data_1JPL
# 
_entry.id   1JPL 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1JPL         
RCSB  RCSB014038   
WWPDB D_1000014038 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1ELK 'VHS domain of Tom1 (Target-of-Myb1)'                                                                  unspecified 
PDB 1DVP 'VHS and FYVE domains of Hrs'                                                                          unspecified 
PDB 1juq 'GGA3 VHS DOMAIN COMPLEXED WITH C-TERMINAL PEPTIDE FROM CATION-DEPENDENT MANNOSE 6-PHOSPHATE RECEPTOR' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1JPL 
_pdbx_database_status.recvd_initial_deposition_date   2001-08-02 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Misra, S.'        1 
'Puertollano, R.'  2 
'Bonifacino, J.S.' 3 
'Hurley, J.H.'     4 
# 
_citation.id                        primary 
_citation.title                     'Structural basis for acidic-cluster-dileucine sorting-signal recognition by VHS domains.' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            415 
_citation.page_first                933 
_citation.page_last                 937 
_citation.year                      2002 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11859375 
_citation.pdbx_database_id_DOI      10.1038/415933a 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Misra, S.'        1 
primary 'Puertollano, R.'  2 
primary 'Kato, Y.'         3 
primary 'Bonifacino, J.S.' 4 
primary 'Hurley, J.H.'     5 
# 
_cell.entry_id           1JPL 
_cell.length_a           108.300 
_cell.length_b           125.300 
_cell.length_c           64.600 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1JPL 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'ADP-RIBOSYLATION FACTOR BINDING PROTEIN GGA3'    19716.924 4   ? ? 'VHS domain'         ? 
2 polymer syn 'Cation-Independent Mannose 6-phosphate receptor' 1457.499  4   ? ? 'C-terminal peptide' ? 
3 water   nat water                                             18.015    237 ? ? ?                    ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no yes 
;GA(MSE)GS(MSE)AEAEGESLESWLNKATNPSNRQEDWEYIIGFCDQINKELEGPQIAVRLLAHKIQSPQEWEALQALT
VLEAC(MSE)KNCGRRFHNEVGKFRFLNELIKVVSPKYLGDRVSEKVKTKVIELLYSWT(MSE)ALPEEAKIKDAYH
(MSE)LKRQGIVQSDPPIPVDRTLIPSPPPRPKN
;
;GAMGSMAEAEGESLESWLNKATNPSNRQEDWEYIIGFCDQINKELEGPQIAVRLLAHKIQSPQEWEALQALTVLEACMKN
CGRRFHNEVGKFRFLNELIKVVSPKYLGDRVSEKVKTKVIELLYSWTMALPEEAKIKDAYHMLKRQGIVQSDPPIPVDRT
LIPSPPPRPKN
;
A,B,C,D ? 
2 'polypeptide(L)' no no  FHDDSDEDLLHI FHDDSDEDLLHI E,F,G,H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ALA n 
1 3   MSE n 
1 4   GLY n 
1 5   SER n 
1 6   MSE n 
1 7   ALA n 
1 8   GLU n 
1 9   ALA n 
1 10  GLU n 
1 11  GLY n 
1 12  GLU n 
1 13  SER n 
1 14  LEU n 
1 15  GLU n 
1 16  SER n 
1 17  TRP n 
1 18  LEU n 
1 19  ASN n 
1 20  LYS n 
1 21  ALA n 
1 22  THR n 
1 23  ASN n 
1 24  PRO n 
1 25  SER n 
1 26  ASN n 
1 27  ARG n 
1 28  GLN n 
1 29  GLU n 
1 30  ASP n 
1 31  TRP n 
1 32  GLU n 
1 33  TYR n 
1 34  ILE n 
1 35  ILE n 
1 36  GLY n 
1 37  PHE n 
1 38  CYS n 
1 39  ASP n 
1 40  GLN n 
1 41  ILE n 
1 42  ASN n 
1 43  LYS n 
1 44  GLU n 
1 45  LEU n 
1 46  GLU n 
1 47  GLY n 
1 48  PRO n 
1 49  GLN n 
1 50  ILE n 
1 51  ALA n 
1 52  VAL n 
1 53  ARG n 
1 54  LEU n 
1 55  LEU n 
1 56  ALA n 
1 57  HIS n 
1 58  LYS n 
1 59  ILE n 
1 60  GLN n 
1 61  SER n 
1 62  PRO n 
1 63  GLN n 
1 64  GLU n 
1 65  TRP n 
1 66  GLU n 
1 67  ALA n 
1 68  LEU n 
1 69  GLN n 
1 70  ALA n 
1 71  LEU n 
1 72  THR n 
1 73  VAL n 
1 74  LEU n 
1 75  GLU n 
1 76  ALA n 
1 77  CYS n 
1 78  MSE n 
1 79  LYS n 
1 80  ASN n 
1 81  CYS n 
1 82  GLY n 
1 83  ARG n 
1 84  ARG n 
1 85  PHE n 
1 86  HIS n 
1 87  ASN n 
1 88  GLU n 
1 89  VAL n 
1 90  GLY n 
1 91  LYS n 
1 92  PHE n 
1 93  ARG n 
1 94  PHE n 
1 95  LEU n 
1 96  ASN n 
1 97  GLU n 
1 98  LEU n 
1 99  ILE n 
1 100 LYS n 
1 101 VAL n 
1 102 VAL n 
1 103 SER n 
1 104 PRO n 
1 105 LYS n 
1 106 TYR n 
1 107 LEU n 
1 108 GLY n 
1 109 ASP n 
1 110 ARG n 
1 111 VAL n 
1 112 SER n 
1 113 GLU n 
1 114 LYS n 
1 115 VAL n 
1 116 LYS n 
1 117 THR n 
1 118 LYS n 
1 119 VAL n 
1 120 ILE n 
1 121 GLU n 
1 122 LEU n 
1 123 LEU n 
1 124 TYR n 
1 125 SER n 
1 126 TRP n 
1 127 THR n 
1 128 MSE n 
1 129 ALA n 
1 130 LEU n 
1 131 PRO n 
1 132 GLU n 
1 133 GLU n 
1 134 ALA n 
1 135 LYS n 
1 136 ILE n 
1 137 LYS n 
1 138 ASP n 
1 139 ALA n 
1 140 TYR n 
1 141 HIS n 
1 142 MSE n 
1 143 LEU n 
1 144 LYS n 
1 145 ARG n 
1 146 GLN n 
1 147 GLY n 
1 148 ILE n 
1 149 VAL n 
1 150 GLN n 
1 151 SER n 
1 152 ASP n 
1 153 PRO n 
1 154 PRO n 
1 155 ILE n 
1 156 PRO n 
1 157 VAL n 
1 158 ASP n 
1 159 ARG n 
1 160 THR n 
1 161 LEU n 
1 162 ILE n 
1 163 PRO n 
1 164 SER n 
1 165 PRO n 
1 166 PRO n 
1 167 PRO n 
1 168 ARG n 
1 169 PRO n 
1 170 LYS n 
1 171 ASN n 
2 1   PHE n 
2 2   HIS n 
2 3   ASP n 
2 4   ASP n 
2 5   SER n 
2 6   ASP n 
2 7   GLU n 
2 8   ASP n 
2 9   LEU n 
2 10  LEU n 
2 11  HIS n 
2 12  ILE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 GGA3 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pHis-parallel2 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'The peptide was chemically synthesized.' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP GGA3_HUMAN 1 
;MAEAEGESLESWLNKATNPSNRQEDWEYIIGFCDQINKELEGPQIAVRLLAHKIQSPQEWEALQALTVLEACMKNCGRRF
HNEVGKFRFLNELIKVVSPKYLGDRVSEKVKTKVIELLYSWTMALPEEAKIKDAYHMLKRQGIVQSDPPIPVDRTLIPSP
PPRPKN
;
