data_1JKO
# 
_entry.id   1JKO 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1JKO         
NDB   PD0234       
RCSB  RCSB013882   
WWPDB D_1000013882 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1HCR 
;Native wild-type Hin recombinase DNA-binding domain bound to underivatized 
hixL half-site.
;
unspecified 
PDB 1IJW 'FORM1 BR18 DERIVATIVE'                                                                       unspecified 
PDB 1JJ6 'FORM1 I5 DERIVATIVE'                                                                         unspecified 
PDB 1JJ8 'FORM2 I4 DERIVATIVE'                                                                         unspecified 
PDB 1JKP 'FORM1 T11G MUTANT'                                                                           unspecified 
PDB 1JKQ 'FORM1 G9T MUTANT'                                                                            unspecified 
PDB 1JKR 'FORM1 T11C MUTANT'                                                                           unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1JKO 
_pdbx_database_status.recvd_initial_deposition_date   2001-07-12 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Chiu, T.K.'      1 
'Sohn, C.'        2 
'Johnson, R.C.'   3 
'Dickerson, R.E.' 4 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Testing water-mediated DNA recognition by the Hin recombinase.' 'EMBO J.' 21  801 814 2002 EMJODG UK 0261-4189 0897 ? 
11847127 10.1093/emboj/21.4.801 
1       
'How Hin Recombinase, FIS and Cations Bind DNA. Chapter 4. Water-Mediated Sequence-Specific Recognition by Hin Recombinase' Thesis 
?   145 241 2001 ?      ?  ?         ?    ? ?        ?                      
2       'Hin Recombinase Bound to DNA: The Origin of Specificity in Major and Minor Groove Interactions' Science   263 348 355 
1994 SCIEAS US 0036-8075 0038 ? ?        ?                      
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Chiu, T.K.'      1 
primary 'Sohn, C.'        2 
primary 'Dickerson, R.E.' 3 
primary 'Johnson, R.C.'   4 
1       'Chiu, T.K.'      5 
2       'Feng, J.A.'      6 
2       'Johnson, R.C.'   7 
2       'Dickerson, R.E.' 8 
# 
_cell.entry_id           1JKO 
_cell.length_a           85.612 
_cell.length_b           81.996 
_cell.length_c           43.734 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1JKO 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn "5'-D(*TP*GP*TP*TP*TP*TP*TP*GP*GP*TP*AP*AP*GP*A)-3'" 4340.835 1  ? ? ?                     ? 
2 polymer     syn "5'-D(*AP*TP*CP*TP*TP*AP*CP*CP*AP*AP*AP*AP*AP*C)-3'" 4216.795 1  ? ? ?                     ? 
3 polymer     syn 'DNA-INVERTASE HIN'                                  6047.051 1  ? ? 'RESIDUES 139 TO 190' ? 
4 non-polymer syn 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL             122.143  1  ? ? ?                     ? 
5 water       nat water                                                18.015   13 ? ? ?                     ? 
# 
_entity_name_com.entity_id   3 
_entity_name_com.name        'Hin Recombinase' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DT)(DG)(DT)(DT)(DT)(DT)(DT)(DG)(DG)(DT)(DA)(DA)(DG)(DA)' TGTTTTTGGTAAGA A ? 
2 polydeoxyribonucleotide no no '(DA)(DT)(DC)(DT)(DT)(DA)(DC)(DC)(DA)(DA)(DA)(DA)(DA)(DC)' ATCTTACCAAAAAC B ? 
3 'polypeptide(L)'        no no GRPRAINKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASSIKKRMN       
GRPRAINKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASSIKKRMN C ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  DT  n 
1 2  DG  n 
1 3  DT  n 
1 4  DT  n 
1 5  DT  n 
1 6  DT  n 
1 7  DT  n 
1 8  DG  n 
1 9  DG  n 
1 10 DT  n 
1 11 DA  n 
1 12 DA  n 
1 13 DG  n 
1 14 DA  n 
2 1  DA  n 
2 2  DT  n 
2 3  DC  n 
2 4  DT  n 
2 5  DT  n 
2 6  DA  n 
2 7  DC  n 
2 8  DC  n 
2 9  DA  n 
2 10 DA  n 
2 11 DA  n 
2 12 DA  n 
2 13 DA  n 
2 14 DC  n 
3 1  GLY n 
3 2  ARG n 
3 3  PRO n 
3 4  ARG n 
3 5  ALA n 
3 6  ILE n 
3 7  ASN n 
3 8  LYS n 
3 9  HIS n 
3 10 GLU n 
3 11 GLN n 
3 12 GLU n 
3 13 GLN n 
3 14 ILE n 
3 15 SER n 
3 16 ARG n 
3 17 LEU n 
3 18 LEU n 
3 19 GLU n 
3 20 LYS n 
3 21 GLY n 
3 22 HIS n 
3 23 PRO n 
3 24 ARG n 
3 25 GLN n 
3 26 GLN n 
3 27 LEU n 
3 28 ALA n 
3 29 ILE n 
3 30 ILE n 
3 31 PHE n 
3 32 GLY n 
3 33 ILE n 
3 34 GLY n 
3 35 VAL n 
3 36 SER n 
3 37 THR n 
3 38 LEU n 
3 39 TYR n 
3 40 ARG n 
3 41 TYR n 
3 42 PHE n 
3 43 PRO n 
3 44 ALA n 
3 45 SER n 
3 46 SER n 
3 47 ILE n 
3 48 LYS n 
3 49 LYS n 
3 50 ARG n 
3 51 MET n 
3 52 ASN n 
# 
_pdbx_entity_src_syn.entity_id              3 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'SYNTHETIC PEPTIDE' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP HIN_SALTY 3 GRPRAINKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASSIKKRMN 139 P03013 ? 
2 PDB 1JKO      1 ?                                                    ?   1JKO   ? 
3 PDB 1JKO      2 ?                                                    ?   1JKO   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1JKO C 1 ? 52 ? P03013 139 ? 190 ? 139 190 
2 2 1JKO A 1 ? 14 ? 1JKO   2   ? 15  ? 2   15  
3 3 1JKO B 1 ? 14 ? 1JKO   16  ? 29  ? 16  29  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                  ?             'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                 ?             'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                               ?             'C4 H8 N2 O3'     132.118 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"     ?             'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"      ?             'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"     ?             'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"             ?             'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                                ?             'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                          ?             'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                  ?             'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                                ?             'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                    ?             'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                               ?             'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                  ?             'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                   ?             'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                               ?             'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                            ?             'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                  ?             'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                   ?             'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                                ?             'C4 H9 N O3'      119.119 
TRS non-polymer         . 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL 'TRIS BUFFER' 'C4 H12 N O3 1'   122.143 
TYR 'L-peptide linking' y TYROSINE                                 ?             'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                   ?             'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1JKO 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.65 
_exptl_crystal.density_percent_sol   51.74 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.50 
_exptl_crystal_grow.pdbx_details    
;HANGING DROP VAPOR DIFFUSION AT 4C, 
WITH INITIAL CONCENTRATION IN DROP OF 0.10 MM DNA,           
0.06 MM HIN, 10 MM HEPES (PH 7.5), 5 MM CACL2, 
13 MM NACL, 2.8% V/V PEG400, AND 1.56 MM NA CACODYLATE.                  
RESERVOIR SOLUTION CONTAINS 100 MM HEPES (PH 7.5), 
50 MM CACL2, AND 25% PEG400. CONCENTRATION OF                
PEG400 IN RESERVOIR SOLUTION WAS INCREASED IN 5%                    
INCREMENTS TO 35%., pH 7.50, VAPOR DIFFUSION, HANGING DROP
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.details 
1 1  1 DNA                 ? ? ? 
1 2  1 HIN                 ? ? ? 
1 3  1 HEPES               ? ? ? 
1 4  1 CaCl2               ? ? ? 
1 5  1 NaCl                ? ? ? 
1 6  1 'PEG 400'           ? ? ? 
1 7  1 'sodium cacodylate' ? ? ? 
1 8  2 HEPES               ? ? ? 
1 9  2 CaCl2               ? ? ? 
1 10 2 'PEG 400'           ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'MAR scanner 300 mm plate' 
_diffrn_detector.pdbx_collection_date   1997-09-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             
'MOLECULAR REPLACEMENT WITH 1IJW HAVING THE PROPER DNA SUBSTITUTIONS AS THE STARTING MODEL.' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.100 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X25' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X25 
_diffrn_source.pdbx_wavelength             1.100 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1JKO 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             14.00 
_reflns.d_resolution_high            2.24 
_reflns.number_obs                   6235 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         81.27 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.0680000 
_reflns.pdbx_netI_over_sigmaI        19.70 
_reflns.B_iso_Wilson_estimate        67.00 
_reflns.pdbx_redundancy              15.00 
_reflns.R_free_details               ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.24 
_reflns_shell.d_res_low              2.34 
_reflns_shell.percent_possible_all   50.80 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.2150000 
_reflns_shell.meanI_over_sigI_obs    2.10 
_reflns_shell.pdbx_redundancy        1.49 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1JKO 
_refine.ls_number_reflns_obs                     6235 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             14.00 
_refine.ls_d_res_high                            2.24 
_refine.ls_percent_reflns_obs                    81.27 
_refine.ls_R_factor_obs                          0.2439000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2439000 
_refine.ls_R_factor_R_free                       0.3057000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 8.21 
_refine.ls_number_reflns_R_free                  630 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               64.00 
_refine.aniso_B[1][1]                            19.38 
_refine.aniso_B[2][2]                            2.14 
_refine.aniso_B[3][3]                            -21.52 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 0.40 
_refine.solvent_model_param_bsol                 100.00 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1IJW 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ANISOTROPIC_FIXED_ISOTROPIC 
_refine.pdbx_stereochemistry_target_values       MLF 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           10000.00 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1JKO 
_refine_analyze.Luzzati_coordinate_error_obs    0.47 
_refine_analyze.Luzzati_sigma_a_obs             0.74 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.41 
_refine_analyze.Luzzati_sigma_a_free            0.73 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        323 
_refine_hist.pdbx_number_atoms_nucleic_acid   568 
_refine_hist.pdbx_number_atoms_ligand         8 
_refine_hist.number_atoms_solvent             13 
_refine_hist.number_atoms_total               912 
_refine_hist.d_res_high                       2.24 
_refine_hist.d_res_low                        14.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.007  ?     ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?      ?     ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?      ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?      ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?      ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?      ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.251  ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?      ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?      ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      19.443 ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?      ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?      ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      1.489  ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?      ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?      ?     ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             4.09   4.000 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            6.22   6.000 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             6.10   6.000 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            9.24   7.000 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   8 
_refine_ls_shell.d_res_high                       2.24 
_refine_ls_shell.d_res_low                        2.34 
_refine_ls_shell.number_reflns_R_work             432 
_refine_ls_shell.R_factor_R_work                  0.4660000 
_refine_ls_shell.percent_reflns_obs               50.80 
_refine_ls_shell.R_factor_R_free                  0.4314000 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            4.50 
_refine_ls_shell.number_reflns_R_free             42 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 DNA-RNA_REP.PARAM DNA-RNA.TOP 'X-RAY DIFFRACTION' 
3 WATER_REP.PARAM   WATER.TOP   'X-RAY DIFFRACTION' 
4 ION.PARAM         ION.TOP     'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1JKO 
_struct.title                     'Testing the Water-Mediated HIN Recombinase DNA Recognition by Systematic Mutations' 
_struct.pdbx_descriptor           'HIN RECOMBINASE/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1JKO 
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN/DNA' 
_struct_keywords.text            
'WATER-MEDIATED RECOGNITION, PROTEIN-DNA COMPLEX, HIN RECOMBINASE, A10G MUTANT, DNA BINDING PROTEIN-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 5 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 HIS C 9  ? LYS C 20 ? HIS C 147 LYS C 158 1 ? 12 
HELX_P HELX_P2 2 PRO C 23 ? ILE C 30 ? PRO C 161 ILE C 168 1 ? 8  
HELX_P HELX_P3 3 GLY C 34 ? PHE C 42 ? GLY C 172 PHE C 180 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? A DG 2  N1 ? ? ? 1_555 B DC 14 N3 ? ? A DG 3  B DC 29 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2  hydrog ? ? A DG 2  N2 ? ? ? 1_555 B DC 14 O2 ? ? A DG 3  B DC 29 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3  hydrog ? ? A DG 2  O6 ? ? ? 1_555 B DC 14 N4 ? ? A DG 3  B DC 29 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4  hydrog ? ? A DT 3  N3 ? ? ? 1_555 B DA 13 N1 ? ? A DT 4  B DA 28 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5  hydrog ? ? A DT 3  O4 ? ? ? 1_555 B DA 13 N6 ? ? A DT 4  B DA 28 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6  hydrog ? ? A DT 4  N3 ? ? ? 1_555 B DA 12 N1 ? ? A DT 5  B DA 27 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7  hydrog ? ? A DT 4  O4 ? ? ? 1_555 B DA 12 N6 ? ? A DT 5  B DA 27 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8  hydrog ? ? A DT 5  N3 ? ? ? 1_555 B DA 11 N1 ? ? A DT 6  B DA 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9  hydrog ? ? A DT 5  O4 ? ? ? 1_555 B DA 11 N6 ? ? A DT 6  B DA 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10 hydrog ? ? A DT 6  N3 ? ? ? 1_555 B DA 10 N1 ? ? A DT 7  B DA 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11 hydrog ? ? A DT 6  O4 ? ? ? 1_555 B DA 10 N6 ? ? A DT 7  B DA 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12 hydrog ? ? A DT 7  N3 ? ? ? 1_555 B DA 9  N1 ? ? A DT 8  B DA 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13 hydrog ? ? A DT 7  O4 ? ? ? 1_555 B DA 9  N6 ? ? A DT 8  B DA 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14 hydrog ? ? A DG 8  N1 ? ? ? 1_555 B DC 8  N3 ? ? A DG 9  B DC 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog15 hydrog ? ? A DG 8  N2 ? ? ? 1_555 B DC 8  O2 ? ? A DG 9  B DC 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16 hydrog ? ? A DG 8  O6 ? ? ? 1_555 B DC 8  N4 ? ? A DG 9  B DC 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17 hydrog ? ? A DG 9  N1 ? ? ? 1_555 B DC 7  N3 ? ? A DG 10 B DC 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18 hydrog ? ? A DG 9  N2 ? ? ? 1_555 B DC 7  O2 ? ? A DG 10 B DC 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19 hydrog ? ? A DG 9  O6 ? ? ? 1_555 B DC 7  N4 ? ? A DG 10 B DC 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20 hydrog ? ? A DT 10 N3 ? ? ? 1_555 B DA 6  N1 ? ? A DT 11 B DA 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21 hydrog ? ? A DT 10 O4 ? ? ? 1_555 B DA 6  N6 ? ? A DT 11 B DA 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22 hydrog ? ? A DA 11 N1 ? ? ? 1_555 B DT 5  N3 ? ? A DA 12 B DT 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23 hydrog ? ? A DA 11 N6 ? ? ? 1_555 B DT 5  O4 ? ? A DA 12 B DT 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog24 hydrog ? ? A DA 12 N1 ? ? ? 1_555 B DT 4  N3 ? ? A DA 13 B DT 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog25 hydrog ? ? A DA 12 N6 ? ? ? 1_555 B DT 4  O4 ? ? A DA 13 B DT 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog26 hydrog ? ? A DG 13 N1 ? ? ? 1_555 B DC 3  N3 ? ? A DG 14 B DC 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog27 hydrog ? ? A DG 13 N2 ? ? ? 1_555 B DC 3  O2 ? ? A DG 14 B DC 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog28 hydrog ? ? A DG 13 O6 ? ? ? 1_555 B DC 3  N4 ? ? A DG 14 B DC 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    3 
_struct_site.details              'BINDING SITE FOR RESIDUE TRS A 204' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 3 DG A 8  ? DG A 9  . ? 1_555 ? 
