data_1JK7
# 
_entry.id   1JK7 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1JK7         
RCSB  RCSB013870   
WWPDB D_1000013870 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1JK7 
_pdbx_database_status.recvd_initial_deposition_date   2001-07-11 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Maynes, J.T.'  1 
'Bateman, K.S.' 2 
'Cherney, M.M.' 3 
'Das, A.K.'     4 
'James, M.N.'   5 
# 
_citation.id                        primary 
_citation.title                     'Crystal structure of the tumor-promoter okadaic acid bound to protein phosphatase-1.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            276 
_citation.page_first                44078 
_citation.page_last                 44082 
_citation.year                      2001 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11535607 
_citation.pdbx_database_id_DOI      10.1074/jbc.M107656200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Maynes, J.T.'  1 
primary 'Bateman, K.S.' 2 
primary 'Cherney, M.M.' 3 
primary 'Das, A.K.'     4 
primary 'Luu, H.A.'     5 
primary 'Holmes, C.F.'  6 
primary 'James, M.N.'   7 
# 
_cell.entry_id           1JK7 
_cell.length_a           99.180 
_cell.length_b           99.180 
_cell.length_c           62.170 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1JK7 
_symmetry.space_group_name_H-M             'P 42 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                94 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'SERINE/THREONINE PROTEIN PHOSPHATASE PP1-GAMMA CATALYTIC SUBUNIT' 37030.777 1   3.1.3.16 ? ? ? 
2 non-polymer syn 'MANGANESE (II) ION'                                               54.938    2   ?        ? ? ? 
3 non-polymer syn 'SULFATE ION'                                                      96.063    1   ?        ? ? ? 
4 non-polymer syn 'OKADAIC ACID'                                                     805.003   1   ?        ? ? ? 
5 non-polymer syn BETA-MERCAPTOETHANOL                                               78.133    3   ?        ? ? ? 
6 water       nat water                                                              18.015    178 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        PP-1G 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGG
FPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLP
IAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPNATRPVTPPRGMITKQ
AKK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGG
FPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLP
IAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPNATRPVTPPRGMITKQ
AKK
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   ASP n 
1 4   LEU n 
1 5   ASP n 
1 6   LYS n 
1 7   LEU n 
1 8   ASN n 
1 9   ILE n 
1 10  ASP n 
1 11  SER n 
1 12  ILE n 
1 13  ILE n 
1 14  GLN n 
1 15  ARG n 
1 16  LEU n 
1 17  LEU n 
1 18  GLU n 
1 19  VAL n 
1 20  ARG n 
1 21  GLY n 
1 22  SER n 
1 23  LYS n 
1 24  PRO n 
1 25  GLY n 
1 26  LYS n 
1 27  ASN n 
1 28  VAL n 
1 29  GLN n 
1 30  LEU n 
1 31  GLN n 
1 32  GLU n 
1 33  ASN n 
1 34  GLU n 
1 35  ILE n 
1 36  ARG n 
1 37  GLY n 
1 38  LEU n 
1 39  CYS n 
1 40  LEU n 
1 41  LYS n 
1 42  SER n 
1 43  ARG n 
1 44  GLU n 
1 45  ILE n 
1 46  PHE n 
1 47  LEU n 
1 48  SER n 
1 49  GLN n 
1 50  PRO n 
1 51  ILE n 
1 52  LEU n 
1 53  LEU n 
1 54  GLU n 
1 55  LEU n 
1 56  GLU n 
1 57  ALA n 
1 58  PRO n 
1 59  LEU n 
1 60  LYS n 
1 61  ILE n 
1 62  CYS n 
1 63  GLY n 
1 64  ASP n 
1 65  ILE n 
1 66  HIS n 
1 67  GLY n 
1 68  GLN n 
1 69  TYR n 
1 70  TYR n 
1 71  ASP n 
1 72  LEU n 
1 73  LEU n 
1 74  ARG n 
1 75  LEU n 
1 76  PHE n 
1 77  GLU n 
1 78  TYR n 
1 79  GLY n 
1 80  GLY n 
1 81  PHE n 
1 82  PRO n 
1 83  PRO n 
1 84  GLU n 
1 85  SER n 
1 86  ASN n 
1 87  TYR n 
1 88  LEU n 
1 89  PHE n 
1 90  LEU n 
1 91  GLY n 
1 92  ASP n 
1 93  TYR n 
1 94  VAL n 
1 95  ASP n 
1 96  ARG n 
1 97  GLY n 
1 98  LYS n 
1 99  GLN n 
1 100 SER n 
1 101 LEU n 
1 102 GLU n 
1 103 THR n 
1 104 ILE n 
1 105 CYS n 
1 106 LEU n 
1 107 LEU n 
1 108 LEU n 
1 109 ALA n 
1 110 TYR n 
1 111 LYS n 
1 112 ILE n 
1 113 LYS n 
1 114 TYR n 
1 115 PRO n 
1 116 GLU n 
1 117 ASN n 
1 118 PHE n 
1 119 PHE n 
1 120 LEU n 
1 121 LEU n 
1 122 ARG n 
1 123 GLY n 
1 124 ASN n 
1 125 HIS n 
1 126 GLU n 
1 127 CYS n 
1 128 ALA n 
1 129 SER n 
1 130 ILE n 
1 131 ASN n 
1 132 ARG n 
1 133 ILE n 
1 134 TYR n 
1 135 GLY n 
1 136 PHE n 
1 137 TYR n 
1 138 ASP n 
1 139 GLU n 
1 140 CYS n 
1 141 LYS n 
1 142 ARG n 
1 143 ARG n 
1 144 TYR n 
1 145 ASN n 
1 146 ILE n 
1 147 LYS n 
1 148 LEU n 
1 149 TRP n 
1 150 LYS n 
1 151 THR n 
1 152 PHE n 
1 153 THR n 
1 154 ASP n 
1 155 CYS n 
1 156 PHE n 
1 157 ASN n 
1 158 CYS n 
1 159 LEU n 
1 160 PRO n 
1 161 ILE n 
1 162 ALA n 
1 163 ALA n 
1 164 ILE n 
1 165 VAL n 
1 166 ASP n 
1 167 GLU n 
1 168 LYS n 
1 169 ILE n 
1 170 PHE n 
1 171 CYS n 
1 172 CYS n 
1 173 HIS n 
1 174 GLY n 
1 175 GLY n 
1 176 LEU n 
1 177 SER n 
1 178 PRO n 
1 179 ASP n 
1 180 LEU n 
1 181 GLN n 
1 182 SER n 
1 183 MET n 
1 184 GLU n 
1 185 GLN n 
1 186 ILE n 
1 187 ARG n 
1 188 ARG n 
1 189 ILE n 
1 190 MET n 
1 191 ARG n 
1 192 PRO n 
1 193 THR n 
1 194 ASP n 
1 195 VAL n 
1 196 PRO n 
1 197 ASP n 
1 198 GLN n 
1 199 GLY n 
1 200 LEU n 
1 201 LEU n 
1 202 CYS n 
1 203 ASP n 
1 204 LEU n 
1 205 LEU n 
1 206 TRP n 
1 207 SER n 
1 208 ASP n 
1 209 PRO n 
1 210 ASP n 
1 211 LYS n 
1 212 ASP n 
1 213 VAL n 
1 214 LEU n 
1 215 GLY n 
1 216 TRP n 
1 217 GLY n 
1 218 GLU n 
1 219 ASN n 
1 220 ASP n 
1 221 ARG n 
1 222 GLY n 
1 223 VAL n 
1 224 SER n 
1 225 PHE n 
1 226 THR n 
1 227 PHE n 
1 228 GLY n 
1 229 ALA n 
1 230 GLU n 
1 231 VAL n 
1 232 VAL n 
1 233 ALA n 
1 234 LYS n 
1 235 PHE n 
1 236 LEU n 
1 237 HIS n 
1 238 LYS n 
1 239 HIS n 
1 240 ASP n 
1 241 LEU n 
1 242 ASP n 
1 243 LEU n 
1 244 ILE n 
1 245 CYS n 
1 246 ARG n 
1 247 ALA n 
1 248 HIS n 
1 249 GLN n 
1 250 VAL n 
1 251 VAL n 
1 252 GLU n 
1 253 ASP n 
1 254 GLY n 
1 255 TYR n 
1 256 GLU n 
1 257 PHE n 
1 258 PHE n 
1 259 ALA n 
1 260 LYS n 
1 261 ARG n 
1 262 GLN n 
1 263 LEU n 
1 264 VAL n 
1 265 THR n 
1 266 LEU n 
1 267 PHE n 
1 268 SER n 
1 269 ALA n 
1 270 PRO n 
1 271 ASN n 
1 272 TYR n 
1 273 CYS n 
1 274 GLY n 
1 275 GLU n 
1 276 PHE n 
1 277 ASP n 
1 278 ASN n 
1 279 ALA n 
1 280 GLY n 
1 281 ALA n 
1 282 MET n 
1 283 MET n 
1 284 SER n 
1 285 VAL n 
1 286 ASP n 
1 287 GLU n 
1 288 THR n 
1 289 LEU n 
1 290 MET n 
1 291 CYS n 
1 292 SER n 
1 293 PHE n 
1 294 GLN n 
1 295 ILE n 
1 296 LEU n 
1 297 LYS n 
1 298 PRO n 
1 299 ALA n 
1 300 GLU n 
1 301 LYS n 
1 302 LYS n 
1 303 LYS n 
1 304 PRO n 
1 305 ASN n 
1 306 ALA n 
1 307 THR n 
1 308 ARG n 
1 309 PRO n 
1 310 VAL n 
1 311 THR n 
1 312 PRO n 
1 313 PRO n 
1 314 ARG n 
1 315 GLY n 
1 316 MET n 
1 317 ILE n 
1 318 THR n 
1 319 LYS n 
1 320 GLN n 
1 321 ALA n 
1 322 LYS n 
1 323 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PCW 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PP1G_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGG
FPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLP
IAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPNATRPVTPPRGMITKQ
AKK
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_accession          P36873 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1JK7 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 323 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P36873 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  323 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       323 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE              ?                                           'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE             ?                                           'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE           ?                                           'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'      ?                                           'C4 H7 N O4'     133.103 
BME non-polymer         . BETA-MERCAPTOETHANOL ?                                           'C2 H6 O S'      78.133  
CYS 'L-peptide linking' y CYSTEINE             ?                                           'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE            ?                                           'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'      ?                                           'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE              ?                                           'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE            ?                                           'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                ?                                           'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE           ?                                           'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE              ?                                           'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE               ?                                           'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE           ?                                           'C5 H11 N O2 S'  149.211 
MN  non-polymer         . 'MANGANESE (II) ION' ?                                           'Mn 2'           54.938  
OKA non-polymer         . 'OKADAIC ACID'       9,10-DEEPITHIO-9,10-DIDEHYDROACANTHIFOLICIN 'C44 H68 O13'    805.003 
PHE 'L-peptide linking' y PHENYLALANINE        ?                                           'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE              ?                                           'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE               ?                                           'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'        ?                                           'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE            ?                                           'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN           ?                                           'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE             ?                                           'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE               ?                                           'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1JK7 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.1 
_exptl_crystal.density_percent_sol   40 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pdbx_details    'LITHIUM SULPHATE, PEG 400, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           105 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV++' 
_diffrn_detector.pdbx_collection_date   2000-07-15 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'OSMIC MIRRORS' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RUH3R' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     1JK7 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   -3.0 
_reflns.d_resolution_low             30.000 
_reflns.d_resolution_high            1.90 
_reflns.number_obs                   24439 
_reflns.number_all                   24439 
_reflns.percent_possible_obs         97.6 
_reflns.pdbx_Rmerge_I_obs            0.043 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        30.0000 
_reflns.B_iso_Wilson_estimate        22.6 
_reflns.pdbx_redundancy              5.46 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.90 
_reflns_shell.d_res_low              1.97 
_reflns_shell.percent_possible_all   95.4 
_reflns_shell.Rmerge_I_obs           0.358 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        5.33 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1JK7 
_refine.ls_number_reflns_obs                     24439 
_refine.ls_number_reflns_all                     24439 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               2611346.14 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.ls_d_res_low                             29.66 
_refine.ls_d_res_high                            1.90 
_refine.ls_percent_reflns_obs                    97.5 
_refine.ls_R_factor_obs                          0.199 
_refine.ls_R_factor_all                          0.199 
_refine.ls_R_factor_R_work                       0.199 
_refine.ls_R_factor_R_free                       0.225 
_refine.ls_R_factor_R_free_error                 0.006 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.8 
_refine.ls_number_reflns_R_free                  1417 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               33.0 
_refine.aniso_B[1][1]                            -0.55 
_refine.aniso_B[2][2]                            -0.55 
_refine.aniso_B[3][3]                            1.11 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.384153 
_refine.solvent_model_param_bsol                 58.6197 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1FJM' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'ENGH & HUBER' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1JK7 
_refine_analyze.Luzzati_coordinate_error_obs    0.21 
_refine_analyze.Luzzati_sigma_a_obs             0.13 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.24 
_refine_analyze.Luzzati_sigma_a_free            0.17 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2373 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         69 
_refine_hist.number_atoms_solvent             172 
_refine_hist.number_atoms_total               2614 
_refine_hist.d_res_high                       1.90 
_refine_hist.d_res_low                        29.66 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.008 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.5   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 22.3  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.94  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        1.36  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       2.09  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        2.06  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       3.02  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   10 
_refine_ls_shell.d_res_high                       1.90 
_refine_ls_shell.d_res_low                        1.97 
_refine_ls_shell.number_reflns_R_work             2216 
_refine_ls_shell.R_factor_R_work                  0.218 
_refine_ls_shell.percent_reflns_obs               95.4 
_refine_ls_shell.R_factor_R_free                  0.243 
_refine_ls_shell.R_factor_R_free_error            0.022 
_refine_ls_shell.percent_reflns_R_free            5.2 
_refine_ls_shell.number_reflns_R_free             122 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 DAM.PARAM         DAM.TOP     'X-RAY DIFFRACTION' 
2 BME.PARAM         BME.TOP     'X-RAY DIFFRACTION' 
3 ION.PARAM         PROTEIN.TOP 'X-RAY DIFFRACTION' 
4 PROTEIN_REP.PARAM WATER.TOP   'X-RAY DIFFRACTION' 
5 WATER_REP.PARAM   ?           'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1JK7 
_struct.title                     'CRYSTAL STRUCTURE OF THE TUMOR-PROMOTER OKADAIC ACID BOUND TO PROTEIN PHOSPHATASE-1' 
_struct.pdbx_descriptor           'SERINE/THREONINE PROTEIN PHOSPHATASE PP1-GAMMA CATALYTIC SUBUNIT (E.C.3.1.3.16)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1JK7 
_struct_keywords.pdbx_keywords   HYDROLASE/TOXIN 
_struct_keywords.text            'HYDROLASE-INHIBITOR COMPLEX, HYDROLASE-TOXIN COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 5 ? 
G N N 5 ? 
H N N 5 ? 
I N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 8   ? GLU A 18  ? ASN A 8   GLU A 18  1 ? 11 
HELX_P HELX_P2  2  GLN A 31  ? GLN A 49  ? GLN A 31  GLN A 49  1 ? 19 
HELX_P HELX_P3  3  GLN A 68  ? GLY A 80  ? GLN A 68  GLY A 80  1 ? 13 
HELX_P HELX_P4  4  GLN A 99  ? TYR A 114 ? GLN A 99  TYR A 114 1 ? 16 
HELX_P HELX_P5  5  CYS A 127 ? ARG A 132 ? CYS A 127 ARG A 132 1 ? 6  
HELX_P HELX_P6  6  GLY A 135 ? TYR A 144 ? GLY A 135 TYR A 144 1 ? 10 
HELX_P HELX_P7  7  ASN A 145 ? ASN A 157 ? ASN A 145 ASN A 157 1 ? 13 
HELX_P HELX_P8  8  SER A 182 ? ARG A 188 ? SER A 182 ARG A 188 1 ? 7  
HELX_P HELX_P9  9  GLY A 199 ? SER A 207 ? GLY A 199 SER A 207 1 ? 9  
HELX_P HELX_P10 10 GLY A 228 ? HIS A 239 ? GLY A 228 HIS A 239 1 ? 12 
HELX_P HELX_P11 11 ASN A 271 ? GLU A 275 ? ASN A 271 GLU A 275 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? A ASP 64  OD2 ? ? ? 1_555 C MN  .   MN  ? ? A ASP 64  A MN  401  1_555 ? ? ? ? ? ? ? 2.021 ? 
metalc2 metalc ? ? A ASP 92  OD2 ? ? ? 1_555 B MN  .   MN  ? ? A ASP 92  A MN  400  1_555 ? ? ? ? ? ? ? 2.174 ? 
metalc3 metalc ? ? A ASP 92  OD2 ? ? ? 1_555 C MN  .   MN  ? ? A ASP 92  A MN  401  1_555 ? ? ? ? ? ? ? 2.404 ? 
metalc4 metalc ? ? A ASN 124 OD1 ? ? ? 1_555 B MN  .   MN  ? ? A ASN 124 A MN  400  1_555 ? ? ? ? ? ? ? 2.123 ? 
metalc5 metalc ? ? B MN  .   MN  ? ? ? 1_555 I HOH .   O   ? ? A MN  400 A HOH 2118 1_555 ? ? ? ? ? ? ? 2.267 ? 
metalc6 metalc ? ? C MN  .   MN  ? ? ? 1_555 I HOH .   O   ? ? A MN  401 A HOH 2118 1_555 ? ? ? ? ? ? ? 2.386 ? 
metalc7 metalc ? ? B MN  .   MN  ? ? ? 1_555 A HIS 173 NE2 ? ? A MN  400 A HIS 173  1_555 ? ? ? ? ? ? ? 2.179 ? 
metalc8 metalc ? ? B MN  .   MN  ? ? ? 1_555 A HIS 248 ND1 ? ? A MN  400 A HIS 248  1_555 ? ? ? ? ? ? ? 2.189 ? 
metalc9 metalc ? ? C MN  .   MN  ? ? ? 1_555 A HIS 66  NE2 ? ? A MN  401 A HIS 66   1_555 ? ? ? ? ? ? ? 2.437 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ALA 57  A . ? ALA 57  A PRO 58  A ? PRO 58  A 1 0.02  
2 PRO 82  A . ? PRO 82  A PRO 83  A ? PRO 83  A 1 -0.13 
3 ARG 191 A . ? ARG 191 A PRO 192 A ? PRO 192 A 1 0.01  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 5 ? 
C ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? parallel      
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 52  ? LEU A 55  ? LEU A 52  LEU A 55  
A 2 ALA A 162 ? VAL A 165 ? ALA A 162 VAL A 165 
A 3 ILE A 169 ? CYS A 172 ? ILE A 169 CYS A 172 
A 4 LEU A 243 ? ARG A 246 ? LEU A 243 ARG A 246 
A 5 LEU A 263 ? LEU A 266 ? LEU A 263 LEU A 266 
A 6 TYR A 255 ? PHE A 258 ? TYR A 255 PHE A 258 
B 1 PHE A 118 ? LEU A 120 ? PHE A 118 LEU A 120 
B 2 TYR A 87  ? PHE A 89  ? TYR A 87  PHE A 89  
B 3 LEU A 59  ? CYS A 62  ? LEU A 59  CYS A 62  
B 4 GLY A 280 ? VAL A 285 ? GLY A 280 VAL A 285 
B 5 CYS A 291 ? LEU A 296 ? CYS A 291 LEU A 296 
C 1 ASP A 208 ? PRO A 209 ? ASP A 208 PRO A 209 
C 2 PHE A 225 ? PHE A 227 ? PHE A 225 PHE A 227 
C 3 TRP A 216 ? GLU A 218 ? TRP A 216 GLU A 218 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 53  ? N LEU A 53  O ALA A 162 ? O ALA A 162 
A 2 3 N VAL A 165 ? N VAL A 165 O ILE A 169 ? O ILE A 169 
A 3 4 N PHE A 170 ? N PHE A 170 O LEU A 243 ? O LEU A 243 
A 4 5 N ARG A 246 ? N ARG A 246 O VAL A 264 ? O VAL A 264 
A 5 6 N THR A 265 ? N THR A 265 O GLU A 256 ? O GLU A 256 
B 1 2 N PHE A 119 ? N PHE A 119 O TYR A 87  ? O TYR A 87  
B 2 3 N LEU A 88  ? N LEU A 88  O LYS A 60  ? O LYS A 60  
B 3 4 N ILE A 61  ? N ILE A 61  O MET A 283 ? O MET A 283 
B 4 5 N SER A 284 ? N SER A 284 O SER A 292 ? O SER A 292 
C 1 2 N ASP A 208 ? N ASP A 208 O PHE A 225 ? O PHE A 225 
C 2 3 O THR A 226 ? O THR A 226 N GLY A 217 ? N GLY A 217 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MN A 400'   
AC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MN A 401'   
AC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE SO4 A 2022' 
AC4 Software ? ? ? ? 21 'BINDING SITE FOR RESIDUE OKA A 501'  
AC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE BME A 2023' 
AC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE BME A 2024' 
AC7 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE BME A 2025' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6  ASP A 92  ? ASP A 92   . ? 1_555 ? 
2  AC1 6  ASN A 124 ? ASN A 124  . ? 1_555 ? 
3  AC1 6  HIS A 173 ? HIS A 173  . ? 1_555 ? 
4  AC1 6  HIS A 248 ? HIS A 248  . ? 1_555 ? 
5  AC1 6  MN  C .   ? MN  A 401  . ? 1_555 ? 
6  AC1 6  HOH I .   ? HOH A 2118 . ? 1_555 ? 
7  AC2 6  ASP A 64  ? ASP A 64   . ? 1_555 ? 
8  AC2 6  HIS A 66  ? HIS A 66   . ? 1_555 ? 
9  AC2 6  ASP A 92  ? ASP A 92   . ? 1_555 ? 
10 AC2 6  HIS A 248 ? HIS A 248  . ? 1_555 ? 
11 AC2 6  MN  B .   ? MN  A 400  . ? 1_555 ? 
12 AC2 6  HOH I .   ? HOH A 2118 . ? 1_555 ? 
13 AC3 6  LYS A 211 ? LYS A 211  . ? 1_555 ? 
14 AC3 6  PHE A 258 ? PHE A 258  . ? 1_555 ? 
15 AC3 6  ALA A 259 ? ALA A 259  . ? 1_555 ? 
16 AC3 6  LYS A 260 ? LYS A 260  . ? 1_555 ? 
17 AC3 6  HOH I .   ? HOH A 2053 . ? 4_564 ? 
18 AC3 6  HOH I .   ? HOH A 2139 . ? 1_555 ? 
19 AC4 21 ARG A 96  ? ARG A 96   . ? 1_555 ? 
20 AC4 21 HIS A 125 ? HIS A 125  . ? 1_555 ? 
21 AC4 21 ILE A 130 ? ILE A 130  . ? 1_555 ? 
22 AC4 21 TYR A 134 ? TYR A 134  . ? 1_555 ? 
23 AC4 21 GLN A 181 ? GLN A 181  . ? 4_565 ? 
24 AC4 21 ARG A 188 ? ARG A 188  . ? 4_565 ? 
25 AC4 21 ASP A 220 ? ASP A 220  . ? 1_555 ? 
26 AC4 21 ARG A 221 ? ARG A 221  . ? 1_555 ? 
27 AC4 21 LYS A 234 ? LYS A 234  . ? 3_645 ? 
28 AC4 21 HIS A 237 ? HIS A 237  . ? 3_645 ? 
29 AC4 21 TYR A 272 ? TYR A 272  . ? 1_555 ? 
30 AC4 21 CYS A 273 ? CYS A 273  . ? 1_555 ? 
31 AC4 21 GLU A 275 ? GLU A 275  . ? 1_555 ? 
32 AC4 21 PHE A 276 ? PHE A 276  . ? 1_555 ? 
33 AC4 21 BME H .   ? BME A 2025 . ? 1_555 ? 
34 AC4 21 HOH I .   ? HOH A 2119 . ? 1_555 ? 
35 AC4 21 HOH I .   ? HOH A 2120 . ? 1_555 ? 
36 AC4 21 HOH I .   ? HOH A 2131 . ? 1_555 ? 
37 AC4 21 HOH I .   ? HOH A 2132 . ? 1_555 ? 
38 AC4 21 HOH I .   ? HOH A 2133 . ? 1_555 ? 
39 AC4 21 HOH I .   ? HOH A 2134 . ? 1_555 ? 
40 AC5 4  TYR A 137 ? TYR A 137  . ? 4_564 ? 
41 AC5 4  LYS A 141 ? LYS A 141  . ? 4_564 ? 
42 AC5 4  ARG A 261 ? ARG A 261  . ? 1_555 ? 
43 AC5 4  HOH I .   ? HOH A 2138 . ? 1_555 ? 
44 AC6 4  ILE A 169 ? ILE A 169  . ? 1_555 ? 
45 AC6 4  LEU A 289 ? LEU A 289  . ? 1_555 ? 
46 AC6 4  MET A 290 ? MET A 290  . ? 1_555 ? 
47 AC6 4  CYS A 291 ? CYS A 291  . ? 1_555 ? 
48 AC7 5  ASP A 208 ? ASP A 208  . ? 1_555 ? 
49 AC7 5  ARG A 221 ? ARG A 221  . ? 1_555 ? 
50 AC7 5  GLN A 249 ? GLN A 249  . ? 1_555 ? 
51 AC7 5  OKA E .   ? OKA A 501  . ? 1_555 ? 
52 AC7 5  HOH I .   ? HOH A 2123 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1JK7 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1JK7 
_atom_sites.fract_transf_matrix[1][1]   0.010083 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010083 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.016085 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MN 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . LYS A 1 6   ? 56.224  28.736 14.298  1.00 61.08  ? 6    LYS A N   1 
ATOM   2    C  CA  . LYS A 1 6   ? 56.577  28.497 15.728  1.00 60.86  ? 6    LYS A CA  1 
ATOM   3    C  C   . LYS A 1 6   ? 56.667  29.801 16.517  1.00 59.95  ? 6    LYS A C   1 
ATOM   4    O  O   . LYS A 1 6   ? 55.998  29.974 17.538  1.00 59.73  ? 6    LYS A O   1 
ATOM   5    C  CB  . LYS A 1 6   ? 57.917  27.760 15.826  1.00 61.90  ? 6    LYS A CB  1 
ATOM   6    C  CG  . LYS A 1 6   ? 58.456  27.661 17.248  1.00 62.60  ? 6    LYS A CG  1 
ATOM   7    C  CD  . LYS A 1 6   ? 59.846  27.042 17.301  1.00 63.23  ? 6    LYS A CD  1 
ATOM   8    C  CE  . LYS A 1 6   ? 59.827  25.566 16.953  1.00 63.08  ? 6    LYS A CE  1 
ATOM   9    N  NZ  . LYS A 1 6   ? 61.188  24.974 17.068  1.00 63.79  ? 6    LYS A NZ  1 
ATOM   10   N  N   . LEU A 1 7   ? 57.502  30.712 16.031  1.00 57.93  ? 7    LEU A N   1 
ATOM   11   C  CA  . LEU A 1 7   ? 57.720  31.998 16.682  1.00 55.19  ? 7    LEU A CA  1 
ATOM   12   C  C   . LEU A 1 7   ? 56.643  33.018 16.322  1.00 52.68  ? 7    LEU A C   1 
ATOM   13   O  O   . LEU A 1 7   ? 56.319  33.197 15.148  1.00 53.40  ? 7    LEU A O   1 
ATOM   14   C  CB  . LEU A 1 7   ? 59.101  32.531 16.286  1.00 56.41  ? 7    LEU A CB  1 
ATOM   15   C  CG  . LEU A 1 7   ? 59.666  33.758 17.002  1.00 56.43  ? 7    LEU A CG  1 
ATOM   16   C  CD1 . LEU A 1 7   ? 59.721  33.502 18.497  1.00 56.85  ? 7    LEU A CD1 1 
ATOM   17   C  CD2 . LEU A 1 7   ? 61.058  34.056 16.465  1.00 56.73  ? 7    LEU A CD2 1 
ATOM   18   N  N   . ASN A 1 8   ? 56.087  33.680 17.335  1.00 49.28  ? 8    ASN A N   1 
ATOM   19   C  CA  . ASN A 1 8   ? 55.056  34.693 17.118  1.00 46.38  ? 8    ASN A CA  1 
ATOM   20   C  C   . ASN A 1 8   ? 55.724  36.062 16.989  1.00 43.77  ? 8    ASN A C   1 
ATOM   21   O  O   . ASN A 1 8   ? 55.813  36.818 17.958  1.00 40.80  ? 8    ASN A O   1 
ATOM   22   C  CB  . ASN A 1 8   ? 54.070  34.720 18.289  1.00 47.34  ? 8    ASN A CB  1 
ATOM   23   C  CG  . ASN A 1 8   ? 52.853  35.591 18.007  1.00 48.84  ? 8    ASN A CG  1 
ATOM   24   O  OD1 . ASN A 1 8   ? 52.971  36.689 17.460  1.00 48.17  ? 8    ASN A OD1 1 
ATOM   25   N  ND2 . ASN A 1 8   ? 51.677  35.105 18.390  1.00 49.67  ? 8    ASN A ND2 1 
ATOM   26   N  N   . ILE A 1 9   ? 56.185  36.375 15.784  1.00 41.84  ? 9    ILE A N   1 
ATOM   27   C  CA  . ILE A 1 9   ? 56.862  37.639 15.522  1.00 40.63  ? 9    ILE A CA  1 
ATOM   28   C  C   . ILE A 1 9   ? 56.010  38.880 15.779  1.00 38.47  ? 9    ILE A C   1 
ATOM   29   O  O   . ILE A 1 9   ? 56.500  39.868 16.324  1.00 36.35  ? 9    ILE A O   1 
ATOM   30   C  CB  . ILE A 1 9   ? 57.385  37.689 14.068  1.00 41.84  ? 9    ILE A CB  1 
ATOM   31   C  CG1 . ILE A 1 9   ? 58.338  36.517 13.821  1.00 44.53  ? 9    ILE A CG1 1 
ATOM   32   C  CG2 . ILE A 1 9   ? 58.108  38.997 13.816  1.00 41.86  ? 9    ILE A CG2 1 
ATOM   33   C  CD1 . ILE A 1 9   ? 59.556  36.512 14.731  1.00 44.82  ? 9    ILE A CD1 1 
ATOM   34   N  N   . ASP A 1 10  ? 54.739  38.839 15.394  1.00 37.46  ? 10   ASP A N   1 
ATOM   35   C  CA  . ASP A 1 10  ? 53.871  39.995 15.592  1.00 38.01  ? 10   ASP A CA  1 
ATOM   36   C  C   . ASP A 1 10  ? 53.652  40.328 17.064  1.00 37.15  ? 10   ASP A C   1 
ATOM   37   O  O   . ASP A 1 10  ? 53.520  41.496 17.427  1.00 36.06  ? 10   ASP A O   1 
ATOM   38   C  CB  . ASP A 1 10  ? 52.524  39.777 14.898  1.00 40.54  ? 10   ASP A CB  1 
ATOM   39   C  CG  . ASP A 1 10  ? 52.668  39.597 13.397  1.00 43.80  ? 10   ASP A CG  1 
ATOM   40   O  OD1 . ASP A 1 10  ? 53.389  40.401 12.768  1.00 43.60  ? 10   ASP A OD1 1 
ATOM   41   O  OD2 . ASP A 1 10  ? 52.057  38.658 12.846  1.00 46.05  ? 10   ASP A OD2 1 
ATOM   42   N  N   . SER A 1 11  ? 53.618  39.300 17.907  1.00 35.20  ? 11   SER A N   1 
ATOM   43   C  CA  . SER A 1 11  ? 53.427  39.495 19.339  1.00 34.47  ? 11   SER A CA  1 
ATOM   44   C  C   . SER A 1 11  ? 54.698  40.063 19.955  1.00 32.66  ? 11   SER A C   1 
ATOM   45   O  O   . SER A 1 11  ? 54.648  40.924 20.831  1.00 34.00  ? 11   SER A O   1 
ATOM   46   C  CB  . SER A 1 11  ? 53.084  38.170 20.019  1.00 33.81  ? 11   SER A CB  1 
ATOM   47   O  OG  . SER A 1 11  ? 52.984  38.340 21.423  1.00 34.03  ? 11   SER A OG  1 
ATOM   48   N  N   . ILE A 1 12  ? 55.837  39.561 19.495  1.00 31.25  ? 12   ILE A N   1 
ATOM   49   C  CA  . ILE A 1 12  ? 57.131  40.018 19.984  1.00 29.63  ? 12   ILE A CA  1 
ATOM   50   C  C   . ILE A 1 12  ? 57.291  41.508 19.683  1.00 28.47  ? 12   ILE A C   1 
ATOM   51   O  O   . ILE A 1 12  ? 57.607  42.305 20.568  1.00 26.81  ? 12   ILE A O   1 
ATOM   52   C  CB  . ILE A 1 12  ? 58.275  39.215 19.314  1.00 29.49  ? 12   ILE A CB  1 
ATOM   53   C  CG1 . ILE A 1 12  ? 58.220  37.758 19.792  1.00 28.99  ? 12   ILE A CG1 1 
ATOM   54   C  CG2 . ILE A 1 12  ? 59.627  39.838 19.642  1.00 28.59  ? 12   ILE A CG2 1 
ATOM   55   C  CD1 . ILE A 1 12  ? 59.206  36.834 19.106  1.00 29.80  ? 12   ILE A CD1 1 
ATOM   56   N  N   . ILE A 1 13  ? 57.061  41.876 18.428  1.00 28.71  ? 13   ILE A N   1 
ATOM   57   C  CA  . ILE A 1 13  ? 57.170  43.262 18.005  1.00 29.36  ? 13   ILE A CA  1 
ATOM   58   C  C   . ILE A 1 13  ? 56.190  44.121 18.794  1.00 29.08  ? 13   ILE A C   1 
ATOM   59   O  O   . ILE A 1 13  ? 56.535  45.203 19.265  1.00 28.84  ? 13   ILE A O   1 
ATOM   60   C  CB  . ILE A 1 13  ? 56.888  43.396 16.489  1.00 30.79  ? 13   ILE A CB  1 
ATOM   61   C  CG1 . ILE A 1 13  ? 58.034  42.751 15.698  1.00 30.34  ? 13   ILE A CG1 1 
ATOM   62   C  CG2 . ILE A 1 13  ? 56.709  44.861 16.110  1.00 30.01  ? 13   ILE A CG2 1 
ATOM   63   C  CD1 . ILE A 1 13  ? 57.852  42.778 14.190  1.00 32.20  ? 13   ILE A CD1 1 
ATOM   64   N  N   . GLN A 1 14  ? 54.969  43.618 18.950  1.00 30.12  ? 14   GLN A N   1 
ATOM   65   C  CA  . GLN A 1 14  ? 53.929  44.329 19.682  1.00 30.60  ? 14   GLN A CA  1 
ATOM   66   C  C   . GLN A 1 14  ? 54.398  44.639 21.100  1.00 29.24  ? 14   GLN A C   1 
ATOM   67   O  O   . GLN A 1 14  ? 54.253  45.763 21.572  1.00 30.87  ? 14   GLN A O   1 
ATOM   68   C  CB  . GLN A 1 14  ? 52.642  43.489 19.711  1.00 32.97  ? 14   GLN A CB  1 
ATOM   69   C  CG  . GLN A 1 14  ? 51.386  44.256 20.108  1.00 39.19  ? 14   GLN A CG  1 
ATOM   70   C  CD  . GLN A 1 14  ? 51.207  44.395 21.608  1.00 41.51  ? 14   GLN A CD  1 
ATOM   71   O  OE1 . GLN A 1 14  ? 50.343  45.138 22.071  1.00 43.94  ? 14   GLN A OE1 1 
ATOM   72   N  NE2 . GLN A 1 14  ? 52.012  43.669 22.375  1.00 45.55  ? 14   GLN A NE2 1 
ATOM   73   N  N   . ARG A 1 15  ? 54.966  43.647 21.779  1.00 29.31  ? 15   ARG A N   1 
ATOM   74   C  CA  . ARG A 1 15  ? 55.448  43.864 23.137  1.00 28.09  ? 15   ARG A CA  1 
ATOM   75   C  C   . ARG A 1 15  ? 56.648  44.804 23.180  1.00 27.52  ? 15   ARG A C   1 
ATOM   76   O  O   . ARG A 1 15  ? 56.772  45.617 24.096  1.00 25.97  ? 15   ARG A O   1 
ATOM   77   C  CB  . ARG A 1 15  ? 55.801  42.532 23.798  1.00 30.82  ? 15   ARG A CB  1 
ATOM   78   C  CG  . ARG A 1 15  ? 54.644  41.922 24.587  1.00 32.09  ? 15   ARG A CG  1 
ATOM   79   C  CD  . ARG A 1 15  ? 55.003  40.540 25.088  1.00 31.20  ? 15   ARG A CD  1 
ATOM   80   N  NE  . ARG A 1 15  ? 55.066  39.587 23.989  1.00 33.26  ? 15   ARG A NE  1 
ATOM   81   C  CZ  . ARG A 1 15  ? 55.815  38.492 23.992  1.00 31.66  ? 15   ARG A CZ  1 
ATOM   82   N  NH1 . ARG A 1 15  ? 56.576  38.210 25.039  1.00 32.45  ? 15   ARG A NH1 1 
ATOM   83   N  NH2 . ARG A 1 15  ? 55.796  37.675 22.947  1.00 33.01  ? 15   ARG A NH2 1 
ATOM   84   N  N   . LEU A 1 16  ? 57.527  44.702 22.189  1.00 26.96  ? 16   LEU A N   1 
ATOM   85   C  CA  . LEU A 1 16  ? 58.698  45.570 22.141  1.00 27.53  ? 16   LEU A CA  1 
ATOM   86   C  C   . LEU A 1 16  ? 58.293  47.019 21.898  1.00 27.36  ? 16   LEU A C   1 
ATOM   87   O  O   . LEU A 1 16  ? 58.835  47.933 22.519  1.00 27.39  ? 16   LEU A O   1 
ATOM   88   C  CB  . LEU A 1 16  ? 59.670  45.103 21.046  1.00 26.26  ? 16   LEU A CB  1 
ATOM   89   C  CG  . LEU A 1 16  ? 60.482  43.838 21.361  1.00 26.27  ? 16   LEU A CG  1 
ATOM   90   C  CD1 . LEU A 1 16  ? 61.118  43.276 20.096  1.00 25.66  ? 16   LEU A CD1 1 
ATOM   91   C  CD2 . LEU A 1 16  ? 61.546  44.173 22.404  1.00 27.52  ? 16   LEU A CD2 1 
ATOM   92   N  N   . LEU A 1 17  ? 57.335  47.227 21.000  1.00 28.93  ? 17   LEU A N   1 
ATOM   93   C  CA  . LEU A 1 17  ? 56.878  48.577 20.681  1.00 31.41  ? 17   LEU A CA  1 
ATOM   94   C  C   . LEU A 1 17  ? 55.893  49.121 21.711  1.00 34.07  ? 17   LEU A C   1 
ATOM   95   O  O   . LEU A 1 17  ? 55.647  50.327 21.774  1.00 34.52  ? 17   LEU A O   1 
ATOM   96   C  CB  . LEU A 1 17  ? 56.239  48.599 19.290  1.00 31.44  ? 17   LEU A CB  1 
ATOM   97   C  CG  . LEU A 1 17  ? 57.172  48.239 18.125  1.00 32.98  ? 17   LEU A CG  1 
ATOM   98   C  CD1 . LEU A 1 17  ? 56.395  48.294 16.821  1.00 33.30  ? 17   LEU A CD1 1 
ATOM   99   C  CD2 . LEU A 1 17  ? 58.358  49.200 18.085  1.00 33.06  ? 17   LEU A CD2 1 
ATOM   100  N  N   . GLU A 1 18  ? 55.336  48.227 22.520  1.00 36.25  ? 18   GLU A N   1 
ATOM   101  C  CA  . GLU A 1 18  ? 54.376  48.615 23.547  1.00 37.34  ? 18   GLU A CA  1 
ATOM   102  C  C   . GLU A 1 18  ? 54.921  49.692 24.485  1.00 37.69  ? 18   GLU A C   1 
ATOM   103  O  O   . GLU A 1 18  ? 54.154  50.429 25.109  1.00 37.66  ? 18   GLU A O   1 
ATOM   104  C  CB  . GLU A 1 18  ? 53.961  47.382 24.358  1.00 40.43  ? 18   GLU A CB  1 
ATOM   105  C  CG  . GLU A 1 18  ? 53.083  47.689 25.555  1.00 42.51  ? 18   GLU A CG  1 
ATOM   106  C  CD  . GLU A 1 18  ? 52.529  46.439 26.204  1.00 45.12  ? 18   GLU A CD  1 
ATOM   107  O  OE1 . GLU A 1 18  ? 53.327  45.554 26.585  1.00 43.84  ? 18   GLU A OE1 1 
ATOM   108  O  OE2 . GLU A 1 18  ? 51.290  46.347 26.334  1.00 46.88  ? 18   GLU A OE2 1 
ATOM   109  N  N   . VAL A 1 19  ? 56.242  49.790 24.585  1.00 36.39  ? 19   VAL A N   1 
ATOM   110  C  CA  . VAL A 1 19  ? 56.844  50.783 25.464  1.00 36.28  ? 19   VAL A CA  1 
ATOM   111  C  C   . VAL A 1 19  ? 57.012  52.172 24.847  1.00 36.71  ? 19   VAL A C   1 
ATOM   112  O  O   . VAL A 1 19  ? 57.608  53.054 25.461  1.00 33.78  ? 19   VAL A O   1 
ATOM   113  C  CB  . VAL A 1 19  ? 58.204  50.302 26.011  1.00 36.85  ? 19   VAL A CB  1 
ATOM   114  C  CG1 . VAL A 1 19  ? 57.981  49.163 26.998  1.00 37.56  ? 19   VAL A CG1 1 
ATOM   115  C  CG2 . VAL A 1 19  ? 59.104  49.852 24.869  1.00 34.65  ? 19   VAL A CG2 1 
ATOM   116  N  N   . ARG A 1 20  ? 56.501  52.375 23.637  1.00 39.32  ? 20   ARG A N   1 
ATOM   117  C  CA  . ARG A 1 20  ? 56.587  53.701 23.035  1.00 43.64  ? 20   ARG A CA  1 
ATOM   118  C  C   . ARG A 1 20  ? 55.726  54.582 23.930  1.00 44.79  ? 20   ARG A C   1 
ATOM   119  O  O   . ARG A 1 20  ? 54.570  54.257 24.192  1.00 47.22  ? 20   ARG A O   1 
ATOM   120  C  CB  . ARG A 1 20  ? 55.984  53.735 21.633  1.00 45.53  ? 20   ARG A CB  1 
ATOM   121  C  CG  . ARG A 1 20  ? 56.680  52.919 20.569  1.00 50.72  ? 20   ARG A CG  1 
ATOM   122  C  CD  . ARG A 1 20  ? 56.319  53.502 19.213  1.00 56.00  ? 20   ARG A CD  1 
ATOM   123  N  NE  . ARG A 1 20  ? 56.422  52.543 18.119  1.00 62.25  ? 20   ARG A NE  1 
ATOM   124  C  CZ  . ARG A 1 20  ? 55.382  51.924 17.565  1.00 65.15  ? 20   ARG A CZ  1 
ATOM   125  N  NH1 . ARG A 1 20  ? 54.151  52.161 18.004  1.00 65.12  ? 20   ARG A NH1 1 
ATOM   126  N  NH2 . ARG A 1 20  ? 55.573  51.079 16.560  1.00 66.33  ? 20   ARG A NH2 1 
ATOM   127  N  N   . GLY A 1 21  ? 56.276  55.690 24.405  1.00 45.93  ? 21   GLY A N   1 
ATOM   128  C  CA  . GLY A 1 21  ? 55.497  56.568 25.260  1.00 45.91  ? 21   GLY A CA  1 
ATOM   129  C  C   . GLY A 1 21  ? 55.747  56.341 26.737  1.00 45.27  ? 21   GLY A C   1 
ATOM   130  O  O   . GLY A 1 21  ? 55.534  57.241 27.548  1.00 45.99  ? 21   GLY A O   1 
ATOM   131  N  N   . SER A 1 22  ? 56.197  55.142 27.095  1.00 44.42  ? 22   SER A N   1 
ATOM   132  C  CA  . SER A 1 22  ? 56.497  54.847 28.490  1.00 42.34  ? 22   SER A CA  1 
ATOM   133  C  C   . SER A 1 22  ? 57.723  55.662 28.858  1.00 41.70  ? 22   SER A C   1 
ATOM   134  O  O   . SER A 1 22  ? 58.386  56.210 27.982  1.00 41.35  ? 22   SER A O   1 
ATOM   135  C  CB  . SER A 1 22  ? 56.798  53.359 28.678  1.00 42.19  ? 22   SER A CB  1 
ATOM   136  O  OG  . SER A 1 22  ? 55.653  52.562 28.429  1.00 42.06  ? 22   SER A OG  1 
ATOM   137  N  N   . LYS A 1 23  ? 58.026  55.746 30.149  1.00 41.47  ? 23   LYS A N   1 
ATOM   138  C  CA  . LYS A 1 23  ? 59.193  56.501 30.581  1.00 41.69  ? 23   LYS A CA  1 
ATOM   139  C  C   . LYS A 1 23  ? 60.447  55.791 30.085  1.00 42.76  ? 23   LYS A C   1 
ATOM   140  O  O   . LYS A 1 23  ? 60.635  54.596 30.335  1.00 41.66  ? 23   LYS A O   1 
ATOM   141  C  CB  . LYS A 1 23  ? 59.228  56.627 32.106  1.00 42.22  ? 23   LYS A CB  1 
ATOM   142  C  CG  . LYS A 1 23  ? 60.384  57.477 32.622  1.00 42.40  ? 23   LYS A CG  1 
ATOM   143  C  CD  . LYS A 1 23  ? 60.272  57.745 34.110  1.00 43.78  ? 23   LYS A CD  1 
