data_1JKR
# 
_entry.id   1JKR 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1JKR         
NDB   PD0237       
RCSB  RCSB013885   
WWPDB D_1000013885 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1HCR 
;Native wild-type Hin recombinase DNA-binding domain bound to underivatized 
hixL half-site.
;
unspecified 
PDB 1IJW 'FORM1 BR18 DERIVATIVE'                                                                       unspecified 
PDB 1JJ6 'FORM1 I5 DERIVATIVE'                                                                         unspecified 
PDB 1JJ8 'FORM2 I4 DERIVATIVE'                                                                         unspecified 
PDB 1JKO 'FORM1 A10G MUTANT'                                                                           unspecified 
PDB 1JKP 'FORM1 T11G MUTANT'                                                                           unspecified 
PDB 1JKQ 'FORM1 G9T MUTANT'                                                                            unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1JKR 
_pdbx_database_status.recvd_initial_deposition_date   2001-07-13 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Chiu, T.K.'      1 
'Sohn, C.'        2 
'Johnson, R.C.'   3 
'Dickerson, R.E.' 4 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Testing water-mediated DNA recognition by the Hin recombinase.' 'EMBO J.' 21  801 814 2002 EMJODG UK 0261-4189 0897 ? 
11847127 10.1093/emboj/21.4.801 
1       
'How Hin Recombinase, FIS and Cations Bind DNA. Chapter 4. Water-Mediated Sequence-Specific Recognition by Hin Recombinase' Thesis 
?   145 241 2001 ?      ?  ?         ?    ? ?        ?                      
2       'Hin Recombinase Bound to DNA: The Origin of Specificity in Major and Minor Groove Interactions' Science   263 348 355 
1994 SCIEAS US 0036-8075 0038 ? ?        ?                      
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Chiu, T.K.'      1 
primary 'Sohn, C.'        2 
primary 'Dickerson, R.E.' 3 
primary 'Johnson, R.C.'   4 
1       'Chiu, T.K.'      5 
2       'Feng, J.A.'      6 
2       'Johnson, R.C.'   7 
2       'Dickerson, R.E.' 8 
# 
_cell.entry_id           1JKR 
_cell.length_a           86.087 
_cell.length_b           82.708 
_cell.length_c           44.865 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1JKR 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn "5'-D(*TP*GP*TP*TP*TP*TP*TP*GP*AP*CP*AP*AP*GP*A)-3'" 4309.826 1 ? ? ?                     ? 
2 polymer     syn "5'-D(*AP*TP*CP*TP*TP*GP*TP*CP*AP*AP*AP*AP*AP*C)-3'" 4247.805 1 ? ? ?                     ? 
3 polymer     syn 'DNA-INVERTASE HIN'                                  6047.051 1 ? ? 'RESIDUES 139 TO 190' ? 
4 non-polymer syn 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL             122.143  1 ? ? ?                     ? 
5 water       nat water                                                18.015   2 ? ? ?                     ? 
# 
_entity_name_com.entity_id   3 
_entity_name_com.name        'Hin Recombinase' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DT)(DG)(DT)(DT)(DT)(DT)(DT)(DG)(DA)(DC)(DA)(DA)(DG)(DA)' TGTTTTTGACAAGA A ? 
2 polydeoxyribonucleotide no no '(DA)(DT)(DC)(DT)(DT)(DG)(DT)(DC)(DA)(DA)(DA)(DA)(DA)(DC)' ATCTTGTCAAAAAC B ? 
3 'polypeptide(L)'        no no GRPRAINKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASSIKKRMN       
GRPRAINKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASSIKKRMN C ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  DT  n 
1 2  DG  n 
1 3  DT  n 
1 4  DT  n 
1 5  DT  n 
1 6  DT  n 
1 7  DT  n 
1 8  DG  n 
1 9  DA  n 
1 10 DC  n 
1 11 DA  n 
1 12 DA  n 
1 13 DG  n 
1 14 DA  n 
2 1  DA  n 
2 2  DT  n 
2 3  DC  n 
2 4  DT  n 
2 5  DT  n 
2 6  DG  n 
2 7  DT  n 
2 8  DC  n 
2 9  DA  n 
2 10 DA  n 
2 11 DA  n 
2 12 DA  n 
2 13 DA  n 
2 14 DC  n 
3 1  GLY n 
3 2  ARG n 
3 3  PRO n 
3 4  ARG n 
3 5  ALA n 
3 6  ILE n 
3 7  ASN n 
3 8  LYS n 
3 9  HIS n 
3 10 GLU n 
3 11 GLN n 
3 12 GLU n 
3 13 GLN n 
3 14 ILE n 
3 15 SER n 
3 16 ARG n 
3 17 LEU n 
3 18 LEU n 
3 19 GLU n 
3 20 LYS n 
3 21 GLY n 
3 22 HIS n 
3 23 PRO n 
3 24 ARG n 
3 25 GLN n 
3 26 GLN n 
3 27 LEU n 
3 28 ALA n 
3 29 ILE n 
3 30 ILE n 
3 31 PHE n 
3 32 GLY n 
3 33 ILE n 
3 34 GLY n 
3 35 VAL n 
3 36 SER n 
3 37 THR n 
3 38 LEU n 
3 39 TYR n 
3 40 ARG n 
3 41 TYR n 
3 42 PHE n 
3 43 PRO n 
3 44 ALA n 
3 45 SER n 
3 46 SER n 
3 47 ILE n 
3 48 LYS n 
3 49 LYS n 
3 50 ARG n 
3 51 MET n 
3 52 ASN n 
# 
_pdbx_entity_src_syn.entity_id              3 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'SYNTHETIC PEPTIDE' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP HIN_SALTY 3 GRPRAINKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASSIKKRMN 139 P03013 ? 
2 PDB 1JKR      1 ?                                                    ?   1JKR   ? 
3 PDB 1JKR      2 ?                                                    ?   1JKR   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1JKR C 1 ? 52 ? P03013 139 ? 190 ? 139 190 
2 2 1JKR A 1 ? 14 ? 1JKR   2   ? 15  ? 2   15  
3 3 1JKR B 1 ? 14 ? 1JKR   16  ? 29  ? 16  29  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                  ?             'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                 ?             'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                               ?             'C4 H8 N2 O3'     132.118 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"     ?             'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"      ?             'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"     ?             'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"             ?             'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                                ?             'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                          ?             'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                  ?             'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                                ?             'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                    ?             'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                               ?             'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                  ?             'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                   ?             'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                               ?             'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                            ?             'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                  ?             'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                   ?             'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                                ?             'C4 H9 N O3'      119.119 
TRS non-polymer         . 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL 'TRIS BUFFER' 'C4 H12 N O3 1'   122.143 
TYR 'L-peptide linking' y TYROSINE                                 ?             'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                   ?             'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1JKR 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.76 
_exptl_crystal.density_percent_sol   53.78 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.50 
_exptl_crystal_grow.pdbx_details    
;HANGING DROP VAPOR DIFFUSION AT 4C, 
WITH INITIAL CONCENTRATION IN DROP OF 0.10 MM DNA,           
0.06 MM HIN, 10 MM TRIS (PH 8.5), 10 MM CACL2, 
23 MM NACL, 2.5% V/V PEG400, AND 1.56 MM NA CACODYLATE.                  
RESERVOIR SOLUTION CONTAINS 100 MM TRIS (PH 8.5), 
100 MM CACL2, 100 MM NACL, AND 25% PEG400. 
CONCENTRATION OF PEG400 IN RESERVOIR SOLUTION WAS 
INCREASED IN 5% INCREMENTS TO 35%., pH 8.50, VAPOR DIFFUSION, HANGING DROP
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.details 
1 1  1 DNA                 ? ? ? 
1 2  1 HIN                 ? ? ? 
1 3  1 TRIS                ? ? ? 
1 4  1 CaCl2               ? ? ? 
1 5  1 NaCl                ? ? ? 
1 6  1 'PEG 400'           ? ? ? 
1 7  1 'sodium cacodylate' ? ? ? 
1 8  2 Tris                ? ? ? 
1 9  2 CaCl2               ? ? ? 
1 10 2 NaCl                ? ? ? 
1 11 2 'PEG 400'           ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   ? 
_diffrn_detector.pdbx_collection_date   1997-08-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             
'MOLECULAR REPLACEMENT WITH 1IJW HAVING THE PROPER DNA SUBSTITUTIONS AS THE STARTING MODEL.' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.908 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'CHESS BEAMLINE A1' 
_diffrn_source.pdbx_synchrotron_site       CHESS 
_diffrn_source.pdbx_synchrotron_beamline   A1 
_diffrn_source.pdbx_wavelength             0.908 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1JKR 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             24.8 
_reflns.d_resolution_high            2.28 
_reflns.number_obs                   7102 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         93.23 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.8900000 
_reflns.pdbx_netI_over_sigmaI        15.68 
_reflns.B_iso_Wilson_estimate        69.00 
_reflns.pdbx_redundancy              17.0 
_reflns.R_free_details               ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.28 
_reflns_shell.d_res_low              2.38 
_reflns_shell.percent_possible_all   72.14 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.2520000 
_reflns_shell.meanI_over_sigI_obs    2.49 
_reflns_shell.pdbx_redundancy        2.60 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1JKR 
_refine.ls_number_reflns_obs                     7102 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             24.80 
_refine.ls_d_res_high                            2.28 
_refine.ls_percent_reflns_obs                    93.23 
_refine.ls_R_factor_obs                          0.2687000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2687000 
_refine.ls_R_factor_R_free                       0.3245000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 9.28 
_refine.ls_number_reflns_R_free                  707 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               60.20 
_refine.aniso_B[1][1]                            15.107 
_refine.aniso_B[2][2]                            2.251 
_refine.aniso_B[3][3]                            -17.359 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 0.25 
_refine.solvent_model_param_bsol                 100.00 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1IJW 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ANISOTROPIC_FIXED_ISOTROPIC 
_refine.pdbx_stereochemistry_target_values       MLF 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1JKR 
_refine_analyze.Luzzati_coordinate_error_obs    0.47 
_refine_analyze.Luzzati_sigma_a_obs             0.80 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.55 
_refine_analyze.Luzzati_sigma_a_free            0.66 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        353 
_refine_hist.pdbx_number_atoms_nucleic_acid   576 
_refine_hist.pdbx_number_atoms_ligand         8 
_refine_hist.number_atoms_solvent             2 
_refine_hist.number_atoms_total               939 
_refine_hist.d_res_high                       2.28 
_refine_hist.d_res_low                        24.80 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.013  ?     ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?      ?     ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?      ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?      ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?      ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?      ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.720  ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?      ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?      ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      19.440 ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?      ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?      ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      1.882  ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?      ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?      ?     ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             8.51   4.000 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            11.44  6.000 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             11.62  6.000 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            15.66  7.000 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   8 
_refine_ls_shell.d_res_high                       2.28 
_refine_ls_shell.d_res_low                        2.38 
_refine_ls_shell.number_reflns_R_work             610 
_refine_ls_shell.R_factor_R_work                  0.4536000 
_refine_ls_shell.percent_reflns_obs               72.14 
_refine_ls_shell.R_factor_R_free                  0.4437000 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            7.04 
_refine_ls_shell.number_reflns_R_free             66 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 DNA-RNA_REP.PARAM DNA-RNA.TOP 'X-RAY DIFFRACTION' 
3 WATER_REP.PARAM   WATER.TOP   'X-RAY DIFFRACTION' 
4 ION.PARAM         ION.TOP     'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1JKR 
_struct.title                     'Testing the Water-Mediated HIN Recombinase DNA Recognition by Systematic Mutations' 
_struct.pdbx_descriptor           'HIN RECOMBINASE/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1JKR 
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN/DNA' 
_struct_keywords.text            
'WATER-MEDIATED RECOGNITION, PROTEIN-DNA COMPLEX, HIN RECOMBINASE, T11C MUTANT, DNA BINDING PROTEIN-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 LYS C 8  ? LYS C 20 ? LYS C 146 LYS C 158 1 ? 13 
HELX_P HELX_P2 2 PRO C 23 ? PHE C 31 ? PRO C 161 PHE C 169 1 ? 9  
HELX_P HELX_P3 3 GLY C 34 ? PHE C 42 ? GLY C 172 PHE C 180 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? A DG 2  N1 ? ? ? 1_555 B DC 14 N3 ? ? A DG 3  B DC 29 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2  hydrog ? ? A DG 2  N2 ? ? ? 1_555 B DC 14 O2 ? ? A DG 3  B DC 29 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3  hydrog ? ? A DG 2  O6 ? ? ? 1_555 B DC 14 N4 ? ? A DG 3  B DC 29 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4  hydrog ? ? A DT 3  N3 ? ? ? 1_555 B DA 13 N1 ? ? A DT 4  B DA 28 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5  hydrog ? ? A DT 3  O4 ? ? ? 1_555 B DA 13 N6 ? ? A DT 4  B DA 28 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6  hydrog ? ? A DT 4  N3 ? ? ? 1_555 B DA 12 N1 ? ? A DT 5  B DA 27 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7  hydrog ? ? A DT 4  O4 ? ? ? 1_555 B DA 12 N6 ? ? A DT 5  B DA 27 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8  hydrog ? ? A DT 5  N3 ? ? ? 1_555 B DA 11 N1 ? ? A DT 6  B DA 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9  hydrog ? ? A DT 5  O4 ? ? ? 1_555 B DA 11 N6 ? ? A DT 6  B DA 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10 hydrog ? ? A DT 6  N3 ? ? ? 1_555 B DA 10 N1 ? ? A DT 7  B DA 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11 hydrog ? ? A DT 6  O4 ? ? ? 1_555 B DA 10 N6 ? ? A DT 7  B DA 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12 hydrog ? ? A DT 7  N3 ? ? ? 1_555 B DA 9  N1 ? ? A DT 8  B DA 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13 hydrog ? ? A DT 7  O4 ? ? ? 1_555 B DA 9  N6 ? ? A DT 8  B DA 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14 hydrog ? ? A DG 8  N1 ? ? ? 1_555 B DC 8  N3 ? ? A DG 9  B DC 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog15 hydrog ? ? A DG 8  N2 ? ? ? 1_555 B DC 8  O2 ? ? A DG 9  B DC 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16 hydrog ? ? A DG 8  O6 ? ? ? 1_555 B DC 8  N4 ? ? A DG 9  B DC 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17 hydrog ? ? A DA 9  N1 ? ? ? 1_555 B DT 7  N3 ? ? A DA 10 B DT 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18 hydrog ? ? A DA 9  N6 ? ? ? 1_555 B DT 7  O4 ? ? A DA 10 B DT 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19 hydrog ? ? A DC 10 N3 ? ? ? 1_555 B DG 6  N1 ? ? A DC 11 B DG 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20 hydrog ? ? A DC 10 N4 ? ? ? 1_555 B DG 6  O6 ? ? A DC 11 B DG 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21 hydrog ? ? A DC 10 O2 ? ? ? 1_555 B DG 6  N2 ? ? A DC 11 B DG 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22 hydrog ? ? A DA 11 N1 ? ? ? 1_555 B DT 5  N3 ? ? A DA 12 B DT 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23 hydrog ? ? A DA 11 N6 ? ? ? 1_555 B DT 5  O4 ? ? A DA 12 B DT 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog24 hydrog ? ? A DA 12 N1 ? ? ? 1_555 B DT 4  N3 ? ? A DA 13 B DT 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog25 hydrog ? ? A DA 12 N6 ? ? ? 1_555 B DT 4  O4 ? ? A DA 13 B DT 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog26 hydrog ? ? A DG 13 N1 ? ? ? 1_555 B DC 3  N3 ? ? A DG 14 B DC 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog27 hydrog ? ? A DG 13 N2 ? ? ? 1_555 B DC 3  O2 ? ? A DG 14 B DC 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog28 hydrog ? ? A DG 13 O6 ? ? ? 1_555 B DC 3  N4 ? ? A DG 14 B DC 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    4 
_struct_site.details              'BINDING SITE FOR RESIDUE TRS A 204' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 DG A 8  ? DG A 9  . ? 1_555 ? 