2 AC1 3 DG A 9  ? DG A 10 . ? 1_555 ? 
3 AC1 3 DA B 10 ? DA B 25 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1JKO 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1JKO 
_atom_sites.fract_transf_matrix[1][1]   0.011681 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012196 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.022865 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   O "O5'" . DT  A 1 1  ? -0.493 33.942 5.974  1.00 110.00 ? 2   DT  A "O5'" 1 
ATOM   2   C "C5'" . DT  A 1 1  ? -0.141 32.565 5.811  1.00 109.73 ? 2   DT  A "C5'" 1 
ATOM   3   C "C4'" . DT  A 1 1  ? 0.143  31.879 7.128  1.00 109.16 ? 2   DT  A "C4'" 1 
ATOM   4   O "O4'" . DT  A 1 1  ? 0.124  30.445 6.927  1.00 106.12 ? 2   DT  A "O4'" 1 
ATOM   5   C "C3'" . DT  A 1 1  ? 1.499  32.196 7.760  1.00 105.87 ? 2   DT  A "C3'" 1 
ATOM   6   O "O3'" . DT  A 1 1  ? 1.360  32.218 9.191  1.00 105.63 ? 2   DT  A "O3'" 1 
ATOM   7   C "C2'" . DT  A 1 1  ? 2.373  31.049 7.282  1.00 105.20 ? 2   DT  A "C2'" 1 
ATOM   8   C "C1'" . DT  A 1 1  ? 1.399  29.881 7.218  1.00 99.19  ? 2   DT  A "C1'" 1 
ATOM   9   N N1    . DT  A 1 1  ? 1.697  28.901 6.158  1.00 88.61  ? 2   DT  A N1    1 
ATOM   10  C C2    . DT  A 1 1  ? 1.335  27.587 6.358  1.00 84.51  ? 2   DT  A C2    1 
ATOM   11  O O2    . DT  A 1 1  ? 0.822  27.185 7.390  1.00 82.39  ? 2   DT  A O2    1 
ATOM   12  N N3    . DT  A 1 1  ? 1.594  26.758 5.301  1.00 84.77  ? 2   DT  A N3    1 
ATOM   13  C C4    . DT  A 1 1  ? 2.170  27.103 4.093  1.00 85.82  ? 2   DT  A C4    1 
ATOM   14  O O4    . DT  A 1 1  ? 2.316  26.251 3.219  1.00 88.05  ? 2   DT  A O4    1 
ATOM   15  C C5    . DT  A 1 1  ? 2.554  28.491 3.966  1.00 85.75  ? 2   DT  A C5    1 
ATOM   16  C C7    . DT  A 1 1  ? 3.209  28.954 2.704  1.00 87.30  ? 2   DT  A C7    1 
ATOM   17  C C6    . DT  A 1 1  ? 2.303  29.307 4.991  1.00 85.26  ? 2   DT  A C6    1 
ATOM   18  P P     . DG  A 1 2  ? 2.631  31.924 10.144 1.00 110.00 ? 3   DG  A P     1 
ATOM   19  O OP1   . DG  A 1 2  ? 2.558  32.900 11.267 1.00 109.12 ? 3   DG  A OP1   1 
ATOM   20  O OP2   . DG  A 1 2  ? 3.893  31.797 9.361  1.00 110.00 ? 3   DG  A OP2   1 
ATOM   21  O "O5'" . DG  A 1 2  ? 2.297  30.503 10.774 1.00 98.51  ? 3   DG  A "O5'" 1 
ATOM   22  C "C5'" . DG  A 1 2  ? 1.218  30.361 11.696 1.00 85.98  ? 3   DG  A "C5'" 1 
ATOM   23  C "C4'" . DG  A 1 2  ? 1.496  29.212 12.629 1.00 74.97  ? 3   DG  A "C4'" 1 
ATOM   24  O "O4'" . DG  A 1 2  ? 1.455  27.978 11.874 1.00 71.20  ? 3   DG  A "O4'" 1 
ATOM   25  C "C3'" . DG  A 1 2  ? 2.893  29.289 13.234 1.00 71.81  ? 3   DG  A "C3'" 1 
ATOM   26  O "O3'" . DG  A 1 2  ? 2.878  28.753 14.561 1.00 76.72  ? 3   DG  A "O3'" 1 
ATOM   27  C "C2'" . DG  A 1 2  ? 3.718  28.438 12.290 1.00 75.54  ? 3   DG  A "C2'" 1 
ATOM   28  C "C1'" . DG  A 1 2  ? 2.732  27.368 11.858 1.00 65.76  ? 3   DG  A "C1'" 1 
ATOM   29  N N9    . DG  A 1 2  ? 2.982  26.870 10.507 1.00 60.96  ? 3   DG  A N9    1 
ATOM   30  C C8    . DG  A 1 2  ? 3.485  27.581 9.440  1.00 59.18  ? 3   DG  A C8    1 
ATOM   31  N N7    . DG  A 1 2  ? 3.667  26.844 8.374  1.00 59.52  ? 3   DG  A N7    1 
ATOM   32  C C5    . DG  A 1 2  ? 3.242  25.575 8.753  1.00 55.29  ? 3   DG  A C5    1 
ATOM   33  C C6    . DG  A 1 2  ? 3.221  24.366 8.023  1.00 50.04  ? 3   DG  A C6    1 
ATOM   34  O O6    . DG  A 1 2  ? 3.573  24.170 6.844  1.00 48.04  ? 3   DG  A O6    1 
ATOM   35  N N1    . DG  A 1 2  ? 2.730  23.311 8.793  1.00 47.16  ? 3   DG  A N1    1 
ATOM   36  C C2    . DG  A 1 2  ? 2.301  23.417 10.102 1.00 52.18  ? 3   DG  A C2    1 
ATOM   37  N N2    . DG  A 1 2  ? 1.866  22.295 10.692 1.00 50.56  ? 3   DG  A N2    1 
ATOM   38  N N3    . DG  A 1 2  ? 2.304  24.545 10.785 1.00 57.17  ? 3   DG  A N3    1 
ATOM   39  C C4    . DG  A 1 2  ? 2.796  25.576 10.057 1.00 57.35  ? 3   DG  A C4    1 
ATOM   40  P P     . DT  A 1 3  ? 4.260  28.486 15.327 1.00 82.36  ? 4   DT  A P     1 
ATOM   41  O OP1   . DT  A 1 3  ? 4.249  29.195 16.627 1.00 81.30  ? 4   DT  A OP1   1 
ATOM   42  O OP2   . DT  A 1 3  ? 5.370  28.720 14.361 1.00 78.14  ? 4   DT  A OP2   1 
ATOM   43  O "O5'" . DT  A 1 3  ? 4.170  26.946 15.687 1.00 77.25  ? 4   DT  A "O5'" 1 
ATOM   44  C "C5'" . DT  A 1 3  ? 2.981  26.420 16.265 1.00 60.94  ? 4   DT  A "C5'" 1 
ATOM   45  C "C4'" . DT  A 1 3  ? 3.098  24.921 16.382 1.00 57.09  ? 4   DT  A "C4'" 1 
ATOM   46  O "O4'" . DT  A 1 3  ? 3.193  24.342 15.052 1.00 46.81  ? 4   DT  A "O4'" 1 
ATOM   47  C "C3'" . DT  A 1 3  ? 4.370  24.507 17.111 1.00 56.60  ? 4   DT  A "C3'" 1 
ATOM   48  O "O3'" . DT  A 1 3  ? 4.093  23.356 17.906 1.00 65.84  ? 4   DT  A "O3'" 1 
ATOM   49  C "C2'" . DT  A 1 3  ? 5.332  24.187 15.979 1.00 56.48  ? 4   DT  A "C2'" 1 
ATOM   50  C "C1'" . DT  A 1 3  ? 4.398  23.627 14.919 1.00 45.98  ? 4   DT  A "C1'" 1 
ATOM   51  N N1    . DT  A 1 3  ? 4.867  23.767 13.529 1.00 45.57  ? 4   DT  A N1    1 
ATOM   52  C C2    . DT  A 1 3  ? 4.866  22.628 12.756 1.00 46.59  ? 4   DT  A C2    1 
ATOM   53  O O2    . DT  A 1 3  ? 4.494  21.548 13.179 1.00 50.11  ? 4   DT  A O2    1 
ATOM   54  N N3    . DT  A 1 3  ? 5.344  22.792 11.477 1.00 41.08  ? 4   DT  A N3    1 
ATOM   55  C C4    . DT  A 1 3  ? 5.838  23.953 10.924 1.00 44.57  ? 4   DT  A C4    1 
ATOM   56  O O4    . DT  A 1 3  ? 6.275  23.954 9.776  1.00 45.61  ? 4   DT  A O4    1 
ATOM   57  C C5    . DT  A 1 3  ? 5.801  25.110 11.781 1.00 41.99  ? 4   DT  A C5    1 
ATOM   58  C C7    . DT  A 1 3  ? 6.305  26.404 11.237 1.00 45.43  ? 4   DT  A C7    1 
ATOM   59  C C6    . DT  A 1 3  ? 5.313  24.972 13.025 1.00 43.42  ? 4   DT  A C6    1 
ATOM   60  P P     . DT  A 1 4  ? 5.261  22.706 18.789 1.00 63.46  ? 5   DT  A P     1 
ATOM   61  O OP1   . DT  A 1 4  ? 4.715  22.207 20.087 1.00 64.13  ? 5   DT  A OP1   1 
ATOM   62  O OP2   . DT  A 1 4  ? 6.374  23.705 18.786 1.00 71.72  ? 5   DT  A OP2   1 
ATOM   63  O "O5'" . DT  A 1 4  ? 5.659  21.404 17.972 1.00 59.12  ? 5   DT  A "O5'" 1 
ATOM   64  C "C5'" . DT  A 1 4  ? 4.733  20.345 17.858 1.00 59.61  ? 5   DT  A "C5'" 1 
ATOM   65  C "C4'" . DT  A 1 4  ? 5.315  19.221 17.037 1.00 64.79  ? 5   DT  A "C4'" 1 
ATOM   66  O "O4'" . DT  A 1 4  ? 5.562  19.633 15.669 1.00 67.30  ? 5   DT  A "O4'" 1 
ATOM   67  C "C3'" . DT  A 1 4  ? 6.636  18.679 17.564 1.00 60.98  ? 5   DT  A "C3'" 1 
ATOM   68  O "O3'" . DT  A 1 4  ? 6.560  17.260 17.551 1.00 68.24  ? 5   DT  A "O3'" 1 
ATOM   69  C "C2'" . DT  A 1 4  ? 7.665  19.192 16.568 1.00 61.25  ? 5   DT  A "C2'" 1 
ATOM   70  C "C1'" . DT  A 1 4  ? 6.864  19.239 15.282 1.00 54.77  ? 5   DT  A "C1'" 1 
ATOM   71  N N1    . DT  A 1 4  ? 7.349  20.195 14.260 1.00 51.66  ? 5   DT  A N1    1 
ATOM   72  C C2    . DT  A 1 4  ? 7.394  19.762 12.951 1.00 50.19  ? 5   DT  A C2    1 
ATOM   73  O O2    . DT  A 1 4  ? 6.971  18.664 12.597 1.00 46.55  ? 5   DT  A O2    1 
ATOM   74  N N3    . DT  A 1 4  ? 7.937  20.668 12.061 1.00 48.80  ? 5   DT  A N3    1 
ATOM   75  C C4    . DT  A 1 4  ? 8.402  21.939 12.345 1.00 49.82  ? 5   DT  A C4    1 
ATOM   76  O O4    . DT  A 1 4  ? 8.901  22.622 11.444 1.00 58.56  ? 5   DT  A O4    1 
ATOM   77  C C5    . DT  A 1 4  ? 8.262  22.352 13.741 1.00 47.23  ? 5   DT  A C5    1 
ATOM   78  C C7    . DT  A 1 4  ? 8.681  23.731 14.148 1.00 38.95  ? 5   DT  A C7    1 
ATOM   79  C C6    . DT  A 1 4  ? 7.755  21.466 14.607 1.00 51.24  ? 5   DT  A C6    1 
ATOM   80  P P     . DT  A 1 5  ? 7.446  16.415 18.581 1.00 76.52  ? 6   DT  A P     1 
ATOM   81  O OP1   . DT  A 1 5  ? 6.549  15.456 19.267 1.00 76.13  ? 6   DT  A OP1   1 
ATOM   82  O OP2   . DT  A 1 5  ? 8.251  17.373 19.390 1.00 70.61  ? 6   DT  A OP2   1 
ATOM   83  O "O5'" . DT  A 1 5  ? 8.366  15.586 17.587 1.00 73.31  ? 6   DT  A "O5'" 1 
ATOM   84  C "C5'" . DT  A 1 5  ? 7.768  14.928 16.473 1.00 79.90  ? 6   DT  A "C5'" 1 
ATOM   85  C "C4'" . DT  A 1 5  ? 8.806  14.625 15.423 1.00 75.87  ? 6   DT  A "C4'" 1 
ATOM   86  O "O4'" . DT  A 1 5  ? 9.083  15.768 14.575 1.00 73.52  ? 6   DT  A "O4'" 1 
ATOM   87  C "C3'" . DT  A 1 5  ? 10.142 14.201 16.020 1.00 81.69  ? 6   DT  A "C3'" 1 
ATOM   88  O "O3'" . DT  A 1 5  ? 10.608 13.052 15.315 1.00 89.22  ? 6   DT  A "O3'" 1 
ATOM   89  C "C2'" . DT  A 1 5  ? 11.038 15.414 15.787 1.00 76.06  ? 6   DT  A "C2'" 1 
ATOM   90  C "C1'" . DT  A 1 5  ? 10.486 15.947 14.479 1.00 59.92  ? 6   DT  A "C1'" 1 
ATOM   91  N N1    . DT  A 1 5  ? 10.765 17.367 14.138 1.00 44.87  ? 6   DT  A N1    1 
ATOM   92  C C2    . DT  A 1 5  ? 10.838 17.685 12.789 1.00 44.52  ? 6   DT  A C2    1 
ATOM   93  O O2    . DT  A 1 5  ? 10.673 16.861 11.896 1.00 47.90  ? 6   DT  A O2    1 
ATOM   94  N N3    . DT  A 1 5  ? 11.110 19.000 12.518 1.00 38.69  ? 6   DT  A N3    1 
ATOM   95  C C4    . DT  A 1 5  ? 11.306 20.015 13.432 1.00 34.49  ? 6   DT  A C4    1 
ATOM   96  O O4    . DT  A 1 5  ? 11.563 21.163 13.033 1.00 37.72  ? 6   DT  A O4    1 
ATOM   97  C C5    . DT  A 1 5  ? 11.189 19.619 14.830 1.00 32.48  ? 6   DT  A C5    1 
ATOM   98  C C7    . DT  A 1 5  ? 11.323 20.664 15.884 1.00 30.77  ? 6   DT  A C7    1 
ATOM   99  C C6    . DT  A 1 5  ? 10.944 18.329 15.106 1.00 36.12  ? 6   DT  A C6    1 
ATOM   100 P P     . DT  A 1 6  ? 11.685 12.082 15.999 1.00 89.54  ? 7   DT  A P     1 
ATOM   101 O OP1   . DT  A 1 6  ? 11.018 10.781 16.262 1.00 86.80  ? 7   DT  A OP1   1 
ATOM   102 O OP2   . DT  A 1 6  ? 12.345 12.808 17.118 1.00 94.56  ? 7   DT  A OP2   1 
ATOM   103 O "O5'" . DT  A 1 6  ? 12.717 11.886 14.813 1.00 78.17  ? 7   DT  A "O5'" 1 
ATOM   104 C "C5'" . DT  A 1 6  ? 12.226 11.746 13.490 1.00 75.36  ? 7   DT  A "C5'" 1 
ATOM   105 C "C4'" . DT  A 1 6  ? 13.176 12.385 12.509 1.00 77.49  ? 7   DT  A "C4'" 1 
ATOM   106 O "O4'" . DT  A 1 6  ? 13.088 13.839 12.575 1.00 70.08  ? 7   DT  A "O4'" 1 
ATOM   107 C "C3'" . DT  A 1 6  ? 14.651 12.013 12.711 1.00 72.20  ? 7   DT  A "C3'" 1 
ATOM   108 O "O3'" . DT  A 1 6  ? 15.171 11.519 11.479 1.00 67.64  ? 7   DT  A "O3'" 1 
ATOM   109 C "C2'" . DT  A 1 6  ? 15.306 13.328 13.098 1.00 74.77  ? 7   DT  A "C2'" 1 
ATOM   110 C "C1'" . DT  A 1 6  ? 14.390 14.369 12.462 1.00 68.49  ? 7   DT  A "C1'" 1 
ATOM   111 N N1    . DT  A 1 6  ? 14.428 15.698 13.120 1.00 61.62  ? 7   DT  A N1    1 
ATOM   112 C C2    . DT  A 1 6  ? 14.504 16.811 12.311 1.00 60.01  ? 7   DT  A C2    1 
ATOM   113 O O2    . DT  A 1 6  ? 14.427 16.758 11.087 1.00 57.73  ? 7   DT  A O2    1 
ATOM   114 N N3    . DT  A 1 6  ? 14.660 17.997 12.986 1.00 54.11  ? 7   DT  A N3    1 
ATOM   115 C C4    . DT  A 1 6  ? 14.719 18.183 14.353 1.00 55.00  ? 7   DT  A C4    1 
ATOM   116 O O4    . DT  A 1 6  ? 14.898 19.318 14.814 1.00 57.08  ? 7   DT  A O4    1 
ATOM   117 C C5    . DT  A 1 6  ? 14.574 16.988 15.143 1.00 54.21  ? 7   DT  A C5    1 
ATOM   118 C C7    . DT  A 1 6  ? 14.587 17.100 16.635 1.00 57.00  ? 7   DT  A C7    1 
ATOM   119 C C6    . DT  A 1 6  ? 14.433 15.818 14.497 1.00 57.63  ? 7   DT  A C6    1 
ATOM   120 P P     . DT  A 1 7  ? 16.747 11.232 11.308 1.00 62.25  ? 8   DT  A P     1 
ATOM   121 O OP1   . DT  A 1 7  ? 16.807 9.943  10.575 1.00 58.32  ? 8   DT  A OP1   1 
ATOM   122 O OP2   . DT  A 1 7  ? 17.479 11.384 12.608 1.00 51.82  ? 8   DT  A OP2   1 
ATOM   123 O "O5'" . DT  A 1 7  ? 17.108 12.340 10.225 1.00 57.05  ? 8   DT  A "O5'" 1 
ATOM   124 C "C5'" . DT  A 1 7  ? 16.191 12.519 9.138  1.00 53.44  ? 8   DT  A "C5'" 1 
ATOM   125 C "C4'" . DT  A 1 7  ? 16.686 13.538 8.143  1.00 53.05  ? 8   DT  A "C4'" 1 
ATOM   126 O "O4'" . DT  A 1 7  ? 16.576 14.882 8.675  1.00 52.49  ? 8   DT  A "O4'" 1 
ATOM   127 C "C3'" . DT  A 1 7  ? 18.130 13.343 7.707  1.00 46.35  ? 8   DT  A "C3'" 1 
ATOM   128 O "O3'" . DT  A 1 7  ? 18.227 13.467 6.291  1.00 46.34  ? 8   DT  A "O3'" 1 
ATOM   129 C "C2'" . DT  A 1 7  ? 18.876 14.455 8.432  1.00 50.27  ? 8   DT  A "C2'" 1 
ATOM   130 C "C1'" . DT  A 1 7  ? 17.829 15.551 8.632  1.00 42.89  ? 8   DT  A "C1'" 1 
ATOM   131 N N1    . DT  A 1 7  ? 17.968 16.303 9.911  1.00 33.79  ? 8   DT  A N1    1 
ATOM   132 C C2    . DT  A 1 7  ? 18.074 17.681 9.876  1.00 32.67  ? 8   DT  A C2    1 
ATOM   133 O O2    . DT  A 1 7  ? 18.113 18.320 8.824  1.00 35.18  ? 8   DT  A O2    1 
ATOM   134 N N3    . DT  A 1 7  ? 18.152 18.286 11.117 1.00 30.86  ? 8   DT  A N3    1 
ATOM   135 C C4    . DT  A 1 7  ? 18.145 17.652 12.350 1.00 40.90  ? 8   DT  A C4    1 
ATOM   136 O O4    . DT  A 1 7  ? 18.202 18.310 13.403 1.00 45.94  ? 8   DT  A O4    1 
ATOM   137 C C5    . DT  A 1 7  ? 18.074 16.229 12.304 1.00 40.48  ? 8   DT  A C5    1 
ATOM   138 C C7    . DT  A 1 7  ? 18.125 15.476 13.594 1.00 48.60  ? 8   DT  A C7    1 
ATOM   139 C C6    . DT  A 1 7  ? 17.983 15.628 11.108 1.00 36.70  ? 8   DT  A C6    1 
ATOM   140 P P     . DG  A 1 8  ? 19.624 13.183 5.593  1.00 55.61  ? 9   DG  A P     1 
ATOM   141 O OP1   . DG  A 1 8  ? 19.530 12.904 4.119  1.00 45.90  ? 9   DG  A OP1   1 
ATOM   142 O OP2   . DG  A 1 8  ? 20.247 12.173 6.493  1.00 53.41  ? 9   DG  A OP2   1 
ATOM   143 O "O5'" . DG  A 1 8  ? 20.375 14.570 5.774  1.00 64.72  ? 9   DG  A "O5'" 1 
