data_1JLH
# 
_entry.id   1JLH 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1JLH         
RCSB  RCSB013909   
WWPDB D_1000013909 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1dqr '1dqr is the Crystal Structure Of Rabbit Phosphoglucose Isomerase'                                                        
unspecified 
PDB 1g98 '1g98 is the Crystal Structure Analysis Of Rabbit Phosphoglucose Isomerase Complexed With 5-Phosphoarabinonate'           
unspecified 
PDB 1hox '1hox is the CRYSTAL STRUCTURE OF RABBIT PHOSPHOGLUCOSE ISOMERASE COMPLEXED WITH FRUCTOSE-6-PHOSPHATE'                    
unspecified 
PDB 1iat '1iat is the Crystal Structure Of Human Phosphoglucose Isomerase/Neuroleukin/Autocrine Motility Factor/Maturation Factor' 
unspecified 
# 
_pdbx_database_status.entry_id                        1JLH 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2001-07-16 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
_audit_author.name           'Cordeiro, A.T.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.id                        primary 
_citation.title                     
'Crystal structure of human phosphoglucose isomerase and analysis of the initial catalytic steps' 
_citation.journal_abbrev            BIOCHIM.BIOPHYS.ACTA 
_citation.journal_volume            1645 
_citation.page_first                117 
_citation.page_last                 122 
_citation.year                      2003 
_citation.journal_id_ASTM           BBACAQ 
_citation.country                   NE 
_citation.journal_id_ISSN           0006-3002 
_citation.journal_id_CSD            0113 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12573240 
_citation.pdbx_database_id_DOI      '10.1016/S1570-9639(02)00464-8' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Cordeiro, A.T.'  1 
primary 'Godoi, P.H.C.'   2 
primary 'Silva, C.H.T.P.' 3 
primary 'Garratt, R.C.'   4 
primary 'Oliva, G.'       5 
primary 'Thiemann, O.H.'  6 
# 
_cell.entry_id           1JLH 
_cell.length_a           80.750 
_cell.length_b           108.021 
_cell.length_c           271.073 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              16 
# 
_symmetry.entry_id                         1JLH 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                19 
_symmetry.cell_setting                     ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'phosphoglucose isomerase' 63229.879 4    5.3.1.9 ? ? ? 
2 water   nat water                      18.015    1289 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'PGI, GLUCOSE PHOSPHATE ISOMERASE' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MAALTRDPQFQKLQQWYREHRSELNLRRLFDANKDRFNHFSLTLNTNHGHILVDYSKNLVTEDVMRMLVDLAKSRGVEAA
RERMFNGEKINYTEGRAVLHVALRNRSNTPILVDGKDVMPEVNKVLDKMKSFCQRVRSGDWKGYTGKTITDVINIGIGGS
DLGPLMVTEALKPYSSGGPRVWYVSNIDGTHIAKTLAQLNPESSLFIIASKTFTTQETITNAETAKEWFLQAAKDPSAVA
KHFVALSTNTTKVKEFGIDPQNMFEFWDWVGGRYSLWSAIGLSIALHVGFDNFEQLLSGAHWMDQHFRTTPLEKNAPVLL
ALLGIWYINCFGCETHAMLPYDQYLHRFAAYFQQGDMESNGKYITKSGTRVDHQTGPIVWGEPGTNGQHAFYQLIHQGTE
MIPCDFLIPVQTQHPIRKGLHHKILLANFLAQTEALMRGKSTEEARKELQAAGKSPEDLERLLPHKVFEGNRPTNSIVFT
KLTPFMLGALVAMYEHKIFVQGIIWDINSFDQWGVELGKQLAKKIEPELDGSAQVTSHDASTNGLINFIKQQREARVQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MAALTRDPQFQKLQQWYREHRSELNLRRLFDANKDRFNHFSLTLNTNHGHILVDYSKNLVTEDVMRMLVDLAKSRGVEAA
RERMFNGEKINYTEGRAVLHVALRNRSNTPILVDGKDVMPEVNKVLDKMKSFCQRVRSGDWKGYTGKTITDVINIGIGGS
DLGPLMVTEALKPYSSGGPRVWYVSNIDGTHIAKTLAQLNPESSLFIIASKTFTTQETITNAETAKEWFLQAAKDPSAVA
KHFVALSTNTTKVKEFGIDPQNMFEFWDWVGGRYSLWSAIGLSIALHVGFDNFEQLLSGAHWMDQHFRTTPLEKNAPVLL
ALLGIWYINCFGCETHAMLPYDQYLHRFAAYFQQGDMESNGKYITKSGTRVDHQTGPIVWGEPGTNGQHAFYQLIHQGTE
MIPCDFLIPVQTQHPIRKGLHHKILLANFLAQTEALMRGKSTEEARKELQAAGKSPEDLERLLPHKVFEGNRPTNSIVFT
KLTPFMLGALVAMYEHKIFVQGIIWDINSFDQWGVELGKQLAKKIEPELDGSAQVTSHDASTNGLINFIKQQREARVQ
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   ALA n 
1 4   LEU n 
1 5   THR n 
1 6   ARG n 
1 7   ASP n 
1 8   PRO n 
1 9   GLN n 
1 10  PHE n 
1 11  GLN n 
1 12  LYS n 
1 13  LEU n 
1 14  GLN n 
1 15  GLN n 
1 16  TRP n 
1 17  TYR n 
1 18  ARG n 
1 19  GLU n 
1 20  HIS n 
1 21  ARG n 
1 22  SER n 
1 23  GLU n 
1 24  LEU n 
1 25  ASN n 
1 26  LEU n 
1 27  ARG n 
1 28  ARG n 
1 29  LEU n 
1 30  PHE n 
1 31  ASP n 
1 32  ALA n 
1 33  ASN n 
1 34  LYS n 
1 35  ASP n 
1 36  ARG n 
1 37  PHE n 
1 38  ASN n 
1 39  HIS n 
1 40  PHE n 
1 41  SER n 
1 42  LEU n 
1 43  THR n 
1 44  LEU n 
1 45  ASN n 
1 46  THR n 
1 47  ASN n 
1 48  HIS n 
1 49  GLY n 
1 50  HIS n 
1 51  ILE n 
1 52  LEU n 
1 53  VAL n 
1 54  ASP n 
1 55  TYR n 
1 56  SER n 
1 57  LYS n 
1 58  ASN n 
1 59  LEU n 
1 60  VAL n 
1 61  THR n 
1 62  GLU n 
1 63  ASP n 
1 64  VAL n 
1 65  MET n 
1 66  ARG n 
1 67  MET n 
1 68  LEU n 
1 69  VAL n 
1 70  ASP n 
1 71  LEU n 
1 72  ALA n 
1 73  LYS n 
1 74  SER n 
1 75  ARG n 
1 76  GLY n 
1 77  VAL n 
1 78  GLU n 
1 79  ALA n 
1 80  ALA n 
1 81  ARG n 
1 82  GLU n 
1 83  ARG n 
1 84  MET n 
1 85  PHE n 
1 86  ASN n 
1 87  GLY n 
1 88  GLU n 
1 89  LYS n 
1 90  ILE n 
1 91  ASN n 
1 92  TYR n 
1 93  THR n 
1 94  GLU n 
1 95  GLY n 
1 96  ARG n 
1 97  ALA n 
1 98  VAL n 
1 99  LEU n 
1 100 HIS n 
1 101 VAL n 
1 102 ALA n 
1 103 LEU n 
1 104 ARG n 
1 105 ASN n 
1 106 ARG n 
1 107 SER n 
1 108 ASN n 
1 109 THR n 
1 110 PRO n 
1 111 ILE n 
1 112 LEU n 
1 113 VAL n 
1 114 ASP n 
1 115 GLY n 
1 116 LYS n 
1 117 ASP n 
1 118 VAL n 
1 119 MET n 
1 120 PRO n 
1 121 GLU n 
1 122 VAL n 
1 123 ASN n 
1 124 LYS n 
1 125 VAL n 
1 126 LEU n 
1 127 ASP n 
1 128 LYS n 
1 129 MET n 
1 130 LYS n 
1 131 SER n 
1 132 PHE n 
1 133 CYS n 
1 134 GLN n 
1 135 ARG n 
1 136 VAL n 
1 137 ARG n 
1 138 SER n 
1 139 GLY n 
1 140 ASP n 
1 141 TRP n 
1 142 LYS n 
1 143 GLY n 
1 144 TYR n 
1 145 THR n 
1 146 GLY n 
1 147 LYS n 
1 148 THR n 
1 149 ILE n 
1 150 THR n 
1 151 ASP n 
1 152 VAL n 
1 153 ILE n 
1 154 ASN n 
1 155 ILE n 
1 156 GLY n 
1 157 ILE n 
1 158 GLY n 
1 159 GLY n 
1 160 SER n 
1 161 ASP n 
1 162 LEU n 
1 163 GLY n 
1 164 PRO n 
1 165 LEU n 
1 166 MET n 
1 167 VAL n 
1 168 THR n 
1 169 GLU n 
1 170 ALA n 
1 171 LEU n 
1 172 LYS n 
1 173 PRO n 
1 174 TYR n 
1 175 SER n 
1 176 SER n 
1 177 GLY n 
1 178 GLY n 
1 179 PRO n 
1 180 ARG n 
1 181 VAL n 
1 182 TRP n 
1 183 TYR n 
1 184 VAL n 
1 185 SER n 
1 186 ASN n 
1 187 ILE n 
1 188 ASP n 
1 189 GLY n 
1 190 THR n 
1 191 HIS n 
1 192 ILE n 
1 193 ALA n 
1 194 LYS n 
1 195 THR n 
1 196 LEU n 
1 197 ALA n 
1 198 GLN n 
1 199 LEU n 
1 200 ASN n 
1 201 PRO n 
1 202 GLU n 
1 203 SER n 
1 204 SER n 
1 205 LEU n 
1 206 PHE n 
1 207 ILE n 
1 208 ILE n 
1 209 ALA n 
1 210 SER n 
1 211 LYS n 
1 212 THR n 
1 213 PHE n 
1 214 THR n 
1 215 THR n 
1 216 GLN n 
1 217 GLU n 
1 218 THR n 
1 219 ILE n 
1 220 THR n 
1 221 ASN n 
1 222 ALA n 
1 223 GLU n 
1 224 THR n 
1 225 ALA n 
1 226 LYS n 
1 227 GLU n 
1 228 TRP n 
1 229 PHE n 
1 230 LEU n 
1 231 GLN n 
1 232 ALA n 
1 233 ALA n 
1 234 LYS n 
1 235 ASP n 
1 236 PRO n 
1 237 SER n 
1 238 ALA n 
1 239 VAL n 
1 240 ALA n 
1 241 LYS n 
1 242 HIS n 
1 243 PHE n 
1 244 VAL n 
1 245 ALA n 
1 246 LEU n 
1 247 SER n 
1 248 THR n 
1 249 ASN n 
1 250 THR n 
1 251 THR n 
1 252 LYS n 
1 253 VAL n 
1 254 LYS n 
1 255 GLU n 
1 256 PHE n 
1 257 GLY n 
1 258 ILE n 
1 259 ASP n 
1 260 PRO n 
1 261 GLN n 
1 262 ASN n 
1 263 MET n 
1 264 PHE n 
1 265 GLU n 
1 266 PHE n 
1 267 TRP n 
1 268 ASP n 
1 269 TRP n 
1 270 VAL n 
1 271 GLY n 
1 272 GLY n 
1 273 ARG n 
1 274 TYR n 
1 275 SER n 
1 276 LEU n 
1 277 TRP n 
1 278 SER n 
1 279 ALA n 
1 280 ILE n 
1 281 GLY n 
1 282 LEU n 
1 283 SER n 
1 284 ILE n 
1 285 ALA n 
1 286 LEU n 
1 287 HIS n 
1 288 VAL n 
1 289 GLY n 
1 290 PHE n 
1 291 ASP n 
1 292 ASN n 
1 293 PHE n 
1 294 GLU n 
1 295 GLN n 
1 296 LEU n 
1 297 LEU n 
1 298 SER n 
1 299 GLY n 
1 300 ALA n 
1 301 HIS n 
1 302 TRP n 
1 303 MET n 
1 304 ASP n 
1 305 GLN n 
1 306 HIS n 
1 307 PHE n 
1 308 ARG n 
1 309 THR n 
1 310 THR n 
1 311 PRO n 
1 312 LEU n 
1 313 GLU n 
1 314 LYS n 
1 315 ASN n 
1 316 ALA n 
1 317 PRO n 
1 318 VAL n 
1 319 LEU n 
1 320 LEU n 
1 321 ALA n 
1 322 LEU n 
1 323 LEU n 
1 324 GLY n 
1 325 ILE n 
1 326 TRP n 
1 327 TYR n 
1 328 ILE n 
1 329 ASN n 
1 330 CYS n 
1 331 PHE n 
1 332 GLY n 
1 333 CYS n 
1 334 GLU n 
1 335 THR n 
1 336 HIS n 
1 337 ALA n 
1 338 MET n 
1 339 LEU n 
1 340 PRO n 
1 341 TYR n 
1 342 ASP n 
1 343 GLN n 
1 344 TYR n 
1 345 LEU n 
1 346 HIS n 
1 347 ARG n 
1 348 PHE n 
1 349 ALA n 
1 350 ALA n 
1 351 TYR n 
1 352 PHE n 
1 353 GLN n 
1 354 GLN n 
1 355 GLY n 
1 356 ASP n 
1 357 MET n 
1 358 GLU n 
1 359 SER n 
1 360 ASN n 
1 361 GLY n 
1 362 LYS n 
1 363 TYR n 
1 364 ILE n 
1 365 THR n 
1 366 LYS n 
1 367 SER n 
1 368 GLY n 
1 369 THR n 
1 370 ARG n 
1 371 VAL n 
1 372 ASP n 
1 373 HIS n 
1 374 GLN n 
1 375 THR n 
1 376 GLY n 
1 377 PRO n 
1 378 ILE n 
1 379 VAL n 
1 380 TRP n 
1 381 GLY n 
1 382 GLU n 
1 383 PRO n 
1 384 GLY n 
1 385 THR n 
1 386 ASN n 
1 387 GLY n 
1 388 GLN n 
1 389 HIS n 
1 390 ALA n 
1 391 PHE n 
1 392 TYR n 
1 393 GLN n 
1 394 LEU n 
1 395 ILE n 
1 396 HIS n 
1 397 GLN n 
1 398 GLY n 
1 399 THR n 
1 400 GLU n 
1 401 MET n 
1 402 ILE n 
1 403 PRO n 
1 404 CYS n 
1 405 ASP n 
1 406 PHE n 
1 407 LEU n 
1 408 ILE n 
1 409 PRO n 
1 410 VAL n 
1 411 GLN n 
1 412 THR n 
1 413 GLN n 
1 414 HIS n 
1 415 PRO n 
1 416 ILE n 
1 417 ARG n 
1 418 LYS n 
1 419 GLY n 
1 420 LEU n 
1 421 HIS n 
1 422 HIS n 
1 423 LYS n 
1 424 ILE n 
1 425 LEU n 
1 426 LEU n 
1 427 ALA n 
1 428 ASN n 
1 429 PHE n 
1 430 LEU n 
1 431 ALA n 
1 432 GLN n 
1 433 THR n 
1 434 GLU n 
1 435 ALA n 
1 436 LEU n 
1 437 MET n 
1 438 ARG n 
1 439 GLY n 
1 440 LYS n 
1 441 SER n 
1 442 THR n 
1 443 GLU n 
1 444 GLU n 
1 445 ALA n 
1 446 ARG n 
1 447 LYS n 
1 448 GLU n 
1 449 LEU n 
1 450 GLN n 
1 451 ALA n 
1 452 ALA n 
1 453 GLY n 
1 454 LYS n 
1 455 SER n 
1 456 PRO n 
1 457 GLU n 
1 458 ASP n 
1 459 LEU n 
1 460 GLU n 
1 461 ARG n 
1 462 LEU n 
1 463 LEU n 
1 464 PRO n 
1 465 HIS n 
1 466 LYS n 
1 467 VAL n 
1 468 PHE n 
1 469 GLU n 
1 470 GLY n 
1 471 ASN n 
1 472 ARG n 
1 473 PRO n 
1 474 THR n 
1 475 ASN n 
1 476 SER n 
1 477 ILE n 
1 478 VAL n 
1 479 PHE n 
1 480 THR n 
1 481 LYS n 
1 482 LEU n 
1 483 THR n 
1 484 PRO n 
1 485 PHE n 
1 486 MET n 
1 487 LEU n 
1 488 GLY n 
1 489 ALA n 
1 490 LEU n 
1 491 VAL n 
1 492 ALA n 
1 493 MET n 
1 494 TYR n 
1 495 GLU n 
1 496 HIS n 
1 497 LYS n 
1 498 ILE n 
1 499 PHE n 
1 500 VAL n 
1 501 GLN n 
1 502 GLY n 
1 503 ILE n 
1 504 ILE n 
1 505 TRP n 
1 506 ASP n 
1 507 ILE n 
1 508 ASN n 
1 509 SER n 
1 510 PHE n 
1 511 ASP n 
1 512 GLN n 
1 513 TRP n 
1 514 GLY n 
1 515 VAL n 
1 516 GLU n 
1 517 LEU n 
1 518 GLY n 
1 519 LYS n 
1 520 GLN n 
1 521 LEU n 
1 522 ALA n 
1 523 LYS n 
1 524 LYS n 
1 525 ILE n 
1 526 GLU n 
1 527 PRO n 
1 528 GLU n 
1 529 LEU n 
1 530 ASP n 
1 531 GLY n 
1 532 SER n 
1 533 ALA n 
1 534 GLN n 
1 535 VAL n 
1 536 THR n 
1 537 SER n 
1 538 HIS n 
1 539 ASP n 
1 540 ALA n 
1 541 SER n 
1 542 THR n 
1 543 ASN n 
1 544 GLY n 
1 545 LEU n 
1 546 ILE n 
1 547 ASN n 
1 548 PHE n 
1 549 ILE n 
1 550 LYS n 
1 551 GLN n 
1 552 GLN n 
1 553 ARG n 
1 554 GLU n 
1 555 ALA n 
1 556 ARG n 
1 557 VAL n 
1 558 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'pET29-a(+)' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    G6PI_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MAALTRDPQFQKLQQWYREHRSELNLRRLFDANKDRFNHFSLTLNTNHGHILVDYSKNLVTEDVMRMLVDLAKSRGVEAA
RERMFNGEKINYTEGRAVLHVALRNRSNTPILVDGKDVMPEVNKVLDKMKSFCQRVRSGDWKGYTGKTITDVINIGIGGS
DLGPLMVTEALKPYSSGGPRVWYVSNIDGTHIAKTLAQLNPESSLFIIASKTFTTQETITNAETAKEWFLQAAKDPSAVA
KHFVALSTNTTKVKEFGIDPQNMFEFWDWVGGRYSLWSAIGLSIALHVGFDNFEQLLSGAHWMDQHFRTTPLEKNAPVLL
ALLGIWYINCFGCETHAMLPYDQYLHRFAAYFQQGDMESNGKYITKSGTRVDHQTGPIVWGEPGTNGQHAFYQLIHQGTK
MIPCDFLIPVQTQHPIRKGLHHKILLANFLAQTEALMRGKSTEEARKELQAAGKSPEDLERLLPHKVFEGNRPTNSIVFT
KLTPFMLGALVAMYEHKIFVQGIIWDINSFDQWGVELGKQLAKKIEPELDGSAQVTSHDASTNGLINFIKQQREARVQ
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_accession          P06744 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1JLH A 1 ? 558 ? P06744 1 ? 558 ? 0 557 
2 1 1JLH B 1 ? 558 ? P06744 1 ? 558 ? 0 557 
3 1 1JLH C 1 ? 558 ? P06744 1 ? 558 ? 0 557 
4 1 1JLH D 1 ? 558 ? P06744 1 ? 558 ? 0 557 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1JLH GLU A 400 ? UNP P06744 LYS 400 'see remark 999' 399 1 
2 1JLH GLU B 400 ? UNP P06744 LYS 400 'see remark 999' 399 2 
3 1JLH GLU C 400 ? UNP P06744 LYS 400 'see remark 999' 399 3 
4 1JLH GLU D 400 ? UNP P06744 LYS 400 'see remark 999' 399 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1JLH 
_exptl.crystals_number   1 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   48.64 
_exptl_crystal.density_Matthews      2.41 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    '10% PEG 10000, 0.1M HEPES , pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 291K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'MAR scanner 345 mm plate' 
_diffrn_detector.pdbx_collection_date   2000-07-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5450 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'LNLS BEAMLINE D03B-MX1' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5450 
_diffrn_source.pdbx_synchrotron_site       LNLS 
_diffrn_source.pdbx_synchrotron_beamline   D03B-MX1 
# 
_reflns.entry_id                     1JLH 
_reflns.d_resolution_high            2.10 
_reflns.d_resolution_low             22.21 
_reflns.limit_h_max                  38 
_reflns.limit_h_min                  0 
_reflns.limit_k_max                  51 
_reflns.limit_k_min                  0 
_reflns.limit_l_max                  129 
_reflns.limit_l_min                  0 
_reflns.number_all                   138847 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.observed_criterion_F_max     3704005.62 
_reflns.observed_criterion_F_min     24.900000 
_reflns.B_iso_Wilson_estimate        15.5 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.number_obs                   138362 
_reflns.percent_possible_obs         99.6 
_reflns.pdbx_Rmerge_I_obs            0.111 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        6.7 
_reflns.pdbx_redundancy              4.8 
_reflns.R_free_details               ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.10 
_reflns_shell.d_res_low              2.23 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.percent_possible_all   99.4 
_reflns_shell.Rmerge_I_obs           0.399 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1JLH 
_refine.ls_number_reflns_all                     138843 
_refine.ls_number_reflns_obs                     138362 
_refine.ls_percent_reflns_obs                    99.7 
_refine.ls_d_res_high                            2.10 
_refine.ls_d_res_low                             22.21 
_refine.B_iso_min                                9.28 
_refine.B_iso_max                                78.40 
_refine.B_iso_mean                               26.8 
_refine.occupancy_min                            1.00 
_refine.occupancy_max                            1.00 
_refine.aniso_B[1][1]                            -1.90 
_refine.aniso_B[2][2]                            9.87 
_refine.aniso_B[3][3]                            -7.97 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_param_bsol                 53.15 
_refine.solvent_model_param_ksol                 0.34 
_refine.solvent_model_details                    'CNS bulk solvent model used' 
_refine.ls_R_factor_R_work                       0.197 
_refine.ls_R_factor_R_free                       0.237 
_refine.ls_R_factor_R_free_error                 0.003 
_refine.ls_number_reflns_R_free                  6914 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.details                                  ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      1DQR 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1JLH 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     2.10 
_refine_analyze.Luzzati_coordinate_error_obs    0.23 
_refine_analyze.Luzzati_sigma_a_obs             0.18 
_refine_analyze.Luzzati_coordinate_error_free   0.29 
_refine_analyze.Luzzati_sigma_a_free            0.24 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        17752 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             1289 
_refine_hist.number_atoms_total               19041 
_refine_hist.d_res_high                       2.10 
_refine_hist.d_res_low                        22.21 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d           0.008 ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg        1.3   ? ? ? 'X-RAY DIFFRACTION' ? 
x_torsion_deg      21.6  ? ? ? 'X-RAY DIFFRACTION' ? 
x_torsion_impr_deg 0.92  ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d 21.6  ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d 0.92  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.R_factor_all 
2.10 2.23  17199 17030 21552 99.40 0.233 0.28  0.008 1183 5.20 6 . 'X-RAY DIFFRACTION' . 
2.20 2.31  17233 17123 16294 99.4  0.225 0.224 0.008 829  4.8  8 . 'X-RAY DIFFRACTION' . 
2.31 2.46  17259 17161 16356 99.4  0.211 0.212 0.007 805  4.7  8 . 'X-RAY DIFFRACTION' . 
2.46 2.64  17208 17159 16292 99.7  0.213 0.213 0.007 867  5.0  8 . 'X-RAY DIFFRACTION' . 
2.64 2.91  17269 17241 16368 99.8  0.213 0.213 0.007 873  5.1  8 . 'X-RAY DIFFRACTION' . 
2.91 3.33  17366 17343 16496 99.9  0.208 0.209 0.007 847  4.9  8 . 'X-RAY DIFFRACTION' . 
3.33 4.19  17470 17452 16579 99.9  0.181 0.183 0.006 873  5.0  8 . 'X-RAY DIFFRACTION' . 
4.19 22.21 17983 17853 16943 99.3  0.17  0.168 0.006 910  5.1  8 . 'X-RAY DIFFRACTION' . 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param protein.top 'X-RAY DIFFRACTION' 
2 water_rep.param   water.top   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1JLH 
_struct.title                     'Human Glucose-6-phosphate Isomerase' 
_struct.pdbx_descriptor           'phosphoglucose isomerase (E.C.5.3.1.9)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1JLH 
_struct_keywords.pdbx_keywords   ISOMERASE 
_struct_keywords.text            'glycolysis, glyconeogenesis, isomerase' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   ALA A 2   ? ASP A 7   ? ALA A 1   ASP A 6   1 ? 6  
HELX_P HELX_P2   2   ASP A 7   ? ARG A 21  ? ASP A 6   ARG A 20  1 ? 15 
HELX_P HELX_P3   3   SER A 22  ? LEU A 24  ? SER A 21  LEU A 23  5 ? 3  
HELX_P HELX_P4   4   ASN A 25  ? ASN A 33  ? ASN A 24  ASN A 32  1 ? 9  
HELX_P HELX_P5   5   ASP A 35  ? PHE A 40  ? ASP A 34  PHE A 39  1 ? 6  
HELX_P HELX_P6   6   THR A 61  ? ARG A 75  ? THR A 60  ARG A 74  1 ? 15 
HELX_P HELX_P7   7   GLY A 76  ? ASN A 86  ? GLY A 75  ASN A 85  1 ? 11 
HELX_P HELX_P8   8   LEU A 99  ? ARG A 104 ? LEU A 98  ARG A 103 1 ? 6  
HELX_P HELX_P9   9   VAL A 118 ? SER A 138 ? VAL A 117 SER A 137 1 ? 21 
HELX_P HELX_P10  10  ILE A 157 ? SER A 160 ? ILE A 156 SER A 159 5 ? 4  
HELX_P HELX_P11  11  ASP A 161 ? LEU A 171 ? ASP A 160 LEU A 170 1 ? 11 
HELX_P HELX_P12  12  LYS A 172 ? SER A 175 ? LYS A 171 SER A 174 5 ? 4  
HELX_P HELX_P13  13  ASP A 188 ? ALA A 197 ? ASP A 187 ALA A 196 1 ? 10 
HELX_P HELX_P14  14  GLN A 198 ? LEU A 199 ? GLN A 197 LEU A 198 5 ? 2  
HELX_P HELX_P15  15  ASN A 200 ? GLU A 202 ? ASN A 199 GLU A 201 5 ? 3  
HELX_P HELX_P16  16  THR A 215 ? LYS A 234 ? THR A 214 LYS A 233 1 ? 20 
HELX_P HELX_P17  17  ASP A 235 ? SER A 237 ? ASP A 234 SER A 236 5 ? 3  
HELX_P HELX_P18  18  ALA A 238 ? HIS A 242 ? ALA A 237 HIS A 241 1 ? 5  
HELX_P HELX_P19  19  ASN A 249 ? GLY A 257 ? ASN A 248 GLY A 256 1 ? 9  
HELX_P HELX_P20  20  ASP A 259 ? ASN A 262 ? ASP A 258 ASN A 261 5 ? 4  
HELX_P HELX_P21  21  GLY A 271 ? SER A 275 ? GLY A 270 SER A 274 5 ? 5  
HELX_P HELX_P22  22  SER A 278 ? ILE A 280 ? SER A 277 ILE A 279 5 ? 3  
HELX_P HELX_P23  23  GLY A 281 ? GLY A 289 ? GLY A 280 GLY A 288 1 ? 9  
HELX_P HELX_P24  24  GLY A 289 ? THR A 310 ? GLY A 288 THR A 309 1 ? 22 
HELX_P HELX_P25  25  PRO A 311 ? LYS A 314 ? PRO A 310 LYS A 313 5 ? 4  
HELX_P HELX_P26  26  ASN A 315 ? CYS A 330 ? ASN A 314 CYS A 329 1 ? 16 
HELX_P HELX_P27  27  ASP A 342 ? HIS A 346 ? ASP A 341 HIS A 345 5 ? 5  
HELX_P HELX_P28  28  ARG A 347 ? GLY A 361 ? ARG A 346 GLY A 360 1 ? 15 
HELX_P HELX_P29  29  ASN A 386 ? ALA A 390 ? ASN A 385 ALA A 389 5 ? 5  
HELX_P HELX_P30  30  PHE A 391 ? GLY A 398 ? PHE A 390 GLY A 397 1 ? 8  
HELX_P HELX_P31  31  ILE A 416 ? LYS A 418 ? ILE A 415 LYS A 417 5 ? 3  
HELX_P HELX_P32  32  GLY A 419 ? GLY A 439 ? GLY A 418 GLY A 438 1 ? 21 
HELX_P HELX_P33  33  SER A 441 ? ALA A 452 ? SER A 440 ALA A 451 1 ? 12 
HELX_P HELX_P34  34  SER A 455 ? LEU A 463 ? SER A 454 LEU A 462 1 ? 9  
HELX_P HELX_P35  35  PRO A 464 ? VAL A 467 ? PRO A 463 VAL A 466 5 ? 4  
HELX_P HELX_P36  36  THR A 483 ? ASP A 506 ? THR A 482 ASP A 505 1 ? 24 
HELX_P HELX_P37  37  GLN A 512 ? GLY A 514 ? GLN A 511 GLY A 513 5 ? 3  
HELX_P HELX_P38  38  VAL A 515 ? ASP A 530 ? VAL A 514 ASP A 529 1 ? 16 
HELX_P HELX_P39  39  ASP A 539 ? ARG A 553 ? ASP A 538 ARG A 552 1 ? 15 
HELX_P HELX_P40  40  ALA B 2   ? ASP B 7   ? ALA B 1   ASP B 6   1 ? 6  
HELX_P HELX_P41  41  ASP B 7   ? ARG B 21  ? ASP B 6   ARG B 20  1 ? 15 
HELX_P HELX_P42  42  SER B 22  ? LEU B 24  ? SER B 21  LEU B 23  5 ? 3  
HELX_P HELX_P43  43  ASN B 25  ? ASN B 33  ? ASN B 24  ASN B 32  1 ? 9  
HELX_P HELX_P44  44  ASP B 35  ? PHE B 40  ? ASP B 34  PHE B 39  1 ? 6  
HELX_P HELX_P45  45  THR B 61  ? ARG B 75  ? THR B 60  ARG B 74  1 ? 15 
HELX_P HELX_P46  46  GLY B 76  ? ASN B 86  ? GLY B 75  ASN B 85  1 ? 11 
HELX_P HELX_P47  47  LEU B 99  ? ARG B 104 ? LEU B 98  ARG B 103 1 ? 6  
HELX_P HELX_P48  48  VAL B 118 ? GLY B 139 ? VAL B 117 GLY B 138 1 ? 22 
HELX_P HELX_P49  49  ILE B 157 ? SER B 160 ? ILE B 156 SER B 159 5 ? 4  
HELX_P HELX_P50  50  ASP B 161 ? LEU B 171 ? ASP B 160 LEU B 170 1 ? 11 
HELX_P HELX_P51  51  LYS B 172 ? SER B 175 ? LYS B 171 SER B 174 5 ? 4  
HELX_P HELX_P52  52  ASP B 188 ? ALA B 197 ? ASP B 187 ALA B 196 1 ? 10 
HELX_P HELX_P53  53  THR B 215 ? LYS B 234 ? THR B 214 LYS B 233 1 ? 20 
HELX_P HELX_P54  54  ASP B 235 ? LYS B 241 ? ASP B 234 LYS B 240 5 ? 7  
HELX_P HELX_P55  55  ASN B 249 ? GLY B 257 ? ASN B 248 GLY B 256 1 ? 9  
HELX_P HELX_P56  56  ASP B 259 ? ASN B 262 ? ASP B 258 ASN B 261 5 ? 4  
HELX_P HELX_P57  57  GLY B 271 ? SER B 275 ? GLY B 270 SER B 274 5 ? 5  
HELX_P HELX_P58  58  SER B 278 ? ILE B 280 ? SER B 277 ILE B 279 5 ? 3  
HELX_P HELX_P59  59  GLY B 281 ? GLY B 289 ? GLY B 280 GLY B 288 1 ? 9  
HELX_P HELX_P60  60  GLY B 289 ? THR B 310 ? GLY B 288 THR B 309 1 ? 22 
HELX_P HELX_P61  61  PRO B 311 ? LYS B 314 ? PRO B 310 LYS B 313 5 ? 4  
HELX_P HELX_P62  62  ASN B 315 ? CYS B 330 ? ASN B 314 CYS B 329 1 ? 16 
HELX_P HELX_P63  63  ASP B 342 ? HIS B 346 ? ASP B 341 HIS B 345 5 ? 5  
HELX_P HELX_P64  64  ARG B 347 ? GLY B 361 ? ARG B 346 GLY B 360 1 ? 15 
HELX_P HELX_P65  65  ASN B 386 ? ALA B 390 ? ASN B 385 ALA B 389 5 ? 5  
HELX_P HELX_P66  66  PHE B 391 ? GLY B 398 ? PHE B 390 GLY B 397 1 ? 8  
HELX_P HELX_P67  67  PRO B 415 ? LYS B 418 ? PRO B 414 LYS B 417 5 ? 4  
HELX_P HELX_P68  68  GLY B 419 ? GLY B 439 ? GLY B 418 GLY B 438 1 ? 21 
HELX_P HELX_P69  69  SER B 441 ? ALA B 452 ? SER B 440 ALA B 451 1 ? 12 
HELX_P HELX_P70  70  SER B 455 ? LEU B 463 ? SER B 454 LEU B 462 1 ? 9  
HELX_P HELX_P71  71  PRO B 464 ? VAL B 467 ? PRO B 463 VAL B 466 5 ? 4  
HELX_P HELX_P72  72  THR B 483 ? ASP B 506 ? THR B 482 ASP B 505 1 ? 24 
HELX_P HELX_P73  73  GLN B 512 ? GLY B 514 ? GLN B 511 GLY B 513 5 ? 3  
HELX_P HELX_P74  74  VAL B 515 ? ASP B 530 ? VAL B 514 ASP B 529 1 ? 16 
HELX_P HELX_P75  75  ASP B 539 ? ARG B 553 ? ASP B 538 ARG B 552 1 ? 15 
HELX_P HELX_P76  76  ASP C 7   ? ARG C 21  ? ASP C 6   ARG C 20  1 ? 15 
HELX_P HELX_P77  77  SER C 22  ? LEU C 24  ? SER C 21  LEU C 23  5 ? 3  
HELX_P HELX_P78  78  ASN C 25  ? ASN C 33  ? ASN C 24  ASN C 32  1 ? 9  
HELX_P HELX_P79  79  ASP C 35  ? PHE C 40  ? ASP C 34  PHE C 39  1 ? 6  
HELX_P HELX_P80  80  THR C 61  ? ARG C 75  ? THR C 60  ARG C 74  1 ? 15 
HELX_P HELX_P81  81  GLY C 76  ? ASN C 86  ? GLY C 75  ASN C 85  1 ? 11 
HELX_P HELX_P82  82  LEU C 99  ? ARG C 104 ? LEU C 98  ARG C 103 1 ? 6  
HELX_P HELX_P83  83  VAL C 118 ? GLY C 139 ? VAL C 117 GLY C 138 1 ? 22 
HELX_P HELX_P84  84  ILE C 157 ? SER C 160 ? ILE C 156 SER C 159 5 ? 4  
HELX_P HELX_P85  85  ASP C 161 ? LEU C 171 ? ASP C 160 LEU C 170 1 ? 11 
HELX_P HELX_P86  86  LYS C 172 ? SER C 175 ? LYS C 171 SER C 174 5 ? 4  
HELX_P HELX_P87  87  ASP C 188 ? ALA C 197 ? ASP C 187 ALA C 196 1 ? 10 
HELX_P HELX_P88  88  GLN C 198 ? LEU C 199 ? GLN C 197 LEU C 198 5 ? 2  
HELX_P HELX_P89  89  ASN C 200 ? GLU C 202 ? ASN C 199 GLU C 201 5 ? 3  
HELX_P HELX_P90  90  THR C 215 ? ALA C 233 ? THR C 214 ALA C 232 1 ? 19 
HELX_P HELX_P91  91  ASP C 235 ? LYS C 241 ? ASP C 234 LYS C 240 5 ? 7  
HELX_P HELX_P92  92  ASN C 249 ? GLY C 257 ? ASN C 248 GLY C 256 1 ? 9  
HELX_P HELX_P93  93  ASP C 259 ? ASN C 262 ? ASP C 258 ASN C 261 5 ? 4  
HELX_P HELX_P94  94  GLY C 271 ? SER C 275 ? GLY C 270 SER C 274 5 ? 5  
HELX_P HELX_P95  95  SER C 278 ? ILE C 280 ? SER C 277 ILE C 279 5 ? 3  
HELX_P HELX_P96  96  GLY C 281 ? GLY C 289 ? GLY C 280 GLY C 288 1 ? 9  
HELX_P HELX_P97  97  GLY C 289 ? THR C 310 ? GLY C 288 THR C 309 1 ? 22 
HELX_P HELX_P98  98  PRO C 311 ? LYS C 314 ? PRO C 310 LYS C 313 5 ? 4  
HELX_P HELX_P99  99  ASN C 315 ? CYS C 330 ? ASN C 314 CYS C 329 1 ? 16 
HELX_P HELX_P100 100 ASP C 342 ? HIS C 346 ? ASP C 341 HIS C 345 5 ? 5  
HELX_P HELX_P101 101 ARG C 347 ? GLY C 361 ? ARG C 346 GLY C 360 1 ? 15 
HELX_P HELX_P102 102 ASN C 386 ? ALA C 390 ? ASN C 385 ALA C 389 5 ? 5  
HELX_P HELX_P103 103 PHE C 391 ? GLY C 398 ? PHE C 390 GLY C 397 1 ? 8  
HELX_P HELX_P104 104 ILE C 416 ? LYS C 418 ? ILE C 415 LYS C 417 5 ? 3  
HELX_P HELX_P105 105 GLY C 419 ? GLY C 439 ? GLY C 418 GLY C 438 1 ? 21 
HELX_P HELX_P106 106 SER C 441 ? GLY C 453 ? SER C 440 GLY C 452 1 ? 13 
HELX_P HELX_P107 107 SER C 455 ? LEU C 463 ? SER C 454 LEU C 462 1 ? 9  
HELX_P HELX_P108 108 PRO C 464 ? VAL C 467 ? PRO C 463 VAL C 466 5 ? 4  
HELX_P HELX_P109 109 THR C 483 ? ASP C 506 ? THR C 482 ASP C 505 1 ? 24 
HELX_P HELX_P110 110 GLN C 512 ? GLY C 514 ? GLN C 511 GLY C 513 5 ? 3  
HELX_P HELX_P111 111 VAL C 515 ? ASP C 530 ? VAL C 514 ASP C 529 1 ? 16 
HELX_P HELX_P112 112 ASP C 539 ? ARG C 553 ? ASP C 538 ARG C 552 1 ? 15 
HELX_P HELX_P113 113 ASP D 7   ? ARG D 21  ? ASP D 6   ARG D 20  1 ? 15 
HELX_P HELX_P114 114 SER D 22  ? LEU D 24  ? SER D 21  LEU D 23  5 ? 3  
HELX_P HELX_P115 115 ASN D 25  ? ASN D 33  ? ASN D 24  ASN D 32  1 ? 9  
HELX_P HELX_P116 116 ASP D 35  ? PHE D 40  ? ASP D 34  PHE D 39  1 ? 6  
HELX_P HELX_P117 117 THR D 61  ? ARG D 75  ? THR D 60  ARG D 74  1 ? 15 
HELX_P HELX_P118 118 GLY D 76  ? ASN D 86  ? GLY D 75  ASN D 85  1 ? 11 
HELX_P HELX_P119 119 LEU D 99  ? ARG D 104 ? LEU D 98  ARG D 103 1 ? 6  
HELX_P HELX_P120 120 VAL D 118 ? SER D 138 ? VAL D 117 SER D 137 1 ? 21 
HELX_P HELX_P121 121 ILE D 157 ? SER D 160 ? ILE D 156 SER D 159 5 ? 4  
HELX_P HELX_P122 122 ASP D 161 ? LEU D 171 ? ASP D 160 LEU D 170 1 ? 11 
HELX_P HELX_P123 123 LYS D 172 ? SER D 175 ? LYS D 171 SER D 174 5 ? 4  
HELX_P HELX_P124 124 ASP D 188 ? ALA D 197 ? ASP D 187 ALA D 196 1 ? 10 
HELX_P HELX_P125 125 GLN D 198 ? LEU D 199 ? GLN D 197 LEU D 198 5 ? 2  
HELX_P HELX_P126 126 ASN D 200 ? GLU D 202 ? ASN D 199 GLU D 201 5 ? 3  
HELX_P HELX_P127 127 THR D 215 ? ALA D 233 ? THR D 214 ALA D 232 1 ? 19 
HELX_P HELX_P128 128 ASP D 235 ? LYS D 241 ? ASP D 234 LYS D 240 5 ? 7  
HELX_P HELX_P129 129 ASN D 249 ? PHE D 256 ? ASN D 248 PHE D 255 1 ? 8  
HELX_P HELX_P130 130 ASP D 259 ? GLN D 261 ? ASP D 258 GLN D 260 5 ? 3  
HELX_P HELX_P131 131 GLY D 271 ? SER D 275 ? GLY D 270 SER D 274 5 ? 5  
HELX_P HELX_P132 132 SER D 278 ? ILE D 280 ? SER D 277 ILE D 279 5 ? 3  
HELX_P HELX_P133 133 GLY D 281 ? GLY D 289 ? GLY D 280 GLY D 288 1 ? 9  
HELX_P HELX_P134 134 GLY D 289 ? THR D 310 ? GLY D 288 THR D 309 1 ? 22 
HELX_P HELX_P135 135 PRO D 311 ? LYS D 314 ? PRO D 310 LYS D 313 5 ? 4  
HELX_P HELX_P136 136 ASN D 315 ? CYS D 330 ? ASN D 314 CYS D 329 1 ? 16 
HELX_P HELX_P137 137 ASP D 342 ? HIS D 346 ? ASP D 341 HIS D 345 5 ? 5  
HELX_P HELX_P138 138 ARG D 347 ? GLY D 361 ? ARG D 346 GLY D 360 1 ? 15 
HELX_P HELX_P139 139 ASN D 386 ? ALA D 390 ? ASN D 385 ALA D 389 5 ? 5  
HELX_P HELX_P140 140 PHE D 391 ? GLY D 398 ? PHE D 390 GLY D 397 1 ? 8  
HELX_P HELX_P141 141 ILE D 416 ? LYS D 418 ? ILE D 415 LYS D 417 5 ? 3  
HELX_P HELX_P142 142 GLY D 419 ? GLY D 439 ? GLY D 418 GLY D 438 1 ? 21 
HELX_P HELX_P143 143 SER D 441 ? GLY D 453 ? SER D 440 GLY D 452 1 ? 13 
HELX_P HELX_P144 144 SER D 455 ? LEU D 463 ? SER D 454 LEU D 462 1 ? 9  
HELX_P HELX_P145 145 PRO D 464 ? VAL D 467 ? PRO D 463 VAL D 466 5 ? 4  
HELX_P HELX_P146 146 THR D 483 ? ASP D 506 ? THR D 482 ASP D 505 1 ? 24 
HELX_P HELX_P147 147 GLN D 512 ? GLY D 514 ? GLN D 511 GLY D 513 5 ? 3  
HELX_P HELX_P148 148 VAL D 515 ? GLU D 526 ? VAL D 514 GLU D 525 1 ? 12 
HELX_P HELX_P149 149 PRO D 527 ? LEU D 529 ? PRO D 526 LEU D 528 5 ? 3  
HELX_P HELX_P150 150 ASP D 539 ? ARG D 553 ? ASP D 538 ARG D 552 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 2 ? 
C ? 4 ? 
D ? 6 ? 
E ? 2 ? 
F ? 4 ? 
G ? 6 ? 
H ? 4 ? 
I ? 6 ? 
J ? 2 ? 
K ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
B 1 2 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? parallel      
C 3 4 ? parallel      
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? parallel      
D 4 5 ? parallel      
D 5 6 ? parallel      
E 1 2 ? anti-parallel 
F 1 2 ? parallel      
F 2 3 ? parallel      
F 3 4 ? parallel      
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? parallel      
G 4 5 ? parallel      
G 5 6 ? parallel      
H 1 2 ? parallel      
H 2 3 ? parallel      
H 3 4 ? parallel      
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
I 3 4 ? parallel      
I 4 5 ? parallel      
I 5 6 ? parallel      
J 1 2 ? anti-parallel 
K 1 2 ? parallel      
K 2 3 ? parallel      
K 3 4 ? parallel      
K 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER A 41  ? ASN A 45  ? SER A 40  ASN A 44  
A 2 HIS A 50  ? ASP A 54  ? HIS A 49  ASP A 53  
A 3 THR A 474 ? LYS A 481 ? THR A 473 LYS A 480 
A 4 CYS A 404 ? GLN A 411 ? CYS A 403 GLN A 410 
A 5 THR A 335 ? PRO A 340 ? THR A 334 PRO A 339 
A 6 ILE A 378 ? TRP A 380 ? ILE A 377 TRP A 379 
B 1 LEU A 112 ? VAL A 113 ? LEU A 111 VAL A 112 
B 2 LYS A 116 ? ASP A 117 ? LYS A 115 ASP A 116 
C 1 ARG A 180 ? VAL A 184 ? ARG A 179 VAL A 183 
C 2 ASP A 151 ? ILE A 155 ? ASP A 150 ILE A 154 
C 3 SER A 204 ? ALA A 209 ? SER A 203 ALA A 208 
C 4 PHE A 243 ? LEU A 246 ? PHE A 242 LEU A 245 
D 1 SER B 41  ? ASN B 45  ? SER B 40  ASN B 44  
D 2 HIS B 50  ? ASP B 54  ? HIS B 49  ASP B 53  
D 3 THR B 474 ? LYS B 481 ? THR B 473 LYS B 480 
D 4 CYS B 404 ? GLN B 411 ? CYS B 403 GLN B 410 
D 5 THR B 335 ? PRO B 340 ? THR B 334 PRO B 339 
D 6 ILE B 378 ? TRP B 380 ? ILE B 377 TRP B 379 
E 1 LEU B 112 ? VAL B 113 ? LEU B 111 VAL B 112 
E 2 LYS B 116 ? ASP B 117 ? LYS B 115 ASP B 116 
F 1 ARG B 180 ? VAL B 184 ? ARG B 179 VAL B 183 
F 2 ASP B 151 ? ILE B 155 ? ASP B 150 ILE B 154 
F 3 SER B 204 ? ALA B 209 ? SER B 203 ALA B 208 
F 4 PHE B 243 ? LEU B 246 ? PHE B 242 LEU B 245 
G 1 SER C 41  ? ASN C 45  ? SER C 40  ASN C 44  
G 2 HIS C 50  ? ASP C 54  ? HIS C 49  ASP C 53  
G 3 THR C 474 ? LYS C 481 ? THR C 473 LYS C 480 
G 4 CYS C 404 ? GLN C 411 ? CYS C 403 GLN C 410 
G 5 THR C 335 ? PRO C 340 ? THR C 334 PRO C 339 
G 6 ILE C 378 ? TRP C 380 ? ILE C 377 TRP C 379 
H 1 ARG C 180 ? VAL C 184 ? ARG C 179 VAL C 183 
H 2 ASP C 151 ? ILE C 155 ? ASP C 150 ILE C 154 
H 3 SER C 204 ? ALA C 209 ? SER C 203 ALA C 208 
H 4 PHE C 243 ? LEU C 246 ? PHE C 242 LEU C 245 
I 1 SER D 41  ? ASN D 45  ? SER D 40  ASN D 44  
I 2 HIS D 50  ? ASP D 54  ? HIS D 49  ASP D 53  
I 3 THR D 474 ? LYS D 481 ? THR D 473 LYS D 480 
I 4 CYS D 404 ? GLN D 411 ? CYS D 403 GLN D 410 
I 5 THR D 335 ? PRO D 340 ? THR D 334 PRO D 339 
I 6 ILE D 378 ? TRP D 380 ? ILE D 377 TRP D 379 
J 1 LEU D 112 ? VAL D 113 ? LEU D 111 VAL D 112 
J 2 LYS D 116 ? ASP D 117 ? LYS D 115 ASP D 116 
K 1 ARG D 180 ? VAL D 184 ? ARG D 179 VAL D 183 
K 2 ASP D 151 ? ILE D 155 ? ASP D 150 ILE D 154 
K 3 SER D 204 ? ALA D 209 ? SER D 203 ALA D 208 
K 4 PHE D 243 ? LEU D 246 ? PHE D 242 LEU D 245 
K 5 MET D 263 ? PHE D 264 ? MET D 262 PHE D 263 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 44  ? N LEU A 43  O ILE A 51  ? O ILE A 50  
A 2 3 N ASP A 54  ? N ASP A 53  O SER A 476 ? O SER A 475 
A 3 4 N ASN A 475 ? N ASN A 474 O CYS A 404 ? O CYS A 403 
A 4 5 N ASP A 405 ? N ASP A 404 O ALA A 337 ? O ALA A 336 
A 5 6 N HIS A 336 ? N HIS A 335 O ILE A 378 ? O ILE A 377 
B 1 2 N VAL A 113 ? N VAL A 112 O LYS A 116 ? O LYS A 115 
C 1 2 O ARG A 180 ? O ARG A 179 N VAL A 152 ? N VAL A 151 
C 2 3 N ILE A 153 ? N ILE A 152 O LEU A 205 ? O LEU A 204 
C 3 4 N ILE A 208 ? N ILE A 207 O VAL A 244 ? O VAL A 243 
D 1 2 N LEU B 44  ? N LEU B 43  O ILE B 51  ? O ILE B 50  
D 2 3 N ASP B 54  ? N ASP B 53  O SER B 476 ? O SER B 475 
D 3 4 N ASN B 475 ? N ASN B 474 O CYS B 404 ? O CYS B 403 
D 4 5 N ASP B 405 ? N ASP B 404 O ALA B 337 ? O ALA B 336 
D 5 6 N HIS B 336 ? N HIS B 335 O ILE B 378 ? O ILE B 377 
E 1 2 N VAL B 113 ? N VAL B 112 O LYS B 116 ? O LYS B 115 
F 1 2 O ARG B 180 ? O ARG B 179 N VAL B 152 ? N VAL B 151 
F 2 3 N ILE B 153 ? N ILE B 152 O LEU B 205 ? O LEU B 204 
F 3 4 N ILE B 208 ? N ILE B 207 O VAL B 244 ? O VAL B 243 
G 1 2 N LEU C 44  ? N LEU C 43  O ILE C 51  ? O ILE C 50  
G 2 3 N ASP C 54  ? N ASP C 53  O SER C 476 ? O SER C 475 
G 3 4 N ASN C 475 ? N ASN C 474 O CYS C 404 ? O CYS C 403 
G 4 5 N ASP C 405 ? N ASP C 404 O ALA C 337 ? O ALA C 336 
G 5 6 N HIS C 336 ? N HIS C 335 O ILE C 378 ? O ILE C 377 
H 1 2 O ARG C 180 ? O ARG C 179 N VAL C 152 ? N VAL C 151 
H 2 3 O ASP C 151 ? O ASP C 150 N LEU C 205 ? N LEU C 204 
H 3 4 O PHE C 206 ? O PHE C 205 N VAL C 244 ? N VAL C 243 
I 1 2 N LEU D 44  ? N LEU D 43  O ILE D 51  ? O ILE D 50  
I 2 3 N ASP D 54  ? N ASP D 53  O SER D 476 ? O SER D 475 
I 3 4 N ASN D 475 ? N ASN D 474 O CYS D 404 ? O CYS D 403 
I 4 5 N ASP D 405 ? N ASP D 404 O ALA D 337 ? O ALA D 336 
I 5 6 N HIS D 336 ? N HIS D 335 O ILE D 378 ? O ILE D 377 
J 1 2 N VAL D 113 ? N VAL D 112 O LYS D 116 ? O LYS D 115 
K 1 2 O ARG D 180 ? O ARG D 179 N VAL D 152 ? N VAL D 151 
K 2 3 N ILE D 153 ? N ILE D 152 O LEU D 205 ? O LEU D 204 
K 3 4 N ILE D 208 ? N ILE D 207 O VAL D 244 ? O VAL D 243 
K 4 5 O ALA D 245 ? O ALA D 244 N PHE D 264 ? N PHE D 263 
# 
_atom_sites.entry_id                    1JLH 
_atom_sites.fract_transf_matrix[1][1]   0.012384 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009257 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003689 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . ALA A 1 2   ? -10.030 -0.886  72.500  1.00 31.59 ? 1   ALA A N   1 
ATOM   2     C CA  . ALA A 1 2   ? -9.031  0.032   71.875  1.00 30.49 ? 1   ALA A CA  1 
ATOM   3     C C   . ALA A 1 2   ? -8.873  -0.286  70.392  1.00 29.05 ? 1   ALA A C   1 
ATOM   4     O O   . ALA A 1 2   ? -9.087  -1.423  69.966  1.00 28.15 ? 1   ALA A O   1 
ATOM   5     C CB  . ALA A 1 2   ? -7.680  -0.091  72.588  1.00 27.95 ? 1   ALA A CB  1 
ATOM   6     N N   . ALA A 1 3   ? -8.497  0.727   69.616  1.00 27.81 ? 2   ALA A N   1 
ATOM   7     C CA  . ALA A 1 3   ? -8.318  0.575   68.177  1.00 27.96 ? 2   ALA A CA  1 
ATOM   8     C C   . ALA A 1 3   ? -7.401  -0.583  67.801  1.00 28.89 ? 2   ALA A C   1 
ATOM   9     O O   . ALA A 1 3   ? -7.759  -1.423  66.972  1.00 31.34 ? 2   ALA A O   1 
ATOM   10    C CB  . ALA A 1 3   ? -7.785  1.870   67.583  1.00 27.77 ? 2   ALA A CB  1 
ATOM   11    N N   . LEU A 1 4   ? -6.222  -0.638  68.409  1.00 27.60 ? 3   LEU A N   1 
ATOM   12    C CA  . LEU A 1 4   ? -5.269  -1.694  68.089  1.00 28.17 ? 3   LEU A CA  1 
ATOM   13    C C   . LEU A 1 4   ? -5.815  -3.111  68.253  1.00 27.58 ? 3   LEU A C   1 
ATOM   14    O O   . LEU A 1 4   ? -5.666  -3.947  67.365  1.00 24.93 ? 3   LEU A O   1 
ATOM   15    C CB  . LEU A 1 4   ? -4.001  -1.540  68.929  1.00 24.86 ? 3   LEU A CB  1 
ATOM   16    C CG  . LEU A 1 4   ? -2.962  -2.633  68.668  1.00 24.71 ? 3   LEU A CG  1 
ATOM   17    C CD1 . LEU A 1 4   ? -2.532  -2.598  67.205  1.00 23.86 ? 3   LEU A CD1 1 
ATOM   18    C CD2 . LEU A 1 4   ? -1.771  -2.440  69.593  1.00 24.51 ? 3   LEU A CD2 1 
ATOM   19    N N   . THR A 1 5   ? -6.431  -3.374  69.400  1.00 29.47 ? 4   THR A N   1 
ATOM   20    C CA  . THR A 1 5   ? -6.996  -4.687  69.696  1.00 32.17 ? 4   THR A CA  1 
ATOM   21    C C   . THR A 1 5   ? -8.055  -5.074  68.672  1.00 31.02 ? 4   THR A C   1 
ATOM   22    O O   . THR A 1 5   ? -8.249  -6.255  68.385  1.00 29.14 ? 4   THR A O   1 
ATOM   23    C CB  . THR A 1 5   ? -7.665  -4.707  71.085  1.00 33.75 ? 4   THR A CB  1 
ATOM   24    O OG1 . THR A 1 5   ? -6.717  -4.310  72.079  1.00 39.37 ? 4   THR A OG1 1 
ATOM   25    C CG2 . THR A 1 5   ? -8.173  -6.106  71.412  1.00 37.34 ? 4   THR A CG2 1 
ATOM   26    N N   . ARG A 1 6   ? -8.741  -4.070  68.133  1.00 30.83 ? 5   ARG A N   1 
ATOM   27    C CA  . ARG A 1 6   ? -9.797  -4.299  67.156  1.00 31.34 ? 5   ARG A CA  1 
ATOM   28    C C   . ARG A 1 6   ? -9.285  -4.406  65.728  1.00 31.01 ? 5   ARG A C   1 
ATOM   29    O O   . ARG A 1 6   ? -10.042 -4.749  64.824  1.00 31.29 ? 5   ARG A O   1 
ATOM   30    C CB  . ARG A 1 6   ? -10.835 -3.177  67.228  1.00 34.14 ? 5   ARG A CB  1 
ATOM   31    C CG  . ARG A 1 6   ? -11.660 -3.154  68.505  1.00 38.26 ? 5   ARG A CG  1 
ATOM   32    C CD  . ARG A 1 6   ? -12.609 -1.968  68.507  1.00 42.76 ? 5   ARG A CD  1 
ATOM   33    N NE  . ARG A 1 6   ? -11.878 -0.711  68.359  1.00 50.68 ? 5   ARG A NE  1 
ATOM   34    C CZ  . ARG A 1 6   ? -12.440 0.494   68.354  1.00 52.60 ? 5   ARG A CZ  1 
ATOM   35    N NH1 . ARG A 1 6   ? -13.756 0.615   68.489  1.00 54.96 ? 5   ARG A NH1 1 
ATOM   36    N NH2 . ARG A 1 6   ? -11.685 1.579   68.221  1.00 52.51 ? 5   ARG A NH2 1 
ATOM   37    N N   . ASP A 1 7   ? -8.008  -4.111  65.515  1.00 30.04 ? 6   ASP A N   1 
ATOM   38    C CA  . ASP A 1 7   ? -7.452  -4.179  64.167  1.00 28.55 ? 6   ASP A CA  1 
ATOM   39    C C   . ASP A 1 7   ? -7.303  -5.628  63.700  1.00 27.87 ? 6   ASP A C   1 
ATOM   40    O O   . ASP A 1 7   ? -6.715  -6.456  64.397  1.00 27.64 ? 6   ASP A O   1 
ATOM   41    C CB  . ASP A 1 7   ? -6.096  -3.483  64.117  1.00 26.59 ? 6   ASP A CB  1 
ATOM   42    C CG  . ASP A 1 7   ? -5.562  -3.367  62.709  1.00 27.08 ? 6   ASP A CG  1 
ATOM   43    O OD1 . ASP A 1 7   ? -5.736  -2.294  62.094  1.00 22.39 ? 6   ASP A OD1 1 
ATOM   44    O OD2 . ASP A 1 7   ? -4.984  -4.358  62.216  1.00 24.69 ? 6   ASP A OD2 1 
ATOM   45    N N   . PRO A 1 8   ? -7.834  -5.948  62.505  1.00 29.44 ? 7   PRO A N   1 
ATOM   46    C CA  . PRO A 1 8   ? -7.783  -7.292  61.910  1.00 29.16 ? 7   PRO A CA  1 
ATOM   47    C C   . PRO A 1 8   ? -6.361  -7.772  61.630  1.00 28.24 ? 7   PRO A C   1 
ATOM   48    O O   . PRO A 1 8   ? -6.065  -8.965  61.733  1.00 26.78 ? 7   PRO A O   1 
ATOM   49    C CB  . PRO A 1 8   ? -8.597  -7.137  60.621  1.00 29.61 ? 7   PRO A CB  1 
ATOM   50    C CG  . PRO A 1 8   ? -9.522  -5.998  60.930  1.00 32.20 ? 7   PRO A CG  1 
ATOM   51    C CD  . PRO A 1 8   ? -8.602  -5.037  61.641  1.00 30.04 ? 7   PRO A CD  1 
ATOM   52    N N   . GLN A 1 9   ? -5.487  -6.840  61.259  1.00 28.16 ? 8   GLN A N   1 
ATOM   53    C CA  . GLN A 1 9   ? -4.099  -7.187  60.980  1.00 27.74 ? 8   GLN A CA  1 
ATOM   54    C C   . GLN A 1 9   ? -3.401  -7.519  62.285  1.00 26.87 ? 8   GLN A C   1 
ATOM   55    O O   . GLN A 1 9   ? -2.561  -8.417  62.337  1.00 26.56 ? 8   GLN A O   1 
ATOM   56    C CB  . GLN A 1 9   ? -3.382  -6.036  60.270  1.00 27.38 ? 8   GLN A CB  1 
ATOM   57    C CG  . GLN A 1 9   ? -3.957  -5.737  58.898  1.00 32.70 ? 8   GLN A CG  1 
ATOM   58    C CD  . GLN A 1 9   ? -4.262  -7.005  58.113  1.00 36.33 ? 8   GLN A CD  1 
ATOM   59    O OE1 . GLN A 1 9   ? -3.361  -7.784  57.784  1.00 37.65 ? 8   GLN A OE1 1 
ATOM   60    N NE2 . GLN A 1 9   ? -5.543  -7.224  57.819  1.00 37.26 ? 8   GLN A NE2 1 
ATOM   61    N N   . PHE A 1 10  ? -3.748  -6.798  63.345  1.00 26.49 ? 9   PHE A N   1 
ATOM   62    C CA  . PHE A 1 10  ? -3.138  -7.080  64.632  1.00 26.64 ? 9   PHE A CA  1 
ATOM   63    C C   . PHE A 1 10  ? -3.645  -8.443  65.090  1.00 26.89 ? 9   PHE A C   1 
ATOM   64    O O   . PHE A 1 10  ? -2.869  -9.286  65.551  1.00 26.18 ? 9   PHE A O   1 
ATOM   65    C CB  . PHE A 1 10  ? -3.508  -6.021  65.670  1.00 24.95 ? 9   PHE A CB  1 
ATOM   66    C CG  . PHE A 1 10  ? -2.939  -6.301  67.031  1.00 25.30 ? 9   PHE A CG  1 
ATOM   67    C CD1 . PHE A 1 10  ? -1.564  -6.314  67.232  1.00 25.47 ? 9   PHE A CD1 1 
ATOM   68    C CD2 . PHE A 1 10  ? -3.776  -6.605  68.101  1.00 25.41 ? 9   PHE A CD2 1 
ATOM   69    C CE1 . PHE A 1 10  ? -1.026  -6.629  68.479  1.00 25.45 ? 9   PHE A CE1 1 
ATOM   70    C CE2 . PHE A 1 10  ? -3.250  -6.921  69.351  1.00 26.24 ? 9   PHE A CE2 1 
ATOM   71    C CZ  . PHE A 1 10  ? -1.868  -6.934  69.539  1.00 26.61 ? 9   PHE A CZ  1 
ATOM   72    N N   . GLN A 1 11  ? -4.953  -8.653  64.956  1.00 26.41 ? 10  GLN A N   1 
ATOM   73    C CA  . GLN A 1 11  ? -5.564  -9.920  65.349  1.00 27.07 ? 10  GLN A CA  1 
ATOM   74    C C   . GLN A 1 11  ? -4.930  -11.077 64.586  1.00 25.28 ? 10  GLN A C   1 
ATOM   75    O O   . GLN A 1 11  ? -4.703  -12.151 65.142  1.00 26.57 ? 10  GLN A O   1 
ATOM   76    C CB  . GLN A 1 11  ? -7.081  -9.867  65.111  1.00 27.56 ? 10  GLN A CB  1 
ATOM   77    C CG  . GLN A 1 11  ? -7.803  -8.985  66.121  1.00 28.88 ? 10  GLN A CG  1 
ATOM   78    C CD  . GLN A 1 11  ? -9.288  -8.802  65.832  1.00 32.80 ? 10  GLN A CD  1 
ATOM   79    O OE1 . GLN A 1 11  ? -10.029 -8.282  66.671  1.00 34.62 ? 10  GLN A OE1 1 
ATOM   80    N NE2 . GLN A 1 11  ? -9.725  -9.211  64.646  1.00 31.11 ? 10  GLN A NE2 1 
ATOM   81    N N   . LYS A 1 12  ? -4.631  -10.846 63.313  1.00 26.33 ? 11  LYS A N   1 
ATOM   82    C CA  . LYS A 1 12  ? -3.997  -11.859 62.472  1.00 29.31 ? 11  LYS A CA  1 
ATOM   83    C C   . LYS A 1 12  ? -2.601  -12.181 63.015  1.00 29.02 ? 11  LYS A C   1 
ATOM   84    O O   . LYS A 1 12  ? -2.206  -13.344 63.098  1.00 28.00 ? 11  LYS A O   1 
ATOM   85    C CB  . LYS A 1 12  ? -3.894  -11.341 61.034  1.00 30.85 ? 11  LYS A CB  1 
ATOM   86    C CG  . LYS A 1 12  ? -3.323  -12.323 60.031  1.00 34.14 ? 11  LYS A CG  1 
ATOM   87    C CD  . LYS A 1 12  ? -3.399  -11.741 58.627  1.00 39.30 ? 11  LYS A CD  1 
ATOM   88    C CE  . LYS A 1 12  ? -2.876  -12.712 57.578  1.00 42.59 ? 11  LYS A CE  1 
ATOM   89    N NZ  . LYS A 1 12  ? -3.018  -12.159 56.196  1.00 44.04 ? 11  LYS A NZ  1 
ATOM   90    N N   . LEU A 1 13  ? -1.867  -11.134 63.383  1.00 28.86 ? 12  LEU A N   1 
ATOM   91    C CA  . LEU A 1 13  ? -0.523  -11.267 63.935  1.00 29.23 ? 12  LEU A CA  1 
ATOM   92    C C   . LEU A 1 13  ? -0.535  -12.062 65.227  1.00 30.15 ? 12  LEU A C   1 
ATOM   93    O O   . LEU A 1 13  ? 0.279   -12.954 65.435  1.00 28.79 ? 12  LEU A O   1 
ATOM   94    C CB  . LEU A 1 13  ? 0.057   -9.889  64.250  1.00 32.22 ? 12  LEU A CB  1 
ATOM   95    C CG  . LEU A 1 13  ? 1.149   -9.283  63.378  1.00 33.60 ? 12  LEU A CG  1 
ATOM   96    C CD1 . LEU A 1 13  ? 1.547   -7.942  63.980  1.00 36.22 ? 12  LEU A CD1 1 
ATOM   97    C CD2 . LEU A 1 13  ? 2.351   -10.210 63.315  1.00 33.91 ? 12  LEU A CD2 1 
ATOM   98    N N   . GLN A 1 14  ? -1.464  -11.713 66.106  1.00 31.89 ? 13  GLN A N   1 
ATOM   99    C CA  . GLN A 1 14  ? -1.566  -12.368 67.399  1.00 34.10 ? 13  GLN A CA  1 
ATOM   100   C C   . GLN A 1 14  ? -1.978  -13.838 67.288  1.00 33.89 ? 13  GLN A C   1 
ATOM   101   O O   . GLN A 1 14  ? -1.571  -14.663 68.104  1.00 33.89 ? 13  GLN A O   1 
ATOM   102   C CB  . GLN A 1 14  ? -2.539  -11.585 68.285  1.00 35.69 ? 13  GLN A CB  1 
ATOM   103   C CG  . GLN A 1 14  ? -2.300  -11.760 69.768  1.00 39.76 ? 13  GLN A CG  1 
ATOM   104   C CD  . GLN A 1 14  ? -2.716  -10.540 70.565  1.00 42.46 ? 13  GLN A CD  1 
ATOM   105   O OE1 . GLN A 1 14  ? -3.857  -10.079 70.471  1.00 41.78 ? 13  GLN A OE1 1 
ATOM   106   N NE2 . GLN A 1 14  ? -1.788  -10.008 71.357  1.00 42.42 ? 13  GLN A NE2 1 
ATOM   107   N N   . GLN A 1 15  ? -2.772  -14.168 66.274  1.00 35.19 ? 14  GLN A N   1 
ATOM   108   C CA  . GLN A 1 15  ? -3.202  -15.550 66.084  1.00 35.24 ? 14  GLN A CA  1 
ATOM   109   C C   . GLN A 1 15  ? -2.049  -16.376 65.533  1.00 33.27 ? 14  GLN A C   1 
ATOM   110   O O   . GLN A 1 15  ? -1.880  -17.540 65.889  1.00 33.57 ? 14  GLN A O   1 
ATOM   111   C CB  . GLN A 1 15  ? -4.395  -15.628 65.126  1.00 37.62 ? 14  GLN A CB  1 
ATOM   112   C CG  . GLN A 1 15  ? -4.851  -17.062 64.842  1.00 44.14 ? 14  GLN A CG  1 
ATOM   113   C CD  . GLN A 1 15  ? -6.197  -17.130 64.136  1.00 48.63 ? 14  GLN A CD  1 
ATOM   114   O OE1 . GLN A 1 15  ? -7.210  -16.657 64.661  1.00 50.77 ? 14  GLN A OE1 1 
ATOM   115   N NE2 . GLN A 1 15  ? -6.216  -17.722 62.942  1.00 49.47 ? 14  GLN A NE2 1 
ATOM   116   N N   . TRP A 1 16  ? -1.258  -15.771 64.654  1.00 31.59 ? 15  TRP A N   1 
ATOM   117   C CA  . TRP A 1 16  ? -0.113  -16.461 64.080  1.00 28.64 ? 15  TRP A CA  1 
ATOM   118   C C   . TRP A 1 16  ? 0.834   -16.762 65.231  1.00 29.44 ? 15  TRP A C   1 
ATOM   119   O O   . TRP A 1 16  ? 1.338   -17.882 65.367  1.00 28.45 ? 15  TRP A O   1 
ATOM   120   C CB  . TRP A 1 16  ? 0.595   -15.567 63.064  1.00 27.37 ? 15  TRP A CB  1 
ATOM   121   C CG  . TRP A 1 16  ? 1.679   -16.260 62.286  1.00 24.64 ? 15  TRP A CG  1 
ATOM   122   C CD1 . TRP A 1 16  ? 1.556   -16.848 61.058  1.00 26.65 ? 15  TRP A CD1 1 
ATOM   123   C CD2 . TRP A 1 16  ? 3.046   -16.441 62.681  1.00 23.35 ? 15  TRP A CD2 1 
ATOM   124   N NE1 . TRP A 1 16  ? 2.761   -17.381 60.662  1.00 26.38 ? 15  TRP A NE1 1 
ATOM   125   C CE2 . TRP A 1 16  ? 3.692   -17.147 61.638  1.00 25.44 ? 15  TRP A CE2 1 
ATOM   126   C CE3 . TRP A 1 16  ? 3.787   -16.076 63.812  1.00 24.30 ? 15  TRP A CE3 1 
ATOM   127   C CZ2 . TRP A 1 16  ? 5.049   -17.497 61.693  1.00 24.52 ? 15  TRP A CZ2 1 
ATOM   128   C CZ3 . TRP A 1 16  ? 5.140   -16.425 63.869  1.00 25.42 ? 15  TRP A CZ3 1 
ATOM   129   C CH2 . TRP A 1 16  ? 5.754   -17.130 62.812  1.00 25.07 ? 15  TRP A CH2 1 
ATOM   130   N N   . TYR A 1 17  ? 1.061   -15.749 66.064  1.00 28.53 ? 16  TYR A N   1 
ATOM   131   C CA  . TYR A 1 17  ? 1.951   -15.876 67.211  1.00 29.17 ? 16  TYR A CA  1 
ATOM   132   C C   . TYR A 1 17  ? 1.536   -17.010 68.137  1.00 30.13 ? 16  TYR A C   1 
ATOM   133   O O   . TYR A 1 17  ? 2.370   -17.803 68.563  1.00 27.38 ? 16  TYR A O   1 
ATOM   134   C CB  . TYR A 1 17  ? 2.004   -14.556 67.985  1.00 26.93 ? 16  TYR A CB  1 
ATOM   135   C CG  . TYR A 1 17  ? 2.680   -14.648 69.338  1.00 25.08 ? 16  TYR A CG  1 
ATOM   136   C CD1 . TYR A 1 17  ? 1.938   -14.871 70.497  1.00 26.23 ? 16  TYR A CD1 1 
ATOM   137   C CD2 . TYR A 1 17  ? 4.061   -14.500 69.460  1.00 24.99 ? 16  TYR A CD2 1 
ATOM   138   C CE1 . TYR A 1 17  ? 2.557   -14.940 71.754  1.00 25.59 ? 16  TYR A CE1 1 
ATOM   139   C CE2 . TYR A 1 17  ? 4.689   -14.570 70.705  1.00 25.18 ? 16  TYR A CE2 1 
ATOM   140   C CZ  . TYR A 1 17  ? 3.929   -14.788 71.847  1.00 25.03 ? 16  TYR A CZ  1 
ATOM   141   O OH  . TYR A 1 17  ? 4.543   -14.854 73.074  1.00 28.09 ? 16  TYR A OH  1 
ATOM   142   N N   . ARG A 1 18  ? 0.247   -17.085 68.450  1.00 34.21 ? 17  ARG A N   1 
ATOM   143   C CA  . ARG A 1 18  ? -0.241  -18.138 69.332  1.00 38.28 ? 17  ARG A CA  1 
ATOM   144   C C   . ARG A 1 18  ? -0.032  -19.527 68.733  1.00 39.28 ? 17  ARG A C   1 
ATOM   145   O O   . ARG A 1 18  ? 0.077   -20.511 69.460  1.00 39.68 ? 17  ARG A O   1 
ATOM   146   C CB  . ARG A 1 18  ? -1.730  -17.936 69.645  1.00 41.01 ? 17  ARG A CB  1 
ATOM   147   C CG  . ARG A 1 18  ? -2.017  -16.860 70.688  1.00 44.15 ? 17  ARG A CG  1 
ATOM   148   C CD  . ARG A 1 18  ? -3.439  -16.980 71.228  1.00 47.12 ? 17  ARG A CD  1 
ATOM   149   N NE  . ARG A 1 18  ? -4.451  -16.615 70.239  1.00 49.42 ? 17  ARG A NE  1 
ATOM   150   C CZ  . ARG A 1 18  ? -4.702  -15.367 69.852  1.00 50.04 ? 17  ARG A CZ  1 
ATOM   151   N NH1 . ARG A 1 18  ? -4.015  -14.359 70.373  1.00 49.98 ? 17  ARG A NH1 1 
ATOM   152   N NH2 . ARG A 1 18  ? -5.639  -15.127 68.942  1.00 48.86 ? 17  ARG A NH2 1 
ATOM   153   N N   . GLU A 1 19  ? 0.036   -19.600 67.408  1.00 40.29 ? 18  GLU A N   1 
ATOM   154   C CA  . GLU A 1 19  ? 0.208   -20.877 66.726  1.00 42.41 ? 18  GLU A CA  1 
ATOM   155   C C   . GLU A 1 19  ? 1.651   -21.285 66.438  1.00 43.06 ? 18  GLU A C   1 
ATOM   156   O O   . GLU A 1 19  ? 1.983   -22.468 66.506  1.00 43.14 ? 18  GLU A O   1 
ATOM   157   C CB  . GLU A 1 19  ? -0.575  -20.875 65.412  1.00 43.25 ? 18  GLU A CB  1 
ATOM   158   C CG  . GLU A 1 19  ? -2.078  -20.735 65.576  1.00 46.02 ? 18  GLU A CG  1 
ATOM   159   C CD  . GLU A 1 19  ? -2.806  -20.760 64.246  1.00 48.75 ? 18  GLU A CD  1 
ATOM   160   O OE1 . GLU A 1 19  ? -2.564  -21.701 63.462  1.00 50.42 ? 18  GLU A OE1 1 
ATOM   161   O OE2 . GLU A 1 19  ? -3.619  -19.847 63.983  1.00 50.89 ? 18  GLU A OE2 1 
ATOM   162   N N   . HIS A 1 20  ? 2.509   -20.320 66.123  1.00 42.75 ? 19  HIS A N   1 
ATOM   163   C CA  . HIS A 1 20  ? 3.892   -20.645 65.798  1.00 43.56 ? 19  HIS A CA  1 
ATOM   164   C C   . HIS A 1 20  ? 4.934   -20.091 66.762  1.00 44.21 ? 19  HIS A C   1 
ATOM   165   O O   . HIS A 1 20  ? 6.126   -20.104 66.461  1.00 44.64 ? 19  HIS A O   1 
ATOM   166   C CB  . HIS A 1 20  ? 4.203   -20.166 64.380  1.00 43.72 ? 19  HIS A CB  1 
ATOM   167   C CG  . HIS A 1 20  ? 3.142   -20.512 63.382  1.00 46.11 ? 19  HIS A CG  1 
ATOM   168   N ND1 . HIS A 1 20  ? 1.928   -19.859 63.328  1.00 47.66 ? 19  HIS A ND1 1 
ATOM   169   C CD2 . HIS A 1 20  ? 3.106   -21.449 62.405  1.00 46.59 ? 19  HIS A CD2 1 
ATOM   170   C CE1 . HIS A 1 20  ? 1.192   -20.377 62.361  1.00 46.02 ? 19  HIS A CE1 1 
ATOM   171   N NE2 . HIS A 1 20  ? 1.883   -21.343 61.786  1.00 46.46 ? 19  HIS A NE2 1 
ATOM   172   N N   . ARG A 1 21  ? 4.494   -19.618 67.922  1.00 44.90 ? 20  ARG A N   1 
ATOM   173   C CA  . ARG A 1 21  ? 5.411   -19.055 68.908  1.00 46.33 ? 20  ARG A CA  1 
ATOM   174   C C   . ARG A 1 21  ? 6.580   -19.991 69.187  1.00 46.46 ? 20  ARG A C   1 
ATOM   175   O O   . ARG A 1 21  ? 7.732   -19.660 68.902  1.00 45.40 ? 20  ARG A O   1 
ATOM   176   C CB  . ARG A 1 21  ? 4.669   -18.760 70.214  1.00 47.44 ? 20  ARG A CB  1 
ATOM   177   C CG  . ARG A 1 21  ? 5.390   -17.782 71.126  1.00 52.41 ? 20  ARG A CG  1 
ATOM   178   C CD  . ARG A 1 21  ? 5.996   -18.444 72.358  1.00 55.19 ? 20  ARG A CD  1 
ATOM   179   N NE  . ARG A 1 21  ? 6.695   -17.467 73.192  1.00 57.11 ? 20  ARG A NE  1 
ATOM   180   C CZ  . ARG A 1 21  ? 7.273   -17.745 74.358  1.00 58.47 ? 20  ARG A CZ  1 
ATOM   181   N NH1 . ARG A 1 21  ? 7.239   -18.982 74.840  1.00 58.68 ? 20  ARG A NH1 1 
ATOM   182   N NH2 . ARG A 1 21  ? 7.890   -16.786 75.040  1.00 57.09 ? 20  ARG A NH2 1 
ATOM   183   N N   . SER A 1 22  ? 6.275   -21.163 69.737  1.00 46.79 ? 21  SER A N   1 
ATOM   184   C CA  . SER A 1 22  ? 7.296   -22.153 70.067  1.00 47.67 ? 21  SER A CA  1 
ATOM   185   C C   . SER A 1 22  ? 7.946   -22.759 68.827  1.00 46.79 ? 21  SER A C   1 
ATOM   186   O O   . SER A 1 22  ? 8.585   -23.805 68.899  1.00 47.91 ? 21  SER A O   1 
ATOM   187   C CB  . SER A 1 22  ? 6.687   -23.265 70.929  1.00 49.07 ? 21  SER A CB  1 
ATOM   188   O OG  . SER A 1 22  ? 5.580   -23.868 70.281  1.00 50.46 ? 21  SER A OG  1 
ATOM   189   N N   . GLU A 1 23  ? 7.786   -22.089 67.694  1.00 46.09 ? 22  GLU A N   1 
ATOM   190   C CA  . GLU A 1 23  ? 8.355   -22.547 66.433  1.00 45.57 ? 22  GLU A CA  1 
ATOM   191   C C   . GLU A 1 23  ? 9.549   -21.673 66.052  1.00 43.86 ? 22  GLU A C   1 
ATOM   192   O O   . GLU A 1 23  ? 10.416  -22.089 65.290  1.00 44.71 ? 22  GLU A O   1 
ATOM   193   C CB  . GLU A 1 23  ? 7.277   -22.481 65.347  1.00 48.89 ? 22  GLU A CB  1 
ATOM   194   C CG  . GLU A 1 23  ? 7.722   -22.829 63.938  1.00 52.31 ? 22  GLU A CG  1 
ATOM   195   C CD  . GLU A 1 23  ? 6.585   -22.683 62.934  1.00 54.99 ? 22  GLU A CD  1 
ATOM   196   O OE1 . GLU A 1 23  ? 5.546   -23.361 63.111  1.00 54.96 ? 22  GLU A OE1 1 
ATOM   197   O OE2 . GLU A 1 23  ? 6.727   -21.888 61.976  1.00 55.87 ? 22  GLU A OE2 1 
ATOM   198   N N   . LEU A 1 24  ? 9.589   -20.465 66.607  1.00 41.15 ? 23  LEU A N   1 
ATOM   199   C CA  . LEU A 1 24  ? 10.656  -19.503 66.337  1.00 37.63 ? 23  LEU A CA  1 
ATOM   200   C C   . LEU A 1 24  ? 11.924  -19.742 67.164  1.00 36.62 ? 23  LEU A C   1 
ATOM   201   O O   . LEU A 1 24  ? 11.939  -19.527 68.377  1.00 36.10 ? 23  LEU A O   1 
ATOM   202   C CB  . LEU A 1 24  ? 10.144  -18.085 66.608  1.00 37.63 ? 23  LEU A CB  1 
ATOM   203   C CG  . LEU A 1 24  ? 8.924   -17.617 65.810  1.00 36.63 ? 23  LEU A CG  1 
ATOM   204   C CD1 . LEU A 1 24  ? 8.215   -16.496 66.553  1.00 35.07 ? 23  LEU A CD1 1 
ATOM   205   C CD2 . LEU A 1 24  ? 9.366   -17.172 64.424  1.00 35.68 ? 23  LEU A CD2 1 
ATOM   206   N N   . ASN A 1 25  ? 12.986  -20.187 66.502  1.00 33.00 ? 24  ASN A N   1 
ATOM   207   C CA  . ASN A 1 25  ? 14.257  -20.429 67.171  1.00 30.39 ? 24  ASN A CA  1 
ATOM   208   C C   . ASN A 1 25  ? 15.367  -19.866 66.292  1.00 30.65 ? 24  ASN A C   1 
ATOM   209   O O   . ASN A 1 25  ? 15.575  -20.323 65.163  1.00 29.36 ? 24  ASN A O   1 
ATOM   210   C CB  . ASN A 1 25  ? 14.467  -21.929 67.408  1.00 29.26 ? 24  ASN A CB  1 
ATOM   211   C CG  . ASN A 1 25  ? 15.788  -22.227 68.092  1.00 26.92 ? 24  ASN A CG  1 
ATOM   212   O OD1 . ASN A 1 25  ? 16.806  -22.442 67.435  1.00 25.11 ? 24  ASN A OD1 1 
ATOM   213   N ND2 . ASN A 1 25  ? 15.781  -22.217 69.423  1.00 26.52 ? 24  ASN A ND2 1 
ATOM   214   N N   . LEU A 1 26  ? 16.073  -18.865 66.810  1.00 29.06 ? 25  LEU A N   1 
ATOM   215   C CA  . LEU A 1 26  ? 17.135  -18.215 66.053  1.00 28.40 ? 25  LEU A CA  1 
ATOM   216   C C   . LEU A 1 26  ? 18.172  -19.164 65.456  1.00 28.67 ? 25  LEU A C   1 
ATOM   217   O O   . LEU A 1 26  ? 18.469  -19.079 64.264  1.00 28.31 ? 25  LEU A O   1 
ATOM   218   C CB  . LEU A 1 26  ? 17.814  -17.146 66.917  1.00 26.46 ? 25  LEU A CB  1 
ATOM   219   C CG  . LEU A 1 26  ? 16.892  -15.949 67.206  1.00 25.92 ? 25  LEU A CG  1 
ATOM   220   C CD1 . LEU A 1 26  ? 17.484  -15.058 68.284  1.00 24.79 ? 25  LEU A CD1 1 
ATOM   221   C CD2 . LEU A 1 26  ? 16.675  -15.161 65.919  1.00 26.40 ? 25  LEU A CD2 1 
ATOM   222   N N   . ARG A 1 27  ? 18.721  -20.067 66.261  1.00 29.07 ? 26  ARG A N   1 
ATOM   223   C CA  . ARG A 1 27  ? 19.716  -20.996 65.737  1.00 30.03 ? 26  ARG A CA  1 
ATOM   224   C C   . ARG A 1 27  ? 19.202  -21.741 64.519  1.00 28.85 ? 26  ARG A C   1 
ATOM   225   O O   . ARG A 1 27  ? 19.897  -21.853 63.511  1.00 29.15 ? 26  ARG A O   1 
ATOM   226   C CB  . ARG A 1 27  ? 20.127  -22.027 66.787  1.00 33.15 ? 26  ARG A CB  1 
ATOM   227   C CG  . ARG A 1 27  ? 21.379  -21.681 67.555  1.00 34.98 ? 26  ARG A CG  1 
ATOM   228   C CD  . ARG A 1 27  ? 22.169  -22.938 67.865  1.00 35.54 ? 26  ARG A CD  1 
ATOM   229   N NE  . ARG A 1 27  ? 22.927  -22.808 69.102  1.00 39.43 ? 26  ARG A NE  1 
ATOM   230   C CZ  . ARG A 1 27  ? 23.841  -23.678 69.519  1.00 39.09 ? 26  ARG A CZ  1 
ATOM   231   N NH1 . ARG A 1 27  ? 24.121  -24.751 68.789  1.00 40.11 ? 26  ARG A NH1 1 
ATOM   232   N NH2 . ARG A 1 27  ? 24.468  -23.478 70.671  1.00 37.62 ? 26  ARG A NH2 1 
ATOM   233   N N   . ARG A 1 28  ? 17.982  -22.256 64.611  1.00 28.11 ? 27  ARG A N   1 
ATOM   234   C CA  . ARG A 1 28  ? 17.412  -23.004 63.501  1.00 29.83 ? 27  ARG A CA  1 
ATOM   235   C C   . ARG A 1 28  ? 17.082  -22.115 62.306  1.00 28.47 ? 27  ARG A C   1 
ATOM   236   O O   . ARG A 1 28  ? 17.262  -22.521 61.158  1.00 27.27 ? 27  ARG A O   1 
ATOM   237   C CB  . ARG A 1 28  ? 16.166  -23.772 63.960  1.00 31.92 ? 27  ARG A CB  1 
ATOM   238   C CG  . ARG A 1 28  ? 16.474  -24.902 64.948  1.00 36.79 ? 27  ARG A CG  1 
ATOM   239   C CD  . ARG A 1 28  ? 15.266  -25.799 65.157  1.00 39.57 ? 27  ARG A CD  1 
ATOM   240   N NE  . ARG A 1 28  ? 14.159  -25.087 65.787  1.00 43.26 ? 27  ARG A NE  1 
ATOM   241   C CZ  . ARG A 1 28  ? 12.878  -25.306 65.508  1.00 45.71 ? 27  ARG A CZ  1 
ATOM   242   N NH1 . ARG A 1 28  ? 12.544  -26.218 64.604  1.00 49.34 ? 27  ARG A NH1 1 
ATOM   243   N NH2 . ARG A 1 28  ? 11.931  -24.613 66.130  1.00 46.91 ? 27  ARG A NH2 1 
ATOM   244   N N   . LEU A 1 29  ? 16.602  -20.904 62.578  1.00 28.19 ? 28  LEU A N   1 
ATOM   245   C CA  . LEU A 1 29  ? 16.264  -19.973 61.510  1.00 26.18 ? 28  LEU A CA  1 
ATOM   246   C C   . LEU A 1 29  ? 17.487  -19.657 60.668  1.00 24.60 ? 28  LEU A C   1 
ATOM   247   O O   . LEU A 1 29  ? 17.419  -19.671 59.436  1.00 25.00 ? 28  LEU A O   1 
ATOM   248   C CB  . LEU A 1 29  ? 15.676  -18.684 62.092  1.00 27.46 ? 28  LEU A CB  1 
ATOM   249   C CG  . LEU A 1 29  ? 14.225  -18.816 62.558  1.00 26.87 ? 28  LEU A CG  1 
ATOM   250   C CD1 . LEU A 1 29  ? 13.799  -17.591 63.338  1.00 27.22 ? 28  LEU A CD1 1 
ATOM   251   C CD2 . LEU A 1 29  ? 13.336  -19.024 61.340  1.00 27.53 ? 28  LEU A CD2 1 
ATOM   252   N N   . PHE A 1 30  ? 18.612  -19.385 61.323  1.00 25.00 ? 29  PHE A N   1 
ATOM   253   C CA  . PHE A 1 30  ? 19.832  -19.077 60.587  1.00 26.30 ? 29  PHE A CA  1 
ATOM   254   C C   . PHE A 1 30  ? 20.404  -20.302 59.880  1.00 29.22 ? 29  PHE A C   1 
ATOM   255   O O   . PHE A 1 30  ? 20.892  -20.200 58.754  1.00 30.08 ? 29  PHE A O   1 
ATOM   256   C CB  . PHE A 1 30  ? 20.891  -18.460 61.506  1.00 25.14 ? 29  PHE A CB  1 
ATOM   257   C CG  . PHE A 1 30  ? 20.727  -16.975 61.706  1.00 23.70 ? 29  PHE A CG  1 
ATOM   258   C CD1 . PHE A 1 30  ? 19.953  -16.477 62.749  1.00 24.20 ? 29  PHE A CD1 1 
ATOM   259   C CD2 . PHE A 1 30  ? 21.327  -16.074 60.830  1.00 22.94 ? 29  PHE A CD2 1 
ATOM   260   C CE1 . PHE A 1 30  ? 19.776  -15.097 62.919  1.00 24.21 ? 29  PHE A CE1 1 
ATOM   261   C CE2 . PHE A 1 30  ? 21.156  -14.697 60.989  1.00 23.34 ? 29  PHE A CE2 1 
ATOM   262   C CZ  . PHE A 1 30  ? 20.378  -14.208 62.038  1.00 22.58 ? 29  PHE A CZ  1 
ATOM   263   N N   . ASP A 1 31  ? 20.338  -21.459 60.527  1.00 31.88 ? 30  ASP A N   1 
ATOM   264   C CA  . ASP A 1 31  ? 20.856  -22.680 59.919  1.00 35.73 ? 30  ASP A CA  1 
ATOM   265   C C   . ASP A 1 31  ? 20.083  -23.059 58.658  1.00 35.66 ? 30  ASP A C   1 
ATOM   266   O O   . ASP A 1 31  ? 20.647  -23.621 57.724  1.00 35.24 ? 30  ASP A O   1 
ATOM   267   C CB  . ASP A 1 31  ? 20.810  -23.834 60.922  1.00 40.83 ? 30  ASP A CB  1 
ATOM   268   C CG  . ASP A 1 31  ? 21.979  -23.811 61.888  1.00 44.54 ? 30  ASP A CG  1 
ATOM   269   O OD1 . ASP A 1 31  ? 22.157  -22.800 62.599  1.00 49.11 ? 30  ASP A OD1 1 
ATOM   270   O OD2 . ASP A 1 31  ? 22.724  -24.810 61.934  1.00 49.40 ? 30  ASP A OD2 1 
ATOM   271   N N   . ALA A 1 32  ? 18.792  -22.736 58.634  1.00 35.91 ? 31  ALA A N   1 
ATOM   272   C CA  . ALA A 1 32  ? 17.945  -23.047 57.491  1.00 34.62 ? 31  ALA A CA  1 
ATOM   273   C C   . ALA A 1 32  ? 17.995  -21.980 56.394  1.00 34.28 ? 31  ALA A C   1 
ATOM   274   O O   . ALA A 1 32  ? 17.654  -22.254 55.246  1.00 33.66 ? 31  ALA A O   1 
ATOM   275   C CB  . ALA A 1 32  ? 16.509  -23.245 57.955  1.00 35.56 ? 31  ALA A CB  1 
ATOM   276   N N   . ASN A 1 33  ? 18.416  -20.767 56.741  1.00 34.15 ? 32  ASN A N   1 
ATOM   277   C CA  . ASN A 1 33  ? 18.489  -19.684 55.760  1.00 32.80 ? 32  ASN A CA  1 
ATOM   278   C C   . ASN A 1 33  ? 19.830  -18.943 55.806  1.00 33.39 ? 32  ASN A C   1 
ATOM   279   O O   . ASN A 1 33  ? 19.993  -17.978 56.555  1.00 35.33 ? 32  ASN A O   1 
ATOM   280   C CB  . ASN A 1 33  ? 17.331  -18.702 55.986  1.00 29.69 ? 32  ASN A CB  1 
ATOM   281   C CG  . ASN A 1 33  ? 17.331  -17.549 54.993  1.00 28.81 ? 32  ASN A CG  1 
ATOM   282   O OD1 . ASN A 1 33  ? 18.089  -17.546 54.020  1.00 26.96 ? 32  ASN A OD1 1 
ATOM   283   N ND2 . ASN A 1 33  ? 16.470  -16.565 55.232  1.00 27.26 ? 32  ASN A ND2 1 
ATOM   284   N N   . LYS A 1 34  ? 20.780  -19.394 54.991  1.00 32.85 ? 33  LYS A N   1 
ATOM   285   C CA  . LYS A 1 34  ? 22.105  -18.786 54.937  1.00 33.59 ? 33  LYS A CA  1 
ATOM   286   C C   . LYS A 1 34  ? 22.074  -17.331 54.464  1.00 32.31 ? 33  LYS A C   1 
ATOM   287   O O   . LYS A 1 34  ? 23.058  -16.605 54.606  1.00 31.36 ? 33  LYS A O   1 
ATOM   288   C CB  . LYS A 1 34  ? 23.023  -19.596 54.019  1.00 36.51 ? 33  LYS A CB  1 
ATOM   289   C CG  . LYS A 1 34  ? 22.606  -19.583 52.552  1.00 40.87 ? 33  LYS A CG  1 
ATOM   290   C CD  . LYS A 1 34  ? 23.615  -20.331 51.685  1.00 43.66 ? 33  LYS A CD  1 
ATOM   291   C CE  . LYS A 1 34  ? 23.120  -20.468 50.255  1.00 44.57 ? 33  LYS A CE  1 
ATOM   292   N NZ  . LYS A 1 34  ? 21.810  -21.181 50.212  1.00 45.25 ? 33  LYS A NZ  1 
ATOM   293   N N   . ASP A 1 35  ? 20.947  -16.911 53.899  1.00 32.22 ? 34  ASP A N   1 
ATOM   294   C CA  . ASP A 1 35  ? 20.797  -15.541 53.418  1.00 32.86 ? 34  ASP A CA  1 
ATOM   295   C C   . ASP A 1 35  ? 19.940  -14.698 54.348  1.00 30.76 ? 34  ASP A C   1 
ATOM   296   O O   . ASP A 1 35  ? 19.415  -13.661 53.943  1.00 30.96 ? 34  ASP A O   1 
ATOM   297   C CB  . ASP A 1 35  ? 20.159  -15.533 52.034  1.00 37.21 ? 34  ASP A CB  1 
ATOM   298   C CG  . ASP A 1 35  ? 21.163  -15.746 50.939  1.00 41.31 ? 34  ASP A CG  1 
ATOM   299   O OD1 . ASP A 1 35  ? 22.061  -14.886 50.793  1.00 43.36 ? 34  ASP A OD1 1 
ATOM   300   O OD2 . ASP A 1 35  ? 21.057  -16.772 50.233  1.00 43.59 ? 34  ASP A OD2 1 
ATOM   301   N N   . ARG A 1 36  ? 19.802  -15.138 55.593  1.00 27.35 ? 35  ARG A N   1 
ATOM   302   C CA  . ARG A 1 36  ? 18.976  -14.422 56.550  1.00 23.97 ? 35  ARG A CA  1 
ATOM   303   C C   . ARG A 1 36  ? 19.427  -12.975 56.779  1.00 22.90 ? 35  ARG A C   1 
ATOM   304   O O   . ARG A 1 36  ? 18.595  -12.076 56.879  1.00 22.03 ? 35  ARG A O   1 
ATOM   305   C CB  . ARG A 1 36  ? 18.928  -15.191 57.875  1.00 22.29 ? 35  ARG A CB  1 
ATOM   306   C CG  . ARG A 1 36  ? 17.812  -14.732 58.803  1.00 22.44 ? 35  ARG A CG  1 
ATOM   307   C CD  . ARG A 1 36  ? 17.713  -15.594 60.054  1.00 22.61 ? 35  ARG A CD  1 
ATOM   308   N NE  . ARG A 1 36  ? 16.889  -14.952 61.071  1.00 22.67 ? 35  ARG A NE  1 
ATOM   309   C CZ  . ARG A 1 36  ? 15.569  -14.812 61.000  1.00 22.23 ? 35  ARG A CZ  1 
ATOM   310   N NH1 . ARG A 1 36  ? 14.897  -15.279 59.957  1.00 23.68 ? 35  ARG A NH1 1 
ATOM   311   N NH2 . ARG A 1 36  ? 14.922  -14.183 61.970  1.00 24.36 ? 35  ARG A NH2 1 
ATOM   312   N N   . PHE A 1 37  ? 20.735  -12.749 56.858  1.00 21.96 ? 36  PHE A N   1 
ATOM   313   C CA  . PHE A 1 37  ? 21.265  -11.401 57.067  1.00 22.41 ? 36  PHE A CA  1 
ATOM   314   C C   . PHE A 1 37  ? 20.847  -10.466 55.927  1.00 23.65 ? 36  PHE A C   1 
ATOM   315   O O   . PHE A 1 37  ? 20.462  -9.319  56.158  1.00 20.65 ? 36  PHE A O   1 
ATOM   316   C CB  . PHE A 1 37  ? 22.796  -11.438 57.166  1.00 21.76 ? 36  PHE A CB  1 
ATOM   317   C CG  . PHE A 1 37  ? 23.440  -10.077 57.125  1.00 21.71 ? 36  PHE A CG  1 
ATOM   318   C CD1 . PHE A 1 37  ? 23.439  -9.254  58.246  1.00 22.56 ? 36  PHE A CD1 1 
ATOM   319   C CD2 . PHE A 1 37  ? 24.023  -9.608  55.954  1.00 22.00 ? 36  PHE A CD2 1 
ATOM   320   C CE1 . PHE A 1 37  ? 24.007  -7.984  58.202  1.00 22.39 ? 36  PHE A CE1 1 
ATOM   321   C CE2 . PHE A 1 37  ? 24.595  -8.339  55.897  1.00 21.73 ? 36  PHE A CE2 1 
ATOM   322   C CZ  . PHE A 1 37  ? 24.585  -7.526  57.028  1.00 23.35 ? 36  PHE A CZ  1 
ATOM   323   N N   . ASN A 1 38  ? 20.932  -10.954 54.693  1.00 23.39 ? 37  ASN A N   1 
ATOM   324   C CA  . ASN A 1 38  ? 20.552  -10.136 53.550  1.00 26.08 ? 37  ASN A CA  1 
ATOM   325   C C   . ASN A 1 38  ? 19.057  -9.829  53.567  1.00 24.71 ? 37  ASN A C   1 
ATOM   326   O O   . ASN A 1 38  ? 18.638  -8.715  53.268  1.00 23.81 ? 37  ASN A O   1 
ATOM   327   C CB  . ASN A 1 38  ? 20.908  -10.842 52.239  1.00 29.70 ? 37  ASN A CB  1 
ATOM   328   C CG  . ASN A 1 38  ? 22.400  -11.013 52.058  1.00 34.66 ? 37  ASN A CG  1 
ATOM   329   O OD1 . ASN A 1 38  ? 23.170  -10.064 52.241  1.00 37.29 ? 37  ASN A OD1 1 
ATOM   330   N ND2 . ASN A 1 38  ? 22.822  -12.223 51.688  1.00 36.73 ? 37  ASN A ND2 1 
ATOM   331   N N   . HIS A 1 39  ? 18.258  -10.825 53.928  1.00 24.71 ? 38  HIS A N   1 
ATOM   332   C CA  . HIS A 1 39  ? 16.808  -10.664 53.965  1.00 25.36 ? 38  HIS A CA  1 
ATOM   333   C C   . HIS A 1 39  ? 16.323  -9.709  55.049  1.00 23.38 ? 38  HIS A C   1 
ATOM   334   O O   . HIS A 1 39  ? 15.333  -9.008  54.853  1.00 22.38 ? 38  HIS A O   1 
ATOM   335   C CB  . HIS A 1 39  ? 16.128  -12.025 54.164  1.00 26.36 ? 38  HIS A CB  1 
ATOM   336   C CG  . HIS A 1 39  ? 16.387  -13.002 53.059  1.00 30.30 ? 38  HIS A CG  1 
ATOM   337   N ND1 . HIS A 1 39  ? 15.935  -14.304 53.096  1.00 32.13 ? 38  HIS A ND1 1 
ATOM   338   C CD2 . HIS A 1 39  ? 17.053  -12.869 51.887  1.00 29.77 ? 38  HIS A CD2 1 
ATOM   339   C CE1 . HIS A 1 39  ? 16.312  -14.930 51.995  1.00 30.54 ? 38  HIS A CE1 1 
ATOM   340   N NE2 . HIS A 1 39  ? 16.992  -14.082 51.245  1.00 29.86 ? 38  HIS A NE2 1 
ATOM   341   N N   . PHE A 1 40  ? 17.015  -9.671  56.185  1.00 21.53 ? 39  PHE A N   1 
ATOM   342   C CA  . PHE A 1 40  ? 16.579  -8.812  57.276  1.00 21.33 ? 39  PHE A CA  1 
ATOM   343   C C   . PHE A 1 40  ? 17.572  -7.760  57.759  1.00 19.63 ? 39  PHE A C   1 
ATOM   344   O O   . PHE A 1 40  ? 17.868  -7.672  58.947  1.00 18.08 ? 39  PHE A O   1 
ATOM   345   C CB  . PHE A 1 40  ? 16.133  -9.675  58.458  1.00 22.69 ? 39  PHE A CB  1 
ATOM   346   C CG  . PHE A 1 40  ? 15.108  -10.707 58.097  1.00 23.12 ? 39  PHE A CG  1 
ATOM   347   C CD1 . PHE A 1 40  ? 15.434  -12.060 58.102  1.00 23.54 ? 39  PHE A CD1 1 
ATOM   348   C CD2 . PHE A 1 40  ? 13.823  -10.328 57.728  1.00 24.74 ? 39  PHE A CD2 1 
ATOM   349   C CE1 . PHE A 1 40  ? 14.491  -13.027 57.742  1.00 26.25 ? 39  PHE A CE1 1 
ATOM   350   C CE2 . PHE A 1 40  ? 12.868  -11.286 57.366  1.00 27.56 ? 39  PHE A CE2 1 
ATOM   351   C CZ  . PHE A 1 40  ? 13.203  -12.639 57.373  1.00 25.00 ? 39  PHE A CZ  1 
ATOM   352   N N   . SER A 1 41  ? 18.084  -6.958  56.836  1.00 19.83 ? 40  SER A N   1 
ATOM   353   C CA  . SER A 1 41  ? 19.011  -5.896  57.201  1.00 19.58 ? 40  SER A CA  1 
ATOM   354   C C   . SER A 1 41  ? 18.874  -4.768  56.185  1.00 21.69 ? 40  SER A C   1 
ATOM   355   O O   . SER A 1 41  ? 18.517  -4.999  55.027  1.00 21.77 ? 40  SER A O   1 
ATOM   356   C CB  . SER A 1 41  ? 20.458  -6.410  57.224  1.00 17.92 ? 40  SER A CB  1 
ATOM   357   O OG  . SER A 1 41  ? 20.943  -6.660  55.916  1.00 17.13 ? 40  SER A OG  1 
ATOM   358   N N   . LEU A 1 42  ? 19.141  -3.546  56.631  1.00 20.90 ? 41  LEU A N   1 
ATOM   359   C CA  . LEU A 1 42  ? 19.066  -2.380  55.760  1.00 19.13 ? 41  LEU A CA  1 
ATOM   360   C C   . LEU A 1 42  ? 20.432  -1.695  55.760  1.00 19.64 ? 41  LEU A C   1 
ATOM   361   O O   . LEU A 1 42  ? 21.093  -1.609  56.790  1.00 17.40 ? 41  LEU A O   1 
ATOM   362   C CB  . LEU A 1 42  ? 18.028  -1.384  56.288  1.00 20.53 ? 41  LEU A CB  1 
ATOM   363   C CG  . LEU A 1 42  ? 16.615  -1.871  56.622  1.00 21.60 ? 41  LEU A CG  1 
ATOM   364   C CD1 . LEU A 1 42  ? 15.893  -0.793  57.405  1.00 20.07 ? 41  LEU A CD1 1 
ATOM   365   C CD2 . LEU A 1 42  ? 15.857  -2.228  55.341  1.00 19.26 ? 41  LEU A CD2 1 
ATOM   366   N N   . THR A 1 43  ? 20.860  -1.221  54.600  1.00 19.74 ? 42  THR A N   1 
ATOM   367   C CA  . THR A 1 43  ? 22.114  -0.498  54.514  1.00 22.97 ? 42  THR A CA  1 
ATOM   368   C C   . THR A 1 43  ? 21.772  0.869   53.935  1.00 22.27 ? 42  THR A C   1 
ATOM   369   O O   . THR A 1 43  ? 21.313  0.974   52.800  1.00 20.99 ? 42  THR A O   1 
ATOM   370   C CB  . THR A 1 43  ? 23.124  -1.215  53.616  1.00 23.73 ? 42  THR A CB  1 
ATOM   371   O OG1 . THR A 1 43  ? 22.524  -1.483  52.346  1.00 30.09 ? 42  THR A OG1 1 
ATOM   372   C CG2 . THR A 1 43  ? 23.557  -2.518  54.259  1.00 23.16 ? 42  THR A CG2 1 
ATOM   373   N N   . LEU A 1 44  ? 21.982  1.905   54.742  1.00 21.57 ? 43  LEU A N   1 
ATOM   374   C CA  . LEU A 1 44  ? 21.687  3.280   54.357  1.00 20.03 ? 43  LEU A CA  1 
ATOM   375   C C   . LEU A 1 44  ? 22.941  4.121   54.090  1.00 20.62 ? 43  LEU A C   1 
ATOM   376   O O   . LEU A 1 44  ? 23.828  4.204   54.940  1.00 20.65 ? 43  LEU A O   1 
ATOM   377   C CB  . LEU A 1 44  ? 20.882  3.955   55.470  1.00 20.75 ? 43  LEU A CB  1 
ATOM   378   C CG  . LEU A 1 44  ? 19.585  3.288   55.934  1.00 20.42 ? 43  LEU A CG  1 
ATOM   379   C CD1 . LEU A 1 44  ? 18.953  4.132   57.026  1.00 20.77 ? 43  LEU A CD1 1 
ATOM   380   C CD2 . LEU A 1 44  ? 18.628  3.144   54.757  1.00 21.27 ? 43  LEU A CD2 1 
ATOM   381   N N   . ASN A 1 45  ? 23.008  4.744   52.914  1.00 18.16 ? 44  ASN A N   1 
ATOM   382   C CA  . ASN A 1 45  ? 24.132  5.609   52.578  1.00 19.22 ? 44  ASN A CA  1 
ATOM   383   C C   . ASN A 1 45  ? 23.653  7.060   52.684  1.00 18.81 ? 44  ASN A C   1 
ATOM   384   O O   . ASN A 1 45  ? 22.877  7.519   51.849  1.00 19.91 ? 44  ASN A O   1 
ATOM   385   C CB  . ASN A 1 45  ? 24.631  5.349   51.153  1.00 18.44 ? 44  ASN A CB  1 
ATOM   386   C CG  . ASN A 1 45  ? 25.849  6.202   50.796  1.00 21.01 ? 44  ASN A CG  1 
ATOM   387   O OD1 . ASN A 1 45  ? 26.334  6.181   49.657  1.00 21.71 ? 44  ASN A OD1 1 
ATOM   388   N ND2 . ASN A 1 45  ? 26.350  6.953   51.773  1.00 16.44 ? 44  ASN A ND2 1 
ATOM   389   N N   . THR A 1 46  ? 24.115  7.774   53.707  1.00 18.38 ? 45  THR A N   1 
ATOM   390   C CA  . THR A 1 46  ? 23.726  9.170   53.914  1.00 18.46 ? 45  THR A CA  1 
ATOM   391   C C   . THR A 1 46  ? 24.641  10.128  53.154  1.00 18.97 ? 45  THR A C   1 
ATOM   392   O O   . THR A 1 46  ? 24.391  11.332  53.119  1.00 17.67 ? 45  THR A O   1 
ATOM   393   C CB  . THR A 1 46  ? 23.796  9.559   55.413  1.00 17.04 ? 45  THR A CB  1 
ATOM   394   O OG1 . THR A 1 46  ? 25.162  9.529   55.852  1.00 18.86 ? 45  THR A OG1 1 
ATOM   395   C CG2 . THR A 1 46  ? 22.989  8.583   56.265  1.00 17.35 ? 45  THR A CG2 1 
ATOM   396   N N   . ASN A 1 47  ? 25.691  9.573   52.549  1.00 17.67 ? 46  ASN A N   1 
ATOM   397   C CA  . ASN A 1 47  ? 26.714  10.325  51.821  1.00 18.61 ? 46  ASN A CA  1 
ATOM   398   C C   . ASN A 1 47  ? 27.728  10.902  52.799  1.00 19.28 ? 46  ASN A C   1 
ATOM   399   O O   . ASN A 1 47  ? 28.752  11.448  52.394  1.00 19.74 ? 46  ASN A O   1 
ATOM   400   C CB  . ASN A 1 47  ? 26.127  11.455  50.975  1.00 19.51 ? 46  ASN A CB  1 
ATOM   401   C CG  . ASN A 1 47  ? 25.513  10.956  49.697  1.00 22.30 ? 46  ASN A CG  1 
ATOM   402   O OD1 . ASN A 1 47  ? 25.961  9.957   49.124  1.00 22.81 ? 46  ASN A OD1 1 
ATOM   403   N ND2 . ASN A 1 47  ? 24.488  11.651  49.228  1.00 19.79 ? 46  ASN A ND2 1 
ATOM   404   N N   . HIS A 1 48  ? 27.428  10.777  54.087  1.00 20.47 ? 47  HIS A N   1 
ATOM   405   C CA  . HIS A 1 48  ? 28.312  11.248  55.153  1.00 19.70 ? 47  HIS A CA  1 
ATOM   406   C C   . HIS A 1 48  ? 28.479  10.095  56.136  1.00 19.40 ? 47  HIS A C   1 
ATOM   407   O O   . HIS A 1 48  ? 28.618  10.295  57.344  1.00 18.57 ? 47  HIS A O   1 
ATOM   408   C CB  . HIS A 1 48  ? 27.697  12.454  55.863  1.00 22.08 ? 47  HIS A CB  1 
ATOM   409   C CG  . HIS A 1 48  ? 27.406  13.604  54.950  1.00 24.16 ? 47  HIS A CG  1 
ATOM   410   N ND1 . HIS A 1 48  ? 28.398  14.396  54.411  1.00 27.03 ? 47  HIS A ND1 1 
ATOM   411   C CD2 . HIS A 1 48  ? 26.235  14.089  54.473  1.00 24.01 ? 47  HIS A CD2 1 
ATOM   412   C CE1 . HIS A 1 48  ? 27.850  15.322  53.642  1.00 26.43 ? 47  HIS A CE1 1 
ATOM   413   N NE2 . HIS A 1 48  ? 26.539  15.157  53.663  1.00 25.73 ? 47  HIS A NE2 1 
ATOM   414   N N   . GLY A 1 49  ? 28.459  8.883   55.595  1.00 18.85 ? 48  GLY A N   1 
ATOM   415   C CA  . GLY A 1 49  ? 28.600  7.696   56.408  1.00 18.07 ? 48  GLY A CA  1 
ATOM   416   C C   . GLY A 1 49  ? 27.449  6.744   56.144  1.00 20.14 ? 48  GLY A C   1 
ATOM   417   O O   . GLY A 1 49  ? 26.349  7.174   55.795  1.00 19.81 ? 48  GLY A O   1 
ATOM   418   N N   . HIS A 1 50  ? 27.702  5.449   56.307  1.00 19.15 ? 49  HIS A N   1 
ATOM   419   C CA  . HIS A 1 50  ? 26.673  4.439   56.101  1.00 18.47 ? 49  HIS A CA  1 
ATOM   420   C C   . HIS A 1 50  ? 26.097  3.973   57.431  1.00 19.49 ? 49  HIS A C   1 
ATOM   421   O O   . HIS A 1 50  ? 26.755  4.044   58.473  1.00 18.19 ? 49  HIS A O   1 
ATOM   422   C CB  . HIS A 1 50  ? 27.252  3.233   55.354  1.00 17.96 ? 49  HIS A CB  1 
ATOM   423   C CG  . HIS A 1 50  ? 27.500  3.484   53.898  1.00 19.26 ? 49  HIS A CG  1 
ATOM   424   N ND1 . HIS A 1 50  ? 26.814  2.823   52.901  1.00 20.51 ? 49  HIS A ND1 1 
ATOM   425   C CD2 . HIS A 1 50  ? 28.368  4.312   53.271  1.00 16.72 ? 49  HIS A CD2 1 
ATOM   426   C CE1 . HIS A 1 50  ? 27.253  3.228   51.723  1.00 18.04 ? 49  HIS A CE1 1 
ATOM   427   N NE2 . HIS A 1 50  ? 28.195  4.132   51.920  1.00 21.12 ? 49  HIS A NE2 1 
ATOM   428   N N   . ILE A 1 51  ? 24.861  3.493   57.386  1.00 19.35 ? 50  ILE A N   1 
ATOM   429   C CA  . ILE A 1 51  ? 24.196  2.988   58.573  1.00 17.85 ? 50  ILE A CA  1 
ATOM   430   C C   . ILE A 1 51  ? 23.650  1.603   58.245  1.00 18.52 ? 50  ILE A C   1 
ATOM   431   O O   . ILE A 1 51  ? 22.816  1.457   57.349  1.00 17.76 ? 50  ILE A O   1 
ATOM   432   C CB  . ILE A 1 51  ? 23.005  3.869   58.979  1.00 19.05 ? 50  ILE A CB  1 
ATOM   433   C CG1 . ILE A 1 51  ? 23.467  5.304   59.240  1.00 18.30 ? 50  ILE A CG1 1 
ATOM   434   C CG2 . ILE A 1 51  ? 22.326  3.273   60.213  1.00 20.03 ? 50  ILE A CG2 1 
ATOM   435   C CD1 . ILE A 1 51  ? 22.316  6.271   59.501  1.00 17.63 ? 50  ILE A CD1 1 
ATOM   436   N N   . LEU A 1 52  ? 24.132  0.589   58.954  1.00 16.90 ? 51  LEU A N   1 
ATOM   437   C CA  . LEU A 1 52  ? 23.650  -0.775  58.747  1.00 15.48 ? 51  LEU A CA  1 
ATOM   438   C C   . LEU A 1 52  ? 22.712  -1.111  59.896  1.00 15.44 ? 51  LEU A C   1 
ATOM   439   O O   . LEU A 1 52  ? 23.109  -1.071  61.065  1.00 15.84 ? 51  LEU A O   1 
ATOM   440   C CB  . LEU A 1 52  ? 24.808  -1.784  58.726  1.00 15.48 ? 51  LEU A CB  1 
ATOM   441   C CG  . LEU A 1 52  ? 24.416  -3.269  58.868  1.00 15.88 ? 51  LEU A CG  1 
ATOM   442   C CD1 . LEU A 1 52  ? 23.478  -3.670  57.742  1.00 16.13 ? 51  LEU A CD1 1 
ATOM   443   C CD2 . LEU A 1 52  ? 25.664  -4.149  58.854  1.00 17.88 ? 51  LEU A CD2 1 
ATOM   444   N N   . VAL A 1 53  ? 21.460  -1.399  59.560  1.00 14.13 ? 52  VAL A N   1 
ATOM   445   C CA  . VAL A 1 53  ? 20.465  -1.766  60.553  1.00 14.29 ? 52  VAL A CA  1 
ATOM   446   C C   . VAL A 1 53  ? 20.208  -3.261  60.333  1.00 15.38 ? 52  VAL A C   1 
ATOM   447   O O   . VAL A 1 53  ? 19.477  -3.663  59.429  1.00 17.02 ? 52  VAL A O   1 
ATOM   448   C CB  . VAL A 1 53  ? 19.154  -0.961  60.367  1.00 15.03 ? 52  VAL A CB  1 
ATOM   449   C CG1 . VAL A 1 53  ? 18.141  -1.350  61.437  1.00 12.97 ? 52  VAL A CG1 1 
ATOM   450   C CG2 . VAL A 1 53  ? 19.451  0.546   60.447  1.00 15.46 ? 52  VAL A CG2 1 
ATOM   451   N N   . ASP A 1 54  ? 20.844  -4.080  61.156  1.00 14.75 ? 53  ASP A N   1 
ATOM   452   C CA  . ASP A 1 54  ? 20.711  -5.522  61.053  1.00 13.35 ? 53  ASP A CA  1 
ATOM   453   C C   . ASP A 1 54  ? 19.692  -5.996  62.074  1.00 14.65 ? 53  ASP A C   1 
ATOM   454   O O   . ASP A 1 54  ? 19.959  -5.999  63.277  1.00 14.51 ? 53  ASP A O   1 
ATOM   455   C CB  . ASP A 1 54  ? 22.072  -6.169  61.312  1.00 12.96 ? 53  ASP A CB  1 
ATOM   456   C CG  . ASP A 1 54  ? 22.014  -7.680  61.306  1.00 15.96 ? 53  ASP A CG  1 
ATOM   457   O OD1 . ASP A 1 54  ? 20.912  -8.239  61.107  1.00 13.03 ? 53  ASP A OD1 1 
ATOM   458   O OD2 . ASP A 1 54  ? 23.082  -8.304  61.502  1.00 13.99 ? 53  ASP A OD2 1 
ATOM   459   N N   . TYR A 1 55  ? 18.512  -6.375  61.594  1.00 15.51 ? 54  TYR A N   1 
ATOM   460   C CA  . TYR A 1 55  ? 17.474  -6.857  62.481  1.00 16.82 ? 54  TYR A CA  1 
ATOM   461   C C   . TYR A 1 55  ? 17.231  -8.343  62.235  1.00 17.10 ? 54  TYR A C   1 
ATOM   462   O O   . TYR A 1 55  ? 16.155  -8.850  62.527  1.00 17.52 ? 54  TYR A O   1 
ATOM   463   C CB  . TYR A 1 55  ? 16.180  -6.045  62.283  1.00 16.55 ? 54  TYR A CB  1 
ATOM   464   C CG  . TYR A 1 55  ? 15.583  -6.083  60.889  1.00 17.53 ? 54  TYR A CG  1 
ATOM   465   C CD1 . TYR A 1 55  ? 14.581  -6.997  60.561  1.00 20.01 ? 54  TYR A CD1 1 
ATOM   466   C CD2 . TYR A 1 55  ? 16.022  -5.204  59.896  1.00 20.03 ? 54  TYR A CD2 1 
ATOM   467   C CE1 . TYR A 1 55  ? 14.026  -7.035  59.278  1.00 21.96 ? 54  TYR A CE1 1 
ATOM   468   C CE2 . TYR A 1 55  ? 15.477  -5.233  58.609  1.00 22.00 ? 54  TYR A CE2 1 
ATOM   469   C CZ  . TYR A 1 55  ? 14.481  -6.150  58.308  1.00 22.41 ? 54  TYR A CZ  1 
ATOM   470   O OH  . TYR A 1 55  ? 13.946  -6.183  57.041  1.00 24.06 ? 54  TYR A OH  1 
ATOM   471   N N   . SER A 1 56  ? 18.247  -9.037  61.725  1.00 17.00 ? 55  SER A N   1 
ATOM   472   C CA  . SER A 1 56  ? 18.130  -10.466 61.420  1.00 17.54 ? 55  SER A CA  1 
ATOM   473   C C   . SER A 1 56  ? 18.142  -11.395 62.638  1.00 19.01 ? 55  SER A C   1 
ATOM   474   O O   . SER A 1 56  ? 17.669  -12.526 62.557  1.00 18.27 ? 55  SER A O   1 
ATOM   475   C CB  . SER A 1 56  ? 19.234  -10.893 60.442  1.00 16.56 ? 55  SER A CB  1 
ATOM   476   O OG  . SER A 1 56  ? 20.515  -10.834 61.041  1.00 13.10 ? 55  SER A OG  1 
ATOM   477   N N   . LYS A 1 57  ? 18.688  -10.928 63.759  1.00 19.38 ? 56  LYS A N   1 
ATOM   478   C CA  . LYS A 1 57  ? 18.731  -11.743 64.971  1.00 17.23 ? 56  LYS A CA  1 
ATOM   479   C C   . LYS A 1 57  ? 17.462  -11.570 65.806  1.00 16.90 ? 56  LYS A C   1 
ATOM   480   O O   . LYS A 1 57  ? 17.502  -11.644 67.037  1.00 17.55 ? 56  LYS A O   1 
ATOM   481   C CB  . LYS A 1 57  ? 19.954  -11.388 65.831  1.00 15.51 ? 56  LYS A CB  1 
ATOM   482   C CG  . LYS A 1 57  ? 21.315  -11.685 65.191  1.00 11.86 ? 56  LYS A CG  1 
ATOM   483   C CD  . LYS A 1 57  ? 22.379  -11.832 66.279  1.00 12.40 ? 56  LYS A CD  1 
ATOM   484   C CE  . LYS A 1 57  ? 23.791  -11.995 65.715  1.00 11.11 ? 56  LYS A CE  1 
ATOM   485   N NZ  . LYS A 1 57  ? 24.302  -10.733 65.104  1.00 14.29 ? 56  LYS A NZ  1 
ATOM   486   N N   . ASN A 1 58  ? 16.345  -11.329 65.128  1.00 15.57 ? 57  ASN A N   1 
ATOM   487   C CA  . ASN A 1 58  ? 15.050  -11.172 65.786  1.00 18.19 ? 57  ASN A CA  1 
ATOM   488   C C   . ASN A 1 58  ? 14.189  -12.401 65.493  1.00 18.91 ? 57  ASN A C   1 
ATOM   489   O O   . ASN A 1 58  ? 14.383  -13.071 64.479  1.00 20.15 ? 57  ASN A O   1 
ATOM   490   C CB  . ASN A 1 58  ? 14.342  -9.904  65.290  1.00 16.90 ? 57  ASN A CB  1 
ATOM   491   C CG  . ASN A 1 58  ? 14.883  -8.641  65.944  1.00 17.84 ? 57  ASN A CG  1 
ATOM   492   O OD1 . ASN A 1 58  ? 14.743  -8.450  67.152  1.00 17.65 ? 57  ASN A OD1 1 
ATOM   493   N ND2 . ASN A 1 58  ? 15.518  -7.786  65.154  1.00 18.09 ? 57  ASN A ND2 1 
ATOM   494   N N   . LEU A 1 59  ? 13.250  -12.695 66.388  1.00 19.63 ? 58  LEU A N   1 
ATOM   495   C CA  . LEU A 1 59  ? 12.366  -13.845 66.233  1.00 22.25 ? 58  LEU A CA  1 
ATOM   496   C C   . LEU A 1 59  ? 11.294  -13.560 65.199  1.00 22.55 ? 58  LEU A C   1 
ATOM   497   O O   . LEU A 1 59  ? 10.100  -13.486 65.514  1.00 24.03 ? 58  LEU A O   1 
ATOM   498   C CB  . LEU A 1 59  ? 11.712  -14.210 67.572  1.00 25.59 ? 58  LEU A CB  1 
ATOM   499   C CG  . LEU A 1 59  ? 12.616  -14.880 68.614  1.00 28.41 ? 58  LEU A CG  1 
ATOM   500   C CD1 . LEU A 1 59  ? 13.370  -16.027 67.956  1.00 31.03 ? 58  LEU A CD1 1 
ATOM   501   C CD2 . LEU A 1 59  ? 13.596  -13.886 69.175  1.00 31.83 ? 58  LEU A CD2 1 
ATOM   502   N N   . VAL A 1 60  ? 11.728  -13.421 63.954  1.00 21.70 ? 59  VAL A N   1 
ATOM   503   C CA  . VAL A 1 60  ? 10.817  -13.119 62.872  1.00 22.40 ? 59  VAL A CA  1 
ATOM   504   C C   . VAL A 1 60  ? 11.142  -13.917 61.609  1.00 21.93 ? 59  VAL A C   1 
ATOM   505   O O   . VAL A 1 60  ? 12.244  -14.442 61.452  1.00 21.02 ? 59  VAL A O   1 
ATOM   506   C CB  . VAL A 1 60  ? 10.873  -11.603 62.549  1.00 23.74 ? 59  VAL A CB  1 
ATOM   507   C CG1 . VAL A 1 60  ? 12.220  -11.250 61.932  1.00 20.57 ? 59  VAL A CG1 1 
ATOM   508   C CG2 . VAL A 1 60  ? 9.758   -11.229 61.610  1.00 28.37 ? 59  VAL A CG2 1 
ATOM   509   N N   . THR A 1 61  ? 10.162  -13.999 60.717  1.00 23.13 ? 60  THR A N   1 
ATOM   510   C CA  . THR A 1 61  ? 10.300  -14.689 59.436  1.00 23.76 ? 60  THR A CA  1 
ATOM   511   C C   . THR A 1 61  ? 9.704   -13.733 58.412  1.00 23.31 ? 60  THR A C   1 
ATOM   512   O O   . THR A 1 61  ? 9.183   -12.683 58.784  1.00 22.61 ? 60  THR A O   1 
ATOM   513   C CB  . THR A 1 61  ? 9.489   -15.990 59.402  1.00 23.70 ? 60  THR A CB  1 
ATOM   514   O OG1 . THR A 1 61  ? 8.098   -15.681 59.550  1.00 22.54 ? 60  THR A OG1 1 
ATOM   515   C CG2 . THR A 1 61  ? 9.915   -16.914 60.529  1.00 23.56 ? 60  THR A CG2 1 
ATOM   516   N N   . GLU A 1 62  ? 9.772   -14.083 57.133  1.00 23.98 ? 61  GLU A N   1 
ATOM   517   C CA  . GLU A 1 62  ? 9.207   -13.215 56.108  1.00 25.89 ? 61  GLU A CA  1 
ATOM   518   C C   . GLU A 1 62  ? 7.714   -12.995 56.354  1.00 24.80 ? 61  GLU A C   1 
ATOM   519   O O   . GLU A 1 62  ? 7.204   -11.892 56.158  1.00 24.48 ? 61  GLU A O   1 
ATOM   520   C CB  . GLU A 1 62  ? 9.416   -13.809 54.711  1.00 29.53 ? 61  GLU A CB  1 
ATOM   521   C CG  . GLU A 1 62  ? 10.869  -13.847 54.238  1.00 37.42 ? 61  GLU A CG  1 
ATOM   522   C CD  . GLU A 1 62  ? 11.480  -12.464 53.996  1.00 40.24 ? 61  GLU A CD  1 
ATOM   523   O OE1 . GLU A 1 62  ? 12.624  -12.403 53.495  1.00 40.96 ? 61  GLU A OE1 1 
ATOM   524   O OE2 . GLU A 1 62  ? 10.827  -11.442 54.306  1.00 44.19 ? 61  GLU A OE2 1 
ATOM   525   N N   . ASP A 1 63  ? 7.008   -14.038 56.785  1.00 24.36 ? 62  ASP A N   1 
ATOM   526   C CA  . ASP A 1 63  ? 5.576   -13.896 57.048  1.00 24.34 ? 62  ASP A CA  1 
ATOM   527   C C   . ASP A 1 63  ? 5.309   -12.888 58.161  1.00 22.76 ? 62  ASP A C   1 
ATOM   528   O O   . ASP A 1 63  ? 4.420   -12.043 58.049  1.00 22.66 ? 62  ASP A O   1 
ATOM   529   C CB  . ASP A 1 63  ? 4.943   -15.235 57.433  1.00 26.52 ? 62  ASP A CB  1 
ATOM   530   C CG  . ASP A 1 63  ? 4.892   -16.215 56.272  1.00 31.37 ? 62  ASP A CG  1 
ATOM   531   O OD1 . ASP A 1 63  ? 4.751   -15.771 55.115  1.00 31.17 ? 62  ASP A OD1 1 
ATOM   532   O OD2 . ASP A 1 63  ? 4.982   -17.433 56.522  1.00 34.59 ? 62  ASP A OD2 1 
ATOM   533   N N   . VAL A 1 64  ? 6.076   -12.982 59.241  1.00 21.48 ? 63  VAL A N   1 
ATOM   534   C CA  . VAL A 1 64  ? 5.890   -12.069 60.356  1.00 21.64 ? 63  VAL A CA  1 
ATOM   535   C C   . VAL A 1 64  ? 6.134   -10.621 59.918  1.00 21.91 ? 63  VAL A C   1 
ATOM   536   O O   . VAL A 1 64  ? 5.319   -9.740  60.190  1.00 23.11 ? 63  VAL A O   1 
ATOM   537   C CB  . VAL A 1 64  ? 6.826   -12.433 61.523  1.00 21.50 ? 63  VAL A CB  1 
ATOM   538   C CG1 . VAL A 1 64  ? 6.666   -11.428 62.657  1.00 22.08 ? 63  VAL A CG1 1 
ATOM   539   C CG2 . VAL A 1 64  ? 6.511   -13.838 62.007  1.00 20.82 ? 63  VAL A CG2 1 
ATOM   540   N N   . MET A 1 65  ? 7.241   -10.375 59.228  1.00 21.09 ? 64  MET A N   1 
ATOM   541   C CA  . MET A 1 65  ? 7.535   -9.023  58.774  1.00 23.54 ? 64  MET A CA  1 
ATOM   542   C C   . MET A 1 65  ? 6.421   -8.517  57.856  1.00 25.06 ? 64  MET A C   1 
ATOM   543   O O   . MET A 1 65  ? 6.060   -7.337  57.898  1.00 26.05 ? 64  MET A O   1 
ATOM   544   C CB  . MET A 1 65  ? 8.884   -8.974  58.044  1.00 23.25 ? 64  MET A CB  1 
ATOM   545   C CG  . MET A 1 65  ? 10.094  -9.267  58.930  1.00 23.24 ? 64  MET A CG  1 
ATOM   546   S SD  . MET A 1 65  ? 10.102  -8.338  60.492  1.00 25.51 ? 64  MET A SD  1 
ATOM   547   C CE  . MET A 1 65  ? 10.353  -6.654  59.898  1.00 23.47 ? 64  MET A CE  1 
ATOM   548   N N   . ARG A 1 66  ? 5.878   -9.409  57.031  1.00 24.21 ? 65  ARG A N   1 
ATOM   549   C CA  . ARG A 1 66  ? 4.794   -9.043  56.114  1.00 25.65 ? 65  ARG A CA  1 
ATOM   550   C C   . ARG A 1 66  ? 3.565   -8.607  56.905  1.00 23.86 ? 65  ARG A C   1 
ATOM   551   O O   . ARG A 1 66  ? 2.942   -7.592  56.595  1.00 23.62 ? 65  ARG A O   1 
ATOM   552   C CB  . ARG A 1 66  ? 4.428   -10.230 55.215  1.00 28.58 ? 65  ARG A CB  1 
ATOM   553   C CG  . ARG A 1 66  ? 3.185   -10.009 54.349  1.00 33.47 ? 65  ARG A CG  1 
ATOM   554   C CD  . ARG A 1 66  ? 2.877   -11.235 53.489  1.00 39.02 ? 65  ARG A CD  1 
ATOM   555   N NE  . ARG A 1 66  ? 2.629   -12.444 54.284  1.00 42.95 ? 65  ARG A NE  1 
ATOM   556   C CZ  . ARG A 1 66  ? 1.529   -12.671 55.001  1.00 45.36 ? 65  ARG A CZ  1 
ATOM   557   N NH1 . ARG A 1 66  ? 0.548   -11.773 55.035  1.00 44.90 ? 65  ARG A NH1 1 
ATOM   558   N NH2 . ARG A 1 66  ? 1.408   -13.800 55.689  1.00 46.04 ? 65  ARG A NH2 1 
ATOM   559   N N   . MET A 1 67  ? 3.217   -9.384  57.924  1.00 23.83 ? 66  MET A N   1 
ATOM   560   C CA  . MET A 1 67  ? 2.070   -9.061  58.764  1.00 22.22 ? 66  MET A CA  1 
ATOM   561   C C   . MET A 1 67  ? 2.323   -7.768  59.529  1.00 21.68 ? 66  MET A C   1 
ATOM   562   O O   . MET A 1 67  ? 1.411   -6.959  59.721  1.00 20.84 ? 66  MET A O   1 
ATOM   563   C CB  . MET A 1 67  ? 1.783   -10.204 59.736  1.00 22.81 ? 66  MET A CB  1 
ATOM   564   C CG  . MET A 1 67  ? 1.290   -11.476 59.046  1.00 25.41 ? 66  MET A CG  1 
ATOM   565   S SD  . MET A 1 67  ? 0.759   -12.750 60.206  1.00 27.79 ? 66  MET A SD  1 
ATOM   566   C CE  . MET A 1 67  ? 2.326   -13.475 60.666  1.00 25.59 ? 66  MET A CE  1 
ATOM   567   N N   . LEU A 1 68  ? 3.566   -7.564  59.955  1.00 19.84 ? 67  LEU A N   1 
ATOM   568   C CA  . LEU A 1 68  ? 3.904   -6.353  60.689  1.00 19.74 ? 67  LEU A CA  1 
ATOM   569   C C   . LEU A 1 68  ? 3.728   -5.140  59.791  1.00 19.08 ? 67  LEU A C   1 
ATOM   570   O O   . LEU A 1 68  ? 3.138   -4.144  60.191  1.00 20.27 ? 67  LEU A O   1 
ATOM   571   C CB  . LEU A 1 68  ? 5.345   -6.421  61.216  1.00 19.08 ? 67  LEU A CB  1 
ATOM   572   C CG  . LEU A 1 68  ? 5.548   -7.362  62.408  1.00 18.89 ? 67  LEU A CG  1 
ATOM   573   C CD1 . LEU A 1 68  ? 7.028   -7.497  62.738  1.00 16.98 ? 67  LEU A CD1 1 
ATOM   574   C CD2 . LEU A 1 68  ? 4.782   -6.831  63.606  1.00 18.12 ? 67  LEU A CD2 1 
ATOM   575   N N   . VAL A 1 69  ? 4.237   -5.225  58.568  1.00 20.20 ? 68  VAL A N   1 
ATOM   576   C CA  . VAL A 1 69  ? 4.106   -4.116  57.646  1.00 19.23 ? 68  VAL A CA  1 
ATOM   577   C C   . VAL A 1 69  ? 2.627   -3.867  57.379  1.00 20.42 ? 68  VAL A C   1 
ATOM   578   O O   . VAL A 1 69  ? 2.196   -2.718  57.283  1.00 20.66 ? 68  VAL A O   1 
ATOM   579   C CB  . VAL A 1 69  ? 4.845   -4.398  56.321  1.00 19.67 ? 68  VAL A CB  1 
ATOM   580   C CG1 . VAL A 1 69  ? 4.551   -3.290  55.314  1.00 19.14 ? 68  VAL A CG1 1 
ATOM   581   C CG2 . VAL A 1 69  ? 6.360   -4.484  56.579  1.00 18.88 ? 68  VAL A CG2 1 
ATOM   582   N N   . ASP A 1 70  ? 1.846   -4.939  57.276  1.00 20.87 ? 69  ASP A N   1 
ATOM   583   C CA  . ASP A 1 70  ? 0.414   -4.795  57.030  1.00 22.31 ? 69  ASP A CA  1 
ATOM   584   C C   . ASP A 1 70  ? -0.253  -4.090  58.208  1.00 22.46 ? 69  ASP A C   1 
ATOM   585   O O   . ASP A 1 70  ? -1.205  -3.328  58.026  1.00 23.73 ? 69  ASP A O   1 
ATOM   586   C CB  . ASP A 1 70  ? -0.256  -6.160  56.797  1.00 23.18 ? 69  ASP A CB  1 
ATOM   587   C CG  . ASP A 1 70  ? 0.093   -6.770  55.439  1.00 26.39 ? 69  ASP A CG  1 
ATOM   588   O OD1 . ASP A 1 70  ? 0.328   -6.011  54.474  1.00 26.73 ? 69  ASP A OD1 1 
ATOM   589   O OD2 . ASP A 1 70  ? 0.117   -8.016  55.333  1.00 29.24 ? 69  ASP A OD2 1 
ATOM   590   N N   . LEU A 1 71  ? 0.245   -4.343  59.414  1.00 23.04 ? 70  LEU A N   1 
ATOM   591   C CA  . LEU A 1 71  ? -0.313  -3.709  60.608  1.00 22.61 ? 70  LEU A CA  1 
ATOM   592   C C   . LEU A 1 71  ? -0.090  -2.199  60.511  1.00 20.81 ? 70  LEU A C   1 
ATOM   593   O O   . LEU A 1 71  ? -0.964  -1.416  60.867  1.00 20.93 ? 70  LEU A O   1 
ATOM   594   C CB  . LEU A 1 71  ? 0.377   -4.230  61.876  1.00 24.03 ? 70  LEU A CB  1 
ATOM   595   C CG  . LEU A 1 71  ? -0.391  -4.252  63.210  1.00 26.71 ? 70  LEU A CG  1 
ATOM   596   C CD1 . LEU A 1 71  ? 0.601   -4.170  64.351  1.00 25.50 ? 70  LEU A CD1 1 
ATOM   597   C CD2 . LEU A 1 71  ? -1.375  -3.113  63.312  1.00 28.74 ? 70  LEU A CD2 1 
ATOM   598   N N   . ALA A 1 72  ? 1.087   -1.799  60.034  1.00 19.13 ? 71  ALA A N   1 
ATOM   599   C CA  . ALA A 1 72  ? 1.419   -0.379  59.906  1.00 19.56 ? 71  ALA A CA  1 
ATOM   600   C C   . ALA A 1 72  ? 0.492   0.301   58.908  1.00 19.69 ? 71  ALA A C   1 
ATOM   601   O O   . ALA A 1 72  ? 0.039   1.422   59.133  1.00 19.65 ? 71  ALA A O   1 
ATOM   602   C CB  . ALA A 1 72  ? 2.872   -0.214  59.471  1.00 16.68 ? 71  ALA A CB  1 
ATOM   603   N N   . LYS A 1 73  ? 0.214   -0.382  57.802  1.00 20.79 ? 72  LYS A N   1 
ATOM   604   C CA  . LYS A 1 73  ? -0.673  0.162   56.783  1.00 22.71 ? 72  LYS A CA  1 
ATOM   605   C C   . LYS A 1 73  ? -2.082  0.253   57.359  1.00 22.83 ? 72  LYS A C   1 
ATOM   606   O O   . LYS A 1 73  ? -2.741  1.286   57.254  1.00 23.84 ? 72  LYS A O   1 
ATOM   607   C CB  . LYS A 1 73  ? -0.664  -0.733  55.537  1.00 24.58 ? 72  LYS A CB  1 
ATOM   608   C CG  . LYS A 1 73  ? 0.684   -0.763  54.826  1.00 27.59 ? 72  LYS A CG  1 
ATOM   609   C CD  . LYS A 1 73  ? 0.737   -1.801  53.713  1.00 27.72 ? 72  LYS A CD  1 
ATOM   610   C CE  . LYS A 1 73  ? 2.110   -1.807  53.051  1.00 31.74 ? 72  LYS A CE  1 
ATOM   611   N NZ  . LYS A 1 73  ? 2.268   -2.913  52.056  1.00 35.13 ? 72  LYS A NZ  1 
ATOM   612   N N   . SER A 1 74  ? -2.525  -0.825  57.995  1.00 22.63 ? 73  SER A N   1 
ATOM   613   C CA  . SER A 1 74  ? -3.854  -0.867  58.589  1.00 23.03 ? 73  SER A CA  1 
ATOM   614   C C   . SER A 1 74  ? -4.051  0.210   59.657  1.00 22.65 ? 73  SER A C   1 
ATOM   615   O O   . SER A 1 74  ? -5.152  0.734   59.823  1.00 22.32 ? 73  SER A O   1 
ATOM   616   C CB  . SER A 1 74  ? -4.109  -2.247  59.195  1.00 22.83 ? 73  SER A CB  1 
ATOM   617   O OG  . SER A 1 74  ? -5.436  -2.341  59.679  1.00 25.88 ? 73  SER A OG  1 
ATOM   618   N N   . ARG A 1 75  ? -2.987  0.549   60.379  1.00 22.30 ? 74  ARG A N   1 
ATOM   619   C CA  . ARG A 1 75  ? -3.097  1.561   61.421  1.00 20.47 ? 74  ARG A CA  1 
ATOM   620   C C   . ARG A 1 75  ? -2.894  2.980   60.894  1.00 20.41 ? 74  ARG A C   1 
ATOM   621   O O   . ARG A 1 75  ? -2.916  3.938   61.661  1.00 19.53 ? 74  ARG A O   1 
ATOM   622   C CB  . ARG A 1 75  ? -2.107  1.266   62.551  1.00 22.55 ? 74  ARG A CB  1 
ATOM   623   C CG  . ARG A 1 75  ? -2.386  -0.049  63.292  1.00 20.46 ? 74  ARG A CG  1 
ATOM   624   C CD  . ARG A 1 75  ? -3.734  -0.026  64.035  1.00 22.93 ? 74  ARG A CD  1 
ATOM   625   N NE  . ARG A 1 75  ? -3.765  0.996   65.080  1.00 22.85 ? 74  ARG A NE  1 
ATOM   626   C CZ  . ARG A 1 75  ? -4.633  2.002   65.112  1.00 24.90 ? 74  ARG A CZ  1 
ATOM   627   N NH1 . ARG A 1 75  ? -5.548  2.117   64.161  1.00 24.00 ? 74  ARG A NH1 1 
ATOM   628   N NH2 . ARG A 1 75  ? -4.573  2.907   66.079  1.00 25.58 ? 74  ARG A NH2 1 
ATOM   629   N N   . GLY A 1 76  ? -2.705  3.109   59.583  1.00 19.77 ? 75  GLY A N   1 
ATOM   630   C CA  . GLY A 1 76  ? -2.521  4.421   58.982  1.00 20.77 ? 75  GLY A CA  1 
ATOM   631   C C   . GLY A 1 76  ? -1.236  5.143   59.357  1.00 20.87 ? 75  GLY A C   1 
ATOM   632   O O   . GLY A 1 76  ? -1.231  6.361   59.559  1.00 20.64 ? 75  GLY A O   1 
ATOM   633   N N   . VAL A 1 77  ? -0.137  4.406   59.442  1.00 20.53 ? 76  VAL A N   1 
ATOM   634   C CA  . VAL A 1 77  ? 1.139   5.018   59.801  1.00 19.52 ? 76  VAL A CA  1 
ATOM   635   C C   . VAL A 1 77  ? 1.587   6.108   58.825  1.00 19.61 ? 76  VAL A C   1 
ATOM   636   O O   . VAL A 1 77  ? 2.016   7.187   59.241  1.00 20.49 ? 76  VAL A O   1 
ATOM   637   C CB  . VAL A 1 77  ? 2.233   3.943   59.934  1.00 18.20 ? 76  VAL A CB  1 
ATOM   638   C CG1 . VAL A 1 77  ? 3.616   4.584   59.948  1.00 17.66 ? 76  VAL A CG1 1 
ATOM   639   C CG2 . VAL A 1 77  ? 2.017   3.171   61.228  1.00 18.55 ? 76  VAL A CG2 1 
ATOM   640   N N   . GLU A 1 78  ? 1.470   5.844   57.528  1.00 20.09 ? 77  GLU A N   1 
ATOM   641   C CA  . GLU A 1 78  ? 1.889   6.819   56.528  1.00 19.85 ? 77  GLU A CA  1 
ATOM   642   C C   . GLU A 1 78  ? 1.049   8.093   56.514  1.00 20.81 ? 77  GLU A C   1 
ATOM   643   O O   . GLU A 1 78  ? 1.593   9.190   56.401  1.00 19.75 ? 77  GLU A O   1 
ATOM   644   C CB  . GLU A 1 78  ? 1.904   6.166   55.145  1.00 21.95 ? 77  GLU A CB  1 
ATOM   645   C CG  . GLU A 1 78  ? 2.897   5.008   55.072  1.00 25.32 ? 77  GLU A CG  1 
ATOM   646   C CD  . GLU A 1 78  ? 2.847   4.252   53.760  1.00 27.30 ? 77  GLU A CD  1 
ATOM   647   O OE1 . GLU A 1 78  ? 3.841   4.290   53.004  1.00 29.82 ? 77  GLU A OE1 1 
ATOM   648   O OE2 . GLU A 1 78  ? 1.812   3.616   53.488  1.00 28.68 ? 77  GLU A OE2 1 
ATOM   649   N N   . ALA A 1 79  ? -0.270  7.954   56.634  1.00 20.46 ? 78  ALA A N   1 
ATOM   650   C CA  . ALA A 1 79  ? -1.145  9.118   56.644  1.00 19.90 ? 78  ALA A CA  1 
ATOM   651   C C   . ALA A 1 79  ? -0.772  10.001  57.830  1.00 19.65 ? 78  ALA A C   1 
ATOM   652   O O   . ALA A 1 79  ? -0.629  11.217  57.691  1.00 19.38 ? 78  ALA A O   1 
ATOM   653   C CB  . ALA A 1 79  ? -2.608  8.685   56.746  1.00 20.14 ? 78  ALA A CB  1 
ATOM   654   N N   . ALA A 1 80  ? -0.608  9.385   58.998  1.00 18.99 ? 79  ALA A N   1 
ATOM   655   C CA  . ALA A 1 80  ? -0.239  10.129  60.198  1.00 18.82 ? 79  ALA A CA  1 
ATOM   656   C C   . ALA A 1 80  ? 1.089   10.860  59.990  1.00 19.43 ? 79  ALA A C   1 
ATOM   657   O O   . ALA A 1 80  ? 1.254   11.997  60.429  1.00 19.91 ? 79  ALA A O   1 
ATOM   658   C CB  . ALA A 1 80  ? -0.136  9.185   61.392  1.00 20.34 ? 79  ALA A CB  1 
ATOM   659   N N   . ARG A 1 81  ? 2.031   10.205  59.316  1.00 19.21 ? 80  ARG A N   1 
ATOM   660   C CA  . ARG A 1 81  ? 3.335   10.802  59.047  1.00 18.46 ? 80  ARG A CA  1 
ATOM   661   C C   . ARG A 1 81  ? 3.183   12.080  58.225  1.00 20.86 ? 80  ARG A C   1 
ATOM   662   O O   . ARG A 1 81  ? 3.802   13.105  58.532  1.00 20.17 ? 80  ARG A O   1 
ATOM   663   C CB  . ARG A 1 81  ? 4.231   9.824   58.279  1.00 17.13 ? 80  ARG A CB  1 
ATOM   664   C CG  . ARG A 1 81  ? 5.597   10.410  57.894  1.00 18.65 ? 80  ARG A CG  1 
ATOM   665   C CD  . ARG A 1 81  ? 6.327   9.524   56.887  1.00 20.48 ? 80  ARG A CD  1 
ATOM   666   N NE  . ARG A 1 81  ? 5.536   9.352   55.672  1.00 20.44 ? 80  ARG A NE  1 
ATOM   667   C CZ  . ARG A 1 81  ? 5.579   8.277   54.889  1.00 21.97 ? 80  ARG A CZ  1 
ATOM   668   N NH1 . ARG A 1 81  ? 6.385   7.262   55.179  1.00 19.66 ? 80  ARG A NH1 1 
ATOM   669   N NH2 . ARG A 1 81  ? 4.784   8.202   53.830  1.00 24.85 ? 80  ARG A NH2 1 
ATOM   670   N N   . GLU A 1 82  ? 2.375   12.011  57.167  1.00 21.05 ? 81  GLU A N   1 
ATOM   671   C CA  . GLU A 1 82  ? 2.154   13.171  56.315  1.00 22.06 ? 81  GLU A CA  1 
ATOM   672   C C   . GLU A 1 82  ? 1.540   14.315  57.111  1.00 21.69 ? 81  GLU A C   1 
ATOM   673   O O   . GLU A 1 82  ? 1.918   15.474  56.940  1.00 19.87 ? 81  GLU A O   1 
ATOM   674   C CB  . GLU A 1 82  ? 1.248   12.810  55.133  1.00 23.92 ? 81  GLU A CB  1 
ATOM   675   C CG  . GLU A 1 82  ? 1.884   11.835  54.161  1.00 29.73 ? 81  GLU A CG  1 
ATOM   676   C CD  . GLU A 1 82  ? 3.362   12.108  53.966  1.00 32.00 ? 81  GLU A CD  1 
ATOM   677   O OE1 . GLU A 1 82  ? 3.714   13.250  53.599  1.00 34.73 ? 81  GLU A OE1 1 
ATOM   678   O OE2 . GLU A 1 82  ? 4.172   11.183  54.188  1.00 32.86 ? 81  GLU A OE2 1 
ATOM   679   N N   . ARG A 1 83  ? 0.594   13.983  57.984  1.00 22.14 ? 82  ARG A N   1 
ATOM   680   C CA  . ARG A 1 83  ? -0.052  14.983  58.819  1.00 22.66 ? 82  ARG A CA  1 
ATOM   681   C C   . ARG A 1 83  ? 0.982   15.668  59.704  1.00 23.16 ? 82  ARG A C   1 
ATOM   682   O O   . ARG A 1 83  ? 0.911   16.878  59.936  1.00 23.60 ? 82  ARG A O   1 
ATOM   683   C CB  . ARG A 1 83  ? -1.138  14.335  59.676  1.00 25.13 ? 82  ARG A CB  1 
ATOM   684   C CG  . ARG A 1 83  ? -2.492  14.229  58.977  1.00 27.31 ? 82  ARG A CG  1 
ATOM   685   C CD  . ARG A 1 83  ? -3.531  13.641  59.905  1.00 31.71 ? 82  ARG A CD  1 
ATOM   686   N NE  . ARG A 1 83  ? -3.389  12.191  60.006  1.00 37.97 ? 82  ARG A NE  1 
ATOM   687   C CZ  . ARG A 1 83  ? -3.622  11.493  61.111  1.00 38.56 ? 82  ARG A CZ  1 
ATOM   688   N NH1 . ARG A 1 83  ? -4.007  12.115  62.219  1.00 41.37 ? 82  ARG A NH1 1 
ATOM   689   N NH2 . ARG A 1 83  ? -3.476  10.175  61.106  1.00 38.48 ? 82  ARG A NH2 1 
ATOM   690   N N   . MET A 1 84  ? 1.946   14.897  60.198  1.00 22.68 ? 83  MET A N   1 
ATOM   691   C CA  . MET A 1 84  ? 2.989   15.474  61.034  1.00 22.71 ? 83  MET A CA  1 
ATOM   692   C C   . MET A 1 84  ? 3.786   16.486  60.235  1.00 21.47 ? 83  MET A C   1 
ATOM   693   O O   . MET A 1 84  ? 3.888   17.650  60.622  1.00 22.07 ? 83  MET A O   1 
ATOM   694   C CB  . MET A 1 84  ? 3.959   14.408  61.555  1.00 23.04 ? 83  MET A CB  1 
ATOM   695   C CG  . MET A 1 84  ? 5.184   15.024  62.244  1.00 24.09 ? 83  MET A CG  1 
ATOM   696   S SD  . MET A 1 84  ? 6.355   13.852  62.981  1.00 27.60 ? 83  MET A SD  1 
ATOM   697   C CE  . MET A 1 84  ? 5.644   13.646  64.549  1.00 21.06 ? 83  MET A CE  1 
ATOM   698   N N   . PHE A 1 85  ? 4.346   16.033  59.118  1.00 21.59 ? 84  PHE A N   1 
ATOM   699   C CA  . PHE A 1 85  ? 5.163   16.892  58.266  1.00 23.90 ? 84  PHE A CA  1 
ATOM   700   C C   . PHE A 1 85  ? 4.399   18.057  57.641  1.00 24.74 ? 84  PHE A C   1 
ATOM   701   O O   . PHE A 1 85  ? 4.998   19.073  57.290  1.00 23.86 ? 84  PHE A O   1 
ATOM   702   C CB  . PHE A 1 85  ? 5.824   16.077  57.149  1.00 22.48 ? 84  PHE A CB  1 
ATOM   703   C CG  . PHE A 1 85  ? 6.988   15.223  57.610  1.00 22.24 ? 84  PHE A CG  1 
ATOM   704   C CD1 . PHE A 1 85  ? 6.773   14.045  58.319  1.00 21.49 ? 84  PHE A CD1 1 
ATOM   705   C CD2 . PHE A 1 85  ? 8.298   15.590  57.307  1.00 20.92 ? 84  PHE A CD2 1 
ATOM   706   C CE1 . PHE A 1 85  ? 7.850   13.238  58.716  1.00 21.39 ? 84  PHE A CE1 1 
ATOM   707   C CE2 . PHE A 1 85  ? 9.377   14.797  57.697  1.00 21.11 ? 84  PHE A CE2 1 
ATOM   708   C CZ  . PHE A 1 85  ? 9.152   13.617  58.403  1.00 20.34 ? 84  PHE A CZ  1 
ATOM   709   N N   . ASN A 1 86  ? 3.085   17.917  57.500  1.00 25.04 ? 85  ASN A N   1 
ATOM   710   C CA  . ASN A 1 86  ? 2.293   18.984  56.904  1.00 28.16 ? 85  ASN A CA  1 
ATOM   711   C C   . ASN A 1 86  ? 1.864   20.064  57.893  1.00 27.49 ? 85  ASN A C   1 
ATOM   712   O O   . ASN A 1 86  ? 1.175   21.009  57.521  1.00 28.65 ? 85  ASN A O   1 
ATOM   713   C CB  . ASN A 1 86  ? 1.069   18.405  56.190  1.00 30.40 ? 85  ASN A CB  1 
ATOM   714   C CG  . ASN A 1 86  ? 1.428   17.746  54.867  1.00 36.72 ? 85  ASN A CG  1 
ATOM   715   O OD1 . ASN A 1 86  ? 2.285   18.242  54.130  1.00 40.06 ? 85  ASN A OD1 1 
ATOM   716   N ND2 . ASN A 1 86  ? 0.769   16.633  54.553  1.00 38.24 ? 85  ASN A ND2 1 
ATOM   717   N N   . GLY A 1 87  ? 2.270   19.920  59.151  1.00 26.28 ? 86  GLY A N   1 
ATOM   718   C CA  . GLY A 1 87  ? 1.925   20.909  60.158  1.00 24.77 ? 86  GLY A CA  1 
ATOM   719   C C   . GLY A 1 87  ? 0.550   20.794  60.796  1.00 25.30 ? 86  GLY A C   1 
ATOM   720   O O   . GLY A 1 87  ? 0.084   21.738  61.438  1.00 23.17 ? 86  GLY A O   1 
ATOM   721   N N   . GLU A 1 88  ? -0.107  19.651  60.634  1.00 25.49 ? 87  GLU A N   1 
ATOM   722   C CA  . GLU A 1 88  ? -1.427  19.467  61.223  1.00 26.18 ? 87  GLU A CA  1 
ATOM   723   C C   . GLU A 1 88  ? -1.309  19.213  62.728  1.00 26.99 ? 87  GLU A C   1 
ATOM   724   O O   . GLU A 1 88  ? -0.283  18.729  63.204  1.00 24.96 ? 87  GLU A O   1 
ATOM   725   C CB  . GLU A 1 88  ? -2.148  18.315  60.524  1.00 26.67 ? 87  GLU A CB  1 
ATOM   726   C CG  . GLU A 1 88  ? -2.505  18.638  59.078  1.00 30.08 ? 87  GLU A CG  1 
ATOM   727   C CD  . GLU A 1 88  ? -3.080  17.450  58.327  1.00 31.17 ? 87  GLU A CD  1 
ATOM   728   O OE1 . GLU A 1 88  ? -4.099  16.881  58.777  1.00 30.97 ? 87  GLU A OE1 1 
ATOM   729   O OE2 . GLU A 1 88  ? -2.508  17.088  57.277  1.00 32.72 ? 87  GLU A OE2 1 
ATOM   730   N N   . LYS A 1 89  ? -2.359  19.556  63.469  1.00 27.98 ? 88  LYS A N   1 
ATOM   731   C CA  . LYS A 1 89  ? -2.373  19.395  64.923  1.00 29.46 ? 88  LYS A CA  1 
ATOM   732   C C   . LYS A 1 89  ? -2.550  17.947  65.389  1.00 28.97 ? 88  LYS A C   1 
ATOM   733   O O   . LYS A 1 89  ? -3.583  17.599  65.965  1.00 27.84 ? 88  LYS A O   1 
ATOM   734   C CB  . LYS A 1 89  ? -3.486  20.256  65.537  1.00 31.77 ? 88  LYS A CB  1 
ATOM   735   C CG  . LYS A 1 89  ? -3.195  21.750  65.589  1.00 36.63 ? 88  LYS A CG  1 
ATOM   736   C CD  . LYS A 1 89  ? -3.397  22.436  64.255  1.00 38.83 ? 88  LYS A CD  1 
ATOM   737   C CE  . LYS A 1 89  ? -3.026  23.917  64.356  1.00 41.33 ? 88  LYS A CE  1 
ATOM   738   N NZ  . LYS A 1 89  ? -3.740  24.616  65.465  1.00 39.66 ? 88  LYS A NZ  1 
ATOM   739   N N   . ILE A 1 90  ? -1.541  17.110  65.163  1.00 27.25 ? 89  ILE A N   1 
ATOM   740   C CA  . ILE A 1 90  ? -1.633  15.713  65.566  1.00 26.13 ? 89  ILE A CA  1 
ATOM   741   C C   . ILE A 1 90  ? -1.541  15.543  67.082  1.00 25.99 ? 89  ILE A C   1 
ATOM   742   O O   . ILE A 1 90  ? -1.821  14.463  67.600  1.00 25.37 ? 89  ILE A O   1 
ATOM   743   C CB  . ILE A 1 90  ? -0.555  14.839  64.877  1.00 24.81 ? 89  ILE A CB  1 
ATOM   744   C CG1 . ILE A 1 90  ? 0.846   15.317  65.259  1.00 23.08 ? 89  ILE A CG1 1 
ATOM   745   C CG2 . ILE A 1 90  ? -0.750  14.886  63.365  1.00 25.71 ? 89  ILE A CG2 1 
ATOM   746   C CD1 . ILE A 1 90  ? 1.950   14.426  64.731  1.00 22.42 ? 89  ILE A CD1 1 
ATOM   747   N N   . ASN A 1 91  ? -1.125  16.595  67.788  1.00 23.52 ? 90  ASN A N   1 
ATOM   748   C CA  . ASN A 1 91  ? -1.079  16.539  69.249  1.00 23.99 ? 90  ASN A CA  1 
ATOM   749   C C   . ASN A 1 91  ? -2.500  16.964  69.594  1.00 25.17 ? 90  ASN A C   1 
ATOM   750   O O   . ASN A 1 91  ? -2.749  18.112  69.974  1.00 22.47 ? 90  ASN A O   1 
ATOM   751   C CB  . ASN A 1 91  ? -0.066  17.542  69.815  1.00 23.45 ? 90  ASN A CB  1 
ATOM   752   C CG  . ASN A 1 91  ? -0.094  17.612  71.342  1.00 24.75 ? 90  ASN A CG  1 
ATOM   753   O OD1 . ASN A 1 91  ? 0.727   18.299  71.963  1.00 24.48 ? 90  ASN A OD1 1 
ATOM   754   N ND2 . ASN A 1 91  ? -1.044  16.911  71.951  1.00 20.54 ? 90  ASN A ND2 1 
ATOM   755   N N   . TYR A 1 92  ? -3.430  16.024  69.446  1.00 25.14 ? 91  TYR A N   1 
ATOM   756   C CA  . TYR A 1 92  ? -4.842  16.306  69.662  1.00 26.71 ? 91  TYR A CA  1 
ATOM   757   C C   . TYR A 1 92  ? -5.332  16.728  71.037  1.00 27.40 ? 91  TYR A C   1 
ATOM   758   O O   . TYR A 1 92  ? -6.265  17.525  71.125  1.00 28.69 ? 91  TYR A O   1 
ATOM   759   C CB  . TYR A 1 92  ? -5.697  15.138  69.166  1.00 27.86 ? 91  TYR A CB  1 
ATOM   760   C CG  . TYR A 1 92  ? -5.298  13.776  69.683  1.00 30.30 ? 91  TYR A CG  1 
ATOM   761   C CD1 . TYR A 1 92  ? -4.342  13.012  69.019  1.00 29.35 ? 91  TYR A CD1 1 
ATOM   762   C CD2 . TYR A 1 92  ? -5.916  13.228  70.808  1.00 31.71 ? 91  TYR A CD2 1 
ATOM   763   C CE1 . TYR A 1 92  ? -4.016  11.731  69.451  1.00 31.37 ? 91  TYR A CE1 1 
ATOM   764   C CE2 . TYR A 1 92  ? -5.594  11.946  71.252  1.00 31.86 ? 91  TYR A CE2 1 
ATOM   765   C CZ  . TYR A 1 92  ? -4.645  11.203  70.564  1.00 32.62 ? 91  TYR A CZ  1 
ATOM   766   O OH  . TYR A 1 92  ? -4.344  9.921   70.973  1.00 34.78 ? 91  TYR A OH  1 
ATOM   767   N N   . THR A 1 93  ? -4.737  16.219  72.110  1.00 26.25 ? 92  THR A N   1 
ATOM   768   C CA  . THR A 1 93  ? -5.217  16.616  73.426  1.00 25.73 ? 92  THR A CA  1 
ATOM   769   C C   . THR A 1 93  ? -4.915  18.084  73.720  1.00 26.32 ? 92  THR A C   1 
ATOM   770   O O   . THR A 1 93  ? -5.684  18.747  74.409  1.00 26.15 ? 92  THR A O   1 
ATOM   771   C CB  . THR A 1 93  ? -4.628  15.736  74.552  1.00 23.26 ? 92  THR A CB  1 
ATOM   772   O OG1 . THR A 1 93  ? -3.205  15.869  74.573  1.00 21.34 ? 92  THR A OG1 1 
ATOM   773   C CG2 . THR A 1 93  ? -5.012  14.269  74.336  1.00 22.12 ? 92  THR A CG2 1 
ATOM   774   N N   . GLU A 1 94  ? -3.807  18.595  73.188  1.00 26.30 ? 93  GLU A N   1 
ATOM   775   C CA  . GLU A 1 94  ? -3.434  19.989  73.419  1.00 26.53 ? 93  GLU A CA  1 
ATOM   776   C C   . GLU A 1 94  ? -3.753  20.846  72.202  1.00 28.05 ? 93  GLU A C   1 
ATOM   777   O O   . GLU A 1 94  ? -3.595  22.069  72.229  1.00 28.85 ? 93  GLU A O   1 
ATOM   778   C CB  . GLU A 1 94  ? -1.941  20.091  73.756  1.00 25.51 ? 93  GLU A CB  1 
ATOM   779   C CG  . GLU A 1 94  ? -1.534  19.240  74.954  1.00 24.73 ? 93  GLU A CG  1 
ATOM   780   C CD  . GLU A 1 94  ? -0.087  19.440  75.369  1.00 25.91 ? 93  GLU A CD  1 
ATOM   781   O OE1 . GLU A 1 94  ? 0.810   19.390  74.498  1.00 26.22 ? 93  GLU A OE1 1 
ATOM   782   O OE2 . GLU A 1 94  ? 0.158   19.636  76.574  1.00 26.58 ? 93  GLU A OE2 1 
ATOM   783   N N   . GLY A 1 95  ? -4.205  20.191  71.137  1.00 27.73 ? 94  GLY A N   1 
ATOM   784   C CA  . GLY A 1 95  ? -4.553  20.888  69.912  1.00 28.21 ? 94  GLY A CA  1 
ATOM   785   C C   . GLY A 1 95  ? -3.395  21.644  69.291  1.00 28.17 ? 94  GLY A C   1 
ATOM   786   O O   . GLY A 1 95  ? -3.542  22.808  68.909  1.00 25.81 ? 94  GLY A O   1 
ATOM   787   N N   . ARG A 1 96  ? -2.246  20.984  69.170  1.00 26.37 ? 95  ARG A N   1 
ATOM   788   C CA  . ARG A 1 96  ? -1.077  21.636  68.601  1.00 25.80 ? 95  ARG A CA  1 
ATOM   789   C C   . ARG A 1 96  ? -0.385  20.802  67.546  1.00 24.08 ? 95  ARG A C   1 
ATOM   790   O O   . ARG A 1 96  ? -0.592  19.596  67.453  1.00 20.90 ? 95  ARG A O   1 
ATOM   791   C CB  . ARG A 1 96  ? -0.088  21.985  69.715  1.00 28.33 ? 95  ARG A CB  1 
ATOM   792   C CG  . ARG A 1 96  ? -0.767  22.698  70.868  1.00 35.19 ? 95  ARG A CG  1 
ATOM   793   C CD  . ARG A 1 96  ? 0.191   23.425  71.788  1.00 37.76 ? 95  ARG A CD  1 
ATOM   794   N NE  . ARG A 1 96  ? 0.929   22.546  72.683  1.00 38.52 ? 95  ARG A NE  1 
ATOM   795   C CZ  . ARG A 1 96  ? 1.303   22.902  73.910  1.00 41.56 ? 95  ARG A CZ  1 
ATOM   796   N NH1 . ARG A 1 96  ? 0.995   24.108  74.369  1.00 39.02 ? 95  ARG A NH1 1 
ATOM   797   N NH2 . ARG A 1 96  ? 1.993   22.063  74.674  1.00 41.96 ? 95  ARG A NH2 1 
ATOM   798   N N   . ALA A 1 97  ? 0.435   21.462  66.738  1.00 22.78 ? 96  ALA A N   1 
ATOM   799   C CA  . ALA A 1 97  ? 1.179   20.770  65.701  1.00 22.15 ? 96  ALA A CA  1 
ATOM   800   C C   . ALA A 1 97  ? 2.389   20.152  66.383  1.00 22.50 ? 96  ALA A C   1 
ATOM   801   O O   . ALA A 1 97  ? 2.676   20.453  67.539  1.00 21.39 ? 96  ALA A O   1 
ATOM   802   C CB  . ALA A 1 97  ? 1.620   21.745  64.626  1.00 19.79 ? 96  ALA A CB  1 
ATOM   803   N N   . VAL A 1 98  ? 3.084   19.278  65.666  1.00 22.85 ? 97  VAL A N   1 
ATOM   804   C CA  . VAL A 1 98  ? 4.275   18.618  66.182  1.00 22.28 ? 97  VAL A CA  1 
ATOM   805   C C   . VAL A 1 98  ? 5.289   18.773  65.068  1.00 21.49 ? 97  VAL A C   1 
ATOM   806   O O   . VAL A 1 98  ? 5.290   18.016  64.102  1.00 21.10 ? 97  VAL A O   1 
ATOM   807   C CB  . VAL A 1 98  ? 4.002   17.123  66.468  1.00 23.22 ? 97  VAL A CB  1 
ATOM   808   C CG1 . VAL A 1 98  ? 5.297   16.411  66.845  1.00 20.91 ? 97  VAL A CG1 1 
ATOM   809   C CG2 . VAL A 1 98  ? 2.982   17.001  67.599  1.00 21.30 ? 97  VAL A CG2 1 
ATOM   810   N N   . LEU A 1 99  ? 6.152   19.771  65.203  1.00 21.97 ? 98  LEU A N   1 
ATOM   811   C CA  . LEU A 1 99  ? 7.112   20.041  64.153  1.00 21.14 ? 98  LEU A CA  1 
ATOM   812   C C   . LEU A 1 99  ? 8.582   20.107  64.510  1.00 21.00 ? 98  LEU A C   1 
ATOM   813   O O   . LEU A 1 99  ? 9.255   21.087  64.171  1.00 18.35 ? 98  LEU A O   1 
ATOM   814   C CB  . LEU A 1 99  ? 6.711   21.331  63.428  1.00 20.33 ? 98  LEU A CB  1 
ATOM   815   C CG  . LEU A 1 99  ? 5.418   21.225  62.609  1.00 22.45 ? 98  LEU A CG  1 
ATOM   816   C CD1 . LEU A 1 99  ? 4.970   22.607  62.145  1.00 19.68 ? 98  LEU A CD1 1 
ATOM   817   C CD2 . LEU A 1 99  ? 5.658   20.300  61.421  1.00 18.36 ? 98  LEU A CD2 1 
ATOM   818   N N   . HIS A 1 100 ? 9.101   19.085  65.187  1.00 20.17 ? 99  HIS A N   1 
ATOM   819   C CA  . HIS A 1 100 ? 10.525  19.113  65.463  1.00 20.08 ? 99  HIS A CA  1 
ATOM   820   C C   . HIS A 1 100 ? 11.223  18.927  64.111  1.00 19.30 ? 99  HIS A C   1 
ATOM   821   O O   . HIS A 1 100 ? 12.385  19.300  63.949  1.00 19.56 ? 99  HIS A O   1 
ATOM   822   C CB  . HIS A 1 100 ? 10.953  18.033  66.481  1.00 20.79 ? 99  HIS A CB  1 
ATOM   823   C CG  . HIS A 1 100 ? 10.148  16.770  66.428  1.00 20.05 ? 99  HIS A CG  1 
ATOM   824   N ND1 . HIS A 1 100 ? 10.585  15.634  65.781  1.00 21.98 ? 99  HIS A ND1 1 
ATOM   825   C CD2 . HIS A 1 100 ? 8.941   16.460  66.957  1.00 19.61 ? 99  HIS A CD2 1 
ATOM   826   C CE1 . HIS A 1 100 ? 9.681   14.679  65.914  1.00 20.70 ? 99  HIS A CE1 1 
ATOM   827   N NE2 . HIS A 1 100 ? 8.674   15.154  66.624  1.00 21.46 ? 99  HIS A NE2 1 
ATOM   828   N N   . VAL A 1 101 ? 10.507  18.377  63.128  1.00 18.81 ? 100 VAL A N   1 
ATOM   829   C CA  . VAL A 1 101 ? 11.103  18.199  61.804  1.00 19.26 ? 100 VAL A CA  1 
ATOM   830   C C   . VAL A 1 101 ? 11.325  19.552  61.105  1.00 20.84 ? 100 VAL A C   1 
ATOM   831   O O   . VAL A 1 101 ? 12.219  19.685  60.272  1.00 22.96 ? 100 VAL A O   1 
ATOM   832   C CB  . VAL A 1 101 ? 10.249  17.267  60.890  1.00 19.48 ? 100 VAL A CB  1 
ATOM   833   C CG1 . VAL A 1 101 ? 10.225  15.850  61.476  1.00 16.11 ? 100 VAL A CG1 1 
ATOM   834   C CG2 . VAL A 1 101 ? 8.823   17.812  60.731  1.00 19.87 ? 100 VAL A CG2 1 
ATOM   835   N N   . ALA A 1 102 ? 10.530  20.560  61.452  1.00 21.02 ? 101 ALA A N   1 
ATOM   836   C CA  . ALA A 1 102 ? 10.693  21.881  60.841  1.00 20.58 ? 101 ALA A CA  1 
ATOM   837   C C   . ALA A 1 102 ? 11.962  22.556  61.364  1.00 20.46 ? 101 ALA A C   1 
ATOM   838   O O   . ALA A 1 102 ? 12.593  23.341  60.654  1.00 18.49 ? 101 ALA A O   1 
ATOM   839   C CB  . ALA A 1 102 ? 9.480   22.757  61.137  1.00 18.97 ? 101 ALA A CB  1 
ATOM   840   N N   . LEU A 1 103 ? 12.329  22.243  62.607  1.00 18.41 ? 102 LEU A N   1 
ATOM   841   C CA  . LEU A 1 103 ? 13.515  22.820  63.235  1.00 17.93 ? 102 LEU A CA  1 
ATOM   842   C C   . LEU A 1 103 ? 14.791  22.525  62.450  1.00 19.21 ? 102 LEU A C   1 
ATOM   843   O O   . LEU A 1 103 ? 15.710  23.353  62.411  1.00 17.29 ? 102 LEU A O   1 
ATOM   844   C CB  . LEU A 1 103 ? 13.666  22.290  64.668  1.00 15.79 ? 102 LEU A CB  1 
ATOM   845   C CG  . LEU A 1 103 ? 12.540  22.644  65.644  1.00 18.23 ? 102 LEU A CG  1 
ATOM   846   C CD1 . LEU A 1 103 ? 12.741  21.897  66.973  1.00 14.97 ? 102 LEU A CD1 1 
ATOM   847   C CD2 . LEU A 1 103 ? 12.515  24.159  65.860  1.00 14.67 ? 102 LEU A CD2 1 
ATOM   848   N N   . ARG A 1 104 ? 14.841  21.344  61.830  1.00 19.16 ? 103 ARG A N   1 
ATOM   849   C CA  . ARG A 1 104 ? 16.000  20.926  61.047  1.00 18.71 ? 103 ARG A CA  1 
ATOM   850   C C   . ARG A 1 104 ? 15.693  20.773  59.554  1.00 19.52 ? 103 ARG A C   1 
ATOM   851   O O   . ARG A 1 104 ? 16.404  20.062  58.842  1.00 18.66 ? 103 ARG A O   1 
ATOM   852   C CB  . ARG A 1 104 ? 16.548  19.600  61.588  1.00 18.51 ? 103 ARG A CB  1 
ATOM   853   C CG  . ARG A 1 104 ? 15.594  18.421  61.452  1.00 16.92 ? 103 ARG A CG  1 
ATOM   854   C CD  . ARG A 1 104 ? 15.102  17.907  62.812  1.00 17.25 ? 103 ARG A CD  1 
ATOM   855   N NE  . ARG A 1 104 ? 14.447  16.606  62.678  1.00 18.26 ? 103 ARG A NE  1 
ATOM   856   C CZ  . ARG A 1 104 ? 14.042  15.850  63.694  1.00 20.19 ? 103 ARG A CZ  1 
ATOM   857   N NH1 . ARG A 1 104 ? 14.217  16.261  64.947  1.00 18.02 ? 103 ARG A NH1 1 
ATOM   858   N NH2 . ARG A 1 104 ? 13.478  14.668  63.455  1.00 15.70 ? 103 ARG A NH2 1 
ATOM   859   N N   . ASN A 1 105 ? 14.633  21.426  59.085  1.00 20.72 ? 104 ASN A N   1 
ATOM   860   C CA  . ASN A 1 105 ? 14.261  21.355  57.672  1.00 22.01 ? 104 ASN A CA  1 
ATOM   861   C C   . ASN A 1 105 ? 15.230  22.208  56.858  1.00 22.96 ? 104 ASN A C   1 
ATOM   862   O O   . ASN A 1 105 ? 14.957  23.371  56.551  1.00 24.80 ? 104 ASN A O   1 
ATOM   863   C CB  . ASN A 1 105 ? 12.821  21.837  57.482  1.00 22.46 ? 104 ASN A CB  1 
ATOM   864   C CG  . ASN A 1 105 ? 12.394  21.865  56.019  1.00 23.96 ? 104 ASN A CG  1 
ATOM   865   O OD1 . ASN A 1 105 ? 12.816  21.035  55.214  1.00 23.92 ? 104 ASN A OD1 1 
ATOM   866   N ND2 . ASN A 1 105 ? 11.535  22.814  55.679  1.00 21.66 ? 104 ASN A ND2 1 
ATOM   867   N N   . ARG A 1 106 ? 16.370  21.614  56.521  1.00 21.27 ? 105 ARG A N   1 
ATOM   868   C CA  . ARG A 1 106 ? 17.410  22.299  55.770  1.00 23.24 ? 105 ARG A CA  1 
ATOM   869   C C   . ARG A 1 106 ? 16.970  22.735  54.373  1.00 24.84 ? 105 ARG A C   1 
ATOM   870   O O   . ARG A 1 106 ? 17.518  23.690  53.823  1.00 26.17 ? 105 ARG A O   1 
ATOM   871   C CB  . ARG A 1 106 ? 18.652  21.407  55.668  1.00 21.16 ? 105 ARG A CB  1 
ATOM   872   C CG  . ARG A 1 106 ? 19.109  20.816  56.999  1.00 21.69 ? 105 ARG A CG  1 
ATOM   873   C CD  . ARG A 1 106 ? 19.344  21.899  58.043  1.00 22.35 ? 105 ARG A CD  1 
ATOM   874   N NE  . ARG A 1 106 ? 20.450  22.777  57.680  1.00 23.95 ? 105 ARG A NE  1 
ATOM   875   C CZ  . ARG A 1 106 ? 20.781  23.884  58.338  1.00 24.57 ? 105 ARG A CZ  1 
ATOM   876   N NH1 . ARG A 1 106 ? 20.090  24.264  59.406  1.00 23.27 ? 105 ARG A NH1 1 
ATOM   877   N NH2 . ARG A 1 106 ? 21.806  24.615  57.924  1.00 24.60 ? 105 ARG A NH2 1 
ATOM   878   N N   . SER A 1 107 ? 15.987  22.042  53.804  1.00 24.46 ? 106 SER A N   1 
ATOM   879   C CA  . SER A 1 107 ? 15.490  22.378  52.473  1.00 26.09 ? 106 SER A CA  1 
ATOM   880   C C   . SER A 1 107 ? 14.703  23.675  52.486  1.00 25.47 ? 106 SER A C   1 
ATOM   881   O O   . SER A 1 107 ? 14.484  24.293  51.447  1.00 25.20 ? 106 SER A O   1 
ATOM   882   C CB  . SER A 1 107 ? 14.593  21.263  51.939  1.00 27.08 ? 106 SER A CB  1 
ATOM   883   O OG  . SER A 1 107 ? 15.344  20.087  51.687  1.00 34.47 ? 106 SER A OG  1 
ATOM   884   N N   . ASN A 1 108 ? 14.286  24.082  53.676  1.00 24.69 ? 107 ASN A N   1 
ATOM   885   C CA  . ASN A 1 108 ? 13.497  25.291  53.855  1.00 27.37 ? 107 ASN A CA  1 
ATOM   886   C C   . ASN A 1 108 ? 12.176  25.281  53.091  1.00 27.87 ? 107 ASN A C   1 
ATOM   887   O O   . ASN A 1 108 ? 11.599  26.333  52.816  1.00 27.42 ? 107 ASN A O   1 
ATOM   888   C CB  . ASN A 1 108 ? 14.314  26.534  53.495  1.00 25.86 ? 107 ASN A CB  1 
ATOM   889   C CG  . ASN A 1 108 ? 15.389  26.831  54.522  1.00 25.77 ? 107 ASN A CG  1 
ATOM   890   O OD1 . ASN A 1 108 ? 15.169  26.677  55.723  1.00 25.53 ? 107 ASN A OD1 1 
ATOM   891   N ND2 . ASN A 1 108 ? 16.549  27.264  54.059  1.00 24.93 ? 107 ASN A ND2 1 
ATOM   892   N N   . THR A 1 109 ? 11.695  24.090  52.750  1.00 28.85 ? 108 THR A N   1 
ATOM   893   C CA  . THR A 1 109 ? 10.413  23.984  52.066  1.00 30.77 ? 108 THR A CA  1 
ATOM   894   C C   . THR A 1 109 ? 9.386   24.476  53.076  1.00 30.12 ? 108 THR A C   1 
ATOM   895   O O   . THR A 1 109 ? 9.415   24.079  54.239  1.00 29.85 ? 108 THR A O   1 
ATOM   896   C CB  . THR A 1 109 ? 10.087  22.530  51.693  1.00 32.66 ? 108 THR A CB  1 
ATOM   897   O OG1 . THR A 1 109 ? 10.945  22.107  50.628  1.00 36.20 ? 108 THR A OG1 1 
ATOM   898   C CG2 . THR A 1 109 ? 8.646   22.403  51.249  1.00 35.25 ? 108 THR A CG2 1 
ATOM   899   N N   . PRO A 1 110 ? 8.465   25.352  52.652  1.00 29.85 ? 109 PRO A N   1 
ATOM   900   C CA  . PRO A 1 110 ? 7.457   25.862  53.583  1.00 29.12 ? 109 PRO A CA  1 
ATOM   901   C C   . PRO A 1 110 ? 6.640   24.799  54.310  1.00 28.73 ? 109 PRO A C   1 
ATOM   902   O O   . PRO A 1 110 ? 6.262   23.783  53.735  1.00 27.95 ? 109 PRO A O   1 
ATOM   903   C CB  . PRO A 1 110 ? 6.590   26.763  52.700  1.00 28.80 ? 109 PRO A CB  1 
ATOM   904   C CG  . PRO A 1 110 ? 6.747   26.159  51.335  1.00 31.65 ? 109 PRO A CG  1 
ATOM   905   C CD  . PRO A 1 110 ? 8.216   25.843  51.285  1.00 29.17 ? 109 PRO A CD  1 
ATOM   906   N N   . ILE A 1 111 ? 6.395   25.047  55.592  1.00 28.68 ? 110 ILE A N   1 
ATOM   907   C CA  . ILE A 1 111 ? 5.596   24.165  56.435  1.00 29.25 ? 110 ILE A CA  1 
ATOM   908   C C   . ILE A 1 111 ? 4.622   25.100  57.143  1.00 29.90 ? 110 ILE A C   1 
ATOM   909   O O   . ILE A 1 111 ? 5.025   25.917  57.973  1.00 28.98 ? 110 ILE A O   1 
ATOM   910   C CB  . ILE A 1 111 ? 6.462   23.428  57.485  1.00 28.88 ? 110 ILE A CB  1 
ATOM   911   C CG1 . ILE A 1 111 ? 7.418   22.454  56.790  1.00 27.38 ? 110 ILE A CG1 1 
ATOM   912   C CG2 . ILE A 1 111 ? 5.569   22.681  58.462  1.00 28.08 ? 110 ILE A CG2 1 
ATOM   913   C CD1 . ILE A 1 111 ? 8.335   21.703  57.747  1.00 24.80 ? 110 ILE A CD1 1 
ATOM   914   N N   . LEU A 1 112 ? 3.343   24.978  56.802  1.00 31.05 ? 111 LEU A N   1 
ATOM   915   C CA  . LEU A 1 112 ? 2.304   25.837  57.359  1.00 32.38 ? 111 LEU A CA  1 
ATOM   916   C C   . LEU A 1 112 ? 1.674   25.400  58.671  1.00 32.70 ? 111 LEU A C   1 
ATOM   917   O O   . LEU A 1 112 ? 1.411   24.220  58.896  1.00 33.94 ? 111 LEU A O   1 
ATOM   918   C CB  . LEU A 1 112 ? 1.186   26.030  56.331  1.00 33.05 ? 111 LEU A CB  1 
ATOM   919   C CG  . LEU A 1 112 ? 1.574   26.631  54.978  1.00 35.19 ? 111 LEU A CG  1 
ATOM   920   C CD1 . LEU A 1 112 ? 0.334   26.744  54.103  1.00 35.34 ? 111 LEU A CD1 1 
ATOM   921   C CD2 . LEU A 1 112 ? 2.210   28.000  55.181  1.00 36.47 ? 111 LEU A CD2 1 
ATOM   922   N N   . VAL A 1 113 ? 1.433   26.388  59.525  1.00 32.60 ? 112 VAL A N   1 
ATOM   923   C CA  . VAL A 1 113 ? 0.797   26.206  60.824  1.00 34.39 ? 112 VAL A CA  1 
ATOM   924   C C   . VAL A 1 113 ? -0.218  27.347  60.881  1.00 35.60 ? 112 VAL A C   1 
ATOM   925   O O   . VAL A 1 113 ? 0.158   28.520  60.975  1.00 35.90 ? 112 VAL A O   1 
ATOM   926   C CB  . VAL A 1 113 ? 1.811   26.355  61.989  1.00 33.79 ? 112 VAL A CB  1 
ATOM   927   C CG1 . VAL A 1 113 ? 1.078   26.377  63.327  1.00 34.76 ? 112 VAL A CG1 1 
ATOM   928   C CG2 . VAL A 1 113 ? 2.804   25.210  61.961  1.00 32.53 ? 112 VAL A CG2 1 
ATOM   929   N N   . ASP A 1 114 ? -1.500  27.007  60.801  1.00 36.31 ? 113 ASP A N   1 
ATOM   930   C CA  . ASP A 1 114 ? -2.544  28.023  60.810  1.00 37.05 ? 113 ASP A CA  1 
ATOM   931   C C   . ASP A 1 114 ? -2.340  28.923  59.593  1.00 36.50 ? 113 ASP A C   1 
ATOM   932   O O   . ASP A 1 114 ? -2.458  30.144  59.674  1.00 36.88 ? 113 ASP A O   1 
ATOM   933   C CB  . ASP A 1 114 ? -2.477  28.836  62.104  1.00 38.92 ? 113 ASP A CB  1 
ATOM   934   C CG  . ASP A 1 114 ? -2.861  28.016  63.323  1.00 41.45 ? 113 ASP A CG  1 
ATOM   935   O OD1 . ASP A 1 114 ? -2.362  28.310  64.433  1.00 41.17 ? 113 ASP A OD1 1 
ATOM   936   O OD2 . ASP A 1 114 ? -3.673  27.079  63.167  1.00 43.30 ? 113 ASP A OD2 1 
ATOM   937   N N   . GLY A 1 115 ? -2.004  28.293  58.471  1.00 36.46 ? 114 GLY A N   1 
ATOM   938   C CA  . GLY A 1 115 ? -1.798  29.005  57.221  1.00 36.48 ? 114 GLY A CA  1 
ATOM   939   C C   . GLY A 1 115 ? -0.557  29.870  57.092  1.00 37.00 ? 114 GLY A C   1 
ATOM   940   O O   . GLY A 1 115 ? -0.450  30.645  56.142  1.00 35.34 ? 114 GLY A O   1 
ATOM   941   N N   . LYS A 1 116 ? 0.391   29.744  58.016  1.00 35.75 ? 115 LYS A N   1 
ATOM   942   C CA  . LYS A 1 116 ? 1.595   30.563  57.944  1.00 34.75 ? 115 LYS A CA  1 
ATOM   943   C C   . LYS A 1 116 ? 2.864   29.729  58.018  1.00 33.23 ? 115 LYS A C   1 
ATOM   944   O O   . LYS A 1 116 ? 3.011   28.885  58.899  1.00 32.46 ? 115 LYS A O   1 
ATOM   945   C CB  . LYS A 1 116 ? 1.573   31.600  59.069  1.00 38.15 ? 115 LYS A CB  1 
ATOM   946   C CG  . LYS A 1 116 ? 2.703   32.614  59.031  1.00 40.65 ? 115 LYS A CG  1 
ATOM   947   C CD  . LYS A 1 116 ? 2.481   33.694  60.086  1.00 44.88 ? 115 LYS A CD  1 
ATOM   948   C CE  . LYS A 1 116 ? 3.714   34.569  60.273  1.00 46.33 ? 115 LYS A CE  1 
ATOM   949   N NZ  . LYS A 1 116 ? 4.138   35.223  59.004  1.00 49.74 ? 115 LYS A NZ  1 
ATOM   950   N N   . ASP A 1 117 ? 3.781   29.969  57.085  1.00 30.95 ? 116 ASP A N   1 
ATOM   951   C CA  . ASP A 1 117 ? 5.034   29.231  57.052  1.00 28.51 ? 116 ASP A CA  1 
ATOM   952   C C   . ASP A 1 117 ? 5.830   29.475  58.323  1.00 26.77 ? 116 ASP A C   1 
ATOM   953   O O   . ASP A 1 117 ? 6.020   30.608  58.759  1.00 23.61 ? 116 ASP A O   1 
ATOM   954   C CB  . ASP A 1 117 ? 5.865   29.620  55.824  1.00 29.61 ? 116 ASP A CB  1 
ATOM   955   C CG  . ASP A 1 117 ? 7.147   28.805  55.700  1.00 28.58 ? 116 ASP A CG  1 
ATOM   956   O OD1 . ASP A 1 117 ? 7.205   27.686  56.252  1.00 30.54 ? 116 ASP A OD1 1 
ATOM   957   O OD2 . ASP A 1 117 ? 8.094   29.272  55.035  1.00 28.72 ? 116 ASP A OD2 1 
ATOM   958   N N   . VAL A 1 118 ? 6.295   28.381  58.905  1.00 25.12 ? 117 VAL A N   1 
ATOM   959   C CA  . VAL A 1 118 ? 7.057   28.401  60.142  1.00 24.14 ? 117 VAL A CA  1 
ATOM   960   C C   . VAL A 1 118 ? 8.561   28.617  59.936  1.00 23.19 ? 117 VAL A C   1 
ATOM   961   O O   . VAL A 1 118 ? 9.261   29.097  60.834  1.00 22.12 ? 117 VAL A O   1 
ATOM   962   C CB  . VAL A 1 118 ? 6.816   27.061  60.890  1.00 25.14 ? 117 VAL A CB  1 
ATOM   963   C CG1 . VAL A 1 118 ? 8.072   26.599  61.580  1.00 29.54 ? 117 VAL A CG1 1 
ATOM   964   C CG2 . VAL A 1 118 ? 5.673   27.218  61.874  1.00 23.58 ? 117 VAL A CG2 1 
ATOM   965   N N   . MET A 1 119 ? 9.054   28.279  58.750  1.00 22.30 ? 118 MET A N   1 
ATOM   966   C CA  . MET A 1 119 ? 10.481  28.382  58.471  1.00 22.88 ? 118 MET A CA  1 
ATOM   967   C C   . MET A 1 119 ? 11.168  29.728  58.712  1.00 23.88 ? 118 MET A C   1 
ATOM   968   O O   . MET A 1 119 ? 12.267  29.772  59.272  1.00 23.70 ? 118 MET A O   1 
ATOM   969   C CB  . MET A 1 119 ? 10.763  27.876  57.058  1.00 22.84 ? 118 MET A CB  1 
ATOM   970   C CG  . MET A 1 119 ? 10.467  26.388  56.894  1.00 22.36 ? 118 MET A CG  1 
ATOM   971   S SD  . MET A 1 119 ? 11.056  25.370  58.283  1.00 22.98 ? 118 MET A SD  1 
ATOM   972   C CE  . MET A 1 119 ? 12.829  25.697  58.249  1.00 18.33 ? 118 MET A CE  1 
ATOM   973   N N   . PRO A 1 120 ? 10.542  30.844  58.304  1.00 25.55 ? 119 PRO A N   1 
ATOM   974   C CA  . PRO A 1 120 ? 11.200  32.134  58.540  1.00 25.63 ? 119 PRO A CA  1 
ATOM   975   C C   . PRO A 1 120 ? 11.563  32.343  60.014  1.00 24.74 ? 119 PRO A C   1 
ATOM   976   O O   . PRO A 1 120 ? 12.658  32.802  60.328  1.00 25.38 ? 119 PRO A O   1 
ATOM   977   C CB  . PRO A 1 120 ? 10.169  33.139  58.035  1.00 27.53 ? 119 PRO A CB  1 
ATOM   978   C CG  . PRO A 1 120 ? 9.536   32.393  56.887  1.00 26.72 ? 119 PRO A CG  1 
ATOM   979   C CD  . PRO A 1 120 ? 9.322   31.018  57.499  1.00 25.64 ? 119 PRO A CD  1 
ATOM   980   N N   . GLU A 1 121 ? 10.647  32.000  60.914  1.00 24.97 ? 120 GLU A N   1 
ATOM   981   C CA  . GLU A 1 121 ? 10.894  32.143  62.348  1.00 24.14 ? 120 GLU A CA  1 
ATOM   982   C C   . GLU A 1 121 ? 11.992  31.181  62.805  1.00 23.08 ? 120 GLU A C   1 
ATOM   983   O O   . GLU A 1 121 ? 12.857  31.544  63.600  1.00 21.63 ? 120 GLU A O   1 
ATOM   984   C CB  . GLU A 1 121 ? 9.610   31.878  63.130  1.00 28.64 ? 120 GLU A CB  1 
ATOM   985   C CG  . GLU A 1 121 ? 8.528   32.914  62.889  1.00 36.06 ? 120 GLU A CG  1 
ATOM   986   C CD  . GLU A 1 121 ? 9.001   34.323  63.203  1.00 41.41 ? 120 GLU A CD  1 
ATOM   987   O OE1 . GLU A 1 121 ? 9.386   34.582  64.366  1.00 42.10 ? 120 GLU A OE1 1 
ATOM   988   O OE2 . GLU A 1 121 ? 8.994   35.171  62.281  1.00 45.63 ? 120 GLU A OE2 1 
ATOM   989   N N   . VAL A 1 122 ? 11.953  29.953  62.294  1.00 21.75 ? 121 VAL A N   1 
ATOM   990   C CA  . VAL A 1 122 ? 12.956  28.950  62.629  1.00 19.72 ? 121 VAL A CA  1 
ATOM   991   C C   . VAL A 1 122 ? 14.350  29.441  62.261  1.00 20.46 ? 121 VAL A C   1 
ATOM   992   O O   . VAL A 1 122 ? 15.278  29.369  63.068  1.00 19.76 ? 121 VAL A O   1 
ATOM   993   C CB  . VAL A 1 122 ? 12.694  27.627  61.872  1.00 20.29 ? 121 VAL A CB  1 
ATOM   994   C CG1 . VAL A 1 122 ? 13.943  26.742  61.908  1.00 19.16 ? 121 VAL A CG1 1 
ATOM   995   C CG2 . VAL A 1 122 ? 11.505  26.910  62.486  1.00 15.69 ? 121 VAL A CG2 1 
ATOM   996   N N   . ASN A 1 123 ? 14.494  29.942  61.036  1.00 22.19 ? 122 ASN A N   1 
ATOM   997   C CA  . ASN A 1 123 ? 15.785  30.430  60.570  1.00 22.82 ? 122 ASN A CA  1 
ATOM   998   C C   . ASN A 1 123 ? 16.210  31.713  61.267  1.00 23.12 ? 122 ASN A C   1 
ATOM   999   O O   . ASN A 1 123 ? 17.401  31.969  61.435  1.00 22.43 ? 122 ASN A O   1 
ATOM   1000  C CB  . ASN A 1 123 ? 15.770  30.615  59.047  1.00 22.95 ? 122 ASN A CB  1 
ATOM   1001  C CG  . ASN A 1 123 ? 15.660  29.290  58.311  1.00 23.30 ? 122 ASN A CG  1 
ATOM   1002  O OD1 . ASN A 1 123 ? 16.295  28.312  58.695  1.00 21.14 ? 122 ASN A OD1 1 
ATOM   1003  N ND2 . ASN A 1 123 ? 14.861  29.255  57.249  1.00 23.44 ? 122 ASN A ND2 1 
ATOM   1004  N N   . LYS A 1 124 ? 15.239  32.511  61.692  1.00 24.24 ? 123 LYS A N   1 
ATOM   1005  C CA  . LYS A 1 124 ? 15.550  33.751  62.391  1.00 25.52 ? 123 LYS A CA  1 
ATOM   1006  C C   . LYS A 1 124 ? 16.273  33.405  63.698  1.00 24.73 ? 123 LYS A C   1 
ATOM   1007  O O   . LYS A 1 124 ? 17.310  33.987  64.018  1.00 22.97 ? 123 LYS A O   1 
ATOM   1008  C CB  . LYS A 1 124 ? 14.261  34.520  62.683  1.00 28.20 ? 123 LYS A CB  1 
ATOM   1009  C CG  . LYS A 1 124 ? 14.456  35.906  63.281  1.00 33.76 ? 123 LYS A CG  1 
ATOM   1010  C CD  . LYS A 1 124 ? 13.101  36.564  63.508  1.00 36.61 ? 123 LYS A CD  1 
ATOM   1011  C CE  . LYS A 1 124 ? 13.231  37.959  64.094  1.00 40.57 ? 123 LYS A CE  1 
ATOM   1012  N NZ  . LYS A 1 124 ? 11.886  38.556  64.359  1.00 42.78 ? 123 LYS A NZ  1 
ATOM   1013  N N   . VAL A 1 125 ? 15.731  32.445  64.445  1.00 23.40 ? 124 VAL A N   1 
ATOM   1014  C CA  . VAL A 1 125 ? 16.351  32.032  65.701  1.00 21.48 ? 124 VAL A CA  1 
ATOM   1015  C C   . VAL A 1 125 ? 17.720  31.405  65.446  1.00 21.62 ? 124 VAL A C   1 
ATOM   1016  O O   . VAL A 1 125 ? 18.673  31.678  66.175  1.00 22.42 ? 124 VAL A O   1 
ATOM   1017  C CB  . VAL A 1 125 ? 15.471  31.024  66.469  1.00 21.11 ? 124 VAL A CB  1 
ATOM   1018  C CG1 . VAL A 1 125 ? 16.178  30.576  67.738  1.00 18.65 ? 124 VAL A CG1 1 
ATOM   1019  C CG2 . VAL A 1 125 ? 14.136  31.669  66.822  1.00 20.02 ? 124 VAL A CG2 1 
ATOM   1020  N N   . LEU A 1 126 ? 17.818  30.570  64.413  1.00 21.42 ? 125 LEU A N   1 
ATOM   1021  C CA  . LEU A 1 126 ? 19.091  29.930  64.075  1.00 21.00 ? 125 LEU A CA  1 
ATOM   1022  C C   . LEU A 1 126 ? 20.145  30.990  63.749  1.00 20.65 ? 125 LEU A C   1 
ATOM   1023  O O   . LEU A 1 126 ? 21.300  30.876  64.161  1.00 21.28 ? 125 LEU A O   1 
ATOM   1024  C CB  . LEU A 1 126 ? 18.920  28.975  62.882  1.00 19.35 ? 125 LEU A CB  1 
ATOM   1025  C CG  . LEU A 1 126 ? 18.271  27.607  63.148  1.00 19.43 ? 125 LEU A CG  1 
ATOM   1026  C CD1 . LEU A 1 126 ? 17.980  26.887  61.820  1.00 15.63 ? 125 LEU A CD1 1 
ATOM   1027  C CD2 . LEU A 1 126 ? 19.201  26.770  64.011  1.00 14.84 ? 125 LEU A CD2 1 
ATOM   1028  N N   . ASP A 1 127 ? 19.753  32.018  63.005  1.00 22.16 ? 126 ASP A N   1 
ATOM   1029  C CA  . ASP A 1 127 ? 20.696  33.085  62.672  1.00 25.23 ? 126 ASP A CA  1 
ATOM   1030  C C   . ASP A 1 127 ? 21.159  33.778  63.945  1.00 22.05 ? 126 ASP A C   1 
ATOM   1031  O O   . ASP A 1 127 ? 22.330  34.123  64.086  1.00 22.33 ? 126 ASP A O   1 
ATOM   1032  C CB  . ASP A 1 127 ? 20.060  34.118  61.736  1.00 30.04 ? 126 ASP A CB  1 
ATOM   1033  C CG  . ASP A 1 127 ? 19.801  33.566  60.351  1.00 34.46 ? 126 ASP A CG  1 
ATOM   1034  O OD1 . ASP A 1 127 ? 20.594  32.714  59.884  1.00 39.91 ? 126 ASP A OD1 1 
ATOM   1035  O OD2 . ASP A 1 127 ? 18.813  33.992  59.720  1.00 39.35 ? 126 ASP A OD2 1 
ATOM   1036  N N   . LYS A 1 128 ? 20.235  33.977  64.876  1.00 21.17 ? 127 LYS A N   1 
ATOM   1037  C CA  . LYS A 1 128 ? 20.576  34.624  66.135  1.00 22.85 ? 127 LYS A CA  1 
ATOM   1038  C C   . LYS A 1 128 ? 21.546  33.748  66.921  1.00 21.10 ? 127 LYS A C   1 
ATOM   1039  O O   . LYS A 1 128 ? 22.460  34.253  67.580  1.00 22.30 ? 127 LYS A O   1 
ATOM   1040  C CB  . LYS A 1 128 ? 19.312  34.879  66.966  1.00 25.57 ? 127 LYS A CB  1 
ATOM   1041  C CG  . LYS A 1 128 ? 19.570  35.677  68.235  1.00 29.62 ? 127 LYS A CG  1 
ATOM   1042  C CD  . LYS A 1 128 ? 18.299  35.909  69.040  1.00 33.37 ? 127 LYS A CD  1 
ATOM   1043  C CE  . LYS A 1 128 ? 17.336  36.828  68.316  1.00 35.62 ? 127 LYS A CE  1 
ATOM   1044  N NZ  . LYS A 1 128 ? 16.076  37.031  69.095  1.00 39.69 ? 127 LYS A NZ  1 
ATOM   1045  N N   . MET A 1 129 ? 21.345  32.434  66.845  1.00 18.51 ? 128 MET A N   1 
ATOM   1046  C CA  . MET A 1 129 ? 22.202  31.478  67.547  1.00 19.56 ? 128 MET A CA  1 
ATOM   1047  C C   . MET A 1 129 ? 23.601  31.509  66.963  1.00 18.88 ? 128 MET A C   1 
ATOM   1048  O O   . MET A 1 129 ? 24.590  31.544  67.698  1.00 20.16 ? 128 MET A O   1 
ATOM   1049  C CB  . MET A 1 129 ? 21.626  30.051  67.434  1.00 17.82 ? 128 MET A CB  1 
ATOM   1050  C CG  . MET A 1 129 ? 20.298  29.867  68.163  1.00 21.15 ? 128 MET A CG  1 
ATOM   1051  S SD  . MET A 1 129 ? 19.514  28.262  67.902  1.00 20.70 ? 128 MET A SD  1 
ATOM   1052  C CE  . MET A 1 129 ? 20.587  27.204  68.886  1.00 18.17 ? 128 MET A CE  1 
ATOM   1053  N N   . LYS A 1 130 ? 23.668  31.497  65.633  1.00 19.49 ? 129 LYS A N   1 
ATOM   1054  C CA  . LYS A 1 130 ? 24.935  31.518  64.919  1.00 21.32 ? 129 LYS A CA  1 
ATOM   1055  C C   . LYS A 1 130 ? 25.749  32.751  65.308  1.00 21.93 ? 129 LYS A C   1 
ATOM   1056  O O   . LYS A 1 130 ? 26.938  32.655  65.608  1.00 23.34 ? 129 LYS A O   1 
ATOM   1057  C CB  . LYS A 1 130 ? 24.675  31.514  63.411  1.00 22.82 ? 129 LYS A CB  1 
ATOM   1058  C CG  . LYS A 1 130 ? 25.930  31.578  62.558  1.00 23.66 ? 129 LYS A CG  1 
ATOM   1059  C CD  . LYS A 1 130 ? 25.594  31.465  61.080  1.00 28.99 ? 129 LYS A CD  1 
ATOM   1060  C CE  . LYS A 1 130 ? 26.861  31.333  60.244  1.00 31.63 ? 129 LYS A CE  1 
ATOM   1061  N NZ  . LYS A 1 130 ? 26.557  31.132  58.800  1.00 36.25 ? 129 LYS A NZ  1 