ATOM   144  C  CE  . LYS A 1 23  ? 60.351  56.468 34.926  1.00 45.31  ? 23   LYS A CE  1 
ATOM   145  N  NZ  . LYS A 1 23  ? 60.305  56.747 36.391  1.00 46.82  ? 23   LYS A NZ  1 
ATOM   146  N  N   . PRO A 1 24  ? 61.316  56.518 29.365  1.00 41.80  ? 24   PRO A N   1 
ATOM   147  C  CA  . PRO A 1 24  ? 62.550  55.934 28.840  1.00 41.36  ? 24   PRO A CA  1 
ATOM   148  C  C   . PRO A 1 24  ? 63.258  55.049 29.858  1.00 40.48  ? 24   PRO A C   1 
ATOM   149  O  O   . PRO A 1 24  ? 63.327  55.376 31.042  1.00 39.14  ? 24   PRO A O   1 
ATOM   150  C  CB  . PRO A 1 24  ? 63.362  57.160 28.453  1.00 43.00  ? 24   PRO A CB  1 
ATOM   151  C  CG  . PRO A 1 24  ? 62.300  58.071 27.923  1.00 43.24  ? 24   PRO A CG  1 
ATOM   152  C  CD  . PRO A 1 24  ? 61.201  57.934 28.970  1.00 43.09  ? 24   PRO A CD  1 
ATOM   153  N  N   . GLY A 1 25  ? 63.772  53.917 29.390  1.00 38.27  ? 25   GLY A N   1 
ATOM   154  C  CA  . GLY A 1 25  ? 64.469  53.005 30.276  1.00 37.23  ? 25   GLY A CA  1 
ATOM   155  C  C   . GLY A 1 25  ? 63.606  51.837 30.717  1.00 35.62  ? 25   GLY A C   1 
ATOM   156  O  O   . GLY A 1 25  ? 64.118  50.861 31.263  1.00 34.99  ? 25   GLY A O   1 
ATOM   157  N  N   . LYS A 1 26  ? 62.298  51.928 30.492  1.00 34.42  ? 26   LYS A N   1 
ATOM   158  C  CA  . LYS A 1 26  ? 61.408  50.844 30.884  1.00 34.73  ? 26   LYS A CA  1 
ATOM   159  C  C   . LYS A 1 26  ? 61.760  49.611 30.062  1.00 33.03  ? 26   LYS A C   1 
ATOM   160  O  O   . LYS A 1 26  ? 61.870  49.685 28.839  1.00 33.13  ? 26   LYS A O   1 
ATOM   161  C  CB  . LYS A 1 26  ? 59.944  51.229 30.653  1.00 35.39  ? 26   LYS A CB  1 
ATOM   162  C  CG  . LYS A 1 26  ? 58.960  50.171 31.142  1.00 37.65  ? 26   LYS A CG  1 
ATOM   163  C  CD  . LYS A 1 26  ? 57.519  50.651 31.083  1.00 39.13  ? 26   LYS A CD  1 
ATOM   164  C  CE  . LYS A 1 26  ? 56.567  49.579 31.607  1.00 41.42  ? 26   LYS A CE  1 
ATOM   165  N  NZ  . LYS A 1 26  ? 55.140  50.029 31.595  1.00 43.62  ? 26   LYS A NZ  1 
ATOM   166  N  N   . ASN A 1 27  ? 61.937  48.480 30.738  1.00 32.55  ? 27   ASN A N   1 
ATOM   167  C  CA  . ASN A 1 27  ? 62.298  47.237 30.066  1.00 31.05  ? 27   ASN A CA  1 
ATOM   168  C  C   . ASN A 1 27  ? 61.152  46.460 29.442  1.00 30.38  ? 27   ASN A C   1 
ATOM   169  O  O   . ASN A 1 27  ? 59.987  46.623 29.805  1.00 30.90  ? 27   ASN A O   1 
ATOM   170  C  CB  . ASN A 1 27  ? 63.008  46.282 31.033  1.00 32.84  ? 27   ASN A CB  1 
ATOM   171  C  CG  . ASN A 1 27  ? 64.372  46.774 31.459  1.00 33.49  ? 27   ASN A CG  1 
ATOM   172  O  OD1 . ASN A 1 27  ? 64.973  47.625 30.808  1.00 35.65  ? 27   ASN A OD1 1 
ATOM   173  N  ND2 . ASN A 1 27  ? 64.882  46.214 32.552  1.00 35.12  ? 27   ASN A ND2 1 
ATOM   174  N  N   . VAL A 1 28  ? 61.516  45.615 28.484  1.00 27.88  ? 28   VAL A N   1 
ATOM   175  C  CA  . VAL A 1 28  ? 60.591  44.709 27.821  1.00 26.59  ? 28   VAL A CA  1 
ATOM   176  C  C   . VAL A 1 28  ? 61.303  43.376 27.998  1.00 27.11  ? 28   VAL A C   1 
ATOM   177  O  O   . VAL A 1 28  ? 62.373  43.155 27.427  1.00 25.58  ? 28   VAL A O   1 
ATOM   178  C  CB  . VAL A 1 28  ? 60.435  44.985 26.320  1.00 27.13  ? 28   VAL A CB  1 
ATOM   179  C  CG1 . VAL A 1 28  ? 59.553  43.899 25.698  1.00 25.24  ? 28   VAL A CG1 1 
ATOM   180  C  CG2 . VAL A 1 28  ? 59.813  46.366 26.099  1.00 28.30  ? 28   VAL A CG2 1 
ATOM   181  N  N   . GLN A 1 29  ? 60.719  42.497 28.806  1.00 26.57  ? 29   GLN A N   1 
ATOM   182  C  CA  . GLN A 1 29  ? 61.331  41.204 29.092  1.00 26.06  ? 29   GLN A CA  1 
ATOM   183  C  C   . GLN A 1 29  ? 60.687  40.063 28.317  1.00 25.85  ? 29   GLN A C   1 
ATOM   184  O  O   . GLN A 1 29  ? 59.707  39.465 28.767  1.00 26.31  ? 29   GLN A O   1 
ATOM   185  C  CB  . GLN A 1 29  ? 61.244  40.926 30.598  1.00 27.29  ? 29   GLN A CB  1 
ATOM   186  C  CG  . GLN A 1 29  ? 62.055  39.741 31.096  1.00 28.03  ? 29   GLN A CG  1 
ATOM   187  C  CD  . GLN A 1 29  ? 63.557  39.995 31.100  1.00 27.48  ? 29   GLN A CD  1 
ATOM   188  O  OE1 . GLN A 1 29  ? 64.014  41.134 30.970  1.00 27.37  ? 29   GLN A OE1 1 
ATOM   189  N  NE2 . GLN A 1 29  ? 64.331  38.929 31.272  1.00 28.19  ? 29   GLN A NE2 1 
ATOM   190  N  N   . LEU A 1 30  ? 61.240  39.769 27.145  1.00 25.33  ? 30   LEU A N   1 
ATOM   191  C  CA  . LEU A 1 30  ? 60.736  38.686 26.316  1.00 25.28  ? 30   LEU A CA  1 
ATOM   192  C  C   . LEU A 1 30  ? 61.113  37.366 26.976  1.00 25.31  ? 30   LEU A C   1 
ATOM   193  O  O   . LEU A 1 30  ? 61.939  37.340 27.887  1.00 24.99  ? 30   LEU A O   1 
ATOM   194  C  CB  . LEU A 1 30  ? 61.360  38.751 24.922  1.00 25.09  ? 30   LEU A CB  1 
ATOM   195  C  CG  . LEU A 1 30  ? 61.033  39.999 24.096  1.00 25.71  ? 30   LEU A CG  1 
ATOM   196  C  CD1 . LEU A 1 30  ? 61.795  39.970 22.758  1.00 23.06  ? 30   LEU A CD1 1 
ATOM   197  C  CD2 . LEU A 1 30  ? 59.531  40.051 23.857  1.00 23.12  ? 30   LEU A CD2 1 
ATOM   198  N  N   . GLN A 1 31  ? 60.505  36.277 26.518  1.00 26.32  ? 31   GLN A N   1 
ATOM   199  C  CA  . GLN A 1 31  ? 60.804  34.960 27.065  1.00 26.42  ? 31   GLN A CA  1 
ATOM   200  C  C   . GLN A 1 31  ? 62.098  34.485 26.422  1.00 28.82  ? 31   GLN A C   1 
ATOM   201  O  O   . GLN A 1 31  ? 62.389  34.833 25.273  1.00 26.98  ? 31   GLN A O   1 
ATOM   202  C  CB  . GLN A 1 31  ? 59.667  33.982 26.748  1.00 28.44  ? 31   GLN A CB  1 
ATOM   203  C  CG  . GLN A 1 31  ? 58.339  34.333 27.415  1.00 26.06  ? 31   GLN A CG  1 
ATOM   204  C  CD  . GLN A 1 31  ? 57.195  33.421 26.984  1.00 29.71  ? 31   GLN A CD  1 
ATOM   205  O  OE1 . GLN A 1 31  ? 56.052  33.607 27.403  1.00 29.96  ? 31   GLN A OE1 1 
ATOM   206  N  NE2 . GLN A 1 31  ? 57.498  32.437 26.143  1.00 26.53  ? 31   GLN A NE2 1 
ATOM   207  N  N   . GLU A 1 32  ? 62.879  33.705 27.165  1.00 27.27  ? 32   GLU A N   1 
ATOM   208  C  CA  . GLU A 1 32  ? 64.142  33.187 26.649  1.00 29.00  ? 32   GLU A CA  1 
ATOM   209  C  C   . GLU A 1 32  ? 63.951  32.482 25.308  1.00 29.12  ? 32   GLU A C   1 
ATOM   210  O  O   . GLU A 1 32  ? 64.727  32.688 24.377  1.00 30.81  ? 32   GLU A O   1 
ATOM   211  C  CB  . GLU A 1 32  ? 64.768  32.212 27.648  1.00 26.93  ? 32   GLU A CB  1 
ATOM   212  C  CG  . GLU A 1 32  ? 66.089  31.640 27.185  1.00 29.91  ? 32   GLU A CG  1 
ATOM   213  C  CD  . GLU A 1 32  ? 66.770  30.789 28.239  1.00 27.81  ? 32   GLU A CD  1 
ATOM   214  O  OE1 . GLU A 1 32  ? 66.922  31.268 29.380  1.00 27.72  ? 32   GLU A OE1 1 
ATOM   215  O  OE2 . GLU A 1 32  ? 67.161  29.646 27.917  1.00 31.86  ? 32   GLU A OE2 1 
ATOM   216  N  N   . ASN A 1 33  ? 62.909  31.665 25.205  1.00 29.74  ? 33   ASN A N   1 
ATOM   217  C  CA  . ASN A 1 33  ? 62.649  30.926 23.974  1.00 31.11  ? 33   ASN A CA  1 
ATOM   218  C  C   . ASN A 1 33  ? 62.431  31.847 22.777  1.00 29.61  ? 33   ASN A C   1 
ATOM   219  O  O   . ASN A 1 33  ? 62.864  31.544 21.666  1.00 29.23  ? 33   ASN A O   1 
ATOM   220  C  CB  . ASN A 1 33  ? 61.439  29.987 24.151  1.00 31.16  ? 33   ASN A CB  1 
ATOM   221  C  CG  . ASN A 1 33  ? 60.109  30.729 24.230  1.00 33.12  ? 33   ASN A CG  1 
ATOM   222  O  OD1 . ASN A 1 33  ? 59.977  31.722 24.937  1.00 36.57  ? 33   ASN A OD1 1 
ATOM   223  N  ND2 . ASN A 1 33  ? 59.108  30.228 23.510  1.00 35.18  ? 33   ASN A ND2 1 
ATOM   224  N  N   . GLU A 1 34  ? 61.769  32.975 23.008  1.00 28.41  ? 34   GLU A N   1 
ATOM   225  C  CA  . GLU A 1 34  ? 61.494  33.918 21.935  1.00 27.82  ? 34   GLU A CA  1 
ATOM   226  C  C   . GLU A 1 34  ? 62.778  34.570 21.432  1.00 27.62  ? 34   GLU A C   1 
ATOM   227  O  O   . GLU A 1 34  ? 62.989  34.693 20.227  1.00 28.30  ? 34   GLU A O   1 
ATOM   228  C  CB  . GLU A 1 34  ? 60.502  34.980 22.417  1.00 28.07  ? 34   GLU A CB  1 
ATOM   229  C  CG  . GLU A 1 34  ? 59.196  34.373 22.920  1.00 28.77  ? 34   GLU A CG  1 
ATOM   230  C  CD  . GLU A 1 34  ? 58.224  35.400 23.459  1.00 28.48  ? 34   GLU A CD  1 
ATOM   231  O  OE1 . GLU A 1 34  ? 58.618  36.209 24.330  1.00 27.45  ? 34   GLU A OE1 1 
ATOM   232  O  OE2 . GLU A 1 34  ? 57.058  35.392 23.013  1.00 32.64  ? 34   GLU A OE2 1 
ATOM   233  N  N   . ILE A 1 35  ? 63.638  34.986 22.353  1.00 26.93  ? 35   ILE A N   1 
ATOM   234  C  CA  . ILE A 1 35  ? 64.897  35.604 21.958  1.00 26.22  ? 35   ILE A CA  1 
ATOM   235  C  C   . ILE A 1 35  ? 65.746  34.593 21.199  1.00 26.45  ? 35   ILE A C   1 
ATOM   236  O  O   . ILE A 1 35  ? 66.294  34.902 20.144  1.00 25.38  ? 35   ILE A O   1 
ATOM   237  C  CB  . ILE A 1 35  ? 65.681  36.113 23.181  1.00 25.47  ? 35   ILE A CB  1 
ATOM   238  C  CG1 . ILE A 1 35  ? 64.865  37.189 23.898  1.00 26.22  ? 35   ILE A CG1 1 
ATOM   239  C  CG2 . ILE A 1 35  ? 67.034  36.674 22.734  1.00 27.37  ? 35   ILE A CG2 1 
ATOM   240  C  CD1 . ILE A 1 35  ? 65.537  37.759 25.118  1.00 25.09  ? 35   ILE A CD1 1 
ATOM   241  N  N   . ARG A 1 36  ? 65.848  33.378 21.731  1.00 28.50  ? 36   ARG A N   1 
ATOM   242  C  CA  . ARG A 1 36  ? 66.629  32.341 21.063  1.00 30.02  ? 36   ARG A CA  1 
ATOM   243  C  C   . ARG A 1 36  ? 66.094  32.141 19.648  1.00 29.54  ? 36   ARG A C   1 
ATOM   244  O  O   . ARG A 1 36  ? 66.862  31.953 18.701  1.00 28.63  ? 36   ARG A O   1 
ATOM   245  C  CB  . ARG A 1 36  ? 66.551  31.027 21.845  1.00 31.20  ? 36   ARG A CB  1 
ATOM   246  C  CG  . ARG A 1 36  ? 67.371  29.899 21.239  1.00 37.14  ? 36   ARG A CG  1 
ATOM   247  C  CD  . ARG A 1 36  ? 67.401  28.685 22.154  1.00 41.20  ? 36   ARG A CD  1 
ATOM   248  N  NE  . ARG A 1 36  ? 68.063  27.541 21.533  1.00 47.49  ? 36   ARG A NE  1 
ATOM   249  C  CZ  . ARG A 1 36  ? 69.336  27.524 21.143  1.00 50.77  ? 36   ARG A CZ  1 
ATOM   250  N  NH1 . ARG A 1 36  ? 70.104  28.595 21.308  1.00 51.28  ? 36   ARG A NH1 1 
ATOM   251  N  NH2 . ARG A 1 36  ? 69.843  26.430 20.585  1.00 51.26  ? 36   ARG A NH2 1 
ATOM   252  N  N   . GLY A 1 37  ? 64.770  32.190 19.515  1.00 29.11  ? 37   GLY A N   1 
ATOM   253  C  CA  . GLY A 1 37  ? 64.141  32.025 18.217  1.00 30.03  ? 37   GLY A CA  1 
ATOM   254  C  C   . GLY A 1 37  ? 64.475  33.163 17.265  1.00 29.67  ? 37   GLY A C   1 
ATOM   255  O  O   . GLY A 1 37  ? 64.647  32.943 16.067  1.00 27.75  ? 37   GLY A O   1 
ATOM   256  N  N   . LEU A 1 38  ? 64.554  34.384 17.787  1.00 28.29  ? 38   LEU A N   1 
ATOM   257  C  CA  . LEU A 1 38  ? 64.888  35.530 16.950  1.00 27.22  ? 38   LEU A CA  1 
ATOM   258  C  C   . LEU A 1 38  ? 66.294  35.324 16.396  1.00 27.44  ? 38   LEU A C   1 
ATOM   259  O  O   . LEU A 1 38  ? 66.555  35.590 15.225  1.00 27.82  ? 38   LEU A O   1 
ATOM   260  C  CB  . LEU A 1 38  ? 64.821  36.834 17.761  1.00 26.36  ? 38   LEU A CB  1 
ATOM   261  C  CG  . LEU A 1 38  ? 63.429  37.313 18.198  1.00 25.47  ? 38   LEU A CG  1 
ATOM   262  C  CD1 . LEU A 1 38  ? 63.553  38.490 19.163  1.00 24.78  ? 38   LEU A CD1 1 
ATOM   263  C  CD2 . LEU A 1 38  ? 62.608  37.709 16.965  1.00 26.57  ? 38   LEU A CD2 1 
ATOM   264  N  N   . CYS A 1 39  ? 67.196  34.831 17.240  1.00 27.95  ? 39   CYS A N   1 
ATOM   265  C  CA  . CYS A 1 39  ? 68.574  34.584 16.823  1.00 30.97  ? 39   CYS A CA  1 
ATOM   266  C  C   . CYS A 1 39  ? 68.677  33.506 15.746  1.00 30.79  ? 39   CYS A C   1 
ATOM   267  O  O   . CYS A 1 39  ? 69.275  33.722 14.690  1.00 29.69  ? 39   CYS A O   1 
ATOM   268  C  CB  . CYS A 1 39  ? 69.432  34.171 18.022  1.00 29.38  ? 39   CYS A CB  1 
ATOM   269  S  SG  . CYS A 1 39  ? 69.710  35.479 19.227  1.00 31.41  ? 39   CYS A SG  1 
ATOM   270  N  N   . LEU A 1 40  ? 68.094  32.343 16.022  1.00 31.31  ? 40   LEU A N   1 
ATOM   271  C  CA  . LEU A 1 40  ? 68.136  31.222 15.091  1.00 31.74  ? 40   LEU A CA  1 
ATOM   272  C  C   . LEU A 1 40  ? 67.456  31.515 13.754  1.00 32.13  ? 40   LEU A C   1 
ATOM   273  O  O   . LEU A 1 40  ? 67.977  31.159 12.697  1.00 33.08  ? 40   LEU A O   1 
ATOM   274  C  CB  . LEU A 1 40  ? 67.510  29.982 15.737  1.00 33.64  ? 40   LEU A CB  1 
ATOM   275  C  CG  . LEU A 1 40  ? 68.197  29.456 17.006  1.00 34.20  ? 40   LEU A CG  1 
ATOM   276  C  CD1 . LEU A 1 40  ? 67.509  28.181 17.458  1.00 36.02  ? 40   LEU A CD1 1 
ATOM   277  C  CD2 . LEU A 1 40  ? 69.670  29.187 16.737  1.00 35.64  ? 40   LEU A CD2 1 
ATOM   278  N  N   . LYS A 1 41  ? 66.297  32.165 13.799  1.00 30.67  ? 41   LYS A N   1 
ATOM   279  C  CA  . LYS A 1 41  ? 65.575  32.493 12.577  1.00 31.61  ? 41   LYS A CA  1 
ATOM   280  C  C   . LYS A 1 41  ? 66.300  33.561 11.756  1.00 30.49  ? 41   LYS A C   1 
ATOM   281  O  O   . LYS A 1 41  ? 66.443  33.418 10.543  1.00 30.98  ? 41   LYS A O   1 
ATOM   282  C  CB  . LYS A 1 41  ? 64.157  32.965 12.906  1.00 33.15  ? 41   LYS A CB  1 
ATOM   283  C  CG  . LYS A 1 41  ? 63.248  33.085 11.690  1.00 38.02  ? 41   LYS A CG  1 
ATOM   284  C  CD  . LYS A 1 41  ? 63.118  31.746 10.972  1.00 42.06  ? 41   LYS A CD  1 
ATOM   285  C  CE  . LYS A 1 41  ? 62.075  31.789 9.858   1.00 45.18  ? 41   LYS A CE  1 
ATOM   286  N  NZ  . LYS A 1 41  ? 62.455  32.678 8.726   1.00 45.93  ? 41   LYS A NZ  1 
ATOM   287  N  N   . SER A 1 42  ? 66.760  34.631 12.405  1.00 28.40  ? 42   SER A N   1 
ATOM   288  C  CA  . SER A 1 42  ? 67.471  35.682 11.676  1.00 28.35  ? 42   SER A CA  1 
ATOM   289  C  C   . SER A 1 42  ? 68.763  35.115 11.086  1.00 29.04  ? 42   SER A C   1 
ATOM   290  O  O   . SER A 1 42  ? 69.137  35.439 9.957   1.00 28.42  ? 42   SER A O   1 
ATOM   291  C  CB  . SER A 1 42  ? 67.780  36.875 12.592  1.00 26.46  ? 42   SER A CB  1 
ATOM   292  O  OG  . SER A 1 42  ? 68.624  36.511 13.673  1.00 24.88  ? 42   SER A OG  1 
ATOM   293  N  N   . ARG A 1 43  ? 69.430  34.257 11.852  1.00 29.74  ? 43   ARG A N   1 
ATOM   294  C  CA  . ARG A 1 43  ? 70.671  33.625 11.415  1.00 32.06  ? 43   ARG A CA  1 
ATOM   295  C  C   . ARG A 1 43  ? 70.452  32.947 10.066  1.00 33.57  ? 43   ARG A C   1 
ATOM   296  O  O   . ARG A 1 43  ? 71.247  33.099 9.135   1.00 33.41  ? 43   ARG A O   1 
ATOM   297  C  CB  . ARG A 1 43  ? 71.117  32.589 12.450  1.00 33.62  ? 43   ARG A CB  1 
ATOM   298  C  CG  . ARG A 1 43  ? 72.405  31.857 12.105  1.00 36.63  ? 43   ARG A CG  1 
ATOM   299  C  CD  . ARG A 1 43  ? 72.811  30.914 13.231  1.00 37.72  ? 43   ARG A CD  1 
ATOM   300  N  NE  . ARG A 1 43  ? 74.147  30.358 13.036  1.00 40.60  ? 43   ARG A NE  1 
ATOM   301  C  CZ  . ARG A 1 43  ? 74.463  29.464 12.104  1.00 42.05  ? 43   ARG A CZ  1 
ATOM   302  N  NH1 . ARG A 1 43  ? 73.538  29.012 11.269  1.00 42.39  ? 43   ARG A NH1 1 
ATOM   303  N  NH2 . ARG A 1 43  ? 75.709  29.020 12.009  1.00 42.28  ? 43   ARG A NH2 1 
ATOM   304  N  N   . GLU A 1 44  ? 69.359  32.198 9.978   1.00 33.64  ? 44   GLU A N   1 
ATOM   305  C  CA  . GLU A 1 44  ? 68.978  31.485 8.763   1.00 34.56  ? 44   GLU A CA  1 
ATOM   306  C  C   . GLU A 1 44  ? 68.845  32.472 7.603   1.00 32.61  ? 44   GLU A C   1 
ATOM   307  O  O   . GLU A 1 44  ? 69.343  32.237 6.501   1.00 32.94  ? 44   GLU A O   1 
ATOM   308  C  CB  . GLU A 1 44  ? 67.642  30.782 9.002   1.00 37.16  ? 44   GLU A CB  1 
ATOM   309  C  CG  . GLU A 1 44  ? 67.085  30.026 7.820   1.00 43.40  ? 44   GLU A CG  1 
ATOM   310  C  CD  . GLU A 1 44  ? 65.690  29.506 8.100   1.00 46.08  ? 44   GLU A CD  1 
ATOM   311  O  OE1 . GLU A 1 44  ? 65.496  28.893 9.172   1.00 48.07  ? 44   GLU A OE1 1 
ATOM   312  O  OE2 . GLU A 1 44  ? 64.792  29.709 7.256   1.00 47.09  ? 44   GLU A OE2 1 
ATOM   313  N  N   . ILE A 1 45  ? 68.168  33.581 7.867   1.00 30.84  ? 45   ILE A N   1 
ATOM   314  C  CA  . ILE A 1 45  ? 67.960  34.615 6.862   1.00 29.90  ? 45   ILE A CA  1 
ATOM   315  C  C   . ILE A 1 45  ? 69.278  35.258 6.427   1.00 30.27  ? 45   ILE A C   1 
ATOM   316  O  O   . ILE A 1 45  ? 69.521  35.425 5.230   1.00 29.55  ? 45   ILE A O   1 
ATOM   317  C  CB  . ILE A 1 45  ? 67.001  35.698 7.399   1.00 29.87  ? 45   ILE A CB  1 
ATOM   318  C  CG1 . ILE A 1 45  ? 65.623  35.077 7.644   1.00 29.15  ? 45   ILE A CG1 1 
ATOM   319  C  CG2 . ILE A 1 45  ? 66.911  36.863 6.420   1.00 29.37  ? 45   ILE A CG2 1 
ATOM   320  C  CD1 . ILE A 1 45  ? 64.598  36.036 8.210   1.00 29.46  ? 45   ILE A CD1 1 
ATOM   321  N  N   . PHE A 1 46  ? 70.130  35.614 7.388   1.00 28.84  ? 46   PHE A N   1 
ATOM   322  C  CA  . PHE A 1 46  ? 71.412  36.230 7.051   1.00 29.17  ? 46   PHE A CA  1 
ATOM   323  C  C   . PHE A 1 46  ? 72.215  35.309 6.128   1.00 30.34  ? 46   PHE A C   1 
ATOM   324  O  O   . PHE A 1 46  ? 72.754  35.749 5.110   1.00 30.19  ? 46   PHE A O   1 
ATOM   325  C  CB  . PHE A 1 46  ? 72.241  36.519 8.311   1.00 25.08  ? 46   PHE A CB  1 
ATOM   326  C  CG  . PHE A 1 46  ? 71.607  37.507 9.256   1.00 25.73  ? 46   PHE A CG  1 
ATOM   327  C  CD1 . PHE A 1 46  ? 71.005  38.670 8.780   1.00 24.43  ? 46   PHE A CD1 1 
ATOM   328  C  CD2 . PHE A 1 46  ? 71.643  37.287 10.632  1.00 24.66  ? 46   PHE A CD2 1 
ATOM   329  C  CE1 . PHE A 1 46  ? 70.445  39.600 9.662   1.00 25.15  ? 46   PHE A CE1 1 
ATOM   330  C  CE2 . PHE A 1 46  ? 71.087  38.209 11.521  1.00 26.44  ? 46   PHE A CE2 1 
ATOM   331  C  CZ  . PHE A 1 46  ? 70.487  39.367 11.037  1.00 26.12  ? 46   PHE A CZ  1 
ATOM   332  N  N   . LEU A 1 47  ? 72.290  34.031 6.486   1.00 32.11  ? 47   LEU A N   1 
ATOM   333  C  CA  . LEU A 1 47  ? 73.034  33.064 5.687   1.00 33.53  ? 47   LEU A CA  1 
ATOM   334  C  C   . LEU A 1 47  ? 72.439  32.850 4.300   1.00 34.55  ? 47   LEU A C   1 
ATOM   335  O  O   . LEU A 1 47  ? 73.159  32.504 3.361   1.00 36.41  ? 47   LEU A O   1 
ATOM   336  C  CB  . LEU A 1 47  ? 73.122  31.720 6.420   1.00 33.50  ? 47   LEU A CB  1 
ATOM   337  C  CG  . LEU A 1 47  ? 74.098  31.661 7.599   1.00 33.96  ? 47   LEU A CG  1 
ATOM   338  C  CD1 . LEU A 1 47  ? 74.065  30.282 8.234   1.00 34.91  ? 47   LEU A CD1 1 
ATOM   339  C  CD2 . LEU A 1 47  ? 75.499  31.990 7.114   1.00 32.87  ? 47   LEU A CD2 1 
ATOM   340  N  N   . SER A 1 48  ? 71.132  33.061 4.172   1.00 35.03  ? 48   SER A N   1 
ATOM   341  C  CA  . SER A 1 48  ? 70.450  32.883 2.896   1.00 36.09  ? 48   SER A CA  1 
ATOM   342  C  C   . SER A 1 48  ? 70.692  34.057 1.948   1.00 35.86  ? 48   SER A C   1 
ATOM   343  O  O   . SER A 1 48  ? 70.577  33.914 0.732   1.00 37.30  ? 48   SER A O   1 
ATOM   344  C  CB  . SER A 1 48  ? 68.945  32.707 3.115   1.00 36.90  ? 48   SER A CB  1 
ATOM   345  O  OG  . SER A 1 48  ? 68.326  33.929 3.482   1.00 38.73  ? 48   SER A OG  1 
ATOM   346  N  N   . GLN A 1 49  ? 71.018  35.219 2.503   1.00 34.44  ? 49   GLN A N   1 
ATOM   347  C  CA  . GLN A 1 49  ? 71.279  36.392 1.677   1.00 32.40  ? 49   GLN A CA  1 
ATOM   348  C  C   . GLN A 1 49  ? 72.789  36.590 1.540   1.00 30.98  ? 49   GLN A C   1 
ATOM   349  O  O   . GLN A 1 49  ? 73.572  36.057 2.327   1.00 29.68  ? 49   GLN A O   1 
ATOM   350  C  CB  . GLN A 1 49  ? 70.617  37.634 2.286   1.00 31.51  ? 49   GLN A CB  1 
ATOM   351  C  CG  . GLN A 1 49  ? 69.110  37.489 2.472   1.00 33.57  ? 49   GLN A CG  1 
ATOM   352  C  CD  . GLN A 1 49  ? 68.464  38.722 3.070   1.00 34.21  ? 49   GLN A CD  1 
ATOM   353  O  OE1 . GLN A 1 49  ? 69.019  39.351 3.970   1.00 32.30  ? 49   GLN A OE1 1 
ATOM   354  N  NE2 . GLN A 1 49  ? 67.273  39.064 2.585   1.00 32.87  ? 49   GLN A NE2 1 
ATOM   355  N  N   . PRO A 1 50  ? 73.218  37.357 0.529   1.00 31.19  ? 50   PRO A N   1 
ATOM   356  C  CA  . PRO A 1 50  ? 74.644  37.610 0.295   1.00 31.10  ? 50   PRO A CA  1 
ATOM   357  C  C   . PRO A 1 50  ? 75.335  38.296 1.471   1.00 30.67  ? 50   PRO A C   1 
ATOM   358  O  O   . PRO A 1 50  ? 74.688  38.989 2.260   1.00 29.08  ? 50   PRO A O   1 
ATOM   359  C  CB  . PRO A 1 50  ? 74.635  38.497 -0.952  1.00 30.22  ? 50   PRO A CB  1 
ATOM   360  C  CG  . PRO A 1 50  ? 73.375  38.096 -1.654  1.00 31.78  ? 50   PRO A CG  1 
ATOM   361  C  CD  . PRO A 1 50  ? 72.399  38.004 -0.509  1.00 31.44  ? 50   PRO A CD  1 
ATOM   362  N  N   . ILE A 1 51  ? 76.646  38.098 1.581   1.00 29.93  ? 51   ILE A N   1 
ATOM   363  C  CA  . ILE A 1 51  ? 77.421  38.725 2.645   1.00 29.25  ? 51   ILE A CA  1 
ATOM   364  C  C   . ILE A 1 51  ? 77.701  40.172 2.219   1.00 29.24  ? 51   ILE A C   1 
ATOM   365  O  O   . ILE A 1 51  ? 78.031  41.033 3.041   1.00 27.28  ? 51   ILE A O   1 
ATOM   366  C  CB  . ILE A 1 51  ? 78.740  37.953 2.911   1.00 28.88  ? 51   ILE A CB  1 
ATOM   367  C  CG1 . ILE A 1 51  ? 79.409  38.491 4.176   1.00 28.91  ? 51   ILE A CG1 1 
ATOM   368  C  CG2 . ILE A 1 51  ? 79.674  38.065 1.709   1.00 30.93  ? 51   ILE A CG2 1 
ATOM   369  C  CD1 . ILE A 1 51  ? 80.652  37.720 4.589   1.00 31.28  ? 51   ILE A CD1 1 
ATOM   370  N  N   . LEU A 1 52  ? 77.558  40.422 0.921   1.00 28.74  ? 52   LEU A N   1 
ATOM   371  C  CA  . LEU A 1 52  ? 77.725  41.755 0.345   1.00 29.08  ? 52   LEU A CA  1 
ATOM   372  C  C   . LEU A 1 52  ? 76.369  42.068 -0.286  1.00 29.11  ? 52   LEU A C   1 
ATOM   373  O  O   . LEU A 1 52  ? 76.068  41.627 -1.397  1.00 29.57  ? 52   LEU A O   1 
ATOM   374  C  CB  . LEU A 1 52  ? 78.820  41.760 -0.726  1.00 30.12  ? 52   LEU A CB  1 
ATOM   375  C  CG  . LEU A 1 52  ? 78.996  43.065 -1.512  1.00 32.49  ? 52   LEU A CG  1 
ATOM   376  C  CD1 . LEU A 1 52  ? 79.604  44.137 -0.625  1.00 32.94  ? 52   LEU A CD1 1 
ATOM   377  C  CD2 . LEU A 1 52  ? 79.890  42.814 -2.719  1.00 33.33  ? 52   LEU A CD2 1 
ATOM   378  N  N   . LEU A 1 53  ? 75.549  42.819 0.437   1.00 28.29  ? 53   LEU A N   1 
ATOM   379  C  CA  . LEU A 1 53  ? 74.210  43.166 -0.019  1.00 28.56  ? 53   LEU A CA  1 
ATOM   380  C  C   . LEU A 1 53  ? 74.160  44.192 -1.145  1.00 29.34  ? 53   LEU A C   1 
ATOM   381  O  O   . LEU A 1 53  ? 74.964  45.114 -1.202  1.00 28.96  ? 53   LEU A O   1 
ATOM   382  C  CB  . LEU A 1 53  ? 73.385  43.689 1.161   1.00 27.62  ? 53   LEU A CB  1 
ATOM   383  C  CG  . LEU A 1 53  ? 73.103  42.734 2.325   1.00 28.44  ? 53   LEU A CG  1 
ATOM   384  C  CD1 . LEU A 1 53  ? 72.568  43.522 3.515   1.00 26.47  ? 53   LEU A CD1 1 
ATOM   385  C  CD2 . LEU A 1 53  ? 72.102  41.668 1.884   1.00 26.78  ? 53   LEU A CD2 1 
ATOM   386  N  N   . GLU A 1 54  ? 73.204  44.012 -2.047  1.00 31.64  ? 54   GLU A N   1 
ATOM   387  C  CA  . GLU A 1 54  ? 73.005  44.939 -3.150  1.00 33.77  ? 54   GLU A CA  1 
ATOM   388  C  C   . GLU A 1 54  ? 71.583  45.452 -2.980  1.00 33.10  ? 54   GLU A C   1 
ATOM   389  O  O   . GLU A 1 54  ? 70.612  44.753 -3.273  1.00 33.10  ? 54   GLU A O   1 
ATOM   390  C  CB  . GLU A 1 54  ? 73.214  44.227 -4.489  1.00 36.67  ? 54   GLU A CB  1 
ATOM   391  C  CG  . GLU A 1 54  ? 74.682  43.878 -4.722  1.00 41.16  ? 54   GLU A CG  1 
ATOM   392  C  CD  . GLU A 1 54  ? 74.946  43.228 -6.065  1.00 44.56  ? 54   GLU A CD  1 
ATOM   393  O  OE1 . GLU A 1 54  ? 74.564  43.813 -7.099  1.00 48.55  ? 54   GLU A OE1 1 
ATOM   394  O  OE2 . GLU A 1 54  ? 75.547  42.134 -6.086  1.00 46.31  ? 54   GLU A OE2 1 
ATOM   395  N  N   . LEU A 1 55  ? 71.483  46.678 -2.470  1.00 33.17  ? 55   LEU A N   1 
ATOM   396  C  CA  . LEU A 1 55  ? 70.205  47.314 -2.178  1.00 31.72  ? 55   LEU A CA  1 
ATOM   397  C  C   . LEU A 1 55  ? 69.872  48.487 -3.092  1.00 33.00  ? 55   LEU A C   1 
ATOM   398  O  O   . LEU A 1 55  ? 70.734  49.004 -3.802  1.00 32.74  ? 55   LEU A O   1 
ATOM   399  C  CB  . LEU A 1 55  ? 70.209  47.809 -0.730  1.00 30.00  ? 55   LEU A CB  1 
ATOM   400  C  CG  . LEU A 1 55  ? 70.754  46.854 0.337   1.00 29.52  ? 55   LEU A CG  1 
ATOM   401  C  CD1 . LEU A 1 55  ? 70.717  47.544 1.694   1.00 27.94  ? 55   LEU A CD1 1 
ATOM   402  C  CD2 . LEU A 1 55  ? 69.936  45.572 0.357   1.00 27.35  ? 55   LEU A CD2 1 
ATOM   403  N  N   . GLU A 1 56  ? 68.614  48.918 -3.045  1.00 33.89  ? 56   GLU A N   1 
ATOM   404  C  CA  . GLU A 1 56  ? 68.158  50.036 -3.862  1.00 35.74  ? 56   GLU A CA  1 
ATOM   405  C  C   . GLU A 1 56  ? 67.406  51.050 -3.009  1.00 35.67  ? 56   GLU A C   1 
ATOM   406  O  O   . GLU A 1 56  ? 66.695  50.678 -2.075  1.00 35.57  ? 56   GLU A O   1 
ATOM   407  C  CB  . GLU A 1 56  ? 67.223  49.544 -4.971  1.00 39.07  ? 56   GLU A CB  1 
ATOM   408  C  CG  . GLU A 1 56  ? 67.679  48.283 -5.686  1.00 44.93  ? 56   GLU A CG  1 
ATOM   409  C  CD  . GLU A 1 56  ? 66.761  47.907 -6.843  1.00 48.60  ? 56   GLU A CD  1 
ATOM   410  O  OE1 . GLU A 1 56  ? 65.523  47.972 -6.673  1.00 48.59  ? 56   GLU A OE1 1 
ATOM   411  O  OE2 . GLU A 1 56  ? 67.278  47.538 -7.920  1.00 50.40  ? 56   GLU A OE2 1 
ATOM   412  N  N   . ALA A 1 57  ? 67.567  52.331 -3.326  1.00 35.25  ? 57   ALA A N   1 
ATOM   413  C  CA  . ALA A 1 57  ? 66.855  53.380 -2.606  1.00 36.13  ? 57   ALA A CA  1 
ATOM   414  C  C   . ALA A 1 57  ? 65.395  53.252 -3.052  1.00 35.42  ? 57   ALA A C   1 
ATOM   415  O  O   . ALA A 1 57  ? 65.116  52.587 -4.045  1.00 35.40  ? 57   ALA A O   1 
ATOM   416  C  CB  . ALA A 1 57  ? 67.406  54.743 -2.988  1.00 35.30  ? 57   ALA A CB  1 
ATOM   417  N  N   . PRO A 1 58  ? 64.445  53.863 -2.322  1.00 35.94  ? 58   PRO A N   1 
ATOM   418  C  CA  . PRO A 1 58  ? 64.572  54.675 -1.107  1.00 35.72  ? 58   PRO A CA  1 
ATOM   419  C  C   . PRO A 1 58  ? 65.060  53.824 0.055   1.00 35.06  ? 58   PRO A C   1 
ATOM   420  O  O   . PRO A 1 58  ? 64.683  52.660 0.184   1.00 33.55  ? 58   PRO A O   1 
ATOM   421  C  CB  . PRO A 1 58  ? 63.147  55.179 -0.868  1.00 37.27  ? 58   PRO A CB  1 
ATOM   422  C  CG  . PRO A 1 58  ? 62.513  55.105 -2.216  1.00 38.19  ? 58   PRO A CG  1 
ATOM   423  C  CD  . PRO A 1 58  ? 63.040  53.810 -2.754  1.00 36.50  ? 58   PRO A CD  1 
ATOM   424  N  N   . LEU A 1 59  ? 65.877  54.420 0.913   1.00 35.14  ? 59   LEU A N   1 
ATOM   425  C  CA  . LEU A 1 59  ? 66.426  53.701 2.049   1.00 34.00  ? 59   LEU A CA  1 
ATOM   426  C  C   . LEU A 1 59  ? 66.860  54.671 3.140   1.00 33.71  ? 59   LEU A C   1 
ATOM   427  O  O   . LEU A 1 59  ? 67.256  55.807 2.858   1.00 34.19  ? 59   LEU A O   1 
ATOM   428  C  CB  . LEU A 1 59  ? 67.630  52.873 1.581   1.00 34.68  ? 59   LEU A CB  1 
ATOM   429  C  CG  . LEU A 1 59  ? 68.422  52.018 2.572   1.00 34.91  ? 59   LEU A CG  1 
ATOM   430  C  CD1 . LEU A 1 59  ? 67.567  50.861 3.078   1.00 36.66  ? 59   LEU A CD1 1 
ATOM   431  C  CD2 . LEU A 1 59  ? 69.661  51.486 1.875   1.00 34.84  ? 59   LEU A CD2 1 
ATOM   432  N  N   . LYS A 1 60  ? 66.759  54.217 4.385   1.00 30.91  ? 60   LYS A N   1 
ATOM   433  C  CA  . LYS A 1 60  ? 67.175  54.994 5.542   1.00 30.29  ? 60   LYS A CA  1 
ATOM   434  C  C   . LYS A 1 60  ? 68.396  54.238 6.075   1.00 28.80  ? 60   LYS A C   1 
ATOM   435  O  O   . LYS A 1 60  ? 68.331  53.024 6.269   1.00 27.60  ? 60   LYS A O   1 
ATOM   436  C  CB  . LYS A 1 60  ? 66.074  55.005 6.606   1.00 33.32  ? 60   LYS A CB  1 
ATOM   437  C  CG  . LYS A 1 60  ? 64.743  55.595 6.152   1.00 35.01  ? 60   LYS A CG  1 
ATOM   438  C  CD  . LYS A 1 60  ? 64.809  57.104 6.043   1.00 36.60  ? 60   LYS A CD  1 
ATOM   439  C  CE  . LYS A 1 60  ? 63.436  57.694 5.735   1.00 39.11  ? 60   LYS A CE  1 
ATOM   440  N  NZ  . LYS A 1 60  ? 63.472  59.185 5.748   1.00 39.37  ? 60   LYS A NZ  1 
ATOM   441  N  N   . ILE A 1 61  ? 69.504  54.939 6.293   1.00 27.26  ? 61   ILE A N   1 
ATOM   442  C  CA  . ILE A 1 61  ? 70.714  54.292 6.797   1.00 27.10  ? 61   ILE A CA  1 
ATOM   443  C  C   . ILE A 1 61  ? 71.065  54.830 8.183   1.00 26.22  ? 61   ILE A C   1 
ATOM   444  O  O   . ILE A 1 61  ? 71.107  56.045 8.395   1.00 27.47  ? 61   ILE A O   1 
ATOM   445  C  CB  . ILE A 1 61  ? 71.905  54.521 5.832   1.00 26.93  ? 61   ILE A CB  1 
ATOM   446  C  CG1 . ILE A 1 61  ? 71.518  54.076 4.419   1.00 25.97  ? 61   ILE A CG1 1 
ATOM   447  C  CG2 . ILE A 1 61  ? 73.125  53.727 6.297   1.00 26.74  ? 61   ILE A CG2 1 
ATOM   448  C  CD1 . ILE A 1 61  ? 72.609  54.303 3.376   1.00 26.26  ? 61   ILE A CD1 1 
ATOM   449  N  N   . CYS A 1 62  ? 71.321  53.924 9.127   1.00 24.32  ? 62   CYS A N   1 
ATOM   450  C  CA  . CYS A 1 62  ? 71.647  54.327 10.490  1.00 24.16  ? 62   CYS A CA  1 
ATOM   451  C  C   . CYS A 1 62  ? 73.000  53.809 10.953  1.00 23.83  ? 62   CYS A C   1 
ATOM   452  O  O   . CYS A 1 62  ? 73.463  52.764 10.499  1.00 22.45  ? 62   CYS A O   1 
ATOM   453  C  CB  . CYS A 1 62  ? 70.577  53.822 11.458  1.00 26.82  ? 62   CYS A CB  1 
ATOM   454  S  SG  . CYS A 1 62  ? 68.903  54.394 11.086  1.00 33.03  ? 62   CYS A SG  1 
ATOM   455  N  N   . GLY A 1 63  ? 73.615  54.545 11.874  1.00 22.22  ? 63   GLY A N   1 
ATOM   456  C  CA  . GLY A 1 63  ? 74.901  54.153 12.416  1.00 21.10  ? 63   GLY A CA  1 
ATOM   457  C  C   . GLY A 1 63  ? 74.734  53.516 13.783  1.00 21.73  ? 63   GLY A C   1 
ATOM   458  O  O   . GLY A 1 63  ? 73.639  53.075 14.130  1.00 21.37  ? 63   GLY A O   1 
ATOM   459  N  N   . ASP A 1 64  ? 75.814  53.493 14.559  1.00 21.93  ? 64   ASP A N   1 
ATOM   460  C  CA  . ASP A 1 64  ? 75.840  52.896 15.903  1.00 21.53  ? 64   ASP A CA  1 
ATOM   461  C  C   . ASP A 1 64  ? 74.623  53.219 16.773  1.00 22.76  ? 64   ASP A C   1 
ATOM   462  O  O   . ASP A 1 64  ? 74.193  54.370 16.856  1.00 23.12  ? 64   ASP A O   1 
ATOM   463  C  CB  . ASP A 1 64  ? 77.104  53.344 16.641  1.00 21.20  ? 64   ASP A CB  1 
ATOM   464  C  CG  . ASP A 1 64  ? 78.377  53.040 15.868  1.00 23.96  ? 64   ASP A CG  1 
ATOM   465  O  OD1 . ASP A 1 64  ? 78.304  52.826 14.637  1.00 18.93  ? 64   ASP A OD1 1 
ATOM   466  O  OD2 . ASP A 1 64  ? 79.453  53.034 16.500  1.00 21.24  ? 64   ASP A OD2 1 
ATOM   467  N  N   . ILE A 1 65  ? 74.085  52.197 17.434  1.00 22.24  ? 65   ILE A N   1 
ATOM   468  C  CA  . ILE A 1 65  ? 72.922  52.361 18.309  1.00 22.42  ? 65   ILE A CA  1 
ATOM   469  C  C   . ILE A 1 65  ? 73.351  52.102 19.753  1.00 21.17  ? 65   ILE A C   1 
ATOM   470  O  O   . ILE A 1 65  ? 72.876  52.745 20.684  1.00 19.98  ? 65   ILE A O   1 
ATOM   471  C  CB  . ILE A 1 65  ? 71.793  51.362 17.956  1.00 24.58  ? 65   ILE A CB  1 
ATOM   472  C  CG1 . ILE A 1 65  ? 71.511  51.382 16.455  1.00 27.50  ? 65   ILE A CG1 1 
ATOM   473  C  CG2 . ILE A 1 65  ? 70.523  51.734 18.719  1.00 26.95  ? 65   ILE A CG2 1 
ATOM   474  C  CD1 . ILE A 1 65  ? 71.065  52.732 15.933  1.00 32.30  ? 65   ILE A CD1 1 
ATOM   475  N  N   . HIS A 1 66  ? 74.255  51.144 19.924  1.00 21.00  ? 66   HIS A N   1 
ATOM   476  C  CA  . HIS A 1 66  ? 74.780  50.794 21.238  1.00 21.29  ? 66   HIS A CA  1 
ATOM   477  C  C   . HIS A 1 66  ? 73.765  50.690 22.380  1.00 21.32  ? 66   HIS A C   1 
ATOM   478  O  O   . HIS A 1 66  ? 73.906  51.354 23.408  1.00 20.98  ? 66   HIS A O   1 
ATOM   479  C  CB  . HIS A 1 66  ? 75.885  51.776 21.634  1.00 20.08  ? 66   HIS A CB  1 
ATOM   480  C  CG  . HIS A 1 66  ? 77.169  51.562 20.897  1.00 20.97  ? 66   HIS A CG  1 
ATOM   481  N  ND1 . HIS A 1 66  ? 77.891  50.391 20.986  1.00 20.22  ? 66   HIS A ND1 1 
ATOM   482  C  CD2 . HIS A 1 66  ? 77.862  52.370 20.060  1.00 20.56  ? 66   HIS A CD2 1 
ATOM   483  C  CE1 . HIS A 1 66  ? 78.974  50.488 20.236  1.00 21.27  ? 66   HIS A CE1 1 
ATOM   484  N  NE2 . HIS A 1 66  ? 78.979  51.679 19.665  1.00 19.59  ? 66   HIS A NE2 1 
ATOM   485  N  N   . GLY A 1 67  ? 72.746  49.860 22.188  1.00 21.85  ? 67   GLY A N   1 
ATOM   486  C  CA  . GLY A 1 67  ? 71.751  49.634 23.224  1.00 21.90  ? 67   GLY A CA  1 
ATOM   487  C  C   . GLY A 1 67  ? 70.878  50.776 23.709  1.00 23.85  ? 67   GLY A C   1 
ATOM   488  O  O   . GLY A 1 67  ? 70.197  50.636 24.734  1.00 22.08  ? 67   GLY A O   1 
ATOM   489  N  N   . GLN A 1 68  ? 70.889  51.899 23.000  1.00 22.71  ? 68   GLN A N   1 
ATOM   490  C  CA  . GLN A 1 68  ? 70.062  53.041 23.391  1.00 23.13  ? 68   GLN A CA  1 
ATOM   491  C  C   . GLN A 1 68  ? 68.709  52.832 22.731  1.00 23.06  ? 68   GLN A C   1 
ATOM   492  O  O   . GLN A 1 68  ? 68.354  53.485 21.746  1.00 24.52  ? 68   GLN A O   1 
ATOM   493  C  CB  . GLN A 1 68  ? 70.731  54.346 22.949  1.00 23.52  ? 68   GLN A CB  1 
ATOM   494  C  CG  . GLN A 1 68  ? 72.121  54.485 23.549  1.00 24.51  ? 68   GLN A CG  1 
ATOM   495  C  CD  . GLN A 1 68  ? 72.733  55.868 23.407  1.00 26.01  ? 68   GLN A CD  1 
ATOM   496  O  OE1 . GLN A 1 68  ? 73.895  56.069 23.750  1.00 27.26  ? 68   GLN A OE1 1 
ATOM   497  N  NE2 . GLN A 1 68  ? 71.958  56.825 22.912  1.00 27.23  ? 68   GLN A NE2 1 
ATOM   498  N  N   . TYR A 1 69  ? 67.960  51.891 23.301  1.00 21.99  ? 69   TYR A N   1 
ATOM   499  C  CA  . TYR A 1 69  ? 66.659  51.490 22.784  1.00 22.73  ? 69   TYR A CA  1 
ATOM   500  C  C   . TYR A 1 69  ? 65.635  52.585 22.520  1.00 23.33  ? 69   TYR A C   1 
ATOM   501  O  O   . TYR A 1 69  ? 64.957  52.558 21.491  1.00 22.91  ? 69   TYR A O   1 
ATOM   502  C  CB  . TYR A 1 69  ? 66.032  50.430 23.697  1.00 21.31  ? 69   TYR A CB  1 
ATOM   503  C  CG  . TYR A 1 69  ? 64.794  49.802 23.099  1.00 22.91  ? 69   TYR A CG  1 
ATOM   504  C  CD1 . TYR A 1 69  ? 64.837  49.202 21.836  1.00 21.37  ? 69   TYR A CD1 1 
ATOM   505  C  CD2 . TYR A 1 69  ? 63.581  49.801 23.790  1.00 22.41  ? 69   TYR A CD2 1 
ATOM   506  C  CE1 . TYR A 1 69  ? 63.710  48.621 21.279  1.00 22.14  ? 69   TYR A CE1 1 
ATOM   507  C  CE2 . TYR A 1 69  ? 62.446  49.218 23.243  1.00 22.50  ? 69   TYR A CE2 1 
ATOM   508  C  CZ  . TYR A 1 69  ? 62.514  48.632 21.991  1.00 22.68  ? 69   TYR A CZ  1 
ATOM   509  O  OH  . TYR A 1 69  ? 61.395  48.058 21.445  1.00 21.85  ? 69   TYR A OH  1 
ATOM   510  N  N   . TYR A 1 70  ? 65.494  53.535 23.434  1.00 23.86  ? 70   TYR A N   1 
ATOM   511  C  CA  . TYR A 1 70  ? 64.510  54.585 23.204  1.00 27.53  ? 70   TYR A CA  1 
ATOM   512  C  C   . TYR A 1 70  ? 64.926  55.518 22.072  1.00 26.29  ? 70   TYR A C   1 
ATOM   513  O  O   . TYR A 1 70  ? 64.080  56.142 21.422  1.00 26.34  ? 70   TYR A O   1 
ATOM   514  C  CB  . TYR A 1 70  ? 64.215  55.332 24.506  1.00 30.03  ? 70   TYR A CB  1 
ATOM   515  C  CG  . TYR A 1 70  ? 63.323  54.496 25.402  1.00 35.38  ? 70   TYR A CG  1 
ATOM   516  C  CD1 . TYR A 1 70  ? 63.822  53.364 26.054  1.00 36.10  ? 70   TYR A CD1 1 
ATOM   517  C  CD2 . TYR A 1 70  ? 61.957  54.763 25.506  1.00 35.81  ? 70   TYR A CD2 1 
ATOM   518  C  CE1 . TYR A 1 70  ? 62.983  52.516 26.778  1.00 37.36  ? 70   TYR A CE1 1 
ATOM   519  C  CE2 . TYR A 1 70  ? 61.107  53.919 26.227  1.00 35.98  ? 70   TYR A CE2 1 
ATOM   520  C  CZ  . TYR A 1 70  ? 61.627  52.797 26.857  1.00 39.06  ? 70   TYR A CZ  1 
ATOM   521  O  OH  . TYR A 1 70  ? 60.793  51.947 27.551  1.00 38.03  ? 70   TYR A OH  1 
ATOM   522  N  N   . ASP A 1 71  ? 66.228  55.588 21.815  1.00 26.17  ? 71   ASP A N   1 
ATOM   523  C  CA  . ASP A 1 71  ? 66.721  56.405 20.719  1.00 25.12  ? 71   ASP A CA  1 
ATOM   524  C  C   . ASP A 1 71  ? 66.459  55.643 19.419  1.00 26.02  ? 71   ASP A C   1 
ATOM   525  O  O   . ASP A 1 71  ? 66.212  56.250 18.375  1.00 26.12  ? 71   ASP A O   1 
ATOM   526  C  CB  . ASP A 1 71  ? 68.213  56.715 20.902  1.00 26.62  ? 71   ASP A CB  1 
ATOM   527  C  CG  . ASP A 1 71  ? 68.466  57.663 22.066  1.00 28.89  ? 71   ASP A CG  1 
ATOM   528  O  OD1 . ASP A 1 71  ? 67.730  58.669 22.173  1.00 30.28  ? 71   ASP A OD1 1 
ATOM   529  O  OD2 . ASP A 1 71  ? 69.397  57.413 22.868  1.00 27.13  ? 71   ASP A OD2 1 
ATOM   530  N  N   . LEU A 1 72  ? 66.498  54.312 19.480  1.00 24.13  ? 72   LEU A N   1 
ATOM   531  C  CA  . LEU A 1 72  ? 66.204  53.505 18.299  1.00 24.36  ? 72   LEU A CA  1 
ATOM   532  C  C   . LEU A 1 72  ? 64.735  53.752 17.970  1.00 25.37  ? 72   LEU A C   1 
ATOM   533  O  O   . LEU A 1 72  ? 64.358  53.906 16.807  1.00 23.54  ? 72   LEU A O   1 
ATOM   534  C  CB  . LEU A 1 72  ? 66.424  52.011 18.577  1.00 26.49  ? 72   LEU A CB  1 