ATOM   144 C "C5'" . DG  A 1 8  ? 20.112 15.670 4.917  1.00 58.35  ? 9   DG  A "C5'" 1 
ATOM   145 C "C4'" . DG  A 1 8  ? 21.150 16.739 5.153  1.00 50.94  ? 9   DG  A "C4'" 1 
ATOM   146 O "O4'" . DG  A 1 8  ? 21.045 17.224 6.515  1.00 49.02  ? 9   DG  A "O4'" 1 
ATOM   147 C "C3'" . DG  A 1 8  ? 22.585 16.233 5.027  1.00 45.55  ? 9   DG  A "C3'" 1 
ATOM   148 O "O3'" . DG  A 1 8  ? 23.394 17.300 4.583  1.00 59.45  ? 9   DG  A "O3'" 1 
ATOM   149 C "C2'" . DG  A 1 8  ? 22.965 15.944 6.467  1.00 39.30  ? 9   DG  A "C2'" 1 
ATOM   150 C "C1'" . DG  A 1 8  ? 22.300 17.100 7.161  1.00 33.66  ? 9   DG  A "C1'" 1 
ATOM   151 N N9    . DG  A 1 8  ? 22.059 16.864 8.573  1.00 33.64  ? 9   DG  A N9    1 
ATOM   152 C C8    . DG  A 1 8  ? 21.920 15.642 9.179  1.00 31.17  ? 9   DG  A C8    1 
ATOM   153 N N7    . DG  A 1 8  ? 21.753 15.734 10.479 1.00 37.84  ? 9   DG  A N7    1 
ATOM   154 C C5    . DG  A 1 8  ? 21.762 17.096 10.742 1.00 34.22  ? 9   DG  A C5    1 
ATOM   155 C C6    . DG  A 1 8  ? 21.573 17.792 11.967 1.00 44.10  ? 9   DG  A C6    1 
ATOM   156 O O6    . DG  A 1 8  ? 21.311 17.335 13.079 1.00 53.70  ? 9   DG  A O6    1 
ATOM   157 N N1    . DG  A 1 8  ? 21.686 19.169 11.803 1.00 43.38  ? 9   DG  A N1    1 
ATOM   158 C C2    . DG  A 1 8  ? 21.914 19.795 10.603 1.00 47.94  ? 9   DG  A C2    1 
ATOM   159 N N2    . DG  A 1 8  ? 22.026 21.123 10.674 1.00 55.05  ? 9   DG  A N2    1 
ATOM   160 N N3    . DG  A 1 8  ? 22.029 19.156 9.426  1.00 37.92  ? 9   DG  A N3    1 
ATOM   161 C C4    . DG  A 1 8  ? 21.952 17.816 9.580  1.00 34.89  ? 9   DG  A C4    1 
ATOM   162 P P     . DG  A 1 9  ? 24.461 17.047 3.433  1.00 71.58  ? 10  DG  A P     1 
ATOM   163 O OP1   . DG  A 1 9  ? 23.739 16.777 2.163  1.00 66.28  ? 10  DG  A OP1   1 
ATOM   164 O OP2   . DG  A 1 9  ? 25.407 16.038 3.974  1.00 74.57  ? 10  DG  A OP2   1 
ATOM   165 O "O5'" . DG  A 1 9  ? 25.193 18.453 3.314  1.00 66.47  ? 10  DG  A "O5'" 1 
ATOM   166 C "C5'" . DG  A 1 9  ? 24.448 19.652 3.143  1.00 58.94  ? 10  DG  A "C5'" 1 
ATOM   167 C "C4'" . DG  A 1 9  ? 25.091 20.781 3.914  1.00 58.79  ? 10  DG  A "C4'" 1 
ATOM   168 O "O4'" . DG  A 1 9  ? 24.843 20.633 5.334  1.00 59.25  ? 10  DG  A "O4'" 1 
ATOM   169 C "C3'" . DG  A 1 9  ? 26.604 20.917 3.755  1.00 56.98  ? 10  DG  A "C3'" 1 
ATOM   170 O "O3'" . DG  A 1 9  ? 26.913 22.300 3.595  1.00 62.02  ? 10  DG  A "O3'" 1 
ATOM   171 C "C2'" . DG  A 1 9  ? 27.160 20.364 5.062  1.00 52.03  ? 10  DG  A "C2'" 1 
ATOM   172 C "C1'" . DG  A 1 9  ? 26.055 20.641 6.081  1.00 47.96  ? 10  DG  A "C1'" 1 
ATOM   173 N N9    . DG  A 1 9  ? 25.916 19.609 7.102  1.00 43.78  ? 10  DG  A N9    1 
ATOM   174 C C8    . DG  A 1 9  ? 25.940 18.251 6.883  1.00 50.35  ? 10  DG  A C8    1 
ATOM   175 N N7    . DG  A 1 9  ? 25.711 17.548 7.962  1.00 46.36  ? 10  DG  A N7    1 
ATOM   176 C C5    . DG  A 1 9  ? 25.548 18.492 8.956  1.00 40.62  ? 10  DG  A C5    1 
ATOM   177 C C6    . DG  A 1 9  ? 25.257 18.321 10.321 1.00 43.31  ? 10  DG  A C6    1 
ATOM   178 O O6    . DG  A 1 9  ? 25.076 17.277 10.934 1.00 45.22  ? 10  DG  A O6    1 
ATOM   179 N N1    . DG  A 1 9  ? 25.170 19.540 10.987 1.00 41.02  ? 10  DG  A N1    1 
ATOM   180 C C2    . DG  A 1 9  ? 25.347 20.762 10.403 1.00 42.80  ? 10  DG  A C2    1 
ATOM   181 N N2    . DG  A 1 9  ? 25.268 21.801 11.237 1.00 45.25  ? 10  DG  A N2    1 
ATOM   182 N N3    . DG  A 1 9  ? 25.596 20.945 9.107  1.00 40.90  ? 10  DG  A N3    1 
ATOM   183 C C4    . DG  A 1 9  ? 25.685 19.775 8.449  1.00 40.60  ? 10  DG  A C4    1 
ATOM   184 P P     . DT  A 1 10 ? 28.437 22.770 3.503  1.00 66.08  ? 11  DT  A P     1 
ATOM   185 O OP1   . DT  A 1 10 ? 28.412 24.153 2.973  1.00 67.37  ? 11  DT  A OP1   1 
ATOM   186 O OP2   . DT  A 1 10 ? 29.216 21.719 2.794  1.00 67.86  ? 11  DT  A OP2   1 
ATOM   187 O "O5'" . DT  A 1 10 ? 28.913 22.784 5.021  1.00 59.60  ? 11  DT  A "O5'" 1 
ATOM   188 C "C5'" . DT  A 1 10 ? 28.095 23.360 6.035  1.00 61.81  ? 11  DT  A "C5'" 1 
ATOM   189 C "C4'" . DT  A 1 10 ? 28.851 23.420 7.340  1.00 56.89  ? 11  DT  A "C4'" 1 
ATOM   190 O "O4'" . DT  A 1 10 ? 28.430 22.380 8.262  1.00 61.68  ? 11  DT  A "O4'" 1 
ATOM   191 C "C3'" . DT  A 1 10 ? 30.371 23.291 7.200  1.00 61.33  ? 11  DT  A "C3'" 1 
ATOM   192 O "O3'" . DT  A 1 10 ? 30.997 24.269 8.022  1.00 72.45  ? 11  DT  A "O3'" 1 
ATOM   193 C "C2'" . DT  A 1 10 ? 30.658 21.906 7.759  1.00 51.59  ? 11  DT  A "C2'" 1 
ATOM   194 C "C1'" . DT  A 1 10 ? 29.578 21.775 8.826  1.00 46.86  ? 11  DT  A "C1'" 1 
ATOM   195 N N1    . DT  A 1 10 ? 29.230 20.398 9.226  1.00 41.71  ? 11  DT  A N1    1 
ATOM   196 C C2    . DT  A 1 10 ? 28.890 20.174 10.555 1.00 45.07  ? 11  DT  A C2    1 
ATOM   197 O O2    . DT  A 1 10 ? 28.762 21.074 11.371 1.00 52.37  ? 11  DT  A O2    1 
ATOM   198 N N3    . DT  A 1 10 ? 28.684 18.848 10.886 1.00 35.51  ? 11  DT  A N3    1 
ATOM   199 C C4    . DT  A 1 10 ? 28.761 17.784 10.036 1.00 32.82  ? 11  DT  A C4    1 
ATOM   200 O O4    . DT  A 1 10 ? 28.594 16.670 10.458 1.00 40.27  ? 11  DT  A O4    1 
ATOM   201 C C5    . DT  A 1 10 ? 29.057 18.097 8.652  1.00 30.72  ? 11  DT  A C5    1 
ATOM   202 C C7    . DT  A 1 10 ? 29.115 16.978 7.674  1.00 35.86  ? 11  DT  A C7    1 
ATOM   203 C C6    . DT  A 1 10 ? 29.270 19.365 8.316  1.00 34.89  ? 11  DT  A C6    1 
ATOM   204 P P     . DA  A 1 11 ? 32.323 25.022 7.511  1.00 74.79  ? 12  DA  A P     1 
ATOM   205 O OP1   . DA  A 1 11 ? 31.881 26.074 6.566  1.00 69.46  ? 12  DA  A OP1   1 
ATOM   206 O OP2   . DA  A 1 11 ? 33.339 24.019 7.077  1.00 78.00  ? 12  DA  A OP2   1 
ATOM   207 O "O5'" . DA  A 1 11 ? 32.830 25.711 8.851  1.00 67.98  ? 12  DA  A "O5'" 1 
ATOM   208 C "C5'" . DA  A 1 11 ? 31.894 26.326 9.722  1.00 64.77  ? 12  DA  A "C5'" 1 
ATOM   209 C "C4'" . DA  A 1 11 ? 32.091 25.853 11.143 1.00 69.79  ? 12  DA  A "C4'" 1 
ATOM   210 O "O4'" . DA  A 1 11 ? 31.696 24.461 11.309 1.00 66.72  ? 12  DA  A "O4'" 1 
ATOM   211 C "C3'" . DA  A 1 11 ? 33.513 25.970 11.687 1.00 71.08  ? 12  DA  A "C3'" 1 
ATOM   212 O "O3'" . DA  A 1 11 ? 33.455 26.587 12.982 1.00 79.12  ? 12  DA  A "O3'" 1 
ATOM   213 C "C2'" . DA  A 1 11 ? 33.987 24.524 11.758 1.00 68.26  ? 12  DA  A "C2'" 1 
ATOM   214 C "C1'" . DA  A 1 11 ? 32.702 23.749 12.022 1.00 63.02  ? 12  DA  A "C1'" 1 
ATOM   215 N N9    . DA  A 1 11 ? 32.701 22.362 11.536 1.00 58.70  ? 12  DA  A N9    1 
ATOM   216 C C8    . DA  A 1 11 ? 33.069 21.944 10.278 1.00 56.86  ? 12  DA  A C8    1 
ATOM   217 N N7    . DA  A 1 11 ? 32.933 20.653 10.089 1.00 54.88  ? 12  DA  A N7    1 
ATOM   218 C C5    . DA  A 1 11 ? 32.446 20.182 11.304 1.00 52.91  ? 12  DA  A C5    1 
ATOM   219 C C6    . DA  A 1 11 ? 32.086 18.880 11.748 1.00 51.46  ? 12  DA  A C6    1 
ATOM   220 N N6    . DA  A 1 11 ? 32.102 17.793 10.967 1.00 49.94  ? 12  DA  A N6    1 
ATOM   221 N N1    . DA  A 1 11 ? 31.686 18.742 13.027 1.00 49.49  ? 12  DA  A N1    1 
ATOM   222 C C2    . DA  A 1 11 ? 31.617 19.842 13.792 1.00 51.91  ? 12  DA  A C2    1 
ATOM   223 N N3    . DA  A 1 11 ? 31.897 21.117 13.481 1.00 56.84  ? 12  DA  A N3    1 
ATOM   224 C C4    . DA  A 1 11 ? 32.315 21.219 12.211 1.00 54.92  ? 12  DA  A C4    1 
ATOM   225 P P     . DA  A 1 12 ? 34.803 26.816 13.831 1.00 83.67  ? 13  DA  A P     1 
ATOM   226 O OP1   . DA  A 1 12 ? 34.539 27.860 14.860 1.00 75.40  ? 13  DA  A OP1   1 
ATOM   227 O OP2   . DA  A 1 12 ? 35.958 26.972 12.902 1.00 81.76  ? 13  DA  A OP2   1 
ATOM   228 O "O5'" . DA  A 1 12 ? 34.950 25.448 14.629 1.00 86.60  ? 13  DA  A "O5'" 1 
ATOM   229 C "C5'" . DA  A 1 12 ? 33.991 25.093 15.622 1.00 87.81  ? 13  DA  A "C5'" 1 
ATOM   230 C "C4'" . DA  A 1 12 ? 34.515 23.949 16.453 1.00 83.89  ? 13  DA  A "C4'" 1 
ATOM   231 O "O4'" . DA  A 1 12 ? 34.413 22.705 15.715 1.00 81.98  ? 13  DA  A "O4'" 1 
ATOM   232 C "C3'" . DA  A 1 12 ? 35.992 24.105 16.812 1.00 80.12  ? 13  DA  A "C3'" 1 
ATOM   233 O "O3'" . DA  A 1 12 ? 36.214 23.576 18.118 1.00 75.98  ? 13  DA  A "O3'" 1 
ATOM   234 C "C2'" . DA  A 1 12 ? 36.690 23.247 15.772 1.00 74.08  ? 13  DA  A "C2'" 1 
ATOM   235 C "C1'" . DA  A 1 12 ? 35.698 22.110 15.614 1.00 71.43  ? 13  DA  A "C1'" 1 
ATOM   236 N N9    . DA  A 1 12 ? 35.758 21.410 14.335 1.00 60.13  ? 13  DA  A N9    1 
ATOM   237 C C8    . DA  A 1 12 ? 36.111 21.898 13.104 1.00 58.33  ? 13  DA  A C8    1 
ATOM   238 N N7    . DA  A 1 12 ? 36.018 21.014 12.147 1.00 56.54  ? 13  DA  A N7    1 
ATOM   239 C C5    . DA  A 1 12 ? 35.574 19.867 12.796 1.00 45.50  ? 13  DA  A C5    1 
ATOM   240 C C6    . DA  A 1 12 ? 35.235 18.592 12.330 1.00 43.27  ? 13  DA  A C6    1 
ATOM   241 N N6    . DA  A 1 12 ? 35.206 18.264 11.037 1.00 45.48  ? 13  DA  A N6    1 
ATOM   242 N N1    . DA  A 1 12 ? 34.879 17.665 13.240 1.00 44.31  ? 13  DA  A N1    1 
ATOM   243 C C2    . DA  A 1 12 ? 34.805 18.032 14.521 1.00 47.18  ? 13  DA  A C2    1 
ATOM   244 N N3    . DA  A 1 12 ? 35.045 19.216 15.071 1.00 43.48  ? 13  DA  A N3    1 
ATOM   245 C C4    . DA  A 1 12 ? 35.436 20.093 14.142 1.00 48.71  ? 13  DA  A C4    1 
ATOM   246 P P     . DG  A 1 13 ? 37.599 23.862 18.869 1.00 80.48  ? 14  DG  A P     1 
ATOM   247 O OP1   . DG  A 1 13 ? 37.265 24.568 20.133 1.00 76.31  ? 14  DG  A OP1   1 
ATOM   248 O OP2   . DG  A 1 13 ? 38.562 24.467 17.903 1.00 73.11  ? 14  DG  A OP2   1 
ATOM   249 O "O5'" . DG  A 1 13 ? 38.095 22.398 19.244 1.00 80.34  ? 14  DG  A "O5'" 1 
ATOM   250 C "C5'" . DG  A 1 13 ? 37.228 21.523 19.958 1.00 76.33  ? 14  DG  A "C5'" 1 
ATOM   251 C "C4'" . DG  A 1 13 ? 37.731 20.105 19.874 1.00 73.02  ? 14  DG  A "C4'" 1 
ATOM   252 O "O4'" . DG  A 1 13 ? 37.426 19.516 18.583 1.00 71.57  ? 14  DG  A "O4'" 1 
ATOM   253 C "C3'" . DG  A 1 13 ? 39.240 19.981 20.063 1.00 73.89  ? 14  DG  A "C3'" 1 
ATOM   254 O "O3'" . DG  A 1 13 ? 39.498 18.844 20.889 1.00 85.92  ? 14  DG  A "O3'" 1 
ATOM   255 C "C2'" . DG  A 1 13 ? 39.741 19.735 18.648 1.00 69.63  ? 14  DG  A "C2'" 1 
ATOM   256 C "C1'" . DG  A 1 13 ? 38.598 18.920 18.059 1.00 60.38  ? 14  DG  A "C1'" 1 
ATOM   257 N N9    . DG  A 1 13 ? 38.498 18.896 16.597 1.00 47.11  ? 14  DG  A N9    1 
ATOM   258 C C8    . DG  A 1 13 ? 38.655 19.950 15.742 1.00 46.39  ? 14  DG  A C8    1 
ATOM   259 N N7    . DG  A 1 13 ? 38.575 19.604 14.485 1.00 43.91  ? 14  DG  A N7    1 
ATOM   260 C C5    . DG  A 1 13 ? 38.325 18.242 14.515 1.00 38.97  ? 14  DG  A C5    1 
ATOM   261 C C6    . DG  A 1 13 ? 38.138 17.328 13.454 1.00 44.34  ? 14  DG  A C6    1 
ATOM   262 O O6    . DG  A 1 13 ? 38.130 17.554 12.232 1.00 49.76  ? 14  DG  A O6    1 
ATOM   263 N N1    . DG  A 1 13 ? 37.931 16.034 13.921 1.00 43.30  ? 14  DG  A N1    1 
ATOM   264 C C2    . DG  A 1 13 ? 37.887 15.682 15.240 1.00 46.65  ? 14  DG  A C2    1 
ATOM   265 N N2    . DG  A 1 13 ? 37.686 14.384 15.491 1.00 53.61  ? 14  DG  A N2    1 
ATOM   266 N N3    . DG  A 1 13 ? 38.035 16.534 16.239 1.00 44.55  ? 14  DG  A N3    1 
ATOM   267 C C4    . DG  A 1 13 ? 38.258 17.788 15.804 1.00 40.80  ? 14  DG  A C4    1 
ATOM   268 P P     . DA  A 1 14 ? 39.206 18.924 22.472 1.00 93.51  ? 15  DA  A P     1 
ATOM   269 O OP1   . DA  A 1 14 ? 37.893 18.290 22.753 1.00 95.90  ? 15  DA  A OP1   1 
ATOM   270 O OP2   . DA  A 1 14 ? 39.463 20.320 22.929 1.00 96.75  ? 15  DA  A OP2   1 
ATOM   271 O "O5'" . DA  A 1 14 ? 40.330 17.998 23.100 1.00 91.86  ? 15  DA  A "O5'" 1 
ATOM   272 C "C5'" . DA  A 1 14 ? 41.685 18.135 22.689 1.00 87.74  ? 15  DA  A "C5'" 1 
ATOM   273 C "C4'" . DA  A 1 14 ? 42.249 19.444 23.189 1.00 81.44  ? 15  DA  A "C4'" 1 
ATOM   274 O "O4'" . DA  A 1 14 ? 41.948 19.587 24.601 1.00 75.92  ? 15  DA  A "O4'" 1 
ATOM   275 C "C3'" . DA  A 1 14 ? 43.766 19.516 23.092 1.00 78.33  ? 15  DA  A "C3'" 1 
ATOM   276 O "O3'" . DA  A 1 14 ? 44.171 20.888 23.129 1.00 83.78  ? 15  DA  A "O3'" 1 
ATOM   277 C "C2'" . DA  A 1 14 ? 44.181 18.890 24.407 1.00 69.44  ? 15  DA  A "C2'" 1 
ATOM   278 C "C1'" . DA  A 1 14 ? 43.124 19.426 25.360 1.00 57.78  ? 15  DA  A "C1'" 1 
ATOM   279 N N9    . DA  A 1 14 ? 42.842 18.498 26.448 1.00 52.77  ? 15  DA  A N9    1 
ATOM   280 C C8    . DA  A 1 14 ? 42.254 17.251 26.398 1.00 53.66  ? 15  DA  A C8    1 
ATOM   281 N N7    . DA  A 1 14 ? 42.278 16.608 27.552 1.00 54.20  ? 15  DA  A N7    1 
ATOM   282 C C5    . DA  A 1 14 ? 42.899 17.504 28.422 1.00 52.59  ? 15  DA  A C5    1 
ATOM   283 C C6    . DA  A 1 14 ? 43.283 17.411 29.782 1.00 52.69  ? 15  DA  A C6    1 
ATOM   284 N N6    . DA  A 1 14 ? 43.144 16.309 30.529 1.00 52.23  ? 15  DA  A N6    1 
ATOM   285 N N1    . DA  A 1 14 ? 43.861 18.498 30.347 1.00 52.87  ? 15  DA  A N1    1 
ATOM   286 C C2    . DA  A 1 14 ? 44.077 19.580 29.583 1.00 57.10  ? 15  DA  A C2    1 
ATOM   287 N N3    . DA  A 1 14 ? 43.798 19.775 28.294 1.00 54.34  ? 15  DA  A N3    1 
ATOM   288 C C4    . DA  A 1 14 ? 43.207 18.689 27.765 1.00 51.05  ? 15  DA  A C4    1 
ATOM   289 O "O5'" . DA  B 2 1  ? 42.688 16.945 2.520  1.00 74.12  ? 16  DA  B "O5'" 1 
ATOM   290 C "C5'" . DA  B 2 1  ? 43.591 16.233 1.668  1.00 75.96  ? 16  DA  B "C5'" 1 