ATOM   1062  N N   . SER A 1 131 ? 25.099  33.906  65.303  1.00 21.55 ? 130 SER A N   1 
ATOM   1063  C CA  . SER A 1 131 ? 25.761  35.157  65.658  1.00 22.91 ? 130 SER A CA  1 
ATOM   1064  C C   . SER A 1 131 ? 26.282  35.134  67.097  1.00 22.01 ? 130 SER A C   1 
ATOM   1065  O O   . SER A 1 131 ? 27.423  35.513  67.364  1.00 23.92 ? 130 SER A O   1 
ATOM   1066  C CB  . SER A 1 131 ? 24.785  36.327  65.474  1.00 23.42 ? 130 SER A CB  1 
ATOM   1067  O OG  . SER A 1 131 ? 25.215  37.472  66.188  1.00 26.92 ? 130 SER A OG  1 
ATOM   1068  N N   . PHE A 1 132 ? 25.442  34.686  68.021  1.00 20.44 ? 131 PHE A N   1 
ATOM   1069  C CA  . PHE A 1 132 ? 25.822  34.629  69.426  1.00 18.66 ? 131 PHE A CA  1 
ATOM   1070  C C   . PHE A 1 132 ? 26.974  33.652  69.670  1.00 18.77 ? 131 PHE A C   1 
ATOM   1071  O O   . PHE A 1 132 ? 27.910  33.955  70.414  1.00 16.39 ? 131 PHE A O   1 
ATOM   1072  C CB  . PHE A 1 132 ? 24.618  34.224  70.277  1.00 16.89 ? 131 PHE A CB  1 
ATOM   1073  C CG  . PHE A 1 132 ? 24.888  34.244  71.751  1.00 20.38 ? 131 PHE A CG  1 
ATOM   1074  C CD1 . PHE A 1 132 ? 24.982  35.451  72.439  1.00 20.87 ? 131 PHE A CD1 1 
ATOM   1075  C CD2 . PHE A 1 132 ? 25.061  33.056  72.457  1.00 18.73 ? 131 PHE A CD2 1 
ATOM   1076  C CE1 . PHE A 1 132 ? 25.244  35.472  73.814  1.00 21.96 ? 131 PHE A CE1 1 
ATOM   1077  C CE2 . PHE A 1 132 ? 25.321  33.068  73.822  1.00 18.59 ? 131 PHE A CE2 1 
ATOM   1078  C CZ  . PHE A 1 132 ? 25.413  34.276  74.503  1.00 20.87 ? 131 PHE A CZ  1 
ATOM   1079  N N   . CYS A 1 133 ? 26.899  32.476  69.050  1.00 19.50 ? 132 CYS A N   1 
ATOM   1080  C CA  . CYS A 1 133 ? 27.945  31.473  69.219  1.00 20.87 ? 132 CYS A CA  1 
ATOM   1081  C C   . CYS A 1 133 ? 29.269  31.997  68.688  1.00 21.21 ? 132 CYS A C   1 
ATOM   1082  O O   . CYS A 1 133 ? 30.314  31.823  69.310  1.00 19.44 ? 132 CYS A O   1 
ATOM   1083  C CB  . CYS A 1 133 ? 27.558  30.171  68.506  1.00 20.90 ? 132 CYS A CB  1 
ATOM   1084  S SG  . CYS A 1 133 ? 26.212  29.271  69.332  1.00 23.54 ? 132 CYS A SG  1 
ATOM   1085  N N   . GLN A 1 134 ? 29.214  32.653  67.538  1.00 23.06 ? 133 GLN A N   1 
ATOM   1086  C CA  . GLN A 1 134 ? 30.407  33.222  66.932  1.00 24.81 ? 133 GLN A CA  1 
ATOM   1087  C C   . GLN A 1 134 ? 31.099  34.200  67.882  1.00 22.96 ? 133 GLN A C   1 
ATOM   1088  O O   . GLN A 1 134 ? 32.311  34.127  68.088  1.00 21.87 ? 133 GLN A O   1 
ATOM   1089  C CB  . GLN A 1 134 ? 30.028  33.939  65.635  1.00 29.12 ? 133 GLN A CB  1 
ATOM   1090  C CG  . GLN A 1 134 ? 31.175  34.664  64.958  1.00 35.38 ? 133 GLN A CG  1 
ATOM   1091  C CD  . GLN A 1 134 ? 30.731  35.384  63.698  1.00 41.28 ? 133 GLN A CD  1 
ATOM   1092  O OE1 . GLN A 1 134 ? 29.839  36.237  63.733  1.00 43.86 ? 133 GLN A OE1 1 
ATOM   1093  N NE2 . GLN A 1 134 ? 31.352  35.040  62.572  1.00 43.76 ? 133 GLN A NE2 1 
ATOM   1094  N N   . ARG A 1 135 ? 30.323  35.105  68.470  1.00 22.95 ? 134 ARG A N   1 
ATOM   1095  C CA  . ARG A 1 135 ? 30.875  36.108  69.377  1.00 23.98 ? 134 ARG A CA  1 
ATOM   1096  C C   . ARG A 1 135 ? 31.437  35.539  70.668  1.00 24.07 ? 134 ARG A C   1 
ATOM   1097  O O   . ARG A 1 135 ? 32.488  35.973  71.140  1.00 21.70 ? 134 ARG A O   1 
ATOM   1098  C CB  . ARG A 1 135 ? 29.817  37.161  69.695  1.00 25.92 ? 134 ARG A CB  1 
ATOM   1099  C CG  . ARG A 1 135 ? 29.558  38.128  68.554  1.00 27.87 ? 134 ARG A CG  1 
ATOM   1100  C CD  . ARG A 1 135 ? 28.420  39.050  68.901  1.00 32.51 ? 134 ARG A CD  1 
ATOM   1101  N NE  . ARG A 1 135 ? 27.142  38.362  68.786  1.00 36.42 ? 134 ARG A NE  1 
ATOM   1102  C CZ  . ARG A 1 135 ? 26.052  38.684  69.472  1.00 38.04 ? 134 ARG A CZ  1 
ATOM   1103  N NH1 . ARG A 1 135 ? 26.080  39.689  70.339  1.00 39.23 ? 134 ARG A NH1 1 
ATOM   1104  N NH2 . ARG A 1 135 ? 24.931  38.003  69.280  1.00 37.17 ? 134 ARG A NH2 1 
ATOM   1105  N N   . VAL A 1 136 ? 30.747  34.564  71.248  1.00 24.13 ? 135 VAL A N   1 
ATOM   1106  C CA  . VAL A 1 136 ? 31.241  33.976  72.482  1.00 23.18 ? 135 VAL A CA  1 
ATOM   1107  C C   . VAL A 1 136 ? 32.531  33.198  72.231  1.00 24.10 ? 135 VAL A C   1 
ATOM   1108  O O   . VAL A 1 136 ? 33.463  33.261  73.033  1.00 24.32 ? 135 VAL A O   1 
ATOM   1109  C CB  . VAL A 1 136 ? 30.208  33.021  73.124  1.00 21.87 ? 135 VAL A CB  1 
ATOM   1110  C CG1 . VAL A 1 136 ? 30.820  32.350  74.348  1.00 22.01 ? 135 VAL A CG1 1 
ATOM   1111  C CG2 . VAL A 1 136 ? 28.954  33.787  73.517  1.00 19.97 ? 135 VAL A CG2 1 
ATOM   1112  N N   . ARG A 1 137 ? 32.591  32.474  71.116  1.00 24.72 ? 136 ARG A N   1 
ATOM   1113  C CA  . ARG A 1 137 ? 33.771  31.666  70.810  1.00 27.11 ? 136 ARG A CA  1 
ATOM   1114  C C   . ARG A 1 137 ? 34.961  32.506  70.374  1.00 25.60 ? 136 ARG A C   1 
ATOM   1115  O O   . ARG A 1 137 ? 36.106  32.147  70.648  1.00 25.45 ? 136 ARG A O   1 
ATOM   1116  C CB  . ARG A 1 137 ? 33.456  30.633  69.720  1.00 25.06 ? 136 ARG A CB  1 
ATOM   1117  C CG  . ARG A 1 137 ? 32.094  29.982  69.861  1.00 30.13 ? 136 ARG A CG  1 
ATOM   1118  C CD  . ARG A 1 137 ? 32.153  28.473  69.888  1.00 30.14 ? 136 ARG A CD  1 
ATOM   1119  N NE  . ARG A 1 137 ? 32.850  27.893  68.743  1.00 26.55 ? 136 ARG A NE  1 
ATOM   1120  C CZ  . ARG A 1 137 ? 33.191  26.611  68.672  1.00 25.97 ? 136 ARG A CZ  1 
ATOM   1121  N NH1 . ARG A 1 137 ? 32.890  25.794  69.675  1.00 26.19 ? 136 ARG A NH1 1 
ATOM   1122  N NH2 . ARG A 1 137 ? 33.854  26.148  67.621  1.00 23.02 ? 136 ARG A NH2 1 
ATOM   1123  N N   . SER A 1 138 ? 34.689  33.619  69.697  1.00 25.29 ? 137 SER A N   1 
ATOM   1124  C CA  . SER A 1 138 ? 35.750  34.505  69.218  1.00 25.51 ? 137 SER A CA  1 
ATOM   1125  C C   . SER A 1 138 ? 36.355  35.335  70.353  1.00 25.53 ? 137 SER A C   1 
ATOM   1126  O O   . SER A 1 138 ? 37.436  35.914  70.212  1.00 26.20 ? 137 SER A O   1 
ATOM   1127  C CB  . SER A 1 138 ? 35.201  35.453  68.152  1.00 24.46 ? 137 SER A CB  1 
ATOM   1128  O OG  . SER A 1 138 ? 34.352  36.430  68.733  1.00 25.55 ? 137 SER A OG  1 
ATOM   1129  N N   . GLY A 1 139 ? 35.653  35.399  71.477  1.00 26.41 ? 138 GLY A N   1 
ATOM   1130  C CA  . GLY A 1 139 ? 36.146  36.183  72.595  1.00 26.34 ? 138 GLY A CA  1 
ATOM   1131  C C   . GLY A 1 139 ? 35.632  37.611  72.534  1.00 27.06 ? 138 GLY A C   1 
ATOM   1132  O O   . GLY A 1 139 ? 36.044  38.459  73.329  1.00 27.09 ? 138 GLY A O   1 
ATOM   1133  N N   . ASP A 1 140 ? 34.735  37.880  71.586  1.00 27.90 ? 139 ASP A N   1 
ATOM   1134  C CA  . ASP A 1 140 ? 34.149  39.209  71.435  1.00 28.98 ? 139 ASP A CA  1 
ATOM   1135  C C   . ASP A 1 140 ? 33.161  39.507  72.554  1.00 27.79 ? 139 ASP A C   1 
ATOM   1136  O O   . ASP A 1 140 ? 33.026  40.652  72.979  1.00 28.33 ? 139 ASP A O   1 
ATOM   1137  C CB  . ASP A 1 140 ? 33.453  39.337  70.083  1.00 32.91 ? 139 ASP A CB  1 
ATOM   1138  C CG  . ASP A 1 140 ? 34.409  39.737  68.984  1.00 40.32 ? 139 ASP A CG  1 
ATOM   1139  O OD1 . ASP A 1 140 ? 34.949  40.866  69.056  1.00 43.13 ? 139 ASP A OD1 1 
ATOM   1140  O OD2 . ASP A 1 140 ? 34.630  38.926  68.056  1.00 43.27 ? 139 ASP A OD2 1 
ATOM   1141  N N   . TRP A 1 141 ? 32.459  38.478  73.017  1.00 24.41 ? 140 TRP A N   1 
ATOM   1142  C CA  . TRP A 1 141 ? 31.512  38.636  74.115  1.00 23.16 ? 140 TRP A CA  1 
ATOM   1143  C C   . TRP A 1 141 ? 32.335  38.509  75.390  1.00 22.28 ? 140 TRP A C   1 
ATOM   1144  O O   . TRP A 1 141 ? 32.948  37.470  75.631  1.00 24.64 ? 140 TRP A O   1 
ATOM   1145  C CB  . TRP A 1 141 ? 30.441  37.541  74.061  1.00 22.24 ? 140 TRP A CB  1 
ATOM   1146  C CG  . TRP A 1 141 ? 29.459  37.587  75.201  1.00 21.91 ? 140 TRP A CG  1 
ATOM   1147  C CD1 . TRP A 1 141 ? 29.674  37.182  76.494  1.00 22.24 ? 140 TRP A CD1 1 
ATOM   1148  C CD2 . TRP A 1 141 ? 28.111  38.071  75.153  1.00 21.89 ? 140 TRP A CD2 1 
ATOM   1149  N NE1 . TRP A 1 141 ? 28.540  37.381  77.248  1.00 20.40 ? 140 TRP A NE1 1 
ATOM   1150  C CE2 . TRP A 1 141 ? 27.567  37.926  76.450  1.00 23.08 ? 140 TRP A CE2 1 
ATOM   1151  C CE3 . TRP A 1 141 ? 27.309  38.613  74.140  1.00 23.52 ? 140 TRP A CE3 1 
ATOM   1152  C CZ2 . TRP A 1 141 ? 26.254  38.305  76.758  1.00 24.17 ? 140 TRP A CZ2 1 
ATOM   1153  C CZ3 . TRP A 1 141 ? 26.001  38.990  74.451  1.00 22.56 ? 140 TRP A CZ3 1 
ATOM   1154  C CH2 . TRP A 1 141 ? 25.490  38.833  75.749  1.00 21.85 ? 140 TRP A CH2 1 
ATOM   1155  N N   . LYS A 1 142 ? 32.360  39.560  76.204  1.00 21.08 ? 141 LYS A N   1 
ATOM   1156  C CA  . LYS A 1 142 ? 33.148  39.522  77.434  1.00 21.00 ? 141 LYS A CA  1 
ATOM   1157  C C   . LYS A 1 142 ? 32.352  39.682  78.720  1.00 20.25 ? 141 LYS A C   1 
ATOM   1158  O O   . LYS A 1 142 ? 31.261  40.254  78.727  1.00 20.02 ? 141 LYS A O   1 
ATOM   1159  C CB  . LYS A 1 142 ? 34.263  40.578  77.370  1.00 20.71 ? 141 LYS A CB  1 
ATOM   1160  C CG  . LYS A 1 142 ? 35.231  40.339  76.218  1.00 22.13 ? 141 LYS A CG  1 
ATOM   1161  C CD  . LYS A 1 142 ? 36.446  41.251  76.265  1.00 24.83 ? 141 LYS A CD  1 
ATOM   1162  C CE  . LYS A 1 142 ? 37.403  40.930  75.125  1.00 22.93 ? 141 LYS A CE  1 
ATOM   1163  N NZ  . LYS A 1 142 ? 36.702  41.002  73.813  1.00 27.35 ? 141 LYS A NZ  1 
ATOM   1164  N N   . GLY A 1 143 ? 32.912  39.160  79.808  1.00 19.33 ? 142 GLY A N   1 
ATOM   1165  C CA  . GLY A 1 143 ? 32.260  39.243  81.100  1.00 19.43 ? 142 GLY A CA  1 
ATOM   1166  C C   . GLY A 1 143 ? 32.314  40.649  81.662  1.00 22.20 ? 142 GLY A C   1 
ATOM   1167  O O   . GLY A 1 143 ? 32.854  41.557  81.020  1.00 20.65 ? 142 GLY A O   1 
ATOM   1168  N N   . TYR A 1 144 ? 31.783  40.831  82.869  1.00 20.31 ? 143 TYR A N   1 
ATOM   1169  C CA  . TYR A 1 144 ? 31.760  42.155  83.472  1.00 22.61 ? 143 TYR A CA  1 
ATOM   1170  C C   . TYR A 1 144 ? 33.140  42.731  83.826  1.00 23.10 ? 143 TYR A C   1 
ATOM   1171  O O   . TYR A 1 144 ? 33.248  43.924  84.125  1.00 23.63 ? 143 TYR A O   1 
ATOM   1172  C CB  . TYR A 1 144 ? 30.840  42.170  84.702  1.00 19.76 ? 143 TYR A CB  1 
ATOM   1173  C CG  . TYR A 1 144 ? 31.440  41.599  85.956  1.00 22.14 ? 143 TYR A CG  1 
ATOM   1174  C CD1 . TYR A 1 144 ? 31.572  40.221  86.131  1.00 23.47 ? 143 TYR A CD1 1 
ATOM   1175  C CD2 . TYR A 1 144 ? 31.882  42.440  86.979  1.00 23.80 ? 143 TYR A CD2 1 
ATOM   1176  C CE1 . TYR A 1 144 ? 32.131  39.698  87.294  1.00 25.22 ? 143 TYR A CE1 1 
ATOM   1177  C CE2 . TYR A 1 144 ? 32.441  41.928  88.141  1.00 25.22 ? 143 TYR A CE2 1 
ATOM   1178  C CZ  . TYR A 1 144 ? 32.563  40.560  88.292  1.00 25.78 ? 143 TYR A CZ  1 
ATOM   1179  O OH  . TYR A 1 144 ? 33.128  40.060  89.438  1.00 29.94 ? 143 TYR A OH  1 
ATOM   1180  N N   . THR A 1 145 ? 34.186  41.902  83.791  1.00 22.79 ? 144 THR A N   1 
ATOM   1181  C CA  . THR A 1 145 ? 35.539  42.380  84.083  1.00 22.22 ? 144 THR A CA  1 
ATOM   1182  C C   . THR A 1 145 ? 36.404  42.354  82.825  1.00 22.88 ? 144 THR A C   1 
ATOM   1183  O O   . THR A 1 145 ? 37.635  42.438  82.900  1.00 23.22 ? 144 THR A O   1 
ATOM   1184  C CB  . THR A 1 145 ? 36.247  41.547  85.180  1.00 23.11 ? 144 THR A CB  1 
ATOM   1185  O OG1 . THR A 1 145 ? 36.287  40.168  84.795  1.00 22.89 ? 144 THR A OG1 1 
ATOM   1186  C CG2 . THR A 1 145 ? 35.523  41.696  86.512  1.00 22.72 ? 144 THR A CG2 1 
ATOM   1187  N N   . GLY A 1 146 ? 35.751  42.225  81.675  1.00 20.56 ? 145 GLY A N   1 
ATOM   1188  C CA  . GLY A 1 146 ? 36.458  42.209  80.407  1.00 22.00 ? 145 GLY A CA  1 
ATOM   1189  C C   . GLY A 1 146 ? 37.090  40.901  79.965  1.00 22.53 ? 145 GLY A C   1 
ATOM   1190  O O   . GLY A 1 146 ? 37.844  40.886  79.001  1.00 22.04 ? 145 GLY A O   1 
ATOM   1191  N N   . LYS A 1 147 ? 36.793  39.801  80.648  1.00 23.43 ? 146 LYS A N   1 
ATOM   1192  C CA  . LYS A 1 147 ? 37.383  38.513  80.274  1.00 24.75 ? 146 LYS A CA  1 
ATOM   1193  C C   . LYS A 1 147 ? 36.459  37.684  79.385  1.00 25.67 ? 146 LYS A C   1 
ATOM   1194  O O   . LYS A 1 147 ? 35.243  37.875  79.383  1.00 26.28 ? 146 LYS A O   1 
ATOM   1195  C CB  . LYS A 1 147 ? 37.740  37.708  81.524  1.00 24.08 ? 146 LYS A CB  1 
ATOM   1196  C CG  . LYS A 1 147 ? 38.779  38.375  82.400  1.00 24.89 ? 146 LYS A CG  1 
ATOM   1197  C CD  . LYS A 1 147 ? 39.155  37.502  83.578  1.00 26.67 ? 146 LYS A CD  1 
ATOM   1198  C CE  . LYS A 1 147 ? 40.131  38.217  84.490  1.00 27.57 ? 146 LYS A CE  1 
ATOM   1199  N NZ  . LYS A 1 147 ? 40.342  37.474  85.757  1.00 30.33 ? 146 LYS A NZ  1 
ATOM   1200  N N   . THR A 1 148 ? 37.051  36.769  78.622  1.00 24.55 ? 147 THR A N   1 
ATOM   1201  C CA  . THR A 1 148 ? 36.291  35.907  77.726  1.00 23.76 ? 147 THR A CA  1 
ATOM   1202  C C   . THR A 1 148 ? 35.615  34.780  78.517  1.00 22.87 ? 147 THR A C   1 
ATOM   1203  O O   . THR A 1 148 ? 36.018  34.458  79.635  1.00 21.96 ? 147 THR A O   1 
ATOM   1204  C CB  . THR A 1 148 ? 37.189  35.299  76.633  1.00 24.35 ? 147 THR A CB  1 
ATOM   1205  O OG1 . THR A 1 148 ? 38.237  34.538  77.243  1.00 26.73 ? 147 THR A OG1 1 
ATOM   1206  C CG2 . THR A 1 148 ? 37.799  36.406  75.782  1.00 24.56 ? 147 THR A CG2 1 
ATOM   1207  N N   . ILE A 1 149 ? 34.584  34.187  77.927  1.00 22.22 ? 148 ILE A N   1 
ATOM   1208  C CA  . ILE A 1 149 ? 33.841  33.113  78.571  1.00 20.49 ? 148 ILE A CA  1 
ATOM   1209  C C   . ILE A 1 149 ? 34.567  31.768  78.463  1.00 19.74 ? 148 ILE A C   1 
ATOM   1210  O O   . ILE A 1 149 ? 34.845  31.288  77.366  1.00 18.60 ? 148 ILE A O   1 
ATOM   1211  C CB  . ILE A 1 149 ? 32.434  32.974  77.946  1.00 20.82 ? 148 ILE A CB  1 
ATOM   1212  C CG1 . ILE A 1 149 ? 31.656  34.274  78.136  1.00 18.43 ? 148 ILE A CG1 1 
ATOM   1213  C CG2 . ILE A 1 149 ? 31.706  31.785  78.561  1.00 18.07 ? 148 ILE A CG2 1 
ATOM   1214  C CD1 . ILE A 1 149 ? 31.464  34.675  79.589  1.00 18.73 ? 148 ILE A CD1 1 
ATOM   1215  N N   . THR A 1 150 ? 34.857  31.162  79.607  1.00 18.73 ? 149 THR A N   1 
ATOM   1216  C CA  . THR A 1 150 ? 35.539  29.882  79.642  1.00 18.57 ? 149 THR A CA  1 
ATOM   1217  C C   . THR A 1 150 ? 34.560  28.746  79.956  1.00 19.68 ? 149 THR A C   1 
ATOM   1218  O O   . THR A 1 150 ? 34.803  27.589  79.609  1.00 19.08 ? 149 THR A O   1 
ATOM   1219  C CB  . THR A 1 150 ? 36.634  29.879  80.722  1.00 19.09 ? 149 THR A CB  1 
ATOM   1220  O OG1 . THR A 1 150 ? 36.049  30.196  81.990  1.00 18.41 ? 149 THR A OG1 1 
ATOM   1221  C CG2 . THR A 1 150 ? 37.724  30.908  80.397  1.00 21.63 ? 149 THR A CG2 1 
ATOM   1222  N N   . ASP A 1 151 ? 33.458  29.091  80.614  1.00 19.36 ? 150 ASP A N   1 
ATOM   1223  C CA  . ASP A 1 151 ? 32.454  28.115  80.997  1.00 18.68 ? 150 ASP A CA  1 
ATOM   1224  C C   . ASP A 1 151 ? 31.020  28.544  80.710  1.00 18.11 ? 150 ASP A C   1 
ATOM   1225  O O   . ASP A 1 151 ? 30.630  29.691  80.960  1.00 17.49 ? 150 ASP A O   1 
ATOM   1226  C CB  . ASP A 1 151 ? 32.590  27.790  82.489  1.00 15.80 ? 150 ASP A CB  1 
ATOM   1227  C CG  . ASP A 1 151 ? 33.967  27.258  82.840  1.00 20.53 ? 150 ASP A CG  1 
ATOM   1228  O OD1 . ASP A 1 151 ? 34.906  28.072  82.996  1.00 16.99 ? 150 ASP A OD1 1 
ATOM   1229  O OD2 . ASP A 1 151 ? 34.119  26.016  82.929  1.00 19.73 ? 150 ASP A OD2 1 
ATOM   1230  N N   . VAL A 1 152 ? 30.243  27.606  80.180  1.00 16.93 ? 151 VAL A N   1 
ATOM   1231  C CA  . VAL A 1 152 ? 28.839  27.825  79.865  1.00 15.13 ? 151 VAL A CA  1 
ATOM   1232  C C   . VAL A 1 152 ? 28.051  26.850  80.733  1.00 16.13 ? 151 VAL A C   1 
ATOM   1233  O O   . VAL A 1 152 ? 28.327  25.643  80.740  1.00 16.47 ? 151 VAL A O   1 
ATOM   1234  C CB  . VAL A 1 152 ? 28.564  27.555  78.364  1.00 17.13 ? 151 VAL A CB  1 
ATOM   1235  C CG1 . VAL A 1 152 ? 27.061  27.582  78.081  1.00 16.29 ? 151 VAL A CG1 1 
ATOM   1236  C CG2 . VAL A 1 152 ? 29.283  28.602  77.513  1.00 16.80 ? 151 VAL A CG2 1 
ATOM   1237  N N   . ILE A 1 153 ? 27.086  27.381  81.475  1.00 15.45 ? 152 ILE A N   1 
ATOM   1238  C CA  . ILE A 1 153 ? 26.260  26.576  82.363  1.00 15.58 ? 152 ILE A CA  1 
ATOM   1239  C C   . ILE A 1 153 ? 24.804  26.586  81.906  1.00 17.05 ? 152 ILE A C   1 
ATOM   1240  O O   . ILE A 1 153 ? 24.147  27.628  81.893  1.00 15.57 ? 152 ILE A O   1 
ATOM   1241  C CB  . ILE A 1 153 ? 26.317  27.095  83.821  1.00 14.61 ? 152 ILE A CB  1 
ATOM   1242  C CG1 . ILE A 1 153 ? 27.761  27.124  84.331  1.00 15.47 ? 152 ILE A CG1 1 
ATOM   1243  C CG2 . ILE A 1 153 ? 25.495  26.190  84.717  1.00 12.81 ? 152 ILE A CG2 1 
ATOM   1244  C CD1 . ILE A 1 153 ? 28.599  28.248  83.779  1.00 14.96 ? 152 ILE A CD1 1 
ATOM   1245  N N   . ASN A 1 154 ? 24.306  25.416  81.528  1.00 18.12 ? 153 ASN A N   1 
ATOM   1246  C CA  . ASN A 1 154 ? 22.935  25.294  81.071  1.00 18.43 ? 153 ASN A CA  1 
ATOM   1247  C C   . ASN A 1 154 ? 22.065  24.887  82.250  1.00 19.40 ? 153 ASN A C   1 
ATOM   1248  O O   . ASN A 1 154 ? 22.348  23.909  82.937  1.00 19.66 ? 153 ASN A O   1 
ATOM   1249  C CB  . ASN A 1 154 ? 22.846  24.249  79.952  1.00 18.93 ? 153 ASN A CB  1 
ATOM   1250  C CG  . ASN A 1 154 ? 21.496  24.251  79.251  1.00 20.99 ? 153 ASN A CG  1 
ATOM   1251  O OD1 . ASN A 1 154 ? 20.583  23.490  79.601  1.00 19.47 ? 153 ASN A OD1 1 
ATOM   1252  N ND2 . ASN A 1 154 ? 21.360  25.120  78.256  1.00 20.41 ? 153 ASN A ND2 1 
ATOM   1253  N N   . ILE A 1 155 ? 21.015  25.656  82.501  1.00 19.87 ? 154 ILE A N   1 
ATOM   1254  C CA  . ILE A 1 155 ? 20.122  25.346  83.605  1.00 20.15 ? 154 ILE A CA  1 
ATOM   1255  C C   . ILE A 1 155 ? 18.732  25.051  83.054  1.00 20.67 ? 154 ILE A C   1 
ATOM   1256  O O   . ILE A 1 155 ? 18.111  25.901  82.419  1.00 18.00 ? 154 ILE A O   1 
ATOM   1257  C CB  . ILE A 1 155 ? 20.060  26.513  84.614  1.00 20.29 ? 154 ILE A CB  1 
ATOM   1258  C CG1 . ILE A 1 155 ? 21.476  26.823  85.117  1.00 19.47 ? 154 ILE A CG1 1 
ATOM   1259  C CG2 . ILE A 1 155 ? 19.148  26.147  85.781  1.00 20.07 ? 154 ILE A CG2 1 
ATOM   1260  C CD1 . ILE A 1 155 ? 21.558  27.895  86.188  1.00 15.92 ? 154 ILE A CD1 1 
ATOM   1261  N N   . GLY A 1 156 ? 18.274  23.821  83.274  1.00 19.58 ? 155 GLY A N   1 
ATOM   1262  C CA  . GLY A 1 156 ? 16.963  23.408  82.807  1.00 21.87 ? 155 GLY A CA  1 
ATOM   1263  C C   . GLY A 1 156 ? 16.612  22.033  83.347  1.00 22.23 ? 155 GLY A C   1 
ATOM   1264  O O   . GLY A 1 156 ? 17.416  21.407  84.041  1.00 22.13 ? 155 GLY A O   1 
ATOM   1265  N N   . ILE A 1 157 ? 15.401  21.573  83.060  1.00 21.80 ? 156 ILE A N   1 
ATOM   1266  C CA  . ILE A 1 157 ? 14.979  20.250  83.499  1.00 22.38 ? 156 ILE A CA  1 
ATOM   1267  C C   . ILE A 1 157 ? 14.469  19.479  82.293  1.00 22.41 ? 156 ILE A C   1 
ATOM   1268  O O   . ILE A 1 157 ? 14.218  20.061  81.233  1.00 22.51 ? 156 ILE A O   1 
ATOM   1269  C CB  . ILE A 1 157 ? 13.841  20.308  84.558  1.00 21.81 ? 156 ILE A CB  1 
ATOM   1270  C CG1 . ILE A 1 157 ? 12.611  21.003  83.971  1.00 23.27 ? 156 ILE A CG1 1 
ATOM   1271  C CG2 . ILE A 1 157 ? 14.324  21.017  85.807  1.00 21.27 ? 156 ILE A CG2 1 
ATOM   1272  C CD1 . ILE A 1 157 ? 11.412  21.004  84.900  1.00 22.45 ? 156 ILE A CD1 1 
ATOM   1273  N N   . GLY A 1 158 ? 14.329  18.168  82.460  1.00 21.31 ? 157 GLY A N   1 
ATOM   1274  C CA  . GLY A 1 158 ? 13.831  17.326  81.393  1.00 20.74 ? 157 GLY A CA  1 
ATOM   1275  C C   . GLY A 1 158 ? 14.458  17.558  80.033  1.00 22.50 ? 157 GLY A C   1 
ATOM   1276  O O   . GLY A 1 158 ? 15.675  17.487  79.883  1.00 19.54 ? 157 GLY A O   1 
ATOM   1277  N N   . GLY A 1 159 ? 13.612  17.837  79.042  1.00 24.55 ? 158 GLY A N   1 
ATOM   1278  C CA  . GLY A 1 159 ? 14.075  18.061  77.682  1.00 26.05 ? 158 GLY A CA  1 
ATOM   1279  C C   . GLY A 1 159 ? 15.011  19.237  77.484  1.00 27.75 ? 158 GLY A C   1 
ATOM   1280  O O   . GLY A 1 159 ? 15.782  19.267  76.526  1.00 29.52 ? 158 GLY A O   1 
ATOM   1281  N N   . SER A 1 160 ? 14.947  20.215  78.377  1.00 27.65 ? 159 SER A N   1 
ATOM   1282  C CA  . SER A 1 160 ? 15.818  21.378  78.266  1.00 28.95 ? 159 SER A CA  1 
ATOM   1283  C C   . SER A 1 160 ? 17.204  21.033  78.808  1.00 28.33 ? 159 SER A C   1 
ATOM   1284  O O   . SER A 1 160 ? 18.118  21.859  78.772  1.00 28.55 ? 159 SER A O   1 
ATOM   1285  C CB  . SER A 1 160 ? 15.235  22.552  79.059  1.00 28.61 ? 159 SER A CB  1 
ATOM   1286  O OG  . SER A 1 160 ? 13.967  22.928  78.555  1.00 32.45 ? 159 SER A OG  1 
ATOM   1287  N N   . ASP A 1 161 ? 17.352  19.806  79.305  1.00 24.82 ? 160 ASP A N   1 
ATOM   1288  C CA  . ASP A 1 161 ? 18.616  19.353  79.873  1.00 23.04 ? 160 ASP A CA  1 
ATOM   1289  C C   . ASP A 1 161 ? 19.221  18.127  79.190  1.00 21.89 ? 160 ASP A C   1 
ATOM   1290  O O   . ASP A 1 161 ? 20.333  18.190  78.663  1.00 20.72 ? 160 ASP A O   1 
ATOM   1291  C CB  . ASP A 1 161 ? 18.443  19.042  81.367  1.00 21.27 ? 160 ASP A CB  1 
ATOM   1292  C CG  . ASP A 1 161 ? 19.649  18.319  81.958  1.00 22.84 ? 160 ASP A CG  1 
ATOM   1293  O OD1 . ASP A 1 161 ? 20.684  18.971  82.216  1.00 21.38 ? 160 ASP A OD1 1 
ATOM   1294  O OD2 . ASP A 1 161 ? 19.569  17.088  82.152  1.00 23.44 ? 160 ASP A OD2 1 
ATOM   1295  N N   . LEU A 1 162 ? 18.484  17.019  79.203  1.00 19.29 ? 161 LEU A N   1 
ATOM   1296  C CA  . LEU A 1 162 ? 18.972  15.758  78.644  1.00 20.23 ? 161 LEU A CA  1 
ATOM   1297  C C   . LEU A 1 162 ? 19.513  15.780  77.218  1.00 17.29 ? 161 LEU A C   1 
ATOM   1298  O O   . LEU A 1 162 ? 20.590  15.250  76.964  1.00 17.20 ? 161 LEU A O   1 
ATOM   1299  C CB  . LEU A 1 162 ? 17.893  14.675  78.755  1.00 21.35 ? 161 LEU A CB  1 
ATOM   1300  C CG  . LEU A 1 162 ? 18.319  13.423  79.527  1.00 26.51 ? 161 LEU A CG  1 
ATOM   1301  C CD1 . LEU A 1 162 ? 19.562  12.798  78.888  1.00 29.14 ? 161 LEU A CD1 1 
ATOM   1302  C CD2 . LEU A 1 162 ? 18.614  13.801  80.968  1.00 30.08 ? 161 LEU A CD2 1 
ATOM   1303  N N   . GLY A 1 163 ? 18.765  16.363  76.288  1.00 16.42 ? 162 GLY A N   1 
ATOM   1304  C CA  . GLY A 1 163 ? 19.225  16.423  74.913  1.00 15.09 ? 162 GLY A CA  1 
ATOM   1305  C C   . GLY A 1 163 ? 20.566  17.119  74.777  1.00 15.87 ? 162 GLY A C   1 
ATOM   1306  O O   . GLY A 1 163 ? 21.535  16.524  74.317  1.00 14.32 ? 162 GLY A O   1 
ATOM   1307  N N   . PRO A 1 164 ? 20.655  18.397  75.162  1.00 16.89 ? 163 PRO A N   1 
ATOM   1308  C CA  . PRO A 1 164 ? 21.934  19.105  75.049  1.00 16.72 ? 163 PRO A CA  1 
ATOM   1309  C C   . PRO A 1 164 ? 23.086  18.374  75.756  1.00 17.97 ? 163 PRO A C   1 
ATOM   1310  O O   . PRO A 1 164 ? 24.196  18.298  75.231  1.00 16.08 ? 163 PRO A O   1 
ATOM   1311  C CB  . PRO A 1 164 ? 21.629  20.459  75.681  1.00 18.46 ? 163 PRO A CB  1 
ATOM   1312  C CG  . PRO A 1 164 ? 20.187  20.672  75.309  1.00 17.55 ? 163 PRO A CG  1 
ATOM   1313  C CD  . PRO A 1 164 ? 19.579  19.307  75.593  1.00 16.64 ? 163 PRO A CD  1 
ATOM   1314  N N   . LEU A 1 165 ? 22.816  17.829  76.942  1.00 18.14 ? 164 LEU A N   1 
ATOM   1315  C CA  . LEU A 1 165 ? 23.845  17.120  77.695  1.00 18.47 ? 164 LEU A CA  1 
ATOM   1316  C C   . LEU A 1 165 ? 24.315  15.868  76.961  1.00 17.54 ? 164 LEU A C   1 
ATOM   1317  O O   . LEU A 1 165 ? 25.512  15.645  76.813  1.00 16.72 ? 164 LEU A O   1 
ATOM   1318  C CB  . LEU A 1 165 ? 23.325  16.754  79.096  1.00 19.17 ? 164 LEU A CB  1 
ATOM   1319  C CG  . LEU A 1 165 ? 24.216  15.923  80.032  1.00 22.52 ? 164 LEU A CG  1 
ATOM   1320  C CD1 . LEU A 1 165 ? 23.690  16.031  81.454  1.00 25.47 ? 164 LEU A CD1 1 
ATOM   1321  C CD2 . LEU A 1 165 ? 24.234  14.467  79.603  1.00 23.85 ? 164 LEU A CD2 1 
ATOM   1322  N N   . MET A 1 166 ? 23.377  15.055  76.496  1.00 16.89 ? 165 MET A N   1 
ATOM   1323  C CA  . MET A 1 166 ? 23.743  13.832  75.792  1.00 17.72 ? 165 MET A CA  1 
ATOM   1324  C C   . MET A 1 166 ? 24.556  14.131  74.539  1.00 17.92 ? 165 MET A C   1 
ATOM   1325  O O   . MET A 1 166 ? 25.564  13.477  74.276  1.00 17.99 ? 165 MET A O   1 
ATOM   1326  C CB  . MET A 1 166 ? 22.485  13.031  75.429  1.00 16.73 ? 165 MET A CB  1 
ATOM   1327  C CG  . MET A 1 166 ? 22.747  11.740  74.643  1.00 16.25 ? 165 MET A CG  1 
ATOM   1328  S SD  . MET A 1 166 ? 22.891  12.032  72.855  1.00 17.65 ? 165 MET A SD  1 
ATOM   1329  C CE  . MET A 1 166 ? 21.164  12.294  72.445  1.00 12.77 ? 165 MET A CE  1 
ATOM   1330  N N   . VAL A 1 167 ? 24.127  15.126  73.771  1.00 17.95 ? 166 VAL A N   1 
ATOM   1331  C CA  . VAL A 1 167 ? 24.832  15.474  72.541  1.00 17.62 ? 166 VAL A CA  1 
ATOM   1332  C C   . VAL A 1 167 ? 26.221  16.061  72.774  1.00 18.43 ? 166 VAL A C   1 
ATOM   1333  O O   . VAL A 1 167 ? 27.176  15.685  72.079  1.00 16.41 ? 166 VAL A O   1 
ATOM   1334  C CB  . VAL A 1 167 ? 24.008  16.456  71.676  1.00 17.66 ? 166 VAL A CB  1 
ATOM   1335  C CG1 . VAL A 1 167 ? 24.788  16.829  70.410  1.00 14.66 ? 166 VAL A CG1 1 
ATOM   1336  C CG2 . VAL A 1 167 ? 22.674  15.814  71.307  1.00 15.93 ? 166 VAL A CG2 1 
ATOM   1337  N N   . THR A 1 168 ? 26.355  16.978  73.732  1.00 17.82 ? 167 THR A N   1 
ATOM   1338  C CA  . THR A 1 168 ? 27.675  17.552  73.976  1.00 17.64 ? 167 THR A CA  1 
ATOM   1339  C C   . THR A 1 168 ? 28.612  16.464  74.497  1.00 15.84 ? 167 THR A C   1 
ATOM   1340  O O   . THR A 1 168 ? 29.809  16.494  74.234  1.00 15.72 ? 167 THR A O   1 
ATOM   1341  C CB  . THR A 1 168 ? 27.632  18.747  74.966  1.00 17.15 ? 167 THR A CB  1 
ATOM   1342  O OG1 . THR A 1 168 ? 26.898  18.389  76.143  1.00 17.65 ? 167 THR A OG1 1 
ATOM   1343  C CG2 . THR A 1 168 ? 26.994  19.956  74.300  1.00 15.87 ? 167 THR A CG2 1 
ATOM   1344  N N   . GLU A 1 169 ? 28.067  15.498  75.230  1.00 16.05 ? 168 GLU A N   1 
ATOM   1345  C CA  . GLU A 1 169 ? 28.888  14.397  75.729  1.00 17.15 ? 168 GLU A CA  1 
ATOM   1346  C C   . GLU A 1 169 ? 29.343  13.545  74.549  1.00 16.47 ? 168 GLU A C   1 
ATOM   1347  O O   . GLU A 1 169 ? 30.509  13.166  74.447  1.00 17.33 ? 168 GLU A O   1 
ATOM   1348  C CB  . GLU A 1 169 ? 28.096  13.520  76.697  1.00 16.70 ? 168 GLU A CB  1 
ATOM   1349  C CG  . GLU A 1 169 ? 27.943  14.115  78.077  1.00 16.41 ? 168 GLU A CG  1 
ATOM   1350  C CD  . GLU A 1 169 ? 29.280  14.389  78.724  1.00 17.92 ? 168 GLU A CD  1 
ATOM   1351  O OE1 . GLU A 1 169 ? 29.569  15.570  79.019  1.00 19.38 ? 168 GLU A OE1 1 
ATOM   1352  O OE2 . GLU A 1 169 ? 30.047  13.423  78.933  1.00 13.75 ? 168 GLU A OE2 1 
ATOM   1353  N N   . ALA A 1 170 ? 28.407  13.274  73.649  1.00 15.43 ? 169 ALA A N   1 
ATOM   1354  C CA  . ALA A 1 170 ? 28.659  12.454  72.475  1.00 15.43 ? 169 ALA A CA  1 
ATOM   1355  C C   . ALA A 1 170 ? 29.602  13.070  71.452  1.00 14.86 ? 169 ALA A C   1 
ATOM   1356  O O   . ALA A 1 170 ? 30.350  12.346  70.796  1.00 15.14 ? 169 ALA A O   1 
ATOM   1357  C CB  . ALA A 1 170 ? 27.332  12.094  71.805  1.00 12.96 ? 169 ALA A CB  1 
ATOM   1358  N N   . LEU A 1 171 ? 29.568  14.394  71.313  1.00 16.38 ? 170 LEU A N   1 
ATOM   1359  C CA  . LEU A 1 171 ? 30.415  15.085  70.341  1.00 16.75 ? 170 LEU A CA  1 
ATOM   1360  C C   . LEU A 1 171 ? 31.564  15.851  70.995  1.00 18.97 ? 170 LEU A C   1 
ATOM   1361  O O   . LEU A 1 171 ? 32.065  16.837  70.447  1.00 17.95 ? 170 LEU A O   1 
ATOM   1362  C CB  . LEU A 1 171 ? 29.564  16.045  69.506  1.00 17.19 ? 170 LEU A CB  1 
ATOM   1363  C CG  . LEU A 1 171 ? 28.334  15.447  68.806  1.00 17.94 ? 170 LEU A CG  1 
ATOM   1364  C CD1 . LEU A 1 171 ? 27.575  16.538  68.070  1.00 18.35 ? 170 LEU A CD1 1 
ATOM   1365  C CD2 . LEU A 1 171 ? 28.772  14.351  67.837  1.00 18.18 ? 170 LEU A CD2 1 
ATOM   1366  N N   . LYS A 1 172 ? 31.990  15.387  72.163  1.00 19.51 ? 171 LYS A N   1 
ATOM   1367  C CA  . LYS A 1 172 ? 33.072  16.038  72.894  1.00 22.24 ? 171 LYS A CA  1 
ATOM   1368  C C   . LYS A 1 172 ? 34.324  16.312  72.035  1.00 23.01 ? 171 LYS A C   1 
ATOM   1369  O O   . LYS A 1 172 ? 34.931  17.379  72.135  1.00 23.28 ? 171 LYS A O   1 
ATOM   1370  C CB  . LYS A 1 172 ? 33.437  15.195  74.126  1.00 22.32 ? 171 LYS A CB  1 
ATOM   1371  C CG  . LYS A 1 172 ? 34.299  15.914  75.175  1.00 24.01 ? 171 LYS A CG  1 
ATOM   1372  C CD  . LYS A 1 172 ? 33.604  17.150  75.771  1.00 24.55 ? 171 LYS A CD  1 
ATOM   1373  C CE  . LYS A 1 172 ? 32.247  16.806  76.394  1.00 24.61 ? 171 LYS A CE  1 
ATOM   1374  N NZ  . LYS A 1 172 ? 31.614  17.962  77.096  1.00 19.29 ? 171 LYS A NZ  1 
ATOM   1375  N N   . PRO A 1 173 ? 34.718  15.359  71.171  1.00 23.64 ? 172 PRO A N   1 
ATOM   1376  C CA  . PRO A 1 173 ? 35.905  15.572  70.332  1.00 23.91 ? 172 PRO A CA  1 
ATOM   1377  C C   . PRO A 1 173 ? 35.832  16.791  69.408  1.00 22.34 ? 172 PRO A C   1 
ATOM   1378  O O   . PRO A 1 173 ? 36.857  17.250  68.905  1.00 20.44 ? 172 PRO A O   1 
ATOM   1379  C CB  . PRO A 1 173 ? 36.000  14.275  69.533  1.00 24.21 ? 172 PRO A CB  1 
ATOM   1380  C CG  . PRO A 1 173 ? 35.377  13.271  70.438  1.00 25.93 ? 172 PRO A CG  1 
ATOM   1381  C CD  . PRO A 1 173 ? 34.179  14.005  70.966  1.00 23.43 ? 172 PRO A CD  1 
ATOM   1382  N N   . TYR A 1 174 ? 34.626  17.307  69.184  1.00 20.34 ? 173 TYR A N   1 
ATOM   1383  C CA  . TYR A 1 174 ? 34.447  18.451  68.295  1.00 20.39 ? 173 TYR A CA  1 
ATOM   1384  C C   . TYR A 1 174 ? 34.360  19.794  69.014  1.00 20.11 ? 173 TYR A C   1 
ATOM   1385  O O   . TYR A 1 174 ? 34.082  20.816  68.390  1.00 18.91 ? 173 TYR A O   1 
ATOM   1386  C CB  . TYR A 1 174 ? 33.185  18.253  67.444  1.00 20.19 ? 173 TYR A CB  1 
ATOM   1387  C CG  . TYR A 1 174 ? 33.214  16.997  66.602  1.00 20.65 ? 173 TYR A CG  1 
ATOM   1388  C CD1 . TYR A 1 174 ? 32.897  15.756  67.155  1.00 19.78 ? 173 TYR A CD1 1 
ATOM   1389  C CD2 . TYR A 1 174 ? 33.609  17.043  65.264  1.00 19.69 ? 173 TYR A CD2 1 
ATOM   1390  C CE1 . TYR A 1 174 ? 32.974  14.590  66.403  1.00 18.54 ? 173 TYR A CE1 1 
ATOM   1391  C CE2 . TYR A 1 174 ? 33.692  15.882  64.498  1.00 19.99 ? 173 TYR A CE2 1 
ATOM   1392  C CZ  . TYR A 1 174 ? 33.372  14.659  65.072  1.00 20.06 ? 173 TYR A CZ  1 
ATOM   1393  O OH  . TYR A 1 174 ? 33.423  13.511  64.319  1.00 17.17 ? 173 TYR A OH  1 
ATOM   1394  N N   . SER A 1 175 ? 34.621  19.793  70.314  1.00 20.19 ? 174 SER A N   1 
ATOM   1395  C CA  . SER A 1 175 ? 34.520  21.011  71.109  1.00 24.08 ? 174 SER A CA  1 
ATOM   1396  C C   . SER A 1 175 ? 35.805  21.817  71.225  1.00 25.68 ? 174 SER A C   1 
ATOM   1397  O O   . SER A 1 175 ? 35.906  22.704  72.078  1.00 24.54 ? 174 SER A O   1 
ATOM   1398  C CB  . SER A 1 175 ? 34.026  20.669  72.513  1.00 21.66 ? 174 SER A CB  1 
ATOM   1399  O OG  . SER A 1 175 ? 34.987  19.880  73.185  1.00 22.30 ? 174 SER A OG  1 
ATOM   1400  N N   . SER A 1 176 ? 36.788  21.504  70.387  1.00 27.35 ? 175 SER A N   1 
ATOM   1401  C CA  . SER A 1 176 ? 38.052  22.226  70.417  1.00 28.61 ? 175 SER A CA  1 
ATOM   1402  C C   . SER A 1 176 ? 37.775  23.690  70.103  1.00 27.97 ? 175 SER A C   1 
ATOM   1403  O O   . SER A 1 176 ? 37.136  24.005  69.104  1.00 27.62 ? 175 SER A O   1 
ATOM   1404  C CB  . SER A 1 176 ? 39.020  21.648  69.383  1.00 30.19 ? 175 SER A CB  1 
ATOM   1405  O OG  . SER A 1 176 ? 40.209  22.415  69.323  1.00 35.30 ? 175 SER A OG  1 
ATOM   1406  N N   . GLY A 1 177 ? 38.246  24.583  70.964  1.00 28.55 ? 176 GLY A N   1 
ATOM   1407  C CA  . GLY A 1 177 ? 38.018  25.998  70.737  1.00 28.09 ? 176 GLY A CA  1 
ATOM   1408  C C   . GLY A 1 177 ? 36.649  26.439  71.217  1.00 29.46 ? 176 GLY A C   1 
ATOM   1409  O O   . GLY A 1 177 ? 36.156  27.506  70.840  1.00 30.54 ? 176 GLY A O   1 
ATOM   1410  N N   . GLY A 1 178 ? 36.022  25.611  72.045  1.00 26.18 ? 177 GLY A N   1 
ATOM   1411  C CA  . GLY A 1 178 ? 34.720  25.962  72.571  1.00 24.51 ? 177 GLY A CA  1 
ATOM   1412  C C   . GLY A 1 178 ? 34.809  26.049  74.077  1.00 23.88 ? 177 GLY A C   1 
ATOM   1413  O O   . GLY A 1 178 ? 35.734  25.495  74.664  1.00 22.90 ? 177 GLY A O   1 
ATOM   1414  N N   . PRO A 1 179 ? 33.884  26.755  74.737  1.00 23.80 ? 178 PRO A N   1 
ATOM   1415  C CA  . PRO A 1 179 ? 33.970  26.831  76.199  1.00 24.85 ? 178 PRO A CA  1 
ATOM   1416  C C   . PRO A 1 179 ? 33.470  25.527  76.828  1.00 25.26 ? 178 PRO A C   1 
ATOM   1417  O O   . PRO A 1 179 ? 32.714  24.787  76.203  1.00 25.43 ? 178 PRO A O   1 
ATOM   1418  C CB  . PRO A 1 179 ? 33.072  28.020  76.533  1.00 23.62 ? 178 PRO A CB  1 
ATOM   1419  C CG  . PRO A 1 179 ? 32.013  27.937  75.459  1.00 22.81 ? 178 PRO A CG  1 
ATOM   1420  C CD  . PRO A 1 179 ? 32.824  27.639  74.216  1.00 21.46 ? 178 PRO A CD  1 
ATOM   1421  N N   . ARG A 1 180 ? 33.905  25.243  78.052  1.00 25.50 ? 179 ARG A N   1 
ATOM   1422  C CA  . ARG A 1 180 ? 33.462  24.037  78.752  1.00 23.48 ? 179 ARG A CA  1 
ATOM   1423  C C   . ARG A 1 180 ? 31.970  24.194  79.006  1.00 20.40 ? 179 ARG A C   1 
ATOM   1424  O O   . ARG A 1 180 ? 31.500  25.312  79.223  1.00 18.08 ? 179 ARG A O   1 
ATOM   1425  C CB  . ARG A 1 180 ? 34.171  23.898  80.105  1.00 23.38 ? 179 ARG A CB  1 
ATOM   1426  C CG  . ARG A 1 180 ? 35.650  23.556  80.045  1.00 26.27 ? 179 ARG A CG  1 
ATOM   1427  C CD  . ARG A 1 180 ? 36.209  23.434  81.457  1.00 27.80 ? 179 ARG A CD  1 
ATOM   1428  N NE  . ARG A 1 180 ? 36.227  24.722  82.149  1.00 29.63 ? 179 ARG A NE  1 
ATOM   1429  C CZ  . ARG A 1 180 ? 37.227  25.595  82.076  1.00 32.10 ? 179 ARG A CZ  1 
ATOM   1430  N NH1 . ARG A 1 180 ? 38.298  25.314  81.347  1.00 34.82 ? 179 ARG A NH1 1 
ATOM   1431  N NH2 . ARG A 1 180 ? 37.154  26.757  82.714  1.00 30.81 ? 179 ARG A NH2 1 
ATOM   1432  N N   . VAL A 1 181 ? 31.224  23.091  78.965  1.00 18.98 ? 180 VAL A N   1 
ATOM   1433  C CA  . VAL A 1 181 ? 29.791  23.160  79.229  1.00 18.07 ? 180 VAL A CA  1 
ATOM   1434  C C   . VAL A 1 181 ? 29.410  22.373  80.468  1.00 19.22 ? 180 VAL A C   1 
ATOM   1435  O O   . VAL A 1 181 ? 29.954  21.300  80.736  1.00 20.80 ? 180 VAL A O   1 
ATOM   1436  C CB  . VAL A 1 181 ? 28.922  22.670  78.028  1.00 17.42 ? 180 VAL A CB  1 
ATOM   1437  C CG1 . VAL A 1 181 ? 28.996  23.678  76.916  1.00 17.19 ? 180 VAL A CG1 1 
ATOM   1438  C CG2 . VAL A 1 181 ? 29.366  21.282  77.546  1.00 15.10 ? 180 VAL A CG2 1 
ATOM   1439  N N   . TRP A 1 182 ? 28.475  22.928  81.229  1.00 19.27 ? 181 TRP A N   1 
ATOM   1440  C CA  . TRP A 1 182 ? 27.997  22.308  82.457  1.00 20.23 ? 181 TRP A CA  1 
ATOM   1441  C C   . TRP A 1 182 ? 26.482  22.265  82.406  1.00 18.30 ? 181 TRP A C   1 
ATOM   1442  O O   . TRP A 1 182 ? 25.852  23.171  81.873  1.00 18.42 ? 181 TRP A O   1 
ATOM   1443  C CB  . TRP A 1 182 ? 28.427  23.126  83.678  1.00 20.92 ? 181 TRP A CB  1 
ATOM   1444  C CG  . TRP A 1 182 ? 29.900  23.341  83.784  1.00 21.55 ? 181 TRP A CG  1 
ATOM   1445  C CD1 . TRP A 1 182 ? 30.672  24.137  82.992  1.00 21.32 ? 181 TRP A CD1 1 
ATOM   1446  C CD2 . TRP A 1 182 ? 30.776  22.782  84.767  1.00 24.01 ? 181 TRP A CD2 1 
ATOM   1447  N NE1 . TRP A 1 182 ? 31.972  24.117  83.421  1.00 21.53 ? 181 TRP A NE1 1 
ATOM   1448  C CE2 . TRP A 1 182 ? 32.067  23.293  84.511  1.00 24.69 ? 181 TRP A CE2 1 
ATOM   1449  C CE3 . TRP A 1 182 ? 30.595  21.899  85.843  1.00 26.83 ? 181 TRP A CE3 1 
ATOM   1450  C CZ2 . TRP A 1 182 ? 33.179  22.953  85.295  1.00 25.60 ? 181 TRP A CZ2 1 
ATOM   1451  C CZ3 . TRP A 1 182 ? 31.702  21.560  86.625  1.00 26.53 ? 181 TRP A CZ3 1 
ATOM   1452  C CH2 . TRP A 1 182 ? 32.977  22.089  86.344  1.00 27.01 ? 181 TRP A CH2 1 
ATOM   1453  N N   . TYR A 1 183 ? 25.900  21.217  82.969  1.00 17.97 ? 182 TYR A N   1 
ATOM   1454  C CA  . TYR A 1 183 ? 24.454  21.070  82.976  1.00 18.35 ? 182 TYR A CA  1 
ATOM   1455  C C   . TYR A 1 183 ? 23.934  20.926  84.396  1.00 20.50 ? 182 TYR A C   1 
ATOM   1456  O O   . TYR A 1 183 ? 24.377  20.063  85.151  1.00 21.02 ? 182 TYR A O   1 
ATOM   1457  C CB  . TYR A 1 183 ? 24.060  19.866  82.111  1.00 17.17 ? 182 TYR A CB  1 
ATOM   1458  C CG  . TYR A 1 183 ? 24.373  20.108  80.654  1.00 17.16 ? 182 TYR A CG  1 
ATOM   1459  C CD1 . TYR A 1 183 ? 23.457  20.751  79.827  1.00 16.78 ? 182 TYR A CD1 1 
ATOM   1460  C CD2 . TYR A 1 183 ? 25.638  19.812  80.134  1.00 17.83 ? 182 TYR A CD2 1 
ATOM   1461  C CE1 . TYR A 1 183 ? 23.789  21.110  78.516  1.00 16.35 ? 182 TYR A CE1 1 
ATOM   1462  C CE2 . TYR A 1 183 ? 25.981  20.167  78.828  1.00 18.35 ? 182 TYR A CE2 1 
ATOM   1463  C CZ  . TYR A 1 183 ? 25.049  20.819  78.027  1.00 17.78 ? 182 TYR A CZ  1 
ATOM   1464  O OH  . TYR A 1 183 ? 25.388  21.200  76.751  1.00 19.76 ? 182 TYR A OH  1 
ATOM   1465  N N   . VAL A 1 184 ? 23.009  21.805  84.760  1.00 21.20 ? 183 VAL A N   1 
ATOM   1466  C CA  . VAL A 1 184 ? 22.402  21.794  86.084  1.00 21.03 ? 183 VAL A CA  1 
ATOM   1467  C C   . VAL A 1 184 ? 20.910  21.595  85.861  1.00 21.88 ? 183 VAL A C   1 
ATOM   1468  O O   . VAL A 1 184 ? 20.272  22.395  85.188  1.00 21.13 ? 183 VAL A O   1 
ATOM   1469  C CB  . VAL A 1 184 ? 22.649  23.138  86.823  1.00 21.00 ? 183 VAL A CB  1 
ATOM   1470  C CG1 . VAL A 1 184 ? 21.944  23.140  88.165  1.00 18.74 ? 183 VAL A CG1 1 
ATOM   1471  C CG2 . VAL A 1 184 ? 24.148  23.356  87.020  1.00 21.00 ? 183 VAL A CG2 1 
ATOM   1472  N N   . SER A 1 185 ? 20.358  20.523  86.423  1.00 22.23 ? 184 SER A N   1 
ATOM   1473  C CA  . SER A 1 185 ? 18.944  20.220  86.245  1.00 21.32 ? 184 SER A CA  1 
ATOM   1474  C C   . SER A 1 185 ? 18.190  19.917  87.535  1.00 20.75 ? 184 SER A C   1 
ATOM   1475  O O   . SER A 1 185 ? 17.035  20.309  87.685  1.00 22.14 ? 184 SER A O   1 
ATOM   1476  C CB  . SER A 1 185 ? 18.805  19.027  85.303  1.00 22.29 ? 184 SER A CB  1 
ATOM   1477  O OG  . SER A 1 185 ? 19.590  17.947  85.777  1.00 21.36 ? 184 SER A OG  1 
ATOM   1478  N N   . ASN A 1 186 ? 18.842  19.214  88.457  1.00 19.36 ? 185 ASN A N   1 
ATOM   1479  C CA  . ASN A 1 186 ? 18.219  18.828  89.724  1.00 19.02 ? 185 ASN A CA  1 
ATOM   1480  C C   . ASN A 1 186 ? 17.913  20.038  90.603  1.00 17.31 ? 185 ASN A C   1 
ATOM   1481  O O   . ASN A 1 186 ? 18.709  20.976  90.678  1.00 16.63 ? 185 ASN A O   1 
ATOM   1482  C CB  . ASN A 1 186 ? 19.149  17.879  90.498  1.00 16.70 ? 185 ASN A CB  1 
ATOM   1483  C CG  . ASN A 1 186 ? 18.389  16.882  91.372  1.00 19.85 ? 185 ASN A CG  1 
ATOM   1484  O OD1 . ASN A 1 186 ? 17.333  17.195  91.932  1.00 16.60 ? 185 ASN A OD1 1 
ATOM   1485  N ND2 . ASN A 1 186 ? 18.941  15.673  91.503  1.00 15.87 ? 185 ASN A ND2 1 
ATOM   1486  N N   . ILE A 1 187 ? 16.755  20.028  91.255  1.00 16.58 ? 186 ILE A N   1 
ATOM   1487  C CA  . ILE A 1 187 ? 16.419  21.122  92.159  1.00 17.63 ? 186 ILE A CA  1 
ATOM   1488  C C   . ILE A 1 187 ? 17.268  20.898  93.414  1.00 17.63 ? 186 ILE A C   1 
ATOM   1489  O O   . ILE A 1 187 ? 17.491  21.818  94.205  1.00 16.20 ? 186 ILE A O   1 
ATOM   1490  C CB  . ILE A 1 187 ? 14.911  21.135  92.531  1.00 18.66 ? 186 ILE A CB  1 
ATOM   1491  C CG1 . ILE A 1 187 ? 14.628  22.286  93.504  1.00 21.45 ? 186 ILE A CG1 1 
ATOM   1492  C CG2 . ILE A 1 187 ? 14.504  19.802  93.141  1.00 19.42 ? 186 ILE A CG2 1 
ATOM   1493  C CD1 . ILE A 1 187 ? 14.913  23.659  92.927  1.00 17.93 ? 186 ILE A CD1 1 
ATOM   1494  N N   . ASP A 1 188 ? 17.737  19.659  93.584  1.00 15.71 ? 187 ASP A N   1 
ATOM   1495  C CA  . ASP A 1 188 ? 18.592  19.300  94.712  1.00 17.83 ? 187 ASP A CA  1 
ATOM   1496  C C   . ASP A 1 188 ? 19.738  20.307  94.696  1.00 18.43 ? 187 ASP A C   1 
ATOM   1497  O O   . ASP A 1 188 ? 20.496  20.384  93.727  1.00 16.67 ? 187 ASP A O   1 
ATOM   1498  C CB  . ASP A 1 188 ? 19.134  17.869  94.544  1.00 17.33 ? 187 ASP A CB  1 
ATOM   1499  C CG  . ASP A 1 188 ? 20.130  17.487  95.623  1.00 18.42 ? 187 ASP A CG  1 
ATOM   1500  O OD1 . ASP A 1 188 ? 20.572  16.316  95.645  1.00 16.00 ? 187 ASP A OD1 1 
ATOM   1501  O OD2 . ASP A 1 188 ? 20.480  18.359  96.448  1.00 15.65 ? 187 ASP A OD2 1 
ATOM   1502  N N   . GLY A 1 189 ? 19.840  21.080  95.774  1.00 19.30 ? 188 GLY A N   1 
ATOM   1503  C CA  . GLY A 1 189 ? 20.856  22.113  95.884  1.00 17.36 ? 188 GLY A CA  1 
ATOM   1504  C C   . GLY A 1 189 ? 22.300  21.724  95.629  1.00 18.04 ? 188 GLY A C   1 
ATOM   1505  O O   . GLY A 1 189 ? 23.118  22.580  95.266  1.00 14.97 ? 188 GLY A O   1 
ATOM   1506  N N   . THR A 1 190 ? 22.641  20.452  95.812  1.00 17.18 ? 189 THR A N   1 
ATOM   1507  C CA  . THR A 1 190 ? 24.024  20.063  95.579  1.00 16.75 ? 189 THR A CA  1 
ATOM   1508  C C   . THR A 1 190 ? 24.380  20.214  94.106  1.00 13.86 ? 189 THR A C   1 
ATOM   1509  O O   . THR A 1 190 ? 25.540  20.430  93.774  1.00 15.17 ? 189 THR A O   1 
ATOM   1510  C CB  . THR A 1 190 ? 24.336  18.588  95.975  1.00 17.41 ? 189 THR A CB  1 
ATOM   1511  O OG1 . THR A 1 190 ? 24.036  17.731  94.876  1.00 24.95 ? 189 THR A OG1 1 
ATOM   1512  C CG2 . THR A 1 190 ? 23.552  18.155  97.185  1.00 11.06 ? 189 THR A CG2 1 
ATOM   1513  N N   . HIS A 1 191 ? 23.399  20.116  93.214  1.00 13.65 ? 190 HIS A N   1 
ATOM   1514  C CA  . HIS A 1 191 ? 23.734  20.223  91.799  1.00 13.86 ? 190 HIS A CA  1 
ATOM   1515  C C   . HIS A 1 191 ? 24.304  21.600  91.446  1.00 16.69 ? 190 HIS A C   1 
ATOM   1516  O O   . HIS A 1 191 ? 25.445  21.700  90.993  1.00 16.63 ? 190 HIS A O   1 
ATOM   1517  C CB  . HIS A 1 191 ? 22.533  19.891  90.917  1.00 14.47 ? 190 HIS A CB  1 
ATOM   1518  C CG  . HIS A 1 191 ? 22.916  19.251  89.618  1.00 15.75 ? 190 HIS A CG  1 
ATOM   1519  N ND1 . HIS A 1 191 ? 21.990  18.773  88.718  1.00 14.97 ? 190 HIS A ND1 1 
ATOM   1520  C CD2 . HIS A 1 191 ? 24.134  18.995  89.078  1.00 13.94 ? 190 HIS A CD2 1 
ATOM   1521  C CE1 . HIS A 1 191 ? 22.618  18.250  87.678  1.00 15.44 ? 190 HIS A CE1 1 
ATOM   1522  N NE2 . HIS A 1 191 ? 23.919  18.371  87.871  1.00 13.50 ? 190 HIS A NE2 1 
ATOM   1523  N N   . ILE A 1 192 ? 23.537  22.659  91.673  1.00 15.19 ? 191 ILE A N   1 
ATOM   1524  C CA  . ILE A 1 192 ? 24.038  24.001  91.376  1.00 18.03 ? 191 ILE A CA  1 
ATOM   1525  C C   . ILE A 1 192 ? 25.243  24.333  92.272  1.00 19.14 ? 191 ILE A C   1 
ATOM   1526  O O   . ILE A 1 192 ? 26.224  24.911  91.811  1.00 20.25 ? 191 ILE A O   1 
ATOM   1527  C CB  . ILE A 1 192 ? 22.944  25.085  91.590  1.00 16.67 ? 191 ILE A CB  1 
ATOM   1528  C CG1 . ILE A 1 192 ? 23.460  26.463  91.152  1.00 18.02 ? 191 ILE A CG1 1 
ATOM   1529  C CG2 . ILE A 1 192 ? 22.551  25.151  93.059  1.00 16.74 ? 191 ILE A CG2 1 
ATOM   1530  C CD1 . ILE A 1 192 ? 23.807  26.553  89.685  1.00 19.26 ? 191 ILE A CD1 1 
ATOM   1531  N N   . ALA A 1 193 ? 25.175  23.941  93.542  1.00 19.82 ? 192 ALA A N   1 
ATOM   1532  C CA  . ALA A 1 193 ? 26.243  24.240  94.492  1.00 19.68 ? 192 ALA A CA  1 
ATOM   1533  C C   . ALA A 1 193 ? 27.616  23.703  94.120  1.00 20.77 ? 192 ALA A C   1 
ATOM   1534  O O   . ALA A 1 193 ? 28.583  24.462  94.080  1.00 18.77 ? 192 ALA A O   1 
ATOM   1535  C CB  . ALA A 1 193 ? 25.862  23.750  95.887  1.00 20.78 ? 192 ALA A CB  1 
ATOM   1536  N N   . LYS A 1 194 ? 27.716  22.403  93.856  1.00 18.99 ? 193 LYS A N   1 
ATOM   1537  C CA  . LYS A 1 194 ? 29.012  21.841  93.517  1.00 20.45 ? 193 LYS A CA  1 
ATOM   1538  C C   . LYS A 1 194 ? 29.520  22.336  92.168  1.00 20.57 ? 193 LYS A C   1 
ATOM   1539  O O   . LYS A 1 194 ? 30.721  22.297  91.902  1.00 20.33 ? 193 LYS A O   1 
ATOM   1540  C CB  . LYS A 1 194 ? 28.970  20.306  93.552  1.00 22.24 ? 193 LYS A CB  1 
ATOM   1541  C CG  . LYS A 1 194 ? 28.148  19.624  92.476  1.00 23.17 ? 193 LYS A CG  1 
ATOM   1542  C CD  . LYS A 1 194 ? 28.112  18.109  92.732  1.00 24.10 ? 193 LYS A CD  1 
ATOM   1543  C CE  . LYS A 1 194 ? 27.311  17.354  91.673  1.00 24.61 ? 193 LYS A CE  1 
ATOM   1544  N NZ  . LYS A 1 194 ? 27.951  17.427  90.329  1.00 23.72 ? 193 LYS A NZ  1 
ATOM   1545  N N   . THR A 1 195 ? 28.604  22.795  91.321  1.00 19.79 ? 194 THR A N   1 
ATOM   1546  C CA  . THR A 1 195 ? 28.965  23.317  90.012  1.00 20.36 ? 194 THR A CA  1 
ATOM   1547  C C   . THR A 1 195 ? 29.555  24.726  90.178  1.00 21.80 ? 194 THR A C   1 
ATOM   1548  O O   . THR A 1 195 ? 30.630  25.023  89.656  1.00 21.20 ? 194 THR A O   1 
ATOM   1549  C CB  . THR A 1 195 ? 27.731  23.382  89.085  1.00 19.98 ? 194 THR A CB  1 
ATOM   1550  O OG1 . THR A 1 195 ? 27.185  22.065  88.924  1.00 19.80 ? 194 THR A OG1 1 
ATOM   1551  C CG2 . THR A 1 195 ? 28.110  23.934  87.718  1.00 18.59 ? 194 THR A CG2 1 
ATOM   1552  N N   . LEU A 1 196 ? 28.853  25.581  90.921  1.00 20.80 ? 195 LEU A N   1 
ATOM   1553  C CA  . LEU A 1 196 ? 29.305  26.953  91.162  1.00 23.28 ? 195 LEU A CA  1 
ATOM   1554  C C   . LEU A 1 196 ? 30.652  27.028  91.889  1.00 24.63 ? 195 LEU A C   1 
ATOM   1555  O O   . LEU A 1 196 ? 31.432  27.958  91.670  1.00 23.78 ? 195 LEU A O   1 
ATOM   1556  C CB  . LEU A 1 196 ? 28.250  27.716  91.967  1.00 23.00 ? 195 LEU A CB  1 
ATOM   1557  C CG  . LEU A 1 196 ? 27.276  28.627  91.217  1.00 25.83 ? 195 LEU A CG  1 
ATOM   1558  C CD1 . LEU A 1 196 ? 27.070  28.152  89.788  1.00 27.01 ? 195 LEU A CD1 1 
ATOM   1559  C CD2 . LEU A 1 196 ? 25.966  28.686  91.992  1.00 24.47 ? 195 LEU A CD2 1 
ATOM   1560  N N   . ALA A 1 197 ? 30.919  26.052  92.755  1.00 23.58 ? 196 ALA A N   1 
ATOM   1561  C CA  . ALA A 1 197 ? 32.172  26.020  93.504  1.00 23.47 ? 196 ALA A CA  1 
ATOM   1562  C C   . ALA A 1 197 ? 33.382  25.896  92.582  1.00 23.35 ? 196 ALA A C   1 
ATOM   1563  O O   . ALA A 1 197 ? 34.493  26.265  92.952  1.00 24.55 ? 196 ALA A O   1 
ATOM   1564  C CB  . ALA A 1 197 ? 32.160  24.857  94.499  1.00 22.81 ? 196 ALA A CB  1 
ATOM   1565  N N   . GLN A 1 198 ? 33.173  25.383  91.378  1.00 24.11 ? 197 GLN A N   1 
ATOM   1566  C CA  . GLN A 1 198 ? 34.279  25.208  90.446  1.00 25.73 ? 197 GLN A CA  1 
ATOM   1567  C C   . GLN A 1 198 ? 34.343  26.299  89.382  1.00 26.12 ? 197 GLN A C   1 
ATOM   1568  O O   . GLN A 1 198 ? 35.130  26.204  88.439  1.00 26.84 ? 197 GLN A O   1 
ATOM   1569  C CB  . GLN A 1 198 ? 34.158  23.847  89.756  1.00 27.28 ? 197 GLN A CB  1 
ATOM   1570  C CG  . GLN A 1 198 ? 33.942  22.689  90.707  1.00 30.22 ? 197 GLN A CG  1 
ATOM   1571  C CD  . GLN A 1 198 ? 33.659  21.385  89.985  1.00 33.45 ? 197 GLN A CD  1 
ATOM   1572  O OE1 . GLN A 1 198 ? 34.580  20.844  89.335  1.00 35.03 ? 197 GLN A OE1 1 
ATOM   1573  N NE2 . GLN A 1 198 ? 32.508  20.902  90.061  1.00 35.42 ? 197 GLN A NE2 1 
ATOM   1574  N N   . LEU A 1 199 ? 33.534  27.342  89.537  1.00 25.03 ? 198 LEU A N   1 
ATOM   1575  C CA  . LEU A 1 199 ? 33.491  28.402  88.540  1.00 22.27 ? 198 LEU A CA  1 
ATOM   1576  C C   . LEU A 1 199 ? 33.911  29.789  89.008  1.00 21.33 ? 198 LEU A C   1 
ATOM   1577  O O   . LEU A 1 199 ? 33.896  30.098  90.197  1.00 19.24 ? 198 LEU A O   1 
ATOM   1578  C CB  . LEU A 1 199 ? 32.082  28.487  87.951  1.00 23.11 ? 198 LEU A CB  1 
ATOM   1579  C CG  . LEU A 1 199 ? 31.507  27.228  87.297  1.00 24.11 ? 198 LEU A CG  1 
ATOM   1580  C CD1 . LEU A 1 199 ? 30.055  27.481  86.906  1.00 24.33 ? 198 LEU A CD1 1 
ATOM   1581  C CD2 . LEU A 1 199 ? 32.331  26.851  86.080  1.00 25.05 ? 198 LEU A CD2 1 
ATOM   1582  N N   . ASN A 1 200 ? 34.300  30.613  88.042  1.00 19.88 ? 199 ASN A N   1 
ATOM   1583  C CA  . ASN A 1 200 ? 34.709  31.989  88.298  1.00 21.22 ? 199 ASN A CA  1 
ATOM   1584  C C   . ASN A 1 200 ? 33.593  32.844  87.712  1.00 18.21 ? 199 ASN A C   1 
ATOM   1585  O O   . ASN A 1 200 ? 33.307  32.757  86.526  1.00 18.34 ? 199 ASN A O   1 
ATOM   1586  C CB  . ASN A 1 200 ? 36.019  32.299  87.573  1.00 22.70 ? 199 ASN A CB  1 
ATOM   1587  C CG  . ASN A 1 200 ? 36.518  33.712  87.844  1.00 27.29 ? 199 ASN A CG  1 
ATOM   1588  O OD1 . ASN A 1 200 ? 35.727  34.633  88.051  1.00 26.76 ? 199 ASN A OD1 1 
ATOM   1589  N ND2 . ASN A 1 200 ? 37.836  33.890  87.825  1.00 28.30 ? 199 ASN A ND2 1 
ATOM   1590  N N   . PRO A 1 201 ? 32.947  33.679  88.535  1.00 19.99 ? 200 PRO A N   1 
ATOM   1591  C CA  . PRO A 1 201 ? 31.856  34.531  88.038  1.00 20.77 ? 200 PRO A CA  1 
ATOM   1592  C C   . PRO A 1 201 ? 32.239  35.379  86.818  1.00 21.27 ? 200 PRO A C   1 
ATOM   1593  O O   . PRO A 1 201 ? 31.412  35.627  85.930  1.00 22.08 ? 200 PRO A O   1 
ATOM   1594  C CB  . PRO A 1 201 ? 31.518  35.405  89.249  1.00 19.70 ? 200 PRO A CB  1 
ATOM   1595  C CG  . PRO A 1 201 ? 31.910  34.550  90.415  1.00 20.14 ? 200 PRO A CG  1 
ATOM   1596  C CD  . PRO A 1 201 ? 33.224  33.960  89.956  1.00 19.80 ? 200 PRO A CD  1 
ATOM   1597  N N   . GLU A 1 202 ? 33.494  35.814  86.782  1.00 19.98 ? 201 GLU A N   1 
ATOM   1598  C CA  . GLU A 1 202 ? 33.995  36.662  85.703  1.00 21.73 ? 201 GLU A CA  1 
ATOM   1599  C C   . GLU A 1 202 ? 34.029  36.036  84.316  1.00 21.53 ? 201 GLU A C   1 
ATOM   1600  O O   . GLU A 1 202 ? 33.960  36.749  83.317  1.00 21.29 ? 201 GLU A O   1 
ATOM   1601  C CB  . GLU A 1 202 ? 35.399  37.165  86.048  1.00 22.01 ? 201 GLU A CB  1 
ATOM   1602  C CG  . GLU A 1 202 ? 35.439  38.153  87.208  1.00 26.95 ? 201 GLU A CG  1 
ATOM   1603  C CD  . GLU A 1 202 ? 36.855  38.592  87.553  1.00 27.40 ? 201 GLU A CD  1 
ATOM   1604  O OE1 . GLU A 1 202 ? 37.634  38.897  86.625  1.00 25.48 ? 201 GLU A OE1 1 
ATOM   1605  O OE2 . GLU A 1 202 ? 37.184  38.639  88.755  1.00 31.52 ? 201 GLU A OE2 1 
ATOM   1606  N N   . SER A 1 203 ? 34.141  34.714  84.246  1.00 20.07 ? 202 SER A N   1 
ATOM   1607  C CA  . SER A 1 203 ? 34.213  34.047  82.953  1.00 22.21 ? 202 SER A CA  1 
ATOM   1608  C C   . SER A 1 203 ? 33.137  32.994  82.714  1.00 21.42 ? 202 SER A C   1 
ATOM   1609  O O   . SER A 1 203 ? 33.302  32.132  81.854  1.00 22.22 ? 202 SER A O   1 
ATOM   1610  C CB  . SER A 1 203 ? 35.597  33.408  82.778  1.00 21.27 ? 202 SER A CB  1 
ATOM   1611  O OG  . SER A 1 203 ? 35.895  32.537  83.853  1.00 19.09 ? 202 SER A OG  1 
ATOM   1612  N N   . SER A 1 204 ? 32.041  33.076  83.461  1.00 21.96 ? 203 SER A N   1 
ATOM   1613  C CA  . SER A 1 204 ? 30.943  32.121  83.329  1.00 22.47 ? 203 SER A CA  1 
ATOM   1614  C C   . SER A 1 204 ? 29.697  32.715  82.671  1.00 21.09 ? 203 SER A C   1 
ATOM   1615  O O   . SER A 1 204 ? 29.274  33.831  82.988  1.00 20.35 ? 203 SER A O   1 
ATOM   1616  C CB  . SER A 1 204 ? 30.558  31.556  84.708  1.00 23.03 ? 203 SER A CB  1 
ATOM   1617  O OG  . SER A 1 204 ? 31.577  30.726  85.250  1.00 23.16 ? 203 SER A OG  1 
ATOM   1618  N N   . LEU A 1 205 ? 29.112  31.951  81.758  1.00 18.73 ? 204 LEU A N   1 
ATOM   1619  C CA  . LEU A 1 205 ? 27.901  32.357  81.054  1.00 17.88 ? 204 LEU A CA  1 
ATOM   1620  C C   . LEU A 1 205 ? 26.798  31.343  81.359  1.00 18.63 ? 204 LEU A C   1 
ATOM   1621  O O   . LEU A 1 205 ? 26.960  30.143  81.105  1.00 19.12 ? 204 LEU A O   1 
ATOM   1622  C CB  . LEU A 1 205 ? 28.152  32.390  79.546  1.00 16.16 ? 204 LEU A CB  1 
ATOM   1623  C CG  . LEU A 1 205 ? 26.935  32.702  78.675  1.00 17.79 ? 204 LEU A CG  1 
ATOM   1624  C CD1 . LEU A 1 205 ? 26.514  34.149  78.904  1.00 15.61 ? 204 LEU A CD1 1 
ATOM   1625  C CD2 . LEU A 1 205 ? 27.278  32.487  77.205  1.00 21.19 ? 204 LEU A CD2 1 
ATOM   1626  N N   . PHE A 1 206 ? 25.684  31.817  81.904  1.00 17.36 ? 205 PHE A N   1 
ATOM   1627  C CA  . PHE A 1 206 ? 24.574  30.928  82.231  1.00 19.85 ? 205 PHE A CA  1 
ATOM   1628  C C   . PHE A 1 206 ? 23.466  30.999  81.196  1.00 19.93 ? 205 PHE A C   1 
ATOM   1629  O O   . PHE A 1 206 ? 23.119  32.079  80.716  1.00 20.69 ? 205 PHE A O   1 
ATOM   1630  C CB  . PHE A 1 206 ? 23.997  31.260  83.615  1.00 19.28 ? 205 PHE A CB  1 
ATOM   1631  C CG  . PHE A 1 206 ? 24.971  31.066  84.744  1.00 20.89 ? 205 PHE A CG  1 
ATOM   1632  C CD1 . PHE A 1 206 ? 25.842  32.086  85.113  1.00 21.21 ? 205 PHE A CD1 1 
ATOM   1633  C CD2 . PHE A 1 206 ? 25.034  29.851  85.425  1.00 20.00 ? 205 PHE A CD2 1 
ATOM   1634  C CE1 . PHE A 1 206 ? 26.766  31.904  86.145  1.00 19.16 ? 205 PHE A CE1 1 
ATOM   1635  C CE2 . PHE A 1 206 ? 25.952  29.656  86.457  1.00 22.28 ? 205 PHE A CE2 1 
ATOM   1636  C CZ  . PHE A 1 206 ? 26.824  30.691  86.819  1.00 21.71 ? 205 PHE A CZ  1 
ATOM   1637  N N   . ILE A 1 207 ? 22.926  29.834  80.851  1.00 19.01 ? 206 ILE A N   1 
ATOM   1638  C CA  . ILE A 1 207 ? 21.839  29.724  79.884  1.00 18.95 ? 206 ILE A CA  1 
ATOM   1639  C C   . ILE A 1 207 ? 20.606  29.199  80.610  1.00 20.54 ? 206 ILE A C   1 
ATOM   1640  O O   . ILE A 1 207 ? 20.582  28.051  81.056  1.00 21.31 ? 206 ILE A O   1 
ATOM   1641  C CB  . ILE A 1 207 ? 22.193  28.742  78.749  1.00 19.82 ? 206 ILE A CB  1 
ATOM   1642  C CG1 . ILE A 1 207 ? 23.419  29.251  77.986  1.00 20.64 ? 206 ILE A CG1 1 
ATOM   1643  C CG2 . ILE A 1 207 ? 21.006  28.572  77.818  1.00 17.10 ? 206 ILE A CG2 1 
ATOM   1644  C CD1 . ILE A 1 207 ? 23.961  28.263  76.992  1.00 18.11 ? 206 ILE A CD1 1 
ATOM   1645  N N   . ILE A 1 208 ? 19.586  30.039  80.729  1.00 18.39 ? 207 ILE A N   1 
ATOM   1646  C CA  . ILE A 1 208 ? 18.365  29.648  81.414  1.00 18.12 ? 207 ILE A CA  1 
ATOM   1647  C C   . ILE A 1 208 ? 17.346  29.164  80.383  1.00 19.20 ? 207 ILE A C   1 
ATOM   1648  O O   . ILE A 1 208 ? 16.763  29.966  79.647  1.00 15.48 ? 207 ILE A O   1 
ATOM   1649  C CB  . ILE A 1 208 ? 17.784  30.842  82.220  1.00 18.04 ? 207 ILE A CB  1 
ATOM   1650  C CG1 . ILE A 1 208 ? 18.903  31.536  83.007  1.00 17.52 ? 207 ILE A CG1 1 
ATOM   1651  C CG2 . ILE A 1 208 ? 16.699  30.361  83.182  1.00 18.93 ? 207 ILE A CG2 1 
ATOM   1652  C CD1 . ILE A 1 208 ? 19.772  30.614  83.842  1.00 14.94 ? 207 ILE A CD1 1 
ATOM   1653  N N   . ALA A 1 209 ? 17.150  27.844  80.341  1.00 17.95 ? 208 ALA A N   1 
ATOM   1654  C CA  . ALA A 1 209 ? 16.230  27.195  79.408  1.00 18.60 ? 208 ALA A CA  1 
ATOM   1655  C C   . ALA A 1 209 ? 14.862  26.924  80.029  1.00 19.98 ? 208 ALA A C   1 
ATOM   1656  O O   . ALA A 1 209 ? 14.718  26.017  80.846  1.00 20.64 ? 208 ALA A O   1 
ATOM   1657  C CB  . ALA A 1 209 ? 16.836  25.880  78.912  1.00 18.02 ? 208 ALA A CB  1 
ATOM   1658  N N   . SER A 1 210 ? 13.863  27.707  79.632  1.00 20.33 ? 209 SER A N   1 
ATOM   1659  C CA  . SER A 1 210 ? 12.502  27.557  80.145  1.00 22.06 ? 209 SER A CA  1 
ATOM   1660  C C   . SER A 1 210 ? 11.511  28.349  79.299  1.00 24.65 ? 209 SER A C   1 
ATOM   1661  O O   . SER A 1 210 ? 11.492  29.580  79.341  1.00 25.86 ? 209 SER A O   1 
ATOM   1662  C CB  . SER A 1 210 ? 12.419  28.041  81.592  1.00 21.45 ? 209 SER A CB  1 
ATOM   1663  O OG  . SER A 1 210 ? 11.067  28.119  82.009  1.00 20.64 ? 209 SER A OG  1 
ATOM   1664  N N   . LYS A 1 211 ? 10.681  27.636  78.547  1.00 26.18 ? 210 LYS A N   1 
ATOM   1665  C CA  . LYS A 1 211 ? 9.690   28.253  77.670  1.00 27.39 ? 210 LYS A CA  1 
ATOM   1666  C C   . LYS A 1 211 ? 8.921   29.387  78.343  1.00 28.74 ? 210 LYS A C   1 
ATOM   1667  O O   . LYS A 1 211 ? 8.892   30.519  77.851  1.00 28.63 ? 210 LYS A O   1 
ATOM   1668  C CB  . LYS A 1 211 ? 8.709   27.181  77.187  1.00 28.16 ? 210 LYS A CB  1 
ATOM   1669  C CG  . LYS A 1 211 ? 7.604   27.672  76.260  1.00 28.42 ? 210 LYS A CG  1 
ATOM   1670  C CD  . LYS A 1 211 ? 8.127   28.014  74.879  1.00 27.46 ? 210 LYS A CD  1 
ATOM   1671  C CE  . LYS A 1 211 ? 6.982   28.206  73.888  1.00 27.62 ? 210 LYS A CE  1 
ATOM   1672  N NZ  . LYS A 1 211 ? 6.114   29.358  74.251  1.00 25.73 ? 210 LYS A NZ  1 
ATOM   1673  N N   . THR A 1 212 ? 8.306   29.069  79.477  1.00 29.80 ? 211 THR A N   1 
ATOM   1674  C CA  . THR A 1 212 ? 7.502   30.020  80.235  1.00 29.51 ? 211 THR A CA  1 
ATOM   1675  C C   . THR A 1 212 ? 8.337   30.954  81.095  1.00 29.35 ? 211 THR A C   1 
ATOM   1676  O O   . THR A 1 212 ? 7.914   32.058  81.430  1.00 29.60 ? 211 THR A O   1 
ATOM   1677  C CB  . THR A 1 212 ? 6.550   29.277  81.178  1.00 31.69 ? 211 THR A CB  1 
ATOM   1678  O OG1 . THR A 1 212 ? 7.322   28.531  82.129  1.00 31.61 ? 211 THR A OG1 1 
ATOM   1679  C CG2 . THR A 1 212 ? 5.661   28.319  80.400  1.00 30.16 ? 211 THR A CG2 1 
ATOM   1680  N N   . PHE A 1 213 ? 9.525   30.488  81.448  1.00 27.44 ? 212 PHE A N   1 
ATOM   1681  C CA  . PHE A 1 213 ? 10.434  31.214  82.311  1.00 26.97 ? 212 PHE A CA  1 
ATOM   1682  C C   . PHE A 1 213 ? 9.833   31.368  83.708  1.00 27.18 ? 212 PHE A C   1 
ATOM   1683  O O   . PHE A 1 213 ? 10.073  32.356  84.399  1.00 26.78 ? 212 PHE A O   1 
ATOM   1684  C CB  . PHE A 1 213 ? 10.796  32.583  81.738  1.00 25.00 ? 212 PHE A CB  1 
ATOM   1685  C CG  . PHE A 1 213 ? 12.229  32.958  81.975  1.00 23.06 ? 212 PHE A CG  1 
ATOM   1686  C CD1 . PHE A 1 213 ? 13.250  32.270  81.333  1.00 22.93 ? 212 PHE A CD1 1 
ATOM   1687  C CD2 . PHE A 1 213 ? 12.565  33.964  82.875  1.00 24.61 ? 212 PHE A CD2 1 
ATOM   1688  C CE1 . PHE A 1 213 ? 14.587  32.573  81.583  1.00 21.96 ? 212 PHE A CE1 1 
ATOM   1689  C CE2 . PHE A 1 213 ? 13.896  34.275  83.133  1.00 22.63 ? 212 PHE A CE2 1 
ATOM   1690  C CZ  . PHE A 1 213 ? 14.910  33.577  82.485  1.00 25.45 ? 212 PHE A CZ  1 
ATOM   1691  N N   . THR A 1 214 ? 9.035   30.380  84.104  1.00 27.22 ? 213 THR A N   1 
ATOM   1692  C CA  . THR A 1 214 ? 8.426   30.348  85.431  1.00 27.42 ? 213 THR A CA  1 
ATOM   1693  C C   . THR A 1 214 ? 8.568   28.930  85.982  1.00 27.47 ? 213 THR A C   1 
ATOM   1694  O O   . THR A 1 214 ? 8.032   28.609  87.039  1.00 28.31 ? 213 THR A O   1 
ATOM   1695  C CB  . THR A 1 214 ? 6.924   30.728  85.408  1.00 27.12 ? 213 THR A CB  1 
ATOM   1696  O OG1 . THR A 1 214 ? 6.215   29.858  84.517  1.00 26.94 ? 213 THR A OG1 1 
ATOM   1697  C CG2 . THR A 1 214 ? 6.746   32.176  84.972  1.00 26.13 ? 213 THR A CG2 1 
ATOM   1698  N N   . THR A 1 215 ? 9.291   28.080  85.255  1.00 27.22 ? 214 THR A N   1 
ATOM   1699  C CA  . THR A 1 215 ? 9.509   26.702  85.693  1.00 26.09 ? 214 THR A CA  1 
ATOM   1700  C C   . THR A 1 215 ? 10.139  26.784  87.082  1.00 25.28 ? 214 THR A C   1 
ATOM   1701  O O   . THR A 1 215 ? 11.186  27.414  87.253  1.00 23.78 ? 214 THR A O   1 
ATOM   1702  C CB  . THR A 1 215 ? 10.471  25.960  84.745  1.00 24.73 ? 214 THR A CB  1 
ATOM   1703  O OG1 . THR A 1 215 ? 9.989   26.061  83.398  1.00 25.52 ? 214 THR A OG1 1 
ATOM   1704  C CG2 . THR A 1 215 ? 10.570  24.494  85.132  1.00 24.12 ? 214 THR A CG2 1 
ATOM   1705  N N   . GLN A 1 216 ? 9.507   26.147  88.066  1.00 23.78 ? 215 GLN A N   1 
ATOM   1706  C CA  . GLN A 1 216 ? 9.993   26.205  89.443  1.00 23.02 ? 215 GLN A CA  1 
ATOM   1707  C C   . GLN A 1 216 ? 11.438  25.790  89.666  1.00 22.16 ? 215 GLN A C   1 
ATOM   1708  O O   . GLN A 1 216 ? 12.225  26.555  90.227  1.00 20.84 ? 215 GLN A O   1 
ATOM   1709  C CB  . GLN A 1 216 ? 9.107   25.378  90.383  1.00 24.41 ? 215 GLN A CB  1 
ATOM   1710  C CG  . GLN A 1 216 ? 9.395   25.686  91.853  1.00 22.92 ? 215 GLN A CG  1 
ATOM   1711  C CD  . GLN A 1 216 ? 8.735   24.727  92.823  1.00 25.24 ? 215 GLN A CD  1 
ATOM   1712  O OE1 . GLN A 1 216 ? 8.522   25.063  93.994  1.00 25.95 ? 215 GLN A OE1 1 
ATOM   1713  N NE2 . GLN A 1 216 ? 8.426   23.525  92.355  1.00 22.62 ? 215 GLN A NE2 1 
ATOM   1714  N N   . GLU A 1 217 ? 11.781  24.576  89.245  1.00 21.85 ? 216 GLU A N   1 
ATOM   1715  C CA  . GLU A 1 217 ? 13.131  24.058  89.435  1.00 22.82 ? 216 GLU A CA  1 
ATOM   1716  C C   . GLU A 1 217 ? 14.176  24.888  88.713  1.00 20.69 ? 216 GLU A C   1 
ATOM   1717  O O   . GLU A 1 217 ? 15.167  25.307  89.308  1.00 19.14 ? 216 GLU A O   1 
ATOM   1718  C CB  . GLU A 1 217 ? 13.234  22.605  88.955  1.00 24.37 ? 216 GLU A CB  1 
ATOM   1719  C CG  . GLU A 1 217 ? 12.300  21.639  89.652  1.00 29.04 ? 216 GLU A CG  1 
ATOM   1720  C CD  . GLU A 1 217 ? 10.897  21.641  89.062  1.00 33.77 ? 216 GLU A CD  1 
ATOM   1721  O OE1 . GLU A 1 217 ? 10.100  20.759  89.449  1.00 36.81 ? 216 GLU A OE1 1 
ATOM   1722  O OE2 . GLU A 1 217 ? 10.586  22.512  88.217  1.00 34.43 ? 216 GLU A OE2 1 
ATOM   1723  N N   . THR A 1 218 ? 13.946  25.118  87.425  1.00 19.62 ? 217 THR A N   1 
ATOM   1724  C CA  . THR A 1 218 ? 14.870  25.882  86.603  1.00 18.63 ? 217 THR A CA  1 
ATOM   1725  C C   . THR A 1 218 ? 15.069  27.313  87.077  1.00 17.77 ? 217 THR A C   1 
ATOM   1726  O O   . THR A 1 218 ? 16.205  27.798  87.154  1.00 17.30 ? 217 THR A O   1 
ATOM   1727  C CB  . THR A 1 218 ? 14.408  25.884  85.136  1.00 18.24 ? 217 THR A CB  1 
ATOM   1728  O OG1 . THR A 1 218 ? 14.428  24.539  84.644  1.00 18.63 ? 217 THR A OG1 1 
ATOM   1729  C CG2 . THR A 1 218 ? 15.332  26.744  84.276  1.00 16.96 ? 217 THR A CG2 1 
ATOM   1730  N N   . ILE A 1 219 ? 13.979  27.989  87.411  1.00 16.62 ? 218 ILE A N   1 
ATOM   1731  C CA  . ILE A 1 219 ? 14.094  29.363  87.866  1.00 18.83 ? 218 ILE A CA  1 
ATOM   1732  C C   . ILE A 1 219 ? 14.724  29.444  89.259  1.00 19.11 ? 218 ILE A C   1 
ATOM   1733  O O   . ILE A 1 219 ? 15.433  30.405  89.559  1.00 19.71 ? 218 ILE A O   1 
ATOM   1734  C CB  . ILE A 1 219 ? 12.721  30.072  87.867  1.00 20.73 ? 218 ILE A CB  1 
ATOM   1735  C CG1 . ILE A 1 219 ? 12.130  30.062  86.454  1.00 22.41 ? 218 ILE A CG1 1 
ATOM   1736  C CG2 . ILE A 1 219 ? 12.876  31.516  88.346  1.00 22.65 ? 218 ILE A CG2 1 
ATOM   1737  C CD1 . ILE A 1 219 ? 13.008  30.733  85.413  1.00 24.58 ? 218 ILE A CD1 1 
ATOM   1738  N N   . THR A 1 220 ? 14.483  28.446  90.110  1.00 19.07 ? 219 THR A N   1 
ATOM   1739  C CA  . THR A 1 220 ? 15.082  28.476  91.448  1.00 17.94 ? 219 THR A CA  1 
ATOM   1740  C C   . THR A 1 220 ? 16.598  28.376  91.288  1.00 19.15 ? 219 THR A C   1 
ATOM   1741  O O   . THR A 1 220 ? 17.349  29.123  91.921  1.00 19.49 ? 219 THR A O   1 
ATOM   1742  C CB  . THR A 1 220 ? 14.579  27.317  92.356  1.00 18.52 ? 219 THR A CB  1 
ATOM   1743  O OG1 . THR A 1 220 ? 13.155  27.405  92.513  1.00 17.98 ? 219 THR A OG1 1 
ATOM   1744  C CG2 . THR A 1 220 ? 15.222  27.410  93.744  1.00 15.87 ? 219 THR A CG2 1 
ATOM   1745  N N   . ASN A 1 221 ? 17.044  27.460  90.430  1.00 18.23 ? 220 ASN A N   1 
ATOM   1746  C CA  . ASN A 1 221 ? 18.472  27.297  90.174  1.00 19.75 ? 220 ASN A CA  1 
ATOM   1747  C C   . ASN A 1 221 ? 19.036  28.573  89.553  1.00 19.64 ? 220 ASN A C   1 
ATOM   1748  O O   . ASN A 1 221 ? 20.129  29.011  89.905  1.00 20.34 ? 220 ASN A O   1 
ATOM   1749  C CB  . ASN A 1 221 ? 18.736  26.109  89.232  1.00 18.53 ? 220 ASN A CB  1 
ATOM   1750  C CG  . ASN A 1 221 ? 18.706  24.765  89.957  1.00 19.79 ? 220 ASN A CG  1 
ATOM   1751  O OD1 . ASN A 1 221 ? 19.219  24.641  91.073  1.00 19.31 ? 220 ASN A OD1 1 
ATOM   1752  N ND2 . ASN A 1 221 ? 18.127  23.752  89.318  1.00 18.74 ? 220 ASN A ND2 1 
ATOM   1753  N N   . ALA A 1 222 ? 18.288  29.161  88.625  1.00 20.25 ? 221 ALA A N   1 
ATOM   1754  C CA  . ALA A 1 222 ? 18.721  30.389  87.963  1.00 20.63 ? 221 ALA A CA  1 
ATOM   1755  C C   . ALA A 1 222 ? 18.915  31.504  88.990  1.00 20.28 ? 221 ALA A C   1 
ATOM   1756  O O   . ALA A 1 222 ? 19.931  32.192  88.981  1.00 20.81 ? 221 ALA A O   1 
ATOM   1757  C CB  . ALA A 1 222 ? 17.692  30.816  86.908  1.00 18.70 ? 221 ALA A CB  1 
ATOM   1758  N N   . GLU A 1 223 ? 17.941  31.672  89.877  1.00 20.16 ? 222 GLU A N   1 
ATOM   1759  C CA  . GLU A 1 223 ? 18.022  32.708  90.900  1.00 20.69 ? 222 GLU A CA  1 
ATOM   1760  C C   . GLU A 1 223 ? 19.167  32.430  91.864  1.00 19.10 ? 222 GLU A C   1 
ATOM   1761  O O   . GLU A 1 223 ? 19.784  33.355  92.387  1.00 17.86 ? 222 GLU A O   1 
ATOM   1762  C CB  . GLU A 1 223 ? 16.689  32.823  91.649  1.00 21.26 ? 222 GLU A CB  1 
ATOM   1763  C CG  . GLU A 1 223 ? 15.530  33.096  90.698  1.00 26.50 ? 222 GLU A CG  1 
ATOM   1764  C CD  . GLU A 1 223 ? 14.236  33.477  91.391  1.00 30.27 ? 222 GLU A CD  1 
ATOM   1765  O OE1 . GLU A 1 223 ? 13.862  32.817  92.383  1.00 32.74 ? 222 GLU A OE1 1 
ATOM   1766  O OE2 . GLU A 1 223 ? 13.580  34.434  90.926  1.00 33.54 ? 222 GLU A OE2 1 
ATOM   1767  N N   . THR A 1 224 ? 19.464  31.157  92.101  1.00 18.52 ? 223 THR A N   1 
ATOM   1768  C CA  . THR A 1 224 ? 20.572  30.838  92.987  1.00 17.05 ? 223 THR A CA  1 
ATOM   1769  C C   . THR A 1 224 ? 21.874  31.220  92.285  1.00 17.74 ? 223 THR A C   1 
ATOM   1770  O O   . THR A 1 224 ? 22.788  31.758  92.908  1.00 17.55 ? 223 THR A O   1 
ATOM   1771  C CB  . THR A 1 224 ? 20.588  29.344  93.358  1.00 17.87 ? 223 THR A CB  1 
ATOM   1772  O OG1 . THR A 1 224 ? 19.479  29.064  94.221  1.00 17.86 ? 223 THR A OG1 1 
ATOM   1773  C CG2 . THR A 1 224 ? 21.883  28.980  94.072  1.00 15.52 ? 223 THR A CG2 1 
ATOM   1774  N N   . ALA A 1 225 ? 21.943  30.946  90.982  1.00 17.89 ? 224 ALA A N   1 
ATOM   1775  C CA  . ALA A 1 225 ? 23.119  31.273  90.181  1.00 19.17 ? 224 ALA A CA  1 
ATOM   1776  C C   . ALA A 1 225 ? 23.323  32.791  90.119  1.00 19.29 ? 224 ALA A C   1 
ATOM   1777  O O   . ALA A 1 225 ? 24.451  33.278  90.200  1.00 19.46 ? 224 ALA A O   1 
ATOM   1778  C CB  . ALA A 1 225 ? 22.965  30.708  88.772  1.00 18.60 ? 224 ALA A CB  1 
ATOM   1779  N N   . LYS A 1 226 ? 22.232  33.535  89.976  1.00 18.56 ? 225 LYS A N   1 
ATOM   1780  C CA  . LYS A 1 226 ? 22.324  34.987  89.917  1.00 21.46 ? 225 LYS A CA  1 
ATOM   1781  C C   . LYS A 1 226 ? 22.800  35.574  91.249  1.00 22.36 ? 225 LYS A C   1 
ATOM   1782  O O   . LYS A 1 226 ? 23.630  36.485  91.265  1.00 24.89 ? 225 LYS A O   1 
ATOM   1783  C CB  . LYS A 1 226 ? 20.976  35.602  89.528  1.00 22.54 ? 225 LYS A CB  1 
ATOM   1784  C CG  . LYS A 1 226 ? 21.007  37.133  89.524  1.00 24.31 ? 225 LYS A CG  1 
ATOM   1785  C CD  . LYS A 1 226 ? 19.820  37.738  88.797  1.00 22.40 ? 225 LYS A CD  1 
ATOM   1786  C CE  . LYS A 1 226 ? 18.518  37.425  89.494  1.00 22.97 ? 225 LYS A CE  1 
ATOM   1787  N NZ  . LYS A 1 226 ? 17.397  38.189  88.881  1.00 24.80 ? 225 LYS A NZ  1 
ATOM   1788  N N   . GLU A 1 227 ? 22.285  35.057  92.363  1.00 22.80 ? 226 GLU A N   1 
ATOM   1789  C CA  . GLU A 1 227 ? 22.701  35.547  93.673  1.00 22.20 ? 226 GLU A CA  1 
ATOM   1790  C C   . GLU A 1 227 ? 24.201  35.308  93.818  1.00 22.58 ? 226 GLU A C   1 
ATOM   1791  O O   . GLU A 1 227 ? 24.934  36.173  94.308  1.00 20.30 ? 226 GLU A O   1 
ATOM   1792  C CB  . GLU A 1 227 ? 21.941  34.825  94.795  1.00 24.60 ? 226 GLU A CB  1 
ATOM   1793  C CG  . GLU A 1 227 ? 22.443  35.160  96.202  1.00 28.28 ? 226 GLU A CG  1 
ATOM   1794  C CD  . GLU A 1 227 ? 21.666  34.452  97.313  1.00 31.40 ? 226 GLU A CD  1 
ATOM   1795  O OE1 . GLU A 1 227 ? 22.185  34.379  98.446  1.00 36.02 ? 226 GLU A OE1 1 
ATOM   1796  O OE2 . GLU A 1 227 ? 20.540  33.978  97.069  1.00 31.30 ? 226 GLU A OE2 1 
ATOM   1797  N N   . TRP A 1 228 ? 24.653  34.132  93.382  1.00 21.46 ? 227 TRP A N   1 
ATOM   1798  C CA  . TRP A 1 228 ? 26.072  33.781  93.444  1.00 21.47 ? 227 TRP A CA  1 
ATOM   1799  C C   . TRP A 1 228 ? 26.883  34.760  92.597  1.00 21.79 ? 227 TRP A C   1 
ATOM   1800  O O   . TRP A 1 228 ? 27.913  35.275  93.034  1.00 24.16 ? 227 TRP A O   1 
ATOM   1801  C CB  . TRP A 1 228 ? 26.283  32.362  92.912  1.00 19.81 ? 227 TRP A CB  1 
ATOM   1802  C CG  . TRP A 1 228 ? 27.718  31.970  92.680  1.00 18.37 ? 227 TRP A CG  1 
ATOM   1803  C CD1 . TRP A 1 228 ? 28.612  31.521  93.614  1.00 19.13 ? 227 TRP A CD1 1 
ATOM   1804  C CD2 . TRP A 1 228 ? 28.404  31.930  91.420  1.00 19.38 ? 227 TRP A CD2 1 
ATOM   1805  N NE1 . TRP A 1 228 ? 29.804  31.195  93.012  1.00 17.90 ? 227 TRP A NE1 1 
ATOM   1806  C CE2 . TRP A 1 228 ? 29.706  31.435  91.667  1.00 18.73 ? 227 TRP A CE2 1 
ATOM   1807  C CE3 . TRP A 1 228 ? 28.045  32.263  90.105  1.00 17.89 ? 227 TRP A CE3 1 
ATOM   1808  C CZ2 . TRP A 1 228 ? 30.651  31.261  90.647  1.00 19.75 ? 227 TRP A CZ2 1 
ATOM   1809  C CZ3 . TRP A 1 228 ? 28.990  32.088  89.088  1.00 19.98 ? 227 TRP A CZ3 1 
ATOM   1810  C CH2 . TRP A 1 228 ? 30.275  31.590  89.369  1.00 17.06 ? 227 TRP A CH2 1 
ATOM   1811  N N   . PHE A 1 229 ? 26.413  35.002  91.378  1.00 21.58 ? 228 PHE A N   1 
ATOM   1812  C CA  . PHE A 1 229 ? 27.090  35.910  90.466  1.00 23.07 ? 228 PHE A CA  1 
ATOM   1813  C C   . PHE A 1 229 ? 27.127  37.337  91.020  1.00 23.82 ? 228 PHE A C   1 
ATOM   1814  O O   . PHE A 1 229 ? 28.183  37.969  91.079  1.00 23.54 ? 228 PHE A O   1 
ATOM   1815  C CB  . PHE A 1 229 ? 26.384  35.925  89.110  1.00 23.61 ? 228 PHE A CB  1 
ATOM   1816  C CG  . PHE A 1 229 ? 26.865  37.014  88.201  1.00 25.67 ? 228 PHE A CG  1 
ATOM   1817  C CD1 . PHE A 1 229 ? 28.131  36.948  87.623  1.00 26.35 ? 228 PHE A CD1 1 
ATOM   1818  C CD2 . PHE A 1 229 ? 26.081  38.140  87.971  1.00 25.40 ? 228 PHE A CD2 1 
ATOM   1819  C CE1 . PHE A 1 229 ? 28.609  37.993  86.829  1.00 26.56 ? 228 PHE A CE1 1 
ATOM   1820  C CE2 . PHE A 1 229 ? 26.548  39.186  87.182  1.00 25.95 ? 228 PHE A CE2 1 
ATOM   1821  C CZ  . PHE A 1 229 ? 27.815  39.114  86.611  1.00 26.46 ? 228 PHE A CZ  1 
ATOM   1822  N N   . LEU A 1 230 ? 25.966  37.839  91.419  1.00 24.52 ? 229 LEU A N   1 
ATOM   1823  C CA  . LEU A 1 230 ? 25.874  39.191  91.950  1.00 26.02 ? 229 LEU A CA  1 
ATOM   1824  C C   . LEU A 1 230 ? 26.673  39.362  93.237  1.00 26.79 ? 229 LEU A C   1 
ATOM   1825  O O   . LEU A 1 230 ? 27.083  40.475  93.574  1.00 26.36 ? 229 LEU A O   1 
ATOM   1826  C CB  . LEU A 1 230 ? 24.405  39.563  92.171  1.00 26.38 ? 229 LEU A CB  1 
ATOM   1827  C CG  . LEU A 1 230 ? 23.830  40.626  91.227  1.00 28.17 ? 229 LEU A CG  1 
ATOM   1828  C CD1 . LEU A 1 230 ? 24.561  40.639  89.896  1.00 26.85 ? 229 LEU A CD1 1 
ATOM   1829  C CD2 . LEU A 1 230 ? 22.351  40.366  91.035  1.00 26.52 ? 229 LEU A CD2 1 
ATOM   1830  N N   . GLN A 1 231 ? 26.902  38.267  93.956  1.00 25.97 ? 230 GLN A N   1 
ATOM   1831  C CA  . GLN A 1 231 ? 27.677  38.354  95.187  1.00 26.29 ? 230 GLN A CA  1 
ATOM   1832  C C   . GLN A 1 231 ? 29.085  38.792  94.818  1.00 23.27 ? 230 GLN A C   1 
ATOM   1833  O O   . GLN A 1 231 ? 29.771  39.443  95.597  1.00 22.72 ? 230 GLN A O   1 
ATOM   1834  C CB  . GLN A 1 231 ? 27.736  37.005  95.905  1.00 29.59 ? 230 GLN A CB  1 
ATOM   1835  C CG  . GLN A 1 231 ? 28.504  37.063  97.224  1.00 35.10 ? 230 GLN A CG  1 
ATOM   1836  C CD  . GLN A 1 231 ? 27.887  38.044  98.216  1.00 39.70 ? 230 GLN A CD  1 
ATOM   1837  O OE1 . GLN A 1 231 ? 28.529  38.454  99.184  1.00 42.41 ? 230 GLN A OE1 1 
ATOM   1838  N NE2 . GLN A 1 231 ? 26.633  38.417  97.979  1.00 41.73 ? 230 GLN A NE2 1 
ATOM   1839  N N   . ALA A 1 232 ? 29.504  38.431  93.614  1.00 23.27 ? 231 ALA A N   1 
ATOM   1840  C CA  . ALA A 1 232 ? 30.826  38.787  93.122  1.00 24.37 ? 231 ALA A CA  1 
ATOM   1841  C C   . ALA A 1 232 ? 30.779  40.093  92.342  1.00 24.08 ? 231 ALA A C   1 
ATOM   1842  O O   . ALA A 1 232 ? 31.582  40.990  92.573  1.00 23.32 ? 231 ALA A O   1 
ATOM   1843  C CB  . ALA A 1 232 ? 31.366  37.676  92.225  1.00 23.97 ? 231 ALA A CB  1 
ATOM   1844  N N   . ALA A 1 233 ? 29.818  40.191  91.427  1.00 25.71 ? 232 ALA A N   1 
ATOM   1845  C CA  . ALA A 1 233 ? 29.669  41.363  90.571  1.00 26.07 ? 232 ALA A CA  1 
ATOM   1846  C C   . ALA A 1 233 ? 29.025  42.577  91.241  1.00 27.62 ? 232 ALA A C   1 
ATOM   1847  O O   . ALA A 1 233 ? 29.430  43.709  90.984  1.00 27.93 ? 232 ALA A O   1 
ATOM   1848  C CB  . ALA A 1 233 ? 28.887  40.983  89.321  1.00 23.60 ? 232 ALA A CB  1 
ATOM   1849  N N   . LYS A 1 234 ? 28.019  42.340  92.081  1.00 28.71 ? 233 LYS A N   1 
ATOM   1850  C CA  . LYS A 1 234 ? 27.317  43.408  92.799  1.00 30.82 ? 233 LYS A CA  1 
ATOM   1851  C C   . LYS A 1 234 ? 26.387  44.228  91.907  1.00 31.28 ? 233 LYS A C   1 
ATOM   1852  O O   . LYS A 1 234 ? 25.200  44.387  92.209  1.00 31.39 ? 233 LYS A O   1 
ATOM   1853  C CB  . LYS A 1 234 ? 28.321  44.343  93.485  1.00 32.12 ? 233 LYS A CB  1 
ATOM   1854  C CG  . LYS A 1 234 ? 29.242  43.647  94.474  1.00 34.16 ? 233 LYS A CG  1 
ATOM   1855  C CD  . LYS A 1 234 ? 28.454  43.017  95.610  1.00 36.46 ? 233 LYS A CD  1 
ATOM   1856  C CE  . LYS A 1 234 ? 29.356  42.197  96.519  1.00 37.77 ? 233 LYS A CE  1 
ATOM   1857  N NZ  . LYS A 1 234 ? 30.499  42.993  97.036  1.00 42.51 ? 233 LYS A NZ  1 
ATOM   1858  N N   . ASP A 1 235 ? 26.933  44.749  90.816  1.00 30.90 ? 234 ASP A N   1 
ATOM   1859  C CA  . ASP A 1 235 ? 26.168  45.557  89.873  1.00 32.47 ? 234 ASP A CA  1 
ATOM   1860  C C   . ASP A 1 235 ? 25.158  44.734  89.072  1.00 31.65 ? 234 ASP A C   1 
ATOM   1861  O O   . ASP A 1 235 ? 25.530  43.841  88.316  1.00 31.43 ? 234 ASP A O   1 
ATOM   1862  C CB  . ASP A 1 235 ? 27.126  46.277  88.924  1.00 34.85 ? 234 ASP A CB  1 
ATOM   1863  C CG  . ASP A 1 235 ? 26.445  46.750  87.660  1.00 38.04 ? 234 ASP A CG  1 
ATOM   1864  O OD1 . ASP A 1 235 ? 25.366  47.374  87.760  1.00 39.76 ? 234 ASP A OD1 1 
ATOM   1865  O OD2 . ASP A 1 235 ? 26.995  46.495  86.566  1.00 40.25 ? 234 ASP A OD2 1 
ATOM   1866  N N   . PRO A 1 236 ? 23.862  45.043  89.220  1.00 31.94 ? 235 PRO A N   1 
ATOM   1867  C CA  . PRO A 1 236 ? 22.779  44.344  88.523  1.00 30.42 ? 235 PRO A CA  1 
ATOM   1868  C C   . PRO A 1 236 ? 22.855  44.366  87.001  1.00 30.51 ? 235 PRO A C   1 
ATOM   1869  O O   . PRO A 1 236 ? 22.437  43.407  86.349  1.00 30.94 ? 235 PRO A O   1 
ATOM   1870  C CB  . PRO A 1 236 ? 21.526  45.039  89.052  1.00 31.24 ? 235 PRO A CB  1 
ATOM   1871  C CG  . PRO A 1 236 ? 22.012  46.425  89.338  1.00 32.92 ? 235 PRO A CG  1 
ATOM   1872  C CD  . PRO A 1 236 ? 23.325  46.158  90.019  1.00 32.93 ? 235 PRO A CD  1 
ATOM   1873  N N   . SER A 1 237 ? 23.388  45.444  86.432  1.00 29.13 ? 236 SER A N   1 
ATOM   1874  C CA  . SER A 1 237 ? 23.489  45.546  84.978  1.00 28.48 ? 236 SER A CA  1 
ATOM   1875  C C   . SER A 1 237 ? 24.498  44.548  84.408  1.00 27.07 ? 236 SER A C   1 
ATOM   1876  O O   . SER A 1 237 ? 24.556  44.339  83.197  1.00 26.66 ? 236 SER A O   1 
ATOM   1877  C CB  . SER A 1 237 ? 23.887  46.964  84.562  1.00 28.52 ? 236 SER A CB  1 
ATOM   1878  O OG  . SER A 1 237 ? 25.243  47.229  84.887  1.00 31.25 ? 236 SER A OG  1 
ATOM   1879  N N   . ALA A 1 238 ? 25.288  43.930  85.280  1.00 25.83 ? 237 ALA A N   1 
ATOM   1880  C CA  . ALA A 1 238 ? 26.287  42.953  84.842  1.00 25.99 ? 237 ALA A CA  1 
ATOM   1881  C C   . ALA A 1 238 ? 25.641  41.609  84.490  1.00 24.20 ? 237 ALA A C   1 
ATOM   1882  O O   . ALA A 1 238 ? 26.228  40.797  83.776  1.00 22.68 ? 237 ALA A O   1 
ATOM   1883  C CB  . ALA A 1 238 ? 27.339  42.757  85.927  1.00 25.80 ? 237 ALA A CB  1 
ATOM   1884  N N   . VAL A 1 239 ? 24.428  41.391  84.988  1.00 23.81 ? 238 VAL A N   1 
ATOM   1885  C CA  . VAL A 1 239 ? 23.701  40.151  84.736  1.00 22.94 ? 238 VAL A CA  1 
ATOM   1886  C C   . VAL A 1 239 ? 23.521  39.923  83.240  1.00 22.59 ? 238 VAL A C   1 
ATOM   1887  O O   . VAL A 1 239 ? 23.593  38.790  82.763  1.00 21.76 ? 238 VAL A O   1 
ATOM   1888  C CB  . VAL A 1 239 ? 22.316  40.176  85.436  1.00 22.65 ? 238 VAL A CB  1 
ATOM   1889  C CG1 . VAL A 1 239 ? 21.475  38.968  85.020  1.00 21.29 ? 238 VAL A CG1 1 
ATOM   1890  C CG2 . VAL A 1 239 ? 22.512  40.176  86.944  1.00 22.03 ? 238 VAL A CG2 1 
ATOM   1891  N N   . ALA A 1 240 ? 23.310  41.007  82.501  1.00 21.72 ? 239 ALA A N   1 
ATOM   1892  C CA  . ALA A 1 240 ? 23.114  40.937  81.052  1.00 20.98 ? 239 ALA A CA  1 
ATOM   1893  C C   . ALA A 1 240 ? 24.325  40.390  80.302  1.00 19.52 ? 239 ALA A C   1 
ATOM   1894  O O   . ALA A 1 240 ? 24.196  39.910  79.180  1.00 20.41 ? 239 ALA A O   1 
ATOM   1895  C CB  . ALA A 1 240 ? 22.749  42.327  80.502  1.00 19.95 ? 239 ALA A CB  1 
ATOM   1896  N N   . LYS A 1 241 ? 25.502  40.472  80.908  1.00 20.63 ? 240 LYS A N   1 
ATOM   1897  C CA  . LYS A 1 241 ? 26.704  39.967  80.254  1.00 21.59 ? 240 LYS A CA  1 
ATOM   1898  C C   . LYS A 1 241 ? 26.973  38.509  80.633  1.00 20.80 ? 240 LYS A C   1 
ATOM   1899  O O   . LYS A 1 241 ? 27.827  37.854  80.031  1.00 20.65 ? 240 LYS A O   1 
ATOM   1900  C CB  . LYS A 1 241 ? 27.926  40.806  80.643  1.00 23.69 ? 240 LYS A CB  1 
ATOM   1901  C CG  . LYS A 1 241 ? 27.820  42.296  80.337  1.00 28.94 ? 240 LYS A CG  1 
ATOM   1902  C CD  . LYS A 1 241 ? 29.012  43.035  80.938  1.00 33.13 ? 240 LYS A CD  1 
ATOM   1903  C CE  . LYS A 1 241 ? 28.914  44.552  80.768  1.00 35.09 ? 240 LYS A CE  1 
ATOM   1904  N NZ  . LYS A 1 241 ? 28.973  44.966  79.340  1.00 38.81 ? 240 LYS A NZ  1 
ATOM   1905  N N   . HIS A 1 242 ? 26.235  37.995  81.613  1.00 19.17 ? 241 HIS A N   1 
ATOM   1906  C CA  . HIS A 1 242 ? 26.459  36.634  82.076  1.00 19.75 ? 241 HIS A CA  1 
ATOM   1907  C C   . HIS A 1 242 ? 25.265  35.683  82.067  1.00 20.16 ? 241 HIS A C   1 
ATOM   1908  O O   . HIS A 1 242 ? 25.401  34.521  82.444  1.00 19.17 ? 241 HIS A O   1 
ATOM   1909  C CB  . HIS A 1 242 ? 27.072  36.701  83.470  1.00 18.27 ? 241 HIS A CB  1 
ATOM   1910  C CG  . HIS A 1 242 ? 28.425  37.343  83.487  1.00 19.22 ? 241 HIS A CG  1 
ATOM   1911  N ND1 . HIS A 1 242 ? 29.590  36.624  83.334  1.00 16.26 ? 241 HIS A ND1 1 
ATOM   1912  C CD2 . HIS A 1 242 ? 28.796  38.642  83.593  1.00 19.40 ? 241 HIS A CD2 1 
ATOM   1913  C CE1 . HIS A 1 242 ? 30.621  37.451  83.349  1.00 18.54 ? 241 HIS A CE1 1 
ATOM   1914  N NE2 . HIS A 1 242 ? 30.166  38.682  83.504  1.00 20.41 ? 241 HIS A NE2 1 
ATOM   1915  N N   . PHE A 1 243 ? 24.109  36.173  81.627  1.00 20.94 ? 242 PHE A N   1 
ATOM   1916  C CA  . PHE A 1 243 ? 22.901  35.359  81.564  1.00 21.07 ? 242 PHE A CA  1 
ATOM   1917  C C   . PHE A 1 243 ? 22.099  35.571  80.282  1.00 21.00 ? 242 PHE A C   1 
ATOM   1918  O O   . PHE A 1 243 ? 21.858  36.707  79.871  1.00 21.62 ? 242 PHE A O   1 
ATOM   1919  C CB  . PHE A 1 243 ? 21.975  35.660  82.755  1.00 20.74 ? 242 PHE A CB  1 
ATOM   1920  C CG  . PHE A 1 243 ? 22.523  35.232  84.086  1.00 22.23 ? 242 PHE A CG  1 
ATOM   1921  C CD1 . PHE A 1 243 ? 23.543  35.959  84.704  1.00 19.65 ? 242 PHE A CD1 1 
ATOM   1922  C CD2 . PHE A 1 243 ? 22.008  34.105  84.732  1.00 21.15 ? 242 PHE A CD2 1 
ATOM   1923  C CE1 . PHE A 1 243 ? 24.040  35.575  85.946  1.00 19.29 ? 242 PHE A CE1 1 
ATOM   1924  C CE2 . PHE A 1 243 ? 22.498  33.708  85.979  1.00 21.45 ? 242 PHE A CE2 1 
ATOM   1925  C CZ  . PHE A 1 243 ? 23.518  34.445  86.590  1.00 21.17 ? 242 PHE A CZ  1 
ATOM   1926  N N   . VAL A 1 244 ? 21.697  34.471  79.650  1.00 20.84 ? 243 VAL A N   1 
ATOM   1927  C CA  . VAL A 1 244 ? 20.862  34.524  78.458  1.00 20.42 ? 243 VAL A CA  1 
ATOM   1928  C C   . VAL A 1 244 ? 19.715  33.551  78.711  1.00 21.17 ? 243 VAL A C   1 
ATOM   1929  O O   . VAL A 1 244 ? 19.814  32.678  79.579  1.00 18.90 ? 243 VAL A O   1 
ATOM   1930  C CB  . VAL A 1 244 ? 21.623  34.121  77.165  1.00 21.60 ? 243 VAL A CB  1 
ATOM   1931  C CG1 . VAL A 1 244 ? 22.745  35.122  76.904  1.00 21.87 ? 243 VAL A CG1 1 
ATOM   1932  C CG2 . VAL A 1 244 ? 22.173  32.715  77.277  1.00 19.80 ? 243 VAL A CG2 1 
ATOM   1933  N N   . ALA A 1 245 ? 18.631  33.697  77.958  1.00 20.93 ? 244 ALA A N   1 
ATOM   1934  C CA  . ALA A 1 245 ? 17.470  32.844  78.145  1.00 20.47 ? 244 ALA A CA  1 
ATOM   1935  C C   . ALA A 1 245 ? 16.994  32.156  76.881  1.00 20.85 ? 244 ALA A C   1 
ATOM   1936  O O   . ALA A 1 245 ? 17.081  32.704  75.784  1.00 19.93 ? 244 ALA A O   1 
ATOM   1937  C CB  . ALA A 1 245 ? 16.337  33.660  78.731  1.00 18.88 ? 244 ALA A CB  1 
ATOM   1938  N N   . LEU A 1 246 ? 16.499  30.935  77.049  1.00 21.05 ? 245 LEU A N   1 
ATOM   1939  C CA  . LEU A 1 246 ? 15.957  30.179  75.937  1.00 22.40 ? 245 LEU A CA  1 
ATOM   1940  C C   . LEU A 1 246 ? 14.459  30.069  76.246  1.00 23.76 ? 245 LEU A C   1 
ATOM   1941  O O   . LEU A 1 246 ? 14.015  29.121  76.894  1.00 25.17 ? 245 LEU A O   1 
ATOM   1942  C CB  . LEU A 1 246 ? 16.594  28.788  75.862  1.00 20.66 ? 245 LEU A CB  1 
ATOM   1943  C CG  . LEU A 1 246 ? 18.128  28.701  75.905  1.00 20.71 ? 245 LEU A CG  1 
ATOM   1944  C CD1 . LEU A 1 246 ? 18.556  27.256  75.736  1.00 19.76 ? 245 LEU A CD1 1 
ATOM   1945  C CD2 . LEU A 1 246 ? 18.745  29.547  74.807  1.00 18.37 ? 245 LEU A CD2 1 
ATOM   1946  N N   . SER A 1 247 ? 13.693  31.067  75.816  1.00 24.58 ? 246 SER A N   1 
ATOM   1947  C CA  . SER A 1 247 ? 12.254  31.074  76.049  1.00 26.23 ? 246 SER A CA  1 
ATOM   1948  C C   . SER A 1 247 ? 11.528  32.102  75.200  1.00 26.50 ? 246 SER A C   1 
ATOM   1949  O O   . SER A 1 247 ? 12.097  32.685  74.273  1.00 25.99 ? 246 SER A O   1 
ATOM   1950  C CB  . SER A 1 247 ? 11.941  31.346  77.523  1.00 27.05 ? 246 SER A CB  1 
ATOM   1951  O OG  . SER A 1 247 ? 12.228  32.676  77.886  1.00 28.12 ? 246 SER A OG  1 
ATOM   1952  N N   . THR A 1 248 ? 10.259  32.321  75.533  1.00 26.90 ? 247 THR A N   1 
ATOM   1953  C CA  . THR A 1 248 ? 9.430   33.275  74.816  1.00 24.71 ? 247 THR A CA  1 
ATOM   1954  C C   . THR A 1 248 ? 8.838   34.333  75.740  1.00 26.23 ? 247 THR A C   1 
ATOM   1955  O O   . THR A 1 248 ? 8.181   35.265  75.269  1.00 28.02 ? 247 THR A O   1 
ATOM   1956  C CB  . THR A 1 248 ? 8.276   32.564  74.104  1.00 25.14 ? 247 THR A CB  1 
ATOM   1957  O OG1 . THR A 1 248 ? 7.498   31.839  75.068  1.00 23.81 ? 247 THR A OG1 1 
ATOM   1958  C CG2 . THR A 1 248 ? 8.816   31.604  73.053  1.00 23.62 ? 247 THR A CG2 1 
ATOM   1959  N N   . ASN A 1 249 ? 9.064   34.201  77.045  1.00 23.02 ? 248 ASN A N   1 
ATOM   1960  C CA  . ASN A 1 249 ? 8.516   35.168  77.991  1.00 24.59 ? 248 ASN A CA  1 
ATOM   1961  C C   . ASN A 1 249 ? 9.420   36.388  78.152  1.00 24.48 ? 248 ASN A C   1 
ATOM   1962  O O   . ASN A 1 249 ? 10.174  36.500  79.120  1.00 23.88 ? 248 ASN A O   1 
ATOM   1963  C CB  . ASN A 1 249 ? 8.290   34.523  79.356  1.00 24.26 ? 248 ASN A CB  1 
ATOM   1964  C CG  . ASN A 1 249 ? 7.346   35.330  80.225  1.00 27.24 ? 248 ASN A CG  1 
ATOM   1965  O OD1 . ASN A 1 249 ? 7.311   36.559  80.146  1.00 28.16 ? 248 ASN A OD1 1 
ATOM   1966  N ND2 . ASN A 1 249 ? 6.584   34.644  81.067  1.00 25.70 ? 248 ASN A ND2 1 
ATOM   1967  N N   . THR A 1 250 ? 9.320   37.305  77.198  1.00 23.80 ? 249 THR A N   1 
ATOM   1968  C CA  . THR A 1 250 ? 10.116  38.526  77.189  1.00 25.53 ? 249 THR A CA  1 
ATOM   1969  C C   . THR A 1 250 ? 10.051  39.330  78.484  1.00 25.74 ? 249 THR A C   1 
ATOM   1970  O O   . THR A 1 250 ? 11.065  39.850  78.949  1.00 27.15 ? 249 THR A O   1 
ATOM   1971  C CB  . THR A 1 250 ? 9.674   39.449  76.047  1.00 25.91 ? 249 THR A CB  1 
ATOM   1972  O OG1 . THR A 1 250 ? 9.644   38.705  74.825  1.00 26.03 ? 249 THR A OG1 1 
ATOM   1973  C CG2 . THR A 1 250 ? 10.637  40.630  75.907  1.00 28.86 ? 249 THR A CG2 1 
ATOM   1974  N N   . THR A 1 251 ? 8.860   39.438  79.058  1.00 26.39 ? 250 THR A N   1 
ATOM   1975  C CA  . THR A 1 251 ? 8.669   40.204  80.282  1.00 28.61 ? 250 THR A CA  1 
ATOM   1976  C C   . THR A 1 251 ? 9.438   39.632  81.468  1.00 28.69 ? 250 THR A C   1 
ATOM   1977  O O   . THR A 1 251 ? 10.175  40.353  82.142  1.00 29.19 ? 250 THR A O   1 
ATOM   1978  C CB  . THR A 1 251 ? 7.168   40.301  80.636  1.00 30.14 ? 250 THR A CB  1 
ATOM   1979  O OG1 . THR A 1 251 ? 6.471   40.931  79.552  1.00 31.64 ? 250 THR A OG1 1 
ATOM   1980  C CG2 . THR A 1 251 ? 6.962   41.124  81.901  1.00 29.29 ? 250 THR A CG2 1 
ATOM   1981  N N   . LYS A 1 252 ? 9.266   38.342  81.729  1.00 28.03 ? 251 LYS A N   1 
ATOM   1982  C CA  . LYS A 1 252 ? 9.968   37.709  82.833  1.00 28.61 ? 251 LYS A CA  1 
ATOM   1983  C C   . LYS A 1 252 ? 11.474  37.685  82.570  1.00 27.96 ? 251 LYS A C   1 
ATOM   1984  O O   . LYS A 1 252 ? 12.270  37.838  83.493  1.00 27.34 ? 251 LYS A O   1 
ATOM   1985  C CB  . LYS A 1 252 ? 9.450   36.283  83.046  1.00 31.31 ? 251 LYS A CB  1 
ATOM   1986  C CG  . LYS A 1 252 ? 8.044   36.215  83.621  1.00 34.84 ? 251 LYS A CG  1 
ATOM   1987  C CD  . LYS A 1 252 ? 8.001   36.824  85.017  1.00 38.14 ? 251 LYS A CD  1 
ATOM   1988  C CE  . LYS A 1 252 ? 6.607   36.749  85.620  1.00 40.28 ? 251 LYS A CE  1 
ATOM   1989  N NZ  . LYS A 1 252 ? 6.589   37.316  86.997  1.00 43.02 ? 251 LYS A NZ  1 
ATOM   1990  N N   . VAL A 1 253 ? 11.866  37.498  81.313  1.00 27.33 ? 252 VAL A N   1 
ATOM   1991  C CA  . VAL A 1 253 ? 13.284  37.469  80.979  1.00 28.24 ? 252 VAL A CA  1 
ATOM   1992  C C   . VAL A 1 253 ? 13.908  38.830  81.286  1.00 28.81 ? 252 VAL A C   1 
ATOM   1993  O O   . VAL A 1 253 ? 15.009  38.907  81.840  1.00 28.79 ? 252 VAL A O   1 
ATOM   1994  C CB  . VAL A 1 253 ? 13.502  37.095  79.498  1.00 27.96 ? 252 VAL A CB  1 
ATOM   1995  C CG1 . VAL A 1 253 ? 14.940  37.358  79.099  1.00 30.21 ? 252 VAL A CG1 1 
ATOM   1996  C CG2 . VAL A 1 253 ? 13.175  35.617  79.287  1.00 27.32 ? 252 VAL A CG2 1 
ATOM   1997  N N   . LYS A 1 254 ? 13.197  39.898  80.938  1.00 29.13 ? 253 LYS A N   1 
ATOM   1998  C CA  . LYS A 1 254 ? 13.668  41.255  81.206  1.00 30.32 ? 253 LYS A CA  1 
ATOM   1999  C C   . LYS A 1 254 ? 13.780  41.460  82.711  1.00 29.66 ? 253 LYS A C   1 
ATOM   2000  O O   . LYS A 1 254 ? 14.778  41.986  83.206  1.00 29.51 ? 253 LYS A O   1 
ATOM   2001  C CB  . LYS A 1 254 ? 12.690  42.291  80.649  1.00 33.18 ? 253 LYS A CB  1 
ATOM   2002  C CG  . LYS A 1 254 ? 12.760  42.530  79.154  1.00 38.61 ? 253 LYS A CG  1 
ATOM   2003  C CD  . LYS A 1 254 ? 11.603  43.433  78.723  1.00 44.12 ? 253 LYS A CD  1 
ATOM   2004  C CE  . LYS A 1 254 ? 11.774  43.959  77.309  1.00 46.17 ? 253 LYS A CE  1 
ATOM   2005  N NZ  . LYS A 1 254 ? 12.934  44.891  77.221  1.00 50.67 ? 253 LYS A NZ  1 
ATOM   2006  N N   . GLU A 1 255 ? 12.741  41.045  83.433  1.00 28.58 ? 254 GLU A N   1 
ATOM   2007  C CA  . GLU A 1 255 ? 12.702  41.181  84.886  1.00 29.01 ? 254 GLU A CA  1 
ATOM   2008  C C   . GLU A 1 255 ? 13.883  40.517  85.581  1.00 27.82 ? 254 GLU A C   1 
ATOM   2009  O O   . GLU A 1 255 ? 14.392  41.028  86.579  1.00 28.87 ? 254 GLU A O   1 
ATOM   2010  C CB  . GLU A 1 255 ? 11.397  40.597  85.436  1.00 29.81 ? 254 GLU A CB  1 
ATOM   2011  C CG  . GLU A 1 255 ? 10.194  41.513  85.273  1.00 35.50 ? 254 GLU A CG  1 
ATOM   2012  C CD  . GLU A 1 255 ? 8.902   40.887  85.777  1.00 37.61 ? 254 GLU A CD  1 
ATOM   2013  O OE1 . GLU A 1 255 ? 8.908   40.310  86.889  1.00 39.67 ? 254 GLU A OE1 1 
ATOM   2014  O OE2 . GLU A 1 255 ? 7.879   40.983  85.066  1.00 38.40 ? 254 GLU A OE2 1 
ATOM   2015  N N   . PHE A 1 256 ? 14.305  39.372  85.054  1.00 26.50 ? 255 PHE A N   1 
ATOM   2016  C CA  . PHE A 1 256 ? 15.425  38.627  85.617  1.00 24.03 ? 255 PHE A CA  1 
ATOM   2017  C C   . PHE A 1 256 ? 16.713  39.434  85.473  1.00 23.06 ? 255 PHE A C   1 
ATOM   2018  O O   . PHE A 1 256 ? 17.652  39.265  86.250  1.00 21.96 ? 255 PHE A O   1 
ATOM   2019  C CB  . PHE A 1 256 ? 15.583  37.289  84.885  1.00 24.16 ? 255 PHE A CB  1 
ATOM   2020  C CG  . PHE A 1 256 ? 16.482  36.309  85.587  1.00 23.43 ? 255 PHE A CG  1 
ATOM   2021  C CD1 . PHE A 1 256 ? 15.992  35.519  86.625  1.00 22.55 ? 255 PHE A CD1 1 
ATOM   2022  C CD2 . PHE A 1 256 ? 17.815  36.166  85.204  1.00 24.85 ? 255 PHE A CD2 1 
ATOM   2023  C CE1 . PHE A 1 256 ? 16.812  34.596  87.271  1.00 23.45 ? 255 PHE A CE1 1 
ATOM   2024  C CE2 . PHE A 1 256 ? 18.649  35.245  85.843  1.00 25.20 ? 255 PHE A CE2 1 
ATOM   2025  C CZ  . PHE A 1 256 ? 18.145  34.456  86.880  1.00 23.43 ? 255 PHE A CZ  1 
ATOM   2026  N N   . GLY A 1 257 ? 16.755  40.302  84.466  1.00 23.92 ? 256 GLY A N   1 
ATOM   2027  C CA  . GLY A 1 257 ? 17.936  41.123  84.242  1.00 24.11 ? 256 GLY A CA  1 
ATOM   2028  C C   . GLY A 1 257 ? 18.671  40.734  82.976  1.00 24.58 ? 256 GLY A C   1 
ATOM   2029  O O   . GLY A 1 257 ? 19.826  41.112  82.765  1.00 24.39 ? 256 GLY A O   1 
ATOM   2030  N N   . ILE A 1 258 ? 17.999  39.970  82.126  1.00 25.35 ? 257 ILE A N   1 
ATOM   2031  C CA  . ILE A 1 258 ? 18.596  39.520  80.879  1.00 26.19 ? 257 ILE A CA  1 
ATOM   2032  C C   . ILE A 1 258 ? 18.246  40.457  79.731  1.00 28.64 ? 257 ILE A C   1 
ATOM   2033  O O   . ILE A 1 258 ? 17.121  40.955  79.644  1.00 29.20 ? 257 ILE A O   1 
ATOM   2034  C CB  . ILE A 1 258 ? 18.115  38.097  80.521  1.00 26.85 ? 257 ILE A CB  1 
ATOM   2035  C CG1 . ILE A 1 258 ? 18.636  37.097  81.555  1.00 26.80 ? 257 ILE A CG1 1 
ATOM   2036  C CG2 . ILE A 1 258 ? 18.582  37.724  79.120  1.00 25.47 ? 257 ILE A CG2 1 
ATOM   2037  C CD1 . ILE A 1 258 ? 18.017  35.716  81.451  1.00 25.93 ? 257 ILE A CD1 1 
ATOM   2038  N N   . ASP A 1 259 ? 19.216  40.694  78.854  1.00 29.29 ? 258 ASP A N   1 
ATOM   2039  C CA  . ASP A 1 259 ? 19.006  41.549  77.694  1.00 29.94 ? 258 ASP A CA  1 
ATOM   2040  C C   . ASP A 1 259 ? 18.083  40.800  76.733  1.00 31.75 ? 258 ASP A C   1 
ATOM   2041  O O   . ASP A 1 259 ? 18.403  39.695  76.290  1.00 32.37 ? 258 ASP A O   1 
ATOM   2042  C CB  . ASP A 1 259 ? 20.340  41.831  77.006  1.00 30.21 ? 258 ASP A CB  1 
ATOM   2043  C CG  . ASP A 1 259 ? 20.212  42.801  75.849  1.00 31.19 ? 258 ASP A CG  1 
ATOM   2044  O OD1 . ASP A 1 259 ? 19.131  42.862  75.218  1.00 30.53 ? 258 ASP A OD1 1 
ATOM   2045  O OD2 . ASP A 1 259 ? 21.210  43.493  75.558  1.00 32.48 ? 258 ASP A OD2 1 
ATOM   2046  N N   . PRO A 1 260 ? 16.926  41.397  76.398  1.00 32.55 ? 259 PRO A N   1 
ATOM   2047  C CA  . PRO A 1 260 ? 15.922  40.829  75.495  1.00 32.49 ? 259 PRO A CA  1 
ATOM   2048  C C   . PRO A 1 260 ? 16.460  40.305  74.165  1.00 32.45 ? 259 PRO A C   1 
ATOM   2049  O O   . PRO A 1 260 ? 15.925  39.343  73.613  1.00 32.69 ? 259 PRO A O   1 
ATOM   2050  C CB  . PRO A 1 260 ? 14.949  41.987  75.294  1.00 33.00 ? 259 PRO A CB  1 
ATOM   2051  C CG  . PRO A 1 260 ? 15.000  42.684  76.604  1.00 34.44 ? 259 PRO A CG  1 
ATOM   2052  C CD  . PRO A 1 260 ? 16.485  42.714  76.893  1.00 33.53 ? 259 PRO A CD  1 
ATOM   2053  N N   . GLN A 1 261 ? 17.505  40.930  73.634  1.00 31.15 ? 260 GLN A N   1 
ATOM   2054  C CA  . GLN A 1 261 ? 18.035  40.464  72.363  1.00 31.07 ? 260 GLN A CA  1 
ATOM   2055  C C   . GLN A 1 261 ? 18.746  39.132  72.546  1.00 29.12 ? 260 GLN A C   1 
ATOM   2056  O O   . GLN A 1 261 ? 19.127  38.478  71.575  1.00 28.15 ? 260 GLN A O   1 
ATOM   2057  C CB  . GLN A 1 261 ? 18.971  41.505  71.744  1.00 34.51 ? 260 GLN A CB  1 
ATOM   2058  C CG  . GLN A 1 261 ? 20.158  41.897  72.593  1.00 41.72 ? 260 GLN A CG  1 
ATOM   2059  C CD  . GLN A 1 261 ? 21.048  42.914  71.897  1.00 45.22 ? 260 GLN A CD  1 
ATOM   2060  O OE1 . GLN A 1 261 ? 21.621  42.633  70.840  1.00 46.93 ? 260 GLN A OE1 1 
ATOM   2061  N NE2 . GLN A 1 261 ? 21.165  44.106  72.484  1.00 44.60 ? 260 GLN A NE2 1 
ATOM   2062  N N   . ASN A 1 262 ? 18.912  38.732  73.803  1.00 27.11 ? 261 ASN A N   1 
ATOM   2063  C CA  . ASN A 1 262 ? 19.548  37.466  74.112  1.00 26.06 ? 261 ASN A CA  1 
ATOM   2064  C C   . ASN A 1 262 ? 18.536  36.461  74.648  1.00 25.32 ? 261 ASN A C   1 
ATOM   2065  O O   . ASN A 1 262 ? 18.813  35.709  75.585  1.00 24.07 ? 261 ASN A O   1 
ATOM   2066  C CB  . ASN A 1 262 ? 20.688  37.665  75.105  1.00 26.06 ? 261 ASN A CB  1 
ATOM   2067  C CG  . ASN A 1 262 ? 21.710  38.658  74.604  1.00 26.62 ? 261 ASN A CG  1 
ATOM   2068  O OD1 . ASN A 1 262 ? 22.142  38.588  73.451  1.00 25.84 ? 261 ASN A OD1 1 
ATOM   2069  N ND2 . ASN A 1 262 ? 22.102  39.589  75.463  1.00 24.71 ? 261 ASN A ND2 1 
ATOM   2070  N N   . MET A 1 263 ? 17.342  36.488  74.065  1.00 24.69 ? 262 MET A N   1 
ATOM   2071  C CA  . MET A 1 263 ? 16.300  35.531  74.413  1.00 23.65 ? 262 MET A CA  1 
ATOM   2072  C C   . MET A 1 263 ? 16.081  34.742  73.127  1.00 23.05 ? 262 MET A C   1 
ATOM   2073  O O   . MET A 1 263 ? 15.649  35.297  72.117  1.00 22.91 ? 262 MET A O   1 
ATOM   2074  C CB  . MET A 1 263 ? 14.990  36.212  74.812  1.00 23.84 ? 262 MET A CB  1 
ATOM   2075  C CG  . MET A 1 263 ? 13.962  35.202  75.321  1.00 23.56 ? 262 MET A CG  1 
ATOM   2076  S SD  . MET A 1 263 ? 12.286  35.822  75.548  1.00 25.41 ? 262 MET A SD  1 
ATOM   2077  C CE  . MET A 1 263 ? 11.667  35.686  73.906  1.00 25.38 ? 262 MET A CE  1 
ATOM   2078  N N   . PHE A 1 264 ? 16.409  33.456  73.162  1.00 22.61 ? 263 PHE A N   1 
ATOM   2079  C CA  . PHE A 1 264 ? 16.257  32.594  71.998  1.00 23.09 ? 263 PHE A CA  1 
ATOM   2080  C C   . PHE A 1 264 ? 14.979  31.795  72.121  1.00 24.13 ? 263 PHE A C   1 
ATOM   2081  O O   . PHE A 1 264 ? 14.892  30.858  72.912  1.00 25.34 ? 263 PHE A O   1 
ATOM   2082  C CB  . PHE A 1 264 ? 17.461  31.670  71.894  1.00 20.16 ? 263 PHE A CB  1 
ATOM   2083  C CG  . PHE A 1 264 ? 18.762  32.405  71.846  1.00 20.78 ? 263 PHE A CG  1 
ATOM   2084  C CD1 . PHE A 1 264 ? 19.291  32.979  72.999  1.00 20.94 ? 263 PHE A CD1 1 
ATOM   2085  C CD2 . PHE A 1 264 ? 19.438  32.571  70.638  1.00 18.97 ? 263 PHE A CD2 1 
ATOM   2086  C CE1 . PHE A 1 264 ? 20.479  33.711  72.953  1.00 20.97 ? 263 PHE A CE1 1 
ATOM   2087  C CE2 . PHE A 1 264 ? 20.624  33.300  70.579  1.00 19.83 ? 263 PHE A CE2 1 
ATOM   2088  C CZ  . PHE A 1 264 ? 21.146  33.871  71.738  1.00 19.58 ? 263 PHE A CZ  1 
ATOM   2089  N N   . GLU A 1 265 ? 13.980  32.157  71.328  1.00 25.86 ? 264 GLU A N   1 
ATOM   2090  C CA  . GLU A 1 265 ? 12.705  31.472  71.418  1.00 27.20 ? 264 GLU A CA  1 
ATOM   2091  C C   . GLU A 1 265 ? 12.514  30.242  70.541  1.00 24.92 ? 264 GLU A C   1 
ATOM   2092  O O   . GLU A 1 265 ? 13.285  29.980  69.623  1.00 22.97 ? 264 GLU A O   1 
ATOM   2093  C CB  . GLU A 1 265 ? 11.564  32.471  71.183  1.00 30.92 ? 264 GLU A CB  1 
ATOM   2094  C CG  . GLU A 1 265 ? 11.774  33.429  70.034  1.00 36.77 ? 264 GLU A CG  1 
ATOM   2095  C CD  . GLU A 1 265 ? 10.700  34.510  69.968  1.00 39.97 ? 264 GLU A CD  1 
ATOM   2096  O OE1 . GLU A 1 265 ? 10.766  35.363  69.058  1.00 39.73 ? 264 GLU A OE1 1 
ATOM   2097  O OE2 . GLU A 1 265 ? 9.788   34.507  70.824  1.00 43.59 ? 264 GLU A OE2 1 
ATOM   2098  N N   . PHE A 1 266 ? 11.495  29.466  70.902  1.00 24.64 ? 265 PHE A N   1 
ATOM   2099  C CA  . PHE A 1 266 ? 11.086  28.273  70.183  1.00 23.94 ? 265 PHE A CA  1 
ATOM   2100  C C   . PHE A 1 266 ? 9.558   28.282  70.242  1.00 25.10 ? 265 PHE A C   1 
ATOM   2101  O O   . PHE A 1 266 ? 8.973   29.251  70.728  1.00 25.09 ? 265 PHE A O   1 
ATOM   2102  C CB  . PHE A 1 266 ? 11.708  26.986  70.773  1.00 21.34 ? 265 PHE A CB  1 
ATOM   2103  C CG  . PHE A 1 266 ? 11.628  26.872  72.271  1.00 23.19 ? 265 PHE A CG  1 
ATOM   2104  C CD1 . PHE A 1 266 ? 10.701  26.021  72.868  1.00 23.64 ? 265 PHE A CD1 1 
ATOM   2105  C CD2 . PHE A 1 266 ? 12.520  27.570  73.087  1.00 25.04 ? 265 PHE A CD2 1 
ATOM   2106  C CE1 . PHE A 1 266 ? 10.667  25.859  74.257  1.00 25.58 ? 265 PHE A CE1 1 
ATOM   2107  C CE2 . PHE A 1 266 ? 12.498  27.418  74.480  1.00 25.29 ? 265 PHE A CE2 1 
ATOM   2108  C CZ  . PHE A 1 266 ? 11.573  26.561  75.065  1.00 25.85 ? 265 PHE A CZ  1 
ATOM   2109  N N   . TRP A 1 267 ? 8.902   27.228  69.770  1.00 24.86 ? 266 TRP A N   1 
ATOM   2110  C CA  . TRP A 1 267 ? 7.445   27.249  69.717  1.00 24.65 ? 266 TRP A CA  1 
ATOM   2111  C C   . TRP A 1 267 ? 6.729   26.098  70.401  1.00 25.46 ? 266 TRP A C   1 
ATOM   2112  O O   . TRP A 1 267 ? 7.344   25.102  70.778  1.00 23.83 ? 266 TRP A O   1 
ATOM   2113  C CB  . TRP A 1 267 ? 7.042   27.372  68.243  1.00 23.82 ? 266 TRP A CB  1 
ATOM   2114  C CG  . TRP A 1 267 ? 7.804   28.501  67.607  1.00 24.01 ? 266 TRP A CG  1 
ATOM   2115  C CD1 . TRP A 1 267 ? 7.433   29.818  67.565  1.00 24.71 ? 266 TRP A CD1 1 
ATOM   2116  C CD2 . TRP A 1 267 ? 9.152   28.451  67.102  1.00 23.40 ? 266 TRP A CD2 1 
ATOM   2117  N NE1 . TRP A 1 267 ? 8.466   30.590  67.079  1.00 25.46 ? 266 TRP A NE1 1 
ATOM   2118  C CE2 . TRP A 1 267 ? 9.532   29.778  66.789  1.00 24.02 ? 266 TRP A CE2 1 
ATOM   2119  C CE3 . TRP A 1 267 ? 10.075  27.415  66.893  1.00 21.11 ? 266 TRP A CE3 1 
ATOM   2120  C CZ2 . TRP A 1 267 ? 10.801  30.098  66.275  1.00 22.60 ? 266 TRP A CZ2 1 
ATOM   2121  C CZ3 . TRP A 1 267 ? 11.339  27.732  66.380  1.00 20.06 ? 266 TRP A CZ3 1 
ATOM   2122  C CH2 . TRP A 1 267 ? 11.687  29.065  66.078  1.00 22.34 ? 266 TRP A CH2 1 
ATOM   2123  N N   . ASP A 1 268 ? 5.418   26.245  70.566  1.00 26.06 ? 267 ASP A N   1 
ATOM   2124  C CA  . ASP A 1 268 ? 4.636   25.223  71.244  1.00 26.57 ? 267 ASP A CA  1 
ATOM   2125  C C   . ASP A 1 268 ? 4.591   23.896  70.491  1.00 25.16 ? 267 ASP A C   1 
ATOM   2126  O O   . ASP A 1 268 ? 4.300   22.861  71.087  1.00 22.42 ? 267 ASP A O   1 
ATOM   2127  C CB  . ASP A 1 268 ? 3.223   25.745  71.531  1.00 30.95 ? 267 ASP A CB  1 
ATOM   2128  C CG  . ASP A 1 268 ? 2.370   25.862  70.283  1.00 34.07 ? 267 ASP A CG  1 
ATOM   2129  O OD1 . ASP A 1 268 ? 2.926   26.107  69.190  1.00 36.87 ? 267 ASP A OD1 1 
ATOM   2130  O OD2 . ASP A 1 268 ? 1.134   25.726  70.404  1.00 37.07 ? 267 ASP A OD2 1 
ATOM   2131  N N   . TRP A 1 269 ? 4.882   23.915  69.191  1.00 22.56 ? 268 TRP A N   1 
ATOM   2132  C CA  . TRP A 1 269 ? 4.890   22.674  68.433  1.00 22.73 ? 268 TRP A CA  1 
ATOM   2133  C C   . TRP A 1 269 ? 6.224   21.945  68.610  1.00 22.70 ? 268 TRP A C   1 
ATOM   2134  O O   . TRP A 1 269 ? 6.473   20.915  67.977  1.00 21.95 ? 268 TRP A O   1 
ATOM   2135  C CB  . TRP A 1 269 ? 4.598   22.907  66.937  1.00 23.90 ? 268 TRP A CB  1 
ATOM   2136  C CG  . TRP A 1 269 ? 5.096   24.195  66.346  1.00 24.86 ? 268 TRP A CG  1 
ATOM   2137  C CD1 . TRP A 1 269 ? 4.372   25.339  66.150  1.00 26.10 ? 268 TRP A CD1 1 
ATOM   2138  C CD2 . TRP A 1 269 ? 6.404   24.455  65.820  1.00 24.60 ? 268 TRP A CD2 1 
ATOM   2139  N NE1 . TRP A 1 269 ? 5.145   26.291  65.527  1.00 26.46 ? 268 TRP A NE1 1 
ATOM   2140  C CE2 . TRP A 1 269 ? 6.396   25.777  65.314  1.00 26.15 ? 268 TRP A CE2 1 
ATOM   2141  C CE3 . TRP A 1 269 ? 7.581   23.701  65.726  1.00 25.25 ? 268 TRP A CE3 1 
ATOM   2142  C CZ2 . TRP A 1 269 ? 7.520   26.359  64.722  1.00 25.26 ? 268 TRP A CZ2 1 
ATOM   2143  C CZ3 . TRP A 1 269 ? 8.703   24.280  65.134  1.00 24.12 ? 268 TRP A CZ3 1 
ATOM   2144  C CH2 . TRP A 1 269 ? 8.662   25.597  64.640  1.00 26.79 ? 268 TRP A CH2 1 
ATOM   2145  N N   . VAL A 1 270 ? 7.083   22.495  69.467  1.00 20.73 ? 269 VAL A N   1 
ATOM   2146  C CA  . VAL A 1 270 ? 8.369   21.878  69.768  1.00 19.11 ? 269 VAL A CA  1 
ATOM   2147  C C   . VAL A 1 270 ? 8.226   21.232  71.146  1.00 20.21 ? 269 VAL A C   1 
ATOM   2148  O O   . VAL A 1 270 ? 8.150   21.934  72.155  1.00 19.34 ? 269 VAL A O   1 
ATOM   2149  C CB  . VAL A 1 270 ? 9.520   22.911  69.842  1.00 19.92 ? 269 VAL A CB  1 
ATOM   2150  C CG1 . VAL A 1 270 ? 10.809  22.214  70.278  1.00 18.85 ? 269 VAL A CG1 1 
ATOM   2151  C CG2 . VAL A 1 270 ? 9.733   23.579  68.481  1.00 19.92 ? 269 VAL A CG2 1 
ATOM   2152  N N   . GLY A 1 271 ? 8.173   19.903  71.190  1.00 18.61 ? 270 GLY A N   1 
ATOM   2153  C CA  . GLY A 1 271 ? 8.046   19.217  72.465  1.00 17.47 ? 270 GLY A CA  1 
ATOM   2154  C C   . GLY A 1 271 ? 9.359   19.251  73.215  1.00 17.31 ? 270 GLY A C   1 
ATOM   2155  O O   . GLY A 1 271 ? 10.424  19.254  72.600  1.00 18.10 ? 270 GLY A O   1 
ATOM   2156  N N   . GLY A 1 272 ? 9.298   19.278  74.542  1.00 19.11 ? 271 GLY A N   1 
ATOM   2157  C CA  . GLY A 1 272 ? 10.523  19.326  75.322  1.00 20.22 ? 271 GLY A CA  1 
ATOM   2158  C C   . GLY A 1 272 ? 11.490  18.206  74.977  1.00 21.29 ? 271 GLY A C   1 
ATOM   2159  O O   . GLY A 1 272 ? 12.685  18.440  74.777  1.00 22.43 ? 271 GLY A O   1 
ATOM   2160  N N   . ARG A 1 273 ? 10.968  16.988  74.895  1.00 21.11 ? 272 ARG A N   1 
ATOM   2161  C CA  . ARG A 1 273 ? 11.780  15.822  74.592  1.00 21.76 ? 272 ARG A CA  1 
ATOM   2162  C C   . ARG A 1 273 ? 12.170  15.724  73.115  1.00 21.47 ? 272 ARG A C   1 
ATOM   2163  O O   . ARG A 1 273 ? 12.741  14.719  72.691  1.00 21.41 ? 272 ARG A O   1 
ATOM   2164  C CB  . ARG A 1 273 ? 11.047  14.557  75.046  1.00 23.26 ? 272 ARG A CB  1 
ATOM   2165  C CG  . ARG A 1 273 ? 9.580   14.500  74.629  1.00 26.42 ? 272 ARG A CG  1 
ATOM   2166  C CD  . ARG A 1 273 ? 8.881   13.273  75.203  1.00 24.55 ? 272 ARG A CD  1 
ATOM   2167  N NE  . ARG A 1 273 ? 7.477   13.201  74.801  1.00 22.66 ? 272 ARG A NE  1 
ATOM   2168  C CZ  . ARG A 1 273 ? 6.494   13.906  75.357  1.00 24.85 ? 272 ARG A CZ  1 
ATOM   2169  N NH1 . ARG A 1 273 ? 6.750   14.747  76.358  1.00 20.88 ? 272 ARG A NH1 1 
ATOM   2170  N NH2 . ARG A 1 273 ? 5.252   13.778  74.902  1.00 21.95 ? 272 ARG A NH2 1 
ATOM   2171  N N   . TYR A 1 274 ? 11.862  16.774  72.349  1.00 19.21 ? 273 TYR A N   1 
ATOM   2172  C CA  . TYR A 1 274 ? 12.189  16.859  70.915  1.00 17.94 ? 273 TYR A CA  1 
ATOM   2173  C C   . TYR A 1 274 ? 12.745  18.258  70.618  1.00 18.24 ? 273 TYR A C   1 
ATOM   2174  O O   . TYR A 1 274 ? 12.713  18.714  69.470  1.00 17.55 ? 273 TYR A O   1 
ATOM   2175  C CB  . TYR A 1 274 ? 10.936  16.672  70.040  1.00 16.88 ? 273 TYR A CB  1 
ATOM   2176  C CG  . TYR A 1 274 ? 10.246  15.336  70.169  1.00 16.87 ? 273 TYR A CG  1 
ATOM   2177  C CD1 . TYR A 1 274 ? 9.152   15.173  71.015  1.00 14.99 ? 273 TYR A CD1 1 
ATOM   2178  C CD2 . TYR A 1 274 ? 10.713  14.222  69.468  1.00 15.04 ? 273 TYR A CD2 1 
ATOM   2179  C CE1 . TYR A 1 274 ? 8.539   13.926  71.162  1.00 17.30 ? 273 TYR A CE1 1 
ATOM   2180  C CE2 . TYR A 1 274 ? 10.113  12.979  69.607  1.00 14.75 ? 273 TYR A CE2 1 
ATOM   2181  C CZ  . TYR A 1 274 ? 9.026   12.835  70.457  1.00 16.99 ? 273 TYR A CZ  1 
ATOM   2182  O OH  . TYR A 1 274 ? 8.430   11.598  70.605  1.00 20.91 ? 273 TYR A OH  1 
ATOM   2183  N N   . SER A 1 275 ? 13.271  18.927  71.644  1.00 17.93 ? 274 SER A N   1 
ATOM   2184  C CA  . SER A 1 275 ? 13.753  20.306  71.495  1.00 18.37 ? 274 SER A CA  1 
ATOM   2185  C C   . SER A 1 275 ? 15.238  20.608  71.285  1.00 18.90 ? 274 SER A C   1 
ATOM   2186  O O   . SER A 1 275 ? 15.589  21.761  71.023  1.00 18.80 ? 274 SER A O   1 
ATOM   2187  C CB  . SER A 1 275 ? 13.284  21.121  72.696  1.00 18.24 ? 274 SER A CB  1 
ATOM   2188  O OG  . SER A 1 275 ? 13.957  20.689  73.866  1.00 15.65 ? 274 SER A OG  1 
ATOM   2189  N N   . LEU A 1 276 ? 16.117  19.619  71.399  1.00 17.39 ? 275 LEU A N   1 
ATOM   2190  C CA  . LEU A 1 276 ? 17.544  19.905  71.226  1.00 18.14 ? 275 LEU A CA  1 
ATOM   2191  C C   . LEU A 1 276 ? 17.862  20.525  69.860  1.00 19.26 ? 275 LEU A C   1 
ATOM   2192  O O   . LEU A 1 276 ? 18.899  21.170  69.690  1.00 17.31 ? 275 LEU A O   1 
ATOM   2193  C CB  . LEU A 1 276 ? 18.380  18.635  71.429  1.00 16.69 ? 275 LEU A CB  1 
ATOM   2194  C CG  . LEU A 1 276 ? 18.323  17.552  70.349  1.00 16.94 ? 275 LEU A CG  1 
ATOM   2195  C CD1 . LEU A 1 276 ? 19.288  17.895  69.208  1.00 15.44 ? 275 LEU A CD1 1 
ATOM   2196  C CD2 . LEU A 1 276 ? 18.708  16.212  70.970  1.00 13.63 ? 275 LEU A CD2 1 
ATOM   2197  N N   . TRP A 1 277 ? 16.959  20.342  68.899  1.00 19.16 ? 276 TRP A N   1 
ATOM   2198  C CA  . TRP A 1 277 ? 17.148  20.865  67.547  1.00 19.03 ? 276 TRP A CA  1 
ATOM   2199  C C   . TRP A 1 277 ? 16.817  22.354  67.431  1.00 20.28 ? 276 TRP A C   1 
ATOM   2200  O O   . TRP A 1 277 ? 17.085  22.976  66.405  1.00 18.28 ? 276 TRP A O   1 
ATOM   2201  C CB  . TRP A 1 277 ? 16.270  20.098  66.555  1.00 17.94 ? 276 TRP A CB  1 
ATOM   2202  C CG  . TRP A 1 277 ? 16.195  18.618  66.812  1.00 18.83 ? 276 TRP A CG  1 
ATOM   2203  C CD1 . TRP A 1 277 ? 15.192  17.943  67.452  1.00 19.59 ? 276 TRP A CD1 1 
ATOM   2204  C CD2 . TRP A 1 277 ? 17.162  17.630  66.430  1.00 19.38 ? 276 TRP A CD2 1 
ATOM   2205  N NE1 . TRP A 1 277 ? 15.473  16.594  67.488  1.00 16.98 ? 276 TRP A NE1 1 
ATOM   2206  C CE2 . TRP A 1 277 ? 16.676  16.376  66.869  1.00 18.26 ? 276 TRP A CE2 1 
ATOM   2207  C CE3 . TRP A 1 277 ? 18.395  17.683  65.756  1.00 19.98 ? 276 TRP A CE3 1 
ATOM   2208  C CZ2 . TRP A 1 277 ? 17.380  15.182  66.656  1.00 17.73 ? 276 TRP A CZ2 1 
ATOM   2209  C CZ3 . TRP A 1 277 ? 19.096  16.493  65.545  1.00 18.91 ? 276 TRP A CZ3 1 
ATOM   2210  C CH2 . TRP A 1 277 ? 18.581  15.260  65.996  1.00 20.41 ? 276 TRP A CH2 1 
ATOM   2211  N N   . SER A 1 278 ? 16.223  22.911  68.482  1.00 19.71 ? 277 SER A N   1 
ATOM   2212  C CA  . SER A 1 278 ? 15.829  24.311  68.495  1.00 20.69 ? 277 SER A CA  1 
ATOM   2213  C C   . SER A 1 278 ? 16.804  25.138  69.324  1.00 20.29 ? 277 SER A C   1 
ATOM   2214  O O   . SER A 1 278 ? 17.942  24.728  69.558  1.00 21.42 ? 277 SER A O   1 
ATOM   2215  C CB  . SER A 1 278 ? 14.428  24.440  69.092  1.00 20.87 ? 277 SER A CB  1 
ATOM   2216  O OG  . SER A 1 278 ? 14.463  24.150  70.481  1.00 20.26 ? 277 SER A OG  1 
ATOM   2217  N N   . ALA A 1 279 ? 16.343  26.305  69.761  1.00 19.69 ? 278 ALA A N   1 
ATOM   2218  C CA  . ALA A 1 279 ? 17.144  27.208  70.583  1.00 19.53 ? 278 ALA A CA  1 
ATOM   2219  C C   . ALA A 1 279 ? 17.683  26.476  71.812  1.00 17.77 ? 278 ALA A C   1 
ATOM   2220  O O   . ALA A 1 279 ? 18.756  26.800  72.322  1.00 16.91 ? 278 ALA A O   1 
ATOM   2221  C CB  . ALA A 1 279 ? 16.297  28.406  71.013  1.00 18.07 ? 278 ALA A CB  1 
ATOM   2222  N N   . ILE A 1 280 ? 16.932  25.484  72.280  1.00 18.78 ? 279 ILE A N   1 
ATOM   2223  C CA  . ILE A 1 280 ? 17.329  24.697  73.451  1.00 18.68 ? 279 ILE A CA  1 
ATOM   2224  C C   . ILE A 1 280 ? 18.727  24.122  73.251  1.00 18.00 ? 279 ILE A C   1 
ATOM   2225  O O   . ILE A 1 280 ? 19.455  23.875  74.215  1.00 19.01 ? 279 ILE A O   1 
ATOM   2226  C CB  . ILE A 1 280 ? 16.326  23.528  73.710  1.00 17.56 ? 279 ILE A CB  1 
ATOM   2227  C CG1 . ILE A 1 280 ? 14.986  24.083  74.206  1.00 19.47 ? 279 ILE A CG1 1 
ATOM   2228  C CG2 . ILE A 1 280 ? 16.902  22.538  74.720  1.00 18.18 ? 279 ILE A CG2 1 
ATOM   2229  C CD1 . ILE A 1 280 ? 15.069  24.908  75.488  1.00 17.76 ? 279 ILE A CD1 1 
ATOM   2230  N N   . GLY A 1 281 ? 19.103  23.922  71.994  1.00 17.33 ? 280 GLY A N   1 
ATOM   2231  C CA  . GLY A 1 281 ? 20.410  23.370  71.699  1.00 17.43 ? 280 GLY A CA  1 
ATOM   2232  C C   . GLY A 1 281 ? 21.533  24.387  71.676  1.00 18.02 ? 280 GLY A C   1 
ATOM   2233  O O   . GLY A 1 281 ? 22.647  24.066  71.260  1.00 17.98 ? 280 GLY A O   1 
ATOM   2234  N N   . LEU A 1 282 ? 21.258  25.606  72.131  1.00 17.68 ? 281 LEU A N   1 
ATOM   2235  C CA  . LEU A 1 282 ? 22.275  26.658  72.133  1.00 18.29 ? 281 LEU A CA  1 
ATOM   2236  C C   . LEU A 1 282 ? 23.609  26.209  72.735  1.00 19.45 ? 281 LEU A C   1 
ATOM   2237  O O   . LEU A 1 282 ? 24.668  26.462  72.165  1.00 19.56 ? 281 LEU A O   1 
ATOM   2238  C CB  . LEU A 1 282 ? 21.765  27.893  72.884  1.00 17.49 ? 281 LEU A CB  1 
ATOM   2239  C CG  . LEU A 1 282 ? 22.694  29.107  72.792  1.00 18.73 ? 281 LEU A CG  1 
ATOM   2240  C CD1 . LEU A 1 282 ? 22.853  29.522  71.323  1.00 16.23 ? 281 LEU A CD1 1 
ATOM   2241  C CD2 . LEU A 1 282 ? 22.129  30.250  73.628  1.00 19.74 ? 281 LEU A CD2 1 
ATOM   2242  N N   . SER A 1 283 ? 23.570  25.550  73.888  1.00 20.94 ? 282 SER A N   1 
ATOM   2243  C CA  . SER A 1 283 ? 24.812  25.088  74.503  1.00 20.90 ? 282 SER A CA  1 
ATOM   2244  C C   . SER A 1 283 ? 25.555  24.134  73.570  1.00 20.31 ? 282 SER A C   1 
ATOM   2245  O O   . SER A 1 283 ? 26.785  24.079  73.579  1.00 20.43 ? 282 SER A O   1 
ATOM   2246  C CB  . SER A 1 283 ? 24.536  24.402  75.846  1.00 21.17 ? 282 SER A CB  1 
ATOM   2247  O OG  . SER A 1 283 ? 23.730  23.255  75.691  1.00 20.61 ? 282 SER A OG  1 
ATOM   2248  N N   . ILE A 1 284 ? 24.817  23.380  72.763  1.00 19.79 ? 283 ILE A N   1 
ATOM   2249  C CA  . ILE A 1 284 ? 25.465  22.465  71.825  1.00 20.14 ? 283 ILE A CA  1 
ATOM   2250  C C   . ILE A 1 284 ? 26.298  23.288  70.850  1.00 19.06 ? 283 ILE A C   1 
ATOM   2251  O O   . ILE A 1 284 ? 27.499  23.052  70.675  1.00 18.01 ? 283 ILE A O   1 
ATOM   2252  C CB  . ILE A 1 284 ? 24.449  21.663  70.993  1.00 20.47 ? 283 ILE A CB  1 
ATOM   2253  C CG1 . ILE A 1 284 ? 23.587  20.786  71.904  1.00 20.45 ? 283 ILE A CG1 1 
ATOM   2254  C CG2 . ILE A 1 284 ? 25.186  20.835  69.953  1.00 18.94 ? 283 ILE A CG2 1 
ATOM   2255  C CD1 . ILE A 1 284 ? 22.496  20.022  71.165  1.00 19.13 ? 283 ILE A CD1 1 
ATOM   2256  N N   . ALA A 1 285 ? 25.643  24.255  70.216  1.00 18.40 ? 284 ALA A N   1 
ATOM   2257  C CA  . ALA A 1 285 ? 26.295  25.127  69.243  1.00 18.46 ? 284 ALA A CA  1 
ATOM   2258  C C   . ALA A 1 285 ? 27.475  25.892  69.832  1.00 18.09 ? 284 ALA A C   1 
ATOM   2259  O O   . ALA A 1 285 ? 28.470  26.119  69.149  1.00 17.95 ? 284 ALA A O   1 
ATOM   2260  C CB  . ALA A 1 285 ? 25.284  26.104  68.662  1.00 20.10 ? 284 ALA A CB  1 
ATOM   2261  N N   . LEU A 1 286 ? 27.368  26.291  71.095  1.00 17.93 ? 285 LEU A N   1 
ATOM   2262  C CA  . LEU A 1 286 ? 28.452  27.023  71.736  1.00 18.72 ? 285 LEU A CA  1 
ATOM   2263  C C   . LEU A 1 286 ? 29.670  26.125  71.947  1.00 20.93 ? 285 LEU A C   1 
ATOM   2264  O O   . LEU A 1 286 ? 30.809  26.530  71.709  1.00 20.42 ? 285 LEU A O   1 
ATOM   2265  C CB  . LEU A 1 286 ? 27.986  27.590  73.083  1.00 16.92 ? 285 LEU A CB  1 
ATOM   2266  C CG  . LEU A 1 286 ? 27.077  28.825  73.037  1.00 17.51 ? 285 LEU A CG  1 
ATOM   2267  C CD1 . LEU A 1 286 ? 26.419  29.047  74.386  1.00 15.49 ? 285 LEU A CD1 1 
ATOM   2268  C CD2 . LEU A 1 286 ? 27.904  30.044  72.633  1.00 20.17 ? 285 LEU A CD2 1 
ATOM   2269  N N   . HIS A 1 287 ? 29.412  24.893  72.370  1.00 20.73 ? 286 HIS A N   1 
ATOM   2270  C CA  . HIS A 1 287 ? 30.466  23.929  72.656  1.00 21.06 ? 286 HIS A CA  1 
ATOM   2271  C C   . HIS A 1 287 ? 31.221  23.410  71.434  1.00 20.62 ? 286 HIS A C   1 
ATOM   2272  O O   . HIS A 1 287 ? 32.456  23.395  71.416  1.00 21.10 ? 286 HIS A O   1 
ATOM   2273  C CB  . HIS A 1 287 ? 29.878  22.732  73.419  1.00 20.51 ? 286 HIS A CB  1 
ATOM   2274  C CG  . HIS A 1 287 ? 30.895  21.948  74.188  1.00 21.76 ? 286 HIS A CG  1 
ATOM   2275  N ND1 . HIS A 1 287 ? 30.828  20.580  74.334  1.00 21.60 ? 286 HIS A ND1 1 
ATOM   2276  C CD2 . HIS A 1 287 ? 31.993  22.346  74.873  1.00 21.51 ? 286 HIS A CD2 1 
ATOM   2277  C CE1 . HIS A 1 287 ? 31.841  20.168  75.075  1.00 22.95 ? 286 HIS A CE1 1 
ATOM   2278  N NE2 . HIS A 1 287 ? 32.563  21.221  75.415  1.00 23.92 ? 286 HIS A NE2 1 
ATOM   2279  N N   . VAL A 1 288 ? 30.484  22.978  70.418  1.00 18.88 ? 287 VAL A N   1 
ATOM   2280  C CA  . VAL A 1 288 ? 31.107  22.427  69.222  1.00 20.11 ? 287 VAL A CA  1 
ATOM   2281  C C   . VAL A 1 288 ? 31.052  23.322  67.990  1.00 20.65 ? 287 VAL A C   1 
ATOM   2282  O O   . VAL A 1 288 ? 31.470  22.911  66.911  1.00 19.99 ? 287 VAL A O   1 
ATOM   2283  C CB  . VAL A 1 288 ? 30.482  21.059  68.867  1.00 19.50 ? 287 VAL A CB  1 
ATOM   2284  C CG1 . VAL A 1 288 ? 30.743  20.072  69.990  1.00 19.48 ? 287 VAL A CG1 1 
ATOM   2285  C CG2 . VAL A 1 288 ? 28.977  21.214  68.631  1.00 19.58 ? 287 VAL A CG2 1 
ATOM   2286  N N   . GLY A 1 289 ? 30.545  24.544  68.152  1.00 23.16 ? 288 GLY A N   1 
ATOM   2287  C CA  . GLY A 1 289 ? 30.466  25.469  67.029  1.00 22.67 ? 288 GLY A CA  1 
ATOM   2288  C C   . GLY A 1 289 ? 29.153  25.351  66.277  1.00 23.43 ? 288 GLY A C   1 
ATOM   2289  O O   . GLY A 1 289 ? 28.561  24.270  66.215  1.00 21.35 ? 288 GLY A O   1 
ATOM   2290  N N   . PHE A 1 290 ? 28.690  26.455  65.698  1.00 22.98 ? 289 PHE A N   1 
ATOM   2291  C CA  . PHE A 1 290 ? 27.430  26.427  64.966  1.00 23.22 ? 289 PHE A CA  1 
ATOM   2292  C C   . PHE A 1 290 ? 27.486  25.518  63.737  1.00 23.90 ? 289 PHE A C   1 
ATOM   2293  O O   . PHE A 1 290 ? 26.477  24.912  63.362  1.00 22.29 ? 289 PHE A O   1 
ATOM   2294  C CB  . PHE A 1 290 ? 27.021  27.836  64.541  1.00 23.88 ? 289 PHE A CB  1 
ATOM   2295  C CG  . PHE A 1 290 ? 25.580  27.942  64.137  1.00 21.29 ? 289 PHE A CG  1 
ATOM   2296  C CD1 . PHE A 1 290 ? 24.575  27.918  65.099  1.00 23.36 ? 289 PHE A CD1 1 
ATOM   2297  C CD2 . PHE A 1 290 ? 25.224  28.023  62.796  1.00 23.34 ? 289 PHE A CD2 1 
ATOM   2298  C CE1 . PHE A 1 290 ? 23.233  27.972  64.734  1.00 21.72 ? 289 PHE A CE1 1 
ATOM   2299  C CE2 . PHE A 1 290 ? 23.883  28.078  62.417  1.00 22.92 ? 289 PHE A CE2 1 
ATOM   2300  C CZ  . PHE A 1 290 ? 22.887  28.051  63.390  1.00 21.53 ? 289 PHE A CZ  1 
ATOM   2301  N N   . ASP A 1 291 ? 28.658  25.422  63.111  1.00 24.86 ? 290 ASP A N   1 
ATOM   2302  C CA  . ASP A 1 291 ? 28.813  24.571  61.930  1.00 26.68 ? 290 ASP A CA  1 
ATOM   2303  C C   . ASP A 1 291 ? 28.499  23.120  62.252  1.00 26.03 ? 290 ASP A C   1 
ATOM   2304  O O   . ASP A 1 291 ? 27.813  22.443  61.485  1.00 24.61 ? 290 ASP A O   1 
ATOM   2305  C CB  . ASP A 1 291 ? 30.231  24.651  61.368  1.00 30.03 ? 290 ASP A CB  1 
ATOM   2306  C CG  . ASP A 1 291 ? 30.492  25.950  60.653  1.00 36.36 ? 290 ASP A CG  1 
ATOM   2307  O OD1 . ASP A 1 291 ? 29.599  26.392  59.895  1.00 39.82 ? 290 ASP A OD1 1 
ATOM   2308  O OD2 . ASP A 1 291 ? 31.587  26.522  60.838  1.00 40.15 ? 290 ASP A OD2 1 
ATOM   2309  N N   . ASN A 1 292 ? 29.018  22.638  63.375  1.00 22.98 ? 291 ASN A N   1 
ATOM   2310  C CA  . ASN A 1 292 ? 28.755  21.266  63.771  1.00 22.34 ? 291 ASN A CA  1 
ATOM   2311  C C   . ASN A 1 292 ? 27.301  21.121  64.201  1.00 21.38 ? 291 ASN A C   1 
ATOM   2312  O O   . ASN A 1 292 ? 26.719  20.047  64.081  1.00 20.63 ? 291 ASN A O   1 
ATOM   2313  C CB  . ASN A 1 292 ? 29.708  20.828  64.887  1.00 19.78 ? 291 ASN A CB  1 
ATOM   2314  C CG  . ASN A 1 292 ? 31.094  20.492  64.356  1.00 21.63 ? 291 ASN A CG  1 
ATOM   2315  O OD1 . ASN A 1 292 ? 31.227  19.959  63.251  1.00 19.95 ? 291 ASN A OD1 1 
ATOM   2316  N ND2 . ASN A 1 292 ? 32.127  20.789  65.138  1.00 17.95 ? 291 ASN A ND2 1 
ATOM   2317  N N   . PHE A 1 293 ? 26.706  22.210  64.681  1.00 21.71 ? 292 PHE A N   1 
ATOM   2318  C CA  . PHE A 1 293 ? 25.310  22.160  65.089  1.00 21.75 ? 292 PHE A CA  1 
ATOM   2319  C C   . PHE A 1 293 ? 24.456  21.938  63.844  1.00 21.99 ? 292 PHE A C   1 
ATOM   2320  O O   . PHE A 1 293 ? 23.522  21.136  63.859  1.00 21.47 ? 292 PHE A O   1 
ATOM   2321  C CB  . PHE A 1 293 ? 24.885  23.457  65.779  1.00 21.56 ? 292 PHE A CB  1 
ATOM   2322  C CG  . PHE A 1 293 ? 23.479  23.417  66.318  1.00 21.74 ? 292 PHE A CG  1 
ATOM   2323  C CD1 . PHE A 1 293 ? 23.122  22.488  67.297  1.00 18.59 ? 292 PHE A CD1 1 
ATOM   2324  C CD2 . PHE A 1 293 ? 22.511  24.296  65.843  1.00 19.94 ? 292 PHE A CD2 1 
ATOM   2325  C CE1 . PHE A 1 293 ? 21.825  22.433  67.792  1.00 16.81 ? 292 PHE A CE1 1 
ATOM   2326  C CE2 . PHE A 1 293 ? 21.207  24.252  66.330  1.00 19.61 ? 292 PHE A CE2 1 
ATOM   2327  C CZ  . PHE A 1 293 ? 20.862  23.316  67.309  1.00 21.00 ? 292 PHE A CZ  1 
ATOM   2328  N N   . GLU A 1 294 ? 24.782  22.652  62.768  1.00 20.81 ? 293 GLU A N   1 
ATOM   2329  C CA  . GLU A 1 294 ? 24.050  22.505  61.515  1.00 21.50 ? 293 GLU A CA  1 
ATOM   2330  C C   . GLU A 1 294 ? 24.222  21.092  60.960  1.00 19.21 ? 293 GLU A C   1 
ATOM   2331  O O   . GLU A 1 294 ? 23.310  20.553  60.342  1.00 19.13 ? 293 GLU A O   1 
ATOM   2332  C CB  . GLU A 1 294 ? 24.531  23.521  60.482  1.00 22.97 ? 293 GLU A CB  1 
ATOM   2333  C CG  . GLU A 1 294 ? 24.178  24.958  60.813  1.00 25.24 ? 293 GLU A CG  1 
ATOM   2334  C CD  . GLU A 1 294 ? 24.438  25.885  59.648  1.00 27.14 ? 293 GLU A CD  1 
ATOM   2335  O OE1 . GLU A 1 294 ? 25.614  26.025  59.238  1.00 27.03 ? 293 GLU A OE1 1 
ATOM   2336  O OE2 . GLU A 1 294 ? 23.460  26.466  59.140  1.00 27.61 ? 293 GLU A OE2 1 
ATOM   2337  N N   . GLN A 1 295 ? 25.397  20.509  61.167  1.00 18.53 ? 294 GLN A N   1 
ATOM   2338  C CA  . GLN A 1 295 ? 25.658  19.143  60.714  1.00 19.48 ? 294 GLN A CA  1 
ATOM   2339  C C   . GLN A 1 295 ? 24.686  18.236  61.456  1.00 17.39 ? 294 GLN A C   1 
ATOM   2340  O O   . GLN A 1 295 ? 24.051  17.374  60.858  1.00 18.29 ? 294 GLN A O   1 
ATOM   2341  C CB  . GLN A 1 295 ? 27.097  18.734  61.035  1.00 23.05 ? 294 GLN A CB  1 
ATOM   2342  C CG  . GLN A 1 295 ? 28.136  19.494  60.241  1.00 29.23 ? 294 GLN A CG  1 
ATOM   2343  C CD  . GLN A 1 295 ? 28.070  19.165  58.767  1.00 33.70 ? 294 GLN A CD  1 
ATOM   2344  O OE1 . GLN A 1 295 ? 28.573  19.913  57.926  1.00 37.08 ? 294 GLN A OE1 1 
ATOM   2345  N NE2 . GLN A 1 295 ? 27.456  18.032  58.442  1.00 34.68 ? 294 GLN A NE2 1 
ATOM   2346  N N   . LEU A 1 296 ? 24.578  18.444  62.767  1.00 16.44 ? 295 LEU A N   1 
ATOM   2347  C CA  . LEU A 1 296 ? 23.661  17.676  63.602  1.00 16.26 ? 295 LEU A CA  1 
ATOM   2348  C C   . LEU A 1 296 ? 22.246  17.764  63.018  1.00 18.02 ? 295 LEU A C   1 
ATOM   2349  O O   . LEU A 1 296 ? 21.580  16.748  62.814  1.00 17.13 ? 295 LEU A O   1 
ATOM   2350  C CB  . LEU A 1 296 ? 23.659  18.235  65.027  1.00 16.26 ? 295 LEU A CB  1 
ATOM   2351  C CG  . LEU A 1 296 ? 22.643  17.651  66.013  1.00 16.09 ? 295 LEU A CG  1 
ATOM   2352  C CD1 . LEU A 1 296 ? 22.991  16.195  66.306  1.00 16.99 ? 295 LEU A CD1 1 
ATOM   2353  C CD2 . LEU A 1 296 ? 22.647  18.478  67.298  1.00 16.58 ? 295 LEU A CD2 1 
ATOM   2354  N N   . LEU A 1 297 ? 21.791  18.985  62.756  1.00 17.25 ? 296 LEU A N   1 
ATOM   2355  C CA  . LEU A 1 297 ? 20.465  19.206  62.189  1.00 18.88 ? 296 LEU A CA  1 
ATOM   2356  C C   . LEU A 1 297 ? 20.341  18.548  60.817  1.00 18.79 ? 296 LEU A C   1 
ATOM   2357  O O   . LEU A 1 297 ? 19.295  17.981  60.484  1.00 17.34 ? 296 LEU A O   1 
ATOM   2358  C CB  . LEU A 1 297 ? 20.189  20.710  62.062  1.00 20.29 ? 296 LEU A CB  1 
ATOM   2359  C CG  . LEU A 1 297 ? 19.427  21.432  63.187  1.00 24.11 ? 296 LEU A CG  1 
ATOM   2360  C CD1 . LEU A 1 297 ? 19.974  21.063  64.560  1.00 22.24 ? 296 LEU A CD1 1 
ATOM   2361  C CD2 . LEU A 1 297 ? 19.525  22.939  62.946  1.00 21.19 ? 296 LEU A CD2 1 
ATOM   2362  N N   . SER A 1 298 ? 21.408  18.619  60.026  1.00 16.65 ? 297 SER A N   1 
ATOM   2363  C CA  . SER A 1 298 ? 21.394  18.032  58.692  1.00 18.94 ? 297 SER A CA  1 
ATOM   2364  C C   . SER A 1 298 ? 21.262  16.507  58.719  1.00 18.77 ? 297 SER A C   1 
ATOM   2365  O O   . SER A 1 298 ? 20.650  15.919  57.825  1.00 19.75 ? 297 SER A O   1 
ATOM   2366  C CB  . SER A 1 298 ? 22.656  18.437  57.926  1.00 20.73 ? 297 SER A CB  1 
ATOM   2367  O OG  . SER A 1 298 ? 22.664  19.838  57.688  1.00 24.51 ? 297 SER A OG  1 
ATOM   2368  N N   . GLY A 1 299 ? 21.837  15.874  59.741  1.00 18.55 ? 298 GLY A N   1 
ATOM   2369  C CA  . GLY A 1 299 ? 21.751  14.427  59.857  1.00 17.39 ? 298 GLY A CA  1 
ATOM   2370  C C   . GLY A 1 299 ? 20.312  14.031  60.111  1.00 18.00 ? 298 GLY A C   1 
ATOM   2371  O O   . GLY A 1 299 ? 19.800  13.082  59.513  1.00 18.26 ? 298 GLY A O   1 
ATOM   2372  N N   . ALA A 1 300 ? 19.655  14.770  61.002  1.00 16.56 ? 299 ALA A N   1 
ATOM   2373  C CA  . ALA A 1 300 ? 18.257  14.520  61.342  1.00 16.83 ? 299 ALA A CA  1 
ATOM   2374  C C   . ALA A 1 300 ? 17.382  14.736  60.110  1.00 16.66 ? 299 ALA A C   1 
ATOM   2375  O O   . ALA A 1 300 ? 16.472  13.959  59.831  1.00 18.56 ? 299 ALA A O   1 
ATOM   2376  C CB  . ALA A 1 300 ? 17.816  15.461  62.461  1.00 15.65 ? 299 ALA A CB  1 
ATOM   2377  N N   . HIS A 1 301 ? 17.660  15.807  59.381  1.00 16.57 ? 300 HIS A N   1 
ATOM   2378  C CA  . HIS A 1 301 ? 16.904  16.119  58.180  1.00 17.98 ? 300 HIS A CA  1 
ATOM   2379  C C   . HIS A 1 301 ? 17.031  14.976  57.182  1.00 16.77 ? 300 HIS A C   1 
ATOM   2380  O O   . HIS A 1 301 ? 16.074  14.636  56.494  1.00 17.32 ? 300 HIS A O   1 
ATOM   2381  C CB  . HIS A 1 301 ? 17.411  17.422  57.556  1.00 17.08 ? 300 HIS A CB  1 
ATOM   2382  C CG  . HIS A 1 301 ? 16.633  17.858  56.353  1.00 20.40 ? 300 HIS A CG  1 
ATOM   2383  N ND1 . HIS A 1 301 ? 15.264  18.018  56.371  1.00 21.46 ? 300 HIS A ND1 1 
ATOM   2384  C CD2 . HIS A 1 301 ? 17.032  18.179  55.100  1.00 20.98 ? 300 HIS A CD2 1 
ATOM   2385  C CE1 . HIS A 1 301 ? 14.853  18.417  55.181  1.00 22.36 ? 300 HIS A CE1 1 
ATOM   2386  N NE2 . HIS A 1 301 ? 15.906  18.523  54.392  1.00 23.09 ? 300 HIS A NE2 1 
ATOM   2387  N N   . TRP A 1 302 ? 18.216  14.379  57.108  1.00 18.28 ? 301 TRP A N   1 
ATOM   2388  C CA  . TRP A 1 302 ? 18.436  13.269  56.187  1.00 17.91 ? 301 TRP A CA  1 
ATOM   2389  C C   . TRP A 1 302 ? 17.553  12.087  56.575  1.00 17.37 ? 301 TRP A C   1 
ATOM   2390  O O   . TRP A 1 302 ? 16.937  11.445  55.718  1.00 17.17 ? 301 TRP A O   1 
ATOM   2391  C CB  . TRP A 1 302 ? 19.903  12.826  56.205  1.00 16.24 ? 301 TRP A CB  1 
ATOM   2392  C CG  . TRP A 1 302 ? 20.205  11.788  55.161  1.00 17.87 ? 301 TRP A CG  1 
ATOM   2393  C CD1 . TRP A 1 302 ? 20.674  12.012  53.897  1.00 18.92 ? 301 TRP A CD1 1 
ATOM   2394  C CD2 . TRP A 1 302 ? 19.952  10.375  55.249  1.00 15.69 ? 301 TRP A CD2 1 
ATOM   2395  N NE1 . TRP A 1 302 ? 20.723  10.831  53.192  1.00 17.01 ? 301 TRP A NE1 1 
ATOM   2396  C CE2 . TRP A 1 302 ? 20.284  9.812   53.994  1.00 16.95 ? 301 TRP A CE2 1 
ATOM   2397  C CE3 . TRP A 1 302 ? 19.471  9.534   56.262  1.00 15.01 ? 301 TRP A CE3 1 
ATOM   2398  C CZ2 . TRP A 1 302 ? 20.149  8.442   53.723  1.00 17.13 ? 301 TRP A CZ2 1 
ATOM   2399  C CZ3 . TRP A 1 302 ? 19.334  8.170   55.994  1.00 14.96 ? 301 TRP A CZ3 1 
ATOM   2400  C CH2 . TRP A 1 302 ? 19.673  7.639   54.731  1.00 14.07 ? 301 TRP A CH2 1 
ATOM   2401  N N   . MET A 1 303 ? 17.504  11.803  57.874  1.00 17.82 ? 302 MET A N   1 
ATOM   2402  C CA  . MET A 1 303 ? 16.712  10.696  58.389  1.00 17.44 ? 302 MET A CA  1 
ATOM   2403  C C   . MET A 1 303 ? 15.230  11.009  58.231  1.00 17.46 ? 302 MET A C   1 
ATOM   2404  O O   . MET A 1 303 ? 14.411  10.102  58.050  1.00 16.89 ? 302 MET A O   1 
ATOM   2405  C CB  . MET A 1 303 ? 17.052  10.447  59.860  1.00 16.72 ? 302 MET A CB  1 
ATOM   2406  C CG  . MET A 1 303 ? 16.409  9.204   60.469  1.00 19.11 ? 302 MET A CG  1 
ATOM   2407  S SD  . MET A 1 303 ? 16.669  7.660   59.533  1.00 17.53 ? 302 MET A SD  1 
ATOM   2408  C CE  . MET A 1 303 ? 18.448  7.368   59.761  1.00 15.25 ? 302 MET A CE  1 
ATOM   2409  N N   . ASP A 1 304 ? 14.888  12.294  58.301  1.00 16.61 ? 303 ASP A N   1 
ATOM   2410  C CA  . ASP A 1 304 ? 13.500  12.712  58.134  1.00 17.28 ? 303 ASP A CA  1 
ATOM   2411  C C   . ASP A 1 304 ? 13.051  12.338  56.721  1.00 17.61 ? 303 ASP A C   1 
ATOM   2412  O O   . ASP A 1 304 ? 11.936  11.843  56.520  1.00 15.76 ? 303 ASP A O   1 
ATOM   2413  C CB  . ASP A 1 304 ? 13.348  14.230  58.323  1.00 17.17 ? 303 ASP A CB  1 
ATOM   2414  C CG  . ASP A 1 304 ? 13.502  14.665  59.772  1.00 18.57 ? 303 ASP A CG  1 
ATOM   2415  O OD1 . ASP A 1 304 ? 13.309  13.826  60.676  1.00 18.01 ? 303 ASP A OD1 1 
ATOM   2416  O OD2 . ASP A 1 304 ? 13.795  15.857  60.010  1.00 16.84 ? 303 ASP A OD2 1 
ATOM   2417  N N   . GLN A 1 305 ? 13.921  12.579  55.742  1.00 14.95 ? 304 GLN A N   1 
ATOM   2418  C CA  . GLN A 1 305 ? 13.585  12.252  54.361  1.00 19.01 ? 304 GLN A CA  1 
ATOM   2419  C C   . GLN A 1 305 ? 13.500  10.737  54.170  1.00 19.13 ? 304 GLN A C   1 
ATOM   2420  O O   . GLN A 1 305 ? 12.565  10.247  53.542  1.00 19.69 ? 304 GLN A O   1 
ATOM   2421  C CB  . GLN A 1 305 ? 14.608  12.847  53.388  1.00 18.24 ? 304 GLN A CB  1 
ATOM   2422  C CG  . GLN A 1 305 ? 14.791  14.350  53.527  1.00 23.29 ? 304 GLN A CG  1 
ATOM   2423  C CD  . GLN A 1 305 ? 13.475  15.073  53.730  1.00 26.15 ? 304 GLN A CD  1 
ATOM   2424  O OE1 . GLN A 1 305 ? 12.610  15.086  52.850  1.00 31.27 ? 304 GLN A OE1 1 
ATOM   2425  N NE2 . GLN A 1 305 ? 13.309  15.668  54.905  1.00 27.23 ? 304 GLN A NE2 1 
ATOM   2426  N N   . HIS A 1 306 ? 14.467  9.995   54.705  1.00 17.63 ? 305 HIS A N   1 
ATOM   2427  C CA  . HIS A 1 306 ? 14.427  8.537   54.578  1.00 18.58 ? 305 HIS A CA  1 
ATOM   2428  C C   . HIS A 1 306 ? 13.096  7.999   55.107  1.00 18.89 ? 305 HIS A C   1 
ATOM   2429  O O   . HIS A 1 306 ? 12.486  7.120   54.504  1.00 18.90 ? 305 HIS A O   1 
ATOM   2430  C CB  . HIS A 1 306 ? 15.576  7.888   55.352  1.00 17.49 ? 305 HIS A CB  1 
ATOM   2431  C CG  . HIS A 1 306 ? 15.461  6.397   55.471  1.00 17.65 ? 305 HIS A CG  1 
ATOM   2432  N ND1 . HIS A 1 306 ? 14.746  5.781   56.475  1.00 20.39 ? 305 HIS A ND1 1 
ATOM   2433  C CD2 . HIS A 1 306 ? 15.957  5.399   54.701  1.00 16.68 ? 305 HIS A CD2 1 
ATOM   2434  C CE1 . HIS A 1 306 ? 14.809  4.470   56.322  1.00 15.50 ? 305 HIS A CE1 1 
ATOM   2435  N NE2 . HIS A 1 306 ? 15.538  4.212   55.252  1.00 19.19 ? 305 HIS A NE2 1 
ATOM   2436  N N   . PHE A 1 307 ? 12.654  8.542   56.237  1.00 18.72 ? 306 PHE A N   1 
ATOM   2437  C CA  . PHE A 1 307 ? 11.407  8.128   56.863  1.00 18.12 ? 306 PHE A CA  1 
ATOM   2438  C C   . PHE A 1 307 ? 10.229  8.424   55.946  1.00 19.87 ? 306 PHE A C   1 
ATOM   2439  O O   . PHE A 1 307 ? 9.318   7.613   55.794  1.00 19.27 ? 306 PHE A O   1 
ATOM   2440  C CB  . PHE A 1 307 ? 11.237  8.870   58.197  1.00 16.34 ? 306 PHE A CB  1 
ATOM   2441  C CG  . PHE A 1 307 ? 9.925   8.599   58.900  1.00 17.95 ? 306 PHE A CG  1 
ATOM   2442  C CD1 . PHE A 1 307 ? 9.391   7.312   58.951  1.00 15.87 ? 306 PHE A CD1 1 
ATOM   2443  C CD2 . PHE A 1 307 ? 9.249   9.635   59.555  1.00 15.80 ? 306 PHE A CD2 1 
ATOM   2444  C CE1 . PHE A 1 307 ? 8.198   7.056   59.647  1.00 18.59 ? 306 PHE A CE1 1 
ATOM   2445  C CE2 . PHE A 1 307 ? 8.064   9.397   60.250  1.00 15.34 ? 306 PHE A CE2 1 
ATOM   2446  C CZ  . PHE A 1 307 ? 7.533   8.102   60.298  1.00 18.67 ? 306 PHE A CZ  1 
ATOM   2447  N N   . ARG A 1 308 ? 10.274  9.583   55.305  1.00 20.17 ? 307 ARG A N   1 
ATOM   2448  C CA  . ARG A 1 308 ? 9.191   9.994   54.445  1.00 22.16 ? 307 ARG A CA  1 
ATOM   2449  C C   . ARG A 1 308 ? 9.098   9.354   53.066  1.00 20.28 ? 307 ARG A C   1 
ATOM   2450  O O   . ARG A 1 308 ? 7.988   9.117   52.583  1.00 17.31 ? 307 ARG A O   1 
ATOM   2451  C CB  . ARG A 1 308 ? 9.204   11.518  54.291  1.00 25.29 ? 307 ARG A CB  1 
ATOM   2452  C CG  . ARG A 1 308 ? 7.823   12.068  54.001  1.00 31.83 ? 307 ARG A CG  1 
ATOM   2453  C CD  . ARG A 1 308 ? 7.788   13.583  53.966  1.00 35.34 ? 307 ARG A CD  1 
ATOM   2454  N NE  . ARG A 1 308 ? 6.408   14.063  53.976  1.00 38.61 ? 307 ARG A NE  1 
ATOM   2455  C CZ  . ARG A 1 308 ? 6.062   15.341  53.881  1.00 40.84 ? 307 ARG A CZ  1 
ATOM   2456  N NH1 . ARG A 1 308 ? 6.999   16.274  53.764  1.00 40.72 ? 307 ARG A NH1 1 
ATOM   2457  N NH2 . ARG A 1 308 ? 4.780   15.686  53.912  1.00 42.95 ? 307 ARG A NH2 1 
ATOM   2458  N N   . THR A 1 309 ? 10.236  9.058   52.438  1.00 17.25 ? 308 THR A N   1 
ATOM   2459  C CA  . THR A 1 309 ? 10.217  8.498   51.085  1.00 18.32 ? 308 THR A CA  1 
ATOM   2460  C C   . THR A 1 309 ? 10.441  6.990   50.943  1.00 18.94 ? 308 THR A C   1 
ATOM   2461  O O   . THR A 1 309 ? 10.247  6.440   49.865  1.00 17.98 ? 308 THR A O   1 
ATOM   2462  C CB  . THR A 1 309 ? 11.261  9.213   50.172  1.00 20.40 ? 308 THR A CB  1 
ATOM   2463  O OG1 . THR A 1 309 ? 12.586  8.811   50.549  1.00 19.34 ? 308 THR A OG1 1 
ATOM   2464  C CG2 . THR A 1 309 ? 11.150  10.738  50.304  1.00 17.92 ? 308 THR A CG2 1 
ATOM   2465  N N   . THR A 1 310 ? 10.837  6.319   52.018  1.00 18.27 ? 309 THR A N   1 
ATOM   2466  C CA  . THR A 1 310 ? 11.108  4.886   51.949  1.00 18.95 ? 309 THR A CA  1 
ATOM   2467  C C   . THR A 1 310 ? 9.897   3.990   52.227  1.00 20.17 ? 309 THR A C   1 
ATOM   2468  O O   . THR A 1 310 ? 9.223   4.128   53.253  1.00 18.33 ? 309 THR A O   1 
ATOM   2469  C CB  . THR A 1 310 ? 12.247  4.500   52.929  1.00 19.60 ? 309 THR A CB  1 
ATOM   2470  O OG1 . THR A 1 310 ? 13.381  5.352   52.702  1.00 16.53 ? 309 THR A OG1 1 
ATOM   2471  C CG2 . THR A 1 310 ? 12.666  3.037   52.729  1.00 18.24 ? 309 THR A CG2 1 
ATOM   2472  N N   . PRO A 1 311 ? 9.600   3.053   51.307  1.00 21.02 ? 310 PRO A N   1 
ATOM   2473  C CA  . PRO A 1 311 ? 8.452   2.172   51.539  1.00 21.36 ? 310 PRO A CA  1 
ATOM   2474  C C   . PRO A 1 311 ? 8.581   1.508   52.902  1.00 20.18 ? 310 PRO A C   1 
ATOM   2475  O O   . PRO A 1 311 ? 9.682   1.173   53.328  1.00 19.10 ? 310 PRO A O   1 
ATOM   2476  C CB  . PRO A 1 311 ? 8.519   1.176   50.373  1.00 23.06 ? 310 PRO A CB  1 
ATOM   2477  C CG  . PRO A 1 311 ? 9.965   1.242   49.917  1.00 25.45 ? 310 PRO A CG  1 
ATOM   2478  C CD  . PRO A 1 311 ? 10.291  2.708   50.052  1.00 20.93 ? 310 PRO A CD  1 
ATOM   2479  N N   . LEU A 1 312 ? 7.450   1.331   53.577  1.00 20.86 ? 311 LEU A N   1 
ATOM   2480  C CA  . LEU A 1 312 ? 7.415   0.736   54.909  1.00 22.45 ? 311 LEU A CA  1 
ATOM   2481  C C   . LEU A 1 312 ? 8.294   -0.504  55.090  1.00 22.31 ? 311 LEU A C   1 
ATOM   2482  O O   . LEU A 1 312 ? 9.023   -0.607  56.080  1.00 21.35 ? 311 LEU A O   1 
ATOM   2483  C CB  . LEU A 1 312 ? 5.963   0.401   55.285  1.00 24.21 ? 311 LEU A CB  1 
ATOM   2484  C CG  . LEU A 1 312 ? 4.997   1.594   55.301  1.00 25.95 ? 311 LEU A CG  1 
ATOM   2485  C CD1 . LEU A 1 312 ? 3.569   1.103   55.336  1.00 27.07 ? 311 LEU A CD1 1 
ATOM   2486  C CD2 . LEU A 1 312 ? 5.285   2.481   56.504  1.00 27.73 ? 311 LEU A CD2 1 
ATOM   2487  N N   . GLU A 1 313 ? 8.233   -1.431  54.135  1.00 21.85 ? 312 GLU A N   1 
ATOM   2488  C CA  . GLU A 1 313 ? 9.003   -2.679  54.204  1.00 22.45 ? 312 GLU A CA  1 
ATOM   2489  C C   . GLU A 1 313 ? 10.506  -2.489  54.384  1.00 21.60 ? 312 GLU A C   1 
ATOM   2490  O O   . GLU A 1 313 ? 11.182  -3.374  54.895  1.00 22.96 ? 312 GLU A O   1 
ATOM   2491  C CB  . GLU A 1 313 ? 8.788   -3.531  52.944  1.00 24.96 ? 312 GLU A CB  1 
ATOM   2492  C CG  . GLU A 1 313 ? 7.358   -3.604  52.455  1.00 32.57 ? 312 GLU A CG  1 
ATOM   2493  C CD  . GLU A 1 313 ? 6.995   -2.426  51.572  1.00 32.13 ? 312 GLU A CD  1 
ATOM   2494  O OE1 . GLU A 1 313 ? 7.453   -2.393  50.412  1.00 36.08 ? 312 GLU A OE1 1 
ATOM   2495  O OE2 . GLU A 1 313 ? 6.262   -1.535  52.042  1.00 33.68 ? 312 GLU A OE2 1 
ATOM   2496  N N   . LYS A 1 314 ? 11.027  -1.346  53.951  1.00 21.18 ? 313 LYS A N   1 
ATOM   2497  C CA  . LYS A 1 314 ? 12.461  -1.067  54.059  1.00 22.00 ? 313 LYS A CA  1 
ATOM   2498  C C   . LYS A 1 314 ? 12.737  0.211   54.839  1.00 20.79 ? 313 LYS A C   1 
ATOM   2499  O O   . LYS A 1 314 ? 13.852  0.723   54.821  1.00 20.60 ? 313 LYS A O   1 
ATOM   2500  C CB  . LYS A 1 314 ? 13.067  -0.932  52.657  1.00 24.73 ? 313 LYS A CB  1 
ATOM   2501  C CG  . LYS A 1 314 ? 13.149  -2.236  51.870  1.00 27.11 ? 313 LYS A CG  1 
ATOM   2502  C CD  . LYS A 1 314 ? 14.205  -3.140  52.474  1.00 32.08 ? 313 LYS A CD  1 
ATOM   2503  C CE  . LYS A 1 314 ? 14.545  -4.319  51.573  1.00 34.64 ? 313 LYS A CE  1 
ATOM   2504  N NZ  . LYS A 1 314 ? 15.756  -5.036  52.082  1.00 35.79 ? 313 LYS A NZ  1 
ATOM   2505  N N   . ASN A 1 315 ? 11.719  0.714   55.529  1.00 20.54 ? 314 ASN A N   1 
ATOM   2506  C CA  . ASN A 1 315 ? 11.824  1.957   56.286  1.00 18.61 ? 314 ASN A CA  1 
ATOM   2507  C C   . ASN A 1 315 ? 12.374  1.694   57.689  1.00 17.73 ? 314 ASN A C   1 
ATOM   2508  O O   . ASN A 1 315 ? 11.699  1.096   58.520  1.00 15.75 ? 314 ASN A O   1 
ATOM   2509  C CB  . ASN A 1 315 ? 10.433  2.610   56.347  1.00 16.99 ? 314 ASN A CB  1 
ATOM   2510  C CG  . ASN A 1 315 ? 10.489  4.079   56.714  1.00 17.38 ? 314 ASN A CG  1 
ATOM   2511  O OD1 . ASN A 1 315 ? 11.025  4.448   57.756  1.00 14.47 ? 314 ASN A OD1 1 
ATOM   2512  N ND2 . ASN A 1 315 ? 9.927   4.925   55.856  1.00 15.35 ? 314 ASN A ND2 1 