2 AC1 4 DA A 9  ? DA A 10 . ? 1_555 ? 
3 AC1 4 DT B 7  ? DT B 22 . ? 6_554 ? 
4 AC1 4 DA B 10 ? DA B 25 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1JKR 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1JKR 
_atom_sites.fract_transf_matrix[1][1]   0.011616 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012091 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.022289 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   O "O5'" . DT  A 1 1  ? -0.638 33.850 6.120  1.00 83.61 ? 2   DT  A "O5'" 1 
ATOM   2   C "C5'" . DT  A 1 1  ? -0.213 32.484 6.015  1.00 83.57 ? 2   DT  A "C5'" 1 
ATOM   3   C "C4'" . DT  A 1 1  ? 0.151  31.825 7.331  1.00 83.54 ? 2   DT  A "C4'" 1 
ATOM   4   O "O4'" . DT  A 1 1  ? 0.153  30.392 7.107  1.00 83.55 ? 2   DT  A "O4'" 1 
ATOM   5   C "C3'" . DT  A 1 1  ? 1.518  32.154 7.949  1.00 83.46 ? 2   DT  A "C3'" 1 
ATOM   6   O "O3'" . DT  A 1 1  ? 1.424  32.099 9.386  1.00 83.59 ? 2   DT  A "O3'" 1 
ATOM   7   C "C2'" . DT  A 1 1  ? 2.402  31.061 7.377  1.00 83.56 ? 2   DT  A "C2'" 1 
ATOM   8   C "C1'" . DT  A 1 1  ? 1.464  29.860 7.289  1.00 83.53 ? 2   DT  A "C1'" 1 
ATOM   9   N N1    . DT  A 1 1  ? 1.747  28.898 6.173  1.00 86.90 ? 2   DT  A N1    1 
ATOM   10  C C2    . DT  A 1 1  ? 1.544  27.569 6.441  1.00 83.20 ? 2   DT  A C2    1 
ATOM   11  O O2    . DT  A 1 1  ? 1.105  27.181 7.515  1.00 81.41 ? 2   DT  A O2    1 
ATOM   12  N N3    . DT  A 1 1  ? 1.856  26.707 5.397  1.00 82.97 ? 2   DT  A N3    1 
ATOM   13  C C4    . DT  A 1 1  ? 2.311  27.051 4.119  1.00 84.22 ? 2   DT  A C4    1 
ATOM   14  O O4    . DT  A 1 1  ? 2.536  26.161 3.258  1.00 86.75 ? 2   DT  A O4    1 
ATOM   15  C C5    . DT  A 1 1  ? 2.476  28.477 3.900  1.00 84.04 ? 2   DT  A C5    1 
ATOM   16  C C7    . DT  A 1 1  ? 2.926  28.955 2.549  1.00 85.52 ? 2   DT  A C7    1 
ATOM   17  C C6    . DT  A 1 1  ? 2.201  29.313 4.928  1.00 83.36 ? 2   DT  A C6    1 
ATOM   18  P P     . DG  A 1 2  ? 2.744  31.902 10.303 1.00 83.93 ? 3   DG  A P     1 
ATOM   19  O OP1   . DG  A 1 2  ? 2.731  32.942 11.392 1.00 83.66 ? 3   DG  A OP1   1 
ATOM   20  O OP2   . DG  A 1 2  ? 3.980  31.703 9.465  1.00 83.68 ? 3   DG  A OP2   1 
ATOM   21  O "O5'" . DG  A 1 2  ? 2.453  30.555 11.113 1.00 83.54 ? 3   DG  A "O5'" 1 
ATOM   22  C "C5'" . DG  A 1 2  ? 1.495  30.577 12.148 1.00 70.03 ? 3   DG  A "C5'" 1 
ATOM   23  C "C4'" . DG  A 1 2  ? 1.635  29.391 13.067 1.00 63.84 ? 3   DG  A "C4'" 1 
ATOM   24  O "O4'" . DG  A 1 2  ? 1.413  28.226 12.267 1.00 44.50 ? 3   DG  A "O4'" 1 
ATOM   25  C "C3'" . DG  A 1 2  ? 3.012  29.219 13.677 1.00 63.26 ? 3   DG  A "C3'" 1 
ATOM   26  O "O3'" . DG  A 1 2  ? 2.895  28.621 14.960 1.00 69.21 ? 3   DG  A "O3'" 1 
ATOM   27  C "C2'" . DG  A 1 2  ? 3.668  28.213 12.767 1.00 64.34 ? 3   DG  A "C2'" 1 
ATOM   28  C "C1'" . DG  A 1 2  ? 2.501  27.361 12.328 1.00 42.25 ? 3   DG  A "C1'" 1 
ATOM   29  N N9    . DG  A 1 2  ? 2.724  26.869 10.982 1.00 42.89 ? 3   DG  A N9    1 
ATOM   30  C C8    . DG  A 1 2  ? 3.109  27.621 9.903  1.00 44.89 ? 3   DG  A C8    1 
ATOM   31  N N7    . DG  A 1 2  ? 3.373  26.901 8.846  1.00 50.49 ? 3   DG  A N7    1 
ATOM   32  C C5    . DG  A 1 2  ? 3.103  25.596 9.243  1.00 45.91 ? 3   DG  A C5    1 
ATOM   33  C C6    . DG  A 1 2  ? 3.213  24.373 8.524  1.00 46.26 ? 3   DG  A C6    1 
ATOM   34  O O6    . DG  A 1 2  ? 3.588  24.196 7.338  1.00 42.40 ? 3   DG  A O6    1 
ATOM   35  N N1    . DG  A 1 2  ? 2.838  23.283 9.314  1.00 41.23 ? 3   DG  A N1    1 
ATOM   36  C C2    . DG  A 1 2  ? 2.405  23.356 10.619 1.00 40.22 ? 3   DG  A C2    1 
ATOM   37  N N2    . DG  A 1 2  ? 2.085  22.190 11.209 1.00 41.45 ? 3   DG  A N2    1 
ATOM   38  N N3    . DG  A 1 2  ? 2.295  24.492 11.299 1.00 43.01 ? 3   DG  A N3    1 
ATOM   39  C C4    . DG  A 1 2  ? 2.667  25.564 10.553 1.00 43.83 ? 3   DG  A C4    1 
ATOM   40  P P     . DT  A 1 3  ? 4.211  28.442 15.858 1.00 71.84 ? 4   DT  A P     1 
ATOM   41  O OP1   . DT  A 1 3  ? 4.112  29.081 17.196 1.00 80.54 ? 4   DT  A OP1   1 
ATOM   42  O OP2   . DT  A 1 3  ? 5.277  28.845 14.917 1.00 67.64 ? 4   DT  A OP2   1 
ATOM   43  O "O5'" . DT  A 1 3  ? 4.301  26.888 16.150 1.00 64.75 ? 4   DT  A "O5'" 1 
ATOM   44  C "C5'" . DT  A 1 3  ? 3.292  26.265 16.909 1.00 56.78 ? 4   DT  A "C5'" 1 
ATOM   45  C "C4'" . DT  A 1 3  ? 3.410  24.767 16.798 1.00 55.87 ? 4   DT  A "C4'" 1 
ATOM   46  O "O4'" . DT  A 1 3  ? 3.513  24.430 15.398 1.00 47.72 ? 4   DT  A "O4'" 1 
ATOM   47  C "C3'" . DT  A 1 3  ? 4.639  24.175 17.466 1.00 57.83 ? 4   DT  A "C3'" 1 
ATOM   48  O "O3'" . DT  A 1 3  ? 4.237  23.093 18.294 1.00 75.59 ? 4   DT  A "O3'" 1 
ATOM   49  C "C2'" . DT  A 1 3  ? 5.515  23.722 16.311 1.00 58.62 ? 4   DT  A "C2'" 1 
ATOM   50  C "C1'" . DT  A 1 3  ? 4.527  23.490 15.184 1.00 44.71 ? 4   DT  A "C1'" 1 
ATOM   51  N N1    . DT  A 1 3  ? 5.013  23.695 13.792 1.00 42.76 ? 4   DT  A N1    1 
ATOM   52  C C2    . DT  A 1 3  ? 5.038  22.608 12.924 1.00 46.06 ? 4   DT  A C2    1 
ATOM   53  O O2    . DT  A 1 3  ? 4.672  21.478 13.238 1.00 50.51 ? 4   DT  A O2    1 
ATOM   54  N N3    . DT  A 1 3  ? 5.497  22.896 11.656 1.00 43.09 ? 4   DT  A N3    1 
ATOM   55  C C4    . DT  A 1 3  ? 5.902  24.122 11.175 1.00 40.27 ? 4   DT  A C4    1 
ATOM   56  O O4    . DT  A 1 3  ? 6.276  24.251 9.996  1.00 43.13 ? 4   DT  A O4    1 
ATOM   57  C C5    . DT  A 1 3  ? 5.843  25.191 12.115 1.00 40.68 ? 4   DT  A C5    1 
ATOM   58  C C7    . DT  A 1 3  ? 6.259  26.539 11.640 1.00 40.35 ? 4   DT  A C7    1 
ATOM   59  C C6    . DT  A 1 3  ? 5.414  24.941 13.367 1.00 35.12 ? 4   DT  A C6    1 
ATOM   60  P P     . DT  A 1 4  ? 5.188  22.638 19.496 1.00 64.58 ? 5   DT  A P     1 
ATOM   61  O OP1   . DT  A 1 4  ? 4.515  22.183 20.741 1.00 56.60 ? 5   DT  A OP1   1 
ATOM   62  O OP2   . DT  A 1 4  ? 6.167  23.767 19.571 1.00 81.41 ? 5   DT  A OP2   1 
ATOM   63  O "O5'" . DT  A 1 4  ? 5.771  21.305 18.866 1.00 53.75 ? 5   DT  A "O5'" 1 
ATOM   64  C "C5'" . DT  A 1 4  ? 4.879  20.351 18.360 1.00 43.59 ? 5   DT  A "C5'" 1 
ATOM   65  C "C4'" . DT  A 1 4  ? 5.576  19.379 17.442 1.00 44.59 ? 5   DT  A "C4'" 1 
ATOM   66  O "O4'" . DT  A 1 4  ? 5.850  19.961 16.144 1.00 50.48 ? 5   DT  A "O4'" 1 
ATOM   67  C "C3'" . DT  A 1 4  ? 6.884  18.776 17.944 1.00 51.38 ? 5   DT  A "C3'" 1 
ATOM   68  O "O3'" . DT  A 1 4  ? 6.783  17.346 17.987 1.00 57.19 ? 5   DT  A "O3'" 1 
ATOM   69  C "C2'" . DT  A 1 4  ? 7.900  19.221 16.897 1.00 64.84 ? 5   DT  A "C2'" 1 
ATOM   70  C "C1'" . DT  A 1 4  ? 7.054  19.418 15.648 1.00 41.36 ? 5   DT  A "C1'" 1 
ATOM   71  N N1    . DT  A 1 4  ? 7.605  20.375 14.660 1.00 47.14 ? 5   DT  A N1    1 
ATOM   72  C C2    . DT  A 1 4  ? 7.675  19.980 13.342 1.00 38.34 ? 5   DT  A C2    1 
ATOM   73  O O2    . DT  A 1 4  ? 7.239  18.923 12.950 1.00 41.31 ? 5   DT  A O2    1 
ATOM   74  N N3    . DT  A 1 4  ? 8.262  20.900 12.489 1.00 38.26 ? 5   DT  A N3    1 
ATOM   75  C C4    . DT  A 1 4  ? 8.729  22.176 12.821 1.00 40.77 ? 5   DT  A C4    1 
ATOM   76  O O4    . DT  A 1 4  ? 9.250  22.892 11.963 1.00 53.32 ? 5   DT  A O4    1 
ATOM   77  C C5    . DT  A 1 4  ? 8.556  22.554 14.203 1.00 39.98 ? 5   DT  A C5    1 
ATOM   78  C C7    . DT  A 1 4  ? 8.928  23.946 14.617 1.00 35.42 ? 5   DT  A C7    1 
ATOM   79  C C6    . DT  A 1 4  ? 8.041  21.637 15.054 1.00 49.70 ? 5   DT  A C6    1 
ATOM   80  P P     . DT  A 1 5  ? 7.579  16.521 19.124 1.00 78.46 ? 6   DT  A P     1 
ATOM   81  O OP1   . DT  A 1 5  ? 6.631  15.647 19.871 1.00 89.49 ? 6   DT  A OP1   1 
ATOM   82  O OP2   . DT  A 1 5  ? 8.450  17.450 19.881 1.00 67.17 ? 6   DT  A OP2   1 
ATOM   83  O "O5'" . DT  A 1 5  ? 8.469  15.571 18.221 1.00 74.71 ? 6   DT  A "O5'" 1 
ATOM   84  C "C5'" . DT  A 1 5  ? 7.850  14.891 17.141 1.00 85.65 ? 6   DT  A "C5'" 1 
ATOM   85  C "C4'" . DT  A 1 5  ? 8.848  14.597 16.049 1.00 81.26 ? 6   DT  A "C4'" 1 
ATOM   86  O "O4'" . DT  A 1 5  ? 9.136  15.760 15.237 1.00 74.26 ? 6   DT  A "O4'" 1 
ATOM   87  C "C3'" . DT  A 1 5  ? 10.193 14.056 16.513 1.00 85.80 ? 6   DT  A "C3'" 1 
ATOM   88  O "O3'" . DT  A 1 5  ? 10.528 12.950 15.667 1.00 89.42 ? 6   DT  A "O3'" 1 
ATOM   89  C "C2'" . DT  A 1 5  ? 11.130 15.235 16.281 1.00 80.09 ? 6   DT  A "C2'" 1 
ATOM   90  C "C1'" . DT  A 1 5  ? 10.526 15.841 15.031 1.00 47.39 ? 6   DT  A "C1'" 1 
ATOM   91  N N1    . DT  A 1 5  ? 10.849 17.239 14.751 1.00 34.95 ? 6   DT  A N1    1 
ATOM   92  C C2    . DT  A 1 5  ? 10.936 17.613 13.426 1.00 49.62 ? 6   DT  A C2    1 
ATOM   93  O O2    . DT  A 1 5  ? 10.776 16.820 12.494 1.00 48.99 ? 6   DT  A O2    1 
ATOM   94  N N3    . DT  A 1 5  ? 11.217 18.952 13.231 1.00 36.75 ? 6   DT  A N3    1 
ATOM   95  C C4    . DT  A 1 5  ? 11.418 19.907 14.217 1.00 40.06 ? 6   DT  A C4    1 
ATOM   96  O O4    . DT  A 1 5  ? 11.665 21.060 13.916 1.00 44.15 ? 6   DT  A O4    1 
ATOM   97  C C5    . DT  A 1 5  ? 11.319 19.441 15.560 1.00 34.18 ? 6   DT  A C5    1 
ATOM   98  C C7    . DT  A 1 5  ? 11.523 20.425 16.662 1.00 39.31 ? 6   DT  A C7    1 
ATOM   99  C C6    . DT  A 1 5  ? 11.044 18.147 15.769 1.00 33.82 ? 6   DT  A C6    1 
ATOM   100 P P     . DT  A 1 6  ? 11.701 11.942 16.095 1.00 79.56 ? 7   DT  A P     1 
ATOM   101 O OP1   . DT  A 1 6  ? 11.182 10.564 15.907 1.00 80.90 ? 7   DT  A OP1   1 
ATOM   102 O OP2   . DT  A 1 6  ? 12.199 12.364 17.426 1.00 88.41 ? 7   DT  A OP2   1 
ATOM   103 O "O5'" . DT  A 1 6  ? 12.804 12.203 14.974 1.00 46.96 ? 7   DT  A "O5'" 1 
ATOM   104 C "C5'" . DT  A 1 6  ? 12.478 11.928 13.618 1.00 74.88 ? 7   DT  A "C5'" 1 
ATOM   105 C "C4'" . DT  A 1 6  ? 13.499 12.529 12.686 1.00 73.76 ? 7   DT  A "C4'" 1 
ATOM   106 O "O4'" . DT  A 1 6  ? 13.397 13.971 12.650 1.00 63.84 ? 7   DT  A "O4'" 1 
ATOM   107 C "C3'" . DT  A 1 6  ? 14.964 12.195 12.973 1.00 69.35 ? 7   DT  A "C3'" 1 
ATOM   108 O "O3'" . DT  A 1 6  ? 15.521 11.784 11.736 1.00 53.40 ? 7   DT  A "O3'" 1 
ATOM   109 C "C2'" . DT  A 1 6  ? 15.547 13.520 13.419 1.00 69.64 ? 7   DT  A "C2'" 1 
ATOM   110 C "C1'" . DT  A 1 6  ? 14.693 14.505 12.635 1.00 61.55 ? 7   DT  A "C1'" 1 
ATOM   111 N N1    . DT  A 1 6  ? 14.639 15.868 13.185 1.00 48.35 ? 7   DT  A N1    1 
ATOM   112 C C2    . DT  A 1 6  ? 14.644 16.903 12.282 1.00 51.10 ? 7   DT  A C2    1 
ATOM   113 O O2    . DT  A 1 6  ? 14.505 16.745 11.071 1.00 52.14 ? 7   DT  A O2    1 
ATOM   114 N N3    . DT  A 1 6  ? 14.804 18.136 12.842 1.00 33.46 ? 7   DT  A N3    1 
ATOM   115 C C4    . DT  A 1 6  ? 14.924 18.435 14.179 1.00 43.89 ? 7   DT  A C4    1 
ATOM   116 O O4    . DT  A 1 6  ? 15.162 19.594 14.531 1.00 53.57 ? 7   DT  A O4    1 
ATOM   117 C C5    . DT  A 1 6  ? 14.785 17.322 15.069 1.00 29.15 ? 7   DT  A C5    1 
ATOM   118 C C7    . DT  A 1 6  ? 14.794 17.577 16.537 1.00 34.98 ? 7   DT  A C7    1 
ATOM   119 C C6    . DT  A 1 6  ? 14.650 16.102 14.540 1.00 39.63 ? 7   DT  A C6    1 
ATOM   120 P P     . DT  A 1 7  ? 17.041 11.328 11.645 1.00 54.87 ? 8   DT  A P     1 
ATOM   121 O OP1   . DT  A 1 7  ? 17.038 10.048 10.882 1.00 43.11 ? 8   DT  A OP1   1 
ATOM   122 O OP2   . DT  A 1 7  ? 17.661 11.389 13.028 1.00 37.87 ? 8   DT  A OP2   1 
ATOM   123 O "O5'" . DT  A 1 7  ? 17.479 12.383 10.555 1.00 54.11 ? 8   DT  A "O5'" 1 
ATOM   124 C "C5'" . DT  A 1 7  ? 16.641 12.440 9.412  1.00 49.21 ? 8   DT  A "C5'" 1 
ATOM   125 C "C4'" . DT  A 1 7  ? 17.002 13.592 8.518  1.00 43.40 ? 8   DT  A "C4'" 1 
ATOM   126 O "O4'" . DT  A 1 7  ? 16.858 14.816 9.258  1.00 42.33 ? 8   DT  A "O4'" 1 
ATOM   127 C "C3'" . DT  A 1 7  ? 18.433 13.558 8.036  1.00 32.58 ? 8   DT  A "C3'" 1 
ATOM   128 O "O3'" . DT  A 1 7  ? 18.472 13.791 6.643  1.00 38.18 ? 8   DT  A "O3'" 1 
ATOM   129 C "C2'" . DT  A 1 7  ? 19.091 14.678 8.810  1.00 46.72 ? 8   DT  A "C2'" 1 
ATOM   130 C "C1'" . DT  A 1 7  ? 17.966 15.642 9.058  1.00 23.84 ? 8   DT  A "C1'" 1 
ATOM   131 N N1    . DT  A 1 7  ? 18.115 16.378 10.290 1.00 21.39 ? 8   DT  A N1    1 
ATOM   132 C C2    . DT  A 1 7  ? 18.121 17.748 10.266 1.00 18.01 ? 8   DT  A C2    1 
ATOM   133 O O2    . DT  A 1 7  ? 18.072 18.389 9.223  1.00 31.54 ? 8   DT  A O2    1 
ATOM   134 N N3    . DT  A 1 7  ? 18.191 18.336 11.497 1.00 22.13 ? 8   DT  A N3    1 
ATOM   135 C C4    . DT  A 1 7  ? 18.265 17.690 12.703 1.00 22.07 ? 8   DT  A C4    1 
ATOM   136 O O4    . DT  A 1 7  ? 18.288 18.324 13.743 1.00 36.77 ? 8   DT  A O4    1 
ATOM   137 C C5    . DT  A 1 7  ? 18.293 16.264 12.641 1.00 31.32 ? 8   DT  A C5    1 
ATOM   138 C C7    . DT  A 1 7  ? 18.410 15.503 13.918 1.00 33.64 ? 8   DT  A C7    1 
ATOM   139 C C6    . DT  A 1 7  ? 18.215 15.675 11.455 1.00 18.39 ? 8   DT  A C6    1 
ATOM   140 P P     . DG  A 1 8  ? 19.720 13.220 5.808  1.00 46.73 ? 9   DG  A P     1 
ATOM   141 O OP1   . DG  A 1 8  ? 19.392 12.772 4.412  1.00 53.73 ? 9   DG  A OP1   1 
ATOM   142 O OP2   . DG  A 1 8  ? 20.367 12.292 6.775  1.00 36.88 ? 9   DG  A OP2   1 
ATOM   143 O "O5'" . DG  A 1 8  ? 20.686 14.470 5.697  1.00 58.34 ? 9   DG  A "O5'" 1 
ATOM   144 C "C5'" . DG  A 1 8  ? 20.271 15.650 5.030  1.00 63.87 ? 9   DG  A "C5'" 1 
ATOM   145 C "C4'" . DG  A 1 8  ? 21.217 16.782 5.353  1.00 49.20 ? 9   DG  A "C4'" 1 