ATOM   291 C "C4'" . DA  B 2 1  ? 44.013 14.919 2.280  1.00 72.82  ? 16  DA  B "C4'" 1 
ATOM   292 O "O4'" . DA  B 2 1  ? 44.880 15.216 3.406  1.00 61.65  ? 16  DA  B "O4'" 1 
ATOM   293 C "C3'" . DA  B 2 1  ? 42.834 14.110 2.828  1.00 74.56  ? 16  DA  B "C3'" 1 
ATOM   294 O "O3'" . DA  B 2 1  ? 42.848 12.725 2.485  1.00 86.25  ? 16  DA  B "O3'" 1 
ATOM   295 C "C2'" . DA  B 2 1  ? 42.937 14.236 4.332  1.00 66.36  ? 16  DA  B "C2'" 1 
ATOM   296 C "C1'" . DA  B 2 1  ? 44.366 14.656 4.608  1.00 53.15  ? 16  DA  B "C1'" 1 
ATOM   297 N N9    . DA  B 2 1  ? 44.294 15.729 5.580  1.00 47.99  ? 16  DA  B N9    1 
ATOM   298 C C8    . DA  B 2 1  ? 44.065 17.073 5.371  1.00 50.48  ? 16  DA  B C8    1 
ATOM   299 N N7    . DA  B 2 1  ? 43.940 17.767 6.481  1.00 44.99  ? 16  DA  B N7    1 
ATOM   300 C C5    . DA  B 2 1  ? 44.129 16.816 7.473  1.00 40.12  ? 16  DA  B C5    1 
ATOM   301 C C6    . DA  B 2 1  ? 44.145 16.914 8.844  1.00 37.30  ? 16  DA  B C6    1 
ATOM   302 N N6    . DA  B 2 1  ? 43.965 18.074 9.491  1.00 36.52  ? 16  DA  B N6    1 
ATOM   303 N N1    . DA  B 2 1  ? 44.366 15.781 9.552  1.00 40.16  ? 16  DA  B N1    1 
ATOM   304 C C2    . DA  B 2 1  ? 44.586 14.634 8.885  1.00 40.88  ? 16  DA  B C2    1 
ATOM   305 N N3    . DA  B 2 1  ? 44.615 14.423 7.571  1.00 35.27  ? 16  DA  B N3    1 
ATOM   306 C C4    . DA  B 2 1  ? 44.368 15.565 6.925  1.00 40.72  ? 16  DA  B C4    1 
ATOM   307 P P     . DT  B 2 2  ? 41.572 11.820 2.875  1.00 95.42  ? 17  DT  B P     1 
ATOM   308 O OP1   . DT  B 2 2  ? 41.734 10.455 2.313  1.00 92.71  ? 17  DT  B OP1   1 
ATOM   309 O OP2   . DT  B 2 2  ? 40.341 12.605 2.576  1.00 94.32  ? 17  DT  B OP2   1 
ATOM   310 O "O5'" . DT  B 2 2  ? 41.670 11.699 4.453  1.00 90.04  ? 17  DT  B "O5'" 1 
ATOM   311 C "C5'" . DT  B 2 2  ? 42.539 10.757 5.037  1.00 83.22  ? 17  DT  B "C5'" 1 
ATOM   312 C "C4'" . DT  B 2 2  ? 41.973 10.310 6.359  1.00 73.46  ? 17  DT  B "C4'" 1 
ATOM   313 O "O4'" . DT  B 2 2  ? 42.191 11.328 7.370  1.00 63.89  ? 17  DT  B "O4'" 1 
ATOM   314 C "C3'" . DT  B 2 2  ? 40.465 10.052 6.323  1.00 68.54  ? 17  DT  B "C3'" 1 
ATOM   315 O "O3'" . DT  B 2 2  ? 40.175 8.907  7.117  1.00 75.52  ? 17  DT  B "O3'" 1 
ATOM   316 C "C2'" . DT  B 2 2  ? 39.892 11.274 7.004  1.00 60.35  ? 17  DT  B "C2'" 1 
ATOM   317 C "C1'" . DT  B 2 2  ? 40.976 11.581 8.024  1.00 54.04  ? 17  DT  B "C1'" 1 
ATOM   318 N N1    . DT  B 2 2  ? 40.997 12.959 8.472  1.00 45.68  ? 17  DT  B N1    1 
ATOM   319 C C2    . DT  B 2 2  ? 41.202 13.187 9.799  1.00 49.06  ? 17  DT  B C2    1 
ATOM   320 O O2    . DT  B 2 2  ? 41.380 12.291 10.603 1.00 53.42  ? 17  DT  B O2    1 
ATOM   321 N N3    . DT  B 2 2  ? 41.193 14.500 10.159 1.00 46.92  ? 17  DT  B N3    1 
ATOM   322 C C4    . DT  B 2 2  ? 41.008 15.591 9.333  1.00 45.25  ? 17  DT  B C4    1 
ATOM   323 O O4    . DT  B 2 2  ? 41.074 16.732 9.793  1.00 52.06  ? 17  DT  B O4    1 
ATOM   324 C C5    . DT  B 2 2  ? 40.771 15.273 7.949  1.00 42.76  ? 17  DT  B C5    1 
ATOM   325 C C7    . DT  B 2 2  ? 40.504 16.383 6.987  1.00 34.70  ? 17  DT  B C7    1 
ATOM   326 C C6    . DT  B 2 2  ? 40.794 13.986 7.587  1.00 42.36  ? 17  DT  B C6    1 
ATOM   327 P P     . DC  B 2 3  ? 38.719 8.246  7.071  1.00 72.55  ? 18  DC  B P     1 
ATOM   328 O OP1   . DC  B 2 3  ? 38.965 6.794  6.872  1.00 68.47  ? 18  DC  B OP1   1 
ATOM   329 O OP2   . DC  B 2 3  ? 37.860 8.992  6.108  1.00 71.08  ? 18  DC  B OP2   1 
ATOM   330 O "O5'" . DC  B 2 3  ? 38.212 8.438  8.566  1.00 71.70  ? 18  DC  B "O5'" 1 
ATOM   331 C "C5'" . DC  B 2 3  ? 39.048 8.029  9.638  1.00 61.86  ? 18  DC  B "C5'" 1 
ATOM   332 C "C4'" . DC  B 2 3  ? 38.549 8.580  10.953 1.00 59.96  ? 18  DC  B "C4'" 1 
ATOM   333 O "O4'" . DC  B 2 3  ? 38.805 10.016 11.070 1.00 55.81  ? 18  DC  B "O4'" 1 
ATOM   334 C "C3'" . DC  B 2 3  ? 37.056 8.365  11.232 1.00 55.15  ? 18  DC  B "C3'" 1 
ATOM   335 O "O3'" . DC  B 2 3  ? 36.895 7.819  12.565 1.00 52.35  ? 18  DC  B "O3'" 1 
ATOM   336 C "C2'" . DC  B 2 3  ? 36.480 9.774  11.105 1.00 52.69  ? 18  DC  B "C2'" 1 
ATOM   337 C "C1'" . DC  B 2 3  ? 37.642 10.638 11.587 1.00 46.25  ? 18  DC  B "C1'" 1 
ATOM   338 N N1    . DC  B 2 3  ? 37.652 12.056 11.195 1.00 39.91  ? 18  DC  B N1    1 
ATOM   339 C C2    . DC  B 2 3  ? 37.842 13.003 12.189 1.00 44.62  ? 18  DC  B C2    1 
ATOM   340 O O2    . DC  B 2 3  ? 37.988 12.620 13.359 1.00 55.96  ? 18  DC  B O2    1 
ATOM   341 N N3    . DC  B 2 3  ? 37.865 14.310 11.872 1.00 37.11  ? 18  DC  B N3    1 
ATOM   342 C C4    . DC  B 2 3  ? 37.707 14.687 10.610 1.00 34.36  ? 18  DC  B C4    1 
ATOM   343 N N4    . DC  B 2 3  ? 37.757 15.999 10.346 1.00 41.01  ? 18  DC  B N4    1 
ATOM   344 C C5    . DC  B 2 3  ? 37.502 13.742 9.562  1.00 34.35  ? 18  DC  B C5    1 
ATOM   345 C C6    . DC  B 2 3  ? 37.483 12.445 9.901  1.00 40.08  ? 18  DC  B C6    1 
ATOM   346 P P     . DT  B 2 4  ? 35.582 6.956  12.947 1.00 53.77  ? 19  DT  B P     1 
ATOM   347 O OP1   . DT  B 2 4  ? 35.990 5.780  13.764 1.00 53.12  ? 19  DT  B OP1   1 
ATOM   348 O OP2   . DT  B 2 4  ? 34.749 6.748  11.721 1.00 51.20  ? 19  DT  B OP2   1 
ATOM   349 O "O5'" . DT  B 2 4  ? 34.835 7.927  13.969 1.00 45.79  ? 19  DT  B "O5'" 1 
ATOM   350 C "C5'" . DT  B 2 4  ? 35.187 9.307  14.021 1.00 45.72  ? 19  DT  B "C5'" 1 
ATOM   351 C "C4'" . DT  B 2 4  ? 34.856 9.907  15.368 1.00 42.82  ? 19  DT  B "C4'" 1 
ATOM   352 O "O4'" . DT  B 2 4  ? 35.233 11.302 15.262 1.00 48.06  ? 19  DT  B "O4'" 1 
ATOM   353 C "C3'" . DT  B 2 4  ? 33.363 9.908  15.685 1.00 54.94  ? 19  DT  B "C3'" 1 
ATOM   354 O "O3'" . DT  B 2 4  ? 33.108 9.776  17.095 1.00 55.60  ? 19  DT  B "O3'" 1 
ATOM   355 C "C2'" . DT  B 2 4  ? 32.873 11.237 15.132 1.00 53.06  ? 19  DT  B "C2'" 1 
ATOM   356 C "C1'" . DT  B 2 4  ? 34.090 12.149 15.192 1.00 45.50  ? 19  DT  B "C1'" 1 
ATOM   357 N N1    . DT  B 2 4  ? 34.211 12.965 13.966 1.00 36.74  ? 19  DT  B N1    1 
ATOM   358 C C2    . DT  B 2 4  ? 34.266 14.342 14.054 1.00 38.83  ? 19  DT  B C2    1 
ATOM   359 O O2    . DT  B 2 4  ? 34.223 14.949 15.114 1.00 49.08  ? 19  DT  B O2    1 
ATOM   360 N N3    . DT  B 2 4  ? 34.346 14.989 12.849 1.00 32.21  ? 19  DT  B N3    1 
ATOM   361 C C4    . DT  B 2 4  ? 34.342 14.415 11.605 1.00 37.29  ? 19  DT  B C4    1 
ATOM   362 O O4    . DT  B 2 4  ? 34.391 15.124 10.607 1.00 41.22  ? 19  DT  B O4    1 
ATOM   363 C C5    . DT  B 2 4  ? 34.273 12.978 11.591 1.00 34.33  ? 19  DT  B C5    1 
ATOM   364 C C7    . DT  B 2 4  ? 34.234 12.266 10.280 1.00 43.63  ? 19  DT  B C7    1 
ATOM   365 C C6    . DT  B 2 4  ? 34.235 12.334 12.754 1.00 33.38  ? 19  DT  B C6    1 
ATOM   366 P P     . DT  B 2 5  ? 31.596 9.514  17.610 1.00 62.20  ? 20  DT  B P     1 
ATOM   367 O OP1   . DT  B 2 5  ? 31.556 8.416  18.608 1.00 66.36  ? 20  DT  B OP1   1 
ATOM   368 O OP2   . DT  B 2 5  ? 30.737 9.421  16.397 1.00 64.72  ? 20  DT  B OP2   1 
ATOM   369 O "O5'" . DT  B 2 5  ? 31.309 10.856 18.408 1.00 57.03  ? 20  DT  B "O5'" 1 
ATOM   370 C "C5'" . DT  B 2 5  ? 31.978 12.053 18.006 1.00 61.25  ? 20  DT  B "C5'" 1 
ATOM   371 C "C4'" . DT  B 2 5  ? 31.371 13.264 18.676 1.00 62.08  ? 20  DT  B "C4'" 1 
ATOM   372 O "O4'" . DT  B 2 5  ? 31.728 14.386 17.823 1.00 65.90  ? 20  DT  B "O4'" 1 
ATOM   373 C "C3'" . DT  B 2 5  ? 29.844 13.252 18.758 1.00 63.20  ? 20  DT  B "C3'" 1 
ATOM   374 O "O3'" . DT  B 2 5  ? 29.394 13.752 20.033 1.00 68.71  ? 20  DT  B "O3'" 1 
ATOM   375 C "C2'" . DT  B 2 5  ? 29.401 14.081 17.564 1.00 62.61  ? 20  DT  B "C2'" 1 
ATOM   376 C "C1'" . DT  B 2 5  ? 30.590 14.983 17.228 1.00 55.20  ? 20  DT  B "C1'" 1 
ATOM   377 N N1    . DT  B 2 5  ? 30.843 15.103 15.757 1.00 46.77  ? 20  DT  B N1    1 
ATOM   378 C C2    . DT  B 2 5  ? 31.396 16.251 15.227 1.00 43.73  ? 20  DT  B C2    1 
ATOM   379 O O2    . DT  B 2 5  ? 31.825 17.180 15.902 1.00 47.24  ? 20  DT  B O2    1 
ATOM   380 N N3    . DT  B 2 5  ? 31.456 16.271 13.855 1.00 39.75  ? 20  DT  B N3    1 
ATOM   381 C C4    . DT  B 2 5  ? 31.095 15.278 12.992 1.00 37.26  ? 20  DT  B C4    1 
ATOM   382 O O4    . DT  B 2 5  ? 31.227 15.434 11.793 1.00 43.15  ? 20  DT  B O4    1 
ATOM   383 C C5    . DT  B 2 5  ? 30.592 14.092 13.602 1.00 35.84  ? 20  DT  B C5    1 
ATOM   384 C C7    . DT  B 2 5  ? 30.223 12.935 12.730 1.00 40.37  ? 20  DT  B C7    1 
ATOM   385 C C6    . DT  B 2 5  ? 30.482 14.062 14.935 1.00 41.00  ? 20  DT  B C6    1 
ATOM   386 P P     . DA  B 2 6  ? 27.820 13.686 20.437 1.00 69.78  ? 21  DA  B P     1 
ATOM   387 O OP1   . DA  B 2 6  ? 27.702 13.347 21.884 1.00 62.13  ? 21  DA  B OP1   1 
ATOM   388 O OP2   . DA  B 2 6  ? 27.063 12.889 19.452 1.00 70.75  ? 21  DA  B OP2   1 
ATOM   389 O "O5'" . DA  B 2 6  ? 27.437 15.224 20.318 1.00 65.53  ? 21  DA  B "O5'" 1 
ATOM   390 C "C5'" . DA  B 2 6  ? 28.273 16.187 20.969 1.00 64.73  ? 21  DA  B "C5'" 1 
ATOM   391 C "C4'" . DA  B 2 6  ? 27.898 17.597 20.581 1.00 66.81  ? 21  DA  B "C4'" 1 
ATOM   392 O "O4'" . DA  B 2 6  ? 28.260 17.831 19.202 1.00 65.04  ? 21  DA  B "O4'" 1 
ATOM   393 C "C3'" . DA  B 2 6  ? 26.427 17.989 20.729 1.00 67.18  ? 21  DA  B "C3'" 1 
ATOM   394 O "O3'" . DA  B 2 6  ? 26.353 19.291 21.358 1.00 70.94  ? 21  DA  B "O3'" 1 
ATOM   395 C "C2'" . DA  B 2 6  ? 25.908 17.935 19.295 1.00 62.19  ? 21  DA  B "C2'" 1 
ATOM   396 C "C1'" . DA  B 2 6  ? 27.139 18.198 18.420 1.00 50.75  ? 21  DA  B "C1'" 1 
ATOM   397 N N9    . DA  B 2 6  ? 27.198 17.403 17.182 1.00 43.68  ? 21  DA  B N9    1 
ATOM   398 C C8    . DA  B 2 6  ? 26.879 16.073 17.074 1.00 35.52  ? 21  DA  B C8    1 
ATOM   399 N N7    . DA  B 2 6  ? 27.007 15.598 15.844 1.00 38.62  ? 21  DA  B N7    1 
ATOM   400 C C5    . DA  B 2 6  ? 27.452 16.686 15.099 1.00 31.19  ? 21  DA  B C5    1 
ATOM   401 C C6    . DA  B 2 6  ? 27.770 16.831 13.715 1.00 35.13  ? 21  DA  B C6    1 
ATOM   402 N N6    . DA  B 2 6  ? 27.689 15.824 12.832 1.00 36.68  ? 21  DA  B N6    1 
ATOM   403 N N1    . DA  B 2 6  ? 28.175 18.056 13.275 1.00 35.23  ? 21  DA  B N1    1 
ATOM   404 C C2    . DA  B 2 6  ? 28.257 19.043 14.175 1.00 37.95  ? 21  DA  B C2    1 
ATOM   405 N N3    . DA  B 2 6  ? 27.976 19.023 15.505 1.00 38.87  ? 21  DA  B N3    1 
ATOM   406 C C4    . DA  B 2 6  ? 27.574 17.805 15.902 1.00 35.57  ? 21  DA  B C4    1 
ATOM   407 P P     . DC  B 2 7  ? 24.928 19.917 21.796 1.00 72.00  ? 22  DC  B P     1 
ATOM   408 O OP1   . DC  B 2 7  ? 24.967 20.439 23.187 1.00 73.60  ? 22  DC  B OP1   1 
ATOM   409 O OP2   . DC  B 2 7  ? 23.872 18.945 21.412 1.00 70.64  ? 22  DC  B OP2   1 
ATOM   410 O "O5'" . DC  B 2 7  ? 24.838 21.159 20.814 1.00 68.05  ? 22  DC  B "O5'" 1 
ATOM   411 C "C5'" . DC  B 2 7  ? 25.086 20.943 19.439 1.00 67.99  ? 22  DC  B "C5'" 1 
ATOM   412 C "C4'" . DC  B 2 7  ? 25.462 22.225 18.746 1.00 60.11  ? 22  DC  B "C4'" 1 
ATOM   413 O "O4'" . DC  B 2 7  ? 25.918 21.826 17.437 1.00 64.03  ? 22  DC  B "O4'" 1 
ATOM   414 C "C3'" . DC  B 2 7  ? 24.290 23.174 18.514 1.00 61.44  ? 22  DC  B "C3'" 1 
ATOM   415 O "O3'" . DC  B 2 7  ? 24.771 24.526 18.480 1.00 66.67  ? 22  DC  B "O3'" 1 
ATOM   416 C "C2'" . DC  B 2 7  ? 23.734 22.712 17.177 1.00 58.91  ? 22  DC  B "C2'" 1 
ATOM   417 C "C1'" . DC  B 2 7  ? 24.943 22.120 16.454 1.00 58.90  ? 22  DC  B "C1'" 1 
ATOM   418 N N1    . DC  B 2 7  ? 24.693 20.874 15.706 1.00 51.13  ? 22  DC  B N1    1 
ATOM   419 C C2    . DC  B 2 7  ? 24.956 20.864 14.327 1.00 52.01  ? 22  DC  B C2    1 
ATOM   420 O O2    . DC  B 2 7  ? 25.372 21.908 13.793 1.00 52.29  ? 22  DC  B O2    1 
ATOM   421 N N3    . DC  B 2 7  ? 24.758 19.722 13.619 1.00 45.21  ? 22  DC  B N3    1 
ATOM   422 C C4    . DC  B 2 7  ? 24.330 18.621 14.238 1.00 43.16  ? 22  DC  B C4    1 
ATOM   423 N N4    . DC  B 2 7  ? 24.190 17.514 13.504 1.00 49.72  ? 22  DC  B N4    1 
ATOM   424 C C5    . DC  B 2 7  ? 24.038 18.602 15.640 1.00 34.96  ? 22  DC  B C5    1 
ATOM   425 C C6    . DC  B 2 7  ? 24.229 19.743 16.331 1.00 41.81  ? 22  DC  B C6    1 
ATOM   426 P P     . DC  B 2 8  ? 23.774 25.752 18.809 1.00 72.02  ? 23  DC  B P     1 
ATOM   427 O OP1   . DC  B 2 8  ? 24.628 26.944 19.030 1.00 65.85  ? 23  DC  B OP1   1 
ATOM   428 O OP2   . DC  B 2 8  ? 22.776 25.357 19.840 1.00 68.76  ? 23  DC  B OP2   1 
ATOM   429 O "O5'" . DC  B 2 8  ? 22.963 25.950 17.456 1.00 69.84  ? 23  DC  B "O5'" 1 
ATOM   430 C "C5'" . DC  B 2 8  ? 23.613 26.304 16.246 1.00 64.08  ? 23  DC  B "C5'" 1 
ATOM   431 C "C4'" . DC  B 2 8  ? 22.683 26.046 15.087 1.00 68.85  ? 23  DC  B "C4'" 1 
ATOM   432 O "O4'" . DC  B 2 8  ? 22.574 24.618 14.851 1.00 69.65  ? 23  DC  B "O4'" 1 
ATOM   433 C "C3'" . DC  B 2 8  ? 21.254 26.540 15.333 1.00 70.08  ? 23  DC  B "C3'" 1 
ATOM   434 O "O3'" . DC  B 2 8  ? 20.716 27.066 14.125 1.00 64.31  ? 23  DC  B "O3'" 1 
ATOM   435 C "C2'" . DC  B 2 8  ? 20.504 25.268 15.688 1.00 69.42  ? 23  DC  B "C2'" 1 
ATOM   436 C "C1'" . DC  B 2 8  ? 21.202 24.280 14.779 1.00 60.05  ? 23  DC  B "C1'" 1 
ATOM   437 N N1    . DC  B 2 8  ? 21.059 22.846 15.080 1.00 50.67  ? 23  DC  B N1    1 