1    Q9NZ52 ? 
2 UNP MPRI_HUMAN 2 FHDDSDEDLLHI 2480 P11717 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1JPL A 6 ? 171 ? Q9NZ52 1    ? 166  ? 1   166 
2 1 1JPL B 6 ? 171 ? Q9NZ52 1    ? 166  ? 1   166 
3 1 1JPL C 6 ? 171 ? Q9NZ52 1    ? 166  ? 1   166 
4 1 1JPL D 6 ? 171 ? Q9NZ52 1    ? 166  ? 1   166 
5 2 1JPL E 1 ? 12  ? P11717 2480 ? 2491 ? 301 312 
6 2 1JPL F 1 ? 12  ? P11717 2480 ? 2491 ? 301 312 
7 2 1JPL G 1 ? 12  ? P11717 2480 ? 2491 ? 301 312 
8 2 1JPL H 1 ? 12  ? P11717 2480 ? 2491 ? 301 312 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1JPL GLY A 1   ? UNP Q9NZ52 ?   ?   'CLONING ARTIFACT' 201 1  
1 1JPL ALA A 2   ? UNP Q9NZ52 ?   ?   'CLONING ARTIFACT' 202 2  
1 1JPL MSE A 3   ? UNP Q9NZ52 ?   ?   'CLONING ARTIFACT' 203 3  
1 1JPL GLY A 4   ? UNP Q9NZ52 ?   ?   'CLONING ARTIFACT' 204 4  
1 1JPL SER A 5   ? UNP Q9NZ52 ?   ?   'CLONING ARTIFACT' 205 5  
1 1JPL MSE A 6   ? UNP Q9NZ52 MET 1   'MODIFIED RESIDUE' 1   6  
1 1JPL MSE A 78  ? UNP Q9NZ52 MET 73  'MODIFIED RESIDUE' 73  7  
1 1JPL MSE A 128 ? UNP Q9NZ52 MET 123 'MODIFIED RESIDUE' 123 8  
1 1JPL MSE A 142 ? UNP Q9NZ52 MET 137 'MODIFIED RESIDUE' 137 9  
2 1JPL GLY B 1   ? UNP Q9NZ52 ?   ?   'CLONING ARTIFACT' 201 10 
2 1JPL ALA B 2   ? UNP Q9NZ52 ?   ?   'CLONING ARTIFACT' 202 11 
2 1JPL MSE B 3   ? UNP Q9NZ52 ?   ?   'CLONING ARTIFACT' 203 12 
2 1JPL GLY B 4   ? UNP Q9NZ52 ?   ?   'CLONING ARTIFACT' 204 13 
2 1JPL SER B 5   ? UNP Q9NZ52 ?   ?   'CLONING ARTIFACT' 205 14 
2 1JPL MSE B 6   ? UNP Q9NZ52 MET 1   'MODIFIED RESIDUE' 1   15 
2 1JPL MSE B 78  ? UNP Q9NZ52 MET 73  'MODIFIED RESIDUE' 73  16 
2 1JPL MSE B 128 ? UNP Q9NZ52 MET 123 'MODIFIED RESIDUE' 123 17 
2 1JPL MSE B 142 ? UNP Q9NZ52 MET 137 'MODIFIED RESIDUE' 137 18 
3 1JPL GLY C 1   ? UNP Q9NZ52 ?   ?   'CLONING ARTIFACT' 201 19 
3 1JPL ALA C 2   ? UNP Q9NZ52 ?   ?   'CLONING ARTIFACT' 202 20 
3 1JPL MSE C 3   ? UNP Q9NZ52 ?   ?   'CLONING ARTIFACT' 203 21 
3 1JPL GLY C 4   ? UNP Q9NZ52 ?   ?   'CLONING ARTIFACT' 204 22 
3 1JPL SER C 5   ? UNP Q9NZ52 ?   ?   'CLONING ARTIFACT' 205 23 
3 1JPL MSE C 6   ? UNP Q9NZ52 MET 1   'MODIFIED RESIDUE' 1   24 
3 1JPL MSE C 78  ? UNP Q9NZ52 MET 73  'MODIFIED RESIDUE' 73  25 
3 1JPL MSE C 128 ? UNP Q9NZ52 MET 123 'MODIFIED RESIDUE' 123 26 
3 1JPL MSE C 142 ? UNP Q9NZ52 MET 137 'MODIFIED RESIDUE' 137 27 
4 1JPL GLY D 1   ? UNP Q9NZ52 ?   ?   'CLONING ARTIFACT' 201 28 
4 1JPL ALA D 2   ? UNP Q9NZ52 ?   ?   'CLONING ARTIFACT' 202 29 
4 1JPL MSE D 3   ? UNP Q9NZ52 ?   ?   'CLONING ARTIFACT' 203 30 
4 1JPL GLY D 4   ? UNP Q9NZ52 ?   ?   'CLONING ARTIFACT' 204 31 
4 1JPL SER D 5   ? UNP Q9NZ52 ?   ?   'CLONING ARTIFACT' 205 32 
4 1JPL MSE D 6   ? UNP Q9NZ52 MET 1   'MODIFIED RESIDUE' 1   33 
4 1JPL MSE D 78  ? UNP Q9NZ52 MET 73  'MODIFIED RESIDUE' 73  34 
4 1JPL MSE D 128 ? UNP Q9NZ52 MET 123 'MODIFIED RESIDUE' 123 35 
4 1JPL MSE D 142 ? UNP Q9NZ52 MET 137 'MODIFIED RESIDUE' 137 36 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE          ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE         ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE       ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'  ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE         ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE        ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'  ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE          ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE        ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER            ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE       ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE          ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE           ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE       ? 'C5 H11 N O2 S'  149.211 
MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 
PHE 'L-peptide linking' y PHENYLALANINE    ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE          ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE           ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE        ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN       ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE         ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE           ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1JPL 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.59 
_exptl_crystal.density_percent_sol   52.43 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              10.6 
_exptl_crystal_grow.pdbx_details    
'1.5M Sodium/Potassium Phosphate, 200mM Lithium Sulfate, pH 10.6, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2001-06-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Focused Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             MAD 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 0.97900 1.0 
2 0.97938 1.0 
3 0.95369 1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X9B' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X9B 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        '0.97900, 0.97938, 0.95369' 
# 
_reflns.entry_id                     1JPL 
_reflns.observed_criterion_sigma_I   5 
_reflns.observed_criterion_sigma_F   5 
_reflns.d_resolution_low             99.0 
_reflns.d_resolution_high            2.4 
_reflns.number_obs                   34790 
_reflns.number_all                   34965 
_reflns.percent_possible_obs         99.5 
_reflns.pdbx_Rmerge_I_obs            0.0960000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        26.7 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              10.3 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.4 
_reflns_shell.d_res_low              2.49 
_reflns_shell.percent_possible_all   99.3 
_reflns_shell.Rmerge_I_obs           0.3030000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    6.7 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      3381 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1JPL 
_refine.ls_number_reflns_obs                     62036 
_refine.ls_number_reflns_all                     62036 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               253695.90 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.ls_d_res_low                             35.08 
_refine.ls_d_res_high                            2.40 
_refine.ls_percent_reflns_obs                    93.5 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2130000 
_refine.ls_R_factor_R_free                       0.2570000 
_refine.ls_R_factor_R_free_error                 0.003 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.0 
_refine.ls_number_reflns_R_free                  6184 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               38.6 
_refine.aniso_B[1][1]                            -8.29 
_refine.aniso_B[2][2]                            3.11 
_refine.aniso_B[3][3]                            5.18 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.371704 
_refine.solvent_model_param_bsol                 37.8533 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1JPL 
_refine_analyze.Luzzati_coordinate_error_obs    0.29 
_refine_analyze.Luzzati_sigma_a_obs             0.28 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.36 
_refine_analyze.Luzzati_sigma_a_free            0.34 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5418 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             237 
_refine_hist.number_atoms_total               5655 
_refine_hist.d_res_high                       2.40 
_refine_hist.d_res_low                        35.08 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.007 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.2   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 19.7  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.87  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        1.37  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       2.30  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        2.29  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       3.47  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.40 
_refine_ls_shell.d_res_low                        2.55 
_refine_ls_shell.number_reflns_R_work             8388 
_refine_ls_shell.R_factor_R_work                  0.2630000 
_refine_ls_shell.percent_reflns_obs               84.5 
_refine_ls_shell.R_factor_R_free                  0.3090000 
_refine_ls_shell.R_factor_R_free_error            0.010 
_refine_ls_shell.percent_reflns_R_free            9.8 
_refine_ls_shell.number_reflns_R_free             914 
_refine_ls_shell.number_reflns_obs                9302 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 WATER_REP.PARAM   WATER.TOP   'X-RAY DIFFRACTION' 
3 ION.PARAM         ION.TOP     'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1JPL 
_struct.title                     
'GGA3 VHS domain complexed with C-terminal peptide from cation-independent mannose 6-phosphate receptor' 
_struct.pdbx_descriptor           'ADP-RIBOSYLATION FACTOR BINDING PROTEIN GGA3/Cation-Independent Mannose 6-phosphate receptor' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1JPL 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            'Protein-peptide complex; VHS domain; DXXLL sorting signal, SIGNALING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 1 ? 
F N N 2 ? 
G N N 1 ? 
H N N 2 ? 
I N N 3 ? 
J N N 3 ? 
K N N 3 ? 
L N N 3 ? 
M N N 3 ? 
N N N 3 ? 
O N N 3 ? 
P N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  MSE A 3   ? ALA A 7   ? MSE A 203 ALA A 2   5 ? 5  
HELX_P HELX_P2  2  GLU A 8   ? ASN A 23  ? GLU A 3   ASN A 18  1 ? 16 
HELX_P HELX_P3  3  ASP A 30  ? GLU A 44  ? ASP A 25  GLU A 39  1 ? 15 
HELX_P HELX_P4  4  GLU A 46  ? GLN A 60  ? GLU A 41  GLN A 55  1 ? 15 
HELX_P HELX_P5  5  GLN A 63  ? CYS A 81  ? GLN A 58  CYS A 76  1 ? 19 
HELX_P HELX_P6  6  CYS A 81  ? GLY A 90  ? CYS A 76  GLY A 85  1 ? 10 
HELX_P HELX_P7  7  LYS A 91  ? SER A 103 ? LYS A 86  SER A 98  1 ? 13 
HELX_P HELX_P8  8  TYR A 106 ? VAL A 111 ? TYR A 101 VAL A 106 5 ? 6  
HELX_P HELX_P9  9  SER A 112 ? LEU A 130 ? SER A 107 LEU A 125 1 ? 19 
HELX_P HELX_P10 10 GLU A 133 ? GLN A 146 ? GLU A 128 GLN A 141 1 ? 14 
HELX_P HELX_P11 11 GLY C 4   ? ALA C 7   ? GLY B 204 ALA B 2   5 ? 4  
HELX_P HELX_P12 12 GLU C 8   ? THR C 22  ? GLU B 3   THR B 17  1 ? 15 
HELX_P HELX_P13 13 ASP C 30  ? GLU C 44  ? ASP B 25  GLU B 39  1 ? 15 
HELX_P HELX_P14 14 GLU C 46  ? GLN C 60  ? GLU B 41  GLN B 55  1 ? 15 
HELX_P HELX_P15 15 GLN C 63  ? CYS C 81  ? GLN B 58  CYS B 76  1 ? 19 
HELX_P HELX_P16 16 CYS C 81  ? GLY C 90  ? CYS B 76  GLY B 85  1 ? 10 
HELX_P HELX_P17 17 LYS C 91  ? SER C 103 ? LYS B 86  SER B 98  1 ? 13 
HELX_P HELX_P18 18 LEU C 107 ? VAL C 111 ? LEU B 102 VAL B 106 5 ? 5  
HELX_P HELX_P19 19 SER C 112 ? LEU C 130 ? SER B 107 LEU B 125 1 ? 19 
HELX_P HELX_P20 20 GLU C 133 ? GLN C 146 ? GLU B 128 GLN B 141 1 ? 14 
HELX_P HELX_P21 21 GLY E 4   ? ALA E 7   ? GLY C 204 ALA C 2   5 ? 4  
HELX_P HELX_P22 22 GLU E 8   ? THR E 22  ? GLU C 3   THR C 17  1 ? 15 
HELX_P HELX_P23 23 ASP E 30  ? GLU E 44  ? ASP C 25  GLU C 39  1 ? 15 
HELX_P HELX_P24 24 GLU E 46  ? GLN E 60  ? GLU C 41  GLN C 55  1 ? 15 
HELX_P HELX_P25 25 GLN E 63  ? CYS E 81  ? GLN C 58  CYS C 76  1 ? 19 
HELX_P HELX_P26 26 CYS E 81  ? GLY E 90  ? CYS C 76  GLY C 85  1 ? 10 
HELX_P HELX_P27 27 LYS E 91  ? SER E 103 ? LYS C 86  SER C 98  1 ? 13 
HELX_P HELX_P28 28 LEU E 107 ? VAL E 111 ? LEU C 102 VAL C 106 5 ? 5  
HELX_P HELX_P29 29 SER E 112 ? LEU E 130 ? SER C 107 LEU C 125 1 ? 19 
HELX_P HELX_P30 30 GLU E 133 ? GLN E 146 ? GLU C 128 GLN C 141 1 ? 14 
HELX_P HELX_P31 31 MSE G 3   ? ALA G 7   ? MSE D 203 ALA D 2   5 ? 5  
HELX_P HELX_P32 32 GLU G 8   ? THR G 22  ? GLU D 3   THR D 17  1 ? 15 
HELX_P HELX_P33 33 ASP G 30  ? GLU G 44  ? ASP D 25  GLU D 39  1 ? 15 
HELX_P HELX_P34 34 GLU G 46  ? GLN G 60  ? GLU D 41  GLN D 55  1 ? 15 
HELX_P HELX_P35 35 GLN G 63  ? CYS G 81  ? GLN D 58  CYS D 76  1 ? 19 
HELX_P HELX_P36 36 CYS G 81  ? GLY G 90  ? CYS D 76  GLY D 85  1 ? 10 
HELX_P HELX_P37 37 LYS G 91  ? SER G 103 ? LYS D 86  SER D 98  1 ? 13 
HELX_P HELX_P38 38 LEU G 107 ? VAL G 111 ? LEU D 102 VAL D 106 5 ? 5  
HELX_P HELX_P39 39 SER G 112 ? LEU G 130 ? SER D 107 LEU D 125 1 ? 19 
HELX_P HELX_P40 40 GLU G 133 ? GLN G 146 ? GLU D 128 GLN D 141 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? A MSE 6   N ? ? ? 1_555 A SER 5   C ? ? A MSE 1   A SER 205 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale2  covale ? ? A MSE 6   C ? ? ? 1_555 A ALA 7   N ? ? A MSE 1   A ALA 2   1_555 ? ? ? ? ? ? ? 1.331 ? 