ATOM   2513  N N   . ALA A 1 316 ? 13.601  2.152   57.945  1.00 17.65 ? 315 ALA A N   1 
ATOM   2514  C CA  . ALA A 1 316 ? 14.271  1.929   59.230  1.00 18.84 ? 315 ALA A CA  1 
ATOM   2515  C C   . ALA A 1 316 ? 13.471  2.239   60.503  1.00 19.19 ? 315 ALA A C   1 
ATOM   2516  O O   . ALA A 1 316 ? 13.271  1.361   61.344  1.00 18.28 ? 315 ALA A O   1 
ATOM   2517  C CB  . ALA A 1 316 ? 15.616  2.681   59.259  1.00 19.48 ? 315 ALA A CB  1 
ATOM   2518  N N   . PRO A 1 317 ? 13.018  3.489   60.675  1.00 18.35 ? 316 PRO A N   1 
ATOM   2519  C CA  . PRO A 1 317 ? 12.254  3.796   61.889  1.00 19.09 ? 316 PRO A CA  1 
ATOM   2520  C C   . PRO A 1 317 ? 11.040  2.869   62.033  1.00 19.69 ? 316 PRO A C   1 
ATOM   2521  O O   . PRO A 1 317 ? 10.757  2.345   63.111  1.00 18.01 ? 316 PRO A O   1 
ATOM   2522  C CB  . PRO A 1 317 ? 11.828  5.249   61.679  1.00 18.89 ? 316 PRO A CB  1 
ATOM   2523  C CG  . PRO A 1 317 ? 12.854  5.786   60.729  1.00 19.88 ? 316 PRO A CG  1 
ATOM   2524  C CD  . PRO A 1 317 ? 13.092  4.657   59.783  1.00 18.69 ? 316 PRO A CD  1 
ATOM   2525  N N   . VAL A 1 318 ? 10.327  2.676   60.931  1.00 18.22 ? 317 VAL A N   1 
ATOM   2526  C CA  . VAL A 1 318 ? 9.140   1.836   60.925  1.00 18.45 ? 317 VAL A CA  1 
ATOM   2527  C C   . VAL A 1 318 ? 9.438   0.391   61.338  1.00 18.65 ? 317 VAL A C   1 
ATOM   2528  O O   . VAL A 1 318 ? 8.722   -0.179  62.162  1.00 19.55 ? 317 VAL A O   1 
ATOM   2529  C CB  . VAL A 1 318 ? 8.464   1.848   59.521  1.00 18.39 ? 317 VAL A CB  1 
ATOM   2530  C CG1 . VAL A 1 318 ? 7.191   1.018   59.543  1.00 18.67 ? 317 VAL A CG1 1 
ATOM   2531  C CG2 . VAL A 1 318 ? 8.144   3.285   59.111  1.00 18.40 ? 317 VAL A CG2 1 
ATOM   2532  N N   . LEU A 1 319 ? 10.483  -0.206  60.775  1.00 17.66 ? 318 LEU A N   1 
ATOM   2533  C CA  . LEU A 1 319 ? 10.806  -1.590  61.121  1.00 20.02 ? 318 LEU A CA  1 
ATOM   2534  C C   . LEU A 1 319 ? 11.261  -1.710  62.577  1.00 20.42 ? 318 LEU A C   1 
ATOM   2535  O O   . LEU A 1 319 ? 10.984  -2.710  63.235  1.00 20.33 ? 318 LEU A O   1 
ATOM   2536  C CB  . LEU A 1 319 ? 11.880  -2.157  60.181  1.00 19.86 ? 318 LEU A CB  1 
ATOM   2537  C CG  . LEU A 1 319 ? 11.505  -2.315  58.699  1.00 20.06 ? 318 LEU A CG  1 
ATOM   2538  C CD1 . LEU A 1 319 ? 12.614  -3.070  57.970  1.00 20.25 ? 318 LEU A CD1 1 
ATOM   2539  C CD2 . LEU A 1 319 ? 10.191  -3.084  58.566  1.00 19.65 ? 318 LEU A CD2 1 
ATOM   2540  N N   . LEU A 1 320 ? 11.954  -0.692  63.081  1.00 20.61 ? 319 LEU A N   1 
ATOM   2541  C CA  . LEU A 1 320 ? 12.404  -0.719  64.470  1.00 18.85 ? 319 LEU A CA  1 
ATOM   2542  C C   . LEU A 1 320 ? 11.176  -0.672  65.370  1.00 17.51 ? 319 LEU A C   1 
ATOM   2543  O O   . LEU A 1 320 ? 11.105  -1.390  66.363  1.00 18.48 ? 319 LEU A O   1 
ATOM   2544  C CB  . LEU A 1 320 ? 13.315  0.473   64.785  1.00 15.97 ? 319 LEU A CB  1 
ATOM   2545  C CG  . LEU A 1 320 ? 14.741  0.442   64.239  1.00 17.34 ? 319 LEU A CG  1 
ATOM   2546  C CD1 . LEU A 1 320 ? 15.479  1.711   64.683  1.00 17.37 ? 319 LEU A CD1 1 
ATOM   2547  C CD2 . LEU A 1 320 ? 15.468  -0.791  64.755  1.00 15.09 ? 319 LEU A CD2 1 
ATOM   2548  N N   . ALA A 1 321 ? 10.208  0.169   65.017  1.00 16.81 ? 320 ALA A N   1 
ATOM   2549  C CA  . ALA A 1 321 ? 8.981   0.278   65.810  1.00 16.93 ? 320 ALA A CA  1 
ATOM   2550  C C   . ALA A 1 321 ? 8.159   -1.008  65.723  1.00 16.48 ? 320 ALA A C   1 
ATOM   2551  O O   . ALA A 1 321 ? 7.666   -1.497  66.730  1.00 18.73 ? 320 ALA A O   1 
ATOM   2552  C CB  . ALA A 1 321 ? 8.140   1.460   65.334  1.00 15.90 ? 320 ALA A CB  1 
ATOM   2553  N N   . LEU A 1 322 ? 8.005   -1.543  64.517  1.00 17.58 ? 321 LEU A N   1 
ATOM   2554  C CA  . LEU A 1 322 ? 7.236   -2.770  64.320  1.00 19.20 ? 321 LEU A CA  1 
ATOM   2555  C C   . LEU A 1 322 ? 7.786   -3.941  65.134  1.00 17.57 ? 321 LEU A C   1 
ATOM   2556  O O   . LEU A 1 322 ? 7.028   -4.718  65.707  1.00 20.56 ? 321 LEU A O   1 
ATOM   2557  C CB  . LEU A 1 322 ? 7.187   -3.132  62.825  1.00 20.25 ? 321 LEU A CB  1 
ATOM   2558  C CG  . LEU A 1 322 ? 5.999   -2.565  62.025  1.00 23.18 ? 321 LEU A CG  1 
ATOM   2559  C CD1 . LEU A 1 322 ? 5.760   -1.126  62.398  1.00 26.78 ? 321 LEU A CD1 1 
ATOM   2560  C CD2 . LEU A 1 322 ? 6.255   -2.691  60.527  1.00 19.41 ? 321 LEU A CD2 1 
ATOM   2561  N N   . LEU A 1 323 ? 9.105   -4.064  65.186  1.00 17.69 ? 322 LEU A N   1 
ATOM   2562  C CA  . LEU A 1 323 ? 9.734   -5.134  65.948  1.00 15.00 ? 322 LEU A CA  1 
ATOM   2563  C C   . LEU A 1 323 ? 9.398   -4.993  67.434  1.00 15.25 ? 322 LEU A C   1 
ATOM   2564  O O   . LEU A 1 323 ? 9.174   -5.986  68.131  1.00 13.09 ? 322 LEU A O   1 
ATOM   2565  C CB  . LEU A 1 323 ? 11.251  -5.098  65.734  1.00 16.71 ? 322 LEU A CB  1 
ATOM   2566  C CG  . LEU A 1 323 ? 11.693  -5.550  64.337  1.00 19.76 ? 322 LEU A CG  1 
ATOM   2567  C CD1 . LEU A 1 323 ? 13.144  -5.160  64.076  1.00 19.70 ? 322 LEU A CD1 1 
ATOM   2568  C CD2 . LEU A 1 323 ? 11.506  -7.067  64.229  1.00 19.70 ? 322 LEU A CD2 1 
ATOM   2569  N N   . GLY A 1 324 ? 9.352   -3.753  67.911  1.00 12.02 ? 323 GLY A N   1 
ATOM   2570  C CA  . GLY A 1 324 ? 9.031   -3.515  69.307  1.00 15.01 ? 323 GLY A CA  1 
ATOM   2571  C C   . GLY A 1 324 ? 7.594   -3.886  69.630  1.00 15.53 ? 323 GLY A C   1 
ATOM   2572  O O   . GLY A 1 324 ? 7.318   -4.414  70.704  1.00 17.35 ? 323 GLY A O   1 
ATOM   2573  N N   . ILE A 1 325 ? 6.675   -3.606  68.706  1.00 16.62 ? 324 ILE A N   1 
ATOM   2574  C CA  . ILE A 1 325 ? 5.268   -3.939  68.917  1.00 17.13 ? 324 ILE A CA  1 
ATOM   2575  C C   . ILE A 1 325 ? 5.142   -5.456  69.018  1.00 17.87 ? 324 ILE A C   1 
ATOM   2576  O O   . ILE A 1 325 ? 4.387   -5.974  69.843  1.00 17.13 ? 324 ILE A O   1 
ATOM   2577  C CB  . ILE A 1 325 ? 4.383   -3.411  67.758  1.00 18.77 ? 324 ILE A CB  1 
ATOM   2578  C CG1 . ILE A 1 325 ? 4.113   -1.916  67.964  1.00 18.90 ? 324 ILE A CG1 1 
ATOM   2579  C CG2 . ILE A 1 325 ? 3.047   -4.159  67.716  1.00 16.36 ? 324 ILE A CG2 1 
ATOM   2580  C CD1 . ILE A 1 325 ? 4.563   -1.078  66.834  1.00 23.84 ? 324 ILE A CD1 1 
ATOM   2581  N N   . TRP A 1 326 ? 5.904   -6.155  68.181  1.00 17.11 ? 325 TRP A N   1 
ATOM   2582  C CA  . TRP A 1 326 ? 5.924   -7.616  68.168  1.00 17.77 ? 325 TRP A CA  1 
ATOM   2583  C C   . TRP A 1 326 ? 6.312   -8.129  69.560  1.00 16.32 ? 325 TRP A C   1 
ATOM   2584  O O   . TRP A 1 326 ? 5.598   -8.932  70.151  1.00 18.53 ? 325 TRP A O   1 
ATOM   2585  C CB  . TRP A 1 326 ? 6.928   -8.086  67.109  1.00 18.85 ? 325 TRP A CB  1 
ATOM   2586  C CG  . TRP A 1 326 ? 7.123   -9.572  66.958  1.00 21.44 ? 325 TRP A CG  1 
ATOM   2587  C CD1 . TRP A 1 326 ? 8.311   -10.243 67.017  1.00 20.96 ? 325 TRP A CD1 1 
ATOM   2588  C CD2 . TRP A 1 326 ? 6.128   -10.549 66.611  1.00 21.02 ? 325 TRP A CD2 1 
ATOM   2589  N NE1 . TRP A 1 326 ? 8.122   -11.574 66.721  1.00 24.71 ? 325 TRP A NE1 1 
ATOM   2590  C CE2 . TRP A 1 326 ? 6.793   -11.790 66.469  1.00 22.73 ? 325 TRP A CE2 1 
ATOM   2591  C CE3 . TRP A 1 326 ? 4.743   -10.497 66.402  1.00 21.18 ? 325 TRP A CE3 1 
ATOM   2592  C CZ2 . TRP A 1 326 ? 6.116   -12.973 66.127  1.00 22.43 ? 325 TRP A CZ2 1 
ATOM   2593  C CZ3 . TRP A 1 326 ? 4.070   -11.673 66.062  1.00 21.54 ? 325 TRP A CZ3 1 
ATOM   2594  C CH2 . TRP A 1 326 ? 4.760   -12.894 65.928  1.00 19.39 ? 325 TRP A CH2 1 
ATOM   2595  N N   . TYR A 1 327 ? 7.423   -7.641  70.099  1.00 15.26 ? 326 TYR A N   1 
ATOM   2596  C CA  . TYR A 1 327 ? 7.876   -8.083  71.416  1.00 17.93 ? 326 TYR A CA  1 
ATOM   2597  C C   . TYR A 1 327 ? 7.020   -7.582  72.576  1.00 17.93 ? 326 TYR A C   1 
ATOM   2598  O O   . TYR A 1 327 ? 6.834   -8.280  73.569  1.00 18.32 ? 326 TYR A O   1 
ATOM   2599  C CB  . TYR A 1 327 ? 9.329   -7.663  71.647  1.00 17.18 ? 326 TYR A CB  1 
ATOM   2600  C CG  . TYR A 1 327 ? 10.286  -8.351  70.712  1.00 17.34 ? 326 TYR A CG  1 
ATOM   2601  C CD1 . TYR A 1 327 ? 10.307  -9.742  70.615  1.00 16.61 ? 326 TYR A CD1 1 
ATOM   2602  C CD2 . TYR A 1 327 ? 11.150  -7.615  69.898  1.00 17.48 ? 326 TYR A CD2 1 
ATOM   2603  C CE1 . TYR A 1 327 ? 11.159  -10.386 69.727  1.00 15.12 ? 326 TYR A CE1 1 
ATOM   2604  C CE2 . TYR A 1 327 ? 12.008  -8.245  69.007  1.00 15.17 ? 326 TYR A CE2 1 
ATOM   2605  C CZ  . TYR A 1 327 ? 12.004  -9.632  68.925  1.00 17.37 ? 326 TYR A CZ  1 
ATOM   2606  O OH  . TYR A 1 327 ? 12.830  -10.268 68.035  1.00 15.91 ? 326 TYR A OH  1 
ATOM   2607  N N   . ILE A 1 328 ? 6.500   -6.371  72.445  1.00 16.96 ? 327 ILE A N   1 
ATOM   2608  C CA  . ILE A 1 328 ? 5.685   -5.789  73.495  1.00 16.70 ? 327 ILE A CA  1 
ATOM   2609  C C   . ILE A 1 328 ? 4.269   -6.353  73.526  1.00 16.58 ? 327 ILE A C   1 
ATOM   2610  O O   . ILE A 1 328 ? 3.812   -6.853  74.553  1.00 16.02 ? 327 ILE A O   1 
ATOM   2611  C CB  . ILE A 1 328 ? 5.604   -4.240  73.337  1.00 15.76 ? 327 ILE A CB  1 
ATOM   2612  C CG1 . ILE A 1 328 ? 6.966   -3.620  73.663  1.00 15.45 ? 327 ILE A CG1 1 
ATOM   2613  C CG2 . ILE A 1 328 ? 4.499   -3.669  74.234  1.00 12.57 ? 327 ILE A CG2 1 
ATOM   2614  C CD1 . ILE A 1 328 ? 7.115   -2.170  73.245  1.00 16.02 ? 327 ILE A CD1 1 
ATOM   2615  N N   . ASN A 1 329 ? 3.584   -6.286  72.393  1.00 17.38 ? 328 ASN A N   1 
ATOM   2616  C CA  . ASN A 1 329 ? 2.202   -6.727  72.331  1.00 19.67 ? 328 ASN A CA  1 
ATOM   2617  C C   . ASN A 1 329 ? 1.960   -8.207  72.072  1.00 21.32 ? 328 ASN A C   1 
ATOM   2618  O O   . ASN A 1 329 ? 0.842   -8.689  72.252  1.00 20.87 ? 328 ASN A O   1 
ATOM   2619  C CB  . ASN A 1 329 ? 1.456   -5.855  71.320  1.00 19.35 ? 328 ASN A CB  1 
ATOM   2620  C CG  . ASN A 1 329 ? 1.429   -4.391  71.742  1.00 19.72 ? 328 ASN A CG  1 
ATOM   2621  O OD1 . ASN A 1 329 ? 1.884   -3.508  71.014  1.00 17.61 ? 328 ASN A OD1 1 
ATOM   2622  N ND2 . ASN A 1 329 ? 0.902   -4.134  72.936  1.00 19.28 ? 328 ASN A ND2 1 
ATOM   2623  N N   . CYS A 1 330 ? 2.994   -8.936  71.665  1.00 21.24 ? 329 CYS A N   1 
ATOM   2624  C CA  . CYS A 1 330 ? 2.826   -10.366 71.434  1.00 21.92 ? 329 CYS A CA  1 
ATOM   2625  C C   . CYS A 1 330 ? 3.632   -11.184 72.443  1.00 21.70 ? 329 CYS A C   1 
ATOM   2626  O O   . CYS A 1 330 ? 3.074   -12.047 73.114  1.00 23.17 ? 329 CYS A O   1 
ATOM   2627  C CB  . CYS A 1 330 ? 3.190   -10.731 69.990  1.00 21.44 ? 329 CYS A CB  1 
ATOM   2628  S SG  . CYS A 1 330 ? 1.912   -10.236 68.778  1.00 24.21 ? 329 CYS A SG  1 
ATOM   2629  N N   . PHE A 1 331 ? 4.931   -10.918 72.568  1.00 20.57 ? 330 PHE A N   1 
ATOM   2630  C CA  . PHE A 1 331 ? 5.745   -11.649 73.542  1.00 20.34 ? 330 PHE A CA  1 
ATOM   2631  C C   . PHE A 1 331 ? 5.559   -11.096 74.953  1.00 20.54 ? 330 PHE A C   1 
ATOM   2632  O O   . PHE A 1 331 ? 5.945   -11.729 75.932  1.00 21.47 ? 330 PHE A O   1 
ATOM   2633  C CB  . PHE A 1 331 ? 7.230   -11.593 73.177  1.00 19.71 ? 330 PHE A CB  1 
ATOM   2634  C CG  . PHE A 1 331 ? 7.616   -12.525 72.061  1.00 19.38 ? 330 PHE A CG  1 
ATOM   2635  C CD1 . PHE A 1 331 ? 7.384   -12.181 70.731  1.00 19.42 ? 330 PHE A CD1 1 
ATOM   2636  C CD2 . PHE A 1 331 ? 8.207   -13.756 72.344  1.00 21.87 ? 330 PHE A CD2 1 
ATOM   2637  C CE1 . PHE A 1 331 ? 7.739   -13.049 69.691  1.00 21.28 ? 330 PHE A CE1 1 
ATOM   2638  C CE2 . PHE A 1 331 ? 8.567   -14.637 71.311  1.00 21.89 ? 330 PHE A CE2 1 
ATOM   2639  C CZ  . PHE A 1 331 ? 8.333   -14.281 69.984  1.00 20.41 ? 330 PHE A CZ  1 
ATOM   2640  N N   . GLY A 1 332 ? 4.983   -9.902  75.051  1.00 19.96 ? 331 GLY A N   1 
ATOM   2641  C CA  . GLY A 1 332 ? 4.750   -9.300  76.352  1.00 19.08 ? 331 GLY A CA  1 
ATOM   2642  C C   . GLY A 1 332 ? 5.983   -8.816  77.101  1.00 19.35 ? 331 GLY A C   1 
ATOM   2643  O O   . GLY A 1 332 ? 6.030   -8.910  78.328  1.00 17.57 ? 331 GLY A O   1 
ATOM   2644  N N   . CYS A 1 333 ? 6.979   -8.305  76.379  1.00 18.66 ? 332 CYS A N   1 
ATOM   2645  C CA  . CYS A 1 333 ? 8.197   -7.798  77.012  1.00 20.61 ? 332 CYS A CA  1 
ATOM   2646  C C   . CYS A 1 333 ? 7.956   -6.380  77.544  1.00 20.35 ? 332 CYS A C   1 
ATOM   2647  O O   . CYS A 1 333 ? 7.497   -5.508  76.809  1.00 18.17 ? 332 CYS A O   1 
ATOM   2648  C CB  . CYS A 1 333 ? 9.356   -7.776  76.006  1.00 21.31 ? 332 CYS A CB  1 
ATOM   2649  S SG  . CYS A 1 333 ? 9.778   -9.393  75.301  1.00 21.86 ? 332 CYS A SG  1 
ATOM   2650  N N   . GLU A 1 334 ? 8.267   -6.167  78.821  1.00 20.69 ? 333 GLU A N   1 
ATOM   2651  C CA  . GLU A 1 334 ? 8.092   -4.871  79.484  1.00 22.08 ? 333 GLU A CA  1 
ATOM   2652  C C   . GLU A 1 334 ? 9.168   -3.825  79.177  1.00 21.81 ? 333 GLU A C   1 
ATOM   2653  O O   . GLU A 1 334 ? 8.904   -2.619  79.227  1.00 20.78 ? 333 GLU A O   1 
ATOM   2654  C CB  . GLU A 1 334 ? 8.089   -5.045  81.005  1.00 22.57 ? 333 GLU A CB  1 
ATOM   2655  C CG  . GLU A 1 334 ? 6.790   -5.490  81.638  1.00 27.03 ? 333 GLU A CG  1 
ATOM   2656  C CD  . GLU A 1 334 ? 6.853   -5.367  83.152  1.00 29.45 ? 333 GLU A CD  1 
ATOM   2657  O OE1 . GLU A 1 334 ? 7.254   -4.285  83.635  1.00 28.72 ? 333 GLU A OE1 1 
ATOM   2658  O OE2 . GLU A 1 334 ? 6.510   -6.340  83.860  1.00 32.16 ? 333 GLU A OE2 1 
ATOM   2659  N N   . THR A 1 335 ? 10.381  -4.286  78.889  1.00 20.13 ? 334 THR A N   1 
ATOM   2660  C CA  . THR A 1 335 ? 11.485  -3.365  78.658  1.00 18.13 ? 334 THR A CA  1 
ATOM   2661  C C   . THR A 1 335 ? 12.157  -3.419  77.295  1.00 17.64 ? 334 THR A C   1 
ATOM   2662  O O   . THR A 1 335 ? 11.895  -4.304  76.474  1.00 18.31 ? 334 THR A O   1 
ATOM   2663  C CB  . THR A 1 335 ? 12.585  -3.556  79.737  1.00 17.28 ? 334 THR A CB  1 
ATOM   2664  O OG1 . THR A 1 335 ? 13.371  -4.713  79.432  1.00 16.75 ? 334 THR A OG1 1 
ATOM   2665  C CG2 . THR A 1 335 ? 11.953  -3.754  81.118  1.00 16.81 ? 334 THR A CG2 1 
ATOM   2666  N N   . HIS A 1 336 ? 13.037  -2.448  77.076  1.00 17.08 ? 335 HIS A N   1 
ATOM   2667  C CA  . HIS A 1 336 ? 13.795  -2.335  75.843  1.00 18.07 ? 335 HIS A CA  1 
ATOM   2668  C C   . HIS A 1 336 ? 15.162  -1.769  76.203  1.00 18.48 ? 335 HIS A C   1 
ATOM   2669  O O   . HIS A 1 336 ? 15.266  -0.625  76.656  1.00 18.45 ? 335 HIS A O   1 
ATOM   2670  C CB  . HIS A 1 336 ? 13.092  -1.393  74.860  1.00 17.12 ? 335 HIS A CB  1 
ATOM   2671  C CG  . HIS A 1 336 ? 13.810  -1.248  73.554  1.00 17.78 ? 335 HIS A CG  1 
ATOM   2672  N ND1 . HIS A 1 336 ? 13.787  -2.223  72.581  1.00 18.37 ? 335 HIS A ND1 1 
ATOM   2673  C CD2 . HIS A 1 336 ? 14.613  -0.265  73.081  1.00 20.23 ? 335 HIS A CD2 1 
ATOM   2674  C CE1 . HIS A 1 336 ? 14.547  -1.849  71.567  1.00 20.68 ? 335 HIS A CE1 1 
ATOM   2675  N NE2 . HIS A 1 336 ? 15.061  -0.665  71.845  1.00 21.23 ? 335 HIS A NE2 1 
ATOM   2676  N N   . ALA A 1 337 ? 16.208  -2.565  75.998  1.00 17.18 ? 336 ALA A N   1 
ATOM   2677  C CA  . ALA A 1 337 ? 17.565  -2.126  76.317  1.00 18.56 ? 336 ALA A CA  1 
ATOM   2678  C C   . ALA A 1 337 ? 18.295  -1.514  75.120  1.00 17.85 ? 336 ALA A C   1 
ATOM   2679  O O   . ALA A 1 337 ? 18.264  -2.046  74.013  1.00 18.73 ? 336 ALA A O   1 
ATOM   2680  C CB  . ALA A 1 337 ? 18.379  -3.297  76.882  1.00 17.06 ? 336 ALA A CB  1 
ATOM   2681  N N   . MET A 1 338 ? 18.942  -0.379  75.363  1.00 18.13 ? 337 MET A N   1 
ATOM   2682  C CA  . MET A 1 338 ? 19.708  0.323   74.345  1.00 18.78 ? 337 MET A CA  1 
ATOM   2683  C C   . MET A 1 338 ? 21.155  0.322   74.842  1.00 19.32 ? 337 MET A C   1 
ATOM   2684  O O   . MET A 1 338 ? 21.497  0.977   75.834  1.00 18.45 ? 337 MET A O   1 
ATOM   2685  C CB  . MET A 1 338 ? 19.138  1.729   74.164  1.00 17.81 ? 337 MET A CB  1 
ATOM   2686  C CG  . MET A 1 338 ? 17.746  1.675   73.534  1.00 19.70 ? 337 MET A CG  1 
ATOM   2687  S SD  . MET A 1 338 ? 16.934  3.257   73.341  1.00 22.08 ? 337 MET A SD  1 
ATOM   2688  C CE  . MET A 1 338 ? 17.992  4.009   72.033  1.00 17.46 ? 337 MET A CE  1 
ATOM   2689  N N   . LEU A 1 339 ? 21.989  -0.449  74.148  1.00 18.07 ? 338 LEU A N   1 
ATOM   2690  C CA  . LEU A 1 339 ? 23.382  -0.646  74.530  1.00 15.47 ? 338 LEU A CA  1 
ATOM   2691  C C   . LEU A 1 339 ? 24.390  -0.197  73.481  1.00 15.38 ? 338 LEU A C   1 
ATOM   2692  O O   . LEU A 1 339 ? 24.853  -0.989  72.646  1.00 15.61 ? 338 LEU A O   1 
ATOM   2693  C CB  . LEU A 1 339 ? 23.583  -2.133  74.842  1.00 16.12 ? 338 LEU A CB  1 
ATOM   2694  C CG  . LEU A 1 339 ? 22.473  -2.696  75.742  1.00 15.03 ? 338 LEU A CG  1 
ATOM   2695  C CD1 . LEU A 1 339 ? 22.497  -4.232  75.755  1.00 16.25 ? 338 LEU A CD1 1 
ATOM   2696  C CD2 . LEU A 1 339 ? 22.648  -2.122  77.139  1.00 13.69 ? 338 LEU A CD2 1 
ATOM   2697  N N   . PRO A 1 340 ? 24.746  1.088   73.503  1.00 12.96 ? 339 PRO A N   1 
ATOM   2698  C CA  . PRO A 1 340 ? 25.713  1.561   72.515  1.00 13.88 ? 339 PRO A CA  1 
ATOM   2699  C C   . PRO A 1 340 ? 27.130  1.260   73.004  1.00 13.40 ? 339 PRO A C   1 
ATOM   2700  O O   . PRO A 1 340 ? 27.460  1.529   74.159  1.00 14.53 ? 339 PRO A O   1 
ATOM   2701  C CB  . PRO A 1 340 ? 25.409  3.055   72.444  1.00 14.32 ? 339 PRO A CB  1 
ATOM   2702  C CG  . PRO A 1 340 ? 25.054  3.372   73.884  1.00 15.12 ? 339 PRO A CG  1 
ATOM   2703  C CD  . PRO A 1 340 ? 24.174  2.203   74.279  1.00 12.68 ? 339 PRO A CD  1 
ATOM   2704  N N   . TYR A 1 341 ? 27.951  0.666   72.145  1.00 12.77 ? 340 TYR A N   1 
ATOM   2705  C CA  . TYR A 1 341 ? 29.340  0.361   72.510  1.00 17.08 ? 340 TYR A CA  1 
ATOM   2706  C C   . TYR A 1 341 ? 30.183  1.574   72.152  1.00 15.85 ? 340 TYR A C   1 
ATOM   2707  O O   . TYR A 1 341 ? 30.952  1.557   71.192  1.00 18.78 ? 340 TYR A O   1 
ATOM   2708  C CB  . TYR A 1 341 ? 29.831  -0.888  71.766  1.00 15.59 ? 340 TYR A CB  1 
ATOM   2709  C CG  . TYR A 1 341 ? 29.425  -2.162  72.475  1.00 17.94 ? 340 TYR A CG  1 
ATOM   2710  C CD1 . TYR A 1 341 ? 28.089  -2.404  72.794  1.00 17.67 ? 340 TYR A CD1 1 
ATOM   2711  C CD2 . TYR A 1 341 ? 30.385  -3.069  72.931  1.00 18.03 ? 340 TYR A CD2 1 
ATOM   2712  C CE1 . TYR A 1 341 ? 27.717  -3.507  73.568  1.00 17.75 ? 340 TYR A CE1 1 
ATOM   2713  C CE2 . TYR A 1 341 ? 30.024  -4.180  73.704  1.00 17.20 ? 340 TYR A CE2 1 
ATOM   2714  C CZ  . TYR A 1 341 ? 28.689  -4.386  74.025  1.00 19.01 ? 340 TYR A CZ  1 
ATOM   2715  O OH  . TYR A 1 341 ? 28.326  -5.430  74.854  1.00 16.88 ? 340 TYR A OH  1 
ATOM   2716  N N   . ASP A 1 342 ? 30.020  2.626   72.947  1.00 16.03 ? 341 ASP A N   1 
ATOM   2717  C CA  . ASP A 1 342 ? 30.702  3.897   72.729  1.00 16.19 ? 341 ASP A CA  1 
ATOM   2718  C C   . ASP A 1 342 ? 30.558  4.706   74.012  1.00 17.05 ? 341 ASP A C   1 
ATOM   2719  O O   . ASP A 1 342 ? 29.438  5.036   74.434  1.00 14.95 ? 341 ASP A O   1 
ATOM   2720  C CB  . ASP A 1 342 ? 30.028  4.639   71.571  1.00 15.26 ? 341 ASP A CB  1 
ATOM   2721  C CG  . ASP A 1 342 ? 30.742  5.921   71.192  1.00 21.59 ? 341 ASP A CG  1 
ATOM   2722  O OD1 . ASP A 1 342 ? 31.691  5.870   70.371  1.00 21.22 ? 341 ASP A OD1 1 
ATOM   2723  O OD2 . ASP A 1 342 ? 30.352  6.982   71.720  1.00 19.95 ? 341 ASP A OD2 1 
ATOM   2724  N N   . GLN A 1 343 ? 31.692  5.017   74.629  1.00 15.43 ? 342 GLN A N   1 
ATOM   2725  C CA  . GLN A 1 343 ? 31.722  5.778   75.874  1.00 17.76 ? 342 GLN A CA  1 
ATOM   2726  C C   . GLN A 1 343 ? 31.179  7.206   75.696  1.00 16.69 ? 342 GLN A C   1 
ATOM   2727  O O   . GLN A 1 343 ? 30.619  7.786   76.628  1.00 16.59 ? 342 GLN A O   1 
ATOM   2728  C CB  . GLN A 1 343 ? 33.158  5.813   76.405  1.00 18.24 ? 342 GLN A CB  1 
ATOM   2729  C CG  . GLN A 1 343 ? 33.336  6.462   77.766  1.00 19.61 ? 342 GLN A CG  1 
ATOM   2730  C CD  . GLN A 1 343 ? 32.576  5.748   78.867  1.00 22.01 ? 342 GLN A CD  1 
ATOM   2731  O OE1 . GLN A 1 343 ? 32.424  4.518   78.853  1.00 20.28 ? 342 GLN A OE1 1 
ATOM   2732  N NE2 . GLN A 1 343 ? 32.108  6.516   79.842  1.00 20.42 ? 342 GLN A NE2 1 
ATOM   2733  N N   . TYR A 1 344 ? 31.342  7.766   74.502  1.00 15.37 ? 343 TYR A N   1 
ATOM   2734  C CA  . TYR A 1 344 ? 30.846  9.113   74.243  1.00 16.59 ? 343 TYR A CA  1 
ATOM   2735  C C   . TYR A 1 344 ? 29.326  9.106   74.275  1.00 16.60 ? 343 TYR A C   1 
ATOM   2736  O O   . TYR A 1 344 ? 28.700  10.117  74.589  1.00 17.42 ? 343 TYR A O   1 
ATOM   2737  C CB  . TYR A 1 344 ? 31.358  9.623   72.886  1.00 14.57 ? 343 TYR A CB  1 
ATOM   2738  C CG  . TYR A 1 344 ? 32.747  10.224  72.973  1.00 18.05 ? 343 TYR A CG  1 
ATOM   2739  C CD1 . TYR A 1 344 ? 33.699  9.996   71.981  1.00 17.31 ? 343 TYR A CD1 1 
ATOM   2740  C CD2 . TYR A 1 344 ? 33.102  11.037  74.053  1.00 17.37 ? 343 TYR A CD2 1 
ATOM   2741  C CE1 . TYR A 1 344 ? 34.978  10.564  72.065  1.00 18.97 ? 343 TYR A CE1 1 
ATOM   2742  C CE2 . TYR A 1 344 ? 34.361  11.605  74.146  1.00 17.47 ? 343 TYR A CE2 1 
ATOM   2743  C CZ  . TYR A 1 344 ? 35.296  11.369  73.156  1.00 19.18 ? 343 TYR A CZ  1 
ATOM   2744  O OH  . TYR A 1 344 ? 36.541  11.945  73.264  1.00 17.92 ? 343 TYR A OH  1 
ATOM   2745  N N   . LEU A 1 345 ? 28.736  7.955   73.962  1.00 14.42 ? 344 LEU A N   1 
ATOM   2746  C CA  . LEU A 1 345 ? 27.277  7.817   73.969  1.00 15.21 ? 344 LEU A CA  1 
ATOM   2747  C C   . LEU A 1 345 ? 26.779  7.339   75.334  1.00 13.93 ? 344 LEU A C   1 
ATOM   2748  O O   . LEU A 1 345 ? 25.674  6.814   75.448  1.00 16.16 ? 344 LEU A O   1 
ATOM   2749  C CB  . LEU A 1 345 ? 26.854  6.813   72.892  1.00 16.58 ? 344 LEU A CB  1 
ATOM   2750  C CG  . LEU A 1 345 ? 26.235  7.262   71.557  1.00 20.29 ? 344 LEU A CG  1 
ATOM   2751  C CD1 . LEU A 1 345 ? 26.477  8.725   71.277  1.00 19.04 ? 344 LEU A CD1 1 
ATOM   2752  C CD2 . LEU A 1 345 ? 26.789  6.387   70.458  1.00 17.91 ? 344 LEU A CD2 1 
ATOM   2753  N N   . HIS A 1 346 ? 27.583  7.528   76.373  1.00 14.97 ? 345 HIS A N   1 
ATOM   2754  C CA  . HIS A 1 346 ? 27.195  7.058   77.700  1.00 17.83 ? 345 HIS A CA  1 
ATOM   2755  C C   . HIS A 1 346 ? 25.852  7.557   78.227  1.00 17.53 ? 345 HIS A C   1 
ATOM   2756  O O   . HIS A 1 346 ? 25.332  7.001   79.191  1.00 19.79 ? 345 HIS A O   1 
ATOM   2757  C CB  . HIS A 1 346 ? 28.301  7.344   78.731  1.00 16.34 ? 345 HIS A CB  1 
ATOM   2758  C CG  . HIS A 1 346 ? 28.461  8.791   79.080  1.00 17.04 ? 345 HIS A CG  1 
ATOM   2759  N ND1 . HIS A 1 346 ? 28.236  9.278   80.351  1.00 18.33 ? 345 HIS A ND1 1 
ATOM   2760  C CD2 . HIS A 1 346 ? 28.867  9.849   78.339  1.00 16.26 ? 345 HIS A CD2 1 
ATOM   2761  C CE1 . HIS A 1 346 ? 28.498  10.573  80.379  1.00 17.87 ? 345 HIS A CE1 1 
ATOM   2762  N NE2 . HIS A 1 346 ? 28.884  10.944  79.170  1.00 17.66 ? 345 HIS A NE2 1 
ATOM   2763  N N   . ARG A 1 347 ? 25.279  8.587   77.609  1.00 19.32 ? 346 ARG A N   1 
ATOM   2764  C CA  . ARG A 1 347 ? 23.988  9.097   78.072  1.00 17.91 ? 346 ARG A CA  1 
ATOM   2765  C C   . ARG A 1 347 ? 22.905  8.998   76.994  1.00 17.79 ? 346 ARG A C   1 
ATOM   2766  O O   . ARG A 1 347 ? 21.854  9.635   77.093  1.00 17.83 ? 346 ARG A O   1 
ATOM   2767  C CB  . ARG A 1 347 ? 24.127  10.551  78.554  1.00 18.20 ? 346 ARG A CB  1 
ATOM   2768  C CG  . ARG A 1 347 ? 25.114  10.732  79.704  1.00 17.92 ? 346 ARG A CG  1 
ATOM   2769  C CD  . ARG A 1 347 ? 24.778  9.816   80.889  1.00 18.88 ? 346 ARG A CD  1 
ATOM   2770  N NE  . ARG A 1 347 ? 23.525  10.178  81.552  1.00 18.80 ? 346 ARG A NE  1 
ATOM   2771  C CZ  . ARG A 1 347 ? 22.899  9.417   82.447  1.00 18.32 ? 346 ARG A CZ  1 
ATOM   2772  N NH1 . ARG A 1 347 ? 23.396  8.236   82.790  1.00 19.85 ? 346 ARG A NH1 1 
ATOM   2773  N NH2 . ARG A 1 347 ? 21.783  9.844   83.014  1.00 15.06 ? 346 ARG A NH2 1 
ATOM   2774  N N   . PHE A 1 348 ? 23.165  8.185   75.976  1.00 16.99 ? 347 PHE A N   1 
ATOM   2775  C CA  . PHE A 1 348 ? 22.221  7.993   74.875  1.00 17.83 ? 347 PHE A CA  1 
ATOM   2776  C C   . PHE A 1 348 ? 20.969  7.250   75.363  1.00 18.03 ? 347 PHE A C   1 
ATOM   2777  O O   . PHE A 1 348 ? 19.840  7.640   75.066  1.00 16.87 ? 347 PHE A O   1 
ATOM   2778  C CB  . PHE A 1 348 ? 22.905  7.198   73.762  1.00 17.83 ? 347 PHE A CB  1 
ATOM   2779  C CG  . PHE A 1 348 ? 22.125  7.129   72.478  1.00 18.06 ? 347 PHE A CG  1 
ATOM   2780  C CD1 . PHE A 1 348 ? 21.948  8.263   71.692  1.00 15.41 ? 347 PHE A CD1 1 
ATOM   2781  C CD2 . PHE A 1 348 ? 21.603  5.910   72.034  1.00 18.29 ? 347 PHE A CD2 1 
ATOM   2782  C CE1 . PHE A 1 348 ? 21.270  8.191   70.478  1.00 17.56 ? 347 PHE A CE1 1 
ATOM   2783  C CE2 . PHE A 1 348 ? 20.921  5.822   70.820  1.00 17.26 ? 347 PHE A CE2 1 
ATOM   2784  C CZ  . PHE A 1 348 ? 20.754  6.965   70.036  1.00 20.10 ? 347 PHE A CZ  1 
ATOM   2785  N N   . ALA A 1 349 ? 21.177  6.182   76.124  1.00 18.40 ? 348 ALA A N   1 
ATOM   2786  C CA  . ALA A 1 349 ? 20.065  5.395   76.642  1.00 18.44 ? 348 ALA A CA  1 
ATOM   2787  C C   . ALA A 1 349 ? 19.212  6.239   77.591  1.00 17.81 ? 348 ALA A C   1 
ATOM   2788  O O   . ALA A 1 349 ? 17.979  6.184   77.557  1.00 17.05 ? 348 ALA A O   1 
ATOM   2789  C CB  . ALA A 1 349 ? 20.598  4.157   77.369  1.00 16.03 ? 348 ALA A CB  1 
ATOM   2790  N N   . ALA A 1 350 ? 19.875  7.026   78.430  1.00 16.94 ? 349 ALA A N   1 
ATOM   2791  C CA  . ALA A 1 350 ? 19.171  7.873   79.388  1.00 19.16 ? 349 ALA A CA  1 
ATOM   2792  C C   . ALA A 1 350 ? 18.313  8.910   78.664  1.00 18.69 ? 349 ALA A C   1 
ATOM   2793  O O   . ALA A 1 350 ? 17.209  9.239   79.100  1.00 16.79 ? 349 ALA A O   1 
ATOM   2794  C CB  . ALA A 1 350 ? 20.178  8.567   80.318  1.00 21.54 ? 349 ALA A CB  1 
ATOM   2795  N N   . TYR A 1 351 ? 18.826  9.414   77.549  1.00 19.36 ? 350 TYR A N   1 
ATOM   2796  C CA  . TYR A 1 351 ? 18.104  10.405  76.771  1.00 19.43 ? 350 TYR A CA  1 
ATOM   2797  C C   . TYR A 1 351 ? 16.821  9.819   76.213  1.00 19.95 ? 350 TYR A C   1 
ATOM   2798  O O   . TYR A 1 351 ? 15.759  10.438  76.303  1.00 18.17 ? 350 TYR A O   1 
ATOM   2799  C CB  . TYR A 1 351 ? 18.963  10.920  75.614  1.00 18.41 ? 350 TYR A CB  1 
ATOM   2800  C CG  . TYR A 1 351 ? 18.205  11.842  74.686  1.00 17.28 ? 350 TYR A CG  1 
ATOM   2801  C CD1 . TYR A 1 351 ? 17.921  13.161  75.053  1.00 17.65 ? 350 TYR A CD1 1 
ATOM   2802  C CD2 . TYR A 1 351 ? 17.730  11.384  73.457  1.00 17.87 ? 350 TYR A CD2 1 
ATOM   2803  C CE1 . TYR A 1 351 ? 17.180  14.000  74.216  1.00 17.23 ? 350 TYR A CE1 1 
ATOM   2804  C CE2 . TYR A 1 351 ? 16.991  12.208  72.619  1.00 17.19 ? 350 TYR A CE2 1 
ATOM   2805  C CZ  . TYR A 1 351 ? 16.721  13.517  73.003  1.00 17.38 ? 350 TYR A CZ  1 
ATOM   2806  O OH  . TYR A 1 351 ? 16.000  14.333  72.160  1.00 16.71 ? 350 TYR A OH  1 
ATOM   2807  N N   . PHE A 1 352 ? 16.913  8.629   75.624  1.00 19.61 ? 351 PHE A N   1 
ATOM   2808  C CA  . PHE A 1 352 ? 15.727  8.018   75.050  1.00 20.76 ? 351 PHE A CA  1 
ATOM   2809  C C   . PHE A 1 352 ? 14.812  7.389   76.073  1.00 22.55 ? 351 PHE A C   1 
ATOM   2810  O O   . PHE A 1 352 ? 13.701  6.959   75.754  1.00 23.04 ? 351 PHE A O   1 
ATOM   2811  C CB  . PHE A 1 352 ? 16.107  7.027   73.955  1.00 20.75 ? 351 PHE A CB  1 
ATOM   2812  C CG  . PHE A 1 352 ? 16.357  7.692   72.645  1.00 19.88 ? 351 PHE A CG  1 
ATOM   2813  C CD1 . PHE A 1 352 ? 17.647  7.896   72.184  1.00 20.90 ? 351 PHE A CD1 1 
ATOM   2814  C CD2 . PHE A 1 352 ? 15.292  8.207   71.916  1.00 20.56 ? 351 PHE A CD2 1 
ATOM   2815  C CE1 . PHE A 1 352 ? 17.876  8.606   71.012  1.00 18.78 ? 351 PHE A CE1 1 
ATOM   2816  C CE2 . PHE A 1 352 ? 15.507  8.916   70.747  1.00 20.87 ? 351 PHE A CE2 1 
ATOM   2817  C CZ  . PHE A 1 352 ? 16.806  9.119   70.294  1.00 20.89 ? 351 PHE A CZ  1 
ATOM   2818  N N   . GLN A 1 353 ? 15.278  7.360   77.315  1.00 23.62 ? 352 GLN A N   1 
ATOM   2819  C CA  . GLN A 1 353 ? 14.480  6.833   78.399  1.00 24.98 ? 352 GLN A CA  1 
ATOM   2820  C C   . GLN A 1 353 ? 13.365  7.863   78.531  1.00 25.51 ? 352 GLN A C   1 
ATOM   2821  O O   . GLN A 1 353 ? 12.218  7.524   78.808  1.00 26.85 ? 352 GLN A O   1 
ATOM   2822  C CB  . GLN A 1 353 ? 15.322  6.762   79.676  1.00 25.58 ? 352 GLN A CB  1 
ATOM   2823  C CG  . GLN A 1 353 ? 14.719  5.945   80.784  1.00 23.54 ? 352 GLN A CG  1 
ATOM   2824  C CD  . GLN A 1 353 ? 15.695  5.729   81.922  1.00 22.94 ? 352 GLN A CD  1 
ATOM   2825  O OE1 . GLN A 1 353 ? 16.188  6.685   82.522  1.00 20.19 ? 352 GLN A OE1 1 
ATOM   2826  N NE2 . GLN A 1 353 ? 15.985  4.468   82.220  1.00 16.22 ? 352 GLN A NE2 1 
ATOM   2827  N N   . GLN A 1 354 ? 13.712  9.131   78.315  1.00 25.18 ? 353 GLN A N   1 
ATOM   2828  C CA  . GLN A 1 354 ? 12.732  10.207  78.377  1.00 22.53 ? 353 GLN A CA  1 
ATOM   2829  C C   . GLN A 1 354 ? 11.984  10.301  77.046  1.00 22.20 ? 353 GLN A C   1 
ATOM   2830  O O   . GLN A 1 354 ? 10.750  10.267  77.002  1.00 23.95 ? 353 GLN A O   1 
ATOM   2831  C CB  . GLN A 1 354 ? 13.409  11.552  78.662  1.00 23.27 ? 353 GLN A CB  1 
ATOM   2832  C CG  . GLN A 1 354 ? 12.419  12.715  78.638  1.00 26.40 ? 353 GLN A CG  1 
ATOM   2833  C CD  . GLN A 1 354 ? 13.067  14.079  78.811  1.00 30.12 ? 353 GLN A CD  1 
ATOM   2834  O OE1 . GLN A 1 354 ? 12.375  15.095  78.920  1.00 29.90 ? 353 GLN A OE1 1 
ATOM   2835  N NE2 . GLN A 1 354 ? 14.395  14.111  78.832  1.00 34.13 ? 353 GLN A NE2 1 
ATOM   2836  N N   . GLY A 1 355 ? 12.735  10.408  75.957  1.00 19.14 ? 354 GLY A N   1 
ATOM   2837  C CA  . GLY A 1 355 ? 12.111  10.520  74.647  1.00 19.07 ? 354 GLY A CA  1 
ATOM   2838  C C   . GLY A 1 355 ? 11.038  9.478   74.370  1.00 19.45 ? 354 GLY A C   1 
ATOM   2839  O O   . GLY A 1 355 ? 9.979   9.788   73.824  1.00 18.20 ? 354 GLY A O   1 
ATOM   2840  N N   . ASP A 1 356 ? 11.315  8.237   74.762  1.00 18.41 ? 355 ASP A N   1 
ATOM   2841  C CA  . ASP A 1 356 ? 10.402  7.126   74.541  1.00 17.20 ? 355 ASP A CA  1 
ATOM   2842  C C   . ASP A 1 356 ? 9.337   7.021   75.628  1.00 15.93 ? 355 ASP A C   1 
ATOM   2843  O O   . ASP A 1 356 ? 8.144   7.074   75.344  1.00 16.48 ? 355 ASP A O   1 
ATOM   2844  C CB  . ASP A 1 356 ? 11.206  5.816   74.478  1.00 17.36 ? 355 ASP A CB  1 
ATOM   2845  C CG  . ASP A 1 356 ? 10.405  4.650   73.903  1.00 16.87 ? 355 ASP A CG  1 
ATOM   2846  O OD1 . ASP A 1 356 ? 9.194   4.549   74.178  1.00 18.42 ? 355 ASP A OD1 1 
ATOM   2847  O OD2 . ASP A 1 356 ? 10.997  3.819   73.186  1.00 17.33 ? 355 ASP A OD2 1 
ATOM   2848  N N   . MET A 1 357 ? 9.770   6.893   76.877  1.00 16.40 ? 356 MET A N   1 
ATOM   2849  C CA  . MET A 1 357 ? 8.837   6.732   77.987  1.00 15.97 ? 356 MET A CA  1 
ATOM   2850  C C   . MET A 1 357 ? 7.861   7.870   78.217  1.00 16.41 ? 356 MET A C   1 
ATOM   2851  O O   . MET A 1 357 ? 6.681   7.616   78.439  1.00 15.51 ? 356 MET A O   1 
ATOM   2852  C CB  . MET A 1 357 ? 9.608   6.420   79.270  1.00 15.86 ? 356 MET A CB  1 
ATOM   2853  C CG  . MET A 1 357 ? 10.337  5.080   79.187  1.00 16.40 ? 356 MET A CG  1 
ATOM   2854  S SD  . MET A 1 357 ? 11.453  4.779   80.560  1.00 21.11 ? 356 MET A SD  1 
ATOM   2855  C CE  . MET A 1 357 ? 10.318  4.227   81.785  1.00 17.64 ? 356 MET A CE  1 
ATOM   2856  N N   . GLU A 1 358 ? 8.327   9.116   78.161  1.00 16.25 ? 357 GLU A N   1 
ATOM   2857  C CA  . GLU A 1 358 ? 7.424   10.248  78.365  1.00 17.66 ? 357 GLU A CA  1 
ATOM   2858  C C   . GLU A 1 358 ? 6.496   10.451  77.159  1.00 19.52 ? 357 GLU A C   1 
ATOM   2859  O O   . GLU A 1 358 ? 5.433   11.076  77.269  1.00 20.81 ? 357 GLU A O   1 
ATOM   2860  C CB  . GLU A 1 358 ? 8.218   11.527  78.646  1.00 19.03 ? 357 GLU A CB  1 
ATOM   2861  C CG  . GLU A 1 358 ? 7.336   12.752  78.865  1.00 24.07 ? 357 GLU A CG  1 
ATOM   2862  C CD  . GLU A 1 358 ? 8.102   13.939  79.420  1.00 26.71 ? 357 GLU A CD  1 
ATOM   2863  O OE1 . GLU A 1 358 ? 8.199   14.066  80.664  1.00 30.20 ? 357 GLU A OE1 1 
ATOM   2864  O OE2 . GLU A 1 358 ? 8.617   14.738  78.612  1.00 28.01 ? 357 GLU A OE2 1 
ATOM   2865  N N   . SER A 1 359 ? 6.902   9.932   76.004  1.00 19.11 ? 358 SER A N   1 
ATOM   2866  C CA  . SER A 1 359 ? 6.078   10.035  74.803  1.00 18.58 ? 358 SER A CA  1 
ATOM   2867  C C   . SER A 1 359 ? 4.991   8.961   74.814  1.00 19.01 ? 358 SER A C   1 
ATOM   2868  O O   . SER A 1 359 ? 3.798   9.263   74.696  1.00 18.62 ? 358 SER A O   1 
ATOM   2869  C CB  . SER A 1 359 ? 6.921   9.839   73.532  1.00 16.70 ? 358 SER A CB  1 
ATOM   2870  O OG  . SER A 1 359 ? 7.799   10.922  73.304  1.00 17.03 ? 358 SER A OG  1 
ATOM   2871  N N   . ASN A 1 360 ? 5.414   7.707   74.975  1.00 17.79 ? 359 ASN A N   1 
ATOM   2872  C CA  . ASN A 1 360 ? 4.487   6.585   74.929  1.00 18.78 ? 359 ASN A CA  1 
ATOM   2873  C C   . ASN A 1 360 ? 4.056   5.893   76.221  1.00 19.30 ? 359 ASN A C   1 
ATOM   2874  O O   . ASN A 1 360 ? 3.446   4.825   76.172  1.00 19.91 ? 359 ASN A O   1 
ATOM   2875  C CB  . ASN A 1 360 ? 5.014   5.552   73.927  1.00 17.27 ? 359 ASN A CB  1 
ATOM   2876  C CG  . ASN A 1 360 ? 5.095   6.114   72.515  1.00 20.01 ? 359 ASN A CG  1 
ATOM   2877  O OD1 . ASN A 1 360 ? 4.519   7.164   72.230  1.00 17.91 ? 359 ASN A OD1 1 
ATOM   2878  N ND2 . ASN A 1 360 ? 5.798   5.416   71.624  1.00 18.25 ? 359 ASN A ND2 1 
ATOM   2879  N N   . GLY A 1 361 ? 4.375   6.481   77.369  1.00 18.37 ? 360 GLY A N   1 
ATOM   2880  C CA  . GLY A 1 361 ? 3.932   5.903   78.627  1.00 17.74 ? 360 GLY A CA  1 
ATOM   2881  C C   . GLY A 1 361 ? 2.542   6.486   78.828  1.00 16.91 ? 360 GLY A C   1 
ATOM   2882  O O   . GLY A 1 361 ? 2.325   7.316   79.714  1.00 17.58 ? 360 GLY A O   1 
ATOM   2883  N N   . LYS A 1 362 ? 1.610   6.043   77.984  1.00 17.91 ? 361 LYS A N   1 
ATOM   2884  C CA  . LYS A 1 362 ? 0.219   6.518   77.969  1.00 18.86 ? 361 LYS A CA  1 
ATOM   2885  C C   . LYS A 1 362 ? -0.778  5.359   78.052  1.00 19.40 ? 361 LYS A C   1 
ATOM   2886  O O   . LYS A 1 362 ? -0.410  4.204   77.821  1.00 20.16 ? 361 LYS A O   1 
ATOM   2887  C CB  . LYS A 1 362 ? -0.037  7.290   76.668  1.00 16.99 ? 361 LYS A CB  1 
ATOM   2888  C CG  . LYS A 1 362 ? 0.973   8.399   76.365  1.00 17.25 ? 361 LYS A CG  1 
ATOM   2889  C CD  . LYS A 1 362 ? 0.742   9.631   77.225  1.00 15.53 ? 361 LYS A CD  1 
ATOM   2890  C CE  . LYS A 1 362 ? 1.956   10.558  77.207  1.00 12.60 ? 361 LYS A CE  1 
ATOM   2891  N NZ  . LYS A 1 362 ? 2.262   11.097  75.848  1.00 10.27 ? 361 LYS A NZ  1 
ATOM   2892  N N   . TYR A 1 363 ? -2.040  5.662   78.354  1.00 19.26 ? 362 TYR A N   1 
ATOM   2893  C CA  . TYR A 1 363 ? -3.041  4.604   78.449  1.00 20.32 ? 362 TYR A CA  1 
ATOM   2894  C C   . TYR A 1 363 ? -4.428  4.982   77.930  1.00 21.72 ? 362 TYR A C   1 
ATOM   2895  O O   . TYR A 1 363 ? -5.361  4.173   77.983  1.00 22.13 ? 362 TYR A O   1 
ATOM   2896  C CB  . TYR A 1 363 ? -3.132  4.095   79.896  1.00 20.21 ? 362 TYR A CB  1 
ATOM   2897  C CG  . TYR A 1 363 ? -3.949  4.947   80.836  1.00 19.69 ? 362 TYR A CG  1 
ATOM   2898  C CD1 . TYR A 1 363 ? -5.109  4.437   81.426  1.00 19.36 ? 362 TYR A CD1 1 
ATOM   2899  C CD2 . TYR A 1 363 ? -3.558  6.249   81.162  1.00 20.56 ? 362 TYR A CD2 1 
ATOM   2900  C CE1 . TYR A 1 363 ? -5.861  5.193   82.320  1.00 19.17 ? 362 TYR A CE1 1 
ATOM   2901  C CE2 . TYR A 1 363 ? -4.307  7.022   82.058  1.00 21.38 ? 362 TYR A CE2 1 
ATOM   2902  C CZ  . TYR A 1 363 ? -5.456  6.485   82.633  1.00 20.91 ? 362 TYR A CZ  1 
ATOM   2903  O OH  . TYR A 1 363 ? -6.197  7.223   83.528  1.00 19.56 ? 362 TYR A OH  1 
ATOM   2904  N N   . ILE A 1 364 ? -4.557  6.208   77.428  1.00 21.65 ? 363 ILE A N   1 
ATOM   2905  C CA  . ILE A 1 364 ? -5.821  6.689   76.876  1.00 20.89 ? 363 ILE A CA  1 
ATOM   2906  C C   . ILE A 1 364 ? -5.636  6.934   75.377  1.00 21.60 ? 363 ILE A C   1 
ATOM   2907  O O   . ILE A 1 364 ? -4.720  7.640   74.966  1.00 21.73 ? 363 ILE A O   1 
ATOM   2908  C CB  . ILE A 1 364 ? -6.268  7.992   77.572  1.00 21.68 ? 363 ILE A CB  1 
ATOM   2909  C CG1 . ILE A 1 364 ? -6.492  7.726   79.063  1.00 21.90 ? 363 ILE A CG1 1 
ATOM   2910  C CG2 . ILE A 1 364 ? -7.551  8.526   76.931  1.00 20.78 ? 363 ILE A CG2 1 
ATOM   2911  C CD1 . ILE A 1 364 ? -7.543  6.662   79.346  1.00 22.30 ? 363 ILE A CD1 1 
ATOM   2912  N N   . THR A 1 365 ? -6.501  6.340   74.562  1.00 21.61 ? 364 THR A N   1 
ATOM   2913  C CA  . THR A 1 365 ? -6.402  6.484   73.114  1.00 22.82 ? 364 THR A CA  1 
ATOM   2914  C C   . THR A 1 365 ? -7.024  7.763   72.570  1.00 25.04 ? 364 THR A C   1 
ATOM   2915  O O   . THR A 1 365 ? -7.661  8.528   73.298  1.00 26.31 ? 364 THR A O   1 
ATOM   2916  C CB  . THR A 1 365 ? -7.053  5.289   72.380  1.00 23.16 ? 364 THR A CB  1 
ATOM   2917  O OG1 . THR A 1 365 ? -8.465  5.297   72.609  1.00 23.33 ? 364 THR A OG1 1 
ATOM   2918  C CG2 . THR A 1 365 ? -6.467  3.972   72.880  1.00 23.63 ? 364 THR A CG2 1 
ATOM   2919  N N   . LYS A 1 366 ? -6.835  7.975   71.272  1.00 25.90 ? 365 LYS A N   1 
ATOM   2920  C CA  . LYS A 1 366 ? -7.344  9.153   70.579  1.00 27.91 ? 365 LYS A CA  1 
ATOM   2921  C C   . LYS A 1 366 ? -8.845  9.364   70.747  1.00 27.64 ? 365 LYS A C   1 
ATOM   2922  O O   . LYS A 1 366 ? -9.321  10.499  70.744  1.00 28.47 ? 365 LYS A O   1 
ATOM   2923  C CB  . LYS A 1 366 ? -7.015  9.063   69.086  1.00 26.86 ? 365 LYS A CB  1 
ATOM   2924  C CG  . LYS A 1 366 ? -7.358  10.318  68.298  1.00 32.27 ? 365 LYS A CG  1 
ATOM   2925  C CD  . LYS A 1 366 ? -7.281  10.087  66.790  1.00 34.87 ? 365 LYS A CD  1 
ATOM   2926  C CE  . LYS A 1 366 ? -5.894  9.661   66.343  1.00 35.02 ? 365 LYS A CE  1 
ATOM   2927  N NZ  . LYS A 1 366 ? -5.826  9.460   64.863  1.00 38.34 ? 365 LYS A NZ  1 
ATOM   2928  N N   . SER A 1 367 ? -9.590  8.276   70.891  1.00 28.11 ? 366 SER A N   1 
ATOM   2929  C CA  . SER A 1 367 ? -11.037 8.373   71.034  1.00 28.37 ? 366 SER A CA  1 
ATOM   2930  C C   . SER A 1 367 ? -11.476 8.503   72.485  1.00 28.92 ? 366 SER A C   1 
ATOM   2931  O O   . SER A 1 367 ? -12.669 8.565   72.774  1.00 29.82 ? 366 SER A O   1 
ATOM   2932  C CB  . SER A 1 367 ? -11.704 7.154   70.397  1.00 28.42 ? 366 SER A CB  1 
ATOM   2933  O OG  . SER A 1 367 ? -11.215 5.964   70.981  1.00 31.55 ? 366 SER A OG  1 
ATOM   2934  N N   . GLY A 1 368 ? -10.513 8.548   73.398  1.00 28.33 ? 367 GLY A N   1 
ATOM   2935  C CA  . GLY A 1 368 ? -10.850 8.677   74.802  1.00 27.47 ? 367 GLY A CA  1 
ATOM   2936  C C   . GLY A 1 368 ? -10.986 7.335   75.489  1.00 27.55 ? 367 GLY A C   1 
ATOM   2937  O O   . GLY A 1 368 ? -11.214 7.270   76.696  1.00 28.79 ? 367 GLY A O   1 
ATOM   2938  N N   . THR A 1 369 ? -10.844 6.263   74.717  1.00 28.53 ? 368 THR A N   1 
ATOM   2939  C CA  . THR A 1 369 ? -10.941 4.903   75.239  1.00 29.58 ? 368 THR A CA  1 
ATOM   2940  C C   . THR A 1 369 ? -9.636  4.466   75.906  1.00 28.43 ? 368 THR A C   1 
ATOM   2941  O O   . THR A 1 369 ? -8.546  4.791   75.436  1.00 26.50 ? 368 THR A O   1 
ATOM   2942  C CB  . THR A 1 369 ? -11.247 3.898   74.110  1.00 30.79 ? 368 THR A CB  1 
ATOM   2943  O OG1 . THR A 1 369 ? -12.483 4.247   73.478  1.00 35.20 ? 368 THR A OG1 1 
ATOM   2944  C CG2 . THR A 1 369 ? -11.354 2.483   74.666  1.00 33.95 ? 368 THR A CG2 1 
ATOM   2945  N N   . ARG A 1 370 ? -9.753  3.723   77.001  1.00 28.26 ? 369 ARG A N   1 
ATOM   2946  C CA  . ARG A 1 370 ? -8.577  3.227   77.708  1.00 28.23 ? 369 ARG A CA  1 
ATOM   2947  C C   . ARG A 1 370 ? -8.006  2.057   76.912  1.00 27.15 ? 369 ARG A C   1 
ATOM   2948  O O   . ARG A 1 370 ? -8.761  1.245   76.383  1.00 25.85 ? 369 ARG A O   1 
ATOM   2949  C CB  . ARG A 1 370 ? -8.951  2.737   79.111  1.00 28.26 ? 369 ARG A CB  1 
ATOM   2950  C CG  . ARG A 1 370 ? -7.745  2.319   79.950  1.00 30.72 ? 369 ARG A CG  1 
ATOM   2951  C CD  . ARG A 1 370 ? -8.149  1.639   81.245  1.00 31.52 ? 369 ARG A CD  1 
ATOM   2952  N NE  . ARG A 1 370 ? -7.007  1.437   82.137  1.00 34.36 ? 369 ARG A NE  1 
ATOM   2953  C CZ  . ARG A 1 370 ? -5.899  0.772   81.812  1.00 33.51 ? 369 ARG A CZ  1 
ATOM   2954  N NH1 . ARG A 1 370 ? -5.762  0.232   80.607  1.00 33.71 ? 369 ARG A NH1 1 
ATOM   2955  N NH2 . ARG A 1 370 ? -4.924  0.642   82.700  1.00 32.75 ? 369 ARG A NH2 1 
ATOM   2956  N N   . VAL A 1 371 ? -6.683  1.978   76.813  1.00 24.82 ? 370 VAL A N   1 
ATOM   2957  C CA  . VAL A 1 371 ? -6.071  0.874   76.089  1.00 25.05 ? 370 VAL A CA  1 
ATOM   2958  C C   . VAL A 1 371 ? -6.353  -0.417  76.854  1.00 24.74 ? 370 VAL A C   1 
ATOM   2959  O O   . VAL A 1 371 ? -6.569  -0.394  78.064  1.00 25.09 ? 370 VAL A O   1 
ATOM   2960  C CB  . VAL A 1 371 ? -4.531  1.039   75.963  1.00 25.34 ? 370 VAL A CB  1 
ATOM   2961  C CG1 . VAL A 1 371 ? -4.201  2.243   75.092  1.00 23.50 ? 370 VAL A CG1 1 
ATOM   2962  C CG2 . VAL A 1 371 ? -3.901  1.177   77.348  1.00 23.89 ? 370 VAL A CG2 1 
ATOM   2963  N N   . ASP A 1 372 ? -6.368  -1.536  76.144  1.00 24.70 ? 371 ASP A N   1 
ATOM   2964  C CA  . ASP A 1 372 ? -6.590  -2.835  76.771  1.00 26.24 ? 371 ASP A CA  1 
ATOM   2965  C C   . ASP A 1 372 ? -5.420  -3.713  76.333  1.00 26.84 ? 371 ASP A C   1 
ATOM   2966  O O   . ASP A 1 372 ? -5.551  -4.925  76.137  1.00 27.33 ? 371 ASP A O   1 
ATOM   2967  C CB  . ASP A 1 372 ? -7.933  -3.425  76.319  1.00 27.71 ? 371 ASP A CB  1 
ATOM   2968  C CG  . ASP A 1 372 ? -7.980  -3.709  74.828  1.00 30.88 ? 371 ASP A CG  1 
ATOM   2969  O OD1 . ASP A 1 372 ? -7.268  -3.025  74.060  1.00 32.04 ? 371 ASP A OD1 1 
ATOM   2970  O OD2 . ASP A 1 372 ? -8.744  -4.609  74.424  1.00 32.27 ? 371 ASP A OD2 1 
ATOM   2971  N N   . HIS A 1 373 ? -4.268  -3.060  76.191  1.00 25.71 ? 372 HIS A N   1 
ATOM   2972  C CA  . HIS A 1 373 ? -3.023  -3.687  75.765  1.00 24.76 ? 372 HIS A CA  1 
ATOM   2973  C C   . HIS A 1 373 ? -1.866  -2.838  76.288  1.00 24.58 ? 372 HIS A C   1 
ATOM   2974  O O   . HIS A 1 373 ? -2.075  -1.717  76.759  1.00 24.37 ? 372 HIS A O   1 
ATOM   2975  C CB  . HIS A 1 373 ? -2.976  -3.738  74.233  1.00 23.92 ? 372 HIS A CB  1 
ATOM   2976  C CG  . HIS A 1 373 ? -3.166  -2.402  73.578  1.00 24.91 ? 372 HIS A CG  1 
ATOM   2977  N ND1 . HIS A 1 373 ? -2.177  -1.442  73.539  1.00 26.16 ? 372 HIS A ND1 1 
ATOM   2978  C CD2 . HIS A 1 373 ? -4.242  -1.857  72.962  1.00 25.41 ? 372 HIS A CD2 1 
ATOM   2979  C CE1 . HIS A 1 373 ? -2.634  -0.364  72.927  1.00 23.13 ? 372 HIS A CE1 1 
ATOM   2980  N NE2 . HIS A 1 373 ? -3.885  -0.589  72.568  1.00 24.95 ? 372 HIS A NE2 1 
ATOM   2981  N N   . GLN A 1 374 ? -0.650  -3.366  76.206  1.00 23.21 ? 373 GLN A N   1 
ATOM   2982  C CA  . GLN A 1 374 ? 0.525   -2.629  76.669  1.00 21.95 ? 373 GLN A CA  1 
ATOM   2983  C C   . GLN A 1 374 ? 0.931   -1.531  75.691  1.00 20.93 ? 373 GLN A C   1 
ATOM   2984  O O   . GLN A 1 374 ? 0.642   -1.606  74.491  1.00 19.69 ? 373 GLN A O   1 
ATOM   2985  C CB  . GLN A 1 374 ? 1.704   -3.584  76.869  1.00 23.19 ? 373 GLN A CB  1 
ATOM   2986  C CG  . GLN A 1 374 ? 1.510   -4.557  78.018  1.00 27.74 ? 373 GLN A CG  1 
ATOM   2987  C CD  . GLN A 1 374 ? 1.283   -3.838  79.337  1.00 31.18 ? 373 GLN A CD  1 
ATOM   2988  O OE1 . GLN A 1 374 ? 2.158   -3.117  79.824  1.00 31.27 ? 373 GLN A OE1 1 
ATOM   2989  N NE2 . GLN A 1 374 ? 0.101   -4.023  79.918  1.00 35.41 ? 373 GLN A NE2 1 
ATOM   2990  N N   . THR A 1 375 ? 1.582   -0.496  76.207  1.00 17.68 ? 374 THR A N   1 
ATOM   2991  C CA  . THR A 1 375 ? 2.046   0.573   75.341  1.00 18.86 ? 374 THR A CA  1 
ATOM   2992  C C   . THR A 1 375 ? 3.551   0.699   75.504  1.00 18.98 ? 374 THR A C   1 
ATOM   2993  O O   . THR A 1 375 ? 4.250   -0.313  75.548  1.00 17.78 ? 374 THR A O   1 
ATOM   2994  C CB  . THR A 1 375 ? 1.345   1.935   75.635  1.00 16.47 ? 374 THR A CB  1 
ATOM   2995  O OG1 . THR A 1 375 ? 1.428   2.249   77.030  1.00 19.07 ? 374 THR A OG1 1 
ATOM   2996  C CG2 . THR A 1 375 ? -0.123  1.871   75.204  1.00 18.73 ? 374 THR A CG2 1 
ATOM   2997  N N   . GLY A 1 376 ? 4.044   1.930   75.602  1.00 19.10 ? 375 GLY A N   1 
ATOM   2998  C CA  . GLY A 1 376 ? 5.473   2.148   75.731  1.00 17.02 ? 375 GLY A CA  1 
ATOM   2999  C C   . GLY A 1 376 ? 6.181   1.284   76.757  1.00 17.66 ? 375 GLY A C   1 
ATOM   3000  O O   . GLY A 1 376 ? 5.682   1.084   77.864  1.00 17.13 ? 375 GLY A O   1 
ATOM   3001  N N   . PRO A 1 377 ? 7.364   0.755   76.410  1.00 18.33 ? 376 PRO A N   1 
ATOM   3002  C CA  . PRO A 1 377 ? 8.135   -0.090  77.321  1.00 18.74 ? 376 PRO A CA  1 
ATOM   3003  C C   . PRO A 1 377 ? 9.064   0.724   78.209  1.00 19.41 ? 376 PRO A C   1 
ATOM   3004  O O   . PRO A 1 377 ? 9.251   1.932   78.007  1.00 18.60 ? 376 PRO A O   1 
ATOM   3005  C CB  . PRO A 1 377 ? 8.934   -0.960  76.369  1.00 20.62 ? 376 PRO A CB  1 
ATOM   3006  C CG  . PRO A 1 377 ? 9.309   0.047   75.313  1.00 17.74 ? 376 PRO A CG  1 
ATOM   3007  C CD  . PRO A 1 377 ? 7.977   0.755   75.067  1.00 17.89 ? 376 PRO A CD  1 
ATOM   3008  N N   . ILE A 1 378 ? 9.648   0.047   79.191  1.00 18.61 ? 377 ILE A N   1 
ATOM   3009  C CA  . ILE A 1 378 ? 10.601  0.674   80.083  1.00 18.79 ? 377 ILE A CA  1 
ATOM   3010  C C   . ILE A 1 378 ? 11.949  0.595   79.358  1.00 19.34 ? 377 ILE A C   1 
ATOM   3011  O O   . ILE A 1 378 ? 12.465  -0.496  79.107  1.00 18.72 ? 377 ILE A O   1 
ATOM   3012  C CB  . ILE A 1 378 ? 10.666  -0.079  81.422  1.00 18.86 ? 377 ILE A CB  1 
ATOM   3013  C CG1 . ILE A 1 378 ? 9.331   0.086   82.156  1.00 19.71 ? 377 ILE A CG1 1 
ATOM   3014  C CG2 . ILE A 1 378 ? 11.822  0.436   82.257  1.00 16.19 ? 377 ILE A CG2 1 
ATOM   3015  C CD1 . ILE A 1 378 ? 9.120   -0.901  83.273  1.00 21.98 ? 377 ILE A CD1 1 
ATOM   3016  N N   . VAL A 1 379 ? 12.501  1.751   79.000  1.00 17.37 ? 378 VAL A N   1 
ATOM   3017  C CA  . VAL A 1 379 ? 13.782  1.801   78.296  1.00 19.20 ? 378 VAL A CA  1 
ATOM   3018  C C   . VAL A 1 379 ? 14.924  2.008   79.280  1.00 18.60 ? 378 VAL A C   1 
ATOM   3019  O O   . VAL A 1 379 ? 14.816  2.811   80.209  1.00 21.44 ? 378 VAL A O   1 
ATOM   3020  C CB  . VAL A 1 379 ? 13.775  2.936   77.246  1.00 19.06 ? 378 VAL A CB  1 
ATOM   3021  C CG1 . VAL A 1 379 ? 15.120  3.027   76.527  1.00 16.48 ? 378 VAL A CG1 1 
ATOM   3022  C CG2 . VAL A 1 379 ? 12.653  2.688   76.260  1.00 18.97 ? 378 VAL A CG2 1 
ATOM   3023  N N   . TRP A 1 380 ? 16.013  1.272   79.081  1.00 17.99 ? 379 TRP A N   1 
ATOM   3024  C CA  . TRP A 1 380 ? 17.174  1.365   79.961  1.00 17.94 ? 379 TRP A CA  1 
ATOM   3025  C C   . TRP A 1 380 ? 18.446  0.912   79.246  1.00 18.22 ? 379 TRP A C   1 
ATOM   3026  O O   . TRP A 1 380 ? 18.408  0.493   78.087  1.00 17.86 ? 379 TRP A O   1 
ATOM   3027  C CB  . TRP A 1 380 ? 16.966  0.496   81.202  1.00 16.37 ? 379 TRP A CB  1 
ATOM   3028  C CG  . TRP A 1 380 ? 16.726  -0.950  80.874  1.00 17.56 ? 379 TRP A CG  1 
ATOM   3029  C CD1 . TRP A 1 380 ? 15.623  -1.484  80.263  1.00 18.25 ? 379 TRP A CD1 1 
ATOM   3030  C CD2 . TRP A 1 380 ? 17.623  -2.041  81.106  1.00 18.50 ? 379 TRP A CD2 1 
ATOM   3031  N NE1 . TRP A 1 380 ? 15.781  -2.841  80.099  1.00 19.23 ? 379 TRP A NE1 1 
ATOM   3032  C CE2 . TRP A 1 380 ? 17.000  -3.210  80.607  1.00 19.76 ? 379 TRP A CE2 1 
ATOM   3033  C CE3 . TRP A 1 380 ? 18.895  -2.147  81.684  1.00 19.24 ? 379 TRP A CE3 1 
ATOM   3034  C CZ2 . TRP A 1 380 ? 17.608  -4.471  80.669  1.00 19.96 ? 379 TRP A CZ2 1 
ATOM   3035  C CZ3 . TRP A 1 380 ? 19.504  -3.405  81.745  1.00 23.23 ? 379 TRP A CZ3 1 
ATOM   3036  C CH2 . TRP A 1 380 ? 18.857  -4.548  81.239  1.00 21.04 ? 379 TRP A CH2 1 
ATOM   3037  N N   . GLY A 1 381 ? 19.571  0.990   79.950  1.00 18.42 ? 380 GLY A N   1 
ATOM   3038  C CA  . GLY A 1 381 ? 20.828  0.574   79.360  1.00 19.63 ? 380 GLY A CA  1 
ATOM   3039  C C   . GLY A 1 381 ? 22.050  1.329   79.853  1.00 21.39 ? 380 GLY A C   1 
ATOM   3040  O O   . GLY A 1 381 ? 21.950  2.350   80.542  1.00 19.88 ? 380 GLY A O   1 
ATOM   3041  N N   . GLU A 1 382 ? 23.217  0.819   79.478  1.00 20.30 ? 381 GLU A N   1 
ATOM   3042  C CA  . GLU A 1 382 ? 24.488  1.417   79.854  1.00 21.74 ? 381 GLU A CA  1 
ATOM   3043  C C   . GLU A 1 382 ? 25.412  1.118   78.666  1.00 21.80 ? 381 GLU A C   1 
ATOM   3044  O O   . GLU A 1 382 ? 25.268  0.083   78.019  1.00 19.70 ? 381 GLU A O   1 
ATOM   3045  C CB  . GLU A 1 382 ? 24.979  0.751   81.141  1.00 22.00 ? 381 GLU A CB  1 
ATOM   3046  C CG  . GLU A 1 382 ? 25.851  1.604   82.028  1.00 27.44 ? 381 GLU A CG  1 
ATOM   3047  C CD  . GLU A 1 382 ? 25.200  2.915   82.455  1.00 24.43 ? 381 GLU A CD  1 
ATOM   3048  O OE1 . GLU A 1 382 ? 24.230  2.904   83.239  1.00 25.11 ? 381 GLU A OE1 1 
ATOM   3049  O OE2 . GLU A 1 382 ? 25.677  3.969   82.002  1.00 22.52 ? 381 GLU A OE2 1 
ATOM   3050  N N   . PRO A 1 383 ? 26.359  2.021   78.351  1.00 21.86 ? 382 PRO A N   1 
ATOM   3051  C CA  . PRO A 1 383 ? 27.271  1.795   77.221  1.00 24.44 ? 382 PRO A CA  1 
ATOM   3052  C C   . PRO A 1 383 ? 28.147  0.538   77.286  1.00 25.54 ? 382 PRO A C   1 
ATOM   3053  O O   . PRO A 1 383 ? 28.404  -0.004  78.362  1.00 24.97 ? 382 PRO A O   1 
ATOM   3054  C CB  . PRO A 1 383 ? 28.107  3.067   77.198  1.00 20.83 ? 382 PRO A CB  1 
ATOM   3055  C CG  . PRO A 1 383 ? 28.174  3.428   78.639  1.00 21.06 ? 382 PRO A CG  1 
ATOM   3056  C CD  . PRO A 1 383 ? 26.741  3.239   79.079  1.00 21.26 ? 382 PRO A CD  1 
ATOM   3057  N N   . GLY A 1 384 ? 28.444  0.127   76.085  1.00 33.37 ? 383 GLY A N   1 
ATOM   3058  C CA  . GLY A 1 384 ? 29.252  -1.011  75.770  1.00 32.15 ? 383 GLY A CA  1 
ATOM   3059  C C   . GLY A 1 384 ? 30.567  -1.137  76.465  1.00 31.94 ? 383 GLY A C   1 
ATOM   3060  O O   . GLY A 1 384 ? 31.485  -0.367  76.367  1.00 32.31 ? 383 GLY A O   1 
ATOM   3061  N N   . THR A 1 385 ? 30.551  -2.321  77.037  1.00 33.90 ? 384 THR A N   1 
ATOM   3062  C CA  . THR A 1 385 ? 31.369  -3.165  77.918  1.00 27.64 ? 384 THR A CA  1 
ATOM   3063  C C   . THR A 1 385 ? 31.080  -2.807  79.337  1.00 23.03 ? 384 THR A C   1 
ATOM   3064  O O   . THR A 1 385 ? 31.027  -3.692  80.144  1.00 22.87 ? 384 THR A O   1 
ATOM   3065  C CB  . THR A 1 385 ? 32.939  -3.484  77.624  1.00 26.88 ? 384 THR A CB  1 
ATOM   3066  O OG1 . THR A 1 385 ? 33.806  -2.520  78.210  1.00 26.27 ? 384 THR A OG1 1 
ATOM   3067  C CG2 . THR A 1 385 ? 33.175  -3.766  76.152  1.00 27.56 ? 384 THR A CG2 1 
ATOM   3068  N N   . ASN A 1 386 ? 30.832  -1.530  79.671  1.00 22.21 ? 385 ASN A N   1 
ATOM   3069  C CA  . ASN A 1 386 ? 30.470  -1.225  81.061  1.00 22.43 ? 385 ASN A CA  1 
ATOM   3070  C C   . ASN A 1 386 ? 29.208  -2.038  81.423  1.00 22.83 ? 385 ASN A C   1 
ATOM   3071  O O   . ASN A 1 386 ? 29.225  -2.785  82.380  1.00 22.56 ? 385 ASN A O   1 
ATOM   3072  C CB  . ASN A 1 386 ? 30.118  0.252   81.275  1.00 22.55 ? 385 ASN A CB  1 
ATOM   3073  C CG  . ASN A 1 386 ? 31.264  1.198   80.905  1.00 29.65 ? 385 ASN A CG  1 
ATOM   3074  O OD1 . ASN A 1 386 ? 32.412  0.776   80.722  1.00 30.46 ? 385 ASN A OD1 1 
ATOM   3075  N ND2 . ASN A 1 386 ? 30.951  2.497   80.811  1.00 28.67 ? 385 ASN A ND2 1 
ATOM   3076  N N   . GLY A 1 387 ? 28.134  -1.890  80.639  1.00 21.89 ? 386 GLY A N   1 
ATOM   3077  C CA  . GLY A 1 387 ? 26.895  -2.616  80.933  1.00 22.48 ? 386 GLY A CA  1 
ATOM   3078  C C   . GLY A 1 387 ? 27.119  -4.115  80.858  1.00 22.74 ? 386 GLY A C   1 
ATOM   3079  O O   . GLY A 1 387 ? 26.560  -4.889  81.614  1.00 22.86 ? 386 GLY A O   1 
ATOM   3080  N N   . GLN A 1 388 ? 27.971  -4.519  79.924  1.00 23.29 ? 387 GLN A N   1 
ATOM   3081  C CA  . GLN A 1 388 ? 28.298  -5.917  79.713  1.00 24.50 ? 387 GLN A CA  1 
ATOM   3082  C C   . GLN A 1 388 ? 28.905  -6.567  80.974  1.00 26.60 ? 387 GLN A C   1 
ATOM   3083  O O   . GLN A 1 388 ? 28.657  -7.741  81.254  1.00 28.29 ? 387 GLN A O   1 
ATOM   3084  C CB  . GLN A 1 388 ? 29.236  -6.014  78.503  1.00 25.05 ? 387 GLN A CB  1 
ATOM   3085  C CG  . GLN A 1 388 ? 29.855  -7.383  78.267  1.00 22.74 ? 387 GLN A CG  1 
ATOM   3086  C CD  . GLN A 1 388 ? 30.783  -7.411  77.048  1.00 22.34 ? 387 GLN A CD  1 
ATOM   3087  O OE1 . GLN A 1 388 ? 31.836  -8.081  77.069  1.00 25.44 ? 387 GLN A OE1 1 
ATOM   3088  N NE2 . GLN A 1 388 ? 30.407  -6.711  75.985  1.00 15.65 ? 387 GLN A NE2 1 
ATOM   3089  N N   . HIS A 1 389 ? 29.694  -5.803  81.738  1.00 25.16 ? 388 HIS A N   1 
ATOM   3090  C CA  . HIS A 1 389 ? 30.297  -6.320  82.963  1.00 24.99 ? 388 HIS A CA  1 
ATOM   3091  C C   . HIS A 1 389 ? 29.454  -5.957  84.183  1.00 23.89 ? 388 HIS A C   1 
ATOM   3092  O O   . HIS A 1 389 ? 29.895  -6.105  85.324  1.00 23.32 ? 388 HIS A O   1 
ATOM   3093  C CB  . HIS A 1 389 ? 31.716  -5.765  83.130  1.00 26.63 ? 388 HIS A CB  1 
ATOM   3094  C CG  . HIS A 1 389 ? 32.638  -6.134  82.010  1.00 28.67 ? 388 HIS A CG  1 
ATOM   3095  N ND1 . HIS A 1 389 ? 32.931  -7.442  81.691  1.00 29.61 ? 388 HIS A ND1 1 
ATOM   3096  C CD2 . HIS A 1 389 ? 33.302  -5.371  81.110  1.00 29.15 ? 388 HIS A CD2 1 
ATOM   3097  C CE1 . HIS A 1 389 ? 33.730  -7.470  80.640  1.00 29.08 ? 388 HIS A CE1 1 
ATOM   3098  N NE2 . HIS A 1 389 ? 33.970  -6.226  80.268  1.00 30.66 ? 388 HIS A NE2 1 
ATOM   3099  N N   . ALA A 1 390 ? 28.229  -5.498  83.940  1.00 22.28 ? 389 ALA A N   1 
ATOM   3100  C CA  . ALA A 1 390 ? 27.354  -5.114  85.034  1.00 20.95 ? 389 ALA A CA  1 
ATOM   3101  C C   . ALA A 1 390 ? 26.090  -5.951  85.161  1.00 19.53 ? 389 ALA A C   1 
ATOM   3102  O O   . ALA A 1 390 ? 25.848  -6.552  86.199  1.00 20.63 ? 389 ALA A O   1 
ATOM   3103  C CB  . ALA A 1 390 ? 26.981  -3.633  84.910  1.00 19.63 ? 389 ALA A CB  1 
ATOM   3104  N N   . PHE A 1 391 ? 25.295  -6.005  84.102  1.00 18.87 ? 390 PHE A N   1 
ATOM   3105  C CA  . PHE A 1 391 ? 24.028  -6.724  84.158  1.00 19.25 ? 390 PHE A CA  1 
ATOM   3106  C C   . PHE A 1 391 ? 23.763  -7.761  83.063  1.00 19.38 ? 390 PHE A C   1 
ATOM   3107  O O   . PHE A 1 391 ? 22.664  -8.309  82.993  1.00 19.14 ? 390 PHE A O   1 
ATOM   3108  C CB  . PHE A 1 391 ? 22.892  -5.696  84.161  1.00 16.97 ? 390 PHE A CB  1 
ATOM   3109  C CG  . PHE A 1 391 ? 22.988  -4.688  83.044  1.00 16.35 ? 390 PHE A CG  1 
ATOM   3110  C CD1 . PHE A 1 391 ? 22.746  -5.061  81.724  1.00 14.52 ? 390 PHE A CD1 1 
ATOM   3111  C CD2 . PHE A 1 391 ? 23.346  -3.364  83.311  1.00 18.25 ? 390 PHE A CD2 1 
ATOM   3112  C CE1 . PHE A 1 391 ? 22.857  -4.131  80.683  1.00 14.39 ? 390 PHE A CE1 1 
ATOM   3113  C CE2 . PHE A 1 391 ? 23.459  -2.422  82.271  1.00 17.33 ? 390 PHE A CE2 1 
ATOM   3114  C CZ  . PHE A 1 391 ? 23.213  -2.813  80.958  1.00 15.86 ? 390 PHE A CZ  1 
ATOM   3115  N N   . TYR A 1 392 ? 24.745  -8.028  82.208  1.00 19.01 ? 391 TYR A N   1 
ATOM   3116  C CA  . TYR A 1 392 ? 24.540  -8.997  81.133  1.00 19.46 ? 391 TYR A CA  1 
ATOM   3117  C C   . TYR A 1 392 ? 24.256  -10.419 81.621  1.00 17.73 ? 391 TYR A C   1 
ATOM   3118  O O   . TYR A 1 392 ? 23.688  -11.223 80.886  1.00 17.54 ? 391 TYR A O   1 
ATOM   3119  C CB  . TYR A 1 392 ? 25.737  -9.005  80.187  1.00 18.93 ? 391 TYR A CB  1 
ATOM   3120  C CG  . TYR A 1 392 ? 25.684  -7.944  79.106  1.00 19.22 ? 391 TYR A CG  1 
ATOM   3121  C CD1 . TYR A 1 392 ? 25.225  -6.658  79.384  1.00 17.80 ? 391 TYR A CD1 1 
ATOM   3122  C CD2 . TYR A 1 392 ? 26.172  -8.205  77.827  1.00 19.85 ? 391 TYR A CD2 1 
ATOM   3123  C CE1 . TYR A 1 392 ? 25.263  -5.658  78.423  1.00 18.23 ? 391 TYR A CE1 1 
ATOM   3124  C CE2 . TYR A 1 392 ? 26.213  -7.211  76.856  1.00 19.47 ? 391 TYR A CE2 1 
ATOM   3125  C CZ  . TYR A 1 392 ? 25.763  -5.937  77.164  1.00 18.99 ? 391 TYR A CZ  1 
ATOM   3126  O OH  . TYR A 1 392 ? 25.859  -4.932  76.230  1.00 18.40 ? 391 TYR A OH  1 
ATOM   3127  N N   . GLN A 1 393 ? 24.656  -10.725 82.852  1.00 17.88 ? 392 GLN A N   1 
ATOM   3128  C CA  . GLN A 1 393 ? 24.411  -12.044 83.435  1.00 16.62 ? 392 GLN A CA  1 
ATOM   3129  C C   . GLN A 1 393 ? 22.912  -12.349 83.378  1.00 17.68 ? 392 GLN A C   1 
ATOM   3130  O O   . GLN A 1 393 ? 22.497  -13.459 83.022  1.00 17.92 ? 392 GLN A O   1 
ATOM   3131  C CB  . GLN A 1 393 ? 24.897  -12.058 84.889  1.00 16.40 ? 392 GLN A CB  1 
ATOM   3132  C CG  . GLN A 1 393 ? 24.305  -13.154 85.764  1.00 14.21 ? 392 GLN A CG  1 
ATOM   3133  C CD  . GLN A 1 393 ? 24.751  -14.552 85.367  1.00 16.35 ? 392 GLN A CD  1 
ATOM   3134  O OE1 . GLN A 1 393 ? 25.935  -14.801 85.159  1.00 17.78 ? 392 GLN A OE1 1 
ATOM   3135  N NE2 . GLN A 1 393 ? 23.801  -15.474 85.280  1.00 16.15 ? 392 GLN A NE2 1 
ATOM   3136  N N   . LEU A 1 394 ? 22.099  -11.348 83.709  1.00 17.30 ? 393 LEU A N   1 
ATOM   3137  C CA  . LEU A 1 394 ? 20.648  -11.509 83.704  1.00 16.80 ? 393 LEU A CA  1 
ATOM   3138  C C   . LEU A 1 394 ? 20.075  -11.597 82.290  1.00 16.82 ? 393 LEU A C   1 
ATOM   3139  O O   . LEU A 1 394 ? 19.101  -12.306 82.061  1.00 17.73 ? 393 LEU A O   1 
ATOM   3140  C CB  . LEU A 1 394 ? 19.976  -10.355 84.470  1.00 14.78 ? 393 LEU A CB  1 
ATOM   3141  C CG  . LEU A 1 394 ? 18.447  -10.445 84.620  1.00 13.25 ? 393 LEU A CG  1 
ATOM   3142  C CD1 . LEU A 1 394 ? 18.013  -9.861  85.966  1.00 10.32 ? 393 LEU A CD1 1 
ATOM   3143  C CD2 . LEU A 1 394 ? 17.761  -9.727  83.474  1.00 12.98 ? 393 LEU A CD2 1 
ATOM   3144  N N   . ILE A 1 395 ? 20.673  -10.884 81.341  1.00 15.93 ? 394 ILE A N   1 
ATOM   3145  C CA  . ILE A 1 395 ? 20.176  -10.926 79.969  1.00 16.67 ? 394 ILE A CA  1 
ATOM   3146  C C   . ILE A 1 395 ? 20.433  -12.301 79.334  1.00 16.56 ? 394 ILE A C   1 
ATOM   3147  O O   . ILE A 1 395 ? 19.635  -12.778 78.526  1.00 15.19 ? 394 ILE A O   1 
ATOM   3148  C CB  . ILE A 1 395 ? 20.828  -9.814  79.097  1.00 16.76 ? 394 ILE A CB  1 
ATOM   3149  C CG1 . ILE A 1 395 ? 20.479  -8.431  79.664  1.00 15.88 ? 394 ILE A CG1 1 
ATOM   3150  C CG2 . ILE A 1 395 ? 20.336  -9.917  77.654  1.00 14.69 ? 394 ILE A CG2 1 
ATOM   3151  C CD1 . ILE A 1 395 ? 21.129  -7.273  78.910  1.00 17.03 ? 394 ILE A CD1 1 
ATOM   3152  N N   . HIS A 1 396 ? 21.542  -12.929 79.718  1.00 16.76 ? 395 HIS A N   1 
ATOM   3153  C CA  . HIS A 1 396 ? 21.920  -14.245 79.195  1.00 18.61 ? 395 HIS A CA  1 
ATOM   3154  C C   . HIS A 1 396 ? 21.268  -15.432 79.891  1.00 18.52 ? 395 HIS A C   1 
ATOM   3155  O O   . HIS A 1 396 ? 20.829  -16.381 79.232  1.00 19.78 ? 395 HIS A O   1 
ATOM   3156  C CB  . HIS A 1 396 ? 23.436  -14.448 79.280  1.00 15.68 ? 395 HIS A CB  1 
ATOM   3157  C CG  . HIS A 1 396 ? 24.197  -13.830 78.154  1.00 17.74 ? 395 HIS A CG  1 
ATOM   3158  N ND1 . HIS A 1 396 ? 24.867  -12.632 78.278  1.00 19.72 ? 395 HIS A ND1 1 
ATOM   3159  C CD2 . HIS A 1 396 ? 24.380  -14.234 76.876  1.00 15.29 ? 395 HIS A CD2 1 
ATOM   3160  C CE1 . HIS A 1 396 ? 25.430  -12.324 77.124  1.00 17.69 ? 395 HIS A CE1 1 
ATOM   3161  N NE2 . HIS A 1 396 ? 25.150  -13.279 76.256  1.00 20.31 ? 395 HIS A NE2 1 
ATOM   3162  N N   . GLN A 1 397 ? 21.219  -15.380 81.220  1.00 19.78 ? 396 GLN A N   1 
ATOM   3163  C CA  . GLN A 1 397 ? 20.677  -16.484 82.006  1.00 19.82 ? 396 GLN A CA  1 
ATOM   3164  C C   . GLN A 1 397 ? 19.591  -16.132 83.005  1.00 19.78 ? 396 GLN A C   1 
ATOM   3165  O O   . GLN A 1 397 ? 19.329  -16.913 83.920  1.00 20.10 ? 396 GLN A O   1 
ATOM   3166  C CB  . GLN A 1 397 ? 21.805  -17.184 82.760  1.00 20.46 ? 396 GLN A CB  1 
ATOM   3167  C CG  . GLN A 1 397 ? 22.933  -17.704 81.887  1.00 21.63 ? 396 GLN A CG  1 
ATOM   3168  C CD  . GLN A 1 397 ? 23.928  -18.515 82.690  1.00 23.02 ? 396 GLN A CD  1 
ATOM   3169  O OE1 . GLN A 1 397 ? 24.413  -18.062 83.725  1.00 21.73 ? 396 GLN A OE1 1 
ATOM   3170  N NE2 . GLN A 1 397 ? 24.234  -19.722 82.221  1.00 20.29 ? 396 GLN A NE2 1 
ATOM   3171  N N   . GLY A 1 398 ? 18.973  -14.965 82.846  1.00 18.39 ? 397 GLY A N   1 
ATOM   3172  C CA  . GLY A 1 398 ? 17.902  -14.569 83.747  1.00 17.91 ? 397 GLY A CA  1 
ATOM   3173  C C   . GLY A 1 398 ? 16.589  -15.164 83.272  1.00 20.00 ? 397 GLY A C   1 
ATOM   3174  O O   . GLY A 1 398 ? 16.596  -16.104 82.477  1.00 18.85 ? 397 GLY A O   1 
ATOM   3175  N N   . THR A 1 399 ? 15.464  -14.626 83.741  1.00 20.86 ? 398 THR A N   1 
ATOM   3176  C CA  . THR A 1 399 ? 14.155  -15.139 83.342  1.00 20.74 ? 398 THR A CA  1 
ATOM   3177  C C   . THR A 1 399 ? 13.353  -14.205 82.433  1.00 22.70 ? 398 THR A C   1 
ATOM   3178  O O   . THR A 1 399 ? 12.328  -14.608 81.880  1.00 24.84 ? 398 THR A O   1 
ATOM   3179  C CB  . THR A 1 399 ? 13.290  -15.509 84.591  1.00 21.27 ? 398 THR A CB  1 
ATOM   3180  O OG1 . THR A 1 399 ? 13.294  -14.424 85.532  1.00 19.11 ? 398 THR A OG1 1 
ATOM   3181  C CG2 . THR A 1 399 ? 13.845  -16.763 85.273  1.00 17.96 ? 398 THR A CG2 1 
ATOM   3182  N N   . GLU A 1 400 ? 13.814  -12.970 82.255  1.00 22.25 ? 399 GLU A N   1 
ATOM   3183  C CA  . GLU A 1 400 ? 13.093  -12.023 81.406  1.00 21.82 ? 399 GLU A CA  1 
ATOM   3184  C C   . GLU A 1 400 ? 13.582  -11.983 79.963  1.00 21.42 ? 399 GLU A C   1 
ATOM   3185  O O   . GLU A 1 400 ? 14.776  -12.136 79.695  1.00 21.89 ? 399 GLU A O   1 
ATOM   3186  C CB  . GLU A 1 400 ? 13.190  -10.596 81.972  1.00 25.70 ? 399 GLU A CB  1 
ATOM   3187  C CG  . GLU A 1 400 ? 12.682  -10.431 83.391  1.00 26.89 ? 399 GLU A CG  1 
ATOM   3188  C CD  . GLU A 1 400 ? 13.775  -10.614 84.425  1.00 28.45 ? 399 GLU A CD  1 
ATOM   3189  O OE1 . GLU A 1 400 ? 14.781  -11.296 84.131  1.00 29.50 ? 399 GLU A OE1 1 
ATOM   3190  O OE2 . GLU A 1 400 ? 13.619  -10.080 85.542  1.00 28.46 ? 399 GLU A OE2 1 
ATOM   3191  N N   . MET A 1 401 ? 12.649  -11.785 79.035  1.00 20.15 ? 400 MET A N   1 
ATOM   3192  C CA  . MET A 1 401 ? 12.996  -11.651 77.626  1.00 18.76 ? 400 MET A CA  1 
ATOM   3193  C C   . MET A 1 401 ? 13.211  -10.141 77.467  1.00 18.77 ? 400 MET A C   1 
ATOM   3194  O O   . MET A 1 401 ? 12.325  -9.346  77.797  1.00 17.50 ? 400 MET A O   1 
ATOM   3195  C CB  . MET A 1 401 ? 11.852  -12.119 76.731  1.00 19.59 ? 400 MET A CB  1 
ATOM   3196  C CG  . MET A 1 401 ? 12.168  -12.012 75.247  1.00 22.32 ? 400 MET A CG  1 
ATOM   3197  S SD  . MET A 1 401 ? 10.797  -12.524 74.189  1.00 26.58 ? 400 MET A SD  1 
ATOM   3198  C CE  . MET A 1 401 ? 11.570  -12.480 72.613  1.00 23.15 ? 400 MET A CE  1 
ATOM   3199  N N   . ILE A 1 402 ? 14.380  -9.749  76.969  1.00 18.13 ? 401 ILE A N   1 
ATOM   3200  C CA  . ILE A 1 402 ? 14.712  -8.332  76.830  1.00 18.51 ? 401 ILE A CA  1 
ATOM   3201  C C   . ILE A 1 402 ? 15.253  -7.927  75.454  1.00 17.66 ? 401 ILE A C   1 
ATOM   3202  O O   . ILE A 1 402 ? 16.437  -8.115  75.171  1.00 17.75 ? 401 ILE A O   1 
ATOM   3203  C CB  . ILE A 1 402 ? 15.778  -7.939  77.879  1.00 21.55 ? 401 ILE A CB  1 
ATOM   3204  C CG1 . ILE A 1 402 ? 15.354  -8.442  79.261  1.00 21.00 ? 401 ILE A CG1 1 
ATOM   3205  C CG2 . ILE A 1 402 ? 15.978  -6.414  77.899  1.00 20.32 ? 401 ILE A CG2 1 
ATOM   3206  C CD1 . ILE A 1 402 ? 16.456  -8.382  80.287  1.00 18.62 ? 401 ILE A CD1 1 
ATOM   3207  N N   . PRO A 1 403 ? 14.395  -7.372  74.582  1.00 15.70 ? 402 PRO A N   1 
ATOM   3208  C CA  . PRO A 1 403 ? 14.869  -6.955  73.258  1.00 15.01 ? 402 PRO A CA  1 
ATOM   3209  C C   . PRO A 1 403 ? 16.005  -5.952  73.476  1.00 15.86 ? 402 PRO A C   1 
ATOM   3210  O O   . PRO A 1 403 ? 15.875  -5.039  74.292  1.00 16.55 ? 402 PRO A O   1 
ATOM   3211  C CB  . PRO A 1 403 ? 13.633  -6.306  72.639  1.00 14.70 ? 402 PRO A CB  1 
ATOM   3212  C CG  . PRO A 1 403 ? 12.512  -7.074  73.255  1.00 14.66 ? 402 PRO A CG  1 
ATOM   3213  C CD  . PRO A 1 403 ? 12.936  -7.203  74.700  1.00 13.47 ? 402 PRO A CD  1 
ATOM   3214  N N   . CYS A 1 404 ? 17.116  -6.133  72.770  1.00 15.30 ? 403 CYS A N   1 
ATOM   3215  C CA  . CYS A 1 404 ? 18.266  -5.248  72.923  1.00 16.99 ? 403 CYS A CA  1 
ATOM   3216  C C   . CYS A 1 404 ? 18.747  -4.634  71.615  1.00 17.00 ? 403 CYS A C   1 
ATOM   3217  O O   . CYS A 1 404 ? 18.845  -5.320  70.600  1.00 16.51 ? 403 CYS A O   1 
ATOM   3218  C CB  . CYS A 1 404 ? 19.455  -6.009  73.531  1.00 17.03 ? 403 CYS A CB  1 
ATOM   3219  S SG  . CYS A 1 404 ? 19.288  -6.623  75.224  1.00 16.30 ? 403 CYS A SG  1 
ATOM   3220  N N   . ASP A 1 405 ? 19.056  -3.340  71.655  1.00 18.26 ? 404 ASP A N   1 
ATOM   3221  C CA  . ASP A 1 405 ? 19.605  -2.638  70.505  1.00 16.76 ? 404 ASP A CA  1 
ATOM   3222  C C   . ASP A 1 405 ? 21.089  -2.430  70.809  1.00 18.55 ? 404 ASP A C   1 
ATOM   3223  O O   . ASP A 1 405 ? 21.435  -1.772  71.797  1.00 18.67 ? 404 ASP A O   1 
ATOM   3224  C CB  . ASP A 1 405 ? 18.954  -1.261  70.312  1.00 17.58 ? 404 ASP A CB  1 
ATOM   3225  C CG  . ASP A 1 405 ? 17.587  -1.335  69.662  1.00 18.59 ? 404 ASP A CG  1 
ATOM   3226  O OD1 . ASP A 1 405 ? 17.148  -2.446  69.300  1.00 16.14 ? 404 ASP A OD1 1 
ATOM   3227  O OD2 . ASP A 1 405 ? 16.954  -0.268  69.511  1.00 19.17 ? 404 ASP A OD2 1 
ATOM   3228  N N   . PHE A 1 406 ? 21.958  -3.006  69.984  1.00 17.40 ? 405 PHE A N   1 
ATOM   3229  C CA  . PHE A 1 406 ? 23.405  -2.843  70.146  1.00 15.86 ? 405 PHE A CA  1 
ATOM   3230  C C   . PHE A 1 406 ? 23.855  -1.858  69.068  1.00 16.76 ? 405 PHE A C   1 
ATOM   3231  O O   . PHE A 1 406 ? 23.604  -2.080  67.883  1.00 16.99 ? 405 PHE A O   1 
ATOM   3232  C CB  . PHE A 1 406 ? 24.140  -4.175  69.937  1.00 16.17 ? 405 PHE A CB  1 
ATOM   3233  C CG  . PHE A 1 406 ? 24.098  -5.098  71.124  1.00 15.22 ? 405 PHE A CG  1 
ATOM   3234  C CD1 . PHE A 1 406 ? 22.904  -5.681  71.537  1.00 15.61 ? 405 PHE A CD1 1 
ATOM   3235  C CD2 . PHE A 1 406 ? 25.262  -5.383  71.831  1.00 15.13 ? 405 PHE A CD2 1 
ATOM   3236  C CE1 . PHE A 1 406 ? 22.874  -6.536  72.645  1.00 12.74 ? 405 PHE A CE1 1 
ATOM   3237  C CE2 . PHE A 1 406 ? 25.241  -6.230  72.933  1.00 13.92 ? 405 PHE A CE2 1 
ATOM   3238  C CZ  . PHE A 1 406 ? 24.047  -6.806  73.340  1.00 14.84 ? 405 PHE A CZ  1 
ATOM   3239  N N   . LEU A 1 407 ? 24.504  -0.768  69.466  1.00 15.53 ? 406 LEU A N   1 
ATOM   3240  C CA  . LEU A 1 407 ? 24.963  0.215   68.491  1.00 14.32 ? 406 LEU A CA  1 
ATOM   3241  C C   . LEU A 1 407 ? 26.469  0.443   68.583  1.00 14.10 ? 406 LEU A C   1 
ATOM   3242  O O   . LEU A 1 407 ? 27.065  0.296   69.643  1.00 15.25 ? 406 LEU A O   1 
ATOM   3243  C CB  . LEU A 1 407 ? 24.225  1.547   68.693  1.00 12.79 ? 406 LEU A CB  1 
ATOM   3244  C CG  . LEU A 1 407 ? 22.692  1.488   68.755  1.00 14.73 ? 406 LEU A CG  1 
ATOM   3245  C CD1 . LEU A 1 407 ? 22.244  1.275   70.207  1.00 14.76 ? 406 LEU A CD1 1 
ATOM   3246  C CD2 . LEU A 1 407 ? 22.105  2.793   68.227  1.00 14.75 ? 406 LEU A CD2 1 
ATOM   3247  N N   . ILE A 1 408 ? 27.096  0.797   67.471  1.00 17.13 ? 407 ILE A N   1 
ATOM   3248  C CA  . ILE A 1 408 ? 28.529  1.052   67.510  1.00 18.53 ? 407 ILE A CA  1 
ATOM   3249  C C   . ILE A 1 408 ? 29.040  1.693   66.232  1.00 18.25 ? 407 ILE A C   1 
ATOM   3250  O O   . ILE A 1 408 ? 28.537  1.412   65.147  1.00 18.27 ? 407 ILE A O   1 
ATOM   3251  C CB  . ILE A 1 408 ? 29.331  -0.253  67.746  1.00 18.25 ? 407 ILE A CB  1 
ATOM   3252  C CG1 . ILE A 1 408 ? 30.748  0.087   68.224  1.00 16.73 ? 407 ILE A CG1 1 
ATOM   3253  C CG2 . ILE A 1 408 ? 29.387  -1.075  66.447  1.00 18.40 ? 407 ILE A CG2 1 
ATOM   3254  C CD1 . ILE A 1 408 ? 31.578  -1.121  68.592  1.00 17.73 ? 407 ILE A CD1 1 
ATOM   3255  N N   . PRO A 1 409 ? 30.018  2.605   66.354  1.00 19.09 ? 408 PRO A N   1 
ATOM   3256  C CA  . PRO A 1 409 ? 30.585  3.260   65.171  1.00 18.17 ? 408 PRO A CA  1 
ATOM   3257  C C   . PRO A 1 409 ? 31.763  2.407   64.707  1.00 18.13 ? 408 PRO A C   1 
ATOM   3258  O O   . PRO A 1 409 ? 32.515  1.885   65.538  1.00 17.97 ? 408 PRO A O   1 
ATOM   3259  C CB  . PRO A 1 409 ? 31.039  4.613   65.706  1.00 18.27 ? 408 PRO A CB  1 
ATOM   3260  C CG  . PRO A 1 409 ? 31.485  4.276   67.101  1.00 20.27 ? 408 PRO A CG  1 
ATOM   3261  C CD  . PRO A 1 409 ? 30.382  3.335   67.584  1.00 17.44 ? 408 PRO A CD  1 
ATOM   3262  N N   . VAL A 1 410 ? 31.925  2.261   63.396  1.00 15.77 ? 409 VAL A N   1 
ATOM   3263  C CA  . VAL A 1 410 ? 33.025  1.465   62.865  1.00 15.95 ? 409 VAL A CA  1 
ATOM   3264  C C   . VAL A 1 410 ? 34.363  2.143   63.146  1.00 17.43 ? 409 VAL A C   1 
ATOM   3265  O O   . VAL A 1 410 ? 35.321  1.492   63.558  1.00 16.84 ? 409 VAL A O   1 
ATOM   3266  C CB  . VAL A 1 410 ? 32.870  1.243   61.342  1.00 14.19 ? 409 VAL A CB  1 
ATOM   3267  C CG1 . VAL A 1 410 ? 34.124  0.575   60.772  1.00 14.98 ? 409 VAL A CG1 1 
ATOM   3268  C CG2 . VAL A 1 410 ? 31.656  0.372   61.077  1.00 14.62 ? 409 VAL A CG2 1 
ATOM   3269  N N   . GLN A 1 411 ? 34.416  3.455   62.937  1.00 17.14 ? 410 GLN A N   1 
ATOM   3270  C CA  . GLN A 1 411 ? 35.637  4.220   63.166  1.00 18.17 ? 410 GLN A CA  1 
ATOM   3271  C C   . GLN A 1 411 ? 35.592  4.922   64.526  1.00 18.98 ? 410 GLN A C   1 
ATOM   3272  O O   . GLN A 1 411 ? 34.596  5.556   64.875  1.00 19.57 ? 410 GLN A O   1 
ATOM   3273  C CB  . GLN A 1 411 ? 35.820  5.240   62.035  1.00 19.00 ? 410 GLN A CB  1 
ATOM   3274  C CG  . GLN A 1 411 ? 35.890  4.590   60.647  1.00 15.64 ? 410 GLN A CG  1 
ATOM   3275  C CD  . GLN A 1 411 ? 36.068  5.585   59.507  1.00 19.09 ? 410 GLN A CD  1 
ATOM   3276  O OE1 . GLN A 1 411 ? 35.964  5.218   58.332  1.00 20.72 ? 410 GLN A OE1 1 
ATOM   3277  N NE2 . GLN A 1 411 ? 36.344  6.842   59.842  1.00 14.98 ? 410 GLN A NE2 1 
ATOM   3278  N N   . THR A 1 412 ? 36.668  4.792   65.297  1.00 17.48 ? 411 THR A N   1 
ATOM   3279  C CA  . THR A 1 412 ? 36.741  5.408   66.615  1.00 17.90 ? 411 THR A CA  1 
ATOM   3280  C C   . THR A 1 412 ? 37.336  6.812   66.564  1.00 19.23 ? 411 THR A C   1 
ATOM   3281  O O   . THR A 1 412 ? 38.137  7.131   65.691  1.00 19.71 ? 411 THR A O   1 
ATOM   3282  C CB  . THR A 1 412 ? 37.584  4.555   67.593  1.00 16.62 ? 411 THR A CB  1 
ATOM   3283  O OG1 . THR A 1 412 ? 37.633  5.201   68.871  1.00 18.55 ? 411 THR A OG1 1 
ATOM   3284  C CG2 . THR A 1 412 ? 39.016  4.388   67.073  1.00 18.96 ? 411 THR A CG2 1 
ATOM   3285  N N   . GLN A 1 413 ? 36.936  7.647   67.513  1.00 19.39 ? 412 GLN A N   1 
ATOM   3286  C CA  . GLN A 1 413 ? 37.439  9.010   67.589  1.00 20.52 ? 412 GLN A CA  1 
ATOM   3287  C C   . GLN A 1 413 ? 38.842  8.977   68.195  1.00 20.28 ? 412 GLN A C   1 
ATOM   3288  O O   . GLN A 1 413 ? 39.577  9.962   68.146  1.00 21.75 ? 412 GLN A O   1 
ATOM   3289  C CB  . GLN A 1 413 ? 36.515  9.857   68.469  1.00 19.81 ? 412 GLN A CB  1 
ATOM   3290  C CG  . GLN A 1 413 ? 35.106  10.069  67.918  1.00 18.34 ? 412 GLN A CG  1 
ATOM   3291  C CD  . GLN A 1 413 ? 35.076  11.084  66.791  1.00 21.56 ? 412 GLN A CD  1 
ATOM   3292  O OE1 . GLN A 1 413 ? 35.991  11.896  66.659  1.00 24.19 ? 412 GLN A OE1 1 
ATOM   3293  N NE2 . GLN A 1 413 ? 34.016  11.058  65.986  1.00 21.63 ? 412 GLN A NE2 1 
ATOM   3294  N N   . HIS A 1 414 ? 39.217  7.835   68.760  1.00 18.46 ? 413 HIS A N   1 
ATOM   3295  C CA  . HIS A 1 414 ? 40.530  7.700   69.389  1.00 20.19 ? 413 HIS A CA  1 
ATOM   3296  C C   . HIS A 1 414 ? 41.182  6.363   69.047  1.00 19.93 ? 413 HIS A C   1 
ATOM   3297  O O   . HIS A 1 414 ? 41.215  5.451   69.871  1.00 21.28 ? 413 HIS A O   1 
ATOM   3298  C CB  . HIS A 1 414 ? 40.389  7.833   70.909  1.00 20.76 ? 413 HIS A CB  1 
ATOM   3299  C CG  . HIS A 1 414 ? 39.906  9.178   71.357  1.00 22.68 ? 413 HIS A CG  1 
ATOM   3300  N ND1 . HIS A 1 414 ? 40.686  10.313  71.282  1.00 23.94 ? 413 HIS A ND1 1 
ATOM   3301  C CD2 . HIS A 1 414 ? 38.719  9.572   71.877  1.00 23.19 ? 413 HIS A CD2 1 
ATOM   3302  C CE1 . HIS A 1 414 ? 40.002  11.346  71.739  1.00 25.67 ? 413 HIS A CE1 1 
ATOM   3303  N NE2 . HIS A 1 414 ? 38.804  10.924  72.106  1.00 25.63 ? 413 HIS A NE2 1 
ATOM   3304  N N   . PRO A 1 415 ? 41.711  6.233   67.820  1.00 20.41 ? 414 PRO A N   1 
ATOM   3305  C CA  . PRO A 1 415 ? 42.366  5.006   67.349  1.00 20.56 ? 414 PRO A CA  1 
ATOM   3306  C C   . PRO A 1 415 ? 43.729  4.778   67.988  1.00 21.70 ? 414 PRO A C   1 
ATOM   3307  O O   . PRO A 1 415 ? 44.720  4.547   67.294  1.00 23.03 ? 414 PRO A O   1 
ATOM   3308  C CB  . PRO A 1 415 ? 42.463  5.234   65.843  1.00 21.52 ? 414 PRO A CB  1 
ATOM   3309  C CG  . PRO A 1 415 ? 42.706  6.715   65.762  1.00 20.73 ? 414 PRO A CG  1 
ATOM   3310  C CD  . PRO A 1 415 ? 41.714  7.268   66.768  1.00 17.06 ? 414 PRO A CD  1 
ATOM   3311  N N   . ILE A 1 416 ? 43.770  4.839   69.314  1.00 21.63 ? 415 ILE A N   1 
ATOM   3312  C CA  . ILE A 1 416 ? 45.011  4.649   70.051  1.00 22.42 ? 415 ILE A CA  1 
ATOM   3313  C C   . ILE A 1 416 ? 45.549  3.228   69.910  1.00 23.52 ? 415 ILE A C   1 
ATOM   3314  O O   . ILE A 1 416 ? 44.813  2.300   69.563  1.00 21.21 ? 415 ILE A O   1 
ATOM   3315  C CB  . ILE A 1 416 ? 44.818  4.950   71.553  1.00 20.38 ? 415 ILE A CB  1 
ATOM   3316  C CG1 . ILE A 1 416 ? 43.716  4.050   72.119  1.00 18.24 ? 415 ILE A CG1 1 
ATOM   3317  C CG2 . ILE A 1 416 ? 44.496  6.434   71.746  1.00 17.81 ? 415 ILE A CG2 1 
ATOM   3318  C CD1 . ILE A 1 416 ? 43.501  4.190   73.628  1.00 20.48 ? 415 ILE A CD1 1 
ATOM   3319  N N   . ARG A 1 417 ? 46.841  3.080   70.184  1.00 24.58 ? 416 ARG A N   1 
ATOM   3320  C CA  . ARG A 1 417 ? 47.516  1.795   70.102  1.00 25.06 ? 416 ARG A CA  1 
ATOM   3321  C C   . ARG A 1 417 ? 47.191  1.035   68.824  1.00 23.89 ? 416 ARG A C   1 
ATOM   3322  O O   . ARG A 1 417 ? 46.816  -0.137  68.861  1.00 25.38 ? 416 ARG A O   1 
ATOM   3323  C CB  . ARG A 1 417 ? 47.175  0.956   71.329  1.00 26.27 ? 416 ARG A CB  1 
ATOM   3324  C CG  . ARG A 1 417 ? 47.878  1.444   72.585  1.00 28.97 ? 416 ARG A CG  1 
ATOM   3325  C CD  . ARG A 1 417 ? 48.695  0.331   73.208  1.00 26.60 ? 416 ARG A CD  1 
ATOM   3326  N NE  . ARG A 1 417 ? 47.978  -0.269  74.320  1.00 33.77 ? 416 ARG A NE  1 
ATOM   3327  C CZ  . ARG A 1 417 ? 48.224  -1.478  74.800  1.00 30.79 ? 416 ARG A CZ  1 
ATOM   3328  N NH1 . ARG A 1 417 ? 49.173  -2.227  74.258  1.00 30.12 ? 416 ARG A NH1 1 
ATOM   3329  N NH2 . ARG A 1 417 ? 47.518  -1.934  75.822  1.00 35.18 ? 416 ARG A NH2 1 
ATOM   3330  N N   . LYS A 1 418 ? 47.342  1.722   67.697  1.00 25.26 ? 417 LYS A N   1 
ATOM   3331  C CA  . LYS A 1 418 ? 47.092  1.158   66.372  1.00 25.40 ? 417 LYS A CA  1 
ATOM   3332  C C   . LYS A 1 418 ? 45.737  0.465   66.249  1.00 26.12 ? 417 LYS A C   1 
ATOM   3333  O O   . LYS A 1 418 ? 45.614  -0.541  65.542  1.00 27.41 ? 417 LYS A O   1 
ATOM   3334  C CB  . LYS A 1 418 ? 48.210  0.173   65.999  1.00 28.47 ? 417 LYS A CB  1 
ATOM   3335  C CG  . LYS A 1 418 ? 49.619  0.726   66.194  1.00 32.69 ? 417 LYS A CG  1 
ATOM   3336  C CD  . LYS A 1 418 ? 49.838  2.001   65.389  1.00 38.16 ? 417 LYS A CD  1 
ATOM   3337  C CE  . LYS A 1 418 ? 51.065  2.764   65.880  1.00 41.85 ? 417 LYS A CE  1 
ATOM   3338  N NZ  . LYS A 1 418 ? 50.900  3.211   67.303  1.00 44.09 ? 417 LYS A NZ  1 
ATOM   3339  N N   . GLY A 1 419 ? 44.729  0.999   66.941  1.00 24.77 ? 418 GLY A N   1 
ATOM   3340  C CA  . GLY A 1 419 ? 43.386  0.437   66.880  1.00 23.32 ? 418 GLY A CA  1 
ATOM   3341  C C   . GLY A 1 419 ? 43.092  -0.772  67.757  1.00 22.97 ? 418 GLY A C   1 
ATOM   3342  O O   . GLY A 1 419 ? 42.037  -1.401  67.622  1.00 21.66 ? 418 GLY A O   1 
ATOM   3343  N N   . LEU A 1 420 ? 44.010  -1.094  68.662  1.00 21.57 ? 419 LEU A N   1 
ATOM   3344  C CA  . LEU A 1 420 ? 43.844  -2.241  69.550  1.00 21.91 ? 419 LEU A CA  1 
ATOM   3345  C C   . LEU A 1 420 ? 42.593  -2.191  70.438  1.00 21.54 ? 419 LEU A C   1 
ATOM   3346  O O   . LEU A 1 420 ? 41.909  -3.208  70.609  1.00 19.37 ? 419 LEU A O   1 
ATOM   3347  C CB  . LEU A 1 420 ? 45.080  -2.394  70.439  1.00 21.88 ? 419 LEU A CB  1 
ATOM   3348  C CG  . LEU A 1 420 ? 45.012  -3.492  71.503  1.00 24.23 ? 419 LEU A CG  1 
ATOM   3349  C CD1 . LEU A 1 420 ? 44.843  -4.864  70.828  1.00 23.51 ? 419 LEU A CD1 1 
ATOM   3350  C CD2 . LEU A 1 420 ? 46.283  -3.451  72.360  1.00 23.30 ? 419 LEU A CD2 1 
ATOM   3351  N N   . HIS A 1 421 ? 42.299  -1.025  71.011  1.00 19.57 ? 420 HIS A N   1 
ATOM   3352  C CA  . HIS A 1 421 ? 41.132  -0.898  71.883  1.00 20.28 ? 420 HIS A CA  1 
ATOM   3353  C C   . HIS A 1 421 ? 39.813  -1.070  71.129  1.00 20.28 ? 420 HIS A C   1 
ATOM   3354  O O   . HIS A 1 421 ? 38.906  -1.754  71.602  1.00 20.58 ? 420 HIS A O   1 
ATOM   3355  C CB  . HIS A 1 421 ? 41.111  0.467   72.597  1.00 19.76 ? 420 HIS A CB  1 
ATOM   3356  C CG  . HIS A 1 421 ? 42.039  0.567   73.772  1.00 17.07 ? 420 HIS A CG  1 
ATOM   3357  N ND1 . HIS A 1 421 ? 43.409  0.655   73.640  1.00 19.71 ? 420 HIS A ND1 1 
ATOM   3358  C CD2 . HIS A 1 421 ? 41.786  0.626   75.102  1.00 15.86 ? 420 HIS A CD2 1 
ATOM   3359  C CE1 . HIS A 1 421 ? 43.960  0.767   74.838  1.00 17.14 ? 420 HIS A CE1 1 
ATOM   3360  N NE2 . HIS A 1 421 ? 42.997  0.752   75.742  1.00 18.08 ? 420 HIS A NE2 1 
ATOM   3361  N N   . HIS A 1 422 ? 39.703  -0.451  69.958  1.00 19.80 ? 421 HIS A N   1 
ATOM   3362  C CA  . HIS A 1 422 ? 38.462  -0.537  69.200  1.00 20.82 ? 421 HIS A CA  1 
ATOM   3363  C C   . HIS A 1 422 ? 38.265  -1.940  68.644  1.00 19.88 ? 421 HIS A C   1 
ATOM   3364  O O   . HIS A 1 422 ? 37.138  -2.388  68.473  1.00 19.63 ? 421 HIS A O   1 
ATOM   3365  C CB  . HIS A 1 422 ? 38.440  0.506   68.076  1.00 20.14 ? 421 HIS A CB  1 
ATOM   3366  C CG  . HIS A 1 422 ? 37.058  0.885   67.636  1.00 21.85 ? 421 HIS A CG  1 
ATOM   3367  N ND1 . HIS A 1 422 ? 36.093  1.324   68.517  1.00 21.97 ? 421 HIS A ND1 1 
ATOM   3368  C CD2 . HIS A 1 422 ? 36.479  0.891   66.411  1.00 20.76 ? 421 HIS A CD2 1 
ATOM   3369  C CE1 . HIS A 1 422 ? 34.979  1.584   67.854  1.00 21.05 ? 421 HIS A CE1 1 
ATOM   3370  N NE2 . HIS A 1 422 ? 35.186  1.329   66.574  1.00 19.67 ? 421 HIS A NE2 1 
ATOM   3371  N N   . LYS A 1 423 ? 39.365  -2.634  68.371  1.00 19.29 ? 422 LYS A N   1 
ATOM   3372  C CA  . LYS A 1 423 ? 39.283  -4.000  67.871  1.00 20.78 ? 422 LYS A CA  1 
ATOM   3373  C C   . LYS A 1 423 ? 38.562  -4.853  68.923  1.00 19.72 ? 422 LYS A C   1 
ATOM   3374  O O   . LYS A 1 423 ? 37.584  -5.537  68.624  1.00 20.58 ? 422 LYS A O   1 
ATOM   3375  C CB  . LYS A 1 423 ? 40.689  -4.556  67.625  1.00 22.02 ? 422 LYS A CB  1 
ATOM   3376  C CG  . LYS A 1 423 ? 40.734  -6.040  67.311  1.00 24.64 ? 422 LYS A CG  1 
ATOM   3377  C CD  . LYS A 1 423 ? 42.181  -6.533  67.253  1.00 27.81 ? 422 LYS A CD  1 
ATOM   3378  C CE  . LYS A 1 423 ? 42.252  -8.031  67.026  1.00 29.79 ? 422 LYS A CE  1 
ATOM   3379  N NZ  . LYS A 1 423 ? 43.662  -8.506  66.969  1.00 29.96 ? 422 LYS A NZ  1 
ATOM   3380  N N   . ILE A 1 424 ? 39.048  -4.801  70.157  1.00 18.74 ? 423 ILE A N   1 
ATOM   3381  C CA  . ILE A 1 424 ? 38.443  -5.563  71.242  1.00 17.28 ? 423 ILE A CA  1 
ATOM   3382  C C   . ILE A 1 424 ? 36.990  -5.139  71.466  1.00 18.10 ? 423 ILE A C   1 
ATOM   3383  O O   . ILE A 1 424 ? 36.124  -5.982  71.714  1.00 18.62 ? 423 ILE A O   1 
ATOM   3384  C CB  . ILE A 1 424 ? 39.246  -5.379  72.548  1.00 17.62 ? 423 ILE A CB  1 
ATOM   3385  C CG1 . ILE A 1 424 ? 40.675  -5.882  72.340  1.00 17.23 ? 423 ILE A CG1 1 
ATOM   3386  C CG2 . ILE A 1 424 ? 38.586  -6.142  73.696  1.00 15.06 ? 423 ILE A CG2 1 
ATOM   3387  C CD1 . ILE A 1 424 ? 41.620  -5.526  73.465  1.00 17.18 ? 423 ILE A CD1 1 
ATOM   3388  N N   . LEU A 1 425 ? 36.725  -3.836  71.372  1.00 17.24 ? 424 LEU A N   1 
ATOM   3389  C CA  . LEU A 1 425 ? 35.375  -3.309  71.565  1.00 15.76 ? 424 LEU A CA  1 
ATOM   3390  C C   . LEU A 1 425 ? 34.462  -3.894  70.492  1.00 16.46 ? 424 LEU A C   1 
ATOM   3391  O O   . LEU A 1 425 ? 33.370  -4.384  70.780  1.00 16.08 ? 424 LEU A O   1 
ATOM   3392  C CB  . LEU A 1 425 ? 35.382  -1.775  71.464  1.00 15.09 ? 424 LEU A CB  1 
ATOM   3393  C CG  . LEU A 1 425 ? 34.067  -1.028  71.715  1.00 15.20 ? 424 LEU A CG  1 
ATOM   3394  C CD1 . LEU A 1 425 ? 33.689  -1.149  73.192  1.00 16.97 ? 424 LEU A CD1 1 
ATOM   3395  C CD2 . LEU A 1 425 ? 34.225  0.448   71.347  1.00 14.93 ? 424 LEU A CD2 1 
ATOM   3396  N N   . LEU A 1 426 ? 34.920  -3.843  69.247  1.00 15.23 ? 425 LEU A N   1 
ATOM   3397  C CA  . LEU A 1 426 ? 34.136  -4.379  68.144  1.00 17.06 ? 425 LEU A CA  1 
ATOM   3398  C C   . LEU A 1 426 ? 33.873  -5.875  68.348  1.00 16.29 ? 425 LEU A C   1 
ATOM   3399  O O   . LEU A 1 426 ? 32.734  -6.333  68.229  1.00 15.35 ? 425 LEU A O   1 
ATOM   3400  C CB  . LEU A 1 426 ? 34.865  -4.133  66.815  1.00 16.26 ? 425 LEU A CB  1 
ATOM   3401  C CG  . LEU A 1 426 ? 34.873  -2.691  66.285  1.00 17.33 ? 425 LEU A CG  1 
ATOM   3402  C CD1 . LEU A 1 426 ? 36.000  -2.510  65.257  1.00 14.43 ? 425 LEU A CD1 1 
ATOM   3403  C CD2 . LEU A 1 426 ? 33.509  -2.369  65.664  1.00 17.62 ? 425 LEU A CD2 1 
ATOM   3404  N N   . ALA A 1 427 ? 34.918  -6.625  68.682  1.00 17.01 ? 426 ALA A N   1 
ATOM   3405  C CA  . ALA A 1 427 ? 34.791  -8.071  68.893  1.00 19.72 ? 426 ALA A CA  1 
ATOM   3406  C C   . ALA A 1 427 ? 33.731  -8.433  69.932  1.00 20.12 ? 426 ALA A C   1 
ATOM   3407  O O   . ALA A 1 427 ? 33.001  -9.410  69.766  1.00 21.85 ? 426 ALA A O   1 
ATOM   3408  C CB  . ALA A 1 427 ? 36.132  -8.663  69.301  1.00 18.13 ? 426 ALA A CB  1 
ATOM   3409  N N   . ASN A 1 428 ? 33.664  -7.655  71.009  1.00 20.40 ? 427 ASN A N   1 
ATOM   3410  C CA  . ASN A 1 428 ? 32.680  -7.893  72.060  1.00 20.34 ? 427 ASN A CA  1 
ATOM   3411  C C   . ASN A 1 428 ? 31.290  -7.508  71.569  1.00 19.89 ? 427 ASN A C   1 
ATOM   3412  O O   . ASN A 1 428 ? 30.316  -8.212  71.830  1.00 20.76 ? 427 ASN A O   1 
ATOM   3413  C CB  . ASN A 1 428 ? 33.051  -7.097  73.309  1.00 18.80 ? 427 ASN A CB  1 
ATOM   3414  C CG  . ASN A 1 428 ? 34.137  -7.777  74.123  1.00 20.02 ? 427 ASN A CG  1 
ATOM   3415  O OD1 . ASN A 1 428 ? 33.849  -8.589  75.000  1.00 18.96 ? 427 ASN A OD1 1 
ATOM   3416  N ND2 . ASN A 1 428 ? 35.389  -7.465  73.822  1.00 18.31 ? 427 ASN A ND2 1 
ATOM   3417  N N   . PHE A 1 429 ? 31.212  -6.388  70.852  1.00 20.00 ? 428 PHE A N   1 
ATOM   3418  C CA  . PHE A 1 429 ? 29.958  -5.906  70.283  1.00 19.05 ? 428 PHE A CA  1 
ATOM   3419  C C   . PHE A 1 429 ? 29.318  -7.025  69.462  1.00 20.08 ? 428 PHE A C   1 
ATOM   3420  O O   . PHE A 1 429 ? 28.116  -7.293  69.572  1.00 19.50 ? 428 PHE A O   1 
ATOM   3421  C CB  . PHE A 1 429 ? 30.235  -4.708  69.377  1.00 18.69 ? 428 PHE A CB  1 
ATOM   3422  C CG  . PHE A 1 429 ? 29.067  -4.305  68.537  1.00 16.94 ? 428 PHE A CG  1 
ATOM   3423  C CD1 . PHE A 1 429 ? 28.089  -3.457  69.041  1.00 19.06 ? 428 PHE A CD1 1 
ATOM   3424  C CD2 . PHE A 1 429 ? 28.940  -4.776  67.241  1.00 16.31 ? 428 PHE A CD2 1 
ATOM   3425  C CE1 . PHE A 1 429 ? 26.999  -3.087  68.263  1.00 18.95 ? 428 PHE A CE1 1 
ATOM   3426  C CE2 . PHE A 1 429 ? 27.852  -4.414  66.454  1.00 18.16 ? 428 PHE A CE2 1 
ATOM   3427  C CZ  . PHE A 1 429 ? 26.882  -3.565  66.967  1.00 18.83 ? 428 PHE A CZ  1 
ATOM   3428  N N   . LEU A 1 430 ? 30.141  -7.672  68.640  1.00 19.17 ? 429 LEU A N   1 
ATOM   3429  C CA  . LEU A 1 430 ? 29.705  -8.769  67.780  1.00 18.21 ? 429 LEU A CA  1 
ATOM   3430  C C   . LEU A 1 430 ? 29.444  -10.062 68.556  1.00 18.79 ? 429 LEU A C   1 
ATOM   3431  O O   . LEU A 1 430 ? 28.426  -10.726 68.349  1.00 21.10 ? 429 LEU A O   1 
ATOM   3432  C CB  . LEU A 1 430 ? 30.764  -9.032  66.709  1.00 16.95 ? 429 LEU A CB  1 
ATOM   3433  C CG  . LEU A 1 430 ? 31.066  -7.869  65.763  1.00 18.08 ? 429 LEU A CG  1 
ATOM   3434  C CD1 . LEU A 1 430 ? 32.420  -8.074  65.093  1.00 11.44 ? 429 LEU A CD1 1 
ATOM   3435  C CD2 . LEU A 1 430 ? 29.945  -7.757  64.734  1.00 15.32 ? 429 LEU A CD2 1 
ATOM   3436  N N   . ALA A 1 431 ? 30.367  -10.417 69.446  1.00 17.94 ? 430 ALA A N   1 
ATOM   3437  C CA  . ALA A 1 431 ? 30.246  -11.636 70.241  1.00 18.02 ? 430 ALA A CA  1 
ATOM   3438  C C   . ALA A 1 431 ? 28.997  -11.691 71.120  1.00 19.38 ? 430 ALA A C   1 
ATOM   3439  O O   . ALA A 1 431 ? 28.361  -12.743 71.242  1.00 19.16 ? 430 ALA A O   1 
ATOM   3440  C CB  . ALA A 1 431 ? 31.480  -11.808 71.102  1.00 16.41 ? 430 ALA A CB  1 
ATOM   3441  N N   . GLN A 1 432 ? 28.640  -10.566 71.733  1.00 19.36 ? 431 GLN A N   1 
ATOM   3442  C CA  . GLN A 1 432 ? 27.473  -10.541 72.607  1.00 18.41 ? 431 GLN A CA  1 
ATOM   3443  C C   . GLN A 1 432 ? 26.160  -10.877 71.905  1.00 18.65 ? 431 GLN A C   1 
ATOM   3444  O O   . GLN A 1 432 ? 25.385  -11.693 72.403  1.00 16.49 ? 431 GLN A O   1 
ATOM   3445  C CB  . GLN A 1 432 ? 27.367  -9.191  73.315  1.00 18.41 ? 431 GLN A CB  1 
ATOM   3446  C CG  . GLN A 1 432 ? 28.378  -9.013  74.457  1.00 20.14 ? 431 GLN A CG  1 
ATOM   3447  C CD  . GLN A 1 432 ? 28.222  -10.062 75.556  1.00 20.54 ? 431 GLN A CD  1 
ATOM   3448  O OE1 . GLN A 1 432 ? 27.107  -10.438 75.917  1.00 19.84 ? 431 GLN A OE1 1 
ATOM   3449  N NE2 . GLN A 1 432 ? 29.340  -10.519 76.103  1.00 16.32 ? 431 GLN A NE2 1 
ATOM   3450  N N   . THR A 1 433 ? 25.896  -10.266 70.752  1.00 17.78 ? 432 THR A N   1 
ATOM   3451  C CA  . THR A 1 433 ? 24.658  -10.584 70.052  1.00 17.01 ? 432 THR A CA  1 
ATOM   3452  C C   . THR A 1 433 ? 24.732  -12.016 69.506  1.00 17.96 ? 432 THR A C   1 
ATOM   3453  O O   . THR A 1 433 ? 23.711  -12.708 69.413  1.00 16.37 ? 432 THR A O   1 
ATOM   3454  C CB  . THR A 1 433 ? 24.361  -9.576  68.912  1.00 15.11 ? 432 THR A CB  1 
ATOM   3455  O OG1 . THR A 1 433 ? 25.372  -9.661  67.901  1.00 15.31 ? 432 THR A OG1 1 
ATOM   3456  C CG2 . THR A 1 433 ? 24.329  -8.145  69.473  1.00 13.84 ? 432 THR A CG2 1 
ATOM   3457  N N   . GLU A 1 434 ? 25.939  -12.461 69.164  1.00 16.90 ? 433 GLU A N   1 
ATOM   3458  C CA  . GLU A 1 434 ? 26.127  -13.825 68.660  1.00 19.79 ? 433 GLU A CA  1 
ATOM   3459  C C   . GLU A 1 434 ? 25.733  -14.815 69.756  1.00 18.33 ? 433 GLU A C   1 
ATOM   3460  O O   . GLU A 1 434 ? 24.955  -15.738 69.522  1.00 20.39 ? 433 GLU A O   1 
ATOM   3461  C CB  . GLU A 1 434 ? 27.592  -14.076 68.257  1.00 18.68 ? 433 GLU A CB  1 
ATOM   3462  C CG  . GLU A 1 434 ? 27.805  -15.405 67.514  1.00 19.45 ? 433 GLU A CG  1 
ATOM   3463  C CD  . GLU A 1 434 ? 29.267  -15.721 67.216  1.00 20.98 ? 433 GLU A CD  1 
ATOM   3464  O OE1 . GLU A 1 434 ? 29.519  -16.693 66.473  1.00 22.99 ? 433 GLU A OE1 1 
ATOM   3465  O OE2 . GLU A 1 434 ? 30.164  -15.015 67.721  1.00 20.36 ? 433 GLU A OE2 1 
ATOM   3466  N N   . ALA A 1 435 ? 26.276  -14.600 70.952  1.00 18.32 ? 434 ALA A N   1 
ATOM   3467  C CA  . ALA A 1 435 ? 26.009  -15.446 72.110  1.00 16.89 ? 434 ALA A CA  1 
ATOM   3468  C C   . ALA A 1 435 ? 24.537  -15.416 72.502  1.00 18.22 ? 434 ALA A C   1 
ATOM   3469  O O   . ALA A 1 435 ? 23.926  -16.457 72.779  1.00 15.92 ? 434 ALA A O   1 
ATOM   3470  C CB  . ALA A 1 435 ? 26.855  -14.983 73.279  1.00 16.04 ? 434 ALA A CB  1 
ATOM   3471  N N   . LEU A 1 436 ? 23.983  -14.209 72.550  1.00 19.62 ? 435 LEU A N   1 
ATOM   3472  C CA  . LEU A 1 436 ? 22.583  -14.005 72.907  1.00 21.20 ? 435 LEU A CA  1 
ATOM   3473  C C   . LEU A 1 436 ? 21.689  -14.861 72.008  1.00 21.87 ? 435 LEU A C   1 
ATOM   3474  O O   . LEU A 1 436 ? 20.710  -15.459 72.464  1.00 23.59 ? 435 LEU A O   1 
ATOM   3475  C CB  . LEU A 1 436 ? 22.236  -12.520 72.756  1.00 20.38 ? 435 LEU A CB  1 
ATOM   3476  C CG  . LEU A 1 436 ? 21.895  -11.652 73.977  1.00 23.96 ? 435 LEU A CG  1 
ATOM   3477  C CD1 . LEU A 1 436 ? 22.378  -12.269 75.273  1.00 22.12 ? 435 LEU A CD1 1 
ATOM   3478  C CD2 . LEU A 1 436 ? 22.495  -10.275 73.769  1.00 21.81 ? 435 LEU A CD2 1 
ATOM   3479  N N   . MET A 1 437 ? 22.027  -14.924 70.726  1.00 22.19 ? 436 MET A N   1 
ATOM   3480  C CA  . MET A 1 437 ? 21.241  -15.721 69.793  1.00 24.54 ? 436 MET A CA  1 
ATOM   3481  C C   . MET A 1 437 ? 21.520  -17.226 69.873  1.00 23.86 ? 436 MET A C   1 
ATOM   3482  O O   . MET A 1 437 ? 20.600  -18.027 70.029  1.00 22.74 ? 436 MET A O   1 
ATOM   3483  C CB  . MET A 1 437 ? 21.489  -15.284 68.354  1.00 25.65 ? 436 MET A CB  1 
ATOM   3484  C CG  . MET A 1 437 ? 21.009  -16.342 67.367  1.00 32.68 ? 436 MET A CG  1 
ATOM   3485  S SD  . MET A 1 437 ? 21.451  -16.037 65.689  1.00 41.33 ? 436 MET A SD  1 
ATOM   3486  C CE  . MET A 1 437 ? 21.419  -17.721 65.021  1.00 37.46 ? 436 MET A CE  1 
ATOM   3487  N N   . ARG A 1 438 ? 22.795  -17.592 69.752  1.00 23.78 ? 437 ARG A N   1 
ATOM   3488  C CA  . ARG A 1 438 ? 23.207  -18.994 69.759  1.00 26.95 ? 437 ARG A CA  1 
ATOM   3489  C C   . ARG A 1 438 ? 23.093  -19.743 71.074  1.00 25.85 ? 437 ARG A C   1 
ATOM   3490  O O   . ARG A 1 438 ? 22.580  -20.863 71.106  1.00 24.08 ? 437 ARG A O   1 
ATOM   3491  C CB  . ARG A 1 438 ? 24.646  -19.129 69.259  1.00 29.09 ? 437 ARG A CB  1 
ATOM   3492  C CG  . ARG A 1 438 ? 24.841  -18.761 67.806  1.00 35.13 ? 437 ARG A CG  1 
ATOM   3493  C CD  . ARG A 1 438 ? 25.957  -19.601 67.216  1.00 40.97 ? 437 ARG A CD  1 
ATOM   3494  N NE  . ARG A 1 438 ? 25.534  -20.988 67.050  1.00 45.17 ? 437 ARG A NE  1 
ATOM   3495  C CZ  . ARG A 1 438 ? 26.345  -22.036 67.149  1.00 47.83 ? 437 ARG A CZ  1 
ATOM   3496  N NH1 . ARG A 1 438 ? 27.633  -21.859 67.420  1.00 50.25 ? 437 ARG A NH1 1 
ATOM   3497  N NH2 . ARG A 1 438 ? 25.867  -23.262 66.978  1.00 48.05 ? 437 ARG A NH2 1 
ATOM   3498  N N   . GLY A 1 439 ? 23.574  -19.135 72.151  1.00 23.75 ? 438 GLY A N   1 
ATOM   3499  C CA  . GLY A 1 439 ? 23.536  -19.809 73.432  1.00 24.35 ? 438 GLY A CA  1 
ATOM   3500  C C   . GLY A 1 439 ? 24.507  -20.981 73.395  1.00 23.70 ? 438 GLY A C   1 
ATOM   3501  O O   . GLY A 1 439 ? 25.339  -21.074 72.495  1.00 21.88 ? 438 GLY A O   1 
ATOM   3502  N N   . LYS A 1 440 ? 24.405  -21.871 74.376  1.00 23.87 ? 439 LYS A N   1 
ATOM   3503  C CA  . LYS A 1 440 ? 25.268  -23.047 74.457  1.00 24.03 ? 439 LYS A CA  1 
ATOM   3504  C C   . LYS A 1 440 ? 24.420  -24.190 75.012  1.00 24.47 ? 439 LYS A C   1 
ATOM   3505  O O   . LYS A 1 440 ? 23.841  -24.071 76.091  1.00 24.00 ? 439 LYS A O   1 
ATOM   3506  C CB  . LYS A 1 440 ? 26.460  -22.780 75.384  1.00 23.04 ? 439 LYS A CB  1 
ATOM   3507  C CG  . LYS A 1 440 ? 27.408  -23.981 75.542  1.00 23.07 ? 439 LYS A CG  1 
ATOM   3508  C CD  . LYS A 1 440 ? 28.497  -23.720 76.577  1.00 22.17 ? 439 LYS A CD  1 
ATOM   3509  C CE  . LYS A 1 440 ? 29.422  -22.583 76.142  1.00 21.58 ? 439 LYS A CE  1 
ATOM   3510  N NZ  . LYS A 1 440 ? 30.478  -22.290 77.145  1.00 20.75 ? 439 LYS A NZ  1 
ATOM   3511  N N   . SER A 1 441 ? 24.356  -25.297 74.280  1.00 24.03 ? 440 SER A N   1 
ATOM   3512  C CA  . SER A 1 441 ? 23.541  -26.435 74.703  1.00 25.26 ? 440 SER A CA  1 
ATOM   3513  C C   . SER A 1 441 ? 24.169  -27.302 75.786  1.00 24.05 ? 440 SER A C   1 
ATOM   3514  O O   . SER A 1 441 ? 25.370  -27.220 76.058  1.00 23.22 ? 440 SER A O   1 
ATOM   3515  C CB  . SER A 1 441 ? 23.204  -27.320 73.496  1.00 24.44 ? 440 SER A CB  1 
ATOM   3516  O OG  . SER A 1 441 ? 24.365  -27.971 73.014  1.00 24.28 ? 440 SER A OG  1 
ATOM   3517  N N   . THR A 1 442 ? 23.337  -28.139 76.398  1.00 26.02 ? 441 THR A N   1 
ATOM   3518  C CA  . THR A 1 442 ? 23.789  -29.059 77.438  1.00 29.21 ? 441 THR A CA  1 
ATOM   3519  C C   . THR A 1 442 ? 24.930  -29.914 76.897  1.00 29.15 ? 441 THR A C   1 
ATOM   3520  O O   . THR A 1 442 ? 25.924  -30.146 77.581  1.00 30.79 ? 441 THR A O   1 
ATOM   3521  C CB  . THR A 1 442 ? 22.655  -30.000 77.873  1.00 29.50 ? 441 THR A CB  1 
ATOM   3522  O OG1 . THR A 1 442 ? 21.520  -29.222 78.265  1.00 31.41 ? 441 THR A OG1 1 
ATOM   3523  C CG2 . THR A 1 442 ? 23.104  -30.873 79.043  1.00 29.19 ? 441 THR A CG2 1 
ATOM   3524  N N   . GLU A 1 443 ? 24.773  -30.377 75.659  1.00 30.68 ? 442 GLU A N   1 
ATOM   3525  C CA  . GLU A 1 443 ? 25.779  -31.205 75.010  1.00 31.51 ? 442 GLU A CA  1 
ATOM   3526  C C   . GLU A 1 443 ? 27.072  -30.442 74.775  1.00 30.61 ? 442 GLU A C   1 
ATOM   3527  O O   . GLU A 1 443 ? 28.158  -30.972 74.999  1.00 30.54 ? 442 GLU A O   1 
ATOM   3528  C CB  . GLU A 1 443 ? 25.245  -31.740 73.677  1.00 36.94 ? 442 GLU A CB  1 
ATOM   3529  C CG  . GLU A 1 443 ? 26.332  -32.312 72.768  1.00 44.11 ? 442 GLU A CG  1 
ATOM   3530  C CD  . GLU A 1 443 ? 25.786  -32.912 71.481  1.00 48.56 ? 442 GLU A CD  1 
ATOM   3531  O OE1 . GLU A 1 443 ? 26.589  -33.139 70.548  1.00 51.18 ? 442 GLU A OE1 1 
ATOM   3532  O OE2 . GLU A 1 443 ? 24.561  -33.166 71.405  1.00 51.74 ? 442 GLU A OE2 1 
ATOM   3533  N N   . GLU A 1 444 ? 26.959  -29.199 74.316  1.00 29.86 ? 443 GLU A N   1 
ATOM   3534  C CA  . GLU A 1 444 ? 28.142  -28.386 74.066  1.00 28.74 ? 443 GLU A CA  1 
ATOM   3535  C C   . GLU A 1 444 ? 28.852  -28.090 75.382  1.00 27.59 ? 443 GLU A C   1 
ATOM   3536  O O   . GLU A 1 444 ? 30.078  -28.176 75.466  1.00 26.19 ? 443 GLU A O   1 
ATOM   3537  C CB  . GLU A 1 444 ? 27.753  -27.083 73.361  1.00 29.09 ? 443 GLU A CB  1 
ATOM   3538  C CG  . GLU A 1 444 ? 27.029  -27.319 72.045  1.00 31.60 ? 443 GLU A CG  1 
ATOM   3539  C CD  . GLU A 1 444 ? 26.613  -26.036 71.354  1.00 32.98 ? 443 GLU A CD  1 
ATOM   3540  O OE1 . GLU A 1 444 ? 25.995  -25.169 72.010  1.00 30.47 ? 443 GLU A OE1 1 
ATOM   3541  O OE2 . GLU A 1 444 ? 26.898  -25.903 70.145  1.00 35.36 ? 443 GLU A OE2 1 
ATOM   3542  N N   . ALA A 1 445 ? 28.079  -27.745 76.409  1.00 26.27 ? 444 ALA A N   1 
ATOM   3543  C CA  . ALA A 1 445 ? 28.655  -27.463 77.717  1.00 25.70 ? 444 ALA A CA  1 
ATOM   3544  C C   . ALA A 1 445 ? 29.289  -28.743 78.272  1.00 26.62 ? 444 ALA A C   1 
ATOM   3545  O O   . ALA A 1 445 ? 30.388  -28.713 78.835  1.00 22.62 ? 444 ALA A O   1 
ATOM   3546  C CB  . ALA A 1 445 ? 27.579  -26.954 78.671  1.00 26.34 ? 444 ALA A CB  1 
ATOM   3547  N N   . ARG A 1 446 ? 28.600  -29.869 78.109  1.00 27.84 ? 445 ARG A N   1 
ATOM   3548  C CA  . ARG A 1 446 ? 29.139  -31.134 78.603  1.00 30.75 ? 445 ARG A CA  1 
ATOM   3549  C C   . ARG A 1 446 ? 30.521  -31.410 78.009  1.00 32.12 ? 445 ARG A C   1 
ATOM   3550  O O   . ARG A 1 446 ? 31.463  -31.704 78.742  1.00 31.55 ? 445 ARG A O   1 
ATOM   3551  C CB  . ARG A 1 446 ? 28.187  -32.293 78.287  1.00 31.46 ? 445 ARG A CB  1 
ATOM   3552  C CG  . ARG A 1 446 ? 28.789  -33.676 78.537  1.00 33.43 ? 445 ARG A CG  1 
ATOM   3553  C CD  . ARG A 1 446 ? 27.747  -34.781 78.456  1.00 35.55 ? 445 ARG A CD  1 
ATOM   3554  N NE  . ARG A 1 446 ? 27.005  -34.928 79.707  1.00 37.50 ? 445 ARG A NE  1 
ATOM   3555  C CZ  . ARG A 1 446 ? 25.684  -34.822 79.808  1.00 38.52 ? 445 ARG A CZ  1 
ATOM   3556  N NH1 . ARG A 1 446 ? 24.956  -34.566 78.731  1.00 39.51 ? 445 ARG A NH1 1 
ATOM   3557  N NH2 . ARG A 1 446 ? 25.092  -34.974 80.985  1.00 39.35 ? 445 ARG A NH2 1 
ATOM   3558  N N   . LYS A 1 447 ? 30.648  -31.303 76.688  1.00 34.38 ? 446 LYS A N   1 
ATOM   3559  C CA  . LYS A 1 447 ? 31.936  -31.550 76.041  1.00 35.84 ? 446 LYS A CA  1 
ATOM   3560  C C   . LYS A 1 447 ? 33.029  -30.714 76.683  1.00 35.54 ? 446 LYS A C   1 
ATOM   3561  O O   . LYS A 1 447 ? 34.115  -31.216 76.985  1.00 34.33 ? 446 LYS A O   1 
ATOM   3562  C CB  . LYS A 1 447 ? 31.883  -31.224 74.546  1.00 36.93 ? 446 LYS A CB  1 
ATOM   3563  C CG  . LYS A 1 447 ? 30.948  -32.094 73.725  1.00 40.68 ? 446 LYS A CG  1 
ATOM   3564  C CD  . LYS A 1 447 ? 31.205  -31.892 72.225  1.00 43.34 ? 446 LYS A CD  1 
ATOM   3565  C CE  . LYS A 1 447 ? 30.122  -32.543 71.374  1.00 43.22 ? 446 LYS A CE  1 
ATOM   3566  N NZ  . LYS A 1 447 ? 29.927  -33.975 71.714  1.00 44.34 ? 446 LYS A NZ  1 
ATOM   3567  N N   . GLU A 1 448 ? 32.739  -29.431 76.884  1.00 35.04 ? 447 GLU A N   1 
ATOM   3568  C CA  . GLU A 1 448 ? 33.705  -28.524 77.491  1.00 34.43 ? 447 GLU A CA  1 
ATOM   3569  C C   . GLU A 1 448 ? 34.129  -28.997 78.873  1.00 34.87 ? 447 GLU A C   1 
ATOM   3570  O O   . GLU A 1 448 ? 35.314  -28.975 79.209  1.00 35.56 ? 447 GLU A O   1 
ATOM   3571  C CB  . GLU A 1 448 ? 33.117  -27.117 77.604  1.00 34.62 ? 447 GLU A CB  1 
ATOM   3572  C CG  . GLU A 1 448 ? 32.983  -26.394 76.284  1.00 33.40 ? 447 GLU A CG  1 
ATOM   3573  C CD  . GLU A 1 448 ? 32.415  -24.995 76.440  1.00 32.90 ? 447 GLU A CD  1 
ATOM   3574  O OE1 . GLU A 1 448 ? 32.463  -24.230 75.455  1.00 31.75 ? 447 GLU A OE1 1 
ATOM   3575  O OE2 . GLU A 1 448 ? 31.918  -24.664 77.541  1.00 30.46 ? 447 GLU A OE2 1 
ATOM   3576  N N   . LEU A 1 449 ? 33.160  -29.418 79.677  1.00 35.35 ? 448 LEU A N   1 
ATOM   3577  C CA  . LEU A 1 449 ? 33.453  -29.877 81.028  1.00 36.45 ? 448 LEU A CA  1 
ATOM   3578  C C   . LEU A 1 449 ? 34.252  -31.174 81.036  1.00 38.06 ? 448 LEU A C   1 
ATOM   3579  O O   . LEU A 1 449 ? 35.053  -31.407 81.944  1.00 37.54 ? 448 LEU A O   1 
ATOM   3580  C CB  . LEU A 1 449 ? 32.156  -30.048 81.827  1.00 35.79 ? 448 LEU A CB  1 
ATOM   3581  C CG  . LEU A 1 449 ? 31.445  -28.747 82.226  1.00 34.92 ? 448 LEU A CG  1 
ATOM   3582  C CD1 . LEU A 1 449 ? 30.191  -29.067 83.030  1.00 35.09 ? 448 LEU A CD1 1 
ATOM   3583  C CD2 . LEU A 1 449 ? 32.387  -27.878 83.045  1.00 33.00 ? 448 LEU A CD2 1 
ATOM   3584  N N   . GLN A 1 450 ? 34.039  -32.017 80.031  1.00 39.06 ? 449 GLN A N   1 
ATOM   3585  C CA  . GLN A 1 450 ? 34.772  -33.274 79.955  1.00 42.64 ? 449 GLN A CA  1 
ATOM   3586  C C   . GLN A 1 450 ? 36.214  -32.945 79.589  1.00 43.35 ? 449 GLN A C   1 
ATOM   3587  O O   . GLN A 1 450 ? 37.152  -33.566 80.092  1.00 43.35 ? 449 GLN A O   1 
ATOM   3588  C CB  . GLN A 1 450 ? 34.158  -34.200 78.901  1.00 43.56 ? 449 GLN A CB  1 
ATOM   3589  C CG  . GLN A 1 450 ? 32.642  -34.274 78.981  1.00 48.85 ? 449 GLN A CG  1 
ATOM   3590  C CD  . GLN A 1 450 ? 32.056  -35.454 78.234  1.00 50.48 ? 449 GLN A CD  1 
ATOM   3591  O OE1 . GLN A 1 450 ? 32.072  -36.583 78.729  1.00 52.41 ? 449 GLN A OE1 1 
ATOM   3592  N NE2 . GLN A 1 450 ? 31.536  -35.201 77.033  1.00 51.09 ? 449 GLN A NE2 1 
ATOM   3593  N N   . ALA A 1 451 ? 36.377  -31.949 78.723  1.00 43.70 ? 450 ALA A N   1 
ATOM   3594  C CA  . ALA A 1 451 ? 37.696  -31.519 78.281  1.00 44.99 ? 450 ALA A CA  1 
ATOM   3595  C C   . ALA A 1 451 ? 38.462  -30.888 79.437  1.00 46.09 ? 450 ALA A C   1 
ATOM   3596  O O   . ALA A 1 451 ? 39.692  -30.911 79.466  1.00 46.93 ? 450 ALA A O   1 
ATOM   3597  C CB  . ALA A 1 451 ? 37.563  -30.528 77.131  1.00 44.43 ? 450 ALA A CB  1 
ATOM   3598  N N   . ALA A 1 452 ? 37.727  -30.326 80.390  1.00 47.67 ? 451 ALA A N   1 
ATOM   3599  C CA  . ALA A 1 452 ? 38.336  -29.694 81.554  1.00 48.72 ? 451 ALA A CA  1 
ATOM   3600  C C   . ALA A 1 452 ? 38.704  -30.752 82.590  1.00 49.82 ? 451 ALA A C   1 
ATOM   3601  O O   . ALA A 1 452 ? 39.203  -30.434 83.671  1.00 50.51 ? 451 ALA A O   1 
ATOM   3602  C CB  . ALA A 1 452 ? 37.375  -28.680 82.159  1.00 48.61 ? 451 ALA A CB  1 
ATOM   3603  N N   . GLY A 1 453 ? 38.449  -32.013 82.254  1.00 50.36 ? 452 GLY A N   1 
ATOM   3604  C CA  . GLY A 1 453 ? 38.770  -33.099 83.161  1.00 51.25 ? 452 GLY A CA  1 
ATOM   3605  C C   . GLY A 1 453 ? 37.939  -33.102 84.427  1.00 51.77 ? 452 GLY A C   1 
ATOM   3606  O O   . GLY A 1 453 ? 38.386  -33.571 85.472  1.00 52.29 ? 452 GLY A O   1 
ATOM   3607  N N   . LYS A 1 454 ? 36.724  -32.573 84.339  1.00 52.14 ? 453 LYS A N   1 
ATOM   3608  C CA  . LYS A 1 454 ? 35.835  -32.533 85.489  1.00 51.78 ? 453 LYS A CA  1 
ATOM   3609  C C   . LYS A 1 454 ? 35.366  -33.936 85.852  1.00 51.69 ? 453 LYS A C   1 
ATOM   3610  O O   . LYS A 1 454 ? 35.102  -34.763 84.980  1.00 51.06 ? 453 LYS A O   1 
ATOM   3611  C CB  . LYS A 1 454 ? 34.626  -31.641 85.193  1.00 52.06 ? 453 LYS A CB  1 
ATOM   3612  C CG  . LYS A 1 454 ? 34.884  -30.156 85.394  1.00 52.03 ? 453 LYS A CG  1 
ATOM   3613  C CD  . LYS A 1 454 ? 34.905  -29.813 86.875  1.00 54.12 ? 453 LYS A CD  1 
ATOM   3614  C CE  . LYS A 1 454 ? 35.240  -28.345 87.122  1.00 54.73 ? 453 LYS A CE  1 
ATOM   3615  N NZ  . LYS A 1 454 ? 36.667  -28.028 86.815  1.00 55.95 ? 453 LYS A NZ  1 
ATOM   3616  N N   . SER A 1 455 ? 35.282  -34.200 87.150  1.00 51.08 ? 454 SER A N   1 
ATOM   3617  C CA  . SER A 1 455 ? 34.831  -35.491 87.645  1.00 50.69 ? 454 SER A CA  1 
ATOM   3618  C C   . SER A 1 455 ? 33.448  -35.796 87.082  1.00 50.53 ? 454 SER A C   1 
ATOM   3619  O O   . SER A 1 455 ? 32.649  -34.887 86.861  1.00 50.97 ? 454 SER A O   1 
ATOM   3620  C CB  . SER A 1 455 ? 34.764  -35.463 89.172  1.00 49.82 ? 454 SER A CB  1 
ATOM   3621  O OG  . SER A 1 455 ? 34.015  -36.554 89.670  1.00 50.01 ? 454 SER A OG  1 
ATOM   3622  N N   . PRO A 1 456 ? 33.150  -37.079 86.834  1.00 50.06 ? 455 PRO A N   1 
ATOM   3623  C CA  . PRO A 1 456 ? 31.836  -37.442 86.296  1.00 49.39 ? 455 PRO A CA  1 
ATOM   3624  C C   . PRO A 1 456 ? 30.723  -36.820 87.137  1.00 48.30 ? 455 PRO A C   1 
ATOM   3625  O O   . PRO A 1 456 ? 29.740  -36.295 86.610  1.00 48.09 ? 455 PRO A O   1 
ATOM   3626  C CB  . PRO A 1 456 ? 31.846  -38.965 86.381  1.00 50.25 ? 455 PRO A CB  1 
ATOM   3627  C CG  . PRO A 1 456 ? 33.283  -39.289 86.119  1.00 49.65 ? 455 PRO A CG  1 
ATOM   3628  C CD  . PRO A 1 456 ? 34.007  -38.269 86.975  1.00 50.02 ? 455 PRO A CD  1 
ATOM   3629  N N   . GLU A 1 457 ? 30.902  -36.876 88.452  1.00 46.73 ? 456 GLU A N   1 
ATOM   3630  C CA  . GLU A 1 457 ? 29.935  -36.331 89.390  1.00 46.02 ? 456 GLU A CA  1 
ATOM   3631  C C   . GLU A 1 457 ? 29.946  -34.803 89.390  1.00 44.14 ? 456 GLU A C   1 
ATOM   3632  O O   . GLU A 1 457 ? 28.890  -34.172 89.351  1.00 42.98 ? 456 GLU A O   1 
ATOM   3633  C CB  . GLU A 1 457 ? 30.229  -36.866 90.794  1.00 48.14 ? 456 GLU A CB  1 
ATOM   3634  C CG  . GLU A 1 457 ? 29.340  -36.311 91.892  1.00 52.41 ? 456 GLU A CG  1 
ATOM   3635  C CD  . GLU A 1 457 ? 29.569  -37.006 93.224  1.00 54.82 ? 456 GLU A CD  1 
ATOM   3636  O OE1 . GLU A 1 457 ? 29.154  -38.178 93.365  1.00 55.47 ? 456 GLU A OE1 1 
ATOM   3637  O OE2 . GLU A 1 457 ? 30.174  -36.385 94.125  1.00 56.53 ? 456 GLU A OE2 1 
ATOM   3638  N N   . ASP A 1 458 ? 31.135  -34.210 89.433  1.00 41.29 ? 457 ASP A N   1 
ATOM   3639  C CA  . ASP A 1 458 ? 31.247  -32.756 89.433  1.00 40.33 ? 457 ASP A CA  1 
ATOM   3640  C C   . ASP A 1 458 ? 30.685  -32.178 88.139  1.00 39.12 ? 457 ASP A C   1 
ATOM   3641  O O   . ASP A 1 458 ? 30.069  -31.113 88.137  1.00 38.80 ? 457 ASP A O   1 
ATOM   3642  C CB  . ASP A 1 458 ? 32.707  -32.317 89.588  1.00 40.03 ? 457 ASP A CB  1 
ATOM   3643  C CG  . ASP A 1 458 ? 33.268  -32.613 90.967  1.00 42.10 ? 457 ASP A CG  1 
ATOM   3644  O OD1 . ASP A 1 458 ? 32.547  -32.403 91.969  1.00 42.92 ? 457 ASP A OD1 1 
ATOM   3645  O OD2 . ASP A 1 458 ? 34.438  -33.041 91.052  1.00 42.47 ? 457 ASP A OD2 1 
ATOM   3646  N N   . LEU A 1 459 ? 30.895  -32.895 87.042  1.00 37.53 ? 458 LEU A N   1 
ATOM   3647  C CA  . LEU A 1 459 ? 30.421  -32.452 85.739  1.00 36.90 ? 458 LEU A CA  1 
ATOM   3648  C C   . LEU A 1 459 ? 28.901  -32.349 85.686  1.00 36.74 ? 458 LEU A C   1 
ATOM   3649  O O   . LEU A 1 459 ? 28.361  -31.372 85.167  1.00 37.20 ? 458 LEU A O   1 
ATOM   3650  C CB  . LEU A 1 459 ? 30.925  -33.402 84.643  1.00 35.37 ? 458 LEU A CB  1 
ATOM   3651  C CG  . LEU A 1 459 ? 30.589  -33.066 83.184  1.00 34.93 ? 458 LEU A CG  1 
ATOM   3652  C CD1 . LEU A 1 459 ? 31.541  -33.801 82.258  1.00 34.00 ? 458 LEU A CD1 1 
ATOM   3653  C CD2 . LEU A 1 459 ? 29.153  -33.439 82.875  1.00 34.34 ? 458 LEU A CD2 1 
ATOM   3654  N N   . GLU A 1 460 ? 28.207  -33.347 86.222  1.00 35.79 ? 459 GLU A N   1 
ATOM   3655  C CA  . GLU A 1 460 ? 26.750  -33.328 86.198  1.00 36.10 ? 459 GLU A CA  1 
ATOM   3656  C C   . GLU A 1 460 ? 26.165  -32.271 87.122  1.00 35.21 ? 459 GLU A C   1 
ATOM   3657  O O   . GLU A 1 460 ? 25.100  -31.727 86.844  1.00 34.37 ? 459 GLU A O   1 
ATOM   3658  C CB  . GLU A 1 460 ? 26.194  -34.708 86.556  1.00 36.80 ? 459 GLU A CB  1 
ATOM   3659  C CG  . GLU A 1 460 ? 26.524  -35.766 85.523  1.00 40.08 ? 459 GLU A CG  1 
ATOM   3660  C CD  . GLU A 1 460 ? 25.913  -35.468 84.161  1.00 42.08 ? 459 GLU A CD  1 
ATOM   3661  O OE1 . GLU A 1 460 ? 26.382  -36.046 83.160  1.00 44.69 ? 459 GLU A OE1 1 
ATOM   3662  O OE2 . GLU A 1 460 ? 24.960  -34.665 84.089  1.00 43.30 ? 459 GLU A OE2 1 
ATOM   3663  N N   . ARG A 1 461 ? 26.864  -31.976 88.213  1.00 35.09 ? 460 ARG A N   1 
ATOM   3664  C CA  . ARG A 1 461 ? 26.400  -30.976 89.172  1.00 35.86 ? 460 ARG A CA  1 
ATOM   3665  C C   . ARG A 1 461 ? 26.488  -29.554 88.603  1.00 34.02 ? 460 ARG A C   1 
ATOM   3666  O O   . ARG A 1 461 ? 25.571  -28.748 88.768  1.00 32.21 ? 460 ARG A O   1 
ATOM   3667  C CB  . ARG A 1 461 ? 27.238  -31.038 90.458  1.00 38.91 ? 460 ARG A CB  1 
ATOM   3668  C CG  . ARG A 1 461 ? 27.347  -32.417 91.095  1.00 44.23 ? 460 ARG A CG  1 
ATOM   3669  C CD  . ARG A 1 461 ? 26.042  -32.864 91.738  1.00 49.43 ? 460 ARG A CD  1 
ATOM   3670  N NE  . ARG A 1 461 ? 26.076  -34.277 92.115  1.00 52.62 ? 460 ARG A NE  1 
ATOM   3671  C CZ  . ARG A 1 461 ? 26.192  -35.281 91.248  1.00 52.86 ? 460 ARG A CZ  1 
ATOM   3672  N NH1 . ARG A 1 461 ? 26.287  -35.035 89.947  1.00 52.53 ? 460 ARG A NH1 1 
ATOM   3673  N NH2 . ARG A 1 461 ? 26.215  -36.534 91.681  1.00 54.35 ? 460 ARG A NH2 1 
ATOM   3674  N N   . LEU A 1 462 ? 27.597  -29.262 87.933  1.00 31.58 ? 461 LEU A N   1 
ATOM   3675  C CA  . LEU A 1 462 ? 27.843  -27.936 87.375  1.00 30.01 ? 461 LEU A CA  1 
ATOM   3676  C C   . LEU A 1 462 ? 27.243  -27.690 85.995  1.00 28.48 ? 461 LEU A C   1 
ATOM   3677  O O   . LEU A 1 462 ? 26.940  -26.551 85.637  1.00 28.62 ? 461 LEU A O   1 
ATOM   3678  C CB  . LEU A 1 462 ? 29.354  -27.692 87.321  1.00 29.76 ? 461 LEU A CB  1 
ATOM   3679  C CG  . LEU A 1 462 ? 29.857  -26.348 86.787  1.00 31.95 ? 461 LEU A CG  1 
ATOM   3680  C CD1 . LEU A 1 462 ? 29.335  -25.215 87.662  1.00 33.23 ? 461 LEU A CD1 1 
ATOM   3681  C CD2 . LEU A 1 462 ? 31.383  -26.349 86.774  1.00 31.93 ? 461 LEU A CD2 1 
ATOM   3682  N N   . LEU A 1 463 ? 27.071  -28.761 85.231  1.00 26.43 ? 462 LEU A N   1 
ATOM   3683  C CA  . LEU A 1 463 ? 26.548  -28.692 83.869  1.00 25.46 ? 462 LEU A CA  1 
ATOM   3684  C C   . LEU A 1 463 ? 25.365  -27.755 83.591  1.00 24.30 ? 462 LEU A C   1 
ATOM   3685  O O   . LEU A 1 463 ? 25.459  -26.876 82.740  1.00 22.88 ? 462 LEU A O   1 
ATOM   3686  C CB  . LEU A 1 463 ? 26.197  -30.105 83.387  1.00 24.28 ? 462 LEU A CB  1 
ATOM   3687  C CG  . LEU A 1 463 ? 25.615  -30.245 81.979  1.00 24.50 ? 462 LEU A CG  1 
ATOM   3688  C CD1 . LEU A 1 463 ? 26.623  -29.771 80.943  1.00 21.41 ? 462 LEU A CD1 1 
ATOM   3689  C CD2 . LEU A 1 463 ? 25.248  -31.703 81.734  1.00 25.92 ? 462 LEU A CD2 1 
ATOM   3690  N N   . PRO A 1 464 ? 24.235  -27.929 84.298  1.00 23.57 ? 463 PRO A N   1 
ATOM   3691  C CA  . PRO A 1 464 ? 23.093  -27.047 84.035  1.00 23.22 ? 463 PRO A CA  1 
ATOM   3692  C C   . PRO A 1 464 ? 23.374  -25.548 84.196  1.00 22.80 ? 463 PRO A C   1 
ATOM   3693  O O   . PRO A 1 464 ? 22.797  -24.724 83.489  1.00 21.74 ? 463 PRO A O   1 
ATOM   3694  C CB  . PRO A 1 464 ? 22.029  -27.568 85.002  1.00 24.00 ? 463 PRO A CB  1 
ATOM   3695  C CG  . PRO A 1 464 ? 22.831  -28.102 86.133  1.00 24.95 ? 463 PRO A CG  1 
ATOM   3696  C CD  . PRO A 1 464 ? 23.954  -28.826 85.431  1.00 22.92 ? 463 PRO A CD  1 
ATOM   3697  N N   . HIS A 1 465 ? 24.276  -25.205 85.108  1.00 22.30 ? 464 HIS A N   1 
ATOM   3698  C CA  . HIS A 1 465 ? 24.627  -23.812 85.352  1.00 21.50 ? 464 HIS A CA  1 
ATOM   3699  C C   . HIS A 1 465 ? 25.395  -23.199 84.190  1.00 21.95 ? 464 HIS A C   1 
ATOM   3700  O O   . HIS A 1 465 ? 25.454  -21.977 84.055  1.00 21.09 ? 464 HIS A O   1 
ATOM   3701  C CB  . HIS A 1 465 ? 25.478  -23.705 86.618  1.00 22.72 ? 464 HIS A CB  1 
ATOM   3702  C CG  . HIS A 1 465 ? 24.778  -24.172 87.855  1.00 22.47 ? 464 HIS A CG  1 
ATOM   3703  N ND1 . HIS A 1 465 ? 23.868  -23.391 88.534  1.00 21.03 ? 464 HIS A ND1 1 
ATOM   3704  C CD2 . HIS A 1 465 ? 24.840  -25.348 88.523  1.00 22.04 ? 464 HIS A CD2 1 
ATOM   3705  C CE1 . HIS A 1 465 ? 23.402  -24.065 89.571  1.00 23.02 ? 464 HIS A CE1 1 
ATOM   3706  N NE2 . HIS A 1 465 ? 23.975  -25.255 89.586  1.00 23.75 ? 464 HIS A NE2 1 
ATOM   3707  N N   . LYS A 1 466 ? 25.979  -24.042 83.346  1.00 21.28 ? 465 LYS A N   1 
ATOM   3708  C CA  . LYS A 1 466 ? 26.772  -23.545 82.228  1.00 21.76 ? 465 LYS A CA  1 
ATOM   3709  C C   . LYS A 1 466 ? 26.043  -23.516 80.896  1.00 20.88 ? 465 LYS A C   1 
ATOM   3710  O O   . LYS A 1 466 ? 26.604  -23.113 79.872  1.00 20.25 ? 465 LYS A O   1 
ATOM   3711  C CB  . LYS A 1 466 ? 28.058  -24.363 82.112  1.00 25.70 ? 465 LYS A CB  1 
ATOM   3712  C CG  . LYS A 1 466 ? 28.752  -24.545 83.449  1.00 26.70 ? 465 LYS A CG  1 
ATOM   3713  C CD  . LYS A 1 466 ? 30.250  -24.722 83.297  1.00 32.51 ? 465 LYS A CD  1 
ATOM   3714  C CE  . LYS A 1 466 ? 30.901  -23.450 82.794  1.00 33.01 ? 465 LYS A CE  1 
ATOM   3715  N NZ  . LYS A 1 466 ? 32.386  -23.559 82.812  1.00 36.13 ? 465 LYS A NZ  1 
ATOM   3716  N N   . VAL A 1 467 ? 24.783  -23.926 80.915  1.00 21.16 ? 466 VAL A N   1 
ATOM   3717  C CA  . VAL A 1 467 ? 23.976  -23.939 79.708  1.00 20.52 ? 466 VAL A CA  1 
ATOM   3718  C C   . VAL A 1 467 ? 23.389  -22.560 79.430  1.00 21.69 ? 466 VAL A C   1 
ATOM   3719  O O   . VAL A 1 467 ? 22.892  -21.893 80.343  1.00 20.37 ? 466 VAL A O   1 
ATOM   3720  C CB  . VAL A 1 467 ? 22.822  -24.951 79.835  1.00 20.06 ? 466 VAL A CB  1 
ATOM   3721  C CG1 . VAL A 1 467 ? 21.866  -24.820 78.653  1.00 19.16 ? 466 VAL A CG1 1 
ATOM   3722  C CG2 . VAL A 1 467 ? 23.390  -26.358 79.903  1.00 18.48 ? 466 VAL A CG2 1 
ATOM   3723  N N   . PHE A 1 468 ? 23.466  -22.136 78.170  1.00 20.40 ? 467 PHE A N   1 
ATOM   3724  C CA  . PHE A 1 468 ? 22.905  -20.857 77.738  1.00 22.04 ? 467 PHE A CA  1 
ATOM   3725  C C   . PHE A 1 468 ? 21.750  -21.213 76.814  1.00 21.18 ? 467 PHE A C   1 
ATOM   3726  O O   . PHE A 1 468 ? 21.973  -21.734 75.727  1.00 21.77 ? 467 PHE A O   1 
ATOM   3727  C CB  . PHE A 1 468 ? 23.942  -20.030 76.969  1.00 20.07 ? 467 PHE A CB  1 
ATOM   3728  C CG  . PHE A 1 468 ? 25.000  -19.416 77.841  1.00 21.92 ? 467 PHE A CG  1 
ATOM   3729  C CD1 . PHE A 1 468 ? 25.959  -20.210 78.466  1.00 21.30 ? 467 PHE A CD1 1 
ATOM   3730  C CD2 . PHE A 1 468 ? 25.025  -18.037 78.056  1.00 22.29 ? 467 PHE A CD2 1 
ATOM   3731  C CE1 . PHE A 1 468 ? 26.926  -19.645 79.294  1.00 21.14 ? 467 PHE A CE1 1 
ATOM   3732  C CE2 . PHE A 1 468 ? 25.988  -17.458 78.882  1.00 22.87 ? 467 PHE A CE2 1 
ATOM   3733  C CZ  . PHE A 1 468 ? 26.942  -18.262 79.505  1.00 22.77 ? 467 PHE A CZ  1 
ATOM   3734  N N   . GLU A 1 469 ? 20.518  -20.938 77.230  1.00 20.75 ? 468 GLU A N   1 
ATOM   3735  C CA  . GLU A 1 469 ? 19.379  -21.291 76.389  1.00 21.44 ? 468 GLU A CA  1 
ATOM   3736  C C   . GLU A 1 469 ? 19.338  -20.487 75.092  1.00 22.40 ? 468 GLU A C   1 
ATOM   3737  O O   . GLU A 1 469 ? 18.725  -20.914 74.109  1.00 22.65 ? 468 GLU A O   1 
ATOM   3738  C CB  . GLU A 1 469 ? 18.070  -21.133 77.172  1.00 21.16 ? 468 GLU A CB  1 
ATOM   3739  C CG  . GLU A 1 469 ? 18.087  -21.856 78.514  1.00 24.63 ? 468 GLU A CG  1 
ATOM   3740  C CD  . GLU A 1 469 ? 16.709  -22.011 79.136  1.00 27.98 ? 468 GLU A CD  1 
ATOM   3741  O OE1 . GLU A 1 469 ? 15.921  -21.041 79.109  1.00 29.66 ? 468 GLU A OE1 1 
ATOM   3742  O OE2 . GLU A 1 469 ? 16.417  -23.105 79.670  1.00 27.24 ? 468 GLU A OE2 1 
ATOM   3743  N N   . GLY A 1 470 ? 19.999  -19.330 75.086  1.00 21.11 ? 469 GLY A N   1 
ATOM   3744  C CA  . GLY A 1 470 ? 20.027  -18.500 73.892  1.00 18.84 ? 469 GLY A CA  1 
ATOM   3745  C C   . GLY A 1 470 ? 18.653  -18.062 73.408  1.00 19.85 ? 469 GLY A C   1 
ATOM   3746  O O   . GLY A 1 470 ? 17.729  -17.871 74.200  1.00 19.69 ? 469 GLY A O   1 
ATOM   3747  N N   . ASN A 1 471 ? 18.526  -17.904 72.096  1.00 19.02 ? 470 ASN A N   1 
ATOM   3748  C CA  . ASN A 1 471 ? 17.286  -17.465 71.473  1.00 20.88 ? 470 ASN A CA  1 
ATOM   3749  C C   . ASN A 1 471 ? 16.831  -16.086 71.973  1.00 19.90 ? 470 ASN A C   1 
ATOM   3750  O O   . ASN A 1 471 ? 15.638  -15.792 72.023  1.00 20.59 ? 470 ASN A O   1 
ATOM   3751  C CB  . ASN A 1 471 ? 16.178  -18.508 71.680  1.00 20.80 ? 470 ASN A CB  1 
ATOM   3752  C CG  . ASN A 1 471 ? 15.137  -18.465 70.579  1.00 25.66 ? 470 ASN A CG  1 
ATOM   3753  O OD1 . ASN A 1 471 ? 15.458  -18.145 69.431  1.00 28.07 ? 470 ASN A OD1 1 
ATOM   3754  N ND2 . ASN A 1 471 ? 13.889  -18.806 70.909  1.00 25.64 ? 470 ASN A ND2 1 
ATOM   3755  N N   . ARG A 1 472 ? 17.791  -15.243 72.340  1.00 19.21 ? 471 ARG A N   1 
ATOM   3756  C CA  . ARG A 1 472 ? 17.486  -13.897 72.811  1.00 18.56 ? 471 ARG A CA  1 
ATOM   3757  C C   . ARG A 1 472 ? 17.771  -12.920 71.663  1.00 18.68 ? 471 ARG A C   1 
ATOM   3758  O O   . ARG A 1 472 ? 18.915  -12.734 71.256  1.00 19.62 ? 471 ARG A O   1 
ATOM   3759  C CB  . ARG A 1 472 ? 18.315  -13.612 74.063  1.00 17.87 ? 471 ARG A CB  1 
ATOM   3760  C CG  . ARG A 1 472 ? 17.817  -14.422 75.274  1.00 15.30 ? 471 ARG A CG  1 
ATOM   3761  C CD  . ARG A 1 472 ? 18.928  -14.744 76.264  1.00 15.59 ? 471 ARG A CD  1 
ATOM   3762  N NE  . ARG A 1 472 ? 18.416  -15.046 77.604  1.00 20.18 ? 471 ARG A NE  1 
ATOM   3763  C CZ  . ARG A 1 472 ? 17.813  -16.178 77.970  1.00 20.18 ? 471 ARG A CZ  1 
ATOM   3764  N NH1 . ARG A 1 472 ? 17.631  -17.163 77.100  1.00 21.82 ? 471 ARG A NH1 1 
ATOM   3765  N NH2 . ARG A 1 472 ? 17.381  -16.320 79.220  1.00 18.42 ? 471 ARG A NH2 1 
ATOM   3766  N N   . PRO A 1 473 ? 16.712  -12.295 71.119  1.00 19.68 ? 472 PRO A N   1 
ATOM   3767  C CA  . PRO A 1 473 ? 16.748  -11.341 70.004  1.00 18.76 ? 472 PRO A CA  1 
ATOM   3768  C C   . PRO A 1 473 ? 17.438  -10.008 70.221  1.00 19.12 ? 472 PRO A C   1 
ATOM   3769  O O   . PRO A 1 473 ? 17.388  -9.427  71.309  1.00 19.60 ? 472 PRO A O   1 
ATOM   3770  C CB  . PRO A 1 473 ? 15.274  -11.166 69.661  1.00 20.18 ? 472 PRO A CB  1 
ATOM   3771  C CG  . PRO A 1 473 ? 14.637  -11.204 71.015  1.00 20.62 ? 472 PRO A CG  1 
ATOM   3772  C CD  . PRO A 1 473 ? 15.349  -12.373 71.685  1.00 20.69 ? 472 PRO A CD  1 
ATOM   3773  N N   . THR A 1 474 ? 18.084  -9.525  69.162  1.00 18.11 ? 473 THR A N   1 
ATOM   3774  C CA  . THR A 1 474 ? 18.780  -8.252  69.215  1.00 17.23 ? 473 THR A CA  1 
ATOM   3775  C C   . THR A 1 474 ? 18.784  -7.561  67.865  1.00 17.67 ? 473 THR A C   1 
ATOM   3776  O O   . THR A 1 474 ? 18.519  -8.174  66.830  1.00 16.20 ? 473 THR A O   1 
ATOM   3777  C CB  . THR A 1 474 ? 20.276  -8.411  69.640  1.00 16.68 ? 473 THR A CB  1 
ATOM   3778  O OG1 . THR A 1 474 ? 20.970  -9.218  68.679  1.00 16.93 ? 473 THR A OG1 1 
ATOM   3779  C CG2 . THR A 1 474 ? 20.396  -9.047  71.019  1.00 15.49 ? 473 THR A CG2 1 
ATOM   3780  N N   . ASN A 1 475 ? 19.061  -6.262  67.905  1.00 18.23 ? 474 ASN A N   1 
ATOM   3781  C CA  . ASN A 1 475 ? 19.211  -5.454  66.708  1.00 16.41 ? 474 ASN A CA  1 
ATOM   3782  C C   . ASN A 1 475 ? 20.670  -5.013  66.790  1.00 15.50 ? 474 ASN A C   1 
ATOM   3783  O O   . ASN A 1 475 ? 21.193  -4.780  67.884  1.00 15.87 ? 474 ASN A O   1 
ATOM   3784  C CB  . ASN A 1 475 ? 18.337  -4.192  66.734  1.00 17.63 ? 474 ASN A CB  1 
ATOM   3785  C CG  . ASN A 1 475 ? 16.890  -4.468  66.390  1.00 17.78 ? 474 ASN A CG  1 
ATOM   3786  O OD1 . ASN A 1 475 ? 16.593  -5.260  65.495  1.00 17.95 ? 474 ASN A OD1 1 
ATOM   3787  N ND2 . ASN A 1 475 ? 15.974  -3.795  67.091  1.00 15.10 ? 474 ASN A ND2 1 
ATOM   3788  N N   . SER A 1 476 ? 21.328  -4.924  65.646  1.00 15.25 ? 475 SER A N   1 
ATOM   3789  C CA  . SER A 1 476 ? 22.705  -4.457  65.594  1.00 15.31 ? 475 SER A CA  1 
ATOM   3790  C C   . SER A 1 476 ? 22.702  -3.280  64.633  1.00 14.89 ? 475 SER A C   1 
ATOM   3791  O O   . SER A 1 476 ? 22.411  -3.439  63.448  1.00 15.69 ? 475 SER A O   1 
ATOM   3792  C CB  . SER A 1 476 ? 23.648  -5.551  65.084  1.00 15.16 ? 475 SER A CB  1 
ATOM   3793  O OG  . SER A 1 476 ? 23.945  -6.493  66.104  1.00 17.06 ? 475 SER A OG  1 
ATOM   3794  N N   . ILE A 1 477 ? 22.987  -2.095  65.162  1.00 14.29 ? 476 ILE A N   1 
ATOM   3795  C CA  . ILE A 1 477 ? 23.024  -0.879  64.365  1.00 14.84 ? 476 ILE A CA  1 
ATOM   3796  C C   . ILE A 1 477 ? 24.471  -0.411  64.308  1.00 15.46 ? 476 ILE A C   1 
ATOM   3797  O O   . ILE A 1 477 ? 25.057  -0.034  65.319  1.00 16.71 ? 476 ILE A O   1 
ATOM   3798  C CB  . ILE A 1 477 ? 22.130  0.211   65.000  1.00 17.81 ? 476 ILE A CB  1 
ATOM   3799  C CG1 . ILE A 1 477 ? 20.673  -0.277  65.005  1.00 18.40 ? 476 ILE A CG1 1 
ATOM   3800  C CG2 . ILE A 1 477 ? 22.255  1.524   64.222  1.00 14.50 ? 476 ILE A CG2 1 
ATOM   3801  C CD1 . ILE A 1 477 ? 19.759  0.493   65.925  1.00 19.76 ? 476 ILE A CD1 1 
ATOM   3802  N N   . VAL A 1 478 ? 25.045  -0.456  63.115  1.00 16.22 ? 477 VAL A N   1 
ATOM   3803  C CA  . VAL A 1 478 ? 26.432  -0.066  62.912  1.00 15.52 ? 477 VAL A CA  1 
ATOM   3804  C C   . VAL A 1 478 ? 26.506  1.096   61.926  1.00 16.14 ? 477 VAL A C   1 
ATOM   3805  O O   . VAL A 1 478 ? 25.887  1.063   60.864  1.00 17.46 ? 477 VAL A O   1 
ATOM   3806  C CB  . VAL A 1 478 ? 27.245  -1.252  62.349  1.00 15.09 ? 477 VAL A CB  1 
ATOM   3807  C CG1 . VAL A 1 478 ? 28.733  -0.922  62.347  1.00 14.75 ? 477 VAL A CG1 1 
ATOM   3808  C CG2 . VAL A 1 478 ? 26.970  -2.507  63.171  1.00 14.88 ? 477 VAL A CG2 1 
ATOM   3809  N N   . PHE A 1 479 ? 27.270  2.119   62.284  1.00 17.22 ? 478 PHE A N   1 
ATOM   3810  C CA  . PHE A 1 479 ? 27.437  3.291   61.439  1.00 15.22 ? 478 PHE A CA  1 
ATOM   3811  C C   . PHE A 1 479 ? 28.921  3.594   61.295  1.00 16.46 ? 478 PHE A C   1 
ATOM   3812  O O   . PHE A 1 479 ? 29.714  3.316   62.199  1.00 15.95 ? 478 PHE A O   1 
ATOM   3813  C CB  . PHE A 1 479 ? 26.684  4.483   62.040  1.00 15.60 ? 478 PHE A CB  1 
ATOM   3814  C CG  . PHE A 1 479 ? 26.684  4.505   63.538  1.00 14.89 ? 478 PHE A CG  1 
ATOM   3815  C CD1 . PHE A 1 479 ? 27.656  5.208   64.240  1.00 15.15 ? 478 PHE A CD1 1 
ATOM   3816  C CD2 . PHE A 1 479 ? 25.721  3.792   64.251  1.00 15.64 ? 478 PHE A CD2 1 
ATOM   3817  C CE1 . PHE A 1 479 ? 27.673  5.203   65.632  1.00 17.34 ? 478 PHE A CE1 1 
ATOM   3818  C CE2 . PHE A 1 479 ? 25.725  3.776   65.644  1.00 15.53 ? 478 PHE A CE2 1 
ATOM   3819  C CZ  . PHE A 1 479 ? 26.707  4.486   66.340  1.00 16.32 ? 478 PHE A CZ  1 
ATOM   3820  N N   . THR A 1 480 ? 29.288  4.162   60.150  1.00 15.44 ? 479 THR A N   1 
ATOM   3821  C CA  . THR A 1 480 ? 30.679  4.478   59.847  1.00 15.22 ? 479 THR A CA  1 
ATOM   3822  C C   . THR A 1 480 ? 31.454  5.218   60.936  1.00 16.10 ? 479 THR A C   1 
ATOM   3823  O O   . THR A 1 480 ? 32.540  4.792   61.330  1.00 16.54 ? 479 THR A O   1 
ATOM   3824  C CB  . THR A 1 480 ? 30.773  5.282   58.544  1.00 13.24 ? 479 THR A CB  1 
ATOM   3825  O OG1 . THR A 1 480 ? 30.034  4.604   57.522  1.00 15.52 ? 479 THR A OG1 1 
ATOM   3826  C CG2 . THR A 1 480 ? 32.230  5.413   58.099  1.00 12.26 ? 479 THR A CG2 1 
ATOM   3827  N N   . LYS A 1 481 ? 30.911  6.329   61.419  1.00 17.48 ? 480 LYS A N   1 
ATOM   3828  C CA  . LYS A 1 481 ? 31.599  7.098   62.450  1.00 16.95 ? 480 LYS A CA  1 
ATOM   3829  C C   . LYS A 1 481 ? 30.606  8.010   63.146  1.00 16.45 ? 480 LYS A C   1 
ATOM   3830  O O   . LYS A 1 481 ? 29.691  8.535   62.508  1.00 16.75 ? 480 LYS A O   1 
ATOM   3831  C CB  . LYS A 1 481 ? 32.726  7.919   61.816  1.00 17.75 ? 480 LYS A CB  1 
ATOM   3832  C CG  . LYS A 1 481 ? 33.607  8.659   62.803  1.00 18.31 ? 480 LYS A CG  1 
ATOM   3833  C CD  . LYS A 1 481 ? 34.768  9.328   62.074  1.00 20.97 ? 480 LYS A CD  1 
ATOM   3834  C CE  . LYS A 1 481 ? 35.742  9.982   63.045  1.00 21.36 ? 480 LYS A CE  1 
ATOM   3835  N NZ  . LYS A 1 481 ? 36.989  10.440  62.368  1.00 22.80 ? 480 LYS A NZ  1 
ATOM   3836  N N   . LEU A 1 482 ? 30.777  8.193   64.450  1.00 14.86 ? 481 LEU A N   1 
ATOM   3837  C CA  . LEU A 1 482 ? 29.866  9.046   65.203  1.00 16.45 ? 481 LEU A CA  1 
ATOM   3838  C C   . LEU A 1 482 ? 30.240  10.526  65.078  1.00 15.85 ? 481 LEU A C   1 
ATOM   3839  O O   . LEU A 1 482 ? 30.866  11.107  65.962  1.00 16.10 ? 481 LEU A O   1 
ATOM   3840  C CB  . LEU A 1 482 ? 29.832  8.627   66.678  1.00 16.09 ? 481 LEU A CB  1 
ATOM   3841  C CG  . LEU A 1 482 ? 28.700  9.141   67.580  1.00 20.37 ? 481 LEU A CG  1 
ATOM   3842  C CD1 . LEU A 1 482 ? 28.910  10.606  67.880  1.00 24.35 ? 481 LEU A CD1 1 
ATOM   3843  C CD2 . LEU A 1 482 ? 27.338  8.913   66.918  1.00 17.09 ? 481 LEU A CD2 1 
ATOM   3844  N N   . THR A 1 483 ? 29.843  11.117  63.961  1.00 15.98 ? 482 THR A N   1 
ATOM   3845  C CA  . THR A 1 483 ? 30.079  12.531  63.689  1.00 18.23 ? 482 THR A CA  1 
ATOM   3846  C C   . THR A 1 483 ? 28.798  13.265  64.078  1.00 17.65 ? 482 THR A C   1 
ATOM   3847  O O   . THR A 1 483 ? 27.795  12.634  64.424  1.00 16.62 ? 482 THR A O   1 
ATOM   3848  C CB  . THR A 1 483 ? 30.298  12.769  62.197  1.00 17.29 ? 482 THR A CB  1 
ATOM   3849  O OG1 . THR A 1 483 ? 29.150  12.298  61.486  1.00 18.35 ? 482 THR A OG1 1 
ATOM   3850  C CG2 . THR A 1 483 ? 31.543  12.033  61.708  1.00 17.13 ? 482 THR A CG2 1 
ATOM   3851  N N   . PRO A 1 484 ? 28.819  14.607  64.045  1.00 17.16 ? 483 PRO A N   1 
ATOM   3852  C CA  . PRO A 1 484 ? 27.617  15.365  64.399  1.00 16.25 ? 483 PRO A CA  1 
ATOM   3853  C C   . PRO A 1 484 ? 26.473  15.003  63.453  1.00 14.76 ? 483 PRO A C   1 
ATOM   3854  O O   . PRO A 1 484 ? 25.332  14.830  63.876  1.00 16.81 ? 483 PRO A O   1 
ATOM   3855  C CB  . PRO A 1 484 ? 28.072  16.815  64.243  1.00 17.05 ? 483 PRO A CB  1 
ATOM   3856  C CG  . PRO A 1 484 ? 29.499  16.740  64.688  1.00 17.42 ? 483 PRO A CG  1 
ATOM   3857  C CD  . PRO A 1 484 ? 29.994  15.493  63.969  1.00 18.02 ? 483 PRO A CD  1 
ATOM   3858  N N   . PHE A 1 485 ? 26.786  14.895  62.167  1.00 15.11 ? 484 PHE A N   1 
ATOM   3859  C CA  . PHE A 1 485 ? 25.784  14.526  61.177  1.00 15.05 ? 484 PHE A CA  1 
ATOM   3860  C C   . PHE A 1 485 ? 25.214  13.140  61.491  1.00 15.18 ? 484 PHE A C   1 
ATOM   3861  O O   . PHE A 1 485 ? 24.000  12.944  61.487  1.00 15.51 ? 484 PHE A O   1 
ATOM   3862  C CB  . PHE A 1 485 ? 26.398  14.499  59.771  1.00 15.91 ? 484 PHE A CB  1 
ATOM   3863  C CG  . PHE A 1 485 ? 25.401  14.208  58.673  1.00 18.39 ? 484 PHE A CG  1 
ATOM   3864  C CD1 . PHE A 1 485 ? 24.854  15.243  57.919  1.00 17.81 ? 484 PHE A CD1 1 
ATOM   3865  C CD2 . PHE A 1 485 ? 25.012  12.901  58.393  1.00 18.67 ? 484 PHE A CD2 1 
ATOM   3866  C CE1 . PHE A 1 485 ? 23.935  14.982  56.899  1.00 19.16 ? 484 PHE A CE1 1 
ATOM   3867  C CE2 . PHE A 1 485 ? 24.091  12.628  57.374  1.00 20.52 ? 484 PHE A CE2 1 
ATOM   3868  C CZ  . PHE A 1 485 ? 23.553  13.671  56.626  1.00 19.10 ? 484 PHE A CZ  1 
ATOM   3869  N N   . MET A 1 486 ? 26.084  12.174  61.764  1.00 13.79 ? 485 MET A N   1 
ATOM   3870  C CA  . MET A 1 486 ? 25.607  10.817  62.037  1.00 16.04 ? 485 MET A CA  1 
ATOM   3871  C C   . MET A 1 486 ? 24.779  10.730  63.313  1.00 16.97 ? 485 MET A C   1 
ATOM   3872  O O   . MET A 1 486 ? 23.796  9.992   63.367  1.00 17.27 ? 485 MET A O   1 
ATOM   3873  C CB  . MET A 1 486 ? 26.774  9.829   62.109  1.00 14.11 ? 485 MET A CB  1 
ATOM   3874  C CG  . MET A 1 486 ? 26.336  8.362   62.276  1.00 17.71 ? 485 MET A CG  1 
ATOM   3875  S SD  . MET A 1 486 ? 25.094  7.820   61.049  1.00 22.02 ? 485 MET A SD  1 
ATOM   3876  C CE  . MET A 1 486 ? 26.154  7.560   59.599  1.00 19.28 ? 485 MET A CE  1 
ATOM   3877  N N   . LEU A 1 487 ? 25.164  11.483  64.340  1.00 16.98 ? 486 LEU A N   1 
ATOM   3878  C CA  . LEU A 1 487 ? 24.408  11.459  65.585  1.00 16.00 ? 486 LEU A CA  1 
ATOM   3879  C C   . LEU A 1 487 ? 23.006  12.016  65.335  1.00 15.65 ? 486 LEU A C   1 
ATOM   3880  O O   . LEU A 1 487 ? 22.022  11.500  65.862  1.00 15.06 ? 486 LEU A O   1 
ATOM   3881  C CB  . LEU A 1 487 ? 25.110  12.285  66.662  1.00 16.35 ? 486 LEU A CB  1 
ATOM   3882  C CG  . LEU A 1 487 ? 24.359  12.412  67.989  1.00 17.09 ? 486 LEU A CG  1 
ATOM   3883  C CD1 . LEU A 1 487 ? 24.218  11.038  68.642  1.00 18.85 ? 486 LEU A CD1 1 
ATOM   3884  C CD2 . LEU A 1 487 ? 25.109  13.357  68.911  1.00 19.37 ? 486 LEU A CD2 1 
ATOM   3885  N N   . GLY A 1 488 ? 22.923  13.065  64.522  1.00 16.18 ? 487 GLY A N   1 
ATOM   3886  C CA  . GLY A 1 488 ? 21.630  13.655  64.211  1.00 15.84 ? 487 GLY A CA  1 
ATOM   3887  C C   . GLY A 1 488 ? 20.715  12.643  63.537  1.00 15.78 ? 487 GLY A C   1 
ATOM   3888  O O   . GLY A 1 488 ? 19.519  12.579  63.814  1.00 14.92 ? 487 GLY A O   1 
ATOM   3889  N N   . ALA A 1 489 ? 21.287  11.846  62.643  1.00 16.51 ? 488 ALA A N   1 
ATOM   3890  C CA  . ALA A 1 489 ? 20.521  10.831  61.921  1.00 18.56 ? 488 ALA A CA  1 
ATOM   3891  C C   . ALA A 1 489 ? 20.005  9.760   62.882  1.00 16.77 ? 488 ALA A C   1 
ATOM   3892  O O   . ALA A 1 489 ? 18.844  9.354   62.811  1.00 17.03 ? 488 ALA A O   1 
ATOM   3893  C CB  . ALA A 1 489 ? 21.394  10.190  60.840  1.00 14.60 ? 488 ALA A CB  1 
ATOM   3894  N N   . LEU A 1 490 ? 20.876  9.318   63.783  1.00 16.54 ? 489 LEU A N   1 
ATOM   3895  C CA  . LEU A 1 490 ? 20.534  8.284   64.760  1.00 16.78 ? 489 LEU A CA  1 
ATOM   3896  C C   . LEU A 1 490 ? 19.445  8.713   65.751  1.00 15.94 ? 489 LEU A C   1 
ATOM   3897  O O   . LEU A 1 490 ? 18.566  7.926   66.100  1.00 15.08 ? 489 LEU A O   1 
ATOM   3898  C CB  . LEU A 1 490 ? 21.800  7.858   65.517  1.00 15.43 ? 489 LEU A CB  1 
ATOM   3899  C CG  . LEU A 1 490 ? 22.866  7.149   64.664  1.00 15.49 ? 489 LEU A CG  1 
ATOM   3900  C CD1 . LEU A 1 490 ? 24.187  7.062   65.428  1.00 10.97 ? 489 LEU A CD1 1 
ATOM   3901  C CD2 . LEU A 1 490 ? 22.369  5.750   64.282  1.00 14.60 ? 489 LEU A CD2 1 
ATOM   3902  N N   . VAL A 1 491 ? 19.504  9.961   66.206  1.00 15.88 ? 490 VAL A N   1 
ATOM   3903  C CA  . VAL A 1 491 ? 18.516  10.465  67.154  1.00 16.45 ? 490 VAL A CA  1 
ATOM   3904  C C   . VAL A 1 491 ? 17.166  10.593  66.455  1.00 16.44 ? 490 VAL A C   1 
ATOM   3905  O O   . VAL A 1 491 ? 16.132  10.210  66.997  1.00 17.99 ? 490 VAL A O   1 
ATOM   3906  C CB  . VAL A 1 491 ? 18.941  11.847  67.723  1.00 16.30 ? 490 VAL A CB  1 
ATOM   3907  C CG1 . VAL A 1 491 ? 17.893  12.358  68.712  1.00 13.60 ? 490 VAL A CG1 1 
ATOM   3908  C CG2 . VAL A 1 491 ? 20.306  11.732  68.395  1.00 13.95 ? 490 VAL A CG2 1 
ATOM   3909  N N   . ALA A 1 492 ? 17.184  11.134  65.243  1.00 16.23 ? 491 ALA A N   1 
ATOM   3910  C CA  . ALA A 1 492 ? 15.961  11.294  64.478  1.00 16.84 ? 491 ALA A CA  1 
ATOM   3911  C C   . ALA A 1 492 ? 15.345  9.926   64.181  1.00 15.51 ? 491 ALA A C   1 
ATOM   3912  O O   . ALA A 1 492 ? 14.124  9.768   64.214  1.00 16.67 ? 491 ALA A O   1 
ATOM   3913  C CB  . ALA A 1 492 ? 16.247  12.039  63.181  1.00 16.58 ? 491 ALA A CB  1 
ATOM   3914  N N   . MET A 1 493 ? 16.183  8.931   63.902  1.00 15.77 ? 492 MET A N   1 
ATOM   3915  C CA  . MET A 1 493 ? 15.666  7.593   63.619  1.00 14.99 ? 492 MET A CA  1 
ATOM   3916  C C   . MET A 1 493 ? 14.817  7.096   64.785  1.00 14.42 ? 492 MET A C   1 
ATOM   3917  O O   . MET A 1 493 ? 13.716  6.585   64.593  1.00 14.66 ? 492 MET A O   1 
ATOM   3918  C CB  . MET A 1 493 ? 16.809  6.608   63.349  1.00 15.73 ? 492 MET A CB  1 
ATOM   3919  C CG  . MET A 1 493 ? 16.343  5.204   62.934  1.00 15.00 ? 492 MET A CG  1 
ATOM   3920  S SD  . MET A 1 493 ? 17.736  4.084   62.589  1.00 16.92 ? 492 MET A SD  1 
ATOM   3921  C CE  . MET A 1 493 ? 18.342  3.845   64.274  1.00 15.29 ? 492 MET A CE  1 
ATOM   3922  N N   . TYR A 1 494 ? 15.321  7.241   66.001  1.00 15.30 ? 493 TYR A N   1 
ATOM   3923  C CA  . TYR A 1 494 ? 14.548  6.798   67.149  1.00 14.54 ? 493 TYR A CA  1 
ATOM   3924  C C   . TYR A 1 494 ? 13.312  7.661   67.401  1.00 16.01 ? 493 TYR A C   1 
ATOM   3925  O O   . TYR A 1 494 ? 12.265  7.152   67.809  1.00 13.65 ? 493 TYR A O   1 
ATOM   3926  C CB  . TYR A 1 494 ? 15.431  6.731   68.393  1.00 13.87 ? 493 TYR A CB  1 
ATOM   3927  C CG  . TYR A 1 494 ? 16.203  5.430   68.467  1.00 15.79 ? 493 TYR A CG  1 
ATOM   3928  C CD1 . TYR A 1 494 ? 17.534  5.355   68.056  1.00 11.65 ? 493 TYR A CD1 1 
ATOM   3929  C CD2 . TYR A 1 494 ? 15.584  4.259   68.916  1.00 14.88 ? 493 TYR A CD2 1 
ATOM   3930  C CE1 . TYR A 1 494 ? 18.228  4.152   68.093  1.00 15.56 ? 493 TYR A CE1 1 
ATOM   3931  C CE2 . TYR A 1 494 ? 16.275  3.040   68.954  1.00 14.43 ? 493 TYR A CE2 1 
ATOM   3932  C CZ  . TYR A 1 494 ? 17.592  2.997   68.543  1.00 14.65 ? 493 TYR A CZ  1 
ATOM   3933  O OH  . TYR A 1 494 ? 18.286  1.809   68.592  1.00 17.18 ? 493 TYR A OH  1 
ATOM   3934  N N   . GLU A 1 495 ? 13.415  8.964   67.159  1.00 14.72 ? 494 GLU A N   1 
ATOM   3935  C CA  . GLU A 1 495 ? 12.247  9.808   67.359  1.00 15.49 ? 494 GLU A CA  1 
ATOM   3936  C C   . GLU A 1 495 ? 11.104  9.260   66.500  1.00 16.76 ? 494 GLU A C   1 
ATOM   3937  O O   . GLU A 1 495 ? 9.968   9.151   66.953  1.00 17.54 ? 494 GLU A O   1 
ATOM   3938  C CB  . GLU A 1 495 ? 12.543  11.250  66.952  1.00 16.44 ? 494 GLU A CB  1 
ATOM   3939  C CG  . GLU A 1 495 ? 13.621  11.931  67.768  1.00 14.66 ? 494 GLU A CG  1 
ATOM   3940  C CD  . GLU A 1 495 ? 13.792  13.393  67.376  1.00 16.43 ? 494 GLU A CD  1 
ATOM   3941  O OE1 . GLU A 1 495 ? 13.724  13.705  66.162  1.00 14.77 ? 494 GLU A OE1 1 
ATOM   3942  O OE2 . GLU A 1 495 ? 14.006  14.228  68.279  1.00 14.81 ? 494 GLU A OE2 1 
ATOM   3943  N N   . HIS A 1 496 ? 11.413  8.892   65.261  1.00 17.53 ? 495 HIS A N   1 
ATOM   3944  C CA  . HIS A 1 496 ? 10.388  8.374   64.368  1.00 18.56 ? 495 HIS A CA  1 
ATOM   3945  C C   . HIS A 1 496 ? 9.942   6.959   64.704  1.00 19.45 ? 495 HIS A C   1 
ATOM   3946  O O   . HIS A 1 496 ? 8.817   6.569   64.389  1.00 18.78 ? 495 HIS A O   1 
ATOM   3947  C CB  . HIS A 1 496 ? 10.860  8.496   62.928  1.00 17.88 ? 495 HIS A CB  1 
ATOM   3948  C CG  . HIS A 1 496 ? 10.973  9.917   62.474  1.00 18.86 ? 495 HIS A CG  1 
ATOM   3949  N ND1 . HIS A 1 496 ? 11.950  10.349  61.603  1.00 19.62 ? 495 HIS A ND1 1 
ATOM   3950  C CD2 . HIS A 1 496 ? 10.239  11.010  62.791  1.00 16.02 ? 495 HIS A CD2 1 
ATOM   3951  C CE1 . HIS A 1 496 ? 11.813  11.649  61.406  1.00 15.97 ? 495 HIS A CE1 1 
ATOM   3952  N NE2 . HIS A 1 496 ? 10.784  12.073  62.115  1.00 17.46 ? 495 HIS A NE2 1 
ATOM   3953  N N   . LYS A 1 497 ? 10.809  6.182   65.344  1.00 18.23 ? 496 LYS A N   1 
ATOM   3954  C CA  . LYS A 1 497 ? 10.396  4.844   65.756  1.00 18.01 ? 496 LYS A CA  1 
ATOM   3955  C C   . LYS A 1 497 ? 9.292   5.078   66.792  1.00 18.44 ? 496 LYS A C   1 
ATOM   3956  O O   . LYS A 1 497 ? 8.202   4.502   66.715  1.00 16.37 ? 496 LYS A O   1 
ATOM   3957  C CB  . LYS A 1 497 ? 11.541  4.088   66.427  1.00 18.71 ? 496 LYS A CB  1 
ATOM   3958  C CG  . LYS A 1 497 ? 11.077  2.850   67.202  1.00 17.64 ? 496 LYS A CG  1 
ATOM   3959  C CD  . LYS A 1 497 ? 12.165  2.330   68.134  1.00 17.77 ? 496 LYS A CD  1 
ATOM   3960  C CE  . LYS A 1 497 ? 11.633  1.241   69.062  1.00 19.05 ? 496 LYS A CE  1 
ATOM   3961  N NZ  . LYS A 1 497 ? 12.655  0.752   70.038  1.00 14.98 ? 496 LYS A NZ  1 
ATOM   3962  N N   . ILE A 1 498 ? 9.594   5.946   67.755  1.00 16.49 ? 497 ILE A N   1 
ATOM   3963  C CA  . ILE A 1 498 ? 8.661   6.278   68.826  1.00 16.74 ? 497 ILE A CA  1 