ATOM   146 O "O4'" . DG  A 1 8  ? 21.097 17.168 6.743  1.00 53.55 ? 9   DG  A "O4'" 1 
ATOM   147 C "C3'" . DG  A 1 8  ? 22.686 16.453 5.155  1.00 40.81 ? 9   DG  A "C3'" 1 
ATOM   148 O "O3'" . DG  A 1 8  ? 23.305 17.591 4.576  1.00 64.17 ? 9   DG  A "O3'" 1 
ATOM   149 C "C2'" . DG  A 1 8  ? 23.170 16.245 6.578  1.00 27.40 ? 9   DG  A "C2'" 1 
ATOM   150 C "C1'" . DG  A 1 8  ? 22.363 17.269 7.307  1.00 18.94 ? 9   DG  A "C1'" 1 
ATOM   151 N N9    . DG  A 1 8  ? 22.234 17.020 8.721  1.00 24.64 ? 9   DG  A N9    1 
ATOM   152 C C8    . DG  A 1 8  ? 22.345 15.815 9.334  1.00 21.45 ? 9   DG  A C8    1 
ATOM   153 N N7    . DG  A 1 8  ? 22.245 15.900 10.637 1.00 42.31 ? 9   DG  A N7    1 
ATOM   154 C C5    . DG  A 1 8  ? 22.042 17.248 10.884 1.00 29.39 ? 9   DG  A C5    1 
ATOM   155 C C6    . DG  A 1 8  ? 21.889 17.930 12.100 1.00 30.12 ? 9   DG  A C6    1 
ATOM   156 O O6    . DG  A 1 8  ? 21.948 17.487 13.228 1.00 63.84 ? 9   DG  A O6    1 
ATOM   157 N N1    . DG  A 1 8  ? 21.680 19.268 11.919 1.00 27.43 ? 9   DG  A N1    1 
ATOM   158 C C2    . DG  A 1 8  ? 21.664 19.888 10.715 1.00 40.68 ? 9   DG  A C2    1 
ATOM   159 N N2    . DG  A 1 8  ? 21.464 21.194 10.767 1.00 47.78 ? 9   DG  A N2    1 
ATOM   160 N N3    . DG  A 1 8  ? 21.835 19.275 9.550  1.00 32.32 ? 9   DG  A N3    1 
ATOM   161 C C4    . DG  A 1 8  ? 22.012 17.955 9.717  1.00 21.28 ? 9   DG  A C4    1 
ATOM   162 P P     . DA  A 1 9  ? 24.567 17.408 3.601  1.00 81.37 ? 10  DA  A P     1 
ATOM   163 O OP1   . DA  A 1 9  ? 24.128 17.308 2.171  1.00 79.18 ? 10  DA  A OP1   1 
ATOM   164 O OP2   . DA  A 1 9  ? 25.438 16.343 4.195  1.00 76.35 ? 10  DA  A OP2   1 
ATOM   165 O "O5'" . DA  A 1 9  ? 25.327 18.797 3.763  1.00 89.32 ? 10  DA  A "O5'" 1 
ATOM   166 C "C5'" . DA  A 1 9  ? 24.635 20.033 3.652  1.00 70.88 ? 10  DA  A "C5'" 1 
ATOM   167 C "C4'" . DA  A 1 9  ? 25.225 21.035 4.615  1.00 71.49 ? 10  DA  A "C4'" 1 
ATOM   168 O "O4'" . DA  A 1 9  ? 24.921 20.658 5.982  1.00 64.90 ? 10  DA  A "O4'" 1 
ATOM   169 C "C3'" . DA  A 1 9  ? 26.743 21.176 4.548  1.00 75.51 ? 10  DA  A "C3'" 1 
ATOM   170 O "O3'" . DA  A 1 9  ? 27.073 22.562 4.460  1.00 97.93 ? 10  DA  A "O3'" 1 
ATOM   171 C "C2'" . DA  A 1 9  ? 27.222 20.567 5.861  1.00 56.53 ? 10  DA  A "C2'" 1 
ATOM   172 C "C1'" . DA  A 1 9  ? 26.057 20.816 6.796  1.00 36.15 ? 10  DA  A "C1'" 1 
ATOM   173 N N9    . DA  A 1 9  ? 25.937 19.860 7.884  1.00 29.88 ? 10  DA  A N9    1 
ATOM   174 C C8    . DA  A 1 9  ? 25.992 18.494 7.779  1.00 31.50 ? 10  DA  A C8    1 
ATOM   175 N N7    . DA  A 1 9  ? 25.825 17.866 8.928  1.00 42.28 ? 10  DA  A N7    1 
ATOM   176 C C5    . DA  A 1 9  ? 25.651 18.892 9.846  1.00 29.02 ? 10  DA  A C5    1 
ATOM   177 C C6    . DA  A 1 9  ? 25.422 18.893 11.240 1.00 39.42 ? 10  DA  A C6    1 
ATOM   178 N N6    . DA  A 1 9  ? 25.285 17.793 11.976 1.00 32.66 ? 10  DA  A N6    1 
ATOM   179 N N1    . DA  A 1 9  ? 25.321 20.083 11.860 1.00 39.61 ? 10  DA  A N1    1 
ATOM   180 C C2    . DA  A 1 9  ? 25.400 21.191 11.116 1.00 47.16 ? 10  DA  A C2    1 
ATOM   181 N N3    . DA  A 1 9  ? 25.585 21.321 9.792  1.00 39.52 ? 10  DA  A N3    1 
ATOM   182 C C4    . DA  A 1 9  ? 25.721 20.125 9.214  1.00 27.03 ? 10  DA  A C4    1 
ATOM   183 P P     . DC  A 1 10 ? 28.603 23.011 4.320  1.00 88.39 ? 11  DC  A P     1 
ATOM   184 O OP1   . DC  A 1 10 ? 28.528 24.266 3.541  1.00 86.66 ? 11  DC  A OP1   1 
ATOM   185 O OP2   . DC  A 1 10 ? 29.407 21.885 3.798  1.00 84.35 ? 11  DC  A OP2   1 
ATOM   186 O "O5'" . DC  A 1 10 ? 29.009 23.298 5.835  1.00 57.98 ? 11  DC  A "O5'" 1 
ATOM   187 C "C5'" . DC  A 1 10 ? 28.178 24.126 6.633  1.00 62.73 ? 11  DC  A "C5'" 1 
ATOM   188 C "C4'" . DC  A 1 10 ? 28.766 24.282 8.011  1.00 79.29 ? 11  DC  A "C4'" 1 
ATOM   189 O "O4'" . DC  A 1 10 ? 28.328 23.221 8.902  1.00 75.02 ? 11  DC  A "O4'" 1 
ATOM   190 C "C3'" . DC  A 1 10 ? 30.292 24.244 8.013  1.00 91.06 ? 11  DC  A "C3'" 1 
ATOM   191 O "O3'" . DC  A 1 10 ? 30.822 25.244 8.895  1.00 96.04 ? 11  DC  A "O3'" 1 
ATOM   192 C "C2'" . DC  A 1 10 ? 30.581 22.867 8.578  1.00 79.09 ? 11  DC  A "C2'" 1 
ATOM   193 C "C1'" . DC  A 1 10 ? 29.454 22.713 9.578  1.00 53.36 ? 11  DC  A "C1'" 1 
ATOM   194 N N1    . DC  A 1 10 ? 29.218 21.309 9.941  1.00 37.72 ? 11  DC  A N1    1 
ATOM   195 C C2    . DC  A 1 10 ? 28.848 20.964 11.293 1.00 51.93 ? 11  DC  A C2    1 
ATOM   196 O O2    . DC  A 1 10 ? 28.508 21.859 12.102 1.00 47.97 ? 11  DC  A O2    1 
ATOM   197 N N3    . DC  A 1 10 ? 28.836 19.663 11.651 1.00 44.39 ? 11  DC  A N3    1 
ATOM   198 C C4    . DC  A 1 10 ? 29.078 18.720 10.731 1.00 51.06 ? 11  DC  A C4    1 
ATOM   199 N N4    . DC  A 1 10 ? 29.056 17.454 11.128 1.00 49.36 ? 11  DC  A N4    1 
ATOM   200 C C5    . DC  A 1 10 ? 29.353 19.038 9.354  1.00 40.57 ? 11  DC  A C5    1 
ATOM   201 C C6    . DC  A 1 10 ? 29.416 20.331 9.010  1.00 35.72 ? 11  DC  A C6    1 
ATOM   202 P P     . DA  A 1 11 ? 32.370 25.685 8.781  1.00 90.66 ? 12  DA  A P     1 
ATOM   203 O OP1   . DA  A 1 11 ? 32.437 26.681 7.669  1.00 62.24 ? 12  DA  A OP1   1 
ATOM   204 O OP2   . DA  A 1 11 ? 33.262 24.491 8.769  1.00 84.92 ? 12  DA  A OP2   1 
ATOM   205 O "O5'" . DA  A 1 11 ? 32.627 26.375 10.181 1.00 55.13 ? 12  DA  A "O5'" 1 
ATOM   206 C "C5'" . DA  A 1 11 ? 31.558 26.521 11.083 1.00 65.63 ? 12  DA  A "C5'" 1 
ATOM   207 C "C4'" . DA  A 1 11 ? 31.946 25.979 12.432 1.00 64.46 ? 12  DA  A "C4'" 1 
ATOM   208 O "O4'" . DA  A 1 11 ? 31.641 24.573 12.565 1.00 75.55 ? 12  DA  A "O4'" 1 
ATOM   209 C "C3'" . DA  A 1 11 ? 33.430 26.127 12.702 1.00 71.79 ? 12  DA  A "C3'" 1 
ATOM   210 O "O3'" . DA  A 1 11 ? 33.626 26.584 14.029 1.00 68.57 ? 12  DA  A "O3'" 1 
ATOM   211 C "C2'" . DA  A 1 11 ? 33.961 24.717 12.547 1.00 83.92 ? 12  DA  A "C2'" 1 
ATOM   212 C "C1'" . DA  A 1 11 ? 32.792 23.871 12.997 1.00 65.27 ? 12  DA  A "C1'" 1 
ATOM   213 N N9    . DA  A 1 11 ? 32.765 22.557 12.365 1.00 49.75 ? 12  DA  A N9    1 
ATOM   214 C C8    . DA  A 1 11 ? 33.031 22.254 11.052 1.00 44.70 ? 12  DA  A C8    1 
ATOM   215 N N7    . DA  A 1 11 ? 32.903 20.984 10.768 1.00 50.02 ? 12  DA  A N7    1 
ATOM   216 C C5    . DA  A 1 11 ? 32.523 20.414 11.973 1.00 46.87 ? 12  DA  A C5    1 
ATOM   217 C C6    . DA  A 1 11 ? 32.221 19.093 12.328 1.00 48.40 ? 12  DA  A C6    1 
ATOM   218 N N6    . DA  A 1 11 ? 32.287 18.076 11.463 1.00 34.46 ? 12  DA  A N6    1 
ATOM   219 N N1    . DA  A 1 11 ? 31.863 18.847 13.612 1.00 51.20 ? 12  DA  A N1    1 
ATOM   220 C C2    . DA  A 1 11 ? 31.844 19.881 14.477 1.00 53.71 ? 12  DA  A C2    1 
ATOM   221 N N3    . DA  A 1 11 ? 32.122 21.173 14.258 1.00 55.89 ? 12  DA  A N3    1 
ATOM   222 C C4    . DA  A 1 11 ? 32.450 21.371 12.969 1.00 48.76 ? 12  DA  A C4    1 
ATOM   223 P P     . DA  A 1 12 ? 35.106 26.987 14.511 1.00 68.72 ? 13  DA  A P     1 
ATOM   224 O OP1   . DA  A 1 12 ? 35.003 28.245 15.304 1.00 68.64 ? 13  DA  A OP1   1 
ATOM   225 O OP2   . DA  A 1 12 ? 36.085 26.892 13.349 1.00 68.66 ? 13  DA  A OP2   1 
ATOM   226 O "O5'" . DA  A 1 12 ? 35.434 25.857 15.568 1.00 68.58 ? 13  DA  A "O5'" 1 
ATOM   227 C "C5'" . DA  A 1 12 ? 34.410 25.345 16.397 1.00 91.10 ? 13  DA  A "C5'" 1 
ATOM   228 C "C4'" . DA  A 1 12 ? 34.891 24.045 16.973 1.00 91.01 ? 13  DA  A "C4'" 1 
ATOM   229 O "O4'" . DA  A 1 12 ? 34.667 22.967 16.031 1.00 69.33 ? 13  DA  A "O4'" 1 
ATOM   230 C "C3'" . DA  A 1 12 ? 36.408 24.127 17.178 1.00 58.58 ? 13  DA  A "C3'" 1 
ATOM   231 O "O3'" . DA  A 1 12 ? 36.761 23.475 18.386 1.00 58.61 ? 13  DA  A "O3'" 1 
ATOM   232 C "C2'" . DA  A 1 12 ? 36.964 23.348 16.007 1.00 78.39 ? 13  DA  A "C2'" 1 
ATOM   233 C "C1'" . DA  A 1 12 ? 35.901 22.290 15.858 1.00 64.31 ? 13  DA  A "C1'" 1 
ATOM   234 N N9    . DA  A 1 12 ? 35.885 21.630 14.565 1.00 49.08 ? 13  DA  A N9    1 
ATOM   235 C C8    . DA  A 1 12 ? 36.206 22.114 13.321 1.00 37.89 ? 13  DA  A C8    1 
ATOM   236 N N7    . DA  A 1 12 ? 36.077 21.223 12.369 1.00 55.22 ? 13  DA  A N7    1 
ATOM   237 C C5    . DA  A 1 12 ? 35.637 20.084 13.039 1.00 41.92 ? 13  DA  A C5    1 
ATOM   238 C C6    . DA  A 1 12 ? 35.296 18.810 12.598 1.00 35.62 ? 13  DA  A C6    1 
ATOM   239 N N6    . DA  A 1 12 ? 35.348 18.445 11.325 1.00 65.85 ? 13  DA  A N6    1 
ATOM   240 N N1    . DA  A 1 12 ? 34.889 17.910 13.510 1.00 37.72 ? 13  DA  A N1    1 
ATOM   241 C C2    . DA  A 1 12 ? 34.833 18.285 14.783 1.00 44.96 ? 13  DA  A C2    1 
ATOM   242 N N3    . DA  A 1 12 ? 35.129 19.460 15.325 1.00 37.41 ? 13  DA  A N3    1 
ATOM   243 C C4    . DA  A 1 12 ? 35.525 20.323 14.383 1.00 39.46 ? 13  DA  A C4    1 
ATOM   244 P P     . DG  A 1 13 ? 38.088 23.928 19.170 1.00 58.85 ? 14  DG  A P     1 
ATOM   245 O OP1   . DG  A 1 13 ? 37.724 24.930 20.260 1.00 58.56 ? 14  DG  A OP1   1 
ATOM   246 O OP2   . DG  A 1 13 ? 39.065 24.314 18.059 1.00 58.66 ? 14  DG  A OP2   1 
ATOM   247 O "O5'" . DG  A 1 13 ? 38.588 22.567 19.866 1.00 58.57 ? 14  DG  A "O5'" 1 
ATOM   248 C "C5'" . DG  A 1 13 ? 37.693 21.758 20.635 1.00 88.12 ? 14  DG  A "C5'" 1 
ATOM   249 C "C4'" . DG  A 1 13 ? 37.903 20.293 20.326 1.00 71.71 ? 14  DG  A "C4'" 1 
ATOM   250 O "O4'" . DG  A 1 13 ? 37.631 20.010 18.920 1.00 74.08 ? 14  DG  A "O4'" 1 
ATOM   251 C "C3'" . DG  A 1 13 ? 39.309 19.756 20.601 1.00 72.22 ? 14  DG  A "C3'" 1 
ATOM   252 O "O3'" . DG  A 1 13 ? 39.199 18.485 21.270 1.00 58.61 ? 14  DG  A "O3'" 1 
ATOM   253 C "C2'" . DG  A 1 13 ? 39.854 19.520 19.197 1.00 71.74 ? 14  DG  A "C2'" 1 
ATOM   254 C "C1'" . DG  A 1 13 ? 38.595 19.080 18.470 1.00 56.77 ? 14  DG  A "C1'" 1 
ATOM   255 N N9    . DG  A 1 13 ? 38.616 19.074 17.003 1.00 44.07 ? 14  DG  A N9    1 
ATOM   256 C C8    . DG  A 1 13 ? 38.897 20.132 16.186 1.00 39.46 ? 14  DG  A C8    1 
ATOM   257 N N7    . DG  A 1 13 ? 38.883 19.819 14.910 1.00 50.17 ? 14  DG  A N7    1 
ATOM   258 C C5    . DG  A 1 13 ? 38.547 18.472 14.877 1.00 34.86 ? 14  DG  A C5    1 
ATOM   259 C C6    . DG  A 1 13 ? 38.376 17.587 13.759 1.00 42.58 ? 14  DG  A C6    1 
ATOM   260 O O6    . DG  A 1 13 ? 38.451 17.853 12.550 1.00 47.96 ? 14  DG  A O6    1 
ATOM   261 N N1    . DG  A 1 13 ? 38.088 16.281 14.169 1.00 27.95 ? 14  DG  A N1    1 
ATOM   262 C C2    . DG  A 1 13 ? 37.976 15.889 15.488 1.00 35.47 ? 14  DG  A C2    1 
ATOM   263 N N2    . DG  A 1 13 ? 37.787 14.597 15.701 1.00 41.19 ? 14  DG  A N2    1 
ATOM   264 N N3    . DG  A 1 13 ? 38.077 16.711 16.531 1.00 39.39 ? 14  DG  A N3    1 
ATOM   265 C C4    . DG  A 1 13 ? 38.377 17.982 16.154 1.00 42.65 ? 14  DG  A C4    1 
ATOM   266 P P     . DA  A 1 14 ? 39.212 18.402 22.904 1.00 58.89 ? 15  DA  A P     1 
ATOM   267 O OP1   . DA  A 1 14 ? 39.735 17.025 23.367 1.00 58.56 ? 15  DA  A OP1   1 
ATOM   268 O OP2   . DA  A 1 14 ? 37.858 18.876 23.408 1.00 58.58 ? 15  DA  A OP2   1 
ATOM   269 O "O5'" . DA  A 1 14 ? 40.204 19.593 23.328 1.00 58.55 ? 15  DA  A "O5'" 1 
ATOM   270 C "C5'" . DA  A 1 14 ? 41.635 19.471 23.272 1.00 68.50 ? 15  DA  A "C5'" 1 
ATOM   271 C "C4'" . DA  A 1 14 ? 42.276 20.501 24.180 1.00 96.14 ? 15  DA  A "C4'" 1 
ATOM   272 O "O4'" . DA  A 1 14 ? 41.953 20.268 25.587 1.00 91.18 ? 15  DA  A "O4'" 1 
ATOM   273 C "C3'" . DA  A 1 14 ? 43.798 20.489 24.108 1.00 68.53 ? 15  DA  A "C3'" 1 
ATOM   274 O "O3'" . DA  A 1 14 ? 44.236 21.835 24.345 1.00 68.56 ? 15  DA  A "O3'" 1 
ATOM   275 C "C2'" . DA  A 1 14 ? 44.170 19.633 25.302 1.00 69.26 ? 15  DA  A "C2'" 1 
ATOM   276 C "C1'" . DA  A 1 14 ? 43.150 20.090 26.329 1.00 63.24 ? 15  DA  A "C1'" 1 
ATOM   277 N N9    . DA  A 1 14 ? 42.934 19.073 27.355 1.00 47.49 ? 15  DA  A N9    1 
ATOM   278 C C8    . DA  A 1 14 ? 42.488 17.803 27.160 1.00 33.27 ? 15  DA  A C8    1 
ATOM   279 N N7    . DA  A 1 14 ? 42.538 17.056 28.236 1.00 51.37 ? 15  DA  A N7    1 
ATOM   280 C C5    . DA  A 1 14 ? 43.035 17.902 29.214 1.00 43.70 ? 15  DA  A C5    1 
ATOM   281 C C6    . DA  A 1 14 ? 43.393 17.698 30.585 1.00 47.48 ? 15  DA  A C6    1 
ATOM   282 N N6    . DA  A 1 14 ? 43.391 16.515 31.217 1.00 49.34 ? 15  DA  A N6    1 
ATOM   283 N N1    . DA  A 1 14 ? 43.809 18.769 31.285 1.00 43.41 ? 15  DA  A N1    1 
ATOM   284 C C2    . DA  A 1 14 ? 43.919 19.937 30.645 1.00 55.86 ? 15  DA  A C2    1 
ATOM   285 N N3    . DA  A 1 14 ? 43.672 20.236 29.360 1.00 57.63 ? 15  DA  A N3    1 
ATOM   286 C C4    . DA  A 1 14 ? 43.227 19.163 28.696 1.00 43.06 ? 15  DA  A C4    1 
ATOM   287 O "O5'" . DA  B 2 1  ? 42.999 17.018 3.017  1.00 82.99 ? 16  DA  B "O5'" 1 
ATOM   288 C "C5'" . DA  B 2 1  ? 43.514 16.058 2.072  1.00 94.85 ? 16  DA  B "C5'" 1 
ATOM   289 C "C4'" . DA  B 2 1  ? 44.062 14.746 2.597  1.00 86.15 ? 16  DA  B "C4'" 1 
ATOM   290 O "O4'" . DA  B 2 1  ? 45.095 15.036 3.577  1.00 70.50 ? 16  DA  B "O4'" 1 
ATOM   291 C "C3'" A DA  B 2 1  ? 43.249 13.596 3.207  0.50 76.42 ? 16  DA  B "C3'" 1 
ATOM   292 C "C3'" B DA  B 2 1  ? 42.894 14.135 3.372  0.50 81.35 ? 16  DA  B "C3'" 1 
ATOM   293 O "O3'" A DA  B 2 1  ? 43.853 12.371 2.723  0.50 65.58 ? 16  DA  B "O3'" 1 
ATOM   294 O "O3'" B DA  B 2 1  ? 42.121 13.093 2.760  0.50 76.53 ? 16  DA  B "O3'" 1 
ATOM   295 C "C2'" . DA  B 2 1  ? 43.454 13.759 4.722  1.00 73.74 ? 16  DA  B "C2'" 1 