covale3  covale ? ? A CYS 77  C ? ? ? 1_555 A MSE 78  N ? ? A CYS 72  A MSE 73  1_555 ? ? ? ? ? ? ? 1.325 ? 
covale4  covale ? ? A MSE 78  C ? ? ? 1_555 A LYS 79  N ? ? A MSE 73  A LYS 74  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale5  covale ? ? A THR 127 C ? ? ? 1_555 A MSE 128 N ? ? A THR 122 A MSE 123 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale6  covale ? ? A MSE 128 C ? ? ? 1_555 A ALA 129 N ? ? A MSE 123 A ALA 124 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale7  covale ? ? A HIS 141 C ? ? ? 1_555 A MSE 142 N ? ? A HIS 136 A MSE 137 1_555 ? ? ? ? ? ? ? 1.324 ? 
covale8  covale ? ? A MSE 142 C ? ? ? 1_555 A LEU 143 N ? ? A MSE 137 A LEU 138 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale9  covale ? ? A ALA 2   C ? ? ? 1_555 A MSE 3   N ? ? A ALA 202 A MSE 203 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale10 covale ? ? A MSE 3   C ? ? ? 1_555 A GLY 4   N ? ? A MSE 203 A GLY 204 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale11 covale ? ? C MSE 6   N ? ? ? 1_555 C SER 5   C ? ? B MSE 1   B SER 205 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale12 covale ? ? C MSE 6   C ? ? ? 1_555 C ALA 7   N ? ? B MSE 1   B ALA 2   1_555 ? ? ? ? ? ? ? 1.327 ? 
covale13 covale ? ? C CYS 77  C ? ? ? 1_555 C MSE 78  N ? ? B CYS 72  B MSE 73  1_555 ? ? ? ? ? ? ? 1.327 ? 
covale14 covale ? ? C MSE 78  C ? ? ? 1_555 C LYS 79  N ? ? B MSE 73  B LYS 74  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale15 covale ? ? C THR 127 C ? ? ? 1_555 C MSE 128 N ? ? B THR 122 B MSE 123 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale16 covale ? ? C MSE 128 C ? ? ? 1_555 C ALA 129 N ? ? B MSE 123 B ALA 124 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale17 covale ? ? C HIS 141 C ? ? ? 1_555 C MSE 142 N ? ? B HIS 136 B MSE 137 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale18 covale ? ? C MSE 142 C ? ? ? 1_555 C LEU 143 N ? ? B MSE 137 B LEU 138 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale19 covale ? ? C MSE 3   C ? ? ? 1_555 C GLY 4   N ? ? B MSE 203 B GLY 204 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale20 covale ? ? E MSE 6   N ? ? ? 1_555 E SER 5   C ? ? C MSE 1   C SER 205 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale21 covale ? ? E MSE 6   C ? ? ? 1_555 E ALA 7   N ? ? C MSE 1   C ALA 2   1_555 ? ? ? ? ? ? ? 1.329 ? 
covale22 covale ? ? E CYS 77  C ? ? ? 1_555 E MSE 78  N ? ? C CYS 72  C MSE 73  1_555 ? ? ? ? ? ? ? 1.333 ? 
covale23 covale ? ? E MSE 78  C ? ? ? 1_555 E LYS 79  N ? ? C MSE 73  C LYS 74  1_555 ? ? ? ? ? ? ? 1.331 ? 
covale24 covale ? ? E THR 127 C ? ? ? 1_555 E MSE 128 N ? ? C THR 122 C MSE 123 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale25 covale ? ? E MSE 128 C ? ? ? 1_555 E ALA 129 N ? ? C MSE 123 C ALA 124 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale26 covale ? ? E HIS 141 C ? ? ? 1_555 E MSE 142 N ? ? C HIS 136 C MSE 137 1_555 ? ? ? ? ? ? ? 1.322 ? 
covale27 covale ? ? E MSE 142 C ? ? ? 1_555 E LEU 143 N ? ? C MSE 137 C LEU 138 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale28 covale ? ? E MSE 3   C ? ? ? 1_555 E GLY 4   N ? ? C MSE 203 C GLY 204 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale29 covale ? ? G MSE 6   C ? ? ? 1_555 G ALA 7   N ? ? D MSE 1   D ALA 2   1_555 ? ? ? ? ? ? ? 1.327 ? 
covale30 covale ? ? G MSE 6   N ? ? ? 1_555 G SER 5   C ? ? D MSE 1   D SER 205 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale31 covale ? ? G CYS 77  C ? ? ? 1_555 G MSE 78  N ? ? D CYS 72  D MSE 73  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale32 covale ? ? G MSE 78  C ? ? ? 1_555 G LYS 79  N ? ? D MSE 73  D LYS 74  1_555 ? ? ? ? ? ? ? 1.331 ? 
covale33 covale ? ? G THR 127 C ? ? ? 1_555 G MSE 128 N ? ? D THR 122 D MSE 123 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale34 covale ? ? G MSE 128 C ? ? ? 1_555 G ALA 129 N ? ? D MSE 123 D ALA 124 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale35 covale ? ? G HIS 141 C ? ? ? 1_555 G MSE 142 N ? ? D HIS 136 D MSE 137 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale36 covale ? ? G MSE 142 C ? ? ? 1_555 G LEU 143 N ? ? D MSE 137 D LEU 138 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale37 covale ? ? G ALA 2   C ? ? ? 1_555 G MSE 3   N ? ? D ALA 202 D MSE 203 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale38 covale ? ? G MSE 3   C ? ? ? 1_555 G GLY 4   N ? ? D MSE 203 D GLY 204 1_555 ? ? ? ? ? ? ? 1.331 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_database_PDB_matrix.entry_id          1JPL 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1JPL 
_atom_sites.fract_transf_matrix[1][1]   0.009234 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007981 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.015480 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
SE 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ALA A 1 2   ? 71.113  45.267 32.454 1.00 77.66  ? 202 ALA A N   1 
ATOM   2    C  CA  . ALA A 1 2   ? 70.749  44.133 31.554 1.00 77.61  ? 202 ALA A CA  1 
ATOM   3    C  C   . ALA A 1 2   ? 69.231  43.980 31.457 1.00 77.36  ? 202 ALA A C   1 
ATOM   4    O  O   . ALA A 1 2   ? 68.617  44.396 30.471 1.00 76.46  ? 202 ALA A O   1 
ATOM   5    C  CB  . ALA A 1 2   ? 71.378  42.836 32.069 1.00 77.24  ? 202 ALA A CB  1 
HETATM 6    N  N   . MSE A 1 3   ? 68.634  43.384 32.487 1.00 77.52  ? 203 MSE A N   1 
HETATM 7    C  CA  . MSE A 1 3   ? 67.189  43.168 32.527 1.00 77.02  ? 203 MSE A CA  1 
HETATM 8    C  C   . MSE A 1 3   ? 66.517  44.085 33.550 1.00 73.35  ? 203 MSE A C   1 
HETATM 9    O  O   . MSE A 1 3   ? 65.296  44.047 33.731 1.00 73.03  ? 203 MSE A O   1 
HETATM 10   C  CB  . MSE A 1 3   ? 66.897  41.704 32.854 1.00 81.56  ? 203 MSE A CB  1 
HETATM 11   C  CG  . MSE A 1 3   ? 67.630  40.733 31.936 1.00 87.98  ? 203 MSE A CG  1 
HETATM 12   SE SE  . MSE A 1 3   ? 67.373  38.876 32.417 1.00 98.56  ? 203 MSE A SE  1 
HETATM 13   C  CE  . MSE A 1 3   ? 68.459  38.813 34.020 1.00 94.93  ? 203 MSE A CE  1 
ATOM   14   N  N   . GLY A 1 4   ? 67.329  44.904 34.216 1.00 69.01  ? 204 GLY A N   1 
ATOM   15   C  CA  . GLY A 1 4   ? 66.816  45.842 35.199 1.00 62.88  ? 204 GLY A CA  1 
ATOM   16   C  C   . GLY A 1 4   ? 66.611  45.275 36.587 1.00 58.46  ? 204 GLY A C   1 