ATOM   3964  C C   . ILE A 1 498 ? 7.338   6.782   68.247  1.00 17.76 ? 497 ILE A C   1 
ATOM   3965  O O   . ILE A 1 498 ? 6.258   6.448   68.745  1.00 17.14 ? 497 ILE A O   1 
ATOM   3966  C CB  . ILE A 1 498 ? 9.276   7.349   69.762  1.00 15.28 ? 497 ILE A CB  1 
ATOM   3967  C CG1 . ILE A 1 498 ? 10.509  6.769   70.460  1.00 14.90 ? 497 ILE A CG1 1 
ATOM   3968  C CG2 . ILE A 1 498 ? 8.252   7.811   70.801  1.00 12.62 ? 497 ILE A CG2 1 
ATOM   3969  C CD1 . ILE A 1 498 ? 11.365  7.807   71.157  1.00 16.60 ? 497 ILE A CD1 1 
ATOM   3970  N N   . PHE A 1 499 ? 7.431   7.567   67.178  1.00 18.16 ? 498 PHE A N   1 
ATOM   3971  C CA  . PHE A 1 499 ? 6.252   8.121   66.525  1.00 18.59 ? 498 PHE A CA  1 
ATOM   3972  C C   . PHE A 1 499 ? 5.375   7.021   65.926  1.00 17.85 ? 498 PHE A C   1 
ATOM   3973  O O   . PHE A 1 499 ? 4.157   7.037   66.079  1.00 18.46 ? 498 PHE A O   1 
ATOM   3974  C CB  . PHE A 1 499 ? 6.674   9.097   65.423  1.00 18.28 ? 498 PHE A CB  1 
ATOM   3975  C CG  . PHE A 1 499 ? 5.532   9.584   64.572  1.00 20.44 ? 498 PHE A CG  1 
ATOM   3976  C CD1 . PHE A 1 499 ? 4.507   10.344  65.126  1.00 20.74 ? 498 PHE A CD1 1 
ATOM   3977  C CD2 . PHE A 1 499 ? 5.478   9.274   63.217  1.00 24.15 ? 498 PHE A CD2 1 
ATOM   3978  C CE1 . PHE A 1 499 ? 3.441   10.792  64.345  1.00 22.84 ? 498 PHE A CE1 1 
ATOM   3979  C CE2 . PHE A 1 499 ? 4.412   9.716   62.419  1.00 25.52 ? 498 PHE A CE2 1 
ATOM   3980  C CZ  . PHE A 1 499 ? 3.391   10.478  62.989  1.00 24.16 ? 498 PHE A CZ  1 
ATOM   3981  N N   . VAL A 1 500 ? 6.001   6.070   65.244  1.00 18.04 ? 499 VAL A N   1 
ATOM   3982  C CA  . VAL A 1 500 ? 5.262   4.978   64.620  1.00 18.30 ? 499 VAL A CA  1 
ATOM   3983  C C   . VAL A 1 500 ? 4.540   4.107   65.647  1.00 18.25 ? 499 VAL A C   1 
ATOM   3984  O O   . VAL A 1 500 ? 3.369   3.781   65.472  1.00 17.36 ? 499 VAL A O   1 
ATOM   3985  C CB  . VAL A 1 500 ? 6.200   4.110   63.757  1.00 18.31 ? 499 VAL A CB  1 
ATOM   3986  C CG1 . VAL A 1 500 ? 5.474   2.873   63.249  1.00 13.17 ? 499 VAL A CG1 1 
ATOM   3987  C CG2 . VAL A 1 500 ? 6.706   4.944   62.582  1.00 17.33 ? 499 VAL A CG2 1 
ATOM   3988  N N   . GLN A 1 501 ? 5.232   3.738   66.717  1.00 17.89 ? 500 GLN A N   1 
ATOM   3989  C CA  . GLN A 1 501 ? 4.616   2.916   67.748  1.00 17.61 ? 500 GLN A CA  1 
ATOM   3990  C C   . GLN A 1 501 ? 3.416   3.629   68.362  1.00 17.02 ? 500 GLN A C   1 
ATOM   3991  O O   . GLN A 1 501 ? 2.381   3.008   68.600  1.00 15.87 ? 500 GLN A O   1 
ATOM   3992  C CB  . GLN A 1 501 ? 5.638   2.560   68.831  1.00 16.02 ? 500 GLN A CB  1 
ATOM   3993  C CG  . GLN A 1 501 ? 6.807   1.725   68.307  1.00 16.07 ? 500 GLN A CG  1 
ATOM   3994  C CD  . GLN A 1 501 ? 7.711   1.215   69.412  1.00 19.30 ? 500 GLN A CD  1 
ATOM   3995  O OE1 . GLN A 1 501 ? 8.090   1.969   70.310  1.00 18.44 ? 500 GLN A OE1 1 
ATOM   3996  N NE2 . GLN A 1 501 ? 8.070   -0.073  69.348  1.00 17.22 ? 500 GLN A NE2 1 
ATOM   3997  N N   . GLY A 1 502 ? 3.548   4.933   68.604  1.00 16.46 ? 501 GLY A N   1 
ATOM   3998  C CA  . GLY A 1 502 ? 2.442   5.687   69.175  1.00 14.01 ? 501 GLY A CA  1 
ATOM   3999  C C   . GLY A 1 502 ? 1.215   5.661   68.271  1.00 15.37 ? 501 GLY A C   1 
ATOM   4000  O O   . GLY A 1 502 ? 0.092   5.500   68.744  1.00 16.53 ? 501 GLY A O   1 
ATOM   4001  N N   . ILE A 1 503 ? 1.421   5.822   66.967  1.00 14.45 ? 502 ILE A N   1 
ATOM   4002  C CA  . ILE A 1 503 ? 0.312   5.797   66.020  1.00 16.63 ? 502 ILE A CA  1 
ATOM   4003  C C   . ILE A 1 503 ? -0.352  4.416   66.031  1.00 19.59 ? 502 ILE A C   1 
ATOM   4004  O O   . ILE A 1 503 ? -1.580  4.305   66.040  1.00 19.86 ? 502 ILE A O   1 
ATOM   4005  C CB  . ILE A 1 503 ? 0.789   6.120   64.581  1.00 17.46 ? 502 ILE A CB  1 
ATOM   4006  C CG1 . ILE A 1 503 ? 1.307   7.565   64.502  1.00 16.16 ? 502 ILE A CG1 1 
ATOM   4007  C CG2 . ILE A 1 503 ? -0.345  5.909   63.594  1.00 18.91 ? 502 ILE A CG2 1 
ATOM   4008  C CD1 . ILE A 1 503 ? 0.317   8.610   64.991  1.00 14.14 ? 502 ILE A CD1 1 
ATOM   4009  N N   . ILE A 1 504 ? 0.465   3.366   66.033  1.00 18.49 ? 503 ILE A N   1 
ATOM   4010  C CA  . ILE A 1 504 ? -0.048  2.002   66.055  1.00 19.17 ? 503 ILE A CA  1 
ATOM   4011  C C   . ILE A 1 504 ? -0.897  1.754   67.306  1.00 21.32 ? 503 ILE A C   1 
ATOM   4012  O O   . ILE A 1 504 ? -1.947  1.105   67.231  1.00 20.10 ? 503 ILE A O   1 
ATOM   4013  C CB  . ILE A 1 504 ? 1.115   0.980   65.992  1.00 18.29 ? 503 ILE A CB  1 
ATOM   4014  C CG1 . ILE A 1 504 ? 1.781   1.063   64.612  1.00 20.41 ? 503 ILE A CG1 1 
ATOM   4015  C CG2 . ILE A 1 504 ? 0.603   -0.427  66.272  1.00 17.45 ? 503 ILE A CG2 1 
ATOM   4016  C CD1 . ILE A 1 504 ? 2.925   0.101   64.395  1.00 18.36 ? 503 ILE A CD1 1 
ATOM   4017  N N   . TRP A 1 505 ? -0.441  2.272   68.448  1.00 20.45 ? 504 TRP A N   1 
ATOM   4018  C CA  . TRP A 1 505 ? -1.160  2.109   69.709  1.00 21.68 ? 504 TRP A CA  1 
ATOM   4019  C C   . TRP A 1 505 ? -2.343  3.069   69.844  1.00 22.16 ? 504 TRP A C   1 
ATOM   4020  O O   . TRP A 1 505 ? -3.160  2.927   70.750  1.00 22.83 ? 504 TRP A O   1 
ATOM   4021  C CB  . TRP A 1 505 ? -0.221  2.303   70.905  1.00 19.66 ? 504 TRP A CB  1 
ATOM   4022  C CG  . TRP A 1 505 ? 0.757   1.185   71.113  1.00 19.23 ? 504 TRP A CG  1 
ATOM   4023  C CD1 . TRP A 1 505 ? 0.509   -0.159  71.005  1.00 18.95 ? 504 TRP A CD1 1 
ATOM   4024  C CD2 . TRP A 1 505 ? 2.131   1.309   71.505  1.00 18.99 ? 504 TRP A CD2 1 
ATOM   4025  N NE1 . TRP A 1 505 ? 1.646   -0.878  71.306  1.00 18.40 ? 504 TRP A NE1 1 
ATOM   4026  C CE2 . TRP A 1 505 ? 2.655   -0.003  71.616  1.00 18.21 ? 504 TRP A CE2 1 
ATOM   4027  C CE3 . TRP A 1 505 ? 2.970   2.399   71.776  1.00 18.95 ? 504 TRP A CE3 1 
ATOM   4028  C CZ2 . TRP A 1 505 ? 3.981   -0.250  71.985  1.00 17.61 ? 504 TRP A CZ2 1 
ATOM   4029  C CZ3 . TRP A 1 505 ? 4.287   2.154   72.144  1.00 17.39 ? 504 TRP A CZ3 1 
ATOM   4030  C CH2 . TRP A 1 505 ? 4.780   0.837   72.245  1.00 19.18 ? 504 TRP A CH2 1 
ATOM   4031  N N   . ASP A 1 506 ? -2.419  4.048   68.952  1.00 22.02 ? 505 ASP A N   1 
ATOM   4032  C CA  . ASP A 1 506 ? -3.506  5.027   68.963  1.00 23.40 ? 505 ASP A CA  1 
ATOM   4033  C C   . ASP A 1 506 ? -3.449  5.955   70.180  1.00 22.75 ? 505 ASP A C   1 
ATOM   4034  O O   . ASP A 1 506 ? -4.487  6.371   70.702  1.00 20.80 ? 505 ASP A O   1 
ATOM   4035  C CB  . ASP A 1 506 ? -4.858  4.300   68.923  1.00 25.03 ? 505 ASP A CB  1 
ATOM   4036  C CG  . ASP A 1 506 ? -5.949  5.130   68.270  1.00 27.18 ? 505 ASP A CG  1 
ATOM   4037  O OD1 . ASP A 1 506 ? -5.724  5.623   67.145  1.00 28.01 ? 505 ASP A OD1 1 
ATOM   4038  O OD2 . ASP A 1 506 ? -7.033  5.279   68.873  1.00 27.92 ? 505 ASP A OD2 1 
ATOM   4039  N N   . ILE A 1 507 ? -2.236  6.269   70.635  1.00 19.78 ? 506 ILE A N   1 
ATOM   4040  C CA  . ILE A 1 507 ? -2.054  7.167   71.774  1.00 18.43 ? 506 ILE A CA  1 
ATOM   4041  C C   . ILE A 1 507 ? -1.395  8.451   71.289  1.00 19.35 ? 506 ILE A C   1 
ATOM   4042  O O   . ILE A 1 507 ? -0.953  8.534   70.145  1.00 20.90 ? 506 ILE A O   1 
ATOM   4043  C CB  . ILE A 1 507 ? -1.151  6.557   72.857  1.00 17.96 ? 506 ILE A CB  1 
ATOM   4044  C CG1 . ILE A 1 507 ? 0.200   6.171   72.244  1.00 18.25 ? 506 ILE A CG1 1 
ATOM   4045  C CG2 . ILE A 1 507 ? -1.832  5.368   73.495  1.00 18.42 ? 506 ILE A CG2 1 
ATOM   4046  C CD1 . ILE A 1 507 ? 1.253   5.833   73.255  1.00 16.73 ? 506 ILE A CD1 1 
ATOM   4047  N N   . ASN A 1 508 ? -1.333  9.452   72.158  1.00 17.75 ? 507 ASN A N   1 
ATOM   4048  C CA  . ASN A 1 508 ? -0.717  10.724  71.803  1.00 17.52 ? 507 ASN A CA  1 
ATOM   4049  C C   . ASN A 1 508 ? 0.716   10.721  72.330  1.00 16.10 ? 507 ASN A C   1 
ATOM   4050  O O   . ASN A 1 508 ? 0.943   10.868  73.530  1.00 17.23 ? 507 ASN A O   1 
ATOM   4051  C CB  . ASN A 1 508 ? -1.509  11.882  72.424  1.00 15.88 ? 507 ASN A CB  1 
ATOM   4052  C CG  . ASN A 1 508 ? -1.025  13.241  71.950  1.00 18.99 ? 507 ASN A CG  1 
ATOM   4053  O OD1 . ASN A 1 508 ? -0.072  13.338  71.170  1.00 20.63 ? 507 ASN A OD1 1 
ATOM   4054  N ND2 . ASN A 1 508 ? -1.685  14.302  72.414  1.00 15.22 ? 507 ASN A ND2 1 
ATOM   4055  N N   . SER A 1 509 ? 1.679   10.528  71.437  1.00 16.56 ? 508 SER A N   1 
ATOM   4056  C CA  . SER A 1 509 ? 3.087   10.499  71.825  1.00 17.95 ? 508 SER A CA  1 
ATOM   4057  C C   . SER A 1 509 ? 3.617   11.891  72.145  1.00 18.09 ? 508 SER A C   1 
ATOM   4058  O O   . SER A 1 509 ? 4.773   12.038  72.532  1.00 17.91 ? 508 SER A O   1 
ATOM   4059  C CB  . SER A 1 509 ? 3.946   9.930   70.685  1.00 18.55 ? 508 SER A CB  1 
ATOM   4060  O OG  . SER A 1 509 ? 3.562   8.616   70.326  1.00 17.82 ? 508 SER A OG  1 
ATOM   4061  N N   . PHE A 1 510 ? 2.779   12.915  72.017  1.00 19.26 ? 509 PHE A N   1 
ATOM   4062  C CA  . PHE A 1 510 ? 3.283   14.263  72.212  1.00 18.51 ? 509 PHE A CA  1 
ATOM   4063  C C   . PHE A 1 510 ? 2.790   15.139  73.337  1.00 18.09 ? 509 PHE A C   1 
ATOM   4064  O O   . PHE A 1 510 ? 3.176   16.307  73.416  1.00 17.30 ? 509 PHE A O   1 
ATOM   4065  C CB  . PHE A 1 510 ? 3.173   14.995  70.882  1.00 17.31 ? 509 PHE A CB  1 
ATOM   4066  C CG  . PHE A 1 510 ? 3.784   14.229  69.754  1.00 19.04 ? 509 PHE A CG  1 
ATOM   4067  C CD1 . PHE A 1 510 ? 2.990   13.480  68.888  1.00 20.68 ? 509 PHE A CD1 1 
ATOM   4068  C CD2 . PHE A 1 510 ? 5.166   14.170  69.615  1.00 17.86 ? 509 PHE A CD2 1 
ATOM   4069  C CE1 . PHE A 1 510 ? 3.564   12.682  67.907  1.00 19.64 ? 509 PHE A CE1 1 
ATOM   4070  C CE2 . PHE A 1 510 ? 5.748   13.374  68.636  1.00 18.39 ? 509 PHE A CE2 1 
ATOM   4071  C CZ  . PHE A 1 510 ? 4.950   12.629  67.784  1.00 19.22 ? 509 PHE A CZ  1 
ATOM   4072  N N   . ASP A 1 511 ? 1.949   14.592  74.207  1.00 18.60 ? 510 ASP A N   1 
ATOM   4073  C CA  . ASP A 1 511 ? 1.467   15.354  75.352  1.00 18.44 ? 510 ASP A CA  1 
ATOM   4074  C C   . ASP A 1 511 ? 2.096   14.703  76.575  1.00 18.79 ? 510 ASP A C   1 
ATOM   4075  O O   . ASP A 1 511 ? 2.829   13.717  76.439  1.00 18.91 ? 510 ASP A O   1 
ATOM   4076  C CB  . ASP A 1 511 ? -0.073  15.340  75.443  1.00 17.44 ? 510 ASP A CB  1 
ATOM   4077  C CG  . ASP A 1 511 ? -0.660  13.932  75.587  1.00 19.79 ? 510 ASP A CG  1 
ATOM   4078  O OD1 . ASP A 1 511 ? 0.096   12.977  75.873  1.00 16.90 ? 510 ASP A OD1 1 
ATOM   4079  O OD2 . ASP A 1 511 ? -1.894  13.790  75.423  1.00 16.62 ? 510 ASP A OD2 1 
ATOM   4080  N N   . GLN A 1 512 ? 1.835   15.252  77.756  1.00 18.41 ? 511 GLN A N   1 
ATOM   4081  C CA  . GLN A 1 512 ? 2.392   14.704  78.990  1.00 19.50 ? 511 GLN A CA  1 
ATOM   4082  C C   . GLN A 1 512 ? 1.568   15.099  80.214  1.00 19.45 ? 511 GLN A C   1 
ATOM   4083  O O   . GLN A 1 512 ? 2.089   15.681  81.167  1.00 19.83 ? 511 GLN A O   1 
ATOM   4084  C CB  . GLN A 1 512 ? 3.849   15.162  79.174  1.00 20.27 ? 511 GLN A CB  1 
ATOM   4085  C CG  . GLN A 1 512 ? 4.055   16.669  79.037  1.00 22.59 ? 511 GLN A CG  1 
ATOM   4086  C CD  . GLN A 1 512 ? 4.079   17.133  77.587  1.00 25.66 ? 511 GLN A CD  1 
ATOM   4087  O OE1 . GLN A 1 512 ? 3.688   18.261  77.274  1.00 30.10 ? 511 GLN A OE1 1 
ATOM   4088  N NE2 . GLN A 1 512 ? 4.553   16.270  76.698  1.00 24.90 ? 511 GLN A NE2 1 
ATOM   4089  N N   . TRP A 1 513 ? 0.279   14.769  80.186  1.00 20.26 ? 512 TRP A N   1 
ATOM   4090  C CA  . TRP A 1 513 ? -0.623  15.085  81.289  1.00 19.46 ? 512 TRP A CA  1 
ATOM   4091  C C   . TRP A 1 513 ? -0.261  14.356  82.580  1.00 20.85 ? 512 TRP A C   1 
ATOM   4092  O O   . TRP A 1 513 ? -0.718  14.732  83.659  1.00 19.76 ? 512 TRP A O   1 
ATOM   4093  C CB  . TRP A 1 513 ? -2.065  14.746  80.901  1.00 18.63 ? 512 TRP A CB  1 
ATOM   4094  C CG  . TRP A 1 513 ? -2.551  15.564  79.765  1.00 18.72 ? 512 TRP A CG  1 
ATOM   4095  C CD1 . TRP A 1 513 ? -2.797  15.143  78.491  1.00 16.77 ? 512 TRP A CD1 1 
ATOM   4096  C CD2 . TRP A 1 513 ? -2.796  16.975  79.780  1.00 18.88 ? 512 TRP A CD2 1 
ATOM   4097  N NE1 . TRP A 1 513 ? -3.179  16.209  77.707  1.00 19.24 ? 512 TRP A NE1 1 
ATOM   4098  C CE2 . TRP A 1 513 ? -3.185  17.345  78.474  1.00 18.42 ? 512 TRP A CE2 1 
ATOM   4099  C CE3 . TRP A 1 513 ? -2.722  17.963  80.772  1.00 19.75 ? 512 TRP A CE3 1 
ATOM   4100  C CZ2 . TRP A 1 513 ? -3.500  18.665  78.132  1.00 20.46 ? 512 TRP A CZ2 1 
ATOM   4101  C CZ3 . TRP A 1 513 ? -3.036  19.275  80.434  1.00 20.37 ? 512 TRP A CZ3 1 
ATOM   4102  C CH2 . TRP A 1 513 ? -3.420  19.613  79.122  1.00 20.75 ? 512 TRP A CH2 1 
ATOM   4103  N N   . GLY A 1 514 ? 0.569   13.323  82.466  1.00 22.19 ? 513 GLY A N   1 
ATOM   4104  C CA  . GLY A 1 514 ? 0.960   12.547  83.630  1.00 23.51 ? 513 GLY A CA  1 
ATOM   4105  C C   . GLY A 1 514 ? 1.842   13.231  84.655  1.00 24.10 ? 513 GLY A C   1 
ATOM   4106  O O   . GLY A 1 514 ? 2.135   12.652  85.699  1.00 24.78 ? 513 GLY A O   1 
ATOM   4107  N N   . VAL A 1 515 ? 2.268   14.458  84.385  1.00 24.06 ? 514 VAL A N   1 
ATOM   4108  C CA  . VAL A 1 515 ? 3.129   15.155  85.337  1.00 26.30 ? 514 VAL A CA  1 
ATOM   4109  C C   . VAL A 1 515 ? 2.382   16.112  86.268  1.00 25.79 ? 514 VAL A C   1 
ATOM   4110  O O   . VAL A 1 515 ? 2.938   16.559  87.270  1.00 25.88 ? 514 VAL A O   1 
ATOM   4111  C CB  . VAL A 1 515 ? 4.241   15.957  84.604  1.00 27.81 ? 514 VAL A CB  1 
ATOM   4112  C CG1 . VAL A 1 515 ? 5.060   15.025  83.718  1.00 30.62 ? 514 VAL A CG1 1 
ATOM   4113  C CG2 . VAL A 1 515 ? 3.621   17.072  83.768  1.00 27.71 ? 514 VAL A CG2 1 
ATOM   4114  N N   . GLU A 1 516 ? 1.122   16.402  85.955  1.00 25.61 ? 515 GLU A N   1 
ATOM   4115  C CA  . GLU A 1 516 ? 0.334   17.348  86.747  1.00 25.81 ? 515 GLU A CA  1 
ATOM   4116  C C   . GLU A 1 516 ? 0.016   17.008  88.199  1.00 24.39 ? 515 GLU A C   1 
ATOM   4117  O O   . GLU A 1 516 ? 0.059   17.886  89.056  1.00 23.41 ? 515 GLU A O   1 
ATOM   4118  C CB  . GLU A 1 516 ? -0.983  17.667  86.034  1.00 27.50 ? 515 GLU A CB  1 
ATOM   4119  C CG  . GLU A 1 516 ? -0.814  18.292  84.670  1.00 31.89 ? 515 GLU A CG  1 
ATOM   4120  C CD  . GLU A 1 516 ? -2.045  19.058  84.232  1.00 34.19 ? 515 GLU A CD  1 
ATOM   4121  O OE1 . GLU A 1 516 ? -3.131  18.446  84.123  1.00 30.11 ? 515 GLU A OE1 1 
ATOM   4122  O OE2 . GLU A 1 516 ? -1.921  20.282  84.002  1.00 38.28 ? 515 GLU A OE2 1 
ATOM   4123  N N   . LEU A 1 517 ? -0.311  15.752  88.482  1.00 21.98 ? 516 LEU A N   1 
ATOM   4124  C CA  . LEU A 1 517 ? -0.672  15.367  89.843  1.00 20.97 ? 516 LEU A CA  1 
ATOM   4125  C C   . LEU A 1 517 ? 0.445   15.611  90.853  1.00 19.82 ? 516 LEU A C   1 
ATOM   4126  O O   . LEU A 1 517 ? 0.235   16.248  91.889  1.00 19.47 ? 516 LEU A O   1 
ATOM   4127  C CB  . LEU A 1 517 ? -1.079  13.892  89.889  1.00 19.01 ? 516 LEU A CB  1 
ATOM   4128  C CG  . LEU A 1 517 ? -2.273  13.510  90.773  1.00 22.33 ? 516 LEU A CG  1 
ATOM   4129  C CD1 . LEU A 1 517 ? -2.188  12.030  91.133  1.00 16.48 ? 516 LEU A CD1 1 
ATOM   4130  C CD2 . LEU A 1 517 ? -2.302  14.365  92.028  1.00 19.70 ? 516 LEU A CD2 1 
ATOM   4131  N N   . GLY A 1 518 ? 1.627   15.087  90.551  1.00 20.25 ? 517 GLY A N   1 
ATOM   4132  C CA  . GLY A 1 518 ? 2.762   15.243  91.441  1.00 19.68 ? 517 GLY A CA  1 
ATOM   4133  C C   . GLY A 1 518 ? 3.050   16.700  91.731  1.00 19.26 ? 517 GLY A C   1 
ATOM   4134  O O   . GLY A 1 518 ? 3.286   17.076  92.876  1.00 17.65 ? 517 GLY A O   1 
ATOM   4135  N N   . LYS A 1 519 ? 3.034   17.530  90.698  1.00 19.81 ? 518 LYS A N   1 
ATOM   4136  C CA  . LYS A 1 519 ? 3.298   18.944  90.900  1.00 21.29 ? 518 LYS A CA  1 
ATOM   4137  C C   . LYS A 1 519 ? 2.254   19.558  91.829  1.00 20.69 ? 518 LYS A C   1 
ATOM   4138  O O   . LYS A 1 519 ? 2.598   20.297  92.751  1.00 21.06 ? 518 LYS A O   1 
ATOM   4139  C CB  . LYS A 1 519 ? 3.324   19.680  89.562  1.00 24.73 ? 518 LYS A CB  1 
ATOM   4140  C CG  . LYS A 1 519 ? 3.744   21.137  89.699  1.00 33.03 ? 518 LYS A CG  1 
ATOM   4141  C CD  . LYS A 1 519 ? 4.700   21.565  88.592  1.00 37.70 ? 518 LYS A CD  1 
ATOM   4142  C CE  . LYS A 1 519 ? 5.371   22.890  88.951  1.00 39.80 ? 518 LYS A CE  1 
ATOM   4143  N NZ  . LYS A 1 519 ? 6.398   23.303  87.956  1.00 42.76 ? 518 LYS A NZ  1 
ATOM   4144  N N   . GLN A 1 520 ? 0.983   19.230  91.609  1.00 19.87 ? 519 GLN A N   1 
ATOM   4145  C CA  . GLN A 1 520 ? -0.089  19.771  92.442  1.00 20.53 ? 519 GLN A CA  1 
ATOM   4146  C C   . GLN A 1 520 ? 0.079   19.414  93.916  1.00 20.10 ? 519 GLN A C   1 
ATOM   4147  O O   . GLN A 1 520 ? -0.047  20.271  94.793  1.00 17.94 ? 519 GLN A O   1 
ATOM   4148  C CB  . GLN A 1 520 ? -1.451  19.248  91.978  1.00 21.85 ? 519 GLN A CB  1 
ATOM   4149  C CG  . GLN A 1 520 ? -1.773  19.508  90.526  1.00 25.55 ? 519 GLN A CG  1 
ATOM   4150  C CD  . GLN A 1 520 ? -3.070  18.839  90.108  1.00 27.97 ? 519 GLN A CD  1 
ATOM   4151  O OE1 . GLN A 1 520 ? -4.154  19.235  90.537  1.00 32.01 ? 519 GLN A OE1 1 
ATOM   4152  N NE2 . GLN A 1 520 ? -2.964  17.813  89.277  1.00 29.82 ? 519 GLN A NE2 1 
ATOM   4153  N N   . LEU A 1 521 ? 0.358   18.143  94.185  1.00 18.11 ? 520 LEU A N   1 
ATOM   4154  C CA  . LEU A 1 521 ? 0.505   17.684  95.559  1.00 18.23 ? 520 LEU A CA  1 
ATOM   4155  C C   . LEU A 1 521 ? 1.757   18.226  96.224  1.00 17.21 ? 520 LEU A C   1 
ATOM   4156  O O   . LEU A 1 521 ? 1.771   18.448  97.434  1.00 18.23 ? 520 LEU A O   1 
ATOM   4157  C CB  . LEU A 1 521 ? 0.487   16.149  95.609  1.00 17.54 ? 520 LEU A CB  1 
ATOM   4158  C CG  . LEU A 1 521 ? -0.804  15.520  95.074  1.00 19.12 ? 520 LEU A CG  1 
ATOM   4159  C CD1 . LEU A 1 521 ? -0.795  14.009  95.313  1.00 16.36 ? 520 LEU A CD1 1 
ATOM   4160  C CD2 . LEU A 1 521 ? -2.001  16.157  95.761  1.00 14.94 ? 520 LEU A CD2 1 
ATOM   4161  N N   . ALA A 1 522 ? 2.803   18.449  95.434  1.00 16.49 ? 521 ALA A N   1 
ATOM   4162  C CA  . ALA A 1 522 ? 4.048   18.979  95.967  1.00 17.04 ? 521 ALA A CA  1 
ATOM   4163  C C   . ALA A 1 522 ? 3.856   20.418  96.448  1.00 17.38 ? 521 ALA A C   1 
ATOM   4164  O O   . ALA A 1 522 ? 4.375   20.804  97.496  1.00 15.51 ? 521 ALA A O   1 
ATOM   4165  C CB  . ALA A 1 522 ? 5.149   18.921  94.905  1.00 14.37 ? 521 ALA A CB  1 
ATOM   4166  N N   . LYS A 1 523 ? 3.112   21.211  95.684  1.00 20.52 ? 522 LYS A N   1 
ATOM   4167  C CA  . LYS A 1 523 ? 2.876   22.597  96.075  1.00 24.10 ? 522 LYS A CA  1 
ATOM   4168  C C   . LYS A 1 523 ? 2.167   22.676  97.422  1.00 22.21 ? 522 LYS A C   1 
ATOM   4169  O O   . LYS A 1 523 ? 2.422   23.584  98.207  1.00 22.06 ? 522 LYS A O   1 
ATOM   4170  C CB  . LYS A 1 523 ? 2.050   23.328  95.011  1.00 26.02 ? 522 LYS A CB  1 
ATOM   4171  C CG  . LYS A 1 523 ? 2.819   23.661  93.736  1.00 31.27 ? 522 LYS A CG  1 
ATOM   4172  C CD  . LYS A 1 523 ? 3.557   25.004  93.830  1.00 34.24 ? 522 LYS A CD  1 
ATOM   4173  C CE  . LYS A 1 523 ? 4.646   25.009  94.887  1.00 34.96 ? 522 LYS A CE  1 
ATOM   4174  N NZ  . LYS A 1 523 ? 5.345   26.325  94.951  1.00 34.97 ? 522 LYS A NZ  1 
ATOM   4175  N N   . LYS A 1 524 ? 1.286   21.719  97.694  1.00 23.90 ? 523 LYS A N   1 
ATOM   4176  C CA  . LYS A 1 524 ? 0.550   21.714  98.959  1.00 25.81 ? 523 LYS A CA  1 
ATOM   4177  C C   . LYS A 1 524 ? 1.433   21.331  100.142 1.00 25.29 ? 523 LYS A C   1 
ATOM   4178  O O   . LYS A 1 524 ? 1.261   21.843  101.250 1.00 25.37 ? 523 LYS A O   1 
ATOM   4179  C CB  . LYS A 1 524 ? -0.633  20.741  98.897  1.00 28.72 ? 523 LYS A CB  1 
ATOM   4180  C CG  . LYS A 1 524 ? -1.684  21.072  97.852  1.00 32.07 ? 523 LYS A CG  1 
ATOM   4181  C CD  . LYS A 1 524 ? -2.867  20.118  97.982  1.00 35.22 ? 523 LYS A CD  1 
ATOM   4182  C CE  . LYS A 1 524 ? -3.868  20.289  96.848  1.00 37.12 ? 523 LYS A CE  1 
ATOM   4183  N NZ  . LYS A 1 524 ? -5.015  19.335  96.962  1.00 38.19 ? 523 LYS A NZ  1 
ATOM   4184  N N   . ILE A 1 525 ? 2.383   20.432  99.909  1.00 23.13 ? 524 ILE A N   1 
ATOM   4185  C CA  . ILE A 1 525 ? 3.262   19.984  100.977 1.00 22.58 ? 524 ILE A CA  1 
ATOM   4186  C C   . ILE A 1 525 ? 4.324   21.012  101.378 1.00 21.93 ? 524 ILE A C   1 
ATOM   4187  O O   . ILE A 1 525 ? 4.688   21.109  102.551 1.00 21.51 ? 524 ILE A O   1 
ATOM   4188  C CB  . ILE A 1 525 ? 3.938   18.644  100.586 1.00 23.66 ? 524 ILE A CB  1 
ATOM   4189  C CG1 . ILE A 1 525 ? 2.883   17.531  100.569 1.00 22.67 ? 524 ILE A CG1 1 
ATOM   4190  C CG2 . ILE A 1 525 ? 5.066   18.326  101.545 1.00 19.52 ? 524 ILE A CG2 1 
ATOM   4191  C CD1 . ILE A 1 525 ? 3.366   16.212  99.995  1.00 24.32 ? 524 ILE A CD1 1 
ATOM   4192  N N   . GLU A 1 526 ? 4.809   21.779  100.407 1.00 21.07 ? 525 GLU A N   1 
ATOM   4193  C CA  . GLU A 1 526 ? 5.833   22.792  100.654 1.00 21.95 ? 525 GLU A CA  1 
ATOM   4194  C C   . GLU A 1 526 ? 5.654   23.645  101.917 1.00 21.84 ? 525 GLU A C   1 
ATOM   4195  O O   . GLU A 1 526 ? 6.541   23.680  102.770 1.00 20.98 ? 525 GLU A O   1 
ATOM   4196  C CB  . GLU A 1 526 ? 5.977   23.701  99.426  1.00 22.31 ? 525 GLU A CB  1 
ATOM   4197  C CG  . GLU A 1 526 ? 6.916   23.133  98.360  1.00 26.42 ? 525 GLU A CG  1 
ATOM   4198  C CD  . GLU A 1 526 ? 6.963   23.956  97.076  1.00 27.66 ? 525 GLU A CD  1 
ATOM   4199  O OE1 . GLU A 1 526 ? 6.809   25.195  97.133  1.00 29.49 ? 525 GLU A OE1 1 
ATOM   4200  O OE2 . GLU A 1 526 ? 7.173   23.359  96.002  1.00 30.04 ? 525 GLU A OE2 1 
ATOM   4201  N N   . PRO A 1 527 ? 4.505   24.328  102.067 1.00 21.19 ? 526 PRO A N   1 
ATOM   4202  C CA  . PRO A 1 527 ? 4.311   25.160  103.262 1.00 22.55 ? 526 PRO A CA  1 
ATOM   4203  C C   . PRO A 1 527 ? 4.195   24.394  104.581 1.00 22.80 ? 526 PRO A C   1 
ATOM   4204  O O   . PRO A 1 527 ? 4.425   24.952  105.650 1.00 21.62 ? 526 PRO A O   1 
ATOM   4205  C CB  . PRO A 1 527 ? 3.042   25.941  102.933 1.00 23.43 ? 526 PRO A CB  1 
ATOM   4206  C CG  . PRO A 1 527 ? 2.251   24.945  102.125 1.00 23.90 ? 526 PRO A CG  1 
ATOM   4207  C CD  . PRO A 1 527 ? 3.312   24.364  101.200 1.00 23.10 ? 526 PRO A CD  1 
ATOM   4208  N N   . GLU A 1 528 ? 3.844   23.116  104.495 1.00 23.70 ? 527 GLU A N   1 
ATOM   4209  C CA  . GLU A 1 528 ? 3.690   22.268  105.673 1.00 24.65 ? 527 GLU A CA  1 
ATOM   4210  C C   . GLU A 1 528 ? 5.019   21.784  106.255 1.00 25.25 ? 527 GLU A C   1 
ATOM   4211  O O   . GLU A 1 528 ? 5.078   21.354  107.410 1.00 25.57 ? 527 GLU A O   1 
ATOM   4212  C CB  . GLU A 1 528 ? 2.819   21.061  105.320 1.00 25.82 ? 527 GLU A CB  1 
ATOM   4213  C CG  . GLU A 1 528 ? 1.475   21.429  104.701 1.00 25.72 ? 527 GLU A CG  1 
ATOM   4214  C CD  . GLU A 1 528 ? 0.645   20.210  104.358 1.00 27.00 ? 527 GLU A CD  1 
ATOM   4215  O OE1 . GLU A 1 528 ? 1.202   19.258  103.773 1.00 28.29 ? 527 GLU A OE1 1 
ATOM   4216  O OE2 . GLU A 1 528 ? -0.564  20.201  104.663 1.00 27.56 ? 527 GLU A OE2 1 
ATOM   4217  N N   . LEU A 1 529 ? 6.079   21.846  105.455 1.00 25.44 ? 528 LEU A N   1 
ATOM   4218  C CA  . LEU A 1 529 ? 7.398   21.406  105.900 1.00 27.82 ? 528 LEU A CA  1 
ATOM   4219  C C   . LEU A 1 529 ? 8.021   22.377  106.900 1.00 29.67 ? 528 LEU A C   1 
ATOM   4220  O O   . LEU A 1 529 ? 8.818   21.977  107.741 1.00 32.12 ? 528 LEU A O   1 
ATOM   4221  C CB  . LEU A 1 529 ? 8.331   21.227  104.696 1.00 24.52 ? 528 LEU A CB  1 
ATOM   4222  C CG  . LEU A 1 529 ? 7.912   20.156  103.678 1.00 25.51 ? 528 LEU A CG  1 
ATOM   4223  C CD1 . LEU A 1 529 ? 8.922   20.087  102.549 1.00 20.56 ? 528 LEU A CD1 1 
ATOM   4224  C CD2 . LEU A 1 529 ? 7.794   18.799  104.371 1.00 23.62 ? 528 LEU A CD2 1 
ATOM   4225  N N   . ASP A 1 530 ? 7.652   23.650  106.804 1.00 31.70 ? 529 ASP A N   1 
ATOM   4226  C CA  . ASP A 1 530 ? 8.170   24.677  107.701 1.00 34.76 ? 529 ASP A CA  1 
ATOM   4227  C C   . ASP A 1 530 ? 7.659   24.445  109.122 1.00 36.29 ? 529 ASP A C   1 
ATOM   4228  O O   . ASP A 1 530 ? 6.461   24.244  109.324 1.00 38.59 ? 529 ASP A O   1 
ATOM   4229  C CB  . ASP A 1 530 ? 7.710   26.060  107.232 1.00 36.05 ? 529 ASP A CB  1 
ATOM   4230  C CG  . ASP A 1 530 ? 8.173   26.390  105.824 1.00 37.79 ? 529 ASP A CG  1 
ATOM   4231  O OD1 . ASP A 1 530 ? 7.593   27.309  105.208 1.00 38.04 ? 529 ASP A OD1 1 
ATOM   4232  O OD2 . ASP A 1 530 ? 9.121   25.745  105.336 1.00 39.84 ? 529 ASP A OD2 1 
ATOM   4233  N N   . GLY A 1 531 ? 8.560   24.466  110.100 1.00 36.59 ? 530 GLY A N   1 
ATOM   4234  C CA  . GLY A 1 531 ? 8.146   24.282  111.482 1.00 39.89 ? 530 GLY A CA  1 
ATOM   4235  C C   . GLY A 1 531 ? 8.260   22.877  112.042 1.00 41.16 ? 530 GLY A C   1 
ATOM   4236  O O   . GLY A 1 531 ? 8.582   21.932  111.323 1.00 42.30 ? 530 GLY A O   1 
ATOM   4237  N N   . SER A 1 532 ? 7.982   22.741  113.336 1.00 40.84 ? 531 SER A N   1 
ATOM   4238  C CA  . SER A 1 532 ? 8.067   21.449  114.007 1.00 41.60 ? 531 SER A CA  1 
ATOM   4239  C C   . SER A 1 532 ? 6.697   20.883  114.345 1.00 39.38 ? 531 SER A C   1 
ATOM   4240  O O   . SER A 1 532 ? 6.593   19.840  114.988 1.00 40.00 ? 531 SER A O   1 
ATOM   4241  C CB  . SER A 1 532 ? 8.889   21.576  115.292 1.00 43.14 ? 531 SER A CB  1 
ATOM   4242  O OG  . SER A 1 532 ? 8.246   22.435  116.221 1.00 45.86 ? 531 SER A OG  1 
ATOM   4243  N N   . ALA A 1 533 ? 5.649   21.574  113.910 1.00 38.02 ? 532 ALA A N   1 
ATOM   4244  C CA  . ALA A 1 533 ? 4.283   21.137  114.168 1.00 35.89 ? 532 ALA A CA  1 
ATOM   4245  C C   . ALA A 1 533 ? 3.960   19.861  113.391 1.00 34.90 ? 532 ALA A C   1 
ATOM   4246  O O   . ALA A 1 533 ? 4.318   19.729  112.221 1.00 34.23 ? 532 ALA A O   1 
ATOM   4247  C CB  . ALA A 1 533 ? 3.308   22.239  113.785 1.00 34.79 ? 532 ALA A CB  1 
ATOM   4248  N N   . GLN A 1 534 ? 3.286   18.924  114.047 1.00 33.53 ? 533 GLN A N   1 
ATOM   4249  C CA  . GLN A 1 534 ? 2.912   17.666  113.407 1.00 33.28 ? 533 GLN A CA  1 
ATOM   4250  C C   . GLN A 1 534 ? 1.977   17.931  112.235 1.00 30.84 ? 533 GLN A C   1 
ATOM   4251  O O   . GLN A 1 534 ? 1.141   18.834  112.291 1.00 29.02 ? 533 GLN A O   1 
ATOM   4252  C CB  . GLN A 1 534 ? 2.195   16.747  114.400 1.00 34.59 ? 533 GLN A CB  1 
ATOM   4253  C CG  . GLN A 1 534 ? 3.017   16.316  115.598 1.00 36.30 ? 533 GLN A CG  1 
ATOM   4254  C CD  . GLN A 1 534 ? 4.301   15.620  115.204 1.00 35.54 ? 533 GLN A CD  1 
ATOM   4255  O OE1 . GLN A 1 534 ? 5.325   16.264  114.983 1.00 36.84 ? 533 GLN A OE1 1 
ATOM   4256  N NE2 . GLN A 1 534 ? 4.249   14.297  115.101 1.00 35.63 ? 533 GLN A NE2 1 
ATOM   4257  N N   . VAL A 1 535 ? 2.119   17.141  111.176 1.00 28.29 ? 534 VAL A N   1 
ATOM   4258  C CA  . VAL A 1 535 ? 1.264   17.277  110.003 1.00 25.35 ? 534 VAL A CA  1 
ATOM   4259  C C   . VAL A 1 535 ? 0.297   16.105  109.999 1.00 25.12 ? 534 VAL A C   1 
ATOM   4260  O O   . VAL A 1 535 ? 0.703   14.963  110.206 1.00 23.10 ? 534 VAL A O   1 
ATOM   4261  C CB  . VAL A 1 535 ? 2.083   17.263  108.709 1.00 26.24 ? 534 VAL A CB  1 
ATOM   4262  C CG1 . VAL A 1 535 ? 1.155   17.276  107.502 1.00 22.83 ? 534 VAL A CG1 1 
ATOM   4263  C CG2 . VAL A 1 535 ? 3.001   18.472  108.679 1.00 26.32 ? 534 VAL A CG2 1 
ATOM   4264  N N   . THR A 1 536 ? -0.980  16.389  109.754 1.00 25.28 ? 535 THR A N   1 
ATOM   4265  C CA  . THR A 1 536 ? -2.007  15.351  109.764 1.00 26.70 ? 535 THR A CA  1 
ATOM   4266  C C   . THR A 1 536 ? -3.016  15.500  108.634 1.00 26.24 ? 535 THR A C   1 
ATOM   4267  O O   . THR A 1 536 ? -4.054  14.853  108.646 1.00 27.86 ? 535 THR A O   1 
ATOM   4268  C CB  . THR A 1 536 ? -2.820  15.395  111.070 1.00 26.88 ? 535 THR A CB  1 
ATOM   4269  O OG1 . THR A 1 536 ? -3.625  16.580  111.075 1.00 29.22 ? 535 THR A OG1 1 
ATOM   4270  C CG2 . THR A 1 536 ? -1.902  15.420  112.284 1.00 26.34 ? 535 THR A CG2 1 
ATOM   4271  N N   . SER A 1 537 ? -2.713  16.343  107.660 1.00 25.69 ? 536 SER A N   1 
ATOM   4272  C CA  . SER A 1 537 ? -3.632  16.592  106.560 1.00 24.90 ? 536 SER A CA  1 
ATOM   4273  C C   . SER A 1 537 ? -3.600  15.590  105.406 1.00 24.69 ? 536 SER A C   1 
ATOM   4274  O O   . SER A 1 537 ? -4.407  15.687  104.488 1.00 25.49 ? 536 SER A O   1 
ATOM   4275  C CB  . SER A 1 537 ? -3.380  17.990  106.011 1.00 24.06 ? 536 SER A CB  1 
ATOM   4276  O OG  . SER A 1 537 ? -2.027  18.114  105.611 1.00 25.27 ? 536 SER A OG  1 
ATOM   4277  N N   . HIS A 1 538 ? -2.683  14.633  105.442 1.00 23.09 ? 537 HIS A N   1 
ATOM   4278  C CA  . HIS A 1 538 ? -2.588  13.649  104.365 1.00 23.71 ? 537 HIS A CA  1 
ATOM   4279  C C   . HIS A 1 538 ? -2.877  12.242  104.871 1.00 23.33 ? 537 HIS A C   1 
ATOM   4280  O O   . HIS A 1 538 ? -3.341  12.046  105.992 1.00 22.08 ? 537 HIS A O   1 
ATOM   4281  C CB  . HIS A 1 538 ? -1.178  13.672  103.762 1.00 22.77 ? 537 HIS A CB  1 
ATOM   4282  C CG  . HIS A 1 538 ? -0.753  15.022  103.274 1.00 22.32 ? 537 HIS A CG  1 
ATOM   4283  N ND1 . HIS A 1 538 ? -0.961  15.445  101.979 1.00 20.58 ? 537 HIS A ND1 1 
ATOM   4284  C CD2 . HIS A 1 538 ? -0.167  16.057  103.920 1.00 20.73 ? 537 HIS A CD2 1 
ATOM   4285  C CE1 . HIS A 1 538 ? -0.523  16.684  101.846 1.00 22.32 ? 537 HIS A CE1 1 
ATOM   4286  N NE2 . HIS A 1 538 ? -0.037  17.079  103.010 1.00 25.85 ? 537 HIS A NE2 1 
ATOM   4287  N N   . ASP A 1 539 ? -2.600  11.261  104.022 1.00 23.68 ? 538 ASP A N   1 
ATOM   4288  C CA  . ASP A 1 539 ? -2.770  9.867   104.398 1.00 22.33 ? 538 ASP A CA  1 
ATOM   4289  C C   . ASP A 1 539 ? -1.720  9.617   105.484 1.00 21.19 ? 538 ASP A C   1 
ATOM   4290  O O   . ASP A 1 539 ? -0.773  10.403  105.636 1.00 21.20 ? 538 ASP A O   1 
ATOM   4291  C CB  . ASP A 1 539 ? -2.504  8.977   103.187 1.00 22.45 ? 538 ASP A CB  1 
ATOM   4292  C CG  . ASP A 1 539 ? -1.081  9.108   102.678 1.00 22.54 ? 538 ASP A CG  1 
ATOM   4293  O OD1 . ASP A 1 539 ? -0.213  8.332   103.140 1.00 21.29 ? 538 ASP A OD1 1 
ATOM   4294  O OD2 . ASP A 1 539 ? -0.835  9.997   101.828 1.00 22.10 ? 538 ASP A OD2 1 
ATOM   4295  N N   . ALA A 1 540 ? -1.883  8.528   106.227 1.00 21.00 ? 539 ALA A N   1 
ATOM   4296  C CA  . ALA A 1 540 ? -0.970  8.167   107.312 1.00 20.85 ? 539 ALA A CA  1 
ATOM   4297  C C   . ALA A 1 540 ? 0.510   8.090   106.935 1.00 20.63 ? 539 ALA A C   1 
ATOM   4298  O O   . ALA A 1 540 ? 1.375   8.443   107.741 1.00 19.98 ? 539 ALA A O   1 
ATOM   4299  C CB  . ALA A 1 540 ? -1.404  6.840   107.936 1.00 19.90 ? 539 ALA A CB  1 
ATOM   4300  N N   . SER A 1 541 ? 0.812   7.619   105.727 1.00 20.07 ? 540 SER A N   1 
ATOM   4301  C CA  . SER A 1 541 ? 2.208   7.511   105.309 1.00 19.68 ? 540 SER A CA  1 
ATOM   4302  C C   . SER A 1 541 ? 2.811   8.891   105.061 1.00 18.86 ? 540 SER A C   1 
ATOM   4303  O O   . SER A 1 541 ? 3.825   9.248   105.655 1.00 18.76 ? 540 SER A O   1 
ATOM   4304  C CB  . SER A 1 541 ? 2.332   6.663   104.042 1.00 19.56 ? 540 SER A CB  1 
ATOM   4305  O OG  . SER A 1 541 ? 3.664   6.694   103.558 1.00 20.63 ? 540 SER A OG  1 
ATOM   4306  N N   . THR A 1 542 ? 2.189   9.659   104.174 1.00 18.48 ? 541 THR A N   1 
ATOM   4307  C CA  . THR A 1 542 ? 2.673   10.996  103.876 1.00 18.77 ? 541 THR A CA  1 
ATOM   4308  C C   . THR A 1 542 ? 2.838   11.771  105.184 1.00 18.91 ? 541 THR A C   1 
ATOM   4309  O O   . THR A 1 542 ? 3.839   12.461  105.377 1.00 20.97 ? 541 THR A O   1 
ATOM   4310  C CB  . THR A 1 542 ? 1.709   11.724  102.912 1.00 17.77 ? 541 THR A CB  1 
ATOM   4311  O OG1 . THR A 1 542 ? 1.691   11.025  101.659 1.00 17.19 ? 541 THR A OG1 1 
ATOM   4312  C CG2 . THR A 1 542 ? 2.156   13.172  102.669 1.00 15.44 ? 541 THR A CG2 1 
ATOM   4313  N N   . ASN A 1 543 ? 1.873   11.631  106.091 1.00 20.68 ? 542 ASN A N   1 
ATOM   4314  C CA  . ASN A 1 543 ? 1.928   12.303  107.391 1.00 17.50 ? 542 ASN A CA  1 
ATOM   4315  C C   . ASN A 1 543 ? 3.154   11.837  108.169 1.00 18.77 ? 542 ASN A C   1 
ATOM   4316  O O   . ASN A 1 543 ? 3.949   12.646  108.641 1.00 18.96 ? 542 ASN A O   1 
ATOM   4317  C CB  . ASN A 1 543 ? 0.690   11.970  108.234 1.00 19.52 ? 542 ASN A CB  1 
ATOM   4318  C CG  . ASN A 1 543 ? -0.578  12.678  107.760 1.00 19.98 ? 542 ASN A CG  1 
ATOM   4319  O OD1 . ASN A 1 543 ? -1.677  12.380  108.239 1.00 21.91 ? 542 ASN A OD1 1 
ATOM   4320  N ND2 . ASN A 1 543 ? -0.434  13.614  106.837 1.00 16.97 ? 542 ASN A ND2 1 
ATOM   4321  N N   . GLY A 1 544 ? 3.288   10.520  108.314 1.00 16.70 ? 543 GLY A N   1 
ATOM   4322  C CA  . GLY A 1 544 ? 4.402   9.963   109.057 1.00 16.46 ? 543 GLY A CA  1 
ATOM   4323  C C   . GLY A 1 544 ? 5.757   10.349  108.503 1.00 16.57 ? 543 GLY A C   1 
ATOM   4324  O O   . GLY A 1 544 ? 6.699   10.616  109.251 1.00 16.98 ? 543 GLY A O   1 
ATOM   4325  N N   . LEU A 1 545 ? 5.863   10.365  107.182 1.00 16.54 ? 544 LEU A N   1 
ATOM   4326  C CA  . LEU A 1 545 ? 7.111   10.718  106.535 1.00 16.19 ? 544 LEU A CA  1 
ATOM   4327  C C   . LEU A 1 545 ? 7.463   12.168  106.856 1.00 16.78 ? 544 LEU A C   1 
ATOM   4328  O O   . LEU A 1 545 ? 8.599   12.471  107.216 1.00 16.78 ? 544 LEU A O   1 
ATOM   4329  C CB  . LEU A 1 545 ? 6.984   10.507  105.025 1.00 16.77 ? 544 LEU A CB  1 
ATOM   4330  C CG  . LEU A 1 545 ? 6.913   9.038   104.602 1.00 17.59 ? 544 LEU A CG  1 
ATOM   4331  C CD1 . LEU A 1 545 ? 6.458   8.946   103.160 1.00 17.40 ? 544 LEU A CD1 1 
ATOM   4332  C CD2 . LEU A 1 545 ? 8.280   8.385   104.784 1.00 16.87 ? 544 LEU A CD2 1 
ATOM   4333  N N   . ILE A 1 546 ? 6.483   13.061  106.742 1.00 17.51 ? 545 ILE A N   1 
ATOM   4334  C CA  . ILE A 1 546 ? 6.716   14.472  107.040 1.00 18.62 ? 545 ILE A CA  1 
ATOM   4335  C C   . ILE A 1 546 ? 7.162   14.671  108.486 1.00 20.23 ? 545 ILE A C   1 
ATOM   4336  O O   . ILE A 1 546 ? 8.106   15.415  108.759 1.00 21.90 ? 545 ILE A O   1 
ATOM   4337  C CB  . ILE A 1 546 ? 5.447   15.318  106.804 1.00 18.95 ? 545 ILE A CB  1 
ATOM   4338  C CG1 . ILE A 1 546 ? 5.150   15.398  105.304 1.00 19.20 ? 545 ILE A CG1 1 
ATOM   4339  C CG2 . ILE A 1 546 ? 5.630   16.719  107.405 1.00 17.64 ? 545 ILE A CG2 1 
ATOM   4340  C CD1 . ILE A 1 546 ? 3.855   16.104  104.966 1.00 15.34 ? 545 ILE A CD1 1 
ATOM   4341  N N   . ASN A 1 547 ? 6.495   14.000  109.417 1.00 19.22 ? 546 ASN A N   1 
ATOM   4342  C CA  . ASN A 1 547 ? 6.851   14.160  110.819 1.00 19.99 ? 546 ASN A CA  1 
ATOM   4343  C C   . ASN A 1 547 ? 8.215   13.572  111.166 1.00 20.49 ? 546 ASN A C   1 
ATOM   4344  O O   . ASN A 1 547 ? 8.890   14.065  112.068 1.00 19.44 ? 546 ASN A O   1 
ATOM   4345  C CB  . ASN A 1 547 ? 5.754   13.572  111.708 1.00 20.29 ? 546 ASN A CB  1 
ATOM   4346  C CG  . ASN A 1 547 ? 4.432   14.296  111.536 1.00 23.34 ? 546 ASN A CG  1 
ATOM   4347  O OD1 . ASN A 1 547 ? 4.404   15.513  111.318 1.00 21.57 ? 546 ASN A OD1 1 
ATOM   4348  N ND2 . ASN A 1 547 ? 3.330   13.562  111.641 1.00 23.01 ? 546 ASN A ND2 1 
ATOM   4349  N N   . PHE A 1 548 ? 8.623   12.522  110.458 1.00 20.05 ? 547 PHE A N   1 
ATOM   4350  C CA  . PHE A 1 548 ? 9.938   11.934  110.708 1.00 20.71 ? 547 PHE A CA  1 
ATOM   4351  C C   . PHE A 1 548 ? 10.973  12.950  110.220 1.00 18.79 ? 547 PHE A C   1 
ATOM   4352  O O   . PHE A 1 548 ? 12.002  13.163  110.850 1.00 18.23 ? 547 PHE A O   1 
ATOM   4353  C CB  . PHE A 1 548 ? 10.102  10.612  109.947 1.00 16.96 ? 547 PHE A CB  1 
ATOM   4354  C CG  . PHE A 1 548 ? 11.489  10.023  110.041 1.00 18.08 ? 547 PHE A CG  1 
ATOM   4355  C CD1 . PHE A 1 548 ? 11.927  9.408   111.208 1.00 16.64 ? 547 PHE A CD1 1 
ATOM   4356  C CD2 . PHE A 1 548 ? 12.360  10.097  108.962 1.00 18.59 ? 547 PHE A CD2 1 
ATOM   4357  C CE1 . PHE A 1 548 ? 13.212  8.879   111.296 1.00 17.72 ? 547 PHE A CE1 1 
ATOM   4358  C CE2 . PHE A 1 548 ? 13.649  9.568   109.043 1.00 17.75 ? 547 PHE A CE2 1 
ATOM   4359  C CZ  . PHE A 1 548 ? 14.072  8.961   110.210 1.00 18.39 ? 547 PHE A CZ  1 
ATOM   4360  N N   . ILE A 1 549 ? 10.677  13.578  109.088 1.00 20.72 ? 548 ILE A N   1 
ATOM   4361  C CA  . ILE A 1 549 ? 11.565  14.579  108.502 1.00 21.78 ? 548 ILE A CA  1 
ATOM   4362  C C   . ILE A 1 549 ? 11.742  15.763  109.452 1.00 21.40 ? 548 ILE A C   1 
ATOM   4363  O O   . ILE A 1 549 ? 12.845  16.274  109.638 1.00 21.39 ? 548 ILE A O   1 
ATOM   4364  C CB  . ILE A 1 549 ? 11.000  15.088  107.156 1.00 22.22 ? 548 ILE A CB  1 
ATOM   4365  C CG1 . ILE A 1 549 ? 11.027  13.955  106.127 1.00 23.23 ? 548 ILE A CG1 1 
ATOM   4366  C CG2 . ILE A 1 549 ? 11.797  16.291  106.669 1.00 25.06 ? 548 ILE A CG2 1 
ATOM   4367  C CD1 . ILE A 1 549 ? 10.405  14.305  104.782 1.00 21.90 ? 548 ILE A CD1 1 
ATOM   4368  N N   . LYS A 1 550 ? 10.650  16.209  110.053 1.00 21.35 ? 549 LYS A N   1 
ATOM   4369  C CA  . LYS A 1 550 ? 10.738  17.327  110.978 1.00 22.88 ? 549 LYS A CA  1 
ATOM   4370  C C   . LYS A 1 550 ? 11.507  16.941  112.232 1.00 21.61 ? 549 LYS A C   1 
ATOM   4371  O O   . LYS A 1 550 ? 12.199  17.766  112.822 1.00 21.88 ? 549 LYS A O   1 
ATOM   4372  C CB  . LYS A 1 550 ? 9.342   17.816  111.351 1.00 21.74 ? 549 LYS A CB  1 
ATOM   4373  C CG  . LYS A 1 550 ? 8.600   18.436  110.181 1.00 24.50 ? 549 LYS A CG  1 
ATOM   4374  C CD  . LYS A 1 550 ? 7.335   19.128  110.645 1.00 26.75 ? 549 LYS A CD  1 
ATOM   4375  C CE  . LYS A 1 550 ? 6.700   19.911  109.517 1.00 27.19 ? 549 LYS A CE  1 
ATOM   4376  N NZ  . LYS A 1 550 ? 5.576   20.751  110.004 1.00 22.83 ? 549 LYS A NZ  1 
ATOM   4377  N N   . GLN A 1 551 ? 11.393  15.680  112.633 1.00 21.82 ? 550 GLN A N   1 
ATOM   4378  C CA  . GLN A 1 551 ? 12.084  15.201  113.823 1.00 21.39 ? 550 GLN A CA  1 
ATOM   4379  C C   . GLN A 1 551 ? 13.590  15.145  113.618 1.00 21.76 ? 550 GLN A C   1 
ATOM   4380  O O   . GLN A 1 551 ? 14.358  15.605  114.462 1.00 20.02 ? 550 GLN A O   1 
ATOM   4381  C CB  . GLN A 1 551 ? 11.596  13.798  114.202 1.00 23.98 ? 550 GLN A CB  1 
ATOM   4382  C CG  . GLN A 1 551 ? 12.436  13.127  115.296 1.00 23.82 ? 550 GLN A CG  1 
ATOM   4383  C CD  . GLN A 1 551 ? 12.127  11.648  115.459 1.00 24.88 ? 550 GLN A CD  1 
ATOM   4384  O OE1 . GLN A 1 551 ? 11.116  11.267  116.055 1.00 26.68 ? 550 GLN A OE1 1 
ATOM   4385  N NE2 . GLN A 1 551 ? 12.994  10.807  114.915 1.00 21.37 ? 550 GLN A NE2 1 
ATOM   4386  N N   . GLN A 1 552 ? 14.003  14.570  112.495 1.00 22.48 ? 551 GLN A N   1 
ATOM   4387  C CA  . GLN A 1 552 ? 15.417  14.405  112.190 1.00 24.75 ? 551 GLN A CA  1 
ATOM   4388  C C   . GLN A 1 552 ? 16.109  15.648  111.646 1.00 26.46 ? 551 GLN A C   1 
ATOM   4389  O O   . GLN A 1 552 ? 17.318  15.641  111.412 1.00 26.18 ? 551 GLN A O   1 
ATOM   4390  C CB  . GLN A 1 552 ? 15.590  13.240  111.213 1.00 23.66 ? 551 GLN A CB  1 
ATOM   4391  C CG  . GLN A 1 552 ? 15.218  11.896  111.815 1.00 21.59 ? 551 GLN A CG  1 
ATOM   4392  C CD  . GLN A 1 552 ? 16.112  11.529  112.977 1.00 22.22 ? 551 GLN A CD  1 
ATOM   4393  O OE1 . GLN A 1 552 ? 17.334  11.481  112.840 1.00 21.97 ? 551 GLN A OE1 1 
ATOM   4394  N NE2 . GLN A 1 552 ? 15.509  11.267  114.131 1.00 23.27 ? 551 GLN A NE2 1 
ATOM   4395  N N   . ARG A 1 553 ? 15.345  16.713  111.445 1.00 27.78 ? 552 ARG A N   1 
ATOM   4396  C CA  . ARG A 1 553 ? 15.916  17.950  110.935 1.00 31.64 ? 552 ARG A CA  1 
ATOM   4397  C C   . ARG A 1 553 ? 17.028  18.445  111.852 1.00 33.56 ? 552 ARG A C   1 
ATOM   4398  O O   . ARG A 1 553 ? 18.053  18.933  111.382 1.00 34.97 ? 552 ARG A O   1 
ATOM   4399  C CB  . ARG A 1 553 ? 14.824  19.011  110.799 1.00 32.36 ? 552 ARG A CB  1 
ATOM   4400  C CG  . ARG A 1 553 ? 15.337  20.419  110.557 1.00 36.30 ? 552 ARG A CG  1 
ATOM   4401  C CD  . ARG A 1 553 ? 14.307  21.243  109.803 1.00 41.39 ? 552 ARG A CD  1 
ATOM   4402  N NE  . ARG A 1 553 ? 12.946  20.993  110.271 1.00 42.47 ? 552 ARG A NE  1 
ATOM   4403  C CZ  . ARG A 1 553 ? 11.858  21.496  109.697 1.00 43.44 ? 552 ARG A CZ  1 
ATOM   4404  N NH1 . ARG A 1 553 ? 11.971  22.278  108.633 1.00 46.69 ? 552 ARG A NH1 1 
ATOM   4405  N NH2 . ARG A 1 553 ? 10.659  21.217  110.182 1.00 44.03 ? 552 ARG A NH2 1 
ATOM   4406  N N   . GLU A 1 554 ? 16.828  18.299  113.158 1.00 37.30 ? 553 GLU A N   1 
ATOM   4407  C CA  . GLU A 1 554 ? 17.810  18.738  114.147 1.00 42.09 ? 553 GLU A CA  1 
ATOM   4408  C C   . GLU A 1 554 ? 18.895  17.710  114.471 1.00 42.36 ? 553 GLU A C   1 
ATOM   4409  O O   . GLU A 1 554 ? 20.029  18.082  114.761 1.00 44.00 ? 553 GLU A O   1 
ATOM   4410  C CB  . GLU A 1 554 ? 17.116  19.127  115.458 1.00 46.28 ? 553 GLU A CB  1 
ATOM   4411  C CG  . GLU A 1 554 ? 16.309  20.419  115.410 1.00 51.26 ? 553 GLU A CG  1 
ATOM   4412  C CD  . GLU A 1 554 ? 15.060  20.299  114.565 1.00 53.49 ? 553 GLU A CD  1 
ATOM   4413  O OE1 . GLU A 1 554 ? 14.258  19.377  114.820 1.00 55.62 ? 553 GLU A OE1 1 
ATOM   4414  O OE2 . GLU A 1 554 ? 14.879  21.129  113.650 1.00 56.13 ? 553 GLU A OE2 1 
ATOM   4415  N N   . ALA A 1 555 ? 18.544  16.427  114.430 1.00 40.81 ? 554 ALA A N   1 
ATOM   4416  C CA  . ALA A 1 555 ? 19.484  15.354  114.747 1.00 39.55 ? 554 ALA A CA  1 
ATOM   4417  C C   . ALA A 1 555 ? 20.914  15.646  114.308 1.00 40.02 ? 554 ALA A C   1 
ATOM   4418  O O   . ALA A 1 555 ? 21.184  15.859  113.128 1.00 39.23 ? 554 ALA A O   1 
ATOM   4419  C CB  . ALA A 1 555 ? 19.008  14.046  114.128 1.00 37.69 ? 554 ALA A CB  1 
ATOM   4420  N N   . ARG A 1 556 ? 21.833  15.660  115.265 1.00 40.38 ? 555 ARG A N   1 
ATOM   4421  C CA  . ARG A 1 556 ? 23.230  15.917  114.950 1.00 42.08 ? 555 ARG A CA  1 
ATOM   4422  C C   . ARG A 1 556 ? 23.928  14.585  114.719 1.00 40.65 ? 555 ARG A C   1 
ATOM   4423  O O   . ARG A 1 556 ? 23.969  13.733  115.602 1.00 39.41 ? 555 ARG A O   1 
ATOM   4424  C CB  . ARG A 1 556 ? 23.921  16.681  116.087 1.00 45.13 ? 555 ARG A CB  1 
ATOM   4425  C CG  . ARG A 1 556 ? 23.269  18.009  116.464 1.00 49.72 ? 555 ARG A CG  1 
ATOM   4426  C CD  . ARG A 1 556 ? 22.835  18.812  115.238 1.00 54.60 ? 555 ARG A CD  1 
ATOM   4427  N NE  . ARG A 1 556 ? 23.881  18.912  114.222 1.00 58.73 ? 555 ARG A NE  1 
ATOM   4428  C CZ  . ARG A 1 556 ? 23.714  19.486  113.033 1.00 60.61 ? 555 ARG A CZ  1 
ATOM   4429  N NH1 . ARG A 1 556 ? 22.540  20.017  112.709 1.00 61.59 ? 555 ARG A NH1 1 
ATOM   4430  N NH2 . ARG A 1 556 ? 24.718  19.525  112.164 1.00 61.12 ? 555 ARG A NH2 1 
ATOM   4431  N N   . VAL A 1 557 ? 24.473  14.413  113.522 1.00 41.27 ? 556 VAL A N   1 
ATOM   4432  C CA  . VAL A 1 557 ? 25.156  13.181  113.157 1.00 42.43 ? 556 VAL A CA  1 
ATOM   4433  C C   . VAL A 1 557 ? 26.546  13.474  112.600 1.00 42.99 ? 556 VAL A C   1 
ATOM   4434  O O   . VAL A 1 557 ? 27.463  12.663  112.842 1.00 43.93 ? 556 VAL A O   1 
ATOM   4435  C CB  . VAL A 1 557 ? 24.341  12.399  112.109 1.00 42.66 ? 556 VAL A CB  1 
ATOM   4436  C CG1 . VAL A 1 557 ? 25.055  11.115  111.745 1.00 45.04 ? 556 VAL A CG1 1 
ATOM   4437  C CG2 . VAL A 1 557 ? 22.957  12.095  112.658 1.00 42.75 ? 556 VAL A CG2 1 
ATOM   4438  N N   . ALA B 1 2   ? 11.013  -26.671 90.731  1.00 25.74 ? 1   ALA B N   1 
ATOM   4439  C CA  . ALA B 1 2   ? 11.768  -25.655 91.515  1.00 27.41 ? 1   ALA B CA  1 
ATOM   4440  C C   . ALA B 1 2   ? 11.246  -25.610 92.948  1.00 27.14 ? 1   ALA B C   1 
ATOM   4441  O O   . ALA B 1 2   ? 10.040  -25.694 93.184  1.00 27.16 ? 1   ALA B O   1 
ATOM   4442  C CB  . ALA B 1 2   ? 11.630  -24.277 90.860  1.00 25.07 ? 1   ALA B CB  1 
ATOM   4443  N N   . ALA B 1 3   ? 12.160  -25.463 93.900  1.00 26.68 ? 2   ALA B N   1 
ATOM   4444  C CA  . ALA B 1 3   ? 11.792  -25.415 95.309  1.00 27.22 ? 2   ALA B CA  1 
ATOM   4445  C C   . ALA B 1 3   ? 10.681  -24.417 95.635  1.00 27.86 ? 2   ALA B C   1 
ATOM   4446  O O   . ALA B 1 3   ? 9.712   -24.770 96.311  1.00 27.00 ? 2   ALA B O   1 
ATOM   4447  C CB  . ALA B 1 3   ? 13.026  -25.111 96.155  1.00 26.03 ? 2   ALA B CB  1 
ATOM   4448  N N   . LEU B 1 4   ? 10.811  -23.179 95.157  1.00 26.91 ? 3   LEU B N   1 
ATOM   4449  C CA  . LEU B 1 4   ? 9.813   -22.152 95.454  1.00 28.09 ? 3   LEU B CA  1 
ATOM   4450  C C   . LEU B 1 4   ? 8.381   -22.545 95.107  1.00 29.40 ? 3   LEU B C   1 
ATOM   4451  O O   . LEU B 1 4   ? 7.492   -22.502 95.959  1.00 30.39 ? 3   LEU B O   1 
ATOM   4452  C CB  . LEU B 1 4   ? 10.155  -20.835 94.750  1.00 27.82 ? 3   LEU B CB  1 
ATOM   4453  C CG  . LEU B 1 4   ? 9.154   -19.712 95.059  1.00 27.08 ? 3   LEU B CG  1 
ATOM   4454  C CD1 . LEU B 1 4   ? 9.116   -19.469 96.569  1.00 26.08 ? 3   LEU B CD1 1 
ATOM   4455  C CD2 . LEU B 1 4   ? 9.542   -18.435 94.325  1.00 27.45 ? 3   LEU B CD2 1 
ATOM   4456  N N   . THR B 1 5   ? 8.165   -22.926 93.856  1.00 29.45 ? 4   THR B N   1 
ATOM   4457  C CA  . THR B 1 5   ? 6.847   -23.319 93.385  1.00 32.13 ? 4   THR B CA  1 
ATOM   4458  C C   . THR B 1 5   ? 6.225   -24.414 94.242  1.00 31.67 ? 4   THR B C   1 
ATOM   4459  O O   . THR B 1 5   ? 5.021   -24.404 94.492  1.00 31.02 ? 4   THR B O   1 
ATOM   4460  C CB  . THR B 1 5   ? 6.914   -23.829 91.938  1.00 33.06 ? 4   THR B CB  1 
ATOM   4461  O OG1 . THR B 1 5   ? 7.623   -22.883 91.135  1.00 37.43 ? 4   THR B OG1 1 
ATOM   4462  C CG2 . THR B 1 5   ? 5.513   -24.009 91.375  1.00 34.75 ? 4   THR B CG2 1 
ATOM   4463  N N   . ARG B 1 6   ? 7.050   -25.357 94.684  1.00 32.12 ? 5   ARG B N   1 
ATOM   4464  C CA  . ARG B 1 6   ? 6.574   -26.469 95.497  1.00 32.19 ? 5   ARG B CA  1 
ATOM   4465  C C   . ARG B 1 6   ? 6.360   -26.096 96.963  1.00 31.28 ? 5   ARG B C   1 
ATOM   4466  O O   . ARG B 1 6   ? 5.776   -26.868 97.721  1.00 30.77 ? 5   ARG B O   1 
ATOM   4467  C CB  . ARG B 1 6   ? 7.556   -27.646 95.400  1.00 33.58 ? 5   ARG B CB  1 
ATOM   4468  C CG  . ARG B 1 6   ? 7.618   -28.295 94.017  1.00 38.59 ? 5   ARG B CG  1 
ATOM   4469  C CD  . ARG B 1 6   ? 8.695   -29.379 93.926  1.00 43.91 ? 5   ARG B CD  1 
ATOM   4470  N NE  . ARG B 1 6   ? 10.041  -28.833 93.737  1.00 48.92 ? 5   ARG B NE  1 
ATOM   4471  C CZ  . ARG B 1 6   ? 11.149  -29.570 93.667  1.00 51.87 ? 5   ARG B CZ  1 
ATOM   4472  N NH1 . ARG B 1 6   ? 11.082  -30.893 93.773  1.00 52.83 ? 5   ARG B NH1 1 
ATOM   4473  N NH2 . ARG B 1 6   ? 12.328  -28.987 93.481  1.00 52.27 ? 5   ARG B NH2 1 
ATOM   4474  N N   . ASP B 1 7   ? 6.816   -24.913 97.362  1.00 30.08 ? 6   ASP B N   1 
ATOM   4475  C CA  . ASP B 1 7   ? 6.670   -24.486 98.752  1.00 28.44 ? 6   ASP B CA  1 
ATOM   4476  C C   . ASP B 1 7   ? 5.214   -24.218 99.124  1.00 28.33 ? 6   ASP B C   1 
ATOM   4477  O O   . ASP B 1 7   ? 4.520   -23.454 98.453  1.00 27.75 ? 6   ASP B O   1 
ATOM   4478  C CB  . ASP B 1 7   ? 7.496   -23.232 99.022  1.00 27.67 ? 6   ASP B CB  1 
ATOM   4479  C CG  . ASP B 1 7   ? 7.562   -22.895 100.498 1.00 28.16 ? 6   ASP B CG  1 
ATOM   4480  O OD1 . ASP B 1 7   ? 8.555   -23.278 101.152 1.00 25.89 ? 6   ASP B OD1 1 
ATOM   4481  O OD2 . ASP B 1 7   ? 6.611   -22.264 101.006 1.00 28.35 ? 6   ASP B OD2 1 
ATOM   4482  N N   . PRO B 1 8   ? 4.741   -24.836 100.219 1.00 28.62 ? 7   PRO B N   1 
ATOM   4483  C CA  . PRO B 1 8   ? 3.367   -24.696 100.718 1.00 28.56 ? 7   PRO B CA  1 
ATOM   4484  C C   . PRO B 1 8   ? 3.003   -23.249 101.013 1.00 29.11 ? 7   PRO B C   1 
ATOM   4485  O O   . PRO B 1 8   ? 1.898   -22.794 100.708 1.00 27.65 ? 7   PRO B O   1 
ATOM   4486  C CB  . PRO B 1 8   ? 3.371   -25.542 101.991 1.00 30.58 ? 7   PRO B CB  1 
ATOM   4487  C CG  . PRO B 1 8   ? 4.457   -26.557 101.733 1.00 30.31 ? 7   PRO B CG  1 
ATOM   4488  C CD  . PRO B 1 8   ? 5.530   -25.706 101.107 1.00 29.32 ? 7   PRO B CD  1 
ATOM   4489  N N   . GLN B 1 9   ? 3.938   -22.533 101.626 1.00 30.06 ? 8   GLN B N   1 
ATOM   4490  C CA  . GLN B 1 9   ? 3.712   -21.140 101.969 1.00 31.37 ? 8   GLN B CA  1 
ATOM   4491  C C   . GLN B 1 9   ? 3.563   -20.312 100.707 1.00 30.01 ? 8   GLN B C   1 
ATOM   4492  O O   . GLN B 1 9   ? 2.680   -19.459 100.621 1.00 31.91 ? 8   GLN B O   1 
ATOM   4493  C CB  . GLN B 1 9   ? 4.865   -20.608 102.815 1.00 32.88 ? 8   GLN B CB  1 
ATOM   4494  C CG  . GLN B 1 9   ? 5.090   -21.414 104.079 1.00 37.38 ? 8   GLN B CG  1 
ATOM   4495  C CD  . GLN B 1 9   ? 3.804   -21.657 104.846 1.00 38.45 ? 8   GLN B CD  1 
ATOM   4496  O OE1 . GLN B 1 9   ? 3.121   -20.715 105.245 1.00 39.00 ? 8   GLN B OE1 1 
ATOM   4497  N NE2 . GLN B 1 9   ? 3.465   -22.930 105.052 1.00 39.10 ? 8   GLN B NE2 1 
ATOM   4498  N N   . PHE B 1 10  ? 4.413   -20.571 99.721  1.00 28.69 ? 9   PHE B N   1 
ATOM   4499  C CA  . PHE B 1 10  ? 4.336   -19.825 98.477  1.00 27.40 ? 9   PHE B CA  1 
ATOM   4500  C C   . PHE B 1 10  ? 2.980   -20.049 97.828  1.00 27.76 ? 9   PHE B C   1 
ATOM   4501  O O   . PHE B 1 10  ? 2.340   -19.105 97.359  1.00 25.36 ? 9   PHE B O   1 
ATOM   4502  C CB  . PHE B 1 10  ? 5.442   -20.245 97.511  1.00 26.80 ? 9   PHE B CB  1 
ATOM   4503  C CG  . PHE B 1 10  ? 5.418   -19.488 96.215  1.00 29.17 ? 9   PHE B CG  1 
ATOM   4504  C CD1 . PHE B 1 10  ? 5.612   -18.108 96.201  1.00 27.44 ? 9   PHE B CD1 1 
ATOM   4505  C CD2 . PHE B 1 10  ? 5.148   -20.142 95.014  1.00 29.02 ? 9   PHE B CD2 1 
ATOM   4506  C CE1 . PHE B 1 10  ? 5.535   -17.389 95.010  1.00 28.66 ? 9   PHE B CE1 1 
ATOM   4507  C CE2 . PHE B 1 10  ? 5.067   -19.433 93.816  1.00 29.98 ? 9   PHE B CE2 1 
ATOM   4508  C CZ  . PHE B 1 10  ? 5.260   -18.053 93.814  1.00 28.95 ? 9   PHE B CZ  1 
ATOM   4509  N N   . GLN B 1 11  ? 2.543   -21.304 97.805  1.00 28.74 ? 10  GLN B N   1 
ATOM   4510  C CA  . GLN B 1 11  ? 1.255   -21.642 97.220  1.00 30.96 ? 10  GLN B CA  1 
ATOM   4511  C C   . GLN B 1 11  ? 0.120   -20.922 97.947  1.00 31.29 ? 10  GLN B C   1 
ATOM   4512  O O   . GLN B 1 11  ? -0.869  -20.523 97.329  1.00 31.91 ? 10  GLN B O   1 
ATOM   4513  C CB  . GLN B 1 11  ? 1.041   -23.154 97.271  1.00 32.64 ? 10  GLN B CB  1 
ATOM   4514  C CG  . GLN B 1 11  ? 1.983   -23.930 96.363  1.00 36.14 ? 10  GLN B CG  1 
ATOM   4515  C CD  . GLN B 1 11  ? 1.893   -25.436 96.565  1.00 39.84 ? 10  GLN B CD  1 
ATOM   4516  O OE1 . GLN B 1 11  ? 2.519   -26.208 95.837  1.00 41.21 ? 10  GLN B OE1 1 
ATOM   4517  N NE2 . GLN B 1 11  ? 1.118   -25.859 97.558  1.00 39.76 ? 10  GLN B NE2 1 
ATOM   4518  N N   . LYS B 1 12  ? 0.271   -20.757 99.258  1.00 30.01 ? 11  LYS B N   1 
ATOM   4519  C CA  . LYS B 1 12  ? -0.735  -20.075 100.066 1.00 30.74 ? 11  LYS B CA  1 
ATOM   4520  C C   . LYS B 1 12  ? -0.814  -18.617 99.618  1.00 30.90 ? 11  LYS B C   1 
ATOM   4521  O O   . LYS B 1 12  ? -1.901  -18.073 99.407  1.00 29.41 ? 11  LYS B O   1 
ATOM   4522  C CB  . LYS B 1 12  ? -0.357  -20.150 101.549 1.00 30.63 ? 11  LYS B CB  1 
ATOM   4523  C CG  . LYS B 1 12  ? -1.424  -19.625 102.488 1.00 33.98 ? 11  LYS B CG  1 
ATOM   4524  C CD  . LYS B 1 12  ? -0.908  -19.495 103.921 1.00 36.84 ? 11  LYS B CD  1 
ATOM   4525  C CE  . LYS B 1 12  ? -2.032  -19.110 104.880 1.00 36.32 ? 11  LYS B CE  1 
ATOM   4526  N NZ  . LYS B 1 12  ? -1.548  -18.733 106.236 1.00 37.80 ? 11  LYS B NZ  1 
ATOM   4527  N N   . LEU B 1 13  ? 0.350   -17.990 99.472  1.00 30.62 ? 12  LEU B N   1 
ATOM   4528  C CA  . LEU B 1 13  ? 0.430   -16.599 99.028  1.00 31.23 ? 12  LEU B CA  1 
ATOM   4529  C C   . LEU B 1 13  ? -0.180  -16.438 97.639  1.00 30.81 ? 12  LEU B C   1 
ATOM   4530  O O   . LEU B 1 13  ? -0.973  -15.525 97.390  1.00 29.06 ? 12  LEU B O   1 
ATOM   4531  C CB  . LEU B 1 13  ? 1.889   -16.142 98.986  1.00 31.64 ? 12  LEU B CB  1 
ATOM   4532  C CG  . LEU B 1 13  ? 2.457   -15.505 100.253 1.00 32.64 ? 12  LEU B CG  1 
ATOM   4533  C CD1 . LEU B 1 13  ? 3.976   -15.465 100.176 1.00 34.75 ? 12  LEU B CD1 1 
ATOM   4534  C CD2 . LEU B 1 13  ? 1.886   -14.105 100.410 1.00 31.44 ? 12  LEU B CD2 1 
ATOM   4535  N N   . GLN B 1 14  ? 0.192   -17.338 96.739  1.00 31.31 ? 13  GLN B N   1 
ATOM   4536  C CA  . GLN B 1 14  ? -0.294  -17.293 95.369  1.00 33.84 ? 13  GLN B CA  1 
ATOM   4537  C C   . GLN B 1 14  ? -1.810  -17.449 95.343  1.00 35.62 ? 13  GLN B C   1 
ATOM   4538  O O   . GLN B 1 14  ? -2.497  -16.815 94.539  1.00 34.58 ? 13  GLN B O   1 
ATOM   4539  C CB  . GLN B 1 14  ? 0.384   -18.393 94.554  1.00 36.13 ? 13  GLN B CB  1 
ATOM   4540  C CG  . GLN B 1 14  ? 0.468   -18.110 93.070  1.00 41.53 ? 13  GLN B CG  1 
ATOM   4541  C CD  . GLN B 1 14  ? 1.798   -18.541 92.480  1.00 44.35 ? 13  GLN B CD  1 
ATOM   4542  O OE1 . GLN B 1 14  ? 2.217   -19.687 92.639  1.00 46.69 ? 13  GLN B OE1 1 
ATOM   4543  N NE2 . GLN B 1 14  ? 2.472   -17.618 91.795  1.00 45.91 ? 13  GLN B NE2 1 
ATOM   4544  N N   . GLN B 1 15  ? -2.326  -18.278 96.245  1.00 36.40 ? 14  GLN B N   1 
ATOM   4545  C CA  . GLN B 1 15  ? -3.762  -18.515 96.335  1.00 37.86 ? 14  GLN B CA  1 
ATOM   4546  C C   . GLN B 1 15  ? -4.472  -17.260 96.843  1.00 35.85 ? 14  GLN B C   1 
ATOM   4547  O O   . GLN B 1 15  ? -5.487  -16.842 96.286  1.00 35.86 ? 14  GLN B O   1 
ATOM   4548  C CB  . GLN B 1 15  ? -4.039  -19.689 97.276  1.00 41.61 ? 14  GLN B CB  1 
ATOM   4549  C CG  . GLN B 1 15  ? -5.452  -20.239 97.199  1.00 47.26 ? 14  GLN B CG  1 
ATOM   4550  C CD  . GLN B 1 15  ? -5.663  -21.440 98.112  1.00 51.69 ? 14  GLN B CD  1 
ATOM   4551  O OE1 . GLN B 1 15  ? -6.720  -22.076 98.086  1.00 55.07 ? 14  GLN B OE1 1 
ATOM   4552  N NE2 . GLN B 1 15  ? -4.657  -21.754 98.927  1.00 53.22 ? 14  GLN B NE2 1 
ATOM   4553  N N   . TRP B 1 16  ? -3.934  -16.666 97.903  1.00 33.95 ? 15  TRP B N   1 
ATOM   4554  C CA  . TRP B 1 16  ? -4.506  -15.453 98.480  1.00 33.17 ? 15  TRP B CA  1 
ATOM   4555  C C   . TRP B 1 16  ? -4.528  -14.378 97.400  1.00 32.49 ? 15  TRP B C   1 
ATOM   4556  O O   . TRP B 1 16  ? -5.533  -13.691 97.202  1.00 32.39 ? 15  TRP B O   1 
ATOM   4557  C CB  . TRP B 1 16  ? -3.651  -14.977 99.655  1.00 32.49 ? 15  TRP B CB  1 
ATOM   4558  C CG  . TRP B 1 16  ? -4.284  -13.907 100.510 1.00 32.91 ? 15  TRP B CG  1 
ATOM   4559  C CD1 . TRP B 1 16  ? -4.910  -14.085 101.711 1.00 33.36 ? 15  TRP B CD1 1 
ATOM   4560  C CD2 . TRP B 1 16  ? -4.307  -12.495 100.253 1.00 32.48 ? 15  TRP B CD2 1 
ATOM   4561  N NE1 . TRP B 1 16  ? -5.314  -12.873 102.223 1.00 33.04 ? 15  TRP B NE1 1 
ATOM   4562  C CE2 . TRP B 1 16  ? -4.958  -11.881 101.348 1.00 32.01 ? 15  TRP B CE2 1 
ATOM   4563  C CE3 . TRP B 1 16  ? -3.842  -11.689 99.204  1.00 31.97 ? 15  TRP B CE3 1 
ATOM   4564  C CZ2 . TRP B 1 16  ? -5.156  -10.496 101.426 1.00 32.21 ? 15  TRP B CZ2 1 
ATOM   4565  C CZ3 . TRP B 1 16  ? -4.041  -10.309 99.280  1.00 32.87 ? 15  TRP B CZ3 1 
ATOM   4566  C CH2 . TRP B 1 16  ? -4.693  -9.729  100.386 1.00 31.99 ? 15  TRP B CH2 1 
ATOM   4567  N N   . TYR B 1 17  ? -3.408  -14.240 96.700  1.00 30.99 ? 16  TYR B N   1 
ATOM   4568  C CA  . TYR B 1 17  ? -3.296  -13.255 95.631  1.00 31.06 ? 16  TYR B CA  1 
ATOM   4569  C C   . TYR B 1 17  ? -4.441  -13.392 94.633  1.00 31.51 ? 16  TYR B C   1 
ATOM   4570  O O   . TYR B 1 17  ? -5.105  -12.411 94.297  1.00 29.96 ? 16  TYR B O   1 
ATOM   4571  C CB  . TYR B 1 17  ? -1.954  -13.416 94.904  1.00 29.73 ? 16  TYR B CB  1 
ATOM   4572  C CG  . TYR B 1 17  ? -1.819  -12.568 93.661  1.00 26.68 ? 16  TYR B CG  1 
ATOM   4573  C CD1 . TYR B 1 17  ? -2.013  -13.117 92.394  1.00 27.13 ? 16  TYR B CD1 1 
ATOM   4574  C CD2 . TYR B 1 17  ? -1.513  -11.209 93.750  1.00 26.36 ? 16  TYR B CD2 1 
ATOM   4575  C CE1 . TYR B 1 17  ? -1.906  -12.335 91.245  1.00 27.31 ? 16  TYR B CE1 1 
ATOM   4576  C CE2 . TYR B 1 17  ? -1.404  -10.413 92.606  1.00 24.48 ? 16  TYR B CE2 1 
ATOM   4577  C CZ  . TYR B 1 17  ? -1.601  -10.983 91.360  1.00 26.23 ? 16  TYR B CZ  1 
ATOM   4578  O OH  . TYR B 1 17  ? -1.496  -10.207 90.230  1.00 25.83 ? 16  TYR B OH  1 
ATOM   4579  N N   . ARG B 1 18  ? -4.675  -14.612 94.166  1.00 33.31 ? 17  ARG B N   1 
ATOM   4580  C CA  . ARG B 1 18  ? -5.737  -14.843 93.198  1.00 37.34 ? 17  ARG B CA  1 
ATOM   4581  C C   . ARG B 1 18  ? -7.119  -14.500 93.737  1.00 39.10 ? 17  ARG B C   1 
ATOM   4582  O O   . ARG B 1 18  ? -8.010  -14.126 92.978  1.00 39.68 ? 17  ARG B O   1 
ATOM   4583  C CB  . ARG B 1 18  ? -5.718  -16.299 92.718  1.00 38.16 ? 17  ARG B CB  1 
ATOM   4584  C CG  . ARG B 1 18  ? -4.617  -16.600 91.709  1.00 41.17 ? 17  ARG B CG  1 
ATOM   4585  C CD  . ARG B 1 18  ? -4.850  -17.938 91.019  1.00 42.28 ? 17  ARG B CD  1 
ATOM   4586  N NE  . ARG B 1 18  ? -4.619  -19.076 91.905  1.00 44.23 ? 17  ARG B NE  1 
ATOM   4587  C CZ  . ARG B 1 18  ? -3.428  -19.626 92.123  1.00 44.10 ? 17  ARG B CZ  1 
ATOM   4588  N NH1 . ARG B 1 18  ? -2.348  -19.147 91.517  1.00 43.89 ? 17  ARG B NH1 1 
ATOM   4589  N NH2 . ARG B 1 18  ? -3.316  -20.658 92.948  1.00 43.67 ? 17  ARG B NH2 1 
ATOM   4590  N N   . GLU B 1 19  ? -7.291  -14.607 95.049  1.00 41.61 ? 18  GLU B N   1 
ATOM   4591  C CA  . GLU B 1 19  ? -8.583  -14.328 95.657  1.00 44.44 ? 18  GLU B CA  1 
ATOM   4592  C C   . GLU B 1 19  ? -8.828  -12.870 96.042  1.00 45.30 ? 18  GLU B C   1 
ATOM   4593  O O   . GLU B 1 19  ? -9.931  -12.362 95.846  1.00 45.06 ? 18  GLU B O   1 
ATOM   4594  C CB  . GLU B 1 19  ? -8.771  -15.214 96.889  1.00 46.65 ? 18  GLU B CB  1 
ATOM   4595  C CG  . GLU B 1 19  ? -8.464  -16.681 96.630  1.00 52.23 ? 18  GLU B CG  1 
ATOM   4596  C CD  . GLU B 1 19  ? -8.630  -17.549 97.866  1.00 55.70 ? 18  GLU B CD  1 
ATOM   4597  O OE1 . GLU B 1 19  ? -8.173  -17.135 98.957  1.00 57.27 ? 18  GLU B OE1 1 
ATOM   4598  O OE2 . GLU B 1 19  ? -9.208  -18.652 97.742  1.00 56.39 ? 18  GLU B OE2 1 
ATOM   4599  N N   . HIS B 1 20  ? -7.813  -12.193 96.571  1.00 44.58 ? 19  HIS B N   1 
ATOM   4600  C CA  . HIS B 1 20  ? -7.986  -10.806 97.007  1.00 45.40 ? 19  HIS B CA  1 
ATOM   4601  C C   . HIS B 1 20  ? -7.292  -9.724  96.182  1.00 44.56 ? 19  HIS B C   1 
ATOM   4602  O O   . HIS B 1 20  ? -7.297  -8.559  96.576  1.00 43.24 ? 19  HIS B O   1 
ATOM   4603  C CB  . HIS B 1 20  ? -7.526  -10.656 98.459  1.00 46.82 ? 19  HIS B CB  1 
ATOM   4604  C CG  . HIS B 1 20  ? -8.073  -11.698 99.382  1.00 48.61 ? 19  HIS B CG  1 
ATOM   4605  N ND1 . HIS B 1 20  ? -7.808  -13.041 99.228  1.00 49.85 ? 19  HIS B ND1 1 
ATOM   4606  C CD2 . HIS B 1 20  ? -8.851  -11.592 100.486 1.00 50.78 ? 19  HIS B CD2 1 
ATOM   4607  C CE1 . HIS B 1 20  ? -8.399  -13.719 100.197 1.00 50.83 ? 19  HIS B CE1 1 
ATOM   4608  N NE2 . HIS B 1 20  ? -9.038  -12.863 100.974 1.00 51.57 ? 19  HIS B NE2 1 
ATOM   4609  N N   . ARG B 1 21  ? -6.700  -10.087 95.050  1.00 44.40 ? 20  ARG B N   1 
ATOM   4610  C CA  . ARG B 1 21  ? -6.001  -9.099  94.239  1.00 45.18 ? 20  ARG B CA  1 
ATOM   4611  C C   . ARG B 1 21  ? -6.842  -7.868  93.907  1.00 45.27 ? 20  ARG B C   1 
ATOM   4612  O O   . ARG B 1 21  ? -6.455  -6.742  94.214  1.00 43.36 ? 20  ARG B O   1 
ATOM   4613  C CB  . ARG B 1 21  ? -5.503  -9.712  92.933  1.00 47.27 ? 20  ARG B CB  1 
ATOM   4614  C CG  . ARG B 1 21  ? -4.613  -8.752  92.172  1.00 50.28 ? 20  ARG B CG  1 
ATOM   4615  C CD  . ARG B 1 21  ? -4.389  -9.159  90.738  1.00 52.96 ? 20  ARG B CD  1 
ATOM   4616  N NE  . ARG B 1 21  ? -3.580  -8.158  90.051  1.00 56.30 ? 20  ARG B NE  1 
ATOM   4617  C CZ  . ARG B 1 21  ? -3.309  -8.176  88.752  1.00 58.98 ? 20  ARG B CZ  1 
ATOM   4618  N NH1 . ARG B 1 21  ? -3.786  -9.152  87.987  1.00 59.85 ? 20  ARG B NH1 1 
ATOM   4619  N NH2 . ARG B 1 21  ? -2.565  -7.217  88.218  1.00 59.82 ? 20  ARG B NH2 1 
ATOM   4620  N N   . SER B 1 22  ? -7.988  -8.082  93.272  1.00 46.24 ? 21  SER B N   1 
ATOM   4621  C CA  . SER B 1 22  ? -8.863  -6.977  92.898  1.00 47.30 ? 21  SER B CA  1 
ATOM   4622  C C   . SER B 1 22  ? -9.450  -6.277  94.122  1.00 47.01 ? 21  SER B C   1 
ATOM   4623  O O   . SER B 1 22  ? -10.277 -5.376  94.000  1.00 47.72 ? 21  SER B O   1 
ATOM   4624  C CB  . SER B 1 22  ? -9.989  -7.483  91.986  1.00 48.73 ? 21  SER B CB  1 
ATOM   4625  O OG  . SER B 1 22  ? -10.797 -8.447  92.641  1.00 50.40 ? 21  SER B OG  1 
ATOM   4626  N N   . GLU B 1 23  ? -9.001  -6.693  95.301  1.00 47.60 ? 22  GLU B N   1 
ATOM   4627  C CA  . GLU B 1 23  ? -9.463  -6.133  96.568  1.00 47.32 ? 22  GLU B CA  1 
ATOM   4628  C C   . GLU B 1 23  ? -8.396  -5.229  97.196  1.00 45.87 ? 22  GLU B C   1 
ATOM   4629  O O   . GLU B 1 23  ? -8.636  -4.568  98.211  1.00 45.99 ? 22  GLU B O   1 
ATOM   4630  C CB  . GLU B 1 23  ? -9.797  -7.280  97.524  1.00 49.72 ? 22  GLU B CB  1 
ATOM   4631  C CG  . GLU B 1 23  ? -10.170 -6.867  98.932  1.00 54.05 ? 22  GLU B CG  1 
ATOM   4632  C CD  . GLU B 1 23  ? -10.307 -8.065  99.854  1.00 57.27 ? 22  GLU B CD  1 
ATOM   4633  O OE1 . GLU B 1 23  ? -11.049 -9.006  99.490  1.00 57.62 ? 22  GLU B OE1 1 
ATOM   4634  O OE2 . GLU B 1 23  ? -9.675  -8.066  100.937 1.00 58.59 ? 22  GLU B OE2 1 
ATOM   4635  N N   . LEU B 1 24  ? -7.214  -5.207  96.590  1.00 42.27 ? 23  LEU B N   1 
ATOM   4636  C CA  . LEU B 1 24  ? -6.115  -4.396  97.096  1.00 39.47 ? 23  LEU B CA  1 
ATOM   4637  C C   . LEU B 1 24  ? -6.110  -3.004  96.484  1.00 37.17 ? 23  LEU B C   1 
ATOM   4638  O O   . LEU B 1 24  ? -5.793  -2.834  95.308  1.00 37.26 ? 23  LEU B O   1 
ATOM   4639  C CB  . LEU B 1 24  ? -4.780  -5.088  96.812  1.00 37.98 ? 23  LEU B CB  1 
ATOM   4640  C CG  . LEU B 1 24  ? -4.539  -6.391  97.571  1.00 37.36 ? 23  LEU B CG  1 
ATOM   4641  C CD1 . LEU B 1 24  ? -3.273  -7.057  97.067  1.00 35.64 ? 23  LEU B CD1 1 
ATOM   4642  C CD2 . LEU B 1 24  ? -4.441  -6.096  99.060  1.00 37.64 ? 23  LEU B CD2 1 
ATOM   4643  N N   . ASN B 1 25  ? -6.469  -2.013  97.292  1.00 35.03 ? 24  ASN B N   1 
ATOM   4644  C CA  . ASN B 1 25  ? -6.506  -0.625  96.855  1.00 34.14 ? 24  ASN B CA  1 
ATOM   4645  C C   . ASN B 1 25  ? -5.983  0.256   97.980  1.00 32.60 ? 24  ASN B C   1 
ATOM   4646  O O   . ASN B 1 25  ? -6.534  0.273   99.080  1.00 32.83 ? 24  ASN B O   1 
ATOM   4647  C CB  . ASN B 1 25  ? -7.933  -0.222  96.478  1.00 34.18 ? 24  ASN B CB  1 
ATOM   4648  C CG  . ASN B 1 25  ? -8.048  1.248   96.145  1.00 35.57 ? 24  ASN B CG  1 
ATOM   4649  O OD1 . ASN B 1 25  ? -8.016  2.098   97.034  1.00 34.67 ? 24  ASN B OD1 1 
ATOM   4650  N ND2 . ASN B 1 25  ? -8.168  1.560   94.856  1.00 34.17 ? 24  ASN B ND2 1 
ATOM   4651  N N   . LEU B 1 26  ? -4.914  0.988   97.692  1.00 31.26 ? 25  LEU B N   1 
ATOM   4652  C CA  . LEU B 1 26  ? -4.270  1.850   98.677  1.00 31.88 ? 25  LEU B CA  1 
ATOM   4653  C C   . LEU B 1 26  ? -5.152  2.904   99.347  1.00 32.93 ? 25  LEU B C   1 
ATOM   4654  O O   . LEU B 1 26  ? -5.075  3.079   100.564 1.00 33.67 ? 25  LEU B O   1 
ATOM   4655  C CB  . LEU B 1 26  ? -3.044  2.516   98.049  1.00 29.82 ? 25  LEU B CB  1 
ATOM   4656  C CG  . LEU B 1 26  ? -1.966  1.528   97.594  1.00 29.15 ? 25  LEU B CG  1 
ATOM   4657  C CD1 . LEU B 1 26  ? -0.857  2.257   96.861  1.00 25.76 ? 25  LEU B CD1 1 
ATOM   4658  C CD2 . LEU B 1 26  ? -1.421  0.794   98.806  1.00 28.97 ? 25  LEU B CD2 1 
ATOM   4659  N N   . ARG B 1 27  ? -5.972  3.615   98.578  1.00 34.65 ? 26  ARG B N   1 
ATOM   4660  C CA  . ARG B 1 27  ? -6.844  4.627   99.180  1.00 36.97 ? 26  ARG B CA  1 
ATOM   4661  C C   . ARG B 1 27  ? -7.699  3.987   100.269 1.00 38.22 ? 26  ARG B C   1 
ATOM   4662  O O   . ARG B 1 27  ? -7.742  4.460   101.403 1.00 37.13 ? 26  ARG B O   1 
ATOM   4663  C CB  . ARG B 1 27  ? -7.771  5.265   98.138  1.00 38.15 ? 26  ARG B CB  1 
ATOM   4664  C CG  . ARG B 1 27  ? -7.153  6.357   97.282  1.00 40.92 ? 26  ARG B CG  1 
ATOM   4665  C CD  . ARG B 1 27  ? -8.249  7.311   96.790  1.00 43.60 ? 26  ARG B CD  1 
ATOM   4666  N NE  . ARG B 1 27  ? -7.763  8.288   95.819  1.00 45.85 ? 26  ARG B NE  1 
ATOM   4667  C CZ  . ARG B 1 27  ? -8.495  9.280   95.313  1.00 48.53 ? 26  ARG B CZ  1 
ATOM   4668  N NH1 . ARG B 1 27  ? -9.760  9.442   95.685  1.00 49.35 ? 26  ARG B NH1 1 
ATOM   4669  N NH2 . ARG B 1 27  ? -7.966  10.106  94.418  1.00 47.92 ? 26  ARG B NH2 1 
ATOM   4670  N N   . ARG B 1 28  ? -8.376  2.900   99.916  1.00 40.36 ? 27  ARG B N   1 
ATOM   4671  C CA  . ARG B 1 28  ? -9.229  2.203   100.866 1.00 42.34 ? 27  ARG B CA  1 
ATOM   4672  C C   . ARG B 1 28  ? -8.441  1.643   102.043 1.00 41.69 ? 27  ARG B C   1 
ATOM   4673  O O   . ARG B 1 28  ? -8.847  1.802   103.195 1.00 41.85 ? 27  ARG B O   1 
ATOM   4674  C CB  . ARG B 1 28  ? -10.002 1.084   100.161 1.00 45.36 ? 27  ARG B CB  1 
ATOM   4675  C CG  . ARG B 1 28  ? -11.144 1.587   99.284  1.00 49.00 ? 27  ARG B CG  1 
ATOM   4676  C CD  . ARG B 1 28  ? -11.938 0.430   98.695  1.00 52.44 ? 27  ARG B CD  1 
ATOM   4677  N NE  . ARG B 1 28  ? -11.180 -0.288  97.676  1.00 55.69 ? 27  ARG B NE  1 
ATOM   4678  C CZ  . ARG B 1 28  ? -11.500 -1.493  97.217  1.00 57.46 ? 27  ARG B CZ  1 
ATOM   4679  N NH1 . ARG B 1 28  ? -12.567 -2.122  97.691  1.00 59.73 ? 27  ARG B NH1 1 
ATOM   4680  N NH2 . ARG B 1 28  ? -10.758 -2.069  96.279  1.00 58.31 ? 27  ARG B NH2 1 
ATOM   4681  N N   . LEU B 1 29  ? -7.314  0.996   101.761 1.00 40.51 ? 28  LEU B N   1 
ATOM   4682  C CA  . LEU B 1 29  ? -6.495  0.429   102.827 1.00 38.45 ? 28  LEU B CA  1 
ATOM   4683  C C   . LEU B 1 29  ? -6.136  1.466   103.883 1.00 38.40 ? 28  LEU B C   1 
ATOM   4684  O O   . LEU B 1 29  ? -6.250  1.200   105.082 1.00 38.68 ? 28  LEU B O   1 
ATOM   4685  C CB  . LEU B 1 29  ? -5.215  -0.185  102.257 1.00 37.89 ? 28  LEU B CB  1 
ATOM   4686  C CG  . LEU B 1 29  ? -5.380  -1.467  101.439 1.00 38.50 ? 28  LEU B CG  1 
ATOM   4687  C CD1 . LEU B 1 29  ? -4.024  -1.916  100.919 1.00 38.87 ? 28  LEU B CD1 1 
ATOM   4688  C CD2 . LEU B 1 29  ? -5.998  -2.552  102.303 1.00 38.00 ? 28  LEU B CD2 1 
ATOM   4689  N N   . PHE B 1 30  ? -5.701  2.646   103.450 1.00 37.68 ? 29  PHE B N   1 
ATOM   4690  C CA  . PHE B 1 30  ? -5.345  3.691   104.405 1.00 37.66 ? 29  PHE B CA  1 
ATOM   4691  C C   . PHE B 1 30  ? -6.580  4.251   105.092 1.00 39.21 ? 29  PHE B C   1 
ATOM   4692  O O   . PHE B 1 30  ? -6.608  4.394   106.314 1.00 39.83 ? 29  PHE B O   1 
ATOM   4693  C CB  . PHE B 1 30  ? -4.584  4.834   103.726 1.00 34.69 ? 29  PHE B CB  1 
ATOM   4694  C CG  . PHE B 1 30  ? -3.109  4.582   103.583 1.00 32.31 ? 29  PHE B CG  1 
ATOM   4695  C CD1 . PHE B 1 30  ? -2.611  3.863   102.503 1.00 30.18 ? 29  PHE B CD1 1 
ATOM   4696  C CD2 . PHE B 1 30  ? -2.217  5.058   104.539 1.00 31.40 ? 29  PHE B CD2 1 
ATOM   4697  C CE1 . PHE B 1 30  ? -1.245  3.623   102.376 1.00 30.84 ? 29  PHE B CE1 1 
ATOM   4698  C CE2 . PHE B 1 30  ? -0.847  4.823   104.424 1.00 30.08 ? 29  PHE B CE2 1 
ATOM   4699  C CZ  . PHE B 1 30  ? -0.361  4.105   103.339 1.00 28.74 ? 29  PHE B CZ  1 
ATOM   4700  N N   . ASP B 1 31  ? -7.601  4.564   104.303 1.00 41.40 ? 30  ASP B N   1 
ATOM   4701  C CA  . ASP B 1 31  ? -8.840  5.108   104.843 1.00 43.87 ? 30  ASP B CA  1 
ATOM   4702  C C   . ASP B 1 31  ? -9.447  4.167   105.879 1.00 43.67 ? 30  ASP B C   1 
ATOM   4703  O O   . ASP B 1 31  ? -10.149 4.606   106.790 1.00 43.91 ? 30  ASP B O   1 
ATOM   4704  C CB  . ASP B 1 31  ? -9.836  5.368   103.710 1.00 45.86 ? 30  ASP B CB  1 
ATOM   4705  C CG  . ASP B 1 31  ? -9.445  6.564   102.855 1.00 48.68 ? 30  ASP B CG  1 
ATOM   4706  O OD1 . ASP B 1 31  ? -8.260  6.670   102.472 1.00 52.34 ? 30  ASP B OD1 1 
ATOM   4707  O OD2 . ASP B 1 31  ? -10.324 7.398   102.556 1.00 51.05 ? 30  ASP B OD2 1 
ATOM   4708  N N   . ALA B 1 32  ? -9.148  2.878   105.750 1.00 43.34 ? 31  ALA B N   1 
ATOM   4709  C CA  . ALA B 1 32  ? -9.669  1.873   106.668 1.00 43.19 ? 31  ALA B CA  1 
ATOM   4710  C C   . ALA B 1 32  ? -8.767  1.598   107.873 1.00 43.94 ? 31  ALA B C   1 
ATOM   4711  O O   . ALA B 1 32  ? -9.213  1.012   108.858 1.00 44.59 ? 31  ALA B O   1 
ATOM   4712  C CB  . ALA B 1 32  ? -9.928  0.575   105.914 1.00 41.79 ? 31  ALA B CB  1 
ATOM   4713  N N   . ASN B 1 33  ? -7.504  2.010   107.804 1.00 44.30 ? 32  ASN B N   1 
ATOM   4714  C CA  . ASN B 1 33  ? -6.580  1.771   108.912 1.00 43.89 ? 32  ASN B CA  1 
ATOM   4715  C C   . ASN B 1 33  ? -5.751  3.012   109.245 1.00 44.65 ? 32  ASN B C   1 
ATOM   4716  O O   . ASN B 1 33  ? -4.793  3.340   108.545 1.00 44.49 ? 32  ASN B O   1 
ATOM   4717  C CB  . ASN B 1 33  ? -5.655  0.599   108.571 1.00 43.41 ? 32  ASN B CB  1 
ATOM   4718  C CG  . ASN B 1 33  ? -4.730  0.234   109.713 1.00 41.69 ? 32  ASN B CG  1 
ATOM   4719  O OD1 . ASN B 1 33  ? -4.808  0.808   110.796 1.00 42.78 ? 32  ASN B OD1 1 
ATOM   4720  N ND2 . ASN B 1 33  ? -3.847  -0.728  109.476 1.00 42.75 ? 32  ASN B ND2 1 
ATOM   4721  N N   . LYS B 1 34  ? -6.124  3.693   110.326 1.00 45.07 ? 33  LYS B N   1 
ATOM   4722  C CA  . LYS B 1 34  ? -5.435  4.907   110.757 1.00 44.03 ? 33  LYS B CA  1 
ATOM   4723  C C   . LYS B 1 34  ? -4.014  4.635   111.239 1.00 42.18 ? 33  LYS B C   1 
ATOM   4724  O O   . LYS B 1 34  ? -3.179  5.540   111.278 1.00 41.68 ? 33  LYS B O   1 
ATOM   4725  C CB  . LYS B 1 34  ? -6.240  5.604   111.862 1.00 46.09 ? 33  LYS B CB  1 
ATOM   4726  C CG  . LYS B 1 34  ? -6.619  4.699   113.029 1.00 47.84 ? 33  LYS B CG  1 
ATOM   4727  C CD  . LYS B 1 34  ? -7.451  5.440   114.075 1.00 50.42 ? 33  LYS B CD  1 
ATOM   4728  C CE  . LYS B 1 34  ? -6.615  6.429   114.881 1.00 51.23 ? 33  LYS B CE  1 
ATOM   4729  N NZ  . LYS B 1 34  ? -5.610  5.737   115.743 1.00 52.40 ? 33  LYS B NZ  1 
ATOM   4730  N N   . ASP B 1 35  ? -3.743  3.387   111.605 1.00 39.97 ? 34  ASP B N   1 
ATOM   4731  C CA  . ASP B 1 35  ? -2.416  3.003   112.072 1.00 38.24 ? 34  ASP B CA  1 
ATOM   4732  C C   . ASP B 1 35  ? -1.620  2.292   110.996 1.00 34.62 ? 34  ASP B C   1 
ATOM   4733  O O   . ASP B 1 35  ? -0.612  1.659   111.301 1.00 35.06 ? 34  ASP B O   1 
ATOM   4734  C CB  . ASP B 1 35  ? -2.511  2.076   113.284 1.00 42.24 ? 34  ASP B CB  1 
ATOM   4735  C CG  . ASP B 1 35  ? -2.781  2.824   114.569 1.00 46.31 ? 34  ASP B CG  1 
ATOM   4736  O OD1 . ASP B 1 35  ? -1.961  3.701   114.925 1.00 47.21 ? 34  ASP B OD1 1 
ATOM   4737  O OD2 . ASP B 1 35  ? -3.808  2.531   115.221 1.00 47.59 ? 34  ASP B OD2 1 
ATOM   4738  N N   . ARG B 1 36  ? -2.059  2.395   109.744 1.00 30.82 ? 35  ARG B N   1 
ATOM   4739  C CA  . ARG B 1 36  ? -1.362  1.719   108.658 1.00 27.92 ? 35  ARG B CA  1 
ATOM   4740  C C   . ARG B 1 36  ? 0.112   2.096   108.564 1.00 27.39 ? 35  ARG B C   1 
ATOM   4741  O O   . ARG B 1 36  ? 0.955   1.244   108.284 1.00 28.64 ? 35  ARG B O   1 
ATOM   4742  C CB  . ARG B 1 36  ? -2.045  1.973   107.312 1.00 27.07 ? 35  ARG B CB  1 
ATOM   4743  C CG  . ARG B 1 36  ? -1.447  1.120   106.201 1.00 24.42 ? 35  ARG B CG  1 
ATOM   4744  C CD  . ARG B 1 36  ? -2.173  1.251   104.883 1.00 24.54 ? 35  ARG B CD  1 
ATOM   4745  N NE  . ARG B 1 36  ? -1.475  0.517   103.827 1.00 24.73 ? 35  ARG B NE  1 
ATOM   4746  C CZ  . ARG B 1 36  ? -1.417  -0.809  103.730 1.00 21.28 ? 35  ARG B CZ  1 
ATOM   4747  N NH1 . ARG B 1 36  ? -2.024  -1.574  104.622 1.00 20.90 ? 35  ARG B NH1 1 
ATOM   4748  N NH2 . ARG B 1 36  ? -0.733  -1.371  102.741 1.00 20.33 ? 35  ARG B NH2 1 
ATOM   4749  N N   . PHE B 1 37  ? 0.432   3.362   108.801 1.00 24.44 ? 36  PHE B N   1 
ATOM   4750  C CA  . PHE B 1 37  ? 1.822   3.781   108.740 1.00 24.58 ? 36  PHE B CA  1 
ATOM   4751  C C   . PHE B 1 37  ? 2.611   3.135   109.867 1.00 24.21 ? 36  PHE B C   1 
ATOM   4752  O O   . PHE B 1 37  ? 3.719   2.646   109.656 1.00 24.42 ? 36  PHE B O   1 
ATOM   4753  C CB  . PHE B 1 37  ? 1.946   5.301   108.854 1.00 24.43 ? 36  PHE B CB  1 
ATOM   4754  C CG  . PHE B 1 37  ? 3.359   5.775   109.031 1.00 21.14 ? 36  PHE B CG  1 
ATOM   4755  C CD1 . PHE B 1 37  ? 4.265   5.724   107.975 1.00 22.38 ? 36  PHE B CD1 1 
ATOM   4756  C CD2 . PHE B 1 37  ? 3.792   6.256   110.264 1.00 22.99 ? 36  PHE B CD2 1 
ATOM   4757  C CE1 . PHE B 1 37  ? 5.592   6.149   108.145 1.00 22.47 ? 36  PHE B CE1 1 
ATOM   4758  C CE2 . PHE B 1 37  ? 5.115   6.681   110.446 1.00 21.06 ? 36  PHE B CE2 1 
ATOM   4759  C CZ  . PHE B 1 37  ? 6.015   6.628   109.385 1.00 21.34 ? 36  PHE B CZ  1 
ATOM   4760  N N   . ASN B 1 38  ? 2.041   3.147   111.068 1.00 24.54 ? 37  ASN B N   1 
ATOM   4761  C CA  . ASN B 1 38  ? 2.703   2.557   112.225 1.00 25.55 ? 37  ASN B CA  1 
ATOM   4762  C C   . ASN B 1 38  ? 2.861   1.050   112.080 1.00 23.76 ? 37  ASN B C   1 
ATOM   4763  O O   . ASN B 1 38  ? 3.851   0.486   112.520 1.00 23.36 ? 37  ASN B O   1 
ATOM   4764  C CB  . ASN B 1 38  ? 1.927   2.868   113.508 1.00 29.12 ? 37  ASN B CB  1 
ATOM   4765  C CG  . ASN B 1 38  ? 1.828   4.358   113.777 1.00 33.87 ? 37  ASN B CG  1 
ATOM   4766  O OD1 . ASN B 1 38  ? 2.766   5.106   113.507 1.00 36.45 ? 37  ASN B OD1 1 
ATOM   4767  N ND2 . ASN B 1 38  ? 0.696   4.795   114.322 1.00 35.57 ? 37  ASN B ND2 1 
ATOM   4768  N N   . HIS B 1 39  ? 1.885   0.407   111.453 1.00 23.75 ? 38  HIS B N   1 
ATOM   4769  C CA  . HIS B 1 39  ? 1.920   -1.038  111.260 1.00 26.57 ? 38  HIS B CA  1 
ATOM   4770  C C   . HIS B 1 39  ? 2.857   -1.472  110.140 1.00 26.32 ? 38  HIS B C   1 
ATOM   4771  O O   . HIS B 1 39  ? 3.419   -2.564  110.193 1.00 26.14 ? 38  HIS B O   1 
ATOM   4772  C CB  . HIS B 1 39  ? 0.517   -1.563  110.947 1.00 29.87 ? 38  HIS B CB  1 
ATOM   4773  C CG  . HIS B 1 39  ? -0.437  -1.480  112.096 1.00 33.00 ? 38  HIS B CG  1 
ATOM   4774  N ND1 . HIS B 1 39  ? -1.795  -1.673  111.948 1.00 33.72 ? 38  HIS B ND1 1 
ATOM   4775  C CD2 . HIS B 1 39  ? -0.231  -1.244  113.415 1.00 34.44 ? 38  HIS B CD2 1 
ATOM   4776  C CE1 . HIS B 1 39  ? -2.383  -1.561  113.125 1.00 34.61 ? 38  HIS B CE1 1 
ATOM   4777  N NE2 . HIS B 1 39  ? -1.457  -1.301  114.032 1.00 36.45 ? 38  HIS B NE2 1 
ATOM   4778  N N   . PHE B 1 40  ? 3.032   -0.623  109.129 1.00 25.42 ? 39  PHE B N   1 
ATOM   4779  C CA  . PHE B 1 40  ? 3.884   -0.990  108.004 1.00 24.32 ? 39  PHE B CA  1 
ATOM   4780  C C   . PHE B 1 40  ? 5.089   -0.085  107.732 1.00 24.55 ? 39  PHE B C   1 
ATOM   4781  O O   . PHE B 1 40  ? 5.319   0.336   106.592 1.00 22.73 ? 39  PHE B O   1 
ATOM   4782  C CB  . PHE B 1 40  ? 3.027   -1.124  106.739 1.00 25.99 ? 39  PHE B CB  1 
ATOM   4783  C CG  . PHE B 1 40  ? 1.875   -2.079  106.888 1.00 28.44 ? 39  PHE B CG  1 
ATOM   4784  C CD1 . PHE B 1 40  ? 0.697   -1.681  107.509 1.00 30.75 ? 39  PHE B CD1 1 
ATOM   4785  C CD2 . PHE B 1 40  ? 1.978   -3.390  106.434 1.00 30.17 ? 39  PHE B CD2 1 
ATOM   4786  C CE1 . PHE B 1 40  ? -0.367  -2.580  107.677 1.00 31.84 ? 39  PHE B CE1 1 
ATOM   4787  C CE2 . PHE B 1 40  ? 0.923   -4.294  106.597 1.00 30.26 ? 39  PHE B CE2 1 
ATOM   4788  C CZ  . PHE B 1 40  ? -0.250  -3.887  107.220 1.00 29.67 ? 39  PHE B CZ  1 
ATOM   4789  N N   . SER B 1 41  ? 5.861   0.194   108.781 1.00 23.19 ? 40  SER B N   1 
ATOM   4790  C CA  . SER B 1 41  ? 7.062   1.014   108.669 1.00 21.97 ? 40  SER B CA  1 
ATOM   4791  C C   . SER B 1 41  ? 8.023   0.635   109.790 1.00 23.05 ? 40  SER B C   1 
ATOM   4792  O O   . SER B 1 41  ? 7.595   0.230   110.870 1.00 23.26 ? 40  SER B O   1 
ATOM   4793  C CB  . SER B 1 41  ? 6.715   2.498   108.778 1.00 20.96 ? 40  SER B CB  1 
ATOM   4794  O OG  . SER B 1 41  ? 6.216   2.802   110.068 1.00 21.54 ? 40  SER B OG  1 
ATOM   4795  N N   . LEU B 1 42  ? 9.319   0.761   109.522 1.00 22.64 ? 41  LEU B N   1 
ATOM   4796  C CA  . LEU B 1 42  ? 10.363  0.442   110.496 1.00 23.16 ? 41  LEU B CA  1 
ATOM   4797  C C   . LEU B 1 42  ? 11.274  1.643   110.690 1.00 21.64 ? 41  LEU B C   1 
ATOM   4798  O O   . LEU B 1 42  ? 11.643  2.310   109.727 1.00 18.98 ? 41  LEU B O   1 
ATOM   4799  C CB  . LEU B 1 42  ? 11.243  -0.713  110.012 1.00 25.28 ? 41  LEU B CB  1 
ATOM   4800  C CG  . LEU B 1 42  ? 10.756  -2.159  109.968 1.00 30.13 ? 41  LEU B CG  1 
ATOM   4801  C CD1 . LEU B 1 42  ? 11.879  -3.022  109.402 1.00 30.09 ? 41  LEU B CD1 1 
ATOM   4802  C CD2 . LEU B 1 42  ? 10.381  -2.635  111.367 1.00 30.61 ? 41  LEU B CD2 1 
ATOM   4803  N N   . THR B 1 43  ? 11.637  1.920   111.934 1.00 21.68 ? 42  THR B N   1 
ATOM   4804  C CA  . THR B 1 43  ? 12.547  3.025   112.204 1.00 24.09 ? 42  THR B CA  1 
ATOM   4805  C C   . THR B 1 43  ? 13.772  2.428   112.882 1.00 23.63 ? 42  THR B C   1 
ATOM   4806  O O   . THR B 1 43  ? 13.682  1.875   113.975 1.00 24.72 ? 42  THR B O   1 
ATOM   4807  C CB  . THR B 1 43  ? 11.905  4.095   113.110 1.00 24.42 ? 42  THR B CB  1 
ATOM   4808  O OG1 . THR B 1 43  ? 11.494  3.500   114.346 1.00 31.17 ? 42  THR B OG1 1 
ATOM   4809  C CG2 . THR B 1 43  ? 10.701  4.708   112.426 1.00 23.13 ? 42  THR B CG2 1 
ATOM   4810  N N   . LEU B 1 44  ? 14.911  2.513   112.209 1.00 21.64 ? 43  LEU B N   1 
ATOM   4811  C CA  . LEU B 1 44  ? 16.142  1.967   112.747 1.00 21.97 ? 43  LEU B CA  1 
ATOM   4812  C C   . LEU B 1 44  ? 17.036  3.098   113.245 1.00 23.02 ? 43  LEU B C   1 
ATOM   4813  O O   . LEU B 1 44  ? 17.233  4.097   112.550 1.00 22.36 ? 43  LEU B O   1 
ATOM   4814  C CB  . LEU B 1 44  ? 16.884  1.176   111.666 1.00 21.06 ? 43  LEU B CB  1 
ATOM   4815  C CG  . LEU B 1 44  ? 16.101  0.181   110.796 1.00 24.83 ? 43  LEU B CG  1 
ATOM   4816  C CD1 . LEU B 1 44  ? 17.066  -0.542  109.868 1.00 23.34 ? 43  LEU B CD1 1 
ATOM   4817  C CD2 . LEU B 1 44  ? 15.361  -0.821  111.672 1.00 24.50 ? 43  LEU B CD2 1 
ATOM   4818  N N   . ASN B 1 45  ? 17.565  2.945   114.454 1.00 20.97 ? 44  ASN B N   1 
ATOM   4819  C CA  . ASN B 1 45  ? 18.464  3.942   115.016 1.00 19.50 ? 44  ASN B CA  1 
ATOM   4820  C C   . ASN B 1 45  ? 19.845  3.294   114.988 1.00 19.61 ? 44  ASN B C   1 
ATOM   4821  O O   . ASN B 1 45  ? 20.147  2.416   115.797 1.00 18.35 ? 44  ASN B O   1 
ATOM   4822  C CB  . ASN B 1 45  ? 18.061  4.299   116.455 1.00 18.89 ? 44  ASN B CB  1 
ATOM   4823  C CG  . ASN B 1 45  ? 18.988  5.334   117.082 1.00 21.25 ? 44  ASN B CG  1 
ATOM   4824  O OD1 . ASN B 1 45  ? 18.843  5.689   118.255 1.00 23.86 ? 44  ASN B OD1 1 
ATOM   4825  N ND2 . ASN B 1 45  ? 19.945  5.825   116.300 1.00 19.63 ? 44  ASN B ND2 1 
ATOM   4826  N N   . THR B 1 46  ? 20.667  3.715   114.032 1.00 20.11 ? 45  THR B N   1 
ATOM   4827  C CA  . THR B 1 46  ? 22.011  3.169   113.867 1.00 20.84 ? 45  THR B CA  1 
ATOM   4828  C C   . THR B 1 46  ? 22.995  3.815   114.831 1.00 21.85 ? 45  THR B C   1 
ATOM   4829  O O   . THR B 1 46  ? 24.150  3.395   114.913 1.00 22.54 ? 45  THR B O   1 
ATOM   4830  C CB  . THR B 1 46  ? 22.548  3.418   112.441 1.00 21.51 ? 45  THR B CB  1 
ATOM   4831  O OG1 . THR B 1 46  ? 22.875  4.806   112.292 1.00 21.69 ? 45  THR B OG1 1 
ATOM   4832  C CG2 . THR B 1 46  ? 21.508  3.038   111.397 1.00 21.80 ? 45  THR B CG2 1 
ATOM   4833  N N   . ASN B 1 47  ? 22.523  4.829   115.554 1.00 20.12 ? 46  ASN B N   1 
ATOM   4834  C CA  . ASN B 1 47  ? 23.335  5.604   116.495 1.00 19.89 ? 46  ASN B CA  1 
ATOM   4835  C C   . ASN B 1 47  ? 24.176  6.640   115.752 1.00 18.44 ? 46  ASN B C   1 
ATOM   4836  O O   . ASN B 1 47  ? 24.878  7.436   116.363 1.00 18.01 ? 46  ASN B O   1 
ATOM   4837  C CB  . ASN B 1 47  ? 24.239  4.713   117.355 1.00 20.83 ? 46  ASN B CB  1 
ATOM   4838  C CG  . ASN B 1 47  ? 23.486  4.063   118.506 1.00 23.71 ? 46  ASN B CG  1 
ATOM   4839  O OD1 . ASN B 1 47  ? 22.542  4.645   119.048 1.00 22.83 ? 46  ASN B OD1 1 
ATOM   4840  N ND2 . ASN B 1 47  ? 23.908  2.860   118.894 1.00 22.92 ? 46  ASN B ND2 1 
ATOM   4841  N N   . HIS B 1 48  ? 24.095  6.618   114.425 1.00 19.62 ? 47  HIS B N   1 
ATOM   4842  C CA  . HIS B 1 48  ? 24.803  7.575   113.572 1.00 19.31 ? 47  HIS B CA  1 
ATOM   4843  C C   . HIS B 1 48  ? 23.788  8.053   112.535 1.00 18.26 ? 47  HIS B C   1 
ATOM   4844  O O   . HIS B 1 48  ? 24.119  8.333   111.384 1.00 17.08 ? 47  HIS B O   1 
ATOM   4845  C CB  . HIS B 1 48  ? 25.994  6.905   112.883 1.00 20.47 ? 47  HIS B CB  1 
ATOM   4846  C CG  . HIS B 1 48  ? 27.080  6.499   113.827 1.00 25.04 ? 47  HIS B CG  1 
ATOM   4847  N ND1 . HIS B 1 48  ? 28.006  7.391   114.324 1.00 27.42 ? 47  HIS B ND1 1 
ATOM   4848  C CD2 . HIS B 1 48  ? 27.368  5.303   114.396 1.00 26.48 ? 47  HIS B CD2 1 
ATOM   4849  C CE1 . HIS B 1 48  ? 28.819  6.763   115.155 1.00 29.37 ? 47  HIS B CE1 1 
ATOM   4850  N NE2 . HIS B 1 48  ? 28.454  5.494   115.216 1.00 28.45 ? 47  HIS B NE2 1 
ATOM   4851  N N   . GLY B 1 49  ? 22.539  8.140   112.968 1.00 17.41 ? 48  GLY B N   1 
ATOM   4852  C CA  . GLY B 1 49  ? 21.474  8.565   112.086 1.00 18.49 ? 48  GLY B CA  1 
ATOM   4853  C C   . GLY B 1 49  ? 20.364  7.531   112.066 1.00 20.14 ? 48  GLY B C   1 
ATOM   4854  O O   . GLY B 1 49  ? 20.602  6.333   112.255 1.00 19.35 ? 48  GLY B O   1 
ATOM   4855  N N   . HIS B 1 50  ? 19.144  7.997   111.846 1.00 19.44 ? 49  HIS B N   1 
ATOM   4856  C CA  . HIS B 1 50  ? 17.988  7.120   111.800 1.00 20.32 ? 49  HIS B CA  1 
ATOM   4857  C C   . HIS B 1 50  ? 17.607  6.773   110.362 1.00 21.20 ? 49  HIS B C   1 
ATOM   4858  O O   . HIS B 1 50  ? 17.903  7.518   109.424 1.00 19.77 ? 49  HIS B O   1 
ATOM   4859  C CB  . HIS B 1 50  ? 16.799  7.790   112.494 1.00 21.17 ? 49  HIS B CB  1 
ATOM   4860  C CG  . HIS B 1 50  ? 16.913  7.835   113.987 1.00 22.13 ? 49  HIS B CG  1 
ATOM   4861  N ND1 . HIS B 1 50  ? 16.074  7.125   114.819 1.00 22.60 ? 49  HIS B ND1 1 
ATOM   4862  C CD2 . HIS B 1 50  ? 17.768  8.503   114.795 1.00 22.02 ? 49  HIS B CD2 1 
ATOM   4863  C CE1 . HIS B 1 50  ? 16.407  7.355   116.076 1.00 20.95 ? 49  HIS B CE1 1 
ATOM   4864  N NE2 . HIS B 1 50  ? 17.431  8.188   116.090 1.00 23.75 ? 49  HIS B NE2 1 
ATOM   4865  N N   . ILE B 1 51  ? 16.968  5.621   110.198 1.00 20.19 ? 50  ILE B N   1 
ATOM   4866  C CA  . ILE B 1 51  ? 16.513  5.182   108.889 1.00 19.49 ? 50  ILE B CA  1 
ATOM   4867  C C   . ILE B 1 51  ? 15.049  4.790   109.019 1.00 18.73 ? 50  ILE B C   1 
ATOM   4868  O O   . ILE B 1 51  ? 14.706  3.895   109.789 1.00 19.06 ? 50  ILE B O   1 
ATOM   4869  C CB  . ILE B 1 51  ? 17.269  3.937   108.385 1.00 19.62 ? 50  ILE B CB  1 
ATOM   4870  C CG1 . ILE B 1 51  ? 18.770  4.211   108.301 1.00 18.98 ? 50  ILE B CG1 1 
ATOM   4871  C CG2 . ILE B 1 51  ? 16.730  3.531   107.017 1.00 19.07 ? 50  ILE B CG2 1 
ATOM   4872  C CD1 . ILE B 1 51  ? 19.586  2.960   108.014 1.00 17.85 ? 50  ILE B CD1 1 
ATOM   4873  N N   . LEU B 1 52  ? 14.186  5.464   108.274 1.00 18.82 ? 51  LEU B N   1 
ATOM   4874  C CA  . LEU B 1 52  ? 12.771  5.144   108.292 1.00 16.72 ? 51  LEU B CA  1 
ATOM   4875  C C   . LEU B 1 52  ? 12.477  4.404   106.998 1.00 19.04 ? 51  LEU B C   1 
ATOM   4876  O O   . LEU B 1 52  ? 12.621  4.964   105.910 1.00 17.67 ? 51  LEU B O   1 
ATOM   4877  C CB  . LEU B 1 52  ? 11.922  6.421   108.374 1.00 18.17 ? 51  LEU B CB  1 
ATOM   4878  C CG  . LEU B 1 52  ? 10.423  6.300   108.047 1.00 17.92 ? 51  LEU B CG  1 
ATOM   4879  C CD1 . LEU B 1 52  ? 9.765   5.266   108.938 1.00 14.56 ? 51  LEU B CD1 1 
ATOM   4880  C CD2 . LEU B 1 52  ? 9.751   7.660   108.227 1.00 15.79 ? 51  LEU B CD2 1 
ATOM   4881  N N   . VAL B 1 53  ? 12.113  3.130   107.123 1.00 19.38 ? 52  VAL B N   1 
ATOM   4882  C CA  . VAL B 1 53  ? 11.767  2.302   105.975 1.00 18.62 ? 52  VAL B CA  1 
ATOM   4883  C C   . VAL B 1 53  ? 10.236  2.191   105.997 1.00 18.62 ? 52  VAL B C   1 
ATOM   4884  O O   . VAL B 1 53  ? 9.673   1.355   106.699 1.00 18.42 ? 52  VAL B O   1 
ATOM   4885  C CB  . VAL B 1 53  ? 12.394  0.886   106.086 1.00 17.42 ? 52  VAL B CB  1 
ATOM   4886  C CG1 . VAL B 1 53  ? 12.027  0.056   104.867 1.00 17.00 ? 52  VAL B CG1 1 
ATOM   4887  C CG2 . VAL B 1 53  ? 13.916  0.991   106.217 1.00 17.90 ? 52  VAL B CG2 1 
ATOM   4888  N N   . ASP B 1 54  ? 9.574   3.056   105.236 1.00 18.85 ? 53  ASP B N   1 
ATOM   4889  C CA  . ASP B 1 54  ? 8.111   3.085   105.171 1.00 19.08 ? 53  ASP B CA  1 
ATOM   4890  C C   . ASP B 1 54  ? 7.586   2.262   104.004 1.00 19.40 ? 53  ASP B C   1 
ATOM   4891  O O   . ASP B 1 54  ? 7.648   2.695   102.852 1.00 19.73 ? 53  ASP B O   1 
ATOM   4892  C CB  . ASP B 1 54  ? 7.631   4.536   105.034 1.00 18.03 ? 53  ASP B CB  1 
ATOM   4893  C CG  . ASP B 1 54  ? 6.119   4.660   104.949 1.00 19.45 ? 53  ASP B CG  1 
ATOM   4894  O OD1 . ASP B 1 54  ? 5.411   3.630   104.989 1.00 18.05 ? 53  ASP B OD1 1 
ATOM   4895  O OD2 . ASP B 1 54  ? 5.638   5.807   104.840 1.00 18.73 ? 53  ASP B OD2 1 
ATOM   4896  N N   . TYR B 1 55  ? 7.061   1.079   104.302 1.00 17.59 ? 54  TYR B N   1 
ATOM   4897  C CA  . TYR B 1 55  ? 6.525   0.222   103.256 1.00 18.12 ? 54  TYR B CA  1 
ATOM   4898  C C   . TYR B 1 55  ? 5.006   0.167   103.300 1.00 18.07 ? 54  TYR B C   1 
ATOM   4899  O O   . TYR B 1 55  ? 4.401   -0.789  102.817 1.00 17.17 ? 54  TYR B O   1 
ATOM   4900  C CB  . TYR B 1 55  ? 7.124   -1.192  103.362 1.00 17.35 ? 54  TYR B CB  1 
ATOM   4901  C CG  . TYR B 1 55  ? 6.928   -1.895  104.694 1.00 20.25 ? 54  TYR B CG  1 
ATOM   4902  C CD1 . TYR B 1 55  ? 5.887   -2.810  104.879 1.00 19.61 ? 54  TYR B CD1 1 
ATOM   4903  C CD2 . TYR B 1 55  ? 7.785   -1.647  105.770 1.00 21.51 ? 54  TYR B CD2 1 
ATOM   4904  C CE1 . TYR B 1 55  ? 5.704   -3.457  106.097 1.00 22.92 ? 54  TYR B CE1 1 
ATOM   4905  C CE2 . TYR B 1 55  ? 7.608   -2.290  106.997 1.00 23.28 ? 54  TYR B CE2 1 
ATOM   4906  C CZ  . TYR B 1 55  ? 6.564   -3.192  107.151 1.00 24.28 ? 54  TYR B CZ  1 
ATOM   4907  O OH  . TYR B 1 55  ? 6.373   -3.823  108.359 1.00 28.14 ? 54  TYR B OH  1 
ATOM   4908  N N   . SER B 1 56  ? 4.391   1.217   103.845 1.00 18.87 ? 55  SER B N   1 
ATOM   4909  C CA  . SER B 1 56  ? 2.936   1.267   103.973 1.00 19.87 ? 55  SER B CA  1 
ATOM   4910  C C   . SER B 1 56  ? 2.185   1.544   102.676 1.00 20.60 ? 55  SER B C   1 
ATOM   4911  O O   . SER B 1 56  ? 0.997   1.227   102.564 1.00 20.21 ? 55  SER B O   1 
ATOM   4912  C CB  . SER B 1 56  ? 2.521   2.294   105.046 1.00 20.98 ? 55  SER B CB  1 
ATOM   4913  O OG  . SER B 1 56  ? 2.862   3.625   104.688 1.00 19.86 ? 55  SER B OG  1 
ATOM   4914  N N   . LYS B 1 57  ? 2.861   2.138   101.697 1.00 19.71 ? 56  LYS B N   1 
ATOM   4915  C CA  . LYS B 1 57  ? 2.213   2.421   100.424 1.00 17.87 ? 56  LYS B CA  1 
ATOM   4916  C C   . LYS B 1 57  ? 2.343   1.230   99.484  1.00 18.51 ? 56  LYS B C   1 
ATOM   4917  O O   . LYS B 1 57  ? 2.450   1.395   98.272  1.00 19.22 ? 56  LYS B O   1 
ATOM   4918  C CB  . LYS B 1 57  ? 2.807   3.671   99.759  1.00 18.08 ? 56  LYS B CB  1 
ATOM   4919  C CG  . LYS B 1 57  ? 2.588   4.980   100.535 1.00 17.18 ? 56  LYS B CG  1 
ATOM   4920  C CD  . LYS B 1 57  ? 2.708   6.192   99.604  1.00 16.28 ? 56  LYS B CD  1 
ATOM   4921  C CE  . LYS B 1 57  ? 2.624   7.507   100.359 1.00 15.57 ? 56  LYS B CE  1 
ATOM   4922  N NZ  . LYS B 1 57  ? 3.872   7.740   101.143 1.00 16.87 ? 56  LYS B NZ  1 
ATOM   4923  N N   . ASN B 1 58  ? 2.336   0.028   100.055 1.00 19.57 ? 57  ASN B N   1 
ATOM   4924  C CA  . ASN B 1 58  ? 2.429   -1.202  99.273  1.00 19.29 ? 57  ASN B CA  1 
ATOM   4925  C C   . ASN B 1 58  ? 1.089   -1.936  99.279  1.00 18.95 ? 57  ASN B C   1 
ATOM   4926  O O   . ASN B 1 58  ? 0.316   -1.827  100.232 1.00 19.33 ? 57  ASN B O   1 
ATOM   4927  C CB  . ASN B 1 58  ? 3.520   -2.114  99.841  1.00 18.78 ? 57  ASN B CB  1 
ATOM   4928  C CG  . ASN B 1 58  ? 4.915   -1.681  99.430  1.00 19.79 ? 57  ASN B CG  1 
ATOM   4929  O OD1 . ASN B 1 58  ? 5.269   -1.748  98.258  1.00 22.33 ? 57  ASN B OD1 1 
ATOM   4930  N ND2 . ASN B 1 58  ? 5.711   -1.235  100.393 1.00 18.64 ? 57  ASN B ND2 1 
ATOM   4931  N N   . LEU B 1 59  ? 0.810   -2.664  98.201  1.00 20.83 ? 58  LEU B N   1 
ATOM   4932  C CA  . LEU B 1 59  ? -0.427  -3.428  98.085  1.00 22.82 ? 58  LEU B CA  1 
ATOM   4933  C C   . LEU B 1 59  ? -0.313  -4.652  98.990  1.00 23.59 ? 58  LEU B C   1 
ATOM   4934  O O   . LEU B 1 59  ? -0.249  -5.789  98.518  1.00 22.82 ? 58  LEU B O   1 
ATOM   4935  C CB  . LEU B 1 59  ? -0.650  -3.878  96.632  1.00 26.36 ? 58  LEU B CB  1 
ATOM   4936  C CG  . LEU B 1 59  ? -1.133  -2.876  95.575  1.00 28.94 ? 58  LEU B CG  1 
ATOM   4937  C CD1 . LEU B 1 59  ? -2.519  -2.363  95.947  1.00 31.35 ? 58  LEU B CD1 1 
ATOM   4938  C CD2 . LEU B 1 59  ? -0.163  -1.732  95.460  1.00 32.16 ? 58  LEU B CD2 1 
ATOM   4939  N N   . VAL B 1 60  ? -0.292  -4.416  100.296 1.00 22.72 ? 59  VAL B N   1 
ATOM   4940  C CA  . VAL B 1 60  ? -0.164  -5.509  101.243 1.00 25.10 ? 59  VAL B CA  1 
ATOM   4941  C C   . VAL B 1 60  ? -1.005  -5.256  102.494 1.00 24.39 ? 59  VAL B C   1 
ATOM   4942  O O   . VAL B 1 60  ? -1.358  -4.114  102.789 1.00 22.79 ? 59  VAL B O   1 
ATOM   4943  C CB  . VAL B 1 60  ? 1.319   -5.684  101.656 1.00 26.00 ? 59  VAL B CB  1 
ATOM   4944  C CG1 . VAL B 1 60  ? 1.780   -4.480  102.464 1.00 25.88 ? 59  VAL B CG1 1 
ATOM   4945  C CG2 . VAL B 1 60  ? 1.488   -6.938  102.461 1.00 29.74 ? 59  VAL B CG2 1 
ATOM   4946  N N   . THR B 1 61  ? -1.333  -6.329  103.213 1.00 24.02 ? 60  THR B N   1 
ATOM   4947  C CA  . THR B 1 61  ? -2.108  -6.237  104.451 1.00 23.64 ? 60  THR B CA  1 
ATOM   4948  C C   . THR B 1 61  ? -1.374  -7.041  105.515 1.00 24.28 ? 60  THR B C   1 
ATOM   4949  O O   . THR B 1 61  ? -0.327  -7.634  105.232 1.00 22.80 ? 60  THR B O   1 
ATOM   4950  C CB  . THR B 1 61  ? -3.521  -6.831  104.300 1.00 25.13 ? 60  THR B CB  1 
ATOM   4951  O OG1 . THR B 1 61  ? -3.426  -8.238  104.047 1.00 26.03 ? 60  THR B OG1 1 
ATOM   4952  C CG2 . THR B 1 61  ? -4.266  -6.157  103.161 1.00 23.01 ? 60  THR B CG2 1 
ATOM   4953  N N   . GLU B 1 62  ? -1.909  -7.063  106.735 1.00 23.64 ? 61  GLU B N   1 
ATOM   4954  C CA  . GLU B 1 62  ? -1.273  -7.814  107.815 1.00 25.73 ? 61  GLU B CA  1 
ATOM   4955  C C   . GLU B 1 62  ? -1.115  -9.281  107.409 1.00 24.52 ? 61  GLU B C   1 
ATOM   4956  O O   . GLU B 1 62  ? -0.069  -9.881  107.636 1.00 22.78 ? 61  GLU B O   1 
ATOM   4957  C CB  . GLU B 1 62  ? -2.108  -7.736  109.097 1.00 30.43 ? 61  GLU B CB  1 
ATOM   4958  C CG  . GLU B 1 62  ? -2.510  -6.321  109.516 1.00 38.31 ? 61  GLU B CG  1 
ATOM   4959  C CD  . GLU B 1 62  ? -1.373  -5.505  110.127 1.00 41.86 ? 61  GLU B CD  1 
ATOM   4960  O OE1 . GLU B 1 62  ? -1.618  -4.326  110.475 1.00 43.78 ? 61  GLU B OE1 1 
ATOM   4961  O OE2 . GLU B 1 62  ? -0.248  -6.034  110.267 1.00 44.99 ? 61  GLU B OE2 1 
ATOM   4962  N N   . ASP B 1 63  ? -2.154  -9.857  106.808 1.00 24.03 ? 62  ASP B N   1 
ATOM   4963  C CA  . ASP B 1 63  ? -2.084  -11.253 106.388 1.00 25.12 ? 62  ASP B CA  1 
ATOM   4964  C C   . ASP B 1 63  ? -0.970  -11.496 105.380 1.00 23.87 ? 62  ASP B C   1 
ATOM   4965  O O   . ASP B 1 63  ? -0.164  -12.409 105.551 1.00 24.06 ? 62  ASP B O   1 
ATOM   4966  C CB  . ASP B 1 63  ? -3.417  -11.719 105.796 1.00 26.95 ? 62  ASP B CB  1 
ATOM   4967  C CG  . ASP B 1 63  ? -4.513  -11.796 106.834 1.00 28.72 ? 62  ASP B CG  1 
ATOM   4968  O OD1 . ASP B 1 63  ? -4.185  -11.997 108.022 1.00 27.87 ? 62  ASP B OD1 1 
ATOM   4969  O OD2 . ASP B 1 63  ? -5.696  -11.669 106.462 1.00 32.67 ? 62  ASP B OD2 1 
ATOM   4970  N N   . VAL B 1 64  ? -0.917  -10.680 104.333 1.00 24.02 ? 63  VAL B N   1 
ATOM   4971  C CA  . VAL B 1 64  ? 0.119   -10.839 103.317 1.00 22.68 ? 63  VAL B CA  1 
ATOM   4972  C C   . VAL B 1 64  ? 1.509   -10.823 103.953 1.00 22.31 ? 63  VAL B C   1 
ATOM   4973  O O   . VAL B 1 64  ? 2.333   -11.705 103.697 1.00 22.59 ? 63  VAL B O   1 
ATOM   4974  C CB  . VAL B 1 64  ? 0.044   -9.729  102.241 1.00 21.95 ? 63  VAL B CB  1 
ATOM   4975  C CG1 . VAL B 1 64  ? 1.157   -9.926  101.215 1.00 20.47 ? 63  VAL B CG1 1 
ATOM   4976  C CG2 . VAL B 1 64  ? -1.311  -9.758  101.549 1.00 22.09 ? 63  VAL B CG2 1 
ATOM   4977  N N   . MET B 1 65  ? 1.772   -9.828  104.791 1.00 22.75 ? 64  MET B N   1 
ATOM   4978  C CA  . MET B 1 65  ? 3.071   -9.743  105.441 1.00 23.70 ? 64  MET B CA  1 
ATOM   4979  C C   . MET B 1 65  ? 3.319   -10.999 106.277 1.00 24.24 ? 64  MET B C   1 
ATOM   4980  O O   . MET B 1 65  ? 4.430   -11.526 106.303 1.00 24.18 ? 64  MET B O   1 
ATOM   4981  C CB  . MET B 1 65  ? 3.157   -8.490  106.318 1.00 24.01 ? 64  MET B CB  1 
ATOM   4982  C CG  . MET B 1 65  ? 3.070   -7.176  105.537 1.00 22.18 ? 64  MET B CG  1 
ATOM   4983  S SD  . MET B 1 65  ? 4.203   -7.103  104.122 1.00 24.62 ? 64  MET B SD  1 
ATOM   4984  C CE  . MET B 1 65  ? 5.776   -6.903  104.951 1.00 25.13 ? 64  MET B CE  1 
ATOM   4985  N N   . ARG B 1 66  ? 2.282   -11.486 106.948 1.00 24.88 ? 65  ARG B N   1 
ATOM   4986  C CA  . ARG B 1 66  ? 2.426   -12.691 107.760 1.00 27.25 ? 65  ARG B CA  1 
ATOM   4987  C C   . ARG B 1 66  ? 2.781   -13.878 106.868 1.00 26.13 ? 65  ARG B C   1 
ATOM   4988  O O   . ARG B 1 66  ? 3.690   -14.645 107.180 1.00 28.32 ? 65  ARG B O   1 
ATOM   4989  C CB  . ARG B 1 66  ? 1.134   -12.981 108.542 1.00 28.62 ? 65  ARG B CB  1 
ATOM   4990  C CG  . ARG B 1 66  ? 1.125   -14.337 109.264 1.00 29.04 ? 65  ARG B CG  1 
ATOM   4991  C CD  . ARG B 1 66  ? -0.042  -14.469 110.245 1.00 30.84 ? 65  ARG B CD  1 
ATOM   4992  N NE  . ARG B 1 66  ? -1.353  -14.245 109.635 1.00 30.48 ? 65  ARG B NE  1 
ATOM   4993  C CZ  . ARG B 1 66  ? -1.918  -15.041 108.732 1.00 31.94 ? 65  ARG B CZ  1 
ATOM   4994  N NH1 . ARG B 1 66  ? -1.292  -16.133 108.317 1.00 33.24 ? 65  ARG B NH1 1 
ATOM   4995  N NH2 . ARG B 1 66  ? -3.119  -14.745 108.245 1.00 30.81 ? 65  ARG B NH2 1 
ATOM   4996  N N   . MET B 1 67  ? 2.076   -14.024 105.752 1.00 25.79 ? 66  MET B N   1 
ATOM   4997  C CA  . MET B 1 67  ? 2.361   -15.128 104.849 1.00 25.32 ? 66  MET B CA  1 
ATOM   4998  C C   . MET B 1 67  ? 3.760   -15.018 104.250 1.00 25.08 ? 66  MET B C   1 
ATOM   4999  O O   . MET B 1 67  ? 4.413   -16.034 104.019 1.00 24.76 ? 66  MET B O   1 
ATOM   5000  C CB  . MET B 1 67  ? 1.326   -15.190 103.728 1.00 26.32 ? 66  MET B CB  1 
ATOM   5001  C CG  . MET B 1 67  ? -0.076  -15.541 104.196 1.00 25.96 ? 66  MET B CG  1 
ATOM   5002  S SD  . MET B 1 67  ? -1.153  -15.842 102.802 1.00 27.70 ? 66  MET B SD  1 
ATOM   5003  C CE  . MET B 1 67  ? -1.518  -14.165 102.315 1.00 29.72 ? 66  MET B CE  1 
ATOM   5004  N N   . LEU B 1 68  ? 4.217   -13.790 104.002 1.00 23.33 ? 67  LEU B N   1 
ATOM   5005  C CA  . LEU B 1 68  ? 5.542   -13.564 103.433 1.00 22.17 ? 67  LEU B CA  1 
ATOM   5006  C C   . LEU B 1 68  ? 6.634   -13.977 104.412 1.00 22.45 ? 67  LEU B C   1 
ATOM   5007  O O   . LEU B 1 68  ? 7.633   -14.590 104.023 1.00 20.17 ? 67  LEU B O   1 
ATOM   5008  C CB  . LEU B 1 68  ? 5.710   -12.093 103.035 1.00 21.80 ? 67  LEU B CB  1 
ATOM   5009  C CG  . LEU B 1 68  ? 4.924   -11.676 101.787 1.00 19.23 ? 67  LEU B CG  1 
ATOM   5010  C CD1 . LEU B 1 68  ? 5.015   -10.171 101.587 1.00 18.71 ? 67  LEU B CD1 1 
ATOM   5011  C CD2 . LEU B 1 68  ? 5.467   -12.413 100.570 1.00 19.33 ? 67  LEU B CD2 1 
ATOM   5012  N N   . VAL B 1 69  ? 6.449   -13.636 105.684 1.00 22.00 ? 68  VAL B N   1 
ATOM   5013  C CA  . VAL B 1 69  ? 7.417   -14.018 106.705 1.00 20.68 ? 68  VAL B CA  1 
ATOM   5014  C C   . VAL B 1 69  ? 7.400   -15.546 106.833 1.00 21.55 ? 68  VAL B C   1 
ATOM   5015  O O   . VAL B 1 69  ? 8.442   -16.173 107.002 1.00 21.21 ? 68  VAL B O   1 
ATOM   5016  C CB  . VAL B 1 69  ? 7.077   -13.376 108.066 1.00 21.94 ? 68  VAL B CB  1 
ATOM   5017  C CG1 . VAL B 1 69  ? 7.967   -13.955 109.156 1.00 20.15 ? 68  VAL B CG1 1 
ATOM   5018  C CG2 . VAL B 1 69  ? 7.269   -11.856 107.982 1.00 22.65 ? 68  VAL B CG2 1 
ATOM   5019  N N   . ASP B 1 70  ? 6.218   -16.146 106.748 1.00 22.26 ? 69  ASP B N   1 
ATOM   5020  C CA  . ASP B 1 70  ? 6.133   -17.599 106.835 1.00 25.16 ? 69  ASP B CA  1 
ATOM   5021  C C   . ASP B 1 70  ? 6.890   -18.191 105.655 1.00 25.05 ? 69  ASP B C   1 
ATOM   5022  O O   . ASP B 1 70  ? 7.479   -19.263 105.758 1.00 25.38 ? 69  ASP B O   1 
ATOM   5023  C CB  . ASP B 1 70  ? 4.677   -18.080 106.804 1.00 25.65 ? 69  ASP B CB  1 
ATOM   5024  C CG  . ASP B 1 70  ? 3.940   -17.806 108.106 1.00 27.25 ? 69  ASP B CG  1 
ATOM   5025  O OD1 . ASP B 1 70  ? 4.604   -17.666 109.157 1.00 27.99 ? 69  ASP B OD1 1 
ATOM   5026  O OD2 . ASP B 1 70  ? 2.693   -17.750 108.077 1.00 28.40 ? 69  ASP B OD2 1 
ATOM   5027  N N   . LEU B 1 71  ? 6.875   -17.479 104.532 1.00 25.41 ? 70  LEU B N   1 
ATOM   5028  C CA  . LEU B 1 71  ? 7.577   -17.936 103.339 1.00 24.84 ? 70  LEU B CA  1 
ATOM   5029  C C   . LEU B 1 71  ? 9.078   -17.897 103.625 1.00 24.19 ? 70  LEU B C   1 
ATOM   5030  O O   . LEU B 1 71  ? 9.808   -18.834 103.301 1.00 24.58 ? 70  LEU B O   1 
ATOM   5031  C CB  . LEU B 1 71  ? 7.260   -17.025 102.146 1.00 24.53 ? 70  LEU B CB  1 
ATOM   5032  C CG  . LEU B 1 71  ? 7.237   -17.611 100.726 1.00 27.84 ? 70  LEU B CG  1 
ATOM   5033  C CD1 . LEU B 1 71  ? 7.481   -16.487 99.727  1.00 26.27 ? 70  LEU B CD1 1 
ATOM   5034  C CD2 . LEU B 1 71  ? 8.284   -18.689 100.555 1.00 26.28 ? 70  LEU B CD2 1 
ATOM   5035  N N   . ALA B 1 72  ? 9.533   -16.806 104.236 1.00 22.60 ? 71  ALA B N   1 
ATOM   5036  C CA  . ALA B 1 72  ? 10.946  -16.649 104.566 1.00 22.64 ? 71  ALA B CA  1 
ATOM   5037  C C   . ALA B 1 72  ? 11.428  -17.759 105.509 1.00 23.43 ? 71  ALA B C   1 
ATOM   5038  O O   . ALA B 1 72  ? 12.555  -18.248 105.395 1.00 22.73 ? 71  ALA B O   1 
ATOM   5039  C CB  . ALA B 1 72  ? 11.182  -15.286 105.201 1.00 21.26 ? 71  ALA B CB  1 
ATOM   5040  N N   . LYS B 1 73  ? 10.577  -18.141 106.455 1.00 23.52 ? 72  LYS B N   1 
ATOM   5041  C CA  . LYS B 1 73  ? 10.924  -19.199 107.394 1.00 25.38 ? 72  LYS B CA  1 
ATOM   5042  C C   . LYS B 1 73  ? 10.913  -20.531 106.653 1.00 24.60 ? 72  LYS B C   1 
ATOM   5043  O O   . LYS B 1 73  ? 11.858  -21.308 106.735 1.00 25.57 ? 72  LYS B O   1 
ATOM   5044  C CB  . LYS B 1 73  ? 9.914   -19.242 108.544 1.00 27.29 ? 72  LYS B CB  1 
ATOM   5045  C CG  . LYS B 1 73  ? 9.919   -18.016 109.433 1.00 28.30 ? 72  LYS B CG  1 
ATOM   5046  C CD  . LYS B 1 73  ? 8.836   -18.128 110.493 1.00 30.33 ? 72  LYS B CD  1 
ATOM   5047  C CE  . LYS B 1 73  ? 8.763   -16.879 111.354 1.00 33.36 ? 72  LYS B CE  1 
ATOM   5048  N NZ  . LYS B 1 73  ? 7.576   -16.907 112.262 1.00 34.57 ? 72  LYS B NZ  1 
ATOM   5049  N N   . SER B 1 74  ? 9.836   -20.776 105.916 1.00 25.19 ? 73  SER B N   1 
ATOM   5050  C CA  . SER B 1 74  ? 9.688   -22.005 105.152 1.00 25.17 ? 73  SER B CA  1 
ATOM   5051  C C   . SER B 1 74  ? 10.870  -22.239 104.212 1.00 25.41 ? 73  SER B C   1 
ATOM   5052  O O   . SER B 1 74  ? 11.337  -23.372 104.064 1.00 25.05 ? 73  SER B O   1 
ATOM   5053  C CB  . SER B 1 74  ? 8.394   -21.960 104.343 1.00 24.73 ? 73  SER B CB  1 
ATOM   5054  O OG  . SER B 1 74  ? 8.209   -23.166 103.628 1.00 28.40 ? 73  SER B OG  1 
ATOM   5055  N N   . ARG B 1 75  ? 11.352  -21.169 103.582 1.00 23.68 ? 74  ARG B N   1 
ATOM   5056  C CA  . ARG B 1 75  ? 12.475  -21.277 102.653 1.00 22.93 ? 74  ARG B CA  1 
ATOM   5057  C C   . ARG B 1 75  ? 13.833  -21.311 103.355 1.00 21.84 ? 74  ARG B C   1 
ATOM   5058  O O   . ARG B 1 75  ? 14.872  -21.360 102.701 1.00 21.02 ? 74  ARG B O   1 
ATOM   5059  C CB  . ARG B 1 75  ? 12.436  -20.127 101.634 1.00 22.90 ? 74  ARG B CB  1 
ATOM   5060  C CG  . ARG B 1 75  ? 11.235  -20.176 100.681 1.00 21.76 ? 74  ARG B CG  1 
ATOM   5061  C CD  . ARG B 1 75  ? 11.306  -21.380 99.748  1.00 24.36 ? 74  ARG B CD  1 
ATOM   5062  N NE  . ARG B 1 75  ? 12.540  -21.378 98.966  1.00 24.13 ? 74  ARG B NE  1 
ATOM   5063  C CZ  . ARG B 1 75  ? 13.411  -22.382 98.936  1.00 27.94 ? 74  ARG B CZ  1 
ATOM   5064  N NH1 . ARG B 1 75  ? 13.185  -23.483 99.643  1.00 28.74 ? 74  ARG B NH1 1 
ATOM   5065  N NH2 . ARG B 1 75  ? 14.521  -22.279 98.216  1.00 28.87 ? 74  ARG B NH2 1 
ATOM   5066  N N   . GLY B 1 76  ? 13.815  -21.282 104.685 1.00 21.69 ? 75  GLY B N   1 
ATOM   5067  C CA  . GLY B 1 76  ? 15.049  -21.344 105.458 1.00 20.21 ? 75  GLY B CA  1 
ATOM   5068  C C   . GLY B 1 76  ? 16.010  -20.176 105.355 1.00 19.21 ? 75  GLY B C   1 
ATOM   5069  O O   . GLY B 1 76  ? 17.225  -20.372 105.355 1.00 18.79 ? 75  GLY B O   1 
ATOM   5070  N N   . VAL B 1 77  ? 15.473  -18.961 105.290 1.00 20.20 ? 76  VAL B N   1 
ATOM   5071  C CA  . VAL B 1 77  ? 16.283  -17.746 105.185 1.00 19.85 ? 76  VAL B CA  1 
ATOM   5072  C C   . VAL B 1 77  ? 17.301  -17.538 106.313 1.00 20.32 ? 76  VAL B C   1 
ATOM   5073  O O   . VAL B 1 77  ? 18.453  -17.174 106.060 1.00 19.54 ? 76  VAL B O   1 
ATOM   5074  C CB  . VAL B 1 77  ? 15.373  -16.484 105.103 1.00 20.50 ? 76  VAL B CB  1 
ATOM   5075  C CG1 . VAL B 1 77  ? 16.207  -15.201 105.283 1.00 17.38 ? 76  VAL B CG1 1 
ATOM   5076  C CG2 . VAL B 1 77  ? 14.652  -16.460 103.757 1.00 18.95 ? 76  VAL B CG2 1 
ATOM   5077  N N   . GLU B 1 78  ? 16.883  -17.765 107.553 1.00 20.65 ? 77  GLU B N   1 
ATOM   5078  C CA  . GLU B 1 78  ? 17.780  -17.564 108.683 1.00 22.92 ? 77  GLU B CA  1 
ATOM   5079  C C   . GLU B 1 78  ? 18.943  -18.552 108.731 1.00 22.84 ? 77  GLU B C   1 
ATOM   5080  O O   . GLU B 1 78  ? 20.072  -18.164 109.024 1.00 22.47 ? 77  GLU B O   1 
ATOM   5081  C CB  . GLU B 1 78  ? 16.986  -17.601 109.992 1.00 22.78 ? 77  GLU B CB  1 
ATOM   5082  C CG  . GLU B 1 78  ? 15.950  -16.486 110.079 1.00 25.41 ? 77  GLU B CG  1 
ATOM   5083  C CD  . GLU B 1 78  ? 15.110  -16.552 111.337 1.00 27.00 ? 77  GLU B CD  1 
ATOM   5084  O OE1 . GLU B 1 78  ? 15.423  -15.828 112.300 1.00 29.63 ? 77  GLU B OE1 1 
ATOM   5085  O OE2 . GLU B 1 78  ? 14.139  -17.335 111.360 1.00 29.60 ? 77  GLU B OE2 1 
ATOM   5086  N N   . ALA B 1 79  ? 18.674  -19.823 108.441 1.00 23.53 ? 78  ALA B N   1 
ATOM   5087  C CA  . ALA B 1 79  ? 19.731  -20.831 108.446 1.00 22.10 ? 78  ALA B CA  1 
ATOM   5088  C C   . ALA B 1 79  ? 20.757  -20.494 107.359 1.00 21.93 ? 78  ALA B C   1 
ATOM   5089  O O   . ALA B 1 79  ? 21.965  -20.569 107.588 1.00 23.15 ? 78  ALA B O   1 
ATOM   5090  C CB  . ALA B 1 79  ? 19.136  -22.224 108.209 1.00 20.16 ? 78  ALA B CB  1 
ATOM   5091  N N   . ALA B 1 80  ? 20.268  -20.116 106.179 1.00 20.98 ? 79  ALA B N   1 
ATOM   5092  C CA  . ALA B 1 80  ? 21.145  -19.750 105.067 1.00 20.27 ? 79  ALA B CA  1 
ATOM   5093  C C   . ALA B 1 80  ? 22.002  -18.546 105.451 1.00 19.28 ? 79  ALA B C   1 
ATOM   5094  O O   . ALA B 1 80  ? 23.192  -18.489 105.126 1.00 19.85 ? 79  ALA B O   1 
ATOM   5095  C CB  . ALA B 1 80  ? 20.314  -19.426 103.823 1.00 18.86 ? 79  ALA B CB  1 
ATOM   5096  N N   . ARG B 1 81  ? 21.396  -17.578 106.135 1.00 18.98 ? 80  ARG B N   1 
ATOM   5097  C CA  . ARG B 1 81  ? 22.132  -16.390 106.566 1.00 20.24 ? 80  ARG B CA  1 
ATOM   5098  C C   . ARG B 1 81  ? 23.301  -16.787 107.468 1.00 20.59 ? 80  ARG B C   1 
ATOM   5099  O O   . ARG B 1 81  ? 24.436  -16.358 107.258 1.00 19.20 ? 80  ARG B O   1 
ATOM   5100  C CB  . ARG B 1 81  ? 21.217  -15.432 107.334 1.00 20.23 ? 80  ARG B CB  1 
ATOM   5101  C CG  . ARG B 1 81  ? 21.953  -14.247 107.953 1.00 21.76 ? 80  ARG B CG  1 
ATOM   5102  C CD  . ARG B 1 81  ? 21.066  -13.524 108.948 1.00 21.67 ? 80  ARG B CD  1 
ATOM   5103  N NE  . ARG B 1 81  ? 20.759  -14.375 110.096 1.00 23.49 ? 80  ARG B NE  1 
ATOM   5104  C CZ  . ARG B 1 81  ? 19.649  -14.284 110.826 1.00 23.36 ? 80  ARG B CZ  1 
ATOM   5105  N NH1 . ARG B 1 81  ? 18.727  -13.378 110.535 1.00 22.20 ? 80  ARG B NH1 1 
ATOM   5106  N NH2 . ARG B 1 81  ? 19.449  -15.115 111.840 1.00 23.81 ? 80  ARG B NH2 1 
ATOM   5107  N N   . GLU B 1 82  ? 23.020  -17.605 108.479 1.00 20.60 ? 81  GLU B N   1 
ATOM   5108  C CA  . GLU B 1 82  ? 24.076  -18.044 109.390 1.00 21.15 ? 81  GLU B CA  1 
ATOM   5109  C C   . GLU B 1 82  ? 25.190  -18.769 108.636 1.00 21.82 ? 81  GLU B C   1 
ATOM   5110  O O   . GLU B 1 82  ? 26.374  -18.632 108.973 1.00 21.89 ? 81  GLU B O   1 
ATOM   5111  C CB  . GLU B 1 82  ? 23.493  -18.949 110.479 1.00 21.78 ? 81  GLU B CB  1 
ATOM   5112  C CG  . GLU B 1 82  ? 22.486  -18.233 111.358 1.00 23.09 ? 81  GLU B CG  1 
ATOM   5113  C CD  . GLU B 1 82  ? 23.024  -16.910 111.880 1.00 24.42 ? 81  GLU B CD  1 
ATOM   5114  O OE1 . GLU B 1 82  ? 24.030  -16.919 112.623 1.00 25.59 ? 81  GLU B OE1 1 
ATOM   5115  O OE2 . GLU B 1 82  ? 22.443  -15.859 111.539 1.00 24.74 ? 81  GLU B OE2 1 
ATOM   5116  N N   . ARG B 1 83  ? 24.814  -19.538 107.619 1.00 20.73 ? 82  ARG B N   1 
ATOM   5117  C CA  . ARG B 1 83  ? 25.799  -20.253 106.825 1.00 22.89 ? 82  ARG B CA  1 
ATOM   5118  C C   . ARG B 1 83  ? 26.734  -19.254 106.152 1.00 23.10 ? 82  ARG B C   1 
ATOM   5119  O O   . ARG B 1 83  ? 27.946  -19.470 106.092 1.00 21.10 ? 82  ARG B O   1 
ATOM   5120  C CB  . ARG B 1 83  ? 25.112  -21.136 105.779 1.00 25.11 ? 82  ARG B CB  1 
ATOM   5121  C CG  . ARG B 1 83  ? 24.767  -22.533 106.299 1.00 28.70 ? 82  ARG B CG  1 
ATOM   5122  C CD  . ARG B 1 83  ? 24.149  -23.400 105.213 1.00 31.06 ? 82  ARG B CD  1 
ATOM   5123  N NE  . ARG B 1 83  ? 22.722  -23.127 105.053 1.00 37.86 ? 82  ARG B NE  1 
ATOM   5124  C CZ  . ARG B 1 83  ? 22.110  -23.004 103.880 1.00 37.94 ? 82  ARG B CZ  1 
ATOM   5125  N NH1 . ARG B 1 83  ? 22.800  -23.126 102.753 1.00 40.24 ? 82  ARG B NH1 1 
ATOM   5126  N NH2 . ARG B 1 83  ? 20.809  -22.758 103.834 1.00 37.02 ? 82  ARG B NH2 1 
ATOM   5127  N N   . MET B 1 84  ? 26.173  -18.154 105.652 1.00 22.11 ? 83  MET B N   1 
ATOM   5128  C CA  . MET B 1 84  ? 26.996  -17.135 105.011 1.00 21.70 ? 83  MET B CA  1 
ATOM   5129  C C   . MET B 1 84  ? 27.954  -16.512 106.016 1.00 19.81 ? 83  MET B C   1 
ATOM   5130  O O   . MET B 1 84  ? 29.161  -16.483 105.788 1.00 19.42 ? 83  MET B O   1 
ATOM   5131  C CB  . MET B 1 84  ? 26.143  -16.021 104.405 1.00 22.23 ? 83  MET B CB  1 
ATOM   5132  C CG  . MET B 1 84  ? 26.988  -14.838 103.929 1.00 25.00 ? 83  MET B CG  1 
ATOM   5133  S SD  . MET B 1 84  ? 26.046  -13.491 103.186 1.00 28.36 ? 83  MET B SD  1 
ATOM   5134  C CE  . MET B 1 84  ? 25.809  -14.113 101.644 1.00 32.46 ? 83  MET B CE  1 
ATOM   5135  N N   . PHE B 1 85  ? 27.409  -16.005 107.119 1.00 20.31 ? 84  PHE B N   1 
ATOM   5136  C CA  . PHE B 1 85  ? 28.220  -15.368 108.153 1.00 21.70 ? 84  PHE B CA  1 
ATOM   5137  C C   . PHE B 1 85  ? 29.249  -16.293 108.797 1.00 22.05 ? 84  PHE B C   1 
ATOM   5138  O O   . PHE B 1 85  ? 30.298  -15.832 109.246 1.00 21.82 ? 84  PHE B O   1 
ATOM   5139  C CB  . PHE B 1 85  ? 27.335  -14.782 109.260 1.00 21.69 ? 84  PHE B CB  1 
ATOM   5140  C CG  . PHE B 1 85  ? 26.687  -13.473 108.900 1.00 23.14 ? 84  PHE B CG  1 
ATOM   5141  C CD1 . PHE B 1 85  ? 25.607  -13.427 108.025 1.00 23.66 ? 84  PHE B CD1 1 
ATOM   5142  C CD2 . PHE B 1 85  ? 27.151  -12.283 109.454 1.00 23.91 ? 84  PHE B CD2 1 
ATOM   5143  C CE1 . PHE B 1 85  ? 24.997  -12.214 107.712 1.00 25.77 ? 84  PHE B CE1 1 
ATOM   5144  C CE2 . PHE B 1 85  ? 26.550  -11.064 109.147 1.00 21.59 ? 84  PHE B CE2 1 
ATOM   5145  C CZ  . PHE B 1 85  ? 25.472  -11.031 108.277 1.00 24.48 ? 84  PHE B CZ  1 
ATOM   5146  N N   . ASN B 1 86  ? 28.947  -17.589 108.846 1.00 23.13 ? 85  ASN B N   1 
ATOM   5147  C CA  . ASN B 1 86  ? 29.855  -18.560 109.457 1.00 24.20 ? 85  ASN B CA  1 
ATOM   5148  C C   . ASN B 1 86  ? 30.963  -19.059 108.534 1.00 24.02 ? 85  ASN B C   1 
ATOM   5149  O O   . ASN B 1 86  ? 31.783  -19.887 108.931 1.00 26.43 ? 85  ASN B O   1 
ATOM   5150  C CB  . ASN B 1 86  ? 29.066  -19.749 110.020 1.00 24.26 ? 85  ASN B CB  1 
ATOM   5151  C CG  . ASN B 1 86  ? 28.280  -19.378 111.261 1.00 27.00 ? 85  ASN B CG  1 
ATOM   5152  O OD1 . ASN B 1 86  ? 28.751  -18.599 112.087 1.00 28.05 ? 85  ASN B OD1 1 
ATOM   5153  N ND2 . ASN B 1 86  ? 27.083  -19.938 111.405 1.00 27.91 ? 85  ASN B ND2 1 
ATOM   5154  N N   . GLY B 1 87  ? 30.983  -18.565 107.303 1.00 22.51 ? 86  GLY B N   1 
ATOM   5155  C CA  . GLY B 1 87  ? 32.032  -18.956 106.380 1.00 20.92 ? 86  GLY B CA  1 
ATOM   5156  C C   . GLY B 1 87  ? 31.853  -20.257 105.623 1.00 21.38 ? 86  GLY B C   1 
ATOM   5157  O O   . GLY B 1 87  ? 32.808  -20.782 105.061 1.00 21.93 ? 86  GLY B O   1 
ATOM   5158  N N   . GLU B 1 88  ? 30.641  -20.786 105.596 1.00 22.88 ? 87  GLU B N   1 
ATOM   5159  C CA  . GLU B 1 88  ? 30.403  -22.017 104.866 1.00 24.71 ? 87  GLU B CA  1 
ATOM   5160  C C   . GLU B 1 88  ? 30.408  -21.706 103.368 1.00 26.43 ? 87  GLU B C   1 
ATOM   5161  O O   . GLU B 1 88  ? 30.261  -20.546 102.968 1.00 22.02 ? 87  GLU B O   1 
ATOM   5162  C CB  . GLU B 1 88  ? 29.079  -22.634 105.319 1.00 27.01 ? 87  GLU B CB  1 
ATOM   5163  C CG  . GLU B 1 88  ? 29.186  -23.240 106.721 1.00 27.38 ? 87  GLU B CG  1 
ATOM   5164  C CD  . GLU B 1 88  ? 27.884  -23.812 107.229 1.00 28.67 ? 87  GLU B CD  1 
ATOM   5165  O OE1 . GLU B 1 88  ? 27.217  -24.550 106.474 1.00 28.54 ? 87  GLU B OE1 1 
ATOM   5166  O OE2 . GLU B 1 88  ? 27.535  -23.533 108.396 1.00 31.14 ? 87  GLU B OE2 1 
ATOM   5167  N N   . LYS B 1 89  ? 30.606  -22.737 102.550 1.00 26.18 ? 88  LYS B N   1 
ATOM   5168  C CA  . LYS B 1 89  ? 30.660  -22.586 101.098 1.00 27.49 ? 88  LYS B CA  1 
ATOM   5169  C C   . LYS B 1 89  ? 29.284  -22.493 100.435 1.00 28.04 ? 88  LYS B C   1 
ATOM   5170  O O   . LYS B 1 89  ? 28.904  -23.376 99.659  1.00 28.04 ? 88  LYS B O   1 
ATOM   5171  C CB  . LYS B 1 89  ? 31.441  -23.756 100.494 1.00 29.38 ? 88  LYS B CB  1 
ATOM   5172  C CG  . LYS B 1 89  ? 32.950  -23.571 100.474 1.00 33.76 ? 88  LYS B CG  1 
ATOM   5173  C CD  . LYS B 1 89  ? 33.526  -23.339 101.851 1.00 36.72 ? 88  LYS B CD  1 
ATOM   5174  C CE  . LYS B 1 89  ? 35.032  -23.116 101.778 1.00 38.98 ? 88  LYS B CE  1 
ATOM   5175  N NZ  . LYS B 1 89  ? 35.745  -24.297 101.212 1.00 40.92 ? 88  LYS B NZ  1 
ATOM   5176  N N   . ILE B 1 90  ? 28.549  -21.415 100.718 1.00 26.32 ? 89  ILE B N   1 
ATOM   5177  C CA  . ILE B 1 90  ? 27.215  -21.240 100.151 1.00 24.95 ? 89  ILE B CA  1 
ATOM   5178  C C   . ILE B 1 90  ? 27.226  -20.923 98.661  1.00 24.35 ? 89  ILE B C   1 
ATOM   5179  O O   . ILE B 1 90  ? 26.199  -21.025 97.998  1.00 25.90 ? 89  ILE B O   1 
ATOM   5180  C CB  . ILE B 1 90  ? 26.414  -20.157 100.899 1.00 23.60 ? 89  ILE B CB  1 
ATOM   5181  C CG1 . ILE B 1 90  ? 27.092  -18.795 100.749 1.00 23.00 ? 89  ILE B CG1 1 
ATOM   5182  C CG2 . ILE B 1 90  ? 26.291  -20.543 102.371 1.00 21.52 ? 89  ILE B CG2 1 
ATOM   5183  C CD1 . ILE B 1 90  ? 26.251  -17.651 101.284 1.00 24.21 ? 89  ILE B CD1 1 
ATOM   5184  N N   . ASN B 1 91  ? 28.376  -20.510 98.138  1.00 23.35 ? 90  ASN B N   1 
ATOM   5185  C CA  . ASN B 1 91  ? 28.495  -20.266 96.703  1.00 23.17 ? 90  ASN B CA  1 
ATOM   5186  C C   . ASN B 1 91  ? 28.849  -21.678 96.242  1.00 23.12 ? 90  ASN B C   1 
ATOM   5187  O O   . ASN B 1 91  ? 30.009  -21.990 95.968  1.00 23.56 ? 90  ASN B O   1 
ATOM   5188  C CB  . ASN B 1 91  ? 29.644  -19.294 96.406  1.00 20.68 ? 90  ASN B CB  1 
ATOM   5189  C CG  . ASN B 1 91  ? 29.882  -19.095 94.909  1.00 22.20 ? 90  ASN B CG  1 
ATOM   5190  O OD1 . ASN B 1 91  ? 30.725  -18.290 94.514  1.00 23.21 ? 90  ASN B OD1 1 
ATOM   5191  N ND2 . ASN B 1 91  ? 29.146  -19.831 94.073  1.00 18.41 ? 90  ASN B ND2 1 
ATOM   5192  N N   . TYR B 1 92  ? 27.832  -22.530 96.189  1.00 24.92 ? 91  TYR B N   1 
ATOM   5193  C CA  . TYR B 1 92  ? 28.003  -23.934 95.833  1.00 25.13 ? 91  TYR B CA  1 
ATOM   5194  C C   . TYR B 1 92  ? 28.510  -24.295 94.439  1.00 26.19 ? 91  TYR B C   1 
ATOM   5195  O O   . TYR B 1 92  ? 29.125  -25.348 94.273  1.00 27.29 ? 91  TYR B O   1 
ATOM   5196  C CB  . TYR B 1 92  ? 26.704  -24.705 96.114  1.00 26.82 ? 91  TYR B CB  1 
ATOM   5197  C CG  . TYR B 1 92  ? 25.438  -24.066 95.573  1.00 26.89 ? 91  TYR B CG  1 
ATOM   5198  C CD1 . TYR B 1 92  ? 24.696  -23.178 96.350  1.00 29.01 ? 91  TYR B CD1 1 
ATOM   5199  C CD2 . TYR B 1 92  ? 24.977  -24.359 94.290  1.00 27.97 ? 91  TYR B CD2 1 
ATOM   5200  C CE1 . TYR B 1 92  ? 23.518  -22.599 95.865  1.00 29.25 ? 91  TYR B CE1 1 
ATOM   5201  C CE2 . TYR B 1 92  ? 23.804  -23.783 93.791  1.00 28.45 ? 91  TYR B CE2 1 
ATOM   5202  C CZ  . TYR B 1 92  ? 23.079  -22.905 94.585  1.00 30.32 ? 91  TYR B CZ  1 
ATOM   5203  O OH  . TYR B 1 92  ? 21.918  -22.337 94.104  1.00 30.71 ? 91  TYR B OH  1 
ATOM   5204  N N   . THR B 1 93  ? 28.266  -23.459 93.433  1.00 24.18 ? 92  THR B N   1 
ATOM   5205  C CA  . THR B 1 93  ? 28.741  -23.803 92.096  1.00 23.75 ? 92  THR B CA  1 
ATOM   5206  C C   . THR B 1 93  ? 30.236  -23.544 91.937  1.00 24.26 ? 92  THR B C   1 
ATOM   5207  O O   . THR B 1 93  ? 30.857  -24.038 91.002  1.00 24.77 ? 92  THR B O   1 
ATOM   5208  C CB  . THR B 1 93  ? 27.985  -23.032 90.990  1.00 23.64 ? 92  THR B CB  1 
ATOM   5209  O OG1 . THR B 1 93  ? 28.233  -21.628 91.123  1.00 25.39 ? 92  THR B OG1 1 
ATOM   5210  C CG2 . THR B 1 93  ? 26.491  -23.297 91.086  1.00 24.55 ? 92  THR B CG2 1 
ATOM   5211  N N   . GLU B 1 94  ? 30.816  -22.771 92.849  1.00 23.29 ? 93  GLU B N   1 
ATOM   5212  C CA  . GLU B 1 94  ? 32.241  -22.474 92.776  1.00 23.91 ? 93  GLU B CA  1 
ATOM   5213  C C   . GLU B 1 94  ? 32.993  -22.982 94.012  1.00 24.32 ? 93  GLU B C   1 
ATOM   5214  O O   . GLU B 1 94  ? 34.204  -22.793 94.131  1.00 23.80 ? 93  GLU B O   1 
ATOM   5215  C CB  . GLU B 1 94  ? 32.455  -20.964 92.609  1.00 24.40 ? 93  GLU B CB  1 
ATOM   5216  C CG  . GLU B 1 94  ? 31.749  -20.387 91.391  1.00 26.07 ? 93  GLU B CG  1 
ATOM   5217  C CD  . GLU B 1 94  ? 32.134  -18.943 91.110  1.00 27.30 ? 93  GLU B CD  1 
ATOM   5218  O OE1 . GLU B 1 94  ? 32.052  -18.109 92.036  1.00 26.49 ? 93  GLU B OE1 1 
ATOM   5219  O OE2 . GLU B 1 94  ? 32.510  -18.642 89.959  1.00 28.78 ? 93  GLU B OE2 1 
ATOM   5220  N N   . GLY B 1 95  ? 32.263  -23.627 94.921  1.00 23.97 ? 94  GLY B N   1 
ATOM   5221  C CA  . GLY B 1 95  ? 32.861  -24.163 96.132  1.00 25.17 ? 94  GLY B CA  1 
ATOM   5222  C C   . GLY B 1 95  ? 33.563  -23.101 96.953  1.00 26.33 ? 94  GLY B C   1 
ATOM   5223  O O   . GLY B 1 95  ? 34.689  -23.297 97.409  1.00 25.96 ? 94  GLY B O   1 
ATOM   5224  N N   . ARG B 1 96  ? 32.893  -21.974 97.161  1.00 25.66 ? 95  ARG B N   1 
ATOM   5225  C CA  . ARG B 1 96  ? 33.505  -20.893 97.908  1.00 25.33 ? 95  ARG B CA  1 
ATOM   5226  C C   . ARG B 1 96  ? 32.599  -20.272 98.954  1.00 23.26 ? 95  ARG B C   1 
ATOM   5227  O O   . ARG B 1 96  ? 31.375  -20.352 98.871  1.00 22.97 ? 95  ARG B O   1 
ATOM   5228  C CB  . ARG B 1 96  ? 33.994  -19.811 96.938  1.00 27.58 ? 95  ARG B CB  1 
ATOM   5229  C CG  . ARG B 1 96  ? 34.993  -20.341 95.930  1.00 30.48 ? 95  ARG B CG  1 
ATOM   5230  C CD  . ARG B 1 96  ? 35.864  -19.260 95.333  1.00 32.85 ? 95  ARG B CD  1 
ATOM   5231  N NE  . ARG B 1 96  ? 35.209  -18.504 94.274  1.00 34.80 ? 95  ARG B NE  1 
ATOM   5232  C CZ  . ARG B 1 96  ? 35.748  -18.284 93.078  1.00 35.69 ? 95  ARG B CZ  1 
ATOM   5233  N NH1 . ARG B 1 96  ? 36.946  -18.772 92.785  1.00 38.31 ? 95  ARG B NH1 1 
ATOM   5234  N NH2 . ARG B 1 96  ? 35.105  -17.552 92.180  1.00 33.90 ? 95  ARG B NH2 1 
ATOM   5235  N N   . ALA B 1 97  ? 33.224  -19.664 99.951  1.00 22.12 ? 96  ALA B N   1 
ATOM   5236  C CA  . ALA B 1 97  ? 32.495  -18.986 101.007 1.00 21.94 ? 96  ALA B CA  1 
ATOM   5237  C C   . ALA B 1 97  ? 32.082  -17.628 100.431 1.00 21.71 ? 96  ALA B C   1 
ATOM   5238  O O   . ALA B 1 97  ? 32.546  -17.235 99.360  1.00 20.33 ? 96  ALA B O   1 
ATOM   5239  C CB  . ALA B 1 97  ? 33.400  -18.801 102.226 1.00 21.21 ? 96  ALA B CB  1 
ATOM   5240  N N   . VAL B 1 98  ? 31.189  -16.933 101.122 1.00 22.84 ? 97  VAL B N   1 
ATOM   5241  C CA  . VAL B 1 98  ? 30.719  -15.618 100.687 1.00 21.21 ? 97  VAL B CA  1 
ATOM   5242  C C   . VAL B 1 98  ? 30.895  -14.744 101.914 1.00 21.09 ? 97  VAL B C   1 
ATOM   5243  O O   . VAL B 1 98  ? 30.049  -14.732 102.811 1.00 20.23 ? 97  VAL B O   1 
ATOM   5244  C CB  . VAL B 1 98  ? 29.245  -15.672 100.280 1.00 22.40 ? 97  VAL B CB  1 
ATOM   5245  C CG1 . VAL B 1 98  ? 28.738  -14.259 99.969  1.00 20.17 ? 97  VAL B CG1 1 
ATOM   5246  C CG2 . VAL B 1 98  ? 29.084  -16.594 99.068  1.00 20.70 ? 97  VAL B CG2 1 
ATOM   5247  N N   . LEU B 1 99  ? 32.001  -14.009 101.946 1.00 21.20 ? 98  LEU B N   1 
ATOM   5248  C CA  . LEU B 1 99  ? 32.321  -13.218 103.114 1.00 19.04 ? 98  LEU B CA  1 
ATOM   5249  C C   . LEU B 1 99  ? 32.593  -11.720 103.009 1.00 19.36 ? 98  LEU B C   1 
ATOM   5250  O O   . LEU B 1 99  ? 33.516  -11.220 103.653 1.00 18.79 ? 98  LEU B O   1 
ATOM   5251  C CB  . LEU B 1 99  ? 33.487  -13.903 103.845 1.00 18.20 ? 98  LEU B CB  1 
ATOM   5252  C CG  . LEU B 1 99  ? 33.162  -15.280 104.450 1.00 16.93 ? 98  LEU B CG  1 
ATOM   5253  C CD1 . LEU B 1 99  ? 34.428  -15.936 105.010 1.00 16.35 ? 98  LEU B CD1 1 
ATOM   5254  C CD2 . LEU B 1 99  ? 32.138  -15.101 105.565 1.00 16.76 ? 98  LEU B CD2 1 
ATOM   5255  N N   . HIS B 1 100 ? 31.809  -10.992 102.221 1.00 18.49 ? 99  HIS B N   1 
ATOM   5256  C CA  . HIS B 1 100 ? 32.022  -9.547  102.177 1.00 19.15 ? 99  HIS B CA  1 
ATOM   5257  C C   . HIS B 1 100 ? 31.743  -8.986  103.581 1.00 19.46 ? 99  HIS B C   1 
ATOM   5258  O O   . HIS B 1 100 ? 32.265  -7.935  103.956 1.00 20.89 ? 99  HIS B O   1 
ATOM   5259  C CB  . HIS B 1 100 ? 31.129  -8.873  101.117 1.00 18.13 ? 99  HIS B CB  1 
ATOM   5260  C CG  . HIS B 1 100 ? 29.788  -9.514  100.939 1.00 14.29 ? 99  HIS B CG  1 
ATOM   5261  N ND1 . HIS B 1 100 ? 28.677  -9.141  101.665 1.00 18.28 ? 99  HIS B ND1 1 
ATOM   5262  C CD2 . HIS B 1 100 ? 29.380  -10.508 100.115 1.00 14.60 ? 99  HIS B CD2 1 
ATOM   5263  C CE1 . HIS B 1 100 ? 27.642  -9.875  101.294 1.00 12.78 ? 99  HIS B CE1 1 
ATOM   5264  N NE2 . HIS B 1 100 ? 28.043  -10.713 100.355 1.00 16.01 ? 99  HIS B NE2 1 
ATOM   5265  N N   . VAL B 1 101 ? 30.944  -9.706  104.371 1.00 20.60 ? 100 VAL B N   1 
ATOM   5266  C CA  . VAL B 1 101 ? 30.649  -9.264  105.734 1.00 19.99 ? 100 VAL B CA  1 
ATOM   5267  C C   . VAL B 1 101 ? 31.914  -9.349  106.593 1.00 20.07 ? 100 VAL B C   1 
ATOM   5268  O O   . VAL B 1 101 ? 32.020  -8.690  107.625 1.00 18.87 ? 100 VAL B O   1 
ATOM   5269  C CB  . VAL B 1 101 ? 29.525  -10.112 106.401 1.00 21.30 ? 100 VAL B CB  1 
ATOM   5270  C CG1 . VAL B 1 101 ? 28.193  -9.863  105.697 1.00 21.53 ? 100 VAL B CG1 1 
ATOM   5271  C CG2 . VAL B 1 101 ? 29.881  -11.602 106.357 1.00 23.02 ? 100 VAL B CG2 1 
ATOM   5272  N N   . ALA B 1 102 ? 32.870  -10.169 106.167 1.00 20.02 ? 101 ALA B N   1 
ATOM   5273  C CA  . ALA B 1 102 ? 34.133  -10.303 106.894 1.00 20.55 ? 101 ALA B CA  1 
ATOM   5274  C C   . ALA B 1 102 ? 34.962  -9.050  106.658 1.00 19.87 ? 101 ALA B C   1 
ATOM   5275  O O   . ALA B 1 102 ? 35.655  -8.570  107.553 1.00 19.54 ? 101 ALA B O   1 
ATOM   5276  C CB  . ALA B 1 102 ? 34.900  -11.526 106.407 1.00 19.93 ? 101 ALA B CB  1 
ATOM   5277  N N   . LEU B 1 103 ? 34.880  -8.529  105.438 1.00 18.87 ? 102 LEU B N   1 
ATOM   5278  C CA  . LEU B 1 103 ? 35.614  -7.335  105.042 1.00 18.43 ? 102 LEU B CA  1 
ATOM   5279  C C   . LEU B 1 103 ? 35.351  -6.131  105.945 1.00 19.19 ? 102 LEU B C   1 
ATOM   5280  O O   . LEU B 1 103 ? 36.254  -5.335  106.206 1.00 20.07 ? 102 LEU B O   1 
ATOM   5281  C CB  . LEU B 1 103 ? 35.258  -6.974  103.597 1.00 19.28 ? 102 LEU B CB  1 
ATOM   5282  C CG  . LEU B 1 103 ? 35.581  -8.046  102.556 1.00 19.12 ? 102 LEU B CG  1 
ATOM   5283  C CD1 . LEU B 1 103 ? 35.009  -7.646  101.185 1.00 20.56 ? 102 LEU B CD1 1 
ATOM   5284  C CD2 . LEU B 1 103 ? 37.092  -8.220  102.494 1.00 17.85 ? 102 LEU B CD2 1 
ATOM   5285  N N   . ARG B 1 104 ? 34.115  -5.991  106.416 1.00 19.18 ? 103 ARG B N   1 
ATOM   5286  C CA  . ARG B 1 104 ? 33.774  -4.868  107.282 1.00 19.30 ? 103 ARG B CA  1 
ATOM   5287  C C   . ARG B 1 104 ? 33.473  -5.307  108.719 1.00 20.03 ? 103 ARG B C   1 
ATOM   5288  O O   . ARG B 1 104 ? 32.797  -4.587  109.457 1.00 17.77 ? 103 ARG B O   1 
ATOM   5289  C CB  . ARG B 1 104 ? 32.575  -4.100  106.709 1.00 16.34 ? 103 ARG B CB  1 
ATOM   5290  C CG  . ARG B 1 104 ? 31.276  -4.902  106.640 1.00 17.66 ? 103 ARG B CG  1 
ATOM   5291  C CD  . ARG B 1 104 ? 30.855  -5.185  105.200 1.00 14.66 ? 103 ARG B CD  1 
ATOM   5292  N NE  . ARG B 1 104 ? 29.472  -5.649  105.130 1.00 14.24 ? 103 ARG B NE  1 
ATOM   5293  C CZ  . ARG B 1 104 ? 28.791  -5.811  103.999 1.00 15.38 ? 103 ARG B CZ  1 
ATOM   5294  N NH1 . ARG B 1 104 ? 29.368  -5.552  102.834 1.00 15.26 ? 103 ARG B NH1 1 
ATOM   5295  N NH2 . ARG B 1 104 ? 27.525  -6.205  104.032 1.00 11.69 ? 103 ARG B NH2 1 
ATOM   5296  N N   . ASN B 1 105 ? 33.984  -6.479  109.108 1.00 20.96 ? 104 ASN B N   1 
ATOM   5297  C CA  . ASN B 1 105 ? 33.773  -7.020  110.455 1.00 21.61 ? 104 ASN B CA  1 
ATOM   5298  C C   . ASN B 1 105 ? 34.628  -6.285  111.488 1.00 22.56 ? 104 ASN B C   1 
ATOM   5299  O O   . ASN B 1 105 ? 35.649  -6.794  111.949 1.00 21.86 ? 104 ASN B O   1 
ATOM   5300  C CB  . ASN B 1 105 ? 34.088  -8.518  110.467 1.00 23.60 ? 104 ASN B CB  1 
ATOM   5301  C CG  . ASN B 1 105 ? 33.863  -9.160  111.835 1.00 25.87 ? 104 ASN B CG  1 
ATOM   5302  O OD1 . ASN B 1 105 ? 33.023  -8.716  112.617 1.00 24.83 ? 104 ASN B OD1 1 
ATOM   5303  N ND2 . ASN B 1 105 ? 34.608  -10.226 112.116 1.00 25.43 ? 104 ASN B ND2 1 
ATOM   5304  N N   . ARG B 1 106 ? 34.192  -5.079  111.846 1.00 22.96 ? 105 ARG B N   1 
ATOM   5305  C CA  . ARG B 1 106 ? 34.901  -4.229  112.795 1.00 23.02 ? 105 ARG B CA  1 
ATOM   5306  C C   . ARG B 1 106 ? 35.105  -4.891  114.156 1.00 23.67 ? 105 ARG B C   1 
ATOM   5307  O O   . ARG B 1 106 ? 36.107  -4.654  114.825 1.00 23.91 ? 105 ARG B O   1 
ATOM   5308  C CB  . ARG B 1 106 ? 34.138  -2.913  112.980 1.00 22.73 ? 105 ARG B CB  1 
ATOM   5309  C CG  . ARG B 1 106 ? 33.709  -2.252  111.678 1.00 22.11 ? 105 ARG B CG  1 
ATOM   5310  C CD  . ARG B 1 106 ? 34.887  -2.029  110.748 1.00 22.69 ? 105 ARG B CD  1 
ATOM   5311  N NE  . ARG B 1 106 ? 35.831  -1.056  111.279 1.00 22.19 ? 105 ARG B NE  1 
ATOM   5312  C CZ  . ARG B 1 106 ? 37.062  -0.881  110.814 1.00 24.40 ? 105 ARG B CZ  1 
ATOM   5313  N NH1 . ARG B 1 106 ? 37.508  -1.621  109.804 1.00 23.04 ? 105 ARG B NH1 1 
ATOM   5314  N NH2 . ARG B 1 106 ? 37.848  0.038   111.353 1.00 24.16 ? 105 ARG B NH2 1 
ATOM   5315  N N   . SER B 1 107 ? 34.152  -5.722  114.558 1.00 24.62 ? 106 SER B N   1 
ATOM   5316  C CA  . SER B 1 107 ? 34.225  -6.409  115.840 1.00 25.58 ? 106 SER B CA  1 
ATOM   5317  C C   . SER B 1 107 ? 35.350  -7.439  115.871 1.00 26.73 ? 106 SER B C   1 
ATOM   5318  O O   . SER B 1 107 ? 35.743  -7.910  116.935 1.00 27.28 ? 106 SER B O   1 
ATOM   5319  C CB  . SER B 1 107 ? 32.889  -7.081  116.133 1.00 26.19 ? 106 SER B CB  1 
ATOM   5320  O OG  . SER B 1 107 ? 31.839  -6.125  116.077 1.00 28.94 ? 106 SER B OG  1 
ATOM   5321  N N   . ASN B 1 108 ? 35.865  -7.778  114.696 1.00 26.25 ? 107 ASN B N   1 
ATOM   5322  C CA  . ASN B 1 108 ? 36.950  -8.745  114.561 1.00 28.18 ? 107 ASN B CA  1 
ATOM   5323  C C   . ASN B 1 108 ? 36.682  -10.149 115.088 1.00 28.21 ? 107 ASN B C   1 
ATOM   5324  O O   . ASN B 1 108 ? 37.613  -10.896 115.395 1.00 28.10 ? 107 ASN B O   1 
ATOM   5325  C CB  . ASN B 1 108 ? 38.225  -8.193  115.190 1.00 27.12 ? 107 ASN B CB  1 
ATOM   5326  C CG  . ASN B 1 108 ? 38.845  -7.101  114.349 1.00 30.15 ? 107 ASN B CG  1 
ATOM   5327  O OD1 . ASN B 1 108 ? 38.815  -7.167  113.118 1.00 30.82 ? 107 ASN B OD1 1 
ATOM   5328  N ND2 . ASN B 1 108 ? 39.421  -6.096  115.000 1.00 29.90 ? 107 ASN B ND2 1 
ATOM   5329  N N   . THR B 1 109 ? 35.408  -10.509 115.179 1.00 28.56 ? 108 THR B N   1 
ATOM   5330  C CA  . THR B 1 109 ? 35.029  -11.837 115.635 1.00 28.34 ? 108 THR B CA  1 
ATOM   5331  C C   . THR B 1 109 ? 35.558  -12.845 114.607 1.00 27.55 ? 108 THR B C   1 
ATOM   5332  O O   . THR B 1 109 ? 35.334  -12.697 113.405 1.00 24.56 ? 108 THR B O   1 
ATOM   5333  C CB  . THR B 1 109 ? 33.501  -11.966 115.725 1.00 29.49 ? 108 THR B CB  1 
ATOM   5334  O OG1 . THR B 1 109 ? 32.975  -10.850 116.454 1.00 35.54 ? 108 THR B OG1 1 
ATOM   5335  C CG2 . THR B 1 109 ? 33.117  -13.251 116.448 1.00 33.65 ? 108 THR B CG2 1 
ATOM   5336  N N   . PRO B 1 110 ? 36.259  -13.889 115.069 1.00 27.74 ? 109 PRO B N   1 
ATOM   5337  C CA  . PRO B 1 110 ? 36.797  -14.885 114.138 1.00 26.75 ? 109 PRO B CA  1 
ATOM   5338  C C   . PRO B 1 110 ? 35.790  -15.483 113.165 1.00 25.67 ? 109 PRO B C   1 
ATOM   5339  O O   . PRO B 1 110 ? 34.674  -15.836 113.538 1.00 25.91 ? 109 PRO B O   1 
ATOM   5340  C CB  . PRO B 1 110 ? 37.411  -15.935 115.064 1.00 28.47 ? 109 PRO B CB  1 
ATOM   5341  C CG  . PRO B 1 110 ? 36.603  -15.800 116.328 1.00 30.14 ? 109 PRO B CG  1 
ATOM   5342  C CD  . PRO B 1 110 ? 36.458  -14.310 116.467 1.00 27.29 ? 109 PRO B CD  1 
ATOM   5343  N N   . ILE B 1 111 ? 36.199  -15.571 111.905 1.00 23.79 ? 110 ILE B N   1 
ATOM   5344  C CA  . ILE B 1 111 ? 35.373  -16.151 110.856 1.00 25.63 ? 110 ILE B CA  1 
ATOM   5345  C C   . ILE B 1 111 ? 36.306  -17.100 110.118 1.00 24.55 ? 110 ILE B C   1 
ATOM   5346  O O   . ILE B 1 111 ? 37.219  -16.671 109.416 1.00 25.17 ? 110 ILE B O   1 
ATOM   5347  C CB  . ILE B 1 111 ? 34.833  -15.072 109.891 1.00 24.71 ? 110 ILE B CB  1 
ATOM   5348  C CG1 . ILE B 1 111 ? 33.938  -14.093 110.665 1.00 24.50 ? 110 ILE B CG1 1 
ATOM   5349  C CG2 . ILE B 1 111 ? 34.052  -15.734 108.759 1.00 23.63 ? 110 ILE B CG2 1 
ATOM   5350  C CD1 . ILE B 1 111 ? 33.415  -12.930 109.839 1.00 25.05 ? 110 ILE B CD1 1 
ATOM   5351  N N   . LEU B 1 112 ? 36.061  -18.392 110.281 1.00 24.61 ? 111 LEU B N   1 
ATOM   5352  C CA  . LEU B 1 112 ? 36.909  -19.411 109.689 1.00 26.38 ? 111 LEU B CA  1 
ATOM   5353  C C   . LEU B 1 112 ? 36.524  -19.928 108.310 1.00 26.75 ? 111 LEU B C   1 
ATOM   5354  O O   . LEU B 1 112 ? 35.348  -20.107 107.996 1.00 26.61 ? 111 LEU B O   1 
ATOM   5355  C CB  . LEU B 1 112 ? 37.005  -20.602 110.643 1.00 26.81 ? 111 LEU B CB  1 
ATOM   5356  C CG  . LEU B 1 112 ? 37.072  -20.300 112.142 1.00 28.16 ? 111 LEU B CG  1 
ATOM   5357  C CD1 . LEU B 1 112 ? 37.124  -21.615 112.905 1.00 30.43 ? 111 LEU B CD1 1 
ATOM   5358  C CD2 . LEU B 1 112 ? 38.282  -19.447 112.462 1.00 28.34 ? 111 LEU B CD2 1 
ATOM   5359  N N   . VAL B 1 113 ? 37.546  -20.155 107.491 1.00 26.57 ? 112 VAL B N   1 
ATOM   5360  C CA  . VAL B 1 113 ? 37.382  -20.713 106.157 1.00 26.89 ? 112 VAL B CA  1 
ATOM   5361  C C   . VAL B 1 113 ? 38.487  -21.752 106.039 1.00 27.04 ? 112 VAL B C   1 
ATOM   5362  O O   . VAL B 1 113 ? 39.672  -21.420 106.088 1.00 26.56 ? 112 VAL B O   1 
ATOM   5363  C CB  . VAL B 1 113 ? 37.539  -19.656 105.042 1.00 26.82 ? 112 VAL B CB  1 
ATOM   5364  C CG1 . VAL B 1 113 ? 37.559  -20.343 103.679 1.00 26.17 ? 112 VAL B CG1 1 
ATOM   5365  C CG2 . VAL B 1 113 ? 36.377  -18.681 105.083 1.00 24.99 ? 112 VAL B CG2 1 
ATOM   5366  N N   . ASP B 1 114 ? 38.089  -23.015 105.920 1.00 27.62 ? 113 ASP B N   1 
ATOM   5367  C CA  . ASP B 1 114 ? 39.042  -24.113 105.816 1.00 27.39 ? 113 ASP B CA  1 
ATOM   5368  C C   . ASP B 1 114 ? 39.894  -24.181 107.078 1.00 26.85 ? 113 ASP B C   1 
ATOM   5369  O O   . ASP B 1 114 ? 41.094  -24.448 107.018 1.00 26.34 ? 113 ASP B O   1 
ATOM   5370  C CB  . ASP B 1 114 ? 39.926  -23.927 104.577 1.00 28.69 ? 113 ASP B CB  1 
ATOM   5371  C CG  . ASP B 1 114 ? 39.142  -24.056 103.281 1.00 30.63 ? 113 ASP B CG  1 
ATOM   5372  O OD1 . ASP B 1 114 ? 39.635  -23.589 102.231 1.00 32.94 ? 113 ASP B OD1 1 
ATOM   5373  O OD2 . ASP B 1 114 ? 38.032  -24.634 103.317 1.00 30.07 ? 113 ASP B OD2 1 
ATOM   5374  N N   . GLY B 1 115 ? 39.254  -23.919 108.215 1.00 27.00 ? 114 GLY B N   1 
ATOM   5375  C CA  . GLY B 1 115 ? 39.927  -23.968 109.501 1.00 27.27 ? 114 GLY B CA  1 
ATOM   5376  C C   . GLY B 1 115 ? 40.833  -22.812 109.884 1.00 26.78 ? 114 GLY B C   1 
ATOM   5377  O O   . GLY B 1 115 ? 41.590  -22.930 110.841 1.00 27.17 ? 114 GLY B O   1 
ATOM   5378  N N   . LYS B 1 116 ? 40.761  -21.693 109.168 1.00 26.59 ? 115 LYS B N   1 
ATOM   5379  C CA  . LYS B 1 116 ? 41.621  -20.552 109.473 1.00 24.13 ? 115 LYS B CA  1 
ATOM   5380  C C   . LYS B 1 116 ? 40.855  -19.239 109.558 1.00 25.23 ? 115 LYS B C   1 
ATOM   5381  O O   . LYS B 1 116 ? 40.072  -18.903 108.668 1.00 24.18 ? 115 LYS B O   1 
ATOM   5382  C CB  . LYS B 1 116 ? 42.714  -20.426 108.411 1.00 24.95 ? 115 LYS B CB  1 
ATOM   5383  C CG  . LYS B 1 116 ? 43.659  -19.246 108.602 1.00 27.26 ? 115 LYS B CG  1 
ATOM   5384  C CD  . LYS B 1 116 ? 44.558  -19.082 107.382 1.00 29.09 ? 115 LYS B CD  1 
ATOM   5385  C CE  . LYS B 1 116 ? 45.583  -17.975 107.574 1.00 30.29 ? 115 LYS B CE  1 
ATOM   5386  N NZ  . LYS B 1 116 ? 46.453  -18.249 108.745 1.00 33.94 ? 115 LYS B NZ  1 
ATOM   5387  N N   . ASP B 1 117 ? 41.093  -18.493 110.631 1.00 23.75 ? 116 ASP B N   1 
ATOM   5388  C CA  . ASP B 1 117 ? 40.427  -17.215 110.812 1.00 23.87 ? 116 ASP B CA  1 
ATOM   5389  C C   . ASP B 1 117 ? 40.864  -16.276 109.696 1.00 23.69 ? 116 ASP B C   1 
ATOM   5390  O O   . ASP B 1 117 ? 42.050  -16.071 109.447 1.00 22.78 ? 116 ASP B O   1 
ATOM   5391  C CB  . ASP B 1 117 ? 40.771  -16.610 112.173 1.00 22.48 ? 116 ASP B CB  1 
ATOM   5392  C CG  . ASP B 1 117 ? 40.010  -15.321 112.449 1.00 23.74 ? 116 ASP B CG  1 
ATOM   5393  O OD1 . ASP B 1 117 ? 39.156  -14.932 111.619 1.00 22.01 ? 116 ASP B OD1 1 
ATOM   5394  O OD2 . ASP B 1 117 ? 40.264  -14.700 113.505 1.00 21.08 ? 116 ASP B OD2 1 
ATOM   5395  N N   . VAL B 1 118 ? 39.875  -15.702 109.035 1.00 22.42 ? 117 VAL B N   1 
ATOM   5396  C CA  . VAL B 1 118 ? 40.090  -14.795 107.925 1.00 24.25 ? 117 VAL B CA  1 
ATOM   5397  C C   . VAL B 1 118 ? 40.391  -13.337 108.324 1.00 22.53 ? 117 VAL B C   1 
ATOM   5398  O O   . VAL B 1 118 ? 40.990  -12.586 107.550 1.00 20.77 ? 117 VAL B O   1 
ATOM   5399  C CB  . VAL B 1 118 ? 38.840  -14.858 107.008 1.00 25.26 ? 117 VAL B CB  1 
ATOM   5400  C CG1 . VAL B 1 118 ? 38.399  -13.476 106.601 1.00 28.10 ? 117 VAL B CG1 1 
ATOM   5401  C CG2 . VAL B 1 118 ? 39.131  -15.739 105.806 1.00 23.78 ? 117 VAL B CG2 1 
ATOM   5402  N N   . MET B 1 119 ? 40.000  -12.951 109.536 1.00 21.69 ? 118 MET B N   1 
ATOM   5403  C CA  . MET B 1 119 ? 40.174  -11.575 109.996 1.00 20.19 ? 118 MET B CA  1 
ATOM   5404  C C   . MET B 1 119 ? 41.596  -11.014 110.038 1.00 22.22 ? 118 MET B C   1 
ATOM   5405  O O   . MET B 1 119 ? 41.827  -9.864  109.649 1.00 22.98 ? 118 MET B O   1 
ATOM   5406  C CB  . MET B 1 119 ? 39.497  -11.393 111.357 1.00 20.88 ? 118 MET B CB  1 
ATOM   5407  C CG  . MET B 1 119 ? 37.971  -11.530 111.313 1.00 20.84 ? 118 MET B CG  1 
ATOM   5408  S SD  . MET B 1 119 ? 37.182  -10.682 109.888 1.00 20.60 ? 118 MET B SD  1 
ATOM   5409  C CE  . MET B 1 119 ? 37.631  -8.968  110.199 1.00 12.92 ? 118 MET B CE  1 
ATOM   5410  N N   . PRO B 1 120 ? 42.565  -11.797 110.528 1.00 22.09 ? 119 PRO B N   1 
ATOM   5411  C CA  . PRO B 1 120 ? 43.933  -11.270 110.565 1.00 22.84 ? 119 PRO B CA  1 
ATOM   5412  C C   . PRO B 1 120 ? 44.383  -10.731 109.193 1.00 24.26 ? 119 PRO B C   1 
ATOM   5413  O O   . PRO B 1 120 ? 44.952  -9.640  109.100 1.00 25.82 ? 119 PRO B O   1 
ATOM   5414  C CB  . PRO B 1 120 ? 44.746  -12.477 111.018 1.00 23.38 ? 119 PRO B CB  1 