ATOM   438 C C2    . DC  B 2 8  ? 21.332 21.947 14.051 1.00 49.20  ? 23  DC  B C2    1 
ATOM   439 O O2    . DC  B 2 8  ? 21.661 22.404 12.929 1.00 43.03  ? 23  DC  B O2    1 
ATOM   440 N N3    . DC  B 2 8  ? 21.231 20.615 14.288 1.00 49.32  ? 23  DC  B N3    1 
ATOM   441 C C4    . DC  B 2 8  ? 20.864 20.180 15.497 1.00 49.10  ? 23  DC  B C4    1 
ATOM   442 N N4    . DC  B 2 8  ? 20.789 18.855 15.681 1.00 46.98  ? 23  DC  B N4    1 
ATOM   443 C C5    . DC  B 2 8  ? 20.563 21.078 16.566 1.00 48.77  ? 23  DC  B C5    1 
ATOM   444 C C6    . DC  B 2 8  ? 20.672 22.393 16.315 1.00 49.73  ? 23  DC  B C6    1 
ATOM   445 P P     . DA  B 2 9  ? 20.288 28.615 14.049 1.00 61.09  ? 24  DA  B P     1 
ATOM   446 O OP1   . DA  B 2 9  ? 21.546 29.401 14.180 1.00 53.93  ? 24  DA  B OP1   1 
ATOM   447 O OP2   . DA  B 2 9  ? 19.146 28.870 14.969 1.00 55.22  ? 24  DA  B OP2   1 
ATOM   448 O "O5'" . DA  B 2 9  ? 19.803 28.791 12.548 1.00 56.10  ? 24  DA  B "O5'" 1 
ATOM   449 C "C5'" . DA  B 2 9  ? 20.769 28.834 11.507 1.00 60.56  ? 24  DA  B "C5'" 1 
ATOM   450 C "C4'" . DA  B 2 9  ? 20.321 27.985 10.343 1.00 60.41  ? 24  DA  B "C4'" 1 
ATOM   451 O "O4'" . DA  B 2 9  ? 20.221 26.588 10.735 1.00 57.03  ? 24  DA  B "O4'" 1 
ATOM   452 C "C3'" . DA  B 2 9  ? 18.955 28.373 9.786  1.00 58.53  ? 24  DA  B "C3'" 1 
ATOM   453 O "O3'" . DA  B 2 9  ? 19.045 28.357 8.370  1.00 61.30  ? 24  DA  B "O3'" 1 
ATOM   454 C "C2'" . DA  B 2 9  ? 18.023 27.291 10.316 1.00 60.65  ? 24  DA  B "C2'" 1 
ATOM   455 C "C1'" . DA  B 2 9  ? 18.935 26.077 10.419 1.00 51.32  ? 24  DA  B "C1'" 1 
ATOM   456 N N9    . DA  B 2 9  ? 18.567 25.104 11.454 1.00 52.32  ? 24  DA  B N9    1 
ATOM   457 C C8    . DA  B 2 9  ? 18.115 25.347 12.733 1.00 55.82  ? 24  DA  B C8    1 
ATOM   458 N N7    . DA  B 2 9  ? 17.885 24.257 13.433 1.00 52.15  ? 24  DA  B N7    1 
ATOM   459 C C5    . DA  B 2 9  ? 18.205 23.227 12.555 1.00 50.54  ? 24  DA  B C5    1 
ATOM   460 C C6    . DA  B 2 9  ? 18.173 21.829 12.687 1.00 47.33  ? 24  DA  B C6    1 
ATOM   461 N N6    . DA  B 2 9  ? 17.775 21.194 13.795 1.00 50.18  ? 24  DA  B N6    1 
ATOM   462 N N1    . DA  B 2 9  ? 18.560 21.093 11.627 1.00 48.93  ? 24  DA  B N1    1 
ATOM   463 C C2    . DA  B 2 9  ? 18.947 21.724 10.517 1.00 49.18  ? 24  DA  B C2    1 
ATOM   464 N N3    . DA  B 2 9  ? 19.012 23.026 10.266 1.00 51.05  ? 24  DA  B N3    1 
ATOM   465 C C4    . DA  B 2 9  ? 18.623 23.733 11.335 1.00 51.45  ? 24  DA  B C4    1 
ATOM   466 P P     . DA  B 2 10 ? 17.727 28.561 7.485  1.00 65.52  ? 25  DA  B P     1 
ATOM   467 O OP1   . DA  B 2 10 ? 18.260 29.008 6.165  1.00 56.83  ? 25  DA  B OP1   1 
ATOM   468 O OP2   . DA  B 2 10 ? 16.758 29.404 8.213  1.00 58.21  ? 25  DA  B OP2   1 
ATOM   469 O "O5'" . DA  B 2 10 ? 17.134 27.083 7.373  1.00 59.04  ? 25  DA  B "O5'" 1 
ATOM   470 C "C5'" . DA  B 2 10 ? 17.798 26.092 6.590  1.00 56.09  ? 25  DA  B "C5'" 1 
ATOM   471 C "C4'" . DA  B 2 10 ? 16.906 24.886 6.404  1.00 55.15  ? 25  DA  B "C4'" 1 
ATOM   472 O "O4'" . DA  B 2 10 ? 16.839 24.121 7.632  1.00 62.61  ? 25  DA  B "O4'" 1 
ATOM   473 C "C3'" . DA  B 2 10 ? 15.457 25.223 6.048  1.00 58.33  ? 25  DA  B "C3'" 1 
ATOM   474 O "O3'" . DA  B 2 10 ? 14.942 24.223 5.171  1.00 58.67  ? 25  DA  B "O3'" 1 
ATOM   475 C "C2'" . DA  B 2 10 ? 14.744 25.101 7.383  1.00 53.65  ? 25  DA  B "C2'" 1 
ATOM   476 C "C1'" . DA  B 2 10 ? 15.475 23.918 7.969  1.00 49.01  ? 25  DA  B "C1'" 1 
ATOM   477 N N9    . DA  B 2 10 ? 15.364 23.776 9.416  1.00 41.21  ? 25  DA  B N9    1 
ATOM   478 C C8    . DA  B 2 10 ? 15.148 24.765 10.343 1.00 39.42  ? 25  DA  B C8    1 
ATOM   479 N N7    . DA  B 2 10 ? 15.020 24.313 11.578 1.00 48.19  ? 25  DA  B N7    1 
ATOM   480 C C5    . DA  B 2 10 ? 15.172 22.934 11.451 1.00 42.47  ? 25  DA  B C5    1 
ATOM   481 C C6    . DA  B 2 10 ? 15.139 21.876 12.397 1.00 47.23  ? 25  DA  B C6    1 
ATOM   482 N N6    . DA  B 2 10 ? 14.856 22.037 13.687 1.00 53.17  ? 25  DA  B N6    1 
ATOM   483 N N1    . DA  B 2 10 ? 15.390 20.631 11.951 1.00 47.44  ? 25  DA  B N1    1 
ATOM   484 C C2    . DA  B 2 10 ? 15.605 20.460 10.625 1.00 45.87  ? 25  DA  B C2    1 
ATOM   485 N N3    . DA  B 2 10 ? 15.625 21.359 9.643  1.00 39.62  ? 25  DA  B N3    1 
ATOM   486 C C4    . DA  B 2 10 ? 15.411 22.593 10.126 1.00 38.40  ? 25  DA  B C4    1 
ATOM   487 P P     . DA  B 2 11 ? 15.036 24.435 3.582  1.00 57.50  ? 26  DA  B P     1 
ATOM   488 O OP1   . DA  B 2 11 ? 16.432 24.813 3.296  1.00 63.23  ? 26  DA  B OP1   1 
ATOM   489 O OP2   . DA  B 2 11 ? 13.933 25.319 3.118  1.00 57.47  ? 26  DA  B OP2   1 
ATOM   490 O "O5'" . DA  B 2 11 ? 14.782 22.971 3.024  1.00 56.63  ? 26  DA  B "O5'" 1 
ATOM   491 C "C5'" . DA  B 2 11 ? 15.787 21.982 3.135  1.00 56.00  ? 26  DA  B "C5'" 1 
ATOM   492 C "C4'" . DA  B 2 11 ? 15.174 20.649 3.490  1.00 60.74  ? 26  DA  B "C4'" 1 
ATOM   493 O "O4'" . DA  B 2 11 ? 14.838 20.557 4.895  1.00 62.40  ? 26  DA  B "O4'" 1 
ATOM   494 C "C3'" . DA  B 2 11 ? 13.912 20.270 2.728  1.00 53.22  ? 26  DA  B "C3'" 1 
ATOM   495 O "O3'" . DA  B 2 11 ? 14.021 18.889 2.409  1.00 60.39  ? 26  DA  B "O3'" 1 
ATOM   496 C "C2'" . DA  B 2 11 ? 12.809 20.492 3.751  1.00 52.01  ? 26  DA  B "C2'" 1 
ATOM   497 C "C1'" . DA  B 2 11 ? 13.493 20.133 5.059  1.00 45.95  ? 26  DA  B "C1'" 1 
ATOM   498 N N9    . DA  B 2 11 ? 12.969 20.839 6.223  1.00 43.73  ? 26  DA  B N9    1 
ATOM   499 C C8    . DA  B 2 11 ? 12.658 22.180 6.309  1.00 48.03  ? 26  DA  B C8    1 
ATOM   500 N N7    . DA  B 2 11 ? 12.253 22.554 7.501  1.00 46.05  ? 26  DA  B N7    1 
ATOM   501 C C5    . DA  B 2 11 ? 12.287 21.383 8.242  1.00 42.53  ? 26  DA  B C5    1 
ATOM   502 C C6    . DA  B 2 11 ? 11.989 21.115 9.585  1.00 45.56  ? 26  DA  B C6    1 
ATOM   503 N N6    . DA  B 2 11 ? 11.547 22.038 10.434 1.00 45.99  ? 26  DA  B N6    1 
ATOM   504 N N1    . DA  B 2 11 ? 12.160 19.848 10.029 1.00 44.15  ? 26  DA  B N1    1 
ATOM   505 C C2    . DA  B 2 11 ? 12.583 18.924 9.160  1.00 45.78  ? 26  DA  B C2    1 
ATOM   506 N N3    . DA  B 2 11 ? 12.886 19.054 7.868  1.00 44.92  ? 26  DA  B N3    1 
ATOM   507 C C4    . DA  B 2 11 ? 12.721 20.321 7.467  1.00 41.07  ? 26  DA  B C4    1 
ATOM   508 P P     . DA  B 2 12 ? 12.892 18.178 1.528  1.00 67.58  ? 27  DA  B P     1 
ATOM   509 O OP1   . DA  B 2 12 ? 13.619 17.068 0.842  1.00 73.16  ? 27  DA  B OP1   1 
ATOM   510 O OP2   . DA  B 2 12 ? 12.148 19.183 0.723  1.00 73.04  ? 27  DA  B OP2   1 
ATOM   511 O "O5'" . DA  B 2 12 ? 11.933 17.548 2.625  1.00 61.04  ? 27  DA  B "O5'" 1 
ATOM   512 C "C5'" . DA  B 2 12 ? 12.455 16.604 3.551  1.00 64.91  ? 27  DA  B "C5'" 1 
ATOM   513 C "C4'" . DA  B 2 12 ? 11.341 16.048 4.399  1.00 63.60  ? 27  DA  B "C4'" 1 
ATOM   514 O "O4'" . DA  B 2 12 ? 10.950 16.972 5.441  1.00 63.51  ? 27  DA  B "O4'" 1 
ATOM   515 C "C3'" . DA  B 2 12 ? 10.073 15.733 3.610  1.00 67.48  ? 27  DA  B "C3'" 1 
ATOM   516 O "O3'" . DA  B 2 12 ? 9.573  14.494 4.101  1.00 79.35  ? 27  DA  B "O3'" 1 
ATOM   517 C "C2'" . DA  B 2 12 ? 9.157  16.904 3.934  1.00 59.02  ? 27  DA  B "C2'" 1 
ATOM   518 C "C1'" . DA  B 2 12 ? 9.552  17.219 5.368  1.00 53.08  ? 27  DA  B "C1'" 1 
ATOM   519 N N9    . DA  B 2 12 ? 9.340  18.587 5.834  1.00 45.24  ? 27  DA  B N9    1 
ATOM   520 C C8    . DA  B 2 12 ? 9.355  19.758 5.114  1.00 40.12  ? 27  DA  B C8    1 
ATOM   521 N N7    . DA  B 2 12 ? 9.295  20.835 5.862  1.00 42.83  ? 27  DA  B N7    1 
ATOM   522 C C5    . DA  B 2 12 ? 9.183  20.336 7.155  1.00 40.67  ? 27  DA  B C5    1 
ATOM   523 C C6    . DA  B 2 12 ? 9.098  20.966 8.401  1.00 45.42  ? 27  DA  B C6    1 
ATOM   524 N N6    . DA  B 2 12 ? 9.085  22.292 8.554  1.00 57.93  ? 27  DA  B N6    1 
ATOM   525 N N1    . DA  B 2 12 ? 9.018  20.179 9.501  1.00 45.82  ? 27  DA  B N1    1 
ATOM   526 C C2    . DA  B 2 12 ? 8.997  18.851 9.332  1.00 49.22  ? 27  DA  B C2    1 
ATOM   527 N N3    . DA  B 2 12 ? 9.062  18.145 8.211  1.00 48.51  ? 27  DA  B N3    1 
ATOM   528 C C4    . DA  B 2 12 ? 9.167  18.956 7.147  1.00 43.86  ? 27  DA  B C4    1 
ATOM   529 P P     . DA  B 2 13 ? 8.452  13.694 3.284  1.00 88.97  ? 28  DA  B P     1 
ATOM   530 O OP1   . DA  B 2 13 ? 9.019  12.354 2.989  1.00 86.69  ? 28  DA  B OP1   1 
ATOM   531 O OP2   . DA  B 2 13 ? 7.925  14.538 2.179  1.00 88.42  ? 28  DA  B OP2   1 
ATOM   532 O "O5'" . DA  B 2 13 ? 7.342  13.561 4.405  1.00 88.03  ? 28  DA  B "O5'" 1 
ATOM   533 C "C5'" . DA  B 2 13 ? 7.420  14.433 5.513  1.00 88.38  ? 28  DA  B "C5'" 1 
ATOM   534 C "C4'" . DA  B 2 13 ? 6.163  14.373 6.333  1.00 88.00  ? 28  DA  B "C4'" 1 
ATOM   535 O "O4'" . DA  B 2 13 ? 6.228  15.566 7.153  1.00 77.95  ? 28  DA  B "O4'" 1 
ATOM   536 C "C3'" . DA  B 2 13 ? 4.874  14.480 5.507  1.00 86.14  ? 28  DA  B "C3'" 1 
ATOM   537 O "O3'" . DA  B 2 13 ? 3.800  13.770 6.145  1.00 88.64  ? 28  DA  B "O3'" 1 
ATOM   538 C "C2'" . DA  B 2 13 ? 4.594  15.963 5.499  1.00 80.61  ? 28  DA  B "C2'" 1 
ATOM   539 C "C1'" . DA  B 2 13 ? 5.119  16.386 6.862  1.00 72.55  ? 28  DA  B "C1'" 1 
ATOM   540 N N9    . DA  B 2 13 ? 5.544  17.776 6.883  1.00 56.43  ? 28  DA  B N9    1 
ATOM   541 C C8    . DA  B 2 13 ? 5.824  18.585 5.809  1.00 53.53  ? 28  DA  B C8    1 
ATOM   542 N N7    . DA  B 2 13 ? 5.988  19.843 6.132  1.00 57.04  ? 28  DA  B N7    1 
ATOM   543 C C5    . DA  B 2 13 ? 5.855  19.848 7.513  1.00 53.36  ? 28  DA  B C5    1 
ATOM   544 C C6    . DA  B 2 13 ? 5.901  20.870 8.448  1.00 58.23  ? 28  DA  B C6    1 
ATOM   545 N N6    . DA  B 2 13 ? 6.104  22.146 8.122  1.00 61.67  ? 28  DA  B N6    1 
ATOM   546 N N1    . DA  B 2 13 ? 5.732  20.541 9.745  1.00 60.19  ? 28  DA  B N1    1 
ATOM   547 C C2    . DA  B 2 13 ? 5.537  19.258 10.056 1.00 56.36  ? 28  DA  B C2    1 
ATOM   548 N N3    . DA  B 2 13 ? 5.469  18.207 9.263  1.00 49.46  ? 28  DA  B N3    1 
ATOM   549 C C4    . DA  B 2 13 ? 5.631  18.574 7.989  1.00 50.40  ? 28  DA  B C4    1 
ATOM   550 P P     . DC  B 2 14 ? 2.360  13.633 5.414  1.00 83.92  ? 29  DC  B P     1 
ATOM   551 O OP1   . DC  B 2 14 ? 1.982  12.200 5.481  1.00 77.30  ? 29  DC  B OP1   1 
ATOM   552 O OP2   . DC  B 2 14 ? 2.377  14.323 4.098  1.00 78.30  ? 29  DC  B OP2   1 
ATOM   553 O "O5'" . DC  B 2 14 ? 1.375  14.421 6.393  1.00 80.52  ? 29  DC  B "O5'" 1 
ATOM   554 C "C5'" . DC  B 2 14 ? 1.306  14.067 7.776  1.00 78.39  ? 29  DC  B "C5'" 1 
ATOM   555 C "C4'" . DC  B 2 14 ? 0.566  15.124 8.562  1.00 74.93  ? 29  DC  B "C4'" 1 
ATOM   556 O "O4'" . DC  B 2 14 ? 1.332  16.355 8.625  1.00 69.81  ? 29  DC  B "O4'" 1 
ATOM   557 C "C3'" . DC  B 2 14 ? -0.790 15.502 7.973  1.00 73.59  ? 29  DC  B "C3'" 1 
ATOM   558 O "O3'" . DC  B 2 14 ? -1.695 15.759 9.051  1.00 82.78  ? 29  DC  B "O3'" 1 
ATOM   559 C "C2'" . DC  B 2 14 ? -0.480 16.784 7.226  1.00 72.18  ? 29  DC  B "C2'" 1 
ATOM   560 C "C1'" . DC  B 2 14 ? 0.547  17.423 8.140  1.00 67.48  ? 29  DC  B "C1'" 1 
ATOM   561 N N1    . DC  B 2 14 ? 1.434  18.405 7.484  1.00 61.94  ? 29  DC  B N1    1 
ATOM   562 C C2    . DC  B 2 14 ? 1.796  19.548 8.192  1.00 60.35  ? 29  DC  B C2    1 
ATOM   563 O O2    . DC  B 2 14 ? 1.442  19.652 9.383  1.00 59.21  ? 29  DC  B O2    1 
ATOM   564 N N3    . DC  B 2 14 ? 2.519  20.510 7.572  1.00 62.48  ? 29  DC  B N3    1 
ATOM   565 C C4    . DC  B 2 14 ? 2.880  20.353 6.299  1.00 65.10  ? 29  DC  B C4    1 
ATOM   566 N N4    . DC  B 2 14 ? 3.541  21.357 5.706  1.00 63.71  ? 29  DC  B N4    1 
ATOM   567 C C5    . DC  B 2 14 ? 2.569  19.174 5.571  1.00 66.18  ? 29  DC  B C5    1 
ATOM   568 C C6    . DC  B 2 14 ? 1.857  18.230 6.198  1.00 65.40  ? 29  DC  B C6    1 
ATOM   569 N N     . GLY C 3 1  ? 6.980  14.113 12.796 1.00 72.69  ? 139 GLY C N     1 
ATOM   570 C CA    . GLY C 3 1  ? 7.123  15.289 11.883 1.00 72.42  ? 139 GLY C CA    1 
ATOM   571 C C     . GLY C 3 1  ? 7.855  14.849 10.635 1.00 75.65  ? 139 GLY C C     1 
ATOM   572 O O     . GLY C 3 1  ? 7.243  14.402 9.658  1.00 75.01  ? 139 GLY C O     1 
ATOM   573 N N     . ARG C 3 2  ? 9.179  14.966 10.659 1.00 79.08  ? 140 ARG C N     1 
ATOM   574 C CA    . ARG C 3 2  ? 9.961  14.545 9.508  1.00 76.15  ? 140 ARG C CA    1 
ATOM   575 C C     . ARG C 3 2  ? 10.213 13.057 9.615  1.00 73.06  ? 140 ARG C C     1 
ATOM   576 O O     . ARG C 3 2  ? 10.637 12.540 10.657 1.00 72.47  ? 140 ARG C O     1 
ATOM   577 C CB    . ARG C 3 2  ? 11.291 15.280 9.423  1.00 72.14  ? 140 ARG C CB    1 
ATOM   578 C CG    . ARG C 3 2  ? 12.102 14.881 8.212  1.00 63.48  ? 140 ARG C CG    1 
ATOM   579 C CD    . ARG C 3 2  ? 13.397 15.660 8.147  1.00 68.95  ? 140 ARG C CD    1 
ATOM   580 N NE    . ARG C 3 2  ? 14.126 15.321 6.935  1.00 69.08  ? 140 ARG C NE    1 
ATOM   581 C CZ    . ARG C 3 2  ? 14.895 16.170 6.274  1.00 66.57  ? 140 ARG C CZ    1 
ATOM   582 N NH1   . ARG C 3 2  ? 15.035 17.410 6.721  1.00 65.77  ? 140 ARG C NH1   1 
ATOM   583 N NH2   . ARG C 3 2  ? 15.503 15.787 5.157  1.00 65.31  ? 140 ARG C NH2   1 
ATOM   584 N N     . PRO C 3 3  ? 9.927  12.342 8.531  1.00 67.24  ? 141 PRO C N     1 