ATOM   535  C  CG  . LEU A 1 72  ? 65.965  51.063 17.461  1.00 25.24  ? 72   LEU A CG  1 
ATOM   536  C  CD1 . LEU A 1 72  ? 66.689  51.410 16.160  1.00 25.11  ? 72   LEU A CD1 1 
ATOM   537  C  CD2 . LEU A 1 72  ? 66.227  49.609 17.860  1.00 24.15  ? 72   LEU A CD2 1 
ATOM   538  N  N   . LEU A 1 73  ? 63.903  53.791 19.007  1.00 25.10  ? 73   LEU A N   1 
ATOM   539  C  CA  . LEU A 1 73  ? 62.481  54.038 18.811  1.00 27.42  ? 73   LEU A CA  1 
ATOM   540  C  C   . LEU A 1 73  ? 62.276  55.420 18.194  1.00 28.32  ? 73   LEU A C   1 
ATOM   541  O  O   . LEU A 1 73  ? 61.445  55.586 17.303  1.00 30.43  ? 73   LEU A O   1 
ATOM   542  C  CB  . LEU A 1 73  ? 61.727  53.924 20.141  1.00 25.39  ? 73   LEU A CB  1 
ATOM   543  C  CG  . LEU A 1 73  ? 61.683  52.500 20.718  1.00 26.00  ? 73   LEU A CG  1 
ATOM   544  C  CD1 . LEU A 1 73  ? 60.911  52.495 22.024  1.00 27.91  ? 73   LEU A CD1 1 
ATOM   545  C  CD2 . LEU A 1 73  ? 61.025  51.560 19.722  1.00 24.01  ? 73   LEU A CD2 1 
ATOM   546  N  N   . ARG A 1 74  ? 63.033  56.409 18.663  1.00 30.22  ? 74   ARG A N   1 
ATOM   547  C  CA  . ARG A 1 74  ? 62.918  57.756 18.111  1.00 32.67  ? 74   ARG A CA  1 
ATOM   548  C  C   . ARG A 1 74  ? 63.282  57.757 16.629  1.00 32.50  ? 74   ARG A C   1 
ATOM   549  O  O   . ARG A 1 74  ? 62.648  58.446 15.828  1.00 32.57  ? 74   ARG A O   1 
ATOM   550  C  CB  . ARG A 1 74  ? 63.823  58.736 18.861  1.00 33.40  ? 74   ARG A CB  1 
ATOM   551  C  CG  . ARG A 1 74  ? 63.263  59.206 20.192  1.00 35.90  ? 74   ARG A CG  1 
ATOM   552  C  CD  . ARG A 1 74  ? 63.841  60.566 20.559  1.00 40.15  ? 74   ARG A CD  1 
ATOM   553  N  NE  . ARG A 1 74  ? 65.261  60.501 20.888  1.00 42.87  ? 74   ARG A NE  1 
ATOM   554  C  CZ  . ARG A 1 74  ? 66.074  61.554 20.928  1.00 42.28  ? 74   ARG A CZ  1 
ATOM   555  N  NH1 . ARG A 1 74  ? 65.615  62.768 20.652  1.00 42.41  ? 74   ARG A NH1 1 
ATOM   556  N  NH2 . ARG A 1 74  ? 67.348  61.392 21.256  1.00 42.58  ? 74   ARG A NH2 1 
ATOM   557  N  N   . LEU A 1 75  ? 64.305  56.987 16.263  1.00 31.39  ? 75   LEU A N   1 
ATOM   558  C  CA  . LEU A 1 75  ? 64.724  56.902 14.866  1.00 32.43  ? 75   LEU A CA  1 
ATOM   559  C  C   . LEU A 1 75  ? 63.575  56.427 13.986  1.00 32.60  ? 75   LEU A C   1 
ATOM   560  O  O   . LEU A 1 75  ? 63.331  56.983 12.912  1.00 33.29  ? 75   LEU A O   1 
ATOM   561  C  CB  . LEU A 1 75  ? 65.905  55.938 14.712  1.00 33.05  ? 75   LEU A CB  1 
ATOM   562  C  CG  . LEU A 1 75  ? 67.276  56.401 15.201  1.00 34.34  ? 75   LEU A CG  1 
ATOM   563  C  CD1 . LEU A 1 75  ? 68.271  55.253 15.075  1.00 34.07  ? 75   LEU A CD1 1 
ATOM   564  C  CD2 . LEU A 1 75  ? 67.741  57.597 14.375  1.00 36.69  ? 75   LEU A CD2 1 
ATOM   565  N  N   . PHE A 1 76  ? 62.881  55.386 14.436  1.00 30.51  ? 76   PHE A N   1 
ATOM   566  C  CA  . PHE A 1 76  ? 61.756  54.839 13.688  1.00 31.96  ? 76   PHE A CA  1 
ATOM   567  C  C   . PHE A 1 76  ? 60.585  55.814 13.686  1.00 34.49  ? 76   PHE A C   1 
ATOM   568  O  O   . PHE A 1 76  ? 59.838  55.910 12.715  1.00 35.19  ? 76   PHE A O   1 
ATOM   569  C  CB  . PHE A 1 76  ? 61.314  53.505 14.289  1.00 30.30  ? 76   PHE A CB  1 
ATOM   570  C  CG  . PHE A 1 76  ? 62.276  52.376 14.037  1.00 28.36  ? 76   PHE A CG  1 
ATOM   571  C  CD1 . PHE A 1 76  ? 62.788  52.155 12.760  1.00 28.17  ? 76   PHE A CD1 1 
ATOM   572  C  CD2 . PHE A 1 76  ? 62.642  51.510 15.066  1.00 26.33  ? 76   PHE A CD2 1 
ATOM   573  C  CE1 . PHE A 1 76  ? 63.651  51.086 12.505  1.00 26.76  ? 76   PHE A CE1 1 
ATOM   574  C  CE2 . PHE A 1 76  ? 63.503  50.439 14.822  1.00 23.86  ? 76   PHE A CE2 1 
ATOM   575  C  CZ  . PHE A 1 76  ? 64.007  50.227 13.539  1.00 26.49  ? 76   PHE A CZ  1 
ATOM   576  N  N   . GLU A 1 77  ? 60.432  56.530 14.791  1.00 38.61  ? 77   GLU A N   1 
ATOM   577  C  CA  . GLU A 1 77  ? 59.372  57.514 14.933  1.00 42.50  ? 77   GLU A CA  1 
ATOM   578  C  C   . GLU A 1 77  ? 59.596  58.630 13.915  1.00 43.23  ? 77   GLU A C   1 
ATOM   579  O  O   . GLU A 1 77  ? 58.656  59.123 13.289  1.00 42.49  ? 77   GLU A O   1 
ATOM   580  C  CB  . GLU A 1 77  ? 59.404  58.072 16.358  1.00 45.48  ? 77   GLU A CB  1 
ATOM   581  C  CG  . GLU A 1 77  ? 58.524  59.280 16.618  1.00 52.60  ? 77   GLU A CG  1 
ATOM   582  C  CD  . GLU A 1 77  ? 58.538  59.681 18.084  1.00 55.69  ? 77   GLU A CD  1 
ATOM   583  O  OE1 . GLU A 1 77  ? 58.079  58.876 18.923  1.00 57.56  ? 77   GLU A OE1 1 
ATOM   584  O  OE2 . GLU A 1 77  ? 59.014  60.795 18.399  1.00 57.90  ? 77   GLU A OE2 1 
ATOM   585  N  N   . TYR A 1 78  ? 60.856  59.005 13.736  1.00 44.02  ? 78   TYR A N   1 
ATOM   586  C  CA  . TYR A 1 78  ? 61.204  60.075 12.818  1.00 44.75  ? 78   TYR A CA  1 
ATOM   587  C  C   . TYR A 1 78  ? 61.362  59.626 11.368  1.00 43.32  ? 78   TYR A C   1 
ATOM   588  O  O   . TYR A 1 78  ? 61.085  60.394 10.447  1.00 42.54  ? 78   TYR A O   1 
ATOM   589  C  CB  . TYR A 1 78  ? 62.483  60.761 13.301  1.00 49.19  ? 78   TYR A CB  1 
ATOM   590  C  CG  . TYR A 1 78  ? 62.744  62.095 12.653  1.00 53.82  ? 78   TYR A CG  1 
ATOM   591  C  CD1 . TYR A 1 78  ? 61.735  63.056 12.560  1.00 56.76  ? 78   TYR A CD1 1 
ATOM   592  C  CD2 . TYR A 1 78  ? 64.001  62.409 12.145  1.00 56.73  ? 78   TYR A CD2 1 
ATOM   593  C  CE1 . TYR A 1 78  ? 61.975  64.297 11.973  1.00 58.72  ? 78   TYR A CE1 1 
ATOM   594  C  CE2 . TYR A 1 78  ? 64.250  63.647 11.559  1.00 58.26  ? 78   TYR A CE2 1 
ATOM   595  C  CZ  . TYR A 1 78  ? 63.237  64.583 11.475  1.00 59.27  ? 78   TYR A CZ  1 
ATOM   596  O  OH  . TYR A 1 78  ? 63.487  65.803 10.889  1.00 61.09  ? 78   TYR A OH  1 
ATOM   597  N  N   . GLY A 1 79  ? 61.797  58.385 11.164  1.00 41.10  ? 79   GLY A N   1 
ATOM   598  C  CA  . GLY A 1 79  ? 61.986  57.889 9.811   1.00 38.65  ? 79   GLY A CA  1 
ATOM   599  C  C   . GLY A 1 79  ? 60.840  57.047 9.285   1.00 38.41  ? 79   GLY A C   1 
ATOM   600  O  O   . GLY A 1 79  ? 60.720  56.827 8.076   1.00 36.90  ? 79   GLY A O   1 
ATOM   601  N  N   . GLY A 1 80  ? 59.992  56.577 10.193  1.00 38.37  ? 80   GLY A N   1 
ATOM   602  C  CA  . GLY A 1 80  ? 58.867  55.748 9.800   1.00 38.24  ? 80   GLY A CA  1 
ATOM   603  C  C   . GLY A 1 80  ? 59.109  54.297 10.172  1.00 39.15  ? 80   GLY A C   1 
ATOM   604  O  O   . GLY A 1 80  ? 60.105  53.701 9.756   1.00 38.58  ? 80   GLY A O   1 
ATOM   605  N  N   . PHE A 1 81  ? 58.202  53.722 10.955  1.00 38.97  ? 81   PHE A N   1 
ATOM   606  C  CA  . PHE A 1 81  ? 58.345  52.333 11.374  1.00 39.09  ? 81   PHE A CA  1 
ATOM   607  C  C   . PHE A 1 81  ? 58.175  51.356 10.226  1.00 38.70  ? 81   PHE A C   1 
ATOM   608  O  O   . PHE A 1 81  ? 57.317  51.538 9.364   1.00 39.58  ? 81   PHE A O   1 
ATOM   609  C  CB  . PHE A 1 81  ? 57.335  51.986 12.473  1.00 38.16  ? 81   PHE A CB  1 
ATOM   610  C  CG  . PHE A 1 81  ? 57.659  52.591 13.804  1.00 38.85  ? 81   PHE A CG  1 
ATOM   611  C  CD1 . PHE A 1 81  ? 57.359  53.923 14.071  1.00 39.11  ? 81   PHE A CD1 1 
ATOM   612  C  CD2 . PHE A 1 81  ? 58.295  51.833 14.785  1.00 36.88  ? 81   PHE A CD2 1 
ATOM   613  C  CE1 . PHE A 1 81  ? 57.689  54.496 15.303  1.00 39.91  ? 81   PHE A CE1 1 
ATOM   614  C  CE2 . PHE A 1 81  ? 58.630  52.392 16.015  1.00 38.21  ? 81   PHE A CE2 1 
ATOM   615  C  CZ  . PHE A 1 81  ? 58.328  53.727 16.277  1.00 39.57  ? 81   PHE A CZ  1 
ATOM   616  N  N   . PRO A 1 82  ? 59.005  50.303 10.198  1.00 38.82  ? 82   PRO A N   1 
ATOM   617  C  CA  . PRO A 1 82  ? 58.919  49.296 9.138   1.00 39.19  ? 82   PRO A CA  1 
ATOM   618  C  C   . PRO A 1 82  ? 57.477  48.792 9.057   1.00 40.25  ? 82   PRO A C   1 
ATOM   619  O  O   . PRO A 1 82  ? 56.806  48.659 10.083  1.00 39.88  ? 82   PRO A O   1 
ATOM   620  C  CB  . PRO A 1 82  ? 59.886  48.221 9.619   1.00 38.76  ? 82   PRO A CB  1 
ATOM   621  C  CG  . PRO A 1 82  ? 60.942  49.024 10.322  1.00 37.48  ? 82   PRO A CG  1 
ATOM   622  C  CD  . PRO A 1 82  ? 60.120  50.007 11.118  1.00 38.59  ? 82   PRO A CD  1 
ATOM   623  N  N   . PRO A 1 83  ? 56.985  48.493 7.842   1.00 40.37  ? 83   PRO A N   1 
ATOM   624  C  CA  . PRO A 1 83  ? 57.685  48.599 6.559   1.00 40.75  ? 83   PRO A CA  1 
ATOM   625  C  C   . PRO A 1 83  ? 57.445  49.923 5.830   1.00 39.93  ? 83   PRO A C   1 
ATOM   626  O  O   . PRO A 1 83  ? 57.561  49.989 4.605   1.00 40.71  ? 83   PRO A O   1 
ATOM   627  C  CB  . PRO A 1 83  ? 57.123  47.419 5.786   1.00 41.05  ? 83   PRO A CB  1 
ATOM   628  C  CG  . PRO A 1 83  ? 55.680  47.470 6.179   1.00 40.95  ? 83   PRO A CG  1 
ATOM   629  C  CD  . PRO A 1 83  ? 55.723  47.744 7.679   1.00 40.32  ? 83   PRO A CD  1 
ATOM   630  N  N   . GLU A 1 84  ? 57.111  50.966 6.581   1.00 39.91  ? 84   GLU A N   1 
ATOM   631  C  CA  . GLU A 1 84  ? 56.853  52.282 6.003   1.00 40.63  ? 84   GLU A CA  1 
ATOM   632  C  C   . GLU A 1 84  ? 58.068  52.775 5.221   1.00 40.44  ? 84   GLU A C   1 
ATOM   633  O  O   . GLU A 1 84  ? 57.932  53.420 4.182   1.00 40.59  ? 84   GLU A O   1 
ATOM   634  C  CB  . GLU A 1 84  ? 56.506  53.279 7.112   1.00 42.99  ? 84   GLU A CB  1 
ATOM   635  C  CG  . GLU A 1 84  ? 56.041  54.635 6.619   1.00 47.43  ? 84   GLU A CG  1 
ATOM   636  C  CD  . GLU A 1 84  ? 55.666  55.566 7.756   1.00 50.02  ? 84   GLU A CD  1 
ATOM   637  O  OE1 . GLU A 1 84  ? 54.843  55.162 8.607   1.00 52.25  ? 84   GLU A OE1 1 
ATOM   638  O  OE2 . GLU A 1 84  ? 56.188  56.700 7.797   1.00 51.29  ? 84   GLU A OE2 1 
ATOM   639  N  N   . SER A 1 85  ? 59.257  52.467 5.732   1.00 38.24  ? 85   SER A N   1 
ATOM   640  C  CA  . SER A 1 85  ? 60.507  52.862 5.089   1.00 36.16  ? 85   SER A CA  1 
ATOM   641  C  C   . SER A 1 85  ? 61.471  51.683 5.141   1.00 34.22  ? 85   SER A C   1 
ATOM   642  O  O   . SER A 1 85  ? 61.388  50.856 6.047   1.00 33.55  ? 85   SER A O   1 
ATOM   643  C  CB  . SER A 1 85  ? 61.136  54.048 5.824   1.00 36.92  ? 85   SER A CB  1 
ATOM   644  O  OG  . SER A 1 85  ? 60.242  55.140 5.924   1.00 39.94  ? 85   SER A OG  1 
ATOM   645  N  N   . ASN A 1 86  ? 62.370  51.599 4.166   1.00 34.36  ? 86   ASN A N   1 
ATOM   646  C  CA  . ASN A 1 86  ? 63.361  50.526 4.130   1.00 32.82  ? 86   ASN A CA  1 
ATOM   647  C  C   . ASN A 1 86  ? 64.542  50.974 4.981   1.00 31.73  ? 86   ASN A C   1 
ATOM   648  O  O   . ASN A 1 86  ? 64.864  52.159 5.010   1.00 31.14  ? 86   ASN A O   1 
ATOM   649  C  CB  . ASN A 1 86  ? 63.836  50.267 2.696   1.00 35.62  ? 86   ASN A CB  1 
ATOM   650  C  CG  . ASN A 1 86  ? 62.805  49.529 1.851   1.00 37.83  ? 86   ASN A CG  1 
ATOM   651  O  OD1 . ASN A 1 86  ? 63.059  49.209 0.689   1.00 41.62  ? 86   ASN A OD1 1 
ATOM   652  N  ND2 . ASN A 1 86  ? 61.643  49.253 2.429   1.00 34.93  ? 86   ASN A ND2 1 
ATOM   653  N  N   . TYR A 1 87  ? 65.188  50.037 5.672   1.00 30.36  ? 87   TYR A N   1 
ATOM   654  C  CA  . TYR A 1 87  ? 66.322  50.385 6.522   1.00 28.33  ? 87   TYR A CA  1 
ATOM   655  C  C   . TYR A 1 87  ? 67.567  49.537 6.337   1.00 27.05  ? 87   TYR A C   1 
ATOM   656  O  O   . TYR A 1 87  ? 67.498  48.364 5.973   1.00 25.37  ? 87   TYR A O   1 
ATOM   657  C  CB  . TYR A 1 87  ? 65.944  50.304 8.005   1.00 27.00  ? 87   TYR A CB  1 
ATOM   658  C  CG  . TYR A 1 87  ? 65.054  51.410 8.511   1.00 27.82  ? 87   TYR A CG  1 
ATOM   659  C  CD1 . TYR A 1 87  ? 63.668  51.345 8.355   1.00 28.10  ? 87   TYR A CD1 1 
ATOM   660  C  CD2 . TYR A 1 87  ? 65.595  52.523 9.157   1.00 28.50  ? 87   TYR A CD2 1 
ATOM   661  C  CE1 . TYR A 1 87  ? 62.846  52.358 8.830   1.00 28.70  ? 87   TYR A CE1 1 
ATOM   662  C  CE2 . TYR A 1 87  ? 64.778  53.546 9.635   1.00 30.04  ? 87   TYR A CE2 1 
ATOM   663  C  CZ  . TYR A 1 87  ? 63.404  53.454 9.467   1.00 29.39  ? 87   TYR A CZ  1 
ATOM   664  O  OH  . TYR A 1 87  ? 62.592  54.459 9.942   1.00 32.03  ? 87   TYR A OH  1 
ATOM   665  N  N   . LEU A 1 88  ? 68.706  50.165 6.607   1.00 25.73  ? 88   LEU A N   1 
ATOM   666  C  CA  . LEU A 1 88  ? 70.005  49.514 6.569   1.00 25.11  ? 88   LEU A CA  1 
ATOM   667  C  C   . LEU A 1 88  ? 70.767  50.076 7.757   1.00 23.36  ? 88   LEU A C   1 
ATOM   668  O  O   . LEU A 1 88  ? 71.014  51.278 7.818   1.00 26.17  ? 88   LEU A O   1 
ATOM   669  C  CB  . LEU A 1 88  ? 70.778  49.837 5.287   1.00 25.63  ? 88   LEU A CB  1 
ATOM   670  C  CG  . LEU A 1 88  ? 72.260  49.427 5.340   1.00 27.24  ? 88   LEU A CG  1 
ATOM   671  C  CD1 . LEU A 1 88  ? 72.375  47.919 5.528   1.00 25.09  ? 88   LEU A CD1 1 
ATOM   672  C  CD2 . LEU A 1 88  ? 72.972  49.857 4.062   1.00 27.00  ? 88   LEU A CD2 1 
ATOM   673  N  N   . PHE A 1 89  ? 71.093  49.217 8.717   1.00 21.89  ? 89   PHE A N   1 
ATOM   674  C  CA  . PHE A 1 89  ? 71.864  49.631 9.882   1.00 20.86  ? 89   PHE A CA  1 
ATOM   675  C  C   . PHE A 1 89  ? 73.283  49.155 9.621   1.00 19.92  ? 89   PHE A C   1 
ATOM   676  O  O   . PHE A 1 89  ? 73.491  48.118 8.983   1.00 21.14  ? 89   PHE A O   1 
ATOM   677  C  CB  . PHE A 1 89  ? 71.311  49.006 11.171  1.00 19.68  ? 89   PHE A CB  1 
ATOM   678  C  CG  . PHE A 1 89  ? 70.020  49.618 11.630  1.00 21.04  ? 89   PHE A CG  1 
ATOM   679  C  CD1 . PHE A 1 89  ? 68.824  49.304 10.996  1.00 20.29  ? 89   PHE A CD1 1 
ATOM   680  C  CD2 . PHE A 1 89  ? 70.002  50.532 12.683  1.00 20.71  ? 89   PHE A CD2 1 
ATOM   681  C  CE1 . PHE A 1 89  ? 67.620  49.895 11.403  1.00 21.41  ? 89   PHE A CE1 1 
ATOM   682  C  CE2 . PHE A 1 89  ? 68.808  51.126 13.094  1.00 21.27  ? 89   PHE A CE2 1 
ATOM   683  C  CZ  . PHE A 1 89  ? 67.612  50.805 12.450  1.00 20.03  ? 89   PHE A CZ  1 
ATOM   684  N  N   . LEU A 1 90  ? 74.256  49.903 10.121  1.00 18.89  ? 90   LEU A N   1 
ATOM   685  C  CA  . LEU A 1 90  ? 75.650  49.581 9.872   1.00 20.53  ? 90   LEU A CA  1 
ATOM   686  C  C   . LEU A 1 90  ? 76.384  48.848 10.982  1.00 20.42  ? 90   LEU A C   1 
ATOM   687  O  O   . LEU A 1 90  ? 77.603  48.688 10.910  1.00 21.87  ? 90   LEU A O   1 
ATOM   688  C  CB  . LEU A 1 90  ? 76.399  50.867 9.503   1.00 18.84  ? 90   LEU A CB  1 
ATOM   689  C  CG  . LEU A 1 90  ? 75.760  51.634 8.335   1.00 21.48  ? 90   LEU A CG  1 
ATOM   690  C  CD1 . LEU A 1 90  ? 76.420  53.001 8.200   1.00 19.33  ? 90   LEU A CD1 1 
ATOM   691  C  CD2 . LEU A 1 90  ? 75.892  50.842 7.041   1.00 22.82  ? 90   LEU A CD2 1 
ATOM   692  N  N   . GLY A 1 91  ? 75.658  48.394 12.000  1.00 19.45  ? 91   GLY A N   1 
ATOM   693  C  CA  . GLY A 1 91  ? 76.309  47.660 13.078  1.00 18.41  ? 91   GLY A CA  1 
ATOM   694  C  C   . GLY A 1 91  ? 76.361  48.387 14.408  1.00 18.98  ? 91   GLY A C   1 
ATOM   695  O  O   . GLY A 1 91  ? 75.850  49.496 14.530  1.00 18.70  ? 91   GLY A O   1 
ATOM   696  N  N   . ASP A 1 92  ? 77.001  47.751 15.393  1.00 18.24  ? 92   ASP A N   1 
ATOM   697  C  CA  . ASP A 1 92  ? 77.140  48.266 16.753  1.00 18.25  ? 92   ASP A CA  1 
ATOM   698  C  C   . ASP A 1 92  ? 75.794  48.511 17.415  1.00 20.17  ? 92   ASP A C   1 
ATOM   699  O  O   . ASP A 1 92  ? 75.468  49.621 17.834  1.00 20.30  ? 92   ASP A O   1 
ATOM   700  C  CB  . ASP A 1 92  ? 78.014  49.523 16.777  1.00 18.80  ? 92   ASP A CB  1 
ATOM   701  C  CG  . ASP A 1 92  ? 79.501  49.186 16.685  1.00 18.52  ? 92   ASP A CG  1 
ATOM   702  O  OD1 . ASP A 1 92  ? 79.815  48.001 16.441  1.00 16.76  ? 92   ASP A OD1 1 
ATOM   703  O  OD2 . ASP A 1 92  ? 80.345  50.089 16.842  1.00 16.77  ? 92   ASP A OD2 1 
ATOM   704  N  N   . TYR A 1 93  ? 75.038  47.424 17.523  1.00 20.09  ? 93   TYR A N   1 
ATOM   705  C  CA  . TYR A 1 93  ? 73.708  47.411 18.120  1.00 20.01  ? 93   TYR A CA  1 
ATOM   706  C  C   . TYR A 1 93  ? 73.754  47.240 19.634  1.00 20.39  ? 93   TYR A C   1 
ATOM   707  O  O   . TYR A 1 93  ? 72.841  47.671 20.335  1.00 20.82  ? 93   TYR A O   1 
ATOM   708  C  CB  . TYR A 1 93  ? 72.906  46.253 17.526  1.00 18.54  ? 93   TYR A CB  1 
ATOM   709  C  CG  . TYR A 1 93  ? 72.987  46.196 16.024  1.00 18.66  ? 93   TYR A CG  1 
ATOM   710  C  CD1 . TYR A 1 93  ? 72.568  47.275 15.252  1.00 18.47  ? 93   TYR A CD1 1 
ATOM   711  C  CD2 . TYR A 1 93  ? 73.509  45.079 15.374  1.00 20.03  ? 93   TYR A CD2 1 
ATOM   712  C  CE1 . TYR A 1 93  ? 72.663  47.249 13.866  1.00 18.97  ? 93   TYR A CE1 1 
ATOM   713  C  CE2 . TYR A 1 93  ? 73.616  45.042 13.986  1.00 17.25  ? 93   TYR A CE2 1 
ATOM   714  C  CZ  . TYR A 1 93  ? 73.189  46.136 13.240  1.00 21.20  ? 93   TYR A CZ  1 
ATOM   715  O  OH  . TYR A 1 93  ? 73.289  46.134 11.867  1.00 21.51  ? 93   TYR A OH  1 
ATOM   716  N  N   . VAL A 1 94  ? 74.814  46.611 20.135  1.00 21.14  ? 94   VAL A N   1 
ATOM   717  C  CA  . VAL A 1 94  ? 74.930  46.359 21.570  1.00 20.41  ? 94   VAL A CA  1 
ATOM   718  C  C   . VAL A 1 94  ? 76.125  47.034 22.245  1.00 22.32  ? 94   VAL A C   1 
ATOM   719  O  O   . VAL A 1 94  ? 76.941  47.673 21.584  1.00 22.33  ? 94   VAL A O   1 
ATOM   720  C  CB  . VAL A 1 94  ? 74.990  44.838 21.837  1.00 20.84  ? 94   VAL A CB  1 
ATOM   721  C  CG1 . VAL A 1 94  ? 73.800  44.143 21.137  1.00 20.06  ? 94   VAL A CG1 1 
ATOM   722  C  CG2 . VAL A 1 94  ? 76.321  44.259 21.328  1.00 20.34  ? 94   VAL A CG2 1 
ATOM   723  N  N   . ASP A 1 95  ? 76.208  46.873 23.565  1.00 21.13  ? 95   ASP A N   1 
ATOM   724  C  CA  . ASP A 1 95  ? 77.268  47.449 24.398  1.00 22.84  ? 95   ASP A CA  1 
ATOM   725  C  C   . ASP A 1 95  ? 77.058  48.929 24.715  1.00 24.61  ? 95   ASP A C   1 
ATOM   726  O  O   . ASP A 1 95  ? 76.371  49.643 23.985  1.00 22.48  ? 95   ASP A O   1 
ATOM   727  C  CB  . ASP A 1 95  ? 78.650  47.293 23.745  1.00 23.41  ? 95   ASP A CB  1 
ATOM   728  C  CG  . ASP A 1 95  ? 79.151  45.862 23.743  1.00 23.54  ? 95   ASP A CG  1 
ATOM   729  O  OD1 . ASP A 1 95  ? 78.718  45.062 24.606  1.00 22.51  ? 95   ASP A OD1 1 
ATOM   730  O  OD2 . ASP A 1 95  ? 80.006  45.542 22.884  1.00 19.18  ? 95   ASP A OD2 1 
ATOM   731  N  N   . ARG A 1 96  ? 77.658  49.369 25.823  1.00 24.31  ? 96   ARG A N   1 
ATOM   732  C  CA  . ARG A 1 96  ? 77.614  50.759 26.269  1.00 26.99  ? 96   ARG A CA  1 
ATOM   733  C  C   . ARG A 1 96  ? 76.257  51.225 26.789  1.00 28.61  ? 96   ARG A C   1 
ATOM   734  O  O   . ARG A 1 96  ? 76.160  51.737 27.909  1.00 28.74  ? 96   ARG A O   1 
ATOM   735  C  CB  . ARG A 1 96  ? 78.071  51.688 25.137  1.00 29.69  ? 96   ARG A CB  1 
ATOM   736  C  CG  . ARG A 1 96  ? 79.358  51.261 24.437  1.00 34.44  ? 96   ARG A CG  1 
ATOM   737  C  CD  . ARG A 1 96  ? 80.616  51.612 25.223  1.00 40.02  ? 96   ARG A CD  1 
ATOM   738  N  NE  . ARG A 1 96  ? 80.791  50.819 26.436  1.00 43.72  ? 96   ARG A NE  1 
ATOM   739  C  CZ  . ARG A 1 96  ? 81.862  50.893 27.223  1.00 45.71  ? 96   ARG A CZ  1 
ATOM   740  N  NH1 . ARG A 1 96  ? 82.853  51.722 26.923  1.00 45.17  ? 96   ARG A NH1 1 
ATOM   741  N  NH2 . ARG A 1 96  ? 81.940  50.144 28.317  1.00 46.96  ? 96   ARG A NH2 1 
ATOM   742  N  N   . GLY A 1 97  ? 75.218  51.060 25.975  1.00 27.73  ? 97   GLY A N   1 
ATOM   743  C  CA  . GLY A 1 97  ? 73.884  51.470 26.378  1.00 26.92  ? 97   GLY A CA  1 
ATOM   744  C  C   . GLY A 1 97  ? 73.296  50.579 27.460  1.00 27.13  ? 97   GLY A C   1 
ATOM   745  O  O   . GLY A 1 97  ? 73.894  49.568 27.830  1.00 25.74  ? 97   GLY A O   1 
ATOM   746  N  N   . LYS A 1 98  ? 72.121  50.956 27.960  1.00 27.10  ? 98   LYS A N   1 
ATOM   747  C  CA  . LYS A 1 98  ? 71.436  50.209 29.020  1.00 28.59  ? 98   LYS A CA  1 
ATOM   748  C  C   . LYS A 1 98  ? 70.468  49.148 28.514  1.00 26.96  ? 98   LYS A C   1 
ATOM   749  O  O   . LYS A 1 98  ? 70.034  48.288 29.284  1.00 26.90  ? 98   LYS A O   1 
ATOM   750  C  CB  . LYS A 1 98  ? 70.642  51.165 29.912  1.00 33.18  ? 98   LYS A CB  1 
ATOM   751  C  CG  . LYS A 1 98  ? 71.469  52.170 30.693  1.00 38.49  ? 98   LYS A CG  1 
ATOM   752  C  CD  . LYS A 1 98  ? 70.558  53.169 31.408  1.00 43.85  ? 98   LYS A CD  1 
ATOM   753  C  CE  . LYS A 1 98  ? 69.550  52.462 32.317  1.00 47.26  ? 98   LYS A CE  1 
ATOM   754  N  NZ  . LYS A 1 98  ? 68.566  53.403 32.936  1.00 49.07  ? 98   LYS A NZ  1 
ATOM   755  N  N   . GLN A 1 99  ? 70.104  49.210 27.237  1.00 22.94  ? 99   GLN A N   1 
ATOM   756  C  CA  . GLN A 1 99  ? 69.160  48.234 26.706  1.00 23.07  ? 99   GLN A CA  1 
ATOM   757  C  C   . GLN A 1 99  ? 69.544  47.590 25.382  1.00 22.63  ? 99   GLN A C   1 
ATOM   758  O  O   . GLN A 1 99  ? 68.827  47.708 24.389  1.00 21.11  ? 99   GLN A O   1 
ATOM   759  C  CB  . GLN A 1 99  ? 67.771  48.865 26.595  1.00 22.41  ? 99   GLN A CB  1 
ATOM   760  C  CG  . GLN A 1 99  ? 67.151  49.185 27.954  1.00 27.27  ? 99   GLN A CG  1 
ATOM   761  C  CD  . GLN A 1 99  ? 65.814  49.891 27.833  1.00 27.07  ? 99   GLN A CD  1 
ATOM   762  O  OE1 . GLN A 1 99  ? 65.750  51.073 27.489  1.00 27.69  ? 99   GLN A OE1 1 
ATOM   763  N  NE2 . GLN A 1 99  ? 64.735  49.163 28.103  1.00 27.73  ? 99   GLN A NE2 1 
ATOM   764  N  N   . SER A 1 100 ? 70.676  46.897 25.377  1.00 21.48  ? 100  SER A N   1 
ATOM   765  C  CA  . SER A 1 100 ? 71.123  46.208 24.180  1.00 21.67  ? 100  SER A CA  1 
ATOM   766  C  C   . SER A 1 100 ? 70.110  45.129 23.810  1.00 21.43  ? 100  SER A C   1 
ATOM   767  O  O   . SER A 1 100 ? 69.816  44.925 22.638  1.00 21.69  ? 100  SER A O   1 
ATOM   768  C  CB  . SER A 1 100 ? 72.492  45.565 24.411  1.00 20.16  ? 100  SER A CB  1 
ATOM   769  O  OG  . SER A 1 100 ? 73.487  46.550 24.613  1.00 24.09  ? 100  SER A OG  1 
ATOM   770  N  N   . LEU A 1 101 ? 69.570  44.439 24.813  1.00 21.00  ? 101  LEU A N   1 
ATOM   771  C  CA  . LEU A 1 101 ? 68.607  43.378 24.541  1.00 21.63  ? 101  LEU A CA  1 
ATOM   772  C  C   . LEU A 1 101 ? 67.389  43.843 23.752  1.00 20.64  ? 101  LEU A C   1 
ATOM   773  O  O   . LEU A 1 101 ? 67.085  43.276 22.706  1.00 20.39  ? 101  LEU A O   1 
ATOM   774  C  CB  . LEU A 1 101 ? 68.184  42.703 25.850  1.00 23.57  ? 101  LEU A CB  1 
ATOM   775  C  CG  . LEU A 1 101 ? 69.320  41.861 26.442  1.00 22.88  ? 101  LEU A CG  1 
ATOM   776  C  CD1 . LEU A 1 101 ? 69.025  41.491 27.888  1.00 27.28  ? 101  LEU A CD1 1 
ATOM   777  C  CD2 . LEU A 1 101 ? 69.516  40.612 25.587  1.00 24.78  ? 101  LEU A CD2 1 
ATOM   778  N  N   . GLU A 1 102 ? 66.695  44.872 24.233  1.00 20.85  ? 102  GLU A N   1 
ATOM   779  C  CA  . GLU A 1 102 ? 65.524  45.364 23.505  1.00 22.34  ? 102  GLU A CA  1 
ATOM   780  C  C   . GLU A 1 102 ? 65.932  45.824 22.113  1.00 21.71  ? 102  GLU A C   1 
ATOM   781  O  O   . GLU A 1 102 ? 65.245  45.559 21.122  1.00 21.55  ? 102  GLU A O   1 
ATOM   782  C  CB  . GLU A 1 102 ? 64.855  46.525 24.250  1.00 22.08  ? 102  GLU A CB  1 
ATOM   783  C  CG  . GLU A 1 102 ? 64.031  46.098 25.454  1.00 24.72  ? 102  GLU A CG  1 
ATOM   784  C  CD  . GLU A 1 102 ? 64.857  45.941 26.723  1.00 25.49  ? 102  GLU A CD  1 
ATOM   785  O  OE1 . GLU A 1 102 ? 66.104  45.893 26.637  1.00 23.12  ? 102  GLU A OE1 1 
ATOM   786  O  OE2 . GLU A 1 102 ? 64.248  45.862 27.814  1.00 22.71  ? 102  GLU A OE2 1 
ATOM   787  N  N   . THR A 1 103 ? 67.067  46.508 22.047  1.00 21.47  ? 103  THR A N   1 
ATOM   788  C  CA  . THR A 1 103 ? 67.576  47.016 20.785  1.00 19.99  ? 103  THR A CA  1 
ATOM   789  C  C   . THR A 1 103 ? 67.782  45.906 19.761  1.00 20.08  ? 103  THR A C   1 
ATOM   790  O  O   . THR A 1 103 ? 67.163  45.919 18.699  1.00 20.94  ? 103  THR A O   1 
ATOM   791  C  CB  . THR A 1 103 ? 68.906  47.765 21.007  1.00 22.27  ? 103  THR A CB  1 
ATOM   792  O  OG1 . THR A 1 103 ? 68.692  48.843 21.927  1.00 22.20  ? 103  THR A OG1 1 
ATOM   793  C  CG2 . THR A 1 103 ? 69.438  48.327 19.691  1.00 18.77  ? 103  THR A CG2 1 
ATOM   794  N  N   . ILE A 1 104 ? 68.632  44.934 20.079  1.00 19.77  ? 104  ILE A N   1 
ATOM   795  C  CA  . ILE A 1 104 ? 68.901  43.859 19.135  1.00 20.59  ? 104  ILE A CA  1 
ATOM   796  C  C   . ILE A 1 104 ? 67.673  42.992 18.817  1.00 20.84  ? 104  ILE A C   1 
ATOM   797  O  O   . ILE A 1 104 ? 67.521  42.536 17.689  1.00 20.84  ? 104  ILE A O   1 
ATOM   798  C  CB  . ILE A 1 104 ? 70.082  42.967 19.622  1.00 20.33  ? 104  ILE A CB  1 
ATOM   799  C  CG1 . ILE A 1 104 ? 70.494  41.986 18.518  1.00 20.64  ? 104  ILE A CG1 1 
ATOM   800  C  CG2 . ILE A 1 104 ? 69.688  42.208 20.885  1.00 19.67  ? 104  ILE A CG2 1 
ATOM   801  C  CD1 . ILE A 1 104 ? 70.891  42.656 17.211  1.00 24.31  ? 104  ILE A CD1 1 
ATOM   802  N  N   . CYS A 1 105 ? 66.796  42.766 19.794  1.00 19.51  ? 105  CYS A N   1 
ATOM   803  C  CA  . CYS A 1 105 ? 65.608  41.957 19.542  1.00 20.83  ? 105  CYS A CA  1 
ATOM   804  C  C   . CYS A 1 105 ? 64.644  42.639 18.567  1.00 21.50  ? 105  CYS A C   1 
ATOM   805  O  O   . CYS A 1 105 ? 64.092  41.983 17.680  1.00 23.45  ? 105  CYS A O   1 
ATOM   806  C  CB  . CYS A 1 105 ? 64.882  41.630 20.851  1.00 21.77  ? 105  CYS A CB  1 
ATOM   807  S  SG  . CYS A 1 105 ? 65.746  40.379 21.837  1.00 22.85  ? 105  CYS A SG  1 
ATOM   808  N  N   . LEU A 1 106 ? 64.450  43.946 18.714  1.00 20.84  ? 106  LEU A N   1 
ATOM   809  C  CA  . LEU A 1 106 ? 63.554  44.652 17.804  1.00 21.49  ? 106  LEU A CA  1 
ATOM   810  C  C   . LEU A 1 106 ? 64.140  44.623 16.397  1.00 21.70  ? 106  LEU A C   1 
ATOM   811  O  O   . LEU A 1 106 ? 63.419  44.414 15.426  1.00 21.95  ? 106  LEU A O   1 
ATOM   812  C  CB  . LEU A 1 106 ? 63.326  46.105 18.252  1.00 22.39  ? 106  LEU A CB  1 
ATOM   813  C  CG  . LEU A 1 106 ? 62.406  46.896 17.304  1.00 22.24  ? 106  LEU A CG  1 
ATOM   814  C  CD1 . LEU A 1 106 ? 61.069  46.176 17.179  1.00 24.08  ? 106  LEU A CD1 1 
ATOM   815  C  CD2 . LEU A 1 106 ? 62.209  48.312 17.804  1.00 20.96  ? 106  LEU A CD2 1 
ATOM   816  N  N   . LEU A 1 107 ? 65.453  44.819 16.287  1.00 22.08  ? 107  LEU A N   1 
ATOM   817  C  CA  . LEU A 1 107 ? 66.108  44.799 14.983  1.00 20.78  ? 107  LEU A CA  1 
ATOM   818  C  C   . LEU A 1 107 ? 66.014  43.414 14.347  1.00 21.16  ? 107  LEU A C   1 
ATOM   819  O  O   . LEU A 1 107 ? 65.670  43.290 13.171  1.00 22.99  ? 107  LEU A O   1 
ATOM   820  C  CB  . LEU A 1 107 ? 67.575  45.217 15.114  1.00 19.83  ? 107  LEU A CB  1 
ATOM   821  C  CG  . LEU A 1 107 ? 67.807  46.668 15.554  1.00 19.72  ? 107  LEU A CG  1 
ATOM   822  C  CD1 . LEU A 1 107 ? 69.289  46.903 15.774  1.00 23.89  ? 107  LEU A CD1 1 
ATOM   823  C  CD2 . LEU A 1 107 ? 67.266  47.624 14.498  1.00 19.78  ? 107  LEU A CD2 1 
ATOM   824  N  N   . LEU A 1 108 ? 66.313  42.368 15.115  1.00 21.05  ? 108  LEU A N   1 
ATOM   825  C  CA  . LEU A 1 108 ? 66.227  41.016 14.568  1.00 21.28  ? 108  LEU A CA  1 
ATOM   826  C  C   . LEU A 1 108 ? 64.778  40.690 14.204  1.00 24.16  ? 108  LEU A C   1 
ATOM   827  O  O   . LEU A 1 108 ? 64.515  40.036 13.192  1.00 24.30  ? 108  LEU A O   1 
ATOM   828  C  CB  . LEU A 1 108 ? 66.749  39.981 15.572  1.00 21.02  ? 108  LEU A CB  1 
ATOM   829  C  CG  . LEU A 1 108 ? 68.229  40.089 15.966  1.00 19.80  ? 108  LEU A CG  1 
ATOM   830  C  CD1 . LEU A 1 108 ? 68.571  38.953 16.924  1.00 22.08  ? 108  LEU A CD1 1 
ATOM   831  C  CD2 . LEU A 1 108 ? 69.108  40.022 14.726  1.00 21.41  ? 108  LEU A CD2 1 
ATOM   832  N  N   . ALA A 1 109 ? 63.842  41.153 15.029  1.00 24.54  ? 109  ALA A N   1 
ATOM   833  C  CA  . ALA A 1 109 ? 62.427  40.906 14.777  1.00 24.47  ? 109  ALA A CA  1 
ATOM   834  C  C   . ALA A 1 109 ? 62.012  41.497 13.429  1.00 26.16  ? 109  ALA A C   1 
ATOM   835  O  O   . ALA A 1 109 ? 61.298  40.850 12.656  1.00 26.76  ? 109  ALA A O   1 
ATOM   836  C  CB  . ALA A 1 109 ? 61.583  41.506 15.894  1.00 22.82  ? 109  ALA A CB  1 
ATOM   837  N  N   . TYR A 1 110 ? 62.454  42.719 13.143  1.00 25.48  ? 110  TYR A N   1 
ATOM   838  C  CA  . TYR A 1 110 ? 62.099  43.354 11.876  1.00 25.93  ? 110  TYR A CA  1 
ATOM   839  C  C   . TYR A 1 110 ? 62.777  42.679 10.694  1.00 26.87  ? 110  TYR A C   1 
ATOM   840  O  O   . TYR A 1 110 ? 62.213  42.628 9.602   1.00 28.44  ? 110  TYR A O   1 
ATOM   841  C  CB  . TYR A 1 110 ? 62.450  44.843 11.881  1.00 27.22  ? 110  TYR A CB  1 
ATOM   842  C  CG  . TYR A 1 110 ? 61.419  45.723 12.549  1.00 26.88  ? 110  TYR A CG  1 
ATOM   843  C  CD1 . TYR A 1 110 ? 60.052  45.523 12.333  1.00 28.38  ? 110  TYR A CD1 1 
ATOM   844  C  CD2 . TYR A 1 110 ? 61.807  46.791 13.356  1.00 27.49  ? 110  TYR A CD2 1 
ATOM   845  C  CE1 . TYR A 1 110 ? 59.099  46.369 12.904  1.00 28.09  ? 110  TYR A CE1 1 
ATOM   846  C  CE2 . TYR A 1 110 ? 60.866  47.641 13.926  1.00 28.03  ? 110  TYR A CE2 1 
ATOM   847  C  CZ  . TYR A 1 110 ? 59.514  47.425 13.695  1.00 28.02  ? 110  TYR A CZ  1 
ATOM   848  O  OH  . TYR A 1 110 ? 58.588  48.271 14.255  1.00 27.28  ? 110  TYR A OH  1 
ATOM   849  N  N   . LYS A 1 111 ? 63.987  42.168 10.910  1.00 25.96  ? 111  LYS A N   1 
ATOM   850  C  CA  . LYS A 1 111 ? 64.720  41.484 9.854   1.00 26.43  ? 111  LYS A CA  1 
ATOM   851  C  C   . LYS A 1 111 ? 63.931  40.249 9.431   1.00 28.16  ? 111  LYS A C   1 
ATOM   852  O  O   . LYS A 1 111 ? 63.818  39.941 8.242   1.00 27.40  ? 111  LYS A O   1 
ATOM   853  C  CB  . LYS A 1 111 ? 66.109  41.056 10.347  1.00 26.14  ? 111  LYS A CB  1 
ATOM   854  C  CG  . LYS A 1 111 ? 66.931  40.331 9.292   1.00 24.66  ? 111  LYS A CG  1 
ATOM   855  C  CD  . LYS A 1 111 ? 67.104  41.208 8.062   1.00 27.07  ? 111  LYS A CD  1 
ATOM   856  C  CE  . LYS A 1 111 ? 67.659  40.430 6.883   1.00 28.73  ? 111  LYS A CE  1 
ATOM   857  N  NZ  . LYS A 1 111 ? 67.533  41.235 5.634   1.00 31.24  ? 111  LYS A NZ  1 
ATOM   858  N  N   . ILE A 1 112 ? 63.386  39.549 10.420  1.00 27.22  ? 112  ILE A N   1 
ATOM   859  C  CA  . ILE A 1 112 ? 62.610  38.344 10.168  1.00 28.57  ? 112  ILE A CA  1 
ATOM   860  C  C   . ILE A 1 112 ? 61.265  38.700 9.539   1.00 30.56  ? 112  ILE A C   1 
ATOM   861  O  O   . ILE A 1 112 ? 60.795  38.020 8.623   1.00 29.92  ? 112  ILE A O   1 
ATOM   862  C  CB  . ILE A 1 112 ? 62.369  37.569 11.482  1.00 28.41  ? 112  ILE A CB  1 
ATOM   863  C  CG1 . ILE A 1 112 ? 63.714  37.145 12.078  1.00 27.32  ? 112  ILE A CG1 1 
ATOM   864  C  CG2 . ILE A 1 112 ? 61.486  36.348 11.224  1.00 30.03  ? 112  ILE A CG2 1 
ATOM   865  C  CD1 . ILE A 1 112 ? 63.627  36.584 13.484  1.00 28.22  ? 112  ILE A CD1 1 
ATOM   866  N  N   . LYS A 1 113 ? 60.660  39.773 10.037  1.00 30.25  ? 113  LYS A N   1 
ATOM   867  C  CA  . LYS A 1 113 ? 59.360  40.233 9.558   1.00 33.39  ? 113  LYS A CA  1 
ATOM   868  C  C   . LYS A 1 113 ? 59.409  40.838 8.151   1.00 33.97  ? 113  LYS A C   1 
ATOM   869  O  O   . LYS A 1 113 ? 58.488  40.645 7.352   1.00 33.86  ? 113  LYS A O   1 
ATOM   870  C  CB  . LYS A 1 113 ? 58.793  41.257 10.548  1.00 33.02  ? 113  LYS A CB  1 
ATOM   871  C  CG  . LYS A 1 113 ? 57.453  41.858 10.167  1.00 36.66  ? 113  LYS A CG  1 
ATOM   872  C  CD  . LYS A 1 113 ? 56.329  40.841 10.217  1.00 36.74  ? 113  LYS A CD  1 
ATOM   873  C  CE  . LYS A 1 113 ? 54.992  41.510 9.946   1.00 37.63  ? 113  LYS A CE  1 
ATOM   874  N  NZ  . LYS A 1 113 ? 53.865  40.541 10.010  1.00 38.55  ? 113  LYS A NZ  1 
ATOM   875  N  N   . TYR A 1 114 ? 60.477  41.570 7.852   1.00 34.20  ? 114  TYR A N   1 
ATOM   876  C  CA  . TYR A 1 114 ? 60.631  42.208 6.544   1.00 33.91  ? 114  TYR A CA  1 
ATOM   877  C  C   . TYR A 1 114 ? 62.039  41.958 6.002   1.00 34.94  ? 114  TYR A C   1 
ATOM   878  O  O   . TYR A 1 114 ? 62.810  42.893 5.798   1.00 34.86  ? 114  TYR A O   1 
ATOM   879  C  CB  . TYR A 1 114 ? 60.390  43.711 6.677   1.00 34.63  ? 114  TYR A CB  1 
ATOM   880  C  CG  . TYR A 1 114 ? 59.069  44.064 7.327   1.00 35.72  ? 114  TYR A CG  1 
ATOM   881  C  CD1 . TYR A 1 114 ? 57.859  43.845 6.664   1.00 36.32  ? 114  TYR A CD1 1 
ATOM   882  C  CD2 . TYR A 1 114 ? 59.027  44.607 8.613   1.00 35.57  ? 114  TYR A CD2 1 
ATOM   883  C  CE1 . TYR A 1 114 ? 56.642  44.156 7.267   1.00 36.00  ? 114  TYR A CE1 1 
ATOM   884  C  CE2 . TYR A 1 114 ? 57.816  44.922 9.224   1.00 36.57  ? 114  TYR A CE2 1 
ATOM   885  C  CZ  . TYR A 1 114 ? 56.627  44.693 8.547   1.00 37.51  ? 114  TYR A CZ  1 
ATOM   886  O  OH  . TYR A 1 114 ? 55.428  44.997 9.155   1.00 36.97  ? 114  TYR A OH  1 
ATOM   887  N  N   . PRO A 1 115 ? 62.377  40.689 5.736   1.00 34.88  ? 115  PRO A N   1 
ATOM   888  C  CA  . PRO A 1 115 ? 63.688  40.277 5.224   1.00 36.10  ? 115  PRO A CA  1 
ATOM   889  C  C   . PRO A 1 115 ? 64.195  40.976 3.962   1.00 36.35  ? 115  PRO A C   1 
ATOM   890  O  O   . PRO A 1 115 ? 65.404  41.073 3.756   1.00 36.37  ? 115  PRO A O   1 
ATOM   891  C  CB  . PRO A 1 115 ? 63.518  38.772 5.026   1.00 37.06  ? 115  PRO A CB  1 
ATOM   892  C  CG  . PRO A 1 115 ? 62.071  38.654 4.665   1.00 36.69  ? 115  PRO A CG  1 
ATOM   893  C  CD  . PRO A 1 115 ? 61.423  39.568 5.674   1.00 36.90  ? 115  PRO A CD  1 
ATOM   894  N  N   . GLU A 1 116 ? 63.283  41.467 3.128   1.00 37.06  ? 116  GLU A N   1 
ATOM   895  C  CA  . GLU A 1 116 ? 63.668  42.137 1.887   1.00 36.77  ? 116  GLU A CA  1 
ATOM   896  C  C   . GLU A 1 116 ? 63.644  43.665 1.967   1.00 35.82  ? 116  GLU A C   1 
ATOM   897  O  O   . GLU A 1 116 ? 64.010  44.341 1.003   1.00 37.26  ? 116  GLU A O   1 
ATOM   898  C  CB  . GLU A 1 116 ? 62.753  41.692 0.740   1.00 39.15  ? 116  GLU A CB  1 
ATOM   899  C  CG  . GLU A 1 116 ? 62.805  40.208 0.394   1.00 41.83  ? 116  GLU A CG  1 
ATOM   900  C  CD  . GLU A 1 116 ? 64.188  39.743 -0.030  1.00 44.50  ? 116  GLU A CD  1 
ATOM   901  O  OE1 . GLU A 1 116 ? 64.959  40.565 -0.569  1.00 44.84  ? 116  GLU A OE1 1 
ATOM   902  O  OE2 . GLU A 1 116 ? 64.500  38.548 0.160   1.00 48.21  ? 116  GLU A OE2 1 
ATOM   903  N  N   . ASN A 1 117 ? 63.228  44.209 3.109   1.00 34.48  ? 117  ASN A N   1 
ATOM   904  C  CA  . ASN A 1 117 ? 63.141  45.660 3.283   1.00 32.81  ? 117  ASN A CA  1 
ATOM   905  C  C   . ASN A 1 117 ? 63.825  46.148 4.554   1.00 31.26  ? 117  ASN A C   1 
ATOM   906  O  O   . ASN A 1 117 ? 63.719  47.322 4.914   1.00 30.70  ? 117  ASN A O   1 
ATOM   907  C  CB  . ASN A 1 117 ? 61.672  46.086 3.325   1.00 34.08  ? 117  ASN A CB  1 
ATOM   908  C  CG  . ASN A 1 117 ? 60.926  45.739 2.051   1.00 38.11  ? 117  ASN A CG  1 
ATOM   909  O  OD1 . ASN A 1 117 ? 60.998  46.461 1.053   1.00 39.57  ? 117  ASN A OD1 1 
ATOM   910  N  ND2 . ASN A 1 117 ? 60.216  44.622 2.075   1.00 37.95  ? 117  ASN A ND2 1 
ATOM   911  N  N   . PHE A 1 118 ? 64.522  45.247 5.234   1.00 28.67  ? 118  PHE A N   1 
ATOM   912  C  CA  . PHE A 1 118 ? 65.200  45.591 6.475   1.00 27.12  ? 118  PHE A CA  1 
ATOM   913  C  C   . PHE A 1 118 ? 66.535  44.864 6.485   1.00 25.78  ? 118  PHE A C   1 
ATOM   914  O  O   . PHE A 1 118 ? 66.577  43.646 6.342   1.00 26.56  ? 118  PHE A O   1 
ATOM   915  C  CB  . PHE A 1 118 ? 64.350  45.137 7.661   1.00 25.67  ? 118  PHE A CB  1 
ATOM   916  C  CG  . PHE A 1 118 ? 64.736  45.768 8.960   1.00 23.98  ? 118  PHE A CG  1 
ATOM   917  C  CD1 . PHE A 1 118 ? 64.261  47.027 9.302   1.00 22.98  ? 118  PHE A CD1 1 
ATOM   918  C  CD2 . PHE A 1 118 ? 65.579  45.106 9.843   1.00 24.74  ? 118  PHE A CD2 1 
ATOM   919  C  CE1 . PHE A 1 118 ? 64.618  47.620 10.502  1.00 24.64  ? 118  PHE A CE1 1 
ATOM   920  C  CE2 . PHE A 1 118 ? 65.944  45.691 11.050  1.00 23.14  ? 118  PHE A CE2 1 
ATOM   921  C  CZ  . PHE A 1 118 ? 65.463  46.948 11.381  1.00 24.74  ? 118  PHE A CZ  1 
ATOM   922  N  N   . PHE A 1 119 ? 67.628  45.604 6.650   1.00 25.86  ? 119  PHE A N   1 
ATOM   923  C  CA  . PHE A 1 119 ? 68.944  44.976 6.649   1.00 25.29  ? 119  PHE A CA  1 
ATOM   924  C  C   . PHE A 1 119 ? 69.858  45.448 7.769   1.00 22.59  ? 119  PHE A C   1 
ATOM   925  O  O   . PHE A 1 119 ? 69.790  46.597 8.204   1.00 21.12  ? 119  PHE A O   1 
ATOM   926  C  CB  . PHE A 1 119 ? 69.615  45.188 5.290   1.00 26.75  ? 119  PHE A CB  1 