ATOM   296 C "C1'" . DA  B 2 1  ? 44.806 14.457 4.843  1.00 48.44 ? 16  DA  B "C1'" 1 
ATOM   297 N N9    . DA  B 2 1  ? 44.657 15.563 5.789  1.00 45.56 ? 16  DA  B N9    1 
ATOM   298 C C8    . DA  B 2 1  ? 44.357 16.887 5.523  1.00 45.84 ? 16  DA  B C8    1 
ATOM   299 N N7    . DA  B 2 1  ? 44.181 17.626 6.608  1.00 37.66 ? 16  DA  B N7    1 
ATOM   300 C C5    . DA  B 2 1  ? 44.392 16.736 7.638  1.00 35.18 ? 16  DA  B C5    1 
ATOM   301 C C6    . DA  B 2 1  ? 44.324 16.890 8.995  1.00 35.30 ? 16  DA  B C6    1 
ATOM   302 N N6    . DA  B 2 1  ? 43.988 18.039 9.583  1.00 39.95 ? 16  DA  B N6    1 
ATOM   303 N N1    . DA  B 2 1  ? 44.603 15.813 9.757  1.00 47.96 ? 16  DA  B N1    1 
ATOM   304 C C2    . DA  B 2 1  ? 44.921 14.653 9.152  1.00 40.87 ? 16  DA  B C2    1 
ATOM   305 N N3    . DA  B 2 1  ? 45.001 14.378 7.858  1.00 31.69 ? 16  DA  B N3    1 
ATOM   306 C C4    . DA  B 2 1  ? 44.719 15.471 7.150  1.00 33.58 ? 16  DA  B C4    1 
ATOM   307 P P     A DT  B 2 2  ? 43.107 10.958 2.917  0.50 59.39 ? 17  DT  B P     1 
ATOM   308 P P     B DT  B 2 2  ? 40.548 12.988 3.143  0.50 76.04 ? 17  DT  B P     1 
ATOM   309 O OP1   A DT  B 2 2  ? 44.151 9.896  2.842  0.50 56.86 ? 17  DT  B OP1   1 
ATOM   310 O OP1   B DT  B 2 2  ? 40.009 11.683 2.681  0.50 78.02 ? 17  DT  B OP1   1 
ATOM   311 O OP2   A DT  B 2 2  ? 41.951 10.903 1.994  0.50 58.70 ? 17  DT  B OP2   1 
ATOM   312 O OP2   B DT  B 2 2  ? 39.820 14.251 2.778  0.50 55.50 ? 17  DT  B OP2   1 
ATOM   313 O "O5'" A DT  B 2 2  ? 42.631 11.032 4.430  0.50 48.16 ? 17  DT  B "O5'" 1 
ATOM   314 O "O5'" B DT  B 2 2  ? 40.612 12.935 4.731  0.50 60.25 ? 17  DT  B "O5'" 1 
ATOM   315 C "C5'" A DT  B 2 2  ? 41.270 10.953 4.816  0.50 45.91 ? 17  DT  B "C5'" 1 
ATOM   316 C "C5'" B DT  B 2 2  ? 39.924 11.932 5.431  0.50 56.56 ? 17  DT  B "C5'" 1 
ATOM   317 C "C4'" A DT  B 2 2  ? 41.237 10.615 6.284  0.50 58.34 ? 17  DT  B "C4'" 1 
ATOM   318 C "C4'" B DT  B 2 2  ? 40.880 10.986 6.120  0.50 60.10 ? 17  DT  B "C4'" 1 
ATOM   319 O "O4'" . DT  B 2 2  ? 41.747 11.714 7.029  1.00 53.55 ? 17  DT  B "O4'" 1 
ATOM   320 C "C3'" . DT  B 2 2  ? 39.975 10.160 7.012  1.00 69.22 ? 17  DT  B "C3'" 1 
ATOM   321 O "O3'" . DT  B 2 2  ? 40.319 8.851  7.327  1.00 76.67 ? 17  DT  B "O3'" 1 
ATOM   322 C "C2'" . DT  B 2 2  ? 39.908 10.990 8.275  1.00 55.47 ? 17  DT  B "C2'" 1 
ATOM   323 C "C1'" . DT  B 2 2  ? 41.279 11.609 8.353  1.00 41.40 ? 17  DT  B "C1'" 1 
ATOM   324 N N1    . DT  B 2 2  ? 41.209 12.960 8.870  1.00 40.23 ? 17  DT  B N1    1 
ATOM   325 C C2    . DT  B 2 2  ? 41.305 13.110 10.209 1.00 38.32 ? 17  DT  B C2    1 
ATOM   326 O O2    . DT  B 2 2  ? 41.436 12.151 10.967 1.00 58.21 ? 17  DT  B O2    1 
ATOM   327 N N3    . DT  B 2 2  ? 41.246 14.422 10.638 1.00 31.12 ? 17  DT  B N3    1 
ATOM   328 C C4    . DT  B 2 2  ? 41.117 15.557 9.850  1.00 37.12 ? 17  DT  B C4    1 
ATOM   329 O O4    . DT  B 2 2  ? 41.130 16.690 10.353 1.00 44.74 ? 17  DT  B O4    1 
ATOM   330 C C5    . DT  B 2 2  ? 40.998 15.309 8.461  1.00 26.83 ? 17  DT  B C5    1 
ATOM   331 C C7    . DT  B 2 2  ? 40.811 16.477 7.556  1.00 26.12 ? 17  DT  B C7    1 
ATOM   332 C C6    . DT  B 2 2  ? 41.052 14.041 8.031  1.00 21.87 ? 17  DT  B C6    1 
ATOM   333 P P     . DC  B 2 3  ? 39.147 7.840  7.515  1.00 77.98 ? 18  DC  B P     1 
ATOM   334 O OP1   . DC  B 2 3  ? 39.685 6.457  7.574  1.00 75.58 ? 18  DC  B OP1   1 
ATOM   335 O OP2   . DC  B 2 3  ? 38.185 8.245  6.451  1.00 81.89 ? 18  DC  B OP2   1 
ATOM   336 O "O5'" . DC  B 2 3  ? 38.654 8.268  8.948  1.00 59.34 ? 18  DC  B "O5'" 1 
ATOM   337 C "C5'" . DC  B 2 3  ? 39.469 7.937  10.026 1.00 54.33 ? 18  DC  B "C5'" 1 
ATOM   338 C "C4'" . DC  B 2 3  ? 38.895 8.524  11.278 1.00 53.69 ? 18  DC  B "C4'" 1 
ATOM   339 O "O4'" . DC  B 2 3  ? 39.056 9.952  11.236 1.00 53.73 ? 18  DC  B "O4'" 1 
ATOM   340 C "C3'" . DC  B 2 3  ? 37.404 8.281  11.469 1.00 40.84 ? 18  DC  B "C3'" 1 
ATOM   341 O "O3'" . DC  B 2 3  ? 37.203 7.968  12.849 1.00 48.73 ? 18  DC  B "O3'" 1 
ATOM   342 C "C2'" . DC  B 2 3  ? 36.817 9.647  11.173 1.00 46.65 ? 18  DC  B "C2'" 1 
ATOM   343 C "C1'" . DC  B 2 3  ? 37.895 10.503 11.774 1.00 31.67 ? 18  DC  B "C1'" 1 
ATOM   344 N N1    . DC  B 2 3  ? 37.900 11.921 11.447 1.00 31.86 ? 18  DC  B N1    1 
ATOM   345 C C2    . DC  B 2 3  ? 38.014 12.822 12.487 1.00 24.36 ? 18  DC  B C2    1 
ATOM   346 O O2    . DC  B 2 3  ? 38.114 12.367 13.636 1.00 42.44 ? 18  DC  B O2    1 
ATOM   347 N N3    . DC  B 2 3  ? 38.024 14.158 12.225 1.00 25.22 ? 18  DC  B N3    1 
ATOM   348 C C4    . DC  B 2 3  ? 37.921 14.576 10.957 1.00 25.25 ? 18  DC  B C4    1 
ATOM   349 N N4    . DC  B 2 3  ? 37.903 15.876 10.718 1.00 31.12 ? 18  DC  B N4    1 
ATOM   350 C C5    . DC  B 2 3  ? 37.818 13.673 9.874  1.00 20.30 ? 18  DC  B C5    1 
ATOM   351 C C6    . DC  B 2 3  ? 37.808 12.354 10.160 1.00 22.94 ? 18  DC  B C6    1 
ATOM   352 P P     . DT  B 2 4  ? 36.036 6.948  13.290 1.00 58.78 ? 19  DT  B P     1 
ATOM   353 O OP1   . DT  B 2 4  ? 36.568 5.843  14.127 1.00 49.97 ? 19  DT  B OP1   1 
ATOM   354 O OP2   . DT  B 2 4  ? 35.203 6.628  12.090 1.00 55.14 ? 19  DT  B OP2   1 
ATOM   355 O "O5'" . DT  B 2 4  ? 35.228 7.851  14.308 1.00 47.87 ? 19  DT  B "O5'" 1 
ATOM   356 C "C5'" . DT  B 2 4  ? 35.371 9.250  14.240 1.00 39.18 ? 19  DT  B "C5'" 1 
ATOM   357 C "C4'" . DT  B 2 4  ? 35.149 9.859  15.598 1.00 49.67 ? 19  DT  B "C4'" 1 
ATOM   358 O "O4'" . DT  B 2 4  ? 35.540 11.230 15.425 1.00 53.12 ? 19  DT  B "O4'" 1 
ATOM   359 C "C3'" . DT  B 2 4  ? 33.689 9.878  16.052 1.00 58.38 ? 19  DT  B "C3'" 1 
ATOM   360 O "O3'" . DT  B 2 4  ? 33.530 9.685  17.461 1.00 62.86 ? 19  DT  B "O3'" 1 
ATOM   361 C "C2'" . DT  B 2 4  ? 33.188 11.247 15.628 1.00 65.07 ? 19  DT  B "C2'" 1 
ATOM   362 C "C1'" . DT  B 2 4  ? 34.440 12.106 15.546 1.00 45.33 ? 19  DT  B "C1'" 1 
ATOM   363 N N1    . DT  B 2 4  ? 34.462 12.984 14.372 1.00 27.61 ? 19  DT  B N1    1 
ATOM   364 C C2    . DT  B 2 4  ? 34.439 14.337 14.573 1.00 27.91 ? 19  DT  B C2    1 
ATOM   365 O O2    . DT  B 2 4  ? 34.395 14.830 15.686 1.00 52.74 ? 19  DT  B O2    1 
ATOM   366 N N3    . DT  B 2 4  ? 34.456 15.088 13.432 1.00 22.70 ? 19  DT  B N3    1 
ATOM   367 C C4    . DT  B 2 4  ? 34.482 14.618 12.155 1.00 23.36 ? 19  DT  B C4    1 
ATOM   368 O O4    . DT  B 2 4  ? 34.481 15.384 11.201 1.00 32.85 ? 19  DT  B O4    1 
ATOM   369 C C5    . DT  B 2 4  ? 34.506 13.209 12.023 1.00 24.18 ? 19  DT  B C5    1 
ATOM   370 C C7    . DT  B 2 4  ? 34.544 12.644 10.645 1.00 55.96 ? 19  DT  B C7    1 
ATOM   371 C C6    . DT  B 2 4  ? 34.497 12.457 13.120 1.00 25.76 ? 19  DT  B C6    1 
ATOM   372 P P     . DT  B 2 5  ? 32.062 9.393  18.060 1.00 60.12 ? 20  DT  B P     1 
ATOM   373 O OP1   . DT  B 2 5  ? 32.151 8.563  19.299 1.00 66.64 ? 20  DT  B OP1   1 
ATOM   374 O OP2   . DT  B 2 5  ? 31.214 8.922  16.934 1.00 71.23 ? 20  DT  B OP2   1 
ATOM   375 O "O5'" . DT  B 2 5  ? 31.590 10.849 18.471 1.00 66.68 ? 20  DT  B "O5'" 1 
ATOM   376 C "C5'" . DT  B 2 5  ? 32.322 11.581 19.429 1.00 76.22 ? 20  DT  B "C5'" 1 
ATOM   377 C "C4'" . DT  B 2 5  ? 31.806 12.993 19.524 1.00 66.47 ? 20  DT  B "C4'" 1 
ATOM   378 O "O4'" . DT  B 2 5  ? 32.170 13.725 18.329 1.00 57.34 ? 20  DT  B "O4'" 1 
ATOM   379 C "C3'" . DT  B 2 5  ? 30.296 13.115 19.670 1.00 64.92 ? 20  DT  B "C3'" 1 
ATOM   380 O "O3'" . DT  B 2 5  ? 29.991 13.884 20.827 1.00 75.95 ? 20  DT  B "O3'" 1 
ATOM   381 C "C2'" . DT  B 2 5  ? 29.863 13.830 18.398 1.00 63.85 ? 20  DT  B "C2'" 1 
ATOM   382 C "C1'" . DT  B 2 5  ? 31.114 14.579 17.970 1.00 48.09 ? 20  DT  B "C1'" 1 
ATOM   383 N N1    . DT  B 2 5  ? 31.239 14.889 16.512 1.00 46.75 ? 20  DT  B N1    1 
ATOM   384 C C2    . DT  B 2 5  ? 31.613 16.172 16.130 1.00 49.64 ? 20  DT  B C2    1 
ATOM   385 O O2    . DT  B 2 5  ? 31.988 17.029 16.917 1.00 66.43 ? 20  DT  B O2    1 
ATOM   386 N N3    . DT  B 2 5  ? 31.562 16.406 14.780 1.00 36.64 ? 20  DT  B N3    1 
ATOM   387 C C4    . DT  B 2 5  ? 31.236 15.499 13.796 1.00 27.99 ? 20  DT  B C4    1 
ATOM   388 O O4    . DT  B 2 5  ? 31.184 15.846 12.621 1.00 44.67 ? 20  DT  B O4    1 
ATOM   389 C C5    . DT  B 2 5  ? 30.965 14.174 14.248 1.00 42.37 ? 20  DT  B C5    1 
ATOM   390 C C7    . DT  B 2 5  ? 30.711 13.121 13.217 1.00 42.80 ? 20  DT  B C7    1 
ATOM   391 C C6    . DT  B 2 5  ? 30.963 13.931 15.570 1.00 42.71 ? 20  DT  B C6    1 
ATOM   392 P P     . DG  B 2 6  ? 28.555 13.682 21.582 1.00 68.67 ? 21  DG  B P     1 
ATOM   393 O OP1   . DG  B 2 6  ? 28.795 13.281 23.025 1.00 68.56 ? 21  DG  B OP1   1 
ATOM   394 O OP2   . DG  B 2 6  ? 27.543 12.907 20.758 1.00 68.45 ? 21  DG  B OP2   1 
ATOM   395 O "O5'" . DG  B 2 6  ? 28.043 15.191 21.702 1.00 68.56 ? 21  DG  B "O5'" 1 
ATOM   396 C "C5'" . DG  B 2 6  ? 28.942 16.231 22.187 1.00 48.58 ? 21  DG  B "C5'" 1 
ATOM   397 C "C4'" . DG  B 2 6  ? 28.653 17.530 21.449 1.00 48.61 ? 21  DG  B "C4'" 1 
ATOM   398 O "O4'" . DG  B 2 6  ? 29.016 17.354 20.025 1.00 48.46 ? 21  DG  B "O4'" 1 
ATOM   399 C "C3'" . DG  B 2 6  ? 27.165 17.973 21.480 1.00 48.60 ? 21  DG  B "C3'" 1 
ATOM   400 O "O3'" . DG  B 2 6  ? 26.962 19.354 21.887 1.00 68.53 ? 21  DG  B "O3'" 1 
ATOM   401 C "C2'" . DG  B 2 6  ? 26.721 17.794 20.035 1.00 48.60 ? 21  DG  B "C2'" 1 
ATOM   402 C "C1'" . DG  B 2 6  ? 28.015 17.998 19.260 1.00 48.52 ? 21  DG  B "C1'" 1 
ATOM   403 N N9    . DG  B 2 6  ? 27.929 17.375 17.941 1.00 58.81 ? 21  DG  B N9    1 
ATOM   404 C C8    . DG  B 2 6  ? 27.482 16.103 17.670 1.00 40.49 ? 21  DG  B C8    1 
ATOM   405 N N7    . DG  B 2 6  ? 27.368 15.870 16.377 1.00 46.76 ? 21  DG  B N7    1 
ATOM   406 C C5    . DG  B 2 6  ? 27.800 17.044 15.768 1.00 48.47 ? 21  DG  B C5    1 
ATOM   407 C C6    . DG  B 2 6  ? 27.925 17.386 14.368 1.00 58.07 ? 21  DG  B C6    1 
ATOM   408 O O6    . DG  B 2 6  ? 27.684 16.673 13.375 1.00 64.66 ? 21  DG  B O6    1 
ATOM   409 N N1    . DG  B 2 6  ? 28.409 18.682 14.189 1.00 52.45 ? 21  DG  B N1    1 
ATOM   410 C C2    . DG  B 2 6  ? 28.753 19.541 15.204 1.00 53.15 ? 21  DG  B C2    1 
ATOM   411 N N2    . DG  B 2 6  ? 29.139 20.770 14.818 1.00 75.60 ? 21  DG  B N2    1 
ATOM   412 N N3    . DG  B 2 6  ? 28.702 19.229 16.507 1.00 50.92 ? 21  DG  B N3    1 
ATOM   413 C C4    . DG  B 2 6  ? 28.202 17.984 16.712 1.00 47.18 ? 21  DG  B C4    1 
ATOM   414 P P     . DT  B 2 7  ? 25.454 19.956 22.084 1.00 68.35 ? 22  DT  B P     1 
ATOM   415 O OP1   . DT  B 2 7  ? 25.336 20.554 23.465 1.00 62.91 ? 22  DT  B OP1   1 
ATOM   416 O OP2   . DT  B 2 7  ? 24.451 18.975 21.616 1.00 72.63 ? 22  DT  B OP2   1 
ATOM   417 O "O5'" . DT  B 2 7  ? 25.468 21.145 21.043 1.00 73.77 ? 22  DT  B "O5'" 1 
ATOM   418 C "C5'" . DT  B 2 7  ? 26.614 21.958 20.971 1.00 59.51 ? 22  DT  B "C5'" 1 
ATOM   419 C "C4'" . DT  B 2 7  ? 26.488 22.896 19.803 1.00 69.55 ? 22  DT  B "C4'" 1 
ATOM   420 O "O4'" . DT  B 2 7  ? 26.615 22.160 18.559 1.00 75.48 ? 22  DT  B "O4'" 1 
ATOM   421 C "C3'" . DT  B 2 7  ? 25.157 23.643 19.726 1.00 62.99 ? 22  DT  B "C3'" 1 
ATOM   422 O "O3'" . DT  B 2 7  ? 25.357 25.021 19.376 1.00 77.22 ? 22  DT  B "O3'" 1 
ATOM   423 C "C2'" . DT  B 2 7  ? 24.423 22.929 18.605 1.00 73.17 ? 22  DT  B "C2'" 1 
ATOM   424 C "C1'" . DT  B 2 7  ? 25.550 22.493 17.690 1.00 50.14 ? 22  DT  B "C1'" 1 
ATOM   425 N N1    . DT  B 2 7  ? 25.228 21.295 16.893 1.00 49.51 ? 22  DT  B N1    1 
ATOM   426 C C2    . DT  B 2 7  ? 25.400 21.353 15.517 1.00 49.84 ? 22  DT  B C2    1 
ATOM   427 O O2    . DT  B 2 7  ? 25.848 22.334 14.944 1.00 42.71 ? 22  DT  B O2    1 
ATOM   428 N N3    . DT  B 2 7  ? 25.027 20.200 14.835 1.00 52.75 ? 22  DT  B N3    1 
ATOM   429 C C4    . DT  B 2 7  ? 24.533 19.017 15.394 1.00 43.72 ? 22  DT  B C4    1 
ATOM   430 O O4    . DT  B 2 7  ? 24.224 18.066 14.663 1.00 38.59 ? 22  DT  B O4    1 
ATOM   431 C C5    . DT  B 2 7  ? 24.425 19.020 16.845 1.00 29.47 ? 22  DT  B C5    1 
ATOM   432 C C7    . DT  B 2 7  ? 23.980 17.777 17.536 1.00 25.17 ? 22  DT  B C7    1 
ATOM   433 C C6    . DT  B 2 7  ? 24.755 20.144 17.511 1.00 34.67 ? 22  DT  B C6    1 
ATOM   434 P P     . DC  B 2 8  ? 24.099 26.021 19.347 1.00 87.73 ? 23  DC  B P     1 
ATOM   435 O OP1   . DC  B 2 8  ? 24.613 27.407 19.464 1.00 92.66 ? 23  DC  B OP1   1 
ATOM   436 O OP2   . DC  B 2 8  ? 23.127 25.510 20.355 1.00 81.55 ? 23  DC  B OP2   1 
ATOM   437 O "O5'" . DC  B 2 8  ? 23.504 25.843 17.875 1.00 69.20 ? 23  DC  B "O5'" 1 
ATOM   438 C "C5'" . DC  B 2 8  ? 24.120 26.483 16.750 1.00 69.65 ? 23  DC  B "C5'" 1 
ATOM   439 C "C4'" . DC  B 2 8  ? 23.241 26.371 15.520 1.00 78.97 ? 23  DC  B "C4'" 1 
ATOM   440 O "O4'" . DC  B 2 8  ? 23.200 24.995 15.045 1.00 79.62 ? 23  DC  B "O4'" 1 
ATOM   441 C "C3'" . DC  B 2 8  ? 21.775 26.809 15.702 1.00 79.69 ? 23  DC  B "C3'" 1 
ATOM   442 O "O3'" . DC  B 2 8  ? 21.280 27.476 14.514 1.00 70.39 ? 23  DC  B "O3'" 1 
ATOM   443 C "C2'" . DC  B 2 8  ? 21.058 25.480 15.854 1.00 83.87 ? 23  DC  B "C2'" 1 
ATOM   444 C "C1'" . DC  B 2 8  ? 21.843 24.616 14.878 1.00 69.86 ? 23  DC  B "C1'" 1 