ATOM   585 C CA    . PRO C 3 3  ? 10.130 10.906 8.518  1.00 65.30  ? 141 PRO C CA    1 
ATOM   586 C C     . PRO C 3 3  ? 11.621 10.665 8.634  1.00 66.31  ? 141 PRO C C     1 
ATOM   587 O O     . PRO C 3 3  ? 12.413 11.477 8.149  1.00 67.54  ? 141 PRO C O     1 
ATOM   588 C CB    . PRO C 3 3  ? 9.571  10.502 7.162  1.00 70.47  ? 141 PRO C CB    1 
ATOM   589 C CG    . PRO C 3 3  ? 9.899  11.679 6.309  1.00 69.76  ? 141 PRO C CG    1 
ATOM   590 C CD    . PRO C 3 3  ? 9.527  12.835 7.204  1.00 67.01  ? 141 PRO C CD    1 
ATOM   591 N N     . ARG C 3 4  ? 11.995 9.581  9.309  1.00 69.66  ? 142 ARG C N     1 
ATOM   592 C CA    . ARG C 3 4  ? 13.393 9.218  9.471  1.00 69.58  ? 142 ARG C CA    1 
ATOM   593 C C     . ARG C 3 4  ? 13.958 8.865  8.111  1.00 73.72  ? 142 ARG C C     1 
ATOM   594 O O     . ARG C 3 4  ? 13.230 8.841  7.111  1.00 73.99  ? 142 ARG C O     1 
ATOM   595 C CB    . ARG C 3 4  ? 13.539 8.012  10.396 1.00 55.68  ? 142 ARG C CB    1 
ATOM   596 C CG    . ARG C 3 4  ? 13.361 8.353  11.843 1.00 46.08  ? 142 ARG C CG    1 
ATOM   597 C CD    . ARG C 3 4  ? 13.488 7.143  12.702 1.00 44.88  ? 142 ARG C CD    1 
ATOM   598 N NE    . ARG C 3 4  ? 13.427 7.521  14.109 1.00 55.38  ? 142 ARG C NE    1 
ATOM   599 C CZ    . ARG C 3 4  ? 14.354 8.250  14.735 1.00 64.66  ? 142 ARG C CZ    1 
ATOM   600 N NH1   . ARG C 3 4  ? 15.431 8.679  14.077 1.00 71.31  ? 142 ARG C NH1   1 
ATOM   601 N NH2   . ARG C 3 4  ? 14.197 8.561  16.021 1.00 66.90  ? 142 ARG C NH2   1 
ATOM   602 N N     . ALA C 3 5  ? 15.258 8.599  8.074  1.00 73.54  ? 143 ALA C N     1 
ATOM   603 C CA    . ALA C 3 5  ? 15.897 8.231  6.827  1.00 79.02  ? 143 ALA C CA    1 
ATOM   604 C C     . ALA C 3 5  ? 16.219 6.743  6.863  1.00 80.72  ? 143 ALA C C     1 
ATOM   605 O O     . ALA C 3 5  ? 16.369 6.113  5.821  1.00 82.18  ? 143 ALA C O     1 
ATOM   606 C CB    . ALA C 3 5  ? 17.161 9.058  6.622  1.00 84.32  ? 143 ALA C CB    1 
ATOM   607 N N     . ILE C 3 6  ? 16.307 6.187  8.068  1.00 81.73  ? 144 ILE C N     1 
ATOM   608 C CA    . ILE C 3 6  ? 16.601 4.764  8.245  1.00 82.79  ? 144 ILE C CA    1 
ATOM   609 C C     . ILE C 3 6  ? 15.723 4.091  9.314  1.00 87.72  ? 144 ILE C C     1 
ATOM   610 O O     . ILE C 3 6  ? 15.826 4.381  10.507 1.00 92.00  ? 144 ILE C O     1 
ATOM   611 C CB    . ILE C 3 6  ? 18.093 4.542  8.612  1.00 79.27  ? 144 ILE C CB    1 
ATOM   612 C CG1   . ILE C 3 6  ? 18.461 5.360  9.855  1.00 80.33  ? 144 ILE C CG1   1 
ATOM   613 C CG2   . ILE C 3 6  ? 18.974 4.918  7.440  1.00 76.31  ? 144 ILE C CG2   1 
ATOM   614 C CD1   . ILE C 3 6  ? 19.928 5.262  10.257 1.00 78.56  ? 144 ILE C CD1   1 
ATOM   615 N N     . ASN C 3 7  ? 14.866 3.180  8.874  1.00 86.71  ? 145 ASN C N     1 
ATOM   616 C CA    . ASN C 3 7  ? 13.963 2.451  9.767  1.00 89.57  ? 145 ASN C CA    1 
ATOM   617 C C     . ASN C 3 7  ? 14.670 1.357  10.579 1.00 91.72  ? 145 ASN C C     1 
ATOM   618 O O     . ASN C 3 7  ? 15.772 0.930  10.229 1.00 95.94  ? 145 ASN C O     1 
ATOM   619 C CB    . ASN C 3 7  ? 12.855 1.844  8.930  1.00 83.85  ? 145 ASN C CB    1 
ATOM   620 C CG    . ASN C 3 7  ? 13.375 1.308  7.629  1.00 81.01  ? 145 ASN C CG    1 
ATOM   621 O OD1   . ASN C 3 7  ? 14.111 0.326  7.607  1.00 81.64  ? 145 ASN C OD1   1 
ATOM   622 N ND2   . ASN C 3 7  ? 13.021 1.965  6.531  1.00 80.91  ? 145 ASN C ND2   1 
ATOM   623 N N     . LYS C 3 8  ? 14.022 0.897  11.650 1.00 90.41  ? 146 LYS C N     1 
ATOM   624 C CA    . LYS C 3 8  ? 14.597 -0.126 12.532 1.00 88.09  ? 146 LYS C CA    1 
ATOM   625 C C     . LYS C 3 8  ? 15.190 -1.331 11.813 1.00 85.25  ? 146 LYS C C     1 
ATOM   626 O O     . LYS C 3 8  ? 16.020 -2.049 12.386 1.00 83.53  ? 146 LYS C O     1 
ATOM   627 C CB    . LYS C 3 8  ? 13.555 -0.617 13.550 1.00 91.90  ? 146 LYS C CB    1 
ATOM   628 N N     . HIS C 3 9  ? 14.773 -1.554 10.566 1.00 82.02  ? 147 HIS C N     1 
ATOM   629 C CA    . HIS C 3 9  ? 15.275 -2.688 9.787  1.00 82.53  ? 147 HIS C CA    1 
ATOM   630 C C     . HIS C 3 9  ? 16.729 -2.459 9.401  1.00 83.52  ? 147 HIS C C     1 
ATOM   631 O O     . HIS C 3 9  ? 17.572 -3.347 9.560  1.00 79.49  ? 147 HIS C O     1 
ATOM   632 N N     . GLU C 3 10 ? 17.003 -1.260 8.889  1.00 87.83  ? 148 GLU C N     1 
ATOM   633 C CA    . GLU C 3 10 ? 18.346 -0.860 8.475  1.00 88.60  ? 148 GLU C CA    1 
ATOM   634 C C     . GLU C 3 10 ? 19.175 -0.664 9.727  1.00 85.99  ? 148 GLU C C     1 
ATOM   635 O O     . GLU C 3 10 ? 20.355 -0.998 9.769  1.00 86.05  ? 148 GLU C O     1 
ATOM   636 C CB    . GLU C 3 10 ? 18.286 0.454  7.706  1.00 89.56  ? 148 GLU C CB    1 
ATOM   637 N N     . GLN C 3 11 ? 18.550 -0.114 10.756 1.00 84.51  ? 149 GLN C N     1 
ATOM   638 C CA    . GLN C 3 11 ? 19.264 0.103  11.996 1.00 85.80  ? 149 GLN C CA    1 
ATOM   639 C C     . GLN C 3 11 ? 19.934 -1.201 12.402 1.00 86.61  ? 149 GLN C C     1 
ATOM   640 O O     . GLN C 3 11 ? 20.832 -1.211 13.235 1.00 91.68  ? 149 GLN C O     1 
ATOM   641 N N     . GLU C 3 12 ? 19.495 -2.300 11.794 1.00 88.46  ? 150 GLU C N     1 
ATOM   642 C CA    . GLU C 3 12 ? 20.072 -3.613 12.062 1.00 87.01  ? 150 GLU C CA    1 
ATOM   643 C C     . GLU C 3 12 ? 20.943 -4.065 10.893 1.00 78.06  ? 150 GLU C C     1 
ATOM   644 O O     . GLU C 3 12 ? 22.057 -4.527 11.101 1.00 74.62  ? 150 GLU C O     1 
ATOM   645 N N     . GLN C 3 13 ? 20.445 -3.929 9.670  1.00 73.39  ? 151 GLN C N     1 
ATOM   646 C CA    . GLN C 3 13 ? 21.222 -4.307 8.492  1.00 76.13  ? 151 GLN C CA    1 
ATOM   647 C C     . GLN C 3 13 ? 22.505 -3.470 8.386  1.00 81.07  ? 151 GLN C C     1 
ATOM   648 O O     . GLN C 3 13 ? 23.595 -3.997 8.141  1.00 80.76  ? 151 GLN C O     1 
ATOM   649 C CB    . GLN C 3 13 ? 20.382 -4.127 7.225  1.00 74.48  ? 151 GLN C CB    1 
ATOM   650 C CG    . GLN C 3 13 ? 21.200 -3.805 5.994  1.00 74.58  ? 151 GLN C CG    1 
ATOM   651 C CD    . GLN C 3 13 ? 20.375 -3.815 4.733  1.00 83.94  ? 151 GLN C CD    1 
ATOM   652 O OE1   . GLN C 3 13 ? 19.198 -3.432 4.738  1.00 82.81  ? 151 GLN C OE1   1 
ATOM   653 N NE2   . GLN C 3 13 ? 20.991 -4.238 3.631  1.00 86.85  ? 151 GLN C NE2   1 
ATOM   654 N N     . ILE C 3 14 ? 22.363 -2.158 8.558  1.00 86.57  ? 152 ILE C N     1 
ATOM   655 C CA    . ILE C 3 14 ? 23.493 -1.243 8.504  1.00 83.77  ? 152 ILE C CA    1 
ATOM   656 C C     . ILE C 3 14 ? 24.420 -1.524 9.677  1.00 85.02  ? 152 ILE C C     1 
ATOM   657 O O     . ILE C 3 14 ? 25.639 -1.596 9.520  1.00 92.06  ? 152 ILE C O     1 
ATOM   658 C CB    . ILE C 3 14 ? 23.019 0.229  8.563  1.00 77.61  ? 152 ILE C CB    1 
ATOM   659 C CG1   . ILE C 3 14 ? 22.604 0.681  7.160  1.00 78.48  ? 152 ILE C CG1   1 
ATOM   660 C CG2   . ILE C 3 14 ? 24.109 1.118  9.145  1.00 70.38  ? 152 ILE C CG2   1 
ATOM   661 C CD1   . ILE C 3 14 ? 22.062 2.098  7.090  1.00 82.72  ? 152 ILE C CD1   1 
ATOM   662 N N     . SER C 3 15 ? 23.841 -1.679 10.858 1.00 79.04  ? 153 SER C N     1 
ATOM   663 C CA    . SER C 3 15 ? 24.651 -1.959 12.025 1.00 82.40  ? 153 SER C CA    1 
ATOM   664 C C     . SER C 3 15 ? 25.534 -3.163 11.714 1.00 86.13  ? 153 SER C C     1 
ATOM   665 O O     . SER C 3 15 ? 26.729 -3.175 12.035 1.00 88.50  ? 153 SER C O     1 
ATOM   666 C CB    . SER C 3 15 ? 23.765 -2.260 13.231 1.00 81.30  ? 153 SER C CB    1 
ATOM   667 O OG    . SER C 3 15 ? 24.551 -2.503 14.383 1.00 79.71  ? 153 SER C OG    1 
ATOM   668 N N     . ARG C 3 16 ? 24.939 -4.169 11.076 1.00 86.00  ? 154 ARG C N     1 
ATOM   669 C CA    . ARG C 3 16 ? 25.659 -5.383 10.714 1.00 85.28  ? 154 ARG C CA    1 
ATOM   670 C C     . ARG C 3 16 ? 26.771 -4.988 9.753  1.00 81.30  ? 154 ARG C C     1 
ATOM   671 O O     . ARG C 3 16 ? 27.937 -5.309 9.966  1.00 83.37  ? 154 ARG C O     1 
ATOM   672 N N     . LEU C 3 17 ? 26.405 -4.280 8.695  1.00 73.05  ? 155 LEU C N     1 
ATOM   673 C CA    . LEU C 3 17 ? 27.384 -3.836 7.723  1.00 68.72  ? 155 LEU C CA    1 
ATOM   674 C C     . LEU C 3 17 ? 28.577 -3.197 8.402  1.00 68.02  ? 155 LEU C C     1 
ATOM   675 O O     . LEU C 3 17 ? 29.712 -3.550 8.116  1.00 68.14  ? 155 LEU C O     1 
ATOM   676 C CB    . LEU C 3 17 ? 26.756 -2.826 6.777  1.00 64.97  ? 155 LEU C CB    1 
ATOM   677 C CG    . LEU C 3 17 ? 25.905 -3.456 5.702  1.00 57.04  ? 155 LEU C CG    1 
ATOM   678 C CD1   . LEU C 3 17 ? 25.378 -2.369 4.771  1.00 62.19  ? 155 LEU C CD1   1 
ATOM   679 C CD2   . LEU C 3 17 ? 26.771 -4.439 4.941  1.00 58.55  ? 155 LEU C CD2   1 
ATOM   680 N N     . LEU C 3 18 ? 28.318 -2.247 9.297  1.00 74.18  ? 156 LEU C N     1 
ATOM   681 C CA    . LEU C 3 18 ? 29.392 -1.554 10.016 1.00 83.15  ? 156 LEU C CA    1 
ATOM   682 C C     . LEU C 3 18 ? 30.165 -2.510 10.933 1.00 89.36  ? 156 LEU C C     1 
ATOM   683 O O     . LEU C 3 18 ? 31.362 -2.330 11.158 1.00 89.49  ? 156 LEU C O     1 
ATOM   684 C CB    . LEU C 3 18 ? 28.823 -0.407 10.865 1.00 80.80  ? 156 LEU C CB    1 
ATOM   685 C CG    . LEU C 3 18 ? 28.093 0.754  10.188 1.00 74.94  ? 156 LEU C CG    1 
ATOM   686 C CD1   . LEU C 3 18 ? 27.487 1.676  11.253 1.00 63.75  ? 156 LEU C CD1   1 
ATOM   687 C CD2   . LEU C 3 18 ? 29.063 1.504  9.307  1.00 71.72  ? 156 LEU C CD2   1 
ATOM   688 N N     . GLU C 3 19 ? 29.471 -3.516 11.463 1.00 95.15  ? 157 GLU C N     1 
ATOM   689 C CA    . GLU C 3 19 ? 30.082 -4.496 12.360 1.00 100.81 ? 157 GLU C CA    1 
ATOM   690 C C     . GLU C 3 19 ? 31.059 -5.377 11.572 1.00 102.40 ? 157 GLU C C     1 
ATOM   691 O O     . GLU C 3 19 ? 31.945 -6.013 12.147 1.00 105.93 ? 157 GLU C O     1 
ATOM   692 N N     . LYS C 3 20 ? 30.881 -5.404 10.251 1.00 99.76  ? 158 LYS C N     1 
ATOM   693 C CA    . LYS C 3 20 ? 31.740 -6.160 9.342  1.00 92.52  ? 158 LYS C CA    1 
ATOM   694 C C     . LYS C 3 20 ? 32.822 -5.208 8.837  1.00 90.87  ? 158 LYS C C     1 
ATOM   695 O O     . LYS C 3 20 ? 33.511 -5.488 7.856  1.00 88.63  ? 158 LYS C O     1 
ATOM   696 C CB    . LYS C 3 20 ? 30.947 -6.662 8.134  1.00 90.80  ? 158 LYS C CB    1 
ATOM   697 N N     . GLY C 3 21 ? 32.953 -4.071 9.511  1.00 88.68  ? 159 GLY C N     1 
ATOM   698 C CA    . GLY C 3 21 ? 33.936 -3.085 9.116  1.00 82.26  ? 159 GLY C CA    1 
ATOM   699 C C     . GLY C 3 21 ? 33.522 -2.397 7.833  1.00 78.71  ? 159 GLY C C     1 
ATOM   700 O O     . GLY C 3 21 ? 34.109 -2.608 6.776  1.00 75.33  ? 159 GLY C O     1 
ATOM   701 N N     . HIS C 3 22 ? 32.482 -1.585 7.911  1.00 78.51  ? 160 HIS C N     1 
ATOM   702 C CA    . HIS C 3 22 ? 32.031 -0.863 6.736  1.00 80.99  ? 160 HIS C CA    1 
ATOM   703 C C     . HIS C 3 22 ? 32.143 0.624  7.015  1.00 83.93  ? 160 HIS C C     1 
ATOM   704 O O     . HIS C 3 22 ? 31.830 1.084  8.117  1.00 89.04  ? 160 HIS C O     1 
ATOM   705 C CB    . HIS C 3 22 ? 30.595 -1.259 6.377  1.00 81.67  ? 160 HIS C CB    1 
ATOM   706 C CG    . HIS C 3 22 ? 30.517 -2.420 5.433  1.00 85.79  ? 160 HIS C CG    1 
ATOM   707 N ND1   . HIS C 3 22 ? 30.989 -2.355 4.140  1.00 88.52  ? 160 HIS C ND1   1 
ATOM   708 C CD2   . HIS C 3 22 ? 30.048 -3.680 5.598  1.00 85.37  ? 160 HIS C CD2   1 
ATOM   709 C CE1   . HIS C 3 22 ? 30.815 -3.524 3.549  1.00 87.37  ? 160 HIS C CE1   1 
ATOM   710 N NE2   . HIS C 3 22 ? 30.246 -4.346 4.413  1.00 90.51  ? 160 HIS C NE2   1 
ATOM   711 N N     . PRO C 3 23 ? 32.628 1.391  6.027  1.00 80.33  ? 161 PRO C N     1 
ATOM   712 C CA    . PRO C 3 23 ? 32.800 2.840  6.146  1.00 76.38  ? 161 PRO C CA    1 
ATOM   713 C C     . PRO C 3 23 ? 31.498 3.622  6.108  1.00 71.33  ? 161 PRO C C     1 
ATOM   714 O O     . PRO C 3 23 ? 30.782 3.610  5.099  1.00 70.91  ? 161 PRO C O     1 
ATOM   715 C CB    . PRO C 3 23 ? 33.709 3.173  4.964  1.00 77.79  ? 161 PRO C CB    1 
ATOM   716 C CG    . PRO C 3 23 ? 33.260 2.197  3.928  1.00 74.88  ? 161 PRO C CG    1 
ATOM   717 C CD    . PRO C 3 23 ? 33.142 0.912  4.731  1.00 81.18  ? 161 PRO C CD    1 
ATOM   718 N N     . ARG C 3 24 ? 31.205 4.308  7.208  1.00 65.74  ? 162 ARG C N     1 
ATOM   719 C CA    . ARG C 3 24 ? 29.997 5.105  7.293  1.00 67.14  ? 162 ARG C CA    1 
ATOM   720 C C     . ARG C 3 24 ? 29.918 6.063  6.112  1.00 71.73  ? 162 ARG C C     1 
ATOM   721 O O     . ARG C 3 24 ? 28.866 6.235  5.496  1.00 71.95  ? 162 ARG C O     1 
ATOM   722 C CB    . ARG C 3 24 ? 29.987 5.894  8.581  1.00 60.03  ? 162 ARG C CB    1 
ATOM   723 C CG    . ARG C 3 24 ? 30.064 5.055  9.835  1.00 50.08  ? 162 ARG C CG    1 
ATOM   724 C CD    . ARG C 3 24 ? 29.486 5.873  10.988 1.00 56.77  ? 162 ARG C CD    1 
ATOM   725 N NE    . ARG C 3 24 ? 29.793 5.356  12.318 1.00 55.24  ? 162 ARG C NE    1 
ATOM   726 C CZ    . ARG C 3 24 ? 30.964 4.830  12.673 1.00 58.94  ? 162 ARG C CZ    1 
ATOM   727 N NH1   . ARG C 3 24 ? 31.154 4.405  13.928 1.00 57.05  ? 162 ARG C NH1   1 
ATOM   728 N NH2   . ARG C 3 24 ? 31.934 4.686  11.763 1.00 56.29  ? 162 ARG C NH2   1 
ATOM   729 N N     . GLN C 3 25 ? 31.046 6.674  5.789  1.00 71.67  ? 163 GLN C N     1 
ATOM   730 C CA    . GLN C 3 25 ? 31.103 7.616  4.685  1.00 76.39  ? 163 GLN C CA    1 
ATOM   731 C C     . GLN C 3 25 ? 30.633 6.993  3.367  1.00 74.43  ? 163 GLN C C     1 
ATOM   732 O O     . GLN C 3 25 ? 30.095 7.672  2.498  1.00 71.90  ? 163 GLN C O     1 