ATOM   927  C  CG  . PHE A 1 119 ? 68.816  44.645 4.145   1.00 27.95  ? 119  PHE A CG  1 
ATOM   928  C  CD1 . PHE A 1 119 ? 67.765  45.380 3.605   1.00 29.46  ? 119  PHE A CD1 1 
ATOM   929  C  CD2 . PHE A 1 119 ? 69.066  43.368 3.652   1.00 28.42  ? 119  PHE A CD2 1 
ATOM   930  C  CE1 . PHE A 1 119 ? 66.968  44.848 2.593   1.00 28.24  ? 119  PHE A CE1 1 
ATOM   931  C  CE2 . PHE A 1 119 ? 68.273  42.827 2.637   1.00 31.38  ? 119  PHE A CE2 1 
ATOM   932  C  CZ  . PHE A 1 119 ? 67.222  43.572 2.111   1.00 29.46  ? 119  PHE A CZ  1 
ATOM   933  N  N   . LEU A 1 120 ? 70.712  44.536 8.228   1.00 22.85  ? 120  LEU A N   1 
ATOM   934  C  CA  . LEU A 1 120 ? 71.646  44.813 9.316   1.00 22.44  ? 120  LEU A CA  1 
ATOM   935  C  C   . LEU A 1 120 ? 73.049  44.332 8.960   1.00 20.83  ? 120  LEU A C   1 
ATOM   936  O  O   . LEU A 1 120 ? 73.229  43.191 8.540   1.00 21.87  ? 120  LEU A O   1 
ATOM   937  C  CB  . LEU A 1 120 ? 71.200  44.085 10.590  1.00 21.85  ? 120  LEU A CB  1 
ATOM   938  C  CG  . LEU A 1 120 ? 69.783  44.276 11.139  1.00 22.66  ? 120  LEU A CG  1 
ATOM   939  C  CD1 . LEU A 1 120 ? 69.526  43.227 12.228  1.00 22.88  ? 120  LEU A CD1 1 
ATOM   940  C  CD2 . LEU A 1 120 ? 69.607  45.686 11.682  1.00 21.57  ? 120  LEU A CD2 1 
ATOM   941  N  N   . LEU A 1 121 ? 74.039  45.204 9.126   1.00 19.62  ? 121  LEU A N   1 
ATOM   942  C  CA  . LEU A 1 121 ? 75.420  44.832 8.862   1.00 19.48  ? 121  LEU A CA  1 
ATOM   943  C  C   . LEU A 1 121 ? 76.086  44.546 10.204  1.00 18.95  ? 121  LEU A C   1 
ATOM   944  O  O   . LEU A 1 121 ? 75.571  44.917 11.259  1.00 20.01  ? 121  LEU A O   1 
ATOM   945  C  CB  . LEU A 1 121 ? 76.184  45.964 8.172   1.00 18.14  ? 121  LEU A CB  1 
ATOM   946  C  CG  . LEU A 1 121 ? 75.723  46.445 6.793   1.00 17.99  ? 121  LEU A CG  1 
ATOM   947  C  CD1 . LEU A 1 121 ? 76.791  47.397 6.253   1.00 20.65  ? 121  LEU A CD1 1 
ATOM   948  C  CD2 . LEU A 1 121 ? 75.539  45.266 5.841   1.00 17.87  ? 121  LEU A CD2 1 
ATOM   949  N  N   . ARG A 1 122 ? 77.240  43.900 10.151  1.00 18.55  ? 122  ARG A N   1 
ATOM   950  C  CA  . ARG A 1 122 ? 77.992  43.570 11.354  1.00 16.92  ? 122  ARG A CA  1 
ATOM   951  C  C   . ARG A 1 122 ? 78.938  44.714 11.740  1.00 19.08  ? 122  ARG A C   1 
ATOM   952  O  O   . ARG A 1 122 ? 79.618  45.279 10.883  1.00 19.13  ? 122  ARG A O   1 
ATOM   953  C  CB  . ARG A 1 122 ? 78.803  42.301 11.100  1.00 19.24  ? 122  ARG A CB  1 
ATOM   954  C  CG  . ARG A 1 122 ? 79.513  41.744 12.316  1.00 19.22  ? 122  ARG A CG  1 
ATOM   955  C  CD  . ARG A 1 122 ? 80.150  40.397 11.996  1.00 20.18  ? 122  ARG A CD  1 
ATOM   956  N  NE  . ARG A 1 122 ? 80.637  39.756 13.213  1.00 19.98  ? 122  ARG A NE  1 
ATOM   957  C  CZ  . ARG A 1 122 ? 81.167  38.540 13.263  1.00 23.15  ? 122  ARG A CZ  1 
ATOM   958  N  NH1 . ARG A 1 122 ? 81.291  37.814 12.159  1.00 21.75  ? 122  ARG A NH1 1 
ATOM   959  N  NH2 . ARG A 1 122 ? 81.568  38.049 14.428  1.00 25.35  ? 122  ARG A NH2 1 
ATOM   960  N  N   . GLY A 1 123 ? 78.964  45.060 13.025  1.00 16.33  ? 123  GLY A N   1 
ATOM   961  C  CA  . GLY A 1 123 ? 79.861  46.094 13.507  1.00 16.33  ? 123  GLY A CA  1 
ATOM   962  C  C   . GLY A 1 123 ? 80.922  45.388 14.336  1.00 17.68  ? 123  GLY A C   1 
ATOM   963  O  O   . GLY A 1 123 ? 80.831  44.171 14.508  1.00 18.80  ? 123  GLY A O   1 
ATOM   964  N  N   . ASN A 1 124 ? 81.919  46.107 14.855  1.00 17.39  ? 124  ASN A N   1 
ATOM   965  C  CA  . ASN A 1 124 ? 82.945  45.435 15.656  1.00 19.55  ? 124  ASN A CA  1 
ATOM   966  C  C   . ASN A 1 124 ? 82.378  44.998 17.006  1.00 19.66  ? 124  ASN A C   1 
ATOM   967  O  O   . ASN A 1 124 ? 82.960  44.151 17.685  1.00 18.66  ? 124  ASN A O   1 
ATOM   968  C  CB  . ASN A 1 124 ? 84.193  46.325 15.848  1.00 17.42  ? 124  ASN A CB  1 
ATOM   969  C  CG  . ASN A 1 124 ? 83.901  47.605 16.601  1.00 19.17  ? 124  ASN A CG  1 
ATOM   970  O  OD1 . ASN A 1 124 ? 82.962  48.332 16.277  1.00 20.43  ? 124  ASN A OD1 1 
ATOM   971  N  ND2 . ASN A 1 124 ? 84.721  47.899 17.603  1.00 18.52  ? 124  ASN A ND2 1 
ATOM   972  N  N   . HIS A 1 125 ? 81.237  45.564 17.386  1.00 19.79  ? 125  HIS A N   1 
ATOM   973  C  CA  . HIS A 1 125 ? 80.607  45.180 18.645  1.00 20.15  ? 125  HIS A CA  1 
ATOM   974  C  C   . HIS A 1 125 ? 79.753  43.922 18.500  1.00 20.89  ? 125  HIS A C   1 
ATOM   975  O  O   . HIS A 1 125 ? 79.235  43.384 19.483  1.00 21.34  ? 125  HIS A O   1 
ATOM   976  C  CB  . HIS A 1 125 ? 79.819  46.353 19.215  1.00 20.68  ? 125  HIS A CB  1 
ATOM   977  C  CG  . HIS A 1 125 ? 80.694  47.371 19.877  1.00 22.87  ? 125  HIS A CG  1 
ATOM   978  N  ND1 . HIS A 1 125 ? 80.908  47.392 21.240  1.00 21.04  ? 125  HIS A ND1 1 
ATOM   979  C  CD2 . HIS A 1 125 ? 81.491  48.336 19.359  1.00 22.77  ? 125  HIS A CD2 1 
ATOM   980  C  CE1 . HIS A 1 125 ? 81.799  48.321 21.531  1.00 24.07  ? 125  HIS A CE1 1 
ATOM   981  N  NE2 . HIS A 1 125 ? 82.172  48.909 20.406  1.00 23.62  ? 125  HIS A NE2 1 
ATOM   982  N  N   . GLU A 1 126 ? 79.601  43.449 17.267  1.00 20.37  ? 126  GLU A N   1 
ATOM   983  C  CA  . GLU A 1 126 ? 78.883  42.204 17.051  1.00 21.22  ? 126  GLU A CA  1 
ATOM   984  C  C   . GLU A 1 126 ? 79.948  41.106 16.969  1.00 23.57  ? 126  GLU A C   1 
ATOM   985  O  O   . GLU A 1 126 ? 79.890  40.213 16.127  1.00 24.72  ? 126  GLU A O   1 
ATOM   986  C  CB  . GLU A 1 126 ? 78.039  42.253 15.774  1.00 19.50  ? 126  GLU A CB  1 
ATOM   987  C  CG  . GLU A 1 126 ? 76.706  42.980 15.962  1.00 19.87  ? 126  GLU A CG  1 
ATOM   988  C  CD  . GLU A 1 126 ? 76.876  44.470 16.187  1.00 22.51  ? 126  GLU A CD  1 
ATOM   989  O  OE1 . GLU A 1 126 ? 77.509  45.115 15.323  1.00 19.70  ? 126  GLU A OE1 1 
ATOM   990  O  OE2 . GLU A 1 126 ? 76.376  45.001 17.212  1.00 18.80  ? 126  GLU A OE2 1 
ATOM   991  N  N   . CYS A 1 127 ? 80.935  41.214 17.856  1.00 24.55  ? 127  CYS A N   1 
ATOM   992  C  CA  . CYS A 1 127 ? 82.029  40.249 17.968  1.00 26.79  ? 127  CYS A CA  1 
ATOM   993  C  C   . CYS A 1 127 ? 82.102  39.882 19.449  1.00 25.85  ? 127  CYS A C   1 
ATOM   994  O  O   . CYS A 1 127 ? 82.125  40.764 20.307  1.00 24.06  ? 127  CYS A O   1 
ATOM   995  C  CB  . CYS A 1 127 ? 83.358  40.869 17.518  1.00 26.21  ? 127  CYS A CB  1 
ATOM   996  S  SG  . CYS A 1 127 ? 83.430  41.315 15.751  1.00 29.84  ? 127  CYS A SG  1 
ATOM   997  N  N   . ALA A 1 128 ? 82.125  38.584 19.742  1.00 27.99  ? 128  ALA A N   1 
ATOM   998  C  CA  . ALA A 1 128 ? 82.164  38.094 21.124  1.00 28.40  ? 128  ALA A CA  1 
ATOM   999  C  C   . ALA A 1 128 ? 83.220  38.737 22.017  1.00 28.32  ? 128  ALA A C   1 
ATOM   1000 O  O   . ALA A 1 128 ? 82.922  39.158 23.135  1.00 25.54  ? 128  ALA A O   1 
ATOM   1001 C  CB  . ALA A 1 128 ? 82.343  36.576 21.132  1.00 28.75  ? 128  ALA A CB  1 
ATOM   1002 N  N   . SER A 1 129 ? 84.454  38.815 21.530  1.00 28.56  ? 129  SER A N   1 
ATOM   1003 C  CA  . SER A 1 129 ? 85.531  39.394 22.322  1.00 29.58  ? 129  SER A CA  1 
ATOM   1004 C  C   . SER A 1 129 ? 85.247  40.824 22.759  1.00 29.28  ? 129  SER A C   1 
ATOM   1005 O  O   . SER A 1 129 ? 85.708  41.256 23.814  1.00 29.09  ? 129  SER A O   1 
ATOM   1006 C  CB  . SER A 1 129 ? 86.851  39.323 21.547  1.00 32.84  ? 129  SER A CB  1 
ATOM   1007 O  OG  . SER A 1 129 ? 86.675  39.668 20.183  1.00 38.69  ? 129  SER A OG  1 
ATOM   1008 N  N   . ILE A 1 130 ? 84.475  41.553 21.956  1.00 25.50  ? 130  ILE A N   1 
ATOM   1009 C  CA  . ILE A 1 130 ? 84.139  42.934 22.275  1.00 26.52  ? 130  ILE A CA  1 
ATOM   1010 C  C   . ILE A 1 130 ? 82.892  43.076 23.154  1.00 25.67  ? 130  ILE A C   1 
ATOM   1011 O  O   . ILE A 1 130 ? 82.947  43.731 24.198  1.00 24.96  ? 130  ILE A O   1 
ATOM   1012 C  CB  . ILE A 1 130 ? 83.922  43.767 20.983  1.00 26.19  ? 130  ILE A CB  1 
ATOM   1013 C  CG1 . ILE A 1 130 ? 85.230  43.864 20.194  1.00 29.26  ? 130  ILE A CG1 1 
ATOM   1014 C  CG2 . ILE A 1 130 ? 83.415  45.161 21.331  1.00 26.10  ? 130  ILE A CG2 1 
ATOM   1015 C  CD1 . ILE A 1 130 ? 86.328  44.638 20.905  1.00 29.43  ? 130  ILE A CD1 1 
ATOM   1016 N  N   . ASN A 1 131 ? 81.773  42.474 22.745  1.00 23.31  ? 131  ASN A N   1 
ATOM   1017 C  CA  . ASN A 1 131 ? 80.552  42.617 23.535  1.00 24.34  ? 131  ASN A CA  1 
ATOM   1018 C  C   . ASN A 1 131 ? 80.590  41.813 24.826  1.00 25.61  ? 131  ASN A C   1 
ATOM   1019 O  O   . ASN A 1 131 ? 79.655  41.839 25.624  1.00 26.13  ? 131  ASN A O   1 
ATOM   1020 C  CB  . ASN A 1 131 ? 79.281  42.305 22.701  1.00 23.15  ? 131  ASN A CB  1 
ATOM   1021 C  CG  . ASN A 1 131 ? 79.212  40.872 22.204  1.00 25.12  ? 131  ASN A CG  1 
ATOM   1022 O  OD1 . ASN A 1 131 ? 79.360  39.922 22.969  1.00 26.74  ? 131  ASN A OD1 1 
ATOM   1023 N  ND2 . ASN A 1 131 ? 78.955  40.712 20.909  1.00 23.32  ? 131  ASN A ND2 1 
ATOM   1024 N  N   . ARG A 1 132 ? 81.696  41.116 25.042  1.00 26.02  ? 132  ARG A N   1 
ATOM   1025 C  CA  . ARG A 1 132 ? 81.867  40.359 26.263  1.00 27.29  ? 132  ARG A CA  1 
ATOM   1026 C  C   . ARG A 1 132 ? 82.319  41.331 27.346  1.00 27.04  ? 132  ARG A C   1 
ATOM   1027 O  O   . ARG A 1 132 ? 81.947  41.196 28.508  1.00 28.84  ? 132  ARG A O   1 
ATOM   1028 C  CB  . ARG A 1 132 ? 82.929  39.273 26.067  1.00 27.72  ? 132  ARG A CB  1 
ATOM   1029 C  CG  . ARG A 1 132 ? 83.370  38.598 27.351  1.00 30.40  ? 132  ARG A CG  1 
ATOM   1030 C  CD  . ARG A 1 132 ? 84.292  37.432 27.055  1.00 32.38  ? 132  ARG A CD  1 
ATOM   1031 N  NE  . ARG A 1 132 ? 83.743  36.198 27.600  1.00 37.31  ? 132  ARG A NE  1 
ATOM   1032 C  CZ  . ARG A 1 132 ? 83.863  35.012 27.020  1.00 38.01  ? 132  ARG A CZ  1 
ATOM   1033 N  NH1 . ARG A 1 132 ? 84.516  34.901 25.870  1.00 37.35  ? 132  ARG A NH1 1 
ATOM   1034 N  NH2 . ARG A 1 132 ? 83.322  33.943 27.588  1.00 39.27  ? 132  ARG A NH2 1 
ATOM   1035 N  N   . ILE A 1 133 ? 83.092  42.335 26.939  1.00 27.88  ? 133  ILE A N   1 
ATOM   1036 C  CA  . ILE A 1 133 ? 83.664  43.323 27.856  1.00 28.58  ? 133  ILE A CA  1 
ATOM   1037 C  C   . ILE A 1 133 ? 82.944  44.657 28.026  1.00 28.09  ? 133  ILE A C   1 
ATOM   1038 O  O   . ILE A 1 133 ? 83.023  45.274 29.092  1.00 26.20  ? 133  ILE A O   1 
ATOM   1039 C  CB  . ILE A 1 133 ? 85.093  43.708 27.420  1.00 32.08  ? 133  ILE A CB  1 
ATOM   1040 C  CG1 . ILE A 1 133 ? 85.870  42.474 26.988  1.00 36.88  ? 133  ILE A CG1 1 
ATOM   1041 C  CG2 . ILE A 1 133 ? 85.811  44.413 28.559  1.00 36.22  ? 133  ILE A CG2 1 
ATOM   1042 C  CD1 . ILE A 1 133 ? 87.144  42.825 26.261  1.00 40.44  ? 133  ILE A CD1 1 
ATOM   1043 N  N   . TYR A 1 134 ? 82.264  45.116 26.982  1.00 25.80  ? 134  TYR A N   1 
ATOM   1044 C  CA  . TYR A 1 134 ? 81.630  46.421 27.040  1.00 24.90  ? 134  TYR A CA  1 
ATOM   1045 C  C   . TYR A 1 134 ? 80.153  46.541 27.382  1.00 24.82  ? 134  TYR A C   1 
ATOM   1046 O  O   . TYR A 1 134 ? 79.542  47.570 27.119  1.00 23.04  ? 134  TYR A O   1 
ATOM   1047 C  CB  . TYR A 1 134 ? 81.957  47.170 25.745  1.00 26.53  ? 134  TYR A CB  1 
ATOM   1048 C  CG  . TYR A 1 134 ? 83.451  47.352 25.586  1.00 26.15  ? 134  TYR A CG  1 
ATOM   1049 C  CD1 . TYR A 1 134 ? 84.172  48.148 26.484  1.00 28.99  ? 134  TYR A CD1 1 
ATOM   1050 C  CD2 . TYR A 1 134 ? 84.157  46.689 24.585  1.00 26.49  ? 134  TYR A CD2 1 
ATOM   1051 C  CE1 . TYR A 1 134 ? 85.562  48.272 26.390  1.00 28.13  ? 134  TYR A CE1 1 
ATOM   1052 C  CE2 . TYR A 1 134 ? 85.550  46.807 24.481  1.00 28.41  ? 134  TYR A CE2 1 
ATOM   1053 C  CZ  . TYR A 1 134 ? 86.242  47.597 25.389  1.00 29.72  ? 134  TYR A CZ  1 
ATOM   1054 O  OH  . TYR A 1 134 ? 87.612  47.692 25.309  1.00 29.72  ? 134  TYR A OH  1 
ATOM   1055 N  N   . GLY A 1 135 ? 79.580  45.503 27.982  1.00 24.93  ? 135  GLY A N   1 
ATOM   1056 C  CA  . GLY A 1 135 ? 78.193  45.604 28.391  1.00 25.28  ? 135  GLY A CA  1 
ATOM   1057 C  C   . GLY A 1 135 ? 77.193  44.526 28.029  1.00 24.02  ? 135  GLY A C   1 
ATOM   1058 O  O   . GLY A 1 135 ? 76.404  44.117 28.881  1.00 23.56  ? 135  GLY A O   1 
ATOM   1059 N  N   . PHE A 1 136 ? 77.208  44.059 26.785  1.00 24.71  ? 136  PHE A N   1 
ATOM   1060 C  CA  . PHE A 1 136 ? 76.232  43.063 26.362  1.00 22.40  ? 136  PHE A CA  1 
ATOM   1061 C  C   . PHE A 1 136 ? 76.239  41.791 27.192  1.00 23.50  ? 136  PHE A C   1 
ATOM   1062 O  O   . PHE A 1 136 ? 75.181  41.304 27.589  1.00 22.88  ? 136  PHE A O   1 
ATOM   1063 C  CB  . PHE A 1 136 ? 76.412  42.727 24.883  1.00 22.58  ? 136  PHE A CB  1 
ATOM   1064 C  CG  . PHE A 1 136 ? 75.246  41.990 24.289  1.00 21.70  ? 136  PHE A CG  1 
ATOM   1065 C  CD1 . PHE A 1 136 ? 73.941  42.371 24.595  1.00 20.73  ? 136  PHE A CD1 1 
ATOM   1066 C  CD2 . PHE A 1 136 ? 75.446  40.939 23.402  1.00 22.03  ? 136  PHE A CD2 1 
ATOM   1067 C  CE1 . PHE A 1 136 ? 72.848  41.713 24.021  1.00 20.77  ? 136  PHE A CE1 1 
ATOM   1068 C  CE2 . PHE A 1 136 ? 74.363  40.277 22.823  1.00 20.01  ? 136  PHE A CE2 1 
ATOM   1069 C  CZ  . PHE A 1 136 ? 73.060  40.669 23.134  1.00 20.75  ? 136  PHE A CZ  1 
ATOM   1070 N  N   . TYR A 1 137 ? 77.423  41.249 27.450  1.00 23.16  ? 137  TYR A N   1 
ATOM   1071 C  CA  . TYR A 1 137 ? 77.532  40.037 28.257  1.00 24.44  ? 137  TYR A CA  1 
ATOM   1072 C  C   . TYR A 1 137 ? 76.903  40.297 29.629  1.00 22.58  ? 137  TYR A C   1 
ATOM   1073 O  O   . TYR A 1 137 ? 76.073  39.520 30.099  1.00 23.85  ? 137  TYR A O   1 
ATOM   1074 C  CB  . TYR A 1 137 ? 79.010  39.643 28.391  1.00 24.64  ? 137  TYR A CB  1 
ATOM   1075 C  CG  . TYR A 1 137 ? 79.295  38.496 29.342  1.00 25.40  ? 137  TYR A CG  1 
ATOM   1076 C  CD1 . TYR A 1 137 ? 79.275  38.686 30.723  1.00 26.98  ? 137  TYR A CD1 1 
ATOM   1077 C  CD2 . TYR A 1 137 ? 79.625  37.232 28.857  1.00 25.10  ? 137  TYR A CD2 1 
ATOM   1078 C  CE1 . TYR A 1 137 ? 79.586  37.642 31.602  1.00 27.50  ? 137  TYR A CE1 1 
ATOM   1079 C  CE2 . TYR A 1 137 ? 79.937  36.184 29.724  1.00 26.46  ? 137  TYR A CE2 1 
ATOM   1080 C  CZ  . TYR A 1 137 ? 79.916  36.400 31.093  1.00 27.15  ? 137  TYR A CZ  1 
ATOM   1081 O  OH  . TYR A 1 137 ? 80.226  35.371 31.953  1.00 30.81  ? 137  TYR A OH  1 
ATOM   1082 N  N   . ASP A 1 138 ? 77.285  41.403 30.258  1.00 23.63  ? 138  ASP A N   1 
ATOM   1083 C  CA  . ASP A 1 138 ? 76.755  41.762 31.573  1.00 25.92  ? 138  ASP A CA  1 
ATOM   1084 C  C   . ASP A 1 138 ? 75.236  41.917 31.576  1.00 24.94  ? 138  ASP A C   1 
ATOM   1085 O  O   . ASP A 1 138 ? 74.562  41.528 32.537  1.00 25.38  ? 138  ASP A O   1 
ATOM   1086 C  CB  . ASP A 1 138 ? 77.404  43.059 32.075  1.00 28.19  ? 138  ASP A CB  1 
ATOM   1087 C  CG  . ASP A 1 138 ? 78.898  42.907 32.325  1.00 30.84  ? 138  ASP A CG  1 
ATOM   1088 O  OD1 . ASP A 1 138 ? 79.303  41.844 32.832  1.00 32.11  ? 138  ASP A OD1 1 
ATOM   1089 O  OD2 . ASP A 1 138 ? 79.664  43.854 32.028  1.00 33.14  ? 138  ASP A OD2 1 
ATOM   1090 N  N   . GLU A 1 139 ? 74.689  42.485 30.508  1.00 24.52  ? 139  GLU A N   1 
ATOM   1091 C  CA  . GLU A 1 139 ? 73.244  42.665 30.429  1.00 25.42  ? 139  GLU A CA  1 
ATOM   1092 C  C   . GLU A 1 139 ? 72.556  41.303 30.333  1.00 25.34  ? 139  GLU A C   1 
ATOM   1093 O  O   . GLU A 1 139 ? 71.529  41.065 30.978  1.00 25.18  ? 139  GLU A O   1 
ATOM   1094 C  CB  . GLU A 1 139 ? 72.873  43.534 29.218  1.00 25.41  ? 139  GLU A CB  1 
ATOM   1095 C  CG  . GLU A 1 139 ? 71.446  44.056 29.272  1.00 29.35  ? 139  GLU A CG  1 
ATOM   1096 C  CD  . GLU A 1 139 ? 71.097  44.991 28.124  1.00 26.63  ? 139  GLU A CD  1 
ATOM   1097 O  OE1 . GLU A 1 139 ? 71.913  45.877 27.797  1.00 26.30  ? 139  GLU A OE1 1 
ATOM   1098 O  OE2 . GLU A 1 139 ? 69.991  44.851 27.567  1.00 29.68  ? 139  GLU A OE2 1 
ATOM   1099 N  N   . CYS A 1 140 ? 73.133  40.408 29.538  1.00 24.96  ? 140  CYS A N   1 
ATOM   1100 C  CA  . CYS A 1 140 ? 72.584  39.068 29.366  1.00 27.82  ? 140  CYS A CA  1 
ATOM   1101 C  C   . CYS A 1 140 ? 72.673  38.283 30.670  1.00 30.53  ? 140  CYS A C   1 
ATOM   1102 O  O   . CYS A 1 140 ? 71.736  37.584 31.054  1.00 29.94  ? 140  CYS A O   1 
ATOM   1103 C  CB  . CYS A 1 140 ? 73.350  38.310 28.279  1.00 28.25  ? 140  CYS A CB  1 
ATOM   1104 S  SG  . CYS A 1 140 ? 73.003  38.866 26.595  1.00 25.60  ? 140  CYS A SG  1 
ATOM   1105 N  N   . LYS A 1 141 ? 73.812  38.411 31.340  1.00 31.20  ? 141  LYS A N   1 
ATOM   1106 C  CA  . LYS A 1 141 ? 74.060  37.726 32.602  1.00 32.94  ? 141  LYS A CA  1 
ATOM   1107 C  C   . LYS A 1 141 ? 73.045  38.155 33.663  1.00 33.32  ? 141  LYS A C   1 
ATOM   1108 O  O   . LYS A 1 141 ? 72.559  37.331 34.435  1.00 33.78  ? 141  LYS A O   1 
ATOM   1109 C  CB  . LYS A 1 141 ? 75.484  38.040 33.075  1.00 34.37  ? 141  LYS A CB  1 
ATOM   1110 C  CG  . LYS A 1 141 ? 76.076  37.057 34.082  1.00 38.18  ? 141  LYS A CG  1 
ATOM   1111 C  CD  . LYS A 1 141 ? 75.528  37.259 35.475  1.00 41.34  ? 141  LYS A CD  1 
ATOM   1112 C  CE  . LYS A 1 141 ? 76.240  36.354 36.476  1.00 44.98  ? 141  LYS A CE  1 
ATOM   1113 N  NZ  . LYS A 1 141 ? 77.701  36.655 36.563  1.00 45.44  ? 141  LYS A NZ  1 
ATOM   1114 N  N   . ARG A 1 142 ? 72.723  39.442 33.692  1.00 32.93  ? 142  ARG A N   1 
ATOM   1115 C  CA  . ARG A 1 142 ? 71.780  39.967 34.670  1.00 34.70  ? 142  ARG A CA  1 
ATOM   1116 C  C   . ARG A 1 142 ? 70.317  39.654 34.375  1.00 34.80  ? 142  ARG A C   1 
ATOM   1117 O  O   . ARG A 1 142 ? 69.577  39.228 35.263  1.00 35.14  ? 142  ARG A O   1 
ATOM   1118 C  CB  . ARG A 1 142 ? 71.941  41.487 34.804  1.00 38.20  ? 142  ARG A CB  1 
ATOM   1119 C  CG  . ARG A 1 142 ? 70.985  42.104 35.824  1.00 43.27  ? 142  ARG A CG  1 
ATOM   1120 C  CD  . ARG A 1 142 ? 71.147  43.618 35.985  1.00 46.61  ? 142  ARG A CD  1 
ATOM   1121 N  NE  . ARG A 1 142 ? 70.707  44.368 34.812  1.00 48.82  ? 142  ARG A NE  1 
ATOM   1122 C  CZ  . ARG A 1 142 ? 71.479  44.646 33.768  1.00 49.53  ? 142  ARG A CZ  1 
ATOM   1123 N  NH1 . ARG A 1 142 ? 72.742  44.239 33.747  1.00 51.94  ? 142  ARG A NH1 1 
ATOM   1124 N  NH2 . ARG A 1 142 ? 70.987  45.328 32.744  1.00 48.83  ? 142  ARG A NH2 1 
ATOM   1125 N  N   . ARG A 1 143 ? 69.908  39.849 33.127  1.00 31.44  ? 143  ARG A N   1 
ATOM   1126 C  CA  . ARG A 1 143 ? 68.518  39.642 32.734  1.00 30.65  ? 143  ARG A CA  1 
ATOM   1127 C  C   . ARG A 1 143 ? 68.126  38.251 32.242  1.00 29.20  ? 143  ARG A C   1 
ATOM   1128 O  O   . ARG A 1 143 ? 66.960  37.862 32.338  1.00 29.99  ? 143  ARG A O   1 
ATOM   1129 C  CB  . ARG A 1 143 ? 68.144  40.692 31.692  1.00 27.94  ? 143  ARG A CB  1 
ATOM   1130 C  CG  . ARG A 1 143 ? 68.357  42.109 32.193  1.00 28.55  ? 143  ARG A CG  1 
ATOM   1131 C  CD  . ARG A 1 143 ? 68.044  43.126 31.117  1.00 27.63  ? 143  ARG A CD  1 
ATOM   1132 N  NE  . ARG A 1 143 ? 66.692  42.954 30.598  1.00 27.22  ? 143  ARG A NE  1 
ATOM   1133 C  CZ  . ARG A 1 143 ? 66.170  43.682 29.619  1.00 27.97  ? 143  ARG A CZ  1 
ATOM   1134 N  NH1 . ARG A 1 143 ? 66.887  44.642 29.045  1.00 26.01  ? 143  ARG A NH1 1 
ATOM   1135 N  NH2 . ARG A 1 143 ? 64.932  43.447 29.212  1.00 27.07  ? 143  ARG A NH2 1 
ATOM   1136 N  N   . TYR A 1 144 ? 69.088  37.510 31.706  1.00 27.49  ? 144  TYR A N   1 
ATOM   1137 C  CA  . TYR A 1 144 ? 68.841  36.160 31.217  1.00 26.92  ? 144  TYR A CA  1 
ATOM   1138 C  C   . TYR A 1 144 ? 70.005  35.293 31.698  1.00 27.93  ? 144  TYR A C   1 
ATOM   1139 O  O   . TYR A 1 144 ? 70.157  35.080 32.902  1.00 28.24  ? 144  TYR A O   1 
ATOM   1140 C  CB  . TYR A 1 144 ? 68.742  36.161 29.684  1.00 26.50  ? 144  TYR A CB  1 
ATOM   1141 C  CG  . TYR A 1 144 ? 67.506  36.875 29.178  1.00 25.27  ? 144  TYR A CG  1 
ATOM   1142 C  CD1 . TYR A 1 144 ? 66.279  36.207 29.071  1.00 24.02  ? 144  TYR A CD1 1 
ATOM   1143 C  CD2 . TYR A 1 144 ? 67.542  38.237 28.878  1.00 23.66  ? 144  TYR A CD2 1 
ATOM   1144 C  CE1 . TYR A 1 144 ? 65.115  36.885 28.681  1.00 23.91  ? 144  TYR A CE1 1 
ATOM   1145 C  CE2 . TYR A 1 144 ? 66.385  38.924 28.491  1.00 24.23  ? 144  TYR A CE2 1 
ATOM   1146 C  CZ  . TYR A 1 144 ? 65.178  38.245 28.398  1.00 24.52  ? 144  TYR A CZ  1 
ATOM   1147 O  OH  . TYR A 1 144 ? 64.035  38.937 28.059  1.00 24.40  ? 144  TYR A OH  1 
ATOM   1148 N  N   . ASN A 1 145 ? 70.829  34.812 30.772  1.00 25.45  ? 145  ASN A N   1 
ATOM   1149 C  CA  . ASN A 1 145 ? 71.977  33.986 31.133  1.00 25.92  ? 145  ASN A CA  1 
ATOM   1150 C  C   . ASN A 1 145 ? 73.047  34.008 30.035  1.00 26.87  ? 145  ASN A C   1 
ATOM   1151 O  O   . ASN A 1 145 ? 72.807  34.499 28.926  1.00 23.35  ? 145  ASN A O   1 
ATOM   1152 C  CB  . ASN A 1 145 ? 71.518  32.552 31.407  1.00 26.50  ? 145  ASN A CB  1 
ATOM   1153 C  CG  . ASN A 1 145 ? 70.725  31.974 30.259  1.00 27.26  ? 145  ASN A CG  1 
ATOM   1154 O  OD1 . ASN A 1 145 ? 71.265  31.713 29.183  1.00 27.57  ? 145  ASN A OD1 1 
ATOM   1155 N  ND2 . ASN A 1 145 ? 69.429  31.790 30.473  1.00 28.42  ? 145  ASN A ND2 1 
ATOM   1156 N  N   . ILE A 1 146 ? 74.223  33.475 30.352  1.00 26.75  ? 146  ILE A N   1 
ATOM   1157 C  CA  . ILE A 1 146 ? 75.348  33.455 29.421  1.00 27.99  ? 146  ILE A CA  1 
ATOM   1158 C  C   . ILE A 1 146 ? 75.129  32.553 28.215  1.00 27.63  ? 146  ILE A C   1 
ATOM   1159 O  O   . ILE A 1 146 ? 75.651  32.811 27.132  1.00 27.30  ? 146  ILE A O   1 
ATOM   1160 C  CB  . ILE A 1 146 ? 76.654  33.047 30.156  1.00 29.32  ? 146  ILE A CB  1 
ATOM   1161 C  CG1 . ILE A 1 146 ? 76.927  34.047 31.281  1.00 28.66  ? 146  ILE A CG1 1 
ATOM   1162 C  CG2 . ILE A 1 146 ? 77.834  32.992 29.183  1.00 30.41  ? 146  ILE A CG2 1 
ATOM   1163 C  CD1 . ILE A 1 146 ? 76.793  35.502 30.857  1.00 32.38  ? 146  ILE A CD1 1 
ATOM   1164 N  N   . LYS A 1 147 ? 74.360  31.490 28.396  1.00 26.05  ? 147  LYS A N   1 
ATOM   1165 C  CA  . LYS A 1 147 ? 74.073  30.596 27.289  1.00 27.30  ? 147  LYS A CA  1 
ATOM   1166 C  C   . LYS A 1 147 ? 73.358  31.385 26.192  1.00 26.27  ? 147  LYS A C   1 
ATOM   1167 O  O   . LYS A 1 147 ? 73.601  31.174 25.002  1.00 26.97  ? 147  LYS A O   1 
ATOM   1168 C  CB  . LYS A 1 147 ? 73.192  29.438 27.762  1.00 30.95  ? 147  LYS A CB  1 
ATOM   1169 C  CG  . LYS A 1 147 ? 72.810  28.452 26.669  1.00 34.85  ? 147  LYS A CG  1 
ATOM   1170 C  CD  . LYS A 1 147 ? 72.048  27.272 27.257  1.00 40.30  ? 147  LYS A CD  1 
ATOM   1171 C  CE  . LYS A 1 147 ? 71.562  26.314 26.181  1.00 41.68  ? 147  LYS A CE  1 
ATOM   1172 N  NZ  . LYS A 1 147 ? 70.789  25.182 26.771  1.00 42.91  ? 147  LYS A NZ  1 
ATOM   1173 N  N   . LEU A 1 148 ? 72.477  32.298 26.596  1.00 23.88  ? 148  LEU A N   1 
ATOM   1174 C  CA  . LEU A 1 148 ? 71.737  33.114 25.633  1.00 23.98  ? 148  LEU A CA  1 
ATOM   1175 C  C   . LEU A 1 148 ? 72.692  34.088 24.944  1.00 24.55  ? 148  LEU A C   1 
ATOM   1176 O  O   . LEU A 1 148 ? 72.540  34.392 23.755  1.00 24.45  ? 148  LEU A O   1 
ATOM   1177 C  CB  . LEU A 1 148 ? 70.619  33.895 26.331  1.00 24.61  ? 148  LEU A CB  1 
ATOM   1178 C  CG  . LEU A 1 148 ? 69.678  34.645 25.377  1.00 24.39  ? 148  LEU A CG  1 
ATOM   1179 C  CD1 . LEU A 1 148 ? 68.991  33.653 24.441  1.00 24.12  ? 148  LEU A CD1 1 
ATOM   1180 C  CD2 . LEU A 1 148 ? 68.645  35.428 26.177  1.00 24.79  ? 148  LEU A CD2 1 
ATOM   1181 N  N   . TRP A 1 149 ? 73.670  34.584 25.696  1.00 23.11  ? 149  TRP A N   1 
ATOM   1182 C  CA  . TRP A 1 149 ? 74.654  35.502 25.136  1.00 23.23  ? 149  TRP A CA  1 
ATOM   1183 C  C   . TRP A 1 149 ? 75.439  34.765 24.050  1.00 24.91  ? 149  TRP A C   1 
ATOM   1184 O  O   . TRP A 1 149 ? 75.737  35.327 22.990  1.00 22.35  ? 149  TRP A O   1 
ATOM   1185 C  CB  . TRP A 1 149 ? 75.607  35.985 26.227  1.00 22.30  ? 149  TRP A CB  1 
ATOM   1186 C  CG  . TRP A 1 149 ? 76.748  36.798 25.704  1.00 23.81  ? 149  TRP A CG  1 
ATOM   1187 C  CD1 . TRP A 1 149 ? 76.695  38.071 25.209  1.00 22.36  ? 149  TRP A CD1 1 
ATOM   1188 C  CD2 . TRP A 1 149 ? 78.108  36.376 25.587  1.00 23.64  ? 149  TRP A CD2 1 
ATOM   1189 N  NE1 . TRP A 1 149 ? 77.944  38.467 24.787  1.00 23.69  ? 149  TRP A NE1 1 
ATOM   1190 C  CE2 . TRP A 1 149 ? 78.830  37.445 25.008  1.00 25.78  ? 149  TRP A CE2 1 
ATOM   1191 C  CE3 . TRP A 1 149 ? 78.790  35.195 25.913  1.00 27.58  ? 149  TRP A CE3 1 
ATOM   1192 C  CZ2 . TRP A 1 149 ? 80.206  37.368 24.749  1.00 23.93  ? 149  TRP A CZ2 1 
ATOM   1193 C  CZ3 . TRP A 1 149 ? 80.158  35.118 25.654  1.00 27.77  ? 149  TRP A CZ3 1 
ATOM   1194 C  CH2 . TRP A 1 149 ? 80.848  36.201 25.077  1.00 25.49  ? 149  TRP A CH2 1 
ATOM   1195 N  N   . LYS A 1 150 ? 75.772  33.502 24.313  1.00 24.99  ? 150  LYS A N   1 
ATOM   1196 C  CA  . LYS A 1 150 ? 76.514  32.706 23.337  1.00 25.94  ? 150  LYS A CA  1 
ATOM   1197 C  C   . LYS A 1 150 ? 75.658  32.485 22.095  1.00 25.25  ? 150  LYS A C   1 
ATOM   1198 O  O   . LYS A 1 150 ? 76.166  32.438 20.973  1.00 25.43  ? 150  LYS A O   1 
ATOM   1199 C  CB  . LYS A 1 150 ? 76.930  31.360 23.941  1.00 30.08  ? 150  LYS A CB  1 
ATOM   1200 C  CG  . LYS A 1 150 ? 77.824  31.505 25.164  1.00 34.43  ? 150  LYS A CG  1 
ATOM   1201 C  CD  . LYS A 1 150 ? 78.713  30.284 25.372  1.00 38.14  ? 150  LYS A CD  1 
ATOM   1202 C  CE  . LYS A 1 150 ? 79.756  30.566 26.444  1.00 40.71  ? 150  LYS A CE  1 
ATOM   1203 N  NZ  . LYS A 1 150 ? 80.874  29.585 26.427  1.00 43.13  ? 150  LYS A NZ  1 
ATOM   1204 N  N   . THR A 1 151 ? 74.352  32.361 22.294  1.00 23.41  ? 151  THR A N   1 
ATOM   1205 C  CA  . THR A 1 151 ? 73.448  32.166 21.171  1.00 25.17  ? 151  THR A CA  1 
ATOM   1206 C  C   . THR A 1 151 ? 73.469  33.412 20.282  1.00 25.60  ? 151  THR A C   1 
ATOM   1207 O  O   . THR A 1 151 ? 73.423  33.314 19.053  1.00 25.27  ? 151  THR A O   1 
ATOM   1208 C  CB  . THR A 1 151 ? 72.013  31.903 21.654  1.00 24.10  ? 151  THR A CB  1 
ATOM   1209 O  OG1 . THR A 1 151 ? 71.968  30.647 22.345  1.00 26.62  ? 151  THR A OG1 1 
ATOM   1210 C  CG2 . THR A 1 151 ? 71.056  31.861 20.479  1.00 26.14  ? 151  THR A CG2 1 
ATOM   1211 N  N   . PHE A 1 152 ? 73.532  34.583 20.909  1.00 24.93  ? 152  PHE A N   1 
ATOM   1212 C  CA  . PHE A 1 152 ? 73.587  35.838 20.162  1.00 26.43  ? 152  PHE A CA  1 
ATOM   1213 C  C   . PHE A 1 152 ? 74.872  35.865 19.338  1.00 26.72  ? 152  PHE A C   1 
ATOM   1214 O  O   . PHE A 1 152 ? 74.881  36.278 18.174  1.00 24.13  ? 152  PHE A O   1 
ATOM   1215 C  CB  . PHE A 1 152 ? 73.577  37.029 21.121  1.00 24.84  ? 152  PHE A CB  1 
ATOM   1216 C  CG  . PHE A 1 152 ? 72.205  37.518 21.472  1.00 25.83  ? 152  PHE A CG  1 
ATOM   1217 C  CD1 . PHE A 1 152 ? 71.402  38.115 20.510  1.00 25.57  ? 152  PHE A CD1 1 
ATOM   1218 C  CD2 . PHE A 1 152 ? 71.725  37.408 22.771  1.00 25.27  ? 152  PHE A CD2 1 
ATOM   1219 C  CE1 . PHE A 1 152 ? 70.141  38.600 20.836  1.00 26.35  ? 152  PHE A CE1 1 
ATOM   1220 C  CE2 . PHE A 1 152 ? 70.464  37.892 23.107  1.00 26.17  ? 152  PHE A CE2 1 
ATOM   1221 C  CZ  . PHE A 1 152 ? 69.672  38.489 22.140  1.00 26.38  ? 152  PHE A CZ  1 
ATOM   1222 N  N   . THR A 1 153 ? 75.961  35.421 19.954  1.00 26.75  ? 153  THR A N   1 
ATOM   1223 C  CA  . THR A 1 153 ? 77.246  35.390 19.278  1.00 30.18  ? 153  THR A CA  1 
ATOM   1224 C  C   . THR A 1 153 ? 77.181  34.577 17.992  1.00 30.96  ? 153  THR A C   1 
ATOM   1225 O  O   . THR A 1 153 ? 77.724  34.993 16.961  1.00 30.32  ? 153  THR A O   1 
ATOM   1226 C  CB  . THR A 1 153 ? 78.339  34.803 20.194  1.00 32.32  ? 153  THR A CB  1 
ATOM   1227 O  OG1 . THR A 1 153 ? 78.588  35.710 21.274  1.00 37.49  ? 153  THR A OG1 1 
ATOM   1228 C  CG2 . THR A 1 153 ? 79.628  34.580 19.417  1.00 34.00  ? 153  THR A CG2 1 
ATOM   1229 N  N   . ASP A 1 154 ? 76.520  33.423 18.042  1.00 31.10  ? 154  ASP A N   1 
ATOM   1230 C  CA  . ASP A 1 154 ? 76.407  32.579 16.855  1.00 31.96  ? 154  ASP A CA  1 
ATOM   1231 C  C   . ASP A 1 154 ? 75.598  33.282 15.773  1.00 30.70  ? 154  ASP A C   1 
ATOM   1232 O  O   . ASP A 1 154 ? 75.827  33.073 14.583  1.00 32.01  ? 154  ASP A O   1 
ATOM   1233 C  CB  . ASP A 1 154 ? 75.762  31.226 17.194  1.00 36.49  ? 154  ASP A CB  1 
ATOM   1234 C  CG  . ASP A 1 154 ? 76.664  30.339 18.048  1.00 40.69  ? 154  ASP A CG  1 
ATOM   1235 O  OD1 . ASP A 1 154 ? 77.897  30.350 17.832  1.00 43.11  ? 154  ASP A OD1 1 
ATOM   1236 O  OD2 . ASP A 1 154 ? 76.141  29.614 18.925  1.00 41.86  ? 154  ASP A OD2 1 
ATOM   1237 N  N   . CYS A 1 155 ? 74.647  34.111 16.192  1.00 27.30  ? 155  CYS A N   1 
ATOM   1238 C  CA  . CYS A 1 155 ? 73.822  34.868 15.257  1.00 27.32  ? 155  CYS A CA  1 
ATOM   1239 C  C   . CYS A 1 155 ? 74.698  35.958 14.630  1.00 24.88  ? 155  CYS A C   1 
ATOM   1240 O  O   . CYS A 1 155 ? 74.773  36.084 13.408  1.00 24.24  ? 155  CYS A O   1 
ATOM   1241 C  CB  . CYS A 1 155 ? 72.640  35.508 15.994  1.00 28.84  ? 155  CYS A CB  1 
ATOM   1242 S  SG  . CYS A 1 155 ? 71.581  36.574 14.975  1.00 30.10  ? 155  CYS A SG  1 
ATOM   1243 N  N   . PHE A 1 156 ? 75.373  36.729 15.477  1.00 24.23  ? 156  PHE A N   1 
ATOM   1244 C  CA  . PHE A 1 156 ? 76.242  37.806 15.006  1.00 22.92  ? 156  PHE A CA  1 
ATOM   1245 C  C   . PHE A 1 156 ? 77.320  37.324 14.028  1.00 24.40  ? 156  PHE A C   1 
ATOM   1246 O  O   . PHE A 1 156 ? 77.688  38.046 13.098  1.00 23.51  ? 156  PHE A O   1 
ATOM   1247 C  CB  . PHE A 1 156 ? 76.925  38.508 16.188  1.00 21.58  ? 156  PHE A CB  1 
ATOM   1248 C  CG  . PHE A 1 156 ? 75.972  39.196 17.139  1.00 21.67  ? 156  PHE A CG  1 
ATOM   1249 C  CD1 . PHE A 1 156 ? 74.665  39.492 16.761  1.00 22.32  ? 156  PHE A CD1 1 
ATOM   1250 C  CD2 . PHE A 1 156 ? 76.405  39.582 18.403  1.00 21.82  ? 156  PHE A CD2 1 
ATOM   1251 C  CE1 . PHE A 1 156 ? 73.807  40.164 17.631  1.00 23.88  ? 156  PHE A CE1 1 
ATOM   1252 C  CE2 . PHE A 1 156 ? 75.554  40.257 19.279  1.00 24.84  ? 156  PHE A CE2 1 
ATOM   1253 C  CZ  . PHE A 1 156 ? 74.255  40.547 18.891  1.00 24.56  ? 156  PHE A CZ  1 
ATOM   1254 N  N   . ASN A 1 157 ? 77.830  36.112 14.236  1.00 22.72  ? 157  ASN A N   1 
ATOM   1255 C  CA  . ASN A 1 157 ? 78.865  35.575 13.356  1.00 24.04  ? 157  ASN A CA  1 
ATOM   1256 C  C   . ASN A 1 157 ? 78.381  35.361 11.924  1.00 23.70  ? 157  ASN A C   1 
ATOM   1257 O  O   . ASN A 1 157 ? 79.188  35.119 11.026  1.00 24.09  ? 157  ASN A O   1 
ATOM   1258 C  CB  . ASN A 1 157 ? 79.418  34.249 13.897  1.00 23.51  ? 157  ASN A CB  1 
ATOM   1259 C  CG  . ASN A 1 157 ? 80.281  34.429 15.133  1.00 25.94  ? 157  ASN A CG  1 
ATOM   1260 O  OD1 . ASN A 1 157 ? 80.688  35.539 15.467  1.00 27.21  ? 157  ASN A OD1 1 
ATOM   1261 N  ND2 . ASN A 1 157 ? 80.574  33.327 15.814  1.00 24.98  ? 157  ASN A ND2 1 
ATOM   1262 N  N   . CYS A 1 158 ? 77.073  35.462 11.705  1.00 22.58  ? 158  CYS A N   1 
ATOM   1263 C  CA  . CYS A 1 158 ? 76.517  35.265 10.367  1.00 24.12  ? 158  CYS A CA  1 
ATOM   1264 C  C   . CYS A 1 158 ? 76.029  36.540 9.682   1.00 23.31  ? 158  CYS A C   1 
ATOM   1265 O  O   . CYS A 1 158 ? 75.552  36.489 8.556   1.00 22.84  ? 158  CYS A O   1 
ATOM   1266 C  CB  . CYS A 1 158 ? 75.362  34.262 10.423  1.00 27.21  ? 158  CYS A CB  1 
ATOM   1267 S  SG  . CYS A 1 158 ? 75.860  32.608 10.940  1.00 30.07  ? 158  CYS A SG  1 
ATOM   1268 N  N   . LEU A 1 159 ? 76.136  37.677 10.362  1.00 23.47  ? 159  LEU A N   1 
ATOM   1269 C  CA  . LEU A 1 159 ? 75.691  38.946 9.789   1.00 23.23  ? 159  LEU A CA  1 
ATOM   1270 C  C   . LEU A 1 159 ? 76.482  39.313 8.538   1.00 21.88  ? 159  LEU A C   1 
ATOM   1271 O  O   . LEU A 1 159 ? 77.656  38.971 8.425   1.00 22.95  ? 159  LEU A O   1 
ATOM   1272 C  CB  . LEU A 1 159 ? 75.856  40.072 10.815  1.00 23.17  ? 159  LEU A CB  1 
ATOM   1273 C  CG  . LEU A 1 159 ? 74.834  40.184 11.947  1.00 22.22  ? 159  LEU A CG  1 
ATOM   1274 C  CD1 . LEU A 1 159 ? 75.390  41.062 13.065  1.00 22.76  ? 159  LEU A CD1 1 
ATOM   1275 C  CD2 . LEU A 1 159 ? 73.540  40.763 11.389  1.00 20.39  ? 159  LEU A CD2 1 
ATOM   1276 N  N   . PRO A 1 160 ? 75.840  40.005 7.572   1.00 21.85  ? 160  PRO A N   1 
ATOM   1277 C  CA  . PRO A 1 160 ? 76.557  40.399 6.354   1.00 21.89  ? 160  PRO A CA  1 
ATOM   1278 C  C   . PRO A 1 160 ? 77.581  41.486 6.715   1.00 22.77  ? 160  PRO A C   1 
ATOM   1279 O  O   . PRO A 1 160 ? 77.473  42.118 7.768   1.00 23.00  ? 160  PRO A O   1 
ATOM   1280 C  CB  . PRO A 1 160 ? 75.444  40.893 5.429   1.00 21.59  ? 160  PRO A CB  1 
ATOM   1281 C  CG  . PRO A 1 160 ? 74.388  41.393 6.387   1.00 20.47  ? 160  PRO A CG  1 
ATOM   1282 C  CD  . PRO A 1 160 ? 74.408  40.340 7.479   1.00 20.64  ? 160  PRO A CD  1 
ATOM   1283 N  N   . ILE A 1 161 ? 78.553  41.711 5.836   1.00 22.20  ? 161  ILE A N   1 
ATOM   1284 C  CA  . ILE A 1 161 ? 79.634  42.665 6.096   1.00 22.45  ? 161  ILE A CA  1 
ATOM   1285 C  C   . ILE A 1 161 ? 79.551  44.011 5.378   1.00 22.42  ? 161  ILE A C   1 
ATOM   1286 O  O   . ILE A 1 161 ? 80.066  45.017 5.866   1.00 23.03  ? 161  ILE A O   1 
ATOM   1287 C  CB  . ILE A 1 161 ? 80.987  41.999 5.757   1.00 22.97  ? 161  ILE A CB  1 
ATOM   1288 C  CG1 . ILE A 1 161 ? 81.122  40.705 6.567   1.00 21.72  ? 161  ILE A CG1 1 
ATOM   1289 C  CG2 . ILE A 1 161 ? 82.150  42.942 6.045   1.00 22.89  ? 161  ILE A CG2 1 
ATOM   1290 C  CD1 . ILE A 1 161 ? 80.877  40.887 8.059   1.00 22.48  ? 161  ILE A CD1 1 
ATOM   1291 N  N   . ALA A 1 162 ? 78.913  44.037 4.217   1.00 22.43  ? 162  ALA A N   1 
ATOM   1292 C  CA  . ALA A 1 162 ? 78.821  45.283 3.479   1.00 22.46  ? 162  ALA A CA  1 
ATOM   1293 C  C   . ALA A 1 162 ? 77.631  45.287 2.546   1.00 21.71  ? 162  ALA A C   1 
ATOM   1294 O  O   . ALA A 1 162 ? 77.004  44.258 2.304   1.00 22.77  ? 162  ALA A O   1 
ATOM   1295 C  CB  . ALA A 1 162 ? 80.108  45.510 2.687   1.00 21.08  ? 162  ALA A CB  1 
ATOM   1296 N  N   . ALA A 1 163 ? 77.325  46.464 2.023   1.00 23.96  ? 163  ALA A N   1 
ATOM   1297 C  CA  . ALA A 1 163 ? 76.220  46.615 1.099   1.00 23.75  ? 163  ALA A CA  1 
ATOM   1298 C  C   . ALA A 1 163 ? 76.561  47.706 0.093   1.00 26.20  ? 163  ALA A C   1 
ATOM   1299 O  O   . ALA A 1 163 ? 77.370  48.591 0.371   1.00 27.12  ? 163  ALA A O   1 
ATOM   1300 C  CB  . ALA A 1 163 ? 74.950  46.984 1.860   1.00 24.49  ? 163  ALA A CB  1 
ATOM   1301 N  N   . ILE A 1 164 ? 75.961  47.621 -1.087  1.00 27.43  ? 164  ILE A N   1 
ATOM   1302 C  CA  . ILE A 1 164 ? 76.166  48.636 -2.111  1.00 28.66  ? 164  ILE A CA  1 
ATOM   1303 C  C   . ILE A 1 164 ? 74.775  49.123 -2.484  1.00 27.07  ? 164  ILE A C   1 
ATOM   1304 O  O   . ILE A 1 164 ? 73.921  48.339 -2.899  1.00 28.00  ? 164  ILE A O   1 
ATOM   1305 C  CB  . ILE A 1 164 ? 76.881  48.070 -3.359  1.00 28.61  ? 164  ILE A CB  1 
ATOM   1306 C  CG1 . ILE A 1 164 ? 78.285  47.597 -2.975  1.00 27.01  ? 164  ILE A CG1 1 
ATOM   1307 C  CG2 . ILE A 1 164 ? 76.981  49.155 -4.433  1.00 27.43  ? 164  ILE A CG2 1 
ATOM   1308 C  CD1 . ILE A 1 164 ? 79.055  46.936 -4.092  1.00 27.61  ? 164  ILE A CD1 1 
ATOM   1309 N  N   . VAL A 1 165 ? 74.543  50.417 -2.305  1.00 28.81  ? 165  VAL A N   1 
ATOM   1310 C  CA  . VAL A 1 165 ? 73.245  51.002 -2.604  1.00 29.76  ? 165  VAL A CA  1 
ATOM   1311 C  C   . VAL A 1 165 ? 73.221  51.594 -4.008  1.00 31.90  ? 165  VAL A C   1 
ATOM   1312 O  O   . VAL A 1 165 ? 74.017  52.475 -4.334  1.00 30.84  ? 165  VAL A O   1 
ATOM   1313 C  CB  . VAL A 1 165 ? 72.888  52.096 -1.577  1.00 30.77  ? 165  VAL A CB  1 
ATOM   1314 C  CG1 . VAL A 1 165 ? 71.530  52.707 -1.909  1.00 30.07  ? 165  VAL A CG1 1 
ATOM   1315 C  CG2 . VAL A 1 165 ? 72.871  51.499 -0.173  1.00 31.93  ? 165  VAL A CG2 1 
ATOM   1316 N  N   . ASP A 1 166 ? 72.305  51.091 -4.832  1.00 33.54  ? 166  ASP A N   1 
ATOM   1317 C  CA  . ASP A 1 166 ? 72.154  51.554 -6.207  1.00 35.85  ? 166  ASP A CA  1 
ATOM   1318 C  C   . ASP A 1 166 ? 73.483  51.666 -6.951  1.00 35.28  ? 166  ASP A C   1 