ATOM   445 N N1    . DC  B 2 8  ? 21.712 23.163 15.088 1.00 50.84 ? 23  DC  B N1    1 
ATOM   446 C C2    . DC  B 2 8  ? 21.857 22.312 13.971 1.00 49.75 ? 23  DC  B C2    1 
ATOM   447 O O2    . DC  B 2 8  ? 22.145 22.815 12.872 1.00 39.50 ? 23  DC  B O2    1 
ATOM   448 N N3    . DC  B 2 8  ? 21.677 20.978 14.122 1.00 46.63 ? 23  DC  B N3    1 
ATOM   449 C C4    . DC  B 2 8  ? 21.369 20.483 15.334 1.00 56.12 ? 23  DC  B C4    1 
ATOM   450 N N4    . DC  B 2 8  ? 21.180 19.160 15.437 1.00 54.45 ? 23  DC  B N4    1 
ATOM   451 C C5    . DC  B 2 8  ? 21.237 21.326 16.498 1.00 31.45 ? 23  DC  B C5    1 
ATOM   452 C C6    . DC  B 2 8  ? 21.423 22.644 16.328 1.00 40.30 ? 23  DC  B C6    1 
ATOM   453 P P     . DA  B 2 9  ? 20.440 28.857 14.630 1.00 56.18 ? 24  DA  B P     1 
ATOM   454 O OP1   . DA  B 2 9  ? 21.415 29.950 14.802 1.00 69.59 ? 24  DA  B OP1   1 
ATOM   455 O OP2   . DA  B 2 9  ? 19.314 28.729 15.613 1.00 49.55 ? 24  DA  B OP2   1 
ATOM   456 O "O5'" . DA  B 2 9  ? 19.886 29.032 13.151 1.00 51.83 ? 24  DA  B "O5'" 1 
ATOM   457 C "C5'" . DA  B 2 9  ? 20.787 29.219 12.068 1.00 49.47 ? 24  DA  B "C5'" 1 
ATOM   458 C "C4'" . DA  B 2 9  ? 20.356 28.411 10.863 1.00 51.24 ? 24  DA  B "C4'" 1 
ATOM   459 O "O4'" . DA  B 2 9  ? 20.315 27.000 11.204 1.00 54.18 ? 24  DA  B "O4'" 1 
ATOM   460 C "C3'" . DA  B 2 9  ? 18.995 28.730 10.254 1.00 48.67 ? 24  DA  B "C3'" 1 
ATOM   461 O "O3'" . DA  B 2 9  ? 19.101 28.667 8.829  1.00 63.68 ? 24  DA  B "O3'" 1 
ATOM   462 C "C2'" . DA  B 2 9  ? 18.094 27.618 10.778 1.00 63.37 ? 24  DA  B "C2'" 1 
ATOM   463 C "C1'" . DA  B 2 9  ? 19.044 26.421 10.899 1.00 48.24 ? 24  DA  B "C1'" 1 
ATOM   464 N N9    . DA  B 2 9  ? 18.739 25.412 11.947 1.00 46.22 ? 24  DA  B N9    1 
ATOM   465 C C8    . DA  B 2 9  ? 18.496 25.638 13.292 1.00 39.31 ? 24  DA  B C8    1 
ATOM   466 N N7    . DA  B 2 9  ? 18.308 24.544 13.997 1.00 31.32 ? 24  DA  B N7    1 
ATOM   467 C C5    . DA  B 2 9  ? 18.419 23.531 13.063 1.00 30.40 ? 24  DA  B C5    1 
ATOM   468 C C6    . DA  B 2 9  ? 18.305 22.143 13.187 1.00 33.48 ? 24  DA  B C6    1 
ATOM   469 N N6    . DA  B 2 9  ? 18.027 21.534 14.343 1.00 34.58 ? 24  DA  B N6    1 
ATOM   470 N N1    . DA  B 2 9  ? 18.467 21.394 12.081 1.00 39.41 ? 24  DA  B N1    1 
ATOM   471 C C2    . DA  B 2 9  ? 18.716 22.023 10.919 1.00 47.52 ? 24  DA  B C2    1 
ATOM   472 N N3    . DA  B 2 9  ? 18.835 23.336 10.667 1.00 47.30 ? 24  DA  B N3    1 
ATOM   473 C C4    . DA  B 2 9  ? 18.674 24.044 11.795 1.00 39.49 ? 24  DA  B C4    1 
ATOM   474 P P     . DA  B 2 10 ? 17.820 29.025 7.926  1.00 69.73 ? 25  DA  B P     1 
ATOM   475 O OP1   . DA  B 2 10 ? 18.246 29.540 6.590  1.00 62.32 ? 25  DA  B OP1   1 
ATOM   476 O OP2   . DA  B 2 10 ? 16.942 29.834 8.799  1.00 66.48 ? 25  DA  B OP2   1 
ATOM   477 O "O5'" . DA  B 2 10 ? 17.119 27.624 7.663  1.00 65.34 ? 25  DA  B "O5'" 1 
ATOM   478 C "C5'" . DA  B 2 10 ? 17.714 26.708 6.746  1.00 72.31 ? 25  DA  B "C5'" 1 
ATOM   479 C "C4'" . DA  B 2 10 ? 16.974 25.392 6.732  1.00 43.26 ? 25  DA  B "C4'" 1 
ATOM   480 O "O4'" . DA  B 2 10 ? 16.983 24.808 8.060  1.00 61.02 ? 25  DA  B "O4'" 1 
ATOM   481 C "C3'" . DA  B 2 10 ? 15.507 25.496 6.328  1.00 45.26 ? 25  DA  B "C3'" 1 
ATOM   482 O "O3'" . DA  B 2 10 ? 15.207 24.450 5.425  1.00 48.38 ? 25  DA  B "O3'" 1 
ATOM   483 C "C2'" . DA  B 2 10 ? 14.772 25.279 7.638  1.00 39.70 ? 25  DA  B "C2'" 1 
ATOM   484 C "C1'" . DA  B 2 10 ? 15.694 24.305 8.316  1.00 53.08 ? 25  DA  B "C1'" 1 
ATOM   485 N N9    . DA  B 2 10 ? 15.530 24.115 9.758  1.00 35.27 ? 25  DA  B N9    1 
ATOM   486 C C8    . DA  B 2 10 ? 15.288 25.056 10.711 1.00 30.02 ? 25  DA  B C8    1 
ATOM   487 N N7    . DA  B 2 10 ? 15.092 24.550 11.920 1.00 48.39 ? 25  DA  B N7    1 
ATOM   488 C C5    . DA  B 2 10 ? 15.232 23.176 11.743 1.00 36.00 ? 25  DA  B C5    1 
ATOM   489 C C6    . DA  B 2 10 ? 15.139 22.073 12.637 1.00 35.66 ? 25  DA  B C6    1 
ATOM   490 N N6    . DA  B 2 10 ? 14.799 22.179 13.921 1.00 47.80 ? 25  DA  B N6    1 
ATOM   491 N N1    . DA  B 2 10 ? 15.401 20.845 12.152 1.00 32.40 ? 25  DA  B N1    1 
ATOM   492 C C2    . DA  B 2 10 ? 15.716 20.730 10.864 1.00 40.36 ? 25  DA  B C2    1 
ATOM   493 N N3    . DA  B 2 10 ? 15.807 21.671 9.921  1.00 45.47 ? 25  DA  B N3    1 
ATOM   494 C C4    . DA  B 2 10 ? 15.545 22.893 10.427 1.00 37.82 ? 25  DA  B C4    1 
ATOM   495 P P     . DA  B 2 11 ? 14.878 24.791 3.888  1.00 55.56 ? 26  DA  B P     1 
ATOM   496 O OP1   . DA  B 2 11 ? 16.032 25.450 3.239  1.00 70.24 ? 26  DA  B OP1   1 
ATOM   497 O OP2   . DA  B 2 11 ? 13.549 25.437 3.818  1.00 81.84 ? 26  DA  B OP2   1 
ATOM   498 O "O5'" . DA  B 2 11 ? 14.732 23.345 3.247  1.00 68.91 ? 26  DA  B "O5'" 1 
ATOM   499 C "C5'" . DA  B 2 11 ? 15.784 22.394 3.379  1.00 75.44 ? 26  DA  B "C5'" 1 
ATOM   500 C "C4'" . DA  B 2 11 ? 15.235 21.059 3.825  1.00 64.13 ? 26  DA  B "C4'" 1 
ATOM   501 O "O4'" . DA  B 2 11 ? 14.942 21.007 5.241  1.00 65.68 ? 26  DA  B "O4'" 1 
ATOM   502 C "C3'" . DA  B 2 11 ? 13.949 20.656 3.135  1.00 46.32 ? 26  DA  B "C3'" 1 
ATOM   503 O "O3'" . DA  B 2 11 ? 14.018 19.261 2.929  1.00 52.74 ? 26  DA  B "O3'" 1 
ATOM   504 C "C2'" . DA  B 2 11 ? 12.902 20.961 4.184  1.00 45.00 ? 26  DA  B "C2'" 1 
ATOM   505 C "C1'" . DA  B 2 11 ? 13.622 20.543 5.441  1.00 28.96 ? 26  DA  B "C1'" 1 
ATOM   506 N N9    . DA  B 2 11 ? 13.127 21.151 6.673  1.00 32.92 ? 26  DA  B N9    1 
ATOM   507 C C8    . DA  B 2 11 ? 12.674 22.435 6.844  1.00 38.83 ? 26  DA  B C8    1 
ATOM   508 N N7    . DA  B 2 11 ? 12.323 22.709 8.088  1.00 32.41 ? 26  DA  B N7    1 
ATOM   509 C C5    . DA  B 2 11 ? 12.549 21.521 8.773  1.00 39.58 ? 26  DA  B C5    1 
ATOM   510 C C6    . DA  B 2 11 ? 12.363 21.148 10.120 1.00 40.89 ? 26  DA  B C6    1 
ATOM   511 N N6    . DA  B 2 11 ? 11.809 21.927 11.040 1.00 55.40 ? 26  DA  B N6    1 
ATOM   512 N N1    . DA  B 2 11 ? 12.736 19.913 10.490 1.00 39.59 ? 26  DA  B N1    1 
ATOM   513 C C2    . DA  B 2 11 ? 13.206 19.093 9.559  1.00 32.13 ? 26  DA  B C2    1 
ATOM   514 N N3    . DA  B 2 11 ? 13.382 19.302 8.251  1.00 39.20 ? 26  DA  B N3    1 
ATOM   515 C C4    . DA  B 2 11 ? 13.043 20.555 7.918  1.00 38.86 ? 26  DA  B C4    1 
ATOM   516 P P     . DA  B 2 12 ? 13.233 18.616 1.700  1.00 56.80 ? 27  DA  B P     1 
ATOM   517 O OP1   . DA  B 2 12 ? 14.167 17.780 0.898  1.00 80.69 ? 27  DA  B OP1   1 
ATOM   518 O OP2   . DA  B 2 12 ? 12.513 19.723 1.037  1.00 61.57 ? 27  DA  B OP2   1 
ATOM   519 O "O5'" . DA  B 2 12 ? 12.245 17.639 2.470  1.00 60.73 ? 27  DA  B "O5'" 1 
ATOM   520 C "C5'" . DA  B 2 12 ? 12.759 16.778 3.488  1.00 69.59 ? 27  DA  B "C5'" 1 
ATOM   521 C "C4'" . DA  B 2 12 ? 11.649 16.265 4.378  1.00 64.43 ? 27  DA  B "C4'" 1 
ATOM   522 O "O4'" . DA  B 2 12 ? 11.346 17.129 5.496  1.00 79.33 ? 27  DA  B "O4'" 1 
ATOM   523 C "C3'" . DA  B 2 12 ? 10.315 15.972 3.706  1.00 66.40 ? 27  DA  B "C3'" 1 
ATOM   524 O "O3'" . DA  B 2 12 ? 9.817  14.767 4.272  1.00 67.92 ? 27  DA  B "O3'" 1 
ATOM   525 C "C2'" . DA  B 2 12 ? 9.455  17.144 4.141  1.00 59.86 ? 27  DA  B "C2'" 1 
ATOM   526 C "C1'" . DA  B 2 12 ? 9.945  17.338 5.566  1.00 53.09 ? 27  DA  B "C1'" 1 
ATOM   527 N N9    . DA  B 2 12 ? 9.720  18.666 6.142  1.00 39.45 ? 27  DA  B N9    1 
ATOM   528 C C8    . DA  B 2 12 ? 9.662  19.876 5.494  1.00 31.64 ? 27  DA  B C8    1 
ATOM   529 N N7    . DA  B 2 12 ? 9.501  20.895 6.310  1.00 33.44 ? 27  DA  B N7    1 
ATOM   530 C C5    . DA  B 2 12 ? 9.431  20.313 7.577  1.00 30.18 ? 27  DA  B C5    1 
ATOM   531 C C6    . DA  B 2 12 ? 9.276  20.857 8.878  1.00 41.06 ? 27  DA  B C6    1 
ATOM   532 N N6    . DA  B 2 12 ? 9.152  22.158 9.128  1.00 69.68 ? 27  DA  B N6    1 
ATOM   533 N N1    . DA  B 2 12 ? 9.254  20.011 9.925  1.00 29.64 ? 27  DA  B N1    1 
ATOM   534 C C2    . DA  B 2 12 ? 9.372  18.710 9.681  1.00 38.89 ? 27  DA  B C2    1 
ATOM   535 N N3    . DA  B 2 12 ? 9.522  18.073 8.510  1.00 45.54 ? 27  DA  B N3    1 
ATOM   536 C C4    . DA  B 2 12 ? 9.547  18.945 7.485  1.00 34.07 ? 27  DA  B C4    1 
ATOM   537 P P     . DA  B 2 13 ? 8.764  13.899 3.452  1.00 90.60 ? 28  DA  B P     1 
ATOM   538 O OP1   . DA  B 2 13 ? 9.236  12.493 3.526  1.00 94.14 ? 28  DA  B OP1   1 
ATOM   539 O OP2   . DA  B 2 13 ? 8.605  14.558 2.116  1.00 80.28 ? 28  DA  B OP2   1 
ATOM   540 O "O5'" . DA  B 2 13 ? 7.434  14.047 4.336  1.00 95.46 ? 28  DA  B "O5'" 1 
ATOM   541 C "C5'" . DA  B 2 13 ? 7.350  13.427 5.633  1.00 84.67 ? 28  DA  B "C5'" 1 
ATOM   542 C "C4'" . DA  B 2 13 ? 6.165  13.947 6.418  1.00 78.21 ? 28  DA  B "C4'" 1 
ATOM   543 O "O4'" . DA  B 2 13 ? 6.442  15.150 7.194  1.00 62.96 ? 28  DA  B "O4'" 1 
ATOM   544 C "C3'" . DA  B 2 13 ? 4.931  14.263 5.573  1.00 84.20 ? 28  DA  B "C3'" 1 
ATOM   545 O "O3'" . DA  B 2 13 ? 3.761  13.806 6.256  1.00 75.70 ? 28  DA  B "O3'" 1 
ATOM   546 C "C2'" . DA  B 2 13 ? 4.922  15.777 5.549  1.00 74.75 ? 28  DA  B "C2'" 1 
ATOM   547 C "C1'" . DA  B 2 13 ? 5.370  16.054 6.974  1.00 52.59 ? 28  DA  B "C1'" 1 
ATOM   548 N N9    . DA  B 2 13 ? 5.784  17.444 7.226  1.00 37.67 ? 28  DA  B N9    1 
ATOM   549 C C8    . DA  B 2 13 ? 6.107  18.384 6.278  1.00 39.43 ? 28  DA  B C8    1 
ATOM   550 N N7    . DA  B 2 13 ? 6.200  19.600 6.756  1.00 42.10 ? 28  DA  B N7    1 
ATOM   551 C C5    . DA  B 2 13 ? 5.985  19.444 8.113  1.00 33.97 ? 28  DA  B C5    1 
ATOM   552 C C6    . DA  B 2 13 ? 5.918  20.362 9.144  1.00 35.29 ? 28  DA  B C6    1 
ATOM   553 N N6    . DA  B 2 13 ? 6.006  21.672 8.955  1.00 53.17 ? 28  DA  B N6    1 
ATOM   554 N N1    . DA  B 2 13 ? 5.726  19.903 10.391 1.00 41.05 ? 28  DA  B N1    1 
ATOM   555 C C2    . DA  B 2 13 ? 5.568  18.596 10.557 1.00 53.74 ? 28  DA  B C2    1 
ATOM   556 N N3    . DA  B 2 13 ? 5.569  17.622 9.647  1.00 45.67 ? 28  DA  B N3    1 
ATOM   557 C C4    . DA  B 2 13 ? 5.787  18.121 8.428  1.00 36.87 ? 28  DA  B C4    1 
ATOM   558 P P     . DC  B 2 14 ? 2.334  13.858 5.519  1.00 63.95 ? 29  DC  B P     1 
ATOM   559 O OP1   . DC  B 2 14 ? 1.933  12.440 5.391  1.00 76.15 ? 29  DC  B OP1   1 
ATOM   560 O OP2   . DC  B 2 14 ? 2.385  14.704 4.292  1.00 58.68 ? 29  DC  B OP2   1 
ATOM   561 O "O5'" . DC  B 2 14 ? 1.438  14.548 6.642  1.00 75.86 ? 29  DC  B "O5'" 1 
ATOM   562 C "C5'" . DC  B 2 14 ? 1.458  14.031 7.974  1.00 71.41 ? 29  DC  B "C5'" 1 
ATOM   563 C "C4'" . DC  B 2 14 ? 0.690  14.932 8.917  1.00 74.75 ? 29  DC  B "C4'" 1 
ATOM   564 O "O4'" . DC  B 2 14 ? 1.412  16.172 9.074  1.00 56.01 ? 29  DC  B "O4'" 1 
ATOM   565 C "C3'" . DC  B 2 14 ? -0.715 15.336 8.465  1.00 78.13 ? 29  DC  B "C3'" 1 
ATOM   566 O "O3'" . DC  B 2 14 ? -1.533 15.719 9.614  1.00 81.99 ? 29  DC  B "O3'" 1 
ATOM   567 C "C2'" . DC  B 2 14 ? -0.430 16.618 7.707  1.00 57.45 ? 29  DC  B "C2'" 1 
ATOM   568 C "C1'" . DC  B 2 14 ? 0.604  17.234 8.633  1.00 46.03 ? 29  DC  B "C1'" 1 
ATOM   569 N N1    . DC  B 2 14 ? 1.464  18.242 8.031  1.00 33.10 ? 29  DC  B N1    1 
ATOM   570 C C2    . DC  B 2 14 ? 1.864  19.320 8.823  1.00 42.29 ? 29  DC  B C2    1 
ATOM   571 O O2    . DC  B 2 14 ? 1.524  19.346 10.031 1.00 52.15 ? 29  DC  B O2    1 
ATOM   572 N N3    . DC  B 2 14 ? 2.620  20.294 8.270  1.00 57.48 ? 29  DC  B N3    1 
ATOM   573 C C4    . DC  B 2 14 ? 2.996  20.202 6.984  1.00 59.48 ? 29  DC  B C4    1 
ATOM   574 N N4    . DC  B 2 14 ? 3.783  21.187 6.476  1.00 59.79 ? 29  DC  B N4    1 
ATOM   575 C C5    . DC  B 2 14 ? 2.604  19.098 6.162  1.00 47.91 ? 29  DC  B C5    1 
ATOM   576 C C6    . DC  B 2 14 ? 1.854  18.150 6.724  1.00 37.00 ? 29  DC  B C6    1 
ATOM   577 N N     . GLY C 3 1  ? 7.077  14.847 13.111 1.00 90.75 ? 139 GLY C N     1 
ATOM   578 C CA    . GLY C 3 1  ? 6.740  15.374 11.769 1.00 88.29 ? 139 GLY C CA    1 
ATOM   579 C C     . GLY C 3 1  ? 7.608  14.828 10.645 1.00 88.55 ? 139 GLY C C     1 
ATOM   580 O O     . GLY C 3 1  ? 7.106  14.083 9.781  1.00 87.90 ? 139 GLY C O     1 
ATOM   581 N N     . ARG C 3 2  ? 8.897  15.201 10.639 1.00 74.07 ? 140 ARG C N     1 
ATOM   582 C CA    . ARG C 3 2  ? 9.811  14.734 9.597  1.00 59.56 ? 140 ARG C CA    1 
ATOM   583 C C     . ARG C 3 2  ? 10.179 13.270 9.811  1.00 56.35 ? 140 ARG C C     1 
ATOM   584 O O     . ARG C 3 2  ? 10.499 12.835 10.923 1.00 65.00 ? 140 ARG C O     1 
ATOM   585 C CB    . ARG C 3 2  ? 11.084 15.585 9.541  1.00 54.35 ? 140 ARG C CB    1 
ATOM   586 C CG    . ARG C 3 2  ? 12.161 15.018 8.573  1.00 62.79 ? 140 ARG C CG    1 
ATOM   587 C CD    . ARG C 3 2  ? 13.378 15.945 8.325  1.00 46.08 ? 140 ARG C CD    1 
ATOM   588 N NE    . ARG C 3 2  ? 14.311 15.361 7.362  1.00 62.37 ? 140 ARG C NE    1 
ATOM   589 C CZ    . ARG C 3 2  ? 15.106 16.068 6.569  1.00 70.96 ? 140 ARG C CZ    1 
ATOM   590 N NH1   . ARG C 3 2  ? 15.067 17.387 6.615  1.00 63.24 ? 140 ARG C NH1   1 
ATOM   591 N NH2   . ARG C 3 2  ? 15.962 15.454 5.757  1.00 87.33 ? 140 ARG C NH2   1 
ATOM   592 N N     . PRO C 3 3  ? 10.126 12.488 8.731  1.00 43.16 ? 141 PRO C N     1 
ATOM   593 C CA    . PRO C 3 3  ? 10.445 11.066 8.767  1.00 42.74 ? 141 PRO C CA    1 
ATOM   594 C C     . PRO C 3 3  ? 11.916 10.769 9.101  1.00 57.83 ? 141 PRO C C     1 