ATOM   17   O  O   . GLY A 1 4   ? 67.277  44.321 36.989 1.00 57.38  ? 204 GLY A O   1 
ATOM   18   N  N   . SER A 1 5   ? 65.679  45.872 37.323 1.00 54.83  ? 205 SER A N   1 
ATOM   19   C  CA  . SER A 1 5   ? 65.378  45.431 38.678 1.00 51.09  ? 205 SER A CA  1 
ATOM   20   C  C   . SER A 1 5   ? 64.674  44.083 38.720 1.00 46.76  ? 205 SER A C   1 
ATOM   21   O  O   . SER A 1 5   ? 64.536  43.487 39.789 1.00 45.97  ? 205 SER A O   1 
ATOM   22   C  CB  . SER A 1 5   ? 64.526  46.476 39.399 1.00 52.50  ? 205 SER A CB  1 
ATOM   23   O  OG  . SER A 1 5   ? 65.316  47.587 39.783 1.00 54.25  ? 205 SER A OG  1 
HETATM 24   N  N   . MSE A 1 6   ? 64.226  43.608 37.564 1.00 43.08  ? 1   MSE A N   1 
HETATM 25   C  CA  . MSE A 1 6   ? 63.546  42.320 37.494 1.00 42.43  ? 1   MSE A CA  1 
HETATM 26   C  C   . MSE A 1 6   ? 64.510  41.243 37.990 1.00 42.56  ? 1   MSE A C   1 
HETATM 27   O  O   . MSE A 1 6   ? 64.140  40.365 38.780 1.00 41.15  ? 1   MSE A O   1 
HETATM 28   C  CB  . MSE A 1 6   ? 63.108  42.022 36.053 1.00 38.83  ? 1   MSE A CB  1 
HETATM 29   C  CG  . MSE A 1 6   ? 62.546  40.614 35.843 1.00 39.70  ? 1   MSE A CG  1 
HETATM 30   SE SE  . MSE A 1 6   ? 60.895  40.198 36.798 1.00 34.75  ? 1   MSE A SE  1 
HETATM 31   C  CE  . MSE A 1 6   ? 61.633  39.610 38.439 1.00 41.42  ? 1   MSE A CE  1 
ATOM   32   N  N   . ALA A 1 7   ? 65.758  41.333 37.537 1.00 42.73  ? 2   ALA A N   1 
ATOM   33   C  CA  . ALA A 1 7   ? 66.784  40.379 37.934 1.00 43.05  ? 2   ALA A CA  1 
ATOM   34   C  C   . ALA A 1 7   ? 67.314  40.653 39.349 1.00 42.66  ? 2   ALA A C   1 
ATOM   35   O  O   . ALA A 1 7   ? 67.977  39.805 39.944 1.00 43.41  ? 2   ALA A O   1 
ATOM   36   C  CB  . ALA A 1 7   ? 67.930  40.409 36.925 1.00 42.99  ? 2   ALA A CB  1 
ATOM   37   N  N   . GLU A 1 8   ? 67.007  41.823 39.894 1.00 42.97  ? 3   GLU A N   1 
ATOM   38   C  CA  . GLU A 1 8   ? 67.484  42.187 41.230 1.00 44.46  ? 3   GLU A CA  1 
ATOM   39   C  C   . GLU A 1 8   ? 66.531  41.827 42.378 1.00 44.06  ? 3   GLU A C   1 
ATOM   40   O  O   . GLU A 1 8   ? 65.519  41.152 42.179 1.00 44.70  ? 3   GLU A O   1 
ATOM   41   C  CB  . GLU A 1 8   ? 67.797  43.688 41.273 1.00 45.49  ? 3   GLU A CB  1 
ATOM   42   C  CG  . GLU A 1 8   ? 68.771  44.152 40.178 1.00 49.68  ? 3   GLU A CG  1 
ATOM   43   C  CD  . GLU A 1 8   ? 70.054  43.323 40.130 1.00 52.61  ? 3   GLU A CD  1 
ATOM   44   O  OE1 . GLU A 1 8   ? 70.736  43.214 41.179 1.00 54.40  ? 3   GLU A OE1 1 
ATOM   45   O  OE2 . GLU A 1 8   ? 70.385  42.781 39.044 1.00 54.09  ? 3   GLU A OE2 1 
ATOM   46   N  N   . ALA A 1 9   ? 66.868  42.285 43.581 1.00 43.41  ? 4   ALA A N   1 
ATOM   47   C  CA  . ALA A 1 9   ? 66.060  42.025 44.773 1.00 41.94  ? 4   ALA A CA  1 
ATOM   48   C  C   . ALA A 1 9   ? 64.610  42.448 44.564 1.00 40.68  ? 4   ALA A C   1 
ATOM   49   O  O   . ALA A 1 9   ? 63.693  41.784 45.052 1.00 39.94  ? 4   ALA A O   1 
ATOM   50   C  CB  . ALA A 1 9   ? 66.650  42.762 45.981 1.00 41.07  ? 4   ALA A CB  1 
ATOM   51   N  N   . GLU A 1 10  ? 64.409  43.557 43.853 1.00 39.50  ? 5   GLU A N   1 
ATOM   52   C  CA  . GLU A 1 10  ? 63.066  44.061 43.574 1.00 40.07  ? 5   GLU A CA  1 
ATOM   53   C  C   . GLU A 1 10  ? 62.204  42.960 42.957 1.00 37.54  ? 5   GLU A C   1 
ATOM   54   O  O   . GLU A 1 10  ? 61.122  42.645 43.456 1.00 34.81  ? 5   GLU A O   1 
ATOM   55   C  CB  . GLU A 1 10  ? 63.134  45.255 42.615 1.00 42.91  ? 5   GLU A CB  1 
ATOM   56   C  CG  . GLU A 1 10  ? 63.615  46.557 43.260 1.00 50.52  ? 5   GLU A CG  1 
ATOM   57   C  CD  . GLU A 1 10  ? 65.059  46.497 43.758 1.00 54.23  ? 5   GLU A CD  1 
ATOM   58   O  OE1 . GLU A 1 10  ? 65.979  46.334 42.917 1.00 53.85  ? 5   GLU A OE1 1 
ATOM   59   O  OE2 . GLU A 1 10  ? 65.267  46.620 44.992 1.00 55.57  ? 5   GLU A OE2 1 
ATOM   60   N  N   . GLY A 1 11  ? 62.706  42.377 41.872 1.00 36.32  ? 6   GLY A N   1 
ATOM   61   C  CA  . GLY A 1 11  ? 61.988  41.316 41.196 1.00 33.28  ? 6   GLY A CA  1 
ATOM   62   C  C   . GLY A 1 11  ? 61.817  40.062 42.033 1.00 32.04  ? 6   GLY A C   1 
ATOM   63   O  O   . GLY A 1 11  ? 60.712  39.522 42.133 1.00 32.39  ? 6   GLY A O   1 
ATOM   64   N  N   . GLU A 1 12  ? 62.900  39.595 42.643 1.00 30.38  ? 7   GLU A N   1 
ATOM   65   C  CA  . GLU A 1 12  ? 62.835  38.387 43.454 1.00 31.34  ? 7   GLU A CA  1 
ATOM   66   C  C   . GLU A 1 12  ? 61.794  38.527 44.567 1.00 31.03  ? 7   GLU A C   1 
ATOM   67   O  O   . GLU A 1 12  ? 61.035  37.593 44.838 1.00 30.44  ? 7   GLU A O   1 
ATOM   68   C  CB  . GLU A 1 12  ? 64.213  38.075 44.057 1.00 31.42  ? 7   GLU A CB  1 
ATOM   69   C  CG  . GLU A 1 12  ? 65.366  38.264 43.077 1.00 33.05  ? 7   GLU A CG  1 
ATOM   70   C  CD  . GLU A 1 12  ? 66.694  37.749 43.603 1.00 35.03  ? 7   GLU A CD  1 
ATOM   71   O  OE1 . GLU A 1 12  ? 66.892  37.779 44.841 1.00 36.11  ? 7   GLU A OE1 1 
ATOM   72   O  OE2 . GLU A 1 12  ? 67.544  37.330 42.776 1.00 33.03  ? 7   GLU A OE2 1 
ATOM   73   N  N   . SER A 1 13  ? 61.751  39.699 45.198 1.00 29.68  ? 8   SER A N   1 
ATOM   74   C  CA  . SER A 1 13  ? 60.807  39.944 46.286 1.00 29.32  ? 8   SER A CA  1 
ATOM   75   C  C   . SER A 1 13  ? 59.363  39.930 45.800 1.00 28.36  ? 8   SER A C   1 
ATOM   76   O  O   . SER A 1 13  ? 58.507  39.296 46.408 1.00 27.18  ? 8   SER A O   1 
ATOM   77   C  CB  . SER A 1 13  ? 61.105  41.288 46.958 1.00 29.37  ? 8   SER A CB  1 
ATOM   78   O  OG  . SER A 1 13  ? 60.131  41.576 47.952 1.00 31.90  ? 8   SER A OG  1 
ATOM   79   N  N   . LEU A 1 14  ? 59.097  40.641 44.706 1.00 28.39  ? 9   LEU A N   1 
ATOM   80   C  CA  . LEU A 1 14  ? 57.754  40.701 44.134 1.00 26.60  ? 9   LEU A CA  1 
ATOM   81   C  C   . LEU A 1 14  ? 57.270  39.336 43.653 1.00 25.99  ? 9   LEU A C   1 
ATOM   82   O  O   . LEU A 1 14  ? 56.093  39.007 43.791 1.00 26.84  ? 9   LEU A O   1 
ATOM   83   C  CB  . LEU A 1 14  ? 57.721  41.703 42.975 1.00 27.28  ? 9   LEU A CB  1 
ATOM   84   C  CG  . LEU A 1 14  ? 57.552  43.175 43.370 1.00 28.00  ? 9   LEU A CG  1 
ATOM   85   C  CD1 . LEU A 1 14  ? 57.694  44.076 42.152 1.00 25.37  ? 9   LEU A CD1 1 
ATOM   86   C  CD2 . LEU A 1 14  ? 56.172  43.352 44.023 1.00 28.16  ? 9   LEU A CD2 1 
ATOM   87   N  N   . GLU A 1 15  ? 58.160  38.532 43.080 1.00 25.27  ? 10  GLU A N   1 
ATOM   88   C  CA  . GLU A 1 15  ? 57.729  37.220 42.627 1.00 24.93  ? 10  GLU A CA  1 