ATOM   1319 O  O   . ASP A 1 166 ? 73.718  52.627 -7.685  1.00 34.47  ? 166  ASP A O   1 
ATOM   1320 C  CB  . ASP A 1 166 ? 71.428  52.901 -6.231  1.00 37.66  ? 166  ASP A CB  1 
ATOM   1321 C  CG  . ASP A 1 166 ? 69.989  52.792 -5.763  1.00 40.19  ? 166  ASP A CG  1 
ATOM   1322 O  OD1 . ASP A 1 166 ? 69.252  51.946 -6.309  1.00 41.83  ? 166  ASP A OD1 1 
ATOM   1323 O  OD2 . ASP A 1 166 ? 69.590  53.550 -4.855  1.00 43.10  ? 166  ASP A OD2 1 
ATOM   1324 N  N   . GLU A 1 167 ? 74.348  50.678 -6.748  1.00 35.96  ? 167  GLU A N   1 
ATOM   1325 C  CA  . GLU A 1 167 ? 75.652  50.635 -7.403  1.00 36.29  ? 167  GLU A CA  1 
ATOM   1326 C  C   . GLU A 1 167 ? 76.503  51.882 -7.186  1.00 34.73  ? 167  GLU A C   1 
ATOM   1327 O  O   . GLU A 1 167 ? 77.462  52.101 -7.922  1.00 35.47  ? 167  GLU A O   1 
ATOM   1328 C  CB  . GLU A 1 167 ? 75.472  50.440 -8.912  1.00 38.30  ? 167  GLU A CB  1 
ATOM   1329 C  CG  . GLU A 1 167 ? 74.840  49.128 -9.324  1.00 40.85  ? 167  GLU A CG  1 
ATOM   1330 C  CD  . GLU A 1 167 ? 74.387  49.149 -10.773 1.00 42.99  ? 167  GLU A CD  1 
ATOM   1331 O  OE1 . GLU A 1 167 ? 73.384  49.833 -11.074 1.00 45.63  ? 167  GLU A OE1 1 
ATOM   1332 O  OE2 . GLU A 1 167 ? 75.039  48.493 -11.612 1.00 44.23  ? 167  GLU A OE2 1 
ATOM   1333 N  N   . LYS A 1 168 ? 76.177  52.697 -6.187  1.00 32.68  ? 168  LYS A N   1 
ATOM   1334 C  CA  . LYS A 1 168 ? 76.952  53.913 -5.975  1.00 30.35  ? 168  LYS A CA  1 
ATOM   1335 C  C   . LYS A 1 168 ? 77.463  54.181 -4.568  1.00 29.34  ? 168  LYS A C   1 
ATOM   1336 O  O   . LYS A 1 168 ? 78.466  54.879 -4.396  1.00 26.68  ? 168  LYS A O   1 
ATOM   1337 C  CB  . LYS A 1 168 ? 76.147  55.123 -6.459  1.00 32.35  ? 168  LYS A CB  1 
ATOM   1338 C  CG  . LYS A 1 168 ? 75.921  55.142 -7.968  1.00 36.00  ? 168  LYS A CG  1 
ATOM   1339 C  CD  . LYS A 1 168 ? 77.248  55.113 -8.717  1.00 39.29  ? 168  LYS A CD  1 
ATOM   1340 C  CE  . LYS A 1 168 ? 77.043  55.089 -10.223 1.00 41.08  ? 168  LYS A CE  1 
ATOM   1341 N  NZ  . LYS A 1 168 ? 78.337  54.958 -10.949 1.00 42.14  ? 168  LYS A NZ  1 
ATOM   1342 N  N   . ILE A 1 169 ? 76.781  53.640 -3.564  1.00 27.08  ? 169  ILE A N   1 
ATOM   1343 C  CA  . ILE A 1 169 ? 77.186  53.857 -2.181  1.00 26.61  ? 169  ILE A CA  1 
ATOM   1344 C  C   . ILE A 1 169 ? 77.678  52.576 -1.509  1.00 25.27  ? 169  ILE A C   1 
ATOM   1345 O  O   . ILE A 1 169 ? 76.907  51.633 -1.317  1.00 24.30  ? 169  ILE A O   1 
ATOM   1346 C  CB  . ILE A 1 169 ? 76.019  54.427 -1.350  1.00 25.48  ? 169  ILE A CB  1 
ATOM   1347 C  CG1 . ILE A 1 169 ? 75.457  55.680 -2.029  1.00 28.49  ? 169  ILE A CG1 1 
ATOM   1348 C  CG2 . ILE A 1 169 ? 76.500  54.779 0.050   1.00 25.38  ? 169  ILE A CG2 1 
ATOM   1349 C  CD1 . ILE A 1 169 ? 74.162  56.174 -1.418  1.00 28.79  ? 169  ILE A CD1 1 
ATOM   1350 N  N   . PHE A 1 170 ? 78.964  52.543 -1.161  1.00 24.50  ? 170  PHE A N   1 
ATOM   1351 C  CA  . PHE A 1 170 ? 79.531  51.380 -0.493  1.00 23.16  ? 170  PHE A CA  1 
ATOM   1352 C  C   . PHE A 1 170 ? 79.359  51.605 1.003   1.00 23.30  ? 170  PHE A C   1 
ATOM   1353 O  O   . PHE A 1 170 ? 79.816  52.615 1.550   1.00 21.12  ? 170  PHE A O   1 
ATOM   1354 C  CB  . PHE A 1 170 ? 81.018  51.220 -0.829  1.00 23.75  ? 170  PHE A CB  1 
ATOM   1355 C  CG  . PHE A 1 170 ? 81.660  50.001 -0.203  1.00 24.73  ? 170  PHE A CG  1 
ATOM   1356 C  CD1 . PHE A 1 170 ? 81.503  48.739 -0.770  1.00 25.13  ? 170  PHE A CD1 1 
ATOM   1357 C  CD2 . PHE A 1 170 ? 82.419  50.119 0.957   1.00 23.36  ? 170  PHE A CD2 1 
ATOM   1358 C  CE1 . PHE A 1 170 ? 82.094  47.614 -0.190  1.00 26.58  ? 170  PHE A CE1 1 
ATOM   1359 C  CE2 . PHE A 1 170 ? 83.014  48.997 1.548   1.00 22.08  ? 170  PHE A CE2 1 
ATOM   1360 C  CZ  . PHE A 1 170 ? 82.852  47.745 0.974   1.00 22.39  ? 170  PHE A CZ  1 
ATOM   1361 N  N   . CYS A 1 171 ? 78.699  50.655 1.656   1.00 23.51  ? 171  CYS A N   1 
ATOM   1362 C  CA  . CYS A 1 171 ? 78.434  50.736 3.089   1.00 22.46  ? 171  CYS A CA  1 
ATOM   1363 C  C   . CYS A 1 171 ? 79.124  49.612 3.855   1.00 20.56  ? 171  CYS A C   1 
ATOM   1364 O  O   . CYS A 1 171 ? 79.122  48.458 3.429   1.00 21.05  ? 171  CYS A O   1 
ATOM   1365 C  CB  . CYS A 1 171 ? 76.926  50.645 3.354   1.00 21.24  ? 171  CYS A CB  1 
ATOM   1366 S  SG  . CYS A 1 171 ? 75.909  51.844 2.442   1.00 24.97  ? 171  CYS A SG  1 
ATOM   1367 N  N   . CYS A 1 172 ? 79.722  49.963 4.984   1.00 21.40  ? 172  CYS A N   1 
ATOM   1368 C  CA  . CYS A 1 172 ? 80.380  48.982 5.834   1.00 20.46  ? 172  CYS A CA  1 
ATOM   1369 C  C   . CYS A 1 172 ? 80.509  49.621 7.210   1.00 21.19  ? 172  CYS A C   1 
ATOM   1370 O  O   . CYS A 1 172 ? 80.245  50.819 7.369   1.00 20.82  ? 172  CYS A O   1 
ATOM   1371 C  CB  . CYS A 1 172 ? 81.747  48.586 5.264   1.00 22.91  ? 172  CYS A CB  1 
ATOM   1372 S  SG  . CYS A 1 172 ? 82.979  49.897 5.232   1.00 26.64  ? 172  CYS A SG  1 
ATOM   1373 N  N   . HIS A 1 173 ? 80.897  48.845 8.211   1.00 18.58  ? 173  HIS A N   1 
ATOM   1374 C  CA  . HIS A 1 173 ? 80.990  49.409 9.550   1.00 19.54  ? 173  HIS A CA  1 
ATOM   1375 C  C   . HIS A 1 173 ? 82.212  50.294 9.796   1.00 19.75  ? 173  HIS A C   1 
ATOM   1376 O  O   . HIS A 1 173 ? 82.074  51.461 10.177  1.00 20.54  ? 173  HIS A O   1 
ATOM   1377 C  CB  . HIS A 1 173 ? 80.956  48.302 10.610  1.00 16.40  ? 173  HIS A CB  1 
ATOM   1378 C  CG  . HIS A 1 173 ? 80.898  48.833 12.007  1.00 18.77  ? 173  HIS A CG  1 
ATOM   1379 N  ND1 . HIS A 1 173 ? 79.780  49.461 12.510  1.00 17.26  ? 173  HIS A ND1 1 
ATOM   1380 C  CD2 . HIS A 1 173 ? 81.835  48.896 12.982  1.00 17.42  ? 173  HIS A CD2 1 
ATOM   1381 C  CE1 . HIS A 1 173 ? 80.031  49.892 13.733  1.00 18.17  ? 173  HIS A CE1 1 
ATOM   1382 N  NE2 . HIS A 1 173 ? 81.271  49.564 14.045  1.00 16.88  ? 173  HIS A NE2 1 
ATOM   1383 N  N   . GLY A 1 174 ? 83.401  49.731 9.597   1.00 20.56  ? 174  GLY A N   1 
ATOM   1384 C  CA  . GLY A 1 174 ? 84.631  50.472 9.818   1.00 20.01  ? 174  GLY A CA  1 
ATOM   1385 C  C   . GLY A 1 174 ? 85.131  51.217 8.595   1.00 20.95  ? 174  GLY A C   1 
ATOM   1386 O  O   . GLY A 1 174 ? 84.887  52.411 8.444   1.00 19.95  ? 174  GLY A O   1 
ATOM   1387 N  N   . GLY A 1 175 ? 85.837  50.518 7.715   1.00 19.93  ? 175  GLY A N   1 
ATOM   1388 C  CA  . GLY A 1 175 ? 86.345  51.179 6.530   1.00 20.27  ? 175  GLY A CA  1 
ATOM   1389 C  C   . GLY A 1 175 ? 87.119  50.261 5.609   1.00 22.02  ? 175  GLY A C   1 
ATOM   1390 O  O   . GLY A 1 175 ? 86.945  49.043 5.632   1.00 20.46  ? 175  GLY A O   1 
ATOM   1391 N  N   . LEU A 1 176 ? 87.987  50.862 4.802   1.00 21.07  ? 176  LEU A N   1 
ATOM   1392 C  CA  . LEU A 1 176 ? 88.789  50.129 3.832   1.00 20.75  ? 176  LEU A CA  1 
ATOM   1393 C  C   . LEU A 1 176 ? 89.928  49.310 4.433   1.00 22.08  ? 176  LEU A C   1 
ATOM   1394 O  O   . LEU A 1 176 ? 90.240  49.407 5.623   1.00 21.61  ? 176  LEU A O   1 
ATOM   1395 C  CB  . LEU A 1 176 ? 89.346  51.105 2.793   1.00 20.36  ? 176  LEU A CB  1 
ATOM   1396 C  CG  . LEU A 1 176 ? 88.305  51.938 2.036   1.00 22.16  ? 176  LEU A CG  1 
ATOM   1397 C  CD1 . LEU A 1 176 ? 89.009  52.797 0.989   1.00 21.06  ? 176  LEU A CD1 1 
ATOM   1398 C  CD2 . LEU A 1 176 ? 87.293  51.024 1.366   1.00 19.96  ? 176  LEU A CD2 1 
ATOM   1399 N  N   . SER A 1 177 ? 90.557  48.515 3.576   1.00 23.21  ? 177  SER A N   1 
ATOM   1400 C  CA  . SER A 1 177 ? 91.644  47.641 3.979   1.00 23.54  ? 177  SER A CA  1 
ATOM   1401 C  C   . SER A 1 177 ? 92.734  47.625 2.918   1.00 24.18  ? 177  SER A C   1 
ATOM   1402 O  O   . SER A 1 177 ? 92.448  47.707 1.726   1.00 25.16  ? 177  SER A O   1 
ATOM   1403 C  CB  . SER A 1 177 ? 91.105  46.219 4.158   1.00 23.66  ? 177  SER A CB  1 
ATOM   1404 O  OG  . SER A 1 177 ? 92.160  45.293 4.331   1.00 26.01  ? 177  SER A OG  1 
ATOM   1405 N  N   . PRO A 1 178 ? 94.005  47.530 3.335   1.00 25.95  ? 178  PRO A N   1 
ATOM   1406 C  CA  . PRO A 1 178 ? 95.031  47.505 2.289   1.00 25.17  ? 178  PRO A CA  1 
ATOM   1407 C  C   . PRO A 1 178 ? 94.965  46.207 1.476   1.00 25.76  ? 178  PRO A C   1 
ATOM   1408 O  O   . PRO A 1 178 ? 95.623  46.079 0.449   1.00 25.74  ? 178  PRO A O   1 
ATOM   1409 C  CB  . PRO A 1 178 ? 96.337  47.663 3.072   1.00 25.76  ? 178  PRO A CB  1 
ATOM   1410 C  CG  . PRO A 1 178 ? 96.001  47.138 4.453   1.00 26.44  ? 178  PRO A CG  1 
ATOM   1411 C  CD  . PRO A 1 178 ? 94.602  47.657 4.678   1.00 24.98  ? 178  PRO A CD  1 
ATOM   1412 N  N   . ASP A 1 179 ? 94.152  45.256 1.937   1.00 27.20  ? 179  ASP A N   1 
ATOM   1413 C  CA  . ASP A 1 179 ? 93.980  43.969 1.256   1.00 28.24  ? 179  ASP A CA  1 
ATOM   1414 C  C   . ASP A 1 179 ? 92.789  43.967 0.297   1.00 29.15  ? 179  ASP A C   1 
ATOM   1415 O  O   . ASP A 1 179 ? 92.652  43.064 -0.533  1.00 28.37  ? 179  ASP A O   1 
ATOM   1416 C  CB  . ASP A 1 179 ? 93.762  42.839 2.268   1.00 27.27  ? 179  ASP A CB  1 
ATOM   1417 C  CG  . ASP A 1 179 ? 95.003  42.523 3.077   1.00 29.97  ? 179  ASP A CG  1 
ATOM   1418 O  OD1 . ASP A 1 179 ? 96.109  42.524 2.495   1.00 29.25  ? 179  ASP A OD1 1 
ATOM   1419 O  OD2 . ASP A 1 179 ? 94.867  42.250 4.288   1.00 28.81  ? 179  ASP A OD2 1 
ATOM   1420 N  N   . LEU A 1 180 ? 91.929  44.972 0.416   1.00 28.00  ? 180  LEU A N   1 
ATOM   1421 C  CA  . LEU A 1 180 ? 90.738  45.060 -0.423  1.00 29.11  ? 180  LEU A CA  1 
ATOM   1422 C  C   . LEU A 1 180 ? 91.026  45.584 -1.828  1.00 31.61  ? 180  LEU A C   1 
ATOM   1423 O  O   . LEU A 1 180 ? 91.237  46.781 -2.028  1.00 32.38  ? 180  LEU A O   1 
ATOM   1424 C  CB  . LEU A 1 180 ? 89.688  45.938 0.266   1.00 28.16  ? 180  LEU A CB  1 
ATOM   1425 C  CG  . LEU A 1 180 ? 88.337  46.132 -0.426  1.00 27.94  ? 180  LEU A CG  1 
ATOM   1426 C  CD1 . LEU A 1 180 ? 87.708  44.778 -0.733  1.00 25.66  ? 180  LEU A CD1 1 
ATOM   1427 C  CD2 . LEU A 1 180 ? 87.428  46.962 0.476   1.00 26.68  ? 180  LEU A CD2 1 
ATOM   1428 N  N   . GLN A 1 181 ? 91.020  44.673 -2.798  1.00 34.18  ? 181  GLN A N   1 
ATOM   1429 C  CA  . GLN A 1 181 ? 91.281  45.011 -4.195  1.00 35.63  ? 181  GLN A CA  1 
ATOM   1430 C  C   . GLN A 1 181 ? 90.029  44.849 -5.059  1.00 36.02  ? 181  GLN A C   1 
ATOM   1431 O  O   . GLN A 1 181 ? 89.858  45.557 -6.052  1.00 36.10  ? 181  GLN A O   1 
ATOM   1432 C  CB  . GLN A 1 181 ? 92.396  44.124 -4.751  1.00 37.97  ? 181  GLN A CB  1 
ATOM   1433 C  CG  . GLN A 1 181 ? 93.689  44.177 -3.959  1.00 42.21  ? 181  GLN A CG  1 
ATOM   1434 C  CD  . GLN A 1 181 ? 94.686  43.137 -4.425  1.00 45.72  ? 181  GLN A CD  1 
ATOM   1435 O  OE1 . GLN A 1 181 ? 94.370  41.949 -4.496  1.00 47.87  ? 181  GLN A OE1 1 
ATOM   1436 N  NE2 . GLN A 1 181 ? 95.900  43.577 -4.741  1.00 47.07  ? 181  GLN A NE2 1 
ATOM   1437 N  N   . SER A 1 182 ? 89.161  43.911 -4.689  1.00 34.97  ? 182  SER A N   1 
ATOM   1438 C  CA  . SER A 1 182 ? 87.929  43.699 -5.440  1.00 35.32  ? 182  SER A CA  1 
ATOM   1439 C  C   . SER A 1 182 ? 86.785  43.283 -4.524  1.00 35.89  ? 182  SER A C   1 
ATOM   1440 O  O   . SER A 1 182 ? 87.005  42.753 -3.431  1.00 35.04  ? 182  SER A O   1 
ATOM   1441 C  CB  . SER A 1 182 ? 88.125  42.630 -6.518  1.00 36.20  ? 182  SER A CB  1 
ATOM   1442 O  OG  . SER A 1 182 ? 87.923  41.332 -5.990  1.00 38.65  ? 182  SER A OG  1 
ATOM   1443 N  N   . MET A 1 183 ? 85.560  43.522 -4.984  1.00 34.93  ? 183  MET A N   1 
ATOM   1444 C  CA  . MET A 1 183 ? 84.371  43.176 -4.220  1.00 35.25  ? 183  MET A CA  1 
ATOM   1445 C  C   . MET A 1 183 ? 84.271  41.675 -4.043  1.00 36.03  ? 183  MET A C   1 
ATOM   1446 O  O   . MET A 1 183 ? 83.716  41.193 -3.055  1.00 36.03  ? 183  MET A O   1 
ATOM   1447 C  CB  . MET A 1 183 ? 83.113  43.681 -4.928  1.00 34.17  ? 183  MET A CB  1 
ATOM   1448 C  CG  . MET A 1 183 ? 83.004  45.190 -5.003  1.00 35.45  ? 183  MET A CG  1 
ATOM   1449 S  SD  . MET A 1 183 ? 82.958  45.961 -3.372  1.00 33.27  ? 183  MET A SD  1 
ATOM   1450 C  CE  . MET A 1 183 ? 82.831  47.675 -3.839  1.00 35.62  ? 183  MET A CE  1 
ATOM   1451 N  N   . GLU A 1 184 ? 84.805  40.933 -5.006  1.00 36.54  ? 184  GLU A N   1 
ATOM   1452 C  CA  . GLU A 1 184 ? 84.759  39.483 -4.939  1.00 36.57  ? 184  GLU A CA  1 
ATOM   1453 C  C   . GLU A 1 184 ? 85.440  38.968 -3.685  1.00 34.70  ? 184  GLU A C   1 
ATOM   1454 O  O   . GLU A 1 184 ? 85.062  37.924 -3.154  1.00 35.10  ? 184  GLU A O   1 
ATOM   1455 C  CB  . GLU A 1 184 ? 85.403  38.871 -6.184  1.00 38.87  ? 184  GLU A CB  1 
ATOM   1456 C  CG  . GLU A 1 184 ? 84.612  39.138 -7.448  1.00 41.93  ? 184  GLU A CG  1 
ATOM   1457 C  CD  . GLU A 1 184 ? 83.161  38.711 -7.318  1.00 44.81  ? 184  GLU A CD  1 
ATOM   1458 O  OE1 . GLU A 1 184 ? 82.914  37.532 -6.988  1.00 45.83  ? 184  GLU A OE1 1 
ATOM   1459 O  OE2 . GLU A 1 184 ? 82.267  39.553 -7.547  1.00 47.03  ? 184  GLU A OE2 1 
ATOM   1460 N  N   . GLN A 1 185 ? 86.442  39.700 -3.208  1.00 33.14  ? 185  GLN A N   1 
ATOM   1461 C  CA  . GLN A 1 185 ? 87.148  39.293 -1.998  1.00 31.29  ? 185  GLN A CA  1 
ATOM   1462 C  C   . GLN A 1 185 ? 86.186  39.291 -0.821  1.00 30.53  ? 185  GLN A C   1 
ATOM   1463 O  O   . GLN A 1 185 ? 86.309  38.473 0.084   1.00 29.11  ? 185  GLN A O   1 
ATOM   1464 C  CB  . GLN A 1 185 ? 88.303  40.242 -1.697  1.00 33.17  ? 185  GLN A CB  1 
ATOM   1465 C  CG  . GLN A 1 185 ? 89.537  40.016 -2.536  1.00 34.99  ? 185  GLN A CG  1 
ATOM   1466 C  CD  . GLN A 1 185 ? 90.606  41.040 -2.243  1.00 36.41  ? 185  GLN A CD  1 
ATOM   1467 O  OE1 . GLN A 1 185 ? 90.531  42.180 -2.702  1.00 36.60  ? 185  GLN A OE1 1 
ATOM   1468 N  NE2 . GLN A 1 185 ? 91.601  40.648 -1.457  1.00 38.25  ? 185  GLN A NE2 1 
ATOM   1469 N  N   . ILE A 1 186 ? 85.234  40.219 -0.831  1.00 30.03  ? 186  ILE A N   1 
ATOM   1470 C  CA  . ILE A 1 186 ? 84.259  40.292 0.247   1.00 29.65  ? 186  ILE A CA  1 
ATOM   1471 C  C   . ILE A 1 186 ? 83.217  39.189 0.079   1.00 30.73  ? 186  ILE A C   1 
ATOM   1472 O  O   . ILE A 1 186 ? 82.873  38.505 1.043   1.00 31.27  ? 186  ILE A O   1 
ATOM   1473 C  CB  . ILE A 1 186 ? 83.561  41.674 0.285   1.00 27.76  ? 186  ILE A CB  1 
ATOM   1474 C  CG1 . ILE A 1 186 ? 84.607  42.769 0.527   1.00 27.48  ? 186  ILE A CG1 1 
ATOM   1475 C  CG2 . ILE A 1 186 ? 82.513  41.706 1.396   1.00 26.71  ? 186  ILE A CG2 1 
ATOM   1476 C  CD1 . ILE A 1 186 ? 84.041  44.178 0.571   1.00 28.05  ? 186  ILE A CD1 1 
ATOM   1477 N  N   . ARG A 1 187 ? 82.729  39.002 -1.145  1.00 32.50  ? 187  ARG A N   1 
ATOM   1478 C  CA  . ARG A 1 187 ? 81.725  37.970 -1.398  1.00 34.80  ? 187  ARG A CA  1 
ATOM   1479 C  C   . ARG A 1 187 ? 82.221  36.582 -1.008  1.00 34.88  ? 187  ARG A C   1 
ATOM   1480 O  O   . ARG A 1 187 ? 81.436  35.735 -0.578  1.00 35.61  ? 187  ARG A O   1 
ATOM   1481 C  CB  . ARG A 1 187 ? 81.315  37.949 -2.876  1.00 37.28  ? 187  ARG A CB  1 
ATOM   1482 C  CG  . ARG A 1 187 ? 80.582  39.187 -3.357  1.00 41.05  ? 187  ARG A CG  1 
ATOM   1483 C  CD  . ARG A 1 187 ? 79.862  38.914 -4.678  1.00 43.69  ? 187  ARG A CD  1 
ATOM   1484 N  NE  . ARG A 1 187 ? 79.121  40.080 -5.155  1.00 46.32  ? 187  ARG A NE  1 
ATOM   1485 C  CZ  . ARG A 1 187 ? 79.680  41.143 -5.725  1.00 47.96  ? 187  ARG A CZ  1 
ATOM   1486 N  NH1 . ARG A 1 187 ? 80.994  41.192 -5.897  1.00 49.40  ? 187  ARG A NH1 1 
ATOM   1487 N  NH2 . ARG A 1 187 ? 78.926  42.161 -6.119  1.00 47.65  ? 187  ARG A NH2 1 
ATOM   1488 N  N   . ARG A 1 188 ? 83.522  36.353 -1.148  1.00 34.00  ? 188  ARG A N   1 
ATOM   1489 C  CA  . ARG A 1 188 ? 84.101  35.055 -0.830  1.00 36.41  ? 188  ARG A CA  1 
ATOM   1490 C  C   . ARG A 1 188 ? 84.344  34.792 0.654   1.00 36.33  ? 188  ARG A C   1 
ATOM   1491 O  O   . ARG A 1 188 ? 84.785  33.703 1.022   1.00 37.65  ? 188  ARG A O   1 
ATOM   1492 C  CB  . ARG A 1 188 ? 85.404  34.852 -1.614  1.00 36.17  ? 188  ARG A CB  1 
ATOM   1493 C  CG  . ARG A 1 188 ? 85.211  34.831 -3.125  1.00 38.59  ? 188  ARG A CG  1 
ATOM   1494 C  CD  . ARG A 1 188 ? 86.399  34.193 -3.831  1.00 38.57  ? 188  ARG A CD  1 
ATOM   1495 N  NE  . ARG A 1 188 ? 87.638  34.944 -3.646  1.00 40.64  ? 188  ARG A NE  1 
ATOM   1496 C  CZ  . ARG A 1 188 ? 88.001  35.993 -4.378  1.00 40.86  ? 188  ARG A CZ  1 
ATOM   1497 N  NH1 . ARG A 1 188 ? 87.220  36.426 -5.359  1.00 40.83  ? 188  ARG A NH1 1 
ATOM   1498 N  NH2 . ARG A 1 188 ? 89.149  36.608 -4.130  1.00 40.97  ? 188  ARG A NH2 1 
ATOM   1499 N  N   . ILE A 1 189 ? 84.067  35.775 1.506   1.00 35.77  ? 189  ILE A N   1 
ATOM   1500 C  CA  . ILE A 1 189 ? 84.253  35.587 2.944   1.00 34.83  ? 189  ILE A CA  1 
ATOM   1501 C  C   . ILE A 1 189 ? 83.220  34.574 3.429   1.00 34.99  ? 189  ILE A C   1 
ATOM   1502 O  O   . ILE A 1 189 ? 82.026  34.717 3.163   1.00 34.13  ? 189  ILE A O   1 
ATOM   1503 C  CB  . ILE A 1 189 ? 84.084  36.913 3.719   1.00 33.95  ? 189  ILE A CB  1 
ATOM   1504 C  CG1 . ILE A 1 189 ? 85.246  37.853 3.383   1.00 32.76  ? 189  ILE A CG1 1 
ATOM   1505 C  CG2 . ILE A 1 189 ? 84.038  36.645 5.219   1.00 31.74  ? 189  ILE A CG2 1 
ATOM   1506 C  CD1 . ILE A 1 189 ? 85.143  39.216 4.019   1.00 30.72  ? 189  ILE A CD1 1 
ATOM   1507 N  N   . MET A 1 190 ? 83.686  33.554 4.143   1.00 35.91  ? 190  MET A N   1 
ATOM   1508 C  CA  . MET A 1 190 ? 82.808  32.500 4.631   1.00 36.50  ? 190  MET A CA  1 
ATOM   1509 C  C   . MET A 1 190 ? 82.213  32.764 6.008   1.00 35.25  ? 190  MET A C   1 
ATOM   1510 O  O   . MET A 1 190 ? 82.857  33.346 6.881   1.00 33.99  ? 190  MET A O   1 
ATOM   1511 C  CB  . MET A 1 190 ? 83.565  31.166 4.649   1.00 40.27  ? 190  MET A CB  1 
ATOM   1512 C  CG  . MET A 1 190 ? 84.105  30.739 3.287   1.00 44.68  ? 190  MET A CG  1 
ATOM   1513 S  SD  . MET A 1 190 ? 85.164  29.273 3.380   1.00 51.30  ? 190  MET A SD  1 
ATOM   1514 C  CE  . MET A 1 190 ? 86.766  30.034 3.739   1.00 48.02  ? 190  MET A CE  1 
ATOM   1515 N  N   . ARG A 1 191 ? 80.970  32.327 6.180   1.00 33.51  ? 191  ARG A N   1 
ATOM   1516 C  CA  . ARG A 1 191 ? 80.248  32.465 7.438   1.00 33.46  ? 191  ARG A CA  1 
ATOM   1517 C  C   . ARG A 1 191 ? 79.761  31.073 7.840   1.00 34.62  ? 191  ARG A C   1 
ATOM   1518 O  O   . ARG A 1 191 ? 79.521  30.227 6.981   1.00 35.26  ? 191  ARG A O   1 
ATOM   1519 C  CB  . ARG A 1 191 ? 79.052  33.401 7.262   1.00 31.04  ? 191  ARG A CB  1 
ATOM   1520 C  CG  . ARG A 1 191 ? 79.432  34.846 6.964   1.00 30.43  ? 191  ARG A CG  1 
ATOM   1521 C  CD  . ARG A 1 191 ? 78.202  35.701 6.699   1.00 31.64  ? 191  ARG A CD  1 
ATOM   1522 N  NE  . ARG A 1 191 ? 77.538  35.334 5.452   1.00 27.14  ? 191  ARG A NE  1 
ATOM   1523 C  CZ  . ARG A 1 191 ? 76.400  35.872 5.024   1.00 29.95  ? 191  ARG A CZ  1 
ATOM   1524 N  NH1 . ARG A 1 191 ? 75.784  36.807 5.745   1.00 28.33  ? 191  ARG A NH1 1 
ATOM   1525 N  NH2 . ARG A 1 191 ? 75.879  35.484 3.870   1.00 26.15  ? 191  ARG A NH2 1 
ATOM   1526 N  N   . PRO A 1 192 ? 79.604  30.814 9.148   1.00 34.55  ? 192  PRO A N   1 
ATOM   1527 C  CA  . PRO A 1 192 ? 79.846  31.720 10.275  1.00 34.74  ? 192  PRO A CA  1 
ATOM   1528 C  C   . PRO A 1 192 ? 81.321  32.027 10.441  1.00 34.85  ? 192  PRO A C   1 
ATOM   1529 O  O   . PRO A 1 192 ? 82.182  31.236 10.054  1.00 34.49  ? 192  PRO A O   1 
ATOM   1530 C  CB  . PRO A 1 192 ? 79.320  30.936 11.477  1.00 34.86  ? 192  PRO A CB  1 
ATOM   1531 C  CG  . PRO A 1 192 ? 78.369  29.940 10.872  1.00 37.15  ? 192  PRO A CG  1 
ATOM   1532 C  CD  . PRO A 1 192 ? 79.086  29.526 9.632   1.00 36.40  ? 192  PRO A CD  1 
ATOM   1533 N  N   . THR A 1 193 ? 81.613  33.181 11.020  1.00 33.67  ? 193  THR A N   1 
ATOM   1534 C  CA  . THR A 1 193 ? 82.991  33.541 11.264  1.00 33.25  ? 193  THR A CA  1 
ATOM   1535 C  C   . THR A 1 193 ? 83.134  34.491 12.430  1.00 33.94  ? 193  THR A C   1 
ATOM   1536 O  O   . THR A 1 193 ? 82.376  35.455 12.570  1.00 31.70  ? 193  THR A O   1 
ATOM   1537 C  CB  . THR A 1 193 ? 83.656  34.208 10.037  1.00 33.92  ? 193  THR A CB  1 
ATOM   1538 O  OG1 . THR A 1 193 ? 85.021  34.511 10.352  1.00 32.68  ? 193  THR A OG1 1 
ATOM   1539 C  CG2 . THR A 1 193 ? 82.946  35.509 9.666   1.00 31.34  ? 193  THR A CG2 1 
ATOM   1540 N  N   . ASP A 1 194 ? 84.084  34.184 13.299  1.00 34.07  ? 194  ASP A N   1 
ATOM   1541 C  CA  . ASP A 1 194 ? 84.390  35.075 14.396  1.00 38.40  ? 194  ASP A CA  1 
ATOM   1542 C  C   . ASP A 1 194 ? 85.488  35.850 13.666  1.00 39.22  ? 194  ASP A C   1 
ATOM   1543 O  O   . ASP A 1 194 ? 85.740  35.580 12.490  1.00 40.81  ? 194  ASP A O   1 
ATOM   1544 C  CB  . ASP A 1 194 ? 84.928  34.288 15.598  1.00 40.83  ? 194  ASP A CB  1 
ATOM   1545 C  CG  . ASP A 1 194 ? 86.194  33.516 15.280  1.00 43.41  ? 194  ASP A CG  1 
ATOM   1546 O  OD1 . ASP A 1 194 ? 86.338  33.039 14.136  1.00 45.28  ? 194  ASP A OD1 1 
ATOM   1547 O  OD2 . ASP A 1 194 ? 87.042  33.373 16.187  1.00 48.07  ? 194  ASP A OD2 1 
ATOM   1548 N  N   . VAL A 1 195 ? 86.138  36.811 14.295  1.00 39.82  ? 195  VAL A N   1 
ATOM   1549 C  CA  . VAL A 1 195 ? 87.172  37.526 13.552  1.00 40.88  ? 195  VAL A CA  1 
ATOM   1550 C  C   . VAL A 1 195 ? 88.509  37.256 14.228  1.00 40.10  ? 195  VAL A C   1 
ATOM   1551 O  O   . VAL A 1 195 ? 89.090  38.130 14.866  1.00 41.75  ? 195  VAL A O   1 
ATOM   1552 C  CB  . VAL A 1 195 ? 86.853  39.033 13.496  1.00 39.68  ? 195  VAL A CB  1 
ATOM   1553 C  CG1 . VAL A 1 195 ? 87.840  39.746 12.589  1.00 40.43  ? 195  VAL A CG1 1 
ATOM   1554 C  CG2 . VAL A 1 195 ? 85.433  39.229 12.970  1.00 39.97  ? 195  VAL A CG2 1 
ATOM   1555 N  N   . PRO A 1 196 ? 89.020  36.023 14.065  1.00 40.06  ? 196  PRO A N   1 
ATOM   1556 C  CA  . PRO A 1 196 ? 90.274  35.521 14.627  1.00 39.07  ? 196  PRO A CA  1 
ATOM   1557 C  C   . PRO A 1 196 ? 91.569  36.170 14.169  1.00 38.64  ? 196  PRO A C   1 
ATOM   1558 O  O   . PRO A 1 196 ? 92.512  36.272 14.952  1.00 37.47  ? 196  PRO A O   1 
ATOM   1559 C  CB  . PRO A 1 196 ? 90.235  34.045 14.258  1.00 39.02  ? 196  PRO A CB  1 
ATOM   1560 C  CG  . PRO A 1 196 ? 89.662  34.094 12.893  1.00 40.02  ? 196  PRO A CG  1 
ATOM   1561 C  CD  . PRO A 1 196 ? 88.499  35.065 13.069  1.00 39.49  ? 196  PRO A CD  1 
ATOM   1562 N  N   . ASP A 1 197 ? 91.622  36.609 12.915  1.00 36.87  ? 197  ASP A N   1 
ATOM   1563 C  CA  . ASP A 1 197 ? 92.857  37.181 12.397  1.00 36.78  ? 197  ASP A CA  1 
ATOM   1564 C  C   . ASP A 1 197 ? 92.798  38.602 11.859  1.00 34.69  ? 197  ASP A C   1 
ATOM   1565 O  O   . ASP A 1 197 ? 91.732  39.114 11.504  1.00 32.82  ? 197  ASP A O   1 
ATOM   1566 C  CB  . ASP A 1 197 ? 93.416  36.276 11.293  1.00 39.87  ? 197  ASP A CB  1 
ATOM   1567 C  CG  . ASP A 1 197 ? 93.498  34.819 11.713  1.00 42.90  ? 197  ASP A CG  1 
ATOM   1568 O  OD1 . ASP A 1 197 ? 93.977  34.546 12.834  1.00 46.59  ? 197  ASP A OD1 1 
ATOM   1569 O  OD2 . ASP A 1 197 ? 93.094  33.946 10.915  1.00 43.24  ? 197  ASP A OD2 1 
ATOM   1570 N  N   . GLN A 1 198 ? 93.969  39.231 11.804  1.00 31.08  ? 198  GLN A N   1 
ATOM   1571 C  CA  . GLN A 1 198 ? 94.087  40.577 11.263  1.00 29.37  ? 198  GLN A CA  1 
ATOM   1572 C  C   . GLN A 1 198 ? 93.832  40.372 9.778   1.00 26.87  ? 198  GLN A C   1 
ATOM   1573 O  O   . GLN A 1 198 ? 93.849  39.236 9.297   1.00 26.10  ? 198  GLN A O   1 
ATOM   1574 C  CB  . GLN A 1 198 ? 95.506  41.132 11.483  1.00 28.95  ? 198  GLN A CB  1 
ATOM   1575 C  CG  . GLN A 1 198 ? 96.606  40.337 10.789  1.00 29.53  ? 198  GLN A CG  1 
ATOM   1576 C  CD  . GLN A 1 198 ? 97.988  40.983 10.903  1.00 30.26  ? 198  GLN A CD  1 
ATOM   1577 O  OE1 . GLN A 1 198 ? 98.187  42.137 10.517  1.00 29.34  ? 198  GLN A OE1 1 
ATOM   1578 N  NE2 . GLN A 1 198 ? 98.950  40.230 11.424  1.00 30.35  ? 198  GLN A NE2 1 
ATOM   1579 N  N   . GLY A 1 199 ? 93.595  41.453 9.047   1.00 25.89  ? 199  GLY A N   1 
ATOM   1580 C  CA  . GLY A 1 199 ? 93.347  41.310 7.625   1.00 25.31  ? 199  GLY A CA  1 
ATOM   1581 C  C   . GLY A 1 199 ? 92.087  42.008 7.151   1.00 24.65  ? 199  GLY A C   1 
ATOM   1582 O  O   . GLY A 1 199 ? 91.546  42.872 7.842   1.00 24.40  ? 199  GLY A O   1 
ATOM   1583 N  N   . LEU A 1 200 ? 91.611  41.609 5.975   1.00 22.46  ? 200  LEU A N   1 
ATOM   1584 C  CA  . LEU A 1 200 ? 90.427  42.203 5.363   1.00 21.79  ? 200  LEU A CA  1 
ATOM   1585 C  C   . LEU A 1 200 ? 89.193  42.370 6.249   1.00 24.09  ? 200  LEU A C   1 
ATOM   1586 O  O   . LEU A 1 200 ? 88.727  43.488 6.472   1.00 23.54  ? 200  LEU A O   1 
ATOM   1587 C  CB  . LEU A 1 200 ? 90.033  41.404 4.123   1.00 22.05  ? 200  LEU A CB  1 
ATOM   1588 C  CG  . LEU A 1 200 ? 88.766  41.887 3.415   1.00 18.94  ? 200  LEU A CG  1 
ATOM   1589 C  CD1 . LEU A 1 200 ? 88.920  43.349 2.985   1.00 22.78  ? 200  LEU A CD1 1 
ATOM   1590 C  CD2 . LEU A 1 200 ? 88.511  40.990 2.209   1.00 23.27  ? 200  LEU A CD2 1 
ATOM   1591 N  N   . LEU A 1 201 ? 88.645  41.260 6.732   1.00 24.88  ? 201  LEU A N   1 
ATOM   1592 C  CA  . LEU A 1 201 ? 87.449  41.327 7.568   1.00 23.34  ? 201  LEU A CA  1 
ATOM   1593 C  C   . LEU A 1 201 ? 87.674  42.184 8.811   1.00 22.37  ? 201  LEU A C   1 
ATOM   1594 O  O   . LEU A 1 201 ? 86.797  42.949 9.209   1.00 20.49  ? 201  LEU A O   1 
ATOM   1595 C  CB  . LEU A 1 201 ? 87.005  39.919 7.965   1.00 26.11  ? 201  LEU A CB  1 
ATOM   1596 C  CG  . LEU A 1 201 ? 85.711  39.822 8.782   1.00 28.88  ? 201  LEU A CG  1 
ATOM   1597 C  CD1 . LEU A 1 201 ? 84.568  40.524 8.054   1.00 28.09  ? 201  LEU A CD1 1 
ATOM   1598 C  CD2 . LEU A 1 201 ? 85.375  38.350 9.012   1.00 30.70  ? 201  LEU A CD2 1 
ATOM   1599 N  N   . CYS A 1 202 ? 88.843  42.048 9.433   1.00 21.80  ? 202  CYS A N   1 
ATOM   1600 C  CA  . CYS A 1 202 ? 89.171  42.839 10.617  1.00 21.67  ? 202  CYS A CA  1 
ATOM   1601 C  C   . CYS A 1 202 ? 89.110  44.332 10.270  1.00 20.54  ? 202  CYS A C   1 
ATOM   1602 O  O   . CYS A 1 202 ? 88.483  45.128 10.978  1.00 19.84  ? 202  CYS A O   1 
ATOM   1603 C  CB  . CYS A 1 202 ? 90.576  42.470 11.113  1.00 22.03  ? 202  CYS A CB  1 
ATOM   1604 S  SG  . CYS A 1 202 ? 91.226  43.512 12.447  1.00 26.90  ? 202  CYS A SG  1 
ATOM   1605 N  N   . ASP A 1 203 ? 89.754  44.703 9.165   1.00 20.32  ? 203  ASP A N   1 
ATOM   1606 C  CA  . ASP A 1 203 ? 89.784  46.092 8.724   1.00 20.76  ? 203  ASP A CA  1 
ATOM   1607 C  C   . ASP A 1 203 ? 88.395  46.634 8.392   1.00 21.48  ? 203  ASP A C   1 
ATOM   1608 O  O   . ASP A 1 203 ? 88.080  47.782 8.713   1.00 21.86  ? 203  ASP A O   1 
ATOM   1609 C  CB  . ASP A 1 203 ? 90.697  46.256 7.497   1.00 20.27  ? 203  ASP A CB  1 
ATOM   1610 C  CG  . ASP A 1 203 ? 92.148  45.900 7.788   1.00 20.79  ? 203  ASP A CG  1 
ATOM   1611 O  OD1 . ASP A 1 203 ? 92.575  46.023 8.956   1.00 20.67  ? 203  ASP A OD1 1 
ATOM   1612 O  OD2 . ASP A 1 203 ? 92.871  45.512 6.843   1.00 21.50  ? 203  ASP A OD2 1 
ATOM   1613 N  N   . LEU A 1 204 ? 87.568  45.822 7.735   1.00 22.08  ? 204  LEU A N   1 
ATOM   1614 C  CA  . LEU A 1 204 ? 86.221  46.260 7.378   1.00 19.02  ? 204  LEU A CA  1 
ATOM   1615 C  C   . LEU A 1 204 ? 85.403  46.601 8.627   1.00 21.12  ? 204  LEU A C   1 
ATOM   1616 O  O   . LEU A 1 204 ? 84.505  47.446 8.587   1.00 17.85  ? 204  LEU A O   1 
ATOM   1617 C  CB  . LEU A 1 204 ? 85.508  45.175 6.565   1.00 19.58  ? 204  LEU A CB  1 
ATOM   1618 C  CG  . LEU A 1 204 ? 85.965  45.041 5.110   1.00 18.92  ? 204  LEU A CG  1 
ATOM   1619 C  CD1 . LEU A 1 204 ? 85.509  43.723 4.524   1.00 20.62  ? 204  LEU A CD1 1 
ATOM   1620 C  CD2 . LEU A 1 204 ? 85.410  46.211 4.307   1.00 20.09  ? 204  LEU A CD2 1 
ATOM   1621 N  N   . LEU A 1 205 ? 85.726  45.952 9.741   1.00 20.13  ? 205  LEU A N   1 
ATOM   1622 C  CA  . LEU A 1 205 ? 85.011  46.190 10.993  1.00 21.80  ? 205  LEU A CA  1 
ATOM   1623 C  C   . LEU A 1 205 ? 85.671  47.216 11.903  1.00 21.93  ? 205  LEU A C   1 
ATOM   1624 O  O   . LEU A 1 205 ? 85.017  47.756 12.799  1.00 21.58  ? 205  LEU A O   1 
ATOM   1625 C  CB  . LEU A 1 205 ? 84.878  44.877 11.779  1.00 21.53  ? 205  LEU A CB  1 
ATOM   1626 C  CG  . LEU A 1 205 ? 83.669  43.949 11.620  1.00 25.56  ? 205  LEU A CG  1 
ATOM   1627 C  CD1 . LEU A 1 205 ? 83.049  44.045 10.246  1.00 27.61  ? 205  LEU A CD1 1 
ATOM   1628 C  CD2 . LEU A 1 205 ? 84.134  42.526 11.924  1.00 24.55  ? 205  LEU A CD2 1 
ATOM   1629 N  N   . TRP A 1 206 ? 86.949  47.502 11.670  1.00 20.54  ? 206  TRP A N   1 
ATOM   1630 C  CA  . TRP A 1 206 ? 87.684  48.412 12.552  1.00 20.81  ? 206  TRP A CA  1 
ATOM   1631 C  C   . TRP A 1 206 ? 88.377  49.658 12.000  1.00 21.09  ? 206  TRP A C   1 
ATOM   1632 O  O   . TRP A 1 206 ? 88.598  50.607 12.752  1.00 20.97  ? 206  TRP A O   1 
ATOM   1633 C  CB  . TRP A 1 206 ? 88.762  47.636 13.308  1.00 22.22  ? 206  TRP A CB  1 
ATOM   1634 C  CG  . TRP A 1 206 ? 88.287  46.698 14.364  1.00 20.37  ? 206  TRP A CG  1 
ATOM   1635 C  CD1 . TRP A 1 206 ? 87.997  45.371 14.216  1.00 21.85  ? 206  TRP A CD1 1 
ATOM   1636 C  CD2 . TRP A 1 206 ? 88.112  46.996 15.753  1.00 21.02  ? 206  TRP A CD2 1 
ATOM   1637 N  NE1 . TRP A 1 206 ? 87.661  44.824 15.429  1.00 21.71  ? 206  TRP A NE1 1 
ATOM   1638 C  CE2 . TRP A 1 206 ? 87.723  45.798 16.391  1.00 21.51  ? 206  TRP A CE2 1 
ATOM   1639 C  CE3 . TRP A 1 206 ? 88.252  48.158 16.523  1.00 18.80  ? 206  TRP A CE3 1 
ATOM   1640 C  CZ2 . TRP A 1 206 ? 87.469  45.728 17.767  1.00 21.77  ? 206  TRP A CZ2 1 
ATOM   1641 C  CZ3 . TRP A 1 206 ? 88.001  48.089 17.892  1.00 21.04  ? 206  TRP A CZ3 1 
ATOM   1642 C  CH2 . TRP A 1 206 ? 87.615  46.882 18.497  1.00 19.67  ? 206  TRP A CH2 1 
ATOM   1643 N  N   . SER A 1 207 ? 88.734  49.673 10.720  1.00 21.63  ? 207  SER A N   1 
ATOM   1644 C  CA  . SER A 1 207 ? 89.469  50.823 10.193  1.00 21.43  ? 207  SER A CA  1 
ATOM   1645 C  C   . SER A 1 207 ? 88.732  52.158 10.274  1.00 21.15  ? 207  SER A C   1 
ATOM   1646 O  O   . SER A 1 207 ? 87.503  52.202 10.342  1.00 20.21  ? 207  SER A O   1 
ATOM   1647 C  CB  . SER A 1 207 ? 89.946  50.557 8.754   1.00 19.33  ? 207  SER A CB  1 
ATOM   1648 O  OG  . SER A 1 207 ? 88.888  50.585 7.819   1.00 19.20  ? 207  SER A OG  1 
ATOM   1649 N  N   . ASP A 1 208 ? 89.507  53.243 10.278  1.00 20.61  ? 208  ASP A N   1 
ATOM   1650 C  CA  . ASP A 1 208 ? 88.966  54.601 10.372  1.00 22.59  ? 208  ASP A CA  1 
ATOM   1651 C  C   . ASP A 1 208 ? 89.629  55.517 9.345   1.00 23.90  ? 208  ASP A C   1 
ATOM   1652 O  O   . ASP A 1 208 ? 90.791  55.328 8.986   1.00 21.90  ? 208  ASP A O   1 
ATOM   1653 C  CB  . ASP A 1 208 ? 89.261  55.227 11.743  1.00 20.83  ? 208  ASP A CB  1 
ATOM   1654 C  CG  . ASP A 1 208 ? 88.529  54.558 12.889  1.00 22.14  ? 208  ASP A CG  1 
ATOM   1655 O  OD1 . ASP A 1 208 ? 87.294  54.688 12.978  1.00 20.70  ? 208  ASP A OD1 1 
ATOM   1656 O  OD2 . ASP A 1 208 ? 89.204  53.910 13.711  1.00 24.33  ? 208  ASP A OD2 1 
ATOM   1657 N  N   . PRO A 1 209 ? 88.895  56.527 8.865   1.00 23.93  ? 209  PRO A N   1 
ATOM   1658 C  CA  . PRO A 1 209 ? 89.482  57.453 7.892   1.00 24.43  ? 209  PRO A CA  1 
ATOM   1659 C  C   . PRO A 1 209 ? 90.363  58.404 8.698   1.00 26.01  ? 209  PRO A C   1 
ATOM   1660 O  O   . PRO A 1 209 ? 90.101  58.640 9.876   1.00 23.77  ? 209  PRO A O   1 
ATOM   1661 C  CB  . PRO A 1 209 ? 88.260  58.150 7.306   1.00 25.03  ? 209  PRO A CB  1 
ATOM   1662 C  CG  . PRO A 1 209 ? 87.327  58.211 8.498   1.00 25.85  ? 209  PRO A CG  1 
ATOM   1663 C  CD  . PRO A 1 209 ? 87.463  56.815 9.076   1.00 24.77  ? 209  PRO A CD  1 
ATOM   1664 N  N   . ASP A 1 210 ? 91.416  58.933 8.085   1.00 29.30  ? 210  ASP A N   1 
ATOM   1665 C  CA  . ASP A 1 210 ? 92.299  59.854 8.794   1.00 35.54  ? 210  ASP A CA  1 
ATOM   1666 C  C   . ASP A 1 210 ? 92.626  61.033 7.890   1.00 37.05  ? 210  ASP A C   1 
ATOM   1667 O  O   . ASP A 1 210 ? 92.984  60.856 6.728   1.00 38.07  ? 210  ASP A O   1 
ATOM   1668 C  CB  . ASP A 1 210 ? 93.584  59.139 9.228   1.00 39.38  ? 210  ASP A CB  1 
ATOM   1669 C  CG  . ASP A 1 210 ? 94.487  60.021 10.079  1.00 45.09  ? 210  ASP A CG  1 
ATOM   1670 O  OD1 . ASP A 1 210 ? 95.000  61.029 9.549   1.00 47.59  ? 210  ASP A OD1 1 
ATOM   1671 O  OD2 . ASP A 1 210 ? 94.682  59.709 11.276  1.00 45.76  ? 210  ASP A OD2 1 
ATOM   1672 N  N   . LYS A 1 211 ? 92.497  62.235 8.440   1.00 39.57  ? 211  LYS A N   1 
ATOM   1673 C  CA  . LYS A 1 211 ? 92.736  63.472 7.700   1.00 42.05  ? 211  LYS A CA  1 
ATOM   1674 C  C   . LYS A 1 211 ? 94.203  63.793 7.425   1.00 41.89  ? 211  LYS A C   1 
ATOM   1675 O  O   . LYS A 1 211 ? 94.536  64.357 6.382   1.00 43.31  ? 211  LYS A O   1 
ATOM   1676 C  CB  . LYS A 1 211 ? 92.115  64.644 8.465   1.00 44.86  ? 211  LYS A CB  1 
ATOM   1677 C  CG  . LYS A 1 211 ? 90.665  64.424 8.865   1.00 49.70  ? 211  LYS A CG  1 
ATOM   1678 C  CD  . LYS A 1 211 ? 90.185  65.513 9.814   1.00 52.76  ? 211  LYS A CD  1 
ATOM   1679 C  CE  . LYS A 1 211 ? 88.722  65.325 10.172  1.00 53.93  ? 211  LYS A CE  1 
ATOM   1680 N  NZ  . LYS A 1 211 ? 87.858  65.387 8.960   1.00 55.73  ? 211  LYS A NZ  1 
ATOM   1681 N  N   . ASP A 1 212 ? 95.077  63.429 8.355   1.00 40.75  ? 212  ASP A N   1 
ATOM   1682 C  CA  . ASP A 1 212 ? 96.497  63.734 8.224   1.00 40.88  ? 212  ASP A CA  1 
ATOM   1683 C  C   . ASP A 1 212 ? 97.303  62.966 7.174   1.00 40.93  ? 212  ASP A C   1 
ATOM   1684 O  O   . ASP A 1 212 ? 98.327  63.461 6.700   1.00 42.02  ? 212  ASP A O   1 
ATOM   1685 C  CB  . ASP A 1 212 ? 97.168  63.598 9.590   1.00 41.61  ? 212  ASP A CB  1 
ATOM   1686 C  CG  . ASP A 1 212 ? 96.477  64.427 10.658  1.00 43.07  ? 212  ASP A CG  1 
ATOM   1687 O  OD1 . ASP A 1 212 ? 96.046  65.557 10.343  1.00 43.04  ? 212  ASP A OD1 1 
ATOM   1688 O  OD2 . ASP A 1 212 ? 96.371  63.956 11.810  1.00 44.05  ? 212  ASP A OD2 1 
ATOM   1689 N  N   . VAL A 1 213 ? 96.852  61.771 6.808   1.00 36.64  ? 213  VAL A N   1 
ATOM   1690 C  CA  . VAL A 1 213 ? 97.556  60.963 5.816   1.00 35.59  ? 213  VAL A CA  1 
ATOM   1691 C  C   . VAL A 1 213 ? 96.707  60.730 4.569   1.00 32.94  ? 213  VAL A C   1 
ATOM   1692 O  O   . VAL A 1 213 ? 95.488  60.613 4.657   1.00 32.81  ? 213  VAL A O   1 
ATOM   1693 C  CB  . VAL A 1 213 ? 97.966  59.591 6.422   1.00 35.92  ? 213  VAL A CB  1 
ATOM   1694 C  CG1 . VAL A 1 213 ? 98.235  58.575 5.323   1.00 38.68  ? 213  VAL A CG1 1 
ATOM   1695 C  CG2 . VAL A 1 213 ? 99.205  59.764 7.286   1.00 37.17  ? 213  VAL A CG2 1 
ATOM   1696 N  N   . LEU A 1 214 ? 97.358  60.673 3.409   1.00 30.94  ? 214  LEU A N   1 
ATOM   1697 C  CA  . LEU A 1 214 ? 96.659  60.427 2.152   1.00 29.54  ? 214  LEU A CA  1 
ATOM   1698 C  C   . LEU A 1 214 ? 96.508  58.929 1.912   1.00 27.75  ? 214  LEU A C   1 
ATOM   1699 O  O   . LEU A 1 214 ? 95.520  58.478 1.325   1.00 25.96  ? 214  LEU A O   1 
ATOM   1700 C  CB  . LEU A 1 214 ? 97.425  61.034 0.972   1.00 30.50  ? 214  LEU A CB  1 
ATOM   1701 C  CG  . LEU A 1 214 ? 97.260  62.529 0.699   1.00 33.49  ? 214  LEU A CG  1 
ATOM   1702 C  CD1 . LEU A 1 214 ? 98.085  62.911 -0.533  1.00 33.04  ? 214  LEU A CD1 1 
ATOM   1703 C  CD2 . LEU A 1 214 ? 95.783  62.845 0.472   1.00 34.38  ? 214  LEU A CD2 1 
ATOM   1704 N  N   . GLY A 1 215 ? 97.503  58.169 2.361   1.00 25.64  ? 215  GLY A N   1 
ATOM   1705 C  CA  . GLY A 1 215 ? 97.489  56.728 2.179   1.00 24.36  ? 215  GLY A CA  1 
ATOM   1706 C  C   . GLY A 1 215 ? 97.079  55.955 3.418   1.00 25.41  ? 215  GLY A C   1 
ATOM   1707 O  O   . GLY A 1 215 ? 95.993  56.170 3.963   1.00 23.07  ? 215  GLY A O   1 
ATOM   1708 N  N   . TRP A 1 216 ? 97.947  55.052 3.866   1.00 23.57  ? 216  TRP A N   1 
ATOM   1709 C  CA  . TRP A 1 216 ? 97.661  54.241 5.048   1.00 22.84  ? 216  TRP A CA  1 
ATOM   1710 C  C   . TRP A 1 216 ? 98.368  54.765 6.290   1.00 23.33  ? 216  TRP A C   1 