ATOM   595 O O     . PRO C 3 3  ? 12.773 11.629 8.902  1.00 81.72 ? 141 PRO C O     1 
ATOM   596 C CB    . PRO C 3 3  ? 10.058 10.606 7.356  1.00 67.63 ? 141 PRO C CB    1 
ATOM   597 C CG    . PRO C 3 3  ? 10.300 11.815 6.498  1.00 43.80 ? 141 PRO C CG    1 
ATOM   598 C CD    . PRO C 3 3  ? 9.773  12.925 7.363  1.00 43.05 ? 141 PRO C CD    1 
ATOM   599 N N     . ARG C 3 4  ? 12.212 9.567  9.610  1.00 50.82 ? 142 ARG C N     1 
ATOM   600 C CA    . ARG C 3 4  ? 13.589 9.197  9.922  1.00 42.78 ? 142 ARG C CA    1 
ATOM   601 C C     . ARG C 3 4  ? 14.359 8.874  8.640  1.00 54.45 ? 142 ARG C C     1 
ATOM   602 O O     . ARG C 3 4  ? 13.760 8.520  7.607  1.00 68.21 ? 142 ARG C O     1 
ATOM   603 C CB    . ARG C 3 4  ? 13.611 8.047  10.903 1.00 29.99 ? 142 ARG C CB    1 
ATOM   604 C CG    . ARG C 3 4  ? 13.431 8.529  12.306 1.00 37.08 ? 142 ARG C CG    1 
ATOM   605 C CD    . ARG C 3 4  ? 13.460 7.363  13.239 1.00 34.50 ? 142 ARG C CD    1 
ATOM   606 N NE    . ARG C 3 4  ? 13.674 7.754  14.629 1.00 44.17 ? 142 ARG C NE    1 
ATOM   607 C CZ    . ARG C 3 4  ? 14.809 8.286  15.094 1.00 83.01 ? 142 ARG C CZ    1 
ATOM   608 N NH1   . ARG C 3 4  ? 15.856 8.505  14.289 1.00 94.18 ? 142 ARG C NH1   1 
ATOM   609 N NH2   . ARG C 3 4  ? 14.919 8.586  16.383 1.00 94.63 ? 142 ARG C NH2   1 
ATOM   610 N N     . ALA C 3 5  ? 15.681 9.043  8.686  1.00 64.18 ? 143 ALA C N     1 
ATOM   611 C CA    . ALA C 3 5  ? 16.511 8.814  7.499  1.00 69.78 ? 143 ALA C CA    1 
ATOM   612 C C     . ALA C 3 5  ? 16.562 7.338  7.102  1.00 64.51 ? 143 ALA C C     1 
ATOM   613 O O     . ALA C 3 5  ? 16.568 7.001  5.907  1.00 69.58 ? 143 ALA C O     1 
ATOM   614 C CB    . ALA C 3 5  ? 17.911 9.364  7.745  1.00 91.09 ? 143 ALA C CB    1 
ATOM   615 N N     . ILE C 3 6  ? 16.607 6.476  8.120  1.00 61.73 ? 144 ILE C N     1 
ATOM   616 C CA    . ILE C 3 6  ? 16.611 5.026  7.945  1.00 66.58 ? 144 ILE C CA    1 
ATOM   617 C C     . ILE C 3 6  ? 15.742 4.348  8.998  1.00 78.43 ? 144 ILE C C     1 
ATOM   618 O O     . ILE C 3 6  ? 15.864 4.616  10.206 1.00 81.31 ? 144 ILE C O     1 
ATOM   619 C CB    . ILE C 3 6  ? 17.994 4.415  8.079  1.00 64.41 ? 144 ILE C CB    1 
ATOM   620 C CG1   . ILE C 3 6  ? 18.561 4.696  9.480  1.00 49.64 ? 144 ILE C CG1   1 
ATOM   621 C CG2   . ILE C 3 6  ? 18.858 4.897  6.949  1.00 74.77 ? 144 ILE C CG2   1 
ATOM   622 C CD1   . ILE C 3 6  ? 18.814 6.138  9.750  1.00 73.15 ? 144 ILE C CD1   1 
ATOM   623 N N     . ASN C 3 7  ? 14.881 3.451  8.522  1.00 86.86 ? 145 ASN C N     1 
ATOM   624 C CA    . ASN C 3 7  ? 13.959 2.704  9.374  1.00 90.61 ? 145 ASN C CA    1 
ATOM   625 C C     . ASN C 3 7  ? 14.682 1.758  10.326 1.00 90.58 ? 145 ASN C C     1 
ATOM   626 O O     . ASN C 3 7  ? 15.671 2.145  10.955 1.00 96.62 ? 145 ASN C O     1 
ATOM   627 C CB    . ASN C 3 7  ? 12.981 1.920  8.501  1.00 76.05 ? 145 ASN C CB    1 
ATOM   628 C CG    . ASN C 3 7  ? 13.678 1.116  7.442  1.00 62.45 ? 145 ASN C CG    1 
ATOM   629 O OD1   . ASN C 3 7  ? 14.441 0.207  7.752  1.00 85.69 ? 145 ASN C OD1   1 
ATOM   630 N ND2   . ASN C 3 7  ? 13.428 1.447  6.176  1.00 73.33 ? 145 ASN C ND2   1 
ATOM   631 N N     . LYS C 3 8  ? 14.181 0.530  10.443 1.00 76.31 ? 146 LYS C N     1 
ATOM   632 C CA    . LYS C 3 8  ? 14.814 -0.452 11.316 1.00 83.90 ? 146 LYS C CA    1 
ATOM   633 C C     . LYS C 3 8  ? 15.544 -1.517 10.505 1.00 91.86 ? 146 LYS C C     1 
ATOM   634 O O     . LYS C 3 8  ? 16.694 -1.871 10.802 1.00 92.80 ? 146 LYS C O     1 
ATOM   635 C CB    . LYS C 3 8  ? 13.787 -1.137 12.184 1.00 83.86 ? 146 LYS C CB    1 
ATOM   636 C CG    . LYS C 3 8  ? 14.377 -1.654 13.466 1.00 93.28 ? 146 LYS C CG    1 
ATOM   637 C CD    . LYS C 3 8  ? 14.454 -0.533 14.488 1.00 98.54 ? 146 LYS C CD    1 
ATOM   638 N N     . HIS C 3 9  ? 14.840 -2.035 9.497  1.00 98.52 ? 147 HIS C N     1 
ATOM   639 C CA    . HIS C 3 9  ? 15.346 -3.056 8.558  1.00 98.57 ? 147 HIS C CA    1 
ATOM   640 C C     . HIS C 3 9  ? 16.803 -2.676 8.294  1.00 95.44 ? 147 HIS C C     1 
ATOM   641 O O     . HIS C 3 9  ? 17.743 -3.346 8.746  1.00 87.36 ? 147 HIS C O     1 
ATOM   642 C CB    . HIS C 3 9  ? 14.524 -2.981 7.237  1.00 98.60 ? 147 HIS C CB    1 
ATOM   643 N N     . GLU C 3 10 ? 16.954 -1.565 7.579  1.00 89.95 ? 148 GLU C N     1 
ATOM   644 C CA    . GLU C 3 10 ? 18.245 -1.013 7.223  1.00 85.74 ? 148 GLU C CA    1 
ATOM   645 C C     . GLU C 3 10 ? 18.977 -0.443 8.437  1.00 63.30 ? 148 GLU C C     1 
ATOM   646 O O     . GLU C 3 10 ? 20.179 -0.302 8.424  1.00 67.11 ? 148 GLU C O     1 
ATOM   647 C CB    . GLU C 3 10 ? 18.044 0.061  6.165  1.00 84.44 ? 148 GLU C CB    1 
ATOM   648 C CG    . GLU C 3 10 ? 17.146 1.192  6.615  1.00 88.80 ? 148 GLU C CG    1 
ATOM   649 C CD    . GLU C 3 10 ? 16.548 1.937  5.437  1.00 98.50 ? 148 GLU C CD    1 
ATOM   650 O OE1   . GLU C 3 10 ? 16.032 3.069  5.634  1.00 98.53 ? 148 GLU C OE1   1 
ATOM   651 O OE2   . GLU C 3 10 ? 16.592 1.377  4.312  1.00 98.49 ? 148 GLU C OE2   1 
ATOM   652 N N     . GLN C 3 11 ? 18.263 -0.113 9.492  1.00 54.49 ? 149 GLN C N     1 
ATOM   653 C CA    . GLN C 3 11 ? 18.945 0.402  10.658 1.00 55.35 ? 149 GLN C CA    1 
ATOM   654 C C     . GLN C 3 11 ? 19.845 -0.646 11.233 1.00 42.66 ? 149 GLN C C     1 
ATOM   655 O O     . GLN C 3 11 ? 20.906 -0.342 11.749 1.00 57.90 ? 149 GLN C O     1 
ATOM   656 C CB    . GLN C 3 11 ? 17.968 0.785  11.735 1.00 67.62 ? 149 GLN C CB    1 
ATOM   657 C CG    . GLN C 3 11 ? 18.583 0.810  13.109 1.00 68.63 ? 149 GLN C CG    1 
ATOM   658 C CD    . GLN C 3 11 ? 17.923 1.862  13.951 1.00 84.00 ? 149 GLN C CD    1 
ATOM   659 O OE1   . GLN C 3 11 ? 18.209 1.994  15.143 1.00 84.00 ? 149 GLN C OE1   1 
ATOM   660 N NE2   . GLN C 3 11 ? 17.025 2.637  13.327 1.00 77.96 ? 149 GLN C NE2   1 
ATOM   661 N N     . GLU C 3 12 ? 19.397 -1.886 11.190 1.00 54.88 ? 150 GLU C N     1 
ATOM   662 C CA    . GLU C 3 12 ? 20.203 -2.970 11.722 1.00 70.03 ? 150 GLU C CA    1 
ATOM   663 C C     . GLU C 3 12 ? 21.034 -3.545 10.583 1.00 64.58 ? 150 GLU C C     1 
ATOM   664 O O     . GLU C 3 12 ? 22.160 -3.968 10.786 1.00 65.10 ? 150 GLU C O     1 
ATOM   665 C CB    . GLU C 3 12 ? 19.315 -4.052 12.309 1.00 83.29 ? 150 GLU C CB    1 
ATOM   666 N N     . GLN C 3 13 ? 20.463 -3.574 9.387  1.00 53.32 ? 151 GLN C N     1 
ATOM   667 C CA    . GLN C 3 13 ? 21.187 -4.061 8.229  1.00 51.05 ? 151 GLN C CA    1 
ATOM   668 C C     . GLN C 3 13 ? 22.519 -3.330 8.260  1.00 66.04 ? 151 GLN C C     1 
ATOM   669 O O     . GLN C 3 13 ? 23.604 -3.935 8.251  1.00 60.94 ? 151 GLN C O     1 
ATOM   670 C CB    . GLN C 3 13 ? 20.441 -3.676 6.960  1.00 36.03 ? 151 GLN C CB    1 
ATOM   671 C CG    . GLN C 3 13 ? 21.181 -3.937 5.673  1.00 47.72 ? 151 GLN C CG    1 
ATOM   672 C CD    . GLN C 3 13 ? 20.347 -3.568 4.452  1.00 73.42 ? 151 GLN C CD    1 
ATOM   673 O OE1   . GLN C 3 13 ? 19.118 -3.444 4.537  1.00 77.94 ? 151 GLN C OE1   1 
ATOM   674 N NE2   . GLN C 3 13 ? 21.007 -3.403 3.307  1.00 70.39 ? 151 GLN C NE2   1 
ATOM   675 N N     . ILE C 3 14 ? 22.401 -2.008 8.302  1.00 72.82 ? 152 ILE C N     1 
ATOM   676 C CA    . ILE C 3 14 ? 23.532 -1.101 8.356  1.00 63.70 ? 152 ILE C CA    1 
ATOM   677 C C     . ILE C 3 14 ? 24.363 -1.426 9.558  1.00 53.98 ? 152 ILE C C     1 
ATOM   678 O O     . ILE C 3 14 ? 25.529 -1.726 9.426  1.00 59.87 ? 152 ILE C O     1 
ATOM   679 C CB    . ILE C 3 14 ? 23.049 0.343  8.439  1.00 68.20 ? 152 ILE C CB    1 
ATOM   680 C CG1   . ILE C 3 14 ? 22.715 0.826  7.032  1.00 75.60 ? 152 ILE C CG1   1 
ATOM   681 C CG2   . ILE C 3 14 ? 24.076 1.214  9.104  1.00 53.14 ? 152 ILE C CG2   1 
ATOM   682 C CD1   . ILE C 3 14 ? 21.897 2.074  7.025  1.00 69.66 ? 152 ILE C CD1   1 
ATOM   683 N N     . SER C 3 15 ? 23.766 -1.379 10.734 1.00 56.05 ? 153 SER C N     1 
ATOM   684 C CA    . SER C 3 15 ? 24.512 -1.695 11.931 1.00 60.04 ? 153 SER C CA    1 
ATOM   685 C C     . SER C 3 15 ? 25.352 -2.945 11.722 1.00 71.84 ? 153 SER C C     1 
ATOM   686 O O     . SER C 3 15 ? 26.567 -2.916 11.888 1.00 74.98 ? 153 SER C O     1 
ATOM   687 C CB    . SER C 3 15 ? 23.566 -1.926 13.088 1.00 72.50 ? 153 SER C CB    1 
ATOM   688 O OG    . SER C 3 15 ? 24.290 -2.427 14.191 1.00 92.00 ? 153 SER C OG    1 
ATOM   689 N N     . ARG C 3 16 ? 24.697 -4.042 11.356 1.00 80.22 ? 154 ARG C N     1 
ATOM   690 C CA    . ARG C 3 16 ? 25.370 -5.321 11.120 1.00 85.39 ? 154 ARG C CA    1 
ATOM   691 C C     . ARG C 3 16 ? 26.530 -5.149 10.134 1.00 82.87 ? 154 ARG C C     1 
ATOM   692 O O     . ARG C 3 16 ? 27.537 -5.843 10.210 1.00 90.88 ? 154 ARG C O     1 
ATOM   693 C CB    . ARG C 3 16 ? 24.365 -6.334 10.563 1.00 95.94 ? 154 ARG C CB    1 
ATOM   694 C CG    . ARG C 3 16 ? 24.888 -7.754 10.377 1.00 95.46 ? 154 ARG C CG    1 
ATOM   695 C CD    . ARG C 3 16 ? 23.992 -8.511 9.412  1.00 88.81 ? 154 ARG C CD    1 
ATOM   696 N NE    . ARG C 3 16 ? 22.591 -8.350 9.780  1.00 80.39 ? 154 ARG C NE    1 
ATOM   697 C CZ    . ARG C 3 16 ? 21.611 -8.163 8.900  1.00 84.06 ? 154 ARG C CZ    1 
ATOM   698 N NH1   . ARG C 3 16 ? 21.878 -8.120 7.588  1.00 52.29 ? 154 ARG C NH1   1 
ATOM   699 N NH2   . ARG C 3 16 ? 20.367 -7.989 9.336  1.00 79.66 ? 154 ARG C NH2   1 
ATOM   700 N N     . LEU C 3 17 ? 26.374 -4.224 9.201  1.00 74.49 ? 155 LEU C N     1 
ATOM   701 C CA    . LEU C 3 17 ? 27.400 -3.951 8.208  1.00 64.15 ? 155 LEU C CA    1 
ATOM   702 C C     . LEU C 3 17 ? 28.660 -3.288 8.766  1.00 66.01 ? 155 LEU C C     1 
ATOM   703 O O     . LEU C 3 17 ? 29.767 -3.660 8.400  1.00 69.98 ? 155 LEU C O     1 
ATOM   704 C CB    . LEU C 3 17 ? 26.822 -3.046 7.139  1.00 70.38 ? 155 LEU C CB    1 
ATOM   705 C CG    . LEU C 3 17 ? 26.054 -3.691 6.006  1.00 59.80 ? 155 LEU C CG    1 
ATOM   706 C CD1   . LEU C 3 17 ? 25.300 -2.654 5.185  1.00 67.77 ? 155 LEU C CD1   1 
ATOM   707 C CD2   . LEU C 3 17 ? 27.051 -4.395 5.147  1.00 69.90 ? 155 LEU C CD2   1 
ATOM   708 N N     . LEU C 3 18 ? 28.490 -2.280 9.620  1.00 71.98 ? 156 LEU C N     1 
ATOM   709 C CA    . LEU C 3 18 ? 29.624 -1.565 10.202 1.00 74.86 ? 156 LEU C CA    1 
ATOM   710 C C     . LEU C 3 18 ? 30.540 -2.500 10.954 1.00 75.37 ? 156 LEU C C     1 
ATOM   711 O O     . LEU C 3 18 ? 31.760 -2.284 10.963 1.00 75.93 ? 156 LEU C O     1 
ATOM   712 C CB    . LEU C 3 18 ? 29.161 -0.471 11.166 1.00 69.36 ? 156 LEU C CB    1 
ATOM   713 C CG    . LEU C 3 18 ? 28.391 0.677  10.536 1.00 60.98 ? 156 LEU C CG    1 
ATOM   714 C CD1   . LEU C 3 18 ? 28.085 1.734  11.574 1.00 60.29 ? 156 LEU C CD1   1 
ATOM   715 C CD2   . LEU C 3 18 ? 29.202 1.230  9.394  1.00 37.81 ? 156 LEU C CD2   1 
ATOM   716 N N     . GLU C 3 19 ? 29.944 -3.518 11.590 1.00 77.32 ? 157 GLU C N     1 
ATOM   717 C CA    . GLU C 3 19 ? 30.686 -4.523 12.367 1.00 84.52 ? 157 GLU C CA    1 
ATOM   718 C C     . GLU C 3 19 ? 31.604 -5.320 11.458 1.00 84.78 ? 157 GLU C C     1 
ATOM   719 O O     . GLU C 3 19 ? 32.674 -5.775 11.875 1.00 94.75 ? 157 GLU C O     1 
ATOM   720 C CB    . GLU C 3 19 ? 29.741 -5.479 13.105 1.00 91.62 ? 157 GLU C CB    1 
ATOM   721 N N     . LYS C 3 20 ? 31.187 -5.484 10.210 1.00 74.14 ? 158 LYS C N     1 
ATOM   722 C CA    . LYS C 3 20 ? 32.011 -6.189 9.244  1.00 72.42 ? 158 LYS C CA    1 
ATOM   723 C C     . LYS C 3 20 ? 33.048 -5.242 8.631  1.00 72.24 ? 158 LYS C C     1 
ATOM   724 O O     . LYS C 3 20 ? 33.654 -5.552 7.607  1.00 75.40 ? 158 LYS C O     1 
ATOM   725 C CB    . LYS C 3 20 ? 31.148 -6.792 8.137  1.00 73.04 ? 158 LYS C CB    1 
ATOM   726 N N     . GLY C 3 21 ? 33.238 -4.087 9.257  1.00 67.51 ? 159 GLY C N     1 
ATOM   727 C CA    . GLY C 3 21 ? 34.197 -3.135 8.754  1.00 61.64 ? 159 GLY C CA    1 
ATOM   728 C C     . GLY C 3 21 ? 33.833 -2.426 7.463  1.00 67.37 ? 159 GLY C C     1 
ATOM   729 O O     . GLY C 3 21 ? 34.461 -2.616 6.409  1.00 72.32 ? 159 GLY C O     1 
ATOM   730 N N     . HIS C 3 22 ? 32.806 -1.599 7.520  1.00 77.84 ? 160 HIS C N     1 
ATOM   731 C CA    . HIS C 3 22 ? 32.453 -0.847 6.335  1.00 84.32 ? 160 HIS C CA    1 
ATOM   732 C C     . HIS C 3 22 ? 32.632 0.598  6.670  1.00 89.82 ? 160 HIS C C     1 
ATOM   733 O O     . HIS C 3 22 ? 32.419 1.006  7.813  1.00 97.77 ? 160 HIS C O     1 
ATOM   734 C CB    . HIS C 3 22 ? 31.028 -1.099 5.911  1.00 85.25 ? 160 HIS C CB    1 
ATOM   735 C CG    . HIS C 3 22 ? 30.856 -2.381 5.169  1.00 86.29 ? 160 HIS C CG    1 
ATOM   736 N ND1   . HIS C 3 22 ? 30.801 -3.604 5.800  1.00 78.16 ? 160 HIS C ND1   1 
ATOM   737 C CD2   . HIS C 3 22 ? 30.752 -2.628 3.841  1.00 83.61 ? 160 HIS C CD2   1 
ATOM   738 C CE1   . HIS C 3 22 ? 30.669 -4.555 4.890  1.00 94.63 ? 160 HIS C CE1   1 
ATOM   739 N NE2   . HIS C 3 22 ? 30.637 -3.989 3.696  1.00 86.34 ? 160 HIS C NE2   1 
ATOM   740 N N     . PRO C 3 23 ? 33.040 1.400  5.678  1.00 85.89 ? 161 PRO C N     1 
ATOM   741 C CA    . PRO C 3 23 ? 33.255 2.831  5.885  1.00 80.38 ? 161 PRO C CA    1 
ATOM   742 C C     . PRO C 3 23 ? 31.986 3.678  5.880  1.00 74.29 ? 161 PRO C C     1 
ATOM   743 O O     . PRO C 3 23 ? 31.253 3.723  4.877  1.00 61.87 ? 161 PRO C O     1 
ATOM   744 C CB    . PRO C 3 23 ? 34.177 3.202  4.729  1.00 85.61 ? 161 PRO C CB    1 