ATOM   89   C  C   . GLU A 1 15  ? 57.467  36.345 43.849 1.00 25.23  ? 10  GLU A C   1 
ATOM   90   O  O   . GLU A 1 15  ? 56.579  35.490 43.841 1.00 26.35  ? 10  GLU A O   1 
ATOM   91   C  CB  . GLU A 1 15  ? 58.782  36.577 41.725 1.00 23.47  ? 10  GLU A CB  1 
ATOM   92   C  CG  . GLU A 1 15  ? 58.477  35.113 41.365 1.00 23.30  ? 10  GLU A CG  1 
ATOM   93   C  CD  . GLU A 1 15  ? 57.153  34.933 40.643 1.00 25.09  ? 10  GLU A CD  1 
ATOM   94   O  OE1 . GLU A 1 15  ? 56.523  35.957 40.307 1.00 25.89  ? 10  GLU A OE1 1 
ATOM   95   O  OE2 . GLU A 1 15  ? 56.737  33.768 40.411 1.00 25.71  ? 10  GLU A OE2 1 
ATOM   96   N  N   . SER A 1 16  ? 58.233  36.571 44.909 1.00 26.37  ? 11  SER A N   1 
ATOM   97   C  CA  . SER A 1 16  ? 58.070  35.802 46.133 1.00 27.52  ? 11  SER A CA  1 
ATOM   98   C  C   . SER A 1 16  ? 56.674  36.087 46.685 1.00 27.71  ? 11  SER A C   1 
ATOM   99   O  O   . SER A 1 16  ? 55.980  35.177 47.143 1.00 29.33  ? 11  SER A O   1 
ATOM   100  C  CB  . SER A 1 16  ? 59.153  36.197 47.146 1.00 29.91  ? 11  SER A CB  1 
ATOM   101  O  OG  . SER A 1 16  ? 59.045  35.448 48.349 1.00 34.54  ? 11  SER A OG  1 
ATOM   102  N  N   . TRP A 1 17  ? 56.259  37.351 46.619 1.00 28.14  ? 12  TRP A N   1 
ATOM   103  C  CA  . TRP A 1 17  ? 54.932  37.768 47.083 1.00 27.28  ? 12  TRP A CA  1 
ATOM   104  C  C   . TRP A 1 17  ? 53.854  37.180 46.182 1.00 26.94  ? 12  TRP A C   1 
ATOM   105  O  O   . TRP A 1 17  ? 52.772  36.829 46.641 1.00 27.91  ? 12  TRP A O   1 
ATOM   106  C  CB  . TRP A 1 17  ? 54.798  39.294 47.061 1.00 28.10  ? 12  TRP A CB  1 
ATOM   107  C  CG  . TRP A 1 17  ? 55.336  39.995 48.263 1.00 31.13  ? 12  TRP A CG  1 
ATOM   108  C  CD1 . TRP A 1 17  ? 56.528  40.629 48.368 1.00 33.30  ? 12  TRP A CD1 1 
ATOM   109  C  CD2 . TRP A 1 17  ? 54.689  40.140 49.539 1.00 32.55  ? 12  TRP A CD2 1 
ATOM   110  N  NE1 . TRP A 1 17  ? 56.673  41.169 49.625 1.00 34.81  ? 12  TRP A NE1 1 
ATOM   111  C  CE2 . TRP A 1 17  ? 55.558  40.881 50.364 1.00 33.75  ? 12  TRP A CE2 1 
ATOM   112  C  CE3 . TRP A 1 17  ? 53.460  39.715 50.063 1.00 32.34  ? 12  TRP A CE3 1 
ATOM   113  C  CZ2 . TRP A 1 17  ? 55.239  41.209 51.690 1.00 33.26  ? 12  TRP A CZ2 1 
ATOM   114  C  CZ3 . TRP A 1 17  ? 53.145  40.043 51.383 1.00 31.65  ? 12  TRP A CZ3 1 
ATOM   115  C  CH2 . TRP A 1 17  ? 54.030  40.781 52.177 1.00 31.58  ? 12  TRP A CH2 1 
ATOM   116  N  N   . LEU A 1 18  ? 54.136  37.093 44.887 1.00 27.96  ? 13  LEU A N   1 
ATOM   117  C  CA  . LEU A 1 18  ? 53.159  36.535 43.955 1.00 27.54  ? 13  LEU A CA  1 
ATOM   118  C  C   . LEU A 1 18  ? 52.950  35.051 44.230 1.00 28.83  ? 13  LEU A C   1 
ATOM   119  O  O   . LEU A 1 18  ? 51.807  34.585 44.235 1.00 30.32  ? 13  LEU A O   1 
ATOM   120  C  CB  . LEU A 1 18  ? 53.603  36.723 42.502 1.00 25.89  ? 13  LEU A CB  1 
ATOM   121  C  CG  . LEU A 1 18  ? 52.647  37.524 41.612 1.00 25.61  ? 13  LEU A CG  1 
ATOM   122  C  CD1 . LEU A 1 18  ? 52.891  37.152 40.156 1.00 20.59  ? 13  LEU A CD1 1 
ATOM   123  C  CD2 . LEU A 1 18  ? 51.207  37.233 41.987 1.00 24.19  ? 13  LEU A CD2 1 
ATOM   124  N  N   . ASN A 1 19  ? 54.048  34.313 44.436 1.00 27.58  ? 14  ASN A N   1 
ATOM   125  C  CA  . ASN A 1 19  ? 53.972  32.874 44.738 1.00 29.93  ? 14  ASN A CA  1 
ATOM   126  C  C   . ASN A 1 19  ? 52.962  32.647 45.862 1.00 29.43  ? 14  ASN A C   1 
ATOM   127  O  O   . ASN A 1 19  ? 52.063  31.818 45.753 1.00 30.63  ? 14  ASN A O   1 
ATOM   128  C  CB  . ASN A 1 19  ? 55.348  32.339 45.182 1.00 28.55  ? 14  ASN A CB  1 
ATOM   129  C  CG  . ASN A 1 19  ? 56.216  31.886 44.012 1.00 28.52  ? 14  ASN A CG  1 
ATOM   130  O  OD1 . ASN A 1 19  ? 56.082  32.382 42.893 1.00 29.17  ? 14  ASN A OD1 1 
ATOM   131  N  ND2 . ASN A 1 19  ? 57.121  30.949 44.274 1.00 25.69  ? 14  ASN A ND2 1 
ATOM   132  N  N   . LYS A 1 20  ? 53.122  33.411 46.935 1.00 30.23  ? 15  LYS A N   1 
ATOM   133  C  CA  . LYS A 1 20  ? 52.253  33.334 48.101 1.00 31.24  ? 15  LYS A CA  1 
ATOM   134  C  C   . LYS A 1 20  ? 50.798  33.604 47.753 1.00 30.33  ? 15  LYS A C   1 
ATOM   135  O  O   . LYS A 1 20  ? 49.906  32.836 48.119 1.00 31.35  ? 15  LYS A O   1 
ATOM   136  C  CB  . LYS A 1 20  ? 52.712  34.353 49.147 1.00 31.59  ? 15  LYS A CB  1 
ATOM   137  C  CG  . LYS A 1 20  ? 53.994  33.995 49.867 1.00 32.20  ? 15  LYS A CG  1 
ATOM   138  C  CD  . LYS A 1 20  ? 53.722  33.176 51.129 1.00 35.40  ? 15  LYS A CD  1 
ATOM   139  C  CE  . LYS A 1 20  ? 55.016  32.967 51.923 1.00 37.39  ? 15  LYS A CE  1 
ATOM   140  N  NZ  . LYS A 1 20  ? 55.760  34.276 52.092 1.00 36.80  ? 15  LYS A NZ  1 
ATOM   141  N  N   . ALA A 1 21  ? 50.565  34.707 47.048 1.00 30.36  ? 16  ALA A N   1 
ATOM   142  C  CA  . ALA A 1 21  ? 49.217  35.108 46.664 1.00 29.81  ? 16  ALA A CA  1 
ATOM   143  C  C   . ALA A 1 21  ? 48.601  34.210 45.600 1.00 30.40  ? 16  ALA A C   1 
ATOM   144  O  O   . ALA A 1 21  ? 47.391  34.258 45.378 1.00 29.18  ? 16  ALA A O   1 
ATOM   145  C  CB  . ALA A 1 21  ? 49.231  36.544 46.169 1.00 29.72  ? 16  ALA A CB  1 
ATOM   146  N  N   . THR A 1 22  ? 49.426  33.396 44.942 1.00 29.30  ? 17  THR A N   1 
ATOM   147  C  CA  . THR A 1 22  ? 48.928  32.521 43.885 1.00 29.67  ? 17  THR A CA  1 
ATOM   148  C  C   . THR A 1 22  ? 49.278  31.052 44.121 1.00 30.01  ? 17  THR A C   1 
ATOM   149  O  O   . THR A 1 22  ? 49.160  30.220 43.214 1.00 27.07  ? 17  THR A O   1 
ATOM   150  C  CB  . THR A 1 22  ? 49.473  32.965 42.491 1.00 28.23  ? 17  THR A CB  1 
ATOM   151  O  OG1 . THR A 1 22  ? 50.888  32.756 42.426 1.00 28.96  ? 17  THR A OG1 1 
ATOM   152  C  CG2 . THR A 1 22  ? 49.200  34.445 42.263 1.00 28.17  ? 17  THR A CG2 1 
ATOM   153  N  N   . ASN A 1 23  ? 49.710  30.734 45.339 1.00 30.76  ? 18  ASN A N   1 
ATOM   154  C  CA  . ASN A 1 23  ? 50.051  29.354 45.676 1.00 31.91  ? 18  ASN A CA  1 
ATOM   155  C  C   . ASN A 1 23  ? 48.836  28.460 45.399 1.00 30.14  ? 18  ASN A C   1 
ATOM   156  O  O   . ASN A 1 23  ? 47.753  28.684 45.938 1.00 27.93  ? 18  ASN A O   1 
ATOM   157  C  CB  . ASN A 1 23  ? 50.455  29.256 47.151 1.00 35.46  ? 18  ASN A CB  1 
ATOM   158  C  CG  . ASN A 1 23  ? 50.941  27.857 47.538 1.00 38.99  ? 18  ASN A CG  1 
ATOM   159  O  OD1 . ASN A 1 23  ? 51.319  27.615 48.689 1.00 39.51  ? 18  ASN A OD1 1 
ATOM   160  N  ND2 . ASN A 1 23  ? 50.933  26.932 46.574 1.00 40.45  ? 18  ASN A ND2 1 