ATOM   1711 O  O   . TRP A 1 216 ? 99.554  55.100 6.248   1.00 23.80  ? 216  TRP A O   1 
ATOM   1712 C  CB  . TRP A 1 216 ? 98.064  52.790 4.797   1.00 22.89  ? 216  TRP A CB  1 
ATOM   1713 C  CG  . TRP A 1 216 ? 97.279  52.162 3.701   1.00 22.04  ? 216  TRP A CG  1 
ATOM   1714 C  CD1 . TRP A 1 216 ? 97.684  51.961 2.414   1.00 22.94  ? 216  TRP A CD1 1 
ATOM   1715 C  CD2 . TRP A 1 216 ? 95.919  51.718 3.770   1.00 22.92  ? 216  TRP A CD2 1 
ATOM   1716 N  NE1 . TRP A 1 216 ? 96.656  51.418 1.673   1.00 22.96  ? 216  TRP A NE1 1 
ATOM   1717 C  CE2 . TRP A 1 216 ? 95.561  51.263 2.482   1.00 22.80  ? 216  TRP A CE2 1 
ATOM   1718 C  CE3 . TRP A 1 216 ? 94.964  51.664 4.798   1.00 24.73  ? 216  TRP A CE3 1 
ATOM   1719 C  CZ2 . TRP A 1 216 ? 94.286  50.761 2.191   1.00 22.37  ? 216  TRP A CZ2 1 
ATOM   1720 C  CZ3 . TRP A 1 216 ? 93.693  51.163 4.508   1.00 22.46  ? 216  TRP A CZ3 1 
ATOM   1721 C  CH2 . TRP A 1 216 ? 93.370  50.721 3.215   1.00 23.64  ? 216  TRP A CH2 1 
ATOM   1722 N  N   . GLY A 1 217 ? 97.632  54.825 7.396   1.00 22.84  ? 217  GLY A N   1 
ATOM   1723 C  CA  . GLY A 1 217 ? 98.192  55.327 8.634   1.00 22.19  ? 217  GLY A CA  1 
ATOM   1724 C  C   . GLY A 1 217 ? 97.982  54.412 9.823   1.00 24.43  ? 217  GLY A C   1 
ATOM   1725 O  O   . GLY A 1 217 ? 97.375  53.343 9.711   1.00 24.52  ? 217  GLY A O   1 
ATOM   1726 N  N   . GLU A 1 218 ? 98.492  54.848 10.970  1.00 24.90  ? 218  GLU A N   1 
ATOM   1727 C  CA  . GLU A 1 218 ? 98.403  54.093 12.206  1.00 25.04  ? 218  GLU A CA  1 
ATOM   1728 C  C   . GLU A 1 218 ? 97.094  54.379 12.947  1.00 26.46  ? 218  GLU A C   1 
ATOM   1729 O  O   . GLU A 1 218 ? 96.679  55.532 13.080  1.00 25.24  ? 218  GLU A O   1 
ATOM   1730 C  CB  . GLU A 1 218 ? 99.622  54.424 13.071  1.00 25.52  ? 218  GLU A CB  1 
ATOM   1731 C  CG  . GLU A 1 218 ? 100.934 53.984 12.420  1.00 28.60  ? 218  GLU A CG  1 
ATOM   1732 C  CD  . GLU A 1 218 ? 102.165 54.421 13.194  1.00 29.87  ? 218  GLU A CD  1 
ATOM   1733 O  OE1 . GLU A 1 218 ? 102.051 54.620 14.417  1.00 33.74  ? 218  GLU A OE1 1 
ATOM   1734 O  OE2 . GLU A 1 218 ? 103.249 54.550 12.583  1.00 25.42  ? 218  GLU A OE2 1 
ATOM   1735 N  N   . ASN A 1 219 ? 96.445  53.318 13.420  1.00 25.84  ? 219  ASN A N   1 
ATOM   1736 C  CA  . ASN A 1 219 ? 95.169  53.449 14.122  1.00 24.97  ? 219  ASN A CA  1 
ATOM   1737 C  C   . ASN A 1 219 ? 95.337  53.398 15.642  1.00 25.97  ? 219  ASN A C   1 
ATOM   1738 O  O   . ASN A 1 219 ? 95.859  52.423 16.188  1.00 25.16  ? 219  ASN A O   1 
ATOM   1739 C  CB  . ASN A 1 219 ? 94.214  52.339 13.665  1.00 24.04  ? 219  ASN A CB  1 
ATOM   1740 C  CG  . ASN A 1 219 ? 92.773  52.621 14.046  1.00 24.21  ? 219  ASN A CG  1 
ATOM   1741 O  OD1 . ASN A 1 219 ? 92.480  52.948 15.196  1.00 27.00  ? 219  ASN A OD1 1 
ATOM   1742 N  ND2 . ASN A 1 219 ? 91.863  52.495 13.083  1.00 23.32  ? 219  ASN A ND2 1 
ATOM   1743 N  N   . ASP A 1 220 ? 94.885  54.449 16.321  1.00 27.26  ? 220  ASP A N   1 
ATOM   1744 C  CA  . ASP A 1 220 ? 94.995  54.530 17.778  1.00 29.39  ? 220  ASP A CA  1 
ATOM   1745 C  C   . ASP A 1 220 ? 94.207  53.461 18.531  1.00 28.62  ? 220  ASP A C   1 
ATOM   1746 O  O   . ASP A 1 220 ? 94.418  53.265 19.724  1.00 27.55  ? 220  ASP A O   1 
ATOM   1747 C  CB  . ASP A 1 220 ? 94.541  55.907 18.278  1.00 31.21  ? 220  ASP A CB  1 
ATOM   1748 C  CG  . ASP A 1 220 ? 95.428  57.034 17.786  1.00 34.43  ? 220  ASP A CG  1 
ATOM   1749 O  OD1 . ASP A 1 220 ? 96.624  56.785 17.537  1.00 37.61  ? 220  ASP A OD1 1 
ATOM   1750 O  OD2 . ASP A 1 220 ? 94.931  58.174 17.665  1.00 38.47  ? 220  ASP A OD2 1 
ATOM   1751 N  N   . ARG A 1 221 ? 93.291  52.780 17.849  1.00 27.42  ? 221  ARG A N   1 
ATOM   1752 C  CA  . ARG A 1 221 ? 92.496  51.745 18.503  1.00 27.45  ? 221  ARG A CA  1 
ATOM   1753 C  C   . ARG A 1 221 ? 93.353  50.561 18.925  1.00 28.81  ? 221  ARG A C   1 
ATOM   1754 O  O   . ARG A 1 221 ? 92.972  49.793 19.811  1.00 30.31  ? 221  ARG A O   1 
ATOM   1755 C  CB  . ARG A 1 221 ? 91.365  51.272 17.579  1.00 25.65  ? 221  ARG A CB  1 
ATOM   1756 C  CG  . ARG A 1 221 ? 90.319  52.346 17.290  1.00 24.67  ? 221  ARG A CG  1 
ATOM   1757 C  CD  . ARG A 1 221 ? 89.235  51.820 16.358  1.00 25.52  ? 221  ARG A CD  1 
ATOM   1758 N  NE  . ARG A 1 221 ? 88.337  52.876 15.898  1.00 24.94  ? 221  ARG A NE  1 
ATOM   1759 C  CZ  . ARG A 1 221 ? 87.259  53.296 16.554  1.00 29.04  ? 221  ARG A CZ  1 
ATOM   1760 N  NH1 . ARG A 1 221 ? 86.925  52.754 17.720  1.00 27.14  ? 221  ARG A NH1 1 
ATOM   1761 N  NH2 . ARG A 1 221 ? 86.504  54.255 16.032  1.00 27.85  ? 221  ARG A NH2 1 
ATOM   1762 N  N   . GLY A 1 222 ? 94.516  50.422 18.296  1.00 29.47  ? 222  GLY A N   1 
ATOM   1763 C  CA  . GLY A 1 222 ? 95.408  49.320 18.621  1.00 28.37  ? 222  GLY A CA  1 
ATOM   1764 C  C   . GLY A 1 222 ? 95.203  48.146 17.688  1.00 29.08  ? 222  GLY A C   1 
ATOM   1765 O  O   . GLY A 1 222 ? 95.814  47.087 17.846  1.00 30.83  ? 222  GLY A O   1 
ATOM   1766 N  N   . VAL A 1 223 ? 94.330  48.336 16.709  1.00 26.44  ? 223  VAL A N   1 
ATOM   1767 C  CA  . VAL A 1 223 ? 94.026  47.306 15.732  1.00 26.06  ? 223  VAL A CA  1 
ATOM   1768 C  C   . VAL A 1 223 ? 93.744  47.969 14.387  1.00 24.29  ? 223  VAL A C   1 
ATOM   1769 O  O   . VAL A 1 223 ? 93.372  49.142 14.336  1.00 22.31  ? 223  VAL A O   1 
ATOM   1770 C  CB  . VAL A 1 223 ? 92.784  46.476 16.174  1.00 28.97  ? 223  VAL A CB  1 
ATOM   1771 C  CG1 . VAL A 1 223 ? 91.610  47.406 16.466  1.00 28.74  ? 223  VAL A CG1 1 
ATOM   1772 C  CG2 . VAL A 1 223 ? 92.406  45.477 15.099  1.00 30.70  ? 223  VAL A CG2 1 
ATOM   1773 N  N   . SER A 1 224 ? 93.944  47.217 13.311  1.00 22.33  ? 224  SER A N   1 
ATOM   1774 C  CA  . SER A 1 224 ? 93.692  47.690 11.953  1.00 22.75  ? 224  SER A CA  1 
ATOM   1775 C  C   . SER A 1 224 ? 94.525  48.915 11.566  1.00 23.54  ? 224  SER A C   1 
ATOM   1776 O  O   . SER A 1 224 ? 95.626  49.102 12.082  1.00 23.52  ? 224  SER A O   1 
ATOM   1777 C  CB  . SER A 1 224 ? 92.198  47.992 11.773  1.00 22.32  ? 224  SER A CB  1 
ATOM   1778 O  OG  . SER A 1 224 ? 91.883  48.160 10.400  1.00 19.12  ? 224  SER A OG  1 
ATOM   1779 N  N   . PHE A 1 225 ? 93.994  49.734 10.655  1.00 22.29  ? 225  PHE A N   1 
ATOM   1780 C  CA  . PHE A 1 225 ? 94.696  50.927 10.167  1.00 22.48  ? 225  PHE A CA  1 
ATOM   1781 C  C   . PHE A 1 225 ? 93.753  52.104 9.918   1.00 22.05  ? 225  PHE A C   1 
ATOM   1782 O  O   . PHE A 1 225 ? 92.548  52.011 10.123  1.00 21.05  ? 225  PHE A O   1 
ATOM   1783 C  CB  . PHE A 1 225 ? 95.385  50.648 8.823   1.00 25.66  ? 225  PHE A CB  1 
ATOM   1784 C  CG  . PHE A 1 225 ? 96.070  49.318 8.737   1.00 26.45  ? 225  PHE A CG  1 
ATOM   1785 C  CD1 . PHE A 1 225 ? 95.353  48.170 8.417   1.00 25.45  ? 225  PHE A CD1 1 
ATOM   1786 C  CD2 . PHE A 1 225 ? 97.437  49.213 8.972   1.00 29.46  ? 225  PHE A CD2 1 
ATOM   1787 C  CE1 . PHE A 1 225 ? 95.988  46.936 8.332   1.00 27.04  ? 225  PHE A CE1 1 
ATOM   1788 C  CE2 . PHE A 1 225 ? 98.083  47.977 8.889   1.00 29.44  ? 225  PHE A CE2 1 
ATOM   1789 C  CZ  . PHE A 1 225 ? 97.355  46.839 8.569   1.00 28.26  ? 225  PHE A CZ  1 
ATOM   1790 N  N   . THR A 1 226 ? 94.331  53.216 9.470   1.00 22.56  ? 226  THR A N   1 
ATOM   1791 C  CA  . THR A 1 226 ? 93.551  54.390 9.103   1.00 22.81  ? 226  THR A CA  1 
ATOM   1792 C  C   . THR A 1 226 ? 93.828  54.559 7.616   1.00 23.13  ? 226  THR A C   1 
ATOM   1793 O  O   . THR A 1 226 ? 94.861  54.094 7.123   1.00 21.05  ? 226  THR A O   1 
ATOM   1794 C  CB  . THR A 1 226 ? 94.008  55.672 9.830   1.00 23.91  ? 226  THR A CB  1 
ATOM   1795 O  OG1 . THR A 1 226 ? 95.380  55.942 9.516   1.00 24.03  ? 226  THR A OG1 1 
ATOM   1796 C  CG2 . THR A 1 226 ? 93.831  55.529 11.331  1.00 22.44  ? 226  THR A CG2 1 
ATOM   1797 N  N   . PHE A 1 227 ? 92.908  55.192 6.894   1.00 22.64  ? 227  PHE A N   1 
ATOM   1798 C  CA  . PHE A 1 227 ? 93.103  55.416 5.464   1.00 22.93  ? 227  PHE A CA  1 
ATOM   1799 C  C   . PHE A 1 227 ? 92.786  56.865 5.086   1.00 24.07  ? 227  PHE A C   1 
ATOM   1800 O  O   . PHE A 1 227 ? 91.884  57.484 5.663   1.00 22.93  ? 227  PHE A O   1 
ATOM   1801 C  CB  . PHE A 1 227 ? 92.243  54.449 4.631   1.00 21.33  ? 227  PHE A CB  1 
ATOM   1802 C  CG  . PHE A 1 227 ? 90.787  54.439 5.008   1.00 20.83  ? 227  PHE A CG  1 
ATOM   1803 C  CD1 . PHE A 1 227 ? 90.340  53.686 6.091   1.00 19.08  ? 227  PHE A CD1 1 
ATOM   1804 C  CD2 . PHE A 1 227 ? 89.860  55.182 4.276   1.00 21.30  ? 227  PHE A CD2 1 
ATOM   1805 C  CE1 . PHE A 1 227 ? 88.991  53.675 6.439   1.00 20.79  ? 227  PHE A CE1 1 
ATOM   1806 C  CE2 . PHE A 1 227 ? 88.508  55.179 4.615   1.00 22.18  ? 227  PHE A CE2 1 
ATOM   1807 C  CZ  . PHE A 1 227 ? 88.072  54.423 5.700   1.00 20.56  ? 227  PHE A CZ  1 
ATOM   1808 N  N   . GLY A 1 228 ? 93.539  57.392 4.120   1.00 22.37  ? 228  GLY A N   1 
ATOM   1809 C  CA  . GLY A 1 228 ? 93.358  58.765 3.674   1.00 22.48  ? 228  GLY A CA  1 
ATOM   1810 C  C   . GLY A 1 228 ? 92.574  58.939 2.386   1.00 22.60  ? 228  GLY A C   1 
ATOM   1811 O  O   . GLY A 1 228 ? 92.080  57.969 1.808   1.00 21.90  ? 228  GLY A O   1 
ATOM   1812 N  N   . ALA A 1 229 ? 92.485  60.184 1.920   1.00 22.38  ? 229  ALA A N   1 
ATOM   1813 C  CA  . ALA A 1 229 ? 91.722  60.508 0.716   1.00 22.69  ? 229  ALA A CA  1 
ATOM   1814 C  C   . ALA A 1 229 ? 92.180  59.832 -0.567  1.00 22.28  ? 229  ALA A C   1 
ATOM   1815 O  O   . ALA A 1 229 ? 91.356  59.541 -1.429  1.00 22.19  ? 229  ALA A O   1 
ATOM   1816 C  CB  . ALA A 1 229 ? 91.681  62.018 0.515   1.00 23.47  ? 229  ALA A CB  1 
ATOM   1817 N  N   . GLU A 1 230 ? 93.479  59.586 -0.710  1.00 22.64  ? 230  GLU A N   1 
ATOM   1818 C  CA  . GLU A 1 230 ? 93.963  58.936 -1.926  1.00 24.87  ? 230  GLU A CA  1 
ATOM   1819 C  C   . GLU A 1 230 ? 93.457  57.494 -1.978  1.00 25.01  ? 230  GLU A C   1 
ATOM   1820 O  O   . GLU A 1 230 ? 93.018  57.014 -3.025  1.00 22.79  ? 230  GLU A O   1 
ATOM   1821 C  CB  . GLU A 1 230 ? 95.493  58.968 -1.988  1.00 25.89  ? 230  GLU A CB  1 
ATOM   1822 C  CG  . GLU A 1 230 ? 96.048  58.453 -3.310  1.00 29.13  ? 230  GLU A CG  1 
ATOM   1823 C  CD  . GLU A 1 230 ? 97.558  58.589 -3.412  1.00 34.01  ? 230  GLU A CD  1 
ATOM   1824 O  OE1 . GLU A 1 230 ? 98.045  59.696 -3.729  1.00 33.90  ? 230  GLU A OE1 1 
ATOM   1825 O  OE2 . GLU A 1 230 ? 98.264  57.588 -3.166  1.00 35.77  ? 230  GLU A OE2 1 
ATOM   1826 N  N   . VAL A 1 231 ? 93.510  56.809 -0.837  1.00 23.96  ? 231  VAL A N   1 
ATOM   1827 C  CA  . VAL A 1 231 ? 93.035  55.435 -0.764  1.00 24.27  ? 231  VAL A CA  1 
ATOM   1828 C  C   . VAL A 1 231 ? 91.565  55.388 -1.155  1.00 22.34  ? 231  VAL A C   1 
ATOM   1829 O  O   . VAL A 1 231 ? 91.163  54.565 -1.969  1.00 23.28  ? 231  VAL A O   1 
ATOM   1830 C  CB  . VAL A 1 231 ? 93.184  54.851 0.662   1.00 24.62  ? 231  VAL A CB  1 
ATOM   1831 C  CG1 . VAL A 1 231 ? 92.413  53.538 0.770   1.00 24.77  ? 231  VAL A CG1 1 
ATOM   1832 C  CG2 . VAL A 1 231 ? 94.656  54.616 0.974   1.00 24.86  ? 231  VAL A CG2 1 
ATOM   1833 N  N   . VAL A 1 232 ? 90.765  56.275 -0.571  1.00 22.48  ? 232  VAL A N   1 
ATOM   1834 C  CA  . VAL A 1 232 ? 89.339  56.311 -0.873  1.00 23.23  ? 232  VAL A CA  1 
ATOM   1835 C  C   . VAL A 1 232 ? 89.078  56.591 -2.356  1.00 24.28  ? 232  VAL A C   1 
ATOM   1836 O  O   . VAL A 1 232 ? 88.245  55.936 -2.980  1.00 24.78  ? 232  VAL A O   1 
ATOM   1837 C  CB  . VAL A 1 232 ? 88.610  57.382 -0.026  1.00 23.34  ? 232  VAL A CB  1 
ATOM   1838 C  CG1 . VAL A 1 232 ? 87.140  57.434 -0.409  1.00 22.62  ? 232  VAL A CG1 1 
ATOM   1839 C  CG2 . VAL A 1 232 ? 88.754  57.058 1.459   1.00 24.60  ? 232  VAL A CG2 1 
ATOM   1840 N  N   . ALA A 1 233 ? 89.795  57.558 -2.920  1.00 24.39  ? 233  ALA A N   1 
ATOM   1841 C  CA  . ALA A 1 233 ? 89.621  57.901 -4.331  1.00 24.97  ? 233  ALA A CA  1 
ATOM   1842 C  C   . ALA A 1 233 ? 89.901  56.708 -5.238  1.00 24.79  ? 233  ALA A C   1 
ATOM   1843 O  O   . ALA A 1 233 ? 89.133  56.430 -6.159  1.00 21.32  ? 233  ALA A O   1 
ATOM   1844 C  CB  . ALA A 1 233 ? 90.527  59.071 -4.699  1.00 24.52  ? 233  ALA A CB  1 
ATOM   1845 N  N   . LYS A 1 234 ? 90.997  55.998 -4.976  1.00 25.25  ? 234  LYS A N   1 
ATOM   1846 C  CA  . LYS A 1 234 ? 91.345  54.831 -5.779  1.00 25.97  ? 234  LYS A CA  1 
ATOM   1847 C  C   . LYS A 1 234 ? 90.241  53.792 -5.685  1.00 26.87  ? 234  LYS A C   1 
ATOM   1848 O  O   . LYS A 1 234 ? 89.870  53.171 -6.678  1.00 27.87  ? 234  LYS A O   1 
ATOM   1849 C  CB  . LYS A 1 234 ? 92.647  54.196 -5.291  1.00 27.20  ? 234  LYS A CB  1 
ATOM   1850 C  CG  . LYS A 1 234 ? 93.898  54.983 -5.581  1.00 29.74  ? 234  LYS A CG  1 
ATOM   1851 C  CD  . LYS A 1 234 ? 95.116  54.171 -5.170  1.00 29.21  ? 234  LYS A CD  1 
ATOM   1852 C  CE  . LYS A 1 234 ? 96.412  54.918 -5.423  1.00 31.73  ? 234  LYS A CE  1 
ATOM   1853 N  NZ  . LYS A 1 234 ? 97.582  54.105 -4.973  1.00 33.18  ? 234  LYS A NZ  1 
ATOM   1854 N  N   . PHE A 1 235 ? 89.723  53.607 -4.477  1.00 26.65  ? 235  PHE A N   1 
ATOM   1855 C  CA  . PHE A 1 235 ? 88.661  52.640 -4.239  1.00 26.57  ? 235  PHE A CA  1 
ATOM   1856 C  C   . PHE A 1 235 ? 87.397  52.976 -5.014  1.00 26.28  ? 235  PHE A C   1 
ATOM   1857 O  O   . PHE A 1 235 ? 86.870  52.143 -5.753  1.00 27.83  ? 235  PHE A O   1 
ATOM   1858 C  CB  . PHE A 1 235 ? 88.332  52.580 -2.744  1.00 26.05  ? 235  PHE A CB  1 
ATOM   1859 C  CG  . PHE A 1 235 ? 87.191  51.662 -2.414  1.00 27.01  ? 235  PHE A CG  1 
ATOM   1860 C  CD1 . PHE A 1 235 ? 87.357  50.279 -2.455  1.00 26.30  ? 235  PHE A CD1 1 
ATOM   1861 C  CD2 . PHE A 1 235 ? 85.944  52.180 -2.080  1.00 25.12  ? 235  PHE A CD2 1 
ATOM   1862 C  CE1 . PHE A 1 235 ? 86.290  49.422 -2.164  1.00 27.24  ? 235  PHE A CE1 1 
ATOM   1863 C  CE2 . PHE A 1 235 ? 84.874  51.336 -1.789  1.00 26.05  ? 235  PHE A CE2 1 
ATOM   1864 C  CZ  . PHE A 1 235 ? 85.047  49.956 -1.831  1.00 26.29  ? 235  PHE A CZ  1 
ATOM   1865 N  N   . LEU A 1 236 ? 86.910  54.199 -4.846  1.00 25.91  ? 236  LEU A N   1 
ATOM   1866 C  CA  . LEU A 1 236 ? 85.690  54.625 -5.516  1.00 28.03  ? 236  LEU A CA  1 
ATOM   1867 C  C   . LEU A 1 236 ? 85.776  54.520 -7.035  1.00 30.43  ? 236  LEU A C   1 
ATOM   1868 O  O   . LEU A 1 236 ? 84.845  54.047 -7.687  1.00 30.19  ? 236  LEU A O   1 
ATOM   1869 C  CB  . LEU A 1 236 ? 85.339  56.058 -5.109  1.00 27.55  ? 236  LEU A CB  1 
ATOM   1870 C  CG  . LEU A 1 236 ? 84.951  56.281 -3.645  1.00 28.08  ? 236  LEU A CG  1 
ATOM   1871 C  CD1 . LEU A 1 236 ? 84.604  57.752 -3.430  1.00 29.59  ? 236  LEU A CD1 1 
ATOM   1872 C  CD2 . LEU A 1 236 ? 83.764  55.388 -3.284  1.00 27.08  ? 236  LEU A CD2 1 
ATOM   1873 N  N   . HIS A 1 237 ? 86.896  54.952 -7.601  1.00 31.76  ? 237  HIS A N   1 
ATOM   1874 C  CA  . HIS A 1 237 ? 87.055  54.890 -9.045  1.00 33.76  ? 237  HIS A CA  1 
ATOM   1875 C  C   . HIS A 1 237 ? 87.173  53.473 -9.587  1.00 32.23  ? 237  HIS A C   1 
ATOM   1876 O  O   . HIS A 1 237 ? 86.569  53.151 -10.607 1.00 32.20  ? 237  HIS A O   1 
ATOM   1877 C  CB  . HIS A 1 237 ? 88.250  55.737 -9.476  1.00 36.23  ? 237  HIS A CB  1 
ATOM   1878 C  CG  . HIS A 1 237 ? 87.994  57.208 -9.381  1.00 41.60  ? 237  HIS A CG  1 
ATOM   1879 N  ND1 . HIS A 1 237 ? 87.852  57.863 -8.175  1.00 43.16  ? 237  HIS A ND1 1 
ATOM   1880 C  CD2 . HIS A 1 237 ? 87.782  58.139 -10.342 1.00 42.70  ? 237  HIS A CD2 1 
ATOM   1881 C  CE1 . HIS A 1 237 ? 87.563  59.132 -8.397  1.00 44.70  ? 237  HIS A CE1 1 
ATOM   1882 N  NE2 . HIS A 1 237 ? 87.513  59.325 -9.704  1.00 44.68  ? 237  HIS A NE2 1 
ATOM   1883 N  N   . LYS A 1 238 ? 87.924  52.619 -8.904  1.00 31.35  ? 238  LYS A N   1 
ATOM   1884 C  CA  . LYS A 1 238 ? 88.077  51.248 -9.368  1.00 33.25  ? 238  LYS A CA  1 
ATOM   1885 C  C   . LYS A 1 238 ? 86.746  50.497 -9.439  1.00 33.46  ? 238  LYS A C   1 
ATOM   1886 O  O   . LYS A 1 238 ? 86.525  49.700 -10.348 1.00 34.70  ? 238  LYS A O   1 
ATOM   1887 C  CB  . LYS A 1 238 ? 89.051  50.481 -8.466  1.00 35.17  ? 238  LYS A CB  1 
ATOM   1888 C  CG  . LYS A 1 238 ? 89.306  49.060 -8.939  1.00 38.18  ? 238  LYS A CG  1 
ATOM   1889 C  CD  . LYS A 1 238 ? 90.386  48.363 -8.133  1.00 40.95  ? 238  LYS A CD  1 
ATOM   1890 C  CE  . LYS A 1 238 ? 90.603  46.941 -8.645  1.00 42.86  ? 238  LYS A CE  1 
ATOM   1891 N  NZ  . LYS A 1 238 ? 91.691  46.231 -7.918  1.00 42.00  ? 238  LYS A NZ  1 
ATOM   1892 N  N   . HIS A 1 239 ? 85.853  50.754 -8.488  1.00 33.59  ? 239  HIS A N   1 
ATOM   1893 C  CA  . HIS A 1 239 ? 84.567  50.065 -8.472  1.00 33.22  ? 239  HIS A CA  1 
ATOM   1894 C  C   . HIS A 1 239 ? 83.402  50.955 -8.887  1.00 32.73  ? 239  HIS A C   1 
ATOM   1895 O  O   . HIS A 1 239 ? 82.245  50.647 -8.613  1.00 33.78  ? 239  HIS A O   1 
ATOM   1896 C  CB  . HIS A 1 239 ? 84.322  49.462 -7.084  1.00 34.93  ? 239  HIS A CB  1 
ATOM   1897 C  CG  . HIS A 1 239 ? 85.448  48.599 -6.605  1.00 34.53  ? 239  HIS A CG  1 
ATOM   1898 N  ND1 . HIS A 1 239 ? 86.517  49.098 -5.892  1.00 37.00  ? 239  HIS A ND1 1 
ATOM   1899 C  CD2 . HIS A 1 239 ? 85.713  47.288 -6.810  1.00 35.75  ? 239  HIS A CD2 1 
ATOM   1900 C  CE1 . HIS A 1 239 ? 87.394  48.133 -5.682  1.00 34.87  ? 239  HIS A CE1 1 
ATOM   1901 N  NE2 . HIS A 1 239 ? 86.931  47.024 -6.230  1.00 37.03  ? 239  HIS A NE2 1 
ATOM   1902 N  N   . ASP A 1 240 ? 83.728  52.055 -9.558  1.00 32.92  ? 240  ASP A N   1 
ATOM   1903 C  CA  . ASP A 1 240 ? 82.746  53.017 -10.054 1.00 33.43  ? 240  ASP A CA  1 
ATOM   1904 C  C   . ASP A 1 240 ? 81.680  53.385 -9.024  1.00 32.90  ? 240  ASP A C   1 
ATOM   1905 O  O   . ASP A 1 240 ? 80.479  53.275 -9.283  1.00 32.10  ? 240  ASP A O   1 
ATOM   1906 C  CB  . ASP A 1 240 ? 82.092  52.469 -11.329 1.00 36.91  ? 240  ASP A CB  1 
ATOM   1907 C  CG  . ASP A 1 240 ? 81.189  53.481 -12.007 1.00 40.29  ? 240  ASP A CG  1 
ATOM   1908 O  OD1 . ASP A 1 240 ? 81.656  54.606 -12.292 1.00 43.20  ? 240  ASP A OD1 1 
ATOM   1909 O  OD2 . ASP A 1 240 ? 80.010  53.151 -12.260 1.00 45.04  ? 240  ASP A OD2 1 
ATOM   1910 N  N   . LEU A 1 241 ? 82.135  53.837 -7.858  1.00 32.16  ? 241  LEU A N   1 
ATOM   1911 C  CA  . LEU A 1 241 ? 81.247  54.228 -6.765  1.00 30.45  ? 241  LEU A CA  1 
ATOM   1912 C  C   . LEU A 1 241 ? 81.372  55.727 -6.519  1.00 30.35  ? 241  LEU A C   1 
ATOM   1913 O  O   . LEU A 1 241 ? 82.345  56.346 -6.941  1.00 31.30  ? 241  LEU A O   1 
ATOM   1914 C  CB  . LEU A 1 241 ? 81.627  53.466 -5.489  1.00 28.88  ? 241  LEU A CB  1 
ATOM   1915 C  CG  . LEU A 1 241 ? 81.534  51.939 -5.531  1.00 26.45  ? 241  LEU A CG  1 
ATOM   1916 C  CD1 . LEU A 1 241 ? 82.293  51.351 -4.357  1.00 27.73  ? 241  LEU A CD1 1 
ATOM   1917 C  CD2 . LEU A 1 241 ? 80.070  51.505 -5.500  1.00 26.89  ? 241  LEU A CD2 1 
ATOM   1918 N  N   . ASP A 1 242 ? 80.396  56.309 -5.829  1.00 29.23  ? 242  ASP A N   1 
ATOM   1919 C  CA  . ASP A 1 242 ? 80.428  57.740 -5.545  1.00 29.43  ? 242  ASP A CA  1 
ATOM   1920 C  C   . ASP A 1 242 ? 80.673  58.078 -4.087  1.00 28.09  ? 242  ASP A C   1 
ATOM   1921 O  O   . ASP A 1 242 ? 81.158  59.166 -3.774  1.00 27.22  ? 242  ASP A O   1 
ATOM   1922 C  CB  . ASP A 1 242 ? 79.108  58.412 -5.938  1.00 32.29  ? 242  ASP A CB  1 
ATOM   1923 C  CG  . ASP A 1 242 ? 78.838  58.361 -7.422  1.00 34.85  ? 242  ASP A CG  1 
ATOM   1924 O  OD1 . ASP A 1 242 ? 79.808  58.323 -8.207  1.00 35.09  ? 242  ASP A OD1 1 
ATOM   1925 O  OD2 . ASP A 1 242 ? 77.645  58.382 -7.795  1.00 37.33  ? 242  ASP A OD2 1 
ATOM   1926 N  N   . LEU A 1 243 ? 80.339  57.155 -3.189  1.00 25.91  ? 243  LEU A N   1 
ATOM   1927 C  CA  . LEU A 1 243 ? 80.479  57.445 -1.773  1.00 25.27  ? 243  LEU A CA  1 
ATOM   1928 C  C   . LEU A 1 243 ? 80.652  56.227 -0.878  1.00 23.77  ? 243  LEU A C   1 
ATOM   1929 O  O   . LEU A 1 243 ? 80.165  55.144 -1.183  1.00 23.54  ? 243  LEU A O   1 
ATOM   1930 C  CB  . LEU A 1 243 ? 79.230  58.204 -1.303  1.00 24.95  ? 243  LEU A CB  1 
ATOM   1931 C  CG  . LEU A 1 243 ? 79.107  58.603 0.169   1.00 26.56  ? 243  LEU A CG  1 
ATOM   1932 C  CD1 . LEU A 1 243 ? 80.010  59.784 0.440   1.00 28.29  ? 243  LEU A CD1 1 
ATOM   1933 C  CD2 . LEU A 1 243 ? 77.660  58.963 0.497   1.00 26.47  ? 243  LEU A CD2 1 
ATOM   1934 N  N   . ILE A 1 244 ? 81.369  56.418 0.223   1.00 24.15  ? 244  ILE A N   1 
ATOM   1935 C  CA  . ILE A 1 244 ? 81.525  55.360 1.209   1.00 22.23  ? 244  ILE A CA  1 
ATOM   1936 C  C   . ILE A 1 244 ? 80.708  55.843 2.402   1.00 23.89  ? 244  ILE A C   1 
ATOM   1937 O  O   . ILE A 1 244 ? 80.853  56.991 2.834   1.00 23.95  ? 244  ILE A O   1 
ATOM   1938 C  CB  . ILE A 1 244 ? 82.984  55.169 1.691   1.00 22.63  ? 244  ILE A CB  1 
ATOM   1939 C  CG1 . ILE A 1 244 ? 83.836  54.553 0.578   1.00 21.02  ? 244  ILE A CG1 1 
ATOM   1940 C  CG2 . ILE A 1 244 ? 82.996  54.257 2.936   1.00 19.59  ? 244  ILE A CG2 1 
ATOM   1941 C  CD1 . ILE A 1 244 ? 85.282  54.309 0.975   1.00 21.43  ? 244  ILE A CD1 1 
ATOM   1942 N  N   . CYS A 1 245 ? 79.836  54.979 2.911   1.00 22.53  ? 245  CYS A N   1 
ATOM   1943 C  CA  . CYS A 1 245 ? 79.020  55.310 4.073   1.00 22.32  ? 245  CYS A CA  1 
ATOM   1944 C  C   . CYS A 1 245 ? 79.369  54.293 5.157   1.00 20.03  ? 245  CYS A C   1 
ATOM   1945 O  O   . CYS A 1 245 ? 79.184  53.094 4.971   1.00 21.23  ? 245  CYS A O   1 
ATOM   1946 C  CB  . CYS A 1 245 ? 77.532  55.209 3.735   1.00 21.58  ? 245  CYS A CB  1 
ATOM   1947 S  SG  . CYS A 1 245 ? 76.420  55.672 5.090   1.00 26.51  ? 245  CYS A SG  1 
ATOM   1948 N  N   . ARG A 1 246 ? 79.889  54.775 6.277   1.00 19.42  ? 246  ARG A N   1 
ATOM   1949 C  CA  . ARG A 1 246 ? 80.263  53.897 7.375   1.00 19.21  ? 246  ARG A CA  1 
ATOM   1950 C  C   . ARG A 1 246 ? 79.839  54.510 8.712   1.00 19.88  ? 246  ARG A C   1 
ATOM   1951 O  O   . ARG A 1 246 ? 79.198  55.558 8.737   1.00 20.74  ? 246  ARG A O   1 
ATOM   1952 C  CB  . ARG A 1 246 ? 81.777  53.622 7.324   1.00 18.10  ? 246  ARG A CB  1 
ATOM   1953 C  CG  . ARG A 1 246 ? 82.646  54.866 7.119   1.00 19.13  ? 246  ARG A CG  1 
ATOM   1954 C  CD  . ARG A 1 246 ? 82.961  55.578 8.432   1.00 19.02  ? 246  ARG A CD  1 
ATOM   1955 N  NE  . ARG A 1 246 ? 83.892  54.785 9.232   1.00 19.92  ? 246  ARG A NE  1 
ATOM   1956 C  CZ  . ARG A 1 246 ? 84.599  55.250 10.254  1.00 20.18  ? 246  ARG A CZ  1 
ATOM   1957 N  NH1 . ARG A 1 246 ? 84.484  56.519 10.620  1.00 21.75  ? 246  ARG A NH1 1 
ATOM   1958 N  NH2 . ARG A 1 246 ? 85.444  54.444 10.896  1.00 19.10  ? 246  ARG A NH2 1 
ATOM   1959 N  N   . ALA A 1 247 ? 80.167  53.848 9.818   1.00 21.45  ? 247  ALA A N   1 
ATOM   1960 C  CA  . ALA A 1 247 ? 79.791  54.350 11.144  1.00 21.80  ? 247  ALA A CA  1 
ATOM   1961 C  C   . ALA A 1 247 ? 81.029  54.225 12.022  1.00 22.74  ? 247  ALA A C   1 
ATOM   1962 O  O   . ALA A 1 247 ? 82.062  54.830 11.723  1.00 21.34  ? 247  ALA A O   1 
ATOM   1963 C  CB  . ALA A 1 247 ? 78.647  53.506 11.705  1.00 22.52  ? 247  ALA A CB  1 
ATOM   1964 N  N   . HIS A 1 248 ? 80.904  53.481 13.122  1.00 22.39  ? 248  HIS A N   1 
ATOM   1965 C  CA  . HIS A 1 248 ? 82.044  53.177 13.991  1.00 24.36  ? 248  HIS A CA  1 
ATOM   1966 C  C   . HIS A 1 248 ? 82.634  54.315 14.838  1.00 26.13  ? 248  HIS A C   1 
ATOM   1967 O  O   . HIS A 1 248 ? 83.096  54.080 15.959  1.00 27.35  ? 248  HIS A O   1 
ATOM   1968 C  CB  . HIS A 1 248 ? 83.118  52.549 13.089  1.00 19.43  ? 248  HIS A CB  1 
ATOM   1969 C  CG  . HIS A 1 248 ? 84.256  51.899 13.810  1.00 20.49  ? 248  HIS A CG  1 
ATOM   1970 N  ND1 . HIS A 1 248 ? 84.076  51.012 14.848  1.00 19.05  ? 248  HIS A ND1 1 
ATOM   1971 C  CD2 . HIS A 1 248 ? 85.586  51.905 13.547  1.00 18.98  ? 248  HIS A CD2 1 
ATOM   1972 C  CE1 . HIS A 1 248 ? 85.242  50.492 15.189  1.00 20.60  ? 248  HIS A CE1 1 
ATOM   1973 N  NE2 . HIS A 1 248 ? 86.176  51.016 14.414  1.00 21.39  ? 248  HIS A NE2 1 
ATOM   1974 N  N   . GLN A 1 249 ? 82.627  55.534 14.314  1.00 27.52  ? 249  GLN A N   1 
ATOM   1975 C  CA  . GLN A 1 249 ? 83.174  56.671 15.052  1.00 29.43  ? 249  GLN A CA  1 
ATOM   1976 C  C   . GLN A 1 249 ? 82.130  57.658 15.561  1.00 29.93  ? 249  GLN A C   1 
ATOM   1977 O  O   . GLN A 1 249 ? 81.257  58.105 14.816  1.00 27.80  ? 249  GLN A O   1 
ATOM   1978 C  CB  . GLN A 1 249 ? 84.179  57.435 14.189  1.00 32.27  ? 249  GLN A CB  1 
ATOM   1979 C  CG  . GLN A 1 249 ? 85.545  56.795 14.100  1.00 36.21  ? 249  GLN A CG  1 
ATOM   1980 C  CD  . GLN A 1 249 ? 86.529  57.651 13.326  1.00 36.20  ? 249  GLN A CD  1 
ATOM   1981 O  OE1 . GLN A 1 249 ? 86.329  57.932 12.146  1.00 33.82  ? 249  GLN A OE1 1 
ATOM   1982 N  NE2 . GLN A 1 249 ? 87.597  58.076 13.994  1.00 40.68  ? 249  GLN A NE2 1 
ATOM   1983 N  N   . VAL A 1 250 ? 82.238  58.008 16.837  1.00 31.57  ? 250  VAL A N   1 
ATOM   1984 C  CA  . VAL A 1 250 ? 81.320  58.965 17.434  1.00 33.11  ? 250  VAL A CA  1 
ATOM   1985 C  C   . VAL A 1 250 ? 81.628  60.340 16.845  1.00 33.37  ? 250  VAL A C   1 
ATOM   1986 O  O   . VAL A 1 250 ? 82.767  60.800 16.907  1.00 32.61  ? 250  VAL A O   1 
ATOM   1987 C  CB  . VAL A 1 250 ? 81.506  59.055 18.965  1.00 34.94  ? 250  VAL A CB  1 
ATOM   1988 C  CG1 . VAL A 1 250 ? 80.419  59.936 19.569  1.00 34.18  ? 250  VAL A CG1 1 
ATOM   1989 C  CG2 . VAL A 1 250 ? 81.484  57.663 19.580  1.00 37.86  ? 250  VAL A CG2 1 
ATOM   1990 N  N   . VAL A 1 251 ? 80.619  60.982 16.267  1.00 33.09  ? 251  VAL A N   1 
ATOM   1991 C  CA  . VAL A 1 251 ? 80.782  62.313 15.693  1.00 35.22  ? 251  VAL A CA  1 
ATOM   1992 C  C   . VAL A 1 251 ? 79.785  63.261 16.357  1.00 36.39  ? 251  VAL A C   1 
ATOM   1993 O  O   . VAL A 1 251 ? 78.611  62.928 16.528  1.00 34.53  ? 251  VAL A O   1 
ATOM   1994 C  CB  . VAL A 1 251 ? 80.563  62.315 14.163  1.00 35.49  ? 251  VAL A CB  1 
ATOM   1995 C  CG1 . VAL A 1 251 ? 81.729  61.625 13.475  1.00 35.99  ? 251  VAL A CG1 1 
ATOM   1996 C  CG2 . VAL A 1 251 ? 79.261  61.623 13.816  1.00 36.48  ? 251  VAL A CG2 1 
ATOM   1997 N  N   . GLU A 1 252 ? 80.271  64.441 16.727  1.00 37.64  ? 252  GLU A N   1 
ATOM   1998 C  CA  . GLU A 1 252 ? 79.469  65.450 17.413  1.00 38.70  ? 252  GLU A CA  1 
ATOM   1999 C  C   . GLU A 1 252 ? 78.092  65.757 16.831  1.00 37.77  ? 252  GLU A C   1 
ATOM   2000 O  O   . GLU A 1 252 ? 77.134  65.947 17.584  1.00 38.50  ? 252  GLU A O   1 
ATOM   2001 C  CB  . GLU A 1 252 ? 80.276  66.746 17.527  1.00 41.45  ? 252  GLU A CB  1 
ATOM   2002 C  CG  . GLU A 1 252 ? 79.551  67.879 18.226  1.00 46.45  ? 252  GLU A CG  1 
ATOM   2003 C  CD  . GLU A 1 252 ? 80.392  69.139 18.299  1.00 49.75  ? 252  GLU A CD  1 
ATOM   2004 O  OE1 . GLU A 1 252 ? 80.743  69.683 17.229  1.00 50.82  ? 252  GLU A OE1 1 
ATOM   2005 O  OE2 . GLU A 1 252 ? 80.705  69.582 19.426  1.00 52.08  ? 252  GLU A OE2 1 
ATOM   2006 N  N   . ASP A 1 253 ? 77.979  65.809 15.507  1.00 36.88  ? 253  ASP A N   1 
ATOM   2007 C  CA  . ASP A 1 253 ? 76.696  66.117 14.875  1.00 35.72  ? 253  ASP A CA  1 
ATOM   2008 C  C   . ASP A 1 253 ? 75.882  64.920 14.381  1.00 33.73  ? 253  ASP A C   1 
ATOM   2009 O  O   . ASP A 1 253 ? 74.865  65.098 13.708  1.00 32.02  ? 253  ASP A O   1 
ATOM   2010 C  CB  . ASP A 1 253 ? 76.906  67.087 13.706  1.00 40.21  ? 253  ASP A CB  1 
ATOM   2011 C  CG  . ASP A 1 253 ? 77.358  68.462 14.164  1.00 43.68  ? 253  ASP A CG  1 
ATOM   2012 O  OD1 . ASP A 1 253 ? 76.656  69.069 15.001  1.00 45.07  ? 253  ASP A OD1 1 
ATOM   2013 O  OD2 . ASP A 1 253 ? 78.412  68.935 13.686  1.00 45.35  ? 253  ASP A OD2 1 
ATOM   2014 N  N   . GLY A 1 254 ? 76.315  63.707 14.709  1.00 31.47  ? 254  GLY A N   1 
ATOM   2015 C  CA  . GLY A 1 254 ? 75.580  62.534 14.263  1.00 31.17  ? 254  GLY A CA  1 
ATOM   2016 C  C   . GLY A 1 254 ? 76.081  62.022 12.925  1.00 30.15  ? 254  GLY A C   1 
ATOM   2017 O  O   . GLY A 1 254 ? 76.037  60.823 12.646  1.00 29.48  ? 254  GLY A O   1 
ATOM   2018 N  N   . TYR A 1 255 ? 76.530  62.940 12.079  1.00 30.28  ? 255  TYR A N   1 
ATOM   2019 C  CA  . TYR A 1 255 ? 77.075  62.573 10.780  1.00 30.25  ? 255  TYR A CA  1 
ATOM   2020 C  C   . TYR A 1 255 ? 78.219  63.525 10.471  1.00 30.11  ? 255  TYR A C   1 
ATOM   2021 O  O   . TYR A 1 255 ? 78.235  64.665 10.942  1.00 29.74  ? 255  TYR A O   1 
ATOM   2022 C  CB  . TYR A 1 255 ? 76.012  62.645 9.676   1.00 31.60  ? 255  TYR A CB  1 
ATOM   2023 C  CG  . TYR A 1 255 ? 75.643  64.041 9.226   1.00 36.81  ? 255  TYR A CG  1 
ATOM   2024 C  CD1 . TYR A 1 255 ? 74.797  64.844 9.992   1.00 37.85  ? 255  TYR A CD1 1 
ATOM   2025 C  CD2 . TYR A 1 255 ? 76.140  64.560 8.026   1.00 38.28  ? 255  TYR A CD2 1 
ATOM   2026 C  CE1 . TYR A 1 255 ? 74.451  66.131 9.575   1.00 39.97  ? 255  TYR A CE1 1 
ATOM   2027 C  CE2 . TYR A 1 255 ? 75.801  65.846 7.600   1.00 40.08  ? 255  TYR A CE2 1 
ATOM   2028 C  CZ  . TYR A 1 255 ? 74.956  66.623 8.379   1.00 41.16  ? 255  TYR A CZ  1 
ATOM   2029 O  OH  . TYR A 1 255 ? 74.610  67.889 7.963   1.00 44.35  ? 255  TYR A OH  1 
ATOM   2030 N  N   . GLU A 1 256 ? 79.187  63.053 9.695   1.00 29.67  ? 256  GLU A N   1 
ATOM   2031 C  CA  . GLU A 1 256 ? 80.330  63.886 9.347   1.00 29.95  ? 256  GLU A CA  1 
ATOM   2032 C  C   . GLU A 1 256 ? 81.036  63.338 8.116   1.00 29.95  ? 256  GLU A C   1 
ATOM   2033 O  O   . GLU A 1 256 ? 81.228  62.129 7.988   1.00 28.28  ? 256  GLU A O   1 
ATOM   2034 C  CB  . GLU A 1 256 ? 81.308  63.947 10.521  1.00 30.86  ? 256  GLU A CB  1 
ATOM   2035 C  CG  . GLU A 1 256 ? 82.366  65.035 10.393  1.00 36.73  ? 256  GLU A CG  1 
ATOM   2036 C  CD  . GLU A 1 256 ? 83.250  65.139 11.623  1.00 39.35  ? 256  GLU A CD  1 
ATOM   2037 O  OE1 . GLU A 1 256 ? 82.704  65.220 12.744  1.00 41.21  ? 256  GLU A OE1 1 
ATOM   2038 O  OE2 . GLU A 1 256 ? 84.491  65.150 11.472  1.00 40.77  ? 256  GLU A OE2 1 
ATOM   2039 N  N   . PHE A 1 257 ? 81.407  64.237 7.208   1.00 28.99  ? 257  PHE A N   1 
ATOM   2040 C  CA  . PHE A 1 257 ? 82.102  63.853 5.987   1.00 28.10  ? 257  PHE A CA  1 
ATOM   2041 C  C   . PHE A 1 257 ? 83.604  63.825 6.221   1.00 26.66  ? 257  PHE A C   1 
ATOM   2042 O  O   . PHE A 1 257 ? 84.133  64.596 7.021   1.00 26.26  ? 257  PHE A O   1 
ATOM   2043 C  CB  . PHE A 1 257 ? 81.771  64.839 4.863   1.00 29.63  ? 257  PHE A CB  1 
ATOM   2044 C  CG  . PHE A 1 257 ? 80.382  64.688 4.321   1.00 31.11  ? 257  PHE A CG  1 
ATOM   2045 C  CD1 . PHE A 1 257 ? 80.073  63.648 3.453   1.00 31.56  ? 257  PHE A CD1 1 
ATOM   2046 C  CD2 . PHE A 1 257 ? 79.372  65.565 4.707   1.00 33.07  ? 257  PHE A CD2 1 
ATOM   2047 C  CE1 . PHE A 1 257 ? 78.779  63.477 2.977   1.00 33.95  ? 257  PHE A CE1 1 
ATOM   2048 C  CE2 . PHE A 1 257 ? 78.073  65.404 4.237   1.00 34.04  ? 257  PHE A CE2 1 
ATOM   2049 C  CZ  . PHE A 1 257 ? 77.774  64.358 3.372   1.00 34.51  ? 257  PHE A CZ  1 
ATOM   2050 N  N   . PHE A 1 258 ? 84.282  62.913 5.532   1.00 26.19  ? 258  PHE A N   1 
ATOM   2051 C  CA  . PHE A 1 258 ? 85.732  62.776 5.629   1.00 26.31  ? 258  PHE A CA  1 
ATOM   2052 C  C   . PHE A 1 258 ? 86.280  62.551 4.227   1.00 24.83  ? 258  PHE A C   1 
ATOM   2053 O  O   . PHE A 1 258 ? 85.522  62.302 3.296   1.00 22.46  ? 258  PHE A O   1 
ATOM   2054 C  CB  . PHE A 1 258 ? 86.127  61.573 6.501   1.00 28.10  ? 258  PHE A CB  1 
ATOM   2055 C  CG  . PHE A 1 258 ? 85.746  61.709 7.956   1.00 31.16  ? 258  PHE A CG  1 
ATOM   2056 C  CD1 . PHE A 1 258 ? 84.449  61.434 8.382   1.00 32.74  ? 258  PHE A CD1 1 
ATOM   2057 C  CD2 . PHE A 1 258 ? 86.691  62.105 8.900   1.00 34.10  ? 258  PHE A CD2 1 
ATOM   2058 C  CE1 . PHE A 1 258 ? 84.095  61.549 9.730   1.00 33.16  ? 258  PHE A CE1 1 
ATOM   2059 C  CE2 . PHE A 1 258 ? 86.348  62.225 10.254  1.00 37.14  ? 258  PHE A CE2 1 
ATOM   2060 C  CZ  . PHE A 1 258 ? 85.046  61.945 10.668  1.00 35.41  ? 258  PHE A CZ  1 
ATOM   2061 N  N   . ALA A 1 259 ? 87.597  62.638 4.085   1.00 26.64  ? 259  ALA A N   1 
ATOM   2062 C  CA  . ALA A 1 259 ? 88.242  62.409 2.796   1.00 27.60  ? 259  ALA A CA  1 
ATOM   2063 C  C   . ALA A 1 259 ? 87.646  63.271 1.686   1.00 27.72  ? 259  ALA A C   1 
ATOM   2064 O  O   . ALA A 1 259 ? 87.305  62.771 0.614   1.00 25.46  ? 259  ALA A O   1 
ATOM   2065 C  CB  . ALA A 1 259 ? 88.129  60.938 2.431   1.00 28.59  ? 259  ALA A CB  1 
ATOM   2066 N  N   . LYS A 1 260 ? 87.535  64.570 1.946   1.00 26.72  ? 260  LYS A N   1 
ATOM   2067 C  CA  . LYS A 1 260 ? 86.975  65.507 0.975   1.00 28.67  ? 260  LYS A CA  1 
ATOM   2068 C  C   . LYS A 1 260 ? 85.585  65.084 0.508   1.00 28.69  ? 260  LYS A C   1 
ATOM   2069 O  O   . LYS A 1 260 ? 85.300  65.052 -0.689  1.00 29.28  ? 260  LYS A O   1 
ATOM   2070 C  CB  . LYS A 1 260 ? 87.904  65.643 -0.236  1.00 28.82  ? 260  LYS A CB  1 
ATOM   2071 C  CG  . LYS A 1 260 ? 89.268  66.246 0.081   1.00 32.39  ? 260  LYS A CG  1 
ATOM   2072 C  CD  . LYS A 1 260 ? 90.204  65.234 0.718   1.00 31.04  ? 260  LYS A CD  1 
ATOM   2073 C  CE  . LYS A 1 260 ? 91.567  65.842 1.039   1.00 31.42  ? 260  LYS A CE  1 
ATOM   2074 N  NZ  . LYS A 1 260 ? 91.550  66.797 2.184   1.00 33.77  ? 260  LYS A NZ  1 
ATOM   2075 N  N   . ARG A 1 261 ? 84.730  64.750 1.469   1.00 28.97  ? 261  ARG A N   1 
ATOM   2076 C  CA  . ARG A 1 261 ? 83.359  64.329 1.204   1.00 28.01  ? 261  ARG A CA  1 
ATOM   2077 C  C   . ARG A 1 261 ? 83.185  63.058 0.375   1.00 26.57  ? 261  ARG A C   1 
ATOM   2078 O  O   . ARG A 1 261 ? 82.109  62.812 -0.165  1.00 26.84  ? 261  ARG A O   1 
ATOM   2079 C  CB  . ARG A 1 261 ? 82.569  65.482 0.570   1.00 31.04  ? 261  ARG A CB  1 
ATOM   2080 C  CG  . ARG A 1 261 ? 82.438  66.671 1.505   1.00 33.92  ? 261  ARG A CG  1 
ATOM   2081 C  CD  . ARG A 1 261 ? 81.538  67.757 0.950   1.00 36.86  ? 261  ARG A CD  1 
ATOM   2082 N  NE  . ARG A 1 261 ? 81.528  68.923 1.827   1.00 38.67  ? 261  ARG A NE  1 
ATOM   2083 C  CZ  . ARG A 1 261 ? 80.882  70.056 1.564   1.00 39.32  ? 261  ARG A CZ  1 
ATOM   2084 N  NH1 . ARG A 1 261 ? 80.183  70.181 0.444   1.00 37.59  ? 261  ARG A NH1 1 
ATOM   2085 N  NH2 . ARG A 1 261 ? 80.945  71.068 2.417   1.00 39.56  ? 261  ARG A NH2 1 
ATOM   2086 N  N   . GLN A 1 262 ? 84.227  62.238 0.281   1.00 24.22  ? 262  GLN A N   1 
ATOM   2087 C  CA  . GLN A 1 262 ? 84.110  60.990 -0.471  1.00 24.19  ? 262  GLN A CA  1 
ATOM   2088 C  C   . GLN A 1 262 ? 83.581  59.932 0.493   1.00 21.82  ? 262  GLN A C   1 
ATOM   2089 O  O   . GLN A 1 262 ? 83.226  58.823 0.090   1.00 20.24  ? 262  GLN A O   1 
ATOM   2090 C  CB  . GLN A 1 262 ? 85.466  60.524 -1.002  1.00 23.01  ? 262  GLN A CB  1 
ATOM   2091 C  CG  . GLN A 1 262 ? 86.182  61.492 -1.934  1.00 27.56  ? 262  GLN A CG  1 
ATOM   2092 C  CD  . GLN A 1 262 ? 87.532  60.950 -2.366  1.00 24.53  ? 262  GLN A CD  1 
ATOM   2093 O  OE1 . GLN A 1 262 ? 87.658  60.336 -3.426  1.00 28.12  ? 262  GLN A OE1 1 
ATOM   2094 N  NE2 . GLN A 1 262 ? 88.546  61.154 -1.533  1.00 22.16  ? 262  GLN A NE2 1 
ATOM   2095 N  N   . LEU A 1 263 ? 83.536  60.297 1.770   1.00 22.55  ? 263  LEU A N   1 
ATOM   2096 C  CA  . LEU A 1 263 ? 83.066  59.399 2.814   1.00 22.78  ? 263  LEU A CA  1 
ATOM   2097 C  C   . LEU A 1 263 ? 82.230  60.129 3.860   1.00 23.55  ? 263  LEU A C   1 
ATOM   2098 O  O   . LEU A 1 263 ? 82.484  61.288 4.175   1.00 23.31  ? 263  LEU A O   1 
ATOM   2099 C  CB  . LEU A 1 263 ? 84.269  58.728 3.495   1.00 22.38  ? 263  LEU A CB  1 
ATOM   2100 C  CG  . LEU A 1 263 ? 84.010  57.770 4.671   1.00 22.21  ? 263  LEU A CG  1 
ATOM   2101 C  CD1 . LEU A 1 263 ? 85.186  56.803 4.795   1.00 21.10  ? 263  LEU A CD1 1 