ATOM   5415  C CG  . PRO B 1 120 ? 43.795  -13.164 111.964 1.00 22.45 ? 119 PRO B CG  1 
ATOM   5416  C CD  . PRO B 1 120 ? 42.476  -13.099 111.214 1.00 21.56 ? 119 PRO B CD  1 
ATOM   5417  N N   . GLU B 1 121 ? 44.124  -11.492 108.134 1.00 23.45 ? 120 GLU B N   1 
ATOM   5418  C CA  . GLU B 1 121 ? 44.497  -11.060 106.787 1.00 24.31 ? 120 GLU B CA  1 
ATOM   5419  C C   . GLU B 1 121 ? 43.665  -9.851  106.354 1.00 22.89 ? 120 GLU B C   1 
ATOM   5420  O O   . GLU B 1 121 ? 44.193  -8.904  105.773 1.00 22.08 ? 120 GLU B O   1 
ATOM   5421  C CB  . GLU B 1 121 ? 44.326  -12.207 105.781 1.00 24.44 ? 120 GLU B CB  1 
ATOM   5422  C CG  . GLU B 1 121 ? 45.439  -13.252 105.837 1.00 29.97 ? 120 GLU B CG  1 
ATOM   5423  C CD  . GLU B 1 121 ? 46.830  -12.646 105.663 1.00 31.79 ? 120 GLU B CD  1 
ATOM   5424  O OE1 . GLU B 1 121 ? 47.122  -12.084 104.586 1.00 33.56 ? 120 GLU B OE1 1 
ATOM   5425  O OE2 . GLU B 1 121 ? 47.636  -12.731 106.612 1.00 36.13 ? 120 GLU B OE2 1 
ATOM   5426  N N   . VAL B 1 122 ? 42.366  -9.881  106.640 1.00 21.60 ? 121 VAL B N   1 
ATOM   5427  C CA  . VAL B 1 122 ? 41.507  -8.760  106.288 1.00 21.28 ? 121 VAL B CA  1 
ATOM   5428  C C   . VAL B 1 122 ? 42.104  -7.480  106.862 1.00 21.18 ? 121 VAL B C   1 
ATOM   5429  O O   . VAL B 1 122 ? 42.243  -6.477  106.161 1.00 20.90 ? 121 VAL B O   1 
ATOM   5430  C CB  . VAL B 1 122 ? 40.080  -8.934  106.858 1.00 22.38 ? 121 VAL B CB  1 
ATOM   5431  C CG1 . VAL B 1 122 ? 39.344  -7.595  106.839 1.00 19.68 ? 121 VAL B CG1 1 
ATOM   5432  C CG2 . VAL B 1 122 ? 39.315  -9.973  106.040 1.00 21.46 ? 121 VAL B CG2 1 
ATOM   5433  N N   . ASN B 1 123 ? 42.464  -7.528  108.142 1.00 22.13 ? 122 ASN B N   1 
ATOM   5434  C CA  . ASN B 1 123 ? 43.038  -6.373  108.824 1.00 22.97 ? 122 ASN B CA  1 
ATOM   5435  C C   . ASN B 1 123 ? 44.453  -6.047  108.368 1.00 22.83 ? 122 ASN B C   1 
ATOM   5436  O O   . ASN B 1 123 ? 44.876  -4.892  108.412 1.00 21.04 ? 122 ASN B O   1 
ATOM   5437  C CB  . ASN B 1 123 ? 43.020  -6.589  110.341 1.00 23.59 ? 122 ASN B CB  1 
ATOM   5438  C CG  . ASN B 1 123 ? 41.617  -6.557  110.910 1.00 25.37 ? 122 ASN B CG  1 
ATOM   5439  O OD1 . ASN B 1 123 ? 40.821  -5.683  110.566 1.00 25.52 ? 122 ASN B OD1 1 
ATOM   5440  N ND2 . ASN B 1 123 ? 41.307  -7.504  111.791 1.00 26.29 ? 122 ASN B ND2 1 
ATOM   5441  N N   . LYS B 1 124 ? 45.192  -7.059  107.937 1.00 22.86 ? 123 LYS B N   1 
ATOM   5442  C CA  . LYS B 1 124 ? 46.547  -6.814  107.470 1.00 25.11 ? 123 LYS B CA  1 
ATOM   5443  C C   . LYS B 1 124 ? 46.458  -5.905  106.248 1.00 25.46 ? 123 LYS B C   1 
ATOM   5444  O O   . LYS B 1 124 ? 47.214  -4.939  106.120 1.00 24.99 ? 123 LYS B O   1 
ATOM   5445  C CB  . LYS B 1 124 ? 47.233  -8.131  107.095 1.00 26.12 ? 123 LYS B CB  1 
ATOM   5446  C CG  . LYS B 1 124 ? 48.668  -7.976  106.601 1.00 29.93 ? 123 LYS B CG  1 
ATOM   5447  C CD  . LYS B 1 124 ? 49.254  -9.330  106.241 1.00 34.11 ? 123 LYS B CD  1 
ATOM   5448  C CE  . LYS B 1 124 ? 50.687  -9.212  105.752 1.00 37.22 ? 123 LYS B CE  1 
ATOM   5449  N NZ  . LYS B 1 124 ? 51.266  -10.560 105.454 1.00 39.59 ? 123 LYS B NZ  1 
ATOM   5450  N N   . VAL B 1 125 ? 45.516  -6.203  105.355 1.00 25.17 ? 124 VAL B N   1 
ATOM   5451  C CA  . VAL B 1 125 ? 45.364  -5.392  104.155 1.00 25.27 ? 124 VAL B CA  1 
ATOM   5452  C C   . VAL B 1 125 ? 44.839  -3.996  104.488 1.00 23.67 ? 124 VAL B C   1 
ATOM   5453  O O   . VAL B 1 125 ? 45.276  -3.012  103.900 1.00 24.57 ? 124 VAL B O   1 
ATOM   5454  C CB  . VAL B 1 125 ? 44.431  -6.069  103.129 1.00 25.01 ? 124 VAL B CB  1 
ATOM   5455  C CG1 . VAL B 1 125 ? 44.311  -5.201  101.884 1.00 24.77 ? 124 VAL B CG1 1 
ATOM   5456  C CG2 . VAL B 1 125 ? 44.982  -7.440  102.753 1.00 24.48 ? 124 VAL B CG2 1 
ATOM   5457  N N   . LEU B 1 126 ? 43.911  -3.906  105.438 1.00 24.72 ? 125 LEU B N   1 
ATOM   5458  C CA  . LEU B 1 126 ? 43.365  -2.608  105.821 1.00 23.55 ? 125 LEU B CA  1 
ATOM   5459  C C   . LEU B 1 126 ? 44.487  -1.716  106.350 1.00 24.32 ? 125 LEU B C   1 
ATOM   5460  O O   . LEU B 1 126 ? 44.575  -0.543  105.986 1.00 23.16 ? 125 LEU B O   1 
ATOM   5461  C CB  . LEU B 1 126 ? 42.256  -2.776  106.868 1.00 20.40 ? 125 LEU B CB  1 
ATOM   5462  C CG  . LEU B 1 126 ? 40.946  -3.339  106.299 1.00 18.94 ? 125 LEU B CG  1 
ATOM   5463  C CD1 . LEU B 1 126 ? 39.955  -3.646  107.418 1.00 16.40 ? 125 LEU B CD1 1 
ATOM   5464  C CD2 . LEU B 1 126 ? 40.354  -2.326  105.323 1.00 19.76 ? 125 LEU B CD2 1 
ATOM   5465  N N   . ASP B 1 127 ? 45.358  -2.274  107.190 1.00 25.42 ? 126 ASP B N   1 
ATOM   5466  C CA  . ASP B 1 127 ? 46.474  -1.497  107.717 1.00 25.47 ? 126 ASP B CA  1 
ATOM   5467  C C   . ASP B 1 127 ? 47.391  -1.025  106.592 1.00 24.81 ? 126 ASP B C   1 
ATOM   5468  O O   . ASP B 1 127 ? 47.911  0.089   106.633 1.00 25.28 ? 126 ASP B O   1 
ATOM   5469  C CB  . ASP B 1 127 ? 47.280  -2.312  108.729 1.00 30.69 ? 126 ASP B CB  1 
ATOM   5470  C CG  . ASP B 1 127 ? 46.480  -2.648  109.970 1.00 33.36 ? 126 ASP B CG  1 
ATOM   5471  O OD1 . ASP B 1 127 ? 45.555  -1.880  110.308 1.00 38.97 ? 126 ASP B OD1 1 
ATOM   5472  O OD2 . ASP B 1 127 ? 46.782  -3.669  110.619 1.00 36.57 ? 126 ASP B OD2 1 
ATOM   5473  N N   . LYS B 1 128 ? 47.597  -1.861  105.578 1.00 25.41 ? 127 LYS B N   1 
ATOM   5474  C CA  . LYS B 1 128 ? 48.455  -1.445  104.476 1.00 24.78 ? 127 LYS B CA  1 
ATOM   5475  C C   . LYS B 1 128 ? 47.779  -0.294  103.736 1.00 23.56 ? 127 LYS B C   1 
ATOM   5476  O O   . LYS B 1 128 ? 48.429  0.679   103.357 1.00 23.04 ? 127 LYS B O   1 
ATOM   5477  C CB  . LYS B 1 128 ? 48.720  -2.599  103.510 1.00 27.43 ? 127 LYS B CB  1 
ATOM   5478  C CG  . LYS B 1 128 ? 49.740  -2.242  102.431 1.00 32.41 ? 127 LYS B CG  1 
ATOM   5479  C CD  . LYS B 1 128 ? 49.896  -3.352  101.397 1.00 37.40 ? 127 LYS B CD  1 
ATOM   5480  C CE  . LYS B 1 128 ? 50.405  -4.638  102.027 1.00 40.88 ? 127 LYS B CE  1 
ATOM   5481  N NZ  . LYS B 1 128 ? 50.523  -5.740  101.026 1.00 44.73 ? 127 LYS B NZ  1 
ATOM   5482  N N   . MET B 1 129 ? 46.468  -0.413  103.539 1.00 23.04 ? 128 MET B N   1 
ATOM   5483  C CA  . MET B 1 129 ? 45.693  0.622   102.861 1.00 22.53 ? 128 MET B CA  1 
ATOM   5484  C C   . MET B 1 129 ? 45.811  1.924   103.638 1.00 21.44 ? 128 MET B C   1 
ATOM   5485  O O   . MET B 1 129 ? 46.065  2.980   103.065 1.00 22.02 ? 128 MET B O   1 
ATOM   5486  C CB  . MET B 1 129 ? 44.217  0.214   102.767 1.00 22.00 ? 128 MET B CB  1 
ATOM   5487  C CG  . MET B 1 129 ? 43.963  -0.995  101.875 1.00 23.20 ? 128 MET B CG  1 
ATOM   5488  S SD  . MET B 1 129 ? 42.238  -1.538  101.889 1.00 20.58 ? 128 MET B SD  1 
ATOM   5489  C CE  . MET B 1 129 ? 41.470  -0.254  100.876 1.00 22.69 ? 128 MET B CE  1 
ATOM   5490  N N   . LYS B 1 130 ? 45.625  1.834   104.951 1.00 22.19 ? 129 LYS B N   1 
ATOM   5491  C CA  . LYS B 1 130 ? 45.709  2.998   105.820 1.00 22.91 ? 129 LYS B CA  1 
ATOM   5492  C C   . LYS B 1 130 ? 47.057  3.699   105.659 1.00 22.10 ? 129 LYS B C   1 
ATOM   5493  O O   . LYS B 1 130 ? 47.114  4.904   105.413 1.00 22.37 ? 129 LYS B O   1 
ATOM   5494  C CB  . LYS B 1 130 ? 45.506  2.570   107.273 1.00 25.34 ? 129 LYS B CB  1 
ATOM   5495  C CG  . LYS B 1 130 ? 45.425  3.719   108.265 1.00 29.01 ? 129 LYS B CG  1 
ATOM   5496  C CD  . LYS B 1 130 ? 45.029  3.206   109.641 1.00 32.54 ? 129 LYS B CD  1 
ATOM   5497  C CE  . LYS B 1 130 ? 44.798  4.348   110.616 1.00 36.08 ? 129 LYS B CE  1 
ATOM   5498  N NZ  . LYS B 1 130 ? 44.296  3.848   111.931 1.00 38.41 ? 129 LYS B NZ  1 
ATOM   5499  N N   . SER B 1 131 ? 48.141  2.944   105.790 1.00 20.69 ? 130 SER B N   1 
ATOM   5500  C CA  . SER B 1 131 ? 49.474  3.514   105.643 1.00 22.21 ? 130 SER B CA  1 
ATOM   5501  C C   . SER B 1 131 ? 49.669  4.163   104.273 1.00 22.62 ? 130 SER B C   1 
ATOM   5502  O O   . SER B 1 131 ? 50.178  5.281   104.183 1.00 22.40 ? 130 SER B O   1 
ATOM   5503  C CB  . SER B 1 131 ? 50.542  2.439   105.860 1.00 24.84 ? 130 SER B CB  1 
ATOM   5504  O OG  . SER B 1 131 ? 51.827  2.909   105.478 1.00 26.97 ? 130 SER B OG  1 
ATOM   5505  N N   . PHE B 1 132 ? 49.260  3.480   103.206 1.00 21.78 ? 131 PHE B N   1 
ATOM   5506  C CA  . PHE B 1 132 ? 49.415  4.042   101.863 1.00 21.21 ? 131 PHE B CA  1 
ATOM   5507  C C   . PHE B 1 132 ? 48.640  5.357   101.694 1.00 21.54 ? 131 PHE B C   1 
ATOM   5508  O O   . PHE B 1 132 ? 49.178  6.335   101.179 1.00 22.65 ? 131 PHE B O   1 
ATOM   5509  C CB  . PHE B 1 132 ? 48.959  3.033   100.804 1.00 20.09 ? 131 PHE B CB  1 
ATOM   5510  C CG  . PHE B 1 132 ? 49.261  3.454   99.390  1.00 21.60 ? 131 PHE B CG  1 
ATOM   5511  C CD1 . PHE B 1 132 ? 50.572  3.483   98.920  1.00 21.91 ? 131 PHE B CD1 1 
ATOM   5512  C CD2 . PHE B 1 132 ? 48.235  3.808   98.520  1.00 20.68 ? 131 PHE B CD2 1 
ATOM   5513  C CE1 . PHE B 1 132 ? 50.852  3.857   97.599  1.00 22.33 ? 131 PHE B CE1 1 
ATOM   5514  C CE2 . PHE B 1 132 ? 48.505  4.183   97.199  1.00 19.73 ? 131 PHE B CE2 1 
ATOM   5515  C CZ  . PHE B 1 132 ? 49.814  4.207   96.738  1.00 20.72 ? 131 PHE B CZ  1 
ATOM   5516  N N   . CYS B 1 133 ? 47.380  5.383   102.126 1.00 22.03 ? 132 CYS B N   1 
ATOM   5517  C CA  . CYS B 1 133 ? 46.567  6.593   102.005 1.00 23.47 ? 132 CYS B CA  1 
ATOM   5518  C C   . CYS B 1 133 ? 47.192  7.741   102.778 1.00 24.26 ? 132 CYS B C   1 
ATOM   5519  O O   . CYS B 1 133 ? 47.225  8.876   102.312 1.00 23.81 ? 132 CYS B O   1 
ATOM   5520  C CB  . CYS B 1 133 ? 45.146  6.338   102.514 1.00 24.34 ? 132 CYS B CB  1 
ATOM   5521  S SG  . CYS B 1 133 ? 44.204  5.222   101.456 1.00 23.88 ? 132 CYS B SG  1 
ATOM   5522  N N   . GLN B 1 134 ? 47.687  7.432   103.969 1.00 26.13 ? 133 GLN B N   1 
ATOM   5523  C CA  . GLN B 1 134 ? 48.339  8.419   104.816 1.00 27.47 ? 133 GLN B CA  1 
ATOM   5524  C C   . GLN B 1 134 ? 49.453  9.096   104.022 1.00 27.09 ? 133 GLN B C   1 
ATOM   5525  O O   . GLN B 1 134 ? 49.478  10.323  103.863 1.00 28.59 ? 133 GLN B O   1 
ATOM   5526  C CB  . GLN B 1 134 ? 48.932  7.714   106.038 1.00 31.54 ? 133 GLN B CB  1 
ATOM   5527  C CG  . GLN B 1 134 ? 49.765  8.583   106.963 1.00 37.06 ? 133 GLN B CG  1 
ATOM   5528  C CD  . GLN B 1 134 ? 50.575  7.750   107.947 1.00 40.40 ? 133 GLN B CD  1 
ATOM   5529  O OE1 . GLN B 1 134 ? 51.575  7.122   107.579 1.00 42.38 ? 133 GLN B OE1 1 
ATOM   5530  N NE2 . GLN B 1 134 ? 50.138  7.727   109.200 1.00 42.05 ? 133 GLN B NE2 1 
ATOM   5531  N N   . ARG B 1 135 ? 50.363  8.276   103.510 1.00 25.58 ? 134 ARG B N   1 
ATOM   5532  C CA  . ARG B 1 135 ? 51.511  8.757   102.748 1.00 27.05 ? 134 ARG B CA  1 
ATOM   5533  C C   . ARG B 1 135 ? 51.178  9.495   101.457 1.00 25.84 ? 134 ARG B C   1 
ATOM   5534  O O   . ARG B 1 135 ? 51.823  10.490  101.127 1.00 25.15 ? 134 ARG B O   1 
ATOM   5535  C CB  . ARG B 1 135 ? 52.445  7.588   102.443 1.00 27.34 ? 134 ARG B CB  1 
ATOM   5536  C CG  . ARG B 1 135 ? 53.137  7.034   103.671 1.00 29.33 ? 134 ARG B CG  1 
ATOM   5537  C CD  . ARG B 1 135 ? 53.965  5.821   103.298 1.00 34.93 ? 134 ARG B CD  1 
ATOM   5538  N NE  . ARG B 1 135 ? 53.119  4.667   103.011 1.00 36.87 ? 134 ARG B NE  1 
ATOM   5539  C CZ  . ARG B 1 135 ? 53.510  3.607   102.310 1.00 40.39 ? 134 ARG B CZ  1 
ATOM   5540  N NH1 . ARG B 1 135 ? 54.741  3.555   101.811 1.00 40.88 ? 134 ARG B NH1 1 
ATOM   5541  N NH2 . ARG B 1 135 ? 52.675  2.591   102.122 1.00 37.75 ? 134 ARG B NH2 1 
ATOM   5542  N N   . VAL B 1 136 ? 50.181  9.014   100.722 1.00 24.62 ? 135 VAL B N   1 
ATOM   5543  C CA  . VAL B 1 136 ? 49.804  9.668   99.476  1.00 23.46 ? 135 VAL B CA  1 
ATOM   5544  C C   . VAL B 1 136 ? 49.132  11.024  99.723  1.00 24.22 ? 135 VAL B C   1 
ATOM   5545  O O   . VAL B 1 136 ? 49.501  12.026  99.105  1.00 21.48 ? 135 VAL B O   1 
ATOM   5546  C CB  . VAL B 1 136 ? 48.853  8.779   98.644  1.00 23.39 ? 135 VAL B CB  1 
ATOM   5547  C CG1 . VAL B 1 136 ? 48.402  9.521   97.395  1.00 20.82 ? 135 VAL B CG1 1 
ATOM   5548  C CG2 . VAL B 1 136 ? 49.560  7.479   98.258  1.00 22.13 ? 135 VAL B CG2 1 
ATOM   5549  N N   . ARG B 1 137 ? 48.167  11.054  100.643 1.00 24.46 ? 136 ARG B N   1 
ATOM   5550  C CA  . ARG B 1 137 ? 47.428  12.280  100.942 1.00 25.96 ? 136 ARG B CA  1 
ATOM   5551  C C   . ARG B 1 137 ? 48.268  13.339  101.638 1.00 26.53 ? 136 ARG B C   1 
ATOM   5552  O O   . ARG B 1 137 ? 48.068  14.530  101.419 1.00 27.99 ? 136 ARG B O   1 
ATOM   5553  C CB  . ARG B 1 137 ? 46.206  11.976  101.817 1.00 25.37 ? 136 ARG B CB  1 
ATOM   5554  C CG  . ARG B 1 137 ? 45.517  10.663  101.506 1.00 27.82 ? 136 ARG B CG  1 
ATOM   5555  C CD  . ARG B 1 137 ? 44.022  10.804  101.422 1.00 25.32 ? 136 ARG B CD  1 
ATOM   5556  N NE  . ARG B 1 137 ? 43.439  11.528  102.547 1.00 25.70 ? 136 ARG B NE  1 
ATOM   5557  C CZ  . ARG B 1 137 ? 42.263  12.142  102.479 1.00 22.72 ? 136 ARG B CZ  1 
ATOM   5558  N NH1 . ARG B 1 137 ? 41.573  12.104  101.349 1.00 23.47 ? 136 ARG B NH1 1 
ATOM   5559  N NH2 . ARG B 1 137 ? 41.782  12.804  103.519 1.00 23.92 ? 136 ARG B NH2 1 
ATOM   5560  N N   . SER B 1 138 ? 49.194  12.905  102.488 1.00 28.47 ? 137 SER B N   1 
ATOM   5561  C CA  . SER B 1 138 ? 50.055  13.830  103.219 1.00 29.57 ? 137 SER B CA  1 
ATOM   5562  C C   . SER B 1 138 ? 51.099  14.430  102.290 1.00 30.85 ? 137 SER B C   1 
ATOM   5563  O O   . SER B 1 138 ? 51.639  15.499  102.562 1.00 32.28 ? 137 SER B O   1 
ATOM   5564  C CB  . SER B 1 138 ? 50.777  13.113  104.361 1.00 30.11 ? 137 SER B CB  1 
ATOM   5565  O OG  . SER B 1 138 ? 51.836  12.312  103.861 1.00 29.00 ? 137 SER B OG  1 
ATOM   5566  N N   . GLY B 1 139 ? 51.387  13.736  101.196 1.00 30.40 ? 138 GLY B N   1 
ATOM   5567  C CA  . GLY B 1 139 ? 52.381  14.237  100.267 1.00 29.99 ? 138 GLY B CA  1 
ATOM   5568  C C   . GLY B 1 139 ? 53.722  13.545  100.435 1.00 29.94 ? 138 GLY B C   1 
ATOM   5569  O O   . GLY B 1 139 ? 54.648  13.803  99.670  1.00 29.72 ? 138 GLY B O   1 
ATOM   5570  N N   . ASP B 1 140 ? 53.833  12.668  101.431 1.00 29.83 ? 139 ASP B N   1 
ATOM   5571  C CA  . ASP B 1 140 ? 55.085  11.946  101.658 1.00 31.93 ? 139 ASP B CA  1 
ATOM   5572  C C   . ASP B 1 140 ? 55.449  11.115  100.435 1.00 30.08 ? 139 ASP B C   1 
ATOM   5573  O O   . ASP B 1 140 ? 56.616  11.039  100.050 1.00 28.53 ? 139 ASP B O   1 
ATOM   5574  C CB  . ASP B 1 140 ? 54.979  11.028  102.878 1.00 35.48 ? 139 ASP B CB  1 
ATOM   5575  C CG  . ASP B 1 140 ? 55.084  11.782  104.190 1.00 39.60 ? 139 ASP B CG  1 
ATOM   5576  O OD1 . ASP B 1 140 ? 55.031  11.124  105.251 1.00 42.63 ? 139 ASP B OD1 1 
ATOM   5577  O OD2 . ASP B 1 140 ? 55.223  13.026  104.164 1.00 42.30 ? 139 ASP B OD2 1 
ATOM   5578  N N   . TRP B 1 141 ? 54.441  10.491  99.834  1.00 28.65 ? 140 TRP B N   1 
ATOM   5579  C CA  . TRP B 1 141 ? 54.643  9.676   98.642  1.00 28.79 ? 140 TRP B CA  1 
ATOM   5580  C C   . TRP B 1 141 ? 54.813  10.605  97.451  1.00 30.18 ? 140 TRP B C   1 
ATOM   5581  O O   . TRP B 1 141 ? 53.921  11.396  97.146  1.00 31.49 ? 140 TRP B O   1 
ATOM   5582  C CB  . TRP B 1 141 ? 53.436  8.769   98.414  1.00 27.84 ? 140 TRP B CB  1 
ATOM   5583  C CG  . TRP B 1 141 ? 53.560  7.899   97.203  1.00 27.04 ? 140 TRP B CG  1 
ATOM   5584  C CD1 . TRP B 1 141 ? 53.481  8.290   95.898  1.00 25.39 ? 140 TRP B CD1 1 
ATOM   5585  C CD2 . TRP B 1 141 ? 53.801  6.487   97.188  1.00 24.18 ? 140 TRP B CD2 1 
ATOM   5586  N NE1 . TRP B 1 141 ? 53.657  7.207   95.069  1.00 26.73 ? 140 TRP B NE1 1 
ATOM   5587  C CE2 . TRP B 1 141 ? 53.856  6.087   95.835  1.00 27.06 ? 140 TRP B CE2 1 
ATOM   5588  C CE3 . TRP B 1 141 ? 53.978  5.521   98.186  1.00 27.13 ? 140 TRP B CE3 1 
ATOM   5589  C CZ2 . TRP B 1 141 ? 54.080  4.758   95.453  1.00 25.27 ? 140 TRP B CZ2 1 
ATOM   5590  C CZ3 . TRP B 1 141 ? 54.202  4.197   97.806  1.00 27.22 ? 140 TRP B CZ3 1 
ATOM   5591  C CH2 . TRP B 1 141 ? 54.250  3.832   96.449  1.00 25.90 ? 140 TRP B CH2 1 
ATOM   5592  N N   . LYS B 1 142 ? 55.948  10.514  96.766  1.00 30.42 ? 141 LYS B N   1 
ATOM   5593  C CA  . LYS B 1 142 ? 56.169  11.392  95.629  1.00 31.61 ? 141 LYS B CA  1 
ATOM   5594  C C   . LYS B 1 142 ? 56.417  10.722  94.283  1.00 30.80 ? 141 LYS B C   1 
ATOM   5595  O O   . LYS B 1 142 ? 56.849  9.570   94.209  1.00 30.65 ? 141 LYS B O   1 
ATOM   5596  C CB  . LYS B 1 142 ? 57.294  12.370  95.964  1.00 33.92 ? 141 LYS B CB  1 
ATOM   5597  C CG  . LYS B 1 142 ? 56.924  13.245  97.152  1.00 35.72 ? 141 LYS B CG  1 
ATOM   5598  C CD  . LYS B 1 142 ? 57.926  14.337  97.417  1.00 38.91 ? 141 LYS B CD  1 
ATOM   5599  C CE  . LYS B 1 142 ? 57.475  15.184  98.596  1.00 37.92 ? 141 LYS B CE  1 
ATOM   5600  N NZ  . LYS B 1 142 ? 57.369  14.367  99.832  1.00 40.58 ? 141 LYS B NZ  1 
ATOM   5601  N N   . GLY B 1 143 ? 56.115  11.462  93.219  1.00 29.10 ? 142 GLY B N   1 
ATOM   5602  C CA  . GLY B 1 143 ? 56.302  10.964  91.868  1.00 29.72 ? 142 GLY B CA  1 
ATOM   5603  C C   . GLY B 1 143 ? 57.762  10.909  91.467  1.00 28.52 ? 142 GLY B C   1 
ATOM   5604  O O   . GLY B 1 143 ? 58.640  11.256  92.259  1.00 29.16 ? 142 GLY B O   1 
ATOM   5605  N N   . TYR B 1 144 ? 58.021  10.496  90.230  1.00 28.59 ? 143 TYR B N   1 
ATOM   5606  C CA  . TYR B 1 144 ? 59.389  10.365  89.745  1.00 27.98 ? 143 TYR B CA  1 
ATOM   5607  C C   . TYR B 1 144 ? 60.185  11.667  89.670  1.00 28.18 ? 143 TYR B C   1 
ATOM   5608  O O   . TYR B 1 144 ? 61.411  11.629  89.556  1.00 29.01 ? 143 TYR B O   1 
ATOM   5609  C CB  . TYR B 1 144 ? 59.421  9.637   88.386  1.00 26.50 ? 143 TYR B CB  1 
ATOM   5610  C CG  . TYR B 1 144 ? 58.997  10.448  87.178  1.00 25.25 ? 143 TYR B CG  1 
ATOM   5611  C CD1 . TYR B 1 144 ? 57.651  10.720  86.923  1.00 25.32 ? 143 TYR B CD1 1 
ATOM   5612  C CD2 . TYR B 1 144 ? 59.948  10.928  86.276  1.00 24.06 ? 143 TYR B CD2 1 
ATOM   5613  C CE1 . TYR B 1 144 ? 57.263  11.451  85.792  1.00 25.31 ? 143 TYR B CE1 1 
ATOM   5614  C CE2 . TYR B 1 144 ? 59.575  11.656  85.148  1.00 24.03 ? 143 TYR B CE2 1 
ATOM   5615  C CZ  . TYR B 1 144 ? 58.234  11.917  84.911  1.00 25.61 ? 143 TYR B CZ  1 
ATOM   5616  O OH  . TYR B 1 144 ? 57.872  12.659  83.806  1.00 27.32 ? 143 TYR B OH  1 
ATOM   5617  N N   . THR B 1 145 ? 59.503  12.810  89.724  1.00 27.50 ? 144 THR B N   1 
ATOM   5618  C CA  . THR B 1 145 ? 60.195  14.099  89.703  1.00 27.22 ? 144 THR B CA  1 
ATOM   5619  C C   . THR B 1 145 ? 60.062  14.779  91.064  1.00 27.25 ? 144 THR B C   1 
ATOM   5620  O O   . THR B 1 145 ? 60.343  15.967  91.207  1.00 27.26 ? 144 THR B O   1 
ATOM   5621  C CB  . THR B 1 145 ? 59.643  15.058  88.627  1.00 27.82 ? 144 THR B CB  1 
ATOM   5622  O OG1 . THR B 1 145 ? 58.263  15.336  88.892  1.00 29.70 ? 144 THR B OG1 1 
ATOM   5623  C CG2 . THR B 1 145 ? 59.796  14.451  87.240  1.00 25.54 ? 144 THR B CG2 1 
ATOM   5624  N N   . GLY B 1 146 ? 59.612  14.019  92.058  1.00 26.65 ? 145 GLY B N   1 
ATOM   5625  C CA  . GLY B 1 146 ? 59.478  14.562  93.397  1.00 26.50 ? 145 GLY B CA  1 
ATOM   5626  C C   . GLY B 1 146 ? 58.213  15.332  93.725  1.00 26.83 ? 145 GLY B C   1 
ATOM   5627  O O   . GLY B 1 146 ? 58.124  15.928  94.794  1.00 27.41 ? 145 GLY B O   1 
ATOM   5628  N N   . LYS B 1 147 ? 57.232  15.336  92.830  1.00 27.61 ? 146 LYS B N   1 
ATOM   5629  C CA  . LYS B 1 147 ? 55.992  16.056  93.106  1.00 28.04 ? 146 LYS B CA  1 
ATOM   5630  C C   . LYS B 1 147 ? 54.980  15.189  93.841  1.00 28.12 ? 146 LYS B C   1 
ATOM   5631  O O   . LYS B 1 147 ? 55.082  13.959  93.844  1.00 27.70 ? 146 LYS B O   1 
ATOM   5632  C CB  . LYS B 1 147 ? 55.372  16.582  91.807  1.00 30.66 ? 146 LYS B CB  1 
ATOM   5633  C CG  . LYS B 1 147 ? 56.170  17.696  91.155  1.00 31.82 ? 146 LYS B CG  1 
ATOM   5634  C CD  . LYS B 1 147 ? 55.450  18.232  89.933  1.00 36.14 ? 146 LYS B CD  1 
ATOM   5635  C CE  . LYS B 1 147 ? 56.298  19.253  89.195  1.00 37.34 ? 146 LYS B CE  1 
ATOM   5636  N NZ  . LYS B 1 147 ? 55.636  19.680  87.927  1.00 40.29 ? 146 LYS B NZ  1 
ATOM   5637  N N   . THR B 1 148 ? 54.006  15.838  94.472  1.00 26.00 ? 147 THR B N   1 
ATOM   5638  C CA  . THR B 1 148 ? 52.967  15.133  95.212  1.00 25.28 ? 147 THR B CA  1 
ATOM   5639  C C   . THR B 1 148 ? 51.850  14.680  94.268  1.00 23.50 ? 147 THR B C   1 
ATOM   5640  O O   . THR B 1 148 ? 51.615  15.295  93.231  1.00 21.61 ? 147 THR B O   1 
ATOM   5641  C CB  . THR B 1 148 ? 52.362  16.038  96.302  1.00 26.95 ? 147 THR B CB  1 
ATOM   5642  O OG1 . THR B 1 148 ? 51.710  17.153  95.681  1.00 28.85 ? 147 THR B OG1 1 
ATOM   5643  C CG2 . THR B 1 148 ? 53.456  16.549  97.242  1.00 23.90 ? 147 THR B CG2 1 
ATOM   5644  N N   . ILE B 1 149 ? 51.169  13.596  94.626  1.00 21.71 ? 148 ILE B N   1 
ATOM   5645  C CA  . ILE B 1 149 ? 50.085  13.077  93.799  1.00 21.69 ? 148 ILE B CA  1 
ATOM   5646  C C   . ILE B 1 149 ? 48.842  13.968  93.849  1.00 20.07 ? 148 ILE B C   1 
ATOM   5647  O O   . ILE B 1 149 ? 48.312  14.239  94.920  1.00 18.91 ? 148 ILE B O   1 
ATOM   5648  C CB  . ILE B 1 149 ? 49.681  11.650  94.235  1.00 21.46 ? 148 ILE B CB  1 
ATOM   5649  C CG1 . ILE B 1 149 ? 50.876  10.704  94.083  1.00 20.11 ? 148 ILE B CG1 1 
ATOM   5650  C CG2 . ILE B 1 149 ? 48.500  11.165  93.407  1.00 19.66 ? 148 ILE B CG2 1 
ATOM   5651  C CD1 . ILE B 1 149 ? 51.482  10.690  92.689  1.00 19.35 ? 148 ILE B CD1 1 
ATOM   5652  N N   . THR B 1 150 ? 48.388  14.413  92.681  1.00 19.70 ? 149 THR B N   1 
ATOM   5653  C CA  . THR B 1 150 ? 47.203  15.266  92.575  1.00 21.39 ? 149 THR B CA  1 
ATOM   5654  C C   . THR B 1 150 ? 46.023  14.488  91.979  1.00 21.45 ? 149 THR B C   1 
ATOM   5655  O O   . THR B 1 150 ? 44.863  14.835  92.193  1.00 21.90 ? 149 THR B O   1 
ATOM   5656  C CB  . THR B 1 150 ? 47.469  16.480  91.674  1.00 21.19 ? 149 THR B CB  1 
ATOM   5657  O OG1 . THR B 1 150 ? 47.807  16.021  90.357  1.00 20.55 ? 149 THR B OG1 1 
ATOM   5658  C CG2 . THR B 1 150 ? 48.619  17.326  92.236  1.00 20.60 ? 149 THR B CG2 1 
ATOM   5659  N N   . ASP B 1 151 ? 46.325  13.431  91.233  1.00 21.01 ? 150 ASP B N   1 
ATOM   5660  C CA  . ASP B 1 151 ? 45.274  12.631  90.624  1.00 21.65 ? 150 ASP B CA  1 
ATOM   5661  C C   . ASP B 1 151 ? 45.483  11.135  90.806  1.00 22.04 ? 150 ASP B C   1 
ATOM   5662  O O   . ASP B 1 151 ? 46.597  10.625  90.668  1.00 21.77 ? 150 ASP B O   1 
ATOM   5663  C CB  . ASP B 1 151 ? 45.158  12.942  89.129  1.00 19.76 ? 150 ASP B CB  1 
ATOM   5664  C CG  . ASP B 1 151 ? 44.777  14.391  88.857  1.00 22.64 ? 150 ASP B CG  1 
ATOM   5665  O OD1 . ASP B 1 151 ? 45.678  15.256  88.832  1.00 19.32 ? 150 ASP B OD1 1 
ATOM   5666  O OD2 . ASP B 1 151 ? 43.568  14.666  88.675  1.00 23.88 ? 150 ASP B OD2 1 
ATOM   5667  N N   . VAL B 1 152 ? 44.390  10.444  91.109  1.00 20.95 ? 151 VAL B N   1 
ATOM   5668  C CA  . VAL B 1 152 ? 44.392  9.001   91.295  1.00 21.34 ? 151 VAL B CA  1 
ATOM   5669  C C   . VAL B 1 152 ? 43.491  8.424   90.211  1.00 21.17 ? 151 VAL B C   1 
ATOM   5670  O O   . VAL B 1 152 ? 42.333  8.825   90.090  1.00 23.65 ? 151 VAL B O   1 
ATOM   5671  C CB  . VAL B 1 152 ? 43.816  8.608   92.673  1.00 21.48 ? 151 VAL B CB  1 
ATOM   5672  C CG1 . VAL B 1 152 ? 43.687  7.095   92.771  1.00 20.62 ? 151 VAL B CG1 1 
ATOM   5673  C CG2 . VAL B 1 152 ? 44.713  9.137   93.784  1.00 21.07 ? 151 VAL B CG2 1 
ATOM   5674  N N   . ILE B 1 153 ? 44.015  7.496   89.419  1.00 20.00 ? 152 ILE B N   1 
ATOM   5675  C CA  . ILE B 1 153 ? 43.226  6.894   88.356  1.00 19.36 ? 152 ILE B CA  1 
ATOM   5676  C C   . ILE B 1 153 ? 42.985  5.411   88.602  1.00 19.54 ? 152 ILE B C   1 
ATOM   5677  O O   . ILE B 1 153 ? 43.925  4.610   88.630  1.00 19.18 ? 152 ILE B O   1 
ATOM   5678  C CB  . ILE B 1 153 ? 43.902  7.057   86.968  1.00 20.53 ? 152 ILE B CB  1 
ATOM   5679  C CG1 . ILE B 1 153 ? 44.166  8.541   86.678  1.00 20.08 ? 152 ILE B CG1 1 
ATOM   5680  C CG2 . ILE B 1 153 ? 43.010  6.458   85.876  1.00 16.32 ? 152 ILE B CG2 1 
ATOM   5681  C CD1 . ILE B 1 153 ? 45.471  9.059   87.273  1.00 20.72 ? 152 ILE B CD1 1 
ATOM   5682  N N   . ASN B 1 154 ? 41.717  5.055   88.785  1.00 17.79 ? 153 ASN B N   1 
ATOM   5683  C CA  . ASN B 1 154 ? 41.345  3.670   89.012  1.00 18.96 ? 153 ASN B CA  1 
ATOM   5684  C C   . ASN B 1 154 ? 41.068  3.046   87.655  1.00 18.75 ? 153 ASN B C   1 
ATOM   5685  O O   . ASN B 1 154 ? 40.379  3.634   86.823  1.00 19.37 ? 153 ASN B O   1 
ATOM   5686  C CB  . ASN B 1 154 ? 40.094  3.583   89.897  1.00 19.87 ? 153 ASN B CB  1 
ATOM   5687  C CG  . ASN B 1 154 ? 39.828  2.169   90.405  1.00 21.31 ? 153 ASN B CG  1 
ATOM   5688  O OD1 . ASN B 1 154 ? 39.024  1.422   89.837  1.00 22.09 ? 153 ASN B OD1 1 
ATOM   5689  N ND2 . ASN B 1 154 ? 40.512  1.795   91.477  1.00 20.09 ? 153 ASN B ND2 1 
ATOM   5690  N N   . ILE B 1 155 ? 41.637  1.870   87.419  1.00 17.48 ? 154 ILE B N   1 
ATOM   5691  C CA  . ILE B 1 155 ? 41.422  1.168   86.164  1.00 18.35 ? 154 ILE B CA  1 
ATOM   5692  C C   . ILE B 1 155 ? 40.932  -0.240  86.491  1.00 19.42 ? 154 ILE B C   1 
ATOM   5693  O O   . ILE B 1 155 ? 41.662  -1.052  87.054  1.00 17.12 ? 154 ILE B O   1 
ATOM   5694  C CB  . ILE B 1 155 ? 42.717  1.070   85.326  1.00 19.77 ? 154 ILE B CB  1 
ATOM   5695  C CG1 . ILE B 1 155 ? 43.253  2.476   85.019  1.00 19.55 ? 154 ILE B CG1 1 
ATOM   5696  C CG2 . ILE B 1 155 ? 42.436  0.308   84.036  1.00 15.70 ? 154 ILE B CG2 1 
ATOM   5697  C CD1 . ILE B 1 155 ? 44.539  2.495   84.199  1.00 18.19 ? 154 ILE B CD1 1 
ATOM   5698  N N   . GLY B 1 156 ? 39.679  -0.510  86.153  1.00 19.05 ? 155 GLY B N   1 
ATOM   5699  C CA  . GLY B 1 156 ? 39.102  -1.815  86.415  1.00 19.64 ? 155 GLY B CA  1 
ATOM   5700  C C   . GLY B 1 156 ? 37.745  -1.861  85.751  1.00 19.14 ? 155 GLY B C   1 
ATOM   5701  O O   . GLY B 1 156 ? 37.262  -0.833  85.276  1.00 18.97 ? 155 GLY B O   1 
ATOM   5702  N N   . ILE B 1 157 ? 37.133  -3.039  85.713  1.00 18.13 ? 156 ILE B N   1 
ATOM   5703  C CA  . ILE B 1 157 ? 35.820  -3.204  85.095  1.00 20.54 ? 156 ILE B CA  1 
ATOM   5704  C C   . ILE B 1 157 ? 34.824  -3.795  86.091  1.00 19.76 ? 156 ILE B C   1 
ATOM   5705  O O   . ILE B 1 157 ? 35.211  -4.306  87.146  1.00 21.05 ? 156 ILE B O   1 
ATOM   5706  C CB  . ILE B 1 157 ? 35.889  -4.151  83.872  1.00 21.69 ? 156 ILE B CB  1 
ATOM   5707  C CG1 . ILE B 1 157 ? 36.389  -5.530  84.319  1.00 23.95 ? 156 ILE B CG1 1 
ATOM   5708  C CG2 . ILE B 1 157 ? 36.804  -3.569  82.807  1.00 21.68 ? 156 ILE B CG2 1 
ATOM   5709  C CD1 . ILE B 1 157 ? 36.386  -6.584  83.229  1.00 26.51 ? 156 ILE B CD1 1 
ATOM   5710  N N   . GLY B 1 158 ? 33.543  -3.724  85.736  1.00 20.55 ? 157 GLY B N   1 
ATOM   5711  C CA  . GLY B 1 158 ? 32.481  -4.253  86.574  1.00 20.86 ? 157 GLY B CA  1 
ATOM   5712  C C   . GLY B 1 158 ? 32.607  -3.955  88.056  1.00 20.86 ? 157 GLY B C   1 
ATOM   5713  O O   . GLY B 1 158 ? 32.564  -2.798  88.479  1.00 18.64 ? 157 GLY B O   1 
ATOM   5714  N N   . GLY B 1 159 ? 32.760  -5.012  88.845  1.00 20.69 ? 158 GLY B N   1 
ATOM   5715  C CA  . GLY B 1 159 ? 32.884  -4.855  90.283  1.00 21.51 ? 158 GLY B CA  1 
ATOM   5716  C C   . GLY B 1 159 ? 34.110  -4.101  90.773  1.00 20.95 ? 158 GLY B C   1 
ATOM   5717  O O   . GLY B 1 159 ? 34.131  -3.642  91.914  1.00 22.30 ? 158 GLY B O   1 
ATOM   5718  N N   . SER B 1 160 ? 35.134  -3.976  89.935  1.00 21.12 ? 159 SER B N   1 
ATOM   5719  C CA  . SER B 1 160 ? 36.350  -3.261  90.336  1.00 21.46 ? 159 SER B CA  1 
ATOM   5720  C C   . SER B 1 160 ? 36.286  -1.784  89.926  1.00 21.46 ? 159 SER B C   1 
ATOM   5721  O O   . SER B 1 160 ? 37.280  -1.065  90.013  1.00 20.85 ? 159 SER B O   1 
ATOM   5722  C CB  . SER B 1 160 ? 37.594  -3.912  89.710  1.00 20.85 ? 159 SER B CB  1 
ATOM   5723  O OG  . SER B 1 160 ? 37.738  -5.270  90.110  1.00 23.68 ? 159 SER B OG  1 
ATOM   5724  N N   . ASP B 1 161 ? 35.111  -1.341  89.488  1.00 18.73 ? 160 ASP B N   1 
ATOM   5725  C CA  . ASP B 1 161 ? 34.920  0.039   89.059  1.00 19.86 ? 160 ASP B CA  1 
ATOM   5726  C C   . ASP B 1 161 ? 33.665  0.689   89.653  1.00 19.98 ? 160 ASP B C   1 
ATOM   5727  O O   . ASP B 1 161 ? 33.742  1.728   90.314  1.00 21.17 ? 160 ASP B O   1 
ATOM   5728  C CB  . ASP B 1 161 ? 34.847  0.093   87.520  1.00 19.41 ? 160 ASP B CB  1 
ATOM   5729  C CG  . ASP B 1 161 ? 34.260  1.402   86.999  1.00 20.46 ? 160 ASP B CG  1 
ATOM   5730  O OD1 . ASP B 1 161 ? 34.970  2.433   86.984  1.00 21.54 ? 160 ASP B OD1 1 
ATOM   5731  O OD2 . ASP B 1 161 ? 33.072  1.400   86.613  1.00 22.57 ? 160 ASP B OD2 1 
ATOM   5732  N N   . LEU B 1 162 ? 32.520  0.055   89.415  1.00 19.99 ? 161 LEU B N   1 
ATOM   5733  C CA  . LEU B 1 162 ? 31.215  0.549   89.847  1.00 21.26 ? 161 LEU B CA  1 
ATOM   5734  C C   . LEU B 1 162 ? 31.082  0.970   91.306  1.00 20.02 ? 161 LEU B C   1 
ATOM   5735  O O   . LEU B 1 162 ? 30.580  2.059   91.592  1.00 20.49 ? 161 LEU B O   1 
ATOM   5736  C CB  . LEU B 1 162 ? 30.147  -0.492  89.520  1.00 23.37 ? 161 LEU B CB  1 
ATOM   5737  C CG  . LEU B 1 162 ? 28.998  -0.065  88.607  1.00 27.89 ? 161 LEU B CG  1 
ATOM   5738  C CD1 . LEU B 1 162 ? 28.216  1.055   89.258  1.00 30.89 ? 161 LEU B CD1 1 
ATOM   5739  C CD2 . LEU B 1 162 ? 29.548  0.378   87.271  1.00 30.53 ? 161 LEU B CD2 1 
ATOM   5740  N N   . GLY B 1 163 ? 31.513  0.106   92.220  1.00 17.90 ? 162 GLY B N   1 
ATOM   5741  C CA  . GLY B 1 163 ? 31.431  0.411   93.639  1.00 17.83 ? 162 GLY B CA  1 
ATOM   5742  C C   . GLY B 1 163 ? 32.189  1.669   94.022  1.00 18.89 ? 162 GLY B C   1 
ATOM   5743  O O   . GLY B 1 163 ? 31.585  2.632   94.502  1.00 16.72 ? 162 GLY B O   1 
ATOM   5744  N N   . PRO B 1 164 ? 33.522  1.691   93.825  1.00 18.00 ? 163 PRO B N   1 
ATOM   5745  C CA  . PRO B 1 164 ? 34.358  2.850   94.154  1.00 17.26 ? 163 PRO B CA  1 
ATOM   5746  C C   . PRO B 1 164 ? 33.847  4.135   93.498  1.00 17.78 ? 163 PRO B C   1 
ATOM   5747  O O   . PRO B 1 164 ? 33.826  5.193   94.124  1.00 16.33 ? 163 PRO B O   1 
ATOM   5748  C CB  . PRO B 1 164 ? 35.737  2.440   93.632  1.00 17.85 ? 163 PRO B CB  1 
ATOM   5749  C CG  . PRO B 1 164 ? 35.730  0.947   93.818  1.00 19.03 ? 163 PRO B CG  1 
ATOM   5750  C CD  . PRO B 1 164 ? 34.346  0.570   93.334  1.00 19.00 ? 163 PRO B CD  1 
ATOM   5751  N N   . LEU B 1 165 ? 33.431  4.032   92.237  1.00 18.50 ? 164 LEU B N   1 
ATOM   5752  C CA  . LEU B 1 165 ? 32.921  5.184   91.508  1.00 18.72 ? 164 LEU B CA  1 
ATOM   5753  C C   . LEU B 1 165 ? 31.653  5.720   92.175  1.00 19.61 ? 164 LEU B C   1 
ATOM   5754  O O   . LEU B 1 165 ? 31.573  6.903   92.503  1.00 17.67 ? 164 LEU B O   1 
ATOM   5755  C CB  . LEU B 1 165 ? 32.649  4.799   90.044  1.00 19.60 ? 164 LEU B CB  1 
ATOM   5756  C CG  . LEU B 1 165 ? 32.041  5.837   89.092  1.00 21.43 ? 164 LEU B CG  1 
ATOM   5757  C CD1 . LEU B 1 165 ? 30.553  6.009   89.376  1.00 21.19 ? 164 LEU B CD1 1 
ATOM   5758  C CD2 . LEU B 1 165 ? 32.778  7.162   89.238  1.00 23.83 ? 164 LEU B CD2 1 
ATOM   5759  N N   . MET B 1 166 ? 30.668  4.848   92.381  1.00 18.07 ? 165 MET B N   1 
ATOM   5760  C CA  . MET B 1 166 ? 29.413  5.254   93.016  1.00 18.32 ? 165 MET B CA  1 
ATOM   5761  C C   . MET B 1 166 ? 29.643  5.858   94.399  1.00 18.01 ? 165 MET B C   1 
ATOM   5762  O O   . MET B 1 166 ? 29.043  6.878   94.747  1.00 19.59 ? 165 MET B O   1 
ATOM   5763  C CB  . MET B 1 166 ? 28.463  4.053   93.134  1.00 17.99 ? 165 MET B CB  1 
ATOM   5764  C CG  . MET B 1 166 ? 27.107  4.347   93.802  1.00 18.78 ? 165 MET B CG  1 
ATOM   5765  S SD  . MET B 1 166 ? 27.148  4.347   95.624  1.00 19.77 ? 165 MET B SD  1 
ATOM   5766  C CE  . MET B 1 166 ? 27.188  2.568   95.952  1.00 18.98 ? 165 MET B CE  1 
ATOM   5767  N N   . VAL B 1 167 ? 30.523  5.244   95.181  1.00 18.46 ? 166 VAL B N   1 
ATOM   5768  C CA  . VAL B 1 167 ? 30.795  5.735   96.531  1.00 18.76 ? 166 VAL B CA  1 
ATOM   5769  C C   . VAL B 1 167 ? 31.533  7.075   96.558  1.00 17.63 ? 166 VAL B C   1 
ATOM   5770  O O   . VAL B 1 167 ? 31.151  7.971   97.313  1.00 17.64 ? 166 VAL B O   1 
ATOM   5771  C CB  . VAL B 1 167 ? 31.573  4.679   97.367  1.00 20.24 ? 166 VAL B CB  1 
ATOM   5772  C CG1 . VAL B 1 167 ? 31.829  5.198   98.769  1.00 20.78 ? 166 VAL B CG1 1 
ATOM   5773  C CG2 . VAL B 1 167 ? 30.765  3.385   97.444  1.00 19.14 ? 166 VAL B CG2 1 
ATOM   5774  N N   . THR B 1 168 ? 32.577  7.230   95.748  1.00 16.38 ? 167 THR B N   1 
ATOM   5775  C CA  . THR B 1 168 ? 33.300  8.502   95.732  1.00 18.08 ? 167 THR B CA  1 
ATOM   5776  C C   . THR B 1 168 ? 32.389  9.621   95.220  1.00 18.39 ? 167 THR B C   1 
ATOM   5777  O O   . THR B 1 168 ? 32.489  10.760  95.659  1.00 19.75 ? 167 THR B O   1 
ATOM   5778  C CB  . THR B 1 168 ? 34.598  8.441   94.865  1.00 17.55 ? 167 THR B CB  1 
ATOM   5779  O OG1 . THR B 1 168 ? 34.299  7.929   93.558  1.00 16.43 ? 167 THR B OG1 1 
ATOM   5780  C CG2 . THR B 1 168 ? 35.647  7.564   95.547  1.00 16.67 ? 167 THR B CG2 1 
ATOM   5781  N N   . GLU B 1 169 ? 31.500  9.295   94.289  1.00 18.54 ? 168 GLU B N   1 
ATOM   5782  C CA  . GLU B 1 169 ? 30.561  10.284  93.776  1.00 19.50 ? 168 GLU B CA  1 
ATOM   5783  C C   . GLU B 1 169 ? 29.591  10.691  94.891  1.00 18.92 ? 168 GLU B C   1 
ATOM   5784  O O   . GLU B 1 169 ? 29.297  11.877  95.079  1.00 18.10 ? 168 GLU B O   1 
ATOM   5785  C CB  . GLU B 1 169 ? 29.779  9.709   92.595  1.00 19.13 ? 168 GLU B CB  1 
ATOM   5786  C CG  . GLU B 1 169 ? 30.562  9.686   91.292  1.00 17.14 ? 168 GLU B CG  1 
ATOM   5787  C CD  . GLU B 1 169 ? 30.922  11.083  90.846  1.00 18.50 ? 168 GLU B CD  1 
ATOM   5788  O OE1 . GLU B 1 169 ? 32.129  11.389  90.738  1.00 19.26 ? 168 GLU B OE1 1 
ATOM   5789  O OE2 . GLU B 1 169 ? 29.990  11.879  90.615  1.00 17.09 ? 168 GLU B OE2 1 
ATOM   5790  N N   . ALA B 1 170 ? 29.108  9.701   95.637  1.00 17.26 ? 169 ALA B N   1 
ATOM   5791  C CA  . ALA B 1 170 ? 28.163  9.949   96.725  1.00 18.12 ? 169 ALA B CA  1 
ATOM   5792  C C   . ALA B 1 170 ? 28.777  10.687  97.910  1.00 18.48 ? 169 ALA B C   1 
ATOM   5793  O O   . ALA B 1 170 ? 28.082  11.427  98.610  1.00 19.08 ? 169 ALA B O   1 
ATOM   5794  C CB  . ALA B 1 170 ? 27.551  8.631   97.210  1.00 18.48 ? 169 ALA B CB  1 
ATOM   5795  N N   . LEU B 1 171 ? 30.074  10.490  98.133  1.00 17.35 ? 170 LEU B N   1 
ATOM   5796  C CA  . LEU B 1 171 ? 30.752  11.121  99.260  1.00 18.71 ? 170 LEU B CA  1 
ATOM   5797  C C   . LEU B 1 171 ? 31.714  12.226  98.832  1.00 18.06 ? 170 LEU B C   1 
ATOM   5798  O O   . LEU B 1 171 ? 32.670  12.538  99.542  1.00 18.06 ? 170 LEU B O   1 
ATOM   5799  C CB  . LEU B 1 171 ? 31.504  10.059  100.077 1.00 17.44 ? 170 LEU B CB  1 
ATOM   5800  C CG  . LEU B 1 171 ? 30.651  8.848   100.505 1.00 19.71 ? 170 LEU B CG  1 
ATOM   5801  C CD1 . LEU B 1 171 ? 31.524  7.811   101.194 1.00 17.13 ? 170 LEU B CD1 1 
ATOM   5802  C CD2 . LEU B 1 171 ? 29.525  9.296   101.430 1.00 16.35 ? 170 LEU B CD2 1 
ATOM   5803  N N   . LYS B 1 172 ? 31.449  12.823  97.675  1.00 17.68 ? 171 LYS B N   1 
ATOM   5804  C CA  . LYS B 1 172 ? 32.297  13.893  97.158  1.00 22.10 ? 171 LYS B CA  1 
ATOM   5805  C C   . LYS B 1 172 ? 32.586  14.970  98.219  1.00 21.84 ? 171 LYS B C   1 
ATOM   5806  O O   . LYS B 1 172 ? 33.707  15.465  98.317  1.00 22.68 ? 171 LYS B O   1 
ATOM   5807  C CB  . LYS B 1 172 ? 31.645  14.522  95.917  1.00 21.67 ? 171 LYS B CB  1 
ATOM   5808  C CG  . LYS B 1 172 ? 32.572  15.403  95.091  1.00 25.42 ? 171 LYS B CG  1 
ATOM   5809  C CD  . LYS B 1 172 ? 33.806  14.634  94.587  1.00 27.99 ? 171 LYS B CD  1 
ATOM   5810  C CE  . LYS B 1 172 ? 33.420  13.461  93.687  1.00 28.07 ? 171 LYS B CE  1 
ATOM   5811  N NZ  . LYS B 1 172 ? 34.606  12.727  93.158  1.00 26.48 ? 171 LYS B NZ  1 
ATOM   5812  N N   . PRO B 1 173 ? 31.583  15.335  99.038  1.00 23.06 ? 172 PRO B N   1 
ATOM   5813  C CA  . PRO B 1 173 ? 31.795  16.356  100.074 1.00 24.15 ? 172 PRO B CA  1 
ATOM   5814  C C   . PRO B 1 173 ? 32.876  16.019  101.099 1.00 23.96 ? 172 PRO B C   1 
ATOM   5815  O O   . PRO B 1 173 ? 33.397  16.907  101.773 1.00 24.69 ? 172 PRO B O   1 
ATOM   5816  C CB  . PRO B 1 173 ? 30.429  16.461  100.747 1.00 25.42 ? 172 PRO B CB  1 
ATOM   5817  C CG  . PRO B 1 173 ? 29.486  16.088  99.667  1.00 25.65 ? 172 PRO B CG  1 
ATOM   5818  C CD  . PRO B 1 173 ? 30.169  14.927  99.000  1.00 22.84 ? 172 PRO B CD  1 
ATOM   5819  N N   . TYR B 1 174 ? 33.207  14.740  101.231 1.00 22.46 ? 173 TYR B N   1 
ATOM   5820  C CA  . TYR B 1 174 ? 34.204  14.333  102.214 1.00 21.20 ? 173 TYR B CA  1 
ATOM   5821  C C   . TYR B 1 174 ? 35.611  14.177  101.635 1.00 21.03 ? 173 TYR B C   1 
ATOM   5822  O O   . TYR B 1 174 ? 36.514  13.695  102.313 1.00 19.32 ? 173 TYR B O   1 
ATOM   5823  C CB  . TYR B 1 174 ? 33.763  13.023  102.880 1.00 21.37 ? 173 TYR B CB  1 
ATOM   5824  C CG  . TYR B 1 174 ? 32.426  13.126  103.592 1.00 18.16 ? 173 TYR B CG  1 
ATOM   5825  C CD1 . TYR B 1 174 ? 31.224  13.011  102.887 1.00 16.30 ? 173 TYR B CD1 1 
ATOM   5826  C CD2 . TYR B 1 174 ? 32.366  13.390  104.964 1.00 18.60 ? 173 TYR B CD2 1 
ATOM   5827  C CE1 . TYR B 1 174 ? 29.995  13.158  103.528 1.00 17.44 ? 173 TYR B CE1 1 
ATOM   5828  C CE2 . TYR B 1 174 ? 31.136  13.543  105.620 1.00 16.80 ? 173 TYR B CE2 1 
ATOM   5829  C CZ  . TYR B 1 174 ? 29.959  13.428  104.895 1.00 16.31 ? 173 TYR B CZ  1 
ATOM   5830  O OH  . TYR B 1 174 ? 28.750  13.590  105.527 1.00 17.69 ? 173 TYR B OH  1 
ATOM   5831  N N   . SER B 1 175 ? 35.792  14.615  100.394 1.00 21.01 ? 174 SER B N   1 
ATOM   5832  C CA  . SER B 1 175 ? 37.072  14.499  99.701  1.00 24.31 ? 174 SER B CA  1 
ATOM   5833  C C   . SER B 1 175 ? 38.020  15.692  99.837  1.00 27.00 ? 174 SER B C   1 
ATOM   5834  O O   . SER B 1 175 ? 39.067  15.724  99.191  1.00 25.05 ? 174 SER B O   1 
ATOM   5835  C CB  . SER B 1 175 ? 36.822  14.258  98.217  1.00 22.46 ? 174 SER B CB  1 
ATOM   5836  O OG  . SER B 1 175 ? 36.182  15.382  97.645  1.00 18.28 ? 174 SER B OG  1 
ATOM   5837  N N   . SER B 1 176 ? 37.663  16.675  100.658 1.00 29.69 ? 175 SER B N   1 
ATOM   5838  C CA  . SER B 1 176 ? 38.526  17.844  100.819 1.00 31.26 ? 175 SER B CA  1 
ATOM   5839  C C   . SER B 1 176 ? 39.900  17.429  101.319 1.00 30.20 ? 175 SER B C   1 
ATOM   5840  O O   . SER B 1 176 ? 40.019  16.725  102.319 1.00 31.49 ? 175 SER B O   1 
ATOM   5841  C CB  . SER B 1 176 ? 37.906  18.840  101.799 1.00 33.78 ? 175 SER B CB  1 
ATOM   5842  O OG  . SER B 1 176 ? 38.778  19.933  102.024 1.00 37.93 ? 175 SER B OG  1 
ATOM   5843  N N   . GLY B 1 177 ? 40.938  17.856  100.610 1.00 30.41 ? 176 GLY B N   1 
ATOM   5844  C CA  . GLY B 1 177 ? 42.286  17.511  101.015 1.00 30.80 ? 176 GLY B CA  1 
ATOM   5845  C C   . GLY B 1 177 ? 42.794  16.246  100.352 1.00 32.28 ? 176 GLY B C   1 
ATOM   5846  O O   . GLY B 1 177 ? 43.957  15.866  100.522 1.00 33.36 ? 176 GLY B O   1 
ATOM   5847  N N   . GLY B 1 178 ? 41.922  15.581  99.604  1.00 29.63 ? 177 GLY B N   1 
ATOM   5848  C CA  . GLY B 1 178 ? 42.327  14.369  98.924  1.00 27.58 ? 177 GLY B CA  1 
ATOM   5849  C C   . GLY B 1 178 ? 42.547  14.643  97.450  1.00 26.11 ? 177 GLY B C   1 
ATOM   5850  O O   . GLY B 1 178 ? 42.092  15.661  96.930  1.00 26.53 ? 177 GLY B O   1 
ATOM   5851  N N   . PRO B 1 179 ? 43.257  13.756  96.746  1.00 25.98 ? 178 PRO B N   1 
ATOM   5852  C CA  . PRO B 1 179 ? 43.494  13.969  95.319  1.00 25.14 ? 178 PRO B CA  1 
ATOM   5853  C C   . PRO B 1 179 ? 42.219  13.684  94.526  1.00 25.42 ? 178 PRO B C   1 
ATOM   5854  O O   . PRO B 1 179 ? 41.318  13.010  95.025  1.00 24.59 ? 178 PRO B O   1 
ATOM   5855  C CB  . PRO B 1 179 ? 44.598  12.968  95.012  1.00 24.54 ? 178 PRO B CB  1 
ATOM   5856  C CG  . PRO B 1 179 ? 44.246  11.828  95.913  1.00 24.79 ? 178 PRO B CG  1 
ATOM   5857  C CD  . PRO B 1 179 ? 43.935  12.532  97.213  1.00 24.97 ? 178 PRO B CD  1 
ATOM   5858  N N   . ARG B 1 180 ? 42.142  14.208  93.305  1.00 23.94 ? 179 ARG B N   1 
ATOM   5859  C CA  . ARG B 1 180 ? 40.985  13.966  92.448  1.00 23.91 ? 179 ARG B CA  1 
ATOM   5860  C C   . ARG B 1 180 ? 41.015  12.483  92.066  1.00 22.78 ? 179 ARG B C   1 
ATOM   5861  O O   . ARG B 1 180 ? 42.091  11.892  91.964  1.00 22.49 ? 179 ARG B O   1 
ATOM   5862  C CB  . ARG B 1 180 ? 41.077  14.811  91.167  1.00 22.89 ? 179 ARG B CB  1 
ATOM   5863  C CG  . ARG B 1 180 ? 40.969  16.327  91.362  1.00 26.10 ? 179 ARG B CG  1 
ATOM   5864  C CD  . ARG B 1 180 ? 41.141  17.071  90.021  1.00 28.36 ? 179 ARG B CD  1 
ATOM   5865  N NE  . ARG B 1 180 ? 42.524  17.043  89.538  1.00 28.38 ? 179 ARG B NE  1 
ATOM   5866  C CZ  . ARG B 1 180 ? 43.474  17.903  89.908  1.00 28.81 ? 179 ARG B CZ  1 
ATOM   5867  N NH1 . ARG B 1 180 ? 43.199  18.881  90.761  1.00 27.21 ? 179 ARG B NH1 1 
ATOM   5868  N NH2 . ARG B 1 180 ? 44.713  17.771  89.442  1.00 28.27 ? 179 ARG B NH2 1 
ATOM   5869  N N   . VAL B 1 181 ? 39.847  11.877  91.872  1.00 21.34 ? 180 VAL B N   1 
ATOM   5870  C CA  . VAL B 1 181 ? 39.790  10.471  91.470  1.00 21.96 ? 180 VAL B CA  1 
ATOM   5871  C C   . VAL B 1 181 ? 39.182  10.348  90.082  1.00 22.51 ? 180 VAL B C   1 
ATOM   5872  O O   . VAL B 1 181 ? 38.261  11.088  89.723  1.00 23.13 ? 180 VAL B O   1 
ATOM   5873  C CB  . VAL B 1 181 ? 38.953  9.594   92.443  1.00 22.51 ? 180 VAL B CB  1 
ATOM   5874  C CG1 . VAL B 1 181 ? 39.729  9.347   93.712  1.00 23.15 ? 180 VAL B CG1 1 
ATOM   5875  C CG2 . VAL B 1 181 ? 37.615  10.265  92.752  1.00 21.22 ? 180 VAL B CG2 1 
ATOM   5876  N N   . TRP B 1 182 ? 39.712  9.410   89.305  1.00 21.32 ? 181 TRP B N   1 
ATOM   5877  C CA  . TRP B 1 182 ? 39.245  9.163   87.948  1.00 21.51 ? 181 TRP B CA  1 
ATOM   5878  C C   . TRP B 1 182 ? 38.960  7.679   87.784  1.00 20.71 ? 181 TRP B C   1 
ATOM   5879  O O   . TRP B 1 182 ? 39.704  6.842   88.293  1.00 20.04 ? 181 TRP B O   1 
ATOM   5880  C CB  . TRP B 1 182 ? 40.316  9.573   86.935  1.00 21.73 ? 181 TRP B CB  1 
ATOM   5881  C CG  . TRP B 1 182 ? 40.756  10.993  87.054  1.00 23.52 ? 181 TRP B CG  1 
ATOM   5882  C CD1 . TRP B 1 182 ? 41.542  11.531  88.030  1.00 23.56 ? 181 TRP B CD1 1 
ATOM   5883  C CD2 . TRP B 1 182 ? 40.440  12.061  86.155  1.00 25.93 ? 181 TRP B CD2 1 
ATOM   5884  N NE1 . TRP B 1 182 ? 41.738  12.873  87.793  1.00 26.19 ? 181 TRP B NE1 1 
ATOM   5885  C CE2 . TRP B 1 182 ? 41.072  13.223  86.648  1.00 26.07 ? 181 TRP B CE2 1 
ATOM   5886  C CE3 . TRP B 1 182 ? 39.683  12.149  84.978  1.00 27.82 ? 181 TRP B CE3 1 
ATOM   5887  C CZ2 . TRP B 1 182 ? 40.973  14.460  86.004  1.00 28.97 ? 181 TRP B CZ2 1 
ATOM   5888  C CZ3 . TRP B 1 182 ? 39.584  13.380  84.335  1.00 30.21 ? 181 TRP B CZ3 1 
ATOM   5889  C CH2 . TRP B 1 182 ? 40.227  14.519  84.852  1.00 30.48 ? 181 TRP B CH2 1 
ATOM   5890  N N   . TYR B 1 183 ? 37.890  7.349   87.073  1.00 19.22 ? 182 TYR B N   1 
ATOM   5891  C CA  . TYR B 1 183 ? 37.562  5.947   86.858  1.00 18.85 ? 182 TYR B CA  1 
ATOM   5892  C C   . TYR B 1 183 ? 37.526  5.639   85.371  1.00 19.77 ? 182 TYR B C   1 
ATOM   5893  O O   . TYR B 1 183 ? 36.781  6.255   84.612  1.00 20.60 ? 182 TYR B O   1 
ATOM   5894  C CB  . TYR B 1 183 ? 36.226  5.605   87.531  1.00 17.13 ? 182 TYR B CB  1 
ATOM   5895  C CG  . TYR B 1 183 ? 36.317  5.663   89.040  1.00 15.23 ? 182 TYR B CG  1 
ATOM   5896  C CD1 . TYR B 1 183 ? 36.684  4.541   89.780  1.00 12.17 ? 182 TYR B CD1 1 
ATOM   5897  C CD2 . TYR B 1 183 ? 36.120  6.867   89.719  1.00 14.25 ? 182 TYR B CD2 1 
ATOM   5898  C CE1 . TYR B 1 183 ? 36.857  4.615   91.163  1.00 15.51 ? 182 TYR B CE1 1 
ATOM   5899  C CE2 . TYR B 1 183 ? 36.294  6.956   91.098  1.00 17.55 ? 182 TYR B CE2 1 
ATOM   5900  C CZ  . TYR B 1 183 ? 36.664  5.829   91.815  1.00 17.30 ? 182 TYR B CZ  1 
ATOM   5901  O OH  . TYR B 1 183 ? 36.861  5.925   93.172  1.00 17.64 ? 182 TYR B OH  1 
ATOM   5902  N N   . VAL B 1 184 ? 38.378  4.706   84.966  1.00 18.23 ? 183 VAL B N   1 
ATOM   5903  C CA  . VAL B 1 184 ? 38.474  4.268   83.582  1.00 18.34 ? 183 VAL B CA  1 
ATOM   5904  C C   . VAL B 1 184 ? 38.089  2.793   83.611  1.00 19.07 ? 183 VAL B C   1 
ATOM   5905  O O   . VAL B 1 184 ? 38.696  1.997   84.331  1.00 16.75 ? 183 VAL B O   1 
ATOM   5906  C CB  . VAL B 1 184 ? 39.924  4.414   83.037  1.00 19.21 ? 183 VAL B CB  1 
ATOM   5907  C CG1 . VAL B 1 184 ? 40.015  3.849   81.626  1.00 18.61 ? 183 VAL B CG1 1 
ATOM   5908  C CG2 . VAL B 1 184 ? 40.341  5.882   83.042  1.00 19.46 ? 183 VAL B CG2 1 
ATOM   5909  N N   . SER B 1 185 ? 37.085  2.423   82.827  1.00 19.07 ? 184 SER B N   1 
ATOM   5910  C CA  . SER B 1 185 ? 36.630  1.047   82.833  1.00 18.50 ? 184 SER B CA  1 
ATOM   5911  C C   . SER B 1 185 ? 36.365  0.459   81.453  1.00 19.34 ? 184 SER B C   1 
ATOM   5912  O O   . SER B 1 185 ? 36.635  -0.717  81.212  1.00 20.27 ? 184 SER B O   1 
ATOM   5913  C CB  . SER B 1 185 ? 35.361  0.953   83.673  1.00 17.01 ? 184 SER B CB  1 
ATOM   5914  O OG  . SER B 1 185 ? 34.380  1.833   83.162  1.00 20.85 ? 184 SER B OG  1 
ATOM   5915  N N   . ASN B 1 186 ? 35.823  1.273   80.557  1.00 17.98 ? 185 ASN B N   1 
ATOM   5916  C CA  . ASN B 1 186 ? 35.498  0.814   79.213  1.00 17.12 ? 185 ASN B CA  1 
ATOM   5917  C C   . ASN B 1 186 ? 36.744  0.467   78.407  1.00 18.03 ? 185 ASN B C   1 
ATOM   5918  O O   . ASN B 1 186 ? 37.716  1.216   78.414  1.00 15.95 ? 185 ASN B O   1 
ATOM   5919  C CB  . ASN B 1 186 ? 34.721  1.900   78.472  1.00 17.07 ? 185 ASN B CB  1 
ATOM   5920  C CG  . ASN B 1 186 ? 33.818  1.339   77.400  1.00 17.78 ? 185 ASN B CG  1 
ATOM   5921  O OD1 . ASN B 1 186 ? 34.105  0.297   76.807  1.00 18.74 ? 185 ASN B OD1 1 
ATOM   5922  N ND2 . ASN B 1 186 ? 32.718  2.031   77.140  1.00 16.59 ? 185 ASN B ND2 1 
ATOM   5923  N N   . ILE B 1 187 ? 36.729  -0.671  77.719  1.00 17.31 ? 186 ILE B N   1 
ATOM   5924  C CA  . ILE B 1 187 ? 37.873  -1.017  76.887  1.00 16.24 ? 186 ILE B CA  1 
ATOM   5925  C C   . ILE B 1 187 ? 37.881  -0.018  75.725  1.00 16.15 ? 186 ILE B C   1 
ATOM   5926  O O   . ILE B 1 187 ? 38.907  0.186   75.074  1.00 16.15 ? 186 ILE B O   1 
ATOM   5927  C CB  . ILE B 1 187 ? 37.788  -2.468  76.344  1.00 16.01 ? 186 ILE B CB  1 
ATOM   5928  C CG1 . ILE B 1 187 ? 39.026  -2.779  75.497  1.00 16.93 ? 186 ILE B CG1 1 
ATOM   5929  C CG2 . ILE B 1 187 ? 36.531  -2.653  75.516  1.00 17.93 ? 186 ILE B CG2 1 
ATOM   5930  C CD1 . ILE B 1 187 ? 40.339  -2.747  76.278  1.00 17.15 ? 186 ILE B CD1 1 
ATOM   5931  N N   . ASP B 1 188 ? 36.724  0.598   75.470  1.00 17.03 ? 187 ASP B N   1 
ATOM   5932  C CA  . ASP B 1 188 ? 36.594  1.613   74.415  1.00 16.36 ? 187 ASP B CA  1 
ATOM   5933  C C   . ASP B 1 188 ? 37.711  2.617   74.678  1.00 15.45 ? 187 ASP B C   1 
ATOM   5934  O O   . ASP B 1 188 ? 37.751  3.248   75.733  1.00 15.86 ? 187 ASP B O   1 
ATOM   5935  C CB  . ASP B 1 188 ? 35.230  2.311   74.514  1.00 16.63 ? 187 ASP B CB  1 
ATOM   5936  C CG  . ASP B 1 188 ? 35.058  3.448   73.502  1.00 16.67 ? 187 ASP B CG  1 
ATOM   5937  O OD1 . ASP B 1 188 ? 33.970  4.065   73.495  1.00 15.58 ? 187 ASP B OD1 1 
ATOM   5938  O OD2 . ASP B 1 188 ? 35.988  3.727   72.714  1.00 15.02 ? 187 ASP B OD2 1 
ATOM   5939  N N   . GLY B 1 189 ? 38.613  2.750   73.714  1.00 15.34 ? 188 GLY B N   1 
ATOM   5940  C CA  . GLY B 1 189 ? 39.749  3.641   73.857  1.00 16.04 ? 188 GLY B CA  1 
ATOM   5941  C C   . GLY B 1 189 ? 39.485  5.096   74.199  1.00 16.55 ? 188 GLY B C   1 
ATOM   5942  O O   . GLY B 1 189 ? 40.372  5.772   74.732  1.00 15.96 ? 188 GLY B O   1 
ATOM   5943  N N   . THR B 1 190 ? 38.297  5.609   73.903  1.00 17.14 ? 189 THR B N   1 
ATOM   5944  C CA  . THR B 1 190 ? 38.059  7.009   74.229  1.00 18.79 ? 189 THR B CA  1 
ATOM   5945  C C   . THR B 1 190 ? 38.095  7.219   75.743  1.00 17.25 ? 189 THR B C   1 
ATOM   5946  O O   . THR B 1 190 ? 38.396  8.313   76.203  1.00 18.09 ? 189 THR B O   1 
ATOM   5947  C CB  . THR B 1 190 ? 36.699  7.541   73.696  1.00 20.87 ? 189 THR B CB  1 
ATOM   5948  O OG1 . THR B 1 190 ? 35.691  7.371   74.695  1.00 26.33 ? 189 THR B OG1 1 
ATOM   5949  C CG2 . THR B 1 190 ? 36.298  6.833   72.433  1.00 18.25 ? 189 THR B CG2 1 
ATOM   5950  N N   . HIS B 1 191 ? 37.823  6.173   76.521  1.00 16.84 ? 190 HIS B N   1 
ATOM   5951  C CA  . HIS B 1 191 ? 37.815  6.333   77.977  1.00 16.75 ? 190 HIS B CA  1 
ATOM   5952  C C   . HIS B 1 191 ? 39.199  6.660   78.541  1.00 17.95 ? 190 HIS B C   1 
ATOM   5953  O O   . HIS B 1 191 ? 39.381  7.692   79.185  1.00 20.27 ? 190 HIS B O   1 
ATOM   5954  C CB  . HIS B 1 191 ? 37.251  5.088   78.665  1.00 17.49 ? 190 HIS B CB  1 
ATOM   5955  C CG  . HIS B 1 191 ? 36.505  5.387   79.932  1.00 19.76 ? 190 HIS B CG  1 
ATOM   5956  N ND1 . HIS B 1 191 ? 35.885  4.407   80.680  1.00 20.58 ? 190 HIS B ND1 1 
ATOM   5957  C CD2 . HIS B 1 191 ? 36.229  6.562   80.550  1.00 17.63 ? 190 HIS B CD2 1 
ATOM   5958  C CE1 . HIS B 1 191 ? 35.255  4.966   81.700  1.00 18.69 ? 190 HIS B CE1 1 
ATOM   5959  N NE2 . HIS B 1 191 ? 35.448  6.272   81.644  1.00 19.05 ? 190 HIS B NE2 1 
ATOM   5960  N N   . ILE B 1 192 ? 40.177  5.797   78.295  1.00 17.27 ? 191 ILE B N   1 
ATOM   5961  C CA  . ILE B 1 192 ? 41.531  6.054   78.786  1.00 18.09 ? 191 ILE B CA  1 
ATOM   5962  C C   . ILE B 1 192 ? 42.151  7.253   78.042  1.00 19.47 ? 191 ILE B C   1 
ATOM   5963  O O   . ILE B 1 192 ? 42.869  8.055   78.637  1.00 20.29 ? 191 ILE B O   1 
ATOM   5964  C CB  . ILE B 1 192 ? 42.443  4.810   78.603  1.00 16.21 ? 191 ILE B CB  1 
ATOM   5965  C CG1 . ILE B 1 192 ? 43.785  5.012   79.316  1.00 15.70 ? 191 ILE B CG1 1 
ATOM   5966  C CG2 . ILE B 1 192 ? 42.703  4.574   77.114  1.00 15.86 ? 191 ILE B CG2 1 
ATOM   5967  C CD1 . ILE B 1 192 ? 43.678  5.295   80.809  1.00 14.95 ? 191 ILE B CD1 1 
ATOM   5968  N N   . ALA B 1 193 ? 41.860  7.381   76.749  1.00 20.01 ? 192 ALA B N   1 
ATOM   5969  C CA  . ALA B 1 193 ? 42.412  8.474   75.957  1.00 20.95 ? 192 ALA B CA  1 
ATOM   5970  C C   . ALA B 1 193 ? 42.002  9.861   76.460  1.00 22.26 ? 192 ALA B C   1 
ATOM   5971  O O   . ALA B 1 193 ? 42.858  10.712  76.714  1.00 21.08 ? 192 ALA B O   1 
ATOM   5972  C CB  . ALA B 1 193 ? 42.014  8.320   74.494  1.00 20.80 ? 192 ALA B CB  1 
ATOM   5973  N N   . LYS B 1 194 ? 40.700  10.092  76.608  1.00 21.56 ? 193 LYS B N   1 
ATOM   5974  C CA  . LYS B 1 194 ? 40.236  11.397  77.062  1.00 21.94 ? 193 LYS B CA  1 
ATOM   5975  C C   . LYS B 1 194 ? 40.607  11.673  78.524  1.00 23.13 ? 193 LYS B C   1 
ATOM   5976  O O   . LYS B 1 194 ? 40.664  12.833  78.956  1.00 21.81 ? 193 LYS B O   1 
ATOM   5977  C CB  . LYS B 1 194 ? 38.719  11.531  76.843  1.00 22.29 ? 193 LYS B CB  1 
ATOM   5978  C CG  . LYS B 1 194 ? 37.833  10.764  77.816  1.00 24.13 ? 193 LYS B CG  1 
ATOM   5979  C CD  . LYS B 1 194 ? 36.365  10.957  77.437  1.00 24.66 ? 193 LYS B CD  1 
ATOM   5980  C CE  . LYS B 1 194 ? 35.423  10.183  78.338  1.00 26.86 ? 193 LYS B CE  1 
ATOM   5981  N NZ  . LYS B 1 194 ? 35.438  10.682  79.734  1.00 27.87 ? 193 LYS B NZ  1 
ATOM   5982  N N   . THR B 1 195 ? 40.876  10.613  79.281  1.00 21.30 ? 194 THR B N   1 
ATOM   5983  C CA  . THR B 1 195 ? 41.254  10.765  80.686  1.00 23.20 ? 194 THR B CA  1 
ATOM   5984  C C   . THR B 1 195 ? 42.733  11.162  80.799  1.00 24.02 ? 194 THR B C   1 
ATOM   5985  O O   . THR B 1 195 ? 43.079  12.101  81.510  1.00 25.16 ? 194 THR B O   1 
ATOM   5986  C CB  . THR B 1 195 ? 40.991  9.447   81.472  1.00 22.17 ? 194 THR B CB  1 
ATOM   5987  O OG1 . THR B 1 195 ? 39.578  9.191   81.503  1.00 21.03 ? 194 THR B OG1 1 
ATOM   5988  C CG2 . THR B 1 195 ? 41.520  9.534   82.901  1.00 19.35 ? 194 THR B CG2 1 
ATOM   5989  N N   . LEU B 1 196 ? 43.595  10.450  80.078  1.00 25.07 ? 195 LEU B N   1 
ATOM   5990  C CA  . LEU B 1 196 ? 45.036  10.714  80.082  1.00 26.35 ? 195 LEU B CA  1 
ATOM   5991  C C   . LEU B 1 196 ? 45.392  12.094  79.537  1.00 27.33 ? 195 LEU B C   1 
ATOM   5992  O O   . LEU B 1 196 ? 46.354  12.722  79.988  1.00 25.93 ? 195 LEU B O   1 
ATOM   5993  C CB  . LEU B 1 196 ? 45.756  9.649   79.256  1.00 25.98 ? 195 LEU B CB  1 
ATOM   5994  C CG  . LEU B 1 196 ? 46.411  8.463   79.974  1.00 27.15 ? 195 LEU B CG  1 
ATOM   5995  C CD1 . LEU B 1 196 ? 45.679  8.114   81.258  1.00 26.34 ? 195 LEU B CD1 1 
ATOM   5996  C CD2 . LEU B 1 196 ? 46.445  7.288   79.010  1.00 26.36 ? 195 LEU B CD2 1 
ATOM   5997  N N   . ALA B 1 197 ? 44.612  12.565  78.571  1.00 26.75 ? 196 ALA B N   1 
ATOM   5998  C CA  . ALA B 1 197 ? 44.856  13.869  77.967  1.00 27.11 ? 196 ALA B CA  1 
ATOM   5999  C C   . ALA B 1 197 ? 44.742  15.005  78.983  1.00 26.28 ? 196 ALA B C   1 
ATOM   6000  O O   . ALA B 1 197 ? 45.201  16.117  78.729  1.00 24.64 ? 196 ALA B O   1 
ATOM   6001  C CB  . ALA B 1 197 ? 43.880  14.099  76.812  1.00 26.51 ? 196 ALA B CB  1 
ATOM   6002  N N   . GLN B 1 198 ? 44.145  14.724  80.136  1.00 25.13 ? 197 GLN B N   1 
ATOM   6003  C CA  . GLN B 1 198 ? 43.968  15.748  81.158  1.00 27.43 ? 197 GLN B CA  1 
ATOM   6004  C C   . GLN B 1 198 ? 44.873  15.563  82.368  1.00 26.60 ? 197 GLN B C   1 
ATOM   6005  O O   . GLN B 1 198 ? 44.719  16.259  83.367  1.00 26.69 ? 197 GLN B O   1 
ATOM   6006  C CB  . GLN B 1 198 ? 42.522  15.749  81.644  1.00 29.57 ? 197 GLN B CB  1 
ATOM   6007  C CG  . GLN B 1 198 ? 41.497  15.729  80.539  1.00 32.53 ? 197 GLN B CG  1 
ATOM   6008  C CD  . GLN B 1 198 ? 40.096  15.709  81.081  1.00 34.92 ? 197 GLN B CD  1 
ATOM   6009  O OE1 . GLN B 1 198 ? 39.681  16.722  81.682  1.00 35.70 ? 197 GLN B OE1 1 
ATOM   6010  N NE2 . GLN B 1 198 ? 39.415  14.675  80.916  1.00 38.39 ? 197 GLN B NE2 1 
ATOM   6011  N N   . LEU B 1 199 ? 45.817  14.634  82.284  1.00 24.73 ? 198 LEU B N   1 
ATOM   6012  C CA  . LEU B 1 199 ? 46.686  14.371  83.416  1.00 23.09 ? 198 LEU B CA  1 
ATOM   6013  C C   . LEU B 1 199 ? 48.148  14.695  83.176  1.00 23.23 ? 198 LEU B C   1 
ATOM   6014  O O   . LEU B 1 199 ? 48.598  14.822  82.036  1.00 22.08 ? 198 LEU B O   1 
ATOM   6015  C CB  . LEU B 1 199 ? 46.567  12.899  83.820  1.00 24.79 ? 198 LEU B CB  1 
ATOM   6016  C CG  . LEU B 1 199 ? 45.174  12.365  84.179  1.00 25.65 ? 198 LEU B CG  1 
ATOM   6017  C CD1 . LEU B 1 199 ? 45.242  10.855  84.355  1.00 25.65 ? 198 LEU B CD1 1 
ATOM   6018  C CD2 . LEU B 1 199 ? 44.669  13.037  85.448  1.00 26.61 ? 198 LEU B CD2 1 
ATOM   6019  N N   . ASN B 1 200 ? 48.881  14.825  84.277  1.00 22.93 ? 199 ASN B N   1 
ATOM   6020  C CA  . ASN B 1 200 ? 50.313  15.089  84.243  1.00 22.82 ? 199 ASN B CA  1 
ATOM   6021  C C   . ASN B 1 200 ? 50.960  13.806  84.775  1.00 20.98 ? 199 ASN B C   1 
ATOM   6022  O O   . ASN B 1 200 ? 50.650  13.363  85.875  1.00 21.54 ? 199 ASN B O   1 
ATOM   6023  C CB  . ASN B 1 200 ? 50.665  16.262  85.165  1.00 24.55 ? 199 ASN B CB  1 
ATOM   6024  C CG  . ASN B 1 200 ? 52.144  16.609  85.130  1.00 27.02 ? 199 ASN B CG  1 
ATOM   6025  O OD1 . ASN B 1 200 ? 53.001  15.726  85.021  1.00 26.55 ? 199 ASN B OD1 1 
ATOM   6026  N ND2 . ASN B 1 200 ? 52.452  17.896  85.237  1.00 26.71 ? 199 ASN B ND2 1 
ATOM   6027  N N   . PRO B 1 201 ? 51.862  13.191  83.998  1.00 22.34 ? 200 PRO B N   1 
ATOM   6028  C CA  . PRO B 1 201 ? 52.517  11.956  84.448  1.00 21.86 ? 200 PRO B CA  1 
ATOM   6029  C C   . PRO B 1 201 ? 53.263  12.096  85.774  1.00 23.19 ? 200 PRO B C   1 
ATOM   6030  O O   . PRO B 1 201 ? 53.440  11.117  86.499  1.00 23.65 ? 200 PRO B O   1 
ATOM   6031  C CB  . PRO B 1 201 ? 53.466  11.630  83.297  1.00 22.50 ? 200 PRO B CB  1 
ATOM   6032  C CG  . PRO B 1 201 ? 52.744  12.188  82.102  1.00 24.47 ? 200 PRO B CG  1 
ATOM   6033  C CD  . PRO B 1 201 ? 52.257  13.522  82.616  1.00 20.06 ? 200 PRO B CD  1 
ATOM   6034  N N   . GLU B 1 202 ? 53.697  13.316  86.085  1.00 22.22 ? 201 GLU B N   1 
ATOM   6035  C CA  . GLU B 1 202 ? 54.444  13.585  87.312  1.00 22.79 ? 201 GLU B CA  1 
ATOM   6036  C C   . GLU B 1 202 ? 53.641  13.534  88.605  1.00 21.66 ? 201 GLU B C   1 
ATOM   6037  O O   . GLU B 1 202 ? 54.212  13.346  89.676  1.00 20.87 ? 201 GLU B O   1 
ATOM   6038  C CB  . GLU B 1 202 ? 55.122  14.954  87.221  1.00 23.43 ? 201 GLU B CB  1 
ATOM   6039  C CG  . GLU B 1 202 ? 56.327  14.981  86.303  1.00 28.58 ? 201 GLU B CG  1 
ATOM   6040  C CD  . GLU B 1 202 ? 56.913  16.369  86.161  1.00 29.83 ? 201 GLU B CD  1 
ATOM   6041  O OE1 . GLU B 1 202 ? 57.264  16.990  87.186  1.00 27.60 ? 201 GLU B OE1 1 
ATOM   6042  O OE2 . GLU B 1 202 ? 57.023  16.837  85.012  1.00 35.11 ? 201 GLU B OE2 1 
ATOM   6043  N N   . SER B 1 203 ? 52.325  13.702  88.513  1.00 20.02 ? 202 SER B N   1 
ATOM   6044  C CA  . SER B 1 203 ? 51.494  13.701  89.710  1.00 20.60 ? 202 SER B CA  1 
ATOM   6045  C C   . SER B 1 203 ? 50.269  12.796  89.645  1.00 21.90 ? 202 SER B C   1 
ATOM   6046  O O   . SER B 1 203 ? 49.320  12.978  90.405  1.00 23.70 ? 202 SER B O   1 
ATOM   6047  C CB  . SER B 1 203 ? 51.052  15.129  90.024  1.00 18.39 ? 202 SER B CB  1 
ATOM   6048  O OG  . SER B 1 203 ? 50.435  15.713  88.893  1.00 19.81 ? 202 SER B OG  1 
ATOM   6049  N N   . SER B 1 204 ? 50.295  11.818  88.748  1.00 22.96 ? 203 SER B N   1 
ATOM   6050  C CA  . SER B 1 204 ? 49.182  10.891  88.608  1.00 22.65 ? 203 SER B CA  1 
ATOM   6051  C C   . SER B 1 204 ? 49.552  9.515   89.137  1.00 22.77 ? 203 SER B C   1 
ATOM   6052  O O   . SER B 1 204 ? 50.623  8.991   88.838  1.00 23.01 ? 203 SER B O   1 
ATOM   6053  C CB  . SER B 1 204 ? 48.764  10.781  87.141  1.00 21.90 ? 203 SER B CB  1 
ATOM   6054  O OG  . SER B 1 204 ? 48.185  11.992  86.699  1.00 23.26 ? 203 SER B OG  1 
ATOM   6055  N N   . LEU B 1 205 ? 48.656  8.940   89.931  1.00 22.39 ? 204 LEU B N   1 
ATOM   6056  C CA  . LEU B 1 205 ? 48.868  7.621   90.507  1.00 21.88 ? 204 LEU B CA  1 
ATOM   6057  C C   . LEU B 1 205 ? 47.799  6.672   89.976  1.00 22.27 ? 204 LEU B C   1 
ATOM   6058  O O   . LEU B 1 205 ? 46.603  6.934   90.123  1.00 21.55 ? 204 LEU B O   1 
ATOM   6059  C CB  . LEU B 1 205 ? 48.777  7.700   92.034  1.00 21.60 ? 204 LEU B CB  1 
ATOM   6060  C CG  . LEU B 1 205 ? 48.805  6.374   92.795  1.00 23.13 ? 204 LEU B CG  1 
ATOM   6061  C CD1 . LEU B 1 205 ? 50.160  5.703   92.625  1.00 22.47 ? 204 LEU B CD1 1 
ATOM   6062  C CD2 . LEU B 1 205 ? 48.518  6.633   94.275  1.00 25.83 ? 204 LEU B CD2 1 
ATOM   6063  N N   . PHE B 1 206 ? 48.224  5.570   89.366  1.00 21.15 ? 205 PHE B N   1 
ATOM   6064  C CA  . PHE B 1 206 ? 47.273  4.609   88.823  1.00 20.72 ? 205 PHE B CA  1 
ATOM   6065  C C   . PHE B 1 206 ? 47.063  3.403   89.721  1.00 22.26 ? 205 PHE B C   1 
ATOM   6066  O O   . PHE B 1 206 ? 48.009  2.879   90.318  1.00 21.93 ? 205 PHE B O   1 
ATOM   6067  C CB  . PHE B 1 206 ? 47.719  4.128   87.439  1.00 21.76 ? 205 PHE B CB  1 
ATOM   6068  C CG  . PHE B 1 206 ? 47.776  5.219   86.409  1.00 23.34 ? 205 PHE B CG  1 
ATOM   6069  C CD1 . PHE B 1 206 ? 48.919  6.003   86.267  1.00 22.14 ? 205 PHE B CD1 1 
ATOM   6070  C CD2 . PHE B 1 206 ? 46.674  5.479   85.592  1.00 23.27 ? 205 PHE B CD2 1 
ATOM   6071  C CE1 . PHE B 1 206 ? 48.967  7.032   85.326  1.00 22.66 ? 205 PHE B CE1 1 
ATOM   6072  C CE2 . PHE B 1 206 ? 46.709  6.507   84.647  1.00 23.45 ? 205 PHE B CE2 1 
ATOM   6073  C CZ  . PHE B 1 206 ? 47.857  7.285   84.513  1.00 23.34 ? 205 PHE B CZ  1 
ATOM   6074  N N   . ILE B 1 207 ? 45.808  2.972   89.807  1.00 20.39 ? 206 ILE B N   1 
ATOM   6075  C CA  . ILE B 1 207 ? 45.428  1.820   90.606  1.00 20.25 ? 206 ILE B CA  1 
ATOM   6076  C C   . ILE B 1 207 ? 44.867  0.776   89.644  1.00 21.98 ? 206 ILE B C   1 
ATOM   6077  O O   . ILE B 1 207 ? 43.829  0.993   89.014  1.00 20.47 ? 206 ILE B O   1 
ATOM   6078  C CB  . ILE B 1 207 ? 44.341  2.197   91.648  1.00 22.40 ? 206 ILE B CB  1 
ATOM   6079  C CG1 . ILE B 1 207 ? 44.887  3.253   92.615  1.00 25.85 ? 206 ILE B CG1 1 
ATOM   6080  C CG2 . ILE B 1 207 ? 43.892  0.965   92.413  1.00 20.77 ? 206 ILE B CG2 1 
ATOM   6081  C CD1 . ILE B 1 207 ? 43.862  3.750   93.629  1.00 25.40 ? 206 ILE B CD1 1 
ATOM   6082  N N   . ILE B 1 208 ? 45.560  -0.350  89.520  1.00 22.59 ? 207 ILE B N   1 
ATOM   6083  C CA  . ILE B 1 208 ? 45.114  -1.407  88.626  1.00 22.87 ? 207 ILE B CA  1 
ATOM   6084  C C   . ILE B 1 208 ? 44.352  -2.451  89.438  1.00 23.88 ? 207 ILE B C   1 
ATOM   6085  O O   . ILE B 1 208 ? 44.947  -3.258  90.162  1.00 21.30 ? 207 ILE B O   1 
ATOM   6086  C CB  . ILE B 1 208 ? 46.311  -2.060  87.904  1.00 22.24 ? 207 ILE B CB  1 
ATOM   6087  C CG1 . ILE B 1 208 ? 47.281  -0.973  87.417  1.00 22.27 ? 207 ILE B CG1 1 
ATOM   6088  C CG2 . ILE B 1 208 ? 45.820  -2.868  86.709  1.00 23.47 ? 207 ILE B CG2 1 
ATOM   6089  C CD1 . ILE B 1 208 ? 46.669  0.047   86.457  1.00 19.71 ? 207 ILE B CD1 1 
ATOM   6090  N N   . ALA B 1 209 ? 43.027  -2.417  89.322  1.00 24.03 ? 208 ALA B N   1 
ATOM   6091  C CA  . ALA B 1 209 ? 42.167  -3.340  90.053  1.00 23.87 ? 208 ALA B CA  1 
ATOM   6092  C C   . ALA B 1 209 ? 41.819  -4.564  89.219  1.00 25.76 ? 208 ALA B C   1 
ATOM   6093  O O   . ALA B 1 209 ? 40.994  -4.493  88.310  1.00 25.73 ? 208 ALA B O   1 
ATOM   6094  C CB  . ALA B 1 209 ? 40.902  -2.630  90.485  1.00 23.65 ? 208 ALA B CB  1 
ATOM   6095  N N   . SER B 1 210 ? 42.456  -5.686  89.542  1.00 27.70 ? 209 SER B N   1 
ATOM   6096  C CA  . SER B 1 210 ? 42.236  -6.949  88.841  1.00 29.61 ? 209 SER B CA  1 
ATOM   6097  C C   . SER B 1 210 ? 42.820  -8.102  89.655  1.00 29.63 ? 209 SER B C   1 
ATOM   6098  O O   . SER B 1 210 ? 44.036  -8.223  89.777  1.00 29.60 ? 209 SER B O   1 
ATOM   6099  C CB  . SER B 1 210 ? 42.901  -6.907  87.462  1.00 30.27 ? 209 SER B CB  1 
ATOM   6100  O OG  . SER B 1 210 ? 43.002  -8.203  86.896  1.00 31.03 ? 209 SER B OG  1 
ATOM   6101  N N   . LYS B 1 211 ? 41.949  -8.944  90.200  1.00 30.32 ? 210 LYS B N   1 
ATOM   6102  C CA  . LYS B 1 211 ? 42.363  -10.091 91.008  1.00 32.45 ? 210 LYS B CA  1 
ATOM   6103  C C   . LYS B 1 211 ? 43.490  -10.907 90.366  1.00 32.68 ? 210 LYS B C   1 
ATOM   6104  O O   . LYS B 1 211 ? 44.580  -11.040 90.932  1.00 32.37 ? 210 LYS B O   1 
ATOM   6105  C CB  . LYS B 1 211 ? 41.154  -10.999 91.266  1.00 32.13 ? 210 LYS B CB  1 
ATOM   6106  C CG  . LYS B 1 211 ? 41.407  -12.178 92.205  1.00 33.98 ? 210 LYS B CG  1 
ATOM   6107  C CD  . LYS B 1 211 ? 41.698  -11.720 93.626  1.00 35.30 ? 210 LYS B CD  1 
ATOM   6108  C CE  . LYS B 1 211 ? 41.663  -12.888 94.597  1.00 35.87 ? 210 LYS B CE  1 
ATOM   6109  N NZ  . LYS B 1 211 ? 42.672  -13.931 94.258  1.00 36.45 ? 210 LYS B NZ  1 
ATOM   6110  N N   . THR B 1 212 ? 43.218  -11.445 89.181  1.00 33.45 ? 211 THR B N   1 
ATOM   6111  C CA  . THR B 1 212 ? 44.181  -12.265 88.449  1.00 33.43 ? 211 THR B CA  1 
ATOM   6112  C C   . THR B 1 212 ? 45.264  -11.428 87.793  1.00 33.06 ? 211 THR B C   1 
ATOM   6113  O O   . THR B 1 212 ? 46.344  -11.928 87.466  1.00 32.36 ? 211 THR B O   1 
ATOM   6114  C CB  . THR B 1 212 ? 43.492  -13.045 87.328  1.00 33.97 ? 211 THR B CB  1 
ATOM   6115  O OG1 . THR B 1 212 ? 42.860  -12.117 86.438  1.00 36.54 ? 211 THR B OG1 1 
ATOM   6116  C CG2 . THR B 1 212 ? 42.447  -14.000 87.894  1.00 34.28 ? 211 THR B CG2 1 
ATOM   6117  N N   . PHE B 1 213 ? 44.956  -10.152 87.602  1.00 32.41 ? 212 PHE B N   1 
ATOM   6118  C CA  . PHE B 1 213 ? 45.851  -9.213  86.946  1.00 31.28 ? 212 PHE B CA  1 
ATOM   6119  C C   . PHE B 1 213 ? 46.105  -9.651  85.505  1.00 31.40 ? 212 PHE B C   1 
ATOM   6120  O O   . PHE B 1 213 ? 47.193  -9.460  84.963  1.00 32.46 ? 212 PHE B O   1 
ATOM   6121  C CB  . PHE B 1 213 ? 47.177  -9.080  87.694  1.00 28.61 ? 212 PHE B CB  1 
ATOM   6122  C CG  . PHE B 1 213 ? 47.728  -7.684  87.673  1.00 29.25 ? 212 PHE B CG  1 
ATOM   6123  C CD1 . PHE B 1 213 ? 47.052  -6.653  88.323  1.00 28.78 ? 212 PHE B CD1 1 
ATOM   6124  C CD2 . PHE B 1 213 ? 48.893  -7.386  86.981  1.00 28.22 ? 212 PHE B CD2 1 
ATOM   6125  C CE1 . PHE B 1 213 ? 47.528  -5.348  88.283  1.00 28.83 ? 212 PHE B CE1 1 
ATOM   6126  C CE2 . PHE B 1 213 ? 49.378  -6.081  86.935  1.00 30.23 ? 212 PHE B CE2 1 
ATOM   6127  C CZ  . PHE B 1 213 ? 48.693  -5.061  87.587  1.00 29.19 ? 212 PHE B CZ  1 
ATOM   6128  N N   . THR B 1 214 ? 45.087  -10.251 84.895  1.00 31.67 ? 213 THR B N   1 
ATOM   6129  C CA  . THR B 1 214 ? 45.174  -10.691 83.510  1.00 31.98 ? 213 THR B CA  1 
ATOM   6130  C C   . THR B 1 214 ? 43.887  -10.308 82.778  1.00 31.31 ? 213 THR B C   1 
ATOM   6131  O O   . THR B 1 214 ? 43.755  -10.532 81.574  1.00 31.20 ? 213 THR B O   1 
ATOM   6132  C CB  . THR B 1 214 ? 45.395  -12.222 83.400  1.00 31.97 ? 213 THR B CB  1 
ATOM   6133  O OG1 . THR B 1 214 ? 44.245  -12.918 83.893  1.00 30.45 ? 213 THR B OG1 1 
ATOM   6134  C CG2 . THR B 1 214 ? 46.624  -12.639 84.198  1.00 33.10 ? 213 THR B CG2 1 
ATOM   6135  N N   . THR B 1 215 ? 42.941  -9.725  83.512  1.00 30.62 ? 214 THR B N   1 
ATOM   6136  C CA  . THR B 1 215 ? 41.672  -9.290  82.930  1.00 29.63 ? 214 THR B CA  1 
ATOM   6137  C C   . THR B 1 215 ? 41.999  -8.486  81.675  1.00 27.83 ? 214 THR B C   1 
ATOM   6138  O O   . THR B 1 215 ? 42.714  -7.486  81.752  1.00 28.70 ? 214 THR B O   1 
ATOM   6139  C CB  . THR B 1 215 ? 40.896  -8.390  83.909  1.00 29.61 ? 214 THR B CB  1 
ATOM   6140  O OG1 . THR B 1 215 ? 40.830  -9.025  85.192  1.00 29.89 ? 214 THR B OG1 1 
ATOM   6141  C CG2 . THR B 1 215 ? 39.486  -8.144  83.401  1.00 26.28 ? 214 THR B CG2 1 
ATOM   6142  N N   . GLN B 1 216 ? 41.479  -8.922  80.531  1.00 25.68 ? 215 GLN B N   1 
ATOM   6143  C CA  . GLN B 1 216 ? 41.755  -8.264  79.249  1.00 25.54 ? 215 GLN B CA  1 
ATOM   6144  C C   . GLN B 1 216 ? 41.510  -6.754  79.209  1.00 25.58 ? 215 GLN B C   1 
ATOM   6145  O O   . GLN B 1 216 ? 42.436  -5.979  78.983  1.00 26.33 ? 215 GLN B O   1 
ATOM   6146  C CB  . GLN B 1 216 ? 40.949  -8.920  78.115  1.00 24.13 ? 215 GLN B CB  1 
ATOM   6147  C CG  . GLN B 1 216 ? 41.396  -8.468  76.715  1.00 24.25 ? 215 GLN B CG  1 
ATOM   6148  C CD  . GLN B 1 216 ? 40.591  -9.094  75.582  1.00 23.93 ? 215 GLN B CD  1 
ATOM   6149  O OE1 . GLN B 1 216 ? 41.084  -9.238  74.462  1.00 23.98 ? 215 GLN B OE1 1 
ATOM   6150  N NE2 . GLN B 1 216 ? 39.350  -9.455  75.866  1.00 23.72 ? 215 GLN B NE2 1 
ATOM   6151  N N   . GLU B 1 217 ? 40.265  -6.341  79.411  1.00 24.50 ? 216 GLU B N   1 
ATOM   6152  C CA  . GLU B 1 217 ? 39.930  -4.924  79.371  1.00 24.95 ? 216 GLU B CA  1 
ATOM   6153  C C   . GLU B 1 217 ? 40.850  -4.111  80.275  1.00 23.26 ? 216 GLU B C   1 
ATOM   6154  O O   . GLU B 1 217 ? 41.505  -3.173  79.827  1.00 21.78 ? 216 GLU B O   1 
ATOM   6155  C CB  . GLU B 1 217 ? 38.474  -4.696  79.801  1.00 28.64 ? 216 GLU B CB  1 
ATOM   6156  C CG  . GLU B 1 217 ? 37.417  -5.458  78.998  1.00 34.43 ? 216 GLU B CG  1 
ATOM   6157  C CD  . GLU B 1 217 ? 37.349  -6.939  79.350  1.00 38.43 ? 216 GLU B CD  1 
ATOM   6158  O OE1 . GLU B 1 217 ? 36.463  -7.634  78.805  1.00 41.70 ? 216 GLU B OE1 1 
ATOM   6159  O OE2 . GLU B 1 217 ? 38.173  -7.418  80.165  1.00 40.27 ? 216 GLU B OE2 1 
ATOM   6160  N N   . THR B 1 218 ? 40.893  -4.489  81.550  1.00 21.74 ? 217 THR B N   1 
ATOM   6161  C CA  . THR B 1 218 ? 41.699  -3.804  82.549  1.00 21.16 ? 217 THR B CA  1 
ATOM   6162  C C   . THR B 1 218 ? 43.197  -3.735  82.246  1.00 21.32 ? 217 THR B C   1 
ATOM   6163  O O   . THR B 1 218 ? 43.796  -2.659  82.305  1.00 19.36 ? 217 THR B O   1 
ATOM   6164  C CB  . THR B 1 218 ? 41.499  -4.453  83.936  1.00 22.19 ? 217 THR B CB  1 
ATOM   6165  O OG1 . THR B 1 218 ? 40.106  -4.411  84.284  1.00 25.31 ? 217 THR B OG1 1 
ATOM   6166  C CG2 . THR B 1 218 ? 42.310  -3.712  84.999  1.00 23.71 ? 217 THR B CG2 1 
ATOM   6167  N N   . ILE B 1 219 ? 43.809  -4.871  81.927  1.00 20.36 ? 218 ILE B N   1 
ATOM   6168  C CA  . ILE B 1 219 ? 45.242  -4.872  81.644  1.00 22.58 ? 218 ILE B CA  1 
ATOM   6169  C C   . ILE B 1 219 ? 45.578  -4.107  80.371  1.00 22.47 ? 218 ILE B C   1 
ATOM   6170  O O   . ILE B 1 219 ? 46.667  -3.546  80.251  1.00 23.16 ? 218 ILE B O   1 
ATOM   6171  C CB  . ILE B 1 219 ? 45.801  -6.305  81.533  1.00 24.83 ? 218 ILE B CB  1 
ATOM   6172  C CG1 . ILE B 1 219 ? 45.578  -7.053  82.852  1.00 25.81 ? 218 ILE B CG1 1 
ATOM   6173  C CG2 . ILE B 1 219 ? 47.299  -6.256  81.217  1.00 25.56 ? 218 ILE B CG2 1 
ATOM   6174  C CD1 . ILE B 1 219 ? 46.304  -6.433  84.041  1.00 27.21 ? 218 ILE B CD1 1 
ATOM   6175  N N   . THR B 1 220 ? 44.653  -4.079  79.415  1.00 22.19 ? 219 THR B N   1 
ATOM   6176  C CA  . THR B 1 220 ? 44.903  -3.341  78.180  1.00 20.29 ? 219 THR B CA  1 
ATOM   6177  C C   . THR B 1 220 ? 44.938  -1.852  78.522  1.00 19.80 ? 219 THR B C   1 
ATOM   6178  O O   . THR B 1 220 ? 45.816  -1.124  78.068  1.00 19.04 ? 219 THR B O   1 
ATOM   6179  C CB  . THR B 1 220 ? 43.812  -3.603  77.129  1.00 19.76 ? 219 THR B CB  1 
ATOM   6180  O OG1 . THR B 1 220 ? 43.783  -5.001  76.823  1.00 20.41 ? 219 THR B OG1 1 
ATOM   6181  C CG2 . THR B 1 220 ? 44.102  -2.825  75.849  1.00 17.10 ? 219 THR B CG2 1 
ATOM   6182  N N   . ASN B 1 221 ? 43.978  -1.406  79.327  1.00 19.50 ? 220 ASN B N   1 
ATOM   6183  C CA  . ASN B 1 221 ? 43.940  -0.011  79.743  1.00 20.18 ? 220 ASN B CA  1 
ATOM   6184  C C   . ASN B 1 221 ? 45.183  0.297   80.571  1.00 19.17 ? 220 ASN B C   1 
ATOM   6185  O O   . ASN B 1 221 ? 45.770  1.371   80.448  1.00 19.43 ? 220 ASN B O   1 
ATOM   6186  C CB  . ASN B 1 221 ? 42.683  0.284   80.575  1.00 19.05 ? 220 ASN B CB  1 
ATOM   6187  C CG  . ASN B 1 221 ? 41.457  0.522   79.717  1.00 17.17 ? 220 ASN B CG  1 
ATOM   6188  O OD1 . ASN B 1 221 ? 41.542  1.124   78.646  1.00 18.42 ? 220 ASN B OD1 1 
ATOM   6189  N ND2 . ASN B 1 221 ? 40.307  0.072   80.193  1.00 16.82 ? 220 ASN B ND2 1 
ATOM   6190  N N   . ALA B 1 222 ? 45.578  -0.649  81.417  1.00 20.57 ? 221 ALA B N   1 
ATOM   6191  C CA  . ALA B 1 222 ? 46.756  -0.472  82.264  1.00 20.97 ? 221 ALA B CA  1 
ATOM   6192  C C   . ALA B 1 222 ? 48.022  -0.323  81.423  1.00 22.96 ? 221 ALA B C   1 
ATOM   6193  O O   . ALA B 1 222 ? 48.851  0.549   81.683  1.00 24.95 ? 221 ALA B O   1 
ATOM   6194  C CB  . ALA B 1 222 ? 46.901  -1.649  83.215  1.00 21.55 ? 221 ALA B CB  1 
ATOM   6195  N N   . GLU B 1 223 ? 48.172  -1.157  80.402  1.00 23.00 ? 222 GLU B N   1 
ATOM   6196  C CA  . GLU B 1 223 ? 49.361  -1.068  79.566  1.00 23.86 ? 222 GLU B CA  1 
ATOM   6197  C C   . GLU B 1 223 ? 49.370  0.214   78.757  1.00 22.62 ? 222 GLU B C   1 
ATOM   6198  O O   . GLU B 1 223 ? 50.431  0.763   78.479  1.00 22.96 ? 222 GLU B O   1 
ATOM   6199  C CB  . GLU B 1 223 ? 49.468  -2.294  78.656  1.00 24.56 ? 222 GLU B CB  1 
ATOM   6200  C CG  . GLU B 1 223 ? 49.449  -3.590  79.455  1.00 30.75 ? 222 GLU B CG  1 
ATOM   6201  C CD  . GLU B 1 223 ? 49.871  -4.806  78.658  1.00 34.18 ? 222 GLU B CD  1 
ATOM   6202  O OE1 . GLU B 1 223 ? 49.430  -4.947  77.499  1.00 39.03 ? 222 GLU B OE1 1 
ATOM   6203  O OE2 . GLU B 1 223 ? 50.633  -5.633  79.204  1.00 38.60 ? 222 GLU B OE2 1 
ATOM   6204  N N   . THR B 1 224 ? 48.188  0.699   78.389  1.00 21.94 ? 223 THR B N   1 
ATOM   6205  C CA  . THR B 1 224 ? 48.086  1.938   77.624  1.00 21.17 ? 223 THR B CA  1 
ATOM   6206  C C   . THR B 1 224 ? 48.504  3.111   78.498  1.00 20.34 ? 223 THR B C   1 
ATOM   6207  O O   . THR B 1 224 ? 49.156  4.043   78.032  1.00 21.09 ? 223 THR B O   1 
ATOM   6208  C CB  . THR B 1 224 ? 46.643  2.157   77.112  1.00 22.86 ? 223 THR B CB  1 
ATOM   6209  O OG1 . THR B 1 224 ? 46.351  1.176   76.111  1.00 20.84 ? 223 THR B OG1 1 
ATOM   6210  C CG2 . THR B 1 224 ? 46.479  3.552   76.508  1.00 19.74 ? 223 THR B CG2 1 
ATOM   6211  N N   . ALA B 1 225 ? 48.127  3.051   79.773  1.00 20.43 ? 224 ALA B N   1 
ATOM   6212  C CA  . ALA B 1 225 ? 48.462  4.089   80.740  1.00 19.56 ? 224 ALA B CA  1 
ATOM   6213  C C   . ALA B 1 225 ? 49.961  4.068   81.028  1.00 20.97 ? 224 ALA B C   1 
ATOM   6214  O O   . ALA B 1 225 ? 50.585  5.115   81.172  1.00 20.39 ? 224 ALA B O   1 
ATOM   6215  C CB  . ALA B 1 225 ? 47.676  3.873   82.039  1.00 17.94 ? 224 ALA B CB  1 
ATOM   6216  N N   . LYS B 1 226 ? 50.537  2.872   81.123  1.00 22.19 ? 225 LYS B N   1 
ATOM   6217  C CA  . LYS B 1 226 ? 51.963  2.761   81.385  1.00 24.45 ? 225 LYS B CA  1 
ATOM   6218  C C   . LYS B 1 226 ? 52.759  3.288   80.192  1.00 25.27 ? 225 LYS B C   1 
ATOM   6219  O O   . LYS B 1 226 ? 53.781  3.956   80.366  1.00 27.16 ? 225 LYS B O   1 
ATOM   6220  C CB  . LYS B 1 226 ? 52.353  1.309   81.678  1.00 25.14 ? 225 LYS B CB  1 
ATOM   6221  C CG  . LYS B 1 226 ? 53.847  1.148   81.920  1.00 26.02 ? 225 LYS B CG  1 
ATOM   6222  C CD  . LYS B 1 226 ? 54.205  -0.201  82.522  1.00 27.41 ? 225 LYS B CD  1 
ATOM   6223  C CE  . LYS B 1 226 ? 53.931  -1.341  81.558  1.00 27.33 ? 225 LYS B CE  1 
ATOM   6224  N NZ  . LYS B 1 226 ? 54.540  -2.593  82.064  1.00 27.48 ? 225 LYS B NZ  1 
ATOM   6225  N N   . GLU B 1 227 ? 52.288  2.991   78.984  1.00 25.16 ? 226 GLU B N   1 
ATOM   6226  C CA  . GLU B 1 227 ? 52.953  3.459   77.773  1.00 26.25 ? 226 GLU B CA  1 
ATOM   6227  C C   . GLU B 1 227 ? 52.959  4.991   77.748  1.00 25.55 ? 226 GLU B C   1 
ATOM   6228  O O   . GLU B 1 227 ? 53.970  5.615   77.423  1.00 24.13 ? 226 GLU B O   1 
ATOM   6229  C CB  . GLU B 1 227 ? 52.241  2.917   76.530  1.00 27.72 ? 226 GLU B CB  1 
ATOM   6230  C CG  . GLU B 1 227 ? 52.848  3.395   75.215  1.00 32.83 ? 226 GLU B CG  1 
ATOM   6231  C CD  . GLU B 1 227 ? 52.206  2.753   73.995  1.00 33.69 ? 226 GLU B CD  1 
ATOM   6232  O OE1 . GLU B 1 227 ? 52.574  3.124   72.864  1.00 37.56 ? 226 GLU B OE1 1 
ATOM   6233  O OE2 . GLU B 1 227 ? 51.339  1.873   74.164  1.00 38.11 ? 226 GLU B OE2 1 
ATOM   6234  N N   . TRP B 1 228 ? 51.820  5.586   78.086  1.00 23.39 ? 227 TRP B N   1 
ATOM   6235  C CA  . TRP B 1 228 ? 51.687  7.038   78.131  1.00 23.10 ? 227 TRP B CA  1 
ATOM   6236  C C   . TRP B 1 228 ? 52.624  7.589   79.206  1.00 25.14 ? 227 TRP B C   1 
ATOM   6237  O O   . TRP B 1 228 ? 53.269  8.630   79.022  1.00 24.31 ? 227 TRP B O   1 
ATOM   6238  C CB  . TRP B 1 228 ? 50.244  7.407   78.471  1.00 22.44 ? 227 TRP B CB  1 
ATOM   6239  C CG  . TRP B 1 228 ? 50.023  8.832   78.875  1.00 20.32 ? 227 TRP B CG  1 
ATOM   6240  C CD1 . TRP B 1 228 ? 49.807  9.898   78.048  1.00 20.92 ? 227 TRP B CD1 1 
ATOM   6241  C CD2 . TRP B 1 228 ? 49.927  9.337   80.214  1.00 18.03 ? 227 TRP B CD2 1 
ATOM   6242  N NE1 . TRP B 1 228 ? 49.572  11.034  78.792  1.00 21.55 ? 227 TRP B NE1 1 
ATOM   6243  C CE2 . TRP B 1 228 ? 49.641  10.717  80.123  1.00 18.43 ? 227 TRP B CE2 1 
ATOM   6244  C CE3 . TRP B 1 228 ? 50.052  8.754   81.483  1.00 17.66 ? 227 TRP B CE3 1 
ATOM   6245  C CZ2 . TRP B 1 228 ? 49.474  11.528  81.254  1.00 19.55 ? 227 TRP B CZ2 1 
ATOM   6246  C CZ3 . TRP B 1 228 ? 49.885  9.562   82.613  1.00 20.40 ? 227 TRP B CZ3 1 
ATOM   6247  C CH2 . TRP B 1 228 ? 49.598  10.936  82.486  1.00 18.70 ? 227 TRP B CH2 1 
ATOM   6248  N N   . PHE B 1 229 ? 52.693  6.882   80.329  1.00 23.57 ? 228 PHE B N   1 
ATOM   6249  C CA  . PHE B 1 229 ? 53.539  7.306   81.431  1.00 26.32 ? 228 PHE B CA  1 
ATOM   6250  C C   . PHE B 1 229 ? 55.023  7.235   81.072  1.00 26.33 ? 228 PHE B C   1 
ATOM   6251  O O   . PHE B 1 229 ? 55.745  8.218   81.212  1.00 27.29 ? 228 PHE B O   1 
ATOM   6252  C CB  . PHE B 1 229 ? 53.276  6.448   82.671  1.00 26.37 ? 228 PHE B CB  1 
ATOM   6253  C CG  . PHE B 1 229 ? 54.179  6.774   83.822  1.00 27.77 ? 228 PHE B CG  1 
ATOM   6254  C CD1 . PHE B 1 229 ? 54.032  7.968   84.521  1.00 26.73 ? 228 PHE B CD1 1 
ATOM   6255  C CD2 . PHE B 1 229 ? 55.222  5.919   84.165  1.00 27.65 ? 228 PHE B CD2 1 
ATOM   6256  C CE1 . PHE B 1 229 ? 54.917  8.308   85.541  1.00 27.38 ? 228 PHE B CE1 1 
ATOM   6257  C CE2 . PHE B 1 229 ? 56.112  6.251   85.182  1.00 26.67 ? 228 PHE B CE2 1 
ATOM   6258  C CZ  . PHE B 1 229 ? 55.960  7.448   85.869  1.00 28.24 ? 228 PHE B CZ  1 
ATOM   6259  N N   . LEU B 1 230 ? 55.473  6.074   80.611  1.00 27.71 ? 229 LEU B N   1 
ATOM   6260  C CA  . LEU B 1 230 ? 56.875  5.898   80.249  1.00 30.27 ? 229 LEU B CA  1 
ATOM   6261  C C   . LEU B 1 230 ? 57.296  6.835   79.126  1.00 32.45 ? 229 LEU B C   1 
ATOM   6262  O O   . LEU B 1 230 ? 58.474  7.178   78.999  1.00 32.71 ? 229 LEU B O   1 
ATOM   6263  C CB  . LEU B 1 230 ? 57.142  4.444   79.854  1.00 30.72 ? 229 LEU B CB  1 
ATOM   6264  C CG  . LEU B 1 230 ? 57.343  3.455   81.010  1.00 31.68 ? 229 LEU B CG  1 
ATOM   6265  C CD1 . LEU B 1 230 ? 56.224  3.594   82.015  1.00 36.47 ? 229 LEU B CD1 1 
ATOM   6266  C CD2 . LEU B 1 230 ? 57.395  2.033   80.472  1.00 31.97 ? 229 LEU B CD2 1 
ATOM   6267  N N   . GLN B 1 231 ? 56.332  7.249   78.311  1.00 33.28 ? 230 GLN B N   1 
ATOM   6268  C CA  . GLN B 1 231 ? 56.609  8.169   77.218  1.00 35.76 ? 230 GLN B CA  1 
ATOM   6269  C C   . GLN B 1 231 ? 57.280  9.426   77.770  1.00 35.43 ? 230 GLN B C   1 
ATOM   6270  O O   . GLN B 1 231 ? 58.183  9.989   77.148  1.00 34.03 ? 230 GLN B O   1 
ATOM   6271  C CB  . GLN B 1 231 ? 55.303  8.544   76.508  1.00 39.73 ? 230 GLN B CB  1 
ATOM   6272  C CG  . GLN B 1 231 ? 55.338  9.880   75.773  1.00 45.58 ? 230 GLN B CG  1 
ATOM   6273  C CD  . GLN B 1 231 ? 56.313  9.896   74.609  1.00 49.67 ? 230 GLN B CD  1 
ATOM   6274  O OE1 . GLN B 1 231 ? 56.597  10.953  74.039  1.00 52.28 ? 230 GLN B OE1 1 
ATOM   6275  N NE2 . GLN B 1 231 ? 56.824  8.723   74.244  1.00 51.63 ? 230 GLN B NE2 1 
ATOM   6276  N N   . ALA B 1 232 ? 56.845  9.854   78.950  1.00 34.39 ? 231 ALA B N   1 
ATOM   6277  C CA  . ALA B 1 232 ? 57.399  11.050  79.570  1.00 35.00 ? 231 ALA B CA  1 
ATOM   6278  C C   . ALA B 1 232 ? 58.504  10.753  80.578  1.00 34.33 ? 231 ALA B C   1 
ATOM   6279  O O   . ALA B 1 232 ? 59.511  11.458  80.623  1.00 34.05 ? 231 ALA B O   1 
ATOM   6280  C CB  . ALA B 1 232 ? 56.284  11.846  80.242  1.00 34.48 ? 231 ALA B CB  1 
ATOM   6281  N N   . ALA B 1 233 ? 58.317  9.710   81.380  1.00 33.87 ? 232 ALA B N   1 
ATOM   6282  C CA  . ALA B 1 233 ? 59.291  9.349   82.405  1.00 36.13 ? 232 ALA B CA  1 
ATOM   6283  C C   . ALA B 1 233 ? 60.520  8.620   81.864  1.00 37.16 ? 232 ALA B C   1 
ATOM   6284  O O   . ALA B 1 233 ? 61.625  8.803   82.374  1.00 37.29 ? 232 ALA B O   1 
ATOM   6285  C CB  . ALA B 1 233 ? 58.618  8.513   83.485  1.00 33.91 ? 232 ALA B CB  1 
ATOM   6286  N N   . LYS B 1 234 ? 60.320  7.792   80.841  1.00 39.86 ? 233 LYS B N   1 
ATOM   6287  C CA  . LYS B 1 234 ? 61.407  7.032   80.212  1.00 41.51 ? 233 LYS B CA  1 
ATOM   6288  C C   . LYS B 1 234 ? 61.931  5.894   81.089  1.00 41.85 ? 233 LYS B C   1 
ATOM   6289  O O   . LYS B 1 234 ? 62.042  4.753   80.643  1.00 44.49 ? 233 LYS B O   1 
ATOM   6290  C CB  . LYS B 1 234 ? 62.581  7.954   79.870  1.00 42.27 ? 233 LYS B CB  1 
ATOM   6291  C CG  . LYS B 1 234 ? 62.210  9.247   79.172  1.00 44.20 ? 233 LYS B CG  1 
ATOM   6292  C CD  . LYS B 1 234 ? 61.672  9.010   77.781  1.00 45.65 ? 233 LYS B CD  1 
ATOM   6293  C CE  . LYS B 1 234 ? 61.489  10.329  77.055  1.00 47.86 ? 233 LYS B CE  1 
ATOM   6294  N NZ  . LYS B 1 234 ? 62.785  11.060  76.942  1.00 50.42 ? 233 LYS B NZ  1 
ATOM   6295  N N   . ASP B 1 235 ? 62.261  6.216   82.335  1.00 40.31 ? 234 ASP B N   1 
ATOM   6296  C CA  . ASP B 1 235 ? 62.799  5.239   83.275  1.00 39.30 ? 234 ASP B CA  1 
ATOM   6297  C C   . ASP B 1 235 ? 61.771  4.246   83.818  1.00 37.40 ? 234 ASP B C   1 
ATOM   6298  O O   . ASP B 1 235 ? 60.892  4.609   84.602  1.00 37.42 ? 234 ASP B O   1 
ATOM   6299  C CB  . ASP B 1 235 ? 63.480  5.975   84.432  1.00 40.84 ? 234 ASP B CB  1 
ATOM   6300  C CG  . ASP B 1 235 ? 63.857  5.054   85.567  1.00 43.91 ? 234 ASP B CG  1 
ATOM   6301  O OD1 . ASP B 1 235 ? 64.430  3.977   85.300  1.00 45.68 ? 234 ASP B OD1 1 
ATOM   6302  O OD2 . ASP B 1 235 ? 63.583  5.413   86.730  1.00 45.94 ? 234 ASP B OD2 1 
ATOM   6303  N N   . PRO B 1 236 ? 61.880  2.971   83.413  1.00 35.35 ? 235 PRO B N   1 
ATOM   6304  C CA  . PRO B 1 236 ? 60.963  1.915   83.855  1.00 34.18 ? 235 PRO B CA  1 
ATOM   6305  C C   . PRO B 1 236 ? 60.837  1.756   85.368  1.00 32.55 ? 235 PRO B C   1 
ATOM   6306  O O   . PRO B 1 236 ? 59.813  1.283   85.863  1.00 31.92 ? 235 PRO B O   1 
ATOM   6307  C CB  . PRO B 1 236 ? 61.520  0.661   83.176  1.00 34.50 ? 235 PRO B CB  1 
ATOM   6308  C CG  . PRO B 1 236 ? 62.971  0.983   82.982  1.00 35.88 ? 235 PRO B CG  1 
ATOM   6309  C CD  . PRO B 1 236 ? 62.918  2.416   82.529  1.00 35.28 ? 235 PRO B CD  1 
ATOM   6310  N N   . SER B 1 237 ? 61.865  2.147   86.110  1.00 30.78 ? 236 SER B N   1 
ATOM   6311  C CA  . SER B 1 237 ? 61.793  2.024   87.560  1.00 31.08 ? 236 SER B CA  1 
ATOM   6312  C C   . SER B 1 237 ? 60.887  3.114   88.139  1.00 28.78 ? 236 SER B C   1 
ATOM   6313  O O   . SER B 1 237 ? 60.565  3.099   89.322  1.00 26.82 ? 236 SER B O   1 
ATOM   6314  C CB  . SER B 1 237 ? 63.190  2.120   88.188  1.00 32.53 ? 236 SER B CB  1 
ATOM   6315  O OG  . SER B 1 237 ? 63.651  3.459   88.220  1.00 35.86 ? 236 SER B OG  1 
ATOM   6316  N N   . ALA B 1 238 ? 60.479  4.060   87.299  1.00 28.54 ? 237 ALA B N   1 
ATOM   6317  C CA  . ALA B 1 238 ? 59.606  5.143   87.747  1.00 28.78 ? 237 ALA B CA  1 
ATOM   6318  C C   . ALA B 1 238 ? 58.162  4.648   87.876  1.00 28.48 ? 237 ALA B C   1 
ATOM   6319  O O   . ALA B 1 238 ? 57.339  5.264   88.557  1.00 27.77 ? 237 ALA B O   1 
ATOM   6320  C CB  . ALA B 1 238 ? 59.677  6.310   86.772  1.00 27.26 ? 237 ALA B CB  1 
ATOM   6321  N N   . VAL B 1 239 ? 57.868  3.525   87.227  1.00 27.99 ? 238 VAL B N   1 
ATOM   6322  C CA  . VAL B 1 239 ? 56.532  2.943   87.260  1.00 26.97 ? 238 VAL B CA  1 
ATOM   6323  C C   . VAL B 1 239 ? 56.094  2.614   88.686  1.00 26.63 ? 238 VAL B C   1 
ATOM   6324  O O   . VAL B 1 239 ? 54.919  2.775   89.042  1.00 25.62 ? 238 VAL B O   1 
ATOM   6325  C CB  . VAL B 1 239 ? 56.476  1.657   86.387  1.00 28.03 ? 238 VAL B CB  1 
ATOM   6326  C CG1 . VAL B 1 239 ? 55.147  0.937   86.570  1.00 27.69 ? 238 VAL B CG1 1 
ATOM   6327  C CG2 . VAL B 1 239 ? 56.667  2.022   84.927  1.00 27.99 ? 238 VAL B CG2 1 
ATOM   6328  N N   . ALA B 1 240 ? 57.045  2.164   89.500  1.00 25.28 ? 239 ALA B N   1 
ATOM   6329  C CA  . ALA B 1 240 ? 56.772  1.794   90.885  1.00 22.76 ? 239 ALA B CA  1 
ATOM   6330  C C   . ALA B 1 240 ? 56.273  2.957   91.745  1.00 23.31 ? 239 ALA B C   1 
ATOM   6331  O O   . ALA B 1 240 ? 55.664  2.741   92.794  1.00 22.39 ? 239 ALA B O   1 
ATOM   6332  C CB  . ALA B 1 240 ? 58.024  1.182   91.513  1.00 23.69 ? 239 ALA B CB  1 
ATOM   6333  N N   . LYS B 1 241 ? 56.538  4.187   91.320  1.00 22.25 ? 240 LYS B N   1 
ATOM   6334  C CA  . LYS B 1 241 ? 56.080  5.338   92.087  1.00 24.72 ? 240 LYS B CA  1 
ATOM   6335  C C   . LYS B 1 241 ? 54.742  5.843   91.563  1.00 24.98 ? 240 LYS B C   1 
ATOM   6336  O O   . LYS B 1 241 ? 54.134  6.727   92.164  1.00 25.97 ? 240 LYS B O   1 
ATOM   6337  C CB  . LYS B 1 241 ? 57.096  6.483   92.017  1.00 25.58 ? 240 LYS B CB  1 
ATOM   6338  C CG  . LYS B 1 241 ? 58.493  6.138   92.528  1.00 28.40 ? 240 LYS B CG  1 
ATOM   6339  C CD  . LYS B 1 241 ? 59.407  7.352   92.441  1.00 31.62 ? 240 LYS B CD  1 
ATOM   6340  C CE  . LYS B 1 241 ? 60.856  7.003   92.750  1.00 32.60 ? 240 LYS B CE  1 
ATOM   6341  N NZ  . LYS B 1 241 ? 61.022  6.462   94.123  1.00 36.20 ? 240 LYS B NZ  1 
ATOM   6342  N N   . HIS B 1 242 ? 54.274  5.276   90.454  1.00 23.53 ? 241 HIS B N   1 
ATOM   6343  C CA  . HIS B 1 242 ? 53.023  5.743   89.863  1.00 23.92 ? 241 HIS B CA  1 
ATOM   6344  C C   . HIS B 1 242 ? 51.945  4.695   89.577  1.00 22.18 ? 241 HIS B C   1 
ATOM   6345  O O   . HIS B 1 242 ? 50.867  5.029   89.089  1.00 21.02 ? 241 HIS B O   1 
ATOM   6346  C CB  . HIS B 1 242 ? 53.360  6.519   88.591  1.00 22.65 ? 241 HIS B CB  1 
ATOM   6347  C CG  . HIS B 1 242 ? 54.138  7.771   88.851  1.00 24.71 ? 241 HIS B CG  1 
ATOM   6348  N ND1 . HIS B 1 242 ? 53.532  8.983   89.105  1.00 24.68 ? 241 HIS B ND1 1 
ATOM   6349  C CD2 . HIS B 1 242 ? 55.472  7.992   88.937  1.00 24.08 ? 241 HIS B CD2 1 
ATOM   6350  C CE1 . HIS B 1 242 ? 54.459  9.896   89.334  1.00 24.43 ? 241 HIS B CE1 1 
ATOM   6351  N NE2 . HIS B 1 242 ? 55.645  9.321   89.238  1.00 22.29 ? 241 HIS B NE2 1 
ATOM   6352  N N   . PHE B 1 243 ? 52.236  3.436   89.886  1.00 22.86 ? 242 PHE B N   1 
ATOM   6353  C CA  . PHE B 1 243 ? 51.284  2.349   89.668  1.00 22.45 ? 242 PHE B CA  1 
ATOM   6354  C C   . PHE B 1 243 ? 51.247  1.384   90.847  1.00 22.59 ? 242 PHE B C   1 
ATOM   6355  O O   . PHE B 1 243 ? 52.288  0.933   91.333  1.00 21.59 ? 242 PHE B O   1 
ATOM   6356  C CB  . PHE B 1 243 ? 51.634  1.534   88.413  1.00 20.75 ? 242 PHE B CB  1 
ATOM   6357  C CG  . PHE B 1 243 ? 51.467  2.286   87.120  1.00 21.06 ? 242 PHE B CG  1 
ATOM   6358  C CD1 . PHE B 1 243 ? 52.399  3.241   86.727  1.00 21.42 ? 242 PHE B CD1 1 
ATOM   6359  C CD2 . PHE B 1 243 ? 50.383  2.024   86.285  1.00 20.12 ? 242 PHE B CD2 1 
ATOM   6360  C CE1 . PHE B 1 243 ? 52.258  3.924   85.518  1.00 22.63 ? 242 PHE B CE1 1 
ATOM   6361  C CE2 . PHE B 1 243 ? 50.230  2.701   85.073  1.00 20.78 ? 242 PHE B CE2 1 
ATOM   6362  C CZ  . PHE B 1 243 ? 51.171  3.654   84.688  1.00 20.21 ? 242 PHE B CZ  1 
ATOM   6363  N N   . VAL B 1 244 ? 50.038  1.076   91.301  1.00 21.54 ? 243 VAL B N   1 
ATOM   6364  C CA  . VAL B 1 244 ? 49.842  0.128   92.382  1.00 22.09 ? 243 VAL B CA  1 
ATOM   6365  C C   . VAL B 1 244 ? 48.799  -0.866  91.884  1.00 22.37 ? 243 VAL B C   1 
ATOM   6366  O O   . VAL B 1 244 ? 48.091  -0.601  90.903  1.00 20.64 ? 243 VAL B O   1 
ATOM   6367  C CB  . VAL B 1 244 ? 49.366  0.809   93.693  1.00 23.69 ? 243 VAL B CB  1 
ATOM   6368  C CG1 . VAL B 1 244 ? 50.433  1.792   94.167  1.00 23.71 ? 243 VAL B CG1 1 
ATOM   6369  C CG2 . VAL B 1 244 ? 48.027  1.517   93.486  1.00 25.64 ? 243 VAL B CG2 1 
ATOM   6370  N N   . ALA B 1 245 ? 48.708  -2.014  92.545  1.00 21.39 ? 244 ALA B N   1 
ATOM   6371  C CA  . ALA B 1 245 ? 47.775  -3.037  92.117  1.00 20.56 ? 244 ALA B CA  1 
ATOM   6372  C C   . ALA B 1 245 ? 46.882  -3.585  93.217  1.00 22.46 ? 244 ALA B C   1 
ATOM   6373  O O   . ALA B 1 245 ? 47.287  -3.705  94.377  1.00 21.60 ? 244 ALA B O   1 
ATOM   6374  C CB  . ALA B 1 245 ? 48.540  -4.177  91.471  1.00 19.85 ? 244 ALA B CB  1 
ATOM   6375  N N   . LEU B 1 246 ? 45.658  -3.919  92.823  1.00 22.29 ? 245 LEU B N   1 
ATOM   6376  C CA  . LEU B 1 246 ? 44.685  -4.497  93.725  1.00 24.22 ? 245 LEU B CA  1 
ATOM   6377  C C   . LEU B 1 246 ? 44.465  -5.905  93.189  1.00 25.93 ? 245 LEU B C   1 
ATOM   6378  O O   . LEU B 1 246 ? 43.577  -6.127  92.374  1.00 26.64 ? 245 LEU B O   1 
ATOM   6379  C CB  . LEU B 1 246 ? 43.378  -3.696  93.685  1.00 22.46 ? 245 LEU B CB  1 
ATOM   6380  C CG  . LEU B 1 246 ? 43.509  -2.176  93.834  1.00 20.38 ? 245 LEU B CG  1 
ATOM   6381  C CD1 . LEU B 1 246 ? 42.114  -1.566  93.953  1.00 20.74 ? 245 LEU B CD1 1 
ATOM   6382  C CD2 . LEU B 1 246 ? 44.346  -1.830  95.071  1.00 17.04 ? 245 LEU B CD2 1 
ATOM   6383  N N   . SER B 1 247 ? 45.310  -6.841  93.616  1.00 28.63 ? 246 SER B N   1 
ATOM   6384  C CA  . SER B 1 247 ? 45.211  -8.232  93.176  1.00 31.10 ? 246 SER B CA  1 
ATOM   6385  C C   . SER B 1 247 ? 46.047  -9.153  94.058  1.00 30.53 ? 246 SER B C   1 
ATOM   6386  O O   . SER B 1 247 ? 46.534  -8.743  95.117  1.00 30.42 ? 246 SER B O   1 
ATOM   6387  C CB  . SER B 1 247 ? 45.678  -8.377  91.724  1.00 32.89 ? 246 SER B CB  1 
ATOM   6388  O OG  . SER B 1 247 ? 47.072  -8.600  91.627  1.00 34.35 ? 246 SER B OG  1 
ATOM   6389  N N   . THR B 1 248 ? 46.205  -10.399 93.613  1.00 30.19 ? 247 THR B N   1 
ATOM   6390  C CA  . THR B 1 248 ? 46.980  -11.392 94.353  1.00 29.13 ? 247 THR B CA  1 
ATOM   6391  C C   . THR B 1 248 ? 48.095  -12.024 93.518  1.00 30.47 ? 247 THR B C   1 
ATOM   6392  O O   . THR B 1 248 ? 48.940  -12.743 94.048  1.00 29.42 ? 247 THR B O   1 
ATOM   6393  C CB  . THR B 1 248 ? 46.064  -12.514 94.905  1.00 29.69 ? 247 THR B CB  1 
ATOM   6394  O OG1 . THR B 1 248 ? 45.260  -13.049 93.845  1.00 26.44 ? 247 THR B OG1 1 
ATOM   6395  C CG2 . THR B 1 248 ? 45.153  -11.965 96.006  1.00 25.98 ? 247 THR B CG2 1 
ATOM   6396  N N   . ASN B 1 249 ? 48.106  -11.744 92.218  1.00 29.68 ? 248 ASN B N   1 
ATOM   6397  C CA  . ASN B 1 249 ? 49.123  -12.303 91.336  1.00 31.56 ? 248 ASN B CA  1 
ATOM   6398  C C   . ASN B 1 249 ? 50.417  -11.506 91.442  1.00 32.82 ? 248 ASN B C   1 
ATOM   6399  O O   . ASN B 1 249 ? 50.676  -10.611 90.637  1.00 33.34 ? 248 ASN B O   1 
ATOM   6400  C CB  . ASN B 1 249 ? 48.636  -12.286 89.890  1.00 30.58 ? 248 ASN B CB  1 
ATOM   6401  C CG  . ASN B 1 249 ? 49.525  -13.103 88.966  1.00 31.26 ? 248 ASN B CG  1 
ATOM   6402  O OD1 . ASN B 1 249 ? 50.748  -13.118 89.107  1.00 29.36 ? 248 ASN B OD1 1 
ATOM   6403  N ND2 . ASN B 1 249 ? 48.909  -13.775 88.003  1.00 32.11 ? 248 ASN B ND2 1 
ATOM   6404  N N   . THR B 1 250 ? 51.231  -11.845 92.434  1.00 32.70 ? 249 THR B N   1 
ATOM   6405  C CA  . THR B 1 250 ? 52.497  -11.157 92.664  1.00 33.60 ? 249 THR B CA  1 
ATOM   6406  C C   . THR B 1 250 ? 53.424  -11.147 91.452  1.00 33.67 ? 249 THR B C   1 
ATOM   6407  O O   . THR B 1 250 ? 54.059  -10.132 91.156  1.00 32.90 ? 249 THR B O   1 
ATOM   6408  C CB  . THR B 1 250 ? 53.239  -11.790 93.846  1.00 34.16 ? 249 THR B CB  1 
ATOM   6409  O OG1 . THR B 1 250 ? 52.355  -11.847 94.970  1.00 34.48 ? 249 THR B OG1 1 
ATOM   6410  C CG2 . THR B 1 250 ? 54.469  -10.967 94.214  1.00 34.62 ? 249 THR B CG2 1 
ATOM   6411  N N   . THR B 1 251 ? 53.505  -12.277 90.753  1.00 34.51 ? 250 THR B N   1 
ATOM   6412  C CA  . THR B 1 251 ? 54.362  -12.385 89.575  1.00 33.85 ? 250 THR B CA  1 
ATOM   6413  C C   . THR B 1 251 ? 53.983  -11.360 88.508  1.00 33.16 ? 250 THR B C   1 
ATOM   6414  O O   . THR B 1 251 ? 54.804  -10.538 88.101  1.00 31.45 ? 250 THR B O   1 
ATOM   6415  C CB  . THR B 1 251 ? 54.288  -13.802 88.953  1.00 35.44 ? 250 THR B CB  1 
ATOM   6416  O OG1 . THR B 1 251 ? 54.822  -14.761 89.876  1.00 35.39 ? 250 THR B OG1 1 
ATOM   6417  C CG2 . THR B 1 251 ? 55.086  -13.861 87.659  1.00 35.20 ? 250 THR B CG2 1 
ATOM   6418  N N   . LYS B 1 252 ? 52.734  -11.410 88.059  1.00 32.30 ? 251 LYS B N   1 
ATOM   6419  C CA  . LYS B 1 252 ? 52.264  -10.488 87.032  1.00 32.70 ? 251 LYS B CA  1 
ATOM   6420  C C   . LYS B 1 252 ? 52.394  -9.030  87.457  1.00 32.41 ? 251 LYS B C   1 
ATOM   6421  O O   . LYS B 1 252 ? 52.683  -8.159  86.633  1.00 30.82 ? 251 LYS B O   1 
ATOM   6422  C CB  . LYS B 1 252 ? 50.811  -10.801 86.668  1.00 34.29 ? 251 LYS B CB  1 
ATOM   6423  C CG  . LYS B 1 252 ? 50.647  -12.110 85.904  1.00 34.61 ? 251 LYS B CG  1 
ATOM   6424  C CD  . LYS B 1 252 ? 51.355  -12.034 84.564  1.00 38.63 ? 251 LYS B CD  1 
ATOM   6425  C CE  . LYS B 1 252 ? 51.288  -13.350 83.805  1.00 39.73 ? 251 LYS B CE  1 
ATOM   6426  N NZ  . LYS B 1 252 ? 52.008  -13.261 82.503  1.00 41.05 ? 251 LYS B NZ  1 
ATOM   6427  N N   . VAL B 1 253 ? 52.184  -8.767  88.742  1.00 30.72 ? 252 VAL B N   1 
ATOM   6428  C CA  . VAL B 1 253 ? 52.291  -7.411  89.249  1.00 31.85 ? 252 VAL B CA  1 
ATOM   6429  C C   . VAL B 1 253 ? 53.751  -6.954  89.207  1.00 33.76 ? 252 VAL B C   1 
ATOM   6430  O O   . VAL B 1 253 ? 54.039  -5.777  88.978  1.00 33.04 ? 252 VAL B O   1 
ATOM   6431  C CB  . VAL B 1 253 ? 51.751  -7.308  90.693  1.00 30.76 ? 252 VAL B CB  1 
ATOM   6432  C CG1 . VAL B 1 253 ? 51.874  -5.871  91.187  1.00 28.31 ? 252 VAL B CG1 1 
ATOM   6433  C CG2 . VAL B 1 253 ? 50.295  -7.760  90.738  1.00 28.39 ? 252 VAL B CG2 1 
ATOM   6434  N N   . LYS B 1 254 ? 54.670  -7.888  89.429  1.00 36.40 ? 253 LYS B N   1 
ATOM   6435  C CA  . LYS B 1 254 ? 56.098  -7.573  89.383  1.00 39.62 ? 253 LYS B CA  1 
ATOM   6436  C C   . LYS B 1 254 ? 56.483  -7.242  87.947  1.00 39.63 ? 253 LYS B C   1 
ATOM   6437  O O   . LYS B 1 254 ? 57.066  -6.191  87.673  1.00 39.70 ? 253 LYS B O   1 
ATOM   6438  C CB  . LYS B 1 254 ? 56.940  -8.765  89.846  1.00 41.17 ? 253 LYS B CB  1 
ATOM   6439  C CG  . LYS B 1 254 ? 57.185  -8.854  91.335  1.00 45.01 ? 253 LYS B CG  1 
ATOM   6440  C CD  . LYS B 1 254 ? 58.023  -10.087 91.644  1.00 48.60 ? 253 LYS B CD  1 
ATOM   6441  C CE  . LYS B 1 254 ? 58.393  -10.167 93.112  1.00 52.03 ? 253 LYS B CE  1 
ATOM   6442  N NZ  . LYS B 1 254 ? 59.282  -9.038  93.510  1.00 56.16 ? 253 LYS B NZ  1 
ATOM   6443  N N   . GLU B 1 255 ? 56.148  -8.155  87.038  1.00 40.19 ? 254 GLU B N   1 
ATOM   6444  C CA  . GLU B 1 255 ? 56.455  -7.995  85.619  1.00 41.14 ? 254 GLU B CA  1 
ATOM   6445  C C   . GLU B 1 255 ? 56.015  -6.629  85.112  1.00 39.72 ? 254 GLU B C   1 
ATOM   6446  O O   . GLU B 1 255 ? 56.751  -5.964  84.381  1.00 40.33 ? 254 GLU B O   1 
ATOM   6447  C CB  . GLU B 1 255 ? 55.757  -9.082  84.794  1.00 44.37 ? 254 GLU B CB  1 
ATOM   6448  C CG  . GLU B 1 255 ? 55.914  -10.490 85.349  1.00 49.77 ? 254 GLU B CG  1 
ATOM   6449  C CD  . GLU B 1 255 ? 55.257  -11.542 84.470  1.00 52.76 ? 254 GLU B CD  1 
ATOM   6450  O OE1 . GLU B 1 255 ? 54.139  -11.288 83.969  1.00 53.79 ? 254 GLU B OE1 1 
ATOM   6451  O OE2 . GLU B 1 255 ? 55.855  -12.627 84.292  1.00 53.92 ? 254 GLU B OE2 1 
ATOM   6452  N N   . PHE B 1 256 ? 54.813  -6.215  85.499  1.00 37.37 ? 255 PHE B N   1 
ATOM   6453  C CA  . PHE B 1 256 ? 54.273  -4.927  85.073  1.00 35.51 ? 255 PHE B CA  1 
ATOM   6454  C C   . PHE B 1 256 ? 55.219  -3.786  85.457  1.00 34.67 ? 255 PHE B C   1 
ATOM   6455  O O   . PHE B 1 256 ? 55.337  -2.795  84.739  1.00 34.59 ? 255 PHE B O   1 
ATOM   6456  C CB  . PHE B 1 256 ? 52.897  -4.697  85.709  1.00 34.82 ? 255 PHE B CB  1 
ATOM   6457  C CG  . PHE B 1 256 ? 52.117  -3.574  85.079  1.00 34.99 ? 255 PHE B CG  1 
ATOM   6458  C CD1 . PHE B 1 256 ? 51.425  -3.774  83.885  1.00 35.00 ? 255 PHE B CD1 1 
ATOM   6459  C CD2 . PHE B 1 256 ? 52.088  -2.314  85.668  1.00 33.24 ? 255 PHE B CD2 1 
ATOM   6460  C CE1 . PHE B 1 256 ? 50.713  -2.733  83.287  1.00 34.21 ? 255 PHE B CE1 1 
ATOM   6461  C CE2 . PHE B 1 256 ? 51.382  -1.267  85.078  1.00 35.03 ? 255 PHE B CE2 1 
ATOM   6462  C CZ  . PHE B 1 256 ? 50.692  -1.478  83.885  1.00 33.71 ? 255 PHE B CZ  1 
ATOM   6463  N N   . GLY B 1 257 ? 55.894  -3.932  86.594  1.00 34.50 ? 256 GLY B N   1 
ATOM   6464  C CA  . GLY B 1 257 ? 56.816  -2.901  87.037  1.00 33.52 ? 256 GLY B CA  1 
ATOM   6465  C C   . GLY B 1 257 ? 56.336  -2.250  88.316  1.00 33.11 ? 256 GLY B C   1 
ATOM   6466  O O   . GLY B 1 257 ? 56.816  -1.190  88.722  1.00 32.85 ? 256 GLY B O   1 
ATOM   6467  N N   . ILE B 1 258 ? 55.373  -2.898  88.953  1.00 33.59 ? 257 ILE B N   1 
ATOM   6468  C CA  . ILE B 1 258 ? 54.807  -2.398  90.194  1.00 32.81 ? 257 ILE B CA  1 
ATOM   6469  C C   . ILE B 1 258 ? 55.557  -3.007  91.366  1.00 32.62 ? 257 ILE B C   1 
ATOM   6470  O O   . ILE B 1 258 ? 55.984  -4.157  91.304  1.00 33.27 ? 257 ILE B O   1 
ATOM   6471  C CB  . ILE B 1 258 ? 53.304  -2.759  90.292  1.00 30.91 ? 257 ILE B CB  1 
ATOM   6472  C CG1 . ILE B 1 258 ? 52.523  -1.992  89.218  1.00 29.83 ? 257 ILE B CG1 1 
ATOM   6473  C CG2 . ILE B 1 258 ? 52.776  -2.444  91.681  1.00 31.91 ? 257 ILE B CG2 1 
ATOM   6474  C CD1 . ILE B 1 258 ? 51.048  -2.301  89.173  1.00 26.79 ? 257 ILE B CD1 1 
ATOM   6475  N N   . ASP B 1 259 ? 55.731  -2.228  92.426  1.00 33.95 ? 258 ASP B N   1 
ATOM   6476  C CA  . ASP B 1 259 ? 56.421  -2.703  93.618  1.00 35.03 ? 258 ASP B CA  1 
ATOM   6477  C C   . ASP B 1 259 ? 55.504  -3.652  94.398  1.00 36.05 ? 258 ASP B C   1 
ATOM   6478  O O   . ASP B 1 259 ? 54.422  -3.259  94.842  1.00 35.39 ? 258 ASP B O   1 
ATOM   6479  C CB  . ASP B 1 259 ? 56.806  -1.521  94.506  1.00 35.44 ? 258 ASP B CB  1 
ATOM   6480  C CG  . ASP B 1 259 ? 57.596  -1.943  95.728  1.00 36.46 ? 258 ASP B CG  1 
ATOM   6481  O OD1 . ASP B 1 259 ? 57.496  -3.122  96.133  1.00 36.67 ? 258 ASP B OD1 1 
ATOM   6482  O OD2 . ASP B 1 259 ? 58.308  -1.087  96.292  1.00 37.24 ? 258 ASP B OD2 1 
ATOM   6483  N N   . PRO B 1 260 ? 55.938  -4.910  94.586  1.00 37.42 ? 259 PRO B N   1 
ATOM   6484  C CA  . PRO B 1 260 ? 55.192  -5.950  95.306  1.00 36.92 ? 259 PRO B CA  1 
ATOM   6485  C C   . PRO B 1 260 ? 54.603  -5.494  96.641  1.00 36.56 ? 259 PRO B C   1 
ATOM   6486  O O   . PRO B 1 260 ? 53.544  -5.969  97.055  1.00 35.40 ? 259 PRO B O   1 
ATOM   6487  C CB  . PRO B 1 260 ? 56.233  -7.052  95.485  1.00 38.63 ? 259 PRO B CB  1 
ATOM   6488  C CG  . PRO B 1 260 ? 57.056  -6.920  94.252  1.00 39.02 ? 259 PRO B CG  1 
ATOM   6489  C CD  . PRO B 1 260 ? 57.252  -5.423  94.160  1.00 37.70 ? 259 PRO B CD  1 
ATOM   6490  N N   . GLN B 1 261 ? 55.286  -4.579  97.322  1.00 36.96 ? 260 GLN B N   1 
ATOM   6491  C CA  . GLN B 1 261 ? 54.781  -4.097  98.601  1.00 37.48 ? 260 GLN B CA  1 
ATOM   6492  C C   . GLN B 1 261 ? 53.555  -3.217  98.370  1.00 35.49 ? 260 GLN B C   1 
ATOM   6493  O O   . GLN B 1 261 ? 52.858  -2.846  99.316  1.00 34.36 ? 260 GLN B O   1 
ATOM   6494  C CB  . GLN B 1 261 ? 55.866  -3.319  99.366  1.00 41.52 ? 260 GLN B CB  1 
ATOM   6495  C CG  . GLN B 1 261 ? 56.324  -2.019  98.716  1.00 46.21 ? 260 GLN B CG  1 
ATOM   6496  C CD  . GLN B 1 261 ? 57.352  -1.266  99.561  1.00 49.82 ? 260 GLN B CD  1 
ATOM   6497  O OE1 . GLN B 1 261 ? 57.061  -0.837  100.681 1.00 51.77 ? 260 GLN B OE1 1 
ATOM   6498  N NE2 . GLN B 1 261 ? 58.559  -1.103  99.024  1.00 50.28 ? 260 GLN B NE2 1 
ATOM   6499  N N   . ASN B 1 262 ? 53.290  -2.900  97.104  1.00 32.99 ? 261 ASN B N   1 
ATOM   6500  C CA  . ASN B 1 262 ? 52.143  -2.072  96.748  1.00 32.82 ? 261 ASN B CA  1 
ATOM   6501  C C   . ASN B 1 262 ? 51.031  -2.859  96.061  1.00 32.22 ? 261 ASN B C   1 
ATOM   6502  O O   . ASN B 1 262 ? 50.310  -2.330  95.208  1.00 30.93 ? 261 ASN B O   1 
ATOM   6503  C CB  . ASN B 1 262 ? 52.576  -0.914  95.855  1.00 33.37 ? 261 ASN B CB  1 
ATOM   6504  C CG  . ASN B 1 262 ? 53.593  -0.024  96.522  1.00 33.81 ? 261 ASN B CG  1 
ATOM   6505  O OD1 . ASN B 1 262 ? 53.440  0.343   97.687  1.00 33.75 ? 261 ASN B OD1 1 
ATOM   6506  N ND2 . ASN B 1 262 ? 54.637  0.337   95.787  1.00 31.39 ? 261 ASN B ND2 1 
ATOM   6507  N N   . MET B 1 263 ? 50.915  -4.133  96.420  1.00 31.01 ? 262 MET B N   1 
ATOM   6508  C CA  . MET B 1 263 ? 49.866  -4.982  95.884  1.00 30.06 ? 262 MET B CA  1 
ATOM   6509  C C   . MET B 1 263 ? 48.907  -5.229  97.038  1.00 28.97 ? 262 MET B C   1 
ATOM   6510  O O   . MET B 1 263 ? 49.261  -5.886  98.016  1.00 27.31 ? 262 MET B O   1 
ATOM   6511  C CB  . MET B 1 263 ? 50.417  -6.319  95.391  1.00 30.69 ? 262 MET B CB  1 
ATOM   6512  C CG  . MET B 1 263 ? 49.335  -7.212  94.801  1.00 31.33 ? 262 MET B CG  1 
ATOM   6513  S SD  . MET B 1 263 ? 49.930  -8.780  94.142  1.00 37.33 ? 262 MET B SD  1 
ATOM   6514  C CE  . MET B 1 263 ? 49.957  -9.767  95.639  1.00 34.72 ? 262 MET B CE  1 
ATOM   6515  N N   . PHE B 1 264 ? 47.701  -4.683  96.928  1.00 27.16 ? 263 PHE B N   1 
ATOM   6516  C CA  . PHE B 1 264 ? 46.695  -4.840  97.968  1.00 25.75 ? 263 PHE B CA  1 
ATOM   6517  C C   . PHE B 1 264 ? 45.787  -5.990  97.564  1.00 26.79 ? 263 PHE B C   1 
ATOM   6518  O O   . PHE B 1 264 ? 45.108  -5.940  96.539  1.00 24.51 ? 263 PHE B O   1 
ATOM   6519  C CB  . PHE B 1 264 ? 45.922  -3.534  98.130  1.00 25.04 ? 263 PHE B CB  1 
ATOM   6520  C CG  . PHE B 1 264 ? 46.811  -2.346  98.377  1.00 23.67 ? 263 PHE B CG  1 
ATOM   6521  C CD1 . PHE B 1 264 ? 47.504  -1.749  97.327  1.00 21.74 ? 263 PHE B CD1 1 
ATOM   6522  C CD2 . PHE B 1 264 ? 46.993  -1.853  99.667  1.00 24.12 ? 263 PHE B CD2 1 
ATOM   6523  C CE1 . PHE B 1 264 ? 48.368  -0.678  97.560  1.00 23.37 ? 263 PHE B CE1 1 
ATOM   6524  C CE2 . PHE B 1 264 ? 47.858  -0.781  99.910  1.00 24.06 ? 263 PHE B CE2 1 
ATOM   6525  C CZ  . PHE B 1 264 ? 48.546  -0.195  98.855  1.00 23.10 ? 263 PHE B CZ  1 
ATOM   6526  N N   . GLU B 1 265 ? 45.769  -7.032  98.380  1.00 26.00 ? 264 GLU B N   1 
ATOM   6527  C CA  . GLU B 1 265 ? 45.000  -8.207  98.032  1.00 28.23 ? 264 GLU B CA  1 
ATOM   6528  C C   . GLU B 1 265 ? 43.648  -8.424  98.679  1.00 26.37 ? 264 GLU B C   1 
ATOM   6529  O O   . GLU B 1 265 ? 43.333  -7.857  99.725  1.00 24.67 ? 264 GLU B O   1 
ATOM   6530  C CB  . GLU B 1 265 ? 45.873  -9.439  98.263  1.00 31.77 ? 264 GLU B CB  1 
ATOM   6531  C CG  . GLU B 1 265 ? 46.539  -9.451  99.618  1.00 37.37 ? 264 GLU B CG  1 
ATOM   6532  C CD  . GLU B 1 265 ? 47.714  -10.407 99.683  1.00 42.35 ? 264 GLU B CD  1 
ATOM   6533  O OE1 . GLU B 1 265 ? 48.385  -10.445 100.739 1.00 42.68 ? 264 GLU B OE1 1 
ATOM   6534  O OE2 . GLU B 1 265 ? 47.964  -11.114 98.681  1.00 44.52 ? 264 GLU B OE2 1 
ATOM   6535  N N   . PHE B 1 266 ? 42.844  -9.239  98.004  1.00 24.59 ? 265 PHE B N   1 
ATOM   6536  C CA  . PHE B 1 266 ? 41.538  -9.638  98.500  1.00 25.84 ? 265 PHE B CA  1 
ATOM   6537  C C   . PHE B 1 266 ? 41.426  -11.145 98.268  1.00 25.78 ? 265 PHE B C   1 
ATOM   6538  O O   . PHE B 1 266 ? 42.393  -11.775 97.825  1.00 26.46 ? 265 PHE B O   1 
ATOM   6539  C CB  . PHE B 1 266 ? 40.383  -8.841  97.866  1.00 24.84 ? 265 PHE B CB  1 
ATOM   6540  C CG  . PHE B 1 266 ? 40.489  -8.640  96.383  1.00 28.24 ? 265 PHE B CG  1 
ATOM   6541  C CD1 . PHE B 1 266 ? 39.523  -9.169  95.534  1.00 29.05 ? 265 PHE B CD1 1 
ATOM   6542  C CD2 . PHE B 1 266 ? 41.500  -7.853  95.840  1.00 28.33 ? 265 PHE B CD2 1 
ATOM   6543  C CE1 . PHE B 1 266 ? 39.558  -8.914  94.162  1.00 31.53 ? 265 PHE B CE1 1 
ATOM   6544  C CE2 . PHE B 1 266 ? 41.547  -7.591  94.472  1.00 31.56 ? 265 PHE B CE2 1 
ATOM   6545  C CZ  . PHE B 1 266 ? 40.572  -8.121  93.630  1.00 33.32 ? 265 PHE B CZ  1 
ATOM   6546  N N   . TRP B 1 267 ? 40.271  -11.732 98.545  1.00 23.91 ? 266 TRP B N   1 
ATOM   6547  C CA  . TRP B 1 267 ? 40.161  -13.180 98.454  1.00 23.44 ? 266 TRP B CA  1 
ATOM   6548  C C   . TRP B 1 267 ? 39.016  -13.719 97.597  1.00 24.87 ? 266 TRP B C   1 
ATOM   6549  O O   . TRP B 1 267 ? 38.121  -12.970 97.210  1.00 23.46 ? 266 TRP B O   1 
ATOM   6550  C CB  . TRP B 1 267 ? 40.091  -13.707 99.891  1.00 22.51 ? 266 TRP B CB  1 
ATOM   6551  C CG  . TRP B 1 267 ? 41.212  -13.129 100.739 1.00 22.54 ? 266 TRP B CG  1 
ATOM   6552  C CD1 . TRP B 1 267 ? 42.452  -13.675 100.944 1.00 24.21 ? 266 TRP B CD1 1 
ATOM   6553  C CD2 . TRP B 1 267 ? 41.243  -11.833 101.364 1.00 23.21 ? 266 TRP B CD2 1 
ATOM   6554  N NE1 . TRP B 1 267 ? 43.251  -12.798 101.646 1.00 25.97 ? 266 TRP B NE1 1 
ATOM   6555  C CE2 . TRP B 1 267 ? 42.536  -11.662 101.915 1.00 23.56 ? 266 TRP B CE2 1 
ATOM   6556  C CE3 . TRP B 1 267 ? 40.306  -10.798 101.505 1.00 25.14 ? 266 TRP B CE3 1 
ATOM   6557  C CZ2 . TRP B 1 267 ? 42.915  -10.498 102.596 1.00 24.89 ? 266 TRP B CZ2 1 
ATOM   6558  C CZ3 . TRP B 1 267 ? 40.686  -9.634  102.186 1.00 24.56 ? 266 TRP B CZ3 1 
ATOM   6559  C CH2 . TRP B 1 267 ? 41.980  -9.498  102.721 1.00 24.34 ? 266 TRP B CH2 1 
ATOM   6560  N N   . ASP B 1 268 ? 39.039  -15.019 97.304  1.00 25.07 ? 267 ASP B N   1 
ATOM   6561  C CA  . ASP B 1 268 ? 37.995  -15.591 96.464  1.00 27.22 ? 267 ASP B CA  1 
ATOM   6562  C C   . ASP B 1 268 ? 36.587  -15.538 97.057  1.00 25.98 ? 267 ASP B C   1 
ATOM   6563  O O   . ASP B 1 268 ? 35.610  -15.632 96.317  1.00 26.26 ? 267 ASP B O   1 
ATOM   6564  C CB  . ASP B 1 268 ? 38.346  -17.026 96.018  1.00 31.74 ? 267 ASP B CB  1 
ATOM   6565  C CG  . ASP B 1 268 ? 38.552  -17.988 97.177  1.00 36.08 ? 267 ASP B CG  1 
ATOM   6566  O OD1 . ASP B 1 268 ? 37.904  -17.827 98.234  1.00 38.56 ? 267 ASP B OD1 1 
ATOM   6567  O OD2 . ASP B 1 268 ? 39.357  -18.933 97.011  1.00 40.26 ? 267 ASP B OD2 1 
ATOM   6568  N N   . TRP B 1 269 ? 36.470  -15.381 98.375  1.00 24.44 ? 268 TRP B N   1 
ATOM   6569  C CA  . TRP B 1 269 ? 35.144  -15.276 98.980  1.00 23.37 ? 268 TRP B CA  1 
ATOM   6570  C C   . TRP B 1 269 ? 34.641  -13.828 98.936  1.00 23.14 ? 268 TRP B C   1 
ATOM   6571  O O   . TRP B 1 269 ? 33.673  -13.464 99.612  1.00 23.57 ? 268 TRP B O   1 
ATOM   6572  C CB  . TRP B 1 269 ? 35.120  -15.807 100.427 1.00 23.54 ? 268 TRP B CB  1 
ATOM   6573  C CG  . TRP B 1 269 ? 36.347  -15.554 101.248 1.00 24.21 ? 268 TRP B CG  1 
ATOM   6574  C CD1 . TRP B 1 269 ? 37.339  -16.447 101.529 1.00 24.48 ? 268 TRP B CD1 1 
ATOM   6575  C CD2 . TRP B 1 269 ? 36.712  -14.331 101.904 1.00 24.90 ? 268 TRP B CD2 1 
ATOM   6576  N NE1 . TRP B 1 269 ? 38.298  -15.862 102.318 1.00 23.21 ? 268 TRP B NE1 1 
ATOM   6577  C CE2 . TRP B 1 269 ? 37.940  -14.562 102.563 1.00 25.57 ? 268 TRP B CE2 1 
ATOM   6578  C CE3 . TRP B 1 269 ? 36.122  -13.063 101.997 1.00 24.55 ? 268 TRP B CE3 1 
ATOM   6579  C CZ2 . TRP B 1 269 ? 38.588  -13.572 103.304 1.00 24.30 ? 268 TRP B CZ2 1 
ATOM   6580  C CZ3 . TRP B 1 269 ? 36.768  -12.078 102.735 1.00 25.47 ? 268 TRP B CZ3 1 
ATOM   6581  C CH2 . TRP B 1 269 ? 37.989  -12.340 103.379 1.00 26.72 ? 268 TRP B CH2 1 
ATOM   6582  N N   . VAL B 1 270 ? 35.311  -13.003 98.139  1.00 20.95 ? 269 VAL B N   1 
ATOM   6583  C CA  . VAL B 1 270 ? 34.907  -11.614 97.962  1.00 19.53 ? 269 VAL B CA  1 
ATOM   6584  C C   . VAL B 1 270 ? 34.395  -11.482 96.532  1.00 18.76 ? 269 VAL B C   1 
ATOM   6585  O O   . VAL B 1 270 ? 35.182  -11.467 95.591  1.00 18.28 ? 269 VAL B O   1 
ATOM   6586  C CB  . VAL B 1 270 ? 36.085  -10.634 98.145  1.00 19.52 ? 269 VAL B CB  1 
ATOM   6587  C CG1 . VAL B 1 270 ? 35.627  -9.214  97.840  1.00 19.14 ? 269 VAL B CG1 1 
ATOM   6588  C CG2 . VAL B 1 270 ? 36.622  -10.708 99.568  1.00 19.85 ? 269 VAL B CG2 1 
ATOM   6589  N N   . GLY B 1 271 ? 33.078  -11.420 96.366  1.00 18.27 ? 270 GLY B N   1 
ATOM   6590  C CA  . GLY B 1 271 ? 32.515  -11.279 95.034  1.00 18.70 ? 270 GLY B CA  1 
ATOM   6591  C C   . GLY B 1 271 ? 32.819  -9.902  94.460  1.00 20.25 ? 270 GLY B C   1 
ATOM   6592  O O   . GLY B 1 271 ? 32.852  -8.912  95.194  1.00 18.98 ? 270 GLY B O   1 
ATOM   6593  N N   . GLY B 1 272 ? 33.046  -9.835  93.151  1.00 19.18 ? 271 GLY B N   1 
ATOM   6594  C CA  . GLY B 1 272 ? 33.346  -8.564  92.518  1.00 19.68 ? 271 GLY B CA  1 
ATOM   6595  C C   . GLY B 1 272 ? 32.329  -7.483  92.841  1.00 19.64 ? 271 GLY B C   1 
ATOM   6596  O O   . GLY B 1 272 ? 32.694  -6.362  93.207  1.00 18.61 ? 271 GLY B O   1 
ATOM   6597  N N   . ARG B 1 273 ? 31.051  -7.825  92.710  1.00 19.20 ? 272 ARG B N   1 
ATOM   6598  C CA  . ARG B 1 273 ? 29.966  -6.889  92.979  1.00 19.02 ? 272 ARG B CA  1 
ATOM   6599  C C   . ARG B 1 273 ? 29.740  -6.660  94.474  1.00 18.82 ? 272 ARG B C   1 
ATOM   6600  O O   . ARG B 1 273 ? 28.754  -6.043  94.864  1.00 19.15 ? 272 ARG B O   1 
ATOM   6601  C CB  . ARG B 1 273 ? 28.675  -7.383  92.310  1.00 21.44 ? 272 ARG B CB  1 
ATOM   6602  C CG  . ARG B 1 273 ? 28.358  -8.855  92.565  1.00 22.37 ? 272 ARG B CG  1 
ATOM   6603  C CD  . ARG B 1 273 ? 27.078  -9.291  91.860  1.00 21.75 ? 272 ARG B CD  1 
ATOM   6604  N NE  . ARG B 1 273 ? 26.796  -10.711 92.076  1.00 22.78 ? 272 ARG B NE  1 
ATOM   6605  C CZ  . ARG B 1 273 ? 27.393  -11.710 91.428  1.00 24.76 ? 272 ARG B CZ  1 
ATOM   6606  N NH1 . ARG B 1 273 ? 28.313  -11.459 90.503  1.00 23.54 ? 272 ARG B NH1 1 
ATOM   6607  N NH2 . ARG B 1 273 ? 27.077  -12.967 91.715  1.00 23.34 ? 272 ARG B NH2 1 
ATOM   6608  N N   . TYR B 1 274 ? 30.660  -7.161  95.299  1.00 18.08 ? 273 TYR B N   1 
ATOM   6609  C CA  . TYR B 1 274 ? 30.606  -7.002  96.756  1.00 17.83 ? 273 TYR B CA  1 
ATOM   6610  C C   . TYR B 1 274 ? 32.020  -6.690  97.251  1.00 18.59 ? 273 TYR B C   1 
ATOM   6611  O O   . TYR B 1 274 ? 32.330  -6.891  98.425  1.00 20.45 ? 273 TYR B O   1 
ATOM   6612  C CB  . TYR B 1 274 ? 30.144  -8.299  97.447  1.00 16.41 ? 273 TYR B CB  1 
ATOM   6613  C CG  . TYR B 1 274 ? 28.734  -8.754  97.120  1.00 19.03 ? 273 TYR B CG  1 
ATOM   6614  C CD1 . TYR B 1 274 ? 28.503  -9.752  96.171  1.00 18.04 ? 273 TYR B CD1 1 
ATOM   6615  C CD2 . TYR B 1 274 ? 27.632  -8.182  97.753  1.00 18.81 ? 273 TYR B CD2 1 
ATOM   6616  C CE1 . TYR B 1 274 ? 27.203  -10.169 95.859  1.00 20.05 ? 273 TYR B CE1 1 
ATOM   6617  C CE2 . TYR B 1 274 ? 26.325  -8.587  97.445  1.00 18.39 ? 273 TYR B CE2 1 
ATOM   6618  C CZ  . TYR B 1 274 ? 26.120  -9.580  96.496  1.00 18.95 ? 273 TYR B CZ  1 
ATOM   6619  O OH  . TYR B 1 274 ? 24.833  -9.962  96.159  1.00 18.63 ? 273 TYR B OH  1 
ATOM   6620  N N   . SER B 1 275 ? 32.868  -6.186  96.359  1.00 19.46 ? 274 SER B N   1 
ATOM   6621  C CA  . SER B 1 275 ? 34.266  -5.918  96.692  1.00 18.99 ? 274 SER B CA  1 
ATOM   6622  C C   . SER B 1 275 ? 34.677  -4.510  97.115  1.00 19.91 ? 274 SER B C   1 
ATOM   6623  O O   . SER B 1 275 ? 35.808  -4.309  97.567  1.00 20.46 ? 274 SER B O   1 
ATOM   6624  C CB  . SER B 1 275 ? 35.139  -6.330  95.507  1.00 20.54 ? 274 SER B CB  1 
ATOM   6625  O OG  . SER B 1 275 ? 34.832  -5.547  94.363  1.00 21.86 ? 274 SER B OG  1 
ATOM   6626  N N   . LEU B 1 276 ? 33.793  -3.531  96.982  1.00 17.81 ? 275 LEU B N   1 
ATOM   6627  C CA  . LEU B 1 276 ? 34.190  -2.177  97.347  1.00 18.29 ? 275 LEU B CA  1 
ATOM   6628  C C   . LEU B 1 276 ? 34.647  -2.093  98.805  1.00 18.11 ? 275 LEU B C   1 
ATOM   6629  O O   . LEU B 1 276 ? 35.367  -1.169  99.176  1.00 19.51 ? 275 LEU B O   1 
ATOM   6630  C CB  . LEU B 1 276 ? 33.045  -1.189  97.072  1.00 17.02 ? 275 LEU B CB  1 
ATOM   6631  C CG  . LEU B 1 276 ? 31.811  -1.234  97.975  1.00 15.33 ? 275 LEU B CG  1 
ATOM   6632  C CD1 . LEU B 1 276 ? 32.114  -0.489  99.262  1.00 14.48 ? 275 LEU B CD1 1 
ATOM   6633  C CD2 . LEU B 1 276 ? 30.615  -0.592  97.257  1.00 17.08 ? 275 LEU B CD2 1 
ATOM   6634  N N   . TRP B 1 277 ? 34.249  -3.070  99.619  1.00 17.98 ? 276 TRP B N   1 
ATOM   6635  C CA  . TRP B 1 277 ? 34.614  -3.099  101.035 1.00 17.39 ? 276 TRP B CA  1 
ATOM   6636  C C   . TRP B 1 277 ? 36.035  -3.613  101.279 1.00 18.46 ? 276 TRP B C   1 
ATOM   6637  O O   . TRP B 1 277 ? 36.562  -3.498  102.393 1.00 16.35 ? 276 TRP B O   1 
ATOM   6638  C CB  . TRP B 1 277 ? 33.632  -3.969  101.815 1.00 16.65 ? 276 TRP B CB  1 
ATOM   6639  C CG  . TRP B 1 277 ? 32.216  -3.776  101.390 1.00 18.13 ? 276 TRP B CG  1 
ATOM   6640  C CD1 . TRP B 1 277 ? 31.516  -4.537  100.502 1.00 19.40 ? 276 TRP B CD1 1 
ATOM   6641  C CD2 . TRP B 1 277 ? 31.332  -2.730  101.808 1.00 19.17 ? 276 TRP B CD2 1 
ATOM   6642  N NE1 . TRP B 1 277 ? 30.244  -4.032  100.340 1.00 19.89 ? 276 TRP B NE1 1 
ATOM   6643  C CE2 . TRP B 1 277 ? 30.107  -2.922  101.131 1.00 17.94 ? 276 TRP B CE2 1 
ATOM   6644  C CE3 . TRP B 1 277 ? 31.456  -1.646  102.692 1.00 20.44 ? 276 TRP B CE3 1 
ATOM   6645  C CZ2 . TRP B 1 277 ? 29.012  -2.073  101.310 1.00 18.34 ? 276 TRP B CZ2 1 
ATOM   6646  C CZ3 . TRP B 1 277 ? 30.361  -0.797  102.869 1.00 15.71 ? 276 TRP B CZ3 1 
ATOM   6647  C CH2 . TRP B 1 277 ? 29.160  -1.019  102.181 1.00 18.07 ? 276 TRP B CH2 1 
ATOM   6648  N N   . SER B 1 278 ? 36.644  -4.171  100.235 1.00 18.13 ? 277 SER B N   1 
ATOM   6649  C CA  . SER B 1 278 ? 37.999  -4.720  100.317 1.00 19.04 ? 277 SER B CA  1 
ATOM   6650  C C   . SER B 1 278 ? 39.011  -3.728  99.767  1.00 19.39 ? 277 SER B C   1 
ATOM   6651  O O   . SER B 1 278 ? 38.741  -2.526  99.697  1.00 18.16 ? 277 SER B O   1 
ATOM   6652  C CB  . SER B 1 278 ? 38.095  -6.020  99.510  1.00 17.86 ? 277 SER B CB  1 
ATOM   6653  O OG  . SER B 1 278 ? 38.036  -5.766  98.112  1.00 16.11 ? 277 SER B OG  1 
ATOM   6654  N N   . ALA B 1 279 ? 40.174  -4.252  99.378  1.00 18.76 ? 278 ALA B N   1 
ATOM   6655  C CA  . ALA B 1 279 ? 41.253  -3.459  98.803  1.00 18.21 ? 278 ALA B CA  1 
ATOM   6656  C C   . ALA B 1 279 ? 40.748  -2.710  97.571  1.00 18.06 ? 278 ALA B C   1 
ATOM   6657  O O   . ALA B 1 279 ? 41.297  -1.676  97.190  1.00 17.74 ? 278 ALA B O   1 
ATOM   6658  C CB  . ALA B 1 279 ? 42.409  -4.371  98.413  1.00 17.50 ? 278 ALA B CB  1 
ATOM   6659  N N   . ILE B 1 280 ? 39.699  -3.247  96.954  1.00 18.88 ? 279 ILE B N   1 
ATOM   6660  C CA  . ILE B 1 280 ? 39.104  -2.641  95.764  1.00 19.33 ? 279 ILE B CA  1 
ATOM   6661  C C   . ILE B 1 280 ? 38.653  -1.215  96.089  1.00 18.14 ? 279 ILE B C   1 
ATOM   6662  O O   . ILE B 1 280 ? 38.597  -0.354  95.220  1.00 18.19 ? 279 ILE B O   1 
ATOM   6663  C CB  . ILE B 1 280 ? 37.895  -3.489  95.266  1.00 19.08 ? 279 ILE B CB  1 
ATOM   6664  C CG1 . ILE B 1 280 ? 38.393  -4.841  94.747  1.00 18.87 ? 279 ILE B CG1 1 
ATOM   6665  C CG2 . ILE B 1 280 ? 37.136  -2.758  94.167  1.00 18.07 ? 279 ILE B CG2 1 
ATOM   6666  C CD1 . ILE B 1 280 ? 39.303  -4.736  93.521  1.00 20.37 ? 279 ILE B CD1 1 
ATOM   6667  N N   . GLY B 1 281 ? 38.353  -0.971  97.356  1.00 18.76 ? 280 GLY B N   1 
ATOM   6668  C CA  . GLY B 1 281 ? 37.917  0.350   97.761  1.00 20.39 ? 280 GLY B CA  1 
ATOM   6669  C C   . GLY B 1 281 ? 39.063  1.308   98.032  1.00 20.48 ? 280 GLY B C   1 
ATOM   6670  O O   . GLY B 1 281 ? 38.847  2.387   98.579  1.00 20.13 ? 280 GLY B O   1 
ATOM   6671  N N   . LEU B 1 282 ? 40.280  0.933   97.645  1.00 19.40 ? 281 LEU B N   1 
ATOM   6672  C CA  . LEU B 1 282 ? 41.424  1.795   97.891  1.00 17.83 ? 281 LEU B CA  1 
ATOM   6673  C C   . LEU B 1 282 ? 41.218  3.217   97.367  1.00 18.89 ? 281 LEU B C   1 
ATOM   6674  O O   . LEU B 1 282 ? 41.535  4.179   98.058  1.00 20.56 ? 281 LEU B O   1 
ATOM   6675  C CB  . LEU B 1 282 ? 42.692  1.198   97.273  1.00 17.70 ? 281 LEU B CB  1 
ATOM   6676  C CG  . LEU B 1 282 ? 43.976  1.973   97.583  1.00 16.64 ? 281 LEU B CG  1 
ATOM   6677  C CD1 . LEU B 1 282 ? 44.224  1.984   99.095  1.00 14.69 ? 281 LEU B CD1 1 
ATOM   6678  C CD2 . LEU B 1 282 ? 45.147  1.338   96.859  1.00 17.42 ? 281 LEU B CD2 1 
ATOM   6679  N N   . SER B 1 283 ? 40.690  3.359   96.153  1.00 19.69 ? 282 SER B N   1 
ATOM   6680  C CA  . SER B 1 283 ? 40.469  4.691   95.594  1.00 18.98 ? 282 SER B CA  1 
ATOM   6681  C C   . SER B 1 283 ? 39.527  5.502   96.481  1.00 18.88 ? 282 SER B C   1 
ATOM   6682  O O   . SER B 1 283 ? 39.667  6.719   96.592  1.00 19.23 ? 282 SER B O   1 
ATOM   6683  C CB  . SER B 1 283 ? 39.919  4.606   94.158  1.00 18.05 ? 282 SER B CB  1 
ATOM   6684  O OG  . SER B 1 283 ? 38.624  4.030   94.112  1.00 22.81 ? 282 SER B OG  1 
ATOM   6685  N N   . ILE B 1 284 ? 38.568  4.829   97.111  1.00 18.35 ? 283 ILE B N   1 
ATOM   6686  C CA  . ILE B 1 284 ? 37.636  5.497   98.016  1.00 18.15 ? 283 ILE B CA  1 
ATOM   6687  C C   . ILE B 1 284 ? 38.442  6.087   99.179  1.00 20.31 ? 283 ILE B C   1 
ATOM   6688  O O   . ILE B 1 284 ? 38.346  7.280   99.491  1.00 17.53 ? 283 ILE B O   1 
ATOM   6689  C CB  . ILE B 1 284 ? 36.616  4.494   98.611  1.00 20.23 ? 283 ILE B CB  1 
ATOM   6690  C CG1 . ILE B 1 284 ? 35.803  3.839   97.494  1.00 20.35 ? 283 ILE B CG1 1 
ATOM   6691  C CG2 . ILE B 1 284 ? 35.701  5.201   99.601  1.00 19.21 ? 283 ILE B CG2 1 
ATOM   6692  C CD1 . ILE B 1 284 ? 34.972  2.659   97.960  1.00 21.28 ? 283 ILE B CD1 1 
ATOM   6693  N N   . ALA B 1 285 ? 39.240  5.232   99.814  1.00 19.24 ? 284 ALA B N   1 
ATOM   6694  C CA  . ALA B 1 285 ? 40.065  5.633   100.955 1.00 20.38 ? 284 ALA B CA  1 
ATOM   6695  C C   . ALA B 1 285 ? 41.031  6.767   100.615 1.00 19.80 ? 284 ALA B C   1 
ATOM   6696  O O   . ALA B 1 285 ? 41.279  7.647   101.439 1.00 18.98 ? 284 ALA B O   1 
ATOM   6697  C CB  . ALA B 1 285 ? 40.842  4.419   101.493 1.00 20.12 ? 284 ALA B CB  1 
ATOM   6698  N N   . LEU B 1 286 ? 41.572  6.752   99.404  1.00 19.73 ? 285 LEU B N   1 
ATOM   6699  C CA  . LEU B 1 286 ? 42.502  7.795   98.994  1.00 20.38 ? 285 LEU B CA  1 
ATOM   6700  C C   . LEU B 1 286 ? 41.794  9.130   98.794  1.00 20.35 ? 285 LEU B C   1 
ATOM   6701  O O   . LEU B 1 286 ? 42.325  10.185  99.143  1.00 20.06 ? 285 LEU B O   1 
ATOM   6702  C CB  . LEU B 1 286 ? 43.208  7.396   97.693  1.00 20.01 ? 285 LEU B CB  1 
ATOM   6703  C CG  . LEU B 1 286 ? 44.319  6.350   97.783  1.00 19.55 ? 285 LEU B CG  1 
ATOM   6704  C CD1 . LEU B 1 286 ? 44.658  5.838   96.391  1.00 18.47 ? 285 LEU B CD1 1 
ATOM   6705  C CD2 . LEU B 1 286 ? 45.548  6.962   98.458  1.00 18.54 ? 285 LEU B CD2 1 
ATOM   6706  N N   . HIS B 1 287 ? 40.589  9.071   98.238  1.00 20.17 ? 286 HIS B N   1 
ATOM   6707  C CA  . HIS B 1 287 ? 39.806  10.265  97.955  1.00 19.48 ? 286 HIS B CA  1 
ATOM   6708  C C   . HIS B 1 287 ? 39.214  10.926  99.195  1.00 19.62 ? 286 HIS B C   1 
ATOM   6709  O O   . HIS B 1 287 ? 39.381  12.131  99.383  1.00 18.78 ? 286 HIS B O   1 
ATOM   6710  C CB  . HIS B 1 287 ? 38.678  9.933   96.968  1.00 18.97 ? 286 HIS B CB  1 
ATOM   6711  C CG  . HIS B 1 287 ? 38.068  11.136  96.314  1.00 19.99 ? 286 HIS B CG  1 
ATOM   6712  N ND1 . HIS B 1 287 ? 36.708  11.282  96.145  1.00 21.81 ? 286 HIS B ND1 1 
ATOM   6713  C CD2 . HIS B 1 287 ? 38.636  12.232  95.755  1.00 18.60 ? 286 HIS B CD2 1 
ATOM   6714  C CE1 . HIS B 1 287 ? 36.462  12.415  95.511  1.00 20.72 ? 286 HIS B CE1 1 
ATOM   6715  N NE2 . HIS B 1 287 ? 37.616  13.011  95.261  1.00 23.40 ? 286 HIS B NE2 1 
ATOM   6716  N N   . VAL B 1 288 ? 38.524  10.158  100.036 1.00 18.32 ? 287 VAL B N   1 
ATOM   6717  C CA  . VAL B 1 288 ? 37.918  10.743  101.234 1.00 20.44 ? 287 VAL B CA  1 
ATOM   6718  C C   . VAL B 1 288 ? 38.641  10.439  102.541 1.00 21.17 ? 287 VAL B C   1 
ATOM   6719  O O   . VAL B 1 288 ? 38.149  10.775  103.614 1.00 21.62 ? 287 VAL B O   1 
ATOM   6720  C CB  . VAL B 1 288 ? 36.421  10.328  101.389 1.00 18.28 ? 287 VAL B CB  1 
ATOM   6721  C CG1 . VAL B 1 288 ? 35.643  10.729  100.142 1.00 18.43 ? 287 VAL B CG1 1 
ATOM   6722  C CG2 . VAL B 1 288 ? 36.304  8.826   101.633 1.00 15.47 ? 287 VAL B CG2 1 
ATOM   6723  N N   . GLY B 1 289 ? 39.811  9.817   102.456 1.00 21.57 ? 288 GLY B N   1 
ATOM   6724  C CA  . GLY B 1 289 ? 40.557  9.503   103.663 1.00 20.88 ? 288 GLY B CA  1 
ATOM   6725  C C   . GLY B 1 289 ? 40.173  8.157   104.249 1.00 22.77 ? 288 GLY B C   1 
ATOM   6726  O O   . GLY B 1 289 ? 39.012  7.735   104.157 1.00 22.16 ? 288 GLY B O   1 
ATOM   6727  N N   . PHE B 1 290 ? 41.142  7.483   104.862 1.00 21.72 ? 289 PHE B N   1 
ATOM   6728  C CA  . PHE B 1 290 ? 40.903  6.173   105.453 1.00 22.36 ? 289 PHE B CA  1 
ATOM   6729  C C   . PHE B 1 290 ? 39.919  6.219   106.626 1.00 22.40 ? 289 PHE B C   1 
ATOM   6730  O O   . PHE B 1 290 ? 39.224  5.241   106.890 1.00 21.67 ? 289 PHE B O   1 
ATOM   6731  C CB  . PHE B 1 290 ? 42.220  5.543   105.911 1.00 21.38 ? 289 PHE B CB  1 
ATOM   6732  C CG  . PHE B 1 290 ? 42.140  4.056   106.083 1.00 23.75 ? 289 PHE B CG  1 
ATOM   6733  C CD1 . PHE B 1 290 ? 42.113  3.216   104.971 1.00 22.18 ? 289 PHE B CD1 1 
ATOM   6734  C CD2 . PHE B 1 290 ? 42.021  3.494   107.350 1.00 22.57 ? 289 PHE B CD2 1 
ATOM   6735  C CE1 . PHE B 1 290 ? 41.966  1.833   105.117 1.00 23.79 ? 289 PHE B CE1 1 
ATOM   6736  C CE2 . PHE B 1 290 ? 41.872  2.109   107.507 1.00 24.28 ? 289 PHE B CE2 1 
ATOM   6737  C CZ  . PHE B 1 290 ? 41.843  1.279   106.389 1.00 20.95 ? 289 PHE B CZ  1 
ATOM   6738  N N   . ASP B 1 291 ? 39.859  7.345   107.330 1.00 24.00 ? 290 ASP B N   1 
ATOM   6739  C CA  . ASP B 1 291 ? 38.933  7.467   108.453 1.00 26.23 ? 290 ASP B CA  1 
ATOM   6740  C C   . ASP B 1 291 ? 37.498  7.355   107.950 1.00 24.08 ? 290 ASP B C   1 
ATOM   6741  O O   . ASP B 1 291 ? 36.664  6.677   108.559 1.00 23.13 ? 290 ASP B O   1 
ATOM   6742  C CB  . ASP B 1 291 ? 39.112  8.805   109.183 1.00 32.35 ? 290 ASP B CB  1 
ATOM   6743  C CG  . ASP B 1 291 ? 40.229  8.768   110.219 1.00 39.29 ? 290 ASP B CG  1 
ATOM   6744  O OD1 . ASP B 1 291 ? 40.259  7.812   111.028 1.00 43.63 ? 290 ASP B OD1 1 
ATOM   6745  O OD2 . ASP B 1 291 ? 41.066  9.700   110.237 1.00 42.39 ? 290 ASP B OD2 1 
ATOM   6746  N N   . ASN B 1 292 ? 37.212  8.024   106.838 1.00 21.73 ? 291 ASN B N   1 
ATOM   6747  C CA  . ASN B 1 292 ? 35.875  7.974   106.269 1.00 20.14 ? 291 ASN B CA  1 
ATOM   6748  C C   . ASN B 1 292 ? 35.599  6.600   105.671 1.00 18.26 ? 291 ASN B C   1 
ATOM   6749  O O   . ASN B 1 292 ? 34.461  6.146   105.660 1.00 19.22 ? 291 ASN B O   1 
ATOM   6750  C CB  . ASN B 1 292 ? 35.692  9.064   105.211 1.00 18.87 ? 291 ASN B CB  1 
ATOM   6751  C CG  . ASN B 1 292 ? 35.453  10.433  105.826 1.00 20.54 ? 291 ASN B CG  1 
ATOM   6752  O OD1 . ASN B 1 292 ? 34.798  10.555  106.870 1.00 17.08 ? 291 ASN B OD1 1 
ATOM   6753  N ND2 . ASN B 1 292 ? 35.964  11.471  105.175 1.00 19.16 ? 291 ASN B ND2 1 
ATOM   6754  N N   . PHE B 1 293 ? 36.640  5.935   105.183 1.00 19.67 ? 292 PHE B N   1 
ATOM   6755  C CA  . PHE B 1 293 ? 36.468  4.603   104.613 1.00 19.53 ? 292 PHE B CA  1 
ATOM   6756  C C   . PHE B 1 293 ? 36.083  3.661   105.748 1.00 18.62 ? 292 PHE B C   1 
ATOM   6757  O O   . PHE B 1 293 ? 35.266  2.762   105.565 1.00 19.79 ? 292 PHE B O   1 
ATOM   6758  C CB  . PHE B 1 293 ? 37.761  4.119   103.945 1.00 19.09 ? 292 PHE B CB  1 
ATOM   6759  C CG  . PHE B 1 293 ? 37.613  2.800   103.231 1.00 18.58 ? 292 PHE B CG  1 
ATOM   6760  C CD1 . PHE B 1 293 ? 36.807  2.692   102.101 1.00 16.89 ? 292 PHE B CD1 1 
ATOM   6761  C CD2 . PHE B 1 293 ? 38.260  1.658   103.703 1.00 20.45 ? 292 PHE B CD2 1 
ATOM   6762  C CE1 . PHE B 1 293 ? 36.640  1.464   101.444 1.00 18.95 ? 292 PHE B CE1 1 
ATOM   6763  C CE2 . PHE B 1 293 ? 38.104  0.422   103.059 1.00 20.83 ? 292 PHE B CE2 1 
ATOM   6764  C CZ  . PHE B 1 293 ? 37.289  0.326   101.922 1.00 20.45 ? 292 PHE B CZ  1 
ATOM   6765  N N   . GLU B 1 294 ? 36.670  3.870   106.926 1.00 19.14 ? 293 GLU B N   1 
ATOM   6766  C CA  . GLU B 1 294 ? 36.347  3.031   108.077 1.00 17.70 ? 293 GLU B CA  1 
ATOM   6767  C C   . GLU B 1 294 ? 34.903  3.256   108.526 1.00 17.43 ? 293 GLU B C   1 
ATOM   6768  O O   . GLU B 1 294 ? 34.237  2.319   108.961 1.00 19.06 ? 293 GLU B O   1 
ATOM   6769  C CB  . GLU B 1 294 ? 37.310  3.298   109.240 1.00 18.69 ? 293 GLU B CB  1 
ATOM   6770  C CG  . GLU B 1 294 ? 38.736  2.802   108.983 1.00 20.54 ? 293 GLU B CG  1 
ATOM   6771  C CD  . GLU B 1 294 ? 39.588  2.743   110.249 1.00 23.71 ? 293 GLU B CD  1 
ATOM   6772  O OE1 . GLU B 1 294 ? 39.839  3.806   110.857 1.00 25.18 ? 293 GLU B OE1 1 
ATOM   6773  O OE2 . GLU B 1 294 ? 40.004  1.627   110.638 1.00 23.03 ? 293 GLU B OE2 1 
ATOM   6774  N N   . GLN B 1 295 ? 34.420  4.493   108.426 1.00 14.93 ? 294 GLN B N   1 
ATOM   6775  C CA  . GLN B 1 295 ? 33.040  4.796   108.804 1.00 17.26 ? 294 GLN B CA  1 
ATOM   6776  C C   . GLN B 1 295 ? 32.117  4.050   107.849 1.00 17.72 ? 294 GLN B C   1 
ATOM   6777  O O   . GLN B 1 295 ? 31.108  3.481   108.261 1.00 20.29 ? 294 GLN B O   1 
ATOM   6778  C CB  . GLN B 1 295 ? 32.765  6.301   108.701 1.00 17.76 ? 294 GLN B CB  1 
ATOM   6779  C CG  . GLN B 1 295 ? 33.548  7.137   109.695 1.00 25.74 ? 294 GLN B CG  1 
ATOM   6780  C CD  . GLN B 1 295 ? 33.095  6.914   111.127 1.00 31.09 ? 294 GLN B CD  1 
ATOM   6781  O OE1 . GLN B 1 295 ? 33.760  7.344   112.071 1.00 36.32 ? 294 GLN B OE1 1 
ATOM   6782  N NE2 . GLN B 1 295 ? 31.955  6.249   111.297 1.00 30.66 ? 294 GLN B NE2 1 
ATOM   6783  N N   . LEU B 1 296 ? 32.474  4.067   106.567 1.00 14.96 ? 295 LEU B N   1 
ATOM   6784  C CA  . LEU B 1 296 ? 31.704  3.386   105.542 1.00 15.73 ? 295 LEU B CA  1 
ATOM   6785  C C   . LEU B 1 296 ? 31.593  1.904   105.923 1.00 15.87 ? 295 LEU B C   1 
ATOM   6786  O O   . LEU B 1 296 ? 30.502  1.333   105.929 1.00 17.35 ? 295 LEU B O   1 
ATOM   6787  C CB  . LEU B 1 296 ? 32.401  3.544   104.188 1.00 13.86 ? 295 LEU B CB  1 
ATOM   6788  C CG  . LEU B 1 296 ? 31.790  2.822   102.986 1.00 15.22 ? 295 LEU B CG  1 
ATOM   6789  C CD1 . LEU B 1 296 ? 30.480  3.493   102.594 1.00 18.67 ? 295 LEU B CD1 1 
ATOM   6790  C CD2 . LEU B 1 296 ? 32.781  2.859   101.816 1.00 17.42 ? 295 LEU B CD2 1 
ATOM   6791  N N   . LEU B 1 297 ? 32.727  1.294   106.245 1.00 16.78 ? 296 LEU B N   1 
ATOM   6792  C CA  . LEU B 1 297 ? 32.768  -0.113  106.658 1.00 17.97 ? 296 LEU B CA  1 
ATOM   6793  C C   . LEU B 1 297 ? 31.919  -0.301  107.926 1.00 18.38 ? 296 LEU B C   1 
ATOM   6794  O O   . LEU B 1 297 ? 31.164  -1.269  108.056 1.00 17.17 ? 296 LEU B O   1 
ATOM   6795  C CB  . LEU B 1 297 ? 34.219  -0.514  106.954 1.00 20.18 ? 296 LEU B CB  1 
ATOM   6796  C CG  . LEU B 1 297 ? 35.075  -1.295  105.947 1.00 24.18 ? 296 LEU B CG  1 
ATOM   6797  C CD1 . LEU B 1 297 ? 34.791  -0.877  104.524 1.00 23.91 ? 296 LEU B CD1 1 
ATOM   6798  C CD2 . LEU B 1 297 ? 36.536  -1.073  106.296 1.00 23.60 ? 296 LEU B CD2 1 
ATOM   6799  N N   . SER B 1 298 ? 32.049  0.640   108.858 1.00 18.33 ? 297 SER B N   1 
ATOM   6800  C CA  . SER B 1 298 ? 31.306  0.579   110.110 1.00 19.07 ? 297 SER B CA  1 
ATOM   6801  C C   . SER B 1 298 ? 29.802  0.625   109.888 1.00 18.30 ? 297 SER B C   1 
ATOM   6802  O O   . SER B 1 298 ? 29.045  -0.072  110.569 1.00 18.92 ? 297 SER B O   1 
ATOM   6803  C CB  . SER B 1 298 ? 31.733  1.723   111.031 1.00 19.93 ? 297 SER B CB  1 
ATOM   6804  O OG  . SER B 1 298 ? 33.102  1.601   111.369 1.00 20.90 ? 297 SER B OG  1 
ATOM   6805  N N   . GLY B 1 299 ? 29.369  1.450   108.940 1.00 18.80 ? 298 GLY B N   1 
ATOM   6806  C CA  . GLY B 1 299 ? 27.952  1.541   108.643 1.00 17.49 ? 298 GLY B CA  1 
ATOM   6807  C C   . GLY B 1 299 ? 27.435  0.195   108.163 1.00 19.54 ? 298 GLY B C   1 
ATOM   6808  O O   . GLY B 1 299 ? 26.411  -0.295  108.638 1.00 19.23 ? 298 GLY B O   1 
ATOM   6809  N N   . ALA B 1 300 ? 28.142  -0.406  107.210 1.00 18.85 ? 299 ALA B N   1 
ATOM   6810  C CA  . ALA B 1 300 ? 27.744  -1.704  106.683 1.00 19.29 ? 299 ALA B CA  1 
ATOM   6811  C C   . ALA B 1 300 ? 27.764  -2.736  107.807 1.00 18.80 ? 299 ALA B C   1 
ATOM   6812  O O   . ALA B 1 300 ? 26.882  -3.590  107.893 1.00 20.44 ? 299 ALA B O   1 
ATOM   6813  C CB  . ALA B 1 300 ? 28.690  -2.131  105.560 1.00 18.06 ? 299 ALA B CB  1 
ATOM   6814  N N   . HIS B 1 301 ? 28.770  -2.653  108.671 1.00 18.87 ? 300 HIS B N   1 
ATOM   6815  C CA  . HIS B 1 301 ? 28.884  -3.598  109.783 1.00 18.96 ? 300 HIS B CA  1 
ATOM   6816  C C   . HIS B 1 301 ? 27.669  -3.526  110.707 1.00 18.60 ? 300 HIS B C   1 
ATOM   6817  O O   . HIS B 1 301 ? 27.218  -4.552  111.222 1.00 18.40 ? 300 HIS B O   1 
ATOM   6818  C CB  . HIS B 1 301 ? 30.168  -3.344  110.579 1.00 16.82 ? 300 HIS B CB  1 
ATOM   6819  C CG  . HIS B 1 301 ? 30.378  -4.301  111.715 1.00 18.26 ? 300 HIS B CG  1 
ATOM   6820  N ND1 . HIS B 1 301 ? 30.315  -5.670  111.560 1.00 18.39 ? 300 HIS B ND1 1 
ATOM   6821  C CD2 . HIS B 1 301 ? 30.673  -4.086  113.019 1.00 17.10 ? 300 HIS B CD2 1 
ATOM   6822  C CE1 . HIS B 1 301 ? 30.563  -6.256  112.717 1.00 18.27 ? 300 HIS B CE1 1 
ATOM   6823  N NE2 . HIS B 1 301 ? 30.784  -5.317  113.620 1.00 19.02 ? 300 HIS B NE2 1 
ATOM   6824  N N   . TRP B 1 302 ? 27.138  -2.321  110.911 1.00 18.12 ? 301 TRP B N   1 
ATOM   6825  C CA  . TRP B 1 302 ? 25.963  -2.140  111.763 1.00 17.82 ? 301 TRP B CA  1 
ATOM   6826  C C   . TRP B 1 302 ? 24.755  -2.808  111.117 1.00 16.15 ? 301 TRP B C   1 
ATOM   6827  O O   . TRP B 1 302 ? 23.952  -3.464  111.790 1.00 16.95 ? 301 TRP B O   1 
ATOM   6828  C CB  . TRP B 1 302 ? 25.633  -0.653  111.961 1.00 17.61 ? 301 TRP B CB  1 
ATOM   6829  C CG  . TRP B 1 302 ? 24.456  -0.447  112.890 1.00 13.34 ? 301 TRP B CG  1 
ATOM   6830  C CD1 . TRP B 1 302 ? 24.499  -0.309  114.252 1.00 13.30 ? 301 TRP B CD1 1 
ATOM   6831  C CD2 . TRP B 1 302 ? 23.065  -0.487  112.535 1.00 14.12 ? 301 TRP B CD2 1 
ATOM   6832  N NE1 . TRP B 1 302 ? 23.223  -0.272  114.765 1.00 14.12 ? 301 TRP B NE1 1 
ATOM   6833  C CE2 . TRP B 1 302 ? 22.324  -0.379  113.734 1.00 13.63 ? 301 TRP B CE2 1 
ATOM   6834  C CE3 . TRP B 1 302 ? 22.373  -0.610  111.318 1.00 12.44 ? 301 TRP B CE3 1 
ATOM   6835  C CZ2 . TRP B 1 302 ? 20.922  -0.392  113.753 1.00 14.54 ? 301 TRP B CZ2 1 
ATOM   6836  C CZ3 . TRP B 1 302 ? 20.979  -0.624  111.337 1.00 10.80 ? 301 TRP B CZ3 1 
ATOM   6837  C CH2 . TRP B 1 302 ? 20.270  -0.515  112.546 1.00 11.58 ? 301 TRP B CH2 1 
ATOM   6838  N N   . MET B 1 303 ? 24.617  -2.618  109.810 1.00 15.66 ? 302 MET B N   1 
ATOM   6839  C CA  . MET B 1 303 ? 23.498  -3.204  109.091 1.00 14.93 ? 302 MET B CA  1 
ATOM   6840  C C   . MET B 1 303 ? 23.629  -4.725  109.067 1.00 15.62 ? 302 MET B C   1 
ATOM   6841  O O   . MET B 1 303 ? 22.621  -5.428  109.125 1.00 14.27 ? 302 MET B O   1 
ATOM   6842  C CB  . MET B 1 303 ? 23.421  -2.648  107.663 1.00 12.77 ? 302 MET B CB  1 
ATOM   6843  C CG  . MET B 1 303 ? 22.234  -3.157  106.840 1.00 14.46 ? 302 MET B CG  1 
ATOM   6844  S SD  . MET B 1 303 ? 20.578  -2.807  107.528 1.00 18.07 ? 302 MET B SD  1 
ATOM   6845  C CE  . MET B 1 303 ? 20.530  -1.005  107.473 1.00 15.95 ? 302 MET B CE  1 
ATOM   6846  N N   . ASP B 1 304 ? 24.858  -5.236  108.990 1.00 16.74 ? 303 ASP B N   1 
ATOM   6847  C CA  . ASP B 1 304 ? 25.044  -6.688  108.983 1.00 18.78 ? 303 ASP B CA  1 
ATOM   6848  C C   . ASP B 1 304 ? 24.440  -7.262  110.268 1.00 19.85 ? 303 ASP B C   1 
ATOM   6849  O O   . ASP B 1 304 ? 23.717  -8.262  110.230 1.00 18.63 ? 303 ASP B O   1 
ATOM   6850  C CB  . ASP B 1 304 ? 26.530  -7.073  108.918 1.00 18.75 ? 303 ASP B CB  1 
ATOM   6851  C CG  . ASP B 1 304 ? 27.187  -6.690  107.601 1.00 18.40 ? 303 ASP B CG  1 
ATOM   6852  O OD1 . ASP B 1 304 ? 26.478  -6.571  106.582 1.00 17.83 ? 303 ASP B OD1 1 
ATOM   6853  O OD2 . ASP B 1 304 ? 28.424  -6.529  107.586 1.00 16.28 ? 303 ASP B OD2 1 
ATOM   6854  N N   . GLN B 1 305 ? 24.732  -6.601  111.392 1.00 20.77 ? 304 GLN B N   1 
ATOM   6855  C CA  . GLN B 1 305 ? 24.247  -7.014  112.710 1.00 22.93 ? 304 GLN B CA  1 
ATOM   6856  C C   . GLN B 1 305 ? 22.734  -6.941  112.767 1.00 22.48 ? 304 GLN B C   1 
ATOM   6857  O O   . GLN B 1 305 ? 22.083  -7.848  113.283 1.00 21.71 ? 304 GLN B O   1 
ATOM   6858  C CB  . GLN B 1 305 ? 24.808  -6.107  113.808 1.00 25.61 ? 304 GLN B CB  1 
ATOM   6859  C CG  . GLN B 1 305 ? 26.249  -5.744  113.635 1.00 33.61 ? 304 GLN B CG  1 
ATOM   6860  C CD  . GLN B 1 305 ? 27.142  -6.951  113.648 1.00 37.17 ? 304 GLN B CD  1 
ATOM   6861  O OE1 . GLN B 1 305 ? 27.316  -7.593  114.682 1.00 43.58 ? 304 GLN B OE1 1 
ATOM   6862  N NE2 . GLN B 1 305 ? 27.712  -7.279  112.494 1.00 40.53 ? 304 GLN B NE2 1 
ATOM   6863  N N   . HIS B 1 306 ? 22.180  -5.840  112.264 1.00 20.96 ? 305 HIS B N   1 
ATOM   6864  C CA  . HIS B 1 306 ? 20.734  -5.685  112.251 1.00 19.62 ? 305 HIS B CA  1 
ATOM   6865  C C   . HIS B 1 306 ? 20.096  -6.853  111.516 1.00 20.47 ? 305 HIS B C   1 