ATOM   161  N  N   . PRO A 1 24  ? 48.997  27.443 44.539 1.00 30.93  ? 19  PRO A N   1 
ATOM   162  C  CA  . PRO A 1 24  ? 47.886  26.537 44.211 1.00 32.54  ? 19  PRO A CA  1 
ATOM   163  C  C   . PRO A 1 24  ? 47.418  25.692 45.400 1.00 35.46  ? 19  PRO A C   1 
ATOM   164  O  O   . PRO A 1 24  ? 46.458  24.928 45.292 1.00 35.65  ? 19  PRO A O   1 
ATOM   165  C  CB  . PRO A 1 24  ? 48.460  25.682 43.085 1.00 31.39  ? 19  PRO A CB  1 
ATOM   166  C  CG  . PRO A 1 24  ? 49.474  26.585 42.450 1.00 31.54  ? 19  PRO A CG  1 
ATOM   167  C  CD  . PRO A 1 24  ? 50.144  27.197 43.654 1.00 30.38  ? 19  PRO A CD  1 
ATOM   168  N  N   . SER A 1 25  ? 48.104  25.820 46.531 1.00 37.85  ? 20  SER A N   1 
ATOM   169  C  CA  . SER A 1 25  ? 47.718  25.077 47.723 1.00 40.95  ? 20  SER A CA  1 
ATOM   170  C  C   . SER A 1 25  ? 46.683  25.906 48.500 1.00 42.08  ? 20  SER A C   1 
ATOM   171  O  O   . SER A 1 25  ? 45.922  25.363 49.307 1.00 41.07  ? 20  SER A O   1 
ATOM   172  C  CB  . SER A 1 25  ? 48.946  24.794 48.600 1.00 41.55  ? 20  SER A CB  1 
ATOM   173  O  OG  . SER A 1 25  ? 49.446  25.988 49.183 1.00 45.05  ? 20  SER A OG  1 
ATOM   174  N  N   . ASN A 1 26  ? 46.651  27.217 48.242 1.00 42.35  ? 21  ASN A N   1 
ATOM   175  C  CA  . ASN A 1 26  ? 45.701  28.102 48.909 1.00 43.34  ? 21  ASN A CA  1 
ATOM   176  C  C   . ASN A 1 26  ? 44.310  27.498 48.916 1.00 45.27  ? 21  ASN A C   1 
ATOM   177  O  O   . ASN A 1 26  ? 43.782  27.122 47.867 1.00 42.56  ? 21  ASN A O   1 
ATOM   178  C  CB  . ASN A 1 26  ? 45.628  29.464 48.222 1.00 41.54  ? 21  ASN A CB  1 
ATOM   179  C  CG  . ASN A 1 26  ? 46.870  30.282 48.426 1.00 43.33  ? 21  ASN A CG  1 
ATOM   180  O  OD1 . ASN A 1 26  ? 47.606  30.084 49.395 1.00 44.24  ? 21  ASN A OD1 1 
ATOM   181  N  ND2 . ASN A 1 26  ? 47.108  31.232 47.527 1.00 43.03  ? 21  ASN A ND2 1 
ATOM   182  N  N   . ARG A 1 27  ? 43.732  27.403 50.110 1.00 49.58  ? 22  ARG A N   1 
ATOM   183  C  CA  . ARG A 1 27  ? 42.390  26.860 50.291 1.00 54.09  ? 22  ARG A CA  1 
ATOM   184  C  C   . ARG A 1 27  ? 41.432  27.735 49.506 1.00 54.79  ? 22  ARG A C   1 
ATOM   185  O  O   . ARG A 1 27  ? 40.501  27.245 48.872 1.00 54.84  ? 22  ARG A O   1 
ATOM   186  C  CB  . ARG A 1 27  ? 42.018  26.871 51.776 1.00 58.88  ? 22  ARG A CB  1 
ATOM   187  C  CG  . ARG A 1 27  ? 42.512  28.111 52.543 1.00 63.62  ? 22  ARG A CG  1 
ATOM   188  C  CD  . ARG A 1 27  ? 41.422  28.687 53.446 1.00 66.72  ? 22  ARG A CD  1 
ATOM   189  N  NE  . ARG A 1 27  ? 40.314  29.243 52.665 1.00 70.79  ? 22  ARG A NE  1 
ATOM   190  C  CZ  . ARG A 1 27  ? 39.207  29.765 53.192 1.00 72.73  ? 22  ARG A CZ  1 
ATOM   191  N  NH1 . ARG A 1 27  ? 39.050  29.805 54.511 1.00 72.71  ? 22  ARG A NH1 1 
ATOM   192  N  NH2 . ARG A 1 27  ? 38.256  30.246 52.399 1.00 72.28  ? 22  ARG A NH2 1 
ATOM   193  N  N   . GLN A 1 28  ? 41.682  29.039 49.566 1.00 55.70  ? 23  GLN A N   1 
ATOM   194  C  CA  . GLN A 1 28  ? 40.897  30.044 48.863 1.00 56.53  ? 23  GLN A CA  1 
ATOM   195  C  C   . GLN A 1 28  ? 41.784  31.270 48.699 1.00 56.13  ? 23  GLN A C   1 
ATOM   196  O  O   . GLN A 1 28  ? 42.984  31.209 48.976 1.00 56.89  ? 23  GLN A O   1 
ATOM   197  C  CB  . GLN A 1 28  ? 39.635  30.400 49.648 1.00 57.94  ? 23  GLN A CB  1 
ATOM   198  C  CG  . GLN A 1 28  ? 38.540  29.327 49.587 1.00 62.48  ? 23  GLN A CG  1 
ATOM   199  C  CD  . GLN A 1 28  ? 38.155  28.927 48.155 1.00 64.01  ? 23  GLN A CD  1 
ATOM   200  O  OE1 . GLN A 1 28  ? 38.895  28.210 47.474 1.00 63.37  ? 23  GLN A OE1 1 
ATOM   201  N  NE2 . GLN A 1 28  ? 36.994  29.396 47.698 1.00 64.57  ? 23  GLN A NE2 1 
ATOM   202  N  N   . GLU A 1 29  ? 41.213  32.380 48.247 1.00 54.65  ? 24  GLU A N   1 
ATOM   203  C  CA  . GLU A 1 29  ? 42.010  33.582 48.062 1.00 54.63  ? 24  GLU A CA  1 
ATOM   204  C  C   . GLU A 1 29  ? 42.520  34.135 49.381 1.00 53.88  ? 24  GLU A C   1 
ATOM   205  O  O   . GLU A 1 29  ? 41.733  34.441 50.272 1.00 54.43  ? 24  GLU A O   1 
ATOM   206  C  CB  . GLU A 1 29  ? 41.206  34.664 47.336 1.00 55.18  ? 24  GLU A CB  1 
ATOM   207  C  CG  . GLU A 1 29  ? 40.894  34.332 45.887 1.00 58.13  ? 24  GLU A CG  1 
ATOM   208  C  CD  . GLU A 1 29  ? 39.602  33.548 45.716 1.00 60.07  ? 24  GLU A CD  1 
ATOM   209  O  OE1 . GLU A 1 29  ? 39.366  32.584 46.481 1.00 61.63  ? 24  GLU A OE1 1 
ATOM   210  O  OE2 . GLU A 1 29  ? 38.823  33.895 44.803 1.00 61.85  ? 24  GLU A OE2 1 
ATOM   211  N  N   . ASP A 1 30  ? 43.839  34.249 49.510 1.00 53.85  ? 25  ASP A N   1 
ATOM   212  C  CA  . ASP A 1 30  ? 44.431  34.806 50.724 1.00 53.23  ? 25  ASP A CA  1 
ATOM   213  C  C   . ASP A 1 30  ? 44.703  36.277 50.475 1.00 50.99  ? 25  ASP A C   1 
ATOM   214  O  O   . ASP A 1 30  ? 45.709  36.641 49.862 1.00 49.12  ? 25  ASP A O   1 
ATOM   215  C  CB  . ASP A 1 30  ? 45.743  34.108 51.093 1.00 55.06  ? 25  ASP A CB  1 
ATOM   216  C  CG  . ASP A 1 30  ? 46.403  34.730 52.323 1.00 58.25  ? 25  ASP A CG  1 
ATOM   217  O  OD1 . ASP A 1 30  ? 46.743  35.932 52.273 1.00 59.22  ? 25  ASP A OD1 1 
ATOM   218  O  OD2 . ASP A 1 30  ? 46.575  34.027 53.345 1.00 59.57  ? 25  ASP A OD2 1 
ATOM   219  N  N   . TRP A 1 31  ? 43.799  37.121 50.957 1.00 50.03  ? 26  TRP A N   1 
ATOM   220  C  CA  . TRP A 1 31  ? 43.932  38.555 50.771 1.00 49.79  ? 26  TRP A CA  1 
ATOM   221  C  C   . TRP A 1 31  ? 45.065  39.175 51.570 1.00 50.63  ? 26  TRP A C   1 
ATOM   222  O  O   . TRP A 1 31  ? 45.483  40.304 51.300 1.00 50.27  ? 26  TRP A O   1 
ATOM   223  C  CB  . TRP A 1 31  ? 42.600  39.231 51.071 1.00 47.79  ? 26  TRP A CB  1 
ATOM   224  C  CG  . TRP A 1 31  ? 41.554  38.770 50.109 1.00 46.32  ? 26  TRP A CG  1 
ATOM   225  C  CD1 . TRP A 1 31  ? 40.675  37.736 50.279 1.00 45.39  ? 26  TRP A CD1 1 
ATOM   226  C  CD2 . TRP A 1 31  ? 41.331  39.274 48.787 1.00 44.69  ? 26  TRP A CD2 1 
ATOM   227  N  NE1 . TRP A 1 31  ? 39.918  37.565 49.142 1.00 44.84  ? 26  TRP A NE1 1 
ATOM   228  C  CE2 . TRP A 1 31  ? 40.300  38.495 48.211 1.00 44.14  ? 26  TRP A CE2 1 
ATOM   229  C  CE3 . TRP A 1 31  ? 41.904  40.309 48.032 1.00 43.29  ? 26  TRP A CE3 1 
ATOM   230  C  CZ2 . TRP A 1 31  ? 39.827  38.718 46.913 1.00 43.87  ? 26  TRP A CZ2 1 
ATOM   231  C  CZ3 . TRP A 1 31  ? 41.434  40.534 46.738 1.00 41.97  ? 26  TRP A CZ3 1 