ATOM   745 C CG    . PRO C 3 23 ? 33.634 2.366  3.623  1.00 71.16 ? 161 PRO C CG    1 
ATOM   746 C CD    . PRO C 3 23 ? 33.419 1.011  4.304  1.00 78.27 ? 161 PRO C CD    1 
ATOM   747 N N     . ARG C 3 24 ? 31.735 4.369  6.986  1.00 61.85 ? 162 ARG C N     1 
ATOM   748 C CA    . ARG C 3 24 ? 30.570 5.216  7.032  1.00 57.27 ? 162 ARG C CA    1 
ATOM   749 C C     . ARG C 3 24 ? 30.524 6.110  5.805  1.00 53.65 ? 162 ARG C C     1 
ATOM   750 O O     . ARG C 3 24 ? 29.488 6.251  5.191  1.00 65.58 ? 162 ARG C O     1 
ATOM   751 C CB    . ARG C 3 24 ? 30.591 6.041  8.281  1.00 49.79 ? 162 ARG C CB    1 
ATOM   752 C CG    . ARG C 3 24 ? 30.557 5.211  9.537  1.00 39.98 ? 162 ARG C CG    1 
ATOM   753 C CD    . ARG C 3 24 ? 30.255 6.160  10.643 1.00 51.42 ? 162 ARG C CD    1 
ATOM   754 N NE    . ARG C 3 24 ? 30.027 5.537  11.925 1.00 49.32 ? 162 ARG C NE    1 
ATOM   755 C CZ    . ARG C 3 24 ? 30.872 4.705  12.496 1.00 57.69 ? 162 ARG C CZ    1 
ATOM   756 N NH1   . ARG C 3 24 ? 30.580 4.193  13.688 1.00 73.18 ? 162 ARG C NH1   1 
ATOM   757 N NH2   . ARG C 3 24 ? 31.995 4.372  11.862 1.00 69.70 ? 162 ARG C NH2   1 
ATOM   758 N N     . GLN C 3 25 ? 31.647 6.704  5.433  1.00 62.89 ? 163 GLN C N     1 
ATOM   759 C CA    . GLN C 3 25 ? 31.692 7.550  4.246  1.00 71.18 ? 163 GLN C CA    1 
ATOM   760 C C     . GLN C 3 25 ? 30.942 6.971  3.067  1.00 68.75 ? 163 GLN C C     1 
ATOM   761 O O     . GLN C 3 25 ? 30.299 7.700  2.327  1.00 69.14 ? 163 GLN C O     1 
ATOM   762 C CB    . GLN C 3 25 ? 33.131 7.761  3.790  1.00 84.86 ? 163 GLN C CB    1 
ATOM   763 C CG    . GLN C 3 25 ? 33.761 8.985  4.344  1.00 88.47 ? 163 GLN C CG    1 
ATOM   764 C CD    . GLN C 3 25 ? 32.914 10.195 4.076  1.00 88.51 ? 163 GLN C CD    1 
ATOM   765 O OE1   . GLN C 3 25 ? 32.474 10.426 2.937  1.00 88.52 ? 163 GLN C OE1   1 
ATOM   766 N NE2   . GLN C 3 25 ? 32.674 10.987 5.121  1.00 88.52 ? 163 GLN C NE2   1 
ATOM   767 N N     . GLN C 3 26 ? 31.062 5.660  2.882  1.00 77.97 ? 164 GLN C N     1 
ATOM   768 C CA    . GLN C 3 26 ? 30.440 4.967  1.759  1.00 83.64 ? 164 GLN C CA    1 
ATOM   769 C C     . GLN C 3 26 ? 28.996 4.611  2.036  1.00 80.09 ? 164 GLN C C     1 
ATOM   770 O O     . GLN C 3 26 ? 28.104 4.874  1.224  1.00 71.22 ? 164 GLN C O     1 
ATOM   771 C CB    . GLN C 3 26 ? 31.249 3.703  1.415  1.00 95.52 ? 164 GLN C CB    1 
ATOM   772 C CG    . GLN C 3 26 ? 32.603 3.986  0.701  1.00 93.48 ? 164 GLN C CG    1 
ATOM   773 C CD    . GLN C 3 26 ? 33.468 2.736  0.453  1.00 93.46 ? 164 GLN C CD    1 
ATOM   774 O OE1   . GLN C 3 26 ? 33.084 1.798  -0.259 1.00 93.48 ? 164 GLN C OE1   1 
ATOM   775 N NE2   . GLN C 3 26 ? 34.648 2.736  1.039  1.00 93.49 ? 164 GLN C NE2   1 
ATOM   776 N N     . LEU C 3 27 ? 28.766 4.013  3.193  1.00 76.35 ? 165 LEU C N     1 
ATOM   777 C CA    . LEU C 3 27 ? 27.419 3.631  3.588  1.00 71.51 ? 165 LEU C CA    1 
ATOM   778 C C     . LEU C 3 27 ? 26.470 4.809  3.415  1.00 75.25 ? 165 LEU C C     1 
ATOM   779 O O     . LEU C 3 27 ? 25.373 4.665  2.871  1.00 88.58 ? 165 LEU C O     1 
ATOM   780 C CB    . LEU C 3 27 ? 27.417 3.162  5.051  1.00 50.07 ? 165 LEU C CB    1 
ATOM   781 C CG    . LEU C 3 27 ? 27.259 1.645  5.282  1.00 53.81 ? 165 LEU C CG    1 
ATOM   782 C CD1   . LEU C 3 27 ? 28.183 0.886  4.360  1.00 52.39 ? 165 LEU C CD1   1 
ATOM   783 C CD2   . LEU C 3 27 ? 27.533 1.275  6.733  1.00 49.39 ? 165 LEU C CD2   1 
ATOM   784 N N     . ALA C 3 28 ? 26.910 5.977  3.867  1.00 77.80 ? 166 ALA C N     1 
ATOM   785 C CA    . ALA C 3 28 ? 26.112 7.188  3.798  1.00 73.34 ? 166 ALA C CA    1 
ATOM   786 C C     . ALA C 3 28 ? 25.664 7.530  2.391  1.00 80.11 ? 166 ALA C C     1 
ATOM   787 O O     . ALA C 3 28 ? 24.516 7.905  2.165  1.00 92.11 ? 166 ALA C O     1 
ATOM   788 C CB    . ALA C 3 28 ? 26.892 8.340  4.386  1.00 76.15 ? 166 ALA C CB    1 
ATOM   789 N N     . ILE C 3 29 ? 26.571 7.393  1.442  1.00 71.09 ? 167 ILE C N     1 
ATOM   790 C CA    . ILE C 3 29 ? 26.265 7.714  0.059  1.00 79.18 ? 167 ILE C CA    1 
ATOM   791 C C     . ILE C 3 29 ? 25.299 6.717  -0.620 1.00 77.82 ? 167 ILE C C     1 
ATOM   792 O O     . ILE C 3 29 ? 24.456 7.094  -1.418 1.00 67.86 ? 167 ILE C O     1 
ATOM   793 C CB    . ILE C 3 29 ? 27.566 7.753  -0.755 1.00 90.42 ? 167 ILE C CB    1 
ATOM   794 C CG1   . ILE C 3 29 ? 28.699 8.363  0.092  1.00 94.20 ? 167 ILE C CG1   1 
ATOM   795 C CG2   . ILE C 3 29 ? 27.338 8.537  -2.045 1.00 88.51 ? 167 ILE C CG2   1 
ATOM   796 C CD1   . ILE C 3 29 ? 30.135 8.025  -0.384 1.00 91.36 ? 167 ILE C CD1   1 
ATOM   797 N N     . ILE C 3 30 ? 25.430 5.439  -0.300 1.00 85.97 ? 168 ILE C N     1 
ATOM   798 C CA    . ILE C 3 30 ? 24.609 4.404  -0.915 1.00 81.38 ? 168 ILE C CA    1 
ATOM   799 C C     . ILE C 3 30 ? 23.181 4.615  -0.490 1.00 76.70 ? 168 ILE C C     1 
ATOM   800 O O     . ILE C 3 30 ? 22.223 4.715  -1.328 1.00 86.62 ? 168 ILE C O     1 
ATOM   801 C CB    . ILE C 3 30 ? 25.030 3.018  -0.406 1.00 92.11 ? 168 ILE C CB    1 
ATOM   802 C CG1   . ILE C 3 30 ? 26.560 2.937  -0.365 1.00 88.49 ? 168 ILE C CG1   1 
ATOM   803 C CG2   . ILE C 3 30 ? 24.468 1.931  -1.297 1.00 89.00 ? 168 ILE C CG2   1 
ATOM   804 C CD1   . ILE C 3 30 ? 27.144 1.785  0.449  1.00 93.47 ? 168 ILE C CD1   1 
ATOM   805 N N     . PHE C 3 31 ? 23.061 4.636  0.833  1.00 69.19 ? 169 PHE C N     1 
ATOM   806 C CA    . PHE C 3 31 ? 21.818 4.790  1.528  1.00 82.39 ? 169 PHE C CA    1 
ATOM   807 C C     . PHE C 3 31 ? 21.280 6.214  1.441  1.00 78.53 ? 169 PHE C C     1 
ATOM   808 O O     . PHE C 3 31 ? 20.201 6.497  1.981  1.00 78.56 ? 169 PHE C O     1 
ATOM   809 C CB    . PHE C 3 31 ? 22.018 4.414  2.971  1.00 78.39 ? 169 PHE C CB    1 
ATOM   810 C CG    . PHE C 3 31 ? 22.048 2.927  3.219  1.00 78.45 ? 169 PHE C CG    1 
ATOM   811 C CD1   . PHE C 3 31 ? 23.051 2.066  2.755  1.00 78.40 ? 169 PHE C CD1   1 
ATOM   812 C CD2   . PHE C 3 31 ? 21.058 2.395  4.001  1.00 78.55 ? 169 PHE C CD2   1 
ATOM   813 C CE1   . PHE C 3 31 ? 23.033 0.699  3.131  1.00 78.39 ? 169 PHE C CE1   1 
ATOM   814 C CE2   . PHE C 3 31 ? 21.037 1.100  4.354  1.00 78.53 ? 169 PHE C CE2   1 
ATOM   815 C CZ    . PHE C 3 31 ? 22.014 0.240  3.936  1.00 78.45 ? 169 PHE C CZ    1 
ATOM   816 N N     . GLY C 3 32 ? 21.982 7.065  0.680  1.00 78.51 ? 170 GLY C N     1 
ATOM   817 C CA    . GLY C 3 32 ? 21.592 8.453  0.442  1.00 82.65 ? 170 GLY C CA    1 
ATOM   818 C C     . GLY C 3 32 ? 21.388 9.306  1.679  1.00 74.49 ? 170 GLY C C     1 
ATOM   819 O O     . GLY C 3 32 ? 20.500 10.157 1.708  1.00 80.43 ? 170 GLY C O     1 
ATOM   820 N N     . ILE C 3 33 ? 22.197 9.098  2.711  1.00 65.19 ? 171 ILE C N     1 
ATOM   821 C CA    . ILE C 3 33 ? 22.052 9.883  3.918  1.00 56.66 ? 171 ILE C CA    1 
ATOM   822 C C     . ILE C 3 33 ? 23.342 10.555 4.395  1.00 52.38 ? 171 ILE C C     1 
ATOM   823 O O     . ILE C 3 33 ? 24.430 10.150 4.051  1.00 53.54 ? 171 ILE C O     1 
ATOM   824 C CB    . ILE C 3 33 ? 21.449 9.033  5.012  1.00 41.25 ? 171 ILE C CB    1 
ATOM   825 C CG1   . ILE C 3 33 ? 22.432 8.002  5.514  1.00 45.01 ? 171 ILE C CG1   1 
ATOM   826 C CG2   . ILE C 3 33 ? 20.280 8.329  4.442  1.00 65.93 ? 171 ILE C CG2   1 
ATOM   827 C CD1   . ILE C 3 33 ? 21.988 7.386  6.800  1.00 29.46 ? 171 ILE C CD1   1 
ATOM   828 N N     . GLY C 3 34 ? 23.190 11.612 5.171  1.00 54.78 ? 172 GLY C N     1 
ATOM   829 C CA    . GLY C 3 34 ? 24.333 12.345 5.649  1.00 57.49 ? 172 GLY C CA    1 
ATOM   830 C C     . GLY C 3 34 ? 25.181 11.576 6.617  1.00 51.41 ? 172 GLY C C     1 
ATOM   831 O O     . GLY C 3 34 ? 24.680 10.794 7.449  1.00 39.13 ? 172 GLY C O     1 
ATOM   832 N N     . VAL C 3 35 ? 26.479 11.840 6.550  1.00 40.77 ? 173 VAL C N     1 
ATOM   833 C CA    . VAL C 3 35 ? 27.367 11.108 7.409  1.00 41.79 ? 173 VAL C CA    1 
ATOM   834 C C     . VAL C 3 35 ? 27.103 11.405 8.857  1.00 49.64 ? 173 VAL C C     1 
ATOM   835 O O     . VAL C 3 35 ? 27.224 10.507 9.692  1.00 57.35 ? 173 VAL C O     1 
ATOM   836 C CB    . VAL C 3 35 ? 28.833 11.381 7.084  1.00 33.94 ? 173 VAL C CB    1 
ATOM   837 C CG1   . VAL C 3 35 ? 29.684 10.667 8.086  1.00 42.85 ? 173 VAL C CG1   1 
ATOM   838 C CG2   . VAL C 3 35 ? 29.154 10.895 5.688  1.00 32.04 ? 173 VAL C CG2   1 
ATOM   839 N N     . SER C 3 36 ? 26.709 12.639 9.156  1.00 36.48 ? 174 SER C N     1 
ATOM   840 C CA    . SER C 3 36 ? 26.476 13.037 10.553 1.00 31.84 ? 174 SER C CA    1 
ATOM   841 C C     . SER C 3 36 ? 25.379 12.197 11.136 1.00 35.56 ? 174 SER C C     1 
ATOM   842 O O     . SER C 3 36 ? 25.353 11.874 12.334 1.00 37.09 ? 174 SER C O     1 
ATOM   843 C CB    . SER C 3 36 ? 26.082 14.512 10.611 1.00 31.05 ? 174 SER C CB    1 
ATOM   844 O OG    . SER C 3 36 ? 26.134 15.032 9.274  1.00 38.33 ? 174 SER C OG    1 
ATOM   845 N N     . THR C 3 37 ? 24.481 11.814 10.242 1.00 38.93 ? 175 THR C N     1 
ATOM   846 C CA    . THR C 3 37 ? 23.300 11.066 10.613 1.00 36.21 ? 175 THR C CA    1 
ATOM   847 C C     . THR C 3 37 ? 23.768 9.729  11.130 1.00 43.98 ? 175 THR C C     1 
ATOM   848 O O     . THR C 3 37 ? 23.362 9.278  12.199 1.00 50.02 ? 175 THR C O     1 
ATOM   849 C CB    . THR C 3 37 ? 22.388 10.926 9.379  1.00 45.33 ? 175 THR C CB    1 
ATOM   850 O OG1   . THR C 3 37 ? 22.001 12.234 8.916  1.00 36.10 ? 175 THR C OG1   1 
ATOM   851 C CG2   . THR C 3 37 ? 21.170 10.122 9.717  1.00 47.40 ? 175 THR C CG2   1 
ATOM   852 N N     . LEU C 3 38 ? 24.681 9.129  10.381 1.00 50.73 ? 176 LEU C N     1 
ATOM   853 C CA    . LEU C 3 38 ? 25.221 7.827  10.731 1.00 37.35 ? 176 LEU C CA    1 
ATOM   854 C C     . LEU C 3 38 ? 25.991 7.788  12.010 1.00 39.99 ? 176 LEU C C     1 
ATOM   855 O O     . LEU C 3 38 ? 25.871 6.856  12.790 1.00 64.04 ? 176 LEU C O     1 
ATOM   856 C CB    . LEU C 3 38 ? 26.111 7.350  9.625  1.00 38.83 ? 176 LEU C CB    1 
ATOM   857 C CG    . LEU C 3 38 ? 25.273 7.065  8.389  1.00 60.81 ? 176 LEU C CG    1 
ATOM   858 C CD1   . LEU C 3 38 ? 26.142 6.611  7.223  1.00 68.97 ? 176 LEU C CD1   1 
ATOM   859 C CD2   . LEU C 3 38 ? 24.277 6.004  8.749  1.00 51.47 ? 176 LEU C CD2   1 
ATOM   860 N N     . TYR C 3 39 ? 26.802 8.792  12.236 1.00 38.93 ? 177 TYR C N     1 
ATOM   861 C CA    . TYR C 3 39 ? 27.574 8.792  13.459 1.00 44.87 ? 177 TYR C CA    1 
ATOM   862 C C     . TYR C 3 39 ? 26.638 8.974  14.624 1.00 48.82 ? 177 TYR C C     1 
ATOM   863 O O     . TYR C 3 39 ? 27.019 8.776  15.792 1.00 48.86 ? 177 TYR C O     1 
ATOM   864 C CB    . TYR C 3 39 ? 28.624 9.916  13.426 1.00 40.67 ? 177 TYR C CB    1 
ATOM   865 C CG    . TYR C 3 39 ? 29.910 9.537  12.723 1.00 50.28 ? 177 TYR C CG    1 
ATOM   866 C CD1   . TYR C 3 39 ? 30.828 8.677  13.330 1.00 54.99 ? 177 TYR C CD1   1 
ATOM   867 C CD2   . TYR C 3 39 ? 30.198 10.012 11.444 1.00 52.45 ? 177 TYR C CD2   1 
ATOM   868 C CE1   . TYR C 3 39 ? 32.013 8.297  12.677 1.00 74.44 ? 177 TYR C CE1   1 
ATOM   869 C CE2   . TYR C 3 39 ? 31.382 9.638  10.778 1.00 60.38 ? 177 TYR C CE2   1 
ATOM   870 C CZ    . TYR C 3 39 ? 32.297 8.777  11.399 1.00 69.93 ? 177 TYR C CZ    1 
ATOM   871 O OH    . TYR C 3 39 ? 33.489 8.403  10.757 1.00 38.87 ? 177 TYR C OH    1 
ATOM   872 N N     . ARG C 3 40 ? 25.406 9.367  14.298 1.00 54.64 ? 178 ARG C N     1 
ATOM   873 C CA    . ARG C 3 40 ? 24.390 9.596  15.325 1.00 54.50 ? 178 ARG C CA    1 
ATOM   874 C C     . ARG C 3 40 ? 23.662 8.314  15.719 1.00 49.63 ? 178 ARG C C     1 
ATOM   875 O O     . ARG C 3 40 ? 23.480 8.051  16.902 1.00 54.56 ? 178 ARG C O     1 
ATOM   876 C CB    . ARG C 3 40 ? 23.377 10.632 14.853 1.00 60.74 ? 178 ARG C CB    1 
ATOM   877 C CG    . ARG C 3 40 ? 22.491 11.174 15.985 1.00 58.99 ? 178 ARG C CG    1 
ATOM   878 C CD    . ARG C 3 40 ? 21.312 11.943 15.403 1.00 49.32 ? 178 ARG C CD    1 
ATOM   879 N NE    . ARG C 3 40 ? 21.789 12.954 14.475 1.00 57.71 ? 178 ARG C NE    1 
ATOM   880 C CZ    . ARG C 3 40 ? 21.220 13.242 13.311 1.00 74.94 ? 178 ARG C CZ    1 
ATOM   881 N NH1   . ARG C 3 40 ? 21.757 14.188 12.546 1.00 61.12 ? 178 ARG C NH1   1 
ATOM   882 N NH2   . ARG C 3 40 ? 20.124 12.598 12.918 1.00 67.49 ? 178 ARG C NH2   1 
ATOM   883 N N     . TYR C 3 41 ? 23.239 7.528  14.728 1.00 41.58 ? 179 TYR C N     1 
ATOM   884 C CA    . TYR C 3 41 ? 22.559 6.255  14.996 1.00 52.76 ? 179 TYR C CA    1 
ATOM   885 C C     . TYR C 3 41 ? 23.579 5.258  15.548 1.00 56.62 ? 179 TYR C C     1 
ATOM   886 O O     . TYR C 3 41 ? 23.291 4.483  16.454 1.00 65.40 ? 179 TYR C O     1 
ATOM   887 C CB    . TYR C 3 41 ? 21.941 5.675  13.711 1.00 67.83 ? 179 TYR C CB    1 
ATOM   888 C CG    . TYR C 3 41 ? 20.573 6.212  13.334 1.00 77.25 ? 179 TYR C CG    1 
ATOM   889 C CD1   . TYR C 3 41 ? 20.329 7.578  13.264 1.00 78.52 ? 179 TYR C CD1   1 
ATOM   890 C CD2   . TYR C 3 41 ? 19.545 5.347  12.973 1.00 85.56 ? 179 TYR C CD2   1 
ATOM   891 C CE1   . TYR C 3 41 ? 19.108 8.069  12.832 1.00 71.98 ? 179 TYR C CE1   1 
ATOM   892 C CE2   . TYR C 3 41 ? 18.319 5.828  12.539 1.00 79.62 ? 179 TYR C CE2   1 
ATOM   893 C CZ    . TYR C 3 41 ? 18.114 7.191  12.456 1.00 74.66 ? 179 TYR C CZ    1 
ATOM   894 O OH    . TYR C 3 41 ? 16.980 7.666  11.850 1.00 56.12 ? 179 TYR C OH    1 