ATOM   733 C CB    . GLN C 3 25 ? 32.532 8.161  4.547  1.00 84.36  ? 163 GLN C CB    1 
ATOM   734 N N     . GLN C 3 26 ? 30.829 5.691  3.222  1.00 77.70  ? 164 GLN C N     1 
ATOM   735 C CA    . GLN C 3 26 ? 30.439 5.005  1.994  1.00 79.95  ? 164 GLN C CA    1 
ATOM   736 C C     . GLN C 3 26 ? 29.052 4.453  2.208  1.00 76.66  ? 164 GLN C C     1 
ATOM   737 O O     . GLN C 3 26 ? 28.205 4.454  1.301  1.00 68.66  ? 164 GLN C O     1 
ATOM   738 N N     . LEU C 3 27 ? 28.844 3.989  3.438  1.00 76.10  ? 165 LEU C N     1 
ATOM   739 C CA    . LEU C 3 27 ? 27.577 3.419  3.852  1.00 79.38  ? 165 LEU C CA    1 
ATOM   740 C C     . LEU C 3 27 ? 26.490 4.471  3.730  1.00 84.70  ? 165 LEU C C     1 
ATOM   741 O O     . LEU C 3 27 ? 25.310 4.168  3.871  1.00 89.80  ? 165 LEU C O     1 
ATOM   742 C CB    . LEU C 3 27 ? 27.673 2.923  5.298  1.00 71.25  ? 165 LEU C CB    1 
ATOM   743 C CG    . LEU C 3 27 ? 26.768 1.729  5.624  1.00 71.03  ? 165 LEU C CG    1 
ATOM   744 C CD1   . LEU C 3 27 ? 27.060 0.608  4.636  1.00 70.28  ? 165 LEU C CD1   1 
ATOM   745 C CD2   . LEU C 3 27 ? 26.993 1.254  7.039  1.00 66.11  ? 165 LEU C CD2   1 
ATOM   746 N N     . ALA C 3 28 ? 26.900 5.706  3.455  1.00 84.80  ? 166 ALA C N     1 
ATOM   747 C CA    . ALA C 3 28 ? 25.972 6.819  3.315  1.00 78.81  ? 166 ALA C CA    1 
ATOM   748 C C     . ALA C 3 28 ? 25.759 7.171  1.852  1.00 79.19  ? 166 ALA C C     1 
ATOM   749 O O     . ALA C 3 28 ? 24.625 7.271  1.401  1.00 83.96  ? 166 ALA C O     1 
ATOM   750 C CB    . ALA C 3 28 ? 26.496 8.020  4.061  1.00 73.80  ? 166 ALA C CB    1 
ATOM   751 N N     . ILE C 3 29 ? 26.845 7.373  1.115  1.00 80.26  ? 167 ILE C N     1 
ATOM   752 C CA    . ILE C 3 29 ? 26.735 7.707  -0.299 1.00 84.04  ? 167 ILE C CA    1 
ATOM   753 C C     . ILE C 3 29 ? 25.680 6.794  -0.902 1.00 86.13  ? 167 ILE C C     1 
ATOM   754 O O     . ILE C 3 29 ? 24.640 7.239  -1.387 1.00 82.13  ? 167 ILE C O     1 
ATOM   755 C CB    . ILE C 3 29 ? 28.050 7.431  -1.068 1.00 86.10  ? 167 ILE C CB    1 
ATOM   756 C CG1   . ILE C 3 29 ? 29.233 8.102  -0.363 1.00 88.18  ? 167 ILE C CG1   1 
ATOM   757 C CG2   . ILE C 3 29 ? 27.919 7.922  -2.513 1.00 81.96  ? 167 ILE C CG2   1 
ATOM   758 C CD1   . ILE C 3 29 ? 30.573 7.867  -1.051 1.00 81.97  ? 167 ILE C CD1   1 
ATOM   759 N N     . ILE C 3 30 ? 25.975 5.501  -0.832 1.00 89.92  ? 168 ILE C N     1 
ATOM   760 C CA    . ILE C 3 30 ? 25.132 4.442  -1.368 1.00 89.42  ? 168 ILE C CA    1 
ATOM   761 C C     . ILE C 3 30 ? 23.683 4.489  -0.892 1.00 87.82  ? 168 ILE C C     1 
ATOM   762 O O     . ILE C 3 30 ? 22.762 4.657  -1.700 1.00 88.04  ? 168 ILE C O     1 
ATOM   763 C CB    . ILE C 3 30 ? 25.747 3.073  -1.029 1.00 87.79  ? 168 ILE C CB    1 
ATOM   764 C CG1   . ILE C 3 30 ? 27.195 3.028  -1.530 1.00 87.67  ? 168 ILE C CG1   1 
ATOM   765 C CG2   . ILE C 3 30 ? 24.953 1.972  -1.689 1.00 85.10  ? 168 ILE C CG2   1 
ATOM   766 C CD1   . ILE C 3 30 ? 28.004 1.864  -1.012 1.00 89.04  ? 168 ILE C CD1   1 
ATOM   767 N N     . PHE C 3 31 ? 23.477 4.329  0.411  1.00 82.83  ? 169 PHE C N     1 
ATOM   768 C CA    . PHE C 3 31 ? 22.131 4.371  0.955  1.00 83.07  ? 169 PHE C CA    1 
ATOM   769 C C     . PHE C 3 31 ? 21.388 5.619  0.495  1.00 87.64  ? 169 PHE C C     1 
ATOM   770 O O     . PHE C 3 31 ? 20.353 5.531  -0.175 1.00 92.38  ? 169 PHE C O     1 
ATOM   771 C CB    . PHE C 3 31 ? 22.178 4.324  2.474  1.00 83.12  ? 169 PHE C CB    1 
ATOM   772 C CG    . PHE C 3 31 ? 22.133 2.933  3.025  1.00 92.04  ? 169 PHE C CG    1 
ATOM   773 C CD1   . PHE C 3 31 ? 23.176 2.046  2.793  1.00 94.05  ? 169 PHE C CD1   1 
ATOM   774 C CD2   . PHE C 3 31 ? 21.024 2.494  3.742  1.00 97.12  ? 169 PHE C CD2   1 
ATOM   775 C CE1   . PHE C 3 31 ? 23.115 0.739  3.264  1.00 96.92  ? 169 PHE C CE1   1 
ATOM   776 C CE2   . PHE C 3 31 ? 20.950 1.189  4.218  1.00 98.08  ? 169 PHE C CE2   1 
ATOM   777 C CZ    . PHE C 3 31 ? 21.998 0.308  3.979  1.00 99.08  ? 169 PHE C CZ    1 
ATOM   778 N N     . GLY C 3 32 ? 21.923 6.782  0.850  1.00 87.10  ? 170 GLY C N     1 
ATOM   779 C CA    . GLY C 3 32 ? 21.300 8.033  0.453  1.00 81.90  ? 170 GLY C CA    1 
ATOM   780 C C     . GLY C 3 32 ? 21.332 9.068  1.560  1.00 75.40  ? 170 GLY C C     1 
ATOM   781 O O     . GLY C 3 32 ? 21.189 10.254 1.308  1.00 71.71  ? 170 GLY C O     1 
ATOM   782 N N     . ILE C 3 33 ? 21.532 8.605  2.788  1.00 72.74  ? 171 ILE C N     1 
ATOM   783 C CA    . ILE C 3 33 ? 21.575 9.482  3.943  1.00 69.60  ? 171 ILE C CA    1 
ATOM   784 C C     . ILE C 3 33 ? 22.954 10.134 4.124  1.00 73.87  ? 171 ILE C C     1 
ATOM   785 O O     . ILE C 3 33 ? 23.963 9.668  3.582  1.00 73.94  ? 171 ILE C O     1 
ATOM   786 C CB    . ILE C 3 33 ? 21.197 8.713  5.232  1.00 59.94  ? 171 ILE C CB    1 
ATOM   787 C CG1   . ILE C 3 33 ? 22.310 7.776  5.647  1.00 53.00  ? 171 ILE C CG1   1 
ATOM   788 C CG2   . ILE C 3 33 ? 19.999 7.840  4.989  1.00 57.28  ? 171 ILE C CG2   1 
ATOM   789 C CD1   . ILE C 3 33 ? 22.037 7.126  6.995  1.00 62.49  ? 171 ILE C CD1   1 
ATOM   790 N N     . GLY C 3 34 ? 22.980 11.225 4.886  1.00 72.93  ? 172 GLY C N     1 
ATOM   791 C CA    . GLY C 3 34 ? 24.218 11.940 5.133  1.00 66.20  ? 172 GLY C CA    1 
ATOM   792 C C     . GLY C 3 34 ? 25.034 11.298 6.231  1.00 57.93  ? 172 GLY C C     1 
ATOM   793 O O     . GLY C 3 34 ? 24.492 10.588 7.088  1.00 56.27  ? 172 GLY C O     1 
ATOM   794 N N     . VAL C 3 35 ? 26.338 11.561 6.205  1.00 50.19  ? 173 VAL C N     1 
ATOM   795 C CA    . VAL C 3 35 ? 27.274 11.007 7.179  1.00 41.46  ? 173 VAL C CA    1 
ATOM   796 C C     . VAL C 3 35 ? 26.926 11.372 8.625  1.00 42.23  ? 173 VAL C C     1 
ATOM   797 O O     . VAL C 3 35 ? 27.079 10.542 9.526  1.00 44.69  ? 173 VAL C O     1 
ATOM   798 C CB    . VAL C 3 35 ? 28.714 11.495 6.869  1.00 40.93  ? 173 VAL C CB    1 
ATOM   799 C CG1   . VAL C 3 35 ? 29.698 10.904 7.854  1.00 47.00  ? 173 VAL C CG1   1 
ATOM   800 C CG2   . VAL C 3 35 ? 29.094 11.105 5.461  1.00 32.12  ? 173 VAL C CG2   1 
ATOM   801 N N     . SER C 3 36 ? 26.456 12.592 8.872  1.00 38.41  ? 174 SER C N     1 
ATOM   802 C CA    . SER C 3 36 ? 26.138 12.947 10.263 1.00 40.91  ? 174 SER C CA    1 
ATOM   803 C C     . SER C 3 36 ? 25.022 12.106 10.824 1.00 45.40  ? 174 SER C C     1 
ATOM   804 O O     . SER C 3 36 ? 25.027 11.780 12.017 1.00 48.94  ? 174 SER C O     1 
ATOM   805 C CB    . SER C 3 36 ? 25.734 14.429 10.416 1.00 39.38  ? 174 SER C CB    1 
ATOM   806 O OG    . SER C 3 36 ? 25.367 15.015 9.180  1.00 54.84  ? 174 SER C OG    1 
ATOM   807 N N     . THR C 3 37 ? 24.049 11.781 9.970  1.00 49.69  ? 175 THR C N     1 
ATOM   808 C CA    . THR C 3 37 ? 22.913 10.977 10.396 1.00 52.33  ? 175 THR C CA    1 
ATOM   809 C C     . THR C 3 37 ? 23.496 9.662  10.853 1.00 55.31  ? 175 THR C C     1 
ATOM   810 O O     . THR C 3 37 ? 23.318 9.277  12.007 1.00 57.04  ? 175 THR C O     1 
ATOM   811 C CB    . THR C 3 37 ? 21.885 10.741 9.245  1.00 58.37  ? 175 THR C CB    1 
ATOM   812 O OG1   . THR C 3 37 ? 21.439 12.004 8.715  1.00 52.72  ? 175 THR C OG1   1 
ATOM   813 C CG2   . THR C 3 37 ? 20.662 9.953  9.763  1.00 57.66  ? 175 THR C CG2   1 
ATOM   814 N N     . LEU C 3 38 ? 24.239 8.999  9.966  1.00 59.27  ? 176 LEU C N     1 
ATOM   815 C CA    . LEU C 3 38 ? 24.877 7.714  10.318 1.00 57.81  ? 176 LEU C CA    1 
ATOM   816 C C     . LEU C 3 38 ? 25.710 7.747  11.608 1.00 59.90  ? 176 LEU C C     1 
ATOM   817 O O     . LEU C 3 38 ? 25.527 6.892  12.469 1.00 70.00  ? 176 LEU C O     1 
ATOM   818 C CB    . LEU C 3 38 ? 25.741 7.192  9.168  1.00 58.10  ? 176 LEU C CB    1 
ATOM   819 C CG    . LEU C 3 38 ? 25.022 6.537  7.981  1.00 63.17  ? 176 LEU C CG    1 
ATOM   820 C CD1   . LEU C 3 38 ? 25.971 6.380  6.804  1.00 71.13  ? 176 LEU C CD1   1 
ATOM   821 C CD2   . LEU C 3 38 ? 24.484 5.177  8.390  1.00 61.16  ? 176 LEU C CD2   1 
ATOM   822 N N     . TYR C 3 39 ? 26.611 8.709  11.774 1.00 55.21  ? 177 TYR C N     1 
ATOM   823 C CA    . TYR C 3 39 ? 27.396 8.738  13.022 1.00 50.79  ? 177 TYR C CA    1 
ATOM   824 C C     . TYR C 3 39 ? 26.496 8.929  14.238 1.00 49.76  ? 177 TYR C C     1 
ATOM   825 O O     . TYR C 3 39 ? 26.830 8.518  15.345 1.00 52.59  ? 177 TYR C O     1 
ATOM   826 C CB    . TYR C 3 39 ? 28.445 9.861  12.991 1.00 44.38  ? 177 TYR C CB    1 
ATOM   827 C CG    . TYR C 3 39 ? 29.702 9.501  12.239 1.00 44.26  ? 177 TYR C CG    1 
ATOM   828 C CD1   . TYR C 3 39 ? 30.595 8.571  12.747 1.00 35.69  ? 177 TYR C CD1   1 
ATOM   829 C CD2   . TYR C 3 39 ? 30.002 10.100 11.024 1.00 46.67  ? 177 TYR C CD2   1 
ATOM   830 C CE1   . TYR C 3 39 ? 31.758 8.251  12.059 1.00 47.70  ? 177 TYR C CE1   1 
ATOM   831 C CE2   . TYR C 3 39 ? 31.155 9.796  10.331 1.00 40.59  ? 177 TYR C CE2   1 
ATOM   832 C CZ    . TYR C 3 39 ? 32.033 8.872  10.845 1.00 49.71  ? 177 TYR C CZ    1 
ATOM   833 O OH    . TYR C 3 39 ? 33.180 8.576  10.144 1.00 53.08  ? 177 TYR C OH    1 
ATOM   834 N N     . ARG C 3 40 ? 25.352 9.569  14.022 1.00 55.09  ? 178 ARG C N     1 
ATOM   835 C CA    . ARG C 3 40 ? 24.395 9.843  15.096 1.00 61.49  ? 178 ARG C CA    1 
ATOM   836 C C     . ARG C 3 40 ? 23.731 8.539  15.558 1.00 66.61  ? 178 ARG C C     1 
ATOM   837 O O     . ARG C 3 40 ? 23.598 8.296  16.758 1.00 70.27  ? 178 ARG C O     1 
ATOM   838 C CB    . ARG C 3 40 ? 23.358 10.870 14.601 1.00 63.34  ? 178 ARG C CB    1 
ATOM   839 C CG    . ARG C 3 40 ? 22.287 11.299 15.600 1.00 54.39  ? 178 ARG C CG    1 
ATOM   840 C CD    . ARG C 3 40 ? 21.861 12.748 15.337 1.00 58.11  ? 178 ARG C CD    1 
ATOM   841 N NE    . ARG C 3 40 ? 21.719 13.042 13.910 1.00 59.83  ? 178 ARG C NE    1 
ATOM   842 C CZ    . ARG C 3 40 ? 20.629 12.774 13.200 1.00 55.92  ? 178 ARG C CZ    1 
ATOM   843 N NH1   . ARG C 3 40 ? 20.581 13.060 11.905 1.00 46.65  ? 178 ARG C NH1   1 
ATOM   844 N NH2   . ARG C 3 40 ? 19.578 12.231 13.794 1.00 66.69  ? 178 ARG C NH2   1 
ATOM   845 N N     . TYR C 3 41 ? 23.324 7.702  14.606 1.00 70.02  ? 179 TYR C N     1 
ATOM   846 C CA    . TYR C 3 41 ? 22.719 6.412  14.930 1.00 71.06  ? 179 TYR C CA    1 
ATOM   847 C C     . TYR C 3 41 ? 23.803 5.397  15.386 1.00 69.99  ? 179 TYR C C     1 
ATOM   848 O O     . TYR C 3 41 ? 23.562 4.554  16.246 1.00 70.72  ? 179 TYR C O     1 
ATOM   849 C CB    . TYR C 3 41 ? 21.994 5.835  13.708 1.00 71.11  ? 179 TYR C CB    1 
ATOM   850 C CG    . TYR C 3 41 ? 20.639 6.436  13.353 1.00 67.71  ? 179 TYR C CG    1 
ATOM   851 C CD1   . TYR C 3 41 ? 20.539 7.602  12.587 1.00 71.49  ? 179 TYR C CD1   1 
ATOM   852 C CD2   . TYR C 3 41 ? 19.464 5.763  13.671 1.00 67.67  ? 179 TYR C CD2   1 
ATOM   853 C CE1   . TYR C 3 41 ? 19.309 8.065  12.133 1.00 71.74  ? 179 TYR C CE1   1 
ATOM   854 C CE2   . TYR C 3 41 ? 18.234 6.215  13.225 1.00 71.70  ? 179 TYR C CE2   1 
ATOM   855 C CZ    . TYR C 3 41 ? 18.160 7.362  12.449 1.00 72.82  ? 179 TYR C CZ    1 
ATOM   856 O OH    . TYR C 3 41 ? 16.939 7.758  11.950 1.00 68.80  ? 179 TYR C OH    1 
ATOM   857 N N     . PHE C 3 42 ? 25.001 5.494  14.818 1.00 68.25  ? 180 PHE C N     1 
ATOM   858 C CA    . PHE C 3 42 ? 26.064 4.573  15.171 1.00 64.83  ? 180 PHE C CA    1 
ATOM   859 C C     . PHE C 3 42 ? 27.344 5.233  15.656 1.00 63.50  ? 180 PHE C C     1 
ATOM   860 O O     . PHE C 3 42 ? 28.342 5.285  14.936 1.00 58.12  ? 180 PHE C O     1 
ATOM   861 C CB    . PHE C 3 42 ? 26.351 3.685  13.977 1.00 66.09  ? 180 PHE C CB    1 
ATOM   862 C CG    . PHE C 3 42 ? 25.122 3.071  13.407 1.00 67.89  ? 180 PHE C CG    1 
ATOM   863 C CD1   . PHE C 3 42 ? 24.641 3.463  12.161 1.00 69.25  ? 180 PHE C CD1   1 
ATOM   864 C CD2   . PHE C 3 42 ? 24.402 2.135  14.144 1.00 59.34  ? 180 PHE C CD2   1 
ATOM   865 C CE1   . PHE C 3 42 ? 23.458 2.931  11.661 1.00 69.16  ? 180 PHE C CE1   1 
ATOM   866 C CE2   . PHE C 3 42 ? 23.230 1.606  13.653 1.00 60.10  ? 180 PHE C CE2   1 
ATOM   867 C CZ    . PHE C 3 42 ? 22.752 2.000  12.411 1.00 64.97  ? 180 PHE C CZ    1 
ATOM   868 N N     . PRO C 3 43 ? 27.333 5.731  16.902 1.00 61.85  ? 181 PRO C N     1 
ATOM   869 C CA    . PRO C 3 43 ? 28.514 6.383  17.460 1.00 64.86  ? 181 PRO C CA    1 
ATOM   870 C C     . PRO C 3 43 ? 29.744 5.530  17.191 1.00 76.44  ? 181 PRO C C     1 
ATOM   871 O O     . PRO C 3 43 ? 29.636 4.309  17.031 1.00 73.71  ? 181 PRO C O     1 
ATOM   872 C CB    . PRO C 3 43 ? 28.193 6.464  18.948 1.00 58.40  ? 181 PRO C CB    1 
ATOM   873 C CG    . PRO C 3 43 ? 26.720 6.599  18.962 1.00 53.71  ? 181 PRO C CG    1 
ATOM   874 C CD    . PRO C 3 43 ? 26.267 5.615  17.911 1.00 58.93  ? 181 PRO C CD    1 
ATOM   875 N N     . ALA C 3 44 ? 30.910 6.169  17.131 1.00 83.01  ? 182 ALA C N     1 
ATOM   876 C CA    . ALA C 3 44 ? 32.150 5.436  16.898 1.00 85.32  ? 182 ALA C CA    1 
ATOM   877 C C     . ALA C 3 44 ? 32.436 4.690  18.187 1.00 85.97  ? 182 ALA C C     1 
ATOM   878 O O     . ALA C 3 44 ? 33.395 3.926  18.288 1.00 91.57  ? 182 ALA C O     1 
ATOM   879 C CB    . ALA C 3 44 ? 33.283 6.390  16.571 1.00 85.46  ? 182 ALA C CB    1 