ATOM   232  C  CH2 . TRP A 1 31  ? 40.405  39.739 46.193 1.00 43.98  ? 26  TRP A CH2 1 
ATOM   233  N  N   . GLU A 1 32  ? 45.573  38.433 52.547 1.00 51.16  ? 27  GLU A N   1 
ATOM   234  C  CA  . GLU A 1 32  ? 46.690  38.926 53.331 1.00 51.94  ? 27  GLU A CA  1 
ATOM   235  C  C   . GLU A 1 32  ? 47.872  39.012 52.358 1.00 51.01  ? 27  GLU A C   1 
ATOM   236  O  O   . GLU A 1 32  ? 48.700  39.916 52.453 1.00 50.64  ? 27  GLU A O   1 
ATOM   237  C  CB  . GLU A 1 32  ? 47.016  37.956 54.468 1.00 55.49  ? 27  GLU A CB  1 
ATOM   238  C  CG  . GLU A 1 32  ? 48.141  38.422 55.392 1.00 60.05  ? 27  GLU A CG  1 
ATOM   239  C  CD  . GLU A 1 32  ? 49.102  37.295 55.762 1.00 63.58  ? 27  GLU A CD  1 
ATOM   240  O  OE1 . GLU A 1 32  ? 48.624  36.206 56.162 1.00 64.32  ? 27  GLU A OE1 1 
ATOM   241  O  OE2 . GLU A 1 32  ? 50.338  37.500 55.656 1.00 64.68  ? 27  GLU A OE2 1 
ATOM   242  N  N   . TYR A 1 33  ? 47.937  38.077 51.409 1.00 49.29  ? 28  TYR A N   1 
ATOM   243  C  CA  . TYR A 1 33  ? 49.023  38.074 50.428 1.00 47.83  ? 28  TYR A CA  1 
ATOM   244  C  C   . TYR A 1 33  ? 48.696  38.866 49.162 1.00 46.55  ? 28  TYR A C   1 
ATOM   245  O  O   . TYR A 1 33  ? 49.581  39.499 48.576 1.00 43.96  ? 28  TYR A O   1 
ATOM   246  C  CB  . TYR A 1 33  ? 49.426  36.639 50.078 1.00 48.67  ? 28  TYR A CB  1 
ATOM   247  C  CG  . TYR A 1 33  ? 50.169  35.949 51.204 1.00 48.82  ? 28  TYR A CG  1 
ATOM   248  C  CD1 . TYR A 1 33  ? 51.315  36.523 51.756 1.00 49.13  ? 28  TYR A CD1 1 
ATOM   249  C  CD2 . TYR A 1 33  ? 49.714  34.739 51.735 1.00 49.67  ? 28  TYR A CD2 1 
ATOM   250  C  CE1 . TYR A 1 33  ? 51.994  35.915 52.813 1.00 50.53  ? 28  TYR A CE1 1 
ATOM   251  C  CE2 . TYR A 1 33  ? 50.385  34.117 52.796 1.00 51.16  ? 28  TYR A CE2 1 
ATOM   252  C  CZ  . TYR A 1 33  ? 51.525  34.713 53.330 1.00 51.40  ? 28  TYR A CZ  1 
ATOM   253  O  OH  . TYR A 1 33  ? 52.199  34.113 54.373 1.00 51.45  ? 28  TYR A OH  1 
ATOM   254  N  N   . ILE A 1 34  ? 47.426  38.841 48.754 1.00 45.60  ? 29  ILE A N   1 
ATOM   255  C  CA  . ILE A 1 34  ? 46.982  39.576 47.569 1.00 44.10  ? 29  ILE A CA  1 
ATOM   256  C  C   . ILE A 1 34  ? 47.217  41.085 47.727 1.00 44.43  ? 29  ILE A C   1 
ATOM   257  O  O   . ILE A 1 34  ? 47.892  41.705 46.908 1.00 44.60  ? 29  ILE A O   1 
ATOM   258  C  CB  . ILE A 1 34  ? 45.477  39.333 47.285 1.00 42.05  ? 29  ILE A CB  1 
ATOM   259  C  CG1 . ILE A 1 34  ? 45.248  37.860 46.923 1.00 43.02  ? 29  ILE A CG1 1 
ATOM   260  C  CG2 . ILE A 1 34  ? 45.009  40.235 46.157 1.00 38.25  ? 29  ILE A CG2 1 
ATOM   261  C  CD1 . ILE A 1 34  ? 43.786  37.464 46.733 1.00 40.78  ? 29  ILE A CD1 1 
ATOM   262  N  N   . ILE A 1 35  ? 46.669  41.672 48.786 1.00 44.71  ? 30  ILE A N   1 
ATOM   263  C  CA  . ILE A 1 35  ? 46.829  43.102 49.024 1.00 44.12  ? 30  ILE A CA  1 
ATOM   264  C  C   . ILE A 1 35  ? 48.287  43.454 49.314 1.00 42.52  ? 30  ILE A C   1 
ATOM   265  O  O   . ILE A 1 35  ? 48.788  44.495 48.872 1.00 42.36  ? 30  ILE A O   1 
ATOM   266  C  CB  . ILE A 1 35  ? 45.928  43.583 50.199 1.00 45.95  ? 30  ILE A CB  1 
ATOM   267  C  CG1 . ILE A 1 35  ? 44.466  43.196 49.934 1.00 45.87  ? 30  ILE A CG1 1 
ATOM   268  C  CG2 . ILE A 1 35  ? 46.012  45.095 50.346 1.00 46.18  ? 30  ILE A CG2 1 
ATOM   269  C  CD1 . ILE A 1 35  ? 43.916  43.701 48.618 1.00 46.10  ? 30  ILE A CD1 1 
ATOM   270  N  N   . GLY A 1 36  ? 48.975  42.584 50.046 1.00 41.38  ? 31  GLY A N   1 
ATOM   271  C  CA  . GLY A 1 36  ? 50.371  42.847 50.360 1.00 40.07  ? 31  GLY A CA  1 
ATOM   272  C  C   . GLY A 1 36  ? 51.225  43.010 49.114 1.00 39.87  ? 31  GLY A C   1 
ATOM   273  O  O   . GLY A 1 36  ? 52.245  43.712 49.133 1.00 40.27  ? 31  GLY A O   1 
ATOM   274  N  N   . PHE A 1 37  ? 50.818  42.348 48.033 1.00 38.46  ? 32  PHE A N   1 
ATOM   275  C  CA  . PHE A 1 37  ? 51.523  42.426 46.754 1.00 37.63  ? 32  PHE A CA  1 
ATOM   276  C  C   . PHE A 1 37  ? 51.301  43.817 46.152 1.00 37.37  ? 32  PHE A C   1 
ATOM   277  O  O   . PHE A 1 37  ? 52.201  44.387 45.539 1.00 35.56  ? 32  PHE A O   1 
ATOM   278  C  CB  . PHE A 1 37  ? 50.990  41.352 45.801 1.00 37.25  ? 32  PHE A CB  1 
ATOM   279  C  CG  . PHE A 1 37  ? 51.593  41.396 44.422 1.00 36.89  ? 32  PHE A CG  1 
ATOM   280  C  CD1 . PHE A 1 37  ? 52.902  40.965 44.201 1.00 36.48  ? 32  PHE A CD1 1 
ATOM   281  C  CD2 . PHE A 1 37  ? 50.835  41.829 43.333 1.00 35.22  ? 32  PHE A CD2 1 
ATOM   282  C  CE1 . PHE A 1 37  ? 53.446  40.958 42.913 1.00 36.27  ? 32  PHE A CE1 1 
ATOM   283  C  CE2 . PHE A 1 37  ? 51.367  41.829 42.038 1.00 36.14  ? 32  PHE A CE2 1 
ATOM   284  C  CZ  . PHE A 1 37  ? 52.675  41.391 41.827 1.00 36.21  ? 32  PHE A CZ  1 
ATOM   285  N  N   . CYS A 1 38  ? 50.097  44.357 46.334 1.00 37.96  ? 33  CYS A N   1 
ATOM   286  C  CA  . CYS A 1 38  ? 49.760  45.690 45.824 1.00 39.02  ? 33  CYS A CA  1 
ATOM   287  C  C   . CYS A 1 38  ? 50.567  46.755 46.573 1.00 40.05  ? 33  CYS A C   1 
ATOM   288  O  O   . CYS A 1 38  ? 51.041  47.735 45.983 1.00 39.35  ? 33  CYS A O   1 
ATOM   289  C  CB  . CYS A 1 38  ? 48.262  45.971 46.012 1.00 38.37  ? 33  CYS A CB  1 
ATOM   290  S  SG  . CYS A 1 38  ? 47.166  44.796 45.193 1.00 36.57  ? 33  CYS A SG  1 
ATOM   291  N  N   . ASP A 1 39  ? 50.709  46.558 47.881 1.00 41.02  ? 34  ASP A N   1 
ATOM   292  C  CA  . ASP A 1 39  ? 51.457  47.487 48.714 1.00 41.85  ? 34  ASP A CA  1 
ATOM   293  C  C   . ASP A 1 39  ? 52.921  47.536 48.293 1.00 42.14  ? 34  ASP A C   1 
ATOM   294  O  O   . ASP A 1 39  ? 53.515  48.618 48.217 1.00 43.46  ? 34  ASP A O   1 
ATOM   295  C  CB  . ASP A 1 39  ? 51.326  47.083 50.180 1.00 42.09  ? 34  ASP A CB  1 
ATOM   296  C  CG  . ASP A 1 39  ? 49.879  47.067 50.644 1.00 43.83  ? 34  ASP A CG  1 
ATOM   297  O  OD1 . ASP A 1 39  ? 49.155  48.061 50.376 1.00 43.20  ? 34  ASP A OD1 1 
ATOM   298  O  OD2 . ASP A 1 39  ? 49.469  46.066 51.276 1.00 44.99  ? 34  ASP A OD2 1 
ATOM   299  N  N   . GLN A 1 40  ? 53.498  46.370 48.009 1.00 41.19  ? 35  GLN A N   1 
ATOM   300  C  CA  . GLN A 1 40  ? 54.884  46.300 47.566 1.00 40.60  ? 35  GLN A CA  1 
ATOM   301  C  C   . GLN A 1 40  ? 55.029  47.065 46.260 1.00 40.14  ? 35  GLN A C   1 
ATOM   302  O  O   . GLN A 1 40  ? 56.026  47.749 46.036 1.00 41.21  ? 35  GLN A O   1 
ATOM   303  C  CB  . GLN A 1 40  ? 55.312  44.846 47.351 1.00 42.26  ? 35  GLN A CB  1 