ATOM   6866  O O   . HIS B 1 306 ? 19.080  -7.394  111.952 1.00 21.42 ? 305 HIS B O   1 
ATOM   6867  C CB  . HIS B 1 306 ? 20.323  -4.380  111.566 1.00 18.50 ? 305 HIS B CB  1 
ATOM   6868  C CG  . HIS B 1 306 ? 18.852  -4.290  111.295 1.00 18.56 ? 305 HIS B CG  1 
ATOM   6869  N ND1 . HIS B 1 306 ? 18.284  -4.720  110.115 1.00 19.82 ? 305 HIS B ND1 1 
ATOM   6870  C CD2 . HIS B 1 306 ? 17.827  -3.874  112.075 1.00 17.60 ? 305 HIS B CD2 1 
ATOM   6871  C CE1 . HIS B 1 306 ? 16.973  -4.572  110.178 1.00 18.58 ? 305 HIS B CE1 1 
ATOM   6872  N NE2 . HIS B 1 306 ? 16.670  -4.061  111.357 1.00 22.04 ? 305 HIS B NE2 1 
ATOM   6873  N N   . PHE B 1 307 ? 20.701  -7.235  110.396 1.00 19.13 ? 306 PHE B N   1 
ATOM   6874  C CA  . PHE B 1 307 ? 20.198  -8.332  109.588 1.00 19.46 ? 306 PHE B CA  1 
ATOM   6875  C C   . PHE B 1 307 ? 20.347  -9.679  110.306 1.00 19.88 ? 306 PHE B C   1 
ATOM   6876  O O   . PHE B 1 307 ? 19.472  -10.543 110.232 1.00 19.34 ? 306 PHE B O   1 
ATOM   6877  C CB  . PHE B 1 307 ? 20.945  -8.345  108.238 1.00 18.58 ? 306 PHE B CB  1 
ATOM   6878  C CG  . PHE B 1 307 ? 20.619  -9.527  107.360 1.00 17.55 ? 306 PHE B CG  1 
ATOM   6879  C CD1 . PHE B 1 307 ? 19.298  -9.907  107.136 1.00 16.90 ? 306 PHE B CD1 1 
ATOM   6880  C CD2 . PHE B 1 307 ? 21.640  -10.251 106.742 1.00 15.30 ? 306 PHE B CD2 1 
ATOM   6881  C CE1 . PHE B 1 307 ? 18.998  -10.995 106.307 1.00 16.44 ? 306 PHE B CE1 1 
ATOM   6882  C CE2 . PHE B 1 307 ? 21.354  -11.333 105.915 1.00 13.75 ? 306 PHE B CE2 1 
ATOM   6883  C CZ  . PHE B 1 307 ? 20.030  -11.708 105.696 1.00 14.20 ? 306 PHE B CZ  1 
ATOM   6884  N N   . ARG B 1 308 ? 21.447  -9.854  111.022 1.00 21.27 ? 307 ARG B N   1 
ATOM   6885  C CA  . ARG B 1 308 ? 21.678  -11.116 111.706 1.00 21.66 ? 307 ARG B CA  1 
ATOM   6886  C C   . ARG B 1 308 ? 20.950  -11.285 113.044 1.00 21.83 ? 307 ARG B C   1 
ATOM   6887  O O   . ARG B 1 308 ? 20.622  -12.406 113.429 1.00 19.29 ? 307 ARG B O   1 
ATOM   6888  C CB  . ARG B 1 308 ? 23.182  -11.323 111.911 1.00 23.46 ? 307 ARG B CB  1 
ATOM   6889  C CG  . ARG B 1 308 ? 23.545  -12.737 112.345 1.00 24.06 ? 307 ARG B CG  1 
ATOM   6890  C CD  . ARG B 1 308 ? 25.050  -12.936 112.439 1.00 24.81 ? 307 ARG B CD  1 
ATOM   6891  N NE  . ARG B 1 308 ? 25.376  -14.357 112.529 1.00 23.33 ? 307 ARG B NE  1 
ATOM   6892  C CZ  . ARG B 1 308 ? 26.605  -14.845 112.635 1.00 22.35 ? 307 ARG B CZ  1 
ATOM   6893  N NH1 . ARG B 1 308 ? 27.648  -14.029 112.671 1.00 21.76 ? 307 ARG B NH1 1 
ATOM   6894  N NH2 . ARG B 1 308 ? 26.790  -16.157 112.688 1.00 25.43 ? 307 ARG B NH2 1 
ATOM   6895  N N   . THR B 1 309 ? 20.668  -10.182 113.736 1.00 21.32 ? 308 THR B N   1 
ATOM   6896  C CA  . THR B 1 309 ? 20.031  -10.256 115.058 1.00 20.08 ? 308 THR B CA  1 
ATOM   6897  C C   . THR B 1 309 ? 18.556  -9.866  115.158 1.00 20.25 ? 308 THR B C   1 
ATOM   6898  O O   . THR B 1 309 ? 17.946  -10.011 116.217 1.00 20.70 ? 308 THR B O   1 
ATOM   6899  C CB  . THR B 1 309 ? 20.792  -9.372  116.065 1.00 21.37 ? 308 THR B CB  1 
ATOM   6900  O OG1 . THR B 1 309 ? 20.646  -7.992  115.694 1.00 20.62 ? 308 THR B OG1 1 
ATOM   6901  C CG2 . THR B 1 309 ? 22.279  -9.729  116.077 1.00 17.83 ? 308 THR B CG2 1 
ATOM   6902  N N   . THR B 1 310 ? 17.974  -9.386  114.068 1.00 18.73 ? 309 THR B N   1 
ATOM   6903  C CA  . THR B 1 310 ? 16.587  -8.939  114.111 1.00 18.21 ? 309 THR B CA  1 
ATOM   6904  C C   . THR B 1 310 ? 15.534  -9.931  113.637 1.00 19.14 ? 309 THR B C   1 
ATOM   6905  O O   . THR B 1 310 ? 15.625  -10.462 112.536 1.00 21.20 ? 309 THR B O   1 
ATOM   6906  C CB  . THR B 1 310 ? 16.429  -7.642  113.290 1.00 16.24 ? 309 THR B CB  1 
ATOM   6907  O OG1 . THR B 1 310 ? 17.339  -6.661  113.792 1.00 14.44 ? 309 THR B OG1 1 
ATOM   6908  C CG2 . THR B 1 310 ? 15.007  -7.100  113.384 1.00 15.33 ? 309 THR B CG2 1 
ATOM   6909  N N   . PRO B 1 311 ? 14.513  -10.193 114.470 1.00 20.26 ? 310 PRO B N   1 
ATOM   6910  C CA  . PRO B 1 311 ? 13.473  -11.134 114.043 1.00 21.48 ? 310 PRO B CA  1 
ATOM   6911  C C   . PRO B 1 311 ? 12.937  -10.718 112.672 1.00 21.13 ? 310 PRO B C   1 
ATOM   6912  O O   . PRO B 1 311 ? 12.815  -9.528  112.377 1.00 21.88 ? 310 PRO B O   1 
ATOM   6913  C CB  . PRO B 1 311 ? 12.428  -11.055 115.165 1.00 21.75 ? 310 PRO B CB  1 
ATOM   6914  C CG  . PRO B 1 311 ? 12.797  -9.822  115.958 1.00 24.52 ? 310 PRO B CG  1 
ATOM   6915  C CD  . PRO B 1 311 ? 14.293  -9.748  115.855 1.00 21.86 ? 310 PRO B CD  1 
ATOM   6916  N N   . LEU B 1 312 ? 12.631  -11.701 111.835 1.00 22.04 ? 311 LEU B N   1 
ATOM   6917  C CA  . LEU B 1 312 ? 12.165  -11.440 110.474 1.00 21.41 ? 311 LEU B CA  1 
ATOM   6918  C C   . LEU B 1 312 ? 11.086  -10.367 110.280 1.00 22.14 ? 311 LEU B C   1 
ATOM   6919  O O   . LEU B 1 312 ? 11.185  -9.558  109.350 1.00 21.04 ? 311 LEU B O   1 
ATOM   6920  C CB  . LEU B 1 312 ? 11.700  -12.746 109.823 1.00 23.25 ? 311 LEU B CB  1 
ATOM   6921  C CG  . LEU B 1 312 ? 12.698  -13.913 109.757 1.00 25.01 ? 311 LEU B CG  1 
ATOM   6922  C CD1 . LEU B 1 312 ? 12.031  -15.091 109.077 1.00 23.65 ? 311 LEU B CD1 1 
ATOM   6923  C CD2 . LEU B 1 312 ? 13.958  -13.509 109.000 1.00 24.84 ? 311 LEU B CD2 1 
ATOM   6924  N N   . GLU B 1 313 ? 10.065  -10.358 111.134 1.00 18.99 ? 312 GLU B N   1 
ATOM   6925  C CA  . GLU B 1 313 ? 8.974   -9.389  111.016 1.00 21.82 ? 312 GLU B CA  1 
ATOM   6926  C C   . GLU B 1 313 ? 9.421   -7.933  111.125 1.00 21.27 ? 312 GLU B C   1 
ATOM   6927  O O   . GLU B 1 313 ? 8.690   -7.038  110.723 1.00 21.56 ? 312 GLU B O   1 
ATOM   6928  C CB  . GLU B 1 313 ? 7.894   -9.627  112.086 1.00 25.02 ? 312 GLU B CB  1 
ATOM   6929  C CG  . GLU B 1 313 ? 7.768   -11.053 112.578 1.00 32.67 ? 312 GLU B CG  1 
ATOM   6930  C CD  . GLU B 1 313 ? 8.866   -11.423 113.558 1.00 32.49 ? 312 GLU B CD  1 
ATOM   6931  O OE1 . GLU B 1 313 ? 8.850   -10.924 114.709 1.00 34.49 ? 312 GLU B OE1 1 
ATOM   6932  O OE2 . GLU B 1 313 ? 9.749   -12.209 113.170 1.00 34.58 ? 312 GLU B OE2 1 
ATOM   6933  N N   . LYS B 1 314 ? 10.606  -7.696  111.680 1.00 22.77 ? 313 LYS B N   1 
ATOM   6934  C CA  . LYS B 1 314 ? 11.122  -6.334  111.855 1.00 23.78 ? 313 LYS B CA  1 
ATOM   6935  C C   . LYS B 1 314 ? 12.503  -6.181  111.216 1.00 23.32 ? 313 LYS B C   1 
ATOM   6936  O O   . LYS B 1 314 ? 13.235  -5.239  111.518 1.00 23.26 ? 313 LYS B O   1 
ATOM   6937  C CB  . LYS B 1 314 ? 11.241  -6.006  113.351 1.00 26.36 ? 313 LYS B CB  1 
ATOM   6938  C CG  . LYS B 1 314 ? 9.948   -6.081  114.138 1.00 30.73 ? 313 LYS B CG  1 
ATOM   6939  C CD  . LYS B 1 314 ? 8.992   -4.978  113.733 1.00 34.78 ? 313 LYS B CD  1 
ATOM   6940  C CE  . LYS B 1 314 ? 7.769   -4.965  114.635 1.00 38.62 ? 313 LYS B CE  1 
ATOM   6941  N NZ  . LYS B 1 314 ? 6.827   -3.882  114.257 1.00 40.21 ? 313 LYS B NZ  1 
ATOM   6942  N N   . ASN B 1 315 ? 12.848  -7.107  110.333 1.00 22.48 ? 314 ASN B N   1 
ATOM   6943  C CA  . ASN B 1 315 ? 14.144  -7.107  109.673 1.00 21.88 ? 314 ASN B CA  1 
ATOM   6944  C C   . ASN B 1 315 ? 14.057  -6.369  108.327 1.00 22.60 ? 314 ASN B C   1 
ATOM   6945  O O   . ASN B 1 315 ? 13.456  -6.871  107.376 1.00 21.77 ? 314 ASN B O   1 
ATOM   6946  C CB  . ASN B 1 315 ? 14.578  -8.560  109.475 1.00 21.41 ? 314 ASN B CB  1 
ATOM   6947  C CG  . ASN B 1 315 ? 16.052  -8.697  109.216 1.00 21.98 ? 314 ASN B CG  1 
ATOM   6948  O OD1 . ASN B 1 315 ? 16.607  -8.008  108.364 1.00 19.06 ? 314 ASN B OD1 1 
ATOM   6949  N ND2 . ASN B 1 315 ? 16.701  -9.602  109.947 1.00 19.98 ? 314 ASN B ND2 1 
ATOM   6950  N N   . ALA B 1 316 ? 14.673  -5.188  108.257 1.00 21.38 ? 315 ALA B N   1 
ATOM   6951  C CA  . ALA B 1 316 ? 14.635  -4.340  107.061 1.00 19.96 ? 315 ALA B CA  1 
ATOM   6952  C C   . ALA B 1 316 ? 14.965  -5.030  105.739 1.00 20.01 ? 315 ALA B C   1 
ATOM   6953  O O   . ALA B 1 316 ? 14.157  -5.004  104.806 1.00 19.61 ? 315 ALA B O   1 
ATOM   6954  C CB  . ALA B 1 316 ? 15.543  -3.109  107.256 1.00 18.77 ? 315 ALA B CB  1 
ATOM   6955  N N   . PRO B 1 317 ? 16.156  -5.643  105.633 1.00 19.86 ? 316 PRO B N   1 
ATOM   6956  C CA  . PRO B 1 317 ? 16.558  -6.333  104.401 1.00 19.59 ? 316 PRO B CA  1 
ATOM   6957  C C   . PRO B 1 317 ? 15.536  -7.399  104.031 1.00 18.51 ? 316 PRO B C   1 
ATOM   6958  O O   . PRO B 1 317 ? 15.168  -7.555  102.868 1.00 16.10 ? 316 PRO B O   1 
ATOM   6959  C CB  . PRO B 1 317 ? 17.905  -6.956  104.778 1.00 19.83 ? 316 PRO B CB  1 
ATOM   6960  C CG  . PRO B 1 317 ? 18.435  -6.017  105.805 1.00 20.53 ? 316 PRO B CG  1 
ATOM   6961  C CD  . PRO B 1 317 ? 17.227  -5.716  106.642 1.00 19.27 ? 316 PRO B CD  1 
ATOM   6962  N N   . VAL B 1 318 ? 15.090  -8.132  105.045 1.00 17.64 ? 317 VAL B N   1 
ATOM   6963  C CA  . VAL B 1 318 ? 14.121  -9.202  104.867 1.00 17.49 ? 317 VAL B CA  1 
ATOM   6964  C C   . VAL B 1 318 ? 12.786  -8.694  104.334 1.00 18.74 ? 317 VAL B C   1 
ATOM   6965  O O   . VAL B 1 318 ? 12.220  -9.276  103.402 1.00 17.55 ? 317 VAL B O   1 
ATOM   6966  C CB  . VAL B 1 318 ? 13.888  -9.948  106.204 1.00 16.35 ? 317 VAL B CB  1 
ATOM   6967  C CG1 . VAL B 1 318 ? 12.751  -10.946 106.063 1.00 15.36 ? 317 VAL B CG1 1 
ATOM   6968  C CG2 . VAL B 1 318 ? 15.170  -10.645 106.623 1.00 14.30 ? 317 VAL B CG2 1 
ATOM   6969  N N   . LEU B 1 319 ? 12.280  -7.609  104.915 1.00 18.58 ? 318 LEU B N   1 
ATOM   6970  C CA  . LEU B 1 319 ? 11.005  -7.065  104.463 1.00 19.54 ? 318 LEU B CA  1 
ATOM   6971  C C   . LEU B 1 319 ? 11.104  -6.573  103.016 1.00 18.93 ? 318 LEU B C   1 
ATOM   6972  O O   . LEU B 1 319 ? 10.250  -6.896  102.185 1.00 19.20 ? 318 LEU B O   1 
ATOM   6973  C CB  . LEU B 1 319 ? 10.545  -5.937  105.393 1.00 19.23 ? 318 LEU B CB  1 
ATOM   6974  C CG  . LEU B 1 319 ? 10.334  -6.363  106.854 1.00 20.77 ? 318 LEU B CG  1 
ATOM   6975  C CD1 . LEU B 1 319 ? 9.789   -5.192  107.650 1.00 22.08 ? 318 LEU B CD1 1 
ATOM   6976  C CD2 . LEU B 1 319 ? 9.375   -7.547  106.928 1.00 22.45 ? 318 LEU B CD2 1 
ATOM   6977  N N   . LEU B 1 320 ? 12.143  -5.803  102.712 1.00 17.46 ? 319 LEU B N   1 
ATOM   6978  C CA  . LEU B 1 320 ? 12.329  -5.303  101.353 1.00 15.82 ? 319 LEU B CA  1 
ATOM   6979  C C   . LEU B 1 320 ? 12.380  -6.485  100.379 1.00 16.54 ? 319 LEU B C   1 
ATOM   6980  O O   . LEU B 1 320 ? 11.762  -6.460  99.309  1.00 16.62 ? 319 LEU B O   1 
ATOM   6981  C CB  . LEU B 1 320 ? 13.617  -4.484  101.265 1.00 17.08 ? 319 LEU B CB  1 
ATOM   6982  C CG  . LEU B 1 320 ? 13.631  -3.144  102.014 1.00 16.15 ? 319 LEU B CG  1 
ATOM   6983  C CD1 . LEU B 1 320 ? 15.001  -2.494  101.874 1.00 13.80 ? 319 LEU B CD1 1 
ATOM   6984  C CD2 . LEU B 1 320 ? 12.546  -2.232  101.460 1.00 12.99 ? 319 LEU B CD2 1 
ATOM   6985  N N   . ALA B 1 321 ? 13.100  -7.532  100.764 1.00 16.15 ? 320 ALA B N   1 
ATOM   6986  C CA  . ALA B 1 321 ? 13.209  -8.720  99.923  1.00 18.14 ? 320 ALA B CA  1 
ATOM   6987  C C   . ALA B 1 321 ? 11.832  -9.338  99.673  1.00 18.06 ? 320 ALA B C   1 
ATOM   6988  O O   . ALA B 1 321 ? 11.467  -9.641  98.533  1.00 19.25 ? 320 ALA B O   1 
ATOM   6989  C CB  . ALA B 1 321 ? 14.139  -9.747  100.585 1.00 15.02 ? 320 ALA B CB  1 
ATOM   6990  N N   . LEU B 1 322 ? 11.070  -9.510  100.749 1.00 19.25 ? 321 LEU B N   1 
ATOM   6991  C CA  . LEU B 1 322 ? 9.736   -10.100 100.684 1.00 18.65 ? 321 LEU B CA  1 
ATOM   6992  C C   . LEU B 1 322 ? 8.759   -9.293  99.844  1.00 18.29 ? 321 LEU B C   1 
ATOM   6993  O O   . LEU B 1 322 ? 7.952   -9.858  99.111  1.00 17.99 ? 321 LEU B O   1 
ATOM   6994  C CB  . LEU B 1 322 ? 9.180   -10.286 102.100 1.00 18.46 ? 321 LEU B CB  1 
ATOM   6995  C CG  . LEU B 1 322 ? 9.613   -11.551 102.856 1.00 19.71 ? 321 LEU B CG  1 
ATOM   6996  C CD1 . LEU B 1 322 ? 11.112  -11.761 102.742 1.00 23.70 ? 321 LEU B CD1 1 
ATOM   6997  C CD2 . LEU B 1 322 ? 9.212   -11.430 104.316 1.00 15.68 ? 321 LEU B CD2 1 
ATOM   6998  N N   . LEU B 1 323 ? 8.819   -7.970  99.955  1.00 17.13 ? 322 LEU B N   1 
ATOM   6999  C CA  . LEU B 1 323 ? 7.927   -7.138  99.173  1.00 15.85 ? 322 LEU B CA  1 
ATOM   7000  C C   . LEU B 1 323 ? 8.231   -7.350  97.689  1.00 14.58 ? 322 LEU B C   1 
ATOM   7001  O O   . LEU B 1 323 ? 7.319   -7.440  96.869  1.00 16.54 ? 322 LEU B O   1 
ATOM   7002  C CB  . LEU B 1 323 ? 8.083   -5.665  99.587  1.00 14.53 ? 322 LEU B CB  1 
ATOM   7003  C CG  . LEU B 1 323 ? 7.584   -5.421  101.022 1.00 14.19 ? 322 LEU B CG  1 
ATOM   7004  C CD1 . LEU B 1 323 ? 8.081   -4.086  101.540 1.00 14.70 ? 322 LEU B CD1 1 
ATOM   7005  C CD2 . LEU B 1 323 ? 6.058   -5.476  101.052 1.00 13.27 ? 322 LEU B CD2 1 
ATOM   7006  N N   . GLY B 1 324 ? 9.514   -7.465  97.353  1.00 15.86 ? 323 GLY B N   1 
ATOM   7007  C CA  . GLY B 1 324 ? 9.894   -7.692  95.969  1.00 14.09 ? 323 GLY B CA  1 
ATOM   7008  C C   . GLY B 1 324 ? 9.434   -9.058  95.477  1.00 15.60 ? 323 GLY B C   1 
ATOM   7009  O O   . GLY B 1 324 ? 9.027   -9.198  94.324  1.00 14.88 ? 323 GLY B O   1 
ATOM   7010  N N   . ILE B 1 325 ? 9.504   -10.076 96.333  1.00 15.71 ? 324 ILE B N   1 
ATOM   7011  C CA  . ILE B 1 325 ? 9.055   -11.412 95.934  1.00 17.55 ? 324 ILE B CA  1 
ATOM   7012  C C   . ILE B 1 325 ? 7.561   -11.320 95.589  1.00 18.26 ? 324 ILE B C   1 
ATOM   7013  O O   . ILE B 1 325 ? 7.090   -11.898 94.610  1.00 18.30 ? 324 ILE B O   1 
ATOM   7014  C CB  . ILE B 1 325 ? 9.246   -12.440 97.084  1.00 19.20 ? 324 ILE B CB  1 
ATOM   7015  C CG1 . ILE B 1 325 ? 10.739  -12.647 97.366  1.00 19.33 ? 324 ILE B CG1 1 
ATOM   7016  C CG2 . ILE B 1 325 ? 8.579   -13.768 96.728  1.00 21.17 ? 324 ILE B CG2 1 
ATOM   7017  C CD1 . ILE B 1 325 ? 11.509  -13.303 96.231  1.00 18.58 ? 324 ILE B CD1 1 
ATOM   7018  N N   . TRP B 1 326 ? 6.830   -10.575 96.410  1.00 18.69 ? 325 TRP B N   1 
ATOM   7019  C CA  . TRP B 1 326 ? 5.394   -10.366 96.236  1.00 18.65 ? 325 TRP B CA  1 
ATOM   7020  C C   . TRP B 1 326 ? 5.089   -9.740  94.862  1.00 19.93 ? 325 TRP B C   1 
ATOM   7021  O O   . TRP B 1 326 ? 4.269   -10.258 94.101  1.00 18.64 ? 325 TRP B O   1 
ATOM   7022  C CB  . TRP B 1 326 ? 4.907   -9.474  97.390  1.00 16.68 ? 325 TRP B CB  1 
ATOM   7023  C CG  . TRP B 1 326 ? 3.451   -9.123  97.432  1.00 21.08 ? 325 TRP B CG  1 
ATOM   7024  C CD1 . TRP B 1 326 ? 2.925   -7.861  97.510  1.00 22.64 ? 325 TRP B CD1 1 
ATOM   7025  C CD2 . TRP B 1 326 ? 2.332   -10.026 97.477  1.00 21.19 ? 325 TRP B CD2 1 
ATOM   7026  N NE1 . TRP B 1 326 ? 1.553   -7.922  97.601  1.00 23.66 ? 325 TRP B NE1 1 
ATOM   7027  C CE2 . TRP B 1 326 ? 1.163   -9.237  97.582  1.00 23.06 ? 325 TRP B CE2 1 
ATOM   7028  C CE3 . TRP B 1 326 ? 2.204   -11.424 97.439  1.00 22.20 ? 325 TRP B CE3 1 
ATOM   7029  C CZ2 . TRP B 1 326 ? -0.121  -9.801  97.651  1.00 23.74 ? 325 TRP B CZ2 1 
ATOM   7030  C CZ3 . TRP B 1 326 ? 0.928   -11.984 97.507  1.00 20.50 ? 325 TRP B CZ3 1 
ATOM   7031  C CH2 . TRP B 1 326 ? -0.216  -11.173 97.612  1.00 23.90 ? 325 TRP B CH2 1 
ATOM   7032  N N   . TYR B 1 327 ? 5.763   -8.643  94.526  1.00 20.63 ? 326 TYR B N   1 
ATOM   7033  C CA  . TYR B 1 327 ? 5.515   -7.993  93.240  1.00 20.48 ? 326 TYR B CA  1 
ATOM   7034  C C   . TYR B 1 327 ? 6.039   -8.777  92.043  1.00 19.75 ? 326 TYR B C   1 
ATOM   7035  O O   . TYR B 1 327 ? 5.439   -8.753  90.962  1.00 18.32 ? 326 TYR B O   1 
ATOM   7036  C CB  . TYR B 1 327 ? 6.104   -6.579  93.237  1.00 20.81 ? 326 TYR B CB  1 
ATOM   7037  C CG  . TYR B 1 327 ? 5.379   -5.655  94.183  1.00 20.45 ? 326 TYR B CG  1 
ATOM   7038  C CD1 . TYR B 1 327 ? 3.993   -5.503  94.107  1.00 21.65 ? 326 TYR B CD1 1 
ATOM   7039  C CD2 . TYR B 1 327 ? 6.065   -4.953  95.170  1.00 20.59 ? 326 TYR B CD2 1 
ATOM   7040  C CE1 . TYR B 1 327 ? 3.306   -4.677  94.997  1.00 21.16 ? 326 TYR B CE1 1 
ATOM   7041  C CE2 . TYR B 1 327 ? 5.389   -4.124  96.063  1.00 19.80 ? 326 TYR B CE2 1 
ATOM   7042  C CZ  . TYR B 1 327 ? 4.012   -3.993  95.972  1.00 21.16 ? 326 TYR B CZ  1 
ATOM   7043  O OH  . TYR B 1 327 ? 3.339   -3.202  96.873  1.00 20.77 ? 326 TYR B OH  1 
ATOM   7044  N N   . ILE B 1 328 ? 7.146   -9.486  92.244  1.00 19.54 ? 327 ILE B N   1 
ATOM   7045  C CA  . ILE B 1 328 ? 7.750   -10.268 91.177  1.00 18.76 ? 327 ILE B CA  1 
ATOM   7046  C C   . ILE B 1 328 ? 7.067   -11.612 90.906  1.00 20.90 ? 327 ILE B C   1 
ATOM   7047  O O   . ILE B 1 328 ? 6.679   -11.895 89.768  1.00 19.62 ? 327 ILE B O   1 
ATOM   7048  C CB  . ILE B 1 328 ? 9.245   -10.541 91.467  1.00 18.08 ? 327 ILE B CB  1 
ATOM   7049  C CG1 . ILE B 1 328 ? 10.050  -9.249  91.320  1.00 15.52 ? 327 ILE B CG1 1 
ATOM   7050  C CG2 . ILE B 1 328 ? 9.769   -11.617 90.522  1.00 18.20 ? 327 ILE B CG2 1 
ATOM   7051  C CD1 . ILE B 1 328 ? 11.479  -9.363  91.826  1.00 14.36 ? 327 ILE B CD1 1 
ATOM   7052  N N   . ASN B 1 329 ? 6.917   -12.439 91.939  1.00 20.10 ? 328 ASN B N   1 
ATOM   7053  C CA  . ASN B 1 329 ? 6.319   -13.755 91.734  1.00 22.22 ? 328 ASN B CA  1 
ATOM   7054  C C   . ASN B 1 329 ? 4.795   -13.848 91.798  1.00 22.08 ? 328 ASN B C   1 
ATOM   7055  O O   . ASN B 1 329 ? 4.219   -14.835 91.346  1.00 22.35 ? 328 ASN B O   1 
ATOM   7056  C CB  . ASN B 1 329 ? 6.960   -14.766 92.683  1.00 20.57 ? 328 ASN B CB  1 
ATOM   7057  C CG  . ASN B 1 329 ? 8.464   -14.869 92.482  1.00 20.79 ? 328 ASN B CG  1 
ATOM   7058  O OD1 . ASN B 1 329 ? 9.244   -14.487 93.353  1.00 20.30 ? 328 ASN B OD1 1 
ATOM   7059  N ND2 . ASN B 1 329 ? 8.874   -15.372 91.322  1.00 18.69 ? 328 ASN B ND2 1 
ATOM   7060  N N   . CYS B 1 330 ? 4.135   -12.838 92.350  1.00 22.77 ? 329 CYS B N   1 
ATOM   7061  C CA  . CYS B 1 330 ? 2.678   -12.869 92.392  1.00 21.68 ? 329 CYS B CA  1 
ATOM   7062  C C   . CYS B 1 330 ? 2.111   -11.864 91.391  1.00 21.72 ? 329 CYS B C   1 
ATOM   7063  O O   . CYS B 1 330 ? 1.283   -12.227 90.566  1.00 22.31 ? 329 CYS B O   1 
ATOM   7064  C CB  . CYS B 1 330 ? 2.164   -12.592 93.810  1.00 21.66 ? 329 CYS B CB  1 
ATOM   7065  S SG  . CYS B 1 330 ? 2.501   -13.950 94.981  1.00 23.83 ? 329 CYS B SG  1 
ATOM   7066  N N   . PHE B 1 331 ? 2.570   -10.613 91.437  1.00 21.17 ? 330 PHE B N   1 
ATOM   7067  C CA  . PHE B 1 331 ? 2.080   -9.608  90.489  1.00 20.33 ? 330 PHE B CA  1 
ATOM   7068  C C   . PHE B 1 331 ? 2.719   -9.708  89.102  1.00 21.10 ? 330 PHE B C   1 
ATOM   7069  O O   . PHE B 1 331 ? 2.192   -9.158  88.136  1.00 21.71 ? 330 PHE B O   1 
ATOM   7070  C CB  . PHE B 1 331 ? 2.292   -8.191  91.026  1.00 19.12 ? 330 PHE B CB  1 
ATOM   7071  C CG  . PHE B 1 331 ? 1.244   -7.747  92.001  1.00 19.90 ? 330 PHE B CG  1 
ATOM   7072  C CD1 . PHE B 1 331 ? 1.371   -8.028  93.356  1.00 17.31 ? 330 PHE B CD1 1 
ATOM   7073  C CD2 . PHE B 1 331 ? 0.125   -7.040  91.561  1.00 20.30 ? 330 PHE B CD2 1 
ATOM   7074  C CE1 . PHE B 1 331 ? 0.404   -7.609  94.263  1.00 18.58 ? 330 PHE B CE1 1 
ATOM   7075  C CE2 . PHE B 1 331 ? -0.853  -6.617  92.460  1.00 19.28 ? 330 PHE B CE2 1 
ATOM   7076  C CZ  . PHE B 1 331 ? -0.711  -6.902  93.816  1.00 19.54 ? 330 PHE B CZ  1 
ATOM   7077  N N   . GLY B 1 332 ? 3.856   -10.391 89.003  1.00 21.48 ? 331 GLY B N   1 
ATOM   7078  C CA  . GLY B 1 332 ? 4.521   -10.543 87.717  1.00 21.96 ? 331 GLY B CA  1 
ATOM   7079  C C   . GLY B 1 332 ? 5.285   -9.327  87.210  1.00 24.11 ? 331 GLY B C   1 
ATOM   7080  O O   . GLY B 1 332 ? 5.447   -9.157  85.999  1.00 24.45 ? 331 GLY B O   1 
ATOM   7081  N N   . CYS B 1 333 ? 5.756   -8.479  88.122  1.00 22.34 ? 332 CYS B N   1 
ATOM   7082  C CA  . CYS B 1 333 ? 6.506   -7.280  87.737  1.00 22.34 ? 332 CYS B CA  1 
ATOM   7083  C C   . CYS B 1 333 ? 7.942   -7.607  87.325  1.00 21.12 ? 332 CYS B C   1 
ATOM   7084  O O   . CYS B 1 333 ? 8.693   -8.220  88.083  1.00 19.16 ? 332 CYS B O   1 
ATOM   7085  C CB  . CYS B 1 333 ? 6.521   -6.271  88.894  1.00 20.02 ? 332 CYS B CB  1 
ATOM   7086  S SG  . CYS B 1 333 ? 4.892   -5.650  89.354  1.00 20.59 ? 332 CYS B SG  1 
ATOM   7087  N N   . GLU B 1 334 ? 8.316   -7.185  86.120  1.00 21.53 ? 333 GLU B N   1 
ATOM   7088  C CA  . GLU B 1 334 ? 9.659   -7.421  85.585  1.00 20.88 ? 333 GLU B CA  1 
ATOM   7089  C C   . GLU B 1 334 ? 10.756  -6.497  86.129  1.00 20.61 ? 333 GLU B C   1 
ATOM   7090  O O   . GLU B 1 334 ? 11.930  -6.871  86.134  1.00 20.77 ? 333 GLU B O   1 
ATOM   7091  C CB  . GLU B 1 334 ? 9.659   -7.255  84.060  1.00 22.17 ? 333 GLU B CB  1 
ATOM   7092  C CG  . GLU B 1 334 ? 9.247   -8.457  83.238  1.00 24.09 ? 333 GLU B CG  1 
ATOM   7093  C CD  . GLU B 1 334 ? 9.627   -8.272  81.777  1.00 27.16 ? 333 GLU B CD  1 
ATOM   7094  O OE1 . GLU B 1 334 ? 10.762  -7.803  81.525  1.00 28.10 ? 333 GLU B OE1 1 
ATOM   7095  O OE2 . GLU B 1 334 ? 8.807   -8.592  80.888  1.00 30.06 ? 333 GLU B OE2 1 
ATOM   7096  N N   . THR B 1 335 ? 10.384  -5.294  86.569  1.00 18.15 ? 334 THR B N   1 
ATOM   7097  C CA  . THR B 1 335 ? 11.377  -4.327  87.030  1.00 17.24 ? 334 THR B CA  1 
ATOM   7098  C C   . THR B 1 335 ? 11.214  -3.770  88.437  1.00 18.33 ? 334 THR B C   1 
ATOM   7099  O O   . THR B 1 335 ? 10.162  -3.897  89.068  1.00 19.21 ? 334 THR B O   1 
ATOM   7100  C CB  . THR B 1 335 ? 11.433  -3.119  86.080  1.00 17.30 ? 334 THR B CB  1 
ATOM   7101  O OG1 . THR B 1 335 ? 10.302  -2.269  86.315  1.00 17.57 ? 334 THR B OG1 1 
ATOM   7102  C CG2 . THR B 1 335 ? 11.387  -3.584  84.638  1.00 17.61 ? 334 THR B CG2 1 
ATOM   7103  N N   . HIS B 1 336 ? 12.283  -3.130  88.904  1.00 17.19 ? 335 HIS B N   1 
ATOM   7104  C CA  . HIS B 1 336 ? 12.328  -2.508  90.216  1.00 15.00 ? 335 HIS B CA  1 
ATOM   7105  C C   . HIS B 1 336 ? 13.086  -1.196  90.051  1.00 16.75 ? 335 HIS B C   1 
ATOM   7106  O O   . HIS B 1 336 ? 14.285  -1.198  89.750  1.00 16.27 ? 335 HIS B O   1 
ATOM   7107  C CB  . HIS B 1 336 ? 13.076  -3.406  91.206  1.00 16.31 ? 335 HIS B CB  1 
ATOM   7108  C CG  . HIS B 1 336 ? 13.188  -2.828  92.585  1.00 18.46 ? 335 HIS B CG  1 
ATOM   7109  N ND1 . HIS B 1 336 ? 12.123  -2.769  93.459  1.00 18.92 ? 335 HIS B ND1 1 
ATOM   7110  C CD2 . HIS B 1 336 ? 14.238  -2.269  93.234  1.00 17.44 ? 335 HIS B CD2 1 
ATOM   7111  C CE1 . HIS B 1 336 ? 12.512  -2.199  94.586  1.00 20.02 ? 335 HIS B CE1 1 
ATOM   7112  N NE2 . HIS B 1 336 ? 13.792  -1.885  94.476  1.00 19.50 ? 335 HIS B NE2 1 
ATOM   7113  N N   . ALA B 1 337 ? 12.394  -0.079  90.251  1.00 15.18 ? 336 ALA B N   1 
ATOM   7114  C CA  . ALA B 1 337 ? 13.021  1.228   90.129  1.00 14.64 ? 336 ALA B CA  1 
ATOM   7115  C C   . ALA B 1 337 ? 13.596  1.718   91.454  1.00 15.77 ? 336 ALA B C   1 
ATOM   7116  O O   . ALA B 1 337 ? 12.940  1.657   92.484  1.00 15.77 ? 336 ALA B O   1 
ATOM   7117  C CB  . ALA B 1 337 ? 12.012  2.243   89.606  1.00 14.16 ? 336 ALA B CB  1 
ATOM   7118  N N   . MET B 1 338 ? 14.837  2.196   91.418  1.00 15.99 ? 337 MET B N   1 
ATOM   7119  C CA  . MET B 1 338 ? 15.483  2.739   92.600  1.00 15.70 ? 337 MET B CA  1 
ATOM   7120  C C   . MET B 1 338 ? 15.689  4.224   92.279  1.00 16.75 ? 337 MET B C   1 
ATOM   7121  O O   . MET B 1 338 ? 16.462  4.591   91.391  1.00 14.35 ? 337 MET B O   1 
ATOM   7122  C CB  . MET B 1 338 ? 16.797  2.001   92.859  1.00 17.82 ? 337 MET B CB  1 
ATOM   7123  C CG  . MET B 1 338 ? 16.559  0.557   93.321  1.00 19.83 ? 337 MET B CG  1 
ATOM   7124  S SD  . MET B 1 338 ? 18.054  -0.431  93.568  1.00 22.54 ? 337 MET B SD  1 
ATOM   7125  C CE  . MET B 1 338 ? 18.662  0.284   95.124  1.00 22.07 ? 337 MET B CE  1 
ATOM   7126  N N   . LEU B 1 339 ? 14.972  5.071   93.007  1.00 16.75 ? 338 LEU B N   1 
ATOM   7127  C CA  . LEU B 1 339 ? 14.991  6.506   92.759  1.00 14.20 ? 338 LEU B CA  1 
ATOM   7128  C C   . LEU B 1 339 ? 15.388  7.344   93.968  1.00 14.53 ? 338 LEU B C   1 
ATOM   7129  O O   . LEU B 1 339 ? 14.535  7.760   94.753  1.00 15.71 ? 338 LEU B O   1 
ATOM   7130  C CB  . LEU B 1 339 ? 13.597  6.925   92.277  1.00 12.83 ? 338 LEU B CB  1 
ATOM   7131  C CG  . LEU B 1 339 ? 13.005  6.076   91.142  1.00 14.37 ? 338 LEU B CG  1 
ATOM   7132  C CD1 . LEU B 1 339 ? 11.488  6.309   91.025  1.00 13.16 ? 338 LEU B CD1 1 
ATOM   7133  C CD2 . LEU B 1 339 ? 13.721  6.411   89.831  1.00 12.81 ? 338 LEU B CD2 1 
ATOM   7134  N N   . PRO B 1 340 ? 16.696  7.592   94.141  1.00 14.08 ? 339 PRO B N   1 
ATOM   7135  C CA  . PRO B 1 340 ? 17.162  8.393   95.268  1.00 14.63 ? 339 PRO B CA  1 
ATOM   7136  C C   . PRO B 1 340 ? 17.071  9.885   94.920  1.00 15.38 ? 339 PRO B C   1 
ATOM   7137  O O   . PRO B 1 340 ? 17.584  10.320  93.889  1.00 14.92 ? 339 PRO B O   1 
ATOM   7138  C CB  . PRO B 1 340 ? 18.604  7.924   95.436  1.00 13.22 ? 339 PRO B CB  1 
ATOM   7139  C CG  . PRO B 1 340 ? 19.023  7.708   94.023  1.00 14.38 ? 339 PRO B CG  1 
ATOM   7140  C CD  . PRO B 1 340 ? 17.835  6.990   93.422  1.00 12.54 ? 339 PRO B CD  1 
ATOM   7141  N N   . TYR B 1 341 ? 16.399  10.659  95.766  1.00 15.27 ? 340 TYR B N   1 
ATOM   7142  C CA  . TYR B 1 341 ? 16.278  12.100  95.538  1.00 16.23 ? 340 TYR B CA  1 
ATOM   7143  C C   . TYR B 1 341 ? 17.526  12.753  96.111  1.00 15.17 ? 340 TYR B C   1 
ATOM   7144  O O   . TYR B 1 341 ? 17.482  13.448  97.122  1.00 18.81 ? 340 TYR B O   1 
ATOM   7145  C CB  . TYR B 1 341 ? 15.007  12.636  96.206  1.00 15.53 ? 340 TYR B CB  1 
ATOM   7146  C CG  . TYR B 1 341 ? 13.784  12.488  95.322  1.00 16.34 ? 340 TYR B CG  1 
ATOM   7147  C CD1 . TYR B 1 341 ? 13.452  11.250  94.766  1.00 13.19 ? 340 TYR B CD1 1 
ATOM   7148  C CD2 . TYR B 1 341 ? 13.019  13.600  94.959  1.00 14.39 ? 340 TYR B CD2 1 
ATOM   7149  C CE1 . TYR B 1 341 ? 12.398  11.121  93.852  1.00 15.34 ? 340 TYR B CE1 1 
ATOM   7150  C CE2 . TYR B 1 341 ? 11.961  13.484  94.046  1.00 14.24 ? 340 TYR B CE2 1 
ATOM   7151  C CZ  . TYR B 1 341 ? 11.663  12.241  93.488  1.00 16.17 ? 340 TYR B CZ  1 
ATOM   7152  O OH  . TYR B 1 341 ? 10.690  12.133  92.507  1.00 13.25 ? 340 TYR B OH  1 
ATOM   7153  N N   . ASP B 1 342 ? 18.643  12.519  95.434  1.00 15.65 ? 341 ASP B N   1 
ATOM   7154  C CA  . ASP B 1 342 ? 19.941  13.016  95.863  1.00 14.95 ? 341 ASP B CA  1 
ATOM   7155  C C   . ASP B 1 342 ? 20.888  12.909  94.672  1.00 14.71 ? 341 ASP B C   1 
ATOM   7156  O O   . ASP B 1 342 ? 21.154  11.811  94.185  1.00 14.74 ? 341 ASP B O   1 
ATOM   7157  C CB  . ASP B 1 342 ? 20.445  12.139  97.015  1.00 14.19 ? 341 ASP B CB  1 
ATOM   7158  C CG  . ASP B 1 342 ? 21.741  12.634  97.615  1.00 17.62 ? 341 ASP B CG  1 
ATOM   7159  O OD1 . ASP B 1 342 ? 21.693  13.496  98.525  1.00 17.73 ? 341 ASP B OD1 1 
ATOM   7160  O OD2 . ASP B 1 342 ? 22.807  12.157  97.170  1.00 16.48 ? 341 ASP B OD2 1 
ATOM   7161  N N   . GLN B 1 343 ? 21.396  14.049  94.213  1.00 15.55 ? 342 GLN B N   1 
ATOM   7162  C CA  . GLN B 1 343 ? 22.308  14.097  93.074  1.00 15.39 ? 342 GLN B CA  1 
ATOM   7163  C C   . GLN B 1 343 ? 23.620  13.349  93.333  1.00 14.33 ? 342 GLN B C   1 
ATOM   7164  O O   . GLN B 1 343 ? 24.188  12.750  92.424  1.00 14.57 ? 342 GLN B O   1 
ATOM   7165  C CB  . GLN B 1 343 ? 22.605  15.556  92.722  1.00 18.24 ? 342 GLN B CB  1 
ATOM   7166  C CG  . GLN B 1 343 ? 23.409  15.759  91.445  1.00 19.95 ? 342 GLN B CG  1 
ATOM   7167  C CD  . GLN B 1 343 ? 22.708  15.210  90.219  1.00 22.07 ? 342 GLN B CD  1 
ATOM   7168  O OE1 . GLN B 1 343 ? 21.480  15.285  90.099  1.00 22.72 ? 342 GLN B OE1 1 
ATOM   7169  N NE2 . GLN B 1 343 ? 23.487  14.666  89.290  1.00 20.30 ? 342 GLN B NE2 1 
ATOM   7170  N N   . TYR B 1 344 ? 24.107  13.393  94.567  1.00 13.22 ? 343 TYR B N   1 
ATOM   7171  C CA  . TYR B 1 344 ? 25.349  12.699  94.896  1.00 14.35 ? 343 TYR B CA  1 
ATOM   7172  C C   . TYR B 1 344 ? 25.181  11.192  94.674  1.00 14.76 ? 343 TYR B C   1 
ATOM   7173  O O   . TYR B 1 344 ? 26.130  10.494  94.317  1.00 17.58 ? 343 TYR B O   1 
ATOM   7174  C CB  . TYR B 1 344 ? 25.751  13.000  96.345  1.00 13.76 ? 343 TYR B CB  1 
ATOM   7175  C CG  . TYR B 1 344 ? 26.507  14.301  96.493  1.00 14.86 ? 343 TYR B CG  1 
ATOM   7176  C CD1 . TYR B 1 344 ? 26.202  15.206  97.510  1.00 17.75 ? 343 TYR B CD1 1 
ATOM   7177  C CD2 . TYR B 1 344 ? 27.535  14.627  95.610  1.00 17.22 ? 343 TYR B CD2 1 
ATOM   7178  C CE1 . TYR B 1 344 ? 26.904  16.406  97.636  1.00 16.41 ? 343 TYR B CE1 1 
ATOM   7179  C CE2 . TYR B 1 344 ? 28.240  15.810  95.729  1.00 16.36 ? 343 TYR B CE2 1 
ATOM   7180  C CZ  . TYR B 1 344 ? 27.923  16.696  96.738  1.00 17.89 ? 343 TYR B CZ  1 
ATOM   7181  O OH  . TYR B 1 344 ? 28.635  17.869  96.838  1.00 19.04 ? 343 TYR B OH  1 
ATOM   7182  N N   . LEU B 1 345 ? 23.960  10.703  94.856  1.00 11.45 ? 344 LEU B N   1 
ATOM   7183  C CA  . LEU B 1 345 ? 23.661  9.287   94.665  1.00 13.32 ? 344 LEU B CA  1 
ATOM   7184  C C   . LEU B 1 345 ? 23.259  9.039   93.204  1.00 12.79 ? 344 LEU B C   1 
ATOM   7185  O O   . LEU B 1 345 ? 22.582  8.056   92.895  1.00 15.08 ? 344 LEU B O   1 
ATOM   7186  C CB  . LEU B 1 345 ? 22.515  8.879   95.600  1.00 12.85 ? 344 LEU B CB  1 
ATOM   7187  C CG  . LEU B 1 345 ? 22.646  7.894   96.774  1.00 17.60 ? 344 LEU B CG  1 
ATOM   7188  C CD1 . LEU B 1 345 ? 24.061  7.746   97.270  1.00 16.78 ? 344 LEU B CD1 1 
ATOM   7189  C CD2 . LEU B 1 345 ? 21.721  8.371   97.884  1.00 16.08 ? 344 LEU B CD2 1 
ATOM   7190  N N   . HIS B 1 346 ? 23.684  9.912   92.296  1.00 12.93 ? 345 HIS B N   1 
ATOM   7191  C CA  . HIS B 1 346 ? 23.303  9.731   90.894  1.00 15.30 ? 345 HIS B CA  1 
ATOM   7192  C C   . HIS B 1 346 ? 23.691  8.382   90.275  1.00 15.74 ? 345 HIS B C   1 
ATOM   7193  O O   . HIS B 1 346 ? 23.099  7.980   89.271  1.00 16.96 ? 345 HIS B O   1 
ATOM   7194  C CB  . HIS B 1 346 ? 23.827  10.881  90.023  1.00 13.68 ? 345 HIS B CB  1 
ATOM   7195  C CG  . HIS B 1 346 ? 25.313  10.894  89.845  1.00 13.51 ? 345 HIS B CG  1 
ATOM   7196  N ND1 . HIS B 1 346 ? 25.909  10.862  88.603  1.00 14.11 ? 345 HIS B ND1 1 
ATOM   7197  C CD2 . HIS B 1 346 ? 26.320  10.982  90.745  1.00 14.37 ? 345 HIS B CD2 1 
ATOM   7198  C CE1 . HIS B 1 346 ? 27.221  10.932  88.745  1.00 14.01 ? 345 HIS B CE1 1 
ATOM   7199  N NE2 . HIS B 1 346 ? 27.496  11.007  90.035  1.00 15.11 ? 345 HIS B NE2 1 
ATOM   7200  N N   . ARG B 1 347 ? 24.663  7.675   90.857  1.00 16.31 ? 346 ARG B N   1 
ATOM   7201  C CA  . ARG B 1 347 ? 25.052  6.365   90.321  1.00 17.20 ? 346 ARG B CA  1 
ATOM   7202  C C   . ARG B 1 347 ? 24.645  5.190   91.226  1.00 18.00 ? 346 ARG B C   1 
ATOM   7203  O O   . ARG B 1 347 ? 25.139  4.070   91.068  1.00 17.81 ? 346 ARG B O   1 
ATOM   7204  C CB  . ARG B 1 347 ? 26.566  6.315   90.053  1.00 17.81 ? 346 ARG B CB  1 
ATOM   7205  C CG  . ARG B 1 347 ? 27.038  7.293   88.978  1.00 19.41 ? 346 ARG B CG  1 
ATOM   7206  C CD  . ARG B 1 347 ? 26.185  7.187   87.714  1.00 19.14 ? 346 ARG B CD  1 
ATOM   7207  N NE  . ARG B 1 347 ? 26.537  6.040   86.880  1.00 18.03 ? 346 ARG B NE  1 
ATOM   7208  C CZ  . ARG B 1 347 ? 25.785  5.575   85.885  1.00 18.76 ? 346 ARG B CZ  1 
ATOM   7209  N NH1 . ARG B 1 347 ? 24.625  6.149   85.600  1.00 19.82 ? 346 ARG B NH1 1 
ATOM   7210  N NH2 . ARG B 1 347 ? 26.201  4.546   85.159  1.00 21.67 ? 346 ARG B NH2 1 
ATOM   7211  N N   . PHE B 1 348 ? 23.731  5.449   92.160  1.00 17.64 ? 347 PHE B N   1 
ATOM   7212  C CA  . PHE B 1 348 ? 23.252  4.430   93.099  1.00 17.77 ? 347 PHE B CA  1 
ATOM   7213  C C   . PHE B 1 348 ? 22.460  3.316   92.399  1.00 17.82 ? 347 PHE B C   1 
ATOM   7214  O O   . PHE B 1 348 ? 22.724  2.132   92.607  1.00 14.90 ? 347 PHE B O   1 
ATOM   7215  C CB  . PHE B 1 348 ? 22.384  5.094   94.179  1.00 16.93 ? 347 PHE B CB  1 
ATOM   7216  C CG  . PHE B 1 348 ? 22.062  4.203   95.349  1.00 18.26 ? 347 PHE B CG  1 
ATOM   7217  C CD1 . PHE B 1 348 ? 23.059  3.809   96.240  1.00 18.69 ? 347 PHE B CD1 1 
ATOM   7218  C CD2 . PHE B 1 348 ? 20.750  3.777   95.580  1.00 19.03 ? 347 PHE B CD2 1 
ATOM   7219  C CE1 . PHE B 1 348 ? 22.758  3.008   97.350  1.00 17.25 ? 347 PHE B CE1 1 
ATOM   7220  C CE2 . PHE B 1 348 ? 20.438  2.974   96.687  1.00 17.07 ? 347 PHE B CE2 1 
ATOM   7221  C CZ  . PHE B 1 348 ? 21.447  2.592   97.573  1.00 18.17 ? 347 PHE B CZ  1 
ATOM   7222  N N   . ALA B 1 349 ? 21.487  3.690   91.571  1.00 18.90 ? 348 ALA B N   1 
ATOM   7223  C CA  . ALA B 1 349 ? 20.691  2.689   90.867  1.00 17.84 ? 348 ALA B CA  1 
ATOM   7224  C C   . ALA B 1 349 ? 21.594  1.879   89.944  1.00 17.70 ? 348 ALA B C   1 
ATOM   7225  O O   . ALA B 1 349 ? 21.489  0.653   89.870  1.00 16.85 ? 348 ALA B O   1 
ATOM   7226  C CB  . ALA B 1 349 ? 19.577  3.355   90.065  1.00 16.09 ? 348 ALA B CB  1 
ATOM   7227  N N   . ALA B 1 350 ? 22.488  2.569   89.246  1.00 17.80 ? 349 ALA B N   1 
ATOM   7228  C CA  . ALA B 1 350 ? 23.412  1.905   88.333  1.00 19.53 ? 349 ALA B CA  1 
ATOM   7229  C C   . ALA B 1 350 ? 24.246  0.852   89.065  1.00 20.63 ? 349 ALA B C   1 
ATOM   7230  O O   . ALA B 1 350 ? 24.498  -0.233  88.530  1.00 20.49 ? 349 ALA B O   1 
ATOM   7231  C CB  . ALA B 1 350 ? 24.327  2.934   87.673  1.00 20.47 ? 349 ALA B CB  1 
ATOM   7232  N N   . TYR B 1 351 ? 24.671  1.175   90.286  1.00 19.84 ? 350 TYR B N   1 
ATOM   7233  C CA  . TYR B 1 351 ? 25.467  0.245   91.083  1.00 19.43 ? 350 TYR B CA  1 
ATOM   7234  C C   . TYR B 1 351 ? 24.693  -1.032  91.394  1.00 20.28 ? 350 TYR B C   1 
ATOM   7235  O O   . TYR B 1 351 ? 25.220  -2.135  91.250  1.00 19.74 ? 350 TYR B O   1 
ATOM   7236  C CB  . TYR B 1 351 ? 25.906  0.883   92.404  1.00 18.79 ? 350 TYR B CB  1 
ATOM   7237  C CG  . TYR B 1 351 ? 26.631  -0.089  93.318  1.00 19.50 ? 350 TYR B CG  1 
ATOM   7238  C CD1 . TYR B 1 351 ? 27.963  -0.442  93.083  1.00 19.07 ? 350 TYR B CD1 1 
ATOM   7239  C CD2 . TYR B 1 351 ? 25.974  -0.679  94.405  1.00 18.70 ? 350 TYR B CD2 1 
ATOM   7240  C CE1 . TYR B 1 351 ? 28.624  -1.360  93.911  1.00 19.13 ? 350 TYR B CE1 1 
ATOM   7241  C CE2 . TYR B 1 351 ? 26.622  -1.599  95.238  1.00 19.03 ? 350 TYR B CE2 1 
ATOM   7242  C CZ  . TYR B 1 351 ? 27.946  -1.935  94.986  1.00 21.00 ? 350 TYR B CZ  1 
ATOM   7243  O OH  . TYR B 1 351 ? 28.586  -2.845  95.803  1.00 21.17 ? 350 TYR B OH  1 
ATOM   7244  N N   . PHE B 1 352 ? 23.447  -0.896  91.836  1.00 20.37 ? 351 PHE B N   1 
ATOM   7245  C CA  . PHE B 1 352 ? 22.680  -2.094  92.151  1.00 21.24 ? 351 PHE B CA  1 
ATOM   7246  C C   . PHE B 1 352 ? 22.147  -2.809  90.937  1.00 21.84 ? 351 PHE B C   1 
ATOM   7247  O O   . PHE B 1 352 ? 21.623  -3.920  91.032  1.00 22.66 ? 351 PHE B O   1 
ATOM   7248  C CB  . PHE B 1 352 ? 21.569  -1.785  93.145  1.00 18.51 ? 351 PHE B CB  1 
ATOM   7249  C CG  . PHE B 1 352 ? 22.057  -1.736  94.555  1.00 20.77 ? 351 PHE B CG  1 
ATOM   7250  C CD1 . PHE B 1 352 ? 22.222  -0.522  95.211  1.00 16.50 ? 351 PHE B CD1 1 
ATOM   7251  C CD2 . PHE B 1 352 ? 22.450  -2.912  95.199  1.00 19.53 ? 351 PHE B CD2 1 
ATOM   7252  C CE1 . PHE B 1 352 ? 22.776  -0.476  96.484  1.00 18.67 ? 351 PHE B CE1 1 
ATOM   7253  C CE2 . PHE B 1 352 ? 23.007  -2.878  96.470  1.00 19.92 ? 351 PHE B CE2 1 
ATOM   7254  C CZ  . PHE B 1 352 ? 23.172  -1.655  97.116  1.00 20.56 ? 351 PHE B CZ  1 
ATOM   7255  N N   . GLN B 1 353 ? 22.299  -2.174  89.785  1.00 22.91 ? 352 GLN B N   1 
ATOM   7256  C CA  . GLN B 1 353 ? 21.875  -2.781  88.547  1.00 22.87 ? 352 GLN B CA  1 
ATOM   7257  C C   . GLN B 1 353 ? 22.786  -4.002  88.398  1.00 23.78 ? 352 GLN B C   1 
ATOM   7258  O O   . GLN B 1 353 ? 22.376  -5.033  87.879  1.00 26.17 ? 352 GLN B O   1 
ATOM   7259  C CB  . GLN B 1 353 ? 22.068  -1.794  87.406  1.00 24.03 ? 352 GLN B CB  1 
ATOM   7260  C CG  . GLN B 1 353 ? 21.167  -2.021  86.234  1.00 22.94 ? 352 GLN B CG  1 
ATOM   7261  C CD  . GLN B 1 353 ? 21.187  -0.857  85.267  1.00 22.26 ? 352 GLN B CD  1 
ATOM   7262  O OE1 . GLN B 1 353 ? 22.256  -0.374  84.878  1.00 18.57 ? 352 GLN B OE1 1 
ATOM   7263  N NE2 . GLN B 1 353 ? 20.000  -0.400  84.865  1.00 20.20 ? 352 GLN B NE2 1 
ATOM   7264  N N   . GLN B 1 354 ? 24.026  -3.885  88.867  1.00 23.97 ? 353 GLN B N   1 
ATOM   7265  C CA  . GLN B 1 354 ? 24.952  -5.013  88.822  1.00 22.67 ? 353 GLN B CA  1 
ATOM   7266  C C   . GLN B 1 354 ? 24.756  -5.855  90.082  1.00 20.80 ? 353 GLN B C   1 
ATOM   7267  O O   . GLN B 1 354 ? 24.573  -7.072  90.016  1.00 19.50 ? 353 GLN B O   1 
ATOM   7268  C CB  . GLN B 1 354 ? 26.417  -4.551  88.775  1.00 23.82 ? 353 GLN B CB  1 
ATOM   7269  C CG  . GLN B 1 354 ? 27.384  -5.718  88.964  1.00 25.69 ? 353 GLN B CG  1 
ATOM   7270  C CD  . GLN B 1 354 ? 28.859  -5.345  88.864  1.00 27.84 ? 353 GLN B CD  1 
ATOM   7271  O OE1 . GLN B 1 354 ? 29.725  -6.220  88.861  1.00 27.65 ? 353 GLN B OE1 1 
ATOM   7272  N NE2 . GLN B 1 354 ? 29.148  -4.053  88.785  1.00 30.33 ? 353 GLN B NE2 1 
ATOM   7273  N N   . GLY B 1 355 ? 24.804  -5.192  91.233  1.00 19.19 ? 354 GLY B N   1 
ATOM   7274  C CA  . GLY B 1 355 ? 24.642  -5.883  92.497  1.00 17.86 ? 354 GLY B CA  1 
ATOM   7275  C C   . GLY B 1 355 ? 23.436  -6.804  92.540  1.00 19.57 ? 354 GLY B C   1 
ATOM   7276  O O   . GLY B 1 355 ? 23.530  -7.958  92.972  1.00 18.68 ? 354 GLY B O   1 
ATOM   7277  N N   . ASP B 1 356 ? 22.297  -6.300  92.084  1.00 18.74 ? 355 ASP B N   1 
ATOM   7278  C CA  . ASP B 1 356 ? 21.074  -7.082  92.086  1.00 19.00 ? 355 ASP B CA  1 
ATOM   7279  C C   . ASP B 1 356 ? 21.016  -8.032  90.884  1.00 20.04 ? 355 ASP B C   1 
ATOM   7280  O O   . ASP B 1 356 ? 20.961  -9.250  91.051  1.00 21.73 ? 355 ASP B O   1 
ATOM   7281  C CB  . ASP B 1 356 ? 19.864  -6.135  92.086  1.00 19.81 ? 355 ASP B CB  1 
ATOM   7282  C CG  . ASP B 1 356 ? 18.546  -6.847  92.365  1.00 23.09 ? 355 ASP B CG  1 
ATOM   7283  O OD1 . ASP B 1 356 ? 18.346  -7.965  91.841  1.00 24.62 ? 355 ASP B OD1 1 
ATOM   7284  O OD2 . ASP B 1 356 ? 17.700  -6.279  93.094  1.00 20.54 ? 355 ASP B OD2 1 
ATOM   7285  N N   . MET B 1 357 ? 21.058  -7.477  89.676  1.00 19.00 ? 356 MET B N   1 
ATOM   7286  C CA  . MET B 1 357 ? 20.955  -8.275  88.455  1.00 16.76 ? 356 MET B CA  1 
ATOM   7287  C C   . MET B 1 357 ? 22.014  -9.345  88.199  1.00 18.56 ? 356 MET B C   1 
ATOM   7288  O O   . MET B 1 357 ? 21.675  -10.443 87.760  1.00 16.69 ? 356 MET B O   1 
ATOM   7289  C CB  . MET B 1 357 ? 20.864  -7.348  87.240  1.00 16.44 ? 356 MET B CB  1 
ATOM   7290  C CG  . MET B 1 357 ? 19.635  -6.445  87.264  1.00 15.56 ? 356 MET B CG  1 
ATOM   7291  S SD  . MET B 1 357 ? 19.667  -5.182  85.985  1.00 16.55 ? 356 MET B SD  1 
ATOM   7292  C CE  . MET B 1 357 ? 19.155  -6.122  84.575  1.00 15.01 ? 356 MET B CE  1 
ATOM   7293  N N   . GLU B 1 358 ? 23.288  -9.042  88.445  1.00 17.51 ? 357 GLU B N   1 
ATOM   7294  C CA  . GLU B 1 358 ? 24.317  -10.043 88.206  1.00 17.66 ? 357 GLU B CA  1 
ATOM   7295  C C   . GLU B 1 358 ? 24.228  -11.127 89.269  1.00 19.30 ? 357 GLU B C   1 
ATOM   7296  O O   . GLU B 1 358 ? 24.666  -12.261 89.052  1.00 17.89 ? 357 GLU B O   1 
ATOM   7297  C CB  . GLU B 1 358 ? 25.714  -9.417  88.203  1.00 19.55 ? 357 GLU B CB  1 
ATOM   7298  C CG  . GLU B 1 358 ? 26.803  -10.427 87.881  1.00 23.02 ? 357 GLU B CG  1 
ATOM   7299  C CD  . GLU B 1 358 ? 28.184  -9.810  87.739  1.00 25.35 ? 357 GLU B CD  1 
ATOM   7300  O OE1 . GLU B 1 358 ? 28.660  -9.669  86.591  1.00 27.20 ? 357 GLU B OE1 1 
ATOM   7301  O OE2 . GLU B 1 358 ? 28.792  -9.467  88.772  1.00 27.57 ? 357 GLU B OE2 1 
ATOM   7302  N N   . SER B 1 359 ? 23.657  -10.773 90.419  1.00 18.13 ? 358 SER B N   1 
ATOM   7303  C CA  . SER B 1 359 ? 23.486  -11.726 91.510  1.00 18.90 ? 358 SER B CA  1 
ATOM   7304  C C   . SER B 1 359 ? 22.322  -12.667 91.254  1.00 19.58 ? 358 SER B C   1 
ATOM   7305  O O   . SER B 1 359 ? 22.486  -13.890 91.249  1.00 19.01 ? 358 SER B O   1 
ATOM   7306  C CB  . SER B 1 359 ? 23.214  -11.010 92.842  1.00 16.08 ? 358 SER B CB  1 
ATOM   7307  O OG  . SER B 1 359 ? 24.388  -10.449 93.391  1.00 15.74 ? 358 SER B OG  1 
ATOM   7308  N N   . ASN B 1 360 ? 21.145  -12.091 91.031  1.00 17.72 ? 359 ASN B N   1 
ATOM   7309  C CA  . ASN B 1 360 ? 19.952  -12.900 90.851  1.00 18.48 ? 359 ASN B CA  1 
ATOM   7310  C C   . ASN B 1 360 ? 19.384  -13.119 89.453  1.00 18.83 ? 359 ASN B C   1 
ATOM   7311  O O   . ASN B 1 360 ? 18.273  -13.631 89.307  1.00 19.06 ? 359 ASN B O   1 
ATOM   7312  C CB  . ASN B 1 360 ? 18.872  -12.393 91.808  1.00 15.31 ? 359 ASN B CB  1 
ATOM   7313  C CG  . ASN B 1 360 ? 19.311  -12.500 93.265  1.00 20.08 ? 359 ASN B CG  1 
ATOM   7314  O OD1 . ASN B 1 360 ? 20.263  -13.223 93.574  1.00 16.74 ? 359 ASN B OD1 1 
ATOM   7315  N ND2 . ASN B 1 360 ? 18.624  -11.793 94.162  1.00 17.65 ? 359 ASN B ND2 1 
ATOM   7316  N N   . GLY B 1 361 ? 20.141  -12.746 88.426  1.00 19.35 ? 360 GLY B N   1 
ATOM   7317  C CA  . GLY B 1 361 ? 19.685  -12.993 87.072  1.00 18.56 ? 360 GLY B CA  1 
ATOM   7318  C C   . GLY B 1 361 ? 20.118  -14.422 86.775  1.00 20.83 ? 360 GLY B C   1 
ATOM   7319  O O   . GLY B 1 361 ? 20.988  -14.662 85.932  1.00 21.78 ? 360 GLY B O   1 
ATOM   7320  N N   . LYS B 1 362 ? 19.516  -15.371 87.491  1.00 20.03 ? 361 LYS B N   1 
ATOM   7321  C CA  . LYS B 1 362 ? 19.840  -16.794 87.361  1.00 20.40 ? 361 LYS B CA  1 
ATOM   7322  C C   . LYS B 1 362 ? 18.595  -17.605 87.003  1.00 20.99 ? 361 LYS B C   1 
ATOM   7323  O O   . LYS B 1 362 ? 17.481  -17.091 87.078  1.00 20.45 ? 361 LYS B O   1 
ATOM   7324  C CB  . LYS B 1 362 ? 20.415  -17.295 88.687  1.00 18.85 ? 361 LYS B CB  1 
ATOM   7325  C CG  . LYS B 1 362 ? 21.587  -16.472 89.199  1.00 18.04 ? 361 LYS B CG  1 
ATOM   7326  C CD  . LYS B 1 362 ? 22.856  -16.726 88.393  1.00 18.68 ? 361 LYS B CD  1 
ATOM   7327  C CE  . LYS B 1 362 ? 23.901  -15.643 88.641  1.00 14.95 ? 361 LYS B CE  1 
ATOM   7328  N NZ  . LYS B 1 362 ? 24.282  -15.531 90.081  1.00 18.20 ? 361 LYS B NZ  1 
ATOM   7329  N N   . TYR B 1 363 ? 18.773  -18.868 86.617  1.00 21.15 ? 362 TYR B N   1 
ATOM   7330  C CA  . TYR B 1 363 ? 17.618  -19.691 86.268  1.00 21.71 ? 362 TYR B CA  1 
ATOM   7331  C C   . TYR B 1 363 ? 17.775  -21.169 86.627  1.00 23.02 ? 362 TYR B C   1 
ATOM   7332  O O   . TYR B 1 363 ? 16.885  -21.977 86.362  1.00 23.09 ? 362 TYR B O   1 
ATOM   7333  C CB  . TYR B 1 363 ? 17.283  -19.535 84.778  1.00 21.50 ? 362 TYR B CB  1 
ATOM   7334  C CG  . TYR B 1 363 ? 18.143  -20.341 83.830  1.00 22.38 ? 362 TYR B CG  1 
ATOM   7335  C CD1 . TYR B 1 363 ? 17.594  -21.396 83.093  1.00 22.40 ? 362 TYR B CD1 1 
ATOM   7336  C CD2 . TYR B 1 363 ? 19.493  -20.041 83.651  1.00 21.57 ? 362 TYR B CD2 1 
ATOM   7337  C CE1 . TYR B 1 363 ? 18.368  -22.132 82.198  1.00 23.07 ? 362 TYR B CE1 1 
ATOM   7338  C CE2 . TYR B 1 363 ? 20.279  -20.769 82.757  1.00 21.70 ? 362 TYR B CE2 1 
ATOM   7339  C CZ  . TYR B 1 363 ? 19.711  -21.812 82.034  1.00 22.86 ? 362 TYR B CZ  1 
ATOM   7340  O OH  . TYR B 1 363 ? 20.478  -22.530 81.145  1.00 22.07 ? 362 TYR B OH  1 
ATOM   7341  N N   . ILE B 1 364 ? 18.906  -21.520 87.229  1.00 23.35 ? 363 ILE B N   1 
ATOM   7342  C CA  . ILE B 1 364 ? 19.145  -22.894 87.648  1.00 24.24 ? 363 ILE B CA  1 
ATOM   7343  C C   . ILE B 1 364 ? 19.178  -22.905 89.175  1.00 24.81 ? 363 ILE B C   1 
ATOM   7344  O O   . ILE B 1 364 ? 19.931  -22.151 89.782  1.00 25.43 ? 363 ILE B O   1 
ATOM   7345  C CB  . ILE B 1 364 ? 20.492  -23.436 87.099  1.00 23.43 ? 363 ILE B CB  1 
ATOM   7346  C CG1 . ILE B 1 364 ? 20.506  -23.367 85.565  1.00 21.98 ? 363 ILE B CG1 1 
ATOM   7347  C CG2 . ILE B 1 364 ? 20.708  -24.876 87.573  1.00 24.13 ? 363 ILE B CG2 1 
ATOM   7348  C CD1 . ILE B 1 364 ? 19.359  -24.106 84.887  1.00 23.47 ? 363 ILE B CD1 1 
ATOM   7349  N N   . THR B 1 365 ? 18.354  -23.748 89.793  1.00 26.63 ? 364 THR B N   1 
ATOM   7350  C CA  . THR B 1 365 ? 18.305  -23.834 91.254  1.00 26.08 ? 364 THR B CA  1 
ATOM   7351  C C   . THR B 1 365 ? 19.456  -24.658 91.822  1.00 27.01 ? 364 THR B C   1 
ATOM   7352  O O   . THR B 1 365 ? 20.249  -25.240 91.078  1.00 25.53 ? 364 THR B O   1 
ATOM   7353  C CB  . THR B 1 365 ? 16.986  -24.461 91.747  1.00 26.53 ? 364 THR B CB  1 
ATOM   7354  O OG1 . THR B 1 365 ? 16.929  -25.837 91.346  1.00 26.42 ? 364 THR B OG1 1 
ATOM   7355  C CG2 . THR B 1 365 ? 15.793  -23.714 91.172  1.00 24.80 ? 364 THR B CG2 1 
ATOM   7356  N N   . LYS B 1 366 ? 19.533  -24.712 93.148  1.00 26.66 ? 365 LYS B N   1 
ATOM   7357  C CA  . LYS B 1 366 ? 20.596  -25.447 93.819  1.00 29.13 ? 365 LYS B CA  1 
ATOM   7358  C C   . LYS B 1 366 ? 20.577  -26.941 93.493  1.00 28.12 ? 365 LYS B C   1 
ATOM   7359  O O   . LYS B 1 366 ? 21.621  -27.582 93.459  1.00 28.67 ? 365 LYS B O   1 
ATOM   7360  C CB  . LYS B 1 366 ? 20.506  -25.248 95.336  1.00 29.66 ? 365 LYS B CB  1 
ATOM   7361  C CG  . LYS B 1 366 ? 21.721  -25.762 96.078  1.00 34.29 ? 365 LYS B CG  1 
ATOM   7362  C CD  . LYS B 1 366 ? 21.512  -25.786 97.585  1.00 38.82 ? 365 LYS B CD  1 
ATOM   7363  C CE  . LYS B 1 366 ? 21.418  -24.395 98.176  1.00 41.38 ? 365 LYS B CE  1 
ATOM   7364  N NZ  . LYS B 1 366 ? 21.355  -24.464 99.669  1.00 45.83 ? 365 LYS B NZ  1 
ATOM   7365  N N   . SER B 1 367 ? 19.397  -27.495 93.251  1.00 28.22 ? 366 SER B N   1 
ATOM   7366  C CA  . SER B 1 367 ? 19.298  -28.912 92.928  1.00 29.60 ? 366 SER B CA  1 
ATOM   7367  C C   . SER B 1 367 ? 19.675  -29.164 91.470  1.00 30.36 ? 366 SER B C   1 
ATOM   7368  O O   . SER B 1 367 ? 19.686  -30.304 91.010  1.00 30.13 ? 366 SER B O   1 
ATOM   7369  C CB  . SER B 1 367 ? 17.878  -29.416 93.184  1.00 30.00 ? 366 SER B CB  1 
ATOM   7370  O OG  . SER B 1 367 ? 16.958  -28.852 92.266  1.00 33.17 ? 366 SER B OG  1 
ATOM   7371  N N   . GLY B 1 368 ? 19.990  -28.095 90.745  1.00 30.17 ? 367 GLY B N   1 
ATOM   7372  C CA  . GLY B 1 368 ? 20.350  -28.241 89.347  1.00 30.09 ? 367 GLY B CA  1 
ATOM   7373  C C   . GLY B 1 368 ? 19.121  -28.189 88.461  1.00 30.66 ? 367 GLY B C   1 
ATOM   7374  O O   . GLY B 1 368 ? 19.216  -28.300 87.241  1.00 30.74 ? 367 GLY B O   1 
ATOM   7375  N N   . THR B 1 369 ? 17.959  -28.018 89.079  1.00 30.88 ? 368 THR B N   1 
ATOM   7376  C CA  . THR B 1 369 ? 16.703  -27.948 88.339  1.00 31.35 ? 368 THR B CA  1 
ATOM   7377  C C   . THR B 1 369 ? 16.458  -26.539 87.806  1.00 30.40 ? 368 THR B C   1 
ATOM   7378  O O   . THR B 1 369 ? 16.863  -25.550 88.419  1.00 29.89 ? 368 THR B O   1 
ATOM   7379  C CB  . THR B 1 369 ? 15.510  -28.359 89.235  1.00 31.97 ? 368 THR B CB  1 
ATOM   7380  O OG1 . THR B 1 369 ? 15.588  -29.762 89.515  1.00 35.15 ? 368 THR B OG1 1 
ATOM   7381  C CG2 . THR B 1 369 ? 14.187  -28.055 88.550  1.00 33.00 ? 368 THR B CG2 1 
ATOM   7382  N N   . ARG B 1 370 ? 15.797  -26.451 86.659  1.00 28.98 ? 369 ARG B N   1 
ATOM   7383  C CA  . ARG B 1 370 ? 15.505  -25.154 86.076  1.00 29.50 ? 369 ARG B CA  1 
ATOM   7384  C C   . ARG B 1 370 ? 14.383  -24.485 86.853  1.00 28.77 ? 369 ARG B C   1 
ATOM   7385  O O   . ARG B 1 370 ? 13.424  -25.136 87.269  1.00 27.93 ? 369 ARG B O   1 
ATOM   7386  C CB  . ARG B 1 370 ? 15.076  -25.288 84.611  1.00 29.38 ? 369 ARG B CB  1 
ATOM   7387  C CG  . ARG B 1 370 ? 14.921  -23.940 83.909  1.00 30.17 ? 369 ARG B CG  1 
ATOM   7388  C CD  . ARG B 1 370 ? 14.161  -24.045 82.591  1.00 30.39 ? 369 ARG B CD  1 
ATOM   7389  N NE  . ARG B 1 370 ? 14.294  -22.833 81.780  1.00 32.74 ? 369 ARG B NE  1 
ATOM   7390  C CZ  . ARG B 1 370 ? 13.968  -21.607 82.187  1.00 34.95 ? 369 ARG B CZ  1 
ATOM   7391  N NH1 . ARG B 1 370 ? 13.479  -21.408 83.406  1.00 36.18 ? 369 ARG B NH1 1 
ATOM   7392  N NH2 . ARG B 1 370 ? 14.135  -20.571 81.374  1.00 33.69 ? 369 ARG B NH2 1 
ATOM   7393  N N   . VAL B 1 371 ? 14.513  -23.182 87.058  1.00 26.90 ? 370 VAL B N   1 
ATOM   7394  C CA  . VAL B 1 371 ? 13.485  -22.425 87.750  1.00 26.00 ? 370 VAL B CA  1 
ATOM   7395  C C   . VAL B 1 371 ? 12.237  -22.454 86.868  1.00 25.00 ? 370 VAL B C   1 
ATOM   7396  O O   . VAL B 1 371 ? 12.344  -22.476 85.643  1.00 24.25 ? 370 VAL B O   1 
ATOM   7397  C CB  . VAL B 1 371 ? 13.940  -20.961 87.958  1.00 26.99 ? 370 VAL B CB  1 
ATOM   7398  C CG1 . VAL B 1 371 ? 12.751  -20.057 88.045  1.00 29.86 ? 370 VAL B CG1 1 
ATOM   7399  C CG2 . VAL B 1 371 ? 14.762  -20.847 89.236  1.00 25.92 ? 370 VAL B CG2 1 
ATOM   7400  N N   . ASP B 1 372 ? 11.058  -22.479 87.480  1.00 25.51 ? 371 ASP B N   1 
ATOM   7401  C CA  . ASP B 1 372 ? 9.819   -22.472 86.708  1.00 26.13 ? 371 ASP B CA  1 
ATOM   7402  C C   . ASP B 1 372 ? 9.000   -21.270 87.161  1.00 25.66 ? 371 ASP B C   1 
ATOM   7403  O O   . ASP B 1 372 ? 7.770   -21.299 87.200  1.00 26.02 ? 371 ASP B O   1 
ATOM   7404  C CB  . ASP B 1 372 ? 9.046   -23.786 86.906  1.00 27.39 ? 371 ASP B CB  1 
ATOM   7405  C CG  . ASP B 1 372 ? 8.495   -23.942 88.309  1.00 30.82 ? 371 ASP B CG  1 
ATOM   7406  O OD1 . ASP B 1 372 ? 9.096   -23.393 89.254  1.00 30.82 ? 371 ASP B OD1 1 
ATOM   7407  O OD2 . ASP B 1 372 ? 7.464   -24.630 88.463  1.00 32.94 ? 371 ASP B OD2 1 
ATOM   7408  N N   . HIS B 1 373 ? 9.720   -20.202 87.489  1.00 25.31 ? 372 HIS B N   1 
ATOM   7409  C CA  . HIS B 1 373 ? 9.133   -18.951 87.957  1.00 25.56 ? 372 HIS B CA  1 
ATOM   7410  C C   . HIS B 1 373 ? 10.125  -17.828 87.647  1.00 24.74 ? 372 HIS B C   1 
ATOM   7411  O O   . HIS B 1 373 ? 11.209  -18.085 87.125  1.00 24.34 ? 372 HIS B O   1 
ATOM   7412  C CB  . HIS B 1 373 ? 8.898   -19.039 89.465  1.00 25.73 ? 372 HIS B CB  1 
ATOM   7413  C CG  . HIS B 1 373 ? 10.120  -19.428 90.236  1.00 26.93 ? 372 HIS B CG  1 
ATOM   7414  N ND1 . HIS B 1 373 ? 11.118  -18.530 90.554  1.00 26.99 ? 372 HIS B ND1 1 
ATOM   7415  C CD2 . HIS B 1 373 ? 10.532  -20.630 90.706  1.00 26.37 ? 372 HIS B CD2 1 
ATOM   7416  C CE1 . HIS B 1 373 ? 12.091  -19.163 91.186  1.00 27.39 ? 372 HIS B CE1 1 
ATOM   7417  N NE2 . HIS B 1 373 ? 11.760  -20.438 91.290  1.00 27.72 ? 372 HIS B NE2 1 
ATOM   7418  N N   . GLN B 1 374 ? 9.759   -16.588 87.959  1.00 22.65 ? 373 GLN B N   1 
ATOM   7419  C CA  . GLN B 1 374 ? 10.657  -15.467 87.712  1.00 22.83 ? 373 GLN B CA  1 
ATOM   7420  C C   . GLN B 1 374 ? 11.662  -15.325 88.844  1.00 20.84 ? 373 GLN B C   1 
ATOM   7421  O O   . GLN B 1 374 ? 11.392  -15.715 89.981  1.00 21.04 ? 373 GLN B O   1 
ATOM   7422  C CB  . GLN B 1 374 ? 9.876   -14.151 87.598  1.00 25.49 ? 373 GLN B CB  1 
ATOM   7423  C CG  . GLN B 1 374 ? 8.963   -14.041 86.386  1.00 29.56 ? 373 GLN B CG  1 
ATOM   7424  C CD  . GLN B 1 374 ? 9.727   -14.072 85.078  1.00 32.26 ? 373 GLN B CD  1 
ATOM   7425  O OE1 . GLN B 1 374 ? 10.605  -13.233 84.833  1.00 31.14 ? 373 GLN B OE1 1 
ATOM   7426  N NE2 . GLN B 1 374 ? 9.398   -15.041 84.226  1.00 32.80 ? 373 GLN B NE2 1 
ATOM   7427  N N   . THR B 1 375 ? 12.825  -14.771 88.528  1.00 18.53 ? 374 THR B N   1 
ATOM   7428  C CA  . THR B 1 375 ? 13.838  -14.522 89.543  1.00 16.69 ? 374 THR B CA  1 
ATOM   7429  C C   . THR B 1 375 ? 14.184  -13.024 89.533  1.00 17.53 ? 374 THR B C   1 
ATOM   7430  O O   . THR B 1 375 ? 13.284  -12.180 89.451  1.00 15.42 ? 374 THR B O   1 
ATOM   7431  C CB  . THR B 1 375 ? 15.110  -15.390 89.327  1.00 15.80 ? 374 THR B CB  1 
ATOM   7432  O OG1 . THR B 1 375 ? 15.582  -15.254 87.982  1.00 14.42 ? 374 THR B OG1 1 
ATOM   7433  C CG2 . THR B 1 375 ? 14.796  -16.857 89.610  1.00 17.67 ? 374 THR B CG2 1 
ATOM   7434  N N   . GLY B 1 376 ? 15.472  -12.698 89.603  1.00 16.88 ? 375 GLY B N   1 
ATOM   7435  C CA  . GLY B 1 376 ? 15.893  -11.306 89.631  1.00 18.04 ? 375 GLY B CA  1 
ATOM   7436  C C   . GLY B 1 376 ? 15.203  -10.360 88.660  1.00 16.91 ? 375 GLY B C   1 
ATOM   7437  O O   . GLY B 1 376 ? 14.997  -10.696 87.495  1.00 15.96 ? 375 GLY B O   1 
ATOM   7438  N N   . PRO B 1 377 ? 14.832  -9.156  89.118  1.00 19.16 ? 376 PRO B N   1 
ATOM   7439  C CA  . PRO B 1 377 ? 14.163  -8.166  88.265  1.00 19.15 ? 376 PRO B CA  1 
ATOM   7440  C C   . PRO B 1 377 ? 15.152  -7.220  87.583  1.00 18.94 ? 376 PRO B C   1 
ATOM   7441  O O   . PRO B 1 377 ? 16.330  -7.167  87.947  1.00 17.62 ? 376 PRO B O   1 
ATOM   7442  C CB  . PRO B 1 377 ? 13.283  -7.421  89.252  1.00 18.92 ? 376 PRO B CB  1 
ATOM   7443  C CG  . PRO B 1 377 ? 14.199  -7.330  90.443  1.00 18.66 ? 376 PRO B CG  1 
ATOM   7444  C CD  . PRO B 1 377 ? 14.773  -8.743  90.535  1.00 17.37 ? 376 PRO B CD  1 
ATOM   7445  N N   . ILE B 1 378 ? 14.667  -6.474  86.596  1.00 17.80 ? 377 ILE B N   1 
ATOM   7446  C CA  . ILE B 1 378 ? 15.505  -5.502  85.912  1.00 16.98 ? 377 ILE B CA  1 
ATOM   7447  C C   . ILE B 1 378 ? 15.502  -4.251  86.788  1.00 17.47 ? 377 ILE B C   1 
ATOM   7448  O O   . ILE B 1 378 ? 14.458  -3.622  86.982  1.00 16.39 ? 377 ILE B O   1 
ATOM   7449  C CB  . ILE B 1 378 ? 14.943  -5.142  84.527  1.00 18.34 ? 377 ILE B CB  1 
ATOM   7450  C CG1 . ILE B 1 378 ? 14.923  -6.388  83.638  1.00 20.38 ? 377 ILE B CG1 1 
ATOM   7451  C CG2 . ILE B 1 378 ? 15.795  -4.040  83.891  1.00 15.86 ? 377 ILE B CG2 1 
ATOM   7452  C CD1 . ILE B 1 378 ? 14.215  -6.197  82.320  1.00 20.18 ? 377 ILE B CD1 1 
ATOM   7453  N N   . VAL B 1 379 ? 16.665  -3.908  87.332  1.00 16.63 ? 378 VAL B N   1 
ATOM   7454  C CA  . VAL B 1 379 ? 16.793  -2.736  88.195  1.00 17.42 ? 378 VAL B CA  1 
ATOM   7455  C C   . VAL B 1 379 ? 17.221  -1.528  87.367  1.00 17.50 ? 378 VAL B C   1 
ATOM   7456  O O   . VAL B 1 379 ? 18.136  -1.621  86.550  1.00 18.89 ? 378 VAL B O   1 
ATOM   7457  C CB  . VAL B 1 379 ? 17.847  -2.970  89.305  1.00 18.47 ? 378 VAL B CB  1 
ATOM   7458  C CG1 . VAL B 1 379 ? 17.974  -1.729  90.183  1.00 18.12 ? 378 VAL B CG1 1 
ATOM   7459  C CG2 . VAL B 1 379 ? 17.464  -4.184  90.142  1.00 16.85 ? 378 VAL B CG2 1 
ATOM   7460  N N   . TRP B 1 380 ? 16.560  -0.397  87.592  1.00 17.53 ? 379 TRP B N   1 
ATOM   7461  C CA  . TRP B 1 380 ? 16.863  0.826   86.861  1.00 17.15 ? 379 TRP B CA  1 
ATOM   7462  C C   . TRP B 1 380 ? 16.452  2.069   87.649  1.00 17.86 ? 379 TRP B C   1 
ATOM   7463  O O   . TRP B 1 380 ? 15.816  1.980   88.698  1.00 17.69 ? 379 TRP B O   1 
ATOM   7464  C CB  . TRP B 1 380 ? 16.127  0.828   85.521  1.00 16.61 ? 379 TRP B CB  1 
ATOM   7465  C CG  . TRP B 1 380 ? 14.628  0.786   85.672  1.00 16.25 ? 379 TRP B CG  1 
ATOM   7466  C CD1 . TRP B 1 380 ? 13.868  -0.275  86.086  1.00 16.94 ? 379 TRP B CD1 1 
ATOM   7467  C CD2 . TRP B 1 380 ? 13.716  1.863   85.437  1.00 15.60 ? 379 TRP B CD2 1 
ATOM   7468  N NE1 . TRP B 1 380 ? 12.537  0.078   86.122  1.00 17.02 ? 379 TRP B NE1 1 
ATOM   7469  C CE2 . TRP B 1 380 ? 12.416  1.385   85.728  1.00 14.95 ? 379 TRP B CE2 1 
ATOM   7470  C CE3 . TRP B 1 380 ? 13.870  3.191   85.011  1.00 15.63 ? 379 TRP B CE3 1 
ATOM   7471  C CZ2 . TRP B 1 380 ? 11.277  2.185   85.603  1.00 14.75 ? 379 TRP B CZ2 1 
ATOM   7472  C CZ3 . TRP B 1 380 ? 12.733  3.994   84.888  1.00 16.17 ? 379 TRP B CZ3 1 
ATOM   7473  C CH2 . TRP B 1 380 ? 11.454  3.486   85.183  1.00 15.59 ? 379 TRP B CH2 1 
ATOM   7474  N N   . GLY B 1 381 ? 16.808  3.235   87.129  1.00 18.75 ? 380 GLY B N   1 
ATOM   7475  C CA  . GLY B 1 381 ? 16.440  4.458   87.807  1.00 17.68 ? 380 GLY B CA  1 
ATOM   7476  C C   . GLY B 1 381 ? 17.374  5.616   87.541  1.00 19.95 ? 380 GLY B C   1 
ATOM   7477  O O   . GLY B 1 381 ? 18.453  5.455   86.966  1.00 18.19 ? 380 GLY B O   1 
ATOM   7478  N N   . GLU B 1 382 ? 16.935  6.792   87.970  1.00 20.06 ? 381 GLU B N   1 
ATOM   7479  C CA  . GLU B 1 382 ? 17.689  8.024   87.830  1.00 22.03 ? 381 GLU B CA  1 
ATOM   7480  C C   . GLU B 1 382 ? 17.364  8.798   89.115  1.00 20.48 ? 381 GLU B C   1 
ATOM   7481  O O   . GLU B 1 382 ? 16.267  8.673   89.659  1.00 20.36 ? 381 GLU B O   1 
ATOM   7482  C CB  . GLU B 1 382 ? 17.207  8.754   86.576  1.00 24.04 ? 381 GLU B CB  1 
ATOM   7483  C CG  . GLU B 1 382 ? 18.225  9.648   85.916  1.00 27.43 ? 381 GLU B CG  1 
ATOM   7484  C CD  . GLU B 1 382 ? 19.492  8.923   85.490  1.00 23.58 ? 381 GLU B CD  1 
ATOM   7485  O OE1 . GLU B 1 382 ? 19.451  8.085   84.563  1.00 24.08 ? 381 GLU B OE1 1 
ATOM   7486  O OE2 . GLU B 1 382 ? 20.540  9.211   86.090  1.00 20.78 ? 381 GLU B OE2 1 
ATOM   7487  N N   . PRO B 1 383 ? 18.315  9.588   89.630  1.00 21.67 ? 382 PRO B N   1 
ATOM   7488  C CA  . PRO B 1 383 ? 18.088  10.355  90.864  1.00 24.42 ? 382 PRO B CA  1 
ATOM   7489  C C   . PRO B 1 383 ? 16.894  11.698  90.471  1.00 26.53 ? 382 PRO B C   1 
ATOM   7490  O O   . PRO B 1 383 ? 16.520  11.811  89.167  1.00 23.77 ? 382 PRO B O   1 
ATOM   7491  C CB  . PRO B 1 383 ? 19.484  10.861  91.209  1.00 24.33 ? 382 PRO B CB  1 
ATOM   7492  C CG  . PRO B 1 383 ? 20.086  11.086  89.844  1.00 23.07 ? 382 PRO B CG  1 
ATOM   7493  C CD  . PRO B 1 383 ? 19.671  9.829   89.103  1.00 20.94 ? 382 PRO B CD  1 
ATOM   7494  N N   . GLY B 1 384 ? 16.372  11.761  91.701  1.00 32.90 ? 383 GLY B N   1 
ATOM   7495  C CA  . GLY B 1 384 ? 15.393  12.640  92.266  1.00 32.68 ? 383 GLY B CA  1 
ATOM   7496  C C   . GLY B 1 384 ? 15.499  13.998  91.703  1.00 31.34 ? 383 GLY B C   1 
ATOM   7497  O O   . GLY B 1 384 ? 16.425  14.733  91.922  1.00 37.02 ? 383 GLY B O   1 
ATOM   7498  N N   . THR B 1 385 ? 14.398  14.198  91.004  1.00 32.18 ? 384 THR B N   1 
ATOM   7499  C CA  . THR B 1 385 ? 13.790  15.172  90.128  1.00 24.91 ? 384 THR B CA  1 
ATOM   7500  C C   . THR B 1 385 ? 14.320  14.964  88.749  1.00 19.54 ? 384 THR B C   1 
ATOM   7501  O O   . THR B 1 385 ? 13.537  15.090  87.849  1.00 20.75 ? 384 THR B O   1 
ATOM   7502  C CB  . THR B 1 385 ? 13.607  16.722  90.578  1.00 23.85 ? 384 THR B CB  1 
ATOM   7503  O OG1 . THR B 1 385 ? 14.768  17.514  90.322  1.00 25.56 ? 384 THR B OG1 1 
ATOM   7504  C CG2 . THR B 1 385 ? 13.105  16.804  92.007  1.00 24.00 ? 384 THR B CG2 1 
ATOM   7505  N N   . ASN B 1 386 ? 15.587  14.584  88.542  1.00 18.14 ? 385 ASN B N   1 
ATOM   7506  C CA  . ASN B 1 386 ? 16.012  14.339  87.138  1.00 16.96 ? 385 ASN B CA  1 
ATOM   7507  C C   . ASN B 1 386 ? 15.100  13.248  86.519  1.00 18.91 ? 385 ASN B C   1 
ATOM   7508  O O   . ASN B 1 386 ? 14.445  13.462  85.484  1.00 20.37 ? 385 ASN B O   1 
ATOM   7509  C CB  . ASN B 1 386 ? 17.468  13.862  87.025  1.00 14.48 ? 385 ASN B CB  1 
ATOM   7510  C CG  . ASN B 1 386 ? 18.469  14.859  87.627  1.00 22.00 ? 385 ASN B CG  1 
ATOM   7511  O OD1 . ASN B 1 386 ? 18.108  15.992  87.967  1.00 20.83 ? 385 ASN B OD1 1 
ATOM   7512  N ND2 . ASN B 1 386 ? 19.732  14.440  87.751  1.00 20.08 ? 385 ASN B ND2 1 
ATOM   7513  N N   . GLY B 1 387 ? 15.055  12.081  87.158  1.00 17.45 ? 386 GLY B N   1 
ATOM   7514  C CA  . GLY B 1 387 ? 14.219  10.986  86.658  1.00 19.92 ? 386 GLY B CA  1 
ATOM   7515  C C   . GLY B 1 387 ? 12.750  11.391  86.603  1.00 20.33 ? 386 GLY B C   1 
ATOM   7516  O O   . GLY B 1 387 ? 12.011  11.043  85.679  1.00 19.30 ? 386 GLY B O   1 
ATOM   7517  N N   . GLN B 1 388 ? 12.330  12.148  87.614  1.00 22.74 ? 387 GLN B N   1 
ATOM   7518  C CA  . GLN B 1 388 ? 10.967  12.644  87.723  1.00 23.99 ? 387 GLN B CA  1 
ATOM   7519  C C   . GLN B 1 388 ? 10.554  13.442  86.477  1.00 25.95 ? 387 GLN B C   1 
ATOM   7520  O O   . GLN B 1 388 ? 9.396   13.391  86.039  1.00 25.01 ? 387 GLN B O   1 
ATOM   7521  C CB  . GLN B 1 388 ? 10.856  13.525  88.979  1.00 23.16 ? 387 GLN B CB  1 
ATOM   7522  C CG  . GLN B 1 388 ? 9.531   14.211  89.134  1.00 19.81 ? 387 GLN B CG  1 
ATOM   7523  C CD  . GLN B 1 388 ? 9.433   15.032  90.415  1.00 21.03 ? 387 GLN B CD  1 
ATOM   7524  O OE1 . GLN B 1 388 ? 8.914   16.179  90.397  1.00 19.73 ? 387 GLN B OE1 1 
ATOM   7525  N NE2 . GLN B 1 388 ? 9.896   14.461  91.532  1.00 11.79 ? 387 GLN B NE2 1 
ATOM   7526  N N   . HIS B 1 389 ? 11.507  14.178  85.905  1.00 23.43 ? 388 HIS B N   1 
ATOM   7527  C CA  . HIS B 1 389 ? 11.214  14.985  84.720  1.00 24.21 ? 388 HIS B CA  1 
ATOM   7528  C C   . HIS B 1 389 ? 11.578  14.265  83.426  1.00 23.54 ? 388 HIS B C   1 
ATOM   7529  O O   . HIS B 1 389 ? 11.566  14.856  82.351  1.00 26.05 ? 388 HIS B O   1 
ATOM   7530  C CB  . HIS B 1 389 ? 11.959  16.327  84.784  1.00 24.29 ? 388 HIS B CB  1 
ATOM   7531  C CG  . HIS B 1 389 ? 11.530  17.201  85.922  1.00 25.38 ? 388 HIS B CG  1 
ATOM   7532  N ND1 . HIS B 1 389 ? 10.220  17.587  86.110  1.00 25.42 ? 388 HIS B ND1 1 
ATOM   7533  C CD2 . HIS B 1 389 ? 12.231  17.741  86.947  1.00 23.37 ? 388 HIS B CD2 1 
ATOM   7534  C CE1 . HIS B 1 389 ? 10.131  18.321  87.204  1.00 23.84 ? 388 HIS B CE1 1 
ATOM   7535  N NE2 . HIS B 1 389 ? 11.338  18.430  87.731  1.00 27.05 ? 388 HIS B NE2 1 
ATOM   7536  N N   . ALA B 1 390 ? 11.894  12.983  83.526  1.00 22.55 ? 389 ALA B N   1 
ATOM   7537  C CA  . ALA B 1 390 ? 12.258  12.227  82.342  1.00 22.38 ? 389 ALA B CA  1 
ATOM   7538  C C   . ALA B 1 390 ? 11.290  11.094  82.005  1.00 21.55 ? 389 ALA B C   1 
ATOM   7539  O O   . ALA B 1 390 ? 10.804  11.013  80.880  1.00 22.75 ? 389 ALA B O   1 
ATOM   7540  C CB  . ALA B 1 390 ? 13.682  11.671  82.495  1.00 21.13 ? 389 ALA B CB  1 
ATOM   7541  N N   . PHE B 1 391 ? 10.994  10.233  82.975  1.00 18.52 ? 390 PHE B N   1 
ATOM   7542  C CA  . PHE B 1 391 ? 10.133  9.091   82.705  1.00 18.65 ? 390 PHE B CA  1 
ATOM   7543  C C   . PHE B 1 391 ? 8.944   8.828   83.630  1.00 18.93 ? 390 PHE B C   1 
ATOM   7544  O O   . PHE B 1 391 ? 8.281   7.806   83.473  1.00 19.39 ? 390 PHE B O   1 
ATOM   7545  C CB  . PHE B 1 391 ? 11.000  7.827   82.657  1.00 16.43 ? 390 PHE B CB  1 
ATOM   7546  C CG  . PHE B 1 391 ? 11.852  7.636   83.884  1.00 16.64 ? 390 PHE B CG  1 
ATOM   7547  C CD1 . PHE B 1 391 ? 11.274  7.279   85.103  1.00 14.34 ? 390 PHE B CD1 1 
ATOM   7548  C CD2 . PHE B 1 391 ? 13.225  7.860   83.832  1.00 14.30 ? 390 PHE B CD2 1 
ATOM   7549  C CE1 . PHE B 1 391 ? 12.046  7.148   86.255  1.00 15.74 ? 390 PHE B CE1 1 
ATOM   7550  C CE2 . PHE B 1 391 ? 14.015  7.735   84.982  1.00 17.34 ? 390 PHE B CE2 1 
ATOM   7551  C CZ  . PHE B 1 391 ? 13.421  7.378   86.198  1.00 16.74 ? 390 PHE B CZ  1 
ATOM   7552  N N   . TYR B 1 392 ? 8.665   9.713   84.584  1.00 17.66 ? 391 TYR B N   1 
ATOM   7553  C CA  . TYR B 1 392 ? 7.545   9.471   85.502  1.00 17.26 ? 391 TYR B CA  1 
ATOM   7554  C C   . TYR B 1 392 ? 6.199   9.452   84.797  1.00 16.89 ? 391 TYR B C   1 
ATOM   7555  O O   . TYR B 1 392 ? 5.231   8.896   85.315  1.00 17.77 ? 391 TYR B O   1 
ATOM   7556  C CB  . TYR B 1 392 ? 7.518   10.505  86.625  1.00 16.03 ? 391 TYR B CB  1 
ATOM   7557  C CG  . TYR B 1 392 ? 8.461   10.220  87.775  1.00 16.46 ? 391 TYR B CG  1 
ATOM   7558  C CD1 . TYR B 1 392 ? 9.718   9.651   87.556  1.00 16.53 ? 391 TYR B CD1 1 
ATOM   7559  C CD2 . TYR B 1 392 ? 8.128   10.597  89.081  1.00 17.35 ? 391 TYR B CD2 1 
ATOM   7560  C CE1 . TYR B 1 392 ? 10.624  9.468   88.605  1.00 15.90 ? 391 TYR B CE1 1 
ATOM   7561  C CE2 . TYR B 1 392 ? 9.031   10.424  90.137  1.00 18.16 ? 391 TYR B CE2 1 
ATOM   7562  C CZ  . TYR B 1 392 ? 10.278  9.860   89.885  1.00 18.42 ? 391 TYR B CZ  1 
ATOM   7563  O OH  . TYR B 1 392 ? 11.185  9.713   90.907  1.00 20.20 ? 391 TYR B OH  1 
ATOM   7564  N N   . GLN B 1 393 ? 6.132   10.068  83.622  1.00 17.35 ? 392 GLN B N   1 
ATOM   7565  C CA  . GLN B 1 393 ? 4.898   10.070  82.847  1.00 17.35 ? 392 GLN B CA  1 
ATOM   7566  C C   . GLN B 1 393 ? 4.421   8.616   82.726  1.00 18.28 ? 392 GLN B C   1 
ATOM   7567  O O   . GLN B 1 393 ? 3.246   8.321   82.947  1.00 19.35 ? 392 GLN B O   1 
ATOM   7568  C CB  . GLN B 1 393 ? 5.155   10.674  81.458  1.00 14.83 ? 392 GLN B CB  1 
ATOM   7569  C CG  . GLN B 1 393 ? 4.086   10.386  80.406  1.00 17.74 ? 392 GLN B CG  1 
ATOM   7570  C CD  . GLN B 1 393 ? 2.720   10.963  80.754  1.00 20.01 ? 392 GLN B CD  1 
ATOM   7571  O OE1 . GLN B 1 393 ? 2.587   12.155  81.048  1.00 21.49 ? 392 GLN B OE1 1 
ATOM   7572  N NE2 . GLN B 1 393 ? 1.694   10.120  80.704  1.00 18.37 ? 392 GLN B NE2 1 
ATOM   7573  N N   . LEU B 1 394 ? 5.345   7.711   82.406  1.00 19.23 ? 393 LEU B N   1 
ATOM   7574  C CA  . LEU B 1 394 ? 5.020   6.290   82.246  1.00 19.83 ? 393 LEU B CA  1 
ATOM   7575  C C   . LEU B 1 394 ? 4.684   5.602   83.562  1.00 19.19 ? 393 LEU B C   1 
ATOM   7576  O O   . LEU B 1 394 ? 3.817   4.736   83.606  1.00 20.53 ? 393 LEU B O   1 
ATOM   7577  C CB  . LEU B 1 394 ? 6.179   5.547   81.559  1.00 20.18 ? 393 LEU B CB  1 
ATOM   7578  C CG  . LEU B 1 394 ? 5.946   4.060   81.238  1.00 20.75 ? 393 LEU B CG  1 
ATOM   7579  C CD1 . LEU B 1 394 ? 6.710   3.670   79.972  1.00 17.85 ? 393 LEU B CD1 1 
ATOM   7580  C CD2 . LEU B 1 394 ? 6.377   3.201   82.411  1.00 20.16 ? 393 LEU B CD2 1 
ATOM   7581  N N   . ILE B 1 395 ? 5.372   5.980   84.633  1.00 17.00 ? 394 ILE B N   1 
ATOM   7582  C CA  . ILE B 1 395 ? 5.112   5.382   85.933  1.00 16.99 ? 394 ILE B CA  1 
ATOM   7583  C C   . ILE B 1 395 ? 3.710   5.743   86.441  1.00 18.52 ? 394 ILE B C   1 
ATOM   7584  O O   . ILE B 1 395 ? 3.053   4.924   87.094  1.00 16.26 ? 394 ILE B O   1 
ATOM   7585  C CB  . ILE B 1 395 ? 6.176   5.818   86.966  1.00 16.86 ? 394 ILE B CB  1 
ATOM   7586  C CG1 . ILE B 1 395 ? 7.562   5.344   86.501  1.00 16.10 ? 394 ILE B CG1 1 
ATOM   7587  C CG2 . ILE B 1 395 ? 5.845   5.245   88.342  1.00 16.67 ? 394 ILE B CG2 1 
ATOM   7588  C CD1 . ILE B 1 395 ? 8.690   5.647   87.468  1.00 12.26 ? 394 ILE B CD1 1 
ATOM   7589  N N   . HIS B 1 396 ? 3.249   6.953   86.117  1.00 17.50 ? 395 HIS B N   1 
ATOM   7590  C CA  . HIS B 1 396 ? 1.930   7.426   86.542  1.00 17.53 ? 395 HIS B CA  1 
ATOM   7591  C C   . HIS B 1 396 ? 0.772   7.014   85.635  1.00 17.79 ? 395 HIS B C   1 
ATOM   7592  O O   . HIS B 1 396 ? -0.286  6.612   86.124  1.00 16.88 ? 395 HIS B O   1 
ATOM   7593  C CB  . HIS B 1 396 ? 1.907   8.956   86.655  1.00 16.94 ? 395 HIS B CB  1 
ATOM   7594  C CG  . HIS B 1 396 ? 2.490   9.484   87.925  1.00 16.75 ? 395 HIS B CG  1 
ATOM   7595  N ND1 . HIS B 1 396 ? 3.793   9.921   88.022  1.00 20.53 ? 395 HIS B ND1 1 
ATOM   7596  C CD2 . HIS B 1 396 ? 1.945   9.654   89.151  1.00 15.88 ? 395 HIS B CD2 1 
ATOM   7597  C CE1 . HIS B 1 396 ? 4.023   10.340  89.252  1.00 18.00 ? 395 HIS B CE1 1 
ATOM   7598  N NE2 . HIS B 1 396 ? 2.917   10.188  89.957  1.00 19.85 ? 395 HIS B NE2 1 
ATOM   7599  N N   . GLN B 1 397 ? 0.966   7.125   84.320  1.00 17.32 ? 396 GLN B N   1 
ATOM   7600  C CA  . GLN B 1 397 ? -0.092  6.803   83.368  1.00 18.76 ? 396 GLN B CA  1 
ATOM   7601  C C   . GLN B 1 397 ? 0.288   5.791   82.291  1.00 20.38 ? 396 GLN B C   1 
ATOM   7602  O O   . GLN B 1 397 ? -0.352  5.741   81.238  1.00 18.96 ? 396 GLN B O   1 
ATOM   7603  C CB  . GLN B 1 397 ? -0.594  8.086   82.689  1.00 18.90 ? 396 GLN B CB  1 
ATOM   7604  C CG  . GLN B 1 397 ? -1.185  9.129   83.634  1.00 20.63 ? 396 GLN B CG  1 
ATOM   7605  C CD  . GLN B 1 397 ? -1.801  10.307  82.889  1.00 22.94 ? 396 GLN B CD  1 
ATOM   7606  O OE1 . GLN B 1 397 ? -1.163  10.903  82.022  1.00 21.92 ? 396 GLN B OE1 1 
ATOM   7607  N NE2 . GLN B 1 397 ? -3.045  10.647  83.227  1.00 19.63 ? 396 GLN B NE2 1 
ATOM   7608  N N   . GLY B 1 398 ? 1.331   5.003   82.544  1.00 21.12 ? 397 GLY B N   1 
ATOM   7609  C CA  . GLY B 1 398 ? 1.749   3.997   81.582  1.00 20.54 ? 397 GLY B CA  1 
ATOM   7610  C C   . GLY B 1 398 ? 0.904   2.747   81.755  1.00 23.26 ? 397 GLY B C   1 
ATOM   7611  O O   . GLY B 1 398 ? -0.163  2.808   82.374  1.00 23.29 ? 397 GLY B O   1 
ATOM   7612  N N   . THR B 1 399 ? 1.370   1.615   81.228  1.00 23.14 ? 398 THR B N   1 
ATOM   7613  C CA  . THR B 1 399 ? 0.617   0.365   81.334  1.00 24.01 ? 398 THR B CA  1 
ATOM   7614  C C   . THR B 1 399 ? 1.251   -0.698  82.220  1.00 24.76 ? 398 THR B C   1 
ATOM   7615  O O   . THR B 1 399 ? 0.582   -1.660  82.595  1.00 26.33 ? 398 THR B O   1 
ATOM   7616  C CB  . THR B 1 399 ? 0.348   -0.271  79.943  1.00 24.01 ? 398 THR B CB  1 
ATOM   7617  O OG1 . THR B 1 399 ? 1.585   -0.456  79.243  1.00 25.18 ? 398 THR B OG1 1 
ATOM   7618  C CG2 . THR B 1 399 ? -0.576  0.617   79.121  1.00 24.03 ? 398 THR B CG2 1 
ATOM   7619  N N   . GLU B 1 400 ? 2.527   -0.544  82.561  1.00 24.04 ? 399 GLU B N   1 
ATOM   7620  C CA  . GLU B 1 400 ? 3.168   -1.534  83.416  1.00 24.84 ? 399 GLU B CA  1 
ATOM   7621  C C   . GLU B 1 400 ? 3.250   -1.134  84.889  1.00 24.94 ? 399 GLU B C   1 
ATOM   7622  O O   . GLU B 1 400 ? 3.348   0.045   85.235  1.00 25.56 ? 399 GLU B O   1 
ATOM   7623  C CB  . GLU B 1 400 ? 4.566   -1.891  82.895  1.00 28.54 ? 399 GLU B CB  1 
ATOM   7624  C CG  . GLU B 1 400 ? 5.418   -0.720  82.464  1.00 31.86 ? 399 GLU B CG  1 
ATOM   7625  C CD  . GLU B 1 400 ? 5.090   -0.232  81.065  1.00 31.79 ? 399 GLU B CD  1 
ATOM   7626  O OE1 . GLU B 1 400 ? 5.316   -0.984  80.093  1.00 33.71 ? 399 GLU B OE1 1 
ATOM   7627  O OE2 . GLU B 1 400 ? 4.607   0.910   80.939  1.00 33.30 ? 399 GLU B OE2 1 
ATOM   7628  N N   . MET B 1 401 ? 3.182   -2.137  85.756  1.00 23.21 ? 400 MET B N   1 
ATOM   7629  C CA  . MET B 1 401 ? 3.261   -1.929  87.192  1.00 22.35 ? 400 MET B CA  1 
ATOM   7630  C C   . MET B 1 401 ? 4.743   -1.937  87.552  1.00 21.06 ? 400 MET B C   1 
ATOM   7631  O O   . MET B 1 401 ? 5.457   -2.889  87.234  1.00 19.98 ? 400 MET B O   1 
ATOM   7632  C CB  . MET B 1 401 ? 2.530   -3.060  87.912  1.00 22.83 ? 400 MET B CB  1 
ATOM   7633  C CG  . MET B 1 401 ? 2.458   -2.906  89.412  1.00 24.76 ? 400 MET B CG  1 
ATOM   7634  S SD  . MET B 1 401 ? 1.661   -4.343  90.138  1.00 23.37 ? 400 MET B SD  1 
ATOM   7635  C CE  . MET B 1 401 ? 1.657   -3.871  91.847  1.00 21.64 ? 400 MET B CE  1 
ATOM   7636  N N   . ILE B 1 402 ? 5.195   -0.879  88.220  1.00 18.86 ? 401 ILE B N   1 
ATOM   7637  C CA  . ILE B 1 402 ? 6.601   -0.733  88.585  1.00 17.42 ? 401 ILE B CA  1 
ATOM   7638  C C   . ILE B 1 402 ? 6.847   -0.424  90.058  1.00 18.15 ? 401 ILE B C   1 
ATOM   7639  O O   . ILE B 1 402 ? 6.625   0.701   90.507  1.00 19.79 ? 401 ILE B O   1 
ATOM   7640  C CB  . ILE B 1 402 ? 7.257   0.406   87.755  1.00 18.69 ? 401 ILE B CB  1 
ATOM   7641  C CG1 . ILE B 1 402 ? 7.067   0.135   86.261  1.00 20.94 ? 401 ILE B CG1 1 
ATOM   7642  C CG2 . ILE B 1 402 ? 8.736   0.529   88.089  1.00 15.18 ? 401 ILE B CG2 1 
ATOM   7643  C CD1 . ILE B 1 402 ? 7.265   1.359   85.386  1.00 21.69 ? 401 ILE B CD1 1 
ATOM   7644  N N   . PRO B 1 403 ? 7.286   -1.421  90.838  1.00 17.22 ? 402 PRO B N   1 
ATOM   7645  C CA  . PRO B 1 403 ? 7.543   -1.129  92.254  1.00 16.79 ? 402 PRO B CA  1 
ATOM   7646  C C   . PRO B 1 403 ? 8.698   -0.119  92.302  1.00 17.53 ? 402 PRO B C   1 
ATOM   7647  O O   . PRO B 1 403 ? 9.699   -0.288  91.601  1.00 16.60 ? 402 PRO B O   1 
ATOM   7648  C CB  . PRO B 1 403 ? 7.955   -2.489  92.820  1.00 16.26 ? 402 PRO B CB  1 
ATOM   7649  C CG  . PRO B 1 403 ? 7.188   -3.464  91.954  1.00 16.81 ? 402 PRO B CG  1 
ATOM   7650  C CD  . PRO B 1 403 ? 7.351   -2.871  90.569  1.00 14.76 ? 402 PRO B CD  1 
ATOM   7651  N N   . CYS B 1 404 ? 8.565   0.927   93.110  1.00 17.12 ? 403 CYS B N   1 
ATOM   7652  C CA  . CYS B 1 404 ? 9.618   1.943   93.212  1.00 16.88 ? 403 CYS B CA  1 
ATOM   7653  C C   . CYS B 1 404 ? 10.117  2.161   94.630  1.00 15.87 ? 403 CYS B C   1 
ATOM   7654  O O   . CYS B 1 404 ? 9.334   2.148   95.570  1.00 17.37 ? 403 CYS B O   1 
ATOM   7655  C CB  . CYS B 1 404 ? 9.120   3.302   92.706  1.00 15.44 ? 403 CYS B CB  1 
ATOM   7656  S SG  . CYS B 1 404 ? 8.660   3.393   90.980  1.00 17.85 ? 403 CYS B SG  1 
ATOM   7657  N N   . ASP B 1 405 ? 11.423  2.370   94.770  1.00 15.95 ? 404 ASP B N   1 
ATOM   7658  C CA  . ASP B 1 405 ? 12.026  2.676   96.064  1.00 16.66 ? 404 ASP B CA  1 
ATOM   7659  C C   . ASP B 1 405 ? 12.452  4.151   95.993  1.00 17.15 ? 404 ASP B C   1 
ATOM   7660  O O   . ASP B 1 405 ? 13.326  4.499   95.204  1.00 16.74 ? 404 ASP B O   1 
ATOM   7661  C CB  . ASP B 1 405 ? 13.286  1.834   96.320  1.00 19.46 ? 404 ASP B CB  1 
ATOM   7662  C CG  . ASP B 1 405 ? 12.980  0.407   96.764  1.00 21.62 ? 404 ASP B CG  1 
ATOM   7663  O OD1 . ASP B 1 405 ? 11.796  0.056   96.970  1.00 18.56 ? 404 ASP B OD1 1 
ATOM   7664  O OD2 . ASP B 1 405 ? 13.950  -0.364  96.911  1.00 20.40 ? 404 ASP B OD2 1 
ATOM   7665  N N   . PHE B 1 406 ? 11.823  5.007   96.796  1.00 17.86 ? 405 PHE B N   1 
ATOM   7666  C CA  . PHE B 1 406 ? 12.162  6.431   96.848  1.00 16.08 ? 405 PHE B CA  1 
ATOM   7667  C C   . PHE B 1 406 ? 13.030  6.625   98.091  1.00 16.29 ? 405 PHE B C   1 
ATOM   7668  O O   . PHE B 1 406 ? 12.614  6.285   99.201  1.00 15.89 ? 405 PHE B O   1 
ATOM   7669  C CB  . PHE B 1 406 ? 10.898  7.302   96.979  1.00 15.24 ? 405 PHE B CB  1 
ATOM   7670  C CG  . PHE B 1 406 ? 10.139  7.497   95.689  1.00 14.02 ? 405 PHE B CG  1 
ATOM   7671  C CD1 . PHE B 1 406 ? 9.529   6.426   95.048  1.00 15.34 ? 405 PHE B CD1 1 
ATOM   7672  C CD2 . PHE B 1 406 ? 10.031  8.762   95.124  1.00 13.50 ? 405 PHE B CD2 1 
ATOM   7673  C CE1 . PHE B 1 406 ? 8.816   6.613   93.850  1.00 16.29 ? 405 PHE B CE1 1 
ATOM   7674  C CE2 . PHE B 1 406 ? 9.326   8.960   93.937  1.00 18.07 ? 405 PHE B CE2 1 
ATOM   7675  C CZ  . PHE B 1 406 ? 8.717   7.882   93.298  1.00 17.55 ? 405 PHE B CZ  1 
ATOM   7676  N N   . LEU B 1 407 ? 14.235  7.156   97.905  1.00 14.48 ? 406 LEU B N   1 
ATOM   7677  C CA  . LEU B 1 407 ? 15.145  7.386   99.020  1.00 14.61 ? 406 LEU B CA  1 
ATOM   7678  C C   . LEU B 1 407 ? 15.565  8.851   99.103  1.00 15.23 ? 406 LEU B C   1 
ATOM   7679  O O   . LEU B 1 407 ? 15.633  9.545   98.088  1.00 13.33 ? 406 LEU B O   1 
ATOM   7680  C CB  . LEU B 1 407 ? 16.398  6.521   98.878  1.00 13.30 ? 406 LEU B CB  1 
ATOM   7681  C CG  . LEU B 1 407 ? 16.200  5.023   98.633  1.00 16.80 ? 406 LEU B CG  1 
ATOM   7682  C CD1 . LEU B 1 407 ? 16.129  4.768   97.121  1.00 16.59 ? 406 LEU B CD1 1 
ATOM   7683  C CD2 . LEU B 1 407 ? 17.359  4.243   99.254  1.00 15.62 ? 406 LEU B CD2 1 
ATOM   7684  N N   . ILE B 1 408 ? 15.849  9.322   100.311 1.00 13.92 ? 407 ILE B N   1 
ATOM   7685  C CA  . ILE B 1 408 ? 16.282  10.704  100.468 1.00 16.16 ? 407 ILE B CA  1 
ATOM   7686  C C   . ILE B 1 408 ? 16.841  10.992  101.851 1.00 14.93 ? 407 ILE B C   1 
ATOM   7687  O O   . ILE B 1 408 ? 16.437  10.375  102.836 1.00 15.93 ? 407 ILE B O   1 
ATOM   7688  C CB  . ILE B 1 408 ? 15.120  11.695  100.218 1.00 15.23 ? 407 ILE B CB  1 
ATOM   7689  C CG1 . ILE B 1 408 ? 15.674  13.115  100.035 1.00 16.45 ? 407 ILE B CG1 1 
ATOM   7690  C CG2 . ILE B 1 408 ? 14.158  11.673  101.399 1.00 18.82 ? 407 ILE B CG2 1 
ATOM   7691  C CD1 . ILE B 1 408 ? 14.611  14.173  99.735  1.00 17.31 ? 407 ILE B CD1 1 
ATOM   7692  N N   . PRO B 1 409 ? 17.819  11.904  101.935 1.00 16.76 ? 408 PRO B N   1 
ATOM   7693  C CA  . PRO B 1 409 ? 18.377  12.230  103.252 1.00 15.88 ? 408 PRO B CA  1 
ATOM   7694  C C   . PRO B 1 409 ? 17.654  13.476  103.788 1.00 17.85 ? 408 PRO B C   1 
ATOM   7695  O O   . PRO B 1 409 ? 17.381  14.418  103.035 1.00 15.65 ? 408 PRO B O   1 
ATOM   7696  C CB  . PRO B 1 409 ? 19.847  12.493  102.947 1.00 15.29 ? 408 PRO B CB  1 
ATOM   7697  C CG  . PRO B 1 409 ? 19.779  13.141  101.601 1.00 15.88 ? 408 PRO B CG  1 
ATOM   7698  C CD  . PRO B 1 409 ? 18.762  12.279  100.861 1.00 15.08 ? 408 PRO B CD  1 
ATOM   7699  N N   . VAL B 1 410 ? 17.341  13.476  105.081 1.00 17.35 ? 409 VAL B N   1 
ATOM   7700  C CA  . VAL B 1 410 ? 16.650  14.609  105.684 1.00 18.26 ? 409 VAL B CA  1 
ATOM   7701  C C   . VAL B 1 410 ? 17.532  15.848  105.649 1.00 17.44 ? 409 VAL B C   1 
ATOM   7702  O O   . VAL B 1 410 ? 17.065  16.942  105.341 1.00 18.36 ? 409 VAL B O   1 
ATOM   7703  C CB  . VAL B 1 410 ? 16.248  14.318  107.154 1.00 16.55 ? 409 VAL B CB  1 
ATOM   7704  C CG1 . VAL B 1 410 ? 15.670  15.576  107.796 1.00 15.70 ? 409 VAL B CG1 1 
ATOM   7705  C CG2 . VAL B 1 410 ? 15.224  13.199  107.196 1.00 15.49 ? 409 VAL B CG2 1 
ATOM   7706  N N   . GLN B 1 411 ? 18.808  15.667  105.967 1.00 18.05 ? 410 GLN B N   1 
ATOM   7707  C CA  . GLN B 1 411 ? 19.758  16.770  105.970 1.00 17.74 ? 410 GLN B CA  1 
ATOM   7708  C C   . GLN B 1 411 ? 20.610  16.734  104.697 1.00 17.74 ? 410 GLN B C   1 
ATOM   7709  O O   . GLN B 1 411 ? 21.165  15.701  104.342 1.00 18.30 ? 410 GLN B O   1 
ATOM   7710  C CB  . GLN B 1 411 ? 20.637  16.682  107.225 1.00 18.70 ? 410 GLN B CB  1 
ATOM   7711  C CG  . GLN B 1 411 ? 19.802  16.578  108.499 1.00 15.12 ? 410 GLN B CG  1 
ATOM   7712  C CD  . GLN B 1 411 ? 20.617  16.481  109.771 1.00 17.36 ? 410 GLN B CD  1 
ATOM   7713  O OE1 . GLN B 1 411 ? 20.061  16.244  110.844 1.00 20.43 ? 410 GLN B OE1 1 
ATOM   7714  N NE2 . GLN B 1 411 ? 21.925  16.668  109.668 1.00 14.88 ? 410 GLN B NE2 1 
ATOM   7715  N N   . THR B 1 412 ? 20.686  17.871  104.011 1.00 17.75 ? 411 THR B N   1 
ATOM   7716  C CA  . THR B 1 412 ? 21.451  17.996  102.775 1.00 17.85 ? 411 THR B CA  1 
ATOM   7717  C C   . THR B 1 412 ? 22.903  18.392  103.044 1.00 18.99 ? 411 THR B C   1 
ATOM   7718  O O   . THR B 1 412 ? 23.209  18.983  104.076 1.00 20.17 ? 411 THR B O   1 
ATOM   7719  C CB  . THR B 1 412 ? 20.819  19.060  101.847 1.00 19.25 ? 411 THR B CB  1 
ATOM   7720  O OG1 . THR B 1 412 ? 21.598  19.181  100.652 1.00 21.04 ? 411 THR B OG1 1 
ATOM   7721  C CG2 . THR B 1 412 ? 20.769  20.421  102.547 1.00 18.98 ? 411 THR B CG2 1 
ATOM   7722  N N   . GLN B 1 413 ? 23.790  18.063  102.112 1.00 18.28 ? 412 GLN B N   1 
ATOM   7723  C CA  . GLN B 1 413 ? 25.204  18.413  102.239 1.00 18.57 ? 412 GLN B CA  1 
ATOM   7724  C C   . GLN B 1 413 ? 25.385  19.883  101.852 1.00 18.44 ? 412 GLN B C   1 
ATOM   7725  O O   . GLN B 1 413 ? 26.411  20.483  102.138 1.00 19.13 ? 412 GLN B O   1 
ATOM   7726  C CB  . GLN B 1 413 ? 26.065  17.542  101.315 1.00 18.66 ? 412 GLN B CB  1 
ATOM   7727  C CG  . GLN B 1 413 ? 26.094  16.051  101.657 1.00 19.76 ? 412 GLN B CG  1 
ATOM   7728  C CD  . GLN B 1 413 ? 26.843  15.768  102.940 1.00 20.38 ? 412 GLN B CD  1 
ATOM   7729  O OE1 . GLN B 1 413 ? 27.746  16.510  103.310 1.00 19.56 ? 412 GLN B OE1 1 
ATOM   7730  N NE2 . GLN B 1 413 ? 26.492  14.677  103.611 1.00 23.22 ? 412 GLN B NE2 1 
ATOM   7731  N N   . HIS B 1 414 ? 24.375  20.460  101.208 1.00 18.25 ? 413 HIS B N   1 
ATOM   7732  C CA  . HIS B 1 414 ? 24.439  21.851  100.776 1.00 18.11 ? 413 HIS B CA  1 
ATOM   7733  C C   . HIS B 1 414 ? 23.151  22.600  101.102 1.00 16.98 ? 413 HIS B C   1 
ATOM   7734  O O   . HIS B 1 414 ? 22.310  22.804  100.231 1.00 19.41 ? 413 HIS B O   1 
ATOM   7735  C CB  . HIS B 1 414 ? 24.693  21.909  99.268  1.00 18.86 ? 413 HIS B CB  1 
ATOM   7736  C CG  . HIS B 1 414 ? 25.956  21.230  98.842  1.00 19.75 ? 413 HIS B CG  1 
ATOM   7737  N ND1 . HIS B 1 414 ? 27.200  21.793  99.021  1.00 20.95 ? 413 HIS B ND1 1 
ATOM   7738  C CD2 . HIS B 1 414 ? 26.167  20.031  98.250  1.00 22.08 ? 413 HIS B CD2 1 
ATOM   7739  C CE1 . HIS B 1 414 ? 28.124  20.971  98.556  1.00 23.69 ? 413 HIS B CE1 1 
ATOM   7740  N NE2 . HIS B 1 414 ? 27.524  19.894  98.083  1.00 24.02 ? 413 HIS B NE2 1 
ATOM   7741  N N   . PRO B 1 415 ? 22.987  23.025  102.361 1.00 17.00 ? 414 PRO B N   1 
ATOM   7742  C CA  . PRO B 1 415 ? 21.793  23.753  102.799 1.00 17.15 ? 414 PRO B CA  1 
ATOM   7743  C C   . PRO B 1 415 ? 21.791  25.209  102.337 1.00 17.35 ? 414 PRO B C   1 
ATOM   7744  O O   . PRO B 1 415 ? 21.637  26.126  103.135 1.00 18.21 ? 414 PRO B O   1 
ATOM   7745  C CB  . PRO B 1 415 ? 21.858  23.621  104.317 1.00 15.64 ? 414 PRO B CB  1 
ATOM   7746  C CG  . PRO B 1 415 ? 23.332  23.688  104.570 1.00 17.29 ? 414 PRO B CG  1 
ATOM   7747  C CD  . PRO B 1 415 ? 23.888  22.766  103.501 1.00 16.65 ? 414 PRO B CD  1 
ATOM   7748  N N   . ILE B 1 416 ? 21.950  25.403  101.035 1.00 19.71 ? 415 ILE B N   1 
ATOM   7749  C CA  . ILE B 1 416 ? 21.976  26.732  100.439 1.00 20.27 ? 415 ILE B CA  1 
ATOM   7750  C C   . ILE B 1 416 ? 20.607  27.405  100.430 1.00 21.85 ? 415 ILE B C   1 
ATOM   7751  O O   . ILE B 1 416 ? 19.562  26.740  100.461 1.00 21.25 ? 415 ILE B O   1 
ATOM   7752  C CB  . ILE B 1 416 ? 22.486  26.669  98.991  1.00 19.39 ? 415 ILE B CB  1 
ATOM   7753  C CG1 . ILE B 1 416 ? 21.563  25.779  98.154  1.00 20.63 ? 415 ILE B CG1 1 
ATOM   7754  C CG2 . ILE B 1 416 ? 23.912  26.130  98.968  1.00 20.58 ? 415 ILE B CG2 1 
ATOM   7755  C CD1 . ILE B 1 416 ? 21.964  25.675  96.680  1.00 19.89 ? 415 ILE B CD1 1 
ATOM   7756  N N   . ARG B 1 417 ? 20.631  28.733  100.384 1.00 21.48 ? 416 ARG B N   1 
ATOM   7757  C CA  . ARG B 1 417 ? 19.417  29.535  100.357 1.00 22.94 ? 416 ARG B CA  1 
ATOM   7758  C C   . ARG B 1 417 ? 18.510  29.219  101.524 1.00 21.91 ? 416 ARG B C   1 
ATOM   7759  O O   . ARG B 1 417 ? 17.292  29.189  101.374 1.00 20.67 ? 416 ARG B O   1 
ATOM   7760  C CB  . ARG B 1 417 ? 18.665  29.306  99.047  1.00 22.64 ? 416 ARG B CB  1 
ATOM   7761  C CG  . ARG B 1 417 ? 19.378  29.886  97.836  1.00 28.32 ? 416 ARG B CG  1 
ATOM   7762  C CD  . ARG B 1 417 ? 18.617  31.080  97.297  1.00 25.63 ? 416 ARG B CD  1 
ATOM   7763  N NE  . ARG B 1 417 ? 18.175  30.802  95.942  1.00 31.96 ? 416 ARG B NE  1 
ATOM   7764  C CZ  . ARG B 1 417 ? 17.049  31.253  95.409  1.00 28.85 ? 416 ARG B CZ  1 
ATOM   7765  N NH1 . ARG B 1 417 ? 16.229  32.020  96.116  1.00 27.58 ? 416 ARG B NH1 1 
ATOM   7766  N NH2 . ARG B 1 417 ? 16.747  30.920  94.167  1.00 30.88 ? 416 ARG B NH2 1 
ATOM   7767  N N   . LYS B 1 418 ? 19.110  28.965  102.680 1.00 23.14 ? 417 LYS B N   1 
ATOM   7768  C CA  . LYS B 1 418 ? 18.343  28.664  103.877 1.00 26.04 ? 417 LYS B CA  1 
ATOM   7769  C C   . LYS B 1 418 ? 17.522  27.379  103.737 1.00 25.55 ? 417 LYS B C   1 
ATOM   7770  O O   . LYS B 1 418 ? 16.438  27.268  104.309 1.00 25.80 ? 417 LYS B O   1 
ATOM   7771  C CB  . LYS B 1 418 ? 17.413  29.841  104.192 1.00 30.14 ? 417 LYS B CB  1 
ATOM   7772  C CG  . LYS B 1 418 ? 18.137  31.160  104.416 1.00 34.20 ? 417 LYS B CG  1 
ATOM   7773  C CD  . LYS B 1 418 ? 18.900  31.145  105.728 1.00 41.36 ? 417 LYS B CD  1 
ATOM   7774  C CE  . LYS B 1 418 ? 19.815  32.356  105.860 1.00 46.24 ? 417 LYS B CE  1 
ATOM   7775  N NZ  . LYS B 1 418 ? 20.933  32.319  104.866 1.00 47.62 ? 417 LYS B NZ  1 
ATOM   7776  N N   . GLY B 1 419 ? 18.035  26.417  102.973 1.00 23.51 ? 418 GLY B N   1 
ATOM   7777  C CA  . GLY B 1 419 ? 17.332  25.157  102.794 1.00 22.17 ? 418 GLY B CA  1 
ATOM   7778  C C   . GLY B 1 419 ? 16.179  25.178  101.807 1.00 20.89 ? 418 GLY B C   1 
ATOM   7779  O O   . GLY B 1 419 ? 15.375  24.240  101.763 1.00 21.08 ? 418 GLY B O   1 
ATOM   7780  N N   . LEU B 1 420 ? 16.087  26.240  101.011 1.00 19.83 ? 419 LEU B N   1 
ATOM   7781  C CA  . LEU B 1 420 ? 15.014  26.361  100.025 1.00 17.70 ? 419 LEU B CA  1 
ATOM   7782  C C   . LEU B 1 420 ? 15.026  25.230  99.003  1.00 16.34 ? 419 LEU B C   1 
ATOM   7783  O O   . LEU B 1 420 ? 13.983  24.689  98.649  1.00 14.98 ? 419 LEU B O   1 
ATOM   7784  C CB  . LEU B 1 420 ? 15.110  27.694  99.280  1.00 18.62 ? 419 LEU B CB  1 
ATOM   7785  C CG  . LEU B 1 420 ? 14.204  27.801  98.043  1.00 19.40 ? 419 LEU B CG  1 
ATOM   7786  C CD1 . LEU B 1 420 ? 12.743  27.663  98.449  1.00 20.22 ? 419 LEU B CD1 1 
ATOM   7787  C CD2 . LEU B 1 420 ? 14.439  29.140  97.351  1.00 20.14 ? 419 LEU B CD2 1 
ATOM   7788  N N   . HIS B 1 421 ? 16.205  24.883  98.513  1.00 14.98 ? 420 HIS B N   1 
ATOM   7789  C CA  . HIS B 1 421 ? 16.300  23.820  97.524  1.00 17.11 ? 420 HIS B CA  1 
ATOM   7790  C C   . HIS B 1 421 ? 15.859  22.493  98.106  1.00 16.69 ? 420 HIS B C   1 
ATOM   7791  O O   . HIS B 1 421 ? 15.074  21.770  97.498  1.00 17.69 ? 420 HIS B O   1 
ATOM   7792  C CB  . HIS B 1 421 ? 17.732  23.669  97.009  1.00 15.93 ? 420 HIS B CB  1 
ATOM   7793  C CG  . HIS B 1 421 ? 18.098  24.648  95.943  1.00 18.89 ? 420 HIS B CG  1 
ATOM   7794  N ND1 . HIS B 1 421 ? 18.332  25.983  96.204  1.00 19.53 ? 420 HIS B ND1 1 
ATOM   7795  C CD2 . HIS B 1 421 ? 18.260  24.490  94.608  1.00 14.83 ? 420 HIS B CD2 1 
ATOM   7796  C CE1 . HIS B 1 421 ? 18.623  26.603  95.075  1.00 15.36 ? 420 HIS B CE1 1 
ATOM   7797  N NE2 . HIS B 1 421 ? 18.586  25.722  94.092  1.00 19.52 ? 420 HIS B NE2 1 
ATOM   7798  N N   . HIS B 1 422 ? 16.362  22.187  99.295  1.00 15.49 ? 421 HIS B N   1 
ATOM   7799  C CA  . HIS B 1 422 ? 16.046  20.925  99.938  1.00 18.62 ? 421 HIS B CA  1 
ATOM   7800  C C   . HIS B 1 422 ? 14.574  20.817  100.302 1.00 19.20 ? 421 HIS B C   1 
ATOM   7801  O O   . HIS B 1 422 ? 14.011  19.719  100.310 1.00 19.42 ? 421 HIS B O   1 
ATOM   7802  C CB  . HIS B 1 422 ? 16.923  20.723  101.174 1.00 16.87 ? 421 HIS B CB  1 
ATOM   7803  C CG  . HIS B 1 422 ? 17.100  19.284  101.539 1.00 19.52 ? 421 HIS B CG  1 
ATOM   7804  N ND1 . HIS B 1 422 ? 17.535  18.340  100.631 1.00 18.67 ? 421 HIS B ND1 1 
ATOM   7805  C CD2 . HIS B 1 422 ? 16.862  18.617  102.693 1.00 18.69 ? 421 HIS B CD2 1 
ATOM   7806  C CE1 . HIS B 1 422 ? 17.553  17.153  101.210 1.00 18.71 ? 421 HIS B CE1 1 
ATOM   7807  N NE2 . HIS B 1 422 ? 17.148  17.292  102.461 1.00 16.75 ? 421 HIS B NE2 1 
ATOM   7808  N N   . LYS B 1 423 ? 13.954  21.958  100.589 1.00 18.68 ? 422 LYS B N   1 
ATOM   7809  C CA  . LYS B 1 423 ? 12.539  21.994  100.933 1.00 18.53 ? 422 LYS B CA  1 
ATOM   7810  C C   . LYS B 1 423 ? 11.723  21.524  99.731  1.00 18.79 ? 422 LYS B C   1 
ATOM   7811  O O   . LYS B 1 423 ? 10.837  20.670  99.856  1.00 17.62 ? 422 LYS B O   1 
ATOM   7812  C CB  . LYS B 1 423 ? 12.123  23.418  101.315 1.00 20.47 ? 422 LYS B CB  1 
ATOM   7813  C CG  . LYS B 1 423 ? 10.622  23.603  101.462 1.00 25.45 ? 422 LYS B CG  1 
ATOM   7814  C CD  . LYS B 1 423 ? 10.286  25.030  101.850 1.00 28.73 ? 422 LYS B CD  1 
ATOM   7815  C CE  . LYS B 1 423 ? 8.787   25.256  101.874 1.00 31.48 ? 422 LYS B CE  1 
ATOM   7816  N NZ  . LYS B 1 423 ? 8.433   26.602  102.415 1.00 34.46 ? 422 LYS B NZ  1 
ATOM   7817  N N   . ILE B 1 424 ? 12.026  22.089  98.567  1.00 17.03 ? 423 ILE B N   1 
ATOM   7818  C CA  . ILE B 1 424 ? 11.328  21.723  97.343  1.00 15.69 ? 423 ILE B CA  1 
ATOM   7819  C C   . ILE B 1 424 ? 11.630  20.262  96.987  1.00 15.74 ? 423 ILE B C   1 
ATOM   7820  O O   . ILE B 1 424 ? 10.743  19.524  96.559  1.00 17.01 ? 423 ILE B O   1 
ATOM   7821  C CB  . ILE B 1 424 ? 11.733  22.652  96.174  1.00 16.01 ? 423 ILE B CB  1 
ATOM   7822  C CG1 . ILE B 1 424 ? 11.395  24.106  96.528  1.00 15.35 ? 423 ILE B CG1 1 
ATOM   7823  C CG2 . ILE B 1 424 ? 10.984  22.258  94.901  1.00 16.26 ? 423 ILE B CG2 1 
ATOM   7824  C CD1 . ILE B 1 424 ? 11.942  25.120  95.543  1.00 17.36 ? 423 ILE B CD1 1 
ATOM   7825  N N   . LEU B 1 425 ? 12.875  19.840  97.182  1.00 15.50 ? 424 LEU B N   1 
ATOM   7826  C CA  . LEU B 1 425 ? 13.254  18.463  96.883  1.00 16.04 ? 424 LEU B CA  1 
ATOM   7827  C C   . LEU B 1 425 ? 12.416  17.498  97.734  1.00 15.62 ? 424 LEU B C   1 
ATOM   7828  O O   . LEU B 1 425 ? 11.834  16.540  97.221  1.00 15.78 ? 424 LEU B O   1 
ATOM   7829  C CB  . LEU B 1 425 ? 14.746  18.255  97.164  1.00 15.92 ? 424 LEU B CB  1 
ATOM   7830  C CG  . LEU B 1 425 ? 15.347  16.909  96.737  1.00 14.20 ? 424 LEU B CG  1 
ATOM   7831  C CD1 . LEU B 1 425 ? 15.286  16.748  95.220  1.00 12.48 ? 424 LEU B CD1 1 
ATOM   7832  C CD2 . LEU B 1 425 ? 16.788  16.843  97.213  1.00 13.63 ? 424 LEU B CD2 1 
ATOM   7833  N N   . LEU B 1 426 ? 12.351  17.772  99.032  1.00 15.31 ? 425 LEU B N   1 
ATOM   7834  C CA  . LEU B 1 426 ? 11.583  16.959  99.971  1.00 16.41 ? 425 LEU B CA  1 
ATOM   7835  C C   . LEU B 1 426 ? 10.087  16.932  99.629  1.00 17.11 ? 425 LEU B C   1 
ATOM   7836  O O   . LEU B 1 426 ? 9.440   15.885  99.716  1.00 15.01 ? 425 LEU B O   1 
ATOM   7837  C CB  . LEU B 1 426 ? 11.772  17.493  101.398 1.00 16.48 ? 425 LEU B CB  1 
ATOM   7838  C CG  . LEU B 1 426 ? 13.101  17.204  102.101 1.00 17.40 ? 425 LEU B CG  1 
ATOM   7839  C CD1 . LEU B 1 426 ? 13.266  18.121  103.309 1.00 16.93 ? 425 LEU B CD1 1 
ATOM   7840  C CD2 . LEU B 1 426 ? 13.140  15.741  102.526 1.00 15.18 ? 425 LEU B CD2 1 
ATOM   7841  N N   . ALA B 1 427 ? 9.538   18.084  99.248  1.00 16.25 ? 426 ALA B N   1 
ATOM   7842  C CA  . ALA B 1 427 ? 8.122   18.163  98.900  1.00 16.78 ? 426 ALA B CA  1 
ATOM   7843  C C   . ALA B 1 427 ? 7.820   17.275  97.699  1.00 16.69 ? 426 ALA B C   1 
ATOM   7844  O O   . ALA B 1 427 ? 6.757   16.662  97.617  1.00 18.53 ? 426 ALA B O   1 
ATOM   7845  C CB  . ALA B 1 427 ? 7.724   19.615  98.605  1.00 17.80 ? 426 ALA B CB  1 
ATOM   7846  N N   . ASN B 1 428 ? 8.753   17.202  96.763  1.00 16.43 ? 427 ASN B N   1 
ATOM   7847  C CA  . ASN B 1 428 ? 8.553   16.363  95.593  1.00 18.59 ? 427 ASN B CA  1 
ATOM   7848  C C   . ASN B 1 428 ? 8.720   14.878  95.934  1.00 17.31 ? 427 ASN B C   1 
ATOM   7849  O O   . ASN B 1 428 ? 7.970   14.043  95.444  1.00 15.87 ? 427 ASN B O   1 
ATOM   7850  C CB  . ASN B 1 428 ? 9.517   16.778  94.485  1.00 18.73 ? 427 ASN B CB  1 
ATOM   7851  C CG  . ASN B 1 428 ? 9.034   18.005  93.736  1.00 22.58 ? 427 ASN B CG  1 
ATOM   7852  O OD1 . ASN B 1 428 ? 8.328   17.896  92.732  1.00 21.80 ? 427 ASN B OD1 1 
ATOM   7853  N ND2 . ASN B 1 428 ? 9.391   19.184  94.236  1.00 20.12 ? 427 ASN B ND2 1 
ATOM   7854  N N   . PHE B 1 429 ? 9.700   14.559  96.775  1.00 17.31 ? 428 PHE B N   1 
ATOM   7855  C CA  . PHE B 1 429 ? 9.940   13.178  97.197  1.00 17.85 ? 428 PHE B CA  1 
ATOM   7856  C C   . PHE B 1 429 ? 8.646   12.634  97.808  1.00 18.70 ? 428 PHE B C   1 
ATOM   7857  O O   . PHE B 1 429 ? 8.204   11.520  97.503  1.00 18.19 ? 428 PHE B O   1 
ATOM   7858  C CB  . PHE B 1 429 ? 11.051  13.152  98.251  1.00 18.34 ? 428 PHE B CB  1 
ATOM   7859  C CG  . PHE B 1 429 ? 11.166  11.843  98.996  1.00 20.23 ? 428 PHE B CG  1 
ATOM   7860  C CD1 . PHE B 1 429 ? 11.928  10.794  98.485  1.00 19.67 ? 428 PHE B CD1 1 
ATOM   7861  C CD2 . PHE B 1 429 ? 10.523  11.668  100.219 1.00 18.89 ? 428 PHE B CD2 1 
ATOM   7862  C CE1 . PHE B 1 429 ? 12.050  9.590   99.186  1.00 17.87 ? 428 PHE B CE1 1 
ATOM   7863  C CE2 . PHE B 1 429 ? 10.637  10.472  100.925 1.00 20.09 ? 428 PHE B CE2 1 
ATOM   7864  C CZ  . PHE B 1 429 ? 11.406  9.428   100.407 1.00 19.57 ? 428 PHE B CZ  1 
ATOM   7865  N N   . LEU B 1 430 ? 8.046   13.445  98.670  1.00 18.03 ? 429 LEU B N   1 
ATOM   7866  C CA  . LEU B 1 430 ? 6.807   13.085  99.358  1.00 19.01 ? 429 LEU B CA  1 
ATOM   7867  C C   . LEU B 1 430 ? 5.584   13.053  98.445  1.00 19.04 ? 429 LEU B C   1 
ATOM   7868  O O   . LEU B 1 430 ? 4.828   12.074  98.437  1.00 18.69 ? 429 LEU B O   1 
ATOM   7869  C CB  . LEU B 1 430 ? 6.549   14.073  100.503 1.00 16.80 ? 429 LEU B CB  1 
ATOM   7870  C CG  . LEU B 1 430 ? 7.567   14.048  101.645 1.00 16.08 ? 429 LEU B CG  1 
ATOM   7871  C CD1 . LEU B 1 430 ? 7.444   15.306  102.488 1.00 13.96 ? 429 LEU B CD1 1 
ATOM   7872  C CD2 . LEU B 1 430 ? 7.337   12.798  102.489 1.00 15.22 ? 429 LEU B CD2 1 
ATOM   7873  N N   . ALA B 1 431 ? 5.401   14.125  97.677  1.00 17.78 ? 430 ALA B N   1 
ATOM   7874  C CA  . ALA B 1 431 ? 4.251   14.268  96.788  1.00 16.68 ? 430 ALA B CA  1 
ATOM   7875  C C   . ALA B 1 431 ? 4.150   13.206  95.708  1.00 17.66 ? 430 ALA B C   1 
ATOM   7876  O O   . ALA B 1 431 ? 3.050   12.815  95.313  1.00 15.81 ? 430 ALA B O   1 
ATOM   7877  C CB  . ALA B 1 431 ? 4.263   15.651  96.141  1.00 14.11 ? 430 ALA B CB  1 
ATOM   7878  N N   . GLN B 1 432 ? 5.293   12.747  95.220  1.00 16.21 ? 431 GLN B N   1 
ATOM   7879  C CA  . GLN B 1 432 ? 5.289   11.748  94.167  1.00 17.32 ? 431 GLN B CA  1 
ATOM   7880  C C   . GLN B 1 432 ? 4.720   10.408  94.614  1.00 16.37 ? 431 GLN B C   1 
ATOM   7881  O O   . GLN B 1 432 ? 3.910   9.811   93.895  1.00 13.99 ? 431 GLN B O   1 
ATOM   7882  C CB  . GLN B 1 432 ? 6.700   11.580  93.596  1.00 17.72 ? 431 GLN B CB  1 
ATOM   7883  C CG  . GLN B 1 432 ? 7.111   12.708  92.631  1.00 17.95 ? 431 GLN B CG  1 
ATOM   7884  C CD  . GLN B 1 432 ? 6.263   12.729  91.361  1.00 16.03 ? 431 GLN B CD  1 
ATOM   7885  O OE1 . GLN B 1 432 ? 5.857   11.683  90.869  1.00 16.11 ? 431 GLN B OE1 1 
ATOM   7886  N NE2 . GLN B 1 432 ? 6.014   13.919  90.820  1.00 12.78 ? 431 GLN B NE2 1 
ATOM   7887  N N   . THR B 1 433 ? 5.120   9.932   95.793  1.00 15.84 ? 432 THR B N   1 
ATOM   7888  C CA  . THR B 1 433 ? 4.592   8.654   96.271  1.00 16.41 ? 432 THR B CA  1 
ATOM   7889  C C   . THR B 1 433 ? 3.121   8.829   96.633  1.00 17.20 ? 432 THR B C   1 
ATOM   7890  O O   . THR B 1 433 ? 2.308   7.922   96.439  1.00 15.92 ? 432 THR B O   1 
ATOM   7891  C CB  . THR B 1 433 ? 5.365   8.121   97.502  1.00 16.13 ? 432 THR B CB  1 
ATOM   7892  O OG1 . THR B 1 433 ? 5.277   9.064   98.578  1.00 16.84 ? 432 THR B OG1 1 
ATOM   7893  C CG2 . THR B 1 433 ? 6.828   7.884   97.146  1.00 16.33 ? 432 THR B CG2 1 
ATOM   7894  N N   . GLU B 1 434 ? 2.783   10.005  97.154  1.00 18.21 ? 433 GLU B N   1 
ATOM   7895  C CA  . GLU B 1 434 ? 1.403   10.311  97.521  1.00 19.82 ? 433 GLU B CA  1 
ATOM   7896  C C   . GLU B 1 434 ? 0.543   10.219  96.260  1.00 19.58 ? 433 GLU B C   1 
ATOM   7897  O O   . GLU B 1 434 ? -0.503  9.570   96.254  1.00 19.90 ? 433 GLU B O   1 
ATOM   7898  C CB  . GLU B 1 434 ? 1.305   11.726  98.114  1.00 16.56 ? 433 GLU B CB  1 
ATOM   7899  C CG  . GLU B 1 434 ? -0.069  12.060  98.688  1.00 18.43 ? 433 GLU B CG  1 
ATOM   7900  C CD  . GLU B 1 434 ? -0.187  13.504  99.186  1.00 19.72 ? 433 GLU B CD  1 
ATOM   7901  O OE1 . GLU B 1 434 ? -1.139  13.791  99.939  1.00 20.54 ? 433 GLU B OE1 1 
ATOM   7902  O OE2 . GLU B 1 434 ? 0.659   14.351  98.821  1.00 19.85 ? 433 GLU B OE2 1 
ATOM   7903  N N   . ALA B 1 435 ? 1.002   10.861  95.187  1.00 18.87 ? 434 ALA B N   1 
ATOM   7904  C CA  . ALA B 1 435 ? 0.274   10.853  93.919  1.00 19.21 ? 434 ALA B CA  1 
ATOM   7905  C C   . ALA B 1 435 ? 0.171   9.445   93.337  1.00 19.20 ? 434 ALA B C   1 
ATOM   7906  O O   . ALA B 1 435 ? -0.892  9.028   92.873  1.00 21.15 ? 434 ALA B O   1 
ATOM   7907  C CB  . ALA B 1 435 ? 0.961   11.783  92.917  1.00 17.95 ? 434 ALA B CB  1 
ATOM   7908  N N   . LEU B 1 436 ? 1.282   8.716   93.355  1.00 19.21 ? 435 LEU B N   1 
ATOM   7909  C CA  . LEU B 1 436 ? 1.310   7.354   92.828  1.00 18.76 ? 435 LEU B CA  1 
ATOM   7910  C C   . LEU B 1 436 ? 0.228   6.507   93.507  1.00 19.57 ? 435 LEU B C   1 
ATOM   7911  O O   . LEU B 1 436 ? -0.460  5.707   92.864  1.00 17.53 ? 435 LEU B O   1 
ATOM   7912  C CB  . LEU B 1 436 ? 2.691   6.737   93.066  1.00 18.11 ? 435 LEU B CB  1 
ATOM   7913  C CG  . LEU B 1 436 ? 3.692   6.524   91.915  1.00 20.90 ? 435 LEU B CG  1 
ATOM   7914  C CD1 . LEU B 1 436 ? 3.106   6.910   90.564  1.00 17.11 ? 435 LEU B CD1 1 
ATOM   7915  C CD2 . LEU B 1 436 ? 4.948   7.306   92.204  1.00 18.64 ? 435 LEU B CD2 1 
ATOM   7916  N N   . MET B 1 437 ? 0.083   6.692   94.815  1.00 20.56 ? 436 MET B N   1 
ATOM   7917  C CA  . MET B 1 437 ? -0.916  5.959   95.585  1.00 22.79 ? 436 MET B CA  1 
ATOM   7918  C C   . MET B 1 437 ? -2.341  6.463   95.379  1.00 21.83 ? 436 MET B C   1 
ATOM   7919  O O   . MET B 1 437 ? -3.237  5.678   95.080  1.00 23.85 ? 436 MET B O   1 
ATOM   7920  C CB  . MET B 1 437 ? -0.596  6.018   97.081  1.00 26.39 ? 436 MET B CB  1 
ATOM   7921  C CG  . MET B 1 437 ? -1.776  5.590   97.955  1.00 30.83 ? 436 MET B CG  1 
ATOM   7922  S SD  . MET B 1 437 ? -1.397  5.608   99.710  1.00 40.36 ? 436 MET B SD  1 
ATOM   7923  C CE  . MET B 1 437 ? -1.601  7.366   100.074 1.00 36.34 ? 436 MET B CE  1 
ATOM   7924  N N   . ARG B 1 438 ? -2.546  7.768   95.542  1.00 22.39 ? 437 ARG B N   1 
ATOM   7925  C CA  . ARG B 1 438 ? -3.875  8.361   95.414  1.00 23.79 ? 437 ARG B CA  1 
ATOM   7926  C C   . ARG B 1 438 ? -4.482  8.467   94.025  1.00 22.86 ? 437 ARG B C   1 
ATOM   7927  O O   . ARG B 1 438 ? -5.652  8.126   93.831  1.00 20.18 ? 437 ARG B O   1 
ATOM   7928  C CB  . ARG B 1 438 ? -3.904  9.751   96.060  1.00 29.46 ? 437 ARG B CB  1 
ATOM   7929  C CG  . ARG B 1 438 ? -4.027  9.715   97.578  1.00 38.67 ? 437 ARG B CG  1 
ATOM   7930  C CD  . ARG B 1 438 ? -4.382  11.079  98.162  1.00 44.42 ? 437 ARG B CD  1 
ATOM   7931  N NE  . ARG B 1 438 ? -5.625  11.624  97.612  1.00 48.26 ? 437 ARG B NE  1 
ATOM   7932  C CZ  . ARG B 1 438 ? -5.694  12.433  96.557  1.00 47.69 ? 437 ARG B CZ  1 
ATOM   7933  N NH1 . ARG B 1 438 ? -4.586  12.801  95.928  1.00 46.68 ? 437 ARG B NH1 1 
ATOM   7934  N NH2 . ARG B 1 438 ? -6.874  12.875  96.132  1.00 47.92 ? 437 ARG B NH2 1 
ATOM   7935  N N   . GLY B 1 439 ? -3.699  8.937   93.060  1.00 21.81 ? 438 GLY B N   1 
ATOM   7936  C CA  . GLY B 1 439 ? -4.227  9.106   91.720  1.00 19.94 ? 438 GLY B CA  1 
ATOM   7937  C C   . GLY B 1 439 ? -5.232  10.249  91.745  1.00 21.20 ? 438 GLY B C   1 
ATOM   7938  O O   . GLY B 1 439 ? -5.300  10.991  92.720  1.00 16.91 ? 438 GLY B O   1 
ATOM   7939  N N   . LYS B 1 440 ? -5.997  10.402  90.668  1.00 21.41 ? 439 LYS B N   1 
ATOM   7940  C CA  . LYS B 1 440 ? -7.011  11.446  90.570  1.00 21.90 ? 439 LYS B CA  1 
ATOM   7941  C C   . LYS B 1 440 ? -8.178  10.853  89.787  1.00 22.75 ? 439 LYS B C   1 
ATOM   7942  O O   . LYS B 1 440 ? -8.030  10.497  88.617  1.00 22.17 ? 439 LYS B O   1 
ATOM   7943  C CB  . LYS B 1 440 ? -6.472  12.679  89.831  1.00 21.78 ? 439 LYS B CB  1 
ATOM   7944  C CG  . LYS B 1 440 ? -7.503  13.819  89.694  1.00 19.32 ? 439 LYS B CG  1 
ATOM   7945  C CD  . LYS B 1 440 ? -7.001  14.944  88.786  1.00 18.74 ? 439 LYS B CD  1 
ATOM   7946  C CE  . LYS B 1 440 ? -5.778  15.638  89.378  1.00 19.81 ? 439 LYS B CE  1 
ATOM   7947  N NZ  . LYS B 1 440 ? -5.263  16.735  88.503  1.00 16.45 ? 439 LYS B NZ  1 
ATOM   7948  N N   . SER B 1 441 ? -9.333  10.754  90.438  1.00 22.95 ? 440 SER B N   1 
ATOM   7949  C CA  . SER B 1 441 ? -10.528 10.177  89.820  1.00 24.26 ? 440 SER B CA  1 
ATOM   7950  C C   . SER B 1 441 ? -11.142 11.031  88.716  1.00 23.20 ? 440 SER B C   1 
ATOM   7951  O O   . SER B 1 441 ? -10.860 12.225  88.594  1.00 22.80 ? 440 SER B O   1 
ATOM   7952  C CB  . SER B 1 441 ? -11.597 9.939   90.884  1.00 24.97 ? 440 SER B CB  1 
ATOM   7953  O OG  . SER B 1 441 ? -12.115 11.178  91.334  1.00 24.79 ? 440 SER B OG  1 
ATOM   7954  N N   . THR B 1 442 ? -12.000 10.404  87.923  1.00 22.12 ? 441 THR B N   1 
ATOM   7955  C CA  . THR B 1 442 ? -12.684 11.101  86.847  1.00 23.13 ? 441 THR B CA  1 
ATOM   7956  C C   . THR B 1 442 ? -13.492 12.251  87.441  1.00 22.65 ? 441 THR B C   1 
ATOM   7957  O O   . THR B 1 442 ? -13.460 13.371  86.932  1.00 22.93 ? 441 THR B O   1 
ATOM   7958  C CB  . THR B 1 442 ? -13.653 10.168  86.111  1.00 24.75 ? 441 THR B CB  1 
ATOM   7959  O OG1 . THR B 1 442 ? -12.945 9.017   85.638  1.00 25.42 ? 441 THR B OG1 1 
ATOM   7960  C CG2 . THR B 1 442 ? -14.281 10.887  84.936  1.00 23.49 ? 441 THR B CG2 1 
ATOM   7961  N N   . GLU B 1 443 ? -14.211 11.971  88.524  1.00 22.58 ? 442 GLU B N   1 
ATOM   7962  C CA  . GLU B 1 443 ? -15.029 12.997  89.163  1.00 23.74 ? 442 GLU B CA  1 
ATOM   7963  C C   . GLU B 1 443 ? -14.190 14.188  89.613  1.00 24.02 ? 442 GLU B C   1 
ATOM   7964  O O   . GLU B 1 443 ? -14.580 15.336  89.407  1.00 23.66 ? 442 GLU B O   1 
ATOM   7965  C CB  . GLU B 1 443 ? -15.796 12.426  90.367  1.00 23.78 ? 442 GLU B CB  1 
ATOM   7966  C CG  . GLU B 1 443 ? -16.567 13.505  91.132  1.00 26.96 ? 442 GLU B CG  1 
ATOM   7967  C CD  . GLU B 1 443 ? -17.435 12.970  92.269  1.00 31.42 ? 442 GLU B CD  1 
ATOM   7968  O OE1 . GLU B 1 443 ? -18.092 13.805  92.933  1.00 29.86 ? 442 GLU B OE1 1 
ATOM   7969  O OE2 . GLU B 1 443 ? -17.466 11.736  92.497  1.00 30.96 ? 442 GLU B OE2 1 
ATOM   7970  N N   . GLU B 1 444 ? -13.043 13.914  90.234  1.00 23.56 ? 443 GLU B N   1 
ATOM   7971  C CA  . GLU B 1 444 ? -12.168 14.984  90.703  1.00 24.50 ? 443 GLU B CA  1 
ATOM   7972  C C   . GLU B 1 444 ? -11.633 15.764  89.509  1.00 22.79 ? 443 GLU B C   1 
ATOM   7973  O O   . GLU B 1 444 ? -11.607 16.993  89.518  1.00 23.70 ? 443 GLU B O   1 
ATOM   7974  C CB  . GLU B 1 444 ? -10.995 14.415  91.517  1.00 24.64 ? 443 GLU B CB  1 
ATOM   7975  C CG  . GLU B 1 444 ? -11.406 13.632  92.748  1.00 27.36 ? 443 GLU B CG  1 
ATOM   7976  C CD  . GLU B 1 444 ? -10.232 12.968  93.452  1.00 30.34 ? 443 GLU B CD  1 
ATOM   7977  O OE1 . GLU B 1 444 ? -9.421  12.302  92.774  1.00 32.04 ? 443 GLU B OE1 1 
ATOM   7978  O OE2 . GLU B 1 444 ? -10.128 13.101  94.689  1.00 31.69 ? 443 GLU B OE2 1 
ATOM   7979  N N   . ALA B 1 445 ? -11.216 15.042  88.475  1.00 21.60 ? 444 ALA B N   1 
ATOM   7980  C CA  . ALA B 1 445 ? -10.676 15.676  87.281  1.00 21.12 ? 444 ALA B CA  1 
ATOM   7981  C C   . ALA B 1 445 ? -11.716 16.536  86.569  1.00 20.92 ? 444 ALA B C   1 
ATOM   7982  O O   . ALA B 1 445 ? -11.394 17.610  86.062  1.00 21.31 ? 444 ALA B O   1 
ATOM   7983  C CB  . ALA B 1 445 ? -10.123 14.616  86.328  1.00 21.23 ? 444 ALA B CB  1 
ATOM   7984  N N   . ARG B 1 446 ? -12.961 16.072  86.531  1.00 21.96 ? 445 ARG B N   1 
ATOM   7985  C CA  . ARG B 1 446 ? -14.019 16.829  85.869  1.00 22.33 ? 445 ARG B CA  1 
ATOM   7986  C C   . ARG B 1 446 ? -14.240 18.174  86.572  1.00 21.61 ? 445 ARG B C   1 
ATOM   7987  O O   . ARG B 1 446 ? -14.417 19.203  85.922  1.00 21.11 ? 445 ARG B O   1 
ATOM   7988  C CB  . ARG B 1 446 ? -15.331 16.030  85.852  1.00 22.53 ? 445 ARG B CB  1 
ATOM   7989  C CG  . ARG B 1 446 ? -16.448 16.726  85.071  1.00 24.47 ? 445 ARG B CG  1 
ATOM   7990  C CD  . ARG B 1 446 ? -17.801 16.013  85.163  1.00 26.40 ? 445 ARG B CD  1 
ATOM   7991  N NE  . ARG B 1 446 ? -17.853 14.748  84.433  1.00 27.23 ? 445 ARG B NE  1 
ATOM   7992  C CZ  . ARG B 1 446 ? -17.669 13.554  84.989  1.00 30.95 ? 445 ARG B CZ  1 
ATOM   7993  N NH1 . ARG B 1 446 ? -17.418 13.451  86.292  1.00 31.02 ? 445 ARG B NH1 1 
ATOM   7994  N NH2 . ARG B 1 446 ? -17.744 12.459  84.243  1.00 32.23 ? 445 ARG B NH2 1 
ATOM   7995  N N   . LYS B 1 447 ? -14.232 18.157  87.899  1.00 23.19 ? 446 LYS B N   1 
ATOM   7996  C CA  . LYS B 1 447 ? -14.434 19.375  88.665  1.00 26.36 ? 446 LYS B CA  1 
ATOM   7997  C C   . LYS B 1 447 ? -13.333 20.394  88.378  1.00 28.72 ? 446 LYS B C   1 
ATOM   7998  O O   . LYS B 1 447 ? -13.606 21.589  88.225  1.00 29.55 ? 446 LYS B O   1 
ATOM   7999  C CB  . LYS B 1 447 ? -14.490 19.054  90.159  1.00 27.79 ? 446 LYS B CB  1 
ATOM   8000  C CG  . LYS B 1 447 ? -15.624 18.103  90.550  1.00 32.54 ? 446 LYS B CG  1 
ATOM   8001  C CD  . LYS B 1 447 ? -15.706 17.943  92.062  1.00 36.76 ? 446 LYS B CD  1 
ATOM   8002  C CE  . LYS B 1 447 ? -16.442 16.667  92.486  1.00 39.74 ? 446 LYS B CE  1 
ATOM   8003  N NZ  . LYS B 1 447 ? -17.857 16.607  92.036  1.00 40.48 ? 446 LYS B NZ  1 
ATOM   8004  N N   . GLU B 1 448 ? -12.087 19.930  88.302  1.00 29.57 ? 447 GLU B N   1 
ATOM   8005  C CA  . GLU B 1 448 ? -10.972 20.832  88.013  1.00 29.26 ? 447 GLU B CA  1 
ATOM   8006  C C   . GLU B 1 448 ? -11.189 21.510  86.662  1.00 29.52 ? 447 GLU B C   1 
ATOM   8007  O O   . GLU B 1 448 ? -11.069 22.730  86.541  1.00 29.16 ? 447 GLU B O   1 
ATOM   8008  C CB  . GLU B 1 448 ? -9.645  20.066  87.992  1.00 28.64 ? 447 GLU B CB  1 
ATOM   8009  C CG  . GLU B 1 448 ? -9.143  19.634  89.361  1.00 27.66 ? 447 GLU B CG  1 
ATOM   8010  C CD  . GLU B 1 448 ? -7.850  18.835  89.279  1.00 28.85 ? 447 GLU B CD  1 
ATOM   8011  O OE1 . GLU B 1 448 ? -7.296  18.485  90.342  1.00 30.07 ? 447 GLU B OE1 1 
ATOM   8012  O OE2 . GLU B 1 448 ? -7.391  18.552  88.150  1.00 28.82 ? 447 GLU B OE2 1 
ATOM   8013  N N   . LEU B 1 449 ? -11.514 20.708  85.651  1.00 29.11 ? 448 LEU B N   1 
ATOM   8014  C CA  . LEU B 1 449 ? -11.748 21.221  84.306  1.00 30.66 ? 448 LEU B CA  1 
ATOM   8015  C C   . LEU B 1 449 ? -12.895 22.233  84.265  1.00 31.35 ? 448 LEU B C   1 
ATOM   8016  O O   . LEU B 1 449 ? -12.850 23.203  83.507  1.00 31.81 ? 448 LEU B O   1 
ATOM   8017  C CB  . LEU B 1 449 ? -12.030 20.058  83.345  1.00 30.78 ? 448 LEU B CB  1 
ATOM   8018  C CG  . LEU B 1 449 ? -10.841 19.123  83.078  1.00 29.99 ? 448 LEU B CG  1 
ATOM   8019  C CD1 . LEU B 1 449 ? -11.312 17.837  82.415  1.00 29.95 ? 448 LEU B CD1 1 
ATOM   8020  C CD2 . LEU B 1 449 ? -9.821  19.838  82.208  1.00 28.39 ? 448 LEU B CD2 1 
ATOM   8021  N N   . GLN B 1 450 ? -13.920 22.010  85.079  1.00 31.88 ? 449 GLN B N   1 
ATOM   8022  C CA  . GLN B 1 450 ? -15.052 22.926  85.118  1.00 33.95 ? 449 GLN B CA  1 
ATOM   8023  C C   . GLN B 1 450 ? -14.633 24.209  85.832  1.00 34.97 ? 449 GLN B C   1 
ATOM   8024  O O   . GLN B 1 450 ? -14.941 25.313  85.381  1.00 34.05 ? 449 GLN B O   1 
ATOM   8025  C CB  . GLN B 1 450 ? -16.241 22.271  85.834  1.00 34.86 ? 449 GLN B CB  1 
ATOM   8026  C CG  . GLN B 1 450 ? -16.756 21.022  85.118  1.00 36.68 ? 449 GLN B CG  1 
ATOM   8027  C CD  . GLN B 1 450 ? -17.758 20.222  85.937  1.00 37.42 ? 449 GLN B CD  1 
ATOM   8028  O OE1 . GLN B 1 450 ? -17.531 19.935  87.111  1.00 36.18 ? 449 GLN B OE1 1 
ATOM   8029  N NE2 . GLN B 1 450 ? -18.866 19.841  85.309  1.00 35.62 ? 449 GLN B NE2 1 
ATOM   8030  N N   . ALA B 1 451 ? -13.914 24.057  86.940  1.00 35.59 ? 450 ALA B N   1 
ATOM   8031  C CA  . ALA B 1 451 ? -13.450 25.208  87.701  1.00 36.94 ? 450 ALA B CA  1 
ATOM   8032  C C   . ALA B 1 451 ? -12.521 26.047  86.831  1.00 37.93 ? 450 ALA B C   1 
ATOM   8033  O O   . ALA B 1 451 ? -12.458 27.268  86.967  1.00 38.71 ? 450 ALA B O   1 
ATOM   8034  C CB  . ALA B 1 451 ? -12.727 24.750  88.963  1.00 36.58 ? 450 ALA B CB  1 
ATOM   8035  N N   . ALA B 1 452 ? -11.797 25.389  85.934  1.00 38.77 ? 451 ALA B N   1 
ATOM   8036  C CA  . ALA B 1 452 ? -10.889 26.093  85.039  1.00 39.86 ? 451 ALA B CA  1 
ATOM   8037  C C   . ALA B 1 452 ? -11.717 26.718  83.926  1.00 40.71 ? 451 ALA B C   1 
ATOM   8038  O O   . ALA B 1 452 ? -11.180 27.301  82.984  1.00 40.59 ? 451 ALA B O   1 
ATOM   8039  C CB  . ALA B 1 452 ? -9.869  25.129  84.457  1.00 40.76 ? 451 ALA B CB  1 
ATOM   8040  N N   . GLY B 1 453 ? -13.033 26.573  84.043  1.00 41.26 ? 452 GLY B N   1 
ATOM   8041  C CA  . GLY B 1 453 ? -13.942 27.134  83.062  1.00 40.97 ? 452 GLY B CA  1 
ATOM   8042  C C   . GLY B 1 453 ? -13.876 26.484  81.700  1.00 41.16 ? 452 GLY B C   1 
ATOM   8043  O O   . GLY B 1 453 ? -14.310 27.074  80.711  1.00 41.11 ? 452 GLY B O   1 
ATOM   8044  N N   . LYS B 1 454 ? -13.338 25.271  81.634  1.00 40.82 ? 453 LYS B N   1 
ATOM   8045  C CA  . LYS B 1 454 ? -13.244 24.575  80.356  1.00 40.86 ? 453 LYS B CA  1 
ATOM   8046  C C   . LYS B 1 454 ? -14.609 24.424  79.700  1.00 41.80 ? 453 LYS B C   1 
ATOM   8047  O O   . LYS B 1 454 ? -15.634 24.321  80.377  1.00 40.88 ? 453 LYS B O   1 
ATOM   8048  C CB  . LYS B 1 454 ? -12.612 23.192  80.536  1.00 39.77 ? 453 LYS B CB  1 
ATOM   8049  C CG  . LYS B 1 454 ? -11.094 23.201  80.573  1.00 39.87 ? 453 LYS B CG  1 
ATOM   8050  C CD  . LYS B 1 454 ? -10.513 23.540  79.203  1.00 39.68 ? 453 LYS B CD  1 
ATOM   8051  C CE  . LYS B 1 454 ? -8.990  23.460  79.207  1.00 40.10 ? 453 LYS B CE  1 
ATOM   8052  N NZ  . LYS B 1 454 ? -8.407  23.629  77.843  1.00 39.62 ? 453 LYS B NZ  1 
ATOM   8053  N N   . SER B 1 455 ? -14.606 24.423  78.372  1.00 42.43 ? 454 SER B N   1 
ATOM   8054  C CA  . SER B 1 455 ? -15.821 24.271  77.589  1.00 43.54 ? 454 SER B CA  1 
ATOM   8055  C C   . SER B 1 455 ? -16.340 22.848  77.743  1.00 44.48 ? 454 SER B C   1 
ATOM   8056  O O   . SER B 1 455 ? -15.588 21.944  78.102  1.00 44.57 ? 454 SER B O   1 
ATOM   8057  C CB  . SER B 1 455 ? -15.518 24.552  76.116  1.00 42.93 ? 454 SER B CB  1 
ATOM   8058  O OG  . SER B 1 455 ? -16.505 23.987  75.276  1.00 44.86 ? 454 SER B OG  1 
ATOM   8059  N N   . PRO B 1 456 ? -17.641 22.635  77.495  1.00 45.62 ? 455 PRO B N   1 
ATOM   8060  C CA  . PRO B 1 456 ? -18.213 21.291  77.614  1.00 46.76 ? 455 PRO B CA  1 
ATOM   8061  C C   . PRO B 1 456 ? -17.574 20.373  76.574  1.00 47.87 ? 455 PRO B C   1 
ATOM   8062  O O   . PRO B 1 456 ? -17.327 19.190  76.825  1.00 47.66 ? 455 PRO B O   1 
ATOM   8063  C CB  . PRO B 1 456 ? -19.695 21.525  77.347  1.00 47.23 ? 455 PRO B CB  1 
ATOM   8064  C CG  . PRO B 1 456 ? -19.910 22.911  77.881  1.00 47.71 ? 455 PRO B CG  1 
ATOM   8065  C CD  . PRO B 1 456 ? -18.704 23.642  77.339  1.00 46.88 ? 455 PRO B CD  1 
ATOM   8066  N N   . GLU B 1 457 ? -17.304 20.943  75.404  1.00 47.99 ? 456 GLU B N   1 
ATOM   8067  C CA  . GLU B 1 457 ? -16.688 20.208  74.313  1.00 48.69 ? 456 GLU B CA  1 
ATOM   8068  C C   . GLU B 1 457 ? -15.247 19.871  74.687  1.00 47.12 ? 456 GLU B C   1 
ATOM   8069  O O   . GLU B 1 457 ? -14.815 18.726  74.558  1.00 47.13 ? 456 GLU B O   1 
ATOM   8070  C CB  . GLU B 1 457 ? -16.699 21.054  73.040  1.00 52.03 ? 456 GLU B CB  1 
ATOM   8071  C CG  . GLU B 1 457 ? -16.618 20.249  71.758  1.00 56.09 ? 456 GLU B CG  1 
ATOM   8072  C CD  . GLU B 1 457 ? -17.936 19.578  71.414  1.00 58.56 ? 456 GLU B CD  1 
ATOM   8073  O OE1 . GLU B 1 457 ? -18.460 18.823  72.263  1.00 60.65 ? 456 GLU B OE1 1 
ATOM   8074  O OE2 . GLU B 1 457 ? -18.448 19.807  70.296  1.00 59.17 ? 456 GLU B OE2 1 
ATOM   8075  N N   . ASP B 1 458 ? -14.510 20.877  75.152  1.00 44.97 ? 457 ASP B N   1 
ATOM   8076  C CA  . ASP B 1 458 ? -13.118 20.690  75.548  1.00 43.52 ? 457 ASP B CA  1 
ATOM   8077  C C   . ASP B 1 458 ? -12.993 19.777  76.766  1.00 41.07 ? 457 ASP B C   1 
ATOM   8078  O O   . ASP B 1 458 ? -12.058 18.977  76.865  1.00 40.37 ? 457 ASP B O   1 
ATOM   8079  C CB  . ASP B 1 458 ? -12.457 22.036  75.876  1.00 45.62 ? 457 ASP B CB  1 
ATOM   8080  C CG  . ASP B 1 458 ? -12.398 22.971  74.683  1.00 49.22 ? 457 ASP B CG  1 
ATOM   8081  O OD1 . ASP B 1 458 ? -12.059 22.506  73.572  1.00 50.26 ? 457 ASP B OD1 1 
ATOM   8082  O OD2 . ASP B 1 458 ? -12.676 24.178  74.862  1.00 50.19 ? 457 ASP B OD2 1 
ATOM   8083  N N   . LEU B 1 459 ? -13.932 19.905  77.696  1.00 37.53 ? 458 LEU B N   1 
ATOM   8084  C CA  . LEU B 1 459 ? -13.904 19.100  78.906  1.00 36.63 ? 458 LEU B CA  1 
ATOM   8085  C C   . LEU B 1 459 ? -13.989 17.602  78.614  1.00 36.86 ? 458 LEU B C   1 
ATOM   8086  O O   . LEU B 1 459 ? -13.143 16.831  79.067  1.00 34.29 ? 458 LEU B O   1 
ATOM   8087  C CB  . LEU B 1 459 ? -15.037 19.529  79.849  1.00 34.73 ? 458 LEU B CB  1 
ATOM   8088  C CG  . LEU B 1 459 ? -15.149 18.808  81.196  1.00 33.45 ? 458 LEU B CG  1 
ATOM   8089  C CD1 . LEU B 1 459 ? -15.761 19.735  82.225  1.00 32.65 ? 458 LEU B CD1 1 
ATOM   8090  C CD2 . LEU B 1 459 ? -15.975 17.539  81.039  1.00 32.64 ? 458 LEU B CD2 1 
ATOM   8091  N N   . GLU B 1 460 ? -14.999 17.190  77.853  1.00 37.92 ? 459 GLU B N   1 
ATOM   8092  C CA  . GLU B 1 460 ? -15.171 15.776  77.531  1.00 39.78 ? 459 GLU B CA  1 
ATOM   8093  C C   . GLU B 1 460 ? -13.986 15.200  76.759  1.00 39.64 ? 459 GLU B C   1 
ATOM   8094  O O   . GLU B 1 460 ? -13.647 14.028  76.916  1.00 38.41 ? 459 GLU B O   1 
ATOM   8095  C CB  . GLU B 1 460 ? -16.455 15.562  76.723  1.00 41.86 ? 459 GLU B CB  1 
ATOM   8096  C CG  . GLU B 1 460 ? -17.749 15.800  77.501  1.00 45.93 ? 459 GLU B CG  1 
ATOM   8097  C CD  . GLU B 1 460 ? -18.041 14.725  78.547  1.00 48.13 ? 459 GLU B CD  1 
ATOM   8098  O OE1 . GLU B 1 460 ? -19.124 14.788  79.169  1.00 49.88 ? 459 GLU B OE1 1 
ATOM   8099  O OE2 . GLU B 1 460 ? -17.202 13.821  78.753  1.00 48.02 ? 459 GLU B OE2 1 
ATOM   8100  N N   . ARG B 1 461 ? -13.358 16.024  75.929  1.00 39.69 ? 460 ARG B N   1 
ATOM   8101  C CA  . ARG B 1 461 ? -12.223 15.575  75.130  1.00 39.88 ? 460 ARG B CA  1 
ATOM   8102  C C   . ARG B 1 461 ? -10.957 15.413  75.961  1.00 38.02 ? 460 ARG B C   1 
ATOM   8103  O O   . ARG B 1 461 ? -10.152 14.513  75.725  1.00 37.74 ? 460 ARG B O   1 
ATOM   8104  C CB  . ARG B 1 461 ? -11.955 16.568  73.995  1.00 43.76 ? 460 ARG B CB  1 
ATOM   8105  C CG  . ARG B 1 461 ? -13.125 16.742  73.040  1.00 50.52 ? 460 ARG B CG  1 
ATOM   8106  C CD  . ARG B 1 461 ? -13.468 15.431  72.343  1.00 55.49 ? 460 ARG B CD  1 
ATOM   8107  N NE  . ARG B 1 461 ? -14.747 15.500  71.640  1.00 59.97 ? 460 ARG B NE  1 
ATOM   8108  C CZ  . ARG B 1 461 ? -15.918 15.718  72.234  1.00 61.74 ? 460 ARG B CZ  1 
ATOM   8109  N NH1 . ARG B 1 461 ? -15.981 15.890  73.550  1.00 61.36 ? 460 ARG B NH1 1 
ATOM   8110  N NH2 . ARG B 1 461 ? -17.031 15.759  71.511  1.00 63.24 ? 460 ARG B NH2 1 
ATOM   8111  N N   . LEU B 1 462 ? -10.793 16.290  76.941  1.00 34.12 ? 461 LEU B N   1 
ATOM   8112  C CA  . LEU B 1 462 ? -9.615  16.279  77.790  1.00 31.84 ? 461 LEU B CA  1 
ATOM   8113  C C   . LEU B 1 462 ? -9.728  15.351  78.996  1.00 28.46 ? 461 LEU B C   1 
ATOM   8114  O O   . LEU B 1 462 ? -8.766  14.680  79.363  1.00 25.70 ? 461 LEU B O   1 
ATOM   8115  C CB  . LEU B 1 462 ? -9.340  17.705  78.267  1.00 33.72 ? 461 LEU B CB  1 
ATOM   8116  C CG  . LEU B 1 462 ? -7.981  18.028  78.875  1.00 37.06 ? 461 LEU B CG  1 
ATOM   8117  C CD1 . LEU B 1 462 ? -6.877  17.695  77.877  1.00 38.26 ? 461 LEU B CD1 1 
ATOM   8118  C CD2 . LEU B 1 462 ? -7.943  19.505  79.240  1.00 38.17 ? 461 LEU B CD2 1 
ATOM   8119  N N   . LEU B 1 463 ? -10.920 15.312  79.586  1.00 25.39 ? 462 LEU B N   1 
ATOM   8120  C CA  . LEU B 1 463 ? -11.210 14.531  80.788  1.00 22.51 ? 462 LEU B CA  1 
ATOM   8121  C C   . LEU B 1 463 ? -10.511 13.195  81.044  1.00 21.16 ? 462 LEU B C   1 
ATOM   8122  O O   . LEU B 1 463 ? -9.787  13.059  82.026  1.00 19.57 ? 462 LEU B O   1 
ATOM   8123  C CB  . LEU B 1 463 ? -12.724 14.322  80.916  1.00 20.76 ? 462 LEU B CB  1 
ATOM   8124  C CG  . LEU B 1 463 ? -13.208 13.582  82.166  1.00 19.18 ? 462 LEU B CG  1 
ATOM   8125  C CD1 . LEU B 1 463 ? -12.646 14.247  83.429  1.00 16.83 ? 462 LEU B CD1 1 
ATOM   8126  C CD2 . LEU B 1 463 ? -14.734 13.577  82.184  1.00 21.55 ? 462 LEU B CD2 1 
ATOM   8127  N N   . PRO B 1 464 ? -10.722 12.190  80.177  1.00 22.03 ? 463 PRO B N   1 
ATOM   8128  C CA  . PRO B 1 464 ? -10.073 10.894  80.411  1.00 21.69 ? 463 PRO B CA  1 
ATOM   8129  C C   . PRO B 1 464 ? -8.543  10.944  80.457  1.00 21.91 ? 463 PRO B C   1 
ATOM   8130  O O   . PRO B 1 464 ? -7.912  10.172  81.186  1.00 19.93 ? 463 PRO B O   1 
ATOM   8131  C CB  . PRO B 1 464 ? -10.608 10.036  79.270  1.00 20.89 ? 463 PRO B CB  1 
ATOM   8132  C CG  . PRO B 1 464 ? -10.733 11.019  78.164  1.00 22.03 ? 463 PRO B CG  1 
ATOM   8133  C CD  . PRO B 1 464 ? -11.350 12.225  78.843  1.00 21.91 ? 463 PRO B CD  1 
ATOM   8134  N N   . HIS B 1 465 ? -7.954  11.854  79.686  1.00 19.80 ? 464 HIS B N   1 
ATOM   8135  C CA  . HIS B 1 465 ? -6.498  12.001  79.657  1.00 21.11 ? 464 HIS B CA  1 
ATOM   8136  C C   . HIS B 1 465 ? -5.939  12.583  80.956  1.00 20.41 ? 464 HIS B C   1 
ATOM   8137  O O   . HIS B 1 465 ? -4.735  12.496  81.213  1.00 19.70 ? 464 HIS B O   1 
ATOM   8138  C CB  . HIS B 1 465 ? -6.084  12.905  78.492  1.00 20.95 ? 464 HIS B CB  1 
ATOM   8139  C CG  . HIS B 1 465 ? -6.362  12.316  77.145  1.00 21.11 ? 464 HIS B CG  1 
ATOM   8140  N ND1 . HIS B 1 465 ? -5.508  11.424  76.533  1.00 20.13 ? 464 HIS B ND1 1 
ATOM   8141  C CD2 . HIS B 1 465 ? -7.412  12.471  76.303  1.00 20.70 ? 464 HIS B CD2 1 
ATOM   8142  C CE1 . HIS B 1 465 ? -6.018  11.055  75.371  1.00 22.80 ? 464 HIS B CE1 1 
ATOM   8143  N NE2 . HIS B 1 465 ? -7.174  11.676  75.208  1.00 22.19 ? 464 HIS B NE2 1 
ATOM   8144  N N   . LYS B 1 466 ? -6.808  13.171  81.774  1.00 18.54 ? 465 LYS B N   1 
ATOM   8145  C CA  . LYS B 1 466 ? -6.366  13.787  83.020  1.00 19.61 ? 465 LYS B CA  1 
ATOM   8146  C C   . LYS B 1 466 ? -6.593  12.922  84.247  1.00 18.71 ? 465 LYS B C   1 
ATOM   8147  O O   . LYS B 1 466 ? -6.315  13.339  85.370  1.00 18.50 ? 465 LYS B O   1 
ATOM   8148  C CB  . LYS B 1 466 ? -7.068  15.133  83.212  1.00 21.38 ? 465 LYS B CB  1 
ATOM   8149  C CG  . LYS B 1 466 ? -7.163  15.945  81.933  1.00 24.88 ? 465 LYS B CG  1 
ATOM   8150  C CD  . LYS B 1 466 ? -7.090  17.430  82.200  1.00 28.03 ? 465 LYS B CD  1 
ATOM   8151  C CE  . LYS B 1 466 ? -5.677  17.830  82.547  1.00 29.86 ? 465 LYS B CE  1 
ATOM   8152  N NZ  . LYS B 1 466 ? -5.546  19.297  82.707  1.00 32.64 ? 465 LYS B NZ  1 
ATOM   8153  N N   . VAL B 1 467 ? -7.106  11.720  84.033  1.00 18.59 ? 466 VAL B N   1 
ATOM   8154  C CA  . VAL B 1 467 ? -7.368  10.809  85.137  1.00 19.83 ? 466 VAL B CA  1 
ATOM   8155  C C   . VAL B 1 467 ? -6.121  10.002  85.468  1.00 18.27 ? 466 VAL B C   1 
ATOM   8156  O O   . VAL B 1 467 ? -5.422  9.542   84.568  1.00 18.58 ? 466 VAL B O   1 
ATOM   8157  C CB  . VAL B 1 467 ? -8.523  9.837   84.788  1.00 20.97 ? 466 VAL B CB  1 
ATOM   8158  C CG1 . VAL B 1 467 ? -8.748  8.843   85.927  1.00 22.12 ? 466 VAL B CG1 1 
ATOM   8159  C CG2 . VAL B 1 467 ? -9.794  10.625  84.516  1.00 19.66 ? 466 VAL B CG2 1 
ATOM   8160  N N   . PHE B 1 468 ? -5.836  9.856   86.760  1.00 17.35 ? 467 PHE B N   1 
ATOM   8161  C CA  . PHE B 1 468 ? -4.693  9.067   87.219  1.00 17.15 ? 467 PHE B CA  1 
ATOM   8162  C C   . PHE B 1 468 ? -5.275  7.884   87.981  1.00 17.74 ? 467 PHE B C   1 
ATOM   8163  O O   . PHE B 1 468 ? -5.927  8.075   89.004  1.00 17.65 ? 467 PHE B O   1 
ATOM   8164  C CB  . PHE B 1 468 ? -3.796  9.869   88.169  1.00 17.83 ? 467 PHE B CB  1 
ATOM   8165  C CG  . PHE B 1 468 ? -2.974  10.929  87.494  1.00 17.65 ? 467 PHE B CG  1 
ATOM   8166  C CD1 . PHE B 1 468 ? -3.574  12.078  86.986  1.00 18.41 ? 467 PHE B CD1 1 
ATOM   8167  C CD2 . PHE B 1 468 ? -1.591  10.787  87.386  1.00 17.35 ? 467 PHE B CD2 1 
ATOM   8168  C CE1 . PHE B 1 468 ? -2.806  13.080  86.379  1.00 20.02 ? 467 PHE B CE1 1 
ATOM   8169  C CE2 . PHE B 1 468 ? -0.814  11.780  86.783  1.00 19.72 ? 467 PHE B CE2 1 
ATOM   8170  C CZ  . PHE B 1 468 ? -1.425  12.930  86.279  1.00 19.67 ? 467 PHE B CZ  1 
ATOM   8171  N N   . GLU B 1 469 ? -5.041  6.665   87.499  1.00 17.90 ? 468 GLU B N   1 
ATOM   8172  C CA  . GLU B 1 469 ? -5.593  5.492   88.174  1.00 19.66 ? 468 GLU B CA  1 
ATOM   8173  C C   . GLU B 1 469 ? -4.980  5.227   89.539  1.00 19.91 ? 468 GLU B C   1 
ATOM   8174  O O   . GLU B 1 469 ? -5.603  4.595   90.388  1.00 20.38 ? 468 GLU B O   1 
ATOM   8175  C CB  . GLU B 1 469 ? -5.470  4.259   87.279  1.00 20.65 ? 468 GLU B CB  1 
ATOM   8176  C CG  . GLU B 1 469 ? -6.260  4.424   85.979  1.00 25.86 ? 468 GLU B CG  1 
ATOM   8177  C CD  . GLU B 1 469 ? -6.274  3.180   85.114  1.00 26.42 ? 468 GLU B CD  1 
ATOM   8178  O OE1 . GLU B 1 469 ? -5.199  2.582   84.911  1.00 28.92 ? 468 GLU B OE1 1 
ATOM   8179  O OE2 . GLU B 1 469 ? -7.363  2.815   84.622  1.00 26.47 ? 468 GLU B OE2 1 
ATOM   8180  N N   . GLY B 1 470 ? -3.769  5.729   89.755  1.00 18.72 ? 469 GLY B N   1 
ATOM   8181  C CA  . GLY B 1 470 ? -3.110  5.542   91.032  1.00 18.18 ? 469 GLY B CA  1 
ATOM   8182  C C   . GLY B 1 470 ? -2.944  4.090   91.448  1.00 19.71 ? 469 GLY B C   1 
ATOM   8183  O O   . GLY B 1 470 ? -2.801  3.194   90.610  1.00 17.76 ? 469 GLY B O   1 
ATOM   8184  N N   . ASN B 1 471 ? -2.964  3.872   92.760  1.00 20.20 ? 470 ASN B N   1 
ATOM   8185  C CA  . ASN B 1 471 ? -2.810  2.545   93.355  1.00 21.81 ? 470 ASN B CA  1 
ATOM   8186  C C   . ASN B 1 471 ? -1.473  1.916   92.974  1.00 20.76 ? 470 ASN B C   1 
ATOM   8187  O O   . ASN B 1 471 ? -1.362  0.700   92.837  1.00 22.29 ? 470 ASN B O   1 
ATOM   8188  C CB  . ASN B 1 471 ? -3.969  1.633   92.930  1.00 21.86 ? 470 ASN B CB  1 
ATOM   8189  C CG  . ASN B 1 471 ? -4.179  0.474   93.888  1.00 22.37 ? 470 ASN B CG  1 
ATOM   8190  O OD1 . ASN B 1 471 ? -4.110  0.647   95.102  1.00 22.57 ? 470 ASN B OD1 1 
ATOM   8191  N ND2 . ASN B 1 471 ? -4.449  -0.712  93.345  1.00 23.25 ? 470 ASN B ND2 1 
ATOM   8192  N N   . ARG B 1 472 ? -0.462  2.761   92.809  1.00 20.45 ? 471 ARG B N   1 
ATOM   8193  C CA  . ARG B 1 472 ? 0.879   2.321   92.445  1.00 19.49 ? 471 ARG B CA  1 
ATOM   8194  C C   . ARG B 1 472 ? 1.757   2.362   93.697  1.00 18.51 ? 471 ARG B C   1 
ATOM   8195  O O   . ARG B 1 472 ? 2.020   3.429   94.261  1.00 20.23 ? 471 ARG B O   1 
ATOM   8196  C CB  . ARG B 1 472 ? 1.417   3.217   91.331  1.00 19.28 ? 471 ARG B CB  1 
ATOM   8197  C CG  . ARG B 1 472 ? 0.605   3.090   90.038  1.00 19.84 ? 471 ARG B CG  1 
ATOM   8198  C CD  . ARG B 1 472 ? 0.810   4.281   89.123  1.00 20.62 ? 471 ARG B CD  1 
ATOM   8199  N NE  . ARG B 1 472 ? 0.569   3.975   87.713  1.00 20.94 ? 471 ARG B NE  1 
ATOM   8200  C CZ  . ARG B 1 472 ? -0.598  3.600   87.200  1.00 21.41 ? 471 ARG B CZ  1 
ATOM   8201  N NH1 . ARG B 1 472 ? -1.664  3.472   87.976  1.00 21.67 ? 471 ARG B NH1 1 
ATOM   8202  N NH2 . ARG B 1 472 ? -0.700  3.369   85.896  1.00 22.52 ? 471 ARG B NH2 1 
ATOM   8203  N N   . PRO B 1 473 ? 2.225   1.184   94.138  1.00 17.14 ? 472 PRO B N   1 
ATOM   8204  C CA  . PRO B 1 473 ? 3.061   0.955   95.317  1.00 18.10 ? 472 PRO B CA  1 
ATOM   8205  C C   . PRO B 1 473 ? 4.487   1.475   95.284  1.00 17.59 ? 472 PRO B C   1 
ATOM   8206  O O   . PRO B 1 473 ? 5.169   1.433   94.257  1.00 18.45 ? 472 PRO B O   1 
ATOM   8207  C CB  . PRO B 1 473 ? 3.006   -0.559  95.473  1.00 18.55 ? 472 PRO B CB  1 
ATOM   8208  C CG  . PRO B 1 473 ? 3.063   -1.006  94.058  1.00 17.48 ? 472 PRO B CG  1 
ATOM   8209  C CD  . PRO B 1 473 ? 2.085   -0.065  93.361  1.00 18.30 ? 472 PRO B CD  1 
ATOM   8210  N N   . THR B 1 474 ? 4.930   1.949   96.440  1.00 17.27 ? 473 THR B N   1 
ATOM   8211  C CA  . THR B 1 474 ? 6.271   2.483   96.580  1.00 16.82 ? 473 THR B CA  1 
ATOM   8212  C C   . THR B 1 474 ? 6.760   2.273   97.999  1.00 17.92 ? 473 THR B C   1 
ATOM   8213  O O   . THR B 1 474 ? 5.961   2.088   98.928  1.00 18.68 ? 473 THR B O   1 
ATOM   8214  C CB  . THR B 1 474 ? 6.304   4.021   96.330  1.00 16.62 ? 473 THR B CB  1 
ATOM   8215  O OG1 . THR B 1 474 ? 5.494   4.684   97.314  1.00 17.29 ? 473 THR B OG1 1 
ATOM   8216  C CG2 . THR B 1 474 ? 5.787   4.366   94.955  1.00 14.59 ? 473 THR B CG2 1 
ATOM   8217  N N   . ASN B 1 475 ? 8.079   2.285   98.152  1.00 17.10 ? 474 ASN B N   1 
ATOM   8218  C CA  . ASN B 1 475 ? 8.709   2.214   99.462  1.00 15.26 ? 474 ASN B CA  1 
ATOM   8219  C C   . ASN B 1 475 ? 9.329   3.607   99.586  1.00 15.68 ? 474 ASN B C   1 
ATOM   8220  O O   . ASN B 1 475 ? 9.765   4.181   98.586  1.00 11.10 ? 474 ASN B O   1 
ATOM   8221  C CB  . ASN B 1 475 ? 9.853   1.191   99.512  1.00 15.25 ? 474 ASN B CB  1 
ATOM   8222  C CG  . ASN B 1 475 ? 9.364   -0.246  99.588  1.00 15.57 ? 474 ASN B CG  1 
ATOM   8223  O OD1 . ASN B 1 475 ? 8.406   -0.551  100.298 1.00 13.29 ? 474 ASN B OD1 1 
ATOM   8224  N ND2 . ASN B 1 475 ? 10.039  -1.140  98.870  1.00 14.38 ? 474 ASN B ND2 1 
ATOM   8225  N N   . SER B 1 476 ? 9.341   4.161   100.792 1.00 14.22 ? 475 SER B N   1 
ATOM   8226  C CA  . SER B 1 476 ? 9.976   5.445   101.013 1.00 16.01 ? 475 SER B CA  1 
ATOM   8227  C C   . SER B 1 476 ? 11.002  5.191   102.097 1.00 16.98 ? 475 SER B C   1 
ATOM   8228  O O   . SER B 1 476 ? 10.662  4.782   103.212 1.00 18.14 ? 475 SER B O   1 
ATOM   8229  C CB  . SER B 1 476 ? 8.974   6.514   101.462 1.00 17.06 ? 475 SER B CB  1 
ATOM   8230  O OG  . SER B 1 476 ? 8.235   7.007   100.353 1.00 17.69 ? 475 SER B OG  1 
ATOM   8231  N N   . ILE B 1 477 ? 12.264  5.406   101.751 1.00 15.82 ? 476 ILE B N   1 
ATOM   8232  C CA  . ILE B 1 477 ? 13.358  5.199   102.686 1.00 16.29 ? 476 ILE B CA  1 
ATOM   8233  C C   . ILE B 1 477 ? 14.008  6.551   102.965 1.00 16.58 ? 476 ILE B C   1 
ATOM   8234  O O   . ILE B 1 477 ? 14.680  7.127   102.109 1.00 16.25 ? 476 ILE B O   1 
ATOM   8235  C CB  . ILE B 1 477 ? 14.393  4.214   102.099 1.00 14.49 ? 476 ILE B CB  1 
ATOM   8236  C CG1 . ILE B 1 477 ? 13.714  2.867   101.808 1.00 15.21 ? 476 ILE B CG1 1 
ATOM   8237  C CG2 . ILE B 1 477 ? 15.552  4.056   103.058 1.00 12.51 ? 476 ILE B CG2 1 
ATOM   8238  C CD1 . ILE B 1 477 ? 14.495  1.955   100.863 1.00 16.62 ? 476 ILE B CD1 1 
ATOM   8239  N N   . VAL B 1 478 ? 13.788  7.048   104.174 1.00 15.98 ? 477 VAL B N   1 
ATOM   8240  C CA  . VAL B 1 478 ? 14.317  8.331   104.589 1.00 15.59 ? 477 VAL B CA  1 
ATOM   8241  C C   . VAL B 1 478 ? 15.373  8.143   105.668 1.00 16.36 ? 477 VAL B C   1 
ATOM   8242  O O   . VAL B 1 478 ? 15.156  7.428   106.645 1.00 17.73 ? 477 VAL B O   1 
ATOM   8243  C CB  . VAL B 1 478 ? 13.188  9.221   105.134 1.00 14.76 ? 477 VAL B CB  1 
ATOM   8244  C CG1 . VAL B 1 478 ? 13.692  10.651  105.336 1.00 17.78 ? 477 VAL B CG1 1 
ATOM   8245  C CG2 . VAL B 1 478 ? 12.007  9.186   104.180 1.00 12.57 ? 477 VAL B CG2 1 
ATOM   8246  N N   . PHE B 1 479 ? 16.526  8.775   105.483 1.00 17.08 ? 478 PHE B N   1 
ATOM   8247  C CA  . PHE B 1 479 ? 17.606  8.674   106.457 1.00 16.20 ? 478 PHE B CA  1 
ATOM   8248  C C   . PHE B 1 479 ? 18.087  10.073  106.842 1.00 16.93 ? 478 PHE B C   1 
ATOM   8249  O O   . PHE B 1 479 ? 17.991  11.019  106.054 1.00 17.97 ? 478 PHE B O   1 
ATOM   8250  C CB  . PHE B 1 479 ? 18.747  7.799   105.907 1.00 16.87 ? 478 PHE B CB  1 
ATOM   8251  C CG  . PHE B 1 479 ? 19.041  8.021   104.450 1.00 18.02 ? 478 PHE B CG  1 
ATOM   8252  C CD1 . PHE B 1 479 ? 20.041  8.897   104.051 1.00 18.35 ? 478 PHE B CD1 1 
ATOM   8253  C CD2 . PHE B 1 479 ? 18.290  7.375   103.476 1.00 16.89 ? 478 PHE B CD2 1 
ATOM   8254  C CE1 . PHE B 1 479 ? 20.288  9.129   102.693 1.00 17.19 ? 478 PHE B CE1 1 
ATOM   8255  C CE2 . PHE B 1 479 ? 18.528  7.600   102.116 1.00 18.82 ? 478 PHE B CE2 1 
ATOM   8256  C CZ  . PHE B 1 479 ? 19.530  8.480   101.728 1.00 17.42 ? 478 PHE B CZ  1 
ATOM   8257  N N   . THR B 1 480 ? 18.596  10.199  108.060 1.00 16.48 ? 479 THR B N   1 
ATOM   8258  C CA  . THR B 1 480 ? 19.031  11.489  108.581 1.00 17.37 ? 479 THR B CA  1 
ATOM   8259  C C   . THR B 1 480 ? 19.970  12.284  107.686 1.00 17.79 ? 479 THR B C   1 
ATOM   8260  O O   . THR B 1 480 ? 19.725  13.466  107.416 1.00 18.71 ? 479 THR B O   1 
ATOM   8261  C CB  . THR B 1 480 ? 19.688  11.332  109.977 1.00 16.36 ? 479 THR B CB  1 
ATOM   8262  O OG1 . THR B 1 480 ? 18.803  10.607  110.846 1.00 18.50 ? 479 THR B OG1 1 
ATOM   8263  C CG2 . THR B 1 480 ? 19.957  12.713  110.595 1.00 16.56 ? 479 THR B CG2 1 
ATOM   8264  N N   . LYS B 1 481 ? 21.041  11.645  107.232 1.00 16.76 ? 480 LYS B N   1 
ATOM   8265  C CA  . LYS B 1 481 ? 22.020  12.326  106.393 1.00 18.64 ? 480 LYS B CA  1 
ATOM   8266  C C   . LYS B 1 481 ? 22.890  11.317  105.669 1.00 17.79 ? 480 LYS B C   1 
ATOM   8267  O O   . LYS B 1 481 ? 23.197  10.255  106.211 1.00 17.34 ? 480 LYS B O   1 
ATOM   8268  C CB  . LYS B 1 481 ? 22.901  13.234  107.252 1.00 17.30 ? 480 LYS B CB  1 
ATOM   8269  C CG  . LYS B 1 481 ? 23.787  14.179  106.460 1.00 20.01 ? 480 LYS B CG  1 
ATOM   8270  C CD  . LYS B 1 481 ? 24.420  15.221  107.381 1.00 22.21 ? 480 LYS B CD  1 
ATOM   8271  C CE  . LYS B 1 481 ? 25.268  16.227  106.613 1.00 22.95 ? 480 LYS B CE  1 
ATOM   8272  N NZ  . LYS B 1 481 ? 25.851  17.234  107.546 1.00 22.82 ? 480 LYS B NZ  1 
ATOM   8273  N N   . LEU B 1 482 ? 23.288  11.652  104.447 1.00 16.59 ? 481 LEU B N   1 
ATOM   8274  C CA  . LEU B 1 482 ? 24.114  10.749  103.666 1.00 18.87 ? 481 LEU B CA  1 
ATOM   8275  C C   . LEU B 1 482 ? 25.589  10.948  103.987 1.00 17.90 ? 481 LEU B C   1 
ATOM   8276  O O   . LEU B 1 482 ? 26.325  11.618  103.269 1.00 16.90 ? 481 LEU B O   1 
ATOM   8277  C CB  . LEU B 1 482 ? 23.849  10.935  102.165 1.00 20.56 ? 481 LEU B CB  1 
ATOM   8278  C CG  . LEU B 1 482 ? 24.269  9.765   101.260 1.00 25.11 ? 481 LEU B CG  1 
ATOM   8279  C CD1 . LEU B 1 482 ? 25.773  9.745   101.097 1.00 29.34 ? 481 LEU B CD1 1 
ATOM   8280  C CD2 . LEU B 1 482 ? 23.785  8.444   101.860 1.00 21.72 ? 481 LEU B CD2 1 
ATOM   8281  N N   . THR B 1 483 ? 25.995  10.355  105.100 1.00 18.33 ? 482 THR B N   1 
ATOM   8282  C CA  . THR B 1 483 ? 27.368  10.399  105.569 1.00 16.35 ? 482 THR B CA  1 
ATOM   8283  C C   . THR B 1 483 ? 28.006  9.069   105.166 1.00 16.17 ? 482 THR B C   1 
ATOM   8284  O O   . THR B 1 483 ? 27.309  8.144   104.754 1.00 15.77 ? 482 THR B O   1 
ATOM   8285  C CB  . THR B 1 483 ? 27.400  10.487  107.090 1.00 15.96 ? 482 THR B CB  1 
ATOM   8286  O OG1 . THR B 1 483 ? 26.729  9.339   107.621 1.00 16.99 ? 482 THR B OG1 1 
ATOM   8287  C CG2 . THR B 1 483 ? 26.698  11.763  107.585 1.00 14.17 ? 482 THR B CG2 1 
ATOM   8288  N N   . PRO B 1 484 ? 29.339  8.956   105.280 1.00 18.33 ? 483 PRO B N   1 
ATOM   8289  C CA  . PRO B 1 484 ? 30.020  7.706   104.917 1.00 17.28 ? 483 PRO B CA  1 
ATOM   8290  C C   . PRO B 1 484 ? 29.409  6.486   105.622 1.00 17.75 ? 483 PRO B C   1 
ATOM   8291  O O   . PRO B 1 484 ? 29.164  5.455   105.004 1.00 18.93 ? 483 PRO B O   1 
ATOM   8292  C CB  . PRO B 1 484 ? 31.459  7.969   105.349 1.00 17.92 ? 483 PRO B CB  1 
ATOM   8293  C CG  . PRO B 1 484 ? 31.614  9.443   105.060 1.00 18.07 ? 483 PRO B CG  1 
ATOM   8294  C CD  . PRO B 1 484 ? 30.314  10.021  105.590 1.00 15.98 ? 483 PRO B CD  1 
ATOM   8295  N N   . PHE B 1 485 ? 29.162  6.617   106.920 1.00 17.90 ? 484 PHE B N   1 
ATOM   8296  C CA  . PHE B 1 485 ? 28.577  5.543   107.712 1.00 17.15 ? 484 PHE B CA  1 
ATOM   8297  C C   . PHE B 1 485 ? 27.185  5.161   107.205 1.00 18.51 ? 484 PHE B C   1 
ATOM   8298  O O   . PHE B 1 485 ? 26.882  3.978   107.016 1.00 16.82 ? 484 PHE B O   1 
ATOM   8299  C CB  . PHE B 1 485 ? 28.474  5.982   109.176 1.00 17.51 ? 484 PHE B CB  1 
ATOM   8300  C CG  . PHE B 1 485 ? 27.885  4.942   110.086 1.00 19.33 ? 484 PHE B CG  1 
ATOM   8301  C CD1 . PHE B 1 485 ? 28.708  4.153   110.892 1.00 19.39 ? 484 PHE B CD1 1 
ATOM   8302  C CD2 . PHE B 1 485 ? 26.503  4.755   110.150 1.00 19.30 ? 484 PHE B CD2 1 
ATOM   8303  C CE1 . PHE B 1 485 ? 28.160  3.196   111.747 1.00 19.69 ? 484 PHE B CE1 1 
ATOM   8304  C CE2 . PHE B 1 485 ? 25.948  3.798   111.005 1.00 19.33 ? 484 PHE B CE2 1 
ATOM   8305  C CZ  . PHE B 1 485 ? 26.773  3.020   111.802 1.00 16.81 ? 484 PHE B CZ  1 
ATOM   8306  N N   . MET B 1 486 ? 26.334  6.161   106.998 1.00 15.97 ? 485 MET B N   1 
ATOM   8307  C CA  . MET B 1 486 ? 24.976  5.897   106.538 1.00 16.43 ? 485 MET B CA  1 
ATOM   8308  C C   . MET B 1 486 ? 24.958  5.236   105.162 1.00 16.78 ? 485 MET B C   1 
ATOM   8309  O O   . MET B 1 486 ? 24.147  4.346   104.921 1.00 16.05 ? 485 MET B O   1 
ATOM   8310  C CB  . MET B 1 486 ? 24.155  7.189   106.511 1.00 15.98 ? 485 MET B CB  1 
ATOM   8311  C CG  . MET B 1 486 ? 22.703  6.992   106.076 1.00 19.63 ? 485 MET B CG  1 
ATOM   8312  S SD  . MET B 1 486 ? 21.816  5.744   107.072 1.00 21.76 ? 485 MET B SD  1 
ATOM   8313  C CE  . MET B 1 486 ? 21.686  6.630   108.644 1.00 19.41 ? 485 MET B CE  1 
ATOM   8314  N N   . LEU B 1 487 ? 25.848  5.659   104.266 1.00 17.28 ? 486 LEU B N   1 
ATOM   8315  C CA  . LEU B 1 487 ? 25.892  5.068   102.931 1.00 17.55 ? 486 LEU B CA  1 