ATOM   880 N N     . SER C 3 45 ? 31.589 4.937  19.177 1.00 84.95  ? 183 SER C N     1 
ATOM   881 C CA    . SER C 3 45 ? 31.692 4.274  20.467 1.00 88.52  ? 183 SER C CA    1 
ATOM   882 C C     . SER C 3 45 ? 30.715 3.098  20.416 1.00 90.88  ? 183 SER C C     1 
ATOM   883 O O     . SER C 3 45 ? 30.098 2.749  21.428 1.00 91.00  ? 183 SER C O     1 
ATOM   884 C CB    . SER C 3 45 ? 31.299 5.234  21.603 1.00 89.90  ? 183 SER C CB    1 
ATOM   885 O OG    . SER C 3 45 ? 32.181 6.343  21.686 1.00 83.78  ? 183 SER C OG    1 
ATOM   886 N N     . SER C 3 46 ? 30.578 2.508  19.223 1.00 91.31  ? 184 SER C N     1 
ATOM   887 C CA    . SER C 3 46 ? 29.683 1.371  18.980 1.00 89.86  ? 184 SER C CA    1 
ATOM   888 C C     . SER C 3 46 ? 30.437 0.163  18.407 1.00 85.83  ? 184 SER C C     1 
ATOM   889 O O     . SER C 3 46 ? 30.186 -0.187 17.225 1.00 81.68  ? 184 SER C O     1 
ATOM   890 C CB    . SER C 3 46 ? 28.566 1.777  18.003 1.00 94.57  ? 184 SER C CB    1 
ATOM   891 O OG    . SER C 3 46 ? 27.837 2.902  18.472 1.00 97.92  ? 184 SER C OG    1 
HETATM 892 C C     . TRS D 4 .  ? 21.057 22.339 5.492  1.00 60.94  ? 204 TRS A C     1 
HETATM 893 C C1    . TRS D 4 .  ? 21.637 22.833 4.156  1.00 53.70  ? 204 TRS A C1    1 
HETATM 894 C C2    . TRS D 4 .  ? 21.699 21.136 5.796  1.00 59.18  ? 204 TRS A C2    1 
HETATM 895 C C3    . TRS D 4 .  ? 19.530 22.273 5.296  1.00 67.62  ? 204 TRS A C3    1 
HETATM 896 N N     . TRS D 4 .  ? 21.354 23.313 6.563  1.00 45.41  ? 204 TRS A N     1 
HETATM 897 O O1    . TRS D 4 .  ? 21.392 21.968 3.132  1.00 68.86  ? 204 TRS A O1    1 
HETATM 898 O O2    . TRS D 4 .  ? 20.991 20.171 6.483  1.00 67.07  ? 204 TRS A O2    1 
HETATM 899 O O3    . TRS D 4 .  ? 18.782 21.856 6.411  1.00 78.93  ? 204 TRS A O3    1 
HETATM 900 O O     . HOH E 5 .  ? 8.598  27.348 14.795 1.00 74.95  ? 202 HOH A O     1 
HETATM 901 O O     . HOH E 5 .  ? 17.060 11.056 1.601  1.00 65.84  ? 203 HOH A O     1 
HETATM 902 O O     . HOH E 5 .  ? 7.073  30.601 12.353 1.00 56.85  ? 206 HOH A O     1 
HETATM 903 O O     . HOH E 5 .  ? 7.368  26.017 8.629  1.00 49.10  ? 207 HOH A O     1 
HETATM 904 O O     . HOH E 5 .  ? 37.008 22.138 9.590  1.00 80.94  ? 209 HOH A O     1 
HETATM 905 O O     . HOH E 5 .  ? 30.303 23.576 15.748 1.00 55.97  ? 210 HOH A O     1 
HETATM 906 O O     . HOH F 5 .  ? 25.368 28.866 13.096 1.00 70.15  ? 201 HOH B O     1 
HETATM 907 O O     . HOH F 5 .  ? 2.014  10.270 10.985 1.00 55.48  ? 208 HOH B O     1 
HETATM 908 O O     . HOH F 5 .  ? 5.576  12.987 -0.928 1.00 83.98  ? 211 HOH B O     1 
HETATM 909 O O     . HOH G 5 .  ? 26.425 13.194 14.066 1.00 46.91  ? 205 HOH C O     1 
HETATM 910 O O     . HOH G 5 .  ? 18.816 -9.507 17.115 1.00 58.21  ? 212 HOH C O     1 
HETATM 911 O O     . HOH G 5 .  ? 9.851  1.637  11.548 1.00 51.80  ? 213 HOH C O     1 
HETATM 912 O O     . HOH G 5 .  ? 16.444 3.922  17.672 1.00 83.20  ? 214 HOH C O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  DT  1  2   2   DT  T   A . n 
A 1 2  DG  2  3   3   DG  G   A . n 
A 1 3  DT  3  4   4   DT  T   A . n 
A 1 4  DT  4  5   5   DT  T   A . n 
A 1 5  DT  5  6   6   DT  T   A . n 
A 1 6  DT  6  7   7   DT  T   A . n 
A 1 7  DT  7  8   8   DT  T   A . n 
A 1 8  DG  8  9   9   DG  G   A . n 
A 1 9  DG  9  10  10  DG  G   A . n 
A 1 10 DT  10 11  11  DT  T   A . n 
A 1 11 DA  11 12  12  DA  A   A . n 
A 1 12 DA  12 13  13  DA  A   A . n 
A 1 13 DG  13 14  14  DG  G   A . n 
A 1 14 DA  14 15  15  DA  A   A . n 
B 2 1  DA  1  16  16  DA  A   B . n 
B 2 2  DT  2  17  17  DT  T   B . n 
B 2 3  DC  3  18  18  DC  C   B . n 
B 2 4  DT  4  19  19  DT  T   B . n 
B 2 5  DT  5  20  20  DT  T   B . n 
B 2 6  DA  6  21  21  DA  A   B . n 
B 2 7  DC  7  22  22  DC  C   B . n 
B 2 8  DC  8  23  23  DC  C   B . n 
B 2 9  DA  9  24  24  DA  A   B . n 
B 2 10 DA  10 25  25  DA  A   B . n 
B 2 11 DA  11 26  26  DA  A   B . n 
B 2 12 DA  12 27  27  DA  A   B . n 
B 2 13 DA  13 28  28  DA  A   B . n 
B 2 14 DC  14 29  29  DC  C   B . n 
C 3 1  GLY 1  139 139 GLY GLY C . n 
C 3 2  ARG 2  140 140 ARG ARG C . n 
C 3 3  PRO 3  141 141 PRO PRO C . n 
C 3 4  ARG 4  142 142 ARG ARG C . n 
C 3 5  ALA 5  143 143 ALA ALA C . n 
C 3 6  ILE 6  144 144 ILE ILE C . n 
C 3 7  ASN 7  145 145 ASN ASN C . n 
C 3 8  LYS 8  146 146 LYS LYS C . n 
C 3 9  HIS 9  147 147 HIS HIS C . n 
C 3 10 GLU 10 148 148 GLU GLU C . n 
C 3 11 GLN 11 149 149 GLN GLN C . n 
C 3 12 GLU 12 150 150 GLU GLU C . n 
C 3 13 GLN 13 151 151 GLN GLN C . n 
C 3 14 ILE 14 152 152 ILE ILE C . n 
C 3 15 SER 15 153 153 SER SER C . n 
C 3 16 ARG 16 154 154 ARG ARG C . n 
C 3 17 LEU 17 155 155 LEU LEU C . n 
C 3 18 LEU 18 156 156 LEU LEU C . n 
C 3 19 GLU 19 157 157 GLU GLU C . n 
C 3 20 LYS 20 158 158 LYS LYS C . n 
C 3 21 GLY 21 159 159 GLY GLY C . n 
C 3 22 HIS 22 160 160 HIS HIS C . n 
C 3 23 PRO 23 161 161 PRO PRO C . n 
C 3 24 ARG 24 162 162 ARG ARG C . n 
C 3 25 GLN 25 163 163 GLN GLN C . n 
C 3 26 GLN 26 164 164 GLN GLN C . n 
C 3 27 LEU 27 165 165 LEU LEU C . n 
C 3 28 ALA 28 166 166 ALA ALA C . n 
C 3 29 ILE 29 167 167 ILE ILE C . n 
C 3 30 ILE 30 168 168 ILE ILE C . n 
C 3 31 PHE 31 169 169 PHE PHE C . n 
C 3 32 GLY 32 170 170 GLY GLY C . n 
C 3 33 ILE 33 171 171 ILE ILE C . n 
C 3 34 GLY 34 172 172 GLY GLY C . n 
C 3 35 VAL 35 173 173 VAL VAL C . n 
C 3 36 SER 36 174 174 SER SER C . n 
C 3 37 THR 37 175 175 THR THR C . n 
C 3 38 LEU 38 176 176 LEU LEU C . n 
C 3 39 TYR 39 177 177 TYR TYR C . n 
C 3 40 ARG 40 178 178 ARG ARG C . n 
C 3 41 TYR 41 179 179 TYR TYR C . n 
C 3 42 PHE 42 180 180 PHE PHE C . n 
C 3 43 PRO 43 181 181 PRO PRO C . n 
C 3 44 ALA 44 182 182 ALA ALA C . n 
C 3 45 SER 45 183 183 SER SER C . n 
C 3 46 SER 46 184 184 SER SER C . n 
C 3 47 ILE 47 185 ?   ?   ?   C . n 
C 3 48 LYS 48 186 ?   ?   ?   C . n 
C 3 49 LYS 49 187 ?   ?   ?   C . n 
C 3 50 ARG 50 188 ?   ?   ?   C . n 
C 3 51 MET 51 189 ?   ?   ?   C . n 
C 3 52 ASN 52 190 ?   ?   ?   C . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-02-22 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS       refinement       . ? 1 
DENZO     'data reduction' . ? 2 
SCALEPACK 'data scaling'   . ? 3 
CNS       phasing          . ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 PRO C 181 ? ? -46.91 153.76 
2 1 SER C 183 ? ? -96.57 34.11  
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 DA A 15 ? ? 0.072 'SIDE CHAIN' 
2 1 DA B 27 ? ? 0.055 'SIDE CHAIN' 
3 1 DA B 28 ? ? 0.067 'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 C LYS 146 ? CG  ? C LYS 8  CG  
2  1 Y 1 C LYS 146 ? CD  ? C LYS 8  CD  
3  1 Y 1 C LYS 146 ? CE  ? C LYS 8  CE  
4  1 Y 1 C LYS 146 ? NZ  ? C LYS 8  NZ  
5  1 Y 1 C HIS 147 ? CB  ? C HIS 9  CB  
6  1 Y 1 C HIS 147 ? CG  ? C HIS 9  CG  
7  1 Y 1 C HIS 147 ? ND1 ? C HIS 9  ND1 
8  1 Y 1 C HIS 147 ? CD2 ? C HIS 9  CD2 
9  1 Y 1 C HIS 147 ? CE1 ? C HIS 9  CE1 
10 1 Y 1 C HIS 147 ? NE2 ? C HIS 9  NE2 
11 1 Y 1 C GLU 148 ? CG  ? C GLU 10 CG  
12 1 Y 1 C GLU 148 ? CD  ? C GLU 10 CD  
13 1 Y 1 C GLU 148 ? OE1 ? C GLU 10 OE1 
14 1 Y 1 C GLU 148 ? OE2 ? C GLU 10 OE2 
15 1 Y 1 C GLN 149 ? CB  ? C GLN 11 CB  
16 1 Y 1 C GLN 149 ? CG  ? C GLN 11 CG  
17 1 Y 1 C GLN 149 ? CD  ? C GLN 11 CD  
18 1 Y 1 C GLN 149 ? OE1 ? C GLN 11 OE1 
19 1 Y 1 C GLN 149 ? NE2 ? C GLN 11 NE2 
20 1 Y 1 C GLU 150 ? CB  ? C GLU 12 CB  
21 1 Y 1 C GLU 150 ? CG  ? C GLU 12 CG  
22 1 Y 1 C GLU 150 ? CD  ? C GLU 12 CD  
23 1 Y 1 C GLU 150 ? OE1 ? C GLU 12 OE1 
24 1 Y 1 C GLU 150 ? OE2 ? C GLU 12 OE2 
25 1 Y 1 C ARG 154 ? CB  ? C ARG 16 CB  
26 1 Y 1 C ARG 154 ? CG  ? C ARG 16 CG  
27 1 Y 1 C ARG 154 ? CD  ? C ARG 16 CD  
28 1 Y 1 C ARG 154 ? NE  ? C ARG 16 NE  
29 1 Y 1 C ARG 154 ? CZ  ? C ARG 16 CZ  
30 1 Y 1 C ARG 154 ? NH1 ? C ARG 16 NH1 
31 1 Y 1 C ARG 154 ? NH2 ? C ARG 16 NH2 
32 1 Y 1 C GLU 157 ? CB  ? C GLU 19 CB  
33 1 Y 1 C GLU 157 ? CG  ? C GLU 19 CG  
34 1 Y 1 C GLU 157 ? CD  ? C GLU 19 CD  
35 1 Y 1 C GLU 157 ? OE1 ? C GLU 19 OE1 
36 1 Y 1 C GLU 157 ? OE2 ? C GLU 19 OE2 
37 1 Y 1 C LYS 158 ? CG  ? C LYS 20 CG  
38 1 Y 1 C LYS 158 ? CD  ? C LYS 20 CD  
39 1 Y 1 C LYS 158 ? CE  ? C LYS 20 CE  
40 1 Y 1 C LYS 158 ? NZ  ? C LYS 20 NZ  
41 1 Y 1 C GLN 163 ? CG  ? C GLN 25 CG  
42 1 Y 1 C GLN 163 ? CD  ? C GLN 25 CD  
43 1 Y 1 C GLN 163 ? OE1 ? C GLN 25 OE1 
44 1 Y 1 C GLN 163 ? NE2 ? C GLN 25 NE2 
45 1 Y 1 C GLN 164 ? CB  ? C GLN 26 CB  
46 1 Y 1 C GLN 164 ? CG  ? C GLN 26 CG  
47 1 Y 1 C GLN 164 ? CD  ? C GLN 26 CD  
48 1 Y 1 C GLN 164 ? OE1 ? C GLN 26 OE1 
49 1 Y 1 C GLN 164 ? NE2 ? C GLN 26 NE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 C ILE 185 ? C ILE 47 
2 1 Y 1 C LYS 186 ? C LYS 48 
3 1 Y 1 C LYS 187 ? C LYS 49 
4 1 Y 1 C ARG 188 ? C ARG 50 
5 1 Y 1 C MET 189 ? C MET 51 
6 1 Y 1 C ASN 190 ? C ASN 52 
# 
_ndb_struct_conf_na.entry_id   1JKO 
_ndb_struct_conf_na.feature    'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DG 2  1_555 B DC 14 1_555 0.013  0.043  -0.579 -12.617 4.824   -1.233  1  A_DG3:DC29_B  A 3  ? B 29 ? 19 1 
1 A DT 3  1_555 B DA 13 1_555 -0.187 -0.224 -0.243 -7.485  -12.746 -12.543 2  A_DT4:DA28_B  A 4  ? B 28 ? 20 1 
1 A DT 4  1_555 B DA 12 1_555 -0.602 -0.217 -0.566 -1.005  -21.512 2.848   3  A_DT5:DA27_B  A 5  ? B 27 ? 20 1 
1 A DT 5  1_555 B DA 11 1_555 -0.224 -0.211 -0.558 4.716   -26.448 -2.954  4  A_DT6:DA26_B  A 6  ? B 26 ? 20 1 
1 A DT 6  1_555 B DA 10 1_555 -0.702 -0.093 -0.414 -6.830  -14.319 0.707   5  A_DT7:DA25_B  A 7  ? B 25 ? 20 1 
1 A DT 7  1_555 B DA 9  1_555 -0.541 -0.094 -0.133 -6.637  -20.935 -1.094  6  A_DT8:DA24_B  A 8  ? B 24 ? 20 1 
1 A DG 8  1_555 B DC 8  1_555 -0.564 -0.132 -0.091 -6.365  -5.087  3.744   7  A_DG9:DC23_B  A 9  ? B 23 ? 19 1 
1 A DG 9  1_555 B DC 7  1_555 0.130  -0.316 0.089  1.736   -13.934 0.396   8  A_DG10:DC22_B A 10 ? B 22 ? 19 1 
1 A DT 10 1_555 B DA 6  1_555 -0.413 -0.337 -0.029 -2.389  -7.728  -1.363  9  A_DT11:DA21_B A 11 ? B 21 ? 20 1 
1 A DA 11 1_555 B DT 5  1_555 -0.248 -0.449 -0.522 -4.334  -19.213 0.759   10 A_DA12:DT20_B A 12 ? B 20 ? 20 1 
1 A DA 12 1_555 B DT 4  1_555 -0.082 -0.095 0.426  13.258  -6.880  9.802   11 A_DA13:DT19_B A 13 ? B 19 ? 20 1 
1 A DG 13 1_555 B DC 3  1_555 -0.237 -0.440 -0.202 1.474   -10.087 -4.352  12 A_DG14:DC18_B A 14 ? B 18 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DG 2  1_555 B DC 14 1_555 A DT 3  1_555 B DA 13 1_555 -1.153 -0.103 3.237 -3.689 10.311 30.239 -2.050 1.417  3.149 18.999 
6.798  32.117 1  AA_DG3DT4:DA28DC29_BB   A 3  ? B 29 ? A 4  ? B 28 ? 
1 A DT 3  1_555 B DA 13 1_555 A DT 4  1_555 B DA 12 1_555 0.215  -0.459 2.921 3.978  1.951  28.972 -1.283 0.342  2.887 3.872  
-7.893 29.302 2  AA_DT4DT5:DA27DA28_BB   A 4  ? B 28 ? A 5  ? B 27 ? 
1 A DT 4  1_555 B DA 12 1_555 A DT 5  1_555 B DA 11 1_555 -0.220 0.393  3.092 0.632  10.933 34.756 -0.839 0.437  3.069 17.764 
-1.027 36.389 3  AA_DT5DT6:DA26DA27_BB   A 5  ? B 27 ? A 6  ? B 26 ? 
1 A DT 5  1_555 B DA 11 1_555 A DT 6  1_555 B DA 10 1_555 1.140  1.013  3.641 3.117  -2.857 39.388 1.868  -1.276 3.638 -4.223 
-4.608 39.606 4  AA_DT6DT7:DA25DA26_BB   A 6  ? B 26 ? A 7  ? B 25 ? 
1 A DT 6  1_555 B DA 10 1_555 A DT 7  1_555 B DA 9  1_555 -0.786 -0.396 3.182 -2.493 4.513  35.435 -1.276 0.930  3.155 7.367  
4.069  35.796 5  AA_DT7DT8:DA24DA25_BB   A 7  ? B 25 ? A 8  ? B 24 ? 
1 A DT 7  1_555 B DA 9  1_555 A DG 8  1_555 B DC 8  1_555 1.002  1.300  3.375 1.228  3.730  38.037 1.490  -1.367 3.511 5.704  
-1.878 38.232 6  AA_DT8DG9:DC23DA24_BB   A 8  ? B 24 ? A 9  ? B 23 ? 
1 A DG 8  1_555 B DC 8  1_555 A DG 9  1_555 B DC 7  1_555 -1.295 1.625  3.093 -4.418 5.546  37.941 1.773  1.412  3.412 8.440  
6.724  38.574 7  AA_DG9DG10:DC22DC23_BB  A 9  ? B 23 ? A 10 ? B 22 ? 
1 A DG 9  1_555 B DC 7  1_555 A DT 10 1_555 B DA 6  1_555 0.618  -0.678 3.504 0.717  1.387  25.526 -1.953 -1.179 3.478 3.135  
-1.620 25.573 8  AA_DG10DT11:DA21DC22_BB A 10 ? B 22 ? A 11 ? B 21 ? 
1 A DT 10 1_555 B DA 6  1_555 A DA 11 1_555 B DT 5  1_555 -0.272 1.424  3.527 2.547  4.618  39.041 1.511  0.736  3.642 6.872  
-3.790 39.382 9  AA_DT11DA12:DT20DA21_BB A 11 ? B 21 ? A 12 ? B 20 ? 
1 A DA 11 1_555 B DT 5  1_555 A DA 12 1_555 B DT 4  1_555 0.500  0.015  2.732 -7.741 3.826  32.684 -0.481 -1.888 2.536 6.655  
13.466 33.775 10 AA_DA12DA13:DT19DT20_BB A 12 ? B 20 ? A 13 ? B 19 ? 
1 A DA 12 1_555 B DT 4  1_555 A DG 13 1_555 B DC 3  1_555 -0.732 -0.466 3.490 0.643  9.782  34.879 -2.193 1.273  3.233 15.934 
-1.047 36.189 11 AA_DA13DG14:DC18DT19_BB A 13 ? B 19 ? A 14 ? B 18 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL TRS 
5 water                                    HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 TRS 1 204 204 TRS TRS A . 
E 5 HOH 1 202 202 HOH HOH A . 
E 5 HOH 2 203 203 HOH HOH A . 
E 5 HOH 3 206 206 HOH HOH A . 
E 5 HOH 4 207 207 HOH HOH A . 
E 5 HOH 5 209 209 HOH HOH A . 
E 5 HOH 6 210 210 HOH HOH A . 
F 5 HOH 1 201 201 HOH HOH B . 
F 5 HOH 2 208 208 HOH HOH B . 
F 5 HOH 3 211 211 HOH HOH B . 
G 5 HOH 1 205 205 HOH HOH C . 
G 5 HOH 2 212 212 HOH HOH C . 
G 5 HOH 3 213 213 HOH HOH C . 
G 5 HOH 4 214 214 HOH HOH C . 
#