ATOM   2102 C  CD2 . LEU A 1 263 ? 83.812  58.556 5.974   1.00 21.70  ? 263  LEU A CD2 1 
ATOM   2103 N  N   . VAL A 1 264 ? 81.227  59.436 4.391   1.00 23.37  ? 264  VAL A N   1 
ATOM   2104 C  CA  . VAL A 1 264 ? 80.385  59.998 5.436   1.00 22.63  ? 264  VAL A CA  1 
ATOM   2105 C  C   . VAL A 1 264 ? 80.305  58.961 6.557   1.00 23.94  ? 264  VAL A C   1 
ATOM   2106 O  O   . VAL A 1 264 ? 80.161  57.762 6.293   1.00 22.77  ? 264  VAL A O   1 
ATOM   2107 C  CB  . VAL A 1 264 ? 78.955  60.305 4.932   1.00 24.09  ? 264  VAL A CB  1 
ATOM   2108 C  CG1 . VAL A 1 264 ? 78.227  59.018 4.584   1.00 24.84  ? 264  VAL A CG1 1 
ATOM   2109 C  CG2 . VAL A 1 264 ? 78.184  61.074 6.003   1.00 24.73  ? 264  VAL A CG2 1 
ATOM   2110 N  N   . THR A 1 265 ? 80.443  59.430 7.794   1.00 24.20  ? 265  THR A N   1 
ATOM   2111 C  CA  . THR A 1 265 ? 80.365  58.579 8.974   1.00 24.82  ? 265  THR A CA  1 
ATOM   2112 C  C   . THR A 1 265 ? 79.030  58.892 9.646   1.00 25.01  ? 265  THR A C   1 
ATOM   2113 O  O   . THR A 1 265 ? 78.661  60.061 9.777   1.00 23.92  ? 265  THR A O   1 
ATOM   2114 C  CB  . THR A 1 265 ? 81.484  58.886 9.992   1.00 25.76  ? 265  THR A CB  1 
ATOM   2115 O  OG1 . THR A 1 265 ? 82.770  58.698 9.386   1.00 25.60  ? 265  THR A OG1 1 
ATOM   2116 C  CG2 . THR A 1 265 ? 81.365  57.960 11.199  1.00 25.73  ? 265  THR A CG2 1 
ATOM   2117 N  N   . LEU A 1 266 ? 78.308  57.850 10.048  1.00 23.12  ? 266  LEU A N   1 
ATOM   2118 C  CA  . LEU A 1 266 ? 77.019  58.005 10.720  1.00 24.16  ? 266  LEU A CA  1 
ATOM   2119 C  C   . LEU A 1 266 ? 77.078  57.382 12.109  1.00 23.83  ? 266  LEU A C   1 
ATOM   2120 O  O   . LEU A 1 266 ? 77.594  56.280 12.277  1.00 20.89  ? 266  LEU A O   1 
ATOM   2121 C  CB  . LEU A 1 266 ? 75.902  57.313 9.932   1.00 24.31  ? 266  LEU A CB  1 
ATOM   2122 C  CG  . LEU A 1 266 ? 75.571  57.751 8.508   1.00 26.55  ? 266  LEU A CG  1 
ATOM   2123 C  CD1 . LEU A 1 266 ? 74.485  56.843 7.947   1.00 25.71  ? 266  LEU A CD1 1 
ATOM   2124 C  CD2 . LEU A 1 266 ? 75.110  59.203 8.509   1.00 28.56  ? 266  LEU A CD2 1 
ATOM   2125 N  N   . PHE A 1 267 ? 76.547  58.095 13.097  1.00 23.32  ? 267  PHE A N   1 
ATOM   2126 C  CA  . PHE A 1 267 ? 76.502  57.614 14.476  1.00 24.83  ? 267  PHE A CA  1 
ATOM   2127 C  C   . PHE A 1 267 ? 75.083  57.972 14.911  1.00 26.21  ? 267  PHE A C   1 
ATOM   2128 O  O   . PHE A 1 267 ? 74.687  59.140 14.861  1.00 26.49  ? 267  PHE A O   1 
ATOM   2129 C  CB  . PHE A 1 267 ? 77.529  58.347 15.339  1.00 25.35  ? 267  PHE A CB  1 
ATOM   2130 C  CG  . PHE A 1 267 ? 77.821  57.667 16.649  1.00 26.83  ? 267  PHE A CG  1 
ATOM   2131 C  CD1 . PHE A 1 267 ? 78.664  56.558 16.699  1.00 25.58  ? 267  PHE A CD1 1 
ATOM   2132 C  CD2 . PHE A 1 267 ? 77.257  58.138 17.835  1.00 27.39  ? 267  PHE A CD2 1 
ATOM   2133 C  CE1 . PHE A 1 267 ? 78.947  55.923 17.910  1.00 27.11  ? 267  PHE A CE1 1 
ATOM   2134 C  CE2 . PHE A 1 267 ? 77.530  57.511 19.058  1.00 25.71  ? 267  PHE A CE2 1 
ATOM   2135 C  CZ  . PHE A 1 267 ? 78.378  56.401 19.095  1.00 27.34  ? 267  PHE A CZ  1 
ATOM   2136 N  N   . SER A 1 268 ? 74.312  56.974 15.327  1.00 25.72  ? 268  SER A N   1 
ATOM   2137 C  CA  . SER A 1 268 ? 72.925  57.224 15.688  1.00 26.75  ? 268  SER A CA  1 
ATOM   2138 C  C   . SER A 1 268 ? 72.560  57.191 17.165  1.00 27.52  ? 268  SER A C   1 
ATOM   2139 O  O   . SER A 1 268 ? 71.382  57.213 17.507  1.00 30.09  ? 268  SER A O   1 
ATOM   2140 C  CB  . SER A 1 268 ? 72.032  56.253 14.914  1.00 26.40  ? 268  SER A CB  1 
ATOM   2141 O  OG  . SER A 1 268 ? 72.276  56.353 13.520  1.00 25.00  ? 268  SER A OG  1 
ATOM   2142 N  N   . ALA A 1 269 ? 73.556  57.152 18.039  1.00 29.89  ? 269  ALA A N   1 
ATOM   2143 C  CA  . ALA A 1 269 ? 73.294  57.119 19.473  1.00 29.44  ? 269  ALA A CA  1 
ATOM   2144 C  C   . ALA A 1 269 ? 73.618  58.455 20.137  1.00 29.80  ? 269  ALA A C   1 
ATOM   2145 O  O   . ALA A 1 269 ? 74.776  58.737 20.450  1.00 28.88  ? 269  ALA A O   1 
ATOM   2146 C  CB  . ALA A 1 269 ? 74.111  56.015 20.122  1.00 30.22  ? 269  ALA A CB  1 
ATOM   2147 N  N   . PRO A 1 270 ? 72.598  59.298 20.359  1.00 32.38  ? 270  PRO A N   1 
ATOM   2148 C  CA  . PRO A 1 270 ? 72.817  60.604 20.997  1.00 33.70  ? 270  PRO A CA  1 
ATOM   2149 C  C   . PRO A 1 270 ? 73.394  60.464 22.408  1.00 36.80  ? 270  PRO A C   1 
ATOM   2150 O  O   . PRO A 1 270 ? 73.079  59.513 23.125  1.00 37.21  ? 270  PRO A O   1 
ATOM   2151 C  CB  . PRO A 1 270 ? 71.421  61.220 21.009  1.00 33.34  ? 270  PRO A CB  1 
ATOM   2152 C  CG  . PRO A 1 270 ? 70.771  60.611 19.805  1.00 34.15  ? 270  PRO A CG  1 
ATOM   2153 C  CD  . PRO A 1 270 ? 71.203  59.167 19.903  1.00 31.56  ? 270  PRO A CD  1 
ATOM   2154 N  N   . ASN A 1 271 ? 74.237  61.416 22.798  1.00 38.65  ? 271  ASN A N   1 
ATOM   2155 C  CA  . ASN A 1 271 ? 74.856  61.416 24.122  1.00 40.56  ? 271  ASN A CA  1 
ATOM   2156 C  C   . ASN A 1 271 ? 75.458  60.055 24.466  1.00 40.81  ? 271  ASN A C   1 
ATOM   2157 O  O   . ASN A 1 271 ? 75.164  59.475 25.513  1.00 39.21  ? 271  ASN A O   1 
ATOM   2158 C  CB  . ASN A 1 271 ? 73.822  61.823 25.178  1.00 43.34  ? 271  ASN A CB  1 
ATOM   2159 C  CG  . ASN A 1 271 ? 74.429  61.999 26.563  1.00 46.69  ? 271  ASN A CG  1 
ATOM   2160 O  OD1 . ASN A 1 271 ? 73.740  62.399 27.505  1.00 49.24  ? 271  ASN A OD1 1 
ATOM   2161 N  ND2 . ASN A 1 271 ? 75.717  61.698 26.696  1.00 46.64  ? 271  ASN A ND2 1 
ATOM   2162 N  N   . TYR A 1 272 ? 76.309  59.561 23.572  1.00 40.57  ? 272  TYR A N   1 
ATOM   2163 C  CA  . TYR A 1 272 ? 76.974  58.271 23.733  1.00 40.96  ? 272  TYR A CA  1 
ATOM   2164 C  C   . TYR A 1 272 ? 77.511  58.058 25.151  1.00 42.48  ? 272  TYR A C   1 
ATOM   2165 O  O   . TYR A 1 272 ? 78.107  58.960 25.744  1.00 43.31  ? 272  TYR A O   1 
ATOM   2166 C  CB  . TYR A 1 272 ? 78.108  58.169 22.706  1.00 38.91  ? 272  TYR A CB  1 
ATOM   2167 C  CG  . TYR A 1 272 ? 78.868  56.861 22.696  1.00 38.15  ? 272  TYR A CG  1 
ATOM   2168 C  CD1 . TYR A 1 272 ? 78.204  55.640 22.561  1.00 37.16  ? 272  TYR A CD1 1 
ATOM   2169 C  CD2 . TYR A 1 272 ? 80.261  56.849 22.773  1.00 36.64  ? 272  TYR A CD2 1 
ATOM   2170 C  CE1 . TYR A 1 272 ? 78.912  54.436 22.498  1.00 36.23  ? 272  TYR A CE1 1 
ATOM   2171 C  CE2 . TYR A 1 272 ? 80.978  55.654 22.710  1.00 37.09  ? 272  TYR A CE2 1 
ATOM   2172 C  CZ  . TYR A 1 272 ? 80.298  54.452 22.571  1.00 37.12  ? 272  TYR A CZ  1 
ATOM   2173 O  OH  . TYR A 1 272 ? 81.009  53.277 22.491  1.00 34.70  ? 272  TYR A OH  1 
ATOM   2174 N  N   . CYS A 1 273 ? 77.286  56.861 25.689  1.00 43.53  ? 273  CYS A N   1 
ATOM   2175 C  CA  . CYS A 1 273 ? 77.736  56.508 27.034  1.00 45.65  ? 273  CYS A CA  1 
ATOM   2176 C  C   . CYS A 1 273 ? 77.217  57.469 28.096  1.00 47.06  ? 273  CYS A C   1 
ATOM   2177 O  O   . CYS A 1 273 ? 77.638  57.409 29.252  1.00 48.40  ? 273  CYS A O   1 
ATOM   2178 C  CB  . CYS A 1 273 ? 79.265  56.482 27.098  1.00 44.62  ? 273  CYS A CB  1 
ATOM   2179 S  SG  . CYS A 1 273 ? 80.037  54.992 26.453  1.00 46.06  ? 273  CYS A SG  1 
ATOM   2180 N  N   . GLY A 1 274 ? 76.303  58.350 27.705  1.00 48.38  ? 274  GLY A N   1 
ATOM   2181 C  CA  . GLY A 1 274 ? 75.773  59.315 28.646  1.00 50.71  ? 274  GLY A CA  1 
ATOM   2182 C  C   . GLY A 1 274 ? 76.864  60.267 29.104  1.00 51.93  ? 274  GLY A C   1 
ATOM   2183 O  O   . GLY A 1 274 ? 76.758  60.876 30.167  1.00 52.28  ? 274  GLY A O   1 
ATOM   2184 N  N   . GLU A 1 275 ? 77.918  60.392 28.302  1.00 52.84  ? 275  GLU A N   1 
ATOM   2185 C  CA  . GLU A 1 275 ? 79.030  61.277 28.634  1.00 54.23  ? 275  GLU A CA  1 
ATOM   2186 C  C   . GLU A 1 275 ? 79.371  62.233 27.498  1.00 53.80  ? 275  GLU A C   1 
ATOM   2187 O  O   . GLU A 1 275 ? 80.187  63.138 27.661  1.00 53.53  ? 275  GLU A O   1 
ATOM   2188 C  CB  . GLU A 1 275 ? 80.263  60.459 29.011  1.00 56.17  ? 275  GLU A CB  1 
ATOM   2189 C  CG  . GLU A 1 275 ? 80.067  59.620 30.255  1.00 60.58  ? 275  GLU A CG  1 
ATOM   2190 C  CD  . GLU A 1 275 ? 81.346  58.968 30.723  1.00 62.92  ? 275  GLU A CD  1 
ATOM   2191 O  OE1 . GLU A 1 275 ? 81.930  58.181 29.950  1.00 64.63  ? 275  GLU A OE1 1 
ATOM   2192 O  OE2 . GLU A 1 275 ? 81.766  59.246 31.867  1.00 66.10  ? 275  GLU A OE2 1 
ATOM   2193 N  N   . PHE A 1 276 ? 78.751  62.021 26.343  1.00 54.23  ? 276  PHE A N   1 
ATOM   2194 C  CA  . PHE A 1 276 ? 78.971  62.885 25.191  1.00 53.92  ? 276  PHE A CA  1 
ATOM   2195 C  C   . PHE A 1 276 ? 77.737  63.743 24.974  1.00 53.14  ? 276  PHE A C   1 
ATOM   2196 O  O   . PHE A 1 276 ? 76.645  63.393 25.409  1.00 53.67  ? 276  PHE A O   1 
ATOM   2197 C  CB  . PHE A 1 276 ? 79.238  62.058 23.930  1.00 54.93  ? 276  PHE A CB  1 
ATOM   2198 C  CG  . PHE A 1 276 ? 80.671  61.652 23.762  1.00 55.37  ? 276  PHE A CG  1 
ATOM   2199 C  CD1 . PHE A 1 276 ? 81.279  60.805 24.678  1.00 55.80  ? 276  PHE A CD1 1 
ATOM   2200 C  CD2 . PHE A 1 276 ? 81.421  62.135 22.693  1.00 55.72  ? 276  PHE A CD2 1 
ATOM   2201 C  CE1 . PHE A 1 276 ? 82.612  60.445 24.533  1.00 55.66  ? 276  PHE A CE1 1 
ATOM   2202 C  CE2 . PHE A 1 276 ? 82.754  61.781 22.539  1.00 55.23  ? 276  PHE A CE2 1 
ATOM   2203 C  CZ  . PHE A 1 276 ? 83.352  60.934 23.462  1.00 56.09  ? 276  PHE A CZ  1 
ATOM   2204 N  N   . ASP A 1 277 ? 77.911  64.875 24.310  1.00 52.37  ? 277  ASP A N   1 
ATOM   2205 C  CA  . ASP A 1 277 ? 76.788  65.756 24.035  1.00 50.71  ? 277  ASP A CA  1 
ATOM   2206 C  C   . ASP A 1 277 ? 76.498  65.636 22.549  1.00 47.42  ? 277  ASP A C   1 
ATOM   2207 O  O   . ASP A 1 277 ? 75.790  66.457 21.967  1.00 47.87  ? 277  ASP A O   1 
ATOM   2208 C  CB  . ASP A 1 277 ? 77.146  67.197 24.402  1.00 53.95  ? 277  ASP A CB  1 
ATOM   2209 C  CG  . ASP A 1 277 ? 77.616  67.327 25.840  1.00 56.61  ? 277  ASP A CG  1 
ATOM   2210 O  OD1 . ASP A 1 277 ? 76.866  66.907 26.749  1.00 58.34  ? 277  ASP A OD1 1 
ATOM   2211 O  OD2 . ASP A 1 277 ? 78.733  67.844 26.063  1.00 58.40  ? 277  ASP A OD2 1 
ATOM   2212 N  N   . ASN A 1 278 ? 77.050  64.587 21.948  1.00 43.90  ? 278  ASN A N   1 
ATOM   2213 C  CA  . ASN A 1 278 ? 76.883  64.334 20.526  1.00 40.00  ? 278  ASN A CA  1 
ATOM   2214 C  C   . ASN A 1 278 ? 75.438  64.057 20.163  1.00 38.22  ? 278  ASN A C   1 
ATOM   2215 O  O   . ASN A 1 278 ? 74.664  63.539 20.970  1.00 38.35  ? 278  ASN A O   1 
ATOM   2216 C  CB  . ASN A 1 278 ? 77.725  63.133 20.088  1.00 38.11  ? 278  ASN A CB  1 
ATOM   2217 C  CG  . ASN A 1 278 ? 77.151  61.813 20.578  1.00 37.45  ? 278  ASN A CG  1 
ATOM   2218 O  OD1 . ASN A 1 278 ? 77.317  61.438 21.741  1.00 33.82  ? 278  ASN A OD1 1 
ATOM   2219 N  ND2 . ASN A 1 278 ? 76.458  61.109 19.692  1.00 34.67  ? 278  ASN A ND2 1 
ATOM   2220 N  N   . ALA A 1 279 ? 75.083  64.403 18.934  1.00 35.78  ? 279  ALA A N   1 
ATOM   2221 C  CA  . ALA A 1 279 ? 73.745  64.162 18.435  1.00 33.72  ? 279  ALA A CA  1 
ATOM   2222 C  C   . ALA A 1 279 ? 73.812  62.858 17.653  1.00 33.31  ? 279  ALA A C   1 
ATOM   2223 O  O   . ALA A 1 279 ? 74.898  62.331 17.398  1.00 32.10  ? 279  ALA A O   1 
ATOM   2224 C  CB  . ALA A 1 279 ? 73.310  65.296 17.524  1.00 34.13  ? 279  ALA A CB  1 
ATOM   2225 N  N   . GLY A 1 280 ? 72.651  62.334 17.290  1.00 32.66  ? 280  GLY A N   1 
ATOM   2226 C  CA  . GLY A 1 280 ? 72.607  61.109 16.520  1.00 32.64  ? 280  GLY A CA  1 
ATOM   2227 C  C   . GLY A 1 280 ? 72.069  61.479 15.158  1.00 32.01  ? 280  GLY A C   1 
ATOM   2228 O  O   . GLY A 1 280 ? 71.353  62.468 15.024  1.00 33.69  ? 280  GLY A O   1 
ATOM   2229 N  N   . ALA A 1 281 ? 72.408  60.709 14.134  1.00 31.62  ? 281  ALA A N   1 
ATOM   2230 C  CA  . ALA A 1 281 ? 71.913  61.032 12.815  1.00 30.50  ? 281  ALA A CA  1 
ATOM   2231 C  C   . ALA A 1 281 ? 71.567  59.807 11.998  1.00 30.41  ? 281  ALA A C   1 
ATOM   2232 O  O   . ALA A 1 281 ? 72.101  58.720 12.211  1.00 26.77  ? 281  ALA A O   1 
ATOM   2233 C  CB  . ALA A 1 281 ? 72.932  61.888 12.069  1.00 32.99  ? 281  ALA A CB  1 
ATOM   2234 N  N   . MET A 1 282 ? 70.654  60.011 11.060  1.00 30.09  ? 282  MET A N   1 
ATOM   2235 C  CA  . MET A 1 282 ? 70.190  58.973 10.157  1.00 31.86  ? 282  MET A CA  1 
ATOM   2236 C  C   . MET A 1 282 ? 70.263  59.605 8.771   1.00 32.39  ? 282  MET A C   1 
ATOM   2237 O  O   . MET A 1 282 ? 69.888  60.765 8.604   1.00 32.48  ? 282  MET A O   1 
ATOM   2238 C  CB  . MET A 1 282 ? 68.749  58.612 10.516  1.00 33.35  ? 282  MET A CB  1 
ATOM   2239 C  CG  . MET A 1 282 ? 68.051  57.631 9.596   1.00 37.07  ? 282  MET A CG  1 
ATOM   2240 S  SD  . MET A 1 282 ? 66.440  57.166 10.307  1.00 40.07  ? 282  MET A SD  1 
ATOM   2241 C  CE  . MET A 1 282 ? 65.706  58.773 10.575  1.00 37.35  ? 282  MET A CE  1 
ATOM   2242 N  N   . MET A 1 283 ? 70.764  58.867 7.785   1.00 32.82  ? 283  MET A N   1 
ATOM   2243 C  CA  . MET A 1 283 ? 70.859  59.414 6.437   1.00 33.69  ? 283  MET A CA  1 
ATOM   2244 C  C   . MET A 1 283 ? 69.816  58.806 5.514   1.00 33.89  ? 283  MET A C   1 
ATOM   2245 O  O   . MET A 1 283 ? 69.727  57.588 5.363   1.00 34.61  ? 283  MET A O   1 
ATOM   2246 C  CB  . MET A 1 283 ? 72.257  59.193 5.845   1.00 33.17  ? 283  MET A CB  1 
ATOM   2247 C  CG  . MET A 1 283 ? 72.427  59.788 4.443   1.00 32.87  ? 283  MET A CG  1 
ATOM   2248 S  SD  . MET A 1 283 ? 74.097  59.616 3.744   1.00 31.58  ? 283  MET A SD  1 
ATOM   2249 C  CE  . MET A 1 283 ? 73.978  58.000 2.946   1.00 30.89  ? 283  MET A CE  1 
ATOM   2250 N  N   . SER A 1 284 ? 69.021  59.667 4.893   1.00 34.27  ? 284  SER A N   1 
ATOM   2251 C  CA  . SER A 1 284 ? 67.988  59.207 3.981   1.00 35.36  ? 284  SER A CA  1 
ATOM   2252 C  C   . SER A 1 284 ? 68.477  59.291 2.540   1.00 36.14  ? 284  SER A C   1 
ATOM   2253 O  O   . SER A 1 284 ? 69.068  60.289 2.133   1.00 35.33  ? 284  SER A O   1 
ATOM   2254 C  CB  . SER A 1 284 ? 66.721  60.047 4.156   1.00 36.65  ? 284  SER A CB  1 
ATOM   2255 O  OG  . SER A 1 284 ? 65.679  59.542 3.343   1.00 40.27  ? 284  SER A OG  1 
ATOM   2256 N  N   . VAL A 1 285 ? 68.234  58.233 1.775   1.00 37.35  ? 285  VAL A N   1 
ATOM   2257 C  CA  . VAL A 1 285 ? 68.646  58.188 0.378   1.00 39.29  ? 285  VAL A CA  1 
ATOM   2258 C  C   . VAL A 1 285 ? 67.414  58.003 -0.499  1.00 41.06  ? 285  VAL A C   1 
ATOM   2259 O  O   . VAL A 1 285 ? 66.857  56.906 -0.571  1.00 40.12  ? 285  VAL A O   1 
ATOM   2260 C  CB  . VAL A 1 285 ? 69.620  57.019 0.119   1.00 38.42  ? 285  VAL A CB  1 
ATOM   2261 C  CG1 . VAL A 1 285 ? 70.019  56.994 -1.348  1.00 39.16  ? 285  VAL A CG1 1 
ATOM   2262 C  CG2 . VAL A 1 285 ? 70.853  57.163 1.004   1.00 39.88  ? 285  VAL A CG2 1 
ATOM   2263 N  N   . ASP A 1 286 ? 66.985  59.076 -1.162  1.00 44.06  ? 286  ASP A N   1 
ATOM   2264 C  CA  . ASP A 1 286 ? 65.807  58.996 -2.015  1.00 47.38  ? 286  ASP A CA  1 
ATOM   2265 C  C   . ASP A 1 286 ? 66.093  58.240 -3.306  1.00 49.36  ? 286  ASP A C   1 
ATOM   2266 O  O   . ASP A 1 286 ? 67.230  57.855 -3.577  1.00 49.52  ? 286  ASP A O   1 
ATOM   2267 C  CB  . ASP A 1 286 ? 65.261  60.395 -2.331  1.00 48.35  ? 286  ASP A CB  1 
ATOM   2268 C  CG  . ASP A 1 286 ? 66.215  61.227 -3.165  1.00 49.40  ? 286  ASP A CG  1 
ATOM   2269 O  OD1 . ASP A 1 286 ? 66.690  60.732 -4.209  1.00 46.92  ? 286  ASP A OD1 1 
ATOM   2270 O  OD2 . ASP A 1 286 ? 66.478  62.386 -2.779  1.00 50.30  ? 286  ASP A OD2 1 
ATOM   2271 N  N   . GLU A 1 287 ? 65.047  58.043 -4.103  1.00 51.87  ? 287  GLU A N   1 
ATOM   2272 C  CA  . GLU A 1 287 ? 65.138  57.311 -5.362  1.00 54.13  ? 287  GLU A CA  1 
ATOM   2273 C  C   . GLU A 1 287 ? 65.931  58.004 -6.471  1.00 54.00  ? 287  GLU A C   1 
ATOM   2274 O  O   . GLU A 1 287 ? 66.192  57.406 -7.516  1.00 54.17  ? 287  GLU A O   1 
ATOM   2275 C  CB  . GLU A 1 287 ? 63.725  56.978 -5.850  1.00 55.90  ? 287  GLU A CB  1 
ATOM   2276 C  CG  . GLU A 1 287 ? 62.636  57.428 -4.883  1.00 59.15  ? 287  GLU A CG  1 
ATOM   2277 C  CD  . GLU A 1 287 ? 61.441  56.494 -4.858  1.00 61.23  ? 287  GLU A CD  1 
ATOM   2278 O  OE1 . GLU A 1 287 ? 61.446  55.496 -5.611  1.00 63.03  ? 287  GLU A OE1 1 
ATOM   2279 O  OE2 . GLU A 1 287 ? 60.499  56.756 -4.078  1.00 62.46  ? 287  GLU A OE2 1 
ATOM   2280 N  N   . THR A 1 288 ? 66.314  59.258 -6.251  1.00 53.59  ? 288  THR A N   1 
ATOM   2281 C  CA  . THR A 1 288 ? 67.099  59.990 -7.243  1.00 53.56  ? 288  THR A CA  1 
ATOM   2282 C  C   . THR A 1 288 ? 68.547  60.024 -6.767  1.00 54.36  ? 288  THR A C   1 
ATOM   2283 O  O   . THR A 1 288 ? 69.373  60.772 -7.288  1.00 54.36  ? 288  THR A O   1 
ATOM   2284 C  CB  . THR A 1 288 ? 66.598  61.444 -7.420  1.00 52.97  ? 288  THR A CB  1 
ATOM   2285 O  OG1 . THR A 1 288 ? 66.850  62.193 -6.225  1.00 50.66  ? 288  THR A OG1 1 
ATOM   2286 C  CG2 . THR A 1 288 ? 65.106  61.461 -7.718  1.00 52.31  ? 288  THR A CG2 1 
ATOM   2287 N  N   . LEU A 1 289 ? 68.836  59.197 -5.766  1.00 54.57  ? 289  LEU A N   1 
ATOM   2288 C  CA  . LEU A 1 289 ? 70.166  59.097 -5.184  1.00 55.05  ? 289  LEU A CA  1 
ATOM   2289 C  C   . LEU A 1 289 ? 70.614  60.430 -4.586  1.00 55.02  ? 289  LEU A C   1 
ATOM   2290 O  O   . LEU A 1 289 ? 71.737  60.880 -4.811  1.00 55.46  ? 289  LEU A O   1 
ATOM   2291 C  CB  . LEU A 1 289 ? 71.173  58.620 -6.238  1.00 55.88  ? 289  LEU A CB  1 
ATOM   2292 C  CG  . LEU A 1 289 ? 72.533  58.113 -5.739  1.00 56.82  ? 289  LEU A CG  1 
ATOM   2293 C  CD1 . LEU A 1 289 ? 72.333  56.925 -4.808  1.00 57.41  ? 289  LEU A CD1 1 
ATOM   2294 C  CD2 . LEU A 1 289 ? 73.397  57.708 -6.925  1.00 56.09  ? 289  LEU A CD2 1 
ATOM   2295 N  N   . MET A 1 290 ? 69.720  61.064 -3.834  1.00 54.88  ? 290  MET A N   1 
ATOM   2296 C  CA  . MET A 1 290 ? 70.023  62.330 -3.174  1.00 54.44  ? 290  MET A CA  1 
ATOM   2297 C  C   . MET A 1 290 ? 70.006  62.057 -1.671  1.00 52.64  ? 290  MET A C   1 
ATOM   2298 O  O   . MET A 1 290 ? 69.059  61.466 -1.154  1.00 51.35  ? 290  MET A O   1 
ATOM   2299 C  CB  . MET A 1 290 ? 68.975  63.393 -3.527  1.00 57.44  ? 290  MET A CB  1 
ATOM   2300 C  CG  . MET A 1 290 ? 69.231  64.754 -2.883  1.00 60.87  ? 290  MET A CG  1 
ATOM   2301 S  SD  . MET A 1 290 ? 67.926  65.975 -3.194  1.00 65.27  ? 290  MET A SD  1 
ATOM   2302 C  CE  . MET A 1 290 ? 66.989  65.873 -1.654  1.00 64.16  ? 290  MET A CE  1 
ATOM   2303 N  N   . CYS A 1 291 ? 71.053  62.485 -0.974  1.00 50.70  ? 291  CYS A N   1 
ATOM   2304 C  CA  . CYS A 1 291 ? 71.147  62.249 0.463   1.00 49.52  ? 291  CYS A CA  1 
ATOM   2305 C  C   . CYS A 1 291 ? 70.747  63.425 1.337   1.00 48.53  ? 291  CYS A C   1 
ATOM   2306 O  O   . CYS A 1 291 ? 71.086  64.575 1.059   1.00 48.87  ? 291  CYS A O   1 
ATOM   2307 C  CB  . CYS A 1 291 ? 72.570  61.831 0.838   1.00 49.69  ? 291  CYS A CB  1 
ATOM   2308 S  SG  . CYS A 1 291 ? 73.103  60.251 0.159   1.00 49.54  ? 291  CYS A SG  1 
ATOM   2309 N  N   . SER A 1 292 ? 70.020  63.119 2.403   1.00 45.81  ? 292  SER A N   1 
ATOM   2310 C  CA  . SER A 1 292 ? 69.590  64.122 3.364   1.00 44.99  ? 292  SER A CA  1 
ATOM   2311 C  C   . SER A 1 292 ? 69.818  63.508 4.740   1.00 43.68  ? 292  SER A C   1 
ATOM   2312 O  O   . SER A 1 292 ? 69.794  62.287 4.892   1.00 42.62  ? 292  SER A O   1 
ATOM   2313 C  CB  . SER A 1 292 ? 68.112  64.473 3.166   1.00 44.62  ? 292  SER A CB  1 
ATOM   2314 O  OG  . SER A 1 292 ? 67.284  63.336 3.307   1.00 45.64  ? 292  SER A OG  1 
ATOM   2315 N  N   . PHE A 1 293 ? 70.047  64.348 5.739   1.00 42.05  ? 293  PHE A N   1 
ATOM   2316 C  CA  . PHE A 1 293 ? 70.306  63.852 7.077   1.00 41.85  ? 293  PHE A CA  1 
ATOM   2317 C  C   . PHE A 1 293 ? 69.259  64.264 8.095   1.00 43.09  ? 293  PHE A C   1 
ATOM   2318 O  O   . PHE A 1 293 ? 68.842  65.420 8.150   1.00 43.60  ? 293  PHE A O   1 
ATOM   2319 C  CB  . PHE A 1 293 ? 71.684  64.324 7.534   1.00 39.71  ? 293  PHE A CB  1 
ATOM   2320 C  CG  . PHE A 1 293 ? 72.800  63.870 6.639   1.00 40.27  ? 293  PHE A CG  1 
ATOM   2321 C  CD1 . PHE A 1 293 ? 73.400  62.626 6.827   1.00 39.07  ? 293  PHE A CD1 1 
ATOM   2322 C  CD2 . PHE A 1 293 ? 73.230  64.670 5.586   1.00 38.00  ? 293  PHE A CD2 1 
ATOM   2323 C  CE1 . PHE A 1 293 ? 74.413  62.187 5.978   1.00 38.97  ? 293  PHE A CE1 1 
ATOM   2324 C  CE2 . PHE A 1 293 ? 74.243  64.239 4.731   1.00 39.67  ? 293  PHE A CE2 1 
ATOM   2325 C  CZ  . PHE A 1 293 ? 74.835  62.994 4.928   1.00 39.61  ? 293  PHE A CZ  1 
ATOM   2326 N  N   . GLN A 1 294 ? 68.832  63.293 8.892   1.00 44.00  ? 294  GLN A N   1 
ATOM   2327 C  CA  . GLN A 1 294 ? 67.857  63.524 9.941   1.00 45.04  ? 294  GLN A CA  1 
ATOM   2328 C  C   . GLN A 1 294 ? 68.622  63.404 11.251  1.00 46.14  ? 294  GLN A C   1 
ATOM   2329 O  O   . GLN A 1 294 ? 69.204  62.359 11.549  1.00 45.32  ? 294  GLN A O   1 
ATOM   2330 C  CB  . GLN A 1 294 ? 66.734  62.489 9.853   1.00 47.65  ? 294  GLN A CB  1 
ATOM   2331 C  CG  . GLN A 1 294 ? 65.799  62.719 8.667   1.00 50.51  ? 294  GLN A CG  1 
ATOM   2332 C  CD  . GLN A 1 294 ? 64.622  61.757 8.636   1.00 53.29  ? 294  GLN A CD  1 
ATOM   2333 O  OE1 . GLN A 1 294 ? 64.774  60.574 8.318   1.00 54.73  ? 294  GLN A OE1 1 
ATOM   2334 N  NE2 . GLN A 1 294 ? 63.438  62.263 8.972   1.00 53.25  ? 294  GLN A NE2 1 
ATOM   2335 N  N   . ILE A 1 295 ? 68.630  64.485 12.021  1.00 45.45  ? 295  ILE A N   1 
ATOM   2336 C  CA  . ILE A 1 295 ? 69.359  64.525 13.280  1.00 46.31  ? 295  ILE A CA  1 
ATOM   2337 C  C   . ILE A 1 295 ? 68.503  64.292 14.516  1.00 47.29  ? 295  ILE A C   1 
ATOM   2338 O  O   . ILE A 1 295 ? 67.390  64.807 14.623  1.00 47.74  ? 295  ILE A O   1 
ATOM   2339 C  CB  . ILE A 1 295 ? 70.080  65.884 13.440  1.00 45.87  ? 295  ILE A CB  1 
ATOM   2340 C  CG1 . ILE A 1 295 ? 70.997  66.127 12.240  1.00 47.01  ? 295  ILE A CG1 1 
ATOM   2341 C  CG2 . ILE A 1 295 ? 70.881  65.906 14.734  1.00 45.42  ? 295  ILE A CG2 1 
ATOM   2342 C  CD1 . ILE A 1 295 ? 71.731  67.451 12.286  1.00 47.31  ? 295  ILE A CD1 1 
ATOM   2343 N  N   . LEU A 1 296 ? 69.034  63.503 15.444  1.00 48.04  ? 296  LEU A N   1 
ATOM   2344 C  CA  . LEU A 1 296 ? 68.352  63.224 16.699  1.00 50.35  ? 296  LEU A CA  1 
ATOM   2345 C  C   . LEU A 1 296 ? 69.096  63.963 17.798  1.00 51.61  ? 296  LEU A C   1 
ATOM   2346 O  O   . LEU A 1 296 ? 70.175  63.548 18.219  1.00 50.24  ? 296  LEU A O   1 
ATOM   2347 C  CB  . LEU A 1 296 ? 68.345  61.727 17.011  1.00 51.24  ? 296  LEU A CB  1 
ATOM   2348 C  CG  . LEU A 1 296 ? 67.396  60.833 16.212  1.00 52.66  ? 296  LEU A CG  1 
ATOM   2349 C  CD1 . LEU A 1 296 ? 67.298  59.490 16.917  1.00 53.12  ? 296  LEU A CD1 1 
ATOM   2350 C  CD2 . LEU A 1 296 ? 66.016  61.470 16.118  1.00 52.49  ? 296  LEU A CD2 1 
ATOM   2351 N  N   . LYS A 1 297 ? 68.517  65.068 18.251  1.00 54.05  ? 297  LYS A N   1 
ATOM   2352 C  CA  . LYS A 1 297 ? 69.127  65.875 19.296  1.00 56.96  ? 297  LYS A CA  1 
ATOM   2353 C  C   . LYS A 1 297 ? 69.176  65.083 20.597  1.00 57.80  ? 297  LYS A C   1 
ATOM   2354 O  O   . LYS A 1 297 ? 68.252  64.331 20.911  1.00 57.94  ? 297  LYS A O   1 
ATOM   2355 C  CB  . LYS A 1 297 ? 68.315  67.155 19.499  1.00 59.84  ? 297  LYS A CB  1 
ATOM   2356 C  CG  . LYS A 1 297 ? 67.985  67.885 18.207  1.00 62.65  ? 297  LYS A CG  1 
ATOM   2357 C  CD  . LYS A 1 297 ? 67.022  69.038 18.453  1.00 65.43  ? 297  LYS A CD  1 
ATOM   2358 C  CE  . LYS A 1 297 ? 66.608  69.703 17.147  1.00 66.85  ? 297  LYS A CE  1 
ATOM   2359 N  NZ  . LYS A 1 297 ? 65.617  70.795 17.369  1.00 67.62  ? 297  LYS A NZ  1 
ATOM   2360 N  N   . PRO A 1 298 ? 70.261  65.232 21.370  1.00 58.79  ? 298  PRO A N   1 
ATOM   2361 C  CA  . PRO A 1 298 ? 70.348  64.493 22.632  1.00 59.79  ? 298  PRO A CA  1 
ATOM   2362 C  C   . PRO A 1 298 ? 69.223  64.931 23.565  1.00 61.07  ? 298  PRO A C   1 
ATOM   2363 O  O   . PRO A 1 298 ? 69.307  65.981 24.203  1.00 61.91  ? 298  PRO A O   1 
ATOM   2364 C  CB  . PRO A 1 298 ? 71.733  64.868 23.153  1.00 59.33  ? 298  PRO A CB  1 
ATOM   2365 C  CG  . PRO A 1 298 ? 71.932  66.255 22.607  1.00 59.49  ? 298  PRO A CG  1 
ATOM   2366 C  CD  . PRO A 1 298 ? 71.420  66.125 21.195  1.00 58.85  ? 298  PRO A CD  1 
ATOM   2367 N  N   . ALA A 1 299 ? 68.165  64.126 23.625  1.00 61.76  ? 299  ALA A N   1 
ATOM   2368 C  CA  . ALA A 1 299 ? 67.012  64.429 24.466  1.00 61.88  ? 299  ALA A CA  1 
ATOM   2369 C  C   . ALA A 1 299 ? 67.038  63.620 25.755  1.00 62.31  ? 299  ALA A C   1 
ATOM   2370 O  O   . ALA A 1 299 ? 67.032  64.243 26.838  1.00 62.86  ? 299  ALA A O   1 
ATOM   2371 C  CB  . ALA A 1 299 ? 65.721  64.150 23.701  1.00 61.93  ? 299  ALA A CB  1 
HETATM 2372 MN MN  . MN  B 2 .   ? 82.265  50.290 15.843  1.00 21.19  ? 400  MN  A MN  1 
HETATM 2373 MN MN  . MN  C 2 .   ? 80.612  52.212 17.937  1.00 75.21  ? 401  MN  A MN  1 
HETATM 2374 S  S   . SO4 D 3 .   ? 89.050  65.520 5.237   1.00 42.88  ? 2022 SO4 A S   1 
HETATM 2375 O  O1  . SO4 D 3 .   ? 87.925  65.960 4.391   1.00 40.04  ? 2022 SO4 A O1  1 
HETATM 2376 O  O2  . SO4 D 3 .   ? 88.647  64.336 6.019   1.00 45.24  ? 2022 SO4 A O2  1 
HETATM 2377 O  O3  . SO4 D 3 .   ? 90.207  65.171 4.388   1.00 45.48  ? 2022 SO4 A O3  1 
HETATM 2378 O  O4  . SO4 D 3 .   ? 89.430  66.607 6.158   1.00 44.36  ? 2022 SO4 A O4  1 
HETATM 2379 C  C1  . OKA E 4 .   ? 84.732  52.587 22.076  1.00 33.67  ? 501  OKA A C1  1 
HETATM 2380 C  C2  . OKA E 4 .   ? 84.513  51.965 23.446  1.00 34.28  ? 501  OKA A C2  1 
HETATM 2381 C  C3  . OKA E 4 .   ? 85.802  51.875 24.237  1.00 34.70  ? 501  OKA A C3  1 
HETATM 2382 C  C4  . OKA E 4 .   ? 86.466  53.230 24.643  1.00 35.90  ? 501  OKA A C4  1 
HETATM 2383 C  C5  . OKA E 4 .   ? 87.707  53.102 25.389  1.00 37.08  ? 501  OKA A C5  1 
HETATM 2384 C  C6  . OKA E 4 .   ? 88.249  54.469 25.783  1.00 36.57  ? 501  OKA A C6  1 
HETATM 2385 C  C7  . OKA E 4 .   ? 87.124  55.176 26.600  1.00 35.38  ? 501  OKA A C7  1 
HETATM 2386 C  C8  . OKA E 4 .   ? 85.848  55.327 25.847  1.00 36.27  ? 501  OKA A C8  1 
HETATM 2387 C  C9  . OKA E 4 .   ? 84.710  55.906 26.538  1.00 34.93  ? 501  OKA A C9  1 
HETATM 2388 C  C10 . OKA E 4 .   ? 83.976  56.936 26.096  1.00 35.75  ? 501  OKA A C10 1 
HETATM 2389 C  C11 . OKA E 4 .   ? 84.289  57.572 24.750  1.00 34.34  ? 501  OKA A C11 1 
HETATM 2390 C  C12 . OKA E 4 .   ? 85.153  56.620 23.873  1.00 34.85  ? 501  OKA A C12 1 
HETATM 2391 C  C13 . OKA E 4 .   ? 85.779  57.316 22.671  1.00 34.76  ? 501  OKA A C13 1 
HETATM 2392 C  C14 . OKA E 4 .   ? 86.619  56.349 21.922  1.00 35.69  ? 501  OKA A C14 1 
HETATM 2393 C  C15 . OKA E 4 .   ? 87.838  56.473 21.645  1.00 33.63  ? 501  OKA A C15 1 
HETATM 2394 C  C16 . OKA E 4 .   ? 88.779  55.518 20.926  1.00 32.70  ? 501  OKA A C16 1 
HETATM 2395 C  C17 . OKA E 4 .   ? 89.759  56.019 19.873  1.00 31.42  ? 501  OKA A C17 1 
HETATM 2396 C  C18 . OKA E 4 .   ? 91.015  55.100 19.992  1.00 30.34  ? 501  OKA A C18 1 
HETATM 2397 C  C19 . OKA E 4 .   ? 90.600  54.120 21.183  1.00 31.90  ? 501  OKA A C19 1 
HETATM 2398 C  C20 . OKA E 4 .   ? 91.755  53.791 22.041  1.00 31.43  ? 501  OKA A C20 1 
HETATM 2399 C  C21 . OKA E 4 .   ? 91.291  52.804 23.197  1.00 33.25  ? 501  OKA A C21 1 
HETATM 2400 C  C22 . OKA E 4 .   ? 90.652  51.576 22.506  1.00 32.10  ? 501  OKA A C22 1 
HETATM 2401 C  C23 . OKA E 4 .   ? 89.540  52.047 21.619  1.00 31.56  ? 501  OKA A C23 1 
HETATM 2402 C  C24 . OKA E 4 .   ? 88.916  50.776 20.957  1.00 30.32  ? 501  OKA A C24 1 
HETATM 2403 C  C25 . OKA E 4 .   ? 88.417  49.769 22.090  1.00 31.95  ? 501  OKA A C25 1 
HETATM 2404 C  C26 . OKA E 4 .   ? 89.519  49.474 23.035  1.00 31.57  ? 501  OKA A C26 1 
HETATM 2405 C  C27 . OKA E 4 .   ? 90.659  48.496 22.606  1.00 31.95  ? 501  OKA A C27 1 
HETATM 2406 C  C28 . OKA E 4 .   ? 90.063  47.112 22.213  1.00 30.55  ? 501  OKA A C28 1 
HETATM 2407 C  C29 . OKA E 4 .   ? 91.105  46.058 21.731  1.00 34.37  ? 501  OKA A C29 1 
HETATM 2408 C  C30 . OKA E 4 .   ? 90.356  44.710 21.485  1.00 33.28  ? 501  OKA A C30 1 
HETATM 2409 C  C31 . OKA E 4 .   ? 89.643  44.141 22.726  1.00 35.20  ? 501  OKA A C31 1 
HETATM 2410 C  C32 . OKA E 4 .   ? 89.040  42.797 22.311  1.00 35.23  ? 501  OKA A C32 1 
HETATM 2411 C  C33 . OKA E 4 .   ? 90.109  41.828 21.722  1.00 37.06  ? 501  OKA A C33 1 
HETATM 2412 C  C34 . OKA E 4 .   ? 90.913  42.463 20.641  1.00 36.65  ? 501  OKA A C34 1 
HETATM 2413 C  C35 . OKA E 4 .   ? 92.163  41.707 20.221  1.00 37.36  ? 501  OKA A C35 1 
HETATM 2414 C  C36 . OKA E 4 .   ? 92.731  42.215 18.865  1.00 38.07  ? 501  OKA A C36 1 
HETATM 2415 C  C37 . OKA E 4 .   ? 91.724  42.366 17.751  1.00 40.18  ? 501  OKA A C37 1 
HETATM 2416 C  C38 . OKA E 4 .   ? 90.487  43.106 18.257  1.00 39.18  ? 501  OKA A C38 1 
HETATM 2417 C  C39 . OKA E 4 .   ? 90.551  43.942 23.975  1.00 35.57  ? 501  OKA A C39 1 
HETATM 2418 C  C40 . OKA E 4 .   ? 91.757  46.519 20.442  1.00 30.82  ? 501  OKA A C40 1 
HETATM 2419 C  C41 . OKA E 4 .   ? 87.232  49.366 22.103  1.00 32.18  ? 501  OKA A C41 1 
HETATM 2420 C  C42 . OKA E 4 .   ? 84.766  57.943 21.761  1.00 36.03  ? 501  OKA A C42 1 
HETATM 2421 C  C43 . OKA E 4 .   ? 82.804  57.515 26.854  1.00 35.41  ? 501  OKA A C43 1 
HETATM 2422 C  C44 . OKA E 4 .   ? 83.936  50.552 23.117  1.00 32.26  ? 501  OKA A C44 1 
HETATM 2423 O  O1  . OKA E 4 .   ? 83.967  53.680 21.829  1.00 35.29  ? 501  OKA A O1  1 
HETATM 2424 O  O2  . OKA E 4 .   ? 85.507  52.214 21.207  1.00 32.36  ? 501  OKA A O2  1 
HETATM 2425 O  O3  . OKA E 4 .   ? 83.480  52.613 24.109  1.00 35.09  ? 501  OKA A O3  1 
HETATM 2426 O  O4  . OKA E 4 .   ? 85.413  53.972 25.383  1.00 36.71  ? 501  OKA A O4  1 
HETATM 2427 O  O5  . OKA E 4 .   ? 87.586  56.491 27.033  1.00 35.01  ? 501  OKA A O5  1 
HETATM 2428 O  O6  . OKA E 4 .   ? 86.177  56.046 24.641  1.00 34.89  ? 501  OKA A O6  1 
HETATM 2429 O  O7  . OKA E 4 .   ? 89.573  54.866 21.887  1.00 30.87  ? 501  OKA A O7  1 
HETATM 2430 O  O8  . OKA E 4 .   ? 89.989  52.934 20.595  1.00 31.96  ? 501  OKA A O8  1 
HETATM 2431 O  O9  . OKA E 4 .   ? 90.198  50.702 23.531  1.00 31.72  ? 501  OKA A O9  1 
HETATM 2432 O  O10 . OKA E 4 .   ? 87.876  51.126 20.065  1.00 27.10  ? 501  OKA A O10 1 
HETATM 2433 O  O11 . OKA E 4 .   ? 91.594  48.314 23.581  1.00 32.99  ? 501  OKA A O11 1 
HETATM 2434 O  O12 . OKA E 4 .   ? 91.360  43.767 20.999  1.00 36.33  ? 501  OKA A O12 1 
HETATM 2435 O  O13 . OKA E 4 .   ? 89.987  42.537 19.520  1.00 39.22  ? 501  OKA A O13 1 
HETATM 2436 C  C1  . BME F 5 .   ? 82.487  69.295 5.914   1.00 60.45  ? 2023 BME A C1  1 
HETATM 2437 C  C2  . BME F 5 .   ? 83.731  68.473 5.531   1.00 59.57  ? 2023 BME A C2  1 
HETATM 2438 O  O1  . BME F 5 .   ? 81.332  68.697 5.368   1.00 61.58  ? 2023 BME A O1  1 
HETATM 2439 S  S2  . BME F 5 .   ? 84.369  69.036 3.939   1.00 59.60  ? 2023 BME A S2  1 
HETATM 2440 C  C1  . BME G 5 .   ? 75.430  60.683 -2.925  1.00 71.54  ? 2024 BME A C1  1 
HETATM 2441 C  C2  . BME G 5 .   ? 74.640  59.366 -2.841  1.00 71.58  ? 2024 BME A C2  1 
HETATM 2442 O  O1  . BME G 5 .   ? 76.717  60.430 -3.449  1.00 71.45  ? 2024 BME A O1  1 
HETATM 2443 S  S2  . BME G 5 .   ? 72.884  59.706 -2.583  1.00 73.29  ? 2024 BME A S2  1 
HETATM 2444 C  C1  . BME H 5 .   ? 90.672  56.179 15.815  1.00 110.82 ? 2025 BME A C1  1 
HETATM 2445 C  C2  . BME H 5 .   ? 89.999  57.473 16.299  1.00 110.98 ? 2025 BME A C2  1 
HETATM 2446 O  O1  . BME H 5 .   ? 90.989  56.289 14.446  1.00 110.56 ? 2025 BME A O1  1 
HETATM 2447 S  S2  . BME H 5 .   ? 88.286  57.130 16.755  1.00 110.90 ? 2025 BME A S2  1 
HETATM 2448 O  O   . HOH I 6 .   ? 66.256  35.414 0.490   1.00 58.43  ? 2026 HOH A O   1 
HETATM 2449 O  O   . HOH I 6 .   ? 68.293  41.311 -0.916  1.00 59.54  ? 2027 HOH A O   1 
HETATM 2450 O  O   . HOH I 6 .   ? 71.254  41.694 -1.883  1.00 46.15  ? 2028 HOH A O   1 
HETATM 2451 O  O   . HOH I 6 .   ? 66.648  47.115 -1.306  1.00 37.66  ? 2029 HOH A O   1 
HETATM 2452 O  O   . HOH I 6 .   ? 60.391  50.089 -1.237  1.00 49.37  ? 2030 HOH A O   1 
HETATM 2453 O  O   . HOH I 6 .   ? 55.677  48.111 1.022   1.00 53.50  ? 2031 HOH A O   1 
HETATM 2454 O  O   . HOH I 6 .   ? 56.621  45.010 2.792   1.00 52.02  ? 2032 HOH A O   1 
HETATM 2455 O  O   . HOH I 6 .   ? 53.570  44.770 4.302   1.00 54.79  ? 2033 HOH A O   1 
HETATM 2456 O  O   . HOH I 6 .   ? 53.010  44.833 7.901   1.00 51.17  ? 2034 HOH A O   1 
HETATM 2457 O  O   . HOH I 6 .   ? 55.497  45.562 12.165  1.00 41.84  ? 2035 HOH A O   1 
HETATM 2458 O  O   . HOH I 6 .   ? 56.257  48.525 13.197  1.00 39.83  ? 2036 HOH A O   1 
HETATM 2459 O  O   . HOH I 6 .   ? 53.533  51.223 14.458  1.00 47.52  ? 2037 HOH A O   1 
HETATM 2460 O  O   . HOH I 6 .   ? 54.593  54.556 17.095  1.00 59.13  ? 2038 HOH A O   1 
HETATM 2461 O  O   . HOH I 6 .   ? 56.510  57.197 16.911  1.00 48.00  ? 2039 HOH A O   1 
HETATM 2462 O  O   . HOH I 6 .   ? 59.351  57.413 20.773  1.00 45.95  ? 2040 HOH A O   1 
HETATM 2463 O  O   . HOH I 6 .   ? 61.302  57.167 22.287  1.00 49.76  ? 2041 HOH A O   1 
HETATM 2464 O  O   . HOH I 6 .   ? 67.700  54.122 25.474  1.00 46.18  ? 2042 HOH A O   1 
HETATM 2465 O  O   . HOH I 6 .   ? 70.730  53.271 27.290  1.00 35.71  ? 2043 HOH A O   1 
HETATM 2466 O  O   . HOH I 6 .   ? 75.526  54.272 24.892  1.00 30.08  ? 2044 HOH A O   1 
HETATM 2467 O  O   . HOH I 6 .   ? 76.103  48.151 28.411  1.00 48.74  ? 2045 HOH A O   1 
HETATM 2468 O  O   . HOH I 6 .   ? 74.619  46.559 27.004  1.00 27.61  ? 2046 HOH A O   1 
HETATM 2469 O  O   . HOH I 6 .   ? 75.579  46.474 30.512  1.00 34.60  ? 2047 HOH A O   1 
HETATM 2470 O  O   . HOH I 6 .   ? 79.070  46.402 31.749  1.00 53.24  ? 2048 HOH A O   1 
HETATM 2471 O  O   . HOH I 6 .   ? 79.523  49.582 29.655  1.00 59.39  ? 2049 HOH A O   1 
HETATM 2472 O  O   . HOH I 6 .   ? 79.894  43.111 29.287  1.00 22.01  ? 2050 HOH A O   1 
HETATM 2473 O  O   . HOH I 6 .   ? 78.424  40.500 34.785  1.00 44.96  ? 2051 HOH A O   1 
HETATM 2474 O  O   . HOH I 6 .   ? 75.685  41.090 34.855  1.00 46.67  ? 2052 HOH A O   1 
HETATM 2475 O  O   . HOH I 6 .   ? 80.111  37.958 35.008  1.00 42.84  ? 2053 HOH A O   1 
HETATM 2476 O  O   . HOH I 6 .   ? 71.944  34.628 34.804  1.00 53.05  ? 2054 HOH A O   1 
HETATM 2477 O  O   . HOH I 6 .   ? 69.121  36.610 35.065  1.00 35.84  ? 2055 HOH A O   1 
HETATM 2478 O  O   . HOH I 6 .   ? 65.228  35.871 32.354  1.00 40.30  ? 2056 HOH A O   1 
HETATM 2479 O  O   . HOH I 6 .   ? 62.850  36.790 31.693  1.00 40.92  ? 2057 HOH A O   1 
HETATM 2480 O  O   . HOH I 6 .   ? 66.120  33.060 31.085  1.00 21.83  ? 2058 HOH A O   1 
HETATM 2481 O  O   . HOH I 6 .   ? 69.487  28.536 29.226  1.00 40.19  ? 2059 HOH A O   1 
HETATM 2482 O  O   . HOH I 6 .   ? 69.872  30.303 27.107  1.00 43.58  ? 2060 HOH A O   1 
HETATM 2483 O  O   . HOH I 6 .   ? 70.052  29.776 24.148  1.00 35.49  ? 2061 HOH A O   1 
HETATM 2484 O  O   . HOH I 6 .   ? 67.546  29.326 25.118  1.00 36.17  ? 2062 HOH A O   1 
HETATM 2485 O  O   . HOH I 6 .   ? 67.892  25.425 25.002  1.00 55.56  ? 2063 HOH A O   1 
HETATM 2486 O  O   . HOH I 6 .   ? 79.765  74.102 1.169   1.00 32.16  ? 2064 HOH A O   1 
HETATM 2487 O  O   . HOH I 6 .   ? 74.130  28.819 23.540  1.00 44.77  ? 2065 HOH A O   1 
HETATM 2488 O  O   . HOH I 6 .   ? 75.009  28.818 21.068  1.00 56.22  ? 2066 HOH A O   1 
HETATM 2489 O  O   . HOH I 6 .   ? 79.320  30.769 15.381  1.00 31.69  ? 2067 HOH A O   1 
HETATM 2490 O  O   . HOH I 6 .   ? 76.928  30.108 14.027  1.00 52.94  ? 2068 HOH A O   1 
HETATM 2491 O  O   . HOH I 6 .   ? 77.756  27.110 12.882  1.00 55.94  ? 2069 HOH A O   1 
HETATM 2492 O  O   . HOH I 6 .   ? 76.712  26.347 10.548  1.00 44.66  ? 2070 HOH A O   1 
HETATM 2493 O  O   . HOH I 6 .   ? 83.362  30.539 13.459  1.00 50.59  ? 2071 HOH A O   1 