ATOM   895 N N     . PHE C 3 42 ? 24.782 5.291  14.989 1.00 63.22 ? 180 PHE C N     1 
ATOM   896 C CA    . PHE C 3 42 ? 25.842 4.397  15.420 1.00 58.27 ? 180 PHE C CA    1 
ATOM   897 C C     . PHE C 3 42 ? 27.138 5.173  15.713 1.00 58.58 ? 180 PHE C C     1 
ATOM   898 O O     . PHE C 3 42 ? 27.893 5.488  14.810 1.00 54.58 ? 180 PHE C O     1 
ATOM   899 C CB    . PHE C 3 42 ? 26.091 3.360  14.327 1.00 54.95 ? 180 PHE C CB    1 
ATOM   900 C CG    . PHE C 3 42 ? 24.847 2.899  13.633 1.00 55.33 ? 180 PHE C CG    1 
ATOM   901 C CD1   . PHE C 3 42 ? 24.522 3.376  12.377 1.00 60.17 ? 180 PHE C CD1   1 
ATOM   902 C CD2   . PHE C 3 42 ? 24.005 1.974  14.235 1.00 66.98 ? 180 PHE C CD2   1 
ATOM   903 C CE1   . PHE C 3 42 ? 23.366 2.928  11.723 1.00 70.38 ? 180 PHE C CE1   1 
ATOM   904 C CE2   . PHE C 3 42 ? 22.841 1.520  13.589 1.00 53.84 ? 180 PHE C CE2   1 
ATOM   905 C CZ    . PHE C 3 42 ? 22.524 1.997  12.331 1.00 63.50 ? 180 PHE C CZ    1 
ATOM   906 N N     . PRO C 3 43 ? 27.391 5.509  16.982 1.00 50.41 ? 181 PRO C N     1 
ATOM   907 C CA    . PRO C 3 43 ? 28.606 6.245  17.364 1.00 60.84 ? 181 PRO C CA    1 
ATOM   908 C C     . PRO C 3 43 ? 29.864 5.378  17.196 1.00 67.87 ? 181 PRO C C     1 
ATOM   909 O O     . PRO C 3 43 ? 29.756 4.159  17.156 1.00 67.74 ? 181 PRO C O     1 
ATOM   910 C CB    . PRO C 3 43 ? 28.352 6.578  18.835 1.00 63.74 ? 181 PRO C CB    1 
ATOM   911 C CG    . PRO C 3 43 ? 26.855 6.676  18.897 1.00 56.76 ? 181 PRO C CG    1 
ATOM   912 C CD    . PRO C 3 43 ? 26.424 5.487  18.090 1.00 50.73 ? 181 PRO C CD    1 
ATOM   913 N N     . ALA C 3 44 ? 31.047 5.993  17.091 1.00 70.87 ? 182 ALA C N     1 
ATOM   914 C CA    . ALA C 3 44 ? 32.297 5.226  16.969 1.00 77.26 ? 182 ALA C CA    1 
ATOM   915 C C     . ALA C 3 44 ? 32.533 4.608  18.316 1.00 79.06 ? 182 ALA C C     1 
ATOM   916 O O     . ALA C 3 44 ? 33.596 4.070  18.595 1.00 79.56 ? 182 ALA C O     1 
ATOM   917 C CB    . ALA C 3 44 ? 33.474 6.109  16.606 1.00 60.91 ? 182 ALA C CB    1 
ATOM   918 N N     . SER C 3 45 ? 31.550 4.732  19.187 1.00 83.06 ? 183 SER C N     1 
ATOM   919 C CA    . SER C 3 45 ? 31.653 4.122  20.488 1.00 86.97 ? 183 SER C CA    1 
ATOM   920 C C     . SER C 3 45 ? 30.669 2.909  20.472 1.00 89.49 ? 183 SER C C     1 
ATOM   921 O O     . SER C 3 45 ? 30.039 2.560  21.481 1.00 89.73 ? 183 SER C O     1 
ATOM   922 C CB    . SER C 3 45 ? 31.340 5.182  21.549 1.00 88.25 ? 183 SER C CB    1 
ATOM   923 O OG    . SER C 3 45 ? 32.266 6.259  21.384 1.00 82.70 ? 183 SER C OG    1 
ATOM   924 N N     . SER C 3 46 ? 30.565 2.265  19.298 1.00 90.06 ? 184 SER C N     1 
ATOM   925 C CA    . SER C 3 46 ? 29.681 1.102  19.059 1.00 88.44 ? 184 SER C CA    1 
ATOM   926 C C     . SER C 3 46 ? 30.436 -0.097 18.447 1.00 84.55 ? 184 SER C C     1 
ATOM   927 O O     . SER C 3 46 ? 30.175 -0.512 17.300 1.00 80.78 ? 184 SER C O     1 
ATOM   928 C CB    . SER C 3 46 ? 28.527 1.495  18.102 1.00 93.00 ? 184 SER C CB    1 
ATOM   929 O OG    . SER C 3 46 ? 27.847 2.668  18.531 1.00 96.70 ? 184 SER C OG    1 
HETATM 930 C C     . TRS D 4 .  ? 20.879 22.580 5.342  1.00 74.85 ? 204 TRS A C     1 
HETATM 931 C C1    . TRS D 4 .  ? 21.144 22.410 3.807  1.00 81.37 ? 204 TRS A C1    1 
HETATM 932 C C2    . TRS D 4 .  ? 21.688 21.637 6.018  1.00 80.15 ? 204 TRS A C2    1 
HETATM 933 C C3    . TRS D 4 .  ? 19.351 22.463 5.555  1.00 97.24 ? 204 TRS A C3    1 
HETATM 934 N N     . TRS D 4 .  ? 21.309 23.930 5.748  1.00 84.27 ? 204 TRS A N     1 
HETATM 935 O O1    . TRS D 4 .  ? 20.407 21.452 3.176  1.00 84.83 ? 204 TRS A O1    1 
HETATM 936 O O2    . TRS D 4 .  ? 21.188 20.837 7.051  1.00 70.17 ? 204 TRS A O2    1 
HETATM 937 O O3    . TRS D 4 .  ? 18.874 22.603 6.876  1.00 78.63 ? 204 TRS A O3    1 
HETATM 938 O O     . HOH E 5 .  ? 30.690 23.170 18.150 1.00 44.51 ? 202 HOH B O     1 
HETATM 939 O O     . HOH F 5 .  ? 17.521 10.978 1.124  1.00 53.81 ? 203 HOH C O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  DT  1  2   2   DT  T   A . n 
A 1 2  DG  2  3   3   DG  G   A . n 
A 1 3  DT  3  4   4   DT  T   A . n 
A 1 4  DT  4  5   5   DT  T   A . n 
A 1 5  DT  5  6   6   DT  T   A . n 
A 1 6  DT  6  7   7   DT  T   A . n 
A 1 7  DT  7  8   8   DT  T   A . n 
A 1 8  DG  8  9   9   DG  G   A . n 
A 1 9  DA  9  10  10  DA  A   A . n 
A 1 10 DC  10 11  11  DC  C   A . n 
A 1 11 DA  11 12  12  DA  A   A . n 
A 1 12 DA  12 13  13  DA  A   A . n 
A 1 13 DG  13 14  14  DG  G   A . n 
A 1 14 DA  14 15  15  DA  A   A . n 
B 2 1  DA  1  16  16  DA  A   B . n 
B 2 2  DT  2  17  17  DT  T   B . n 
B 2 3  DC  3  18  18  DC  C   B . n 
B 2 4  DT  4  19  19  DT  T   B . n 
B 2 5  DT  5  20  20  DT  T   B . n 
B 2 6  DG  6  21  21  DG  G   B . n 
B 2 7  DT  7  22  22  DT  T   B . n 
B 2 8  DC  8  23  23  DC  C   B . n 
B 2 9  DA  9  24  24  DA  A   B . n 
B 2 10 DA  10 25  25  DA  A   B . n 
B 2 11 DA  11 26  26  DA  A   B . n 
B 2 12 DA  12 27  27  DA  A   B . n 
B 2 13 DA  13 28  28  DA  A   B . n 
B 2 14 DC  14 29  29  DC  C   B . n 
C 3 1  GLY 1  139 139 GLY GLY C . n 
C 3 2  ARG 2  140 140 ARG ARG C . n 
C 3 3  PRO 3  141 141 PRO PRO C . n 
C 3 4  ARG 4  142 142 ARG ARG C . n 
C 3 5  ALA 5  143 143 ALA ALA C . n 
C 3 6  ILE 6  144 144 ILE ILE C . n 
C 3 7  ASN 7  145 145 ASN ASN C . n 
C 3 8  LYS 8  146 146 LYS LYS C . n 
C 3 9  HIS 9  147 147 HIS HIS C . n 
C 3 10 GLU 10 148 148 GLU GLU C . n 
C 3 11 GLN 11 149 149 GLN GLN C . n 
C 3 12 GLU 12 150 150 GLU GLU C . n 
C 3 13 GLN 13 151 151 GLN GLN C . n 
C 3 14 ILE 14 152 152 ILE ILE C . n 
C 3 15 SER 15 153 153 SER SER C . n 
C 3 16 ARG 16 154 154 ARG ARG C . n 
C 3 17 LEU 17 155 155 LEU LEU C . n 
C 3 18 LEU 18 156 156 LEU LEU C . n 
C 3 19 GLU 19 157 157 GLU GLU C . n 
C 3 20 LYS 20 158 158 LYS LYS C . n 
C 3 21 GLY 21 159 159 GLY GLY C . n 
C 3 22 HIS 22 160 160 HIS HIS C . n 
C 3 23 PRO 23 161 161 PRO PRO C . n 
C 3 24 ARG 24 162 162 ARG ARG C . n 
C 3 25 GLN 25 163 163 GLN GLN C . n 
C 3 26 GLN 26 164 164 GLN GLN C . n 
C 3 27 LEU 27 165 165 LEU LEU C . n 
C 3 28 ALA 28 166 166 ALA ALA C . n 
C 3 29 ILE 29 167 167 ILE ILE C . n 
C 3 30 ILE 30 168 168 ILE ILE C . n 
C 3 31 PHE 31 169 169 PHE PHE C . n 
C 3 32 GLY 32 170 170 GLY GLY C . n 
C 3 33 ILE 33 171 171 ILE ILE C . n 
C 3 34 GLY 34 172 172 GLY GLY C . n 
C 3 35 VAL 35 173 173 VAL VAL C . n 
C 3 36 SER 36 174 174 SER SER C . n 
C 3 37 THR 37 175 175 THR THR C . n 
C 3 38 LEU 38 176 176 LEU LEU C . n 
C 3 39 TYR 39 177 177 TYR TYR C . n 
C 3 40 ARG 40 178 178 ARG ARG C . n 
C 3 41 TYR 41 179 179 TYR TYR C . n 
C 3 42 PHE 42 180 180 PHE PHE C . n 
C 3 43 PRO 43 181 181 PRO PRO C . n 
C 3 44 ALA 44 182 182 ALA ALA C . n 
C 3 45 SER 45 183 183 SER SER C . n 
C 3 46 SER 46 184 184 SER SER C . n 
C 3 47 ILE 47 185 ?   ?   ?   C . n 
C 3 48 LYS 48 186 ?   ?   ?   C . n 
C 3 49 LYS 49 187 ?   ?   ?   C . n 
C 3 50 ARG 50 188 ?   ?   ?   C . n 
C 3 51 MET 51 189 ?   ?   ?   C . n 
C 3 52 ASN 52 190 ?   ?   ?   C . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-02-22 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS       refinement       . ? 1 
DENZO     'data reduction' . ? 2 
SCALEPACK 'data scaling'   . ? 3 
CNS       phasing          . ? 4 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O5'" A DT 8  ? ? P     A DT 8  ? ? OP2   A DT 8  ? ? 119.29 110.70 8.59  1.20 N 
2 1 "C5'" B DA 16 ? ? "C4'" B DA 16 ? ? "C3'" B DA 16 ? A 126.49 115.70 10.79 1.20 N 
3 1 "C5'" B DT 17 ? A "C4'" B DT 17 ? A "C3'" B DT 17 ? ? 123.34 115.70 7.64  1.20 N 
4 1 "O4'" B DA 28 ? ? "C1'" B DA 28 ? ? N9    B DA 28 ? ? 111.25 108.30 2.95  0.30 N 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    ASN 
_pdbx_validate_torsion.auth_asym_id    C 
_pdbx_validate_torsion.auth_seq_id     145 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -65.63 
_pdbx_validate_torsion.psi             -135.49 
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 DT  A 7   ? ? 0.094 'SIDE CHAIN' 
2 1 DC  A 11  ? ? 0.079 'SIDE CHAIN' 
3 1 DA  A 15  ? ? 0.088 'SIDE CHAIN' 
4 1 DT  B 20  ? ? 0.067 'SIDE CHAIN' 
5 1 DA  B 28  ? ? 0.095 'SIDE CHAIN' 
6 1 TYR C 179 ? ? 0.069 'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 C LYS 146 ? CE  ? C LYS 8  CE  
2  1 Y 1 C LYS 146 ? NZ  ? C LYS 8  NZ  
3  1 Y 1 C HIS 147 ? CG  ? C HIS 9  CG  
4  1 Y 1 C HIS 147 ? ND1 ? C HIS 9  ND1 
5  1 Y 1 C HIS 147 ? CD2 ? C HIS 9  CD2 
6  1 Y 1 C HIS 147 ? CE1 ? C HIS 9  CE1 
7  1 Y 1 C HIS 147 ? NE2 ? C HIS 9  NE2 
8  1 Y 1 C GLU 150 ? CG  ? C GLU 12 CG  
9  1 Y 1 C GLU 150 ? CD  ? C GLU 12 CD  
10 1 Y 1 C GLU 150 ? OE1 ? C GLU 12 OE1 
11 1 Y 1 C GLU 150 ? OE2 ? C GLU 12 OE2 
12 1 Y 1 C GLU 157 ? CG  ? C GLU 19 CG  
13 1 Y 1 C GLU 157 ? CD  ? C GLU 19 CD  
14 1 Y 1 C GLU 157 ? OE1 ? C GLU 19 OE1 
15 1 Y 1 C GLU 157 ? OE2 ? C GLU 19 OE2 
16 1 Y 1 C LYS 158 ? CG  ? C LYS 20 CG  
17 1 Y 1 C LYS 158 ? CD  ? C LYS 20 CD  
18 1 Y 1 C LYS 158 ? CE  ? C LYS 20 CE  
19 1 Y 1 C LYS 158 ? NZ  ? C LYS 20 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 C ILE 185 ? C ILE 47 
2 1 Y 1 C LYS 186 ? C LYS 48 
3 1 Y 1 C LYS 187 ? C LYS 49 
4 1 Y 1 C ARG 188 ? C ARG 50 
5 1 Y 1 C MET 189 ? C MET 51 
6 1 Y 1 C ASN 190 ? C ASN 52 
# 
_ndb_struct_conf_na.entry_id   1JKR 
_ndb_struct_conf_na.feature    'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DG 2  1_555 B DC 14 1_555 0.372  0.192  -0.820 -22.437 7.227   -2.976  1  A_DG3:DC29_B  A 3  ? B 29 ? 19 1 
1 A DT 3  1_555 B DA 13 1_555 0.951  -0.224 -0.338 -4.581  -9.404  -14.995 2  A_DT4:DA28_B  A 4  ? B 28 ? 20 1 
1 A DT 4  1_555 B DA 12 1_555 -0.079 -0.133 -0.485 -1.157  -27.297 0.373   3  A_DT5:DA27_B  A 5  ? B 27 ? 20 1 
1 A DT 5  1_555 B DA 11 1_555 -0.005 0.036  -0.979 -2.067  -32.019 -3.281  4  A_DT6:DA26_B  A 6  ? B 26 ? 20 1 
1 A DT 6  1_555 B DA 10 1_555 -1.231 -0.275 -0.355 -2.925  -17.969 -6.631  5  A_DT7:DA25_B  A 7  ? B 25 ? 20 1 
1 A DT 7  1_555 B DA 9  1_555 -0.555 0.171  -0.150 2.269   -14.495 -0.251  6  A_DT8:DA24_B  A 8  ? B 24 ? 20 1 
1 A DG 8  1_555 B DC 8  1_555 -0.016 -0.212 -0.086 4.565   -15.734 1.432   7  A_DG9:DC23_B  A 9  ? B 23 ? 19 1 
1 A DA 9  1_555 B DT 7  1_555 0.172  0.009  0.173  6.632   -20.759 -6.971  8  A_DA10:DT22_B A 10 ? B 22 ? 20 1 
1 A DC 10 1_555 B DG 6  1_555 -0.193 -0.238 0.130  2.848   -26.083 -4.892  9  A_DC11:DG21_B A 11 ? B 21 ? 19 1 
1 A DA 11 1_555 B DT 5  1_555 0.431  -0.261 -0.138 2.121   -17.181 -4.107  10 A_DA12:DT20_B A 12 ? B 20 ? 20 1 
1 A DA 12 1_555 B DT 4  1_555 0.432  -0.033 0.400  17.358  -7.505  4.084   11 A_DA13:DT19_B A 13 ? B 19 ? 20 1 
1 A DG 13 1_555 B DC 3  1_555 0.195  -0.132 -0.073 4.677   -12.558 -4.561  12 A_DG14:DC18_B A 14 ? B 18 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DG 2  1_555 B DC 14 1_555 A DT 3  1_555 B DA 13 1_555 -1.077 -0.268 3.022 -3.680 9.655  33.922 -1.764 1.266  2.936 16.090 
6.134  35.417 1  AA_DG3DT4:DA28DC29_BB   A 3  ? B 29 ? A 4  ? B 28 ? 
1 A DT 3  1_555 B DA 13 1_555 A DT 4  1_555 B DA 12 1_555 0.362  -0.397 3.102 3.220  2.129  26.203 -1.403 0.019  3.082 4.663  
-7.054 26.481 2  AA_DT4DT5:DA27DA28_BB   A 4  ? B 28 ? A 5  ? B 27 ? 
1 A DT 4  1_555 B DA 12 1_555 A DT 5  1_555 B DA 11 1_555 -0.311 0.640  3.176 3.788  11.275 35.588 -0.480 0.980  3.178 17.843 
-5.995 37.462 3  AA_DT5DT6:DA26DA27_BB   A 5  ? B 27 ? A 6  ? B 26 ? 
1 A DT 5  1_555 B DA 11 1_555 A DT 6  1_555 B DA 10 1_555 0.729  0.496  3.258 -1.271 -2.741 34.285 1.260  -1.427 3.182 -4.638 
2.151  34.414 4  AA_DT6DT7:DA25DA26_BB   A 6  ? B 26 ? A 7  ? B 25 ? 
1 A DT 6  1_555 B DA 10 1_555 A DT 7  1_555 B DA 9  1_555 -0.158 -0.325 3.133 -1.083 -2.121 37.505 -0.238 0.109  3.149 -3.295 
1.683  37.578 5  AA_DT7DT8:DA24DA25_BB   A 7  ? B 25 ? A 8  ? B 24 ? 
1 A DT 7  1_555 B DA 9  1_555 A DG 8  1_555 B DC 8  1_555 0.811  1.372  3.453 4.098  2.719  39.109 1.687  -0.679 3.600 4.042  
-6.093 39.405 6  AA_DT8DG9:DC23DA24_BB   A 8  ? B 24 ? A 9  ? B 23 ? 
1 A DG 8  1_555 B DC 8  1_555 A DA 9  1_555 B DT 7  1_555 -1.002 0.348  3.352 -4.866 9.074  35.508 -0.749 0.885  3.438 14.506 
7.780  36.924 7  AA_DG9DA10:DT22DC23_BB  A 9  ? B 23 ? A 10 ? B 22 ? 
1 A DA 9  1_555 B DT 7  1_555 A DC 10 1_555 B DG 6  1_555 0.570  -0.683 3.448 -0.712 0.924  33.024 -1.365 -1.129 3.415 1.625  
1.251  33.044 8  AA_DA10DC11:DG21DT22_BB A 10 ? B 22 ? A 11 ? B 21 ? 
1 A DC 10 1_555 B DG 6  1_555 A DA 11 1_555 B DT 5  1_555 -0.114 0.651  3.522 0.368  2.381  38.998 0.664  0.218  3.553 3.563  
-0.550 39.070 9  AA_DC11DA12:DT20DG21_BB A 11 ? B 21 ? A 12 ? B 20 ? 
1 A DA 11 1_555 B DT 5  1_555 A DA 12 1_555 B DT 4  1_555 0.705  -0.173 2.764 -3.970 -0.340 28.996 -0.281 -2.109 2.647 -0.674 
7.883  29.262 10 AA_DA12DA13:DT19DT20_BB A 12 ? B 20 ? A 13 ? B 19 ? 
1 A DA 12 1_555 B DT 4  1_555 A DG 13 1_555 B DC 3  1_555 -0.550 -0.661 3.647 1.159  5.675  35.237 -1.979 1.080  3.482 9.296  
-1.898 35.695 11 AA_DA13DG14:DC18DT19_BB A 13 ? B 19 ? A 14 ? B 18 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL TRS 
5 water                                    HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 TRS 1 204 204 TRS TRS A . 
E 5 HOH 1 202 202 HOH HOH B . 
F 5 HOH 1 203 203 HOH HOH C . 
#