ATOM   8316  C C   . LEU B 1 487 ? 26.265  3.591   103.068 1.00 18.52 ? 486 LEU B C   1 
ATOM   8317  O O   . LEU B 1 487 ? 25.683  2.732   102.407 1.00 18.69 ? 486 LEU B O   1 
ATOM   8318  C CB  . LEU B 1 487 ? 26.913  5.786   102.044 1.00 14.02 ? 486 LEU B CB  1 
ATOM   8319  C CG  . LEU B 1 487 ? 27.147  5.193   100.648 1.00 14.80 ? 486 LEU B CG  1 
ATOM   8320  C CD1 . LEU B 1 487 ? 25.853  5.198   99.835  1.00 15.13 ? 486 LEU B CD1 1 
ATOM   8321  C CD2 . LEU B 1 487 ? 28.212  6.000   99.926  1.00 17.99 ? 486 LEU B CD2 1 
ATOM   8322  N N   . GLY B 1 488 ? 27.239  3.303   103.927 1.00 18.03 ? 487 GLY B N   1 
ATOM   8323  C CA  . GLY B 1 488 ? 27.636  1.923   104.134 1.00 17.96 ? 487 GLY B CA  1 
ATOM   8324  C C   . GLY B 1 488 ? 26.442  1.098   104.572 1.00 18.46 ? 487 GLY B C   1 
ATOM   8325  O O   . GLY B 1 488 ? 26.239  -0.015  104.094 1.00 19.32 ? 487 GLY B O   1 
ATOM   8326  N N   . ALA B 1 489 ? 25.643  1.654   105.480 1.00 17.06 ? 488 ALA B N   1 
ATOM   8327  C CA  . ALA B 1 489 ? 24.463  0.972   105.990 1.00 16.81 ? 488 ALA B CA  1 
ATOM   8328  C C   . ALA B 1 489 ? 23.443  0.721   104.885 1.00 16.36 ? 488 ALA B C   1 
ATOM   8329  O O   . ALA B 1 489 ? 22.922  -0.387  104.757 1.00 15.21 ? 488 ALA B O   1 
ATOM   8330  C CB  . ALA B 1 489 ? 23.828  1.790   107.108 1.00 14.81 ? 488 ALA B CB  1 
ATOM   8331  N N   . LEU B 1 490 ? 23.165  1.745   104.085 1.00 14.01 ? 489 LEU B N   1 
ATOM   8332  C CA  . LEU B 1 490 ? 22.203  1.625   102.992 1.00 15.77 ? 489 LEU B CA  1 
ATOM   8333  C C   . LEU B 1 490 ? 22.617  0.600   101.925 1.00 16.78 ? 489 LEU B C   1 
ATOM   8334  O O   . LEU B 1 490 ? 21.777  -0.149  101.418 1.00 15.79 ? 489 LEU B O   1 
ATOM   8335  C CB  . LEU B 1 490 ? 21.987  2.998   102.338 1.00 16.18 ? 489 LEU B CB  1 
ATOM   8336  C CG  . LEU B 1 490 ? 21.268  4.027   103.214 1.00 14.53 ? 489 LEU B CG  1 
ATOM   8337  C CD1 . LEU B 1 490 ? 21.326  5.399   102.571 1.00 17.95 ? 489 LEU B CD1 1 
ATOM   8338  C CD2 . LEU B 1 490 ? 19.820  3.597   103.410 1.00 15.59 ? 489 LEU B CD2 1 
ATOM   8339  N N   . VAL B 1 491 ? 23.903  0.571   101.579 1.00 16.16 ? 490 VAL B N   1 
ATOM   8340  C CA  . VAL B 1 491 ? 24.389  -0.377  100.579 1.00 16.77 ? 490 VAL B CA  1 
ATOM   8341  C C   . VAL B 1 491 ? 24.279  -1.802  101.117 1.00 15.50 ? 490 VAL B C   1 
ATOM   8342  O O   . VAL B 1 491 ? 23.824  -2.710  100.421 1.00 15.40 ? 490 VAL B O   1 
ATOM   8343  C CB  . VAL B 1 491 ? 25.870  -0.091  100.189 1.00 18.02 ? 490 VAL B CB  1 
ATOM   8344  C CG1 . VAL B 1 491 ? 26.408  -1.210  99.288  1.00 17.89 ? 490 VAL B CG1 1 
ATOM   8345  C CG2 . VAL B 1 491 ? 25.965  1.245   99.456  1.00 16.84 ? 490 VAL B CG2 1 
ATOM   8346  N N   . ALA B 1 492 ? 24.692  -1.991  102.363 1.00 15.59 ? 491 ALA B N   1 
ATOM   8347  C CA  . ALA B 1 492 ? 24.638  -3.312  102.979 1.00 16.00 ? 491 ALA B CA  1 
ATOM   8348  C C   . ALA B 1 492 ? 23.194  -3.799  103.084 1.00 17.03 ? 491 ALA B C   1 
ATOM   8349  O O   . ALA B 1 492 ? 22.922  -5.000  102.978 1.00 15.78 ? 491 ALA B O   1 
ATOM   8350  C CB  . ALA B 1 492 ? 25.276  -3.269  104.364 1.00 15.25 ? 491 ALA B CB  1 
ATOM   8351  N N   . MET B 1 493 ? 22.271  -2.865  103.293 1.00 16.03 ? 492 MET B N   1 
ATOM   8352  C CA  . MET B 1 493 ? 20.862  -3.221  103.414 1.00 16.60 ? 492 MET B CA  1 
ATOM   8353  C C   . MET B 1 493 ? 20.385  -3.860  102.114 1.00 17.02 ? 492 MET B C   1 
ATOM   8354  O O   . MET B 1 493 ? 19.700  -4.879  102.131 1.00 15.76 ? 492 MET B O   1 
ATOM   8355  C CB  . MET B 1 493 ? 20.023  -1.982  103.749 1.00 16.49 ? 492 MET B CB  1 
ATOM   8356  C CG  . MET B 1 493 ? 18.549  -2.270  104.014 1.00 13.79 ? 492 MET B CG  1 
ATOM   8357  S SD  . MET B 1 493 ? 17.641  -0.741  104.333 1.00 18.91 ? 492 MET B SD  1 
ATOM   8358  C CE  . MET B 1 493 ? 17.605  -0.050  102.706 1.00 17.12 ? 492 MET B CE  1 
ATOM   8359  N N   . TYR B 1 494 ? 20.760  -3.281  100.979 1.00 17.47 ? 493 TYR B N   1 
ATOM   8360  C CA  . TYR B 1 494 ? 20.338  -3.859  99.716  1.00 17.04 ? 493 TYR B CA  1 
ATOM   8361  C C   . TYR B 1 494 ? 21.067  -5.163  99.401  1.00 16.29 ? 493 TYR B C   1 
ATOM   8362  O O   . TYR B 1 494 ? 20.479  -6.074  98.824  1.00 16.73 ? 493 TYR B O   1 
ATOM   8363  C CB  . TYR B 1 494 ? 20.495  -2.854  98.573  1.00 16.75 ? 493 TYR B CB  1 
ATOM   8364  C CG  . TYR B 1 494 ? 19.322  -1.898  98.466  1.00 17.26 ? 493 TYR B CG  1 
ATOM   8365  C CD1 . TYR B 1 494 ? 19.353  -0.651  99.083  1.00 16.54 ? 493 TYR B CD1 1 
ATOM   8366  C CD2 . TYR B 1 494 ? 18.169  -2.258  97.763  1.00 18.91 ? 493 TYR B CD2 1 
ATOM   8367  C CE1 . TYR B 1 494 ? 18.263  0.224   99.004  1.00 18.17 ? 493 TYR B CE1 1 
ATOM   8368  C CE2 . TYR B 1 494 ? 17.073  -1.395  97.679  1.00 18.67 ? 493 TYR B CE2 1 
ATOM   8369  C CZ  . TYR B 1 494 ? 17.132  -0.156  98.301  1.00 18.31 ? 493 TYR B CZ  1 
ATOM   8370  O OH  . TYR B 1 494 ? 16.068  0.705   98.220  1.00 19.95 ? 493 TYR B OH  1 
ATOM   8371  N N   . GLU B 1 495 ? 22.336  -5.264  99.784  1.00 15.94 ? 494 GLU B N   1 
ATOM   8372  C CA  . GLU B 1 495 ? 23.081  -6.499  99.542  1.00 16.92 ? 494 GLU B CA  1 
ATOM   8373  C C   . GLU B 1 495 ? 22.340  -7.674  100.188 1.00 17.45 ? 494 GLU B C   1 
ATOM   8374  O O   . GLU B 1 495 ? 22.216  -8.750  99.601  1.00 19.35 ? 494 GLU B O   1 
ATOM   8375  C CB  . GLU B 1 495 ? 24.488  -6.416  100.150 1.00 14.34 ? 494 GLU B CB  1 
ATOM   8376  C CG  . GLU B 1 495 ? 25.390  -5.379  99.518  1.00 15.76 ? 494 GLU B CG  1 
ATOM   8377  C CD  . GLU B 1 495 ? 26.811  -5.430  100.057 1.00 14.94 ? 494 GLU B CD  1 
ATOM   8378  O OE1 . GLU B 1 495 ? 26.996  -5.665  101.271 1.00 13.45 ? 494 GLU B OE1 1 
ATOM   8379  O OE2 . GLU B 1 495 ? 27.745  -5.216  99.264  1.00 15.48 ? 494 GLU B OE2 1 
ATOM   8380  N N   . HIS B 1 496 ? 21.860  -7.465  101.410 1.00 17.42 ? 495 HIS B N   1 
ATOM   8381  C CA  . HIS B 1 496 ? 21.159  -8.516  102.131 1.00 17.79 ? 495 HIS B CA  1 
ATOM   8382  C C   . HIS B 1 496 ? 19.757  -8.767  101.616 1.00 18.20 ? 495 HIS B C   1 
ATOM   8383  O O   . HIS B 1 496 ? 19.248  -9.884  101.713 1.00 19.04 ? 495 HIS B O   1 
ATOM   8384  C CB  . HIS B 1 496 ? 21.189  -8.206  103.621 1.00 16.93 ? 495 HIS B CB  1 
ATOM   8385  C CG  . HIS B 1 496 ? 22.564  -8.317  104.197 1.00 15.86 ? 495 HIS B CG  1 
ATOM   8386  N ND1 . HIS B 1 496 ? 22.983  -7.596  105.291 1.00 17.09 ? 495 HIS B ND1 1 
ATOM   8387  C CD2 . HIS B 1 496 ? 23.634  -9.043  103.794 1.00 17.63 ? 495 HIS B CD2 1 
ATOM   8388  C CE1 . HIS B 1 496 ? 24.252  -7.867  105.535 1.00 15.25 ? 495 HIS B CE1 1 
ATOM   8389  N NE2 . HIS B 1 496 ? 24.671  -8.742  104.640 1.00 19.20 ? 495 HIS B NE2 1 
ATOM   8390  N N   . LYS B 1 497 ? 19.140  -7.736  101.049 1.00 17.02 ? 496 LYS B N   1 
ATOM   8391  C CA  . LYS B 1 497 ? 17.818  -7.892  100.454 1.00 16.19 ? 496 LYS B CA  1 
ATOM   8392  C C   . LYS B 1 497 ? 18.001  -8.878  99.291  1.00 15.85 ? 496 LYS B C   1 
ATOM   8393  O O   . LYS B 1 497 ? 17.192  -9.784  99.075  1.00 16.45 ? 496 LYS B O   1 
ATOM   8394  C CB  . LYS B 1 497 ? 17.309  -6.555  99.897  1.00 16.06 ? 496 LYS B CB  1 
ATOM   8395  C CG  . LYS B 1 497 ? 16.099  -6.706  98.983  1.00 15.17 ? 496 LYS B CG  1 
ATOM   8396  C CD  . LYS B 1 497 ? 15.937  -5.523  98.031  1.00 15.29 ? 496 LYS B CD  1 
ATOM   8397  C CE  . LYS B 1 497 ? 14.750  -5.732  97.097  1.00 14.87 ? 496 LYS B CE  1 
ATOM   8398  N NZ  . LYS B 1 497 ? 14.592  -4.643  96.084  1.00 13.11 ? 496 LYS B NZ  1 
ATOM   8399  N N   . ILE B 1 498 ? 19.087  -8.687  98.552  1.00 14.30 ? 497 ILE B N   1 
ATOM   8400  C CA  . ILE B 1 498 ? 19.412  -9.523  97.405  1.00 15.25 ? 497 ILE B CA  1 
ATOM   8401  C C   . ILE B 1 498 ? 19.688  -10.974 97.843  1.00 17.11 ? 497 ILE B C   1 
ATOM   8402  O O   . ILE B 1 498 ? 19.274  -11.931 97.178  1.00 14.96 ? 497 ILE B O   1 
ATOM   8403  C CB  . ILE B 1 498 ? 20.617  -8.892  96.653  1.00 15.59 ? 497 ILE B CB  1 
ATOM   8404  C CG1 . ILE B 1 498 ? 20.160  -7.563  96.023  1.00 15.82 ? 497 ILE B CG1 1 
ATOM   8405  C CG2 . ILE B 1 498 ? 21.160  -9.833  95.589  1.00 14.36 ? 497 ILE B CG2 1 
ATOM   8406  C CD1 . ILE B 1 498 ? 21.293  -6.678  95.510  1.00 13.92 ? 497 ILE B CD1 1 
ATOM   8407  N N   . PHE B 1 499 ? 20.370  -11.122 98.976  1.00 18.50 ? 498 PHE B N   1 
ATOM   8408  C CA  . PHE B 1 499 ? 20.682  -12.433 99.534  1.00 19.79 ? 498 PHE B CA  1 
ATOM   8409  C C   . PHE B 1 499 ? 19.373  -13.147 99.878  1.00 20.18 ? 498 PHE B C   1 
ATOM   8410  O O   . PHE B 1 499 ? 19.153  -14.296 99.489  1.00 20.79 ? 498 PHE B O   1 
ATOM   8411  C CB  . PHE B 1 499 ? 21.527  -12.280 100.803 1.00 20.80 ? 498 PHE B CB  1 
ATOM   8412  C CG  . PHE B 1 499 ? 21.731  -13.565 101.553 1.00 22.44 ? 498 PHE B CG  1 
ATOM   8413  C CD1 . PHE B 1 499 ? 22.625  -14.523 101.087 1.00 23.34 ? 498 PHE B CD1 1 
ATOM   8414  C CD2 . PHE B 1 499 ? 20.989  -13.839 102.700 1.00 23.06 ? 498 PHE B CD2 1 
ATOM   8415  C CE1 . PHE B 1 499 ? 22.781  -15.743 101.744 1.00 24.00 ? 498 PHE B CE1 1 
ATOM   8416  C CE2 . PHE B 1 499 ? 21.131  -15.055 103.370 1.00 24.65 ? 498 PHE B CE2 1 
ATOM   8417  C CZ  . PHE B 1 499 ? 22.030  -16.012 102.891 1.00 24.75 ? 498 PHE B CZ  1 
ATOM   8418  N N   . VAL B 1 500 ? 18.498  -12.457 100.598 1.00 19.58 ? 499 VAL B N   1 
ATOM   8419  C CA  . VAL B 1 500 ? 17.219  -13.051 100.983 1.00 18.16 ? 499 VAL B CA  1 
ATOM   8420  C C   . VAL B 1 500 ? 16.402  -13.518 99.779  1.00 18.37 ? 499 VAL B C   1 
ATOM   8421  O O   . VAL B 1 500 ? 15.873  -14.636 99.782  1.00 19.24 ? 499 VAL B O   1 
ATOM   8422  C CB  . VAL B 1 500 ? 16.392  -12.065 101.820 1.00 16.37 ? 499 VAL B CB  1 
ATOM   8423  C CG1 . VAL B 1 500 ? 15.051  -12.681 102.197 1.00 13.92 ? 499 VAL B CG1 1 
ATOM   8424  C CG2 . VAL B 1 500 ? 17.172  -11.697 103.065 1.00 16.09 ? 499 VAL B CG2 1 
ATOM   8425  N N   . GLN B 1 501 ? 16.301  -12.674 98.752  1.00 17.48 ? 500 GLN B N   1 
ATOM   8426  C CA  . GLN B 1 501 ? 15.554  -13.025 97.545  1.00 17.85 ? 500 GLN B CA  1 
ATOM   8427  C C   . GLN B 1 501 ? 16.144  -14.259 96.883  1.00 18.40 ? 500 GLN B C   1 
ATOM   8428  O O   . GLN B 1 501 ? 15.413  -15.152 96.456  1.00 18.15 ? 500 GLN B O   1 
ATOM   8429  C CB  . GLN B 1 501 ? 15.547  -11.863 96.547  1.00 18.27 ? 500 GLN B CB  1 
ATOM   8430  C CG  . GLN B 1 501 ? 14.912  -10.587 97.110  1.00 19.95 ? 500 GLN B CG  1 
ATOM   8431  C CD  . GLN B 1 501 ? 14.531  -9.588  96.036  1.00 17.97 ? 500 GLN B CD  1 
ATOM   8432  O OE1 . GLN B 1 501 ? 15.320  -9.291  95.141  1.00 16.52 ? 500 GLN B OE1 1 
ATOM   8433  N NE2 . GLN B 1 501 ? 13.310  -9.063  96.121  1.00 16.67 ? 500 GLN B NE2 1 
ATOM   8434  N N   . GLY B 1 502 ? 17.471  -14.309 96.812  1.00 18.07 ? 501 GLY B N   1 
ATOM   8435  C CA  . GLY B 1 502 ? 18.138  -15.444 96.205  1.00 18.63 ? 501 GLY B CA  1 
ATOM   8436  C C   . GLY B 1 502 ? 17.873  -16.764 96.917  1.00 18.60 ? 501 GLY B C   1 
ATOM   8437  O O   . GLY B 1 502 ? 17.706  -17.793 96.259  1.00 19.17 ? 501 GLY B O   1 
ATOM   8438  N N   . ILE B 1 503 ? 17.847  -16.750 98.250  1.00 19.11 ? 502 ILE B N   1 
ATOM   8439  C CA  . ILE B 1 503 ? 17.599  -17.975 99.011  1.00 19.66 ? 502 ILE B CA  1 
ATOM   8440  C C   . ILE B 1 503 ? 16.166  -18.448 98.779  1.00 20.13 ? 502 ILE B C   1 
ATOM   8441  O O   . ILE B 1 503 ? 15.908  -19.645 98.627  1.00 21.00 ? 502 ILE B O   1 
ATOM   8442  C CB  . ILE B 1 503 ? 17.837  -17.755 100.525 1.00 21.58 ? 502 ILE B CB  1 
ATOM   8443  C CG1 . ILE B 1 503 ? 19.303  -17.390 100.772 1.00 18.95 ? 502 ILE B CG1 1 
ATOM   8444  C CG2 . ILE B 1 503 ? 17.462  -19.018 101.314 1.00 22.25 ? 502 ILE B CG2 1 
ATOM   8445  C CD1 . ILE B 1 503 ? 20.301  -18.443 100.322 1.00 21.71 ? 502 ILE B CD1 1 
ATOM   8446  N N   . ILE B 1 504 ? 15.239  -17.496 98.732  1.00 19.52 ? 503 ILE B N   1 
ATOM   8447  C CA  . ILE B 1 504 ? 13.828  -17.795 98.506  1.00 19.23 ? 503 ILE B CA  1 
ATOM   8448  C C   . ILE B 1 504 ? 13.616  -18.389 97.112  1.00 20.95 ? 503 ILE B C   1 
ATOM   8449  O O   . ILE B 1 504 ? 12.795  -19.294 96.935  1.00 21.13 ? 503 ILE B O   1 
ATOM   8450  C CB  . ILE B 1 504 ? 12.973  -16.515 98.715  1.00 18.99 ? 503 ILE B CB  1 
ATOM   8451  C CG1 . ILE B 1 504 ? 12.895  -16.222 100.219 1.00 18.84 ? 503 ILE B CG1 1 
ATOM   8452  C CG2 . ILE B 1 504 ? 11.581  -16.670 98.089  1.00 17.73 ? 503 ILE B CG2 1 
ATOM   8453  C CD1 . ILE B 1 504 ? 12.302  -14.873 100.575 1.00 18.19 ? 503 ILE B CD1 1 
ATOM   8454  N N   . TRP B 1 505 ? 14.375  -17.900 96.131  1.00 19.76 ? 504 TRP B N   1 
ATOM   8455  C CA  . TRP B 1 505 ? 14.272  -18.403 94.762  1.00 18.89 ? 504 TRP B CA  1 
ATOM   8456  C C   . TRP B 1 505 ? 15.070  -19.694 94.600  1.00 19.08 ? 504 TRP B C   1 
ATOM   8457  O O   . TRP B 1 505 ? 14.939  -20.383 93.601  1.00 21.43 ? 504 TRP B O   1 
ATOM   8458  C CB  . TRP B 1 505 ? 14.790  -17.369 93.753  1.00 17.60 ? 504 TRP B CB  1 
ATOM   8459  C CG  . TRP B 1 505 ? 13.884  -16.192 93.559  1.00 18.86 ? 504 TRP B CG  1 
ATOM   8460  C CD1 . TRP B 1 505 ? 12.521  -16.209 93.484  1.00 18.09 ? 504 TRP B CD1 1 
ATOM   8461  C CD2 . TRP B 1 505 ? 14.280  -14.823 93.393  1.00 18.76 ? 504 TRP B CD2 1 
ATOM   8462  N NE1 . TRP B 1 505 ? 12.042  -14.934 93.287  1.00 21.61 ? 504 TRP B NE1 1 
ATOM   8463  C CE2 . TRP B 1 505 ? 13.100  -14.064 93.228  1.00 18.99 ? 504 TRP B CE2 1 
ATOM   8464  C CE3 . TRP B 1 505 ? 15.518  -14.166 93.367  1.00 19.27 ? 504 TRP B CE3 1 
ATOM   8465  C CZ2 . TRP B 1 505 ? 13.119  -12.677 93.041  1.00 20.14 ? 504 TRP B CZ2 1 
ATOM   8466  C CZ3 . TRP B 1 505 ? 15.538  -12.784 93.179  1.00 18.99 ? 504 TRP B CZ3 1 
ATOM   8467  C CH2 . TRP B 1 505 ? 14.343  -12.057 93.020  1.00 18.33 ? 504 TRP B CH2 1 
ATOM   8468  N N   . ASP B 1 506 ? 15.904  -20.000 95.590  1.00 20.66 ? 505 ASP B N   1 
ATOM   8469  C CA  . ASP B 1 506 ? 16.735  -21.202 95.600  1.00 21.35 ? 505 ASP B CA  1 
ATOM   8470  C C   . ASP B 1 506 ? 17.842  -21.161 94.550  1.00 20.61 ? 505 ASP B C   1 
ATOM   8471  O O   . ASP B 1 506 ? 18.252  -22.196 94.032  1.00 18.15 ? 505 ASP B O   1 
ATOM   8472  C CB  . ASP B 1 506 ? 15.869  -22.456 95.395  1.00 25.14 ? 505 ASP B CB  1 
ATOM   8473  C CG  . ASP B 1 506 ? 16.574  -23.735 95.838  1.00 26.12 ? 505 ASP B CG  1 
ATOM   8474  O OD1 . ASP B 1 506 ? 17.090  -23.772 96.974  1.00 27.00 ? 505 ASP B OD1 1 
ATOM   8475  O OD2 . ASP B 1 506 ? 16.608  -24.704 95.057  1.00 28.08 ? 505 ASP B OD2 1 
ATOM   8476  N N   . ILE B 1 507 ? 18.319  -19.962 94.231  1.00 17.58 ? 506 ILE B N   1 
ATOM   8477  C CA  . ILE B 1 507 ? 19.392  -19.831 93.257  1.00 18.04 ? 506 ILE B CA  1 
ATOM   8478  C C   . ILE B 1 507 ? 20.672  -19.402 93.957  1.00 16.40 ? 506 ILE B C   1 
ATOM   8479  O O   . ILE B 1 507 ? 20.682  -19.177 95.167  1.00 17.52 ? 506 ILE B O   1 
ATOM   8480  C CB  . ILE B 1 507 ? 19.056  -18.790 92.177  1.00 16.93 ? 506 ILE B CB  1 
ATOM   8481  C CG1 . ILE B 1 507 ? 18.759  -17.440 92.837  1.00 19.05 ? 506 ILE B CG1 1 
ATOM   8482  C CG2 . ILE B 1 507 ? 17.901  -19.279 91.351  1.00 18.71 ? 506 ILE B CG2 1 
ATOM   8483  C CD1 . ILE B 1 507 ? 18.776  -16.278 91.896  1.00 22.20 ? 506 ILE B CD1 1 
ATOM   8484  N N   . ASN B 1 508 ? 21.750  -19.293 93.189  1.00 17.08 ? 507 ASN B N   1 
ATOM   8485  C CA  . ASN B 1 508 ? 23.045  -18.878 93.724  1.00 16.38 ? 507 ASN B CA  1 
ATOM   8486  C C   . ASN B 1 508 ? 23.272  -17.411 93.352  1.00 17.13 ? 507 ASN B C   1 
ATOM   8487  O O   . ASN B 1 508 ? 23.495  -17.072 92.185  1.00 16.25 ? 507 ASN B O   1 
ATOM   8488  C CB  . ASN B 1 508 ? 24.148  -19.753 93.136  1.00 16.05 ? 507 ASN B CB  1 
ATOM   8489  C CG  . ASN B 1 508 ? 25.512  -19.482 93.754  1.00 20.38 ? 507 ASN B CG  1 
ATOM   8490  O OD1 . ASN B 1 508 ? 25.640  -18.736 94.731  1.00 18.32 ? 507 ASN B OD1 1 
ATOM   8491  N ND2 . ASN B 1 508 ? 26.544  -20.103 93.188  1.00 18.74 ? 507 ASN B ND2 1 
ATOM   8492  N N   . SER B 1 509 ? 23.185  -16.542 94.351  1.00 17.63 ? 508 SER B N   1 
ATOM   8493  C CA  . SER B 1 509 ? 23.365  -15.109 94.147  1.00 18.91 ? 508 SER B CA  1 
ATOM   8494  C C   . SER B 1 509 ? 24.829  -14.733 94.004  1.00 19.55 ? 508 SER B C   1 
ATOM   8495  O O   . SER B 1 509 ? 25.148  -13.581 93.698  1.00 18.45 ? 508 SER B O   1 
ATOM   8496  C CB  . SER B 1 509 ? 22.800  -14.329 95.341  1.00 18.39 ? 508 SER B CB  1 
ATOM   8497  O OG  . SER B 1 509 ? 21.425  -14.599 95.557  1.00 19.02 ? 508 SER B OG  1 
ATOM   8498  N N   . PHE B 1 510 ? 25.726  -15.693 94.208  1.00 18.51 ? 509 PHE B N   1 
ATOM   8499  C CA  . PHE B 1 510 ? 27.137  -15.354 94.176  1.00 18.77 ? 509 PHE B CA  1 
ATOM   8500  C C   . PHE B 1 510 ? 28.039  -15.860 93.069  1.00 20.05 ? 509 PHE B C   1 
ATOM   8501  O O   . PHE B 1 510 ? 29.237  -15.598 93.093  1.00 19.87 ? 509 PHE B O   1 
ATOM   8502  C CB  . PHE B 1 510 ? 27.722  -15.657 95.551  1.00 17.81 ? 509 PHE B CB  1 
ATOM   8503  C CG  . PHE B 1 510 ? 26.926  -15.036 96.665  1.00 19.07 ? 509 PHE B CG  1 
ATOM   8504  C CD1 . PHE B 1 510 ? 25.995  -15.789 97.376  1.00 16.30 ? 509 PHE B CD1 1 
ATOM   8505  C CD2 . PHE B 1 510 ? 27.022  -13.667 96.918  1.00 17.59 ? 509 PHE B CD2 1 
ATOM   8506  C CE1 . PHE B 1 510 ? 25.162  -15.191 98.318  1.00 20.71 ? 509 PHE B CE1 1 
ATOM   8507  C CE2 . PHE B 1 510 ? 26.194  -13.052 97.856  1.00 20.05 ? 509 PHE B CE2 1 
ATOM   8508  C CZ  . PHE B 1 510 ? 25.258  -13.814 98.558  1.00 20.71 ? 509 PHE B CZ  1 
ATOM   8509  N N   . ASP B 1 511 ? 27.483  -16.576 92.097  1.00 21.77 ? 510 ASP B N   1 
ATOM   8510  C CA  . ASP B 1 511 ? 28.297  -17.012 90.969  1.00 22.58 ? 510 ASP B CA  1 
ATOM   8511  C C   . ASP B 1 511 ? 27.874  -16.147 89.776  1.00 22.92 ? 510 ASP B C   1 
ATOM   8512  O O   . ASP B 1 511 ? 27.021  -15.267 89.911  1.00 21.07 ? 510 ASP B O   1 
ATOM   8513  C CB  . ASP B 1 511 ? 28.105  -18.513 90.662  1.00 21.31 ? 510 ASP B CB  1 
ATOM   8514  C CG  . ASP B 1 511 ? 26.682  -18.868 90.272  1.00 22.53 ? 510 ASP B CG  1 
ATOM   8515  O OD1 . ASP B 1 511 ? 25.913  -17.955 89.911  1.00 21.04 ? 510 ASP B OD1 1 
ATOM   8516  O OD2 . ASP B 1 511 ? 26.337  -20.075 90.314  1.00 19.38 ? 510 ASP B OD2 1 
ATOM   8517  N N   . GLN B 1 512 ? 28.485  -16.367 88.621  1.00 24.07 ? 511 GLN B N   1 
ATOM   8518  C CA  . GLN B 1 512 ? 28.128  -15.603 87.431  1.00 24.64 ? 511 GLN B CA  1 
ATOM   8519  C C   . GLN B 1 512 ? 28.650  -16.309 86.188  1.00 23.76 ? 511 GLN B C   1 
ATOM   8520  O O   . GLN B 1 512 ? 29.478  -15.777 85.446  1.00 24.28 ? 511 GLN B O   1 
ATOM   8521  C CB  . GLN B 1 512 ? 28.676  -14.164 87.510  1.00 25.97 ? 511 GLN B CB  1 
ATOM   8522  C CG  . GLN B 1 512 ? 30.179  -14.065 87.696  1.00 26.95 ? 511 GLN B CG  1 
ATOM   8523  C CD  . GLN B 1 512 ? 30.620  -14.387 89.108  1.00 29.32 ? 511 GLN B CD  1 
ATOM   8524  O OE1 . GLN B 1 512 ? 31.714  -14.911 89.324  1.00 30.65 ? 511 GLN B OE1 1 
ATOM   8525  N NE2 . GLN B 1 512 ? 29.778  -14.057 90.082  1.00 28.21 ? 511 GLN B NE2 1 
ATOM   8526  N N   . TRP B 1 513 ? 28.158  -17.524 85.972  1.00 22.96 ? 512 TRP B N   1 
ATOM   8527  C CA  . TRP B 1 513 ? 28.559  -18.311 84.818  1.00 21.70 ? 512 TRP B CA  1 
ATOM   8528  C C   . TRP B 1 513 ? 28.037  -17.678 83.535  1.00 21.58 ? 512 TRP B C   1 
ATOM   8529  O O   . TRP B 1 513 ? 28.542  -17.947 82.444  1.00 19.52 ? 512 TRP B O   1 
ATOM   8530  C CB  . TRP B 1 513 ? 28.025  -19.741 84.949  1.00 20.22 ? 512 TRP B CB  1 
ATOM   8531  C CG  . TRP B 1 513 ? 28.597  -20.456 86.124  1.00 21.36 ? 512 TRP B CG  1 
ATOM   8532  C CD1 . TRP B 1 513 ? 27.968  -20.745 87.301  1.00 20.37 ? 512 TRP B CD1 1 
ATOM   8533  C CD2 . TRP B 1 513 ? 29.947  -20.916 86.266  1.00 24.04 ? 512 TRP B CD2 1 
ATOM   8534  N NE1 . TRP B 1 513 ? 28.846  -21.353 88.172  1.00 21.09 ? 512 TRP B NE1 1 
ATOM   8535  C CE2 . TRP B 1 513 ? 30.068  -21.469 87.561  1.00 23.08 ? 512 TRP B CE2 1 
ATOM   8536  C CE3 . TRP B 1 513 ? 31.070  -20.911 85.423  1.00 25.87 ? 512 TRP B CE3 1 
ATOM   8537  C CZ2 . TRP B 1 513 ? 31.267  -22.013 88.035  1.00 25.17 ? 512 TRP B CZ2 1 
ATOM   8538  C CZ3 . TRP B 1 513 ? 32.263  -21.451 85.895  1.00 26.79 ? 512 TRP B CZ3 1 
ATOM   8539  C CH2 . TRP B 1 513 ? 32.350  -21.995 87.192  1.00 26.13 ? 512 TRP B CH2 1 
ATOM   8540  N N   . GLY B 1 514 ? 27.030  -16.822 83.675  1.00 21.61 ? 513 GLY B N   1 
ATOM   8541  C CA  . GLY B 1 514 ? 26.444  -16.180 82.512  1.00 23.42 ? 513 GLY B CA  1 
ATOM   8542  C C   . GLY B 1 514 ? 27.350  -15.288 81.683  1.00 24.17 ? 513 GLY B C   1 
ATOM   8543  O O   . GLY B 1 514 ? 26.941  -14.824 80.619  1.00 26.51 ? 513 GLY B O   1 
ATOM   8544  N N   . VAL B 1 515 ? 28.578  -15.051 82.129  1.00 22.87 ? 514 VAL B N   1 
ATOM   8545  C CA  . VAL B 1 515 ? 29.462  -14.175 81.370  1.00 25.29 ? 514 VAL B CA  1 
ATOM   8546  C C   . VAL B 1 515 ? 30.453  -14.872 80.444  1.00 24.49 ? 514 VAL B C   1 
ATOM   8547  O O   . VAL B 1 515 ? 31.064  -14.230 79.589  1.00 22.10 ? 514 VAL B O   1 
ATOM   8548  C CB  . VAL B 1 515 ? 30.264  -13.255 82.316  1.00 26.48 ? 514 VAL B CB  1 
ATOM   8549  C CG1 . VAL B 1 515 ? 29.322  -12.597 83.320  1.00 30.99 ? 514 VAL B CG1 1 
ATOM   8550  C CG2 . VAL B 1 515 ? 31.347  -14.049 83.032  1.00 27.11 ? 514 VAL B CG2 1 
ATOM   8551  N N   . GLU B 1 516 ? 30.589  -16.185 80.588  1.00 24.42 ? 515 GLU B N   1 
ATOM   8552  C CA  . GLU B 1 516 ? 31.561  -16.932 79.796  1.00 25.74 ? 515 GLU B CA  1 
ATOM   8553  C C   . GLU B 1 516 ? 31.369  -17.055 78.286  1.00 22.70 ? 515 GLU B C   1 
ATOM   8554  O O   . GLU B 1 516 ? 32.333  -16.901 77.535  1.00 21.14 ? 515 GLU B O   1 
ATOM   8555  C CB  . GLU B 1 516 ? 31.741  -18.329 80.387  1.00 27.96 ? 515 GLU B CB  1 
ATOM   8556  C CG  . GLU B 1 516 ? 32.023  -18.307 81.869  1.00 33.93 ? 515 GLU B CG  1 
ATOM   8557  C CD  . GLU B 1 516 ? 32.604  -19.612 82.368  1.00 37.27 ? 515 GLU B CD  1 
ATOM   8558  O OE1 . GLU B 1 516 ? 32.026  -20.682 82.072  1.00 34.62 ? 515 GLU B OE1 1 
ATOM   8559  O OE2 . GLU B 1 516 ? 33.642  -19.557 83.062  1.00 40.62 ? 515 GLU B OE2 1 
ATOM   8560  N N   . LEU B 1 517 ? 30.149  -17.337 77.838  1.00 20.84 ? 516 LEU B N   1 
ATOM   8561  C CA  . LEU B 1 517 ? 29.896  -17.503 76.407  1.00 19.88 ? 516 LEU B CA  1 
ATOM   8562  C C   . LEU B 1 517 ? 30.339  -16.275 75.618  1.00 20.25 ? 516 LEU B C   1 
ATOM   8563  O O   . LEU B 1 517 ? 31.038  -16.390 74.607  1.00 20.82 ? 516 LEU B O   1 
ATOM   8564  C CB  . LEU B 1 517 ? 28.408  -17.757 76.150  1.00 20.20 ? 516 LEU B CB  1 
ATOM   8565  C CG  . LEU B 1 517 ? 27.990  -18.720 75.023  1.00 20.19 ? 516 LEU B CG  1 
ATOM   8566  C CD1 . LEU B 1 517 ? 26.769  -18.161 74.351  1.00 15.94 ? 516 LEU B CD1 1 
ATOM   8567  C CD2 . LEU B 1 517 ? 29.109  -18.936 73.997  1.00 16.01 ? 516 LEU B CD2 1 
ATOM   8568  N N   . GLY B 1 518 ? 29.920  -15.101 76.081  1.00 19.80 ? 517 GLY B N   1 
ATOM   8569  C CA  . GLY B 1 518 ? 30.289  -13.873 75.407  1.00 20.15 ? 517 GLY B CA  1 
ATOM   8570  C C   . GLY B 1 518 ? 31.793  -13.707 75.303  1.00 19.95 ? 517 GLY B C   1 
ATOM   8571  O O   . GLY B 1 518 ? 32.309  -13.332 74.257  1.00 18.76 ? 517 GLY B O   1 
ATOM   8572  N N   . LYS B 1 519 ? 32.509  -13.997 76.384  1.00 22.08 ? 518 LYS B N   1 
ATOM   8573  C CA  . LYS B 1 519 ? 33.957  -13.849 76.362  1.00 24.14 ? 518 LYS B CA  1 
ATOM   8574  C C   . LYS B 1 519 ? 34.636  -14.855 75.428  1.00 23.89 ? 518 LYS B C   1 
ATOM   8575  O O   . LYS B 1 519 ? 35.637  -14.530 74.790  1.00 23.50 ? 518 LYS B O   1 
ATOM   8576  C CB  . LYS B 1 519 ? 34.525  -13.968 77.778  1.00 27.10 ? 518 LYS B CB  1 
ATOM   8577  C CG  . LYS B 1 519 ? 35.916  -13.358 77.917  1.00 34.10 ? 518 LYS B CG  1 
ATOM   8578  C CD  . LYS B 1 519 ? 36.322  -13.157 79.375  1.00 38.42 ? 518 LYS B CD  1 
ATOM   8579  C CE  . LYS B 1 519 ? 37.639  -12.382 79.466  1.00 41.79 ? 518 LYS B CE  1 
ATOM   8580  N NZ  . LYS B 1 519 ? 38.065  -12.080 80.866  1.00 46.19 ? 518 LYS B NZ  1 
ATOM   8581  N N   . GLN B 1 520 ? 34.096  -16.069 75.336  1.00 22.80 ? 519 GLN B N   1 
ATOM   8582  C CA  . GLN B 1 520 ? 34.683  -17.082 74.458  1.00 21.52 ? 519 GLN B CA  1 
ATOM   8583  C C   . GLN B 1 520 ? 34.492  -16.705 72.989  1.00 20.28 ? 519 GLN B C   1 
ATOM   8584  O O   . GLN B 1 520 ? 35.420  -16.805 72.182  1.00 19.90 ? 519 GLN B O   1 
ATOM   8585  C CB  . GLN B 1 520 ? 34.038  -18.450 74.691  1.00 22.51 ? 519 GLN B CB  1 
ATOM   8586  C CG  . GLN B 1 520 ? 34.088  -18.946 76.121  1.00 24.51 ? 519 GLN B CG  1 
ATOM   8587  C CD  . GLN B 1 520 ? 33.346  -20.258 76.292  1.00 28.83 ? 519 GLN B CD  1 
ATOM   8588  O OE1 . GLN B 1 520 ? 33.860  -21.335 75.959  1.00 29.92 ? 519 GLN B OE1 1 
ATOM   8589  N NE2 . GLN B 1 520 ? 32.119  -20.176 76.792  1.00 28.10 ? 519 GLN B NE2 1 
ATOM   8590  N N   . LEU B 1 521 ? 33.285  -16.269 72.643  1.00 18.08 ? 520 LEU B N   1 
ATOM   8591  C CA  . LEU B 1 521 ? 32.992  -15.910 71.265  1.00 19.04 ? 520 LEU B CA  1 
ATOM   8592  C C   . LEU B 1 521 ? 33.745  -14.670 70.808  1.00 18.83 ? 520 LEU B C   1 
ATOM   8593  O O   . LEU B 1 521 ? 34.033  -14.525 69.624  1.00 20.46 ? 520 LEU B O   1 
ATOM   8594  C CB  . LEU B 1 521 ? 31.482  -15.723 71.070  1.00 17.26 ? 520 LEU B CB  1 
ATOM   8595  C CG  . LEU B 1 521 ? 30.631  -16.951 71.421  1.00 20.39 ? 520 LEU B CG  1 
ATOM   8596  C CD1 . LEU B 1 521 ? 29.212  -16.770 70.883  1.00 21.00 ? 520 LEU B CD1 1 
ATOM   8597  C CD2 . LEU B 1 521 ? 31.258  -18.208 70.825  1.00 20.93 ? 520 LEU B CD2 1 
ATOM   8598  N N   . ALA B 1 522 ? 34.074  -13.781 71.741  1.00 18.83 ? 521 ALA B N   1 
ATOM   8599  C CA  . ALA B 1 522 ? 34.808  -12.569 71.393  1.00 18.81 ? 521 ALA B CA  1 
ATOM   8600  C C   . ALA B 1 522 ? 36.258  -12.912 71.068  1.00 19.24 ? 521 ALA B C   1 
ATOM   8601  O O   . ALA B 1 522 ? 36.825  -12.395 70.104  1.00 19.25 ? 521 ALA B O   1 
ATOM   8602  C CB  . ALA B 1 522 ? 34.745  -11.569 72.535  1.00 19.23 ? 521 ALA B CB  1 
ATOM   8603  N N   . LYS B 1 523 ? 36.862  -13.789 71.865  1.00 21.03 ? 522 LYS B N   1 
ATOM   8604  C CA  . LYS B 1 523 ? 38.247  -14.194 71.613  1.00 22.61 ? 522 LYS B CA  1 
ATOM   8605  C C   . LYS B 1 523 ? 38.390  -14.783 70.211  1.00 22.24 ? 522 LYS B C   1 
ATOM   8606  O O   . LYS B 1 523 ? 39.409  -14.591 69.552  1.00 21.32 ? 522 LYS B O   1 
ATOM   8607  C CB  . LYS B 1 523 ? 38.710  -15.234 72.638  1.00 25.11 ? 522 LYS B CB  1 
ATOM   8608  C CG  . LYS B 1 523 ? 39.004  -14.689 74.025  1.00 29.13 ? 522 LYS B CG  1 
ATOM   8609  C CD  . LYS B 1 523 ? 40.414  -14.093 74.135  1.00 31.82 ? 522 LYS B CD  1 
ATOM   8610  C CE  . LYS B 1 523 ? 40.536  -12.747 73.450  1.00 31.78 ? 522 LYS B CE  1 
ATOM   8611  N NZ  . LYS B 1 523 ? 41.920  -12.199 73.543  1.00 30.06 ? 522 LYS B NZ  1 
ATOM   8612  N N   . LYS B 1 524 ? 37.370  -15.500 69.755  1.00 22.42 ? 523 LYS B N   1 
ATOM   8613  C CA  . LYS B 1 524 ? 37.428  -16.106 68.432  1.00 25.11 ? 523 LYS B CA  1 
ATOM   8614  C C   . LYS B 1 524 ? 37.284  -15.091 67.301  1.00 24.27 ? 523 LYS B C   1 
ATOM   8615  O O   . LYS B 1 524 ? 37.888  -15.237 66.240  1.00 23.15 ? 523 LYS B O   1 
ATOM   8616  C CB  . LYS B 1 524 ? 36.371  -17.209 68.323  1.00 29.14 ? 523 LYS B CB  1 
ATOM   8617  C CG  . LYS B 1 524 ? 36.715  -18.424 69.191  1.00 34.57 ? 523 LYS B CG  1 
ATOM   8618  C CD  . LYS B 1 524 ? 35.807  -19.621 68.941  1.00 38.67 ? 523 LYS B CD  1 
ATOM   8619  C CE  . LYS B 1 524 ? 34.444  -19.457 69.598  1.00 41.87 ? 523 LYS B CE  1 
ATOM   8620  N NZ  . LYS B 1 524 ? 33.552  -20.631 69.329  1.00 42.66 ? 523 LYS B NZ  1 
ATOM   8621  N N   . ILE B 1 525 ? 36.506  -14.043 67.541  1.00 23.75 ? 524 ILE B N   1 
ATOM   8622  C CA  . ILE B 1 525 ? 36.291  -13.007 66.538  1.00 21.18 ? 524 ILE B CA  1 
ATOM   8623  C C   . ILE B 1 525 ? 37.471  -12.040 66.403  1.00 20.75 ? 524 ILE B C   1 
ATOM   8624  O O   . ILE B 1 525 ? 37.762  -11.546 65.307  1.00 20.30 ? 524 ILE B O   1 
ATOM   8625  C CB  . ILE B 1 525 ? 35.004  -12.216 66.868  1.00 20.38 ? 524 ILE B CB  1 
ATOM   8626  C CG1 . ILE B 1 525 ? 33.791  -13.105 66.587  1.00 19.38 ? 524 ILE B CG1 1 
ATOM   8627  C CG2 . ILE B 1 525 ? 34.954  -10.909 66.081  1.00 16.67 ? 524 ILE B CG2 1 
ATOM   8628  C CD1 . ILE B 1 525 ? 32.480  -12.545 67.076  1.00 18.31 ? 524 ILE B CD1 1 
ATOM   8629  N N   . GLU B 1 526 ? 38.155  -11.778 67.509  1.00 18.91 ? 525 GLU B N   1 
ATOM   8630  C CA  . GLU B 1 526 ? 39.285  -10.852 67.501  1.00 19.76 ? 525 GLU B CA  1 
ATOM   8631  C C   . GLU B 1 526 ? 40.261  -11.016 66.333  1.00 19.23 ? 525 GLU B C   1 
ATOM   8632  O O   . GLU B 1 526 ? 40.503  -10.065 65.587  1.00 18.82 ? 525 GLU B O   1 
ATOM   8633  C CB  . GLU B 1 526 ? 40.036  -10.923 68.841  1.00 19.73 ? 525 GLU B CB  1 
ATOM   8634  C CG  . GLU B 1 526 ? 39.351  -10.132 69.952  1.00 21.72 ? 525 GLU B CG  1 
ATOM   8635  C CD  . GLU B 1 526 ? 40.005  -10.302 71.318  1.00 24.63 ? 525 GLU B CD  1 
ATOM   8636  O OE1 . GLU B 1 526 ? 41.222  -10.552 71.381  1.00 27.14 ? 525 GLU B OE1 1 
ATOM   8637  O OE2 . GLU B 1 526 ? 39.296  -10.168 72.336  1.00 27.90 ? 525 GLU B OE2 1 
ATOM   8638  N N   . PRO B 1 527 ? 40.822  -12.222 66.141  1.00 18.47 ? 526 PRO B N   1 
ATOM   8639  C CA  . PRO B 1 527 ? 41.763  -12.380 65.024  1.00 19.81 ? 526 PRO B CA  1 
ATOM   8640  C C   . PRO B 1 527 ? 41.116  -12.273 63.642  1.00 18.31 ? 526 PRO B C   1 
ATOM   8641  O O   . PRO B 1 527 ? 41.764  -11.883 62.668  1.00 18.69 ? 526 PRO B O   1 
ATOM   8642  C CB  . PRO B 1 527 ? 42.387  -13.751 65.291  1.00 19.51 ? 526 PRO B CB  1 
ATOM   8643  C CG  . PRO B 1 527 ? 41.274  -14.496 65.961  1.00 19.73 ? 526 PRO B CG  1 
ATOM   8644  C CD  . PRO B 1 527 ? 40.702  -13.470 66.913  1.00 18.02 ? 526 PRO B CD  1 
ATOM   8645  N N   . GLU B 1 528 ? 39.833  -12.601 63.563  1.00 18.40 ? 527 GLU B N   1 
ATOM   8646  C CA  . GLU B 1 528 ? 39.118  -12.534 62.294  1.00 19.79 ? 527 GLU B CA  1 
ATOM   8647  C C   . GLU B 1 528 ? 38.940  -11.094 61.806  1.00 20.23 ? 527 GLU B C   1 
ATOM   8648  O O   . GLU B 1 528 ? 38.790  -10.857 60.602  1.00 19.26 ? 527 GLU B O   1 
ATOM   8649  C CB  . GLU B 1 528 ? 37.749  -13.210 62.421  1.00 20.51 ? 527 GLU B CB  1 
ATOM   8650  C CG  . GLU B 1 528 ? 37.818  -14.673 62.840  1.00 23.15 ? 527 GLU B CG  1 
ATOM   8651  C CD  . GLU B 1 528 ? 36.446  -15.315 62.930  1.00 25.21 ? 527 GLU B CD  1 
ATOM   8652  O OE1 . GLU B 1 528 ? 35.532  -14.702 63.520  1.00 27.39 ? 527 GLU B OE1 1 
ATOM   8653  O OE2 . GLU B 1 528 ? 36.280  -16.436 62.415  1.00 27.56 ? 527 GLU B OE2 1 
ATOM   8654  N N   . LEU B 1 529 ? 38.956  -10.136 62.733  1.00 18.52 ? 528 LEU B N   1 
ATOM   8655  C CA  . LEU B 1 529 ? 38.799  -8.730  62.368  1.00 19.52 ? 528 LEU B CA  1 
ATOM   8656  C C   . LEU B 1 529 ? 40.051  -8.198  61.676  1.00 21.61 ? 528 LEU B C   1 
ATOM   8657  O O   . LEU B 1 529 ? 39.979  -7.264  60.881  1.00 22.23 ? 528 LEU B O   1 
ATOM   8658  C CB  . LEU B 1 529 ? 38.486  -7.886  63.606  1.00 18.72 ? 528 LEU B CB  1 
ATOM   8659  C CG  . LEU B 1 529 ? 37.178  -8.224  64.324  1.00 19.60 ? 528 LEU B CG  1 
ATOM   8660  C CD1 . LEU B 1 529 ? 37.041  -7.399  65.599  1.00 19.13 ? 528 LEU B CD1 1 
ATOM   8661  C CD2 . LEU B 1 529 ? 36.012  -7.958  63.382  1.00 18.63 ? 528 LEU B CD2 1 
ATOM   8662  N N   . ASP B 1 530 ? 41.197  -8.800  61.982  1.00 23.00 ? 529 ASP B N   1 
ATOM   8663  C CA  . ASP B 1 530 ? 42.463  -8.403  61.369  1.00 23.62 ? 529 ASP B CA  1 
ATOM   8664  C C   . ASP B 1 530 ? 42.462  -8.792  59.893  1.00 23.15 ? 529 ASP B C   1 
ATOM   8665  O O   . ASP B 1 530 ? 42.009  -9.879  59.530  1.00 21.10 ? 529 ASP B O   1 
ATOM   8666  C CB  . ASP B 1 530 ? 43.632  -9.118  62.052  1.00 26.93 ? 529 ASP B CB  1 
ATOM   8667  C CG  . ASP B 1 530 ? 43.789  -8.732  63.505  1.00 30.06 ? 529 ASP B CG  1 
ATOM   8668  O OD1 . ASP B 1 530 ? 44.459  -9.489  64.239  1.00 32.21 ? 529 ASP B OD1 1 
ATOM   8669  O OD2 . ASP B 1 530 ? 43.259  -7.674  63.908  1.00 30.44 ? 529 ASP B OD2 1 
ATOM   8670  N N   . GLY B 1 531 ? 42.976  -7.911  59.043  1.00 23.41 ? 530 GLY B N   1 
ATOM   8671  C CA  . GLY B 1 531 ? 43.031  -8.216  57.624  1.00 24.38 ? 530 GLY B CA  1 
ATOM   8672  C C   . GLY B 1 531 ? 41.776  -7.862  56.851  1.00 23.93 ? 530 GLY B C   1 
ATOM   8673  O O   . GLY B 1 531 ? 40.720  -7.613  57.432  1.00 24.22 ? 530 GLY B O   1 
ATOM   8674  N N   . SER B 1 532 ? 41.891  -7.870  55.526  1.00 23.96 ? 531 SER B N   1 
ATOM   8675  C CA  . SER B 1 532 ? 40.786  -7.513  54.649  1.00 23.99 ? 531 SER B CA  1 
ATOM   8676  C C   . SER B 1 532 ? 39.900  -8.660  54.167  1.00 22.46 ? 531 SER B C   1 
ATOM   8677  O O   . SER B 1 532 ? 38.926  -8.426  53.454  1.00 23.19 ? 531 SER B O   1 
ATOM   8678  C CB  . SER B 1 532 ? 41.348  -6.774  53.436  1.00 26.07 ? 531 SER B CB  1 
ATOM   8679  O OG  . SER B 1 532 ? 42.312  -7.582  52.781  1.00 31.92 ? 531 SER B OG  1 
ATOM   8680  N N   . ALA B 1 533 ? 40.220  -9.893  54.551  1.00 21.82 ? 532 ALA B N   1 
ATOM   8681  C CA  . ALA B 1 533 ? 39.436  -11.050 54.109  1.00 20.96 ? 532 ALA B CA  1 
ATOM   8682  C C   . ALA B 1 533 ? 38.005  -11.096 54.650  1.00 20.98 ? 532 ALA B C   1 
ATOM   8683  O O   . ALA B 1 533 ? 37.744  -10.715 55.794  1.00 20.71 ? 532 ALA B O   1 
ATOM   8684  C CB  . ALA B 1 533 ? 40.169  -12.350 54.477  1.00 18.64 ? 532 ALA B CB  1 
ATOM   8685  N N   . GLN B 1 534 ? 37.082  -11.571 53.819  1.00 21.89 ? 533 GLN B N   1 
ATOM   8686  C CA  . GLN B 1 534 ? 35.682  -11.696 54.219  1.00 23.23 ? 533 GLN B CA  1 
ATOM   8687  C C   . GLN B 1 534 ? 35.612  -12.828 55.233  1.00 22.85 ? 533 GLN B C   1 
ATOM   8688  O O   . GLN B 1 534 ? 36.349  -13.809 55.124  1.00 24.56 ? 533 GLN B O   1 
ATOM   8689  C CB  . GLN B 1 534 ? 34.790  -12.068 53.025  1.00 23.70 ? 533 GLN B CB  1 
ATOM   8690  C CG  . GLN B 1 534 ? 34.723  -11.058 51.891  1.00 27.30 ? 533 GLN B CG  1 
ATOM   8691  C CD  . GLN B 1 534 ? 34.102  -9.740  52.310  1.00 27.86 ? 533 GLN B CD  1 
ATOM   8692  O OE1 . GLN B 1 534 ? 34.775  -8.873  52.853  1.00 32.23 ? 533 GLN B OE1 1 
ATOM   8693  N NE2 . GLN B 1 534 ? 32.810  -9.591  52.067  1.00 27.51 ? 533 GLN B NE2 1 
ATOM   8694  N N   . VAL B 1 535 ? 34.730  -12.698 56.215  1.00 20.69 ? 534 VAL B N   1 
ATOM   8695  C CA  . VAL B 1 535 ? 34.577  -13.736 57.223  1.00 21.28 ? 534 VAL B CA  1 
ATOM   8696  C C   . VAL B 1 535 ? 33.303  -14.503 56.888  1.00 21.13 ? 534 VAL B C   1 
ATOM   8697  O O   . VAL B 1 535 ? 32.290  -13.907 56.545  1.00 18.48 ? 534 VAL B O   1 
ATOM   8698  C CB  . VAL B 1 535 ? 34.473  -13.131 58.644  1.00 22.50 ? 534 VAL B CB  1 
ATOM   8699  C CG1 . VAL B 1 535 ? 34.260  -14.240 59.675  1.00 21.59 ? 534 VAL B CG1 1 
ATOM   8700  C CG2 . VAL B 1 535 ? 35.743  -12.351 58.968  1.00 23.37 ? 534 VAL B CG2 1 
ATOM   8701  N N   . THR B 1 536 ? 33.355  -15.823 56.984  1.00 21.84 ? 535 THR B N   1 
ATOM   8702  C CA  . THR B 1 536 ? 32.194  -16.637 56.650  1.00 24.62 ? 535 THR B CA  1 
ATOM   8703  C C   . THR B 1 536 ? 31.994  -17.749 57.666  1.00 23.89 ? 535 THR B C   1 
ATOM   8704  O O   . THR B 1 536 ? 31.097  -18.577 57.526  1.00 27.42 ? 535 THR B O   1 
ATOM   8705  C CB  . THR B 1 536 ? 32.376  -17.275 55.266  1.00 26.39 ? 535 THR B CB  1 
ATOM   8706  O OG1 . THR B 1 536 ? 33.529  -18.127 55.290  1.00 29.15 ? 535 THR B OG1 1 
ATOM   8707  C CG2 . THR B 1 536 ? 32.586  -16.202 54.206  1.00 28.02 ? 535 THR B CG2 1 
ATOM   8708  N N   . SER B 1 537 ? 32.827  -17.739 58.698  1.00 24.05 ? 536 SER B N   1 
ATOM   8709  C CA  . SER B 1 537 ? 32.817  -18.751 59.744  1.00 23.55 ? 536 SER B CA  1 
ATOM   8710  C C   . SER B 1 537 ? 31.675  -18.720 60.761  1.00 23.86 ? 536 SER B C   1 
ATOM   8711  O O   . SER B 1 537 ? 31.546  -19.649 61.556  1.00 23.19 ? 536 SER B O   1 
ATOM   8712  C CB  . SER B 1 537 ? 34.146  -18.690 60.499  1.00 25.33 ? 536 SER B CB  1 
ATOM   8713  O OG  . SER B 1 537 ? 34.351  -17.395 61.045  1.00 25.47 ? 536 SER B OG  1 
ATOM   8714  N N   . HIS B 1 538 ? 30.852  -17.677 60.745  1.00 21.50 ? 537 HIS B N   1 
ATOM   8715  C CA  . HIS B 1 538 ? 29.756  -17.568 61.710  1.00 20.74 ? 537 HIS B CA  1 
ATOM   8716  C C   . HIS B 1 538 ? 28.388  -17.603 61.034  1.00 20.69 ? 537 HIS B C   1 
ATOM   8717  O O   . HIS B 1 538 ? 28.274  -17.852 59.830  1.00 21.11 ? 537 HIS B O   1 
ATOM   8718  C CB  . HIS B 1 538 ? 29.876  -16.250 62.488  1.00 20.07 ? 537 HIS B CB  1 
ATOM   8719  C CG  . HIS B 1 538 ? 31.198  -16.053 63.169  1.00 20.40 ? 537 HIS B CG  1 
ATOM   8720  N ND1 . HIS B 1 538 ? 31.442  -16.470 64.459  1.00 19.92 ? 537 HIS B ND1 1 
ATOM   8721  C CD2 . HIS B 1 538 ? 32.340  -15.462 62.743  1.00 20.66 ? 537 HIS B CD2 1 
ATOM   8722  C CE1 . HIS B 1 538 ? 32.676  -16.141 64.801  1.00 22.27 ? 537 HIS B CE1 1 
ATOM   8723  N NE2 . HIS B 1 538 ? 33.242  -15.528 63.777  1.00 20.30 ? 537 HIS B NE2 1 
ATOM   8724  N N   . ASP B 1 539 ? 27.347  -17.361 61.825  1.00 20.13 ? 538 ASP B N   1 
ATOM   8725  C CA  . ASP B 1 539 ? 25.985  -17.298 61.303  1.00 19.51 ? 538 ASP B CA  1 
ATOM   8726  C C   . ASP B 1 539 ? 26.035  -16.115 60.330  1.00 19.13 ? 538 ASP B C   1 
ATOM   8727  O O   . ASP B 1 539 ? 26.976  -15.315 60.379  1.00 18.47 ? 538 ASP B O   1 
ATOM   8728  C CB  . ASP B 1 539 ? 25.010  -17.011 62.443  1.00 19.02 ? 538 ASP B CB  1 
ATOM   8729  C CG  . ASP B 1 539 ? 25.296  -15.680 63.122  1.00 22.12 ? 538 ASP B CG  1 
ATOM   8730  O OD1 . ASP B 1 539 ? 24.849  -14.640 62.589  1.00 21.82 ? 538 ASP B OD1 1 
ATOM   8731  O OD2 . ASP B 1 539 ? 25.984  -15.671 64.173  1.00 20.02 ? 538 ASP B OD2 1 
ATOM   8732  N N   . ALA B 1 540 ? 25.035  -15.999 59.460  1.00 18.93 ? 539 ALA B N   1 
ATOM   8733  C CA  . ALA B 1 540 ? 25.000  -14.936 58.453  1.00 19.14 ? 539 ALA B CA  1 
ATOM   8734  C C   . ALA B 1 540 ? 25.041  -13.505 58.996  1.00 20.30 ? 539 ALA B C   1 
ATOM   8735  O O   . ALA B 1 540 ? 25.645  -12.624 58.385  1.00 19.75 ? 539 ALA B O   1 
ATOM   8736  C CB  . ALA B 1 540 ? 23.775  -15.114 57.563  1.00 19.37 ? 539 ALA B CB  1 
ATOM   8737  N N   . SER B 1 541 ? 24.397  -13.271 60.134  1.00 20.45 ? 540 SER B N   1 
ATOM   8738  C CA  . SER B 1 541 ? 24.377  -11.937 60.729  1.00 21.05 ? 540 SER B CA  1 
ATOM   8739  C C   . SER B 1 541 ? 25.762  -11.519 61.224  1.00 19.69 ? 540 SER B C   1 
ATOM   8740  O O   . SER B 1 541 ? 26.229  -10.416 60.925  1.00 19.37 ? 540 SER B O   1 
ATOM   8741  C CB  . SER B 1 541 ? 23.376  -11.892 61.889  1.00 19.48 ? 540 SER B CB  1 
ATOM   8742  O OG  . SER B 1 541 ? 23.427  -10.642 62.548  1.00 19.72 ? 540 SER B OG  1 
ATOM   8743  N N   . THR B 1 542 ? 26.413  -12.393 61.986  1.00 18.71 ? 541 THR B N   1 
ATOM   8744  C CA  . THR B 1 542 ? 27.743  -12.093 62.499  1.00 18.12 ? 541 THR B CA  1 
ATOM   8745  C C   . THR B 1 542 ? 28.693  -11.858 61.325  1.00 19.30 ? 541 THR B C   1 
ATOM   8746  O O   . THR B 1 542 ? 29.507  -10.932 61.349  1.00 18.20 ? 541 THR B O   1 
ATOM   8747  C CB  . THR B 1 542 ? 28.268  -13.239 63.398  1.00 17.68 ? 541 THR B CB  1 
ATOM   8748  O OG1 . THR B 1 542 ? 27.367  -13.429 64.495  1.00 16.54 ? 541 THR B OG1 1 
ATOM   8749  C CG2 . THR B 1 542 ? 29.649  -12.902 63.961  1.00 16.30 ? 541 THR B CG2 1 
ATOM   8750  N N   . ASN B 1 543 ? 28.573  -12.686 60.289  1.00 18.99 ? 542 ASN B N   1 
ATOM   8751  C CA  . ASN B 1 543 ? 29.411  -12.553 59.100  1.00 17.05 ? 542 ASN B CA  1 
ATOM   8752  C C   . ASN B 1 543 ? 29.162  -11.192 58.440  1.00 18.69 ? 542 ASN B C   1 
ATOM   8753  O O   . ASN B 1 543 ? 30.100  -10.453 58.128  1.00 15.55 ? 542 ASN B O   1 
ATOM   8754  C CB  . ASN B 1 543 ? 29.073  -13.642 58.074  1.00 16.53 ? 542 ASN B CB  1 
ATOM   8755  C CG  . ASN B 1 543 ? 29.482  -15.043 58.521  1.00 18.38 ? 542 ASN B CG  1 
ATOM   8756  O OD1 . ASN B 1 543 ? 29.076  -16.036 57.912  1.00 20.14 ? 542 ASN B OD1 1 
ATOM   8757  N ND2 . ASN B 1 543 ? 30.295  -15.128 59.566  1.00 15.58 ? 542 ASN B ND2 1 
ATOM   8758  N N   . GLY B 1 544 ? 27.885  -10.885 58.222  1.00 16.56 ? 543 GLY B N   1 
ATOM   8759  C CA  . GLY B 1 544 ? 27.511  -9.642  57.570  1.00 18.84 ? 543 GLY B CA  1 
ATOM   8760  C C   . GLY B 1 544 ? 27.976  -8.397  58.292  1.00 17.65 ? 543 GLY B C   1 
ATOM   8761  O O   . GLY B 1 544 ? 28.426  -7.437  57.664  1.00 19.20 ? 543 GLY B O   1 
ATOM   8762  N N   . LEU B 1 545 ? 27.854  -8.414  59.615  1.00 16.50 ? 544 LEU B N   1 
ATOM   8763  C CA  . LEU B 1 545 ? 28.263  -7.295  60.448  1.00 16.62 ? 544 LEU B CA  1 
ATOM   8764  C C   . LEU B 1 545 ? 29.777  -7.087  60.348  1.00 17.13 ? 544 LEU B C   1 
ATOM   8765  O O   . LEU B 1 545 ? 30.255  -5.959  60.239  1.00 15.82 ? 544 LEU B O   1 
ATOM   8766  C CB  . LEU B 1 545 ? 27.853  -7.560  61.902  1.00 16.64 ? 544 LEU B CB  1 
ATOM   8767  C CG  . LEU B 1 545 ? 26.354  -7.447  62.208  1.00 15.79 ? 544 LEU B CG  1 
ATOM   8768  C CD1 . LEU B 1 545 ? 26.036  -8.116  63.529  1.00 16.26 ? 544 LEU B CD1 1 
ATOM   8769  C CD2 . LEU B 1 545 ? 25.961  -5.982  62.257  1.00 16.29 ? 544 LEU B CD2 1 
ATOM   8770  N N   . ILE B 1 546 ? 30.527  -8.181  60.375  1.00 15.96 ? 545 ILE B N   1 
ATOM   8771  C CA  . ILE B 1 546 ? 31.979  -8.095  60.285  1.00 18.37 ? 545 ILE B CA  1 
ATOM   8772  C C   . ILE B 1 546 ? 32.425  -7.609  58.913  1.00 17.20 ? 545 ILE B C   1 
ATOM   8773  O O   . ILE B 1 546 ? 33.367  -6.824  58.801  1.00 19.30 ? 545 ILE B O   1 
ATOM   8774  C CB  . ILE B 1 546 ? 32.646  -9.465  60.564  1.00 18.55 ? 545 ILE B CB  1 
ATOM   8775  C CG1 . ILE B 1 546 ? 32.485  -9.825  62.043  1.00 19.41 ? 545 ILE B CG1 1 
ATOM   8776  C CG2 . ILE B 1 546 ? 34.131  -9.419  60.180  1.00 19.30 ? 545 ILE B CG2 1 
ATOM   8777  C CD1 . ILE B 1 546 ? 32.900  -11.245 62.381  1.00 20.01 ? 545 ILE B CD1 1 
ATOM   8778  N N   . ASN B 1 547 ? 31.752  -8.065  57.866  1.00 16.88 ? 546 ASN B N   1 
ATOM   8779  C CA  . ASN B 1 547 ? 32.147  -7.656  56.526  1.00 18.69 ? 546 ASN B CA  1 
ATOM   8780  C C   . ASN B 1 547 ? 31.794  -6.189  56.277  1.00 18.04 ? 546 ASN B C   1 
ATOM   8781  O O   . ASN B 1 547 ? 32.484  -5.490  55.539  1.00 19.04 ? 546 ASN B O   1 
ATOM   8782  C CB  . ASN B 1 547 ? 31.526  -8.605  55.486  1.00 17.62 ? 546 ASN B CB  1 
ATOM   8783  C CG  . ASN B 1 547 ? 32.079  -10.034 55.611  1.00 20.40 ? 546 ASN B CG  1 
ATOM   8784  O OD1 . ASN B 1 547 ? 33.252  -10.224 55.949  1.00 22.14 ? 546 ASN B OD1 1 
ATOM   8785  N ND2 . ASN B 1 547 ? 31.245  -11.031 55.334  1.00 15.70 ? 546 ASN B ND2 1 
ATOM   8786  N N   . PHE B 1 548 ? 30.724  -5.719  56.905  1.00 17.50 ? 547 PHE B N   1 
ATOM   8787  C CA  . PHE B 1 548 ? 30.340  -4.317  56.777  1.00 17.48 ? 547 PHE B CA  1 
ATOM   8788  C C   . PHE B 1 548 ? 31.432  -3.502  57.484  1.00 17.90 ? 547 PHE B C   1 
ATOM   8789  O O   . PHE B 1 548 ? 31.866  -2.460  56.991  1.00 18.30 ? 547 PHE B O   1 
ATOM   8790  C CB  . PHE B 1 548 ? 28.981  -4.073  57.452  1.00 15.38 ? 547 PHE B CB  1 
ATOM   8791  C CG  . PHE B 1 548 ? 28.533  -2.629  57.428  1.00 16.83 ? 547 PHE B CG  1 
ATOM   8792  C CD1 . PHE B 1 548 ? 28.053  -2.051  56.256  1.00 15.53 ? 547 PHE B CD1 1 
ATOM   8793  C CD2 . PHE B 1 548 ? 28.605  -1.846  58.579  1.00 15.57 ? 547 PHE B CD2 1 
ATOM   8794  C CE1 . PHE B 1 548 ? 27.654  -0.717  56.231  1.00 16.10 ? 547 PHE B CE1 1 
ATOM   8795  C CE2 . PHE B 1 548 ? 28.207  -0.510  58.565  1.00 14.70 ? 547 PHE B CE2 1 
ATOM   8796  C CZ  . PHE B 1 548 ? 27.732  0.054   57.393  1.00 16.03 ? 547 PHE B CZ  1 
ATOM   8797  N N   . ILE B 1 549 ? 31.881  -3.989  58.639  1.00 20.14 ? 548 ILE B N   1 
ATOM   8798  C CA  . ILE B 1 549 ? 32.923  -3.301  59.406  1.00 20.61 ? 548 ILE B CA  1 
ATOM   8799  C C   . ILE B 1 549 ? 34.204  -3.150  58.586  1.00 21.18 ? 548 ILE B C   1 
ATOM   8800  O O   . ILE B 1 549 ? 34.782  -2.063  58.507  1.00 21.56 ? 548 ILE B O   1 
ATOM   8801  C CB  . ILE B 1 549 ? 33.278  -4.067  60.703  1.00 21.01 ? 548 ILE B CB  1 
ATOM   8802  C CG1 . ILE B 1 549 ? 32.071  -4.114  61.643  1.00 22.33 ? 548 ILE B CG1 1 
ATOM   8803  C CG2 . ILE B 1 549 ? 34.460  -3.395  61.397  1.00 18.95 ? 548 ILE B CG2 1 
ATOM   8804  C CD1 . ILE B 1 549 ? 31.647  -2.772  62.149  1.00 25.98 ? 548 ILE B CD1 1 
ATOM   8805  N N   . LYS B 1 550 ? 34.651  -4.243  57.982  1.00 20.28 ? 549 LYS B N   1 
ATOM   8806  C CA  . LYS B 1 550 ? 35.864  -4.203  57.178  1.00 21.24 ? 549 LYS B CA  1 
ATOM   8807  C C   . LYS B 1 550 ? 35.691  -3.246  56.003  1.00 21.38 ? 549 LYS B C   1 
ATOM   8808  O O   . LYS B 1 550 ? 36.629  -2.560  55.613  1.00 21.54 ? 549 LYS B O   1 
ATOM   8809  C CB  . LYS B 1 550 ? 36.215  -5.608  56.675  1.00 21.43 ? 549 LYS B CB  1 
ATOM   8810  C CG  . LYS B 1 550 ? 36.494  -6.606  57.800  1.00 22.17 ? 549 LYS B CG  1 
ATOM   8811  C CD  . LYS B 1 550 ? 37.402  -7.743  57.335  1.00 24.28 ? 549 LYS B CD  1 
ATOM   8812  C CE  . LYS B 1 550 ? 37.801  -8.661  58.491  1.00 22.42 ? 549 LYS B CE  1 
ATOM   8813  N NZ  . LYS B 1 550 ? 38.877  -9.632  58.108  1.00 17.94 ? 549 LYS B NZ  1 
ATOM   8814  N N   . GLN B 1 551 ? 34.487  -3.189  55.445  1.00 20.16 ? 550 GLN B N   1 
ATOM   8815  C CA  . GLN B 1 551 ? 34.235  -2.295  54.326  1.00 20.96 ? 550 GLN B CA  1 
ATOM   8816  C C   . GLN B 1 551 ? 34.264  -0.822  54.725  1.00 19.93 ? 550 GLN B C   1 
ATOM   8817  O O   . GLN B 1 551 ? 34.875  -0.006  54.045  1.00 21.36 ? 550 GLN B O   1 
ATOM   8818  C CB  . GLN B 1 551 ? 32.878  -2.594  53.686  1.00 22.05 ? 550 GLN B CB  1 
ATOM   8819  C CG  . GLN B 1 551 ? 32.415  -1.487  52.747  1.00 20.92 ? 550 GLN B CG  1 
ATOM   8820  C CD  . GLN B 1 551 ? 30.994  -1.675  52.270  1.00 23.01 ? 550 GLN B CD  1 
ATOM   8821  O OE1 . GLN B 1 551 ? 30.733  -2.418  51.311  1.00 20.96 ? 550 GLN B OE1 1 
ATOM   8822  N NE2 . GLN B 1 551 ? 30.056  -1.011  52.943  1.00 17.03 ? 550 GLN B NE2 1 
ATOM   8823  N N   . GLN B 1 552 ? 33.610  -0.486  55.830  1.00 20.28 ? 551 GLN B N   1 
ATOM   8824  C CA  . GLN B 1 552 ? 33.525  0.902   56.270  1.00 23.08 ? 551 GLN B CA  1 
ATOM   8825  C C   . GLN B 1 552 ? 34.758  1.399   57.006  1.00 24.79 ? 551 GLN B C   1 
ATOM   8826  O O   . GLN B 1 552 ? 34.929  2.598   57.234  1.00 23.21 ? 551 GLN B O   1 
ATOM   8827  C CB  . GLN B 1 552 ? 32.281  1.086   57.138  1.00 20.36 ? 551 GLN B CB  1 
ATOM   8828  C CG  . GLN B 1 552 ? 30.989  1.033   56.350  1.00 21.41 ? 551 GLN B CG  1 
ATOM   8829  C CD  . GLN B 1 552 ? 30.943  2.075   55.250  1.00 23.19 ? 551 GLN B CD  1 
ATOM   8830  O OE1 . GLN B 1 552 ? 31.008  3.277   55.513  1.00 20.06 ? 551 GLN B OE1 1 
ATOM   8831  N NE2 . GLN B 1 552 ? 30.838  1.618   54.006  1.00 24.53 ? 551 GLN B NE2 1 
ATOM   8832  N N   . ARG B 1 553 ? 35.617  0.459   57.367  1.00 27.46 ? 552 ARG B N   1 
ATOM   8833  C CA  . ARG B 1 553 ? 36.851  0.747   58.074  1.00 31.68 ? 552 ARG B CA  1 
ATOM   8834  C C   . ARG B 1 553 ? 37.709  1.724   57.264  1.00 33.60 ? 552 ARG B C   1 
ATOM   8835  O O   . ARG B 1 553 ? 38.445  2.531   57.827  1.00 33.76 ? 552 ARG B O   1 
ATOM   8836  C CB  . ARG B 1 553 ? 37.591  -0.575  58.293  1.00 32.79 ? 552 ARG B CB  1 
ATOM   8837  C CG  . ARG B 1 553 ? 38.777  -0.519  59.206  1.00 34.94 ? 552 ARG B CG  1 
ATOM   8838  C CD  . ARG B 1 553 ? 38.995  -1.888  59.847  1.00 37.24 ? 552 ARG B CD  1 
ATOM   8839  N NE  . ARG B 1 553 ? 39.356  -2.941  58.899  1.00 34.06 ? 552 ARG B NE  1 
ATOM   8840  C CZ  . ARG B 1 553 ? 39.507  -4.221  59.238  1.00 34.69 ? 552 ARG B CZ  1 
ATOM   8841  N NH1 . ARG B 1 553 ? 39.321  -4.599  60.494  1.00 32.35 ? 552 ARG B NH1 1 
ATOM   8842  N NH2 . ARG B 1 553 ? 39.860  -5.123  58.333  1.00 31.67 ? 552 ARG B NH2 1 
ATOM   8843  N N   . GLU B 1 554 ? 37.592  1.650   55.940  1.00 36.50 ? 553 GLU B N   1 
ATOM   8844  C CA  . GLU B 1 554 ? 38.363  2.500   55.034  1.00 39.62 ? 553 GLU B CA  1 
ATOM   8845  C C   . GLU B 1 554 ? 37.632  3.752   54.552  1.00 39.42 ? 553 GLU B C   1 
ATOM   8846  O O   . GLU B 1 554 ? 38.243  4.636   53.951  1.00 40.28 ? 553 GLU B O   1 
ATOM   8847  C CB  . GLU B 1 554 ? 38.800  1.686   53.812  1.00 43.46 ? 553 GLU B CB  1 
ATOM   8848  C CG  . GLU B 1 554 ? 40.293  1.387   53.749  1.00 49.67 ? 553 GLU B CG  1 
ATOM   8849  C CD  . GLU B 1 554 ? 40.770  0.536   54.909  1.00 52.89 ? 553 GLU B CD  1 
ATOM   8850  O OE1 . GLU B 1 554 ? 40.271  -0.602  55.053  1.00 55.96 ? 553 GLU B OE1 1 
ATOM   8851  O OE2 . GLU B 1 554 ? 41.644  1.003   55.674  1.00 54.64 ? 553 GLU B OE2 1 
ATOM   8852  N N   . ALA B 1 555 ? 36.332  3.827   54.813  1.00 36.59 ? 554 ALA B N   1 
ATOM   8853  C CA  . ALA B 1 555 ? 35.527  4.964   54.378  1.00 36.22 ? 554 ALA B CA  1 
ATOM   8854  C C   . ALA B 1 555 ? 35.968  6.313   54.947  1.00 35.39 ? 554 ALA B C   1 
ATOM   8855  O O   . ALA B 1 555 ? 36.096  6.476   56.156  1.00 34.69 ? 554 ALA B O   1 
ATOM   8856  C CB  . ALA B 1 555 ? 34.057  4.712   54.724  1.00 35.96 ? 554 ALA B CB  1 
ATOM   8857  N N   . ARG B 1 556 ? 36.193  7.282   54.070  1.00 36.33 ? 555 ARG B N   1 
ATOM   8858  C CA  . ARG B 1 556 ? 36.588  8.610   54.514  1.00 39.81 ? 555 ARG B CA  1 
ATOM   8859  C C   . ARG B 1 556 ? 35.345  9.475   54.672  1.00 40.57 ? 555 ARG B C   1 
ATOM   8860  O O   . ARG B 1 556 ? 34.634  9.729   53.704  1.00 41.05 ? 555 ARG B O   1 
ATOM   8861  C CB  . ARG B 1 556 ? 37.544  9.260   53.510  1.00 43.09 ? 555 ARG B CB  1 
ATOM   8862  C CG  . ARG B 1 556 ? 38.885  8.553   53.374  1.00 48.86 ? 555 ARG B CG  1 
ATOM   8863  C CD  . ARG B 1 556 ? 39.479  8.246   54.742  1.00 54.55 ? 555 ARG B CD  1 
ATOM   8864  N NE  . ARG B 1 556 ? 39.448  9.411   55.625  1.00 59.30 ? 555 ARG B NE  1 
ATOM   8865  C CZ  . ARG B 1 556 ? 39.739  9.376   56.923  1.00 60.87 ? 555 ARG B CZ  1 
ATOM   8866  N NH1 . ARG B 1 556 ? 40.086  8.230   57.500  1.00 61.33 ? 555 ARG B NH1 1 
ATOM   8867  N NH2 . ARG B 1 556 ? 39.677  10.488  57.646  1.00 61.61 ? 555 ARG B NH2 1 
ATOM   8868  N N   . VAL B 1 557 ? 35.084  9.915   55.898  1.00 41.95 ? 556 VAL B N   1 
ATOM   8869  C CA  . VAL B 1 557 ? 33.926  10.752  56.190  1.00 44.78 ? 556 VAL B CA  1 
ATOM   8870  C C   . VAL B 1 557 ? 34.295  11.887  57.145  1.00 46.69 ? 556 VAL B C   1 
ATOM   8871  O O   . VAL B 1 557 ? 33.900  13.041  56.877  1.00 47.81 ? 556 VAL B O   1 
ATOM   8872  C CB  . VAL B 1 557 ? 32.784  9.928   56.825  1.00 45.32 ? 556 VAL B CB  1 
ATOM   8873  C CG1 . VAL B 1 557 ? 31.641  10.848  57.219  1.00 46.45 ? 556 VAL B CG1 1 
ATOM   8874  C CG2 . VAL B 1 557 ? 32.290  8.876   55.841  1.00 45.47 ? 556 VAL B CG2 1 
ATOM   8875  N N   . ALA C 1 2   ? 12.680  134.643 144.274 1.00 43.53 ? 1   ALA C N   1 
ATOM   8876  C CA  . ALA C 1 2   ? 13.379  133.660 143.398 1.00 43.50 ? 1   ALA C CA  1 
ATOM   8877  C C   . ALA C 1 2   ? 12.888  133.779 141.958 1.00 42.81 ? 1   ALA C C   1 
ATOM   8878  O O   . ALA C 1 2   ? 11.719  134.076 141.712 1.00 41.02 ? 1   ALA C O   1 
ATOM   8879  C CB  . ALA C 1 2   ? 13.151  132.244 143.916 1.00 43.13 ? 1   ALA C CB  1 
ATOM   8880  N N   . ALA C 1 3   ? 13.790  133.533 141.013 1.00 42.44 ? 2   ALA C N   1 
ATOM   8881  C CA  . ALA C 1 3   ? 13.467  133.625 139.596 1.00 42.26 ? 2   ALA C CA  1 
ATOM   8882  C C   . ALA C 1 3   ? 12.349  132.681 139.179 1.00 42.28 ? 2   ALA C C   1 
ATOM   8883  O O   . ALA C 1 3   ? 11.436  133.071 138.455 1.00 42.11 ? 2   ALA C O   1 
ATOM   8884  C CB  . ALA C 1 3   ? 14.712  133.346 138.767 1.00 42.57 ? 2   ALA C CB  1 
ATOM   8885  N N   . LEU C 1 4   ? 12.422  131.438 139.643 1.00 41.81 ? 3   LEU C N   1 
ATOM   8886  C CA  . LEU C 1 4   ? 11.428  130.433 139.292 1.00 41.17 ? 3   LEU C CA  1 
ATOM   8887  C C   . LEU C 1 4   ? 10.008  130.786 139.728 1.00 41.50 ? 3   LEU C C   1 
ATOM   8888  O O   . LEU C 1 4   ? 9.062   130.637 138.954 1.00 41.49 ? 3   LEU C O   1 
ATOM   8889  C CB  . LEU C 1 4   ? 11.847  129.074 139.868 1.00 40.77 ? 3   LEU C CB  1 
ATOM   8890  C CG  . LEU C 1 4   ? 11.010  127.824 139.572 1.00 41.18 ? 3   LEU C CG  1 
ATOM   8891  C CD1 . LEU C 1 4   ? 9.834   127.774 140.511 1.00 41.29 ? 3   LEU C CD1 1 
ATOM   8892  C CD2 . LEU C 1 4   ? 10.556  127.811 138.117 1.00 39.65 ? 3   LEU C CD2 1 
ATOM   8893  N N   . THR C 1 5   ? 9.852   131.256 140.959 1.00 41.76 ? 4   THR C N   1 
ATOM   8894  C CA  . THR C 1 5   ? 8.527   131.609 141.457 1.00 42.68 ? 4   THR C CA  1 
ATOM   8895  C C   . THR C 1 5   ? 7.919   132.771 140.670 1.00 42.62 ? 4   THR C C   1 
ATOM   8896  O O   . THR C 1 5   ? 6.698   132.887 140.562 1.00 41.20 ? 4   THR C O   1 
ATOM   8897  C CB  . THR C 1 5   ? 8.580   131.982 142.954 1.00 42.53 ? 4   THR C CB  1 
ATOM   8898  O OG1 . THR C 1 5   ? 9.001   130.844 143.714 1.00 43.26 ? 4   THR C OG1 1 
ATOM   8899  C CG2 . THR C 1 5   ? 7.210   132.422 143.445 1.00 42.71 ? 4   THR C CG2 1 
ATOM   8900  N N   . ARG C 1 6   ? 8.779   133.617 140.112 1.00 43.58 ? 5   ARG C N   1 
ATOM   8901  C CA  . ARG C 1 6   ? 8.336   134.775 139.339 1.00 44.36 ? 5   ARG C CA  1 
ATOM   8902  C C   . ARG C 1 6   ? 8.076   134.436 137.877 1.00 43.09 ? 5   ARG C C   1 
ATOM   8903  O O   . ARG C 1 6   ? 7.712   135.309 137.092 1.00 42.89 ? 5   ARG C O   1 
ATOM   8904  C CB  . ARG C 1 6   ? 9.385   135.884 139.409 1.00 45.61 ? 5   ARG C CB  1 
ATOM   8905  C CG  . ARG C 1 6   ? 9.730   136.322 140.816 1.00 49.43 ? 5   ARG C CG  1 
ATOM   8906  C CD  . ARG C 1 6   ? 10.811  137.378 140.797 1.00 52.64 ? 5   ARG C CD  1 
ATOM   8907  N NE  . ARG C 1 6   ? 11.192  137.782 142.145 1.00 58.44 ? 5   ARG C NE  1 
ATOM   8908  C CZ  . ARG C 1 6   ? 12.081  138.733 142.413 1.00 61.80 ? 5   ARG C CZ  1 
ATOM   8909  N NH1 . ARG C 1 6   ? 12.684  139.376 141.419 1.00 63.12 ? 5   ARG C NH1 1 
ATOM   8910  N NH2 . ARG C 1 6   ? 12.364  139.045 143.673 1.00 63.25 ? 5   ARG C NH2 1 
ATOM   8911  N N   . ASP C 1 7   ? 8.267   133.175 137.507 1.00 41.33 ? 6   ASP C N   1 
ATOM   8912  C CA  . ASP C 1 7   ? 8.054   132.765 136.126 1.00 38.51 ? 6   ASP C CA  1 
ATOM   8913  C C   . ASP C 1 7   ? 6.570   132.653 135.807 1.00 37.53 ? 6   ASP C C   1 
ATOM   8914  O O   . ASP C 1 7   ? 5.808   132.022 136.541 1.00 36.93 ? 6   ASP C O   1 
ATOM   8915  C CB  . ASP C 1 7   ? 8.726   131.421 135.844 1.00 39.21 ? 6   ASP C CB  1 
ATOM   8916  C CG  . ASP C 1 7   ? 8.746   131.083 134.363 1.00 38.67 ? 6   ASP C CG  1 
ATOM   8917  O OD1 . ASP C 1 7   ? 9.736   131.432 133.691 1.00 36.87 ? 6   ASP C OD1 1 
ATOM   8918  O OD2 . ASP C 1 7   ? 7.765   130.484 133.869 1.00 39.74 ? 6   ASP C OD2 1 
ATOM   8919  N N   . PRO C 1 8   ? 6.143   133.265 134.694 1.00 36.53 ? 7   PRO C N   1 
ATOM   8920  C CA  . PRO C 1 8   ? 4.746   133.245 134.258 1.00 35.32 ? 7   PRO C CA  1 
ATOM   8921  C C   . PRO C 1 8   ? 4.296   131.816 133.991 1.00 35.10 ? 7   PRO C C   1 
ATOM   8922  O O   . PRO C 1 8   ? 3.205   131.412 134.388 1.00 33.80 ? 7   PRO C O   1 
ATOM   8923  C CB  . PRO C 1 8   ? 4.773   134.082 132.979 1.00 36.75 ? 7   PRO C CB  1 
ATOM   8924  C CG  . PRO C 1 8   ? 5.945   135.004 133.191 1.00 36.36 ? 7   PRO C CG  1 
ATOM   8925  C CD  . PRO C 1 8   ? 6.964   134.066 133.771 1.00 36.72 ? 7   PRO C CD  1 
ATOM   8926  N N   . GLN C 1 9   ? 5.150   131.055 133.309 1.00 35.21 ? 8   GLN C N   1 
ATOM   8927  C CA  . GLN C 1 9   ? 4.838   129.667 132.988 1.00 35.74 ? 8   GLN C CA  1 
ATOM   8928  C C   . GLN C 1 9   ? 4.709   128.840 134.259 1.00 33.80 ? 8   GLN C C   1 
ATOM   8929  O O   . GLN C 1 9   ? 3.817   128.007 134.377 1.00 33.89 ? 8   GLN C O   1 
ATOM   8930  C CB  . GLN C 1 9   ? 5.922   129.070 132.085 1.00 37.96 ? 8   GLN C CB  1 
ATOM   8931  C CG  . GLN C 1 9   ? 6.088   129.804 130.761 1.00 41.74 ? 8   GLN C CG  1 
ATOM   8932  C CD  . GLN C 1 9   ? 4.759   130.056 130.067 1.00 43.50 ? 8   GLN C CD  1 
ATOM   8933  O OE1 . GLN C 1 9   ? 3.985   129.126 129.820 1.00 42.75 ? 8   GLN C OE1 1 
ATOM   8934  N NE2 . GLN C 1 9   ? 4.487   131.321 129.752 1.00 43.71 ? 8   GLN C NE2 1 
ATOM   8935  N N   . PHE C 1 10  ? 5.603   129.074 135.211 1.00 35.20 ? 9   PHE C N   1 
ATOM   8936  C CA  . PHE C 1 10  ? 5.565   128.348 136.474 1.00 35.97 ? 9   PHE C CA  1 
ATOM   8937  C C   . PHE C 1 10  ? 4.226   128.606 137.163 1.00 36.91 ? 9   PHE C C   1 
ATOM   8938  O O   . PHE C 1 10  ? 3.558   127.675 137.621 1.00 37.24 ? 9   PHE C O   1 
ATOM   8939  C CB  . PHE C 1 10  ? 6.721   128.797 137.374 1.00 37.46 ? 9   PHE C CB  1 
ATOM   8940  C CG  . PHE C 1 10  ? 6.756   128.108 138.707 1.00 39.32 ? 9   PHE C CG  1 
ATOM   8941  C CD1 . PHE C 1 10  ? 6.943   126.731 138.790 1.00 39.57 ? 9   PHE C CD1 1 
ATOM   8942  C CD2 . PHE C 1 10  ? 6.581   128.834 139.884 1.00 39.95 ? 9   PHE C CD2 1 
ATOM   8943  C CE1 . PHE C 1 10  ? 6.952   126.083 140.031 1.00 39.40 ? 9   PHE C CE1 1 
ATOM   8944  C CE2 . PHE C 1 10  ? 6.589   128.197 141.125 1.00 39.55 ? 9   PHE C CE2 1 
ATOM   8945  C CZ  . PHE C 1 10  ? 6.774   126.819 141.198 1.00 39.33 ? 9   PHE C CZ  1 
ATOM   8946  N N   . GLN C 1 11  ? 3.823   129.871 137.219 1.00 37.25 ? 10  GLN C N   1 
ATOM   8947  C CA  . GLN C 1 11  ? 2.561   130.224 137.854 1.00 38.43 ? 10  GLN C CA  1 
ATOM   8948  C C   . GLN C 1 11  ? 1.393   129.587 137.105 1.00 38.39 ? 10  GLN C C   1 
ATOM   8949  O O   . GLN C 1 11  ? 0.418   129.148 137.715 1.00 37.97 ? 10  GLN C O   1 
ATOM   8950  C CB  . GLN C 1 11  ? 2.412   131.742 137.900 1.00 41.55 ? 10  GLN C CB  1 
ATOM   8951  C CG  . GLN C 1 11  ? 3.588   132.433 138.576 1.00 44.44 ? 10  GLN C CG  1 
ATOM   8952  C CD  . GLN C 1 11  ? 3.464   133.946 138.579 1.00 47.68 ? 10  GLN C CD  1 
ATOM   8953  O OE1 . GLN C 1 11  ? 4.392   134.656 138.974 1.00 49.04 ? 10  GLN C OE1 1 
ATOM   8954  N NE2 . GLN C 1 11  ? 2.314   134.449 138.142 1.00 48.41 ? 10  GLN C NE2 1 
ATOM   8955  N N   . LYS C 1 12  ? 1.499   129.527 135.780 1.00 38.45 ? 11  LYS C N   1 
ATOM   8956  C CA  . LYS C 1 12  ? 0.455   128.917 134.965 1.00 37.60 ? 11  LYS C CA  1 
ATOM   8957  C C   . LYS C 1 12  ? 0.315   127.439 135.350 1.00 37.50 ? 11  LYS C C   1 
ATOM   8958  O O   . LYS C 1 12  ? -0.799  126.920 135.474 1.00 36.60 ? 11  LYS C O   1 
ATOM   8959  C CB  . LYS C 1 12  ? 0.809   129.044 133.478 1.00 37.94 ? 11  LYS C CB  1 
ATOM   8960  C CG  . LYS C 1 12  ? -0.230  128.454 132.533 1.00 36.14 ? 11  LYS C CG  1 
ATOM   8961  C CD  . LYS C 1 12  ? 0.248   128.502 131.084 1.00 37.59 ? 11  LYS C CD  1 
ATOM   8962  C CE  . LYS C 1 12  ? -0.723  127.783 130.155 1.00 36.32 ? 11  LYS C CE  1 
ATOM   8963  N NZ  . LYS C 1 12  ? -0.195  127.657 128.767 1.00 35.70 ? 11  LYS C NZ  1 
ATOM   8964  N N   . LEU C 1 13  ? 1.453   126.770 135.535 1.00 38.11 ? 12  LEU C N   1 
ATOM   8965  C CA  . LEU C 1 13  ? 1.476   125.358 135.925 1.00 37.53 ? 12  LEU C CA  1 
ATOM   8966  C C   . LEU C 1 13  ? 0.825   125.198 137.290 1.00 36.82 ? 12  LEU C C   1 
ATOM   8967  O O   . LEU C 1 13  ? -0.014  124.321 137.502 1.00 35.03 ? 12  LEU C O   1 
ATOM   8968  C CB  . LEU C 1 13  ? 2.919   124.845 136.020 1.00 39.21 ? 12  LEU C CB  1 
ATOM   8969  C CG  . LEU C 1 13  ? 3.545   124.100 134.840 1.00 41.64 ? 12  LEU C CG  1 
ATOM   8970  C CD1 . LEU C 1 13  ? 5.000   123.798 135.162 1.00 42.19 ? 12  LEU C CD1 1 
ATOM   8971  C CD2 . LEU C 1 13  ? 2.782   122.813 134.565 1.00 39.48 ? 12  LEU C CD2 1 
ATOM   8972  N N   . GLN C 1 14  ? 1.232   126.060 138.214 1.00 36.43 ? 13  GLN C N   1 
ATOM   8973  C CA  . GLN C 1 14  ? 0.721   126.031 139.575 1.00 38.90 ? 13  GLN C CA  1 
ATOM   8974  C C   . GLN C 1 14  ? -0.789  126.250 139.595 1.00 38.78 ? 13  GLN C C   1 
ATOM   8975  O O   . GLN C 1 14  ? -1.521  125.560 140.308 1.00 37.80 ? 13  GLN C O   1 
ATOM   8976  C CB  . GLN C 1 14  ? 1.422   127.105 140.400 1.00 39.71 ? 13  GLN C CB  1 
ATOM   8977  C CG  . GLN C 1 14  ? 1.586   126.751 141.856 1.00 44.19 ? 13  GLN C CG  1 
ATOM   8978  C CD  . GLN C 1 14  ? 3.004   126.969 142.330 1.00 45.42 ? 13  GLN C CD  1 
ATOM   8979  O OE1 . GLN C 1 14  ? 3.557   128.058 142.175 1.00 47.27 ? 13  GLN C OE1 1 
ATOM   8980  N NE2 . GLN C 1 14  ? 3.604   125.933 142.910 1.00 45.90 ? 13  GLN C NE2 1 
ATOM   8981  N N   . GLN C 1 15  ? -1.252  127.210 138.801 1.00 38.87 ? 14  GLN C N   1 
ATOM   8982  C CA  . GLN C 1 15  ? -2.675  127.503 138.734 1.00 39.23 ? 14  GLN C CA  1 
ATOM   8983  C C   . GLN C 1 15  ? -3.419  126.307 138.161 1.00 38.00 ? 14  GLN C C   1 
ATOM   8984  O O   . GLN C 1 15  ? -4.480  125.925 138.659 1.00 37.48 ? 14  GLN C O   1 
ATOM   8985  C CB  . GLN C 1 15  ? -2.927  128.735 137.866 1.00 41.86 ? 14  GLN C CB  1 
ATOM   8986  C CG  . GLN C 1 15  ? -4.382  129.164 137.844 1.00 44.38 ? 14  GLN C CG  1 
ATOM   8987  C CD  . GLN C 1 15  ? -4.978  129.227 139.238 1.00 46.88 ? 14  GLN C CD  1 
ATOM   8988  O OE1 . GLN C 1 15  ? -4.366  129.764 140.164 1.00 48.07 ? 14  GLN C OE1 1 
ATOM   8989  N NE2 . GLN C 1 15  ? -6.179  128.682 139.395 1.00 46.87 ? 14  GLN C NE2 1 
ATOM   8990  N N   . TRP C 1 16  ? -2.861  125.718 137.109 1.00 35.70 ? 15  TRP C N   1 
ATOM   8991  C CA  . TRP C 1 16  ? -3.482  124.556 136.493 1.00 35.19 ? 15  TRP C CA  1 
ATOM   8992  C C   . TRP C 1 16  ? -3.590  123.455 137.545 1.00 34.69 ? 15  TRP C C   1 
ATOM   8993  O O   . TRP C 1 16  ? -4.628  122.802 137.673 1.00 33.98 ? 15  TRP C O   1 
ATOM   8994  C CB  . TRP C 1 16  ? -2.638  124.054 135.318 1.00 34.86 ? 15  TRP C CB  1 
ATOM   8995  C CG  . TRP C 1 16  ? -3.344  123.038 134.475 1.00 34.61 ? 15  TRP C CG  1 
ATOM   8996  C CD1 . TRP C 1 16  ? -4.058  123.273 133.337 1.00 36.06 ? 15  TRP C CD1 1 
ATOM   8997  C CD2 . TRP C 1 16  ? -3.441  121.631 134.726 1.00 34.45 ? 15  TRP C CD2 1 
ATOM   8998  N NE1 . TRP C 1 16  ? -4.595  122.100 132.862 1.00 36.68 ? 15  TRP C NE1 1 
ATOM   8999  C CE2 . TRP C 1 16  ? -4.232  121.076 133.697 1.00 34.48 ? 15  TRP C CE2 1 
ATOM   9000  C CE3 . TRP C 1 16  ? -2.937  120.785 135.721 1.00 34.85 ? 15  TRP C CE3 1 
ATOM   9001  C CZ2 . TRP C 1 16  ? -4.533  119.712 133.633 1.00 35.06 ? 15  TRP C CZ2 1 
ATOM   9002  C CZ3 . TRP C 1 16  ? -3.236  119.425 135.658 1.00 35.71 ? 15  TRP C CZ3 1 
ATOM   9003  C CH2 . TRP C 1 16  ? -4.027  118.905 134.619 1.00 34.42 ? 15  TRP C CH2 1 
ATOM   9004  N N   . TYR C 1 17  ? -2.509  123.265 138.297 1.00 35.43 ? 16  TYR C N   1 
ATOM   9005  C CA  . TYR C 1 17  ? -2.454  122.246 139.343 1.00 37.37 ? 16  TYR C CA  1 
ATOM   9006  C C   . TYR C 1 17  ? -3.593  122.389 140.347 1.00 38.20 ? 16  TYR C C   1 
ATOM   9007  O O   . TYR C 1 17  ? -4.323  121.433 140.613 1.00 37.54 ? 16  TYR C O   1 
ATOM   9008  C CB  . TYR C 1 17  ? -1.100  122.309 140.072 1.00 37.54 ? 16  TYR C CB  1 
ATOM   9009  C CG  . TYR C 1 17  ? -0.998  121.399 141.286 1.00 36.63 ? 16  TYR C CG  1 
ATOM   9010  C CD1 . TYR C 1 17  ? -1.384  121.843 142.552 1.00 37.95 ? 16  TYR C CD1 1 
ATOM   9011  C CD2 . TYR C 1 17  ? -0.541  120.086 141.163 1.00 36.90 ? 16  TYR C CD2 1 
ATOM   9012  C CE1 . TYR C 1 17  ? -1.318  120.999 143.668 1.00 36.82 ? 16  TYR C CE1 1 
ATOM   9013  C CE2 . TYR C 1 17  ? -0.475  119.233 142.272 1.00 36.04 ? 16  TYR C CE2 1 
ATOM   9014  C CZ  . TYR C 1 17  ? -0.865  119.697 143.517 1.00 36.10 ? 16  TYR C CZ  1 
ATOM   9015  O OH  . TYR C 1 17  ? -0.812  118.859 144.607 1.00 35.76 ? 16  TYR C OH  1 
ATOM   9016  N N   . ARG C 1 18  ? -3.746  123.587 140.897 1.00 40.01 ? 17  ARG C N   1 
ATOM   9017  C CA  . ARG C 1 18  ? -4.800  123.841 141.873 1.00 42.98 ? 17  ARG C CA  1 
ATOM   9018  C C   . ARG C 1 18  ? -6.206  123.627 141.314 1.00 44.16 ? 17  ARG C C   1 
ATOM   9019  O O   . ARG C 1 18  ? -7.105  123.185 142.032 1.00 44.80 ? 17  ARG C O   1 
ATOM   9020  C CB  . ARG C 1 18  ? -4.682  125.268 142.415 1.00 43.66 ? 17  ARG C CB  1 
ATOM   9021  C CG  . ARG C 1 18  ? -3.436  125.522 143.251 1.00 45.45 ? 17  ARG C CG  1 
ATOM   9022  C CD  . ARG C 1 18  ? -3.524  126.874 143.937 1.00 47.67 ? 17  ARG C CD  1 
ATOM   9023  N NE  . ARG C 1 18  ? -3.436  127.985 142.993 1.00 49.18 ? 17  ARG C NE  1 
ATOM   9024  C CZ  . ARG C 1 18  ? -2.292  128.475 142.526 1.00 49.41 ? 17  ARG C CZ  1 
ATOM   9025  N NH1 . ARG C 1 18  ? -1.139  127.955 142.919 1.00 49.93 ? 17  ARG C NH1 1 
ATOM   9026  N NH2 . ARG C 1 18  ? -2.300  129.485 141.668 1.00 48.95 ? 17  ARG C NH2 1 
ATOM   9027  N N   . GLU C 1 19  ? -6.392  123.926 140.032 1.00 45.69 ? 18  GLU C N   1 
ATOM   9028  C CA  . GLU C 1 19  ? -7.699  123.785 139.401 1.00 47.86 ? 18  GLU C CA  1 
ATOM   9029  C C   . GLU C 1 19  ? -8.083  122.380 138.956 1.00 48.64 ? 18  GLU C C   1 
ATOM   9030  O O   . GLU C 1 19  ? -9.250  121.998 139.053 1.00 49.09 ? 18  GLU C O   1 
ATOM   9031  C CB  . GLU C 1 19  ? -7.807  124.722 138.197 1.00 49.66 ? 18  GLU C CB  1 
ATOM   9032  C CG  . GLU C 1 19  ? -7.657  126.196 138.530 1.00 53.61 ? 18  GLU C CG  1 
ATOM   9033  C CD  . GLU C 1 19  ? -7.982  127.092 137.347 1.00 56.29 ? 18  GLU C CD  1 
ATOM   9034  O OE1 . GLU C 1 19  ? -7.790  128.322 137.455 1.00 58.82 ? 18  GLU C OE1 1 
ATOM   9035  O OE2 . GLU C 1 19  ? -8.436  126.565 136.309 1.00 57.92 ? 18  GLU C OE2 1 
ATOM   9036  N N   . HIS C 1 20  ? -7.118  121.606 138.468 1.00 49.13 ? 19  HIS C N   1 
ATOM   9037  C CA  . HIS C 1 20  ? -7.431  120.264 137.990 1.00 50.29 ? 19  HIS C CA  1 
ATOM   9038  C C   . HIS C 1 20  ? -6.722  119.128 138.713 1.00 50.67 ? 19  HIS C C   1 
ATOM   9039  O O   . HIS C 1 20  ? -6.779  117.986 138.263 1.00 49.96 ? 19  HIS C O   1 
ATOM   9040  C CB  . HIS C 1 20  ? -7.124  120.157 136.493 1.00 51.32 ? 19  HIS C CB  1 
ATOM   9041  C CG  . HIS C 1 20  ? -7.720  121.257 135.670 1.00 52.13 ? 19  HIS C CG  1 
ATOM   9042  N ND1 . HIS C 1 20  ? -7.277  122.560 135.737 1.00 53.02 ? 19  HIS C ND1 1 
ATOM   9043  C CD2 . HIS C 1 20  ? -8.723  121.247 134.760 1.00 52.91 ? 19  HIS C CD2 1 
ATOM   9044  C CE1 . HIS C 1 20  ? -7.980  123.306 134.904 1.00 53.16 ? 19  HIS C CE1 1 
ATOM   9045  N NE2 . HIS C 1 20  ? -8.864  122.534 134.299 1.00 53.23 ? 19  HIS C NE2 1 
ATOM   9046  N N   . ARG C 1 21  ? -6.069  119.422 139.832 1.00 51.46 ? 20  ARG C N   1 
ATOM   9047  C CA  . ARG C 1 21  ? -5.350  118.382 140.558 1.00 53.00 ? 20  ARG C CA  1 
ATOM   9048  C C   . ARG C 1 21  ? -6.182  117.123 140.783 1.00 53.67 ? 20  ARG C C   1 
ATOM   9049  O O   . ARG C 1 21  ? -5.787  116.037 140.365 1.00 54.02 ? 20  ARG C O   1 
ATOM   9050  C CB  . ARG C 1 21  ? -4.852  118.891 141.911 1.00 53.98 ? 20  ARG C CB  1 
ATOM   9051  C CG  . ARG C 1 21  ? -3.794  117.980 142.499 1.00 56.39 ? 20  ARG C CG  1 
ATOM   9052  C CD  . ARG C 1 21  ? -3.932  117.800 143.993 1.00 59.52 ? 20  ARG C CD  1 
ATOM   9053  N NE  . ARG C 1 21  ? -3.071  116.715 144.461 1.00 63.28 ? 20  ARG C NE  1 
ATOM   9054  C CZ  . ARG C 1 21  ? -3.040  116.264 145.712 1.00 64.28 ? 20  ARG C CZ  1 
ATOM   9055  N NH1 . ARG C 1 21  ? -3.826  116.804 146.635 1.00 65.17 ? 20  ARG C NH1 1 
ATOM   9056  N NH2 . ARG C 1 21  ? -2.221  115.272 146.040 1.00 64.26 ? 20  ARG C NH2 1 
ATOM   9057  N N   . SER C 1 22  ? -7.331  117.263 141.441 1.00 54.36 ? 21  SER C N   1 
ATOM   9058  C CA  . SER C 1 22  ? -8.191  116.113 141.718 1.00 54.51 ? 21  SER C CA  1 
ATOM   9059  C C   . SER C 1 22  ? -8.864  115.569 140.459 1.00 54.36 ? 21  SER C C   1 
ATOM   9060  O O   . SER C 1 22  ? -9.884  114.883 140.531 1.00 55.72 ? 21  SER C O   1 
ATOM   9061  C CB  . SER C 1 22  ? -9.251  116.483 142.762 1.00 55.19 ? 21  SER C CB  1 
ATOM   9062  O OG  . SER C 1 22  ? -10.040 117.581 142.338 1.00 56.29 ? 21  SER C OG  1 
ATOM   9063  N N   . GLU C 1 23  ? -8.278  115.876 139.307 1.00 54.07 ? 22  GLU C N   1 
ATOM   9064  C CA  . GLU C 1 23  ? -8.792  115.427 138.017 1.00 53.03 ? 22  GLU C CA  1 
ATOM   9065  C C   . GLU C 1 23  ? -7.811  114.421 137.413 1.00 51.68 ? 22  GLU C C   1 
ATOM   9066  O O   . GLU C 1 23  ? -8.115  113.756 136.420 1.00 51.39 ? 22  GLU C O   1 
ATOM   9067  C CB  . GLU C 1 23  ? -8.946  116.635 137.088 1.00 55.20 ? 22  GLU C CB  1 
ATOM   9068  C CG  . GLU C 1 23  ? -9.405  116.329 135.670 1.00 58.02 ? 22  GLU C CG  1 
ATOM   9069  C CD  . GLU C 1 23  ? -9.502  117.588 134.816 1.00 59.96 ? 22  GLU C CD  1 
ATOM   9070  O OE1 . GLU C 1 23  ? -10.255 118.509 135.204 1.00 60.53 ? 22  GLU C OE1 1 
ATOM   9071  O OE2 . GLU C 1 23  ? -8.827  117.657 133.763 1.00 59.87 ? 22  GLU C OE2 1 
ATOM   9072  N N   . LEU C 1 24  ? -6.639  114.311 138.036 1.00 49.01 ? 23  LEU C N   1 
ATOM   9073  C CA  . LEU C 1 24  ? -5.580  113.413 137.583 1.00 45.85 ? 23  LEU C CA  1 
ATOM   9074  C C   . LEU C 1 24  ? -5.663  112.020 138.207 1.00 44.07 ? 23  LEU C C   1 
ATOM   9075  O O   . LEU C 1 24  ? -5.198  111.806 139.326 1.00 44.58 ? 23  LEU C O   1 
ATOM   9076  C CB  . LEU C 1 24  ? -4.214  114.030 137.904 1.00 45.16 ? 23  LEU C CB  1 
ATOM   9077  C CG  . LEU C 1 24  ? -3.953  115.452 137.390 1.00 44.22 ? 23  LEU C CG  1 
ATOM   9078  C CD1 . LEU C 1 24  ? -2.684  116.006 138.023 1.00 42.04 ? 23  LEU C CD1 1 
ATOM   9079  C CD2 . LEU C 1 24  ? -3.843  115.441 135.871 1.00 44.14 ? 23  LEU C CD2 1 
ATOM   9080  N N   . ASN C 1 25  ? -6.257  111.078 137.480 1.00 41.39 ? 24  ASN C N   1 
ATOM   9081  C CA  . ASN C 1 25  ? -6.387  109.701 137.949 1.00 39.72 ? 24  ASN C CA  1 
ATOM   9082  C C   . ASN C 1 25  ? -5.890  108.765 136.855 1.00 38.76 ? 24  ASN C C   1 
ATOM   9083  O O   . ASN C 1 25  ? -6.471  108.691 135.772 1.00 38.49 ? 24  ASN C O   1 
ATOM   9084  C CB  . ASN C 1 25  ? -7.844  109.380 138.297 1.00 39.09 ? 24  ASN C CB  1 
ATOM   9085  C CG  . ASN C 1 25  ? -8.052  107.913 138.660 1.00 41.02 ? 24  ASN C CG  1 
ATOM   9086  O OD1 . ASN C 1 25  ? -8.065  107.043 137.790 1.00 39.88 ? 24  ASN C OD1 1 
ATOM   9087  N ND2 . ASN C 1 25  ? -8.205  107.634 139.952 1.00 40.84 ? 24  ASN C ND2 1 
ATOM   9088  N N   . LEU C 1 26  ? -4.813  108.048 137.147 1.00 37.90 ? 25  LEU C N   1 
ATOM   9089  C CA  . LEU C 1 26  ? -4.212  107.140 136.180 1.00 37.48 ? 25  LEU C CA  1 
ATOM   9090  C C   . LEU C 1 26  ? -5.176  106.166 135.507 1.00 38.23 ? 25  LEU C C   1 
ATOM   9091  O O   . LEU C 1 26  ? -5.182  106.058 134.276 1.00 37.45 ? 25  LEU C O   1 
ATOM   9092  C CB  . LEU C 1 26  ? -3.065  106.372 136.838 1.00 35.61 ? 25  LEU C CB  1 
ATOM   9093  C CG  . LEU C 1 26  ? -1.919  107.268 137.308 1.00 34.21 ? 25  LEU C CG  1 
ATOM   9094  C CD1 . LEU C 1 26  ? -0.880  106.429 138.031 1.00 33.37 ? 25  LEU C CD1 1 
ATOM   9095  C CD2 . LEU C 1 26  ? -1.306  107.985 136.107 1.00 34.38 ? 25  LEU C CD2 1 
ATOM   9096  N N   . ARG C 1 27  ? -5.982  105.457 136.294 1.00 38.32 ? 26  ARG C N   1 
ATOM   9097  C CA  . ARG C 1 27  ? -6.929  104.502 135.719 1.00 40.05 ? 26  ARG C CA  1 
ATOM   9098  C C   . ARG C 1 27  ? -7.790  105.128 134.626 1.00 40.50 ? 26  ARG C C   1 
ATOM   9099  O O   . ARG C 1 27  ? -7.957  104.553 133.546 1.00 39.71 ? 26  ARG C O   1 
ATOM   9100  C CB  . ARG C 1 27  ? -7.847  103.916 136.797 1.00 42.03 ? 26  ARG C CB  1 
ATOM   9101  C CG  . ARG C 1 27  ? -7.327  102.659 137.485 1.00 42.96 ? 26  ARG C CG  1 
ATOM   9102  C CD  . ARG C 1 27  ? -8.478  101.925 138.167 1.00 45.42 ? 26  ARG C CD  1 
ATOM   9103  N NE  . ARG C 1 27  ? -8.039  100.782 138.962 1.00 47.85 ? 26  ARG C NE  1 
ATOM   9104  C CZ  . ARG C 1 27  ? -8.857  100.001 139.665 1.00 49.40 ? 26  ARG C CZ  1 
ATOM   9105  N NH1 . ARG C 1 27  ? -10.163 100.238 139.669 1.00 50.32 ? 26  ARG C NH1 1 
ATOM   9106  N NH2 . ARG C 1 27  ? -8.373  98.987  140.372 1.00 49.59 ? 26  ARG C NH2 1 
ATOM   9107  N N   . ARG C 1 28  ? -8.336  106.306 134.910 1.00 41.32 ? 27  ARG C N   1 
ATOM   9108  C CA  . ARG C 1 28  ? -9.186  106.998 133.949 1.00 42.59 ? 27  ARG C CA  1 
ATOM   9109  C C   . ARG C 1 28  ? -8.386  107.512 132.759 1.00 41.69 ? 27  ARG C C   1 
ATOM   9110  O O   . ARG C 1 28  ? -8.885  107.542 131.634 1.00 41.10 ? 27  ARG C O   1 
ATOM   9111  C CB  . ARG C 1 28  ? -9.922  108.154 134.634 1.00 43.67 ? 27  ARG C CB  1 
ATOM   9112  C CG  . ARG C 1 28  ? -10.823 107.693 135.771 1.00 47.24 ? 27  ARG C CG  1 
ATOM   9113  C CD  . ARG C 1 28  ? -11.635 108.833 136.374 1.00 50.72 ? 27  ARG C CD  1 
ATOM   9114  N NE  . ARG C 1 28  ? -10.794 109.921 136.863 1.00 53.08 ? 27  ARG C NE  1 
ATOM   9115  C CZ  . ARG C 1 28  ? -11.219 110.883 137.673 1.00 53.91 ? 27  ARG C CZ  1 
ATOM   9116  N NH1 . ARG C 1 28  ? -12.479 110.887 138.087 1.00 56.27 ? 27  ARG C NH1 1 
ATOM   9117  N NH2 . ARG C 1 28  ? -10.391 111.843 138.065 1.00 55.34 ? 27  ARG C NH2 1 
ATOM   9118  N N   . LEU C 1 29  ? -7.143  107.910 133.004 1.00 41.62 ? 28  LEU C N   1 
ATOM   9119  C CA  . LEU C 1 29  ? -6.290  108.410 131.933 1.00 40.67 ? 28  LEU C CA  1 
ATOM   9120  C C   . LEU C 1 29  ? -6.022  107.319 130.903 1.00 40.79 ? 28  LEU C C   1 
ATOM   9121  O O   . LEU C 1 29  ? -6.172  107.538 129.700 1.00 40.61 ? 28  LEU C O   1 
ATOM   9122  C CB  . LEU C 1 29  ? -4.973  108.937 132.503 1.00 39.48 ? 28  LEU C CB  1 
ATOM   9123  C CG  . LEU C 1 29  ? -5.080  110.258 133.266 1.00 38.13 ? 28  LEU C CG  1 
ATOM   9124  C CD1 . LEU C 1 29  ? -3.716  110.658 133.804 1.00 37.86 ? 28  LEU C CD1 1 
ATOM   9125  C CD2 . LEU C 1 29  ? -5.616  111.334 132.336 1.00 37.85 ? 28  LEU C CD2 1 
ATOM   9126  N N   . PHE C 1 30  ? -5.632  106.138 131.366 1.00 40.12 ? 29  PHE C N   1 
ATOM   9127  C CA  . PHE C 1 30  ? -5.379  105.053 130.434 1.00 40.67 ? 29  PHE C CA  1 
ATOM   9128  C C   . PHE C 1 30  ? -6.679  104.575 129.791 1.00 42.21 ? 29  PHE C C   1 
ATOM   9129  O O   . PHE C 1 30  ? -6.751  104.408 128.573 1.00 41.81 ? 29  PHE C O   1 
ATOM   9130  C CB  . PHE C 1 30  ? -4.664  103.893 131.131 1.00 37.32 ? 29  PHE C CB  1 
ATOM   9131  C CG  . PHE C 1 30  ? -3.191  104.124 131.318 1.00 35.19 ? 29  PHE C CG  1 
ATOM   9132  C CD1 . PHE C 1 30  ? -2.723  104.938 132.345 1.00 34.32 ? 29  PHE C CD1 1 
ATOM   9133  C CD2 . PHE C 1 30  ? -2.272  103.564 130.433 1.00 34.18 ? 29  PHE C CD2 1 
ATOM   9134  C CE1 . PHE C 1 30  ? -1.360  105.195 132.489 1.00 34.45 ? 29  PHE C CE1 1 
ATOM   9135  C CE2 . PHE C 1 30  ? -0.907  103.814 130.566 1.00 34.70 ? 29  PHE C CE2 1 
ATOM   9136  C CZ  . PHE C 1 30  ? -0.450  104.632 131.596 1.00 34.71 ? 29  PHE C CZ  1 
ATOM   9137  N N   . ASP C 1 31  ? -7.709  104.370 130.606 1.00 43.97 ? 30  ASP C N   1 
ATOM   9138  C CA  . ASP C 1 31  ? -8.994  103.918 130.091 1.00 44.96 ? 30  ASP C CA  1 
ATOM   9139  C C   . ASP C 1 31  ? -9.550  104.834 129.004 1.00 43.87 ? 30  ASP C C   1 
ATOM   9140  O O   . ASP C 1 31  ? -10.280 104.380 128.125 1.00 44.70 ? 30  ASP C O   1 
ATOM   9141  C CB  . ASP C 1 31  ? -10.014 103.796 131.229 1.00 48.17 ? 30  ASP C CB  1 
ATOM   9142  C CG  . ASP C 1 31  ? -9.889  102.483 131.991 1.00 51.87 ? 30  ASP C CG  1 
ATOM   9143  O OD1 . ASP C 1 31  ? -8.807  102.210 132.556 1.00 55.02 ? 30  ASP C OD1 1 
ATOM   9144  O OD2 . ASP C 1 31  ? -10.880 101.722 132.022 1.00 53.95 ? 30  ASP C OD2 1 
ATOM   9145  N N   . ALA C 1 32  ? -9.196  106.115 129.051 1.00 42.44 ? 31  ALA C N   1 
ATOM   9146  C CA  . ALA C 1 32  ? -9.688  107.071 128.063 1.00 41.64 ? 31  ALA C CA  1 
ATOM   9147  C C   . ALA C 1 32  ? -8.793  107.252 126.835 1.00 42.06 ? 31  ALA C C   1 
ATOM   9148  O O   . ALA C 1 32  ? -9.243  107.770 125.814 1.00 41.78 ? 31  ALA C O   1 
ATOM   9149  C CB  . ALA C 1 32  ? -9.929  108.422 128.726 1.00 41.85 ? 31  ALA C CB  1 
ATOM   9150  N N   . ASN C 1 33  ? -7.533  106.838 126.929 1.00 42.09 ? 32  ASN C N   1 
ATOM   9151  C CA  . ASN C 1 33  ? -6.608  106.981 125.805 1.00 42.68 ? 32  ASN C CA  1 
ATOM   9152  C C   . ASN C 1 33  ? -5.774  105.718 125.579 1.00 42.89 ? 32  ASN C C   1 
ATOM   9153  O O   . ASN C 1 33  ? -4.826  105.447 126.319 1.00 42.03 ? 32  ASN C O   1 
ATOM   9154  C CB  . ASN C 1 33  ? -5.692  108.189 126.036 1.00 41.36 ? 32  ASN C CB  1 
ATOM   9155  C CG  . ASN C 1 33  ? -4.642  108.346 124.949 1.00 41.78 ? 32  ASN C CG  1 
ATOM   9156  O OD1 . ASN C 1 33  ? -4.764  107.777 123.862 1.00 40.82 ? 32  ASN C OD1 1 
ATOM   9157  N ND2 . ASN C 1 33  ? -3.608  109.131 125.233 1.00 41.13 ? 32  ASN C ND2 1 
ATOM   9158  N N   . LYS C 1 34  ? -6.135  104.952 124.551 1.00 42.82 ? 33  LYS C N   1 
ATOM   9159  C CA  . LYS C 1 34  ? -5.428  103.717 124.236 1.00 43.58 ? 33  LYS C CA  1 
ATOM   9160  C C   . LYS C 1 34  ? -4.012  103.964 123.731 1.00 42.35 ? 33  LYS C C   1 
ATOM   9161  O O   . LYS C 1 34  ? -3.210  103.033 123.628 1.00 42.88 ? 33  LYS C O   1 
ATOM   9162  C CB  . LYS C 1 34  ? -6.204  102.893 123.200 1.00 46.15 ? 33  LYS C CB  1 
ATOM   9163  C CG  . LYS C 1 34  ? -6.504  103.611 121.890 1.00 47.69 ? 33  LYS C CG  1 
ATOM   9164  C CD  . LYS C 1 34  ? -6.735  102.621 120.742 1.00 49.49 ? 33  LYS C CD  1 
ATOM   9165  C CE  . LYS C 1 34  ? -7.696  101.485 121.114 1.00 50.07 ? 33  LYS C CE  1 
ATOM   9166  N NZ  . LYS C 1 34  ? -9.060  101.948 121.502 1.00 49.95 ? 33  LYS C NZ  1 
ATOM   9167  N N   . ASP C 1 35  ? -3.708  105.217 123.418 1.00 39.93 ? 34  ASP C N   1 
ATOM   9168  C CA  . ASP C 1 35  ? -2.383  105.576 122.937 1.00 39.29 ? 34  ASP C CA  1 
ATOM   9169  C C   . ASP C 1 35  ? -1.588  106.360 123.969 1.00 36.13 ? 34  ASP C C   1 
ATOM   9170  O O   . ASP C 1 35  ? -0.622  107.038 123.623 1.00 35.41 ? 34  ASP C O   1 
ATOM   9171  C CB  . ASP C 1 35  ? -2.487  106.399 121.654 1.00 43.14 ? 34  ASP C CB  1 
ATOM   9172  C CG  . ASP C 1 35  ? -2.901  105.562 120.466 1.00 48.03 ? 34  ASP C CG  1 
ATOM   9173  O OD1 . ASP C 1 35  ? -2.148  104.628 120.111 1.00 49.97 ? 34  ASP C OD1 1 
ATOM   9174  O OD2 . ASP C 1 35  ? -3.979  105.835 119.892 1.00 49.87 ? 34  ASP C OD2 1 
ATOM   9175  N N   . ARG C 1 36  ? -1.986  106.269 125.235 1.00 33.06 ? 35  ARG C N   1 
ATOM   9176  C CA  . ARG C 1 36  ? -1.278  106.998 126.279 1.00 30.83 ? 35  ARG C CA  1 
ATOM   9177  C C   . ARG C 1 36  ? 0.180   106.551 126.369 1.00 28.01 ? 35  ARG C C   1 
ATOM   9178  O O   . ARG C 1 36  ? 1.071   107.374 126.571 1.00 27.04 ? 35  ARG C O   1 
ATOM   9179  C CB  . ARG C 1 36  ? -1.960  106.822 127.638 1.00 30.87 ? 35  ARG C CB  1 
ATOM   9180  C CG  . ARG C 1 36  ? -1.319  107.671 128.730 1.00 30.19 ? 35  ARG C CG  1 
ATOM   9181  C CD  . ARG C 1 36  ? -2.045  107.541 130.051 1.00 28.90 ? 35  ARG C CD  1 
ATOM   9182  N NE  . ARG C 1 36  ? -1.352  108.252 131.124 1.00 28.87 ? 35  ARG C NE  1 
ATOM   9183  C CZ  . ARG C 1 36  ? -1.270  109.577 131.235 1.00 27.90 ? 35  ARG C CZ  1 
ATOM   9184  N NH1 . ARG C 1 36  ? -1.841  110.371 130.335 1.00 26.50 ? 35  ARG C NH1 1 
ATOM   9185  N NH2 . ARG C 1 36  ? -0.614  110.108 132.259 1.00 24.10 ? 35  ARG C NH2 1 
ATOM   9186  N N   . PHE C 1 37  ? 0.422   105.253 126.221 1.00 25.35 ? 36  PHE C N   1 
ATOM   9187  C CA  . PHE C 1 37  ? 1.785   104.740 126.274 1.00 25.74 ? 36  PHE C CA  1 
ATOM   9188  C C   . PHE C 1 37  ? 2.626   105.339 125.146 1.00 25.68 ? 36  PHE C C   1 
ATOM   9189  O O   . PHE C 1 37  ? 3.724   105.840 125.383 1.00 25.26 ? 36  PHE C O   1 
ATOM   9190  C CB  . PHE C 1 37  ? 1.794   103.210 126.156 1.00 24.46 ? 36  PHE C CB  1 
ATOM   9191  C CG  . PHE C 1 37  ? 3.172   102.628 125.968 1.00 25.11 ? 36  PHE C CG  1 
ATOM   9192  C CD1 . PHE C 1 37  ? 4.094   102.629 127.014 1.00 22.51 ? 36  PHE C CD1 1 
ATOM   9193  C CD2 . PHE C 1 37  ? 3.561   102.110 124.732 1.00 26.04 ? 36  PHE C CD2 1 
ATOM   9194  C CE1 . PHE C 1 37  ? 5.386   102.124 126.835 1.00 24.33 ? 36  PHE C CE1 1 
ATOM   9195  C CE2 . PHE C 1 37  ? 4.851   101.602 124.537 1.00 25.51 ? 36  PHE C CE2 1 
ATOM   9196  C CZ  . PHE C 1 37  ? 5.766   101.610 125.594 1.00 25.92 ? 36  PHE C CZ  1 
ATOM   9197  N N   . ASN C 1 38  ? 2.103   105.287 123.921 1.00 26.46 ? 37  ASN C N   1 
ATOM   9198  C CA  . ASN C 1 38  ? 2.818   105.814 122.760 1.00 27.31 ? 37  ASN C CA  1 
ATOM   9199  C C   . ASN C 1 38  ? 3.063   107.317 122.853 1.00 27.09 ? 37  ASN C C   1 
ATOM   9200  O O   . ASN C 1 38  ? 4.093   107.818 122.396 1.00 28.54 ? 37  ASN C O   1 
ATOM   9201  C CB  . ASN C 1 38  ? 2.043   105.521 121.470 1.00 30.85 ? 37  ASN C CB  1 
ATOM   9202  C CG  . ASN C 1 38  ? 1.753   104.046 121.281 1.00 34.64 ? 37  ASN C CG  1 
ATOM   9203  O OD1 . ASN C 1 38  ? 2.661   103.214 121.287 1.00 35.49 ? 37  ASN C OD1 1 
ATOM   9204  N ND2 . ASN C 1 38  ? 0.476   103.713 121.106 1.00 38.18 ? 37  ASN C ND2 1 
ATOM   9205  N N   . HIS C 1 39  ? 2.118   108.039 123.440 1.00 25.76 ? 38  HIS C N   1 
ATOM   9206  C CA  . HIS C 1 39  ? 2.246   109.485 123.563 1.00 27.66 ? 38  HIS C CA  1 
ATOM   9207  C C   . HIS C 1 39  ? 3.119   109.906 124.733 1.00 27.45 ? 38  HIS C C   1 
ATOM   9208  O O   . HIS C 1 39  ? 3.693   110.993 124.717 1.00 27.53 ? 38  HIS C O   1 
ATOM   9209  C CB  . HIS C 1 39  ? 0.862   110.120 123.716 1.00 31.58 ? 38  HIS C CB  1 
ATOM   9210  C CG  . HIS C 1 39  ? -0.025  109.923 122.525 1.00 35.40 ? 38  HIS C CG  1 
ATOM   9211  N ND1 . HIS C 1 39  ? -1.391  110.092 122.580 1.00 37.03 ? 38  HIS C ND1 1 
ATOM   9212  C CD2 . HIS C 1 39  ? 0.262   109.581 121.246 1.00 36.45 ? 38  HIS C CD2 1 
ATOM   9213  C CE1 . HIS C 1 39  ? -1.909  109.862 121.386 1.00 38.62 ? 38  HIS C CE1 1 
ATOM   9214  N NE2 . HIS C 1 39  ? -0.927  109.550 120.559 1.00 39.38 ? 38  HIS C NE2 1 
ATOM   9215  N N   . PHE C 1 40  ? 3.226   109.053 125.747 1.00 27.30 ? 39  PHE C N   1 
ATOM   9216  C CA  . PHE C 1 40  ? 4.026   109.401 126.915 1.00 27.14 ? 39  PHE C CA  1 
ATOM   9217  C C   . PHE C 1 40  ? 5.214   108.479 127.198 1.00 27.49 ? 39  PHE C C   1 
ATOM   9218  O O   . PHE C 1 40  ? 5.416   108.034 128.333 1.00 24.49 ? 39  PHE C O   1 
ATOM   9219  C CB  . PHE C 1 40  ? 3.125   109.501 128.150 1.00 28.53 ? 39  PHE C CB  1 
ATOM   9220  C CG  . PHE C 1 40  ? 2.089   110.589 128.056 1.00 31.35 ? 39  PHE C CG  1 
ATOM   9221  C CD1 . PHE C 1 40  ? 0.845   110.339 127.487 1.00 32.84 ? 39  PHE C CD1 1 
ATOM   9222  C CD2 . PHE C 1 40  ? 2.367   111.873 128.520 1.00 32.47 ? 39  PHE C CD2 1 
ATOM   9223  C CE1 . PHE C 1 40  ? -0.111  111.354 127.380 1.00 33.36 ? 39  PHE C CE1 1 
ATOM   9224  C CE2 . PHE C 1 40  ? 1.421   112.892 128.419 1.00 34.00 ? 39  PHE C CE2 1 
ATOM   9225  C CZ  . PHE C 1 40  ? 0.181   112.634 127.848 1.00 32.50 ? 39  PHE C CZ  1 
ATOM   9226  N N   . SER C 1 41  ? 6.002   108.208 126.158 1.00 26.07 ? 40  SER C N   1 
ATOM   9227  C CA  . SER C 1 41  ? 7.183   107.365 126.282 1.00 25.64 ? 40  SER C CA  1 
ATOM   9228  C C   . SER C 1 41  ? 8.171   107.713 125.179 1.00 26.07 ? 40  SER C C   1 
ATOM   9229  O O   . SER C 1 41  ? 7.788   108.227 124.131 1.00 25.08 ? 40  SER C O   1 
ATOM   9230  C CB  . SER C 1 41  ? 6.808   105.883 126.187 1.00 24.72 ? 40  SER C CB  1 
ATOM   9231  O OG  . SER C 1 41  ? 6.241   105.572 124.926 1.00 22.74 ? 40  SER C OG  1 
ATOM   9232  N N   . LEU C 1 42  ? 9.447   107.441 125.429 1.00 26.64 ? 41  LEU C N   1 
ATOM   9233  C CA  . LEU C 1 42  ? 10.495  107.709 124.454 1.00 26.75 ? 41  LEU C CA  1 
ATOM   9234  C C   . LEU C 1 42  ? 11.333  106.461 124.260 1.00 26.58 ? 41  LEU C C   1 
ATOM   9235  O O   . LEU C 1 42  ? 11.747  105.833 125.238 1.00 25.78 ? 41  LEU C O   1 
ATOM   9236  C CB  . LEU C 1 42  ? 11.427  108.820 124.937 1.00 27.57 ? 41  LEU C CB  1 
ATOM   9237  C CG  . LEU C 1 42  ? 10.902  110.236 125.160 1.00 31.46 ? 41  LEU C CG  1 
ATOM   9238  C CD1 . LEU C 1 42  ? 12.063  111.138 125.576 1.00 28.93 ? 41  LEU C CD1 1 
ATOM   9239  C CD2 . LEU C 1 42  ? 10.258  110.754 123.886 1.00 30.90 ? 41  LEU C CD2 1 
ATOM   9240  N N   . THR C 1 43  ? 11.578  106.090 123.008 1.00 24.21 ? 42  THR C N   1 
ATOM   9241  C CA  . THR C 1 43  ? 12.425  104.938 122.737 1.00 24.80 ? 42  THR C CA  1 
ATOM   9242  C C   . THR C 1 43  ? 13.689  105.479 122.081 1.00 24.85 ? 42  THR C C   1 
ATOM   9243  O O   . THR C 1 43  ? 13.635  106.082 121.007 1.00 25.85 ? 42  THR C O   1 
ATOM   9244  C CB  . THR C 1 43  ? 11.751  103.911 121.799 1.00 25.60 ? 42  THR C CB  1 
ATOM   9245  O OG1 . THR C 1 43  ? 11.466  104.521 120.535 1.00 29.24 ? 42  THR C OG1 1 
ATOM   9246  C CG2 . THR C 1 43  ? 10.464  103.392 122.420 1.00 23.63 ? 42  THR C CG2 1 
ATOM   9247  N N   . LEU C 1 44  ? 14.825  105.291 122.741 1.00 23.09 ? 43  LEU C N   1 
ATOM   9248  C CA  . LEU C 1 44  ? 16.085  105.778 122.205 1.00 22.30 ? 43  LEU C CA  1 
ATOM   9249  C C   . LEU C 1 44  ? 16.944  104.640 121.680 1.00 23.86 ? 43  LEU C C   1 
ATOM   9250  O O   . LEU C 1 44  ? 17.135  103.634 122.360 1.00 23.35 ? 43  LEU C O   1 
ATOM   9251  C CB  . LEU C 1 44  ? 16.869  106.524 123.287 1.00 23.06 ? 43  LEU C CB  1 
ATOM   9252  C CG  . LEU C 1 44  ? 16.171  107.668 124.023 1.00 25.39 ? 43  LEU C CG  1 
ATOM   9253  C CD1 . LEU C 1 44  ? 17.173  108.363 124.934 1.00 25.17 ? 43  LEU C CD1 1 
ATOM   9254  C CD2 . LEU C 1 44  ? 15.593  108.644 123.024 1.00 25.70 ? 43  LEU C CD2 1 
ATOM   9255  N N   . ASN C 1 45  ? 17.459  104.795 120.465 1.00 22.10 ? 44  ASN C N   1 
ATOM   9256  C CA  . ASN C 1 45  ? 18.332  103.781 119.903 1.00 22.53 ? 44  ASN C CA  1 
ATOM   9257  C C   . ASN C 1 45  ? 19.734  104.378 119.938 1.00 21.13 ? 44  ASN C C   1 
ATOM   9258  O O   . ASN C 1 45  ? 20.041  105.302 119.190 1.00 20.73 ? 44  ASN C O   1 
ATOM   9259  C CB  . ASN C 1 45  ? 17.929  103.439 118.463 1.00 20.89 ? 44  ASN C CB  1 
ATOM   9260  C CG  . ASN C 1 45  ? 18.748  102.293 117.886 1.00 22.07 ? 44  ASN C CG  1 
ATOM   9261  O OD1 . ASN C 1 45  ? 18.538  101.882 116.745 1.00 24.76 ? 44  ASN C OD1 1 
ATOM   9262  N ND2 . ASN C 1 45  ? 19.685  101.773 118.673 1.00 15.53 ? 44  ASN C ND2 1 
ATOM   9263  N N   . THR C 1 46  ? 20.572  103.859 120.828 1.00 21.03 ? 45  THR C N   1 
ATOM   9264  C CA  . THR C 1 46  ? 21.945  104.347 120.974 1.00 20.53 ? 45  THR C CA  1 
ATOM   9265  C C   . THR C 1 46  ? 22.878  103.636 120.009 1.00 20.73 ? 45  THR C C   1 
ATOM   9266  O O   . THR C 1 46  ? 24.055  103.980 119.914 1.00 22.22 ? 45  THR C O   1 
ATOM   9267  C CB  . THR C 1 46  ? 22.496  104.071 122.385 1.00 20.14 ? 45  THR C CB  1 
ATOM   9268  O OG1 . THR C 1 46  ? 22.710  102.660 122.538 1.00 20.12 ? 45  THR C OG1 1 
ATOM   9269  C CG2 . THR C 1 46  ? 21.515  104.555 123.456 1.00 17.96 ? 45  THR C CG2 1 
ATOM   9270  N N   . ASN C 1 47  ? 22.338  102.648 119.304 1.00 19.15 ? 46  ASN C N   1 
ATOM   9271  C CA  . ASN C 1 47  ? 23.100  101.824 118.374 1.00 21.65 ? 46  ASN C CA  1 
ATOM   9272  C C   . ASN C 1 47  ? 23.874  100.745 119.139 1.00 21.99 ? 46  ASN C C   1 
ATOM   9273  O O   . ASN C 1 47  ? 24.495  99.876  118.536 1.00 22.70 ? 46  ASN C O   1 
ATOM   9274  C CB  . ASN C 1 47  ? 24.050  102.670 117.516 1.00 21.29 ? 46  ASN C CB  1 
ATOM   9275  C CG  . ASN C 1 47  ? 23.324  103.392 116.400 1.00 20.78 ? 46  ASN C CG  1 
ATOM   9276  O OD1 . ASN C 1 47  ? 22.358  102.870 115.846 1.00 20.97 ? 46  ASN C OD1 1 
ATOM   9277  N ND2 . ASN C 1 47  ? 23.786  104.590 116.057 1.00 21.30 ? 46  ASN C ND2 1 
ATOM   9278  N N   . HIS C 1 48  ? 23.812  100.810 120.469 1.00 20.96 ? 47  HIS C N   1 
ATOM   9279  C CA  . HIS C 1 48  ? 24.460  99.841  121.348 1.00 22.42 ? 47  HIS C CA  1 
ATOM   9280  C C   . HIS C 1 48  ? 23.450  99.411  122.413 1.00 22.64 ? 47  HIS C C   1 
ATOM   9281  O O   . HIS C 1 48  ? 23.806  99.092  123.554 1.00 23.06 ? 47  HIS C O   1 
ATOM   9282  C CB  . HIS C 1 48  ? 25.702  100.457 121.999 1.00 23.96 ? 47  HIS C CB  1 
ATOM   9283  C CG  . HIS C 1 48  ? 26.789  100.769 121.020 1.00 27.11 ? 47  HIS C CG  1 
ATOM   9284  N ND1 . HIS C 1 48  ? 27.544  99.789  120.413 1.00 30.06 ? 47  HIS C ND1 1 
ATOM   9285  C CD2 . HIS C 1 48  ? 27.192  101.944 120.480 1.00 28.59 ? 47  HIS C CD2 1 
ATOM   9286  C CE1 . HIS C 1 48  ? 28.364  100.347 119.539 1.00 30.91 ? 47  HIS C CE1 1 
ATOM   9287  N NE2 . HIS C 1 48  ? 28.170  101.653 119.560 1.00 30.18 ? 47  HIS C NE2 1 
ATOM   9288  N N   . GLY C 1 49  ? 22.185  99.402  122.011 1.00 21.56 ? 48  GLY C N   1 
ATOM   9289  C CA  . GLY C 1 49  ? 21.105  99.024  122.900 1.00 21.97 ? 48  GLY C CA  1 
ATOM   9290  C C   . GLY C 1 49  ? 20.022  100.084 122.864 1.00 22.37 ? 48  GLY C C   1 
ATOM   9291  O O   . GLY C 1 49  ? 20.295  101.239 122.531 1.00 22.53 ? 48  GLY C O   1 
ATOM   9292  N N   . HIS C 1 50  ? 18.793  99.699  123.188 1.00 21.63 ? 49  HIS C N   1 
ATOM   9293  C CA  . HIS C 1 50  ? 17.684  100.647 123.195 1.00 21.52 ? 49  HIS C CA  1 
ATOM   9294  C C   . HIS C 1 50  ? 17.291  101.021 124.617 1.00 21.67 ? 49  HIS C C   1 
ATOM   9295  O O   . HIS C 1 50  ? 17.410  100.209 125.537 1.00 21.32 ? 49  HIS C O   1 
ATOM   9296  C CB  . HIS C 1 50  ? 16.465  100.057 122.487 1.00 22.31 ? 49  HIS C CB  1 
ATOM   9297  C CG  . HIS C 1 50  ? 16.588  100.017 120.996 1.00 24.38 ? 49  HIS C CG  1 
ATOM   9298  N ND1 . HIS C 1 50  ? 15.671  100.618 120.158 1.00 24.99 ? 49  HIS C ND1 1 
ATOM   9299  C CD2 . HIS C 1 50  ? 17.502  99.426  120.192 1.00 22.35 ? 49  HIS C CD2 1 
ATOM   9300  C CE1 . HIS C 1 50  ? 16.015  100.397 118.902 1.00 23.43 ? 49  HIS C CE1 1 
ATOM   9301  N NE2 . HIS C 1 50  ? 17.122  99.676  118.895 1.00 24.28 ? 49  HIS C NE2 1 
ATOM   9302  N N   . ILE C 1 51  ? 16.837  102.257 124.794 1.00 21.25 ? 50  ILE C N   1 
ATOM   9303  C CA  . ILE C 1 51  ? 16.391  102.734 126.096 1.00 20.24 ? 50  ILE C CA  1 
ATOM   9304  C C   . ILE C 1 51  ? 14.941  103.191 125.980 1.00 20.52 ? 50  ILE C C   1 
ATOM   9305  O O   . ILE C 1 51  ? 14.633  104.125 125.240 1.00 22.44 ? 50  ILE C O   1 
ATOM   9306  C CB  . ILE C 1 51  ? 17.214  103.932 126.590 1.00 20.92 ? 50  ILE C CB  1 
ATOM   9307  C CG1 . ILE C 1 51  ? 18.699  103.576 126.629 1.00 22.26 ? 50  ILE C CG1 1 
ATOM   9308  C CG2 . ILE C 1 51  ? 16.743  104.337 127.989 1.00 21.52 ? 50  ILE C CG2 1 
ATOM   9309  C CD1 . ILE C 1 51  ? 19.588  104.736 127.029 1.00 22.40 ? 50  ILE C CD1 1 
ATOM   9310  N N   . LEU C 1 52  ? 14.050  102.523 126.696 1.00 19.30 ? 51  LEU C N   1 
ATOM   9311  C CA  . LEU C 1 52  ? 12.645  102.894 126.684 1.00 17.76 ? 51  LEU C CA  1 
ATOM   9312  C C   . LEU C 1 52  ? 12.351  103.685 127.949 1.00 19.63 ? 51  LEU C C   1 
ATOM   9313  O O   . LEU C 1 52  ? 12.424  103.153 129.057 1.00 18.07 ? 51  LEU C O   1 
ATOM   9314  C CB  . LEU C 1 52  ? 11.752  101.650 126.634 1.00 18.02 ? 51  LEU C CB  1 
ATOM   9315  C CG  . LEU C 1 52  ? 10.263  101.842 126.964 1.00 18.14 ? 51  LEU C CG  1 
ATOM   9316  C CD1 . LEU C 1 52  ? 9.644   102.907 126.061 1.00 17.35 ? 51  LEU C CD1 1 
ATOM   9317  C CD2 . LEU C 1 52  ? 9.535   100.507 126.802 1.00 14.72 ? 51  LEU C CD2 1 
ATOM   9318  N N   . VAL C 1 53  ? 12.063  104.970 127.786 1.00 19.99 ? 52  VAL C N   1 
ATOM   9319  C CA  . VAL C 1 53  ? 11.734  105.812 128.927 1.00 21.86 ? 52  VAL C CA  1 
ATOM   9320  C C   . VAL C 1 53  ? 10.215  105.979 128.922 1.00 21.60 ? 52  VAL C C   1 
ATOM   9321  O O   . VAL C 1 53  ? 9.673   106.850 128.237 1.00 20.96 ? 52  VAL C O   1 
ATOM   9322  C CB  . VAL C 1 53  ? 12.416  107.194 128.829 1.00 21.40 ? 52  VAL C CB  1 
ATOM   9323  C CG1 . VAL C 1 53  ? 12.056  108.041 130.048 1.00 24.80 ? 52  VAL C CG1 1 
ATOM   9324  C CG2 . VAL C 1 53  ? 13.922  107.018 128.739 1.00 22.37 ? 52  VAL C CG2 1 
ATOM   9325  N N   . ASP C 1 54  ? 9.539   105.115 129.672 1.00 20.87 ? 53  ASP C N   1 
ATOM   9326  C CA  . ASP C 1 54  ? 8.083   105.133 129.769 1.00 21.45 ? 53  ASP C CA  1 
ATOM   9327  C C   . ASP C 1 54  ? 7.634   105.943 130.975 1.00 23.14 ? 53  ASP C C   1 
ATOM   9328  O O   . ASP C 1 54  ? 7.721   105.482 132.114 1.00 21.94 ? 53  ASP C O   1 
ATOM   9329  C CB  . ASP C 1 54  ? 7.552   103.698 129.876 1.00 20.76 ? 53  ASP C CB  1 
ATOM   9330  C CG  . ASP C 1 54  ? 6.045   103.636 130.055 1.00 19.82 ? 53  ASP C CG  1 
ATOM   9331  O OD1 . ASP C 1 54  ? 5.381   104.692 129.976 1.00 16.59 ? 53  ASP C OD1 1 
ATOM   9332  O OD2 . ASP C 1 54  ? 5.526   102.520 130.273 1.00 17.71 ? 53  ASP C OD2 1 
ATOM   9333  N N   . TYR C 1 55  ? 7.155   107.155 130.713 1.00 23.70 ? 54  TYR C N   1 
ATOM   9334  C CA  . TYR C 1 55  ? 6.684   108.038 131.771 1.00 23.97 ? 54  TYR C CA  1 
ATOM   9335  C C   . TYR C 1 55  ? 5.162   108.218 131.685 1.00 23.75 ? 54  TYR C C   1 
ATOM   9336  O O   . TYR C 1 55  ? 4.617   109.211 132.167 1.00 23.31 ? 54  TYR C O   1 
ATOM   9337  C CB  . TYR C 1 55  ? 7.405   109.397 131.674 1.00 24.59 ? 54  TYR C CB  1 
ATOM   9338  C CG  . TYR C 1 55  ? 7.204   110.124 130.359 1.00 26.45 ? 54  TYR C CG  1 
ATOM   9339  C CD1 . TYR C 1 55  ? 6.058   110.890 130.130 1.00 29.32 ? 54  TYR C CD1 1 
ATOM   9340  C CD2 . TYR C 1 55  ? 8.136   110.009 129.323 1.00 27.10 ? 54  TYR C CD2 1 
ATOM   9341  C CE1 . TYR C 1 55  ? 5.838   111.523 128.902 1.00 28.59 ? 54  TYR C CE1 1 
ATOM   9342  C CE2 . TYR C 1 55  ? 7.925   110.638 128.084 1.00 29.10 ? 54  TYR C CE2 1 
ATOM   9343  C CZ  . TYR C 1 55  ? 6.771   111.393 127.884 1.00 30.25 ? 54  TYR C CZ  1 
ATOM   9344  O OH  . TYR C 1 55  ? 6.539   112.008 126.671 1.00 28.75 ? 54  TYR C OH  1 
ATOM   9345  N N   . SER C 1 56  ? 4.478   107.241 131.092 1.00 22.57 ? 55  SER C N   1 
ATOM   9346  C CA  . SER C 1 56  ? 3.029   107.321 130.933 1.00 22.25 ? 55  SER C CA  1 
ATOM   9347  C C   . SER C 1 56  ? 2.243   107.045 132.214 1.00 23.43 ? 55  SER C C   1 
ATOM   9348  O O   . SER C 1 56  ? 1.062   107.397 132.309 1.00 22.46 ? 55  SER C O   1 
ATOM   9349  C CB  . SER C 1 56  ? 2.555   106.380 129.806 1.00 22.34 ? 55  SER C CB  1 
ATOM   9350  O OG  . SER C 1 56  ? 2.809   105.010 130.092 1.00 21.23 ? 55  SER C OG  1 
ATOM   9351  N N   . LYS C 1 57  ? 2.880   106.416 133.199 1.00 22.55 ? 56  LYS C N   1 
ATOM   9352  C CA  . LYS C 1 57  ? 2.190   106.146 134.456 1.00 20.56 ? 56  LYS C CA  1 
ATOM   9353  C C   . LYS C 1 57  ? 2.372   107.333 135.406 1.00 22.32 ? 56  LYS C C   1 
ATOM   9354  O O   . LYS C 1 57  ? 2.453   107.162 136.624 1.00 19.88 ? 56  LYS C O   1 
ATOM   9355  C CB  . LYS C 1 57  ? 2.713   104.870 135.125 1.00 20.47 ? 56  LYS C CB  1 
ATOM   9356  C CG  . LYS C 1 57  ? 2.389   103.558 134.408 1.00 19.35 ? 56  LYS C CG  1 
ATOM   9357  C CD  . LYS C 1 57  ? 2.537   102.385 135.375 1.00 18.69 ? 56  LYS C CD  1 
ATOM   9358  C CE  . LYS C 1 57  ? 2.404   101.012 134.703 1.00 19.46 ? 56  LYS C CE  1 
ATOM   9359  N NZ  . LYS C 1 57  ? 3.645   100.577 133.981 1.00 17.18 ? 56  LYS C NZ  1 
ATOM   9360  N N   . ASN C 1 58  ? 2.449   108.535 134.840 1.00 21.97 ? 57  ASN C N   1 
ATOM   9361  C CA  . ASN C 1 58  ? 2.603   109.738 135.644 1.00 22.88 ? 57  ASN C CA  1 
ATOM   9362  C C   . ASN C 1 58  ? 1.326   110.559 135.638 1.00 24.66 ? 57  ASN C C   1 
ATOM   9363  O O   . ASN C 1 58  ? 0.545   110.494 134.690 1.00 24.44 ? 57  ASN C O   1 
ATOM   9364  C CB  . ASN C 1 58  ? 3.761   110.588 135.131 1.00 23.84 ? 57  ASN C CB  1 
ATOM   9365  C CG  . ASN C 1 58  ? 5.105   110.080 135.609 1.00 25.19 ? 57  ASN C CG  1 
ATOM   9366  O OD1 . ASN C 1 58  ? 5.375   110.042 136.812 1.00 26.97 ? 57  ASN C OD1 1 
ATOM   9367  N ND2 . ASN C 1 58  ? 5.952   109.685 134.674 1.00 21.50 ? 57  ASN C ND2 1 
ATOM   9368  N N   . LEU C 1 59  ? 1.120   111.322 136.710 1.00 26.97 ? 58  LEU C N   1 
ATOM   9369  C CA  . LEU C 1 59  ? -0.063  112.166 136.856 1.00 26.76 ? 58  LEU C CA  1 
ATOM   9370  C C   . LEU C 1 59  ? 0.104   113.405 135.989 1.00 27.65 ? 58  LEU C C   1 
ATOM   9371  O O   . LEU C 1 59  ? 0.257   114.522 136.486 1.00 25.97 ? 58  LEU C O   1 
ATOM   9372  C CB  . LEU C 1 59  ? -0.246  112.557 138.326 1.00 27.13 ? 58  LEU C CB  1 
ATOM   9373  C CG  . LEU C 1 59  ? -0.356  111.351 139.265 1.00 26.51 ? 58  LEU C CG  1 
ATOM   9374  C CD1 . LEU C 1 59  ? -0.460  111.816 140.710 1.00 27.75 ? 58  LEU C CD1 1 
ATOM   9375  C CD2 . LEU C 1 59  ? -1.565  110.523 138.872 1.00 28.09 ? 58  LEU C CD2 1 
ATOM   9376  N N   . VAL C 1 60  ? 0.072   113.185 134.679 1.00 28.69 ? 59  VAL C N   1 
ATOM   9377  C CA  . VAL C 1 60  ? 0.248   114.261 133.720 1.00 30.58 ? 59  VAL C CA  1 
ATOM   9378  C C   . VAL C 1 60  ? -0.636  114.051 132.492 1.00 30.56 ? 59  VAL C C   1 
ATOM   9379  O O   . VAL C 1 60  ? -1.035  112.925 132.181 1.00 29.55 ? 59  VAL C O   1 
ATOM   9380  C CB  . VAL C 1 60  ? 1.729   114.336 133.270 1.00 31.85 ? 59  VAL C CB  1 
ATOM   9381  C CG1 . VAL C 1 60  ? 2.118   113.057 132.539 1.00 30.92 ? 59  VAL C CG1 1 
ATOM   9382  C CG2 . VAL C 1 60  ? 1.943   115.533 132.378 1.00 34.04 ? 59  VAL C CG2 1 
ATOM   9383  N N   . THR C 1 61  ? -0.950  115.149 131.809 1.00 30.72 ? 60  THR C N   1 
ATOM   9384  C CA  . THR C 1 61  ? -1.761  115.100 130.598 1.00 29.22 ? 60  THR C CA  1 
ATOM   9385  C C   . THR C 1 61  ? -0.995  115.823 129.503 1.00 28.88 ? 60  THR C C   1 
ATOM   9386  O O   . THR C 1 61  ? 0.060   116.399 129.755 1.00 28.11 ? 60  THR C O   1 
ATOM   9387  C CB  . THR C 1 61  ? -3.117  115.807 130.783 1.00 29.35 ? 60  THR C CB  1 
ATOM   9388  O OG1 . THR C 1 61  ? -2.899  117.207 131.011 1.00 29.39 ? 60  THR C OG1 1 
ATOM   9389  C CG2 . THR C 1 61  ? -3.873  115.207 131.962 1.00 26.86 ? 60  THR C CG2 1 
ATOM   9390  N N   . GLU C 1 62  ? -1.529  115.790 128.287 1.00 30.54 ? 61  GLU C N   1 
ATOM   9391  C CA  . GLU C 1 62  ? -0.888  116.456 127.162 1.00 32.16 ? 61  GLU C CA  1 
ATOM   9392  C C   . GLU C 1 62  ? -0.632  117.920 127.511 1.00 30.98 ? 61  GLU C C   1 
ATOM   9393  O O   . GLU C 1 62  ? 0.437   118.459 127.224 1.00 31.51 ? 61  GLU C O   1 
ATOM   9394  C CB  . GLU C 1 62  ? -1.787  116.376 125.926 1.00 35.49 ? 61  GLU C CB  1 
ATOM   9395  C CG  . GLU C 1 62  ? -2.252  114.971 125.568 1.00 41.22 ? 61  GLU C CG  1 
ATOM   9396  C CD  . GLU C 1 62  ? -1.180  114.143 124.881 1.00 45.68 ? 61  GLU C CD  1 
ATOM   9397  O OE1 . GLU C 1 62  ? -1.475  112.985 124.498 1.00 45.97 ? 61  GLU C OE1 1 
ATOM   9398  O OE2 . GLU C 1 62  ? -0.048  114.652 124.718 1.00 47.99 ? 61  GLU C OE2 1 
ATOM   9399  N N   . ASP C 1 63  ? -1.619  118.559 128.138 1.00 30.60 ? 62  ASP C N   1 
ATOM   9400  C CA  . ASP C 1 63  ? -1.500  119.964 128.516 1.00 28.87 ? 62  ASP C CA  1 
ATOM   9401  C C   . ASP C 1 63  ? -0.412  120.206 129.552 1.00 27.76 ? 62  ASP C C   1 
ATOM   9402  O O   . ASP C 1 63  ? 0.318   121.195 129.472 1.00 26.19 ? 62  ASP C O   1 
ATOM   9403  C CB  . ASP C 1 63  ? -2.833  120.499 129.055 1.00 30.57 ? 62  ASP C CB  1 
ATOM   9404  C CG  . ASP C 1 63  ? -3.906  120.590 127.982 1.00 32.69 ? 62  ASP C CG  1 
ATOM   9405  O OD1 . ASP C 1 63  ? -3.584  121.000 126.849 1.00 32.72 ? 62  ASP C OD1 1 
ATOM   9406  O OD2 . ASP C 1 63  ? -5.076  120.265 128.278 1.00 35.52 ? 62  ASP C OD2 1 
ATOM   9407  N N   . VAL C 1 64  ? -0.311  119.312 130.531 1.00 26.49 ? 63  VAL C N   1 
ATOM   9408  C CA  . VAL C 1 64  ? 0.703   119.457 131.569 1.00 27.78 ? 63  VAL C CA  1 
ATOM   9409  C C   . VAL C 1 64  ? 2.107   119.369 130.973 1.00 27.81 ? 63  VAL C C   1 
ATOM   9410  O O   . VAL C 1 64  ? 2.969   120.204 131.265 1.00 28.97 ? 63  VAL C O   1 
ATOM   9411  C CB  . VAL C 1 64  ? 0.554   118.377 132.660 1.00 28.35 ? 63  VAL C CB  1 
ATOM   9412  C CG1 . VAL C 1 64  ? 1.667   118.524 133.686 1.00 25.69 ? 63  VAL C CG1 1 
ATOM   9413  C CG2 . VAL C 1 64  ? -0.812  118.500 133.332 1.00 26.98 ? 63  VAL C CG2 1 
ATOM   9414  N N   . MET C 1 65  ? 2.337   118.356 130.140 1.00 28.08 ? 64  MET C N   1 
ATOM   9415  C CA  . MET C 1 65  ? 3.640   118.194 129.504 1.00 27.57 ? 64  MET C CA  1 
ATOM   9416  C C   . MET C 1 65  ? 3.957   119.441 128.686 1.00 27.17 ? 64  MET C C   1 
ATOM   9417  O O   . MET C 1 65  ? 5.085   119.931 128.703 1.00 28.94 ? 64  MET C O   1 
ATOM   9418  C CB  . MET C 1 65  ? 3.659   116.955 128.601 1.00 27.14 ? 64  MET C CB  1 
ATOM   9419  C CG  . MET C 1 65  ? 3.548   115.623 129.351 1.00 27.80 ? 64  MET C CG  1 
ATOM   9420  S SD  . MET C 1 65  ? 4.680   115.495 130.769 1.00 30.64 ? 64  MET C SD  1 
ATOM   9421  C CE  . MET C 1 65  ? 6.302   115.569 129.961 1.00 26.66 ? 64  MET C CE  1 
ATOM   9422  N N   . ARG C 1 66  ? 2.962   119.955 127.968 1.00 28.01 ? 65  ARG C N   1 
ATOM   9423  C CA  . ARG C 1 66  ? 3.160   121.159 127.164 1.00 29.14 ? 65  ARG C CA  1 
ATOM   9424  C C   . ARG C 1 66  ? 3.594   122.322 128.056 1.00 27.34 ? 65  ARG C C   1 
ATOM   9425  O O   . ARG C 1 66  ? 4.569   123.011 127.763 1.00 26.35 ? 65  ARG C O   1 
ATOM   9426  C CB  . ARG C 1 66  ? 1.871   121.526 126.410 1.00 32.52 ? 65  ARG C CB  1 
ATOM   9427  C CG  . ARG C 1 66  ? 1.890   122.928 125.789 1.00 34.72 ? 65  ARG C CG  1 
ATOM   9428  C CD  . ARG C 1 66  ? 0.718   123.145 124.841 1.00 37.98 ? 65  ARG C CD  1 
ATOM   9429  N NE  . ARG C 1 66  ? -0.580  122.964 125.487 1.00 39.26 ? 65  ARG C NE  1 
ATOM   9430  C CZ  . ARG C 1 66  ? -1.082  123.777 126.413 1.00 40.53 ? 65  ARG C CZ  1 
ATOM   9431  N NH1 . ARG C 1 66  ? -0.396  124.840 126.813 1.00 39.22 ? 65  ARG C NH1 1 
ATOM   9432  N NH2 . ARG C 1 66  ? -2.276  123.527 126.935 1.00 41.24 ? 65  ARG C NH2 1 
ATOM   9433  N N   . MET C 1 67  ? 2.868   122.539 129.147 1.00 27.36 ? 66  MET C N   1 
ATOM   9434  C CA  . MET C 1 67  ? 3.216   123.615 130.062 1.00 27.15 ? 66  MET C CA  1 
ATOM   9435  C C   . MET C 1 67  ? 4.590   123.386 130.677 1.00 26.89 ? 66  MET C C   1 
ATOM   9436  O O   . MET C 1 67  ? 5.335   124.338 130.915 1.00 24.75 ? 66  MET C O   1 
ATOM   9437  C CB  . MET C 1 67  ? 2.170   123.734 131.165 1.00 27.95 ? 66  MET C CB  1 
ATOM   9438  C CG  . MET C 1 67  ? 0.832   124.248 130.673 1.00 28.95 ? 66  MET C CG  1 
ATOM   9439  S SD  . MET C 1 67  ? -0.317  124.445 132.023 1.00 31.23 ? 66  MET C SD  1 
ATOM   9440  C CE  . MET C 1 67  ? -0.820  122.744 132.256 1.00 30.53 ? 66  MET C CE  1 
ATOM   9441  N N   . LEU C 1 68  ? 4.925   122.126 130.942 1.00 26.07 ? 67  LEU C N   1 
ATOM   9442  C CA  . LEU C 1 68  ? 6.230   121.819 131.510 1.00 25.90 ? 67  LEU C CA  1 
ATOM   9443  C C   . LEU C 1 68  ? 7.334   122.212 130.533 1.00 26.18 ? 67  LEU C C   1 
ATOM   9444  O O   . LEU C 1 68  ? 8.305   122.861 130.917 1.00 24.85 ? 67  LEU C O   1 
ATOM   9445  C CB  . LEU C 1 68  ? 6.330   120.333 131.860 1.00 26.37 ? 67  LEU C CB  1 
ATOM   9446  C CG  . LEU C 1 68  ? 5.653   119.959 133.184 1.00 27.27 ? 67  LEU C CG  1 
ATOM   9447  C CD1 . LEU C 1 68  ? 5.759   118.463 133.436 1.00 23.90 ? 67  LEU C CD1 1 
ATOM   9448  C CD2 . LEU C 1 68  ? 6.321   120.729 134.313 1.00 26.44 ? 67  LEU C CD2 1 
ATOM   9449  N N   . VAL C 1 69  ? 7.181   121.828 129.269 1.00 24.89 ? 68  VAL C N   1 
ATOM   9450  C CA  . VAL C 1 69  ? 8.178   122.175 128.261 1.00 25.95 ? 68  VAL C CA  1 
ATOM   9451  C C   . VAL C 1 69  ? 8.287   123.695 128.141 1.00 25.76 ? 68  VAL C C   1 
ATOM   9452  O O   . VAL C 1 69  ? 9.378   124.239 127.985 1.00 24.17 ? 68  VAL C O   1 
ATOM   9453  C CB  . VAL C 1 69  ? 7.819   121.575 126.879 1.00 25.38 ? 68  VAL C CB  1 
ATOM   9454  C CG1 . VAL C 1 69  ? 8.751   122.119 125.812 1.00 25.01 ? 68  VAL C CG1 1 
ATOM   9455  C CG2 . VAL C 1 69  ? 7.938   120.056 126.932 1.00 27.60 ? 68  VAL C CG2 1 
ATOM   9456  N N   . ASP C 1 70  ? 7.152   124.382 128.222 1.00 27.08 ? 69  ASP C N   1 
ATOM   9457  C CA  . ASP C 1 70  ? 7.160   125.836 128.130 1.00 28.92 ? 69  ASP C CA  1 
ATOM   9458  C C   . ASP C 1 70  ? 7.974   126.441 129.265 1.00 28.36 ? 69  ASP C C   1 
ATOM   9459  O O   . ASP C 1 70  ? 8.591   127.489 129.103 1.00 29.01 ? 69  ASP C O   1 
ATOM   9460  C CB  . ASP C 1 70  ? 5.731   126.384 128.155 1.00 30.29 ? 69  ASP C CB  1 
ATOM   9461  C CG  . ASP C 1 70  ? 4.996   126.146 126.847 1.00 33.39 ? 69  ASP C CG  1 
ATOM   9462  O OD1 . ASP C 1 70  ? 5.638   126.269 125.780 1.00 33.65 ? 69  ASP C OD1 1 
ATOM   9463  O OD2 . ASP C 1 70  ? 3.782   125.850 126.880 1.00 35.35 ? 69  ASP C OD2 1 
ATOM   9464  N N   . LEU C 1 71  ? 7.985   125.768 130.413 1.00 28.86 ? 70  LEU C N   1 
ATOM   9465  C CA  . LEU C 1 71  ? 8.735   126.246 131.570 1.00 28.97 ? 70  LEU C CA  1 
ATOM   9466  C C   . LEU C 1 71  ? 10.228  126.154 131.273 1.00 29.27 ? 70  LEU C C   1 
ATOM   9467  O O   . LEU C 1 71  ? 10.980  127.093 131.524 1.00 29.04 ? 70  LEU C O   1 
ATOM   9468  C CB  . LEU C 1 71  ? 8.411   125.395 132.804 1.00 30.88 ? 70  LEU C CB  1 
ATOM   9469  C CG  . LEU C 1 71  ? 8.426   126.045 134.193 1.00 34.69 ? 70  LEU C CG  1 
ATOM   9470  C CD1 . LEU C 1 71  ? 8.516   124.951 135.250 1.00 35.78 ? 70  LEU C CD1 1 
ATOM   9471  C CD2 . LEU C 1 71  ? 9.590   126.994 134.337 1.00 35.17 ? 70  LEU C CD2 1 
ATOM   9472  N N   . ALA C 1 72  ? 10.654  125.009 130.743 1.00 29.41 ? 71  ALA C N   1 
ATOM   9473  C CA  . ALA C 1 72  ? 12.060  124.795 130.413 1.00 29.62 ? 71  ALA C CA  1 
ATOM   9474  C C   . ALA C 1 72  ? 12.548  125.874 129.451 1.00 29.03 ? 71  ALA C C   1 
ATOM   9475  O O   . ALA C 1 72  ? 13.672  126.373 129.569 1.00 29.08 ? 71  ALA C O   1 
ATOM   9476  C CB  . ALA C 1 72  ? 12.250  123.410 129.792 1.00 28.99 ? 71  ALA C CB  1 
ATOM   9477  N N   . LYS C 1 73  ? 11.698  126.221 128.491 1.00 29.48 ? 72  LYS C N   1 
ATOM   9478  C CA  . LYS C 1 73  ? 12.034  127.252 127.517 1.00 30.53 ? 72  LYS C CA  1 
ATOM   9479  C C   . LYS C 1 73  ? 12.081  128.608 128.212 1.00 30.57 ? 72  LYS C C   1 
ATOM   9480  O O   . LYS C 1 73  ? 13.053  129.347 128.088 1.00 31.02 ? 72  LYS C O   1 
ATOM   9481  C CB  . LYS C 1 73  ? 10.995  127.274 126.389 1.00 30.73 ? 72  LYS C CB  1 
ATOM   9482  C CG  . LYS C 1 73  ? 11.095  126.088 125.439 1.00 32.38 ? 72  LYS C CG  1 
ATOM   9483  C CD  . LYS C 1 73  ? 9.996   126.105 124.386 1.00 35.01 ? 72  LYS C CD  1 
ATOM   9484  C CE  . LYS C 1 73  ? 10.234  125.042 123.318 1.00 34.90 ? 72  LYS C CE  1 
ATOM   9485  N NZ  . LYS C 1 73  ? 9.089   124.951 122.363 1.00 38.23 ? 72  LYS C NZ  1 
ATOM   9486  N N   . SER C 1 74  ? 11.030  128.922 128.959 1.00 31.83 ? 73  SER C N   1 
ATOM   9487  C CA  . SER C 1 74  ? 10.960  130.192 129.669 1.00 32.08 ? 73  SER C CA  1 
ATOM   9488  C C   . SER C 1 74  ? 12.159  130.369 130.597 1.00 31.83 ? 73  SER C C   1 
ATOM   9489  O O   . SER C 1 74  ? 12.675  131.477 130.756 1.00 31.73 ? 73  SER C O   1 
ATOM   9490  C CB  . SER C 1 74  ? 9.667   130.268 130.480 1.00 32.37 ? 73  SER C CB  1 
ATOM   9491  O OG  . SER C 1 74  ? 9.526   131.545 131.069 1.00 35.78 ? 73  SER C OG  1 
ATOM   9492  N N   . ARG C 1 75  ? 12.608  129.272 131.200 1.00 29.34 ? 74  ARG C N   1 
ATOM   9493  C CA  . ARG C 1 75  ? 13.740  129.322 132.115 1.00 28.69 ? 74  ARG C CA  1 
ATOM   9494  C C   . ARG C 1 75  ? 15.102  129.283 131.417 1.00 27.59 ? 74  ARG C C   1 
ATOM   9495  O O   . ARG C 1 75  ? 16.140  129.344 132.073 1.00 27.91 ? 74  ARG C O   1 
ATOM   9496  C CB  . ARG C 1 75  ? 13.634  128.185 133.138 1.00 29.38 ? 74  ARG C CB  1 
ATOM   9497  C CG  . ARG C 1 75  ? 12.451  128.322 134.091 1.00 30.70 ? 74  ARG C CG  1 
ATOM   9498  C CD  . ARG C 1 75  ? 12.617  129.527 135.010 1.00 31.11 ? 74  ARG C CD  1 
ATOM   9499  N NE  . ARG C 1 75  ? 13.856  129.435 135.777 1.00 31.69 ? 74  ARG C NE  1 
ATOM   9500  C CZ  . ARG C 1 75  ? 14.728  130.429 135.918 1.00 32.55 ? 74  ARG C CZ  1 
ATOM   9501  N NH1 . ARG C 1 75  ? 14.500  131.604 135.344 1.00 33.68 ? 74  ARG C NH1 1 
ATOM   9502  N NH2 . ARG C 1 75  ? 15.842  130.242 136.615 1.00 30.28 ? 74  ARG C NH2 1 
ATOM   9503  N N   . GLY C 1 76  ? 15.095  129.180 130.091 1.00 25.94 ? 75  GLY C N   1 
ATOM   9504  C CA  . GLY C 1 76  ? 16.341  129.171 129.341 1.00 24.99 ? 75  GLY C CA  1 
ATOM   9505  C C   . GLY C 1 76  ? 17.226  127.945 129.486 1.00 24.28 ? 75  GLY C C   1 
ATOM   9506  O O   . GLY C 1 76  ? 18.448  128.067 129.519 1.00 22.05 ? 75  GLY C O   1 
ATOM   9507  N N   . VAL C 1 77  ? 16.617  126.764 129.556 1.00 25.61 ? 76  VAL C N   1 
ATOM   9508  C CA  . VAL C 1 77  ? 17.366  125.515 129.696 1.00 23.70 ? 76  VAL C CA  1 
ATOM   9509  C C   . VAL C 1 77  ? 18.387  125.298 128.579 1.00 23.88 ? 76  VAL C C   1 
ATOM   9510  O O   . VAL C 1 77  ? 19.551  125.011 128.841 1.00 24.93 ? 76  VAL C O   1 
ATOM   9511  C CB  . VAL C 1 77  ? 16.410  124.292 129.734 1.00 23.58 ? 76  VAL C CB  1 
ATOM   9512  C CG1 . VAL C 1 77  ? 17.198  123.000 129.569 1.00 22.15 ? 76  VAL C CG1 1 
ATOM   9513  C CG2 . VAL C 1 77  ? 15.652  124.266 131.059 1.00 24.13 ? 76  VAL C CG2 1 
ATOM   9514  N N   . GLU C 1 78  ? 17.953  125.444 127.335 1.00 24.55 ? 77  GLU C N   1 
ATOM   9515  C CA  . GLU C 1 78  ? 18.840  125.225 126.198 1.00 25.16 ? 77  GLU C CA  1 
ATOM   9516  C C   . GLU C 1 78  ? 20.042  126.165 126.173 1.00 24.88 ? 77  GLU C C   1 
ATOM   9517  O O   . GLU C 1 78  ? 21.162  125.737 125.888 1.00 24.28 ? 77  GLU C O   1 
ATOM   9518  C CB  . GLU C 1 78  ? 18.034  125.315 124.896 1.00 24.17 ? 77  GLU C CB  1 
ATOM   9519  C CG  . GLU C 1 78  ? 16.781  124.438 124.951 1.00 28.49 ? 77  GLU C CG  1 
ATOM   9520  C CD  . GLU C 1 78  ? 15.925  124.506 123.705 1.00 29.82 ? 77  GLU C CD  1 
ATOM   9521  O OE1 . GLU C 1 78  ? 16.181  123.736 122.759 1.00 30.07 ? 77  GLU C OE1 1 
ATOM   9522  O OE2 . GLU C 1 78  ? 14.989  125.332 123.674 1.00 34.22 ? 77  GLU C OE2 1 
ATOM   9523  N N   . ALA C 1 79  ? 19.825  127.436 126.493 1.00 25.17 ? 78  ALA C N   1 
ATOM   9524  C CA  . ALA C 1 79  ? 20.925  128.395 126.493 1.00 24.13 ? 78  ALA C CA  1 
ATOM   9525  C C   . ALA C 1 79  ? 21.965  128.024 127.546 1.00 24.84 ? 78  ALA C C   1 
ATOM   9526  O O   . ALA C 1 79  ? 23.174  128.112 127.295 1.00 23.78 ? 78  ALA C O   1 
ATOM   9527  C CB  . ALA C 1 79  ? 20.394  129.813 126.749 1.00 24.60 ? 78  ALA C CB  1 
ATOM   9528  N N   . ALA C 1 80  ? 21.494  127.622 128.727 1.00 24.21 ? 79  ALA C N   1 
ATOM   9529  C CA  . ALA C 1 80  ? 22.390  127.229 129.813 1.00 24.54 ? 79  ALA C CA  1 
ATOM   9530  C C   . ALA C 1 80  ? 23.150  125.965 129.403 1.00 24.72 ? 79  ALA C C   1 
ATOM   9531  O O   . ALA C 1 80  ? 24.347  125.835 129.673 1.00 25.92 ? 79  ALA C O   1 
ATOM   9532  C CB  . ALA C 1 80  ? 21.590  126.982 131.097 1.00 24.76 ? 79  ALA C CB  1 
ATOM   9533  N N   . ARG C 1 81  ? 22.453  125.038 128.748 1.00 24.78 ? 80  ARG C N   1 
ATOM   9534  C CA  . ARG C 1 81  ? 23.087  123.807 128.283 1.00 25.09 ? 80  ARG C CA  1 
ATOM   9535  C C   . ARG C 1 81  ? 24.259  124.185 127.386 1.00 25.47 ? 80  ARG C C   1 
ATOM   9536  O O   . ARG C 1 81  ? 25.384  123.730 127.591 1.00 24.54 ? 80  ARG C O   1 
ATOM   9537  C CB  . ARG C 1 81  ? 22.097  122.952 127.482 1.00 25.94 ? 80  ARG C CB  1 
ATOM   9538  C CG  . ARG C 1 81  ? 22.717  121.699 126.856 1.00 25.43 ? 80  ARG C CG  1 
ATOM   9539  C CD  . ARG C 1 81  ? 21.728  120.995 125.940 1.00 26.28 ? 80  ARG C CD  1 
ATOM   9540  N NE  . ARG C 1 81  ? 21.378  121.841 124.802 1.00 28.57 ? 80  ARG C NE  1 
ATOM   9541  C CZ  . ARG C 1 81  ? 20.218  121.792 124.158 1.00 28.02 ? 80  ARG C CZ  1 
ATOM   9542  N NH1 . ARG C 1 81  ? 19.280  120.931 124.533 1.00 28.63 ? 80  ARG C NH1 1 
ATOM   9543  N NH2 . ARG C 1 81  ? 19.988  122.623 123.150 1.00 25.77 ? 80  ARG C NH2 1 
ATOM   9544  N N   . GLU C 1 82  ? 23.990  125.030 126.394 1.00 26.57 ? 81  GLU C N   1 
ATOM   9545  C CA  . GLU C 1 82  ? 25.036  125.462 125.470 1.00 27.84 ? 81  GLU C CA  1 
ATOM   9546  C C   . GLU C 1 82  ? 26.205  126.103 126.203 1.00 27.19 ? 81  GLU C C   1 
ATOM   9547  O O   . GLU C 1 82  ? 27.364  125.872 125.858 1.00 27.56 ? 81  GLU C O   1 
ATOM   9548  C CB  . GLU C 1 82  ? 24.471  126.437 124.430 1.00 27.73 ? 81  GLU C CB  1 
ATOM   9549  C CG  . GLU C 1 82  ? 23.528  125.778 123.430 1.00 29.57 ? 81  GLU C CG  1 
ATOM   9550  C CD  . GLU C 1 82  ? 24.101  124.481 122.877 1.00 30.77 ? 81  GLU C CD  1 
ATOM   9551  O OE1 . GLU C 1 82  ? 25.183  124.520 122.248 1.00 29.64 ? 81  GLU C OE1 1 
ATOM   9552  O OE2 . GLU C 1 82  ? 23.472  123.421 123.084 1.00 32.06 ? 81  GLU C OE2 1 
ATOM   9553  N N   . ARG C 1 83  ? 25.909  126.908 127.217 1.00 27.88 ? 82  ARG C N   1 
ATOM   9554  C CA  . ARG C 1 83  ? 26.976  127.547 127.973 1.00 29.04 ? 82  ARG C CA  1 
ATOM   9555  C C   . ARG C 1 83  ? 27.863  126.498 128.641 1.00 29.18 ? 82  ARG C C   1 
ATOM   9556  O O   . ARG C 1 83  ? 29.086  126.648 128.684 1.00 27.58 ? 82  ARG C O   1 
ATOM   9557  C CB  . ARG C 1 83  ? 26.397  128.498 129.022 1.00 30.97 ? 82  ARG C CB  1 
ATOM   9558  C CG  . ARG C 1 83  ? 26.195  129.929 128.522 1.00 31.58 ? 82  ARG C CG  1 
ATOM   9559  C CD  . ARG C 1 83  ? 25.668  130.814 129.634 1.00 32.78 ? 82  ARG C CD  1 
ATOM   9560  N NE  . ARG C 1 83  ? 24.220  130.698 129.763 1.00 36.75 ? 82  ARG C NE  1 
ATOM   9561  C CZ  . ARG C 1 83  ? 23.576  130.523 130.913 1.00 38.28 ? 82  ARG C CZ  1 
ATOM   9562  N NH1 . ARG C 1 83  ? 24.253  130.438 132.052 1.00 39.02 ? 82  ARG C NH1 1 
ATOM   9563  N NH2 . ARG C 1 83  ? 22.249  130.440 130.922 1.00 35.98 ? 82  ARG C NH2 1 
ATOM   9564  N N   . MET C 1 84  ? 27.252  125.436 129.161 1.00 28.39 ? 83  MET C N   1 
ATOM   9565  C CA  . MET C 1 84  ? 28.027  124.376 129.804 1.00 28.19 ? 83  MET C CA  1 
ATOM   9566  C C   . MET C 1 84  ? 28.915  123.671 128.784 1.00 27.02 ? 83  MET C C   1 
ATOM   9567  O O   . MET C 1 84  ? 30.118  123.496 129.007 1.00 25.69 ? 83  MET C O   1 
ATOM   9568  C CB  . MET C 1 84  ? 27.107  123.341 130.467 1.00 27.72 ? 83  MET C CB  1 
ATOM   9569  C CG  . MET C 1 84  ? 27.865  122.124 131.008 1.00 29.70 ? 83  MET C CG  1 
ATOM   9570  S SD  . MET C 1 84  ? 26.812  120.842 131.737 1.00 30.17 ? 83  MET C SD  1 
ATOM   9571  C CE  . MET C 1 84  ? 27.229  120.983 133.374 1.00 34.74 ? 83  MET C CE  1 
ATOM   9572  N N   . PHE C 1 85  ? 28.310  123.265 127.669 1.00 27.55 ? 84  PHE C N   1 
ATOM   9573  C CA  . PHE C 1 85  ? 29.025  122.566 126.606 1.00 29.42 ? 84  PHE C CA  1 
ATOM   9574  C C   . PHE C 1 85  ? 30.080  123.412 125.901 1.00 30.62 ? 84  PHE C C   1 
ATOM   9575  O O   . PHE C 1 85  ? 31.035  122.873 125.342 1.00 30.00 ? 84  PHE C O   1 
ATOM   9576  C CB  . PHE C 1 85  ? 28.044  122.039 125.550 1.00 29.31 ? 84  PHE C CB  1 
ATOM   9577  C CG  . PHE C 1 85  ? 27.434  120.705 125.883 1.00 27.77 ? 84  PHE C CG  1 
ATOM   9578  C CD1 . PHE C 1 85  ? 26.375  120.606 126.780 1.00 27.51 ? 84  PHE C CD1 1 
ATOM   9579  C CD2 . PHE C 1 85  ? 27.910  119.542 125.281 1.00 29.13 ? 84  PHE C CD2 1 
ATOM   9580  C CE1 . PHE C 1 85  ? 25.798  119.370 127.069 1.00 27.47 ? 84  PHE C CE1 1 
ATOM   9581  C CE2 . PHE C 1 85  ? 27.341  118.304 125.564 1.00 25.17 ? 84  PHE C CE2 1 
ATOM   9582  C CZ  . PHE C 1 85  ? 26.282  118.219 126.458 1.00 26.29 ? 84  PHE C CZ  1 
ATOM   9583  N N   . ASN C 1 86  ? 29.907  124.731 125.907 1.00 31.87 ? 85  ASN C N   1 
ATOM   9584  C CA  . ASN C 1 86  ? 30.870  125.599 125.238 1.00 33.33 ? 85  ASN C CA  1 
ATOM   9585  C C   . ASN C 1 86  ? 32.072  125.941 126.108 1.00 33.59 ? 85  ASN C C   1 
ATOM   9586  O O   . ASN C 1 86  ? 33.008  126.599 125.655 1.00 35.01 ? 85  ASN C O   1 
ATOM   9587  C CB  . ASN C 1 86  ? 30.186  126.877 124.741 1.00 33.35 ? 85  ASN C CB  1 
ATOM   9588  C CG  . ASN C 1 86  ? 29.245  126.614 123.575 1.00 33.90 ? 85  ASN C CG  1 
ATOM   9589  O OD1 . ASN C 1 86  ? 29.555  125.816 122.690 1.00 33.90 ? 85  ASN C OD1 1 
ATOM   9590  N ND2 . ASN C 1 86  ? 28.098  127.286 123.564 1.00 32.77 ? 85  ASN C ND2 1 
ATOM   9591  N N   . GLY C 1 87  ? 32.042  125.491 127.358 1.00 34.09 ? 86  GLY C N   1 
ATOM   9592  C CA  . GLY C 1 87  ? 33.155  125.738 128.259 1.00 33.25 ? 86  GLY C CA  1 
ATOM   9593  C C   . GLY C 1 87  ? 33.090  127.031 129.046 1.00 32.31 ? 86  GLY C C   1 
ATOM   9594  O O   . GLY C 1 87  ? 34.090  127.458 129.622 1.00 31.03 ? 86  GLY C O   1 
ATOM   9595  N N   . GLU C 1 88  ? 31.921  127.659 129.072 1.00 32.28 ? 87  GLU C N   1 
ATOM   9596  C CA  . GLU C 1 88  ? 31.749  128.902 129.808 1.00 33.17 ? 87  GLU C CA  1 
ATOM   9597  C C   . GLU C 1 88  ? 31.727  128.619 131.317 1.00 34.24 ? 87  GLU C C   1 
ATOM   9598  O O   . GLU C 1 88  ? 31.329  127.536 131.745 1.00 32.36 ? 87  GLU C O   1 
ATOM   9599  C CB  . GLU C 1 88  ? 30.456  129.588 129.357 1.00 33.62 ? 87  GLU C CB  1 
ATOM   9600  C CG  . GLU C 1 88  ? 30.494  130.037 127.889 1.00 35.84 ? 87  GLU C CG  1 
ATOM   9601  C CD  . GLU C 1 88  ? 29.232  130.759 127.448 1.00 35.84 ? 87  GLU C CD  1 
ATOM   9602  O OE1 . GLU C 1 88  ? 28.809  131.700 128.148 1.00 35.60 ? 87  GLU C OE1 1 
ATOM   9603  O OE2 . GLU C 1 88  ? 28.668  130.392 126.394 1.00 38.15 ? 87  GLU C OE2 1 
ATOM   9604  N N   . LYS C 1 89  ? 32.167  129.587 132.116 1.00 34.47 ? 88  LYS C N   1 
ATOM   9605  C CA  . LYS C 1 89  ? 32.205  129.423 133.570 1.00 35.56 ? 88  LYS C CA  1 
ATOM   9606  C C   . LYS C 1 89  ? 30.828  129.446 134.228 1.00 33.88 ? 88  LYS C C   1 
ATOM   9607  O O   . LYS C 1 89  ? 30.515  130.390 134.950 1.00 34.09 ? 88  LYS C O   1 
ATOM   9608  C CB  . LYS C 1 89  ? 33.061  130.520 134.209 1.00 37.52 ? 88  LYS C CB  1 
ATOM   9609  C CG  . LYS C 1 89  ? 34.566  130.314 134.116 1.00 40.42 ? 88  LYS C CG  1 
ATOM   9610  C CD  . LYS C 1 89  ? 35.093  130.553 132.720 1.00 42.88 ? 88  LYS C CD  1 
ATOM   9611  C CE  . LYS C 1 89  ? 36.609  130.435 132.694 1.00 43.78 ? 88  LYS C CE  1 
ATOM   9612  N NZ  . LYS C 1 89  ? 37.256  131.381 133.650 1.00 44.49 ? 88  LYS C NZ  1 
ATOM   9613  N N   . ILE C 1 90  ? 30.015  128.413 134.007 1.00 32.09 ? 89  ILE C N   1 
ATOM   9614  C CA  . ILE C 1 90  ? 28.679  128.390 134.604 1.00 30.43 ? 89  ILE C CA  1 
ATOM   9615  C C   . ILE C 1 90  ? 28.684  128.162 136.111 1.00 30.18 ? 89  ILE C C   1 
ATOM   9616  O O   . ILE C 1 90  ? 27.663  128.365 136.770 1.00 30.75 ? 89  ILE C O   1 
ATOM   9617  C CB  . ILE C 1 90  ? 27.750  127.340 133.938 1.00 29.86 ? 89  ILE C CB  1 
ATOM   9618  C CG1 . ILE C 1 90  ? 28.338  125.935 134.074 1.00 27.96 ? 89  ILE C CG1 1 
ATOM   9619  C CG2 . ILE C 1 90  ? 27.520  127.715 132.477 1.00 30.50 ? 89  ILE C CG2 1 
ATOM   9620  C CD1 . ILE C 1 90  ? 27.371  124.847 133.668 1.00 27.24 ? 89  ILE C CD1 1 
ATOM   9621  N N   . ASN C 1 91  ? 29.815  127.720 136.655 1.00 29.31 ? 90  ASN C N   1 
ATOM   9622  C CA  . ASN C 1 91  ? 29.927  127.536 138.102 1.00 28.74 ? 90  ASN C CA  1 
ATOM   9623  C C   . ASN C 1 91  ? 30.343  128.925 138.592 1.00 29.34 ? 90  ASN C C   1 
ATOM   9624  O O   . ASN C 1 91  ? 31.508  129.164 138.916 1.00 27.39 ? 90  ASN C O   1 
ATOM   9625  C CB  . ASN C 1 91  ? 31.011  126.510 138.447 1.00 27.08 ? 90  ASN C CB  1 
ATOM   9626  C CG  . ASN C 1 91  ? 31.224  126.366 139.949 1.00 28.25 ? 90  ASN C CG  1 
ATOM   9627  O OD1 . ASN C 1 91  ? 32.089  125.612 140.392 1.00 28.86 ? 90  ASN C OD1 1 
ATOM   9628  N ND2 . ASN C 1 91  ? 30.434  127.091 140.737 1.00 23.98 ? 90  ASN C ND2 1 
ATOM   9629  N N   . TYR C 1 92  ? 29.375  129.835 138.635 1.00 31.27 ? 91  TYR C N   1 
ATOM   9630  C CA  . TYR C 1 92  ? 29.638  131.214 139.022 1.00 33.69 ? 91  TYR C CA  1 
ATOM   9631  C C   . TYR C 1 92  ? 30.221  131.482 140.404 1.00 34.67 ? 91  TYR C C   1 
ATOM   9632  O O   . TYR C 1 92  ? 31.109  132.324 140.534 1.00 35.94 ? 91  TYR C O   1 
ATOM   9633  C CB  . TYR C 1 92  ? 28.380  132.075 138.820 1.00 34.49 ? 91  TYR C CB  1 
ATOM   9634  C CG  . TYR C 1 92  ? 27.082  131.480 139.333 1.00 37.28 ? 91  TYR C CG  1 
ATOM   9635  C CD1 . TYR C 1 92  ? 26.315  130.633 138.534 1.00 37.16 ? 91  TYR C CD1 1 
ATOM   9636  C CD2 . TYR C 1 92  ? 26.610  131.786 140.610 1.00 37.51 ? 91  TYR C CD2 1 
ATOM   9637  C CE1 . TYR C 1 92  ? 25.103  130.108 138.992 1.00 38.15 ? 91  TYR C CE1 1 
ATOM   9638  C CE2 . TYR C 1 92  ? 25.403  131.266 141.077 1.00 38.90 ? 91  TYR C CE2 1 
ATOM   9639  C CZ  . TYR C 1 92  ? 24.655  130.429 140.264 1.00 38.42 ? 91  TYR C CZ  1 
ATOM   9640  O OH  . TYR C 1 92  ? 23.461  129.916 140.724 1.00 38.22 ? 91  TYR C OH  1 
ATOM   9641  N N   . THR C 1 93  ? 29.750  130.786 141.435 1.00 34.43 ? 92  THR C N   1 
ATOM   9642  C CA  . THR C 1 93  ? 30.279  131.040 142.773 1.00 34.01 ? 92  THR C CA  1 
ATOM   9643  C C   . THR C 1 93  ? 31.768  130.742 142.868 1.00 34.92 ? 92  THR C C   1 
ATOM   9644  O O   . THR C 1 93  ? 32.476  131.354 143.663 1.00 35.84 ? 92  THR C O   1 
ATOM   9645  C CB  . THR C 1 93  ? 29.547  130.221 143.849 1.00 33.86 ? 92  THR C CB  1 
ATOM   9646  O OG1 . THR C 1 93  ? 29.850  128.830 143.684 1.00 32.77 ? 92  THR C OG1 1 
ATOM   9647  C CG2 . THR C 1 93  ? 28.041  130.446 143.750 1.00 32.39 ? 92  THR C CG2 1 
ATOM   9648  N N   . GLU C 1 94  ? 32.250  129.805 142.058 1.00 35.26 ? 93  GLU C N   1 
ATOM   9649  C CA  . GLU C 1 94  ? 33.669  129.465 142.080 1.00 35.13 ? 93  GLU C CA  1 
ATOM   9650  C C   . GLU C 1 94  ? 34.360  129.943 140.804 1.00 35.23 ? 93  GLU C C   1 
ATOM   9651  O O   . GLU C 1 94  ? 35.569  129.780 140.638 1.00 34.82 ? 93  GLU C O   1 
ATOM   9652  C CB  . GLU C 1 94  ? 33.842  127.954 142.248 1.00 36.38 ? 93  GLU C CB  1 
ATOM   9653  C CG  . GLU C 1 94  ? 33.112  127.404 143.467 1.00 37.00 ? 93  GLU C CG  1 
ATOM   9654  C CD  . GLU C 1 94  ? 33.448  125.956 143.753 1.00 37.92 ? 93  GLU C CD  1 
ATOM   9655  O OE1 . GLU C 1 94  ? 33.332  125.124 142.831 1.00 37.21 ? 93  GLU C OE1 1 
ATOM   9656  O OE2 . GLU C 1 94  ? 33.822  125.650 144.906 1.00 39.57 ? 93  GLU C OE2 1 
ATOM   9657  N N   . GLY C 1 95  ? 33.579  130.540 139.910 1.00 35.44 ? 94  GLY C N   1 
ATOM   9658  C CA  . GLY C 1 95  ? 34.121  131.045 138.662 1.00 35.21 ? 94  GLY C CA  1 
ATOM   9659  C C   . GLY C 1 95  ? 34.833  129.980 137.855 1.00 35.11 ? 94  GLY C C   1 
ATOM   9660  O O   . GLY C 1 95  ? 35.944  130.190 137.373 1.00 35.86 ? 94  GLY C O   1 
ATOM   9661  N N   . ARG C 1 96  ? 34.199  128.827 137.701 1.00 34.52 ? 95  ARG C N   1 
ATOM   9662  C CA  . ARG C 1 96  ? 34.819  127.758 136.939 1.00 34.12 ? 95  ARG C CA  1 
ATOM   9663  C C   . ARG C 1 96  ? 33.885  127.159 135.904 1.00 32.32 ? 95  ARG C C   1 
ATOM   9664  O O   . ARG C 1 96  ? 32.666  127.355 135.945 1.00 30.61 ? 95  ARG C O   1 
ATOM   9665  C CB  . ARG C 1 96  ? 35.342  126.671 137.887 1.00 34.20 ? 95  ARG C CB  1 
ATOM   9666  C CG  . ARG C 1 96  ? 36.422  127.200 138.819 1.00 39.61 ? 95  ARG C CG  1 
ATOM   9667  C CD  . ARG C 1 96  ? 37.158  126.123 139.601 1.00 41.92 ? 95  ARG C CD  1 
ATOM   9668  N NE  . ARG C 1 96  ? 36.323  125.492 140.614 1.00 44.22 ? 95  ARG C NE  1 
ATOM   9669  C CZ  . ARG C 1 96  ? 36.802  124.858 141.681 1.00 46.06 ? 95  ARG C CZ  1 
ATOM   9670  N NH1 . ARG C 1 96  ? 38.112  124.778 141.874 1.00 47.10 ? 95  ARG C NH1 1 
ATOM   9671  N NH2 . ARG C 1 96  ? 35.972  124.298 142.552 1.00 46.84 ? 95  ARG C NH2 1 
ATOM   9672  N N   . ALA C 1 97  ? 34.476  126.446 134.957 1.00 31.13 ? 96  ALA C N   1 
ATOM   9673  C CA  . ALA C 1 97  ? 33.707  125.794 133.912 1.00 30.23 ? 96  ALA C CA  1 
ATOM   9674  C C   . ALA C 1 97  ? 33.247  124.451 134.471 1.00 29.49 ? 96  ALA C C   1 
ATOM   9675  O O   . ALA C 1 97  ? 33.761  123.985 135.488 1.00 30.01 ? 96  ALA C O   1 
ATOM   9676  C CB  . ALA C 1 97  ? 34.579  125.586 132.672 1.00 27.45 ? 96  ALA C CB  1 
ATOM   9677  N N   . VAL C 1 98  ? 32.261  123.850 133.817 1.00 28.28 ? 97  VAL C N   1 
ATOM   9678  C CA  . VAL C 1 98  ? 31.735  122.553 134.219 1.00 27.40 ? 97  VAL C CA  1 
ATOM   9679  C C   . VAL C 1 98  ? 31.832  121.701 132.961 1.00 27.60 ? 97  VAL C C   1 
ATOM   9680  O O   . VAL C 1 98  ? 30.963  121.756 132.089 1.00 27.56 ? 97  VAL C O   1 
ATOM   9681  C CB  . VAL C 1 98  ? 30.270  122.660 134.674 1.00 26.99 ? 97  VAL C CB  1 
ATOM   9682  C CG1 . VAL C 1 98  ? 29.768  121.291 135.123 1.00 26.33 ? 97  VAL C CG1 1 
ATOM   9683  C CG2 . VAL C 1 98  ? 30.154  123.672 135.822 1.00 26.20 ? 97  VAL C CG2 1 
ATOM   9684  N N   . LEU C 1 99  ? 32.901  120.921 132.866 1.00 26.53 ? 98  LEU C N   1 
ATOM   9685  C CA  . LEU C 1 99  ? 33.114  120.123 131.676 1.00 26.05 ? 98  LEU C CA  1 
ATOM   9686  C C   . LEU C 1 99  ? 33.344  118.626 131.831 1.00 25.27 ? 98  LEU C C   1 
ATOM   9687  O O   . LEU C 1 99  ? 34.309  118.089 131.292 1.00 25.01 ? 98  LEU C O   1 
ATOM   9688  C CB  . LEU C 1 99  ? 34.263  120.730 130.870 1.00 23.80 ? 98  LEU C CB  1 
ATOM   9689  C CG  . LEU C 1 99  ? 33.991  122.102 130.242 1.00 21.95 ? 98  LEU C CG  1 
ATOM   9690  C CD1 . LEU C 1 99  ? 35.247  122.599 129.552 1.00 22.88 ? 98  LEU C CD1 1 
ATOM   9691  C CD2 . LEU C 1 99  ? 32.857  121.997 129.241 1.00 21.69 ? 98  LEU C CD2 1 
ATOM   9692  N N   . HIS C 1 100 ? 32.467  117.943 132.555 1.00 24.23 ? 99  HIS C N   1 
ATOM   9693  C CA  . HIS C 1 100 ? 32.624  116.504 132.669 1.00 22.88 ? 99  HIS C CA  1 
ATOM   9694  C C   . HIS C 1 100 ? 32.301  115.924 131.293 1.00 22.97 ? 99  HIS C C   1 
ATOM   9695  O O   . HIS C 1 100 ? 32.719  114.815 130.969 1.00 24.18 ? 99  HIS C O   1 
ATOM   9696  C CB  . HIS C 1 100 ? 31.706  115.919 133.758 1.00 22.01 ? 99  HIS C CB  1 
ATOM   9697  C CG  . HIS C 1 100 ? 30.401  116.640 133.917 1.00 20.76 ? 99  HIS C CG  1 
ATOM   9698  N ND1 . HIS C 1 100 ? 29.241  116.232 133.295 1.00 19.88 ? 99  HIS C ND1 1 
ATOM   9699  C CD2 . HIS C 1 100 ? 30.075  117.741 134.634 1.00 18.90 ? 99  HIS C CD2 1 
ATOM   9700  C CE1 . HIS C 1 100 ? 28.257  117.050 133.624 1.00 19.22 ? 99  HIS C CE1 1 
ATOM   9701  N NE2 . HIS C 1 100 ? 28.737  117.974 134.436 1.00 19.29 ? 99  HIS C NE2 1 
ATOM   9702  N N   . VAL C 1 101 ? 31.572  116.685 130.476 1.00 22.51 ? 100 VAL C N   1 
ATOM   9703  C CA  . VAL C 1 101 ? 31.234  116.229 129.126 1.00 23.47 ? 100 VAL C CA  1 
ATOM   9704  C C   . VAL C 1 101 ? 32.470  116.253 128.218 1.00 21.71 ? 100 VAL C C   1 
ATOM   9705  O O   . VAL C 1 101 ? 32.503  115.594 127.185 1.00 22.90 ? 100 VAL C O   1 
ATOM   9706  C CB  . VAL C 1 101 ? 30.105  117.086 128.483 1.00 23.46 ? 100 VAL C CB  1 
ATOM   9707  C CG1 . VAL C 1 101 ? 28.808  116.884 129.245 1.00 24.17 ? 100 VAL C CG1 1 
ATOM   9708  C CG2 . VAL C 1 101 ? 30.489  118.560 128.481 1.00 25.00 ? 100 VAL C CG2 1 
ATOM   9709  N N   . ALA C 1 102 ? 33.488  117.011 128.611 1.00 21.63 ? 101 ALA C N   1 
ATOM   9710  C CA  . ALA C 1 102 ? 34.724  117.074 127.840 1.00 21.12 ? 101 ALA C CA  1 
ATOM   9711  C C   . ALA C 1 102 ? 35.534  115.808 128.117 1.00 23.18 ? 101 ALA C C   1 
ATOM   9712  O O   . ALA C 1 102 ? 36.304  115.349 127.279 1.00 22.72 ? 101 ALA C O   1 
ATOM   9713  C CB  . ALA C 1 102 ? 35.525  118.300 128.239 1.00 22.05 ? 101 ALA C CB  1 
ATOM   9714  N N   . LEU C 1 103 ? 35.348  115.241 129.305 1.00 23.20 ? 102 LEU C N   1 
ATOM   9715  C CA  . LEU C 1 103 ? 36.064  114.035 129.694 1.00 22.77 ? 102 LEU C CA  1 
ATOM   9716  C C   . LEU C 1 103 ? 35.721  112.858 128.784 1.00 24.14 ? 102 LEU C C   1 
ATOM   9717  O O   . LEU C 1 103 ? 36.588  112.043 128.445 1.00 24.15 ? 102 LEU C O   1 
ATOM   9718  C CB  . LEU C 1 103 ? 35.719  113.668 131.142 1.00 22.96 ? 102 LEU C CB  1 
ATOM   9719  C CG  . LEU C 1 103 ? 36.103  114.682 132.222 1.00 21.48 ? 102 LEU C CG  1 
ATOM   9720  C CD1 . LEU C 1 103 ? 35.580  114.215 133.583 1.00 19.91 ? 102 LEU C CD1 1 
ATOM   9721  C CD2 . LEU C 1 103 ? 37.626  114.833 132.246 1.00 20.89 ? 102 LEU C CD2 1 
ATOM   9722  N N   . ARG C 1 104 ? 34.451  112.776 128.398 1.00 23.89 ? 103 ARG C N   1 
ATOM   9723  C CA  . ARG C 1 104 ? 33.970  111.693 127.551 1.00 23.55 ? 103 ARG C CA  1 
ATOM   9724  C C   . ARG C 1 104 ? 33.703  112.129 126.104 1.00 24.90 ? 103 ARG C C   1 
ATOM   9725  O O   . ARG C 1 104 ? 32.992  111.446 125.367 1.00 24.52 ? 103 ARG C O   1 
ATOM   9726  C CB  . ARG C 1 104 ? 32.695  111.108 128.158 1.00 21.33 ? 103 ARG C CB  1 
ATOM   9727  C CG  . ARG C 1 104 ? 31.549  112.107 128.273 1.00 21.60 ? 103 ARG C CG  1 
ATOM   9728  C CD  . ARG C 1 104 ? 31.137  112.366 129.726 1.00 19.69 ? 103 ARG C CD  1 
ATOM   9729  N NE  . ARG C 1 104 ? 29.765  112.864 129.797 1.00 18.89 ? 103 ARG C NE  1 
ATOM   9730  C CZ  . ARG C 1 104 ? 29.090  113.088 130.922 1.00 18.32 ? 103 ARG C CZ  1 
ATOM   9731  N NH1 . ARG C 1 104 ? 29.654  112.871 132.105 1.00 14.86 ? 103 ARG C NH1 1 
ATOM   9732  N NH2 . ARG C 1 104 ? 27.830  113.496 130.859 1.00 13.51 ? 103 ARG C NH2 1 
ATOM   9733  N N   . ASN C 1 105 ? 34.274  113.264 125.706 1.00 26.32 ? 104 ASN C N   1 
ATOM   9734  C CA  . ASN C 1 105 ? 34.099  113.783 124.351 1.00 28.06 ? 104 ASN C CA  1 
ATOM   9735  C C   . ASN C 1 105 ? 34.949  112.999 123.352 1.00 28.49 ? 104 ASN C C   1 
ATOM   9736  O O   . ASN C 1 105 ? 35.997  113.466 122.903 1.00 28.39 ? 104 ASN C O   1 
ATOM   9737  C CB  . ASN C 1 105 ? 34.467  115.269 124.306 1.00 28.14 ? 104 ASN C CB  1 
ATOM   9738  C CG  . ASN C 1 105 ? 34.363  115.850 122.910 1.00 30.33 ? 104 ASN C CG  1 
ATOM   9739  O OD1 . ASN C 1 105 ? 33.457  115.507 122.147 1.00 31.17 ? 104 ASN C OD1 1 
ATOM   9740  N ND2 . ASN C 1 105 ? 35.283  116.744 122.571 1.00 30.49 ? 104 ASN C ND2 1 
ATOM   9741  N N   . ARG C 1 106 ? 34.480  111.804 123.012 1.00 28.35 ? 105 ARG C N   1 
ATOM   9742  C CA  . ARG C 1 106 ? 35.184  110.924 122.089 1.00 28.28 ? 105 ARG C CA  1 
ATOM   9743  C C   . ARG C 1 106 ? 35.378  111.563 120.721 1.00 29.28 ? 105 ARG C C   1 
ATOM   9744  O O   . ARG C 1 106 ? 36.329  111.243 120.011 1.00 27.30 ? 105 ARG C O   1 
ATOM   9745  C CB  . ARG C 1 106 ? 34.410  109.612 121.936 1.00 28.22 ? 105 ARG C CB  1 
ATOM   9746  C CG  . ARG C 1 106 ? 33.985  109.004 123.267 1.00 29.47 ? 105 ARG C CG  1 
ATOM   9747  C CD  . ARG C 1 106 ? 35.188  108.792 124.167 1.00 27.85 ? 105 ARG C CD  1 
ATOM   9748  N NE  . ARG C 1 106 ? 36.095  107.795 123.615 1.00 26.48 ? 105 ARG C NE  1 
ATOM   9749  C CZ  . ARG C 1 106 ? 37.332  107.590 124.046 1.00 27.57 ? 105 ARG C CZ  1 
ATOM   9750  N NH1 . ARG C 1 106 ? 37.822  108.321 125.039 1.00 26.60 ? 105 ARG C NH1 1 
ATOM   9751  N NH2 . ARG C 1 106 ? 38.076  106.643 123.487 1.00 28.74 ? 105 ARG C NH2 1 
ATOM   9752  N N   . SER C 1 107 ? 34.471  112.465 120.359 1.00 30.12 ? 106 SER C N   1 
ATOM   9753  C CA  . SER C 1 107 ? 34.534  113.142 119.071 1.00 31.61 ? 106 SER C CA  1 
ATOM   9754  C C   . SER C 1 107 ? 35.703  114.119 119.004 1.00 32.14 ? 106 SER C C   1 
ATOM   9755  O O   . SER C 1 107 ? 36.068  114.592 117.929 1.00 33.34 ? 106 SER C O   1 
ATOM   9756  C CB  . SER C 1 107 ? 33.217  113.878 118.809 1.00 32.38 ? 106 SER C CB  1 
ATOM   9757  O OG  . SER C 1 107 ? 32.134  112.958 118.734 1.00 33.45 ? 106 SER C OG  1 
ATOM   9758  N N   . ASN C 1 108 ? 36.287  114.408 120.160 1.00 30.45 ? 107 ASN C N   1 
ATOM   9759  C CA  . ASN C 1 108 ? 37.416  115.323 120.262 1.00 31.53 ? 107 ASN C CA  1 
ATOM   9760  C C   . ASN C 1 108 ? 37.175  116.717 119.697 1.00 32.28 ? 107 ASN C C   1 
ATOM   9761  O O   . ASN C 1 108 ? 38.122  117.418 119.334 1.00 30.26 ? 107 ASN C O   1 
ATOM   9762  C CB  . ASN C 1 108 ? 38.661  114.709 119.621 1.00 30.50 ? 107 ASN C CB  1 
ATOM   9763  C CG  . ASN C 1 108 ? 39.196  113.532 120.416 1.00 32.07 ? 107 ASN C CG  1 
ATOM   9764  O OD1 . ASN C 1 108 ? 39.288  113.589 121.647 1.00 28.67 ? 107 ASN C OD1 1 
ATOM   9765  N ND2 . ASN C 1 108 ? 39.559  112.460 119.718 1.00 31.28 ? 107 ASN C ND2 1 
ATOM   9766  N N   . THR C 1 109 ? 35.906  117.111 119.620 1.00 33.47 ? 108 THR C N   1 