HETATM 2494 O  O   . HOH I 6 .   ? 86.976  31.431 12.028  1.00 57.47  ? 2072 HOH A O   1 
HETATM 2495 O  O   . HOH I 6 .   ? 89.380  37.033 10.470  1.00 33.32  ? 2073 HOH A O   1 
HETATM 2496 O  O   . HOH I 6 .   ? 90.433  39.534 8.840   1.00 26.79  ? 2074 HOH A O   1 
HETATM 2497 O  O   . HOH I 6 .   ? 89.807  38.437 6.354   1.00 31.06  ? 2075 HOH A O   1 
HETATM 2498 O  O   . HOH I 6 .   ? 93.245  39.407 4.718   1.00 34.88  ? 2076 HOH A O   1 
HETATM 2499 O  O   . HOH I 6 .   ? 96.227  38.703 6.967   1.00 64.71  ? 2077 HOH A O   1 
HETATM 2500 O  O   . HOH I 6 .   ? 96.917  41.555 5.879   1.00 28.32  ? 2078 HOH A O   1 
HETATM 2501 O  O   . HOH I 6 .   ? 95.135  44.134 6.165   1.00 25.32  ? 2079 HOH A O   1 
HETATM 2502 O  O   . HOH I 6 .   ? 96.528  43.271 8.879   1.00 25.23  ? 2080 HOH A O   1 
HETATM 2503 O  O   . HOH I 6 .   ? 94.229  44.155 10.135  1.00 24.69  ? 2081 HOH A O   1 
HETATM 2504 O  O   . HOH I 6 .   ? 86.901  41.924 15.878  1.00 38.11  ? 2082 HOH A O   1 
HETATM 2505 O  O   . HOH I 6 .   ? 85.136  37.347 18.390  1.00 45.18  ? 2083 HOH A O   1 
HETATM 2506 O  O   . HOH I 6 .   ? 86.105  35.632 20.434  1.00 47.32  ? 2084 HOH A O   1 
HETATM 2507 O  O   . HOH I 6 .   ? 85.654  36.388 23.625  1.00 49.76  ? 2085 HOH A O   1 
HETATM 2508 O  O   . HOH I 6 .   ? 82.225  36.641 17.671  1.00 40.98  ? 2086 HOH A O   1 
HETATM 2509 O  O   . HOH I 6 .   ? 79.758  37.552 9.723   1.00 21.73  ? 2087 HOH A O   1 
HETATM 2510 O  O   . HOH I 6 .   ? 78.451  33.592 3.363   1.00 49.45  ? 2088 HOH A O   1 
HETATM 2511 O  O   . HOH I 6 .   ? 80.231  31.015 3.608   1.00 58.99  ? 2089 HOH A O   1 
HETATM 2512 O  O   . HOH I 6 .   ? 81.118  32.199 0.544   1.00 51.20  ? 2090 HOH A O   1 
HETATM 2513 O  O   . HOH I 6 .   ? 77.664  35.984 -0.314  1.00 56.13  ? 2091 HOH A O   1 
HETATM 2514 O  O   . HOH I 6 .   ? 77.875  38.344 -1.622  1.00 45.53  ? 2092 HOH A O   1 
HETATM 2515 O  O   . HOH I 6 .   ? 80.844  36.033 -6.917  1.00 53.65  ? 2093 HOH A O   1 
HETATM 2516 O  O   . HOH I 6 .   ? 84.436  35.299 -6.639  1.00 43.93  ? 2094 HOH A O   1 
HETATM 2517 O  O   . HOH I 6 .   ? 89.533  38.585 -6.649  1.00 45.35  ? 2095 HOH A O   1 
HETATM 2518 O  O   . HOH I 6 .   ? 91.207  43.275 -8.815  1.00 48.70  ? 2096 HOH A O   1 
HETATM 2519 O  O   . HOH I 6 .   ? 86.800  46.484 -10.974 1.00 57.82  ? 2097 HOH A O   1 
HETATM 2520 O  O   . HOH I 6 .   ? 88.795  47.473 -12.714 1.00 54.33  ? 2098 HOH A O   1 
HETATM 2521 O  O   . HOH I 6 .   ? 84.848  44.024 -8.061  1.00 52.19  ? 2099 HOH A O   1 
HETATM 2522 O  O   . HOH I 6 .   ? 81.803  42.846 -8.903  1.00 69.67  ? 2100 HOH A O   1 
HETATM 2523 O  O   . HOH I 6 .   ? 79.660  44.659 -7.369  1.00 61.60  ? 2101 HOH A O   1 
HETATM 2524 O  O   . HOH I 6 .   ? 80.646  47.579 -7.726  1.00 52.54  ? 2102 HOH A O   1 
HETATM 2525 O  O   . HOH I 6 .   ? 78.005  47.536 -7.651  1.00 47.77  ? 2103 HOH A O   1 
HETATM 2526 O  O   . HOH I 6 .   ? 75.651  46.537 -6.585  1.00 51.71  ? 2104 HOH A O   1 
HETATM 2527 O  O   . HOH I 6 .   ? 73.800  48.114 -5.564  1.00 31.55  ? 2105 HOH A O   1 
HETATM 2528 O  O   . HOH I 6 .   ? 71.282  47.575 -6.925  1.00 48.34  ? 2106 HOH A O   1 
HETATM 2529 O  O   . HOH I 6 .   ? 66.200  53.015 -6.696  1.00 43.41  ? 2107 HOH A O   1 
HETATM 2530 O  O   . HOH I 6 .   ? 59.128  54.552 1.938   1.00 54.70  ? 2108 HOH A O   1 
HETATM 2531 O  O   . HOH I 6 .   ? 62.499  53.783 2.373   1.00 38.87  ? 2109 HOH A O   1 
HETATM 2532 O  O   . HOH I 6 .   ? 61.618  48.182 6.808   1.00 36.65  ? 2110 HOH A O   1 
HETATM 2533 O  O   . HOH I 6 .   ? 60.450  42.310 3.545   1.00 36.69  ? 2111 HOH A O   1 
HETATM 2534 O  O   . HOH I 6 .   ? 71.143  39.707 5.384   1.00 24.89  ? 2112 HOH A O   1 
HETATM 2535 O  O   . HOH I 6 .   ? 73.261  38.356 4.499   1.00 24.19  ? 2113 HOH A O   1 
HETATM 2536 O  O   . HOH I 6 .   ? 70.965  41.943 7.184   1.00 23.45  ? 2114 HOH A O   1 
HETATM 2537 O  O   . HOH I 6 .   ? 80.789  45.936 8.310   1.00 25.55  ? 2115 HOH A O   1 
HETATM 2538 O  O   . HOH I 6 .   ? 76.868  51.320 12.873  1.00 26.07  ? 2116 HOH A O   1 
HETATM 2539 O  O   . HOH I 6 .   ? 73.448  50.460 13.503  1.00 24.07  ? 2117 HOH A O   1 
HETATM 2540 O  O   . HOH I 6 .   ? 82.878  51.528 17.640  1.00 28.84  ? 2118 HOH A O   1 
HETATM 2541 O  O   . HOH I 6 .   ? 84.284  50.459 19.453  1.00 33.23  ? 2119 HOH A O   1 
HETATM 2542 O  O   . HOH I 6 .   ? 84.439  54.136 19.061  1.00 38.34  ? 2120 HOH A O   1 
HETATM 2543 O  O   . HOH I 6 .   ? 85.482  56.554 18.036  1.00 41.83  ? 2121 HOH A O   1 
HETATM 2544 O  O   . HOH I 6 .   ? 92.585  58.811 18.706  1.00 56.71  ? 2122 HOH A O   1 
HETATM 2545 O  O   . HOH I 6 .   ? 93.647  56.368 14.889  1.00 34.71  ? 2123 HOH A O   1 
HETATM 2546 O  O   . HOH I 6 .   ? 94.447  58.708 14.157  1.00 44.58  ? 2124 HOH A O   1 
HETATM 2547 O  O   . HOH I 6 .   ? 96.651  57.837 11.662  1.00 31.05  ? 2125 HOH A O   1 
HETATM 2548 O  O   . HOH I 6 .   ? 97.711  57.396 15.027  1.00 47.89  ? 2126 HOH A O   1 
HETATM 2549 O  O   . HOH I 6 .   ? 98.440  55.084 16.284  1.00 58.40  ? 2127 HOH A O   1 
HETATM 2550 O  O   . HOH I 6 .   ? 97.736  50.773 13.073  1.00 32.07  ? 2128 HOH A O   1 
HETATM 2551 O  O   . HOH I 6 .   ? 97.174  47.990 14.466  1.00 39.09  ? 2129 HOH A O   1 
HETATM 2552 O  O   . HOH I 6 .   ? 94.756  47.016 21.788  1.00 58.00  ? 2130 HOH A O   1 
HETATM 2553 O  O   . HOH I 6 .   ? 94.015  44.261 21.476  1.00 40.00  ? 2131 HOH A O   1 
HETATM 2554 O  O   . HOH I 6 .   ? 90.690  51.054 26.198  1.00 50.29  ? 2132 HOH A O   1 
HETATM 2555 O  O   . HOH I 6 .   ? 90.645  57.001 23.576  1.00 44.71  ? 2133 HOH A O   1 
HETATM 2556 O  O   . HOH I 6 .   ? 86.285  57.166 29.394  1.00 45.84  ? 2134 HOH A O   1 
HETATM 2557 O  O   . HOH I 6 .   ? 83.001  65.042 15.518  1.00 41.62  ? 2135 HOH A O   1 
HETATM 2558 O  O   . HOH I 6 .   ? 80.234  66.102 13.490  1.00 45.81  ? 2136 HOH A O   1 
HETATM 2559 O  O   . HOH I 6 .   ? 79.115  67.384 10.270  1.00 44.04  ? 2137 HOH A O   1 
HETATM 2560 O  O   . HOH I 6 .   ? 80.804  66.995 7.807   1.00 32.57  ? 2138 HOH A O   1 
HETATM 2561 O  O   . HOH I 6 .   ? 85.261  65.770 4.084   1.00 26.45  ? 2139 HOH A O   1 
HETATM 2562 O  O   . HOH I 6 .   ? 90.050  60.456 5.361   1.00 42.72  ? 2140 HOH A O   1 
HETATM 2563 O  O   . HOH I 6 .   ? 93.451  62.184 3.527   1.00 35.60  ? 2141 HOH A O   1 
HETATM 2564 O  O   . HOH I 6 .   ? 94.392  66.909 3.742   1.00 54.80  ? 2142 HOH A O   1 
HETATM 2565 O  O   . HOH I 6 .   ? 100.495 61.288 3.289   1.00 40.70  ? 2143 HOH A O   1 
HETATM 2566 O  O   . HOH I 6 .   ? 100.248 60.610 -2.933  1.00 41.28  ? 2144 HOH A O   1 
HETATM 2567 O  O   . HOH I 6 .   ? 99.899  54.806 -1.089  1.00 61.48  ? 2145 HOH A O   1 
HETATM 2568 O  O   . HOH I 6 .   ? 97.365  54.983 -1.760  1.00 52.49  ? 2146 HOH A O   1 
HETATM 2569 O  O   . HOH I 6 .   ? 100.356 54.644 2.415   1.00 28.36  ? 2147 HOH A O   1 
HETATM 2570 O  O   . HOH I 6 .   ? 92.147  51.750 -2.397  1.00 38.60  ? 2148 HOH A O   1 
HETATM 2571 O  O   . HOH I 6 .   ? 91.299  50.514 -4.552  1.00 44.99  ? 2149 HOH A O   1 
HETATM 2572 O  O   . HOH I 6 .   ? 89.821  48.359 -4.047  1.00 37.48  ? 2150 HOH A O   1 
HETATM 2573 O  O   . HOH I 6 .   ? 90.954  49.480 0.038   1.00 39.18  ? 2151 HOH A O   1 
HETATM 2574 O  O   . HOH I 6 .   ? 91.674  53.115 -8.902  1.00 36.74  ? 2152 HOH A O   1 
HETATM 2575 O  O   . HOH I 6 .   ? 88.474  55.286 -12.793 1.00 50.16  ? 2153 HOH A O   1 
HETATM 2576 O  O   . HOH I 6 .   ? 83.314  56.803 -9.573  1.00 45.07  ? 2154 HOH A O   1 
HETATM 2577 O  O   . HOH I 6 .   ? 83.652  59.004 -8.001  1.00 52.02  ? 2155 HOH A O   1 
HETATM 2578 O  O   . HOH I 6 .   ? 85.193  60.233 -5.932  1.00 48.35  ? 2156 HOH A O   1 
HETATM 2579 O  O   . HOH I 6 .   ? 78.975  68.757 -1.433  1.00 56.95  ? 2157 HOH A O   1 
HETATM 2580 O  O   . HOH I 6 .   ? 72.992  64.195 -1.714  1.00 44.79  ? 2158 HOH A O   1 
HETATM 2581 O  O   . HOH I 6 .   ? 67.342  62.564 0.815   1.00 42.96  ? 2159 HOH A O   1 
HETATM 2582 O  O   . HOH I 6 .   ? 64.674  61.410 1.741   1.00 45.02  ? 2160 HOH A O   1 
HETATM 2583 O  O   . HOH I 6 .   ? 70.103  67.230 5.047   1.00 45.04  ? 2161 HOH A O   1 
HETATM 2584 O  O   . HOH I 6 .   ? 71.444  69.024 8.087   1.00 57.02  ? 2162 HOH A O   1 
HETATM 2585 O  O   . HOH I 6 .   ? 65.719  65.864 12.751  1.00 73.13  ? 2163 HOH A O   1 
HETATM 2586 O  O   . HOH I 6 .   ? 58.236  62.620 13.725  1.00 53.32  ? 2164 HOH A O   1 
HETATM 2587 O  O   . HOH I 6 .   ? 55.751  55.052 11.353  1.00 45.30  ? 2165 HOH A O   1 
HETATM 2588 O  O   . HOH I 6 .   ? 55.326  56.964 4.499   1.00 54.54  ? 2166 HOH A O   1 
HETATM 2589 O  O   . HOH I 6 .   ? 52.972  51.162 20.153  1.00 46.36  ? 2167 HOH A O   1 
HETATM 2590 O  O   . HOH I 6 .   ? 52.758  47.916 20.744  1.00 36.61  ? 2168 HOH A O   1 
HETATM 2591 O  O   . HOH I 6 .   ? 52.801  44.235 15.877  1.00 47.01  ? 2169 HOH A O   1 
HETATM 2592 O  O   . HOH I 6 .   ? 50.358  41.327 19.203  1.00 45.18  ? 2170 HOH A O   1 
HETATM 2593 O  O   . HOH I 6 .   ? 49.922  37.815 17.273  1.00 48.48  ? 2171 HOH A O   1 
HETATM 2594 O  O   . HOH I 6 .   ? 53.310  36.444 13.448  1.00 48.70  ? 2172 HOH A O   1 
HETATM 2595 O  O   . HOH I 6 .   ? 57.135  32.755 19.716  1.00 46.33  ? 2173 HOH A O   1 
HETATM 2596 O  O   . HOH I 6 .   ? 53.091  37.750 26.729  1.00 64.04  ? 2174 HOH A O   1 
HETATM 2597 O  O   . HOH I 6 .   ? 55.226  37.941 28.370  1.00 37.02  ? 2175 HOH A O   1 
HETATM 2598 O  O   . HOH I 6 .   ? 55.936  35.730 29.537  1.00 34.86  ? 2176 HOH A O   1 
HETATM 2599 O  O   . HOH I 6 .   ? 57.247  39.729 27.389  1.00 34.45  ? 2177 HOH A O   1 
HETATM 2600 O  O   . HOH I 6 .   ? 56.347  42.449 27.930  1.00 40.02  ? 2178 HOH A O   1 
HETATM 2601 O  O   . HOH I 6 .   ? 58.097  42.862 29.882  1.00 37.71  ? 2179 HOH A O   1 
HETATM 2602 O  O   . HOH I 6 .   ? 57.533  45.841 29.317  1.00 48.73  ? 2180 HOH A O   1 
HETATM 2603 O  O   . HOH I 6 .   ? 55.945  45.093 26.507  1.00 36.65  ? 2181 HOH A O   1 
HETATM 2604 O  O   . HOH I 6 .   ? 59.931  46.049 33.047  1.00 47.93  ? 2182 HOH A O   1 
HETATM 2605 O  O   . HOH I 6 .   ? 61.994  48.369 33.524  1.00 42.89  ? 2183 HOH A O   1 
HETATM 2606 O  O   . HOH I 6 .   ? 67.545  45.839 34.081  1.00 44.69  ? 2184 HOH A O   1 
HETATM 2607 O  O   . HOH I 6 .   ? 69.127  46.251 30.734  1.00 40.37  ? 2185 HOH A O   1 
HETATM 2608 O  O   . HOH I 6 .   ? 67.040  51.183 31.151  1.00 45.80  ? 2186 HOH A O   1 
HETATM 2609 O  O   . HOH I 6 .   ? 66.328  52.773 34.262  1.00 65.81  ? 2187 HOH A O   1 
HETATM 2610 O  O   . HOH I 6 .   ? 58.461  57.177 25.456  1.00 47.91  ? 2188 HOH A O   1 
HETATM 2611 O  O   . HOH I 6 .   ? 53.922  53.883 31.112  1.00 19.99  ? 2189 HOH A O   1 
HETATM 2612 O  O   . HOH I 6 .   ? 63.647  41.008 26.223  1.00 24.22  ? 2190 HOH A O   1 
HETATM 2613 O  O   . HOH I 6 .   ? 70.019  58.947 24.984  1.00 46.16  ? 2191 HOH A O   1 
HETATM 2614 O  O   . HOH I 6 .   ? 68.818  60.981 23.862  1.00 59.89  ? 2192 HOH A O   1 
HETATM 2615 O  O   . HOH I 6 .   ? 73.782  68.945 16.199  1.00 54.93  ? 2193 HOH A O   1 
HETATM 2616 O  O   . HOH I 6 .   ? 80.459  70.392 14.567  1.00 61.40  ? 2194 HOH A O   1 
HETATM 2617 O  O   . HOH I 6 .   ? 98.583  37.139 11.673  1.00 56.28  ? 2195 HOH A O   1 
HETATM 2618 O  O   . HOH I 6 .   ? 104.316 56.379 14.677  1.00 45.94  ? 2196 HOH A O   1 
HETATM 2619 O  O   . HOH I 6 .   ? 96.463  37.874 13.592  1.00 44.61  ? 2197 HOH A O   1 
HETATM 2620 O  O   . HOH I 6 .   ? 97.822  40.681 -0.095  1.00 56.56  ? 2198 HOH A O   1 
HETATM 2621 O  O   . HOH I 6 .   ? 88.442  37.172 1.166   1.00 40.72  ? 2199 HOH A O   1 
HETATM 2622 O  O   . HOH I 6 .   ? 77.738  40.527 -8.724  1.00 60.33  ? 2200 HOH A O   1 
HETATM 2623 O  O   . HOH I 6 .   ? 79.269  50.234 -9.211  1.00 47.20  ? 2201 HOH A O   1 
HETATM 2624 O  O   . HOH I 6 .   ? 70.096  29.861 5.469   1.00 45.72  ? 2202 HOH A O   1 
HETATM 2625 O  O   . HOH I 6 .   ? 61.057  22.061 18.328  1.00 63.60  ? 2203 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   ALA 2   2   ?   ?   ?   A . n 
A 1 3   ASP 3   3   ?   ?   ?   A . n 
A 1 4   LEU 4   4   ?   ?   ?   A . n 
A 1 5   ASP 5   5   ?   ?   ?   A . n 
A 1 6   LYS 6   6   6   LYS LYS A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   ASN 8   8   8   ASN ASN A . n 
A 1 9   ILE 9   9   9   ILE ILE A . n 
A 1 10  ASP 10  10  10  ASP ASP A . n 
A 1 11  SER 11  11  11  SER SER A . n 
A 1 12  ILE 12  12  12  ILE ILE A . n 
A 1 13  ILE 13  13  13  ILE ILE A . n 
A 1 14  GLN 14  14  14  GLN GLN A . n 
A 1 15  ARG 15  15  15  ARG ARG A . n 
A 1 16  LEU 16  16  16  LEU LEU A . n 
A 1 17  LEU 17  17  17  LEU LEU A . n 
A 1 18  GLU 18  18  18  GLU GLU A . n 
A 1 19  VAL 19  19  19  VAL VAL A . n 
A 1 20  ARG 20  20  20  ARG ARG A . n 
A 1 21  GLY 21  21  21  GLY GLY A . n 
A 1 22  SER 22  22  22  SER SER A . n 
A 1 23  LYS 23  23  23  LYS LYS A . n 
A 1 24  PRO 24  24  24  PRO PRO A . n 
A 1 25  GLY 25  25  25  GLY GLY A . n 
A 1 26  LYS 26  26  26  LYS LYS A . n 
A 1 27  ASN 27  27  27  ASN ASN A . n 
A 1 28  VAL 28  28  28  VAL VAL A . n 
A 1 29  GLN 29  29  29  GLN GLN A . n 
A 1 30  LEU 30  30  30  LEU LEU A . n 
A 1 31  GLN 31  31  31  GLN GLN A . n 
A 1 32  GLU 32  32  32  GLU GLU A . n 
A 1 33  ASN 33  33  33  ASN ASN A . n 
A 1 34  GLU 34  34  34  GLU GLU A . n 
A 1 35  ILE 35  35  35  ILE ILE A . n 
A 1 36  ARG 36  36  36  ARG ARG A . n 
A 1 37  GLY 37  37  37  GLY GLY A . n 
A 1 38  LEU 38  38  38  LEU LEU A . n 
A 1 39  CYS 39  39  39  CYS CYS A . n 
A 1 40  LEU 40  40  40  LEU LEU A . n 
A 1 41  LYS 41  41  41  LYS LYS A . n 
A 1 42  SER 42  42  42  SER SER A . n 
A 1 43  ARG 43  43  43  ARG ARG A . n 
A 1 44  GLU 44  44  44  GLU GLU A . n 
A 1 45  ILE 45  45  45  ILE ILE A . n 
A 1 46  PHE 46  46  46  PHE PHE A . n 
A 1 47  LEU 47  47  47  LEU LEU A . n 
A 1 48  SER 48  48  48  SER SER A . n 
A 1 49  GLN 49  49  49  GLN GLN A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  ILE 51  51  51  ILE ILE A . n 
A 1 52  LEU 52  52  52  LEU LEU A . n 
A 1 53  LEU 53  53  53  LEU LEU A . n 
A 1 54  GLU 54  54  54  GLU GLU A . n 
A 1 55  LEU 55  55  55  LEU LEU A . n 
A 1 56  GLU 56  56  56  GLU GLU A . n 
A 1 57  ALA 57  57  57  ALA ALA A . n 
A 1 58  PRO 58  58  58  PRO PRO A . n 
A 1 59  LEU 59  59  59  LEU LEU A . n 
A 1 60  LYS 60  60  60  LYS LYS A . n 
A 1 61  ILE 61  61  61  ILE ILE A . n 
A 1 62  CYS 62  62  62  CYS CYS A . n 
A 1 63  GLY 63  63  63  GLY GLY A . n 
A 1 64  ASP 64  64  64  ASP ASP A . n 
A 1 65  ILE 65  65  65  ILE ILE A . n 
A 1 66  HIS 66  66  66  HIS HIS A . n 
A 1 67  GLY 67  67  67  GLY GLY A . n 
A 1 68  GLN 68  68  68  GLN GLN A . n 
A 1 69  TYR 69  69  69  TYR TYR A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  ASP 71  71  71  ASP ASP A . n 
A 1 72  LEU 72  72  72  LEU LEU A . n 
A 1 73  LEU 73  73  73  LEU LEU A . n 
A 1 74  ARG 74  74  74  ARG ARG A . n 
A 1 75  LEU 75  75  75  LEU LEU A . n 
A 1 76  PHE 76  76  76  PHE PHE A . n 
A 1 77  GLU 77  77  77  GLU GLU A . n 
A 1 78  TYR 78  78  78  TYR TYR A . n 
A 1 79  GLY 79  79  79  GLY GLY A . n 
A 1 80  GLY 80  80  80  GLY GLY A . n 
A 1 81  PHE 81  81  81  PHE PHE A . n 
A 1 82  PRO 82  82  82  PRO PRO A . n 
A 1 83  PRO 83  83  83  PRO PRO A . n 
A 1 84  GLU 84  84  84  GLU GLU A . n 
A 1 85  SER 85  85  85  SER SER A . n 
A 1 86  ASN 86  86  86  ASN ASN A . n 
A 1 87  TYR 87  87  87  TYR TYR A . n 
A 1 88  LEU 88  88  88  LEU LEU A . n 
A 1 89  PHE 89  89  89  PHE PHE A . n 
A 1 90  LEU 90  90  90  LEU LEU A . n 
A 1 91  GLY 91  91  91  GLY GLY A . n 
A 1 92  ASP 92  92  92  ASP ASP A . n 
A 1 93  TYR 93  93  93  TYR TYR A . n 
A 1 94  VAL 94  94  94  VAL VAL A . n 
A 1 95  ASP 95  95  95  ASP ASP A . n 
A 1 96  ARG 96  96  96  ARG ARG A . n 
A 1 97  GLY 97  97  97  GLY GLY A . n 
A 1 98  LYS 98  98  98  LYS LYS A . n 
A 1 99  GLN 99  99  99  GLN GLN A . n 
A 1 100 SER 100 100 100 SER SER A . n 
A 1 101 LEU 101 101 101 LEU LEU A . n 
A 1 102 GLU 102 102 102 GLU GLU A . n 
A 1 103 THR 103 103 103 THR THR A . n 
A 1 104 ILE 104 104 104 ILE ILE A . n 
A 1 105 CYS 105 105 105 CYS CYS A . n 
A 1 106 LEU 106 106 106 LEU LEU A . n 
A 1 107 LEU 107 107 107 LEU LEU A . n 
A 1 108 LEU 108 108 108 LEU LEU A . n 
A 1 109 ALA 109 109 109 ALA ALA A . n 
A 1 110 TYR 110 110 110 TYR TYR A . n 
A 1 111 LYS 111 111 111 LYS LYS A . n 
A 1 112 ILE 112 112 112 ILE ILE A . n 
A 1 113 LYS 113 113 113 LYS LYS A . n 
A 1 114 TYR 114 114 114 TYR TYR A . n 
A 1 115 PRO 115 115 115 PRO PRO A . n 
A 1 116 GLU 116 116 116 GLU GLU A . n 
A 1 117 ASN 117 117 117 ASN ASN A . n 
A 1 118 PHE 118 118 118 PHE PHE A . n 
A 1 119 PHE 119 119 119 PHE PHE A . n 
A 1 120 LEU 120 120 120 LEU LEU A . n 
A 1 121 LEU 121 121 121 LEU LEU A . n 
A 1 122 ARG 122 122 122 ARG ARG A . n 
A 1 123 GLY 123 123 123 GLY GLY A . n 
A 1 124 ASN 124 124 124 ASN ASN A . n 
A 1 125 HIS 125 125 125 HIS HIS A . n 
A 1 126 GLU 126 126 126 GLU GLU A . n 
A 1 127 CYS 127 127 127 CYS CYS A . n 
A 1 128 ALA 128 128 128 ALA ALA A . n 
A 1 129 SER 129 129 129 SER SER A . n 
A 1 130 ILE 130 130 130 ILE ILE A . n 
A 1 131 ASN 131 131 131 ASN ASN A . n 
A 1 132 ARG 132 132 132 ARG ARG A . n 
A 1 133 ILE 133 133 133 ILE ILE A . n 
A 1 134 TYR 134 134 134 TYR TYR A . n 
A 1 135 GLY 135 135 135 GLY GLY A . n 
A 1 136 PHE 136 136 136 PHE PHE A . n 
A 1 137 TYR 137 137 137 TYR TYR A . n 
A 1 138 ASP 138 138 138 ASP ASP A . n 
A 1 139 GLU 139 139 139 GLU GLU A . n 
A 1 140 CYS 140 140 140 CYS CYS A . n 
A 1 141 LYS 141 141 141 LYS LYS A . n 
A 1 142 ARG 142 142 142 ARG ARG A . n 
A 1 143 ARG 143 143 143 ARG ARG A . n 
A 1 144 TYR 144 144 144 TYR TYR A . n 
A 1 145 ASN 145 145 145 ASN ASN A . n 
A 1 146 ILE 146 146 146 ILE ILE A . n 
A 1 147 LYS 147 147 147 LYS LYS A . n 
A 1 148 LEU 148 148 148 LEU LEU A . n 
A 1 149 TRP 149 149 149 TRP TRP A . n 
A 1 150 LYS 150 150 150 LYS LYS A . n 
A 1 151 THR 151 151 151 THR THR A . n 
A 1 152 PHE 152 152 152 PHE PHE A . n 
A 1 153 THR 153 153 153 THR THR A . n 
A 1 154 ASP 154 154 154 ASP ASP A . n 
A 1 155 CYS 155 155 155 CYS CYS A . n 
A 1 156 PHE 156 156 156 PHE PHE A . n 
A 1 157 ASN 157 157 157 ASN ASN A . n 
A 1 158 CYS 158 158 158 CYS CYS A . n 
A 1 159 LEU 159 159 159 LEU LEU A . n 
A 1 160 PRO 160 160 160 PRO PRO A . n 
A 1 161 ILE 161 161 161 ILE ILE A . n 
A 1 162 ALA 162 162 162 ALA ALA A . n 
A 1 163 ALA 163 163 163 ALA ALA A . n 
A 1 164 ILE 164 164 164 ILE ILE A . n 
A 1 165 VAL 165 165 165 VAL VAL A . n 
A 1 166 ASP 166 166 166 ASP ASP A . n 
A 1 167 GLU 167 167 167 GLU GLU A . n 
A 1 168 LYS 168 168 168 LYS LYS A . n 
A 1 169 ILE 169 169 169 ILE ILE A . n 
A 1 170 PHE 170 170 170 PHE PHE A . n 
A 1 171 CYS 171 171 171 CYS CYS A . n 
A 1 172 CYS 172 172 172 CYS CYS A . n 
A 1 173 HIS 173 173 173 HIS HIS A . n 
A 1 174 GLY 174 174 174 GLY GLY A . n 
A 1 175 GLY 175 175 175 GLY GLY A . n 
A 1 176 LEU 176 176 176 LEU LEU A . n 
A 1 177 SER 177 177 177 SER SER A . n 
A 1 178 PRO 178 178 178 PRO PRO A . n 
A 1 179 ASP 179 179 179 ASP ASP A . n 
A 1 180 LEU 180 180 180 LEU LEU A . n 
A 1 181 GLN 181 181 181 GLN GLN A . n 
A 1 182 SER 182 182 182 SER SER A . n 
A 1 183 MET 183 183 183 MET MET A . n 
A 1 184 GLU 184 184 184 GLU GLU A . n 
A 1 185 GLN 185 185 185 GLN GLN A . n 
A 1 186 ILE 186 186 186 ILE ILE A . n 
A 1 187 ARG 187 187 187 ARG ARG A . n 
A 1 188 ARG 188 188 188 ARG ARG A . n 
A 1 189 ILE 189 189 189 ILE ILE A . n 
A 1 190 MET 190 190 190 MET MET A . n 
A 1 191 ARG 191 191 191 ARG ARG A . n 
A 1 192 PRO 192 192 192 PRO PRO A . n 
A 1 193 THR 193 193 193 THR THR A . n 
A 1 194 ASP 194 194 194 ASP ASP A . n 
A 1 195 VAL 195 195 195 VAL VAL A . n 
A 1 196 PRO 196 196 196 PRO PRO A . n 
A 1 197 ASP 197 197 197 ASP ASP A . n 
A 1 198 GLN 198 198 198 GLN GLN A . n 
A 1 199 GLY 199 199 199 GLY GLY A . n 
A 1 200 LEU 200 200 200 LEU LEU A . n 
A 1 201 LEU 201 201 201 LEU LEU A . n 
A 1 202 CYS 202 202 202 CYS CYS A . n 
A 1 203 ASP 203 203 203 ASP ASP A . n 
A 1 204 LEU 204 204 204 LEU LEU A . n 
A 1 205 LEU 205 205 205 LEU LEU A . n 
A 1 206 TRP 206 206 206 TRP TRP A . n 
A 1 207 SER 207 207 207 SER SER A . n 
A 1 208 ASP 208 208 208 ASP ASP A . n 
A 1 209 PRO 209 209 209 PRO PRO A . n 
A 1 210 ASP 210 210 210 ASP ASP A . n 
A 1 211 LYS 211 211 211 LYS LYS A . n 
A 1 212 ASP 212 212 212 ASP ASP A . n 
A 1 213 VAL 213 213 213 VAL VAL A . n 
A 1 214 LEU 214 214 214 LEU LEU A . n 
A 1 215 GLY 215 215 215 GLY GLY A . n 
A 1 216 TRP 216 216 216 TRP TRP A . n 
A 1 217 GLY 217 217 217 GLY GLY A . n 
A 1 218 GLU 218 218 218 GLU GLU A . n 
A 1 219 ASN 219 219 219 ASN ASN A . n 
A 1 220 ASP 220 220 220 ASP ASP A . n 
A 1 221 ARG 221 221 221 ARG ARG A . n 
A 1 222 GLY 222 222 222 GLY GLY A . n 
A 1 223 VAL 223 223 223 VAL VAL A . n 
A 1 224 SER 224 224 224 SER SER A . n 
A 1 225 PHE 225 225 225 PHE PHE A . n 
A 1 226 THR 226 226 226 THR THR A . n 
A 1 227 PHE 227 227 227 PHE PHE A . n 
A 1 228 GLY 228 228 228 GLY GLY A . n 
A 1 229 ALA 229 229 229 ALA ALA A . n 
A 1 230 GLU 230 230 230 GLU GLU A . n 
A 1 231 VAL 231 231 231 VAL VAL A . n 
A 1 232 VAL 232 232 232 VAL VAL A . n 
A 1 233 ALA 233 233 233 ALA ALA A . n 
A 1 234 LYS 234 234 234 LYS LYS A . n 
A 1 235 PHE 235 235 235 PHE PHE A . n 
A 1 236 LEU 236 236 236 LEU LEU A . n 
A 1 237 HIS 237 237 237 HIS HIS A . n 
A 1 238 LYS 238 238 238 LYS LYS A . n 
A 1 239 HIS 239 239 239 HIS HIS A . n 
A 1 240 ASP 240 240 240 ASP ASP A . n 
A 1 241 LEU 241 241 241 LEU LEU A . n 
A 1 242 ASP 242 242 242 ASP ASP A . n 
A 1 243 LEU 243 243 243 LEU LEU A . n 
A 1 244 ILE 244 244 244 ILE ILE A . n 
A 1 245 CYS 245 245 245 CYS CYS A . n 
A 1 246 ARG 246 246 246 ARG ARG A . n 
A 1 247 ALA 247 247 247 ALA ALA A . n 
A 1 248 HIS 248 248 248 HIS HIS A . n 
A 1 249 GLN 249 249 249 GLN GLN A . n 
A 1 250 VAL 250 250 250 VAL VAL A . n 
A 1 251 VAL 251 251 251 VAL VAL A . n 
A 1 252 GLU 252 252 252 GLU GLU A . n 
A 1 253 ASP 253 253 253 ASP ASP A . n 
A 1 254 GLY 254 254 254 GLY GLY A . n 
A 1 255 TYR 255 255 255 TYR TYR A . n 
A 1 256 GLU 256 256 256 GLU GLU A . n 
A 1 257 PHE 257 257 257 PHE PHE A . n 
A 1 258 PHE 258 258 258 PHE PHE A . n 
A 1 259 ALA 259 259 259 ALA ALA A . n 
A 1 260 LYS 260 260 260 LYS LYS A . n 
A 1 261 ARG 261 261 261 ARG ARG A . n 
A 1 262 GLN 262 262 262 GLN GLN A . n 
A 1 263 LEU 263 263 263 LEU LEU A . n 
A 1 264 VAL 264 264 264 VAL VAL A . n 
A 1 265 THR 265 265 265 THR THR A . n 
A 1 266 LEU 266 266 266 LEU LEU A . n 
A 1 267 PHE 267 267 267 PHE PHE A . n 
A 1 268 SER 268 268 268 SER SER A . n 
A 1 269 ALA 269 269 269 ALA ALA A . n 
A 1 270 PRO 270 270 270 PRO PRO A . n 
A 1 271 ASN 271 271 271 ASN ASN A . n 
A 1 272 TYR 272 272 272 TYR TYR A . n 
A 1 273 CYS 273 273 273 CYS CYS A . n 
A 1 274 GLY 274 274 274 GLY GLY A . n 
A 1 275 GLU 275 275 275 GLU GLU A . n 
A 1 276 PHE 276 276 276 PHE PHE A . n 
A 1 277 ASP 277 277 277 ASP ASP A . n 
A 1 278 ASN 278 278 278 ASN ASN A . n 
A 1 279 ALA 279 279 279 ALA ALA A . n 
A 1 280 GLY 280 280 280 GLY GLY A . n 
A 1 281 ALA 281 281 281 ALA ALA A . n 
A 1 282 MET 282 282 282 MET MET A . n 
A 1 283 MET 283 283 283 MET MET A . n 
A 1 284 SER 284 284 284 SER SER A . n 
A 1 285 VAL 285 285 285 VAL VAL A . n 
A 1 286 ASP 286 286 286 ASP ASP A . n 
A 1 287 GLU 287 287 287 GLU GLU A . n 
A 1 288 THR 288 288 288 THR THR A . n 
A 1 289 LEU 289 289 289 LEU LEU A . n 
A 1 290 MET 290 290 290 MET MET A . n 
A 1 291 CYS 291 291 291 CYS CYS A . n 
A 1 292 SER 292 292 292 SER SER A . n 
A 1 293 PHE 293 293 293 PHE PHE A . n 
A 1 294 GLN 294 294 294 GLN GLN A . n 
A 1 295 ILE 295 295 295 ILE ILE A . n 
A 1 296 LEU 296 296 296 LEU LEU A . n 
A 1 297 LYS 297 297 297 LYS LYS A . n 
A 1 298 PRO 298 298 298 PRO PRO A . n 
A 1 299 ALA 299 299 299 ALA ALA A . n 
A 1 300 GLU 300 300 ?   ?   ?   A . n 
A 1 301 LYS 301 301 ?   ?   ?   A . n 
A 1 302 LYS 302 302 ?   ?   ?   A . n 
A 1 303 LYS 303 303 ?   ?   ?   A . n 
A 1 304 PRO 304 304 ?   ?   ?   A . n 
A 1 305 ASN 305 305 ?   ?   ?   A . n 
A 1 306 ALA 306 306 ?   ?   ?   A . n 
A 1 307 THR 307 307 ?   ?   ?   A . n 
A 1 308 ARG 308 308 ?   ?   ?   A . n 
A 1 309 PRO 309 309 ?   ?   ?   A . n 
A 1 310 VAL 310 310 ?   ?   ?   A . n 
A 1 311 THR 311 311 ?   ?   ?   A . n 
A 1 312 PRO 312 312 ?   ?   ?   A . n 
A 1 313 PRO 313 313 ?   ?   ?   A . n 
A 1 314 ARG 314 314 ?   ?   ?   A . n 
A 1 315 GLY 315 315 ?   ?   ?   A . n 
A 1 316 MET 316 316 ?   ?   ?   A . n 
A 1 317 ILE 317 317 ?   ?   ?   A . n 
A 1 318 THR 318 318 ?   ?   ?   A . n 
A 1 319 LYS 319 319 ?   ?   ?   A . n 
A 1 320 GLN 320 320 ?   ?   ?   A . n 
A 1 321 ALA 321 321 ?   ?   ?   A . n 
A 1 322 LYS 322 322 ?   ?   ?   A . n 
A 1 323 LYS 323 323 ?   ?   ?   A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 2058 ? I HOH . 
2 1 A HOH 2189 ? I HOH . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD2 ? A ASP 64  ? A ASP 64   ? 1_555 MN ? C MN . ? A MN 401 ? 1_555 OD2 ? A ASP 92  ? A ASP 92   ? 1_555 88.4  ? 
2  OD2 ? A ASP 64  ? A ASP 64   ? 1_555 MN ? C MN . ? A MN 401 ? 1_555 O   ? I HOH .   ? A HOH 2118 ? 1_555 125.0 ? 
3  OD2 ? A ASP 92  ? A ASP 92   ? 1_555 MN ? C MN . ? A MN 401 ? 1_555 O   ? I HOH .   ? A HOH 2118 ? 1_555 78.2  ? 
4  OD2 ? A ASP 64  ? A ASP 64   ? 1_555 MN ? C MN . ? A MN 401 ? 1_555 NE2 ? A HIS 66  ? A HIS 66   ? 1_555 102.1 ? 
5  OD2 ? A ASP 92  ? A ASP 92   ? 1_555 MN ? C MN . ? A MN 401 ? 1_555 NE2 ? A HIS 66  ? A HIS 66   ? 1_555 93.2  ? 
6  O   ? I HOH .   ? A HOH 2118 ? 1_555 MN ? C MN . ? A MN 401 ? 1_555 NE2 ? A HIS 66  ? A HIS 66   ? 1_555 131.5 ? 
7  OD2 ? A ASP 92  ? A ASP 92   ? 1_555 MN ? B MN . ? A MN 400 ? 1_555 OD1 ? A ASN 124 ? A ASN 124  ? 1_555 96.4  ? 
8  OD2 ? A ASP 92  ? A ASP 92   ? 1_555 MN ? B MN . ? A MN 400 ? 1_555 O   ? I HOH .   ? A HOH 2118 ? 1_555 85.7  ? 
9  OD1 ? A ASN 124 ? A ASN 124  ? 1_555 MN ? B MN . ? A MN 400 ? 1_555 O   ? I HOH .   ? A HOH 2118 ? 1_555 104.6 ? 
10 OD2 ? A ASP 92  ? A ASP 92   ? 1_555 MN ? B MN . ? A MN 400 ? 1_555 NE2 ? A HIS 173 ? A HIS 173  ? 1_555 86.9  ? 
11 OD1 ? A ASN 124 ? A ASN 124  ? 1_555 MN ? B MN . ? A MN 400 ? 1_555 NE2 ? A HIS 173 ? A HIS 173  ? 1_555 90.6  ? 
12 O   ? I HOH .   ? A HOH 2118 ? 1_555 MN ? B MN . ? A MN 400 ? 1_555 NE2 ? A HIS 173 ? A HIS 173  ? 1_555 163.6 ? 
13 OD2 ? A ASP 92  ? A ASP 92   ? 1_555 MN ? B MN . ? A MN 400 ? 1_555 ND1 ? A HIS 248 ? A HIS 248  ? 1_555 166.0 ? 
14 OD1 ? A ASN 124 ? A ASN 124  ? 1_555 MN ? B MN . ? A MN 400 ? 1_555 ND1 ? A HIS 248 ? A HIS 248  ? 1_555 97.2  ? 
15 O   ? I HOH .   ? A HOH 2118 ? 1_555 MN ? B MN . ? A MN 400 ? 1_555 ND1 ? A HIS 248 ? A HIS 248  ? 1_555 87.5  ? 
16 NE2 ? A HIS 173 ? A HIS 173  ? 1_555 MN ? B MN . ? A MN 400 ? 1_555 ND1 ? A HIS 248 ? A HIS 248  ? 1_555 96.4  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2001-08-15 
2 'Structure model' 1 1 2007-10-16 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' .   ? 1 
SCALEPACK 'data scaling'   .   ? 2 
AMoRE     phasing          .   ? 3 
CNS       refinement       1.0 ? 4 
# 
_pdbx_entry_details.entry_id             1JK7 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   
;The Okadaic Acid was obtained from 
DINOFLAGELLATE, PROROCENTRUM LIMA.
;
_pdbx_entry_details.sequence_details     ? 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     2057 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     2057 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   8_666 
_pdbx_validate_symm_contact.dist              1.38 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASP A 95  ? ? 79.09   155.74  
2  1 ARG A 96  ? ? 70.70   -54.54  
3  1 GLU A 126 ? ? -95.94  41.51   
4  1 TYR A 144 ? ? -136.36 -112.88 
5  1 GLU A 167 ? ? 54.95   17.42   
6  1 VAL A 195 ? ? -116.19 72.60   
7  1 SER A 224 ? ? 60.01   -151.90 
8  1 ALA A 247 ? ? -134.36 -121.76 
9  1 HIS A 248 ? ? 70.80   -34.30  
10 1 CYS A 273 ? ? 56.12   9.20    
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A ALA 2   ? A ALA 2   
3  1 Y 1 A ASP 3   ? A ASP 3   
4  1 Y 1 A LEU 4   ? A LEU 4   
5  1 Y 1 A ASP 5   ? A ASP 5   
6  1 Y 1 A GLU 300 ? A GLU 300 
7  1 Y 1 A LYS 301 ? A LYS 301 
8  1 Y 1 A LYS 302 ? A LYS 302 
9  1 Y 1 A LYS 303 ? A LYS 303 
10 1 Y 1 A PRO 304 ? A PRO 304 
11 1 Y 1 A ASN 305 ? A ASN 305 
12 1 Y 1 A ALA 306 ? A ALA 306 
13 1 Y 1 A THR 307 ? A THR 307 
14 1 Y 1 A ARG 308 ? A ARG 308 
15 1 Y 1 A PRO 309 ? A PRO 309 
16 1 Y 1 A VAL 310 ? A VAL 310 
17 1 Y 1 A THR 311 ? A THR 311 
18 1 Y 1 A PRO 312 ? A PRO 312 
19 1 Y 1 A PRO 313 ? A PRO 313 
20 1 Y 1 A ARG 314 ? A ARG 314 
21 1 Y 1 A GLY 315 ? A GLY 315 
22 1 Y 1 A MET 316 ? A MET 316 
23 1 Y 1 A ILE 317 ? A ILE 317 
24 1 Y 1 A THR 318 ? A THR 318 
25 1 Y 1 A LYS 319 ? A LYS 319 
26 1 Y 1 A GLN 320 ? A GLN 320 
27 1 Y 1 A ALA 321 ? A ALA 321 
28 1 Y 1 A LYS 322 ? A LYS 322 
29 1 Y 1 A LYS 323 ? A LYS 323 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MANGANESE (II) ION' MN  
3 'SULFATE ION'        SO4 
4 'OKADAIC ACID'       OKA 
5 BETA-MERCAPTOETHANOL BME 
6 water                HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 MN  1   400  400  MN  MN  A . 
C 2 MN  1   401  401  MN  MN  A . 
D 3 SO4 1   2022 2022 SO4 SO4 A . 
E 4 OKA 1   501  501  OKA OKA A . 
F 5 BME 1   2023 301  BME BME A . 
G 5 BME 1   2024 302  BME BME A . 
H 5 BME 1   2025 303  BME BME A . 
I 6 HOH 1   2026 1    HOH HOH A . 
I 6 HOH 2   2027 2    HOH HOH A . 
I 6 HOH 3   2028 3    HOH HOH A . 
I 6 HOH 4   2029 4    HOH HOH A . 
I 6 HOH 5   2030 5    HOH HOH A . 
I 6 HOH 6   2031 6    HOH HOH A . 
I 6 HOH 7   2032 7    HOH HOH A . 
I 6 HOH 8   2033 8    HOH HOH A . 
I 6 HOH 9   2034 9    HOH HOH A . 
I 6 HOH 10  2035 10   HOH HOH A . 
I 6 HOH 11  2036 11   HOH HOH A . 
I 6 HOH 12  2037 12   HOH HOH A . 
I 6 HOH 13  2038 13   HOH HOH A . 
I 6 HOH 14  2039 14   HOH HOH A . 
I 6 HOH 15  2040 15   HOH HOH A . 
I 6 HOH 16  2041 16   HOH HOH A . 
I 6 HOH 17  2042 17   HOH HOH A . 
I 6 HOH 18  2043 18   HOH HOH A . 
I 6 HOH 19  2044 19   HOH HOH A . 
I 6 HOH 20  2045 20   HOH HOH A . 
I 6 HOH 21  2046 21   HOH HOH A . 
I 6 HOH 22  2047 22   HOH HOH A . 
I 6 HOH 23  2048 23   HOH HOH A . 
I 6 HOH 24  2049 24   HOH HOH A . 
I 6 HOH 25  2050 25   HOH HOH A . 
I 6 HOH 26  2051 26   HOH HOH A . 
I 6 HOH 27  2052 27   HOH HOH A . 
I 6 HOH 28  2053 28   HOH HOH A . 
I 6 HOH 29  2054 29   HOH HOH A . 
I 6 HOH 30  2055 30   HOH HOH A . 
I 6 HOH 31  2056 31   HOH HOH A . 
I 6 HOH 32  2057 32   HOH HOH A . 
I 6 HOH 33  2058 33   HOH HOH A . 
I 6 HOH 34  2059 34   HOH HOH A . 
I 6 HOH 35  2060 35   HOH HOH A . 
I 6 HOH 36  2061 36   HOH HOH A . 
I 6 HOH 37  2062 37   HOH HOH A . 
I 6 HOH 38  2063 38   HOH HOH A . 
I 6 HOH 39  2064 39   HOH HOH A . 
I 6 HOH 40  2065 40   HOH HOH A . 
I 6 HOH 41  2066 41   HOH HOH A . 
I 6 HOH 42  2067 42   HOH HOH A . 
I 6 HOH 43  2068 43   HOH HOH A . 
I 6 HOH 44  2069 44   HOH HOH A . 
I 6 HOH 45  2070 45   HOH HOH A . 
I 6 HOH 46  2071 46   HOH HOH A . 
I 6 HOH 47  2072 47   HOH HOH A . 
I 6 HOH 48  2073 48   HOH HOH A . 
I 6 HOH 49  2074 49   HOH HOH A . 
I 6 HOH 50  2075 50   HOH HOH A . 
I 6 HOH 51  2076 51   HOH HOH A . 
I 6 HOH 52  2077 52   HOH HOH A . 
I 6 HOH 53  2078 53   HOH HOH A . 
I 6 HOH 54  2079 54   HOH HOH A . 
I 6 HOH 55  2080 55   HOH HOH A . 
I 6 HOH 56  2081 56   HOH HOH A . 
I 6 HOH 57  2082 58   HOH HOH A . 
I 6 HOH 58  2083 59   HOH HOH A . 
I 6 HOH 59  2084 60   HOH HOH A . 
I 6 HOH 60  2085 61   HOH HOH A . 
I 6 HOH 61  2086 62   HOH HOH A . 
I 6 HOH 62  2087 63   HOH HOH A . 
I 6 HOH 63  2088 64   HOH HOH A . 
I 6 HOH 64  2089 65   HOH HOH A . 
I 6 HOH 65  2090 66   HOH HOH A . 
I 6 HOH 66  2091 67   HOH HOH A . 
I 6 HOH 67  2092 68   HOH HOH A . 
I 6 HOH 68  2093 69   HOH HOH A . 
I 6 HOH 69  2094 70   HOH HOH A . 
I 6 HOH 70  2095 71   HOH HOH A . 
I 6 HOH 71  2096 72   HOH HOH A . 
I 6 HOH 72  2097 73   HOH HOH A . 
I 6 HOH 73  2098 74   HOH HOH A . 
I 6 HOH 74  2099 75   HOH HOH A . 
I 6 HOH 75  2100 76   HOH HOH A . 
I 6 HOH 76  2101 77   HOH HOH A . 
I 6 HOH 77  2102 78   HOH HOH A . 
I 6 HOH 78  2103 79   HOH HOH A . 
I 6 HOH 79  2104 80   HOH HOH A . 
I 6 HOH 80  2105 81   HOH HOH A . 
I 6 HOH 81  2106 82   HOH HOH A . 
I 6 HOH 82  2107 83   HOH HOH A . 
I 6 HOH 83  2108 85   HOH HOH A . 
I 6 HOH 84  2109 86   HOH HOH A . 
I 6 HOH 85  2110 87   HOH HOH A . 
I 6 HOH 86  2111 88   HOH HOH A . 
I 6 HOH 87  2112 90   HOH HOH A . 
I 6 HOH 88  2113 91   HOH HOH A . 
I 6 HOH 89  2114 92   HOH HOH A . 
I 6 HOH 90  2115 93   HOH HOH A . 
I 6 HOH 91  2116 94   HOH HOH A . 
I 6 HOH 92  2117 95   HOH HOH A . 
I 6 HOH 93  2118 96   HOH HOH A . 
I 6 HOH 94  2119 97   HOH HOH A . 
I 6 HOH 95  2120 98   HOH HOH A . 
I 6 HOH 96  2121 99   HOH HOH A . 
I 6 HOH 97  2122 100  HOH HOH A . 
I 6 HOH 98  2123 101  HOH HOH A . 
I 6 HOH 99  2124 102  HOH HOH A . 
I 6 HOH 100 2125 103  HOH HOH A . 
I 6 HOH 101 2126 104  HOH HOH A . 
I 6 HOH 102 2127 105  HOH HOH A . 
I 6 HOH 103 2128 106  HOH HOH A . 
I 6 HOH 104 2129 107  HOH HOH A . 
I 6 HOH 105 2130 108  HOH HOH A . 
I 6 HOH 106 2131 109  HOH HOH A . 
I 6 HOH 107 2132 110  HOH HOH A . 
I 6 HOH 108 2133 111  HOH HOH A . 
I 6 HOH 109 2134 112  HOH HOH A . 
I 6 HOH 110 2135 113  HOH HOH A . 
I 6 HOH 111 2136 114  HOH HOH A . 
I 6 HOH 112 2137 115  HOH HOH A . 
I 6 HOH 113 2138 116  HOH HOH A . 
I 6 HOH 114 2139 117  HOH HOH A . 
I 6 HOH 115 2140 118  HOH HOH A . 
I 6 HOH 116 2141 119  HOH HOH A . 
I 6 HOH 117 2142 120  HOH HOH A . 
I 6 HOH 118 2143 121  HOH HOH A . 
I 6 HOH 119 2144 122  HOH HOH A . 
I 6 HOH 120 2145 123  HOH HOH A . 
I 6 HOH 121 2146 124  HOH HOH A . 
I 6 HOH 122 2147 125  HOH HOH A . 
I 6 HOH 123 2148 126  HOH HOH A . 
I 6 HOH 124 2149 127  HOH HOH A . 
I 6 HOH 125 2150 128  HOH HOH A . 
I 6 HOH 126 2151 129  HOH HOH A . 
I 6 HOH 127 2152 130  HOH HOH A . 
I 6 HOH 128 2153 131  HOH HOH A . 
I 6 HOH 129 2154 132  HOH HOH A . 
I 6 HOH 130 2155 133  HOH HOH A . 
I 6 HOH 131 2156 134  HOH HOH A . 
I 6 HOH 132 2157 135  HOH HOH A . 
I 6 HOH 133 2158 136  HOH HOH A . 
I 6 HOH 134 2159 137  HOH HOH A . 
I 6 HOH 135 2160 138  HOH HOH A . 
I 6 HOH 136 2161 139  HOH HOH A . 
I 6 HOH 137 2162 140  HOH HOH A . 
I 6 HOH 138 2163 141  HOH HOH A . 
I 6 HOH 139 2164 142  HOH HOH A . 
I 6 HOH 140 2165 143  HOH HOH A . 
I 6 HOH 141 2166 144  HOH HOH A . 
I 6 HOH 142 2167 145  HOH HOH A . 
I 6 HOH 143 2168 146  HOH HOH A . 
I 6 HOH 144 2169 147  HOH HOH A . 
I 6 HOH 145 2170 148  HOH HOH A . 
I 6 HOH 146 2171 149  HOH HOH A . 
I 6 HOH 147 2172 150  HOH HOH A . 
I 6 HOH 148 2173 151  HOH HOH A . 
I 6 HOH 149 2174 152  HOH HOH A . 
I 6 HOH 150 2175 153  HOH HOH A . 
I 6 HOH 151 2176 154  HOH HOH A . 
I 6 HOH 152 2177 155  HOH HOH A . 
I 6 HOH 153 2178 156  HOH HOH A . 
I 6 HOH 154 2179 157  HOH HOH A . 
I 6 HOH 155 2180 158  HOH HOH A . 
I 6 HOH 156 2181 159  HOH HOH A . 
I 6 HOH 157 2182 160  HOH HOH A . 
I 6 HOH 158 2183 161  HOH HOH A . 
I 6 HOH 159 2184 162  HOH HOH A . 
I 6 HOH 160 2185 163  HOH HOH A . 
I 6 HOH 161 2186 164  HOH HOH A . 
I 6 HOH 162 2187 165  HOH HOH A . 
I 6 HOH 163 2188 166  HOH HOH A . 
I 6 HOH 164 2189 167  HOH HOH A . 
I 6 HOH 165 2190 168  HOH HOH A . 
I 6 HOH 166 2191 169  HOH HOH A . 
I 6 HOH 167 2192 170  HOH HOH A . 
I 6 HOH 168 2193 171  HOH HOH A . 
I 6 HOH 169 2194 172  HOH HOH A . 
I 6 HOH 170 2195 173  HOH HOH A . 
I 6 HOH 171 2196 174  HOH HOH A . 
I 6 HOH 172 2197 175  HOH HOH A . 
I 6 HOH 173 2198 176  HOH HOH A . 
I 6 HOH 174 2199 177  HOH HOH A . 
I 6 HOH 175 2200 178  HOH HOH A . 
I 6 HOH 176 2201 179  HOH HOH A . 
I 6 HOH 177 2202 180  HOH HOH A . 
I 6 HOH 178 2203 181  HOH HOH A . 
#