ATOM   9767  C CA  . THR C 1 109 ? 35.538  118.441 119.143 1.00 33.59 ? 108 THR C CA  1 
ATOM   9768  C C   . THR C 1 109 ? 36.219  119.386 120.131 1.00 34.03 ? 108 THR C C   1 
ATOM   9769  O O   . THR C 1 109 ? 36.074  119.224 121.342 1.00 33.94 ? 108 THR C O   1 
ATOM   9770  C CB  . THR C 1 109 ? 34.013  118.683 119.250 1.00 34.70 ? 108 THR C CB  1 
ATOM   9771  O OG1 . THR C 1 109 ? 33.302  117.496 118.887 1.00 40.34 ? 108 THR C OG1 1 
ATOM   9772  C CG2 . THR C 1 109 ? 33.591  119.806 118.332 1.00 37.23 ? 108 THR C CG2 1 
ATOM   9773  N N   . PRO C 1 110 ? 36.965  120.387 119.639 1.00 34.88 ? 109 PRO C N   1 
ATOM   9774  C CA  . PRO C 1 110 ? 37.619  121.287 120.593 1.00 33.41 ? 109 PRO C CA  1 
ATOM   9775  C C   . PRO C 1 110 ? 36.654  121.978 121.550 1.00 31.89 ? 109 PRO C C   1 
ATOM   9776  O O   . PRO C 1 110 ? 35.573  122.407 121.155 1.00 30.74 ? 109 PRO C O   1 
ATOM   9777  C CB  . PRO C 1 110 ? 38.355  122.274 119.689 1.00 34.57 ? 109 PRO C CB  1 
ATOM   9778  C CG  . PRO C 1 110 ? 37.497  122.308 118.460 1.00 36.80 ? 109 PRO C CG  1 
ATOM   9779  C CD  . PRO C 1 110 ? 37.157  120.854 118.255 1.00 34.72 ? 109 PRO C CD  1 
ATOM   9780  N N   . ILE C 1 111 ? 37.048  122.053 122.817 1.00 30.76 ? 110 ILE C N   1 
ATOM   9781  C CA  . ILE C 1 111 ? 36.249  122.711 123.844 1.00 31.67 ? 110 ILE C CA  1 
ATOM   9782  C C   . ILE C 1 111 ? 37.191  123.660 124.573 1.00 31.04 ? 110 ILE C C   1 
ATOM   9783  O O   . ILE C 1 111 ? 38.139  123.230 125.231 1.00 28.83 ? 110 ILE C O   1 
ATOM   9784  C CB  . ILE C 1 111 ? 35.647  121.702 124.841 1.00 32.19 ? 110 ILE C CB  1 
ATOM   9785  C CG1 . ILE C 1 111 ? 34.682  120.762 124.110 1.00 32.45 ? 110 ILE C CG1 1 
ATOM   9786  C CG2 . ILE C 1 111 ? 34.920  122.448 125.955 1.00 33.52 ? 110 ILE C CG2 1 
ATOM   9787  C CD1 . ILE C 1 111 ? 34.038  119.716 125.002 1.00 32.70 ? 110 ILE C CD1 1 
ATOM   9788  N N   . LEU C 1 112 ? 36.919  124.955 124.453 1.00 31.40 ? 111 LEU C N   1 
ATOM   9789  C CA  . LEU C 1 112 ? 37.779  125.966 125.048 1.00 32.80 ? 111 LEU C CA  1 
ATOM   9790  C C   . LEU C 1 112 ? 37.444  126.430 126.454 1.00 34.11 ? 111 LEU C C   1 
ATOM   9791  O O   . LEU C 1 112 ? 36.284  126.659 126.802 1.00 34.25 ? 111 LEU C O   1 
ATOM   9792  C CB  . LEU C 1 112 ? 37.832  127.193 124.138 1.00 32.75 ? 111 LEU C CB  1 
ATOM   9793  C CG  . LEU C 1 112 ? 38.206  126.949 122.677 1.00 33.09 ? 111 LEU C CG  1 
ATOM   9794  C CD1 . LEU C 1 112 ? 37.981  128.221 121.882 1.00 32.95 ? 111 LEU C CD1 1 
ATOM   9795  C CD2 . LEU C 1 112 ? 39.646  126.488 122.581 1.00 33.39 ? 111 LEU C CD2 1 
ATOM   9796  N N   . VAL C 1 113 ? 38.495  126.563 127.250 1.00 35.13 ? 112 VAL C N   1 
ATOM   9797  C CA  . VAL C 1 113 ? 38.411  127.059 128.613 1.00 36.45 ? 112 VAL C CA  1 
ATOM   9798  C C   . VAL C 1 113 ? 39.543  128.076 128.650 1.00 37.70 ? 112 VAL C C   1 
ATOM   9799  O O   . VAL C 1 113 ? 40.717  127.709 128.562 1.00 37.64 ? 112 VAL C O   1 
ATOM   9800  C CB  . VAL C 1 113 ? 38.679  125.956 129.659 1.00 35.58 ? 112 VAL C CB  1 
ATOM   9801  C CG1 . VAL C 1 113 ? 38.829  126.580 131.048 1.00 33.75 ? 112 VAL C CG1 1 
ATOM   9802  C CG2 . VAL C 1 113 ? 37.528  124.960 129.664 1.00 35.36 ? 112 VAL C CG2 1 
ATOM   9803  N N   . ASP C 1 114 ? 39.190  129.352 128.749 1.00 39.36 ? 113 ASP C N   1 
ATOM   9804  C CA  . ASP C 1 114 ? 40.194  130.404 128.767 1.00 41.11 ? 113 ASP C CA  1 
ATOM   9805  C C   . ASP C 1 114 ? 40.935  130.399 127.429 1.00 41.15 ? 113 ASP C C   1 
ATOM   9806  O O   . ASP C 1 114 ? 42.159  130.517 127.377 1.00 41.81 ? 113 ASP C O   1 
ATOM   9807  C CB  . ASP C 1 114 ? 41.172  130.181 129.929 1.00 42.80 ? 113 ASP C CB  1 
ATOM   9808  C CG  . ASP C 1 114 ? 40.544  130.476 131.288 1.00 45.93 ? 113 ASP C CG  1 
ATOM   9809  O OD1 . ASP C 1 114 ? 41.136  130.088 132.322 1.00 44.64 ? 113 ASP C OD1 1 
ATOM   9810  O OD2 . ASP C 1 114 ? 39.462  131.106 131.322 1.00 46.92 ? 113 ASP C OD2 1 
ATOM   9811  N N   . GLY C 1 115 ? 40.173  130.244 126.350 1.00 40.97 ? 114 GLY C N   1 
ATOM   9812  C CA  . GLY C 1 115 ? 40.741  130.240 125.014 1.00 40.72 ? 114 GLY C CA  1 
ATOM   9813  C C   . GLY C 1 115 ? 41.739  129.141 124.691 1.00 41.67 ? 114 GLY C C   1 
ATOM   9814  O O   . GLY C 1 115 ? 42.624  129.333 123.858 1.00 42.20 ? 114 GLY C O   1 
ATOM   9815  N N   . LYS C 1 116 ? 41.604  127.986 125.331 1.00 40.60 ? 115 LYS C N   1 
ATOM   9816  C CA  . LYS C 1 116 ? 42.526  126.889 125.069 1.00 39.90 ? 115 LYS C CA  1 
ATOM   9817  C C   . LYS C 1 116 ? 41.792  125.549 125.067 1.00 38.24 ? 115 LYS C C   1 
ATOM   9818  O O   . LYS C 1 116 ? 41.095  125.208 126.025 1.00 36.94 ? 115 LYS C O   1 
ATOM   9819  C CB  . LYS C 1 116 ? 43.633  126.885 126.122 1.00 40.16 ? 115 LYS C CB  1 
ATOM   9820  C CG  . LYS C 1 116 ? 44.764  125.920 125.841 1.00 42.83 ? 115 LYS C CG  1 
ATOM   9821  C CD  . LYS C 1 116 ? 45.765  125.927 126.985 1.00 46.34 ? 115 LYS C CD  1 
ATOM   9822  C CE  . LYS C 1 116 ? 46.962  125.045 126.679 1.00 48.35 ? 115 LYS C CE  1 
ATOM   9823  N NZ  . LYS C 1 116 ? 47.691  125.537 125.478 1.00 50.73 ? 115 LYS C NZ  1 
ATOM   9824  N N   . ASP C 1 117 ? 41.952  124.794 123.984 1.00 36.24 ? 116 ASP C N   1 
ATOM   9825  C CA  . ASP C 1 117 ? 41.300  123.496 123.857 1.00 34.91 ? 116 ASP C CA  1 
ATOM   9826  C C   . ASP C 1 117 ? 41.677  122.583 125.015 1.00 33.41 ? 116 ASP C C   1 
ATOM   9827  O O   . ASP C 1 117 ? 42.851  122.393 125.317 1.00 33.15 ? 116 ASP C O   1 
ATOM   9828  C CB  . ASP C 1 117 ? 41.685  122.822 122.540 1.00 34.22 ? 116 ASP C CB  1 
ATOM   9829  C CG  . ASP C 1 117 ? 40.824  121.607 122.235 1.00 35.53 ? 116 ASP C CG  1 
ATOM   9830  O OD1 . ASP C 1 117 ? 39.978  121.247 123.085 1.00 33.09 ? 116 ASP C OD1 1 
ATOM   9831  O OD2 . ASP C 1 117 ? 40.990  121.013 121.148 1.00 34.54 ? 116 ASP C OD2 1 
ATOM   9832  N N   . VAL C 1 118 ? 40.662  122.013 125.651 1.00 32.11 ? 117 VAL C N   1 
ATOM   9833  C CA  . VAL C 1 118 ? 40.853  121.118 126.781 1.00 32.29 ? 117 VAL C CA  1 
ATOM   9834  C C   . VAL C 1 118 ? 41.147  119.672 126.371 1.00 30.25 ? 117 VAL C C   1 
ATOM   9835  O O   . VAL C 1 118 ? 41.855  118.949 127.076 1.00 29.65 ? 117 VAL C O   1 
ATOM   9836  C CB  . VAL C 1 118 ? 39.595  121.125 127.680 1.00 33.78 ? 117 VAL C CB  1 
ATOM   9837  C CG1 . VAL C 1 118 ? 39.557  119.877 128.522 1.00 38.01 ? 117 VAL C CG1 1 
ATOM   9838  C CG2 . VAL C 1 118 ? 39.590  122.359 128.568 1.00 32.50 ? 117 VAL C CG2 1 
ATOM   9839  N N   . MET C 1 119 ? 40.605  119.258 125.232 1.00 28.94 ? 118 MET C N   1 
ATOM   9840  C CA  . MET C 1 119 ? 40.769  117.889 124.756 1.00 28.16 ? 118 MET C CA  1 
ATOM   9841  C C   . MET C 1 119 ? 42.187  117.328 124.743 1.00 30.23 ? 118 MET C C   1 
ATOM   9842  O O   . MET C 1 119 ? 42.389  116.153 125.067 1.00 30.11 ? 118 MET C O   1 
ATOM   9843  C CB  . MET C 1 119 ? 40.141  117.733 123.371 1.00 26.83 ? 118 MET C CB  1 
ATOM   9844  C CG  . MET C 1 119 ? 38.629  117.896 123.367 1.00 25.44 ? 118 MET C CG  1 
ATOM   9845  S SD  . MET C 1 119 ? 37.842  117.191 124.852 1.00 26.46 ? 118 MET C SD  1 
ATOM   9846  C CE  . MET C 1 119 ? 38.208  115.434 124.664 1.00 25.28 ? 118 MET C CE  1 
ATOM   9847  N N   . PRO C 1 120 ? 43.189  118.146 124.364 1.00 30.20 ? 119 PRO C N   1 
ATOM   9848  C CA  . PRO C 1 120 ? 44.564  117.637 124.342 1.00 30.93 ? 119 PRO C CA  1 
ATOM   9849  C C   . PRO C 1 120 ? 44.990  117.065 125.696 1.00 31.06 ? 119 PRO C C   1 
ATOM   9850  O O   . PRO C 1 120 ? 45.555  115.974 125.765 1.00 32.88 ? 119 PRO C O   1 
ATOM   9851  C CB  . PRO C 1 120 ? 45.377  118.867 123.946 1.00 31.45 ? 119 PRO C CB  1 
ATOM   9852  C CG  . PRO C 1 120 ? 44.431  119.619 123.068 1.00 30.65 ? 119 PRO C CG  1 
ATOM   9853  C CD  . PRO C 1 120 ? 43.134  119.522 123.839 1.00 29.47 ? 119 PRO C CD  1 
ATOM   9854  N N   . GLU C 1 121 ? 44.722  117.801 126.770 1.00 30.79 ? 120 GLU C N   1 
ATOM   9855  C CA  . GLU C 1 121 ? 45.081  117.333 128.110 1.00 30.54 ? 120 GLU C CA  1 
ATOM   9856  C C   . GLU C 1 121 ? 44.221  116.142 128.544 1.00 29.36 ? 120 GLU C C   1 
ATOM   9857  O O   . GLU C 1 121 ? 44.716  115.210 129.183 1.00 30.27 ? 120 GLU C O   1 
ATOM   9858  C CB  . GLU C 1 121 ? 44.948  118.471 129.126 1.00 30.87 ? 120 GLU C CB  1 
ATOM   9859  C CG  . GLU C 1 121 ? 45.993  119.555 128.966 1.00 34.44 ? 120 GLU C CG  1 
ATOM   9860  C CD  . GLU C 1 121 ? 47.408  118.999 128.997 1.00 37.41 ? 120 GLU C CD  1 
ATOM   9861  O OE1 . GLU C 1 121 ? 47.805  118.432 130.038 1.00 37.31 ? 120 GLU C OE1 1 
ATOM   9862  O OE2 . GLU C 1 121 ? 48.121  119.122 127.974 1.00 39.65 ? 120 GLU C OE2 1 
ATOM   9863  N N   . VAL C 1 122 ? 42.935  116.175 128.200 1.00 27.69 ? 121 VAL C N   1 
ATOM   9864  C CA  . VAL C 1 122 ? 42.024  115.084 128.541 1.00 27.31 ? 121 VAL C CA  1 
ATOM   9865  C C   . VAL C 1 122 ? 42.560  113.774 127.959 1.00 27.11 ? 121 VAL C C   1 
ATOM   9866  O O   . VAL C 1 122 ? 42.716  112.779 128.670 1.00 25.65 ? 121 VAL C O   1 
ATOM   9867  C CB  . VAL C 1 122 ? 40.605  115.340 127.970 1.00 26.82 ? 121 VAL C CB  1 
ATOM   9868  C CG1 . VAL C 1 122 ? 39.748  114.097 128.119 1.00 25.22 ? 121 VAL C CG1 1 
ATOM   9869  C CG2 . VAL C 1 122 ? 39.955  116.516 128.692 1.00 24.04 ? 121 VAL C CG2 1 
ATOM   9870  N N   . ASN C 1 123 ? 42.852  113.788 126.661 1.00 26.38 ? 122 ASN C N   1 
ATOM   9871  C CA  . ASN C 1 123 ? 43.365  112.606 125.978 1.00 27.48 ? 122 ASN C CA  1 
ATOM   9872  C C   . ASN C 1 123 ? 44.776  112.237 126.423 1.00 26.68 ? 122 ASN C C   1 
ATOM   9873  O O   . ASN C 1 123 ? 45.181  111.079 126.332 1.00 24.75 ? 122 ASN C O   1 
ATOM   9874  C CB  . ASN C 1 123 ? 43.328  112.817 124.463 1.00 27.93 ? 122 ASN C CB  1 
ATOM   9875  C CG  . ASN C 1 123 ? 41.921  112.963 123.943 1.00 29.63 ? 122 ASN C CG  1 
ATOM   9876  O OD1 . ASN C 1 123 ? 41.024  112.231 124.360 1.00 31.81 ? 122 ASN C OD1 1 
ATOM   9877  N ND2 . ASN C 1 123 ? 41.713  113.899 123.024 1.00 30.35 ? 122 ASN C ND2 1 
ATOM   9878  N N   . LYS C 1 124 ? 45.523  113.222 126.903 1.00 26.85 ? 123 LYS C N   1 
ATOM   9879  C CA  . LYS C 1 124 ? 46.878  112.971 127.375 1.00 28.63 ? 123 LYS C CA  1 
ATOM   9880  C C   . LYS C 1 124 ? 46.799  112.080 128.613 1.00 28.14 ? 123 LYS C C   1 
ATOM   9881  O O   . LYS C 1 124 ? 47.550  111.108 128.741 1.00 28.18 ? 123 LYS C O   1 
ATOM   9882  C CB  . LYS C 1 124 ? 47.559  114.297 127.718 1.00 31.94 ? 123 LYS C CB  1 
ATOM   9883  C CG  . LYS C 1 124 ? 49.000  114.189 128.178 1.00 36.91 ? 123 LYS C CG  1 
ATOM   9884  C CD  . LYS C 1 124 ? 49.547  115.592 128.435 1.00 41.02 ? 123 LYS C CD  1 
ATOM   9885  C CE  . LYS C 1 124 ? 50.971  115.582 128.953 1.00 43.32 ? 123 LYS C CE  1 
ATOM   9886  N NZ  . LYS C 1 124 ? 51.450  116.976 129.217 1.00 45.57 ? 123 LYS C NZ  1 
ATOM   9887  N N   . VAL C 1 125 ? 45.879  112.402 129.519 1.00 25.81 ? 124 VAL C N   1 
ATOM   9888  C CA  . VAL C 1 125 ? 45.719  111.606 130.734 1.00 26.12 ? 124 VAL C CA  1 
ATOM   9889  C C   . VAL C 1 125 ? 45.130  110.239 130.390 1.00 25.18 ? 124 VAL C C   1 
ATOM   9890  O O   . VAL C 1 125 ? 45.536  109.223 130.950 1.00 24.74 ? 124 VAL C O   1 
ATOM   9891  C CB  . VAL C 1 125 ? 44.801  112.306 131.763 1.00 27.01 ? 124 VAL C CB  1 
ATOM   9892  C CG1 . VAL C 1 125 ? 44.792  111.524 133.070 1.00 26.13 ? 124 VAL C CG1 1 
ATOM   9893  C CG2 . VAL C 1 125 ? 45.288  113.731 132.013 1.00 28.55 ? 124 VAL C CG2 1 
ATOM   9894  N N   . LEU C 1 126 ? 44.178  110.217 129.460 1.00 26.17 ? 125 LEU C N   1 
ATOM   9895  C CA  . LEU C 1 126 ? 43.560  108.964 129.050 1.00 26.04 ? 125 LEU C CA  1 
ATOM   9896  C C   . LEU C 1 126 ? 44.619  107.997 128.509 1.00 25.72 ? 125 LEU C C   1 
ATOM   9897  O O   . LEU C 1 126 ? 44.606  106.807 128.830 1.00 25.77 ? 125 LEU C O   1 
ATOM   9898  C CB  . LEU C 1 126 ? 42.472  109.224 127.997 1.00 24.51 ? 125 LEU C CB  1 
ATOM   9899  C CG  . LEU C 1 126 ? 41.152  109.797 128.534 1.00 25.99 ? 125 LEU C CG  1 
ATOM   9900  C CD1 . LEU C 1 126 ? 40.250  110.246 127.386 1.00 24.28 ? 125 LEU C CD1 1 
ATOM   9901  C CD2 . LEU C 1 126 ? 40.453  108.736 129.376 1.00 25.36 ? 125 LEU C CD2 1 
ATOM   9902  N N   . ASP C 1 127 ? 45.542  108.506 127.698 1.00 27.42 ? 126 ASP C N   1 
ATOM   9903  C CA  . ASP C 1 127 ? 46.596  107.655 127.149 1.00 28.33 ? 126 ASP C CA  1 
ATOM   9904  C C   . ASP C 1 127 ? 47.447  107.097 128.285 1.00 26.29 ? 126 ASP C C   1 
ATOM   9905  O O   . ASP C 1 127 ? 47.818  105.921 128.284 1.00 25.31 ? 126 ASP C O   1 
ATOM   9906  C CB  . ASP C 1 127 ? 47.487  108.439 126.174 1.00 32.51 ? 126 ASP C CB  1 
ATOM   9907  C CG  . ASP C 1 127 ? 46.762  108.823 124.888 1.00 36.89 ? 126 ASP C CG  1 
ATOM   9908  O OD1 . ASP C 1 127 ? 46.029  107.974 124.338 1.00 39.04 ? 126 ASP C OD1 1 
ATOM   9909  O OD2 . ASP C 1 127 ? 46.940  109.970 124.418 1.00 40.27 ? 126 ASP C OD2 1 
ATOM   9910  N N   . LYS C 1 128 ? 47.758  107.943 129.259 1.00 26.26 ? 127 LYS C N   1 
ATOM   9911  C CA  . LYS C 1 128 ? 48.561  107.507 130.392 1.00 26.81 ? 127 LYS C CA  1 
ATOM   9912  C C   . LYS C 1 128 ? 47.826  106.398 131.139 1.00 25.94 ? 127 LYS C C   1 
ATOM   9913  O O   . LYS C 1 128 ? 48.438  105.441 131.618 1.00 24.71 ? 127 LYS C O   1 
ATOM   9914  C CB  . LYS C 1 128 ? 48.831  108.677 131.339 1.00 28.86 ? 127 LYS C CB  1 
ATOM   9915  C CG  . LYS C 1 128 ? 49.785  108.328 132.473 1.00 33.52 ? 127 LYS C CG  1 
ATOM   9916  C CD  . LYS C 1 128 ? 49.995  109.496 133.423 1.00 35.48 ? 127 LYS C CD  1 
ATOM   9917  C CE  . LYS C 1 128 ? 50.603  110.693 132.717 1.00 37.18 ? 127 LYS C CE  1 
ATOM   9918  N NZ  . LYS C 1 128 ? 50.696  111.869 133.630 1.00 38.27 ? 127 LYS C NZ  1 
ATOM   9919  N N   . MET C 1 129 ? 46.507  106.530 131.229 1.00 24.94 ? 128 MET C N   1 
ATOM   9920  C CA  . MET C 1 129 ? 45.692  105.540 131.913 1.00 24.95 ? 128 MET C CA  1 
ATOM   9921  C C   . MET C 1 129 ? 45.716  104.226 131.150 1.00 26.60 ? 128 MET C C   1 
ATOM   9922  O O   . MET C 1 129 ? 45.873  103.154 131.739 1.00 27.77 ? 128 MET C O   1 
ATOM   9923  C CB  . MET C 1 129 ? 44.251  106.031 132.025 1.00 25.73 ? 128 MET C CB  1 
ATOM   9924  C CG  . MET C 1 129 ? 44.082  107.289 132.849 1.00 25.74 ? 128 MET C CG  1 
ATOM   9925  S SD  . MET C 1 129 ? 42.349  107.708 132.986 1.00 28.49 ? 128 MET C SD  1 
ATOM   9926  C CE  . MET C 1 129 ? 42.398  109.471 132.823 1.00 31.28 ? 128 MET C CE  1 
ATOM   9927  N N   . LYS C 1 130 ? 45.551  104.317 129.832 1.00 26.72 ? 129 LYS C N   1 
ATOM   9928  C CA  . LYS C 1 130 ? 45.547  103.137 128.981 1.00 26.52 ? 129 LYS C CA  1 
ATOM   9929  C C   . LYS C 1 130 ? 46.860  102.378 129.133 1.00 26.88 ? 129 LYS C C   1 
ATOM   9930  O O   . LYS C 1 130 ? 46.869  101.157 129.296 1.00 26.67 ? 129 LYS C O   1 
ATOM   9931  C CB  . LYS C 1 130 ? 45.346  103.547 127.522 1.00 26.95 ? 129 LYS C CB  1 
ATOM   9932  C CG  . LYS C 1 130 ? 45.245  102.377 126.565 1.00 27.61 ? 129 LYS C CG  1 
ATOM   9933  C CD  . LYS C 1 130 ? 44.962  102.850 125.154 1.00 30.98 ? 129 LYS C CD  1 
ATOM   9934  C CE  . LYS C 1 130 ? 44.789  101.670 124.211 1.00 32.04 ? 129 LYS C CE  1 
ATOM   9935  N NZ  . LYS C 1 130 ? 44.589  102.111 122.800 1.00 33.87 ? 129 LYS C NZ  1 
ATOM   9936  N N   . SER C 1 131 ? 47.966  103.115 129.084 1.00 26.95 ? 130 SER C N   1 
ATOM   9937  C CA  . SER C 1 131 ? 49.303  102.538 129.215 1.00 29.61 ? 130 SER C CA  1 
ATOM   9938  C C   . SER C 1 131 ? 49.504  101.843 130.564 1.00 30.14 ? 130 SER C C   1 
ATOM   9939  O O   . SER C 1 131 ? 50.051  100.736 130.634 1.00 29.63 ? 130 SER C O   1 
ATOM   9940  C CB  . SER C 1 131 ? 50.356  103.634 129.043 1.00 31.53 ? 130 SER C CB  1 
ATOM   9941  O OG  . SER C 1 131 ? 51.653  103.134 129.302 1.00 37.29 ? 130 SER C OG  1 
ATOM   9942  N N   . PHE C 1 132 ? 49.054  102.494 131.633 1.00 28.88 ? 131 PHE C N   1 
ATOM   9943  C CA  . PHE C 1 132 ? 49.194  101.933 132.970 1.00 27.89 ? 131 PHE C CA  1 
ATOM   9944  C C   . PHE C 1 132 ? 48.373  100.655 133.118 1.00 27.40 ? 131 PHE C C   1 
ATOM   9945  O O   . PHE C 1 132 ? 48.886  99.630  133.569 1.00 26.05 ? 131 PHE C O   1 
ATOM   9946  C CB  . PHE C 1 132 ? 48.758  102.958 134.023 1.00 28.83 ? 131 PHE C CB  1 
ATOM   9947  C CG  . PHE C 1 132 ? 49.073  102.548 135.439 1.00 28.50 ? 131 PHE C CG  1 
ATOM   9948  C CD1 . PHE C 1 132 ? 50.395  102.446 135.873 1.00 27.29 ? 131 PHE C CD1 1 
ATOM   9949  C CD2 . PHE C 1 132 ? 48.047  102.252 136.335 1.00 26.82 ? 131 PHE C CD2 1 
ATOM   9950  C CE1 . PHE C 1 132 ? 50.690  102.054 137.183 1.00 27.56 ? 131 PHE C CE1 1 
ATOM   9951  C CE2 . PHE C 1 132 ? 48.329  101.859 137.643 1.00 27.01 ? 131 PHE C CE2 1 
ATOM   9952  C CZ  . PHE C 1 132 ? 49.654  101.759 138.069 1.00 27.12 ? 131 PHE C CZ  1 
ATOM   9953  N N   . CYS C 1 133 ? 47.101  100.714 132.729 1.00 27.07 ? 132 CYS C N   1 
ATOM   9954  C CA  . CYS C 1 133 ? 46.225  99.551  132.839 1.00 28.00 ? 132 CYS C CA  1 
ATOM   9955  C C   . CYS C 1 133 ? 46.750  98.346  132.067 1.00 28.41 ? 132 CYS C C   1 
ATOM   9956  O O   . CYS C 1 133 ? 46.614  97.215  132.517 1.00 27.17 ? 132 CYS C O   1 
ATOM   9957  C CB  . CYS C 1 133 ? 44.810  99.896  132.366 1.00 27.14 ? 132 CYS C CB  1 
ATOM   9958  S SG  . CYS C 1 133 ? 43.966  101.114 133.400 1.00 27.11 ? 132 CYS C SG  1 
ATOM   9959  N N   . GLN C 1 134 ? 47.356  98.579  130.910 1.00 29.99 ? 133 GLN C N   1 
ATOM   9960  C CA  . GLN C 1 134 ? 47.889  97.470  130.128 1.00 31.16 ? 133 GLN C CA  1 
ATOM   9961  C C   . GLN C 1 134 ? 49.018  96.768  130.883 1.00 30.86 ? 133 GLN C C   1 
ATOM   9962  O O   . GLN C 1 134 ? 49.007  95.547  131.040 1.00 28.49 ? 133 GLN C O   1 
ATOM   9963  C CB  . GLN C 1 134 ? 48.413  97.966  128.780 1.00 35.51 ? 133 GLN C CB  1 
ATOM   9964  C CG  . GLN C 1 134 ? 48.983  96.863  127.904 1.00 39.33 ? 133 GLN C CG  1 
ATOM   9965  C CD  . GLN C 1 134 ? 49.613  97.399  126.635 1.00 45.10 ? 133 GLN C CD  1 
ATOM   9966  O OE1 . GLN C 1 134 ? 50.572  98.173  126.683 1.00 47.29 ? 133 GLN C OE1 1 
ATOM   9967  N NE2 . GLN C 1 134 ? 49.074  96.993  125.488 1.00 48.43 ? 133 GLN C NE2 1 
ATOM   9968  N N   . ARG C 1 135 ? 49.991  97.543  131.349 1.00 30.25 ? 134 ARG C N   1 
ATOM   9969  C CA  . ARG C 1 135 ? 51.125  96.986  132.083 1.00 32.55 ? 134 ARG C CA  1 
ATOM   9970  C C   . ARG C 1 135 ? 50.694  96.247  133.350 1.00 32.46 ? 134 ARG C C   1 
ATOM   9971  O O   . ARG C 1 135 ? 51.178  95.150  133.635 1.00 32.29 ? 134 ARG C O   1 
ATOM   9972  C CB  . ARG C 1 135 ? 52.114  98.100  132.443 1.00 33.87 ? 134 ARG C CB  1 
ATOM   9973  C CG  . ARG C 1 135 ? 52.925  98.604  131.261 1.00 37.49 ? 134 ARG C CG  1 
ATOM   9974  C CD  . ARG C 1 135 ? 53.657  99.892  131.595 1.00 41.40 ? 134 ARG C CD  1 
ATOM   9975  N NE  . ARG C 1 135 ? 52.732  101.010 131.763 1.00 46.33 ? 134 ARG C NE  1 
ATOM   9976  C CZ  . ARG C 1 135 ? 53.085  102.228 132.167 1.00 47.36 ? 134 ARG C CZ  1 
ATOM   9977  N NH1 . ARG C 1 135 ? 54.353  102.496 132.453 1.00 48.91 ? 134 ARG C NH1 1 
ATOM   9978  N NH2 . ARG C 1 135 ? 52.168  103.181 132.281 1.00 46.07 ? 134 ARG C NH2 1 
ATOM   9979  N N   . VAL C 1 136 ? 49.779  96.841  134.108 1.00 32.04 ? 135 VAL C N   1 
ATOM   9980  C CA  . VAL C 1 136 ? 49.315  96.208  135.337 1.00 31.35 ? 135 VAL C CA  1 
ATOM   9981  C C   . VAL C 1 136 ? 48.511  94.941  135.054 1.00 31.32 ? 135 VAL C C   1 
ATOM   9982  O O   . VAL C 1 136 ? 48.749  93.902  135.669 1.00 29.97 ? 135 VAL C O   1 
ATOM   9983  C CB  . VAL C 1 136 ? 48.443  97.169  136.180 1.00 32.42 ? 135 VAL C CB  1 
ATOM   9984  C CG1 . VAL C 1 136 ? 47.996  96.475  137.456 1.00 32.55 ? 135 VAL C CG1 1 
ATOM   9985  C CG2 . VAL C 1 136 ? 49.225  98.432  136.517 1.00 31.95 ? 135 VAL C CG2 1 
ATOM   9986  N N   . ARG C 1 137 ? 47.568  95.023  134.118 1.00 31.41 ? 136 ARG C N   1 
ATOM   9987  C CA  . ARG C 1 137 ? 46.731  93.872  133.793 1.00 32.85 ? 136 ARG C CA  1 
ATOM   9988  C C   . ARG C 1 137 ? 47.486  92.778  133.045 1.00 34.00 ? 136 ARG C C   1 
ATOM   9989  O O   . ARG C 1 137 ? 47.174  91.597  133.194 1.00 33.18 ? 136 ARG C O   1 
ATOM   9990  C CB  . ARG C 1 137 ? 45.511  94.301  132.965 1.00 32.85 ? 136 ARG C CB  1 
ATOM   9991  C CG  . ARG C 1 137 ? 44.811  95.552  133.477 1.00 33.40 ? 136 ARG C CG  1 
ATOM   9992  C CD  . ARG C 1 137 ? 43.315  95.394  133.514 1.00 32.22 ? 136 ARG C CD  1 
ATOM   9993  N NE  . ARG C 1 137 ? 42.774  94.746  132.326 1.00 30.93 ? 136 ARG C NE  1 
ATOM   9994  C CZ  . ARG C 1 137 ? 41.582  94.160  132.299 1.00 30.47 ? 136 ARG C CZ  1 
ATOM   9995  N NH1 . ARG C 1 137 ? 40.829  94.156  133.392 1.00 29.01 ? 136 ARG C NH1 1 
ATOM   9996  N NH2 . ARG C 1 137 ? 41.154  93.557  131.199 1.00 30.10 ? 136 ARG C NH2 1 
ATOM   9997  N N   . SER C 1 138 ? 48.468  93.170  132.235 1.00 34.62 ? 137 SER C N   1 
ATOM   9998  C CA  . SER C 1 138 ? 49.261  92.206  131.471 1.00 34.78 ? 137 SER C CA  1 
ATOM   9999  C C   . SER C 1 138 ? 50.179  91.452  132.419 1.00 35.29 ? 137 SER C C   1 
ATOM   10000 O O   . SER C 1 138 ? 50.563  90.313  132.152 1.00 36.80 ? 137 SER C O   1 
ATOM   10001 C CB  . SER C 1 138 ? 50.125  92.914  130.426 1.00 34.74 ? 137 SER C CB  1 
ATOM   10002 O OG  . SER C 1 138 ? 51.196  93.609  131.051 1.00 32.42 ? 137 SER C OG  1 
ATOM   10003 N N   . GLY C 1 139 ? 50.531  92.102  133.523 1.00 34.76 ? 138 GLY C N   1 
ATOM   10004 C CA  . GLY C 1 139 ? 51.416  91.488  134.492 1.00 34.62 ? 138 GLY C CA  1 
ATOM   10005 C C   . GLY C 1 139 ? 52.823  92.042  134.377 1.00 34.76 ? 138 GLY C C   1 
ATOM   10006 O O   . GLY C 1 139 ? 53.709  91.656  135.138 1.00 33.99 ? 138 GLY C O   1 
ATOM   10007 N N   . ASP C 1 140 ? 53.034  92.944  133.421 1.00 35.32 ? 139 ASP C N   1 
ATOM   10008 C CA  . ASP C 1 140 ? 54.347  93.550  133.228 1.00 35.11 ? 139 ASP C CA  1 
ATOM   10009 C C   . ASP C 1 140 ? 54.735  94.332  134.475 1.00 34.37 ? 139 ASP C C   1 
ATOM   10010 O O   . ASP C 1 140 ? 55.885  94.289  134.908 1.00 34.33 ? 139 ASP C O   1 
ATOM   10011 C CB  . ASP C 1 140 ? 54.351  94.491  132.013 1.00 36.90 ? 139 ASP C CB  1 
ATOM   10012 C CG  . ASP C 1 140 ? 54.367  93.745  130.680 1.00 38.39 ? 139 ASP C CG  1 
ATOM   10013 O OD1 . ASP C 1 140 ? 54.478  94.409  129.628 1.00 39.07 ? 139 ASP C OD1 1 
ATOM   10014 O OD2 . ASP C 1 140 ? 54.269  92.501  130.677 1.00 39.28 ? 139 ASP C OD2 1 
ATOM   10015 N N   . TRP C 1 141 ? 53.773  95.053  135.043 1.00 33.54 ? 140 TRP C N   1 
ATOM   10016 C CA  . TRP C 1 141 ? 54.016  95.839  136.249 1.00 33.56 ? 140 TRP C CA  1 
ATOM   10017 C C   . TRP C 1 141 ? 54.129  94.877  137.425 1.00 34.85 ? 140 TRP C C   1 
ATOM   10018 O O   . TRP C 1 141 ? 53.235  94.063  137.654 1.00 35.60 ? 140 TRP C O   1 
ATOM   10019 C CB  . TRP C 1 141 ? 52.869  96.825  136.472 1.00 31.49 ? 140 TRP C CB  1 
ATOM   10020 C CG  . TRP C 1 141 ? 53.072  97.742  137.634 1.00 30.21 ? 140 TRP C CG  1 
ATOM   10021 C CD1 . TRP C 1 141 ? 52.959  97.430  138.957 1.00 29.20 ? 140 TRP C CD1 1 
ATOM   10022 C CD2 . TRP C 1 141 ? 53.419  99.130  137.576 1.00 28.83 ? 140 TRP C CD2 1 
ATOM   10023 N NE1 . TRP C 1 141 ? 53.212  98.540  139.729 1.00 29.46 ? 140 TRP C NE1 1 
ATOM   10024 C CE2 . TRP C 1 141 ? 53.498  99.596  138.906 1.00 29.17 ? 140 TRP C CE2 1 
ATOM   10025 C CE3 . TRP C 1 141 ? 53.673  100.025 136.529 1.00 30.07 ? 140 TRP C CE3 1 
ATOM   10026 C CZ2 . TRP C 1 141 ? 53.819  100.921 139.218 1.00 31.01 ? 140 TRP C CZ2 1 
ATOM   10027 C CZ3 . TRP C 1 141 ? 53.992  101.345 136.838 1.00 31.61 ? 140 TRP C CZ3 1 
ATOM   10028 C CH2 . TRP C 1 141 ? 54.063  101.778 138.174 1.00 31.93 ? 140 TRP C CH2 1 
ATOM   10029 N N   . LYS C 1 142 ? 55.222  94.974  138.178 1.00 35.48 ? 141 LYS C N   1 
ATOM   10030 C CA  . LYS C 1 142 ? 55.437  94.063  139.296 1.00 36.49 ? 141 LYS C CA  1 
ATOM   10031 C C   . LYS C 1 142 ? 55.651  94.680  140.674 1.00 36.03 ? 141 LYS C C   1 
ATOM   10032 O O   . LYS C 1 142 ? 55.988  95.857  140.802 1.00 34.73 ? 141 LYS C O   1 
ATOM   10033 C CB  . LYS C 1 142 ? 56.605  93.134  138.953 1.00 37.85 ? 141 LYS C CB  1 
ATOM   10034 C CG  . LYS C 1 142 ? 56.220  92.067  137.940 1.00 38.95 ? 141 LYS C CG  1 
ATOM   10035 C CD  . LYS C 1 142 ? 57.421  91.475  137.246 1.00 37.81 ? 141 LYS C CD  1 
ATOM   10036 C CE  . LYS C 1 142 ? 57.048  90.181  136.534 1.00 37.25 ? 141 LYS C CE  1 
ATOM   10037 N NZ  . LYS C 1 142 ? 55.865  90.316  135.646 1.00 34.62 ? 141 LYS C NZ  1 
ATOM   10038 N N   . GLY C 1 143 ? 55.446  93.858  141.701 1.00 37.68 ? 142 GLY C N   1 
ATOM   10039 C CA  . GLY C 1 143 ? 55.618  94.299  143.076 1.00 41.27 ? 142 GLY C CA  1 
ATOM   10040 C C   . GLY C 1 143 ? 57.080  94.355  143.482 1.00 42.58 ? 142 GLY C C   1 
ATOM   10041 O O   . GLY C 1 143 ? 57.961  94.084  142.666 1.00 43.00 ? 142 GLY C O   1 
ATOM   10042 N N   . TYR C 1 144 ? 57.346  94.700  144.740 1.00 44.04 ? 143 TYR C N   1 
ATOM   10043 C CA  . TYR C 1 144 ? 58.721  94.794  145.216 1.00 44.30 ? 143 TYR C CA  1 
ATOM   10044 C C   . TYR C 1 144 ? 59.402  93.435  145.336 1.00 43.51 ? 143 TYR C C   1 
ATOM   10045 O O   . TYR C 1 144 ? 60.577  93.359  145.698 1.00 44.24 ? 143 TYR C O   1 
ATOM   10046 C CB  . TYR C 1 144 ? 58.787  95.529  146.562 1.00 46.93 ? 143 TYR C CB  1 
ATOM   10047 C CG  . TYR C 1 144 ? 58.220  94.767  147.747 1.00 49.71 ? 143 TYR C CG  1 
ATOM   10048 C CD1 . TYR C 1 144 ? 56.848  94.748  148.006 1.00 50.68 ? 143 TYR C CD1 1 
ATOM   10049 C CD2 . TYR C 1 144 ? 59.063  94.079  148.623 1.00 50.25 ? 143 TYR C CD2 1 
ATOM   10050 C CE1 . TYR C 1 144 ? 56.330  94.065  149.110 1.00 50.42 ? 143 TYR C CE1 1 
ATOM   10051 C CE2 . TYR C 1 144 ? 58.556  93.393  149.727 1.00 50.90 ? 143 TYR C CE2 1 
ATOM   10052 C CZ  . TYR C 1 144 ? 57.192  93.392  149.965 1.00 51.18 ? 143 TYR C CZ  1 
ATOM   10053 O OH  . TYR C 1 144 ? 56.695  92.721  151.058 1.00 52.33 ? 143 TYR C OH  1 
ATOM   10054 N N   . THR C 1 145 ? 58.666  92.367  145.035 1.00 42.04 ? 144 THR C N   1 
ATOM   10055 C CA  . THR C 1 145 ? 59.218  91.016  145.094 1.00 41.63 ? 144 THR C CA  1 
ATOM   10056 C C   . THR C 1 145 ? 59.021  90.262  143.776 1.00 41.52 ? 144 THR C C   1 
ATOM   10057 O O   . THR C 1 145 ? 59.132  89.034  143.730 1.00 40.81 ? 144 THR C O   1 
ATOM   10058 C CB  . THR C 1 145 ? 58.587  90.187  146.233 1.00 41.83 ? 144 THR C CB  1 
ATOM   10059 O OG1 . THR C 1 145 ? 57.192  89.998  145.978 1.00 42.22 ? 144 THR C OG1 1 
ATOM   10060 C CG2 . THR C 1 145 ? 58.771  90.891  147.571 1.00 41.35 ? 144 THR C CG2 1 
ATOM   10061 N N   . GLY C 1 146 ? 58.720  91.004  142.711 1.00 40.16 ? 145 GLY C N   1 
ATOM   10062 C CA  . GLY C 1 146 ? 58.537  90.395  141.403 1.00 39.44 ? 145 GLY C CA  1 
ATOM   10063 C C   . GLY C 1 146 ? 57.194  89.749  141.116 1.00 39.39 ? 145 GLY C C   1 
ATOM   10064 O O   . GLY C 1 146 ? 57.060  89.002  140.143 1.00 38.44 ? 145 GLY C O   1 
ATOM   10065 N N   . LYS C 1 147 ? 56.197  90.029  141.949 1.00 39.99 ? 146 LYS C N   1 
ATOM   10066 C CA  . LYS C 1 147 ? 54.863  89.462  141.760 1.00 40.34 ? 146 LYS C CA  1 
ATOM   10067 C C   . LYS C 1 147 ? 53.988  90.405  140.935 1.00 38.80 ? 146 LYS C C   1 
ATOM   10068 O O   . LYS C 1 147 ? 54.222  91.616  140.902 1.00 36.06 ? 146 LYS C O   1 
ATOM   10069 C CB  . LYS C 1 147 ? 54.173  89.241  143.110 1.00 42.50 ? 146 LYS C CB  1 
ATOM   10070 C CG  . LYS C 1 147 ? 54.842  88.257  144.056 1.00 45.94 ? 146 LYS C CG  1 
ATOM   10071 C CD  . LYS C 1 147 ? 54.620  86.818  143.630 1.00 47.10 ? 146 LYS C CD  1 
ATOM   10072 C CE  . LYS C 1 147 ? 54.578  85.900  144.846 1.00 49.92 ? 146 LYS C CE  1 
ATOM   10073 N NZ  . LYS C 1 147 ? 55.716  86.138  145.783 1.00 50.48 ? 146 LYS C NZ  1 
ATOM   10074 N N   . THR C 1 148 ? 52.980  89.843  140.276 1.00 37.72 ? 147 THR C N   1 
ATOM   10075 C CA  . THR C 1 148 ? 52.041  90.641  139.495 1.00 37.68 ? 147 THR C CA  1 
ATOM   10076 C C   . THR C 1 148 ? 51.009  91.201  140.482 1.00 37.51 ? 147 THR C C   1 
ATOM   10077 O O   . THR C 1 148 ? 50.865  90.691  141.595 1.00 35.74 ? 147 THR C O   1 
ATOM   10078 C CB  . THR C 1 148 ? 51.317  89.784  138.435 1.00 38.32 ? 147 THR C CB  1 
ATOM   10079 O OG1 . THR C 1 148 ? 50.665  88.680  139.075 1.00 39.77 ? 147 THR C OG1 1 
ATOM   10080 C CG2 . THR C 1 148 ? 52.311  89.255  137.404 1.00 38.76 ? 147 THR C CG2 1 
ATOM   10081 N N   . ILE C 1 149 ? 50.301  92.251  140.088 1.00 36.07 ? 148 ILE C N   1 
ATOM   10082 C CA  . ILE C 1 149 ? 49.308  92.847  140.970 1.00 34.60 ? 148 ILE C CA  1 
ATOM   10083 C C   . ILE C 1 149 ? 47.992  92.067  140.939 1.00 33.76 ? 148 ILE C C   1 
ATOM   10084 O O   . ILE C 1 149 ? 47.428  91.824  139.870 1.00 33.21 ? 148 ILE C O   1 
ATOM   10085 C CB  . ILE C 1 149 ? 49.041  94.312  140.582 1.00 34.63 ? 148 ILE C CB  1 
ATOM   10086 C CG1 . ILE C 1 149 ? 50.342  95.115  140.681 1.00 33.68 ? 148 ILE C CG1 1 
ATOM   10087 C CG2 . ILE C 1 149 ? 47.966  94.901  141.482 1.00 33.72 ? 148 ILE C CG2 1 
ATOM   10088 C CD1 . ILE C 1 149 ? 50.927  95.189  142.080 1.00 34.99 ? 148 ILE C CD1 1 
ATOM   10089 N N   . THR C 1 150 ? 47.512  91.676  142.117 1.00 32.02 ? 149 THR C N   1 
ATOM   10090 C CA  . THR C 1 150 ? 46.263  90.922  142.227 1.00 32.15 ? 149 THR C CA  1 
ATOM   10091 C C   . THR C 1 150 ? 45.123  91.764  142.804 1.00 31.07 ? 149 THR C C   1 
ATOM   10092 O O   . THR C 1 150 ? 43.950  91.484  142.556 1.00 31.83 ? 149 THR C O   1 
ATOM   10093 C CB  . THR C 1 150 ? 46.434  89.671  143.123 1.00 30.88 ? 149 THR C CB  1 
ATOM   10094 O OG1 . THR C 1 150 ? 46.802  90.080  144.446 1.00 30.02 ? 149 THR C OG1 1 
ATOM   10095 C CG2 . THR C 1 150 ? 47.510  88.756  142.561 1.00 30.50 ? 149 THR C CG2 1 
ATOM   10096 N N   . ASP C 1 151 ? 45.468  92.792  143.574 1.00 30.61 ? 150 ASP C N   1 
ATOM   10097 C CA  . ASP C 1 151 ? 44.457  93.653  144.175 1.00 29.98 ? 150 ASP C CA  1 
ATOM   10098 C C   . ASP C 1 151 ? 44.764  95.138  144.038 1.00 28.43 ? 150 ASP C C   1 
ATOM   10099 O O   . ASP C 1 151 ? 45.905  95.572  144.207 1.00 28.69 ? 150 ASP C O   1 
ATOM   10100 C CB  . ASP C 1 151 ? 44.282  93.318  145.661 1.00 30.71 ? 150 ASP C CB  1 
ATOM   10101 C CG  . ASP C 1 151 ? 43.845  91.885  145.888 1.00 33.38 ? 150 ASP C CG  1 
ATOM   10102 O OD1 . ASP C 1 151 ? 44.704  90.981  145.801 1.00 32.68 ? 150 ASP C OD1 1 
ATOM   10103 O OD2 . ASP C 1 151 ? 42.641  91.663  146.141 1.00 31.35 ? 150 ASP C OD2 1 
ATOM   10104 N N   . VAL C 1 152 ? 43.728  95.909  143.730 1.00 25.43 ? 151 VAL C N   1 
ATOM   10105 C CA  . VAL C 1 152 ? 43.843  97.350  143.586 1.00 23.50 ? 151 VAL C CA  1 
ATOM   10106 C C   . VAL C 1 152 ? 42.957  97.951  144.655 1.00 24.14 ? 151 VAL C C   1 
ATOM   10107 O O   . VAL C 1 152 ? 41.769  97.638  144.726 1.00 24.57 ? 151 VAL C O   1 
ATOM   10108 C CB  . VAL C 1 152 ? 43.348  97.825  142.208 1.00 24.17 ? 151 VAL C CB  1 
ATOM   10109 C CG1 . VAL C 1 152 ? 43.293  99.356  142.166 1.00 22.82 ? 151 VAL C CG1 1 
ATOM   10110 C CG2 . VAL C 1 152 ? 44.269  97.292  141.123 1.00 23.09 ? 151 VAL C CG2 1 
ATOM   10111 N N   . ILE C 1 153 ? 43.538  98.800  145.494 1.00 23.83 ? 152 ILE C N   1 
ATOM   10112 C CA  . ILE C 1 153 ? 42.788  99.428  146.565 1.00 25.11 ? 152 ILE C CA  1 
ATOM   10113 C C   . ILE C 1 153 ? 42.668  100.921 146.308 1.00 25.86 ? 152 ILE C C   1 
ATOM   10114 O O   . ILE C 1 153 ? 43.665  101.640 146.257 1.00 23.97 ? 152 ILE C O   1 
ATOM   10115 C CB  . ILE C 1 153 ? 43.462  99.205  147.943 1.00 24.46 ? 152 ILE C CB  1 
ATOM   10116 C CG1 . ILE C 1 153 ? 43.535  97.710  148.266 1.00 25.31 ? 152 ILE C CG1 1 
ATOM   10117 C CG2 . ILE C 1 153 ? 42.672  99.914  149.031 1.00 25.01 ? 152 ILE C CG2 1 
ATOM   10118 C CD1 . ILE C 1 153 ? 44.564  96.944  147.463 1.00 25.39 ? 152 ILE C CD1 1 
ATOM   10119 N N   . ASN C 1 154 ? 41.432  101.378 146.146 1.00 26.06 ? 153 ASN C N   1 
ATOM   10120 C CA  . ASN C 1 154 ? 41.173  102.782 145.900 1.00 26.61 ? 153 ASN C CA  1 
ATOM   10121 C C   . ASN C 1 154 ? 40.845  103.484 147.204 1.00 27.26 ? 153 ASN C C   1 
ATOM   10122 O O   . ASN C 1 154 ? 39.959  103.060 147.950 1.00 26.71 ? 153 ASN C O   1 
ATOM   10123 C CB  . ASN C 1 154 ? 40.018  102.949 144.914 1.00 27.59 ? 153 ASN C CB  1 
ATOM   10124 C CG  . ASN C 1 154 ? 39.824  104.391 144.497 1.00 29.20 ? 153 ASN C CG  1 
ATOM   10125 O OD1 . ASN C 1 154 ? 39.085  105.144 145.133 1.00 31.14 ? 153 ASN C OD1 1 
ATOM   10126 N ND2 . ASN C 1 154 ? 40.510  104.791 143.435 1.00 27.83 ? 153 ASN C ND2 1 
ATOM   10127 N N   . ILE C 1 155 ? 41.572  104.559 147.476 1.00 27.28 ? 154 ILE C N   1 
ATOM   10128 C CA  . ILE C 1 155 ? 41.372  105.322 148.694 1.00 27.24 ? 154 ILE C CA  1 
ATOM   10129 C C   . ILE C 1 155 ? 40.978  106.748 148.346 1.00 27.02 ? 154 ILE C C   1 
ATOM   10130 O O   . ILE C 1 155 ? 41.742  107.483 147.720 1.00 27.29 ? 154 ILE C O   1 
ATOM   10131 C CB  . ILE C 1 155 ? 42.656  105.332 149.555 1.00 27.68 ? 154 ILE C CB  1 
ATOM   10132 C CG1 . ILE C 1 155 ? 43.088  103.889 149.849 1.00 28.65 ? 154 ILE C CG1 1 
ATOM   10133 C CG2 . ILE C 1 155 ? 42.407  106.095 150.851 1.00 27.32 ? 154 ILE C CG2 1 
ATOM   10134 C CD1 . ILE C 1 155 ? 44.364  103.767 150.669 1.00 29.66 ? 154 ILE C CD1 1 
ATOM   10135 N N   . GLY C 1 156 ? 39.771  107.126 148.745 1.00 25.94 ? 155 GLY C N   1 
ATOM   10136 C CA  . GLY C 1 156 ? 39.272  108.461 148.473 1.00 24.77 ? 155 GLY C CA  1 
ATOM   10137 C C   . GLY C 1 156 ? 37.914  108.627 149.123 1.00 24.51 ? 155 GLY C C   1 
ATOM   10138 O O   . GLY C 1 156 ? 37.311  107.649 149.560 1.00 23.41 ? 155 GLY C O   1 
ATOM   10139 N N   . ILE C 1 157 ? 37.428  109.859 149.197 1.00 24.25 ? 156 ILE C N   1 
ATOM   10140 C CA  . ILE C 1 157 ? 36.135  110.114 149.812 1.00 26.06 ? 156 ILE C CA  1 
ATOM   10141 C C   . ILE C 1 157 ? 35.179  110.749 148.814 1.00 26.17 ? 156 ILE C C   1 
ATOM   10142 O O   . ILE C 1 157 ? 35.596  111.268 147.778 1.00 27.16 ? 156 ILE C O   1 
ATOM   10143 C CB  . ILE C 1 157 ? 36.262  111.066 151.024 1.00 26.77 ? 156 ILE C CB  1 
ATOM   10144 C CG1 . ILE C 1 157 ? 36.819  112.416 150.563 1.00 28.12 ? 156 ILE C CG1 1 
ATOM   10145 C CG2 . ILE C 1 157 ? 37.162  110.449 152.084 1.00 26.95 ? 156 ILE C CG2 1 
ATOM   10146 C CD1 . ILE C 1 157 ? 36.786  113.499 151.624 1.00 29.10 ? 156 ILE C CD1 1 
ATOM   10147 N N   . GLY C 1 158 ? 33.893  110.700 149.135 1.00 25.85 ? 157 GLY C N   1 
ATOM   10148 C CA  . GLY C 1 158 ? 32.887  111.291 148.274 1.00 25.37 ? 157 GLY C CA  1 
ATOM   10149 C C   . GLY C 1 158 ? 33.018  110.946 146.805 1.00 25.73 ? 157 GLY C C   1 
ATOM   10150 O O   . GLY C 1 158 ? 32.990  109.773 146.426 1.00 23.95 ? 157 GLY C O   1 
ATOM   10151 N N   . GLY C 1 159 ? 33.166  111.977 145.979 1.00 24.89 ? 158 GLY C N   1 
ATOM   10152 C CA  . GLY C 1 159 ? 33.279  111.776 144.545 1.00 26.23 ? 158 GLY C CA  1 
ATOM   10153 C C   . GLY C 1 159 ? 34.447  110.928 144.077 1.00 26.74 ? 158 GLY C C   1 
ATOM   10154 O O   . GLY C 1 159 ? 34.440  110.432 142.949 1.00 27.68 ? 158 GLY C O   1 
ATOM   10155 N N   . SER C 1 160 ? 35.456  110.761 144.924 1.00 27.03 ? 159 SER C N   1 
ATOM   10156 C CA  . SER C 1 160 ? 36.624  109.962 144.558 1.00 28.20 ? 159 SER C CA  1 
ATOM   10157 C C   . SER C 1 160 ? 36.434  108.502 144.956 1.00 27.86 ? 159 SER C C   1 
ATOM   10158 O O   . SER C 1 160 ? 37.360  107.698 144.851 1.00 30.26 ? 159 SER C O   1 
ATOM   10159 C CB  . SER C 1 160 ? 37.883  110.511 145.240 1.00 28.13 ? 159 SER C CB  1 
ATOM   10160 O OG  . SER C 1 160 ? 38.180  111.821 144.797 1.00 29.58 ? 159 SER C OG  1 
ATOM   10161 N N   . ASP C 1 161 ? 35.226  108.167 145.395 1.00 25.94 ? 160 ASP C N   1 
ATOM   10162 C CA  . ASP C 1 161 ? 34.900  106.816 145.835 1.00 25.91 ? 160 ASP C CA  1 
ATOM   10163 C C   . ASP C 1 161 ? 33.610  106.269 145.208 1.00 25.08 ? 160 ASP C C   1 
ATOM   10164 O O   . ASP C 1 161 ? 33.627  105.246 144.526 1.00 24.69 ? 160 ASP C O   1 
ATOM   10165 C CB  . ASP C 1 161 ? 34.777  106.808 147.371 1.00 25.31 ? 160 ASP C CB  1 
ATOM   10166 C CG  . ASP C 1 161 ? 34.176  105.522 147.909 1.00 26.35 ? 160 ASP C CG  1 
ATOM   10167 O OD1 . ASP C 1 161 ? 34.885  104.493 147.947 1.00 24.69 ? 160 ASP C OD1 1 
ATOM   10168 O OD2 . ASP C 1 161 ? 32.986  105.542 148.289 1.00 25.90 ? 160 ASP C OD2 1 
ATOM   10169 N N   . LEU C 1 162 ? 32.502  106.967 145.432 1.00 25.00 ? 161 LEU C N   1 
ATOM   10170 C CA  . LEU C 1 162 ? 31.191  106.540 144.941 1.00 25.97 ? 161 LEU C CA  1 
ATOM   10171 C C   . LEU C 1 162 ? 31.084  106.117 143.472 1.00 23.44 ? 161 LEU C C   1 
ATOM   10172 O O   . LEU C 1 162 ? 30.575  105.034 143.172 1.00 24.92 ? 161 LEU C O   1 
ATOM   10173 C CB  . LEU C 1 162 ? 30.150  107.627 145.229 1.00 27.82 ? 161 LEU C CB  1 
ATOM   10174 C CG  . LEU C 1 162 ? 29.033  107.244 146.202 1.00 31.23 ? 161 LEU C CG  1 
ATOM   10175 C CD1 . LEU C 1 162 ? 28.363  105.953 145.731 1.00 33.61 ? 161 LEU C CD1 1 
ATOM   10176 C CD2 . LEU C 1 162 ? 29.611  107.050 147.594 1.00 34.28 ? 161 LEU C CD2 1 
ATOM   10177 N N   . GLY C 1 163 ? 31.541  106.968 142.562 1.00 22.07 ? 162 GLY C N   1 
ATOM   10178 C CA  . GLY C 1 163 ? 31.471  106.640 141.144 1.00 19.91 ? 162 GLY C CA  1 
ATOM   10179 C C   . GLY C 1 163 ? 32.181  105.341 140.804 1.00 20.17 ? 162 GLY C C   1 
ATOM   10180 O O   . GLY C 1 163 ? 31.548  104.379 140.363 1.00 19.05 ? 162 GLY C O   1 
ATOM   10181 N N   . PRO C 1 164 ? 33.508  105.284 141.003 1.00 20.46 ? 163 PRO C N   1 
ATOM   10182 C CA  . PRO C 1 164 ? 34.316  104.095 140.720 1.00 19.55 ? 163 PRO C CA  1 
ATOM   10183 C C   . PRO C 1 164 ? 33.767  102.858 141.418 1.00 20.57 ? 163 PRO C C   1 
ATOM   10184 O O   . PRO C 1 164 ? 33.780  101.764 140.857 1.00 20.46 ? 163 PRO C O   1 
ATOM   10185 C CB  . PRO C 1 164 ? 35.696  104.484 141.245 1.00 22.09 ? 163 PRO C CB  1 
ATOM   10186 C CG  . PRO C 1 164 ? 35.721  105.980 141.037 1.00 21.05 ? 163 PRO C CG  1 
ATOM   10187 C CD  . PRO C 1 164 ? 34.350  106.381 141.514 1.00 20.09 ? 163 PRO C CD  1 
ATOM   10188 N N   . LEU C 1 165 ? 33.291  103.032 142.648 1.00 20.23 ? 164 LEU C N   1 
ATOM   10189 C CA  . LEU C 1 165 ? 32.736  101.916 143.399 1.00 21.70 ? 164 LEU C CA  1 
ATOM   10190 C C   . LEU C 1 165 ? 31.435  101.433 142.757 1.00 21.42 ? 164 LEU C C   1 
ATOM   10191 O O   . LEU C 1 165 ? 31.275  100.245 142.482 1.00 21.09 ? 164 LEU C O   1 
ATOM   10192 C CB  . LEU C 1 165 ? 32.489  102.326 144.859 1.00 22.17 ? 164 LEU C CB  1 
ATOM   10193 C CG  . LEU C 1 165 ? 31.965  101.267 145.834 1.00 24.22 ? 164 LEU C CG  1 
ATOM   10194 C CD1 . LEU C 1 165 ? 32.258  101.713 147.265 1.00 24.32 ? 164 LEU C CD1 1 
ATOM   10195 C CD2 . LEU C 1 165 ? 30.469  101.043 145.631 1.00 25.05 ? 164 LEU C CD2 1 
ATOM   10196 N N   . MET C 1 166 ? 30.509  102.353 142.512 1.00 20.26 ? 165 MET C N   1 
ATOM   10197 C CA  . MET C 1 166 ? 29.235  101.973 141.913 1.00 19.89 ? 165 MET C CA  1 
ATOM   10198 C C   . MET C 1 166 ? 29.420  101.318 140.549 1.00 19.85 ? 165 MET C C   1 
ATOM   10199 O O   . MET C 1 166 ? 28.812  100.287 140.265 1.00 20.25 ? 165 MET C O   1 
ATOM   10200 C CB  . MET C 1 166 ? 28.318  103.192 141.799 1.00 19.94 ? 165 MET C CB  1 
ATOM   10201 C CG  . MET C 1 166 ? 26.967  102.919 141.135 1.00 19.95 ? 165 MET C CG  1 
ATOM   10202 S SD  . MET C 1 166 ? 27.039  102.911 139.316 1.00 18.95 ? 165 MET C SD  1 
ATOM   10203 C CE  . MET C 1 166 ? 26.889  104.699 138.974 1.00 15.97 ? 165 MET C CE  1 
ATOM   10204 N N   . VAL C 1 167 ? 30.276  101.901 139.717 1.00 19.54 ? 166 VAL C N   1 
ATOM   10205 C CA  . VAL C 1 167 ? 30.522  101.366 138.384 1.00 18.97 ? 166 VAL C CA  1 
ATOM   10206 C C   . VAL C 1 167 ? 31.188  99.985  138.393 1.00 20.62 ? 166 VAL C C   1 
ATOM   10207 O O   . VAL C 1 167 ? 30.762  99.083  137.662 1.00 20.12 ? 166 VAL C O   1 
ATOM   10208 C CB  . VAL C 1 167 ? 31.377  102.338 137.545 1.00 19.59 ? 166 VAL C CB  1 
ATOM   10209 C CG1 . VAL C 1 167 ? 31.663  101.732 136.180 1.00 17.77 ? 166 VAL C CG1 1 
ATOM   10210 C CG2 . VAL C 1 167 ? 30.645  103.672 137.385 1.00 19.63 ? 166 VAL C CG2 1 
ATOM   10211 N N   . THR C 1 168 ? 32.229  99.807  139.204 1.00 19.75 ? 167 THR C N   1 
ATOM   10212 C CA  . THR C 1 168 ? 32.888  98.501  139.249 1.00 20.17 ? 167 THR C CA  1 
ATOM   10213 C C   . THR C 1 168 ? 31.952  97.425  139.789 1.00 18.50 ? 167 THR C C   1 
ATOM   10214 O O   . THR C 1 168 ? 32.102  96.246  139.479 1.00 20.38 ? 167 THR C O   1 
ATOM   10215 C CB  . THR C 1 168 ? 34.182  98.528  140.095 1.00 18.80 ? 167 THR C CB  1 
ATOM   10216 O OG1 . THR C 1 168 ? 33.923  99.136  141.367 1.00 19.82 ? 167 THR C OG1 1 
ATOM   10217 C CG2 . THR C 1 168 ? 35.263  99.300  139.365 1.00 19.80 ? 167 THR C CG2 1 
ATOM   10218 N N   . GLU C 1 169 ? 30.989  97.821  140.607 1.00 19.27 ? 168 GLU C N   1 
ATOM   10219 C CA  . GLU C 1 169 ? 30.039  96.849  141.121 1.00 19.84 ? 168 GLU C CA  1 
ATOM   10220 C C   . GLU C 1 169 ? 29.064  96.500  139.996 1.00 19.56 ? 168 GLU C C   1 
ATOM   10221 O O   . GLU C 1 169 ? 28.752  95.330  139.765 1.00 20.29 ? 168 GLU C O   1 
ATOM   10222 C CB  . GLU C 1 169 ? 29.289  97.419  142.324 1.00 19.73 ? 168 GLU C CB  1 
ATOM   10223 C CG  . GLU C 1 169 ? 30.114  97.458  143.603 1.00 18.41 ? 168 GLU C CG  1 
ATOM   10224 C CD  . GLU C 1 169 ? 30.451  96.067  144.101 1.00 20.29 ? 168 GLU C CD  1 
ATOM   10225 O OE1 . GLU C 1 169 ? 31.650  95.746  144.204 1.00 18.83 ? 168 GLU C OE1 1 
ATOM   10226 O OE2 . GLU C 1 169 ? 29.514  95.290  144.383 1.00 18.73 ? 168 GLU C OE2 1 
ATOM   10227 N N   . ALA C 1 170 ? 28.612  97.521  139.276 1.00 20.16 ? 169 ALA C N   1 
ATOM   10228 C CA  . ALA C 1 170 ? 27.672  97.332  138.173 1.00 21.03 ? 169 ALA C CA  1 
ATOM   10229 C C   . ALA C 1 170 ? 28.240  96.549  136.992 1.00 22.44 ? 169 ALA C C   1 
ATOM   10230 O O   . ALA C 1 170 ? 27.503  95.834  136.314 1.00 21.38 ? 169 ALA C O   1 
ATOM   10231 C CB  . ALA C 1 170 ? 27.171  98.685  137.679 1.00 22.61 ? 169 ALA C CB  1 
ATOM   10232 N N   . LEU C 1 171 ? 29.542  96.685  136.744 1.00 22.44 ? 170 LEU C N   1 
ATOM   10233 C CA  . LEU C 1 171 ? 30.174  96.007  135.617 1.00 23.24 ? 170 LEU C CA  1 
ATOM   10234 C C   . LEU C 1 171 ? 31.066  94.838  136.029 1.00 24.60 ? 170 LEU C C   1 
ATOM   10235 O O   . LEU C 1 171 ? 31.978  94.451  135.289 1.00 24.03 ? 170 LEU C O   1 
ATOM   10236 C CB  . LEU C 1 171 ? 30.994  97.013  134.802 1.00 21.91 ? 170 LEU C CB  1 
ATOM   10237 C CG  . LEU C 1 171 ? 30.222  98.229  134.276 1.00 21.35 ? 170 LEU C CG  1 
ATOM   10238 C CD1 . LEU C 1 171 ? 31.175  99.149  133.534 1.00 20.88 ? 170 LEU C CD1 1 
ATOM   10239 C CD2 . LEU C 1 171 ? 29.087  97.783  133.359 1.00 19.37 ? 170 LEU C CD2 1 
ATOM   10240 N N   . LYS C 1 172 ? 30.794  94.271  137.200 1.00 24.28 ? 171 LYS C N   1 
ATOM   10241 C CA  . LYS C 1 172 ? 31.576  93.145  137.709 1.00 25.00 ? 171 LYS C CA  1 
ATOM   10242 C C   . LYS C 1 172 ? 31.795  92.032  136.671 1.00 24.67 ? 171 LYS C C   1 
ATOM   10243 O O   . LYS C 1 172 ? 32.878  91.453  136.592 1.00 25.71 ? 171 LYS C O   1 
ATOM   10244 C CB  . LYS C 1 172 ? 30.905  92.570  138.964 1.00 24.09 ? 171 LYS C CB  1 
ATOM   10245 C CG  . LYS C 1 172 ? 31.776  91.603  139.765 1.00 28.05 ? 171 LYS C CG  1 
ATOM   10246 C CD  . LYS C 1 172 ? 33.061  92.273  140.276 1.00 26.22 ? 171 LYS C CD  1 
ATOM   10247 C CE  . LYS C 1 172 ? 32.756  93.393  141.267 1.00 29.44 ? 171 LYS C CE  1 
ATOM   10248 N NZ  . LYS C 1 172 ? 33.988  94.051  141.811 1.00 26.37 ? 171 LYS C NZ  1 
ATOM   10249 N N   . PRO C 1 173 ? 30.776  91.723  135.852 1.00 24.48 ? 172 PRO C N   1 
ATOM   10250 C CA  . PRO C 1 173 ? 30.928  90.666  134.843 1.00 23.80 ? 172 PRO C CA  1 
ATOM   10251 C C   . PRO C 1 173 ? 32.002  90.944  133.795 1.00 23.29 ? 172 PRO C C   1 
ATOM   10252 O O   . PRO C 1 173 ? 32.414  90.038  133.077 1.00 21.64 ? 172 PRO C O   1 
ATOM   10253 C CB  . PRO C 1 173 ? 29.547  90.593  134.197 1.00 23.17 ? 172 PRO C CB  1 
ATOM   10254 C CG  . PRO C 1 173 ? 28.638  91.077  135.264 1.00 24.73 ? 172 PRO C CG  1 
ATOM   10255 C CD  . PRO C 1 173 ? 29.395  92.234  135.859 1.00 23.74 ? 172 PRO C CD  1 
ATOM   10256 N N   . TYR C 1 174 ? 32.441  92.195  133.701 1.00 22.26 ? 173 TYR C N   1 
ATOM   10257 C CA  . TYR C 1 174 ? 33.456  92.568  132.725 1.00 23.91 ? 173 TYR C CA  1 
ATOM   10258 C C   . TYR C 1 174 ? 34.869  92.646  133.302 1.00 24.66 ? 173 TYR C C   1 
ATOM   10259 O O   . TYR C 1 174 ? 35.792  93.081  132.622 1.00 26.23 ? 173 TYR C O   1 
ATOM   10260 C CB  . TYR C 1 174 ? 33.098  93.919  132.085 1.00 22.41 ? 173 TYR C CB  1 
ATOM   10261 C CG  . TYR C 1 174 ? 31.773  93.905  131.358 1.00 21.02 ? 173 TYR C CG  1 
ATOM   10262 C CD1 . TYR C 1 174 ? 30.580  94.145  132.040 1.00 18.08 ? 173 TYR C CD1 1 
ATOM   10263 C CD2 . TYR C 1 174 ? 31.705  93.565  130.005 1.00 20.53 ? 173 TYR C CD2 1 
ATOM   10264 C CE1 . TYR C 1 174 ? 29.352  94.037  131.398 1.00 19.83 ? 173 TYR C CE1 1 
ATOM   10265 C CE2 . TYR C 1 174 ? 30.479  93.452  129.352 1.00 20.21 ? 173 TYR C CE2 1 
ATOM   10266 C CZ  . TYR C 1 174 ? 29.311  93.684  130.055 1.00 19.00 ? 173 TYR C CZ  1 
ATOM   10267 O OH  . TYR C 1 174 ? 28.099  93.526  129.430 1.00 20.33 ? 173 TYR C OH  1 
ATOM   10268 N N   . SER C 1 175 ? 35.041  92.220  134.547 1.00 24.78 ? 174 SER C N   1 
ATOM   10269 C CA  . SER C 1 175 ? 36.351  92.287  135.188 1.00 26.95 ? 174 SER C CA  1 
ATOM   10270 C C   . SER C 1 175 ? 37.213  91.037  135.032 1.00 27.64 ? 174 SER C C   1 
ATOM   10271 O O   . SER C 1 175 ? 38.179  90.860  135.769 1.00 26.14 ? 174 SER C O   1 
ATOM   10272 C CB  . SER C 1 175 ? 36.181  92.583  136.675 1.00 26.47 ? 174 SER C CB  1 
ATOM   10273 O OG  . SER C 1 175 ? 35.497  91.524  137.311 1.00 28.00 ? 174 SER C OG  1 
ATOM   10274 N N   . SER C 1 176 ? 36.866  90.174  134.082 1.00 31.04 ? 175 SER C N   1 
ATOM   10275 C CA  . SER C 1 176 ? 37.637  88.956  133.856 1.00 33.71 ? 175 SER C CA  1 
ATOM   10276 C C   . SER C 1 176 ? 39.027  89.329  133.348 1.00 34.26 ? 175 SER C C   1 
ATOM   10277 O O   . SER C 1 176 ? 39.167  90.002  132.327 1.00 35.25 ? 175 SER C O   1 
ATOM   10278 C CB  . SER C 1 176 ? 36.933  88.060  132.830 1.00 36.21 ? 175 SER C CB  1 
ATOM   10279 O OG  . SER C 1 176 ? 37.671  86.873  132.586 1.00 39.18 ? 175 SER C OG  1 
ATOM   10280 N N   . GLY C 1 177 ? 40.054  88.898  134.070 1.00 34.82 ? 176 GLY C N   1 
ATOM   10281 C CA  . GLY C 1 177 ? 41.410  89.209  133.664 1.00 34.61 ? 176 GLY C CA  1 
ATOM   10282 C C   . GLY C 1 177 ? 41.953  90.416  134.396 1.00 35.23 ? 176 GLY C C   1 
ATOM   10283 O O   . GLY C 1 177 ? 43.123  90.772  134.245 1.00 37.80 ? 176 GLY C O   1 
ATOM   10284 N N   . GLY C 1 178 ? 41.105  91.055  135.193 1.00 33.00 ? 177 GLY C N   1 
ATOM   10285 C CA  . GLY C 1 178 ? 41.552  92.216  135.936 1.00 30.90 ? 177 GLY C CA  1 
ATOM   10286 C C   . GLY C 1 178 ? 41.763  91.874  137.396 1.00 29.61 ? 177 GLY C C   1 
ATOM   10287 O O   . GLY C 1 178 ? 41.327  90.821  137.853 1.00 29.66 ? 177 GLY C O   1 
ATOM   10288 N N   . PRO C 1 179 ? 42.450  92.734  138.156 1.00 28.92 ? 178 PRO C N   1 
ATOM   10289 C CA  . PRO C 1 179 ? 42.681  92.465  139.576 1.00 29.18 ? 178 PRO C CA  1 
ATOM   10290 C C   . PRO C 1 179 ? 41.421  92.821  140.363 1.00 30.47 ? 178 PRO C C   1 
ATOM   10291 O O   . PRO C 1 179 ? 40.577  93.573  139.877 1.00 29.87 ? 178 PRO C O   1 
ATOM   10292 C CB  . PRO C 1 179 ? 43.829  93.402  139.909 1.00 27.65 ? 178 PRO C CB  1 
ATOM   10293 C CG  . PRO C 1 179 ? 43.501  94.600  139.067 1.00 27.23 ? 178 PRO C CG  1 
ATOM   10294 C CD  . PRO C 1 179 ? 43.140  93.968  137.739 1.00 28.52 ? 178 PRO C CD  1 
ATOM   10295 N N   . ARG C 1 180 ? 41.290  92.282  141.570 1.00 29.85 ? 179 ARG C N   1 
ATOM   10296 C CA  . ARG C 1 180 ? 40.137  92.598  142.401 1.00 29.27 ? 179 ARG C CA  1 
ATOM   10297 C C   . ARG C 1 180 ? 40.281  94.063  142.795 1.00 27.82 ? 179 ARG C C   1 
ATOM   10298 O O   . ARG C 1 180 ? 41.395  94.579  142.852 1.00 28.09 ? 179 ARG C O   1 
ATOM   10299 C CB  . ARG C 1 180 ? 40.132  91.730  143.662 1.00 30.15 ? 179 ARG C CB  1 
ATOM   10300 C CG  . ARG C 1 180 ? 39.979  90.234  143.417 1.00 32.61 ? 179 ARG C CG  1 
ATOM   10301 C CD  . ARG C 1 180 ? 40.052  89.460  144.733 1.00 37.63 ? 179 ARG C CD  1 
ATOM   10302 N NE  . ARG C 1 180 ? 41.402  89.442  145.302 1.00 39.99 ? 179 ARG C NE  1 
ATOM   10303 C CZ  . ARG C 1 180 ? 42.373  88.616  144.914 1.00 40.43 ? 179 ARG C CZ  1 
ATOM   10304 N NH1 . ARG C 1 180 ? 42.148  87.729  143.958 1.00 41.89 ? 179 ARG C NH1 1 
ATOM   10305 N NH2 . ARG C 1 180 ? 43.574  88.684  145.474 1.00 40.71 ? 179 ARG C NH2 1 
ATOM   10306 N N   . VAL C 1 181 ? 39.165  94.738  143.048 1.00 27.28 ? 180 VAL C N   1 
ATOM   10307 C CA  . VAL C 1 181 ? 39.204  96.137  143.464 1.00 25.42 ? 180 VAL C CA  1 
ATOM   10308 C C   . VAL C 1 181 ? 38.598  96.288  144.856 1.00 26.32 ? 180 VAL C C   1 
ATOM   10309 O O   . VAL C 1 181 ? 37.654  95.580  145.214 1.00 26.41 ? 180 VAL C O   1 
ATOM   10310 C CB  . VAL C 1 181 ? 38.443  97.076  142.475 1.00 25.12 ? 180 VAL C CB  1 
ATOM   10311 C CG1 . VAL C 1 181 ? 39.266  97.280  141.221 1.00 26.18 ? 180 VAL C CG1 1 
ATOM   10312 C CG2 . VAL C 1 181 ? 37.073  96.492  142.119 1.00 20.74 ? 180 VAL C CG2 1 
ATOM   10313 N N   . TRP C 1 182 ? 39.158  97.211  145.636 1.00 25.89 ? 181 TRP C N   1 
ATOM   10314 C CA  . TRP C 1 182 ? 38.696  97.483  146.992 1.00 26.88 ? 181 TRP C CA  1 
ATOM   10315 C C   . TRP C 1 182 ? 38.529  98.986  147.150 1.00 26.02 ? 181 TRP C C   1 
ATOM   10316 O O   . TRP C 1 182 ? 39.299  99.762  146.595 1.00 25.40 ? 181 TRP C O   1 
ATOM   10317 C CB  . TRP C 1 182 ? 39.714  96.988  148.028 1.00 28.51 ? 181 TRP C CB  1 
ATOM   10318 C CG  . TRP C 1 182 ? 40.024  95.532  147.934 1.00 31.94 ? 181 TRP C CG  1 
ATOM   10319 C CD1 . TRP C 1 182 ? 40.762  94.912  146.970 1.00 32.15 ? 181 TRP C CD1 1 
ATOM   10320 C CD2 . TRP C 1 182 ? 39.578  94.502  148.825 1.00 34.22 ? 181 TRP C CD2 1 
ATOM   10321 N NE1 . TRP C 1 182 ? 40.803  93.557  147.203 1.00 34.75 ? 181 TRP C NE1 1 
ATOM   10322 C CE2 . TRP C 1 182 ? 40.084  93.279  148.336 1.00 35.65 ? 181 TRP C CE2 1 
ATOM   10323 C CE3 . TRP C 1 182 ? 38.798  94.495  149.989 1.00 36.72 ? 181 TRP C CE3 1 
ATOM   10324 C CZ2 . TRP C 1 182 ? 39.836  92.056  148.973 1.00 36.76 ? 181 TRP C CZ2 1 
ATOM   10325 C CZ3 . TRP C 1 182 ? 38.551  93.277  150.623 1.00 38.00 ? 181 TRP C CZ3 1 
ATOM   10326 C CH2 . TRP C 1 182 ? 39.070  92.076  150.111 1.00 37.84 ? 181 TRP C CH2 1 
ATOM   10327 N N   . TYR C 1 183 ? 37.523  99.397  147.907 1.00 24.40 ? 182 TYR C N   1 
ATOM   10328 C CA  . TYR C 1 183 ? 37.289  100.815 148.120 1.00 24.51 ? 182 TYR C CA  1 
ATOM   10329 C C   . TYR C 1 183 ? 37.291  101.152 149.600 1.00 24.16 ? 182 TYR C C   1 
ATOM   10330 O O   . TYR C 1 183 ? 36.507  100.613 150.378 1.00 25.21 ? 182 TYR C O   1 
ATOM   10331 C CB  . TYR C 1 183 ? 35.969  101.224 147.458 1.00 22.80 ? 182 TYR C CB  1 
ATOM   10332 C CG  . TYR C 1 183 ? 36.058  101.137 145.949 1.00 23.31 ? 182 TYR C CG  1 
ATOM   10333 C CD1 . TYR C 1 183 ? 36.466  102.232 145.189 1.00 21.50 ? 182 TYR C CD1 1 
ATOM   10334 C CD2 . TYR C 1 183 ? 35.833  99.927  145.290 1.00 22.27 ? 182 TYR C CD2 1 
ATOM   10335 C CE1 . TYR C 1 183 ? 36.655  102.122 143.805 1.00 21.70 ? 182 TYR C CE1 1 
ATOM   10336 C CE2 . TYR C 1 183 ? 36.024  99.808  143.912 1.00 22.56 ? 182 TYR C CE2 1 
ATOM   10337 C CZ  . TYR C 1 183 ? 36.436  100.907 143.179 1.00 21.38 ? 182 TYR C CZ  1 
ATOM   10338 O OH  . TYR C 1 183 ? 36.647  100.773 141.825 1.00 22.13 ? 182 TYR C OH  1 
ATOM   10339 N N   . VAL C 1 184 ? 38.211  102.028 149.978 1.00 24.39 ? 183 VAL C N   1 
ATOM   10340 C CA  . VAL C 1 184 ? 38.351  102.482 151.351 1.00 24.75 ? 183 VAL C CA  1 
ATOM   10341 C C   . VAL C 1 184 ? 38.035  103.971 151.316 1.00 25.19 ? 183 VAL C C   1 
ATOM   10342 O O   . VAL C 1 184 ? 38.668  104.723 150.579 1.00 27.11 ? 183 VAL C O   1 
ATOM   10343 C CB  . VAL C 1 184 ? 39.794  102.250 151.852 1.00 24.60 ? 183 VAL C CB  1 
ATOM   10344 C CG1 . VAL C 1 184 ? 40.005  102.917 153.202 1.00 24.76 ? 183 VAL C CG1 1 
ATOM   10345 C CG2 . VAL C 1 184 ? 40.061  100.755 151.953 1.00 25.53 ? 183 VAL C CG2 1 
ATOM   10346 N N   . SER C 1 185 ? 37.052  104.399 152.103 1.00 25.41 ? 184 SER C N   1 
ATOM   10347 C CA  . SER C 1 185 ? 36.657  105.804 152.101 1.00 22.97 ? 184 SER C CA  1 
ATOM   10348 C C   . SER C 1 185 ? 36.388  106.387 153.481 1.00 23.26 ? 184 SER C C   1 
ATOM   10349 O O   . SER C 1 185 ? 36.623  107.574 153.718 1.00 21.03 ? 184 SER C O   1 
ATOM   10350 C CB  . SER C 1 185 ? 35.401  105.975 151.248 1.00 23.34 ? 184 SER C CB  1 
ATOM   10351 O OG  . SER C 1 185 ? 34.343  105.186 151.766 1.00 24.62 ? 184 SER C OG  1 
ATOM   10352 N N   . ASN C 1 186 ? 35.884  105.560 154.389 1.00 21.57 ? 185 ASN C N   1 
ATOM   10353 C CA  . ASN C 1 186 ? 35.569  106.049 155.725 1.00 23.66 ? 185 ASN C CA  1 
ATOM   10354 C C   . ASN C 1 186 ? 36.832  106.344 156.517 1.00 23.48 ? 185 ASN C C   1 
ATOM   10355 O O   . ASN C 1 186 ? 37.800  105.586 156.456 1.00 24.90 ? 185 ASN C O   1 
ATOM   10356 C CB  . ASN C 1 186 ? 34.738  105.020 156.492 1.00 23.83 ? 185 ASN C CB  1 
ATOM   10357 C CG  . ASN C 1 186 ? 33.872  105.655 157.562 1.00 22.73 ? 185 ASN C CG  1 
ATOM   10358 O OD1 . ASN C 1 186 ? 34.209  106.708 158.112 1.00 22.21 ? 185 ASN C OD1 1 
ATOM   10359 N ND2 . ASN C 1 186 ? 32.755  105.014 157.869 1.00 18.83 ? 185 ASN C ND2 1 
ATOM   10360 N N   . ILE C 1 187 ? 36.833  107.455 157.244 1.00 23.96 ? 186 ILE C N   1 
ATOM   10361 C CA  . ILE C 1 187 ? 37.983  107.787 158.073 1.00 24.29 ? 186 ILE C CA  1 
ATOM   10362 C C   . ILE C 1 187 ? 37.976  106.780 159.223 1.00 22.69 ? 186 ILE C C   1 
ATOM   10363 O O   . ILE C 1 187 ? 38.978  106.584 159.906 1.00 23.20 ? 186 ILE C O   1 
ATOM   10364 C CB  . ILE C 1 187 ? 37.885  109.215 158.643 1.00 24.03 ? 186 ILE C CB  1 
ATOM   10365 C CG1 . ILE C 1 187 ? 39.147  109.538 159.442 1.00 25.14 ? 186 ILE C CG1 1 
ATOM   10366 C CG2 . ILE C 1 187 ? 36.653  109.349 159.522 1.00 26.95 ? 186 ILE C CG2 1 
ATOM   10367 C CD1 . ILE C 1 187 ? 40.421  109.491 158.614 1.00 26.64 ? 186 ILE C CD1 1 
ATOM   10368 N N   . ASP C 1 188 ? 36.823  106.147 159.425 1.00 23.21 ? 187 ASP C N   1 
ATOM   10369 C CA  . ASP C 1 188 ? 36.653  105.140 160.469 1.00 22.59 ? 187 ASP C CA  1 
ATOM   10370 C C   . ASP C 1 188 ? 37.703  104.063 160.224 1.00 22.89 ? 187 ASP C C   1 
ATOM   10371 O O   . ASP C 1 188 ? 37.677  103.372 159.203 1.00 21.94 ? 187 ASP C O   1 
ATOM   10372 C CB  . ASP C 1 188 ? 35.244  104.543 160.392 1.00 22.23 ? 187 ASP C CB  1 
ATOM   10373 C CG  . ASP C 1 188 ? 34.991  103.473 161.442 1.00 23.38 ? 187 ASP C CG  1 
ATOM   10374 O OD1 . ASP C 1 188 ? 33.836  102.991 161.518 1.00 20.96 ? 187 ASP C OD1 1 
ATOM   10375 O OD2 . ASP C 1 188 ? 35.934  103.109 162.184 1.00 22.99 ? 187 ASP C OD2 1 
ATOM   10376 N N   . GLY C 1 189 ? 38.625  103.941 161.172 1.00 23.07 ? 188 GLY C N   1 
ATOM   10377 C CA  . GLY C 1 189 ? 39.712  102.985 161.072 1.00 22.53 ? 188 GLY C CA  1 
ATOM   10378 C C   . GLY C 1 189 ? 39.381  101.549 160.720 1.00 22.87 ? 188 GLY C C   1 
ATOM   10379 O O   . GLY C 1 189 ? 40.252  100.836 160.226 1.00 23.66 ? 188 GLY C O   1 
ATOM   10380 N N   . THR C 1 190 ? 38.151  101.101 160.962 1.00 22.13 ? 189 THR C N   1 
ATOM   10381 C CA  . THR C 1 190 ? 37.822  99.716  160.627 1.00 23.24 ? 189 THR C CA  1 
ATOM   10382 C C   . THR C 1 190 ? 37.832  99.503  159.111 1.00 21.00 ? 189 THR C C   1 
ATOM   10383 O O   . THR C 1 190 ? 38.098  98.398  158.630 1.00 19.14 ? 189 THR C O   1 
ATOM   10384 C CB  . THR C 1 190 ? 36.422  99.277  161.153 1.00 23.96 ? 189 THR C CB  1 
ATOM   10385 O OG1 . THR C 1 190 ? 35.412  99.699  160.235 1.00 30.10 ? 189 THR C OG1 1 
ATOM   10386 C CG2 . THR C 1 190 ? 36.135  99.871  162.516 1.00 21.72 ? 189 THR C CG2 1 
ATOM   10387 N N   . HIS C 1 191 ? 37.553  100.556 158.352 1.00 19.05 ? 190 HIS C N   1 
ATOM   10388 C CA  . HIS C 1 191 ? 37.513  100.401 156.903 1.00 21.54 ? 190 HIS C CA  1 
ATOM   10389 C C   . HIS C 1 191 ? 38.870  99.963  156.363 1.00 23.29 ? 190 HIS C C   1 
ATOM   10390 O O   . HIS C 1 191 ? 39.003  98.879  155.791 1.00 23.76 ? 190 HIS C O   1 
ATOM   10391 C CB  . HIS C 1 191 ? 37.066  101.701 156.230 1.00 20.57 ? 190 HIS C CB  1 
ATOM   10392 C CG  . HIS C 1 191 ? 36.309  101.480 154.956 1.00 20.82 ? 190 HIS C CG  1 
ATOM   10393 N ND1 . HIS C 1 191 ? 35.773  102.513 154.216 1.00 20.30 ? 190 HIS C ND1 1 
ATOM   10394 C CD2 . HIS C 1 191 ? 35.971  100.339 154.309 1.00 19.50 ? 190 HIS C CD2 1 
ATOM   10395 C CE1 . HIS C 1 191 ? 35.134  102.017 153.171 1.00 20.72 ? 190 HIS C CE1 1 
ATOM   10396 N NE2 . HIS C 1 191 ? 35.239  100.700 153.204 1.00 20.38 ? 190 HIS C NE2 1 
ATOM   10397 N N   . ILE C 1 192 ? 39.880  100.799 156.561 1.00 24.28 ? 191 ILE C N   1 
ATOM   10398 C CA  . ILE C 1 192 ? 41.217  100.469 156.096 1.00 26.86 ? 191 ILE C CA  1 
ATOM   10399 C C   . ILE C 1 192 ? 41.728  99.221  156.814 1.00 27.55 ? 191 ILE C C   1 
ATOM   10400 O O   . ILE C 1 192 ? 42.280  98.314  156.192 1.00 27.26 ? 191 ILE C O   1 
ATOM   10401 C CB  . ILE C 1 192 ? 42.196  101.640 156.346 1.00 26.65 ? 191 ILE C CB  1 
ATOM   10402 C CG1 . ILE C 1 192 ? 43.563  101.311 155.748 1.00 29.33 ? 191 ILE C CG1 1 
ATOM   10403 C CG2 . ILE C 1 192 ? 42.317  101.917 157.839 1.00 28.49 ? 191 ILE C CG2 1 
ATOM   10404 C CD1 . ILE C 1 192 ? 43.546  101.157 154.250 1.00 28.38 ? 191 ILE C CD1 1 
ATOM   10405 N N   . ALA C 1 193 ? 41.517  99.165  158.124 1.00 29.01 ? 192 ALA C N   1 
ATOM   10406 C CA  . ALA C 1 193 ? 41.982  98.036  158.918 1.00 29.79 ? 192 ALA C CA  1 
ATOM   10407 C C   . ALA C 1 193 ? 41.507  96.664  158.440 1.00 30.03 ? 192 ALA C C   1 
ATOM   10408 O O   . ALA C 1 193 ? 42.326  95.775  158.195 1.00 31.64 ? 192 ALA C O   1 
ATOM   10409 C CB  . ALA C 1 193 ? 41.598  98.238  160.383 1.00 31.82 ? 192 ALA C CB  1 
ATOM   10410 N N   . LYS C 1 194 ? 40.196  96.481  158.303 1.00 28.94 ? 193 LYS C N   1 
ATOM   10411 C CA  . LYS C 1 194 ? 39.674  95.183  157.882 1.00 28.36 ? 193 LYS C CA  1 
ATOM   10412 C C   . LYS C 1 194 ? 40.003  94.848  156.430 1.00 27.85 ? 193 LYS C C   1 
ATOM   10413 O O   . LYS C 1 194 ? 39.973  93.682  156.033 1.00 26.32 ? 193 LYS C O   1 
ATOM   10414 C CB  . LYS C 1 194 ? 38.159  95.109  158.126 1.00 30.63 ? 193 LYS C CB  1 
ATOM   10415 C CG  . LYS C 1 194 ? 37.286  95.940  157.194 1.00 31.92 ? 193 LYS C CG  1 
ATOM   10416 C CD  . LYS C 1 194 ? 35.849  95.980  157.723 1.00 32.98 ? 193 LYS C CD  1 
ATOM   10417 C CE  . LYS C 1 194 ? 34.878  96.592  156.717 1.00 35.70 ? 193 LYS C CE  1 
ATOM   10418 N NZ  . LYS C 1 194 ? 34.581  95.674  155.579 1.00 34.70 ? 193 LYS C NZ  1 
ATOM   10419 N N   . THR C 1 195 ? 40.324  95.874  155.648 1.00 26.71 ? 194 THR C N   1 
ATOM   10420 C CA  . THR C 1 195 ? 40.687  95.699  154.244 1.00 27.49 ? 194 THR C CA  1 
ATOM   10421 C C   . THR C 1 195 ? 42.116  95.155  154.161 1.00 29.69 ? 194 THR C C   1 
ATOM   10422 O O   . THR C 1 195 ? 42.366  94.132  153.526 1.00 30.00 ? 194 THR C O   1 
ATOM   10423 C CB  . THR C 1 195 ? 40.613  97.045  153.481 1.00 25.53 ? 194 THR C CB  1 
ATOM   10424 O OG1 . THR C 1 195 ? 39.252  97.484  153.425 1.00 21.65 ? 194 THR C OG1 1 
ATOM   10425 C CG2 . THR C 1 195 ? 41.158  96.902  152.061 1.00 24.47 ? 194 THR C CG2 1 
ATOM   10426 N N   . LEU C 1 196 ? 43.047  95.841  154.815 1.00 31.81 ? 195 LEU C N   1 
ATOM   10427 C CA  . LEU C 1 196 ? 44.446  95.429  154.818 1.00 34.26 ? 195 LEU C CA  1 
ATOM   10428 C C   . LEU C 1 196 ? 44.640  93.998  155.312 1.00 36.90 ? 195 LEU C C   1 
ATOM   10429 O O   . LEU C 1 196 ? 45.447  93.243  154.767 1.00 36.96 ? 195 LEU C O   1 
ATOM   10430 C CB  . LEU C 1 196 ? 45.261  96.393  155.678 1.00 33.65 ? 195 LEU C CB  1 
ATOM   10431 C CG  . LEU C 1 196 ? 45.960  97.550  154.958 1.00 33.94 ? 195 LEU C CG  1 
ATOM   10432 C CD1 . LEU C 1 196 ? 45.282  97.852  153.637 1.00 33.10 ? 195 LEU C CD1 1 
ATOM   10433 C CD2 . LEU C 1 196 ? 45.984  98.764  155.867 1.00 32.27 ? 195 LEU C CD2 1 
ATOM   10434 N N   . ALA C 1 197 ? 43.888  93.627  156.339 1.00 37.95 ? 196 ALA C N   1 
ATOM   10435 C CA  . ALA C 1 197 ? 43.979  92.291  156.913 1.00 39.30 ? 196 ALA C CA  1 
ATOM   10436 C C   . ALA C 1 197 ? 43.754  91.176  155.896 1.00 40.30 ? 196 ALA C C   1 
ATOM   10437 O O   . ALA C 1 197 ? 44.035  90.012  156.174 1.00 41.32 ? 196 ALA C O   1 
ATOM   10438 C CB  . ALA C 1 197 ? 42.979  92.155  158.051 1.00 39.10 ? 196 ALA C CB  1 
ATOM   10439 N N   . GLN C 1 198 ? 43.254  91.524  154.716 1.00 41.04 ? 197 GLN C N   1 
ATOM   10440 C CA  . GLN C 1 198 ? 42.987  90.517  153.695 1.00 41.21 ? 197 GLN C CA  1 
ATOM   10441 C C   . GLN C 1 198 ? 43.902  90.657  152.490 1.00 40.77 ? 197 GLN C C   1 
ATOM   10442 O O   . GLN C 1 198 ? 43.782  89.903  151.525 1.00 42.16 ? 197 GLN C O   1 
ATOM   10443 C CB  . GLN C 1 198 ? 41.542  90.632  153.216 1.00 42.17 ? 197 GLN C CB  1 
ATOM   10444 C CG  . GLN C 1 198 ? 40.514  90.693  154.326 1.00 43.65 ? 197 GLN C CG  1 
ATOM   10445 C CD  . GLN C 1 198 ? 39.128  91.018  153.805 1.00 44.13 ? 197 GLN C CD  1 
ATOM   10446 O OE1 . GLN C 1 198 ? 38.576  90.212  153.028 1.00 45.45 ? 197 GLN C OE1 1 
ATOM   10447 N NE2 . GLN C 1 198 ? 38.591  92.085  154.170 1.00 45.39 ? 197 GLN C NE2 1 
ATOM   10448 N N   . LEU C 1 199 ? 44.816  91.616  152.545 1.00 40.17 ? 198 LEU C N   1 
ATOM   10449 C CA  . LEU C 1 199 ? 45.706  91.865  151.421 1.00 39.76 ? 198 LEU C CA  1 
ATOM   10450 C C   . LEU C 1 199 ? 47.164  91.495  151.666 1.00 40.51 ? 198 LEU C C   1 
ATOM   10451 O O   . LEU C 1 199 ? 47.616  91.393  152.806 1.00 40.21 ? 198 LEU C O   1 
ATOM   10452 C CB  . LEU C 1 199 ? 45.620  93.341  151.034 1.00 38.59 ? 198 LEU C CB  1 
ATOM   10453 C CG  . LEU C 1 199 ? 44.213  93.893  150.791 1.00 37.07 ? 198 LEU C CG  1 
ATOM   10454 C CD1 . LEU C 1 199 ? 44.290  95.404  150.636 1.00 35.65 ? 198 LEU C CD1 1 
ATOM   10455 C CD2 . LEU C 1 199 ? 43.601  93.247  149.558 1.00 34.65 ? 198 LEU C CD2 1 
ATOM   10456 N N   . ASN C 1 200 ? 47.891  91.303  150.569 1.00 41.23 ? 199 ASN C N   1 
ATOM   10457 C CA  . ASN C 1 200 ? 49.306  90.963  150.611 1.00 40.94 ? 199 ASN C CA  1 
ATOM   10458 C C   . ASN C 1 200 ? 50.065  92.143  150.016 1.00 40.52 ? 199 ASN C C   1 
ATOM   10459 O O   . ASN C 1 200 ? 49.886  92.473  148.846 1.00 40.70 ? 199 ASN C O   1 
ATOM   10460 C CB  . ASN C 1 200 ? 49.573  89.709  149.780 1.00 41.50 ? 199 ASN C CB  1 
ATOM   10461 C CG  . ASN C 1 200 ? 51.012  89.246  149.875 1.00 42.31 ? 199 ASN C CG  1 
ATOM   10462 O OD1 . ASN C 1 200 ? 51.939  90.055  149.848 1.00 41.71 ? 199 ASN C OD1 1 
ATOM   10463 N ND2 . ASN C 1 200 ? 51.207  87.938  149.979 1.00 43.92 ? 199 ASN C ND2 1 
ATOM   10464 N N   . PRO C 1 201 ? 50.932  92.789  150.812 1.00 40.76 ? 200 PRO C N   1 
ATOM   10465 C CA  . PRO C 1 201 ? 51.715  93.942  150.356 1.00 41.04 ? 200 PRO C CA  1 
ATOM   10466 C C   . PRO C 1 201 ? 52.497  93.702  149.060 1.00 41.81 ? 200 PRO C C   1 
ATOM   10467 O O   . PRO C 1 201 ? 52.777  94.638  148.312 1.00 41.11 ? 200 PRO C O   1 
ATOM   10468 C CB  . PRO C 1 201 ? 52.645  94.219  151.538 1.00 41.60 ? 200 PRO C CB  1 
ATOM   10469 C CG  . PRO C 1 201 ? 51.864  93.726  152.713 1.00 41.85 ? 200 PRO C CG  1 
ATOM   10470 C CD  . PRO C 1 201 ? 51.279  92.438  152.200 1.00 40.91 ? 200 PRO C CD  1 
ATOM   10471 N N   . GLU C 1 202 ? 52.845  92.446  148.799 1.00 42.16 ? 201 GLU C N   1 
ATOM   10472 C CA  . GLU C 1 202 ? 53.612  92.099  147.606 1.00 43.09 ? 201 GLU C CA  1 
ATOM   10473 C C   . GLU C 1 202 ? 52.819  92.125  146.301 1.00 40.82 ? 201 GLU C C   1 
ATOM   10474 O O   . GLU C 1 202 ? 53.402  92.105  145.219 1.00 39.64 ? 201 GLU C O   1 
ATOM   10475 C CB  . GLU C 1 202 ? 54.252  90.719  147.781 1.00 45.75 ? 201 GLU C CB  1 
ATOM   10476 C CG  . GLU C 1 202 ? 55.440  90.707  148.733 1.00 51.39 ? 201 GLU C CG  1 
ATOM   10477 C CD  . GLU C 1 202 ? 55.981  89.309  148.966 1.00 53.61 ? 201 GLU C CD  1 
ATOM   10478 O OE1 . GLU C 1 202 ? 56.228  88.593  147.972 1.00 55.55 ? 201 GLU C OE1 1 
ATOM   10479 O OE2 . GLU C 1 202 ? 56.160  88.928  150.143 1.00 55.08 ? 201 GLU C OE2 1 
ATOM   10480 N N   . SER C 1 203 ? 51.495  92.171  146.394 1.00 38.40 ? 202 SER C N   1 
ATOM   10481 C CA  . SER C 1 203 ? 50.673  92.190  145.191 1.00 34.57 ? 202 SER C CA  1 
ATOM   10482 C C   . SER C 1 203 ? 49.524  93.179  145.283 1.00 33.13 ? 202 SER C C   1 
ATOM   10483 O O   . SER C 1 203 ? 48.489  92.999  144.639 1.00 32.96 ? 202 SER C O   1 
ATOM   10484 C CB  . SER C 1 203 ? 50.125  90.792  144.918 1.00 33.56 ? 202 SER C CB  1 
ATOM   10485 O OG  . SER C 1 203 ? 49.505  90.272  146.076 1.00 34.58 ? 202 SER C OG  1 
ATOM   10486 N N   . SER C 1 204 ? 49.712  94.230  146.073 1.00 32.16 ? 203 SER C N   1 
ATOM   10487 C CA  . SER C 1 204 ? 48.672  95.230  146.246 1.00 30.97 ? 203 SER C CA  1 
ATOM   10488 C C   . SER C 1 204 ? 49.070  96.591  145.711 1.00 30.80 ? 203 SER C C   1 
ATOM   10489 O O   . SER C 1 204 ? 50.130  97.122  146.046 1.00 29.61 ? 203 SER C O   1 
ATOM   10490 C CB  . SER C 1 204 ? 48.296  95.357  147.726 1.00 30.42 ? 203 SER C CB  1 
ATOM   10491 O OG  . SER C 1 204 ? 47.652  94.185  148.186 1.00 31.32 ? 203 SER C OG  1 
ATOM   10492 N N   . LEU C 1 205 ? 48.197  97.149  144.878 1.00 29.79 ? 204 LEU C N   1 
ATOM   10493 C CA  . LEU C 1 205 ? 48.416  98.458  144.285 1.00 29.31 ? 204 LEU C CA  1 
ATOM   10494 C C   . LEU C 1 205 ? 47.397  99.428  144.867 1.00 29.81 ? 204 LEU C C   1 
ATOM   10495 O O   . LEU C 1 205 ? 46.188  99.220  144.732 1.00 28.43 ? 204 LEU C O   1 
ATOM   10496 C CB  . LEU C 1 205 ? 48.249  98.389  142.766 1.00 28.30 ? 204 LEU C CB  1 
ATOM   10497 C CG  . LEU C 1 205 ? 48.363  99.724  142.026 1.00 27.43 ? 204 LEU C CG  1 
ATOM   10498 C CD1 . LEU C 1 205 ? 49.770  100.281 142.197 1.00 26.62 ? 204 LEU C CD1 1 
ATOM   10499 C CD2 . LEU C 1 205 ? 48.041  99.524  140.550 1.00 26.22 ? 204 LEU C CD2 1 
ATOM   10500 N N   . PHE C 1 206 ? 47.888  100.482 145.508 1.00 29.89 ? 205 PHE C N   1 
ATOM   10501 C CA  . PHE C 1 206 ? 47.020  101.482 146.115 1.00 31.91 ? 205 PHE C CA  1 
ATOM   10502 C C   . PHE C 1 206 ? 46.872  102.724 145.255 1.00 31.61 ? 205 PHE C C   1 
ATOM   10503 O O   . PHE C 1 206 ? 47.854  103.249 144.734 1.00 32.64 ? 205 PHE C O   1 
ATOM   10504 C CB  . PHE C 1 206 ? 47.550  101.890 147.495 1.00 31.92 ? 205 PHE C CB  1 
ATOM   10505 C CG  . PHE C 1 206 ? 47.503  100.789 148.510 1.00 34.51 ? 205 PHE C CG  1 
ATOM   10506 C CD1 . PHE C 1 206 ? 48.407  99.735  148.454 1.00 34.61 ? 205 PHE C CD1 1 
ATOM   10507 C CD2 . PHE C 1 206 ? 46.533  100.791 149.511 1.00 35.05 ? 205 PHE C CD2 1 
ATOM   10508 C CE1 . PHE C 1 206 ? 48.349  98.694  149.378 1.00 35.92 ? 205 PHE C CE1 1 
ATOM   10509 C CE2 . PHE C 1 206 ? 46.464  99.756  150.440 1.00 36.32 ? 205 PHE C CE2 1 
ATOM   10510 C CZ  . PHE C 1 206 ? 47.375  98.704  150.373 1.00 36.83 ? 205 PHE C CZ  1 
ATOM   10511 N N   . ILE C 1 207 ? 45.634  103.188 145.118 1.00 31.69 ? 206 ILE C N   1 
ATOM   10512 C CA  . ILE C 1 207 ? 45.327  104.384 144.339 1.00 32.51 ? 206 ILE C CA  1 
ATOM   10513 C C   . ILE C 1 207 ? 44.799  105.452 145.277 1.00 32.23 ? 206 ILE C C   1 
ATOM   10514 O O   . ILE C 1 207 ? 43.704  105.316 145.828 1.00 30.63 ? 206 ILE C O   1 
ATOM   10515 C CB  . ILE C 1 207 ? 44.247  104.116 143.266 1.00 32.61 ? 206 ILE C CB  1 
ATOM   10516 C CG1 . ILE C 1 207 ? 44.743  103.061 142.275 1.00 34.39 ? 206 ILE C CG1 1 
ATOM   10517 C CG2 . ILE C 1 207 ? 43.904  105.411 142.545 1.00 32.16 ? 206 ILE C CG2 1 
ATOM   10518 C CD1 . ILE C 1 207 ? 43.752  102.731 141.169 1.00 35.61 ? 206 ILE C CD1 1 
ATOM   10519 N N   . ILE C 1 208 ? 45.586  106.506 145.467 1.00 31.87 ? 207 ILE C N   1 
ATOM   10520 C CA  . ILE C 1 208 ? 45.183  107.599 146.339 1.00 32.28 ? 207 ILE C CA  1 
ATOM   10521 C C   . ILE C 1 208 ? 44.514  108.669 145.488 1.00 32.47 ? 207 ILE C C   1 
ATOM   10522 O O   . ILE C 1 208 ? 45.179  109.431 144.781 1.00 32.98 ? 207 ILE C O   1 
ATOM   10523 C CB  . ILE C 1 208 ? 46.391  108.215 147.093 1.00 32.33 ? 207 ILE C CB  1 
ATOM   10524 C CG1 . ILE C 1 208 ? 46.917  107.252 148.167 1.00 33.23 ? 207 ILE C CG1 1 
ATOM   10525 C CG2 . ILE C 1 208 ? 45.947  109.476 147.815 1.00 32.26 ? 207 ILE C CG2 1 
ATOM   10526 C CD1 . ILE C 1 208 ? 47.094  105.813 147.735 1.00 32.90 ? 207 ILE C CD1 1 
ATOM   10527 N N   . ALA C 1 209 ? 43.187  108.706 145.558 1.00 32.27 ? 208 ALA C N   1 
ATOM   10528 C CA  . ALA C 1 209 ? 42.390  109.656 144.794 1.00 32.24 ? 208 ALA C CA  1 
ATOM   10529 C C   . ALA C 1 209 ? 42.128  110.930 145.584 1.00 32.28 ? 208 ALA C C   1 
ATOM   10530 O O   . ALA C 1 209 ? 41.293  110.942 146.487 1.00 32.04 ? 208 ALA C O   1 
ATOM   10531 C CB  . ALA C 1 209 ? 41.065  109.008 144.390 1.00 31.36 ? 208 ALA C CB  1 
ATOM   10532 N N   . SER C 1 210 ? 42.843  111.996 145.240 1.00 33.20 ? 209 SER C N   1 
ATOM   10533 C CA  . SER C 1 210 ? 42.680  113.281 145.913 1.00 35.17 ? 209 SER C CA  1 
ATOM   10534 C C   . SER C 1 210 ? 43.252  114.441 145.104 1.00 35.70 ? 209 SER C C   1 
ATOM   10535 O O   . SER C 1 210 ? 44.461  114.568 144.976 1.00 35.85 ? 209 SER C O   1 
ATOM   10536 C CB  . SER C 1 210 ? 43.362  113.258 147.281 1.00 35.25 ? 209 SER C CB  1 
ATOM   10537 O OG  . SER C 1 210 ? 43.370  114.559 147.844 1.00 34.91 ? 209 SER C OG  1 
ATOM   10538 N N   . LYS C 1 211 ? 42.381  115.299 144.586 1.00 36.91 ? 210 LYS C N   1 
ATOM   10539 C CA  . LYS C 1 211 ? 42.812  116.446 143.793 1.00 40.14 ? 210 LYS C CA  1 
ATOM   10540 C C   . LYS C 1 211 ? 43.997  117.193 144.417 1.00 40.66 ? 210 LYS C C   1 
ATOM   10541 O O   . LYS C 1 211 ? 45.082  117.247 143.836 1.00 39.60 ? 210 LYS C O   1 
ATOM   10542 C CB  . LYS C 1 211 ? 41.638  117.413 143.602 1.00 40.73 ? 210 LYS C CB  1 
ATOM   10543 C CG  . LYS C 1 211 ? 41.945  118.618 142.718 1.00 43.01 ? 210 LYS C CG  1 
ATOM   10544 C CD  . LYS C 1 211 ? 42.279  118.197 141.294 1.00 43.70 ? 210 LYS C CD  1 
ATOM   10545 C CE  . LYS C 1 211 ? 42.562  119.403 140.416 1.00 43.95 ? 210 LYS C CE  1 
ATOM   10546 N NZ  . LYS C 1 211 ? 43.729  120.174 140.918 1.00 45.35 ? 210 LYS C NZ  1 
ATOM   10547 N N   . THR C 1 212 ? 43.777  117.764 145.599 1.00 41.90 ? 211 THR C N   1 
ATOM   10548 C CA  . THR C 1 212 ? 44.806  118.521 146.311 1.00 41.91 ? 211 THR C CA  1 
ATOM   10549 C C   . THR C 1 212 ? 45.843  117.614 146.954 1.00 41.56 ? 211 THR C C   1 
ATOM   10550 O O   . THR C 1 212 ? 46.980  118.020 147.194 1.00 40.76 ? 211 THR C O   1 
ATOM   10551 C CB  . THR C 1 212 ? 44.196  119.360 147.441 1.00 42.74 ? 211 THR C CB  1 
ATOM   10552 O OG1 . THR C 1 212 ? 43.505  118.489 148.348 1.00 44.01 ? 211 THR C OG1 1 
ATOM   10553 C CG2 . THR C 1 212 ? 43.228  120.394 146.888 1.00 44.18 ? 211 THR C CG2 1 
ATOM   10554 N N   . PHE C 1 213 ? 45.433  116.387 147.244 1.00 41.36 ? 212 PHE C N   1 
ATOM   10555 C CA  . PHE C 1 213 ? 46.298  115.416 147.891 1.00 40.91 ? 212 PHE C CA  1 
ATOM   10556 C C   . PHE C 1 213 ? 46.545  115.856 149.338 1.00 40.87 ? 212 PHE C C   1 
ATOM   10557 O O   . PHE C 1 213 ? 47.589  115.562 149.920 1.00 40.83 ? 212 PHE C O   1 
ATOM   10558 C CB  . PHE C 1 213 ? 47.628  115.283 147.146 1.00 39.36 ? 212 PHE C CB  1 
ATOM   10559 C CG  . PHE C 1 213 ? 48.214  113.905 147.208 1.00 38.60 ? 212 PHE C CG  1 
ATOM   10560 C CD1 . PHE C 1 213 ? 47.587  112.843 146.563 1.00 39.75 ? 212 PHE C CD1 1 
ATOM   10561 C CD2 . PHE C 1 213 ? 49.379  113.660 147.923 1.00 40.36 ? 212 PHE C CD2 1 
ATOM   10562 C CE1 . PHE C 1 213 ? 48.108  111.558 146.628 1.00 38.14 ? 212 PHE C CE1 1 
ATOM   10563 C CE2 . PHE C 1 213 ? 49.911  112.375 147.998 1.00 39.35 ? 212 PHE C CE2 1 
ATOM   10564 C CZ  . PHE C 1 213 ? 49.273  111.321 147.348 1.00 40.27 ? 212 PHE C CZ  1 
ATOM   10565 N N   . THR C 1 214 ? 45.578  116.576 149.903 1.00 41.05 ? 213 THR C N   1 
ATOM   10566 C CA  . THR C 1 214 ? 45.660  117.038 151.287 1.00 42.04 ? 213 THR C CA  1 
ATOM   10567 C C   . THR C 1 214 ? 44.340  116.748 152.011 1.00 41.95 ? 213 THR C C   1 
ATOM   10568 O O   . THR C 1 214 ? 44.095  117.245 153.114 1.00 44.18 ? 213 THR C O   1 
ATOM   10569 C CB  . THR C 1 214 ? 45.958  118.554 151.382 1.00 40.85 ? 213 THR C CB  1 
ATOM   10570 O OG1 . THR C 1 214 ? 44.866  119.297 150.828 1.00 42.35 ? 213 THR C OG1 1 
ATOM   10571 C CG2 . THR C 1 214 ? 47.241  118.893 150.641 1.00 40.61 ? 213 THR C CG2 1 
ATOM   10572 N N   . THR C 1 215 ? 43.488  115.948 151.377 1.00 40.87 ? 214 THR C N   1 
ATOM   10573 C CA  . THR C 1 215 ? 42.206  115.564 151.963 1.00 39.67 ? 214 THR C CA  1 
ATOM   10574 C C   . THR C 1 215 ? 42.527  114.771 153.229 1.00 37.22 ? 214 THR C C   1 
ATOM   10575 O O   . THR C 1 215 ? 43.135  113.701 153.153 1.00 36.48 ? 214 THR C O   1 
ATOM   10576 C CB  . THR C 1 215 ? 41.409  114.658 151.003 1.00 39.99 ? 214 THR C CB  1 
ATOM   10577 O OG1 . THR C 1 215 ? 41.394  115.242 149.695 1.00 39.59 ? 214 THR C OG1 1 
ATOM   10578 C CG2 . THR C 1 215 ? 39.981  114.494 151.492 1.00 40.87 ? 214 THR C CG2 1 
ATOM   10579 N N   . GLN C 1 216 ? 42.122  115.295 154.385 1.00 36.38 ? 215 GLN C N   1 
ATOM   10580 C CA  . GLN C 1 216 ? 42.405  114.645 155.666 1.00 34.49 ? 215 GLN C CA  1 
ATOM   10581 C C   . GLN C 1 216 ? 42.090  113.149 155.703 1.00 32.52 ? 215 GLN C C   1 
ATOM   10582 O O   . GLN C 1 216 ? 42.975  112.331 155.942 1.00 32.15 ? 215 GLN C O   1 
ATOM   10583 C CB  . GLN C 1 216 ? 41.651  115.341 156.807 1.00 34.55 ? 215 GLN C CB  1 
ATOM   10584 C CG  . GLN C 1 216 ? 42.127  114.890 158.187 1.00 35.46 ? 215 GLN C CG  1 
ATOM   10585 C CD  . GLN C 1 216 ? 41.327  115.480 159.335 1.00 35.87 ? 215 GLN C CD  1 
ATOM   10586 O OE1 . GLN C 1 216 ? 41.768  115.458 160.487 1.00 35.95 ? 215 GLN C OE1 1 
ATOM   10587 N NE2 . GLN C 1 216 ? 40.146  115.998 159.033 1.00 35.10 ? 215 GLN C NE2 1 
ATOM   10588 N N   . GLU C 1 217 ? 40.832  112.798 155.466 1.00 31.53 ? 216 GLU C N   1 
ATOM   10589 C CA  . GLU C 1 217 ? 40.407  111.400 155.488 1.00 31.66 ? 216 GLU C CA  1 
ATOM   10590 C C   . GLU C 1 217 ? 41.225  110.528 154.541 1.00 29.84 ? 216 GLU C C   1 
ATOM   10591 O O   . GLU C 1 217 ? 41.773  109.496 154.936 1.00 28.10 ? 216 GLU C O   1 
ATOM   10592 C CB  . GLU C 1 217 ? 38.928  111.276 155.100 1.00 33.15 ? 216 GLU C CB  1 
ATOM   10593 C CG  . GLU C 1 217 ? 37.938  111.997 156.000 1.00 36.41 ? 216 GLU C CG  1 
ATOM   10594 C CD  . GLU C 1 217 ? 37.844  113.484 155.712 1.00 38.87 ? 216 GLU C CD  1 
ATOM   10595 O OE1 . GLU C 1 217 ? 36.843  114.101 156.136 1.00 39.44 ? 216 GLU C OE1 1 
ATOM   10596 O OE2 . GLU C 1 217 ? 38.764  114.041 155.072 1.00 38.44 ? 216 GLU C OE2 1 
ATOM   10597 N N   . THR C 1 218 ? 41.291  110.956 153.284 1.00 28.29 ? 217 THR C N   1 
ATOM   10598 C CA  . THR C 1 218 ? 42.011  110.230 152.250 1.00 27.60 ? 217 THR C CA  1 
ATOM   10599 C C   . THR C 1 218 ? 43.503  110.058 152.530 1.00 27.56 ? 217 THR C C   1 
ATOM   10600 O O   . THR C 1 218 ? 44.050  108.965 152.361 1.00 27.19 ? 217 THR C O   1 
ATOM   10601 C CB  . THR C 1 218 ? 41.835  110.927 150.891 1.00 28.77 ? 217 THR C CB  1 
ATOM   10602 O OG1 . THR C 1 218 ? 40.436  111.050 150.603 1.00 28.88 ? 217 THR C OG1 1 
ATOM   10603 C CG2 . THR C 1 218 ? 42.517  110.132 149.786 1.00 27.86 ? 217 THR C CG2 1 
ATOM   10604 N N   . ILE C 1 219 ? 44.161  111.131 152.952 1.00 26.68 ? 218 ILE C N   1 
ATOM   10605 C CA  . ILE C 1 219 ? 45.590  111.064 153.238 1.00 27.99 ? 218 ILE C CA  1 
ATOM   10606 C C   . ILE C 1 219 ? 45.869  110.239 154.492 1.00 27.63 ? 218 ILE C C   1 
ATOM   10607 O O   . ILE C 1 219 ? 46.860  109.510 154.553 1.00 28.80 ? 218 ILE C O   1 
ATOM   10608 C CB  . ILE C 1 219 ? 46.186  112.468 153.411 1.00 29.08 ? 218 ILE C CB  1 
ATOM   10609 C CG1 . ILE C 1 219 ? 45.921  113.292 152.148 1.00 30.23 ? 218 ILE C CG1 1 
ATOM   10610 C CG2 . ILE C 1 219 ? 47.685  112.372 153.692 1.00 29.03 ? 218 ILE C CG2 1 
ATOM   10611 C CD1 . ILE C 1 219 ? 46.417  112.637 150.865 1.00 30.64 ? 218 ILE C CD1 1 
ATOM   10612 N N   . THR C 1 220 ? 44.993  110.351 155.486 1.00 26.74 ? 219 THR C N   1 
ATOM   10613 C CA  . THR C 1 220 ? 45.160  109.591 156.717 1.00 25.90 ? 219 THR C CA  1 
ATOM   10614 C C   . THR C 1 220 ? 45.133  108.109 156.361 1.00 25.82 ? 219 THR C C   1 
ATOM   10615 O O   . THR C 1 220 ? 45.995  107.345 156.795 1.00 26.57 ? 219 THR C O   1 
ATOM   10616 C CB  . THR C 1 220 ? 44.029  109.887 157.735 1.00 26.79 ? 219 THR C CB  1 
ATOM   10617 O OG1 . THR C 1 220 ? 44.016  111.284 158.049 1.00 26.18 ? 219 THR C OG1 1 
ATOM   10618 C CG2 . THR C 1 220 ? 44.243  109.095 159.019 1.00 25.18 ? 219 THR C CG2 1 
ATOM   10619 N N   . ASN C 1 221 ? 44.146  107.703 155.567 1.00 25.88 ? 220 ASN C N   1 
ATOM   10620 C CA  . ASN C 1 221 ? 44.045  106.306 155.162 1.00 27.10 ? 220 ASN C CA  1 
ATOM   10621 C C   . ASN C 1 221 ? 45.242  105.921 154.300 1.00 27.03 ? 220 ASN C C   1 
ATOM   10622 O O   . ASN C 1 221 ? 45.731  104.794 154.370 1.00 26.41 ? 220 ASN C O   1 
ATOM   10623 C CB  . ASN C 1 221 ? 42.751  106.049 154.379 1.00 26.21 ? 220 ASN C CB  1 
ATOM   10624 C CG  . ASN C 1 221 ? 41.527  105.977 155.275 1.00 28.32 ? 220 ASN C CG  1 
ATOM   10625 O OD1 . ASN C 1 221 ? 41.511  105.243 156.262 1.00 27.63 ? 220 ASN C OD1 1 
ATOM   10626 N ND2 . ASN C 1 221 ? 40.493  106.731 154.928 1.00 28.29 ? 220 ASN C ND2 1 
ATOM   10627 N N   . ALA C 1 222 ? 45.706  106.866 153.487 1.00 28.65 ? 221 ALA C N   1 
ATOM   10628 C CA  . ALA C 1 222 ? 46.851  106.631 152.609 1.00 29.54 ? 221 ALA C CA  1 
ATOM   10629 C C   . ALA C 1 222 ? 48.106  106.338 153.433 1.00 30.78 ? 221 ALA C C   1 
ATOM   10630 O O   . ALA C 1 222 ? 48.794  105.338 153.208 1.00 31.09 ? 221 ALA C O   1 
ATOM   10631 C CB  . ALA C 1 222 ? 47.080  107.847 151.723 1.00 27.55 ? 221 ALA C CB  1 
ATOM   10632 N N   . GLU C 1 223 ? 48.395  107.210 154.394 1.00 32.40 ? 222 GLU C N   1 
ATOM   10633 C CA  . GLU C 1 223 ? 49.572  107.039 155.237 1.00 33.50 ? 222 GLU C CA  1 
ATOM   10634 C C   . GLU C 1 223 ? 49.481  105.755 156.042 1.00 33.33 ? 222 GLU C C   1 
ATOM   10635 O O   . GLU C 1 223 ? 50.486  105.068 156.241 1.00 32.81 ? 222 GLU C O   1 
ATOM   10636 C CB  . GLU C 1 223 ? 49.738  108.250 156.148 1.00 35.47 ? 222 GLU C CB  1 
ATOM   10637 C CG  . GLU C 1 223 ? 49.795  109.548 155.349 1.00 42.20 ? 222 GLU C CG  1 
ATOM   10638 C CD  . GLU C 1 223 ? 50.199  110.749 156.175 1.00 45.41 ? 222 GLU C CD  1 
ATOM   10639 O OE1 . GLU C 1 223 ? 49.574  110.991 157.230 1.00 48.82 ? 222 GLU C OE1 1 
ATOM   10640 O OE2 . GLU C 1 223 ? 51.139  111.461 155.761 1.00 49.47 ? 222 GLU C OE2 1 
ATOM   10641 N N   . THR C 1 224 ? 48.276  105.419 156.494 1.00 32.32 ? 223 THR C N   1 
ATOM   10642 C CA  . THR C 1 224 ? 48.083  104.188 157.246 1.00 30.95 ? 223 THR C CA  1 
ATOM   10643 C C   . THR C 1 224 ? 48.397  103.008 156.336 1.00 32.65 ? 223 THR C C   1 
ATOM   10644 O O   . THR C 1 224 ? 48.969  102.004 156.771 1.00 32.91 ? 223 THR C O   1 
ATOM   10645 C CB  . THR C 1 224 ? 46.634  104.051 157.751 1.00 31.09 ? 223 THR C CB  1 
ATOM   10646 O OG1 . THR C 1 224 ? 46.404  104.995 158.802 1.00 31.25 ? 223 THR C OG1 1 
ATOM   10647 C CG2 . THR C 1 224 ? 46.379  102.642 158.274 1.00 27.61 ? 223 THR C CG2 1 
ATOM   10648 N N   . ALA C 1 225 ? 48.013  103.134 155.069 1.00 32.42 ? 224 ALA C N   1 
ATOM   10649 C CA  . ALA C 1 225 ? 48.252  102.086 154.089 1.00 33.51 ? 224 ALA C CA  1 
ATOM   10650 C C   . ALA C 1 225 ? 49.749  101.952 153.822 1.00 35.07 ? 224 ALA C C   1 
ATOM   10651 O O   . ALA C 1 225 ? 50.279  100.841 153.727 1.00 34.55 ? 224 ALA C O   1 
ATOM   10652 C CB  . ALA C 1 225 ? 47.515  102.405 152.791 1.00 33.52 ? 224 ALA C CB  1 
ATOM   10653 N N   . LYS C 1 226 ? 50.427  103.088 153.701 1.00 35.25 ? 225 LYS C N   1 
ATOM   10654 C CA  . LYS C 1 226 ? 51.855  103.079 153.440 1.00 38.08 ? 225 LYS C CA  1 
ATOM   10655 C C   . LYS C 1 226 ? 52.628  102.447 154.592 1.00 39.58 ? 225 LYS C C   1 
ATOM   10656 O O   . LYS C 1 226 ? 53.523  101.629 154.368 1.00 39.73 ? 225 LYS C O   1 
ATOM   10657 C CB  . LYS C 1 226 ? 52.370  104.497 153.191 1.00 37.83 ? 225 LYS C CB  1 
ATOM   10658 C CG  . LYS C 1 226 ? 53.845  104.525 152.813 1.00 39.21 ? 225 LYS C CG  1 
ATOM   10659 C CD  . LYS C 1 226 ? 54.254  105.847 152.199 1.00 38.40 ? 225 LYS C CD  1 
ATOM   10660 C CE  . LYS C 1 226 ? 54.121  106.985 153.182 1.00 38.64 ? 225 LYS C CE  1 
ATOM   10661 N NZ  . LYS C 1 226 ? 54.662  108.239 152.593 1.00 39.10 ? 225 LYS C NZ  1 
ATOM   10662 N N   . GLU C 1 227 ? 52.280  102.826 155.820 1.00 40.30 ? 226 GLU C N   1 
ATOM   10663 C CA  . GLU C 1 227 ? 52.947  102.288 156.998 1.00 41.25 ? 226 GLU C CA  1 
ATOM   10664 C C   . GLU C 1 227 ? 52.810  100.774 157.020 1.00 41.30 ? 226 GLU C C   1 
ATOM   10665 O O   . GLU C 1 227 ? 53.784  100.055 157.235 1.00 42.65 ? 226 GLU C O   1 
ATOM   10666 C CB  . GLU C 1 227 ? 52.348  102.879 158.277 1.00 43.32 ? 226 GLU C CB  1 
ATOM   10667 C CG  . GLU C 1 227 ? 52.980  102.325 159.550 1.00 45.13 ? 226 GLU C CG  1 
ATOM   10668 C CD  . GLU C 1 227 ? 52.393  102.923 160.814 1.00 46.16 ? 226 GLU C CD  1 
ATOM   10669 O OE1 . GLU C 1 227 ? 52.838  102.535 161.913 1.00 48.46 ? 226 GLU C OE1 1 
ATOM   10670 O OE2 . GLU C 1 227 ? 51.493  103.780 160.714 1.00 46.59 ? 226 GLU C OE2 1 
ATOM   10671 N N   . TRP C 1 228 ? 51.592  100.295 156.798 1.00 40.55 ? 227 TRP C N   1 
ATOM   10672 C CA  . TRP C 1 228 ? 51.323  98.865  156.772 1.00 39.58 ? 227 TRP C CA  1 
ATOM   10673 C C   . TRP C 1 228 ? 52.190  98.219  155.695 1.00 41.58 ? 227 TRP C C   1 
ATOM   10674 O O   . TRP C 1 228 ? 52.668  97.092  155.853 1.00 41.77 ? 227 TRP C O   1 
ATOM   10675 C CB  . TRP C 1 228 ? 49.844  98.628  156.452 1.00 37.17 ? 227 TRP C CB  1 
ATOM   10676 C CG  . TRP C 1 228 ? 49.518  97.229  156.013 1.00 33.17 ? 227 TRP C CG  1 
ATOM   10677 C CD1 . TRP C 1 228 ? 49.296  96.146  156.812 1.00 33.29 ? 227 TRP C CD1 1 
ATOM   10678 C CD2 . TRP C 1 228 ? 49.364  96.769  154.664 1.00 32.38 ? 227 TRP C CD2 1 
ATOM   10679 N NE1 . TRP C 1 228 ? 49.007  95.040  156.048 1.00 31.06 ? 227 TRP C NE1 1 
ATOM   10680 C CE2 . TRP C 1 228 ? 49.044  95.396  154.725 1.00 32.04 ? 227 TRP C CE2 1 
ATOM   10681 C CE3 . TRP C 1 228 ? 49.468  97.385  153.410 1.00 31.20 ? 227 TRP C CE3 1 
ATOM   10682 C CZ2 . TRP C 1 228 ? 48.821  94.629  153.580 1.00 32.25 ? 227 TRP C CZ2 1 
ATOM   10683 C CZ3 . TRP C 1 228 ? 49.249  96.624  152.274 1.00 30.89 ? 227 TRP C CZ3 1 
ATOM   10684 C CH2 . TRP C 1 228 ? 48.929  95.260  152.365 1.00 32.61 ? 227 TRP C CH2 1 
ATOM   10685 N N   . PHE C 1 229 ? 52.379  98.953  154.600 1.00 42.97 ? 228 PHE C N   1 
ATOM   10686 C CA  . PHE C 1 229 ? 53.168  98.490  153.461 1.00 44.23 ? 228 PHE C CA  1 
ATOM   10687 C C   . PHE C 1 229 ? 54.667  98.462  153.760 1.00 45.37 ? 228 PHE C C   1 
ATOM   10688 O O   . PHE C 1 229 ? 55.326  97.445  153.553 1.00 45.90 ? 228 PHE C O   1 
ATOM   10689 C CB  . PHE C 1 229 ? 52.904  99.386  152.245 1.00 43.21 ? 228 PHE C CB  1 
ATOM   10690 C CG  . PHE C 1 229 ? 53.745  99.045  151.047 1.00 42.48 ? 228 PHE C CG  1 
ATOM   10691 C CD1 . PHE C 1 229 ? 53.591  97.825  150.395 1.00 41.25 ? 228 PHE C CD1 1 
ATOM   10692 C CD2 . PHE C 1 229 ? 54.717  99.932  150.593 1.00 42.09 ? 228 PHE C CD2 1 
ATOM   10693 C CE1 . PHE C 1 229 ? 54.399  97.491  149.307 1.00 41.87 ? 228 PHE C CE1 1 
ATOM   10694 C CE2 . PHE C 1 229 ? 55.530  99.608  149.507 1.00 42.23 ? 228 PHE C CE2 1 
ATOM   10695 C CZ  . PHE C 1 229 ? 55.371  98.386  148.865 1.00 40.73 ? 228 PHE C CZ  1 
ATOM   10696 N N   . LEU C 1 230 ? 55.197  99.583  154.240 1.00 46.86 ? 229 LEU C N   1 
ATOM   10697 C CA  . LEU C 1 230 ? 56.615  99.688  154.568 1.00 49.37 ? 229 LEU C CA  1 
ATOM   10698 C C   . LEU C 1 230 ? 57.015  98.716  155.671 1.00 52.20 ? 229 LEU C C   1 
ATOM   10699 O O   . LEU C 1 230 ? 58.201  98.483  155.901 1.00 53.78 ? 229 LEU C O   1 
ATOM   10700 C CB  . LEU C 1 230 ? 56.952  101.116 155.002 1.00 46.89 ? 229 LEU C CB  1 
ATOM   10701 C CG  . LEU C 1 230 ? 56.817  102.200 153.932 1.00 45.30 ? 229 LEU C CG  1 
ATOM   10702 C CD1 . LEU C 1 230 ? 57.118  103.558 154.533 1.00 43.59 ? 229 LEU C CD1 1 
ATOM   10703 C CD2 . LEU C 1 230 ? 57.763  101.897 152.780 1.00 45.78 ? 229 LEU C CD2 1 
ATOM   10704 N N   . GLN C 1 231 ? 56.023  98.152  156.351 1.00 54.85 ? 230 GLN C N   1 
ATOM   10705 C CA  . GLN C 1 231 ? 56.277  97.209  157.432 1.00 57.77 ? 230 GLN C CA  1 
ATOM   10706 C C   . GLN C 1 231 ? 56.784  95.889  156.860 1.00 58.88 ? 230 GLN C C   1 
ATOM   10707 O O   . GLN C 1 231 ? 57.739  95.303  157.375 1.00 58.97 ? 230 GLN C O   1 
ATOM   10708 C CB  . GLN C 1 231 ? 54.991  96.978  158.235 1.00 58.92 ? 230 GLN C CB  1 
ATOM   10709 C CG  . GLN C 1 231 ? 55.173  96.247  159.562 1.00 60.10 ? 230 GLN C CG  1 
ATOM   10710 C CD  . GLN C 1 231 ? 55.659  94.820  159.394 1.00 61.59 ? 230 GLN C CD  1 
ATOM   10711 O OE1 . GLN C 1 231 ? 55.049  94.024  158.677 1.00 61.69 ? 230 GLN C OE1 1 
ATOM   10712 N NE2 . GLN C 1 231 ? 56.762  94.488  160.062 1.00 61.59 ? 230 GLN C NE2 1 
ATOM   10713 N N   . ALA C 1 232 ? 56.140  95.429  155.790 1.00 59.81 ? 231 ALA C N   1 
ATOM   10714 C CA  . ALA C 1 232 ? 56.515  94.178  155.140 1.00 60.90 ? 231 ALA C CA  1 
ATOM   10715 C C   . ALA C 1 232 ? 57.569  94.418  154.065 1.00 61.60 ? 231 ALA C C   1 
ATOM   10716 O O   . ALA C 1 232 ? 58.229  93.484  153.607 1.00 61.59 ? 231 ALA C O   1 
ATOM   10717 C CB  . ALA C 1 232 ? 55.284  93.522  154.528 1.00 60.75 ? 231 ALA C CB  1 
ATOM   10718 N N   . ALA C 1 233 ? 57.717  95.677  153.666 1.00 62.39 ? 232 ALA C N   1 
ATOM   10719 C CA  . ALA C 1 233 ? 58.688  96.064  152.649 1.00 63.31 ? 232 ALA C CA  1 
ATOM   10720 C C   . ALA C 1 233 ? 59.452  97.290  153.132 1.00 64.27 ? 232 ALA C C   1 
ATOM   10721 O O   . ALA C 1 233 ? 59.093  98.422  152.805 1.00 65.87 ? 232 ALA C O   1 
ATOM   10722 C CB  . ALA C 1 233 ? 57.978  96.372  151.333 1.00 63.03 ? 232 ALA C CB  1 
ATOM   10723 N N   . LYS C 1 234 ? 60.503  97.058  153.913 1.00 63.69 ? 233 LYS C N   1 
ATOM   10724 C CA  . LYS C 1 234 ? 61.317  98.138  154.461 1.00 62.66 ? 233 LYS C CA  1 
ATOM   10725 C C   . LYS C 1 234 ? 62.120  98.893  153.409 1.00 61.20 ? 233 LYS C C   1 
ATOM   10726 O O   . LYS C 1 234 ? 63.330  99.061  153.551 1.00 61.20 ? 233 LYS C O   1 
ATOM   10727 C CB  . LYS C 1 234 ? 62.276  97.584  155.518 1.00 64.15 ? 233 LYS C CB  1 
ATOM   10728 C CG  . LYS C 1 234 ? 61.612  97.150  156.812 1.00 65.26 ? 233 LYS C CG  1 
ATOM   10729 C CD  . LYS C 1 234 ? 61.133  98.344  157.621 1.00 66.22 ? 233 LYS C CD  1 
ATOM   10730 C CE  . LYS C 1 234 ? 60.557  97.900  158.957 1.00 67.45 ? 233 LYS C CE  1 
ATOM   10731 N NZ  . LYS C 1 234 ? 61.550  97.127  159.759 1.00 67.64 ? 233 LYS C NZ  1 
ATOM   10732 N N   . ASP C 1 235 ? 61.453  99.357  152.360 1.00 59.14 ? 234 ASP C N   1 
ATOM   10733 C CA  . ASP C 1 235 ? 62.138  100.099 151.312 1.00 56.95 ? 234 ASP C CA  1 
ATOM   10734 C C   . ASP C 1 235 ? 61.292  101.274 150.831 1.00 56.01 ? 234 ASP C C   1 
ATOM   10735 O O   . ASP C 1 235 ? 60.347  101.101 150.063 1.00 56.48 ? 234 ASP C O   1 
ATOM   10736 C CB  . ASP C 1 235 ? 62.479  99.164  150.147 1.00 55.67 ? 234 ASP C CB  1 
ATOM   10737 C CG  . ASP C 1 235 ? 63.207  99.874  149.020 1.00 54.92 ? 234 ASP C CG  1 
ATOM   10738 O OD1 . ASP C 1 235 ? 63.921  100.859 149.297 1.00 55.24 ? 234 ASP C OD1 1 
ATOM   10739 O OD2 . ASP C 1 235 ? 63.075  99.437  147.857 1.00 55.44 ? 234 ASP C OD2 1 
ATOM   10740 N N   . PRO C 1 236 ? 61.630  102.492 151.280 1.00 54.54 ? 235 PRO C N   1 
ATOM   10741 C CA  . PRO C 1 236 ? 60.903  103.706 150.899 1.00 53.88 ? 235 PRO C CA  1 
ATOM   10742 C C   . PRO C 1 236 ? 60.756  103.900 149.392 1.00 53.09 ? 235 PRO C C   1 
ATOM   10743 O O   . PRO C 1 236 ? 59.841  104.590 148.934 1.00 52.71 ? 235 PRO C O   1 
ATOM   10744 C CB  . PRO C 1 236 ? 61.721  104.818 151.556 1.00 54.68 ? 235 PRO C CB  1 
ATOM   10745 C CG  . PRO C 1 236 ? 63.102  104.236 151.614 1.00 54.69 ? 235 PRO C CG  1 
ATOM   10746 C CD  . PRO C 1 236 ? 62.826  102.830 152.067 1.00 54.52 ? 235 PRO C CD  1 
ATOM   10747 N N   . SER C 1 237 ? 61.652  103.290 148.625 1.00 51.03 ? 236 SER C N   1 
ATOM   10748 C CA  . SER C 1 237 ? 61.601  103.412 147.176 1.00 48.55 ? 236 SER C CA  1 
ATOM   10749 C C   . SER C 1 237 ? 60.613  102.406 146.601 1.00 47.13 ? 236 SER C C   1 
ATOM   10750 O O   . SER C 1 237 ? 60.146  102.561 145.474 1.00 47.12 ? 236 SER C O   1 
ATOM   10751 C CB  . SER C 1 237 ? 62.984  103.169 146.571 1.00 48.62 ? 236 SER C CB  1 
ATOM   10752 O OG  . SER C 1 237 ? 63.360  101.811 146.711 1.00 48.34 ? 236 SER C OG  1 
ATOM   10753 N N   . ALA C 1 238 ? 60.297  101.375 147.381 1.00 44.96 ? 237 ALA C N   1 
ATOM   10754 C CA  . ALA C 1 238 ? 59.364  100.342 146.943 1.00 43.73 ? 237 ALA C CA  1 
ATOM   10755 C C   . ALA C 1 238 ? 57.928  100.861 146.874 1.00 43.33 ? 237 ALA C C   1 
ATOM   10756 O O   . ALA C 1 238 ? 57.047  100.200 146.322 1.00 42.05 ? 237 ALA C O   1 
ATOM   10757 C CB  . ALA C 1 238 ? 59.442  99.139  147.877 1.00 43.13 ? 237 ALA C CB  1 
ATOM   10758 N N   . VAL C 1 239 ? 57.698  102.045 147.433 1.00 42.52 ? 238 VAL C N   1 
ATOM   10759 C CA  . VAL C 1 239 ? 56.371  102.648 147.432 1.00 41.29 ? 238 VAL C CA  1 
ATOM   10760 C C   . VAL C 1 239 ? 55.940  103.019 146.013 1.00 41.61 ? 238 VAL C C   1 
ATOM   10761 O O   . VAL C 1 239 ? 54.759  102.923 145.668 1.00 41.71 ? 238 VAL C O   1 
ATOM   10762 C CB  . VAL C 1 239 ? 56.333  103.917 148.324 1.00 40.68 ? 238 VAL C CB  1 
ATOM   10763 C CG1 . VAL C 1 239 ? 54.957  104.572 148.259 1.00 39.93 ? 238 VAL C CG1 1 
ATOM   10764 C CG2 . VAL C 1 239 ? 56.667  103.547 149.759 1.00 40.16 ? 238 VAL C CG2 1 
ATOM   10765 N N   . ALA C 1 240 ? 56.900  103.432 145.189 1.00 40.18 ? 239 ALA C N   1 
ATOM   10766 C CA  . ALA C 1 240 ? 56.605  103.819 143.814 1.00 38.87 ? 239 ALA C CA  1 
ATOM   10767 C C   . ALA C 1 240 ? 56.020  102.667 142.996 1.00 37.32 ? 239 ALA C C   1 
ATOM   10768 O O   . ALA C 1 240 ? 55.374  102.897 141.976 1.00 36.99 ? 239 ALA C O   1 
ATOM   10769 C CB  . ALA C 1 240 ? 57.862  104.356 143.141 1.00 39.54 ? 239 ALA C CB  1 
ATOM   10770 N N   . LYS C 1 241 ? 56.245  101.435 143.444 1.00 36.37 ? 240 LYS C N   1 
ATOM   10771 C CA  . LYS C 1 241 ? 55.727  100.255 142.749 1.00 35.92 ? 240 LYS C CA  1 
ATOM   10772 C C   . LYS C 1 241 ? 54.371  99.796  143.277 1.00 35.65 ? 240 LYS C C   1 
ATOM   10773 O O   . LYS C 1 241 ? 53.745  98.900  142.703 1.00 35.61 ? 240 LYS C O   1 
ATOM   10774 C CB  . LYS C 1 241 ? 56.705  99.080  142.865 1.00 37.69 ? 240 LYS C CB  1 
ATOM   10775 C CG  . LYS C 1 241 ? 57.919  99.153  141.951 1.00 39.45 ? 240 LYS C CG  1 
ATOM   10776 C CD  . LYS C 1 241 ? 58.735  97.869  142.033 1.00 40.21 ? 240 LYS C CD  1 
ATOM   10777 C CE  . LYS C 1 241 ? 59.859  97.858  141.005 1.00 41.25 ? 240 LYS C CE  1 
ATOM   10778 N NZ  . LYS C 1 241 ? 60.752  99.040  141.160 1.00 41.20 ? 240 LYS C NZ  1 
ATOM   10779 N N   . HIS C 1 242 ? 53.912  100.403 144.365 1.00 34.30 ? 241 HIS C N   1 
ATOM   10780 C CA  . HIS C 1 242 ? 52.643  100.003 144.950 1.00 33.83 ? 241 HIS C CA  1 
ATOM   10781 C C   . HIS C 1 242 ? 51.661  101.140 145.243 1.00 32.85 ? 241 HIS C C   1 
ATOM   10782 O O   . HIS C 1 242 ? 50.554  100.900 145.724 1.00 32.24 ? 241 HIS C O   1 
ATOM   10783 C CB  . HIS C 1 242 ? 52.920  99.196  146.219 1.00 33.79 ? 241 HIS C CB  1 
ATOM   10784 C CG  . HIS C 1 242 ? 53.552  97.864  145.958 1.00 33.28 ? 241 HIS C CG  1 
ATOM   10785 N ND1 . HIS C 1 242 ? 52.817  96.706  145.809 1.00 33.20 ? 241 HIS C ND1 1 
ATOM   10786 C CD2 . HIS C 1 242 ? 54.849  97.508  145.801 1.00 31.92 ? 241 HIS C CD2 1 
ATOM   10787 C CE1 . HIS C 1 242 ? 53.634  95.694  145.576 1.00 33.48 ? 241 HIS C CE1 1 
ATOM   10788 N NE2 . HIS C 1 242 ? 54.873  96.154  145.567 1.00 33.02 ? 241 HIS C NE2 1 
ATOM   10789 N N   . PHE C 1 243 ? 52.062  102.372 144.950 1.00 32.15 ? 242 PHE C N   1 
ATOM   10790 C CA  . PHE C 1 243 ? 51.201  103.527 145.183 1.00 30.75 ? 242 PHE C CA  1 
ATOM   10791 C C   . PHE C 1 243 ? 51.198  104.496 144.008 1.00 31.92 ? 242 PHE C C   1 
ATOM   10792 O O   . PHE C 1 243 ? 52.259  104.930 143.553 1.00 30.71 ? 242 PHE C O   1 
ATOM   10793 C CB  . PHE C 1 243 ? 51.644  104.302 146.427 1.00 31.46 ? 242 PHE C CB  1 
ATOM   10794 C CG  . PHE C 1 243 ? 51.349  103.606 147.730 1.00 33.62 ? 242 PHE C CG  1 
ATOM   10795 C CD1 . PHE C 1 243 ? 51.999  102.425 148.076 1.00 34.24 ? 242 PHE C CD1 1 
ATOM   10796 C CD2 . PHE C 1 243 ? 50.433  104.153 148.627 1.00 34.05 ? 242 PHE C CD2 1 
ATOM   10797 C CE1 . PHE C 1 243 ? 51.743  101.799 149.296 1.00 34.88 ? 242 PHE C CE1 1 
ATOM   10798 C CE2 . PHE C 1 243 ? 50.170  103.537 149.847 1.00 34.61 ? 242 PHE C CE2 1 
ATOM   10799 C CZ  . PHE C 1 243 ? 50.827  102.358 150.183 1.00 35.50 ? 242 PHE C CZ  1 
ATOM   10800 N N   . VAL C 1 244 ? 50.005  104.829 143.518 1.00 30.85 ? 243 VAL C N   1 
ATOM   10801 C CA  . VAL C 1 244 ? 49.861  105.797 142.432 1.00 31.35 ? 243 VAL C CA  1 
ATOM   10802 C C   . VAL C 1 244 ? 48.900  106.870 142.926 1.00 31.95 ? 243 VAL C C   1 
ATOM   10803 O O   . VAL C 1 244 ? 48.168  106.656 143.900 1.00 31.49 ? 243 VAL C O   1 
ATOM   10804 C CB  . VAL C 1 244 ? 49.298  105.168 141.133 1.00 31.33 ? 243 VAL C CB  1 
ATOM   10805 C CG1 . VAL C 1 244 ? 50.221  104.054 140.657 1.00 28.87 ? 243 VAL C CG1 1 
ATOM   10806 C CG2 . VAL C 1 244 ? 47.883  104.650 141.352 1.00 30.72 ? 243 VAL C CG2 1 
ATOM   10807 N N   . ALA C 1 245 ? 48.893  108.023 142.267 1.00 31.16 ? 244 ALA C N   1 
ATOM   10808 C CA  . ALA C 1 245 ? 48.018  109.104 142.695 1.00 30.16 ? 244 ALA C CA  1 
ATOM   10809 C C   . ALA C 1 245 ? 47.150  109.703 141.595 1.00 30.32 ? 244 ALA C C   1 
ATOM   10810 O O   . ALA C 1 245 ? 47.563  109.814 140.439 1.00 27.33 ? 244 ALA C O   1 
ATOM   10811 C CB  . ALA C 1 245 ? 48.845  110.202 143.346 1.00 30.52 ? 244 ALA C CB  1 
ATOM   10812 N N   . LEU C 1 246 ? 45.935  110.087 141.974 1.00 29.17 ? 245 LEU C N   1 
ATOM   10813 C CA  . LEU C 1 246 ? 45.008  110.721 141.048 1.00 29.21 ? 245 LEU C CA  1 
ATOM   10814 C C   . LEU C 1 246 ? 44.847  112.133 141.594 1.00 29.43 ? 245 LEU C C   1 
ATOM   10815 O O   . LEU C 1 246 ? 43.969  112.384 142.417 1.00 27.49 ? 245 LEU C O   1 
ATOM   10816 C CB  . LEU C 1 246 ? 43.649  110.007 141.042 1.00 26.33 ? 245 LEU C CB  1 
ATOM   10817 C CG  . LEU C 1 246 ? 43.612  108.480 140.949 1.00 24.19 ? 245 LEU C CG  1 
ATOM   10818 C CD1 . LEU C 1 246 ? 42.165  108.009 140.844 1.00 22.09 ? 245 LEU C CD1 1 
ATOM   10819 C CD2 . LEU C 1 246 ? 44.404  108.010 139.744 1.00 23.59 ? 245 LEU C CD2 1 
ATOM   10820 N N   . SER C 1 247 ? 45.720  113.038 141.154 1.00 32.16 ? 246 SER C N   1 
ATOM   10821 C CA  . SER C 1 247 ? 45.683  114.430 141.596 1.00 35.21 ? 246 SER C CA  1 
ATOM   10822 C C   . SER C 1 247 ? 46.566  115.327 140.739 1.00 36.57 ? 246 SER C C   1 
ATOM   10823 O O   . SER C 1 247 ? 46.998  114.947 139.653 1.00 36.99 ? 246 SER C O   1 
ATOM   10824 C CB  . SER C 1 247 ? 46.146  114.544 143.043 1.00 36.11 ? 246 SER C CB  1 
ATOM   10825 O OG  . SER C 1 247 ? 47.521  114.240 143.170 1.00 39.45 ? 246 SER C OG  1 
ATOM   10826 N N   . THR C 1 248 ? 46.838  116.523 141.252 1.00 38.59 ? 247 THR C N   1 
ATOM   10827 C CA  . THR C 1 248 ? 47.665  117.491 140.547 1.00 38.75 ? 247 THR C CA  1 
ATOM   10828 C C   . THR C 1 248 ? 48.881  117.936 141.366 1.00 40.26 ? 247 THR C C   1 
ATOM   10829 O O   . THR C 1 248 ? 49.890  118.366 140.804 1.00 40.51 ? 247 THR C O   1 
ATOM   10830 C CB  . THR C 1 248 ? 46.832  118.732 140.158 1.00 38.35 ? 247 THR C CB  1 
ATOM   10831 O OG1 . THR C 1 248 ? 46.127  119.213 141.309 1.00 37.05 ? 247 THR C OG1 1 
ATOM   10832 C CG2 . THR C 1 248 ? 45.828  118.382 139.066 1.00 37.33 ? 247 THR C CG2 1 
ATOM   10833 N N   . ASN C 1 249 ? 48.789  117.823 142.689 1.00 40.82 ? 248 ASN C N   1 
ATOM   10834 C CA  . ASN C 1 249 ? 49.882  118.230 143.568 1.00 42.58 ? 248 ASN C CA  1 
ATOM   10835 C C   . ASN C 1 249 ? 51.099  117.320 143.418 1.00 42.52 ? 248 ASN C C   1 
ATOM   10836 O O   . ASN C 1 249 ? 51.259  116.349 144.163 1.00 42.18 ? 248 ASN C O   1 
ATOM   10837 C CB  . ASN C 1 249 ? 49.419  118.218 145.026 1.00 44.33 ? 248 ASN C CB  1 
ATOM   10838 C CG  . ASN C 1 249 ? 50.329  119.030 145.934 1.00 46.77 ? 248 ASN C CG  1 
ATOM   10839 O OD1 . ASN C 1 249 ? 51.558  118.941 145.853 1.00 46.51 ? 248 ASN C OD1 1 
ATOM   10840 N ND2 . ASN C 1 249 ? 49.725  119.821 146.814 1.00 47.39 ? 248 ASN C ND2 1 
ATOM   10841 N N   . THR C 1 250 ? 51.959  117.649 142.459 1.00 43.04 ? 249 THR C N   1 
ATOM   10842 C CA  . THR C 1 250 ? 53.163  116.867 142.190 1.00 43.19 ? 249 THR C CA  1 
ATOM   10843 C C   . THR C 1 250 ? 54.075  116.796 143.413 1.00 43.16 ? 249 THR C C   1 
ATOM   10844 O O   . THR C 1 250 ? 54.667  115.754 143.700 1.00 42.49 ? 249 THR C O   1 
ATOM   10845 C CB  . THR C 1 250 ? 53.959  117.471 141.014 1.00 43.85 ? 249 THR C CB  1 
ATOM   10846 O OG1 . THR C 1 250 ? 53.059  117.817 139.955 1.00 44.17 ? 249 THR C OG1 1 
ATOM   10847 C CG2 . THR C 1 250 ? 54.977  116.468 140.488 1.00 43.38 ? 249 THR C CG2 1 
ATOM   10848 N N   . THR C 1 251 ? 54.182  117.912 144.128 1.00 44.05 ? 250 THR C N   1 
ATOM   10849 C CA  . THR C 1 251 ? 55.017  117.999 145.323 1.00 45.05 ? 250 THR C CA  1 
ATOM   10850 C C   . THR C 1 251 ? 54.646  116.939 146.358 1.00 45.41 ? 250 THR C C   1 
ATOM   10851 O O   . THR C 1 251 ? 55.458  116.075 146.696 1.00 44.98 ? 250 THR C O   1 
ATOM   10852 C CB  . THR C 1 251 ? 54.889  119.390 145.983 1.00 46.02 ? 250 THR C CB  1 
ATOM   10853 O OG1 . THR C 1 251 ? 55.305  120.398 145.053 1.00 46.78 ? 250 THR C OG1 1 
ATOM   10854 C CG2 . THR C 1 251 ? 55.751  119.473 147.234 1.00 45.25 ? 250 THR C CG2 1 
ATOM   10855 N N   . LYS C 1 252 ? 53.416  117.017 146.857 1.00 45.76 ? 251 LYS C N   1 
ATOM   10856 C CA  . LYS C 1 252 ? 52.926  116.075 147.857 1.00 46.50 ? 251 LYS C CA  1 
ATOM   10857 C C   . LYS C 1 252 ? 53.036  114.633 147.380 1.00 46.59 ? 251 LYS C C   1 
ATOM   10858 O O   . LYS C 1 252 ? 53.437  113.753 148.142 1.00 47.10 ? 251 LYS C O   1 
ATOM   10859 C CB  . LYS C 1 252 ? 51.469  116.390 148.208 1.00 46.70 ? 251 LYS C CB  1 
ATOM   10860 C CG  . LYS C 1 252 ? 51.268  117.755 148.832 1.00 47.86 ? 251 LYS C CG  1 
ATOM   10861 C CD  . LYS C 1 252 ? 52.052  117.882 150.128 1.00 50.12 ? 251 LYS C CD  1 
ATOM   10862 C CE  . LYS C 1 252 ? 51.845  119.246 150.769 1.00 50.79 ? 251 LYS C CE  1 
ATOM   10863 N NZ  . LYS C 1 252 ? 52.609  119.379 152.037 1.00 51.40 ? 251 LYS C NZ  1 
ATOM   10864 N N   . VAL C 1 253 ? 52.678  114.392 146.121 1.00 46.22 ? 252 VAL C N   1 
ATOM   10865 C CA  . VAL C 1 253 ? 52.747  113.048 145.560 1.00 46.59 ? 252 VAL C CA  1 
ATOM   10866 C C   . VAL C 1 253 ? 54.182  112.536 145.610 1.00 47.50 ? 252 VAL C C   1 
ATOM   10867 O O   . VAL C 1 253 ? 54.425  111.376 145.947 1.00 46.87 ? 252 VAL C O   1 
ATOM   10868 C CB  . VAL C 1 253 ? 52.244  113.021 144.099 1.00 46.67 ? 252 VAL C CB  1 
ATOM   10869 C CG1 . VAL C 1 253 ? 52.389  111.620 143.522 1.00 45.30 ? 252 VAL C CG1 1 
ATOM   10870 C CG2 . VAL C 1 253 ? 50.792  113.463 144.048 1.00 46.95 ? 252 VAL C CG2 1 
ATOM   10871 N N   . LYS C 1 254 ? 55.130  113.404 145.266 1.00 49.06 ? 253 LYS C N   1 
ATOM   10872 C CA  . LYS C 1 254 ? 56.542  113.038 145.303 1.00 50.37 ? 253 LYS C CA  1 
ATOM   10873 C C   . LYS C 1 254 ? 56.898  112.675 146.737 1.00 49.96 ? 253 LYS C C   1 
ATOM   10874 O O   . LYS C 1 254 ? 57.405  111.586 147.009 1.00 49.44 ? 253 LYS C O   1 
ATOM   10875 C CB  . LYS C 1 254 ? 57.423  114.212 144.863 1.00 52.98 ? 253 LYS C CB  1 
ATOM   10876 C CG  . LYS C 1 254 ? 57.383  114.545 143.383 1.00 56.06 ? 253 LYS C CG  1 
ATOM   10877 C CD  . LYS C 1 254 ? 58.262  115.755 143.090 1.00 59.44 ? 253 LYS C CD  1 
ATOM   10878 C CE  . LYS C 1 254 ? 58.326  116.060 141.599 1.00 61.92 ? 253 LYS C CE  1 
ATOM   10879 N NZ  . LYS C 1 254 ? 58.977  114.965 140.823 1.00 62.99 ? 253 LYS C NZ  1 
ATOM   10880 N N   . GLU C 1 255 ? 56.621  113.607 147.647 1.00 49.85 ? 254 GLU C N   1 
ATOM   10881 C CA  . GLU C 1 255 ? 56.907  113.429 149.067 1.00 51.04 ? 254 GLU C CA  1 
ATOM   10882 C C   . GLU C 1 255 ? 56.361  112.115 149.607 1.00 49.97 ? 254 GLU C C   1 
ATOM   10883 O O   . GLU C 1 255 ? 57.014  111.445 150.410 1.00 49.92 ? 254 GLU C O   1 
ATOM   10884 C CB  . GLU C 1 255 ? 56.323  114.593 149.871 1.00 52.20 ? 254 GLU C CB  1 
ATOM   10885 C CG  . GLU C 1 255 ? 56.819  115.956 149.420 1.00 55.14 ? 254 GLU C CG  1 
ATOM   10886 C CD  . GLU C 1 255 ? 56.282  117.086 150.274 1.00 57.13 ? 254 GLU C CD  1 
ATOM   10887 O OE1 . GLU C 1 255 ? 55.045  117.180 150.434 1.00 58.33 ? 254 GLU C OE1 1 
ATOM   10888 O OE2 . GLU C 1 255 ? 57.098  117.885 150.783 1.00 59.07 ? 254 GLU C OE2 1 
ATOM   10889 N N   . PHE C 1 256 ? 55.164  111.747 149.162 1.00 48.81 ? 255 PHE C N   1 
ATOM   10890 C CA  . PHE C 1 256 ? 54.542  110.509 149.609 1.00 47.44 ? 255 PHE C CA  1 
ATOM   10891 C C   . PHE C 1 256 ? 55.431  109.324 149.238 1.00 46.73 ? 255 PHE C C   1 
ATOM   10892 O O   . PHE C 1 256 ? 55.496  108.332 149.964 1.00 45.92 ? 255 PHE C O   1 
ATOM   10893 C CB  . PHE C 1 256 ? 53.169  110.344 148.957 1.00 47.64 ? 255 PHE C CB  1 
ATOM   10894 C CG  . PHE C 1 256 ? 52.300  109.323 149.629 1.00 46.92 ? 255 PHE C CG  1 
ATOM   10895 C CD1 . PHE C 1 256 ? 51.542  109.667 150.745 1.00 46.98 ? 255 PHE C CD1 1 
ATOM   10896 C CD2 . PHE C 1 256 ? 52.265  108.009 149.169 1.00 46.42 ? 255 PHE C CD2 1 
ATOM   10897 C CE1 . PHE C 1 256 ? 50.760  108.715 151.398 1.00 45.92 ? 255 PHE C CE1 1 
ATOM   10898 C CE2 . PHE C 1 256 ? 51.488  107.048 149.814 1.00 46.89 ? 255 PHE C CE2 1 
ATOM   10899 C CZ  . PHE C 1 256 ? 50.734  107.402 150.932 1.00 46.24 ? 255 PHE C CZ  1 
ATOM   10900 N N   . GLY C 1 257 ? 56.115  109.442 148.102 1.00 46.27 ? 256 GLY C N   1 
ATOM   10901 C CA  . GLY C 1 257 ? 56.992  108.380 147.638 1.00 45.17 ? 256 GLY C CA  1 
ATOM   10902 C C   . GLY C 1 257 ? 56.462  107.755 146.362 1.00 44.68 ? 256 GLY C C   1 
ATOM   10903 O O   . GLY C 1 257 ? 56.858  106.655 145.978 1.00 43.33 ? 256 GLY C O   1 
ATOM   10904 N N   . ILE C 1 258 ? 55.555  108.473 145.707 1.00 45.10 ? 257 ILE C N   1 
ATOM   10905 C CA  . ILE C 1 258 ? 54.934  108.014 144.470 1.00 44.29 ? 257 ILE C CA  1 
ATOM   10906 C C   . ILE C 1 258 ? 55.672  108.570 143.260 1.00 44.38 ? 257 ILE C C   1 
ATOM   10907 O O   . ILE C 1 258 ? 56.051  109.744 143.239 1.00 43.88 ? 257 ILE C O   1 
ATOM   10908 C CB  . ILE C 1 258 ? 53.457  108.478 144.389 1.00 44.43 ? 257 ILE C CB  1 
ATOM   10909 C CG1 . ILE C 1 258 ? 52.662  107.909 145.569 1.00 43.75 ? 257 ILE C CG1 1 
ATOM   10910 C CG2 . ILE C 1 258 ? 52.843  108.050 143.065 1.00 43.89 ? 257 ILE C CG2 1 
ATOM   10911 C CD1 . ILE C 1 258 ? 51.246  108.434 145.658 1.00 42.48 ? 257 ILE C CD1 1 
ATOM   10912 N N   . ASP C 1 259 ? 55.876  107.727 142.253 1.00 44.01 ? 258 ASP C N   1 
ATOM   10913 C CA  . ASP C 1 259 ? 56.550  108.160 141.036 1.00 44.67 ? 258 ASP C CA  1 
ATOM   10914 C C   . ASP C 1 259 ? 55.666  109.219 140.375 1.00 45.39 ? 258 ASP C C   1 
ATOM   10915 O O   . ASP C 1 259 ? 54.557  108.921 139.931 1.00 46.64 ? 258 ASP C O   1 
ATOM   10916 C CB  . ASP C 1 259 ? 56.735  106.981 140.082 1.00 44.30 ? 258 ASP C CB  1 
ATOM   10917 C CG  . ASP C 1 259 ? 57.604  107.332 138.892 1.00 42.95 ? 258 ASP C CG  1 
ATOM   10918 O OD1 . ASP C 1 259 ? 57.700  108.534 138.563 1.00 39.22 ? 258 ASP C OD1 1 
ATOM   10919 O OD2 . ASP C 1 259 ? 58.181  106.405 138.283 1.00 43.02 ? 258 ASP C OD2 1 
ATOM   10920 N N   . PRO C 1 260 ? 56.152  110.468 140.294 1.00 45.60 ? 259 PRO C N   1 
ATOM   10921 C CA  . PRO C 1 260 ? 55.402  111.573 139.691 1.00 45.29 ? 259 PRO C CA  1 
ATOM   10922 C C   . PRO C 1 260 ? 54.768  111.256 138.337 1.00 45.75 ? 259 PRO C C   1 
ATOM   10923 O O   . PRO C 1 260 ? 53.720  111.804 137.997 1.00 45.64 ? 259 PRO C O   1 
ATOM   10924 C CB  . PRO C 1 260 ? 56.445  112.682 139.593 1.00 45.36 ? 259 PRO C CB  1 
ATOM   10925 C CG  . PRO C 1 260 ? 57.316  112.412 140.771 1.00 46.21 ? 259 PRO C CG  1 
ATOM   10926 C CD  . PRO C 1 260 ? 57.495  110.916 140.700 1.00 46.15 ? 259 PRO C CD  1 
ATOM   10927 N N   . GLN C 1 261 ? 55.395  110.380 137.560 1.00 45.56 ? 260 GLN C N   1 
ATOM   10928 C CA  . GLN C 1 261 ? 54.833  110.051 136.259 1.00 46.34 ? 260 GLN C CA  1 
ATOM   10929 C C   . GLN C 1 261 ? 53.638  109.120 136.415 1.00 44.55 ? 260 GLN C C   1 
ATOM   10930 O O   . GLN C 1 261 ? 52.974  108.777 135.436 1.00 43.48 ? 260 GLN C O   1 
ATOM   10931 C CB  . GLN C 1 261 ? 55.894  109.431 135.344 1.00 49.18 ? 260 GLN C CB  1 
ATOM   10932 C CG  . GLN C 1 261 ? 56.370  108.053 135.738 1.00 53.76 ? 260 GLN C CG  1 
ATOM   10933 C CD  . GLN C 1 261 ? 57.402  107.516 134.765 1.00 56.92 ? 260 GLN C CD  1 
ATOM   10934 O OE1 . GLN C 1 261 ? 57.184  107.514 133.551 1.00 59.27 ? 260 GLN C OE1 1 
ATOM   10935 N NE2 . GLN C 1 261 ? 58.533  107.052 135.291 1.00 57.43 ? 260 GLN C NE2 1 
ATOM   10936 N N   . ASN C 1 262 ? 53.370  108.718 137.654 1.00 42.48 ? 261 ASN C N   1 
ATOM   10937 C CA  . ASN C 1 262 ? 52.235  107.853 137.949 1.00 40.71 ? 261 ASN C CA  1 
ATOM   10938 C C   . ASN C 1 262 ? 51.154  108.656 138.662 1.00 39.17 ? 261 ASN C C   1 
ATOM   10939 O O   . ASN C 1 262 ? 50.371  108.119 139.447 1.00 38.47 ? 261 ASN C O   1 
ATOM   10940 C CB  . ASN C 1 262 ? 52.656  106.660 138.807 1.00 42.08 ? 261 ASN C CB  1 
ATOM   10941 C CG  . ASN C 1 262 ? 53.519  105.674 138.048 1.00 42.33 ? 261 ASN C CG  1 
ATOM   10942 O OD1 . ASN C 1 262 ? 53.248  105.358 136.889 1.00 42.57 ? 261 ASN C OD1 1 
ATOM   10943 N ND2 . ASN C 1 262 ? 54.555  105.168 138.703 1.00 42.68 ? 261 ASN C ND2 1 
ATOM   10944 N N   . MET C 1 263 ? 51.141  109.958 138.395 1.00 36.48 ? 262 MET C N   1 
ATOM   10945 C CA  . MET C 1 263 ? 50.145  110.853 138.958 1.00 33.14 ? 262 MET C CA  1 
ATOM   10946 C C   . MET C 1 263 ? 49.214  111.211 137.805 1.00 32.56 ? 262 MET C C   1 
ATOM   10947 O O   . MET C 1 263 ? 49.611  111.897 136.863 1.00 32.98 ? 262 MET C O   1 
ATOM   10948 C CB  . MET C 1 263 ? 50.796  112.123 139.506 1.00 32.81 ? 262 MET C CB  1 
ATOM   10949 C CG  . MET C 1 263 ? 49.794  113.107 140.086 1.00 32.60 ? 262 MET C CG  1 
ATOM   10950 S SD  . MET C 1 263 ? 50.513  114.674 140.614 1.00 32.99 ? 262 MET C SD  1 
ATOM   10951 C CE  . MET C 1 263 ? 50.522  115.566 139.073 1.00 31.58 ? 262 MET C CE  1 
ATOM   10952 N N   . PHE C 1 264 ? 47.979  110.735 137.874 1.00 30.28 ? 263 PHE C N   1 
ATOM   10953 C CA  . PHE C 1 264 ? 47.007  110.998 136.826 1.00 30.18 ? 263 PHE C CA  1 
ATOM   10954 C C   . PHE C 1 264 ? 46.169  112.195 137.231 1.00 31.87 ? 263 PHE C C   1 
ATOM   10955 O O   . PHE C 1 264 ? 45.380  112.129 138.169 1.00 33.49 ? 263 PHE C O   1 
ATOM   10956 C CB  . PHE C 1 264 ? 46.144  109.760 136.614 1.00 28.61 ? 263 PHE C CB  1 
ATOM   10957 C CG  . PHE C 1 264 ? 46.945  108.512 136.364 1.00 27.06 ? 263 PHE C CG  1 
ATOM   10958 C CD1 . PHE C 1 264 ? 47.619  107.883 137.405 1.00 26.53 ? 263 PHE C CD1 1 
ATOM   10959 C CD2 . PHE C 1 264 ? 47.044  107.978 135.084 1.00 26.82 ? 263 PHE C CD2 1 
ATOM   10960 C CE1 . PHE C 1 264 ? 48.381  106.742 137.178 1.00 26.04 ? 263 PHE C CE1 1 
ATOM   10961 C CE2 . PHE C 1 264 ? 47.805  106.835 134.845 1.00 26.89 ? 263 PHE C CE2 1 
ATOM   10962 C CZ  . PHE C 1 264 ? 48.475  106.217 135.894 1.00 27.05 ? 263 PHE C CZ  1 
ATOM   10963 N N   . GLU C 1 265 ? 46.340  113.295 136.512 1.00 33.02 ? 264 GLU C N   1 
ATOM   10964 C CA  . GLU C 1 265 ? 45.638  114.522 136.846 1.00 35.57 ? 264 GLU C CA  1 
ATOM   10965 C C   . GLU C 1 265 ? 44.310  114.803 136.157 1.00 34.20 ? 264 GLU C C   1 
ATOM   10966 O O   . GLU C 1 265 ? 44.039  114.317 135.059 1.00 34.51 ? 264 GLU C O   1 
ATOM   10967 C CB  . GLU C 1 265 ? 46.582  115.710 136.628 1.00 39.61 ? 264 GLU C CB  1 
ATOM   10968 C CG  . GLU C 1 265 ? 47.215  115.752 135.252 1.00 44.72 ? 264 GLU C CG  1 
ATOM   10969 C CD  . GLU C 1 265 ? 48.288  116.822 135.128 1.00 49.57 ? 264 GLU C CD  1 
ATOM   10970 O OE1 . GLU C 1 265 ? 48.873  116.958 134.032 1.00 50.50 ? 264 GLU C OE1 1 
ATOM   10971 O OE2 . GLU C 1 265 ? 48.551  117.526 136.127 1.00 52.33 ? 264 GLU C OE2 1 
ATOM   10972 N N   . PHE C 1 266 ? 43.477  115.574 136.848 1.00 32.79 ? 265 PHE C N   1 
ATOM   10973 C CA  . PHE C 1 266 ? 42.191  116.009 136.331 1.00 32.98 ? 265 PHE C CA  1 
ATOM   10974 C C   . PHE C 1 266 ? 42.139  117.508 136.627 1.00 32.94 ? 265 PHE C C   1 
ATOM   10975 O O   . PHE C 1 266 ? 43.063  118.041 137.244 1.00 33.00 ? 265 PHE C O   1 
ATOM   10976 C CB  . PHE C 1 266 ? 41.017  115.222 136.945 1.00 32.90 ? 265 PHE C CB  1 
ATOM   10977 C CG  . PHE C 1 266 ? 41.034  115.130 138.443 1.00 35.66 ? 265 PHE C CG  1 
ATOM   10978 C CD1 . PHE C 1 266 ? 40.144  115.879 139.207 1.00 34.94 ? 265 PHE C CD1 1 
ATOM   10979 C CD2 . PHE C 1 266 ? 41.901  114.255 139.091 1.00 35.09 ? 265 PHE C CD2 1 
ATOM   10980 C CE1 . PHE C 1 266 ? 40.115  115.752 140.594 1.00 37.35 ? 265 PHE C CE1 1 
ATOM   10981 C CE2 . PHE C 1 266 ? 41.880  114.123 140.478 1.00 36.18 ? 265 PHE C CE2 1 
ATOM   10982 C CZ  . PHE C 1 266 ? 40.985  114.872 141.230 1.00 36.53 ? 265 PHE C CZ  1 
ATOM   10983 N N   . TRP C 1 267 ? 41.081  118.191 136.206 1.00 31.23 ? 266 TRP C N   1 
ATOM   10984 C CA  . TRP C 1 267 ? 41.034  119.641 136.361 1.00 30.35 ? 266 TRP C CA  1 
ATOM   10985 C C   . TRP C 1 267 ? 39.929  120.236 137.222 1.00 32.24 ? 266 TRP C C   1 
ATOM   10986 O O   . TRP C 1 267 ? 38.985  119.546 137.617 1.00 31.05 ? 266 TRP C O   1 
ATOM   10987 C CB  . TRP C 1 267 ? 41.018  120.244 134.952 1.00 30.09 ? 266 TRP C CB  1 
ATOM   10988 C CG  . TRP C 1 267 ? 42.092  119.615 134.105 1.00 28.75 ? 266 TRP C CG  1 
ATOM   10989 C CD1 . TRP C 1 267 ? 43.376  120.051 133.956 1.00 29.65 ? 266 TRP C CD1 1 
ATOM   10990 C CD2 . TRP C 1 267 ? 42.025  118.344 133.439 1.00 28.95 ? 266 TRP C CD2 1 
ATOM   10991 N NE1 . TRP C 1 267 ? 44.117  119.131 133.253 1.00 28.09 ? 266 TRP C NE1 1 
ATOM   10992 C CE2 . TRP C 1 267 ? 43.313  118.073 132.923 1.00 29.43 ? 266 TRP C CE2 1 
ATOM   10993 C CE3 . TRP C 1 267 ? 41.005  117.404 133.237 1.00 29.45 ? 266 TRP C CE3 1 
ATOM   10994 C CZ2 . TRP C 1 267 ? 43.610  116.898 132.216 1.00 27.75 ? 266 TRP C CZ2 1 
ATOM   10995 C CZ3 . TRP C 1 267 ? 41.301  116.232 132.532 1.00 29.23 ? 266 TRP C CZ3 1 
ATOM   10996 C CH2 . TRP C 1 267 ? 42.595  115.994 132.032 1.00 29.65 ? 266 TRP C CH2 1 
ATOM   10997 N N   . ASP C 1 268 ? 40.052  121.532 137.499 1.00 31.96 ? 267 ASP C N   1 
ATOM   10998 C CA  . ASP C 1 268 ? 39.090  122.229 138.341 1.00 33.46 ? 267 ASP C CA  1 
ATOM   10999 C C   . ASP C 1 268 ? 37.663  122.216 137.814 1.00 31.51 ? 267 ASP C C   1 
ATOM   11000 O O   . ASP C 1 268 ? 36.719  122.353 138.590 1.00 31.83 ? 267 ASP C O   1 
ATOM   11001 C CB  . ASP C 1 268 ? 39.544  123.678 138.599 1.00 38.16 ? 267 ASP C CB  1 
ATOM   11002 C CG  . ASP C 1 268 ? 39.614  124.512 137.332 1.00 41.48 ? 267 ASP C CG  1 
ATOM   11003 O OD1 . ASP C 1 268 ? 38.565  124.716 136.686 1.00 44.81 ? 267 ASP C OD1 1 
ATOM   11004 O OD2 . ASP C 1 268 ? 40.723  124.972 136.983 1.00 46.81 ? 267 ASP C OD2 1 
ATOM   11005 N N   . TRP C 1 269 ? 37.493  122.055 136.506 1.00 29.37 ? 268 TRP C N   1 
ATOM   11006 C CA  . TRP C 1 269 ? 36.147  122.019 135.946 1.00 28.47 ? 268 TRP C CA  1 
ATOM   11007 C C   . TRP C 1 269 ? 35.544  120.617 136.017 1.00 28.30 ? 268 TRP C C   1 
ATOM   11008 O O   . TRP C 1 269 ? 34.468  120.368 135.472 1.00 29.43 ? 268 TRP C O   1 
ATOM   11009 C CB  . TRP C 1 269 ? 36.126  122.535 134.496 1.00 28.96 ? 268 TRP C CB  1 
ATOM   11010 C CG  . TRP C 1 269 ? 37.355  122.238 133.695 1.00 28.67 ? 268 TRP C CG  1 
ATOM   11011 C CD1 . TRP C 1 269 ? 38.409  123.077 133.473 1.00 28.92 ? 268 TRP C CD1 1 
ATOM   11012 C CD2 . TRP C 1 269 ? 37.659  121.018 133.009 1.00 27.49 ? 268 TRP C CD2 1 
ATOM   11013 N NE1 . TRP C 1 269 ? 39.351  122.454 132.689 1.00 28.06 ? 268 TRP C NE1 1 
ATOM   11014 C CE2 . TRP C 1 269 ? 38.917  121.191 132.391 1.00 26.26 ? 268 TRP C CE2 1 
ATOM   11015 C CE3 . TRP C 1 269 ? 36.991  119.795 132.858 1.00 26.53 ? 268 TRP C CE3 1 
ATOM   11016 C CZ2 . TRP C 1 269 ? 39.521  120.189 131.636 1.00 26.56 ? 268 TRP C CZ2 1 
ATOM   11017 C CZ3 . TRP C 1 269 ? 37.591  118.798 132.107 1.00 26.51 ? 268 TRP C CZ3 1 
ATOM   11018 C CH2 . TRP C 1 269 ? 38.846  119.000 131.504 1.00 27.29 ? 268 TRP C CH2 1 
ATOM   11019 N N   . VAL C 1 270 ? 36.248  119.706 136.686 1.00 26.60 ? 269 VAL C N   1 
ATOM   11020 C CA  . VAL C 1 270 ? 35.767  118.339 136.872 1.00 26.09 ? 269 VAL C CA  1 
ATOM   11021 C C   . VAL C 1 270 ? 35.240  118.233 138.301 1.00 26.29 ? 269 VAL C C   1 
ATOM   11022 O O   . VAL C 1 270 ? 36.023  118.162 139.249 1.00 23.83 ? 269 VAL C O   1 
ATOM   11023 C CB  . VAL C 1 270 ? 36.888  117.292 136.713 1.00 27.37 ? 269 VAL C CB  1 
ATOM   11024 C CG1 . VAL C 1 270 ? 36.316  115.893 136.944 1.00 24.70 ? 269 VAL C CG1 1 
ATOM   11025 C CG2 . VAL C 1 270 ? 37.523  117.398 135.329 1.00 26.67 ? 269 VAL C CG2 1 
ATOM   11026 N N   . GLY C 1 271 ? 33.918  118.231 138.451 1.00 25.33 ? 270 GLY C N   1 
ATOM   11027 C CA  . GLY C 1 271 ? 33.326  118.135 139.773 1.00 25.47 ? 270 GLY C CA  1 
ATOM   11028 C C   . GLY C 1 271 ? 33.515  116.755 140.372 1.00 26.60 ? 270 GLY C C   1 
ATOM   11029 O O   . GLY C 1 271 ? 33.446  115.748 139.662 1.00 26.27 ? 270 GLY C O   1 
ATOM   11030 N N   . GLY C 1 272 ? 33.758  116.706 141.679 1.00 25.83 ? 271 GLY C N   1 
ATOM   11031 C CA  . GLY C 1 272 ? 33.950  115.432 142.344 1.00 23.86 ? 271 GLY C CA  1 
ATOM   11032 C C   . GLY C 1 272 ? 32.835  114.452 142.029 1.00 24.23 ? 271 GLY C C   1 
ATOM   11033 O O   . GLY C 1 272 ? 33.101  113.313 141.644 1.00 23.16 ? 271 GLY C O   1 
ATOM   11034 N N   . ARG C 1 273 ? 31.587  114.891 142.188 1.00 21.92 ? 272 ARG C N   1 
ATOM   11035 C CA  . ARG C 1 273 ? 30.440  114.032 141.917 1.00 23.28 ? 272 ARG C CA  1 
ATOM   11036 C C   . ARG C 1 273 ? 30.215  113.771 140.421 1.00 23.57 ? 272 ARG C C   1 
ATOM   11037 O O   . ARG C 1 273 ? 29.238  113.122 140.041 1.00 22.46 ? 272 ARG C O   1 
ATOM   11038 C CB  . ARG C 1 273 ? 29.177  114.622 142.556 1.00 24.82 ? 272 ARG C CB  1 
ATOM   11039 C CG  . ARG C 1 273 ? 28.984  116.106 142.296 1.00 26.45 ? 272 ARG C CG  1 
ATOM   11040 C CD  . ARG C 1 273 ? 27.701  116.628 142.924 1.00 26.31 ? 272 ARG C CD  1 
ATOM   11041 N NE  . ARG C 1 273 ? 27.546  118.063 142.693 1.00 26.03 ? 272 ARG C NE  1 
ATOM   11042 C CZ  . ARG C 1 273 ? 28.188  119.010 143.373 1.00 25.94 ? 272 ARG C CZ  1 
ATOM   11043 N NH1 . ARG C 1 273 ? 29.031  118.678 144.342 1.00 22.17 ? 272 ARG C NH1 1 
ATOM   11044 N NH2 . ARG C 1 273 ? 27.999  120.292 143.073 1.00 23.88 ? 272 ARG C NH2 1 
ATOM   11045 N N   . TYR C 1 274 ? 31.125  114.273 139.583 1.00 21.91 ? 273 TYR C N   1 
ATOM   11046 C CA  . TYR C 1 274 ? 31.059  114.074 138.131 1.00 21.25 ? 273 TYR C CA  1 
ATOM   11047 C C   . TYR C 1 274 ? 32.458  113.702 137.630 1.00 20.65 ? 273 TYR C C   1 
ATOM   11048 O O   . TYR C 1 274 ? 32.792  113.942 136.468 1.00 20.40 ? 273 TYR C O   1 
ATOM   11049 C CB  . TYR C 1 274 ? 30.631  115.361 137.408 1.00 21.77 ? 273 TYR C CB  1 
ATOM   11050 C CG  . TYR C 1 274 ? 29.272  115.908 137.779 1.00 22.55 ? 273 TYR C CG  1 
ATOM   11051 C CD1 . TYR C 1 274 ? 29.144  116.966 138.679 1.00 23.55 ? 273 TYR C CD1 1 
ATOM   11052 C CD2 . TYR C 1 274 ? 28.113  115.375 137.223 1.00 20.83 ? 273 TYR C CD2 1 
ATOM   11053 C CE1 . TYR C 1 274 ? 27.889  117.481 139.014 1.00 22.24 ? 273 TYR C CE1 1 
ATOM   11054 C CE2 . TYR C 1 274 ? 26.858  115.880 137.549 1.00 21.47 ? 273 TYR C CE2 1 
ATOM   11055 C CZ  . TYR C 1 274 ? 26.752  116.930 138.444 1.00 21.50 ? 273 TYR C CZ  1 
ATOM   11056 O OH  . TYR C 1 274 ? 25.506  117.421 138.766 1.00 19.05 ? 273 TYR C OH  1 
ATOM   11057 N N   . SER C 1 275 ? 33.264  113.099 138.496 1.00 18.80 ? 274 SER C N   1 
ATOM   11058 C CA  . SER C 1 275 ? 34.641  112.779 138.135 1.00 20.38 ? 274 SER C CA  1 
ATOM   11059 C C   . SER C 1 275 ? 34.995  111.341 137.768 1.00 20.71 ? 274 SER C C   1 
ATOM   11060 O O   . SER C 1 275 ? 36.142  111.067 137.411 1.00 19.00 ? 274 SER C O   1 
ATOM   11061 C CB  . SER C 1 275 ? 35.570  113.226 139.269 1.00 21.21 ? 274 SER C CB  1 
ATOM   11062 O OG  . SER C 1 275 ? 35.375  112.419 140.423 1.00 22.77 ? 274 SER C OG  1 
ATOM   11063 N N   . LEU C 1 276 ? 34.045  110.417 137.846 1.00 19.20 ? 275 LEU C N   1 
ATOM   11064 C CA  . LEU C 1 276 ? 34.379  109.034 137.520 1.00 20.09 ? 275 LEU C CA  1 
ATOM   11065 C C   . LEU C 1 276 ? 34.836  108.899 136.067 1.00 21.62 ? 275 LEU C C   1 
ATOM   11066 O O   . LEU C 1 276 ? 35.485  107.919 135.704 1.00 21.31 ? 275 LEU C O   1 
ATOM   11067 C CB  . LEU C 1 276 ? 33.184  108.111 137.788 1.00 20.12 ? 275 LEU C CB  1 
ATOM   11068 C CG  . LEU C 1 276 ? 31.951  108.254 136.893 1.00 21.63 ? 275 LEU C CG  1 
ATOM   11069 C CD1 . LEU C 1 276 ? 32.145  107.443 135.605 1.00 17.75 ? 275 LEU C CD1 1 
ATOM   11070 C CD2 . LEU C 1 276 ? 30.728  107.767 137.660 1.00 19.41 ? 275 LEU C CD2 1 
ATOM   11071 N N   . TRP C 1 277 ? 34.508  109.893 135.246 1.00 21.08 ? 276 TRP C N   1 
ATOM   11072 C CA  . TRP C 1 277 ? 34.872  109.879 133.832 1.00 20.80 ? 276 TRP C CA  1 
ATOM   11073 C C   . TRP C 1 277 ? 36.313  110.304 133.584 1.00 22.64 ? 276 TRP C C   1 
ATOM   11074 O O   . TRP C 1 277 ? 36.810  110.188 132.462 1.00 20.47 ? 276 TRP C O   1 
ATOM   11075 C CB  . TRP C 1 277 ? 33.949  110.805 133.043 1.00 20.07 ? 276 TRP C CB  1 
ATOM   11076 C CG  . TRP C 1 277 ? 32.533  110.738 133.486 1.00 19.61 ? 276 TRP C CG  1 
ATOM   11077 C CD1 . TRP C 1 277 ? 31.915  111.556 134.390 1.00 19.07 ? 276 TRP C CD1 1 
ATOM   11078 C CD2 . TRP C 1 277 ? 31.557  109.778 133.076 1.00 19.59 ? 276 TRP C CD2 1 
ATOM   11079 N NE1 . TRP C 1 277 ? 30.610  111.162 134.568 1.00 19.47 ? 276 TRP C NE1 1 
ATOM   11080 C CE2 . TRP C 1 277 ? 30.364  110.072 133.775 1.00 19.50 ? 276 TRP C CE2 1 
ATOM   11081 C CE3 . TRP C 1 277 ? 31.574  108.695 132.185 1.00 19.49 ? 276 TRP C CE3 1 
ATOM   11082 C CZ2 . TRP C 1 277 ? 29.195  109.322 133.610 1.00 19.41 ? 276 TRP C CZ2 1 
ATOM   11083 C CZ3 . TRP C 1 277 ? 30.410  107.947 132.021 1.00 20.32 ? 276 TRP C CZ3 1 
ATOM   11084 C CH2 . TRP C 1 277 ? 29.236  108.266 132.733 1.00 20.34 ? 276 TRP C CH2 1 
ATOM   11085 N N   . SER C 1 278 ? 36.979  110.790 134.631 1.00 23.19 ? 277 SER C N   1 
ATOM   11086 C CA  . SER C 1 278 ? 38.363  111.254 134.529 1.00 23.19 ? 277 SER C CA  1 
ATOM   11087 C C   . SER C 1 278 ? 39.361  110.238 135.078 1.00 23.36 ? 277 SER C C   1 
ATOM   11088 O O   . SER C 1 278 ? 39.104  109.033 135.099 1.00 22.47 ? 277 SER C O   1 
ATOM   11089 C CB  . SER C 1 278 ? 38.529  112.560 135.304 1.00 23.29 ? 277 SER C CB  1 
ATOM   11090 O OG  . SER C 1 278 ? 38.426  112.317 136.702 1.00 26.12 ? 277 SER C OG  1 
ATOM   11091 N N   . ALA C 1 279 ? 40.510  110.745 135.517 1.00 23.34 ? 278 ALA C N   1 
ATOM   11092 C CA  . ALA C 1 279 ? 41.552  109.909 136.099 1.00 23.66 ? 278 ALA C CA  1 
ATOM   11093 C C   . ALA C 1 279 ? 40.988  109.181 137.321 1.00 23.33 ? 278 ALA C C   1 
ATOM   11094 O O   . ALA C 1 279 ? 41.454  108.100 137.691 1.00 23.58 ? 278 ALA C O   1 
ATOM   11095 C CB  . ALA C 1 279 ? 42.736  110.770 136.508 1.00 23.04 ? 278 ALA C CB  1 
ATOM   11096 N N   . ILE C 1 280 ? 39.980  109.786 137.940 1.00 23.57 ? 279 ILE C N   1 
ATOM   11097 C CA  . ILE C 1 280 ? 39.341  109.208 139.118 1.00 23.02 ? 279 ILE C CA  1 
ATOM   11098 C C   . ILE C 1 280 ? 38.800  107.815 138.814 1.00 22.86 ? 279 ILE C C   1 
ATOM   11099 O O   . ILE C 1 280 ? 38.631  106.996 139.715 1.00 23.29 ? 279 ILE C O   1 
ATOM   11100 C CB  . ILE C 1 280 ? 38.187  110.111 139.615 1.00 22.94 ? 279 ILE C CB  1 
ATOM   11101 C CG1 . ILE C 1 280 ? 38.760  111.425 140.151 1.00 23.34 ? 279 ILE C CG1 1 
ATOM   11102 C CG2 . ILE C 1 280 ? 37.364  109.396 140.692 1.00 23.01 ? 279 ILE C CG2 1 
ATOM   11103 C CD1 . ILE C 1 280 ? 39.773  111.241 141.277 1.00 23.30 ? 279 ILE C CD1 1 
ATOM   11104 N N   . GLY C 1 281 ? 38.538  107.548 137.540 1.00 22.52 ? 280 GLY C N   1 
ATOM   11105 C CA  . GLY C 1 281 ? 38.016  106.249 137.165 1.00 22.01 ? 280 GLY C CA  1 
ATOM   11106 C C   . GLY C 1 281 ? 39.074  105.206 136.862 1.00 22.45 ? 280 GLY C C   1 
ATOM   11107 O O   . GLY C 1 281 ? 38.751  104.158 136.306 1.00 21.91 ? 280 GLY C O   1 
ATOM   11108 N N   . LEU C 1 282 ? 40.329  105.478 137.226 1.00 22.03 ? 281 LEU C N   1 
ATOM   11109 C CA  . LEU C 1 282 ? 41.419  104.538 136.957 1.00 20.58 ? 281 LEU C CA  1 
ATOM   11110 C C   . LEU C 1 282 ? 41.131  103.121 137.464 1.00 21.52 ? 281 LEU C C   1 
ATOM   11111 O O   . LEU C 1 282 ? 41.391  102.144 136.758 1.00 21.50 ? 281 LEU C O   1 
ATOM   11112 C CB  . LEU C 1 282 ? 42.731  105.035 137.580 1.00 20.95 ? 281 LEU C CB  1 
ATOM   11113 C CG  . LEU C 1 282 ? 43.960  104.187 137.226 1.00 22.63 ? 281 LEU C CG  1 
ATOM   11114 C CD1 . LEU C 1 282 ? 44.207  104.270 135.721 1.00 21.55 ? 281 LEU C CD1 1 
ATOM   11115 C CD2 . LEU C 1 282 ? 45.180  104.667 137.993 1.00 20.04 ? 281 LEU C CD2 1 
ATOM   11116 N N   . SER C 1 283 ? 40.607  103.005 138.683 1.00 21.40 ? 282 SER C N   1 
ATOM   11117 C CA  . SER C 1 283 ? 40.299  101.689 139.238 1.00 22.94 ? 282 SER C CA  1 
ATOM   11118 C C   . SER C 1 283 ? 39.263  100.981 138.355 1.00 23.62 ? 282 SER C C   1 
ATOM   11119 O O   . SER C 1 283 ? 39.246  99.746  138.260 1.00 23.27 ? 282 SER C O   1 
ATOM   11120 C CB  . SER C 1 283 ? 39.793  101.809 140.690 1.00 23.33 ? 282 SER C CB  1 
ATOM   11121 O OG  . SER C 1 283 ? 38.551  102.491 140.784 1.00 23.07 ? 282 SER C OG  1 
ATOM   11122 N N   . ILE C 1 284 ? 38.404  101.763 137.702 1.00 22.28 ? 283 ILE C N   1 
ATOM   11123 C CA  . ILE C 1 284 ? 37.401  101.190 136.807 1.00 21.52 ? 283 ILE C CA  1 
ATOM   11124 C C   . ILE C 1 284 ? 38.114  100.582 135.594 1.00 22.47 ? 283 ILE C C   1 
ATOM   11125 O O   . ILE C 1 284 ? 37.883  99.421  135.233 1.00 21.73 ? 283 ILE C O   1 
ATOM   11126 C CB  . ILE C 1 284 ? 36.394  102.261 136.307 1.00 21.82 ? 283 ILE C CB  1 
ATOM   11127 C CG1 . ILE C 1 284 ? 35.544  102.767 137.476 1.00 22.40 ? 283 ILE C CG1 1 
ATOM   11128 C CG2 . ILE C 1 284 ? 35.507  101.675 135.212 1.00 18.39 ? 283 ILE C CG2 1 
ATOM   11129 C CD1 . ILE C 1 284 ? 34.577  103.872 137.101 1.00 25.23 ? 283 ILE C CD1 1 
ATOM   11130 N N   . ALA C 1 285 ? 38.986  101.373 134.977 1.00 21.29 ? 284 ALA C N   1 
ATOM   11131 C CA  . ALA C 1 285 ? 39.748  100.925 133.813 1.00 21.07 ? 284 ALA C CA  1 
ATOM   11132 C C   . ALA C 1 285 ? 40.648  99.739  134.155 1.00 21.55 ? 284 ALA C C   1 
ATOM   11133 O O   . ALA C 1 285 ? 40.842  98.839  133.334 1.00 20.30 ? 284 ALA C O   1 
ATOM   11134 C CB  . ALA C 1 285 ? 40.589  102.079 133.265 1.00 20.89 ? 284 ALA C CB  1 
ATOM   11135 N N   . LEU C 1 286 ? 41.201  99.747  135.366 1.00 22.59 ? 285 LEU C N   1 
ATOM   11136 C CA  . LEU C 1 286 ? 42.080  98.673  135.821 1.00 22.19 ? 285 LEU C CA  1 
ATOM   11137 C C   . LEU C 1 286 ? 41.322  97.370  136.046 1.00 23.35 ? 285 LEU C C   1 
ATOM   11138 O O   . LEU C 1 286 ? 41.834  96.281  135.773 1.00 22.57 ? 285 LEU C O   1 
ATOM   11139 C CB  . LEU C 1 286 ? 42.773  99.079  137.127 1.00 22.69 ? 285 LEU C CB  1 
ATOM   11140 C CG  . LEU C 1 286 ? 43.964  100.039 137.031 1.00 22.64 ? 285 LEU C CG  1 
ATOM   11141 C CD1 . LEU C 1 286 ? 44.326  100.570 138.411 1.00 20.84 ? 285 LEU C CD1 1 
ATOM   11142 C CD2 . LEU C 1 286 ? 45.149  99.311  136.401 1.00 21.10 ? 285 LEU C CD2 1 
ATOM   11143 N N   . HIS C 1 287 ? 40.091  97.492  136.533 1.00 24.50 ? 286 HIS C N   1 
ATOM   11144 C CA  . HIS C 1 287 ? 39.259  96.335  136.834 1.00 23.26 ? 286 HIS C CA  1 
ATOM   11145 C C   . HIS C 1 287 ? 38.615  95.666  135.622 1.00 23.32 ? 286 HIS C C   1 
ATOM   11146 O O   . HIS C 1 287 ? 38.650  94.441  135.488 1.00 24.80 ? 286 HIS C O   1 
ATOM   11147 C CB  . HIS C 1 287 ? 38.163  96.735  137.828 1.00 24.67 ? 286 HIS C CB  1 
ATOM   11148 C CG  . HIS C 1 287 ? 37.557  95.574  138.552 1.00 25.15 ? 286 HIS C CG  1 
ATOM   11149 N ND1 . HIS C 1 287 ? 36.199  95.440  138.745 1.00 26.96 ? 286 HIS C ND1 1 
ATOM   11150 C CD2 . HIS C 1 287 ? 38.130  94.506  139.155 1.00 23.77 ? 286 HIS C CD2 1 
ATOM   11151 C CE1 . HIS C 1 287 ? 35.962  94.340  139.439 1.00 27.06 ? 286 HIS C CE1 1 
ATOM   11152 N NE2 . HIS C 1 287 ? 37.118  93.756  139.701 1.00 26.27 ? 286 HIS C NE2 1 
ATOM   11153 N N   . VAL C 1 288 ? 38.014  96.461  134.745 1.00 23.50 ? 287 VAL C N   1 
ATOM   11154 C CA  . VAL C 1 288 ? 37.352  95.905  133.574 1.00 22.91 ? 287 VAL C CA  1 
ATOM   11155 C C   . VAL C 1 288 ? 38.108  96.163  132.277 1.00 24.56 ? 287 VAL C C   1 
ATOM   11156 O O   . VAL C 1 288 ? 37.616  95.839  131.196 1.00 24.27 ? 287 VAL C O   1 
ATOM   11157 C CB  . VAL C 1 288 ? 35.905  96.456  133.430 1.00 22.34 ? 287 VAL C CB  1 
ATOM   11158 C CG1 . VAL C 1 288 ? 35.089  96.099  134.667 1.00 23.94 ? 287 VAL C CG1 1 
ATOM   11159 C CG2 . VAL C 1 288 ? 35.931  97.966  133.231 1.00 19.49 ? 287 VAL C CG2 1 
ATOM   11160 N N   . GLY C 1 289 ? 39.303  96.735  132.383 1.00 24.88 ? 288 GLY C N   1 
ATOM   11161 C CA  . GLY C 1 289 ? 40.085  97.011  131.190 1.00 26.10 ? 288 GLY C CA  1 
ATOM   11162 C C   . GLY C 1 289 ? 39.774  98.385  130.635 1.00 27.73 ? 288 GLY C C   1 
ATOM   11163 O O   . GLY C 1 289 ? 38.665  98.895  130.808 1.00 27.20 ? 288 GLY C O   1 
ATOM   11164 N N   . PHE C 1 290 ? 40.749  98.982  129.958 1.00 27.61 ? 289 PHE C N   1 
ATOM   11165 C CA  . PHE C 1 290 ? 40.586  100.311 129.389 1.00 27.10 ? 289 PHE C CA  1 
ATOM   11166 C C   . PHE C 1 290 ? 39.607  100.354 128.213 1.00 26.40 ? 289 PHE C C   1 
ATOM   11167 O O   . PHE C 1 290 ? 38.998  101.390 127.957 1.00 25.26 ? 289 PHE C O   1 
ATOM   11168 C CB  . PHE C 1 290 ? 41.940  100.861 128.943 1.00 27.39 ? 289 PHE C CB  1 
ATOM   11169 C CG  . PHE C 1 290 ? 41.929  102.334 128.668 1.00 24.60 ? 289 PHE C CG  1 
ATOM   11170 C CD1 . PHE C 1 290 ? 41.971  103.248 129.713 1.00 27.95 ? 289 PHE C CD1 1 
ATOM   11171 C CD2 . PHE C 1 290 ? 41.867  102.810 127.366 1.00 26.63 ? 289 PHE C CD2 1 
ATOM   11172 C CE1 . PHE C 1 290 ? 41.953  104.623 129.464 1.00 27.04 ? 289 PHE C CE1 1 
ATOM   11173 C CE2 . PHE C 1 290 ? 41.847  104.182 127.107 1.00 27.64 ? 289 PHE C CE2 1 
ATOM   11174 C CZ  . PHE C 1 290 ? 41.891  105.086 128.159 1.00 27.60 ? 289 PHE C CZ  1 
ATOM   11175 N N   . ASP C 1 291 ? 39.462  99.246  127.492 1.00 26.95 ? 290 ASP C N   1 
ATOM   11176 C CA  . ASP C 1 291 ? 38.533  99.206  126.364 1.00 28.53 ? 290 ASP C CA  1 
ATOM   11177 C C   . ASP C 1 291 ? 37.107  99.403  126.862 1.00 26.21 ? 290 ASP C C   1 
ATOM   11178 O O   . ASP C 1 291 ? 36.320  100.135 126.259 1.00 25.85 ? 290 ASP C O   1 
ATOM   11179 C CB  . ASP C 1 291 ? 38.619  97.872  125.619 1.00 33.36 ? 290 ASP C CB  1 
ATOM   11180 C CG  . ASP C 1 291 ? 39.899  97.729  124.824 1.00 39.67 ? 290 ASP C CG  1 
ATOM   11181 O OD1 . ASP C 1 291 ? 40.424  98.759  124.349 1.00 43.75 ? 290 ASP C OD1 1 
ATOM   11182 O OD2 . ASP C 1 291 ? 40.370  96.584  124.658 1.00 44.44 ? 290 ASP C OD2 1 
ATOM   11183 N N   . ASN C 1 292 ? 36.778  98.738  127.962 1.00 23.64 ? 291 ASN C N   1 
ATOM   11184 C CA  . ASN C 1 292 ? 35.452  98.856  128.539 1.00 23.28 ? 291 ASN C CA  1 
ATOM   11185 C C   . ASN C 1 292 ? 35.253  100.256 129.111 1.00 22.52 ? 291 ASN C C   1 
ATOM   11186 O O   . ASN C 1 292 ? 34.153  100.801 129.055 1.00 22.01 ? 291 ASN C O   1 
ATOM   11187 C CB  . ASN C 1 292 ? 35.241  97.789  129.617 1.00 23.00 ? 291 ASN C CB  1 
ATOM   11188 C CG  . ASN C 1 292 ? 34.899  96.428  129.026 1.00 23.53 ? 291 ASN C CG  1 
ATOM   11189 O OD1 . ASN C 1 292 ? 34.128  96.336  128.068 1.00 23.10 ? 291 ASN C OD1 1 
ATOM   11190 N ND2 . ASN C 1 292 ? 35.456  95.367  129.602 1.00 20.32 ? 291 ASN C ND2 1 
ATOM   11191 N N   . PHE C 1 293 ? 36.325  100.845 129.635 1.00 22.59 ? 292 PHE C N   1 
ATOM   11192 C CA  . PHE C 1 293 ? 36.257  102.191 130.191 1.00 23.54 ? 292 PHE C CA  1 
ATOM   11193 C C   . PHE C 1 293 ? 35.878  103.152 129.066 1.00 23.31 ? 292 PHE C C   1 
ATOM   11194 O O   . PHE C 1 293 ? 35.078  104.070 129.260 1.00 24.84 ? 292 PHE C O   1 
ATOM   11195 C CB  . PHE C 1 293 ? 37.613  102.592 130.790 1.00 22.78 ? 292 PHE C CB  1 
ATOM   11196 C CG  . PHE C 1 293 ? 37.609  103.939 131.476 1.00 22.95 ? 292 PHE C CG  1 
ATOM   11197 C CD1 . PHE C 1 293 ? 36.858  104.148 132.630 1.00 24.03 ? 292 PHE C CD1 1 
ATOM   11198 C CD2 . PHE C 1 293 ? 38.353  104.998 130.965 1.00 23.60 ? 292 PHE C CD2 1 
ATOM   11199 C CE1 . PHE C 1 293 ? 36.846  105.390 133.264 1.00 23.64 ? 292 PHE C CE1 1 
ATOM   11200 C CE2 . PHE C 1 293 ? 38.348  106.242 131.591 1.00 23.47 ? 292 PHE C CE2 1 
ATOM   11201 C CZ  . PHE C 1 293 ? 37.591  106.438 132.745 1.00 24.21 ? 292 PHE C CZ  1 
ATOM   11202 N N   . GLU C 1 294 ? 36.461  102.935 127.890 1.00 22.98 ? 293 GLU C N   1 
ATOM   11203 C CA  . GLU C 1 294 ? 36.172  103.777 126.738 1.00 23.16 ? 293 GLU C CA  1 
ATOM   11204 C C   . GLU C 1 294 ? 34.717  103.628 126.317 1.00 22.40 ? 293 GLU C C   1 
ATOM   11205 O O   . GLU C 1 294 ? 34.075  104.606 125.932 1.00 22.18 ? 293 GLU C O   1 
ATOM   11206 C CB  . GLU C 1 294 ? 37.098  103.432 125.573 1.00 23.70 ? 293 GLU C CB  1 
ATOM   11207 C CG  . GLU C 1 294 ? 38.534  103.884 125.797 1.00 27.74 ? 293 GLU C CG  1 
ATOM   11208 C CD  . GLU C 1 294 ? 39.385  103.762 124.548 1.00 30.20 ? 293 GLU C CD  1 
ATOM   11209 O OE1 . GLU C 1 294 ? 39.402  102.661 123.954 1.00 31.34 ? 293 GLU C OE1 1 
ATOM   11210 O OE2 . GLU C 1 294 ? 40.033  104.764 124.162 1.00 30.24 ? 293 GLU C OE2 1 
ATOM   11211 N N   . GLN C 1 295 ? 34.199  102.406 126.381 1.00 20.30 ? 294 GLN C N   1 
ATOM   11212 C CA  . GLN C 1 295 ? 32.807  102.178 126.040 1.00 20.93 ? 294 GLN C CA  1 
ATOM   11213 C C   . GLN C 1 295 ? 31.939  102.967 127.019 1.00 20.48 ? 294 GLN C C   1 
ATOM   11214 O O   . GLN C 1 295 ? 30.943  103.568 126.622 1.00 19.23 ? 294 GLN C O   1 
ATOM   11215 C CB  . GLN C 1 295 ? 32.462  100.691 126.131 1.00 24.74 ? 294 GLN C CB  1 
ATOM   11216 C CG  . GLN C 1 295 ? 33.115  99.825  125.068 1.00 30.64 ? 294 GLN C CG  1 
ATOM   11217 C CD  . GLN C 1 295 ? 32.687  100.182 123.654 1.00 36.65 ? 294 GLN C CD  1 
ATOM   11218