ATOM   304  C  CG  . GLN A 1 40  ? 55.543  44.073 48.637 1.00 44.81  ? 35  GLN A CG  1 
ATOM   305  C  CD  . GLN A 1 40  ? 56.424  44.839 49.606 1.00 45.41  ? 35  GLN A CD  1 
ATOM   306  O  OE1 . GLN A 1 40  ? 57.525  45.269 49.259 1.00 45.40  ? 35  GLN A OE1 1 
ATOM   307  N  NE2 . GLN A 1 40  ? 55.936  45.022 50.826 1.00 45.61  ? 35  GLN A NE2 1 
ATOM   308  N  N   . ILE A 1 41  ? 54.027  46.939 45.396 1.00 38.63  ? 36  ILE A N   1 
ATOM   309  C  CA  . ILE A 1 41  ? 54.037  47.626 44.110 1.00 37.51  ? 36  ILE A CA  1 
ATOM   310  C  C   . ILE A 1 41  ? 53.931  49.137 44.301 1.00 38.31  ? 36  ILE A C   1 
ATOM   311  O  O   . ILE A 1 41  ? 54.558  49.910 43.567 1.00 36.11  ? 36  ILE A O   1 
ATOM   312  C  CB  . ILE A 1 41  ? 52.861  47.151 43.215 1.00 36.01  ? 36  ILE A CB  1 
ATOM   313  C  CG1 . ILE A 1 41  ? 53.049  45.677 42.846 1.00 33.93  ? 36  ILE A CG1 1 
ATOM   314  C  CG2 . ILE A 1 41  ? 52.776  48.005 41.954 1.00 35.33  ? 36  ILE A CG2 1 
ATOM   315  C  CD1 . ILE A 1 41  ? 51.874  45.084 42.116 1.00 32.08  ? 36  ILE A CD1 1 
ATOM   316  N  N   . ASN A 1 42  ? 53.133  49.554 45.282 1.00 38.61  ? 37  ASN A N   1 
ATOM   317  C  CA  . ASN A 1 42  ? 52.945  50.976 45.549 1.00 40.58  ? 37  ASN A CA  1 
ATOM   318  C  C   . ASN A 1 42  ? 54.174  51.667 46.131 1.00 41.39  ? 37  ASN A C   1 
ATOM   319  O  O   . ASN A 1 42  ? 54.308  52.888 46.027 1.00 42.91  ? 37  ASN A O   1 
ATOM   320  C  CB  . ASN A 1 42  ? 51.746  51.186 46.478 1.00 40.13  ? 37  ASN A CB  1 
ATOM   321  C  CG  . ASN A 1 42  ? 50.453  50.711 45.860 1.00 40.36  ? 37  ASN A CG  1 
ATOM   322  O  OD1 . ASN A 1 42  ? 50.313  50.693 44.637 1.00 40.83  ? 37  ASN A OD1 1 
ATOM   323  N  ND2 . ASN A 1 42  ? 49.492  50.334 46.697 1.00 40.73  ? 37  ASN A ND2 1 
ATOM   324  N  N   . LYS A 1 43  ? 55.072  50.895 46.737 1.00 41.52  ? 38  LYS A N   1 
ATOM   325  C  CA  . LYS A 1 43  ? 56.286  51.458 47.323 1.00 41.13  ? 38  LYS A CA  1 
ATOM   326  C  C   . LYS A 1 43  ? 57.484  51.328 46.378 1.00 42.52  ? 38  LYS A C   1 
ATOM   327  O  O   . LYS A 1 43  ? 58.443  52.103 46.469 1.00 43.07  ? 38  LYS A O   1 
ATOM   328  C  CB  . LYS A 1 43  ? 56.621  50.749 48.636 1.00 40.47  ? 38  LYS A CB  1 
ATOM   329  C  CG  . LYS A 1 43  ? 55.499  50.720 49.666 1.00 39.22  ? 38  LYS A CG  1 
ATOM   330  C  CD  . LYS A 1 43  ? 55.332  52.044 50.415 1.00 37.62  ? 38  LYS A CD  1 
ATOM   331  C  CE  . LYS A 1 43  ? 54.308  51.882 51.544 1.00 35.96  ? 38  LYS A CE  1 
ATOM   332  N  NZ  . LYS A 1 43  ? 54.241  53.043 52.467 1.00 34.47  ? 38  LYS A NZ  1 
ATOM   333  N  N   . GLU A 1 44  ? 57.436  50.349 45.477 1.00 42.13  ? 39  GLU A N   1 
ATOM   334  C  CA  . GLU A 1 44  ? 58.541  50.126 44.544 1.00 43.61  ? 39  GLU A CA  1 
ATOM   335  C  C   . GLU A 1 44  ? 58.539  51.026 43.314 1.00 43.22  ? 39  GLU A C   1 
ATOM   336  O  O   . GLU A 1 44  ? 57.521  51.207 42.645 1.00 44.05  ? 39  GLU A O   1 
ATOM   337  C  CB  . GLU A 1 44  ? 58.584  48.655 44.108 1.00 44.88  ? 39  GLU A CB  1 
ATOM   338  C  CG  . GLU A 1 44  ? 59.049  47.695 45.199 1.00 46.57  ? 39  GLU A CG  1 
ATOM   339  C  CD  . GLU A 1 44  ? 60.432  48.052 45.736 1.00 49.50  ? 39  GLU A CD  1 
ATOM   340  O  OE1 . GLU A 1 44  ? 61.389  48.089 44.935 1.00 51.28  ? 39  GLU A OE1 1 
ATOM   341  O  OE2 . GLU A 1 44  ? 60.564  48.299 46.957 1.00 50.88  ? 39  GLU A OE2 1 
ATOM   342  N  N   . LEU A 1 45  ? 59.704  51.585 43.016 1.00 43.55  ? 40  LEU A N   1 
ATOM   343  C  CA  . LEU A 1 45  ? 59.854  52.474 41.876 1.00 42.23  ? 40  LEU A CA  1 
ATOM   344  C  C   . LEU A 1 45  ? 59.430  51.807 40.574 1.00 41.09  ? 40  LEU A C   1 
ATOM   345  O  O   . LEU A 1 45  ? 58.752  52.420 39.749 1.00 40.21  ? 40  LEU A O   1 
ATOM   346  C  CB  . LEU A 1 45  ? 61.306  52.932 41.757 1.00 42.98  ? 40  LEU A CB  1 
ATOM   347  C  CG  . LEU A 1 45  ? 61.538  53.935 40.627 1.00 42.61  ? 40  LEU A CG  1 
ATOM   348  C  CD1 . LEU A 1 45  ? 60.830  55.235 40.971 1.00 41.58  ? 40  LEU A CD1 1 
ATOM   349  C  CD2 . LEU A 1 45  ? 63.027  54.164 40.429 1.00 43.07  ? 40  LEU A CD2 1 
ATOM   350  N  N   . GLU A 1 46  ? 59.850  50.558 40.389 1.00 41.31  ? 41  GLU A N   1 
ATOM   351  C  CA  . GLU A 1 46  ? 59.515  49.807 39.181 1.00 40.61  ? 41  GLU A CA  1 
ATOM   352  C  C   . GLU A 1 46  ? 58.541  48.681 39.518 1.00 38.69  ? 41  GLU A C   1 
ATOM   353  O  O   . GLU A 1 46  ? 58.560  47.620 38.884 1.00 37.44  ? 41  GLU A O   1 
ATOM   354  C  CB  . GLU A 1 46  ? 60.774  49.208 38.538 1.00 43.92  ? 41  GLU A CB  1 
ATOM   355  C  CG  . GLU A 1 46  ? 61.997  50.115 38.536 1.00 50.09  ? 41  GLU A CG  1 
ATOM   356  C  CD  . GLU A 1 46  ? 62.871  49.922 39.776 1.00 55.51  ? 41  GLU A CD  1 
ATOM   357  O  OE1 . GLU A 1 46  ? 62.333  49.929 40.912 1.00 57.49  ? 41  GLU A OE1 1 
ATOM   358  O  OE2 . GLU A 1 46  ? 64.102  49.768 39.613 1.00 57.67  ? 41  GLU A OE2 1 
ATOM   359  N  N   . GLY A 1 47  ? 57.695  48.916 40.521 1.00 35.46  ? 42  GLY A N   1 
ATOM   360  C  CA  . GLY A 1 47  ? 56.722  47.917 40.917 1.00 32.12  ? 42  GLY A CA  1 
ATOM   361  C  C   . GLY A 1 47  ? 55.774  47.541 39.790 1.00 30.15  ? 42  GLY A C   1 
ATOM   362  O  O   . GLY A 1 47  ? 55.573  46.355 39.524 1.00 29.53  ? 42  GLY A O   1 
ATOM   363  N  N   . PRO A 1 48  ? 55.181  48.526 39.095 1.00 28.87  ? 43  PRO A N   1 
ATOM   364  C  CA  . PRO A 1 48  ? 54.249  48.252 37.994 1.00 28.99  ? 43  PRO A CA  1 
ATOM   365  C  C   . PRO A 1 48  ? 54.872  47.508 36.813 1.00 29.85  ? 43  PRO A C   1 
ATOM   366  O  O   . PRO A 1 48  ? 54.278  46.564 36.280 1.00 29.30  ? 43  PRO A O   1 
ATOM   367  C  CB  . PRO A 1 48  ? 53.765  49.648 37.596 1.00 27.15  ? 43  PRO A CB  1 
ATOM   368  C  CG  . PRO A 1 48  ? 53.898  50.430 38.884 1.00 26.67  ? 43  PRO A CG  1 
ATOM   369  C  CD  . PRO A 1 48  ? 55.240  49.970 39.373 1.00 27.10  ? 43  PRO A CD  1 
ATOM   370  N  N   . GLN A 1 49  ? 56.064  47.933 36.397 1.00 29.57  ? 44  GLN A N   1 
ATOM   371  C  CA  . GLN A 1 49  ? 56.719  47.286 35.265 1.00 30.89  ? 44  GLN A CA  1 
ATOM   372  C  C   . GLN A 1 49  ? 56.998  45.827 35.560 1.00 29.25  ? 44  GLN A C   1 
ATOM   373  O  O   . GLN A 1 49  ? 56.689  44.949 34.756 1.00 29.16  ? 44  GLN A O   1 
ATOM   374  C  CB  . GLN A 1 49  ? 58.026  48.000 34.900 1.00 31.97  ? 44  GLN A CB  1 
ATOM   375  C  CG  . GLN A 1 49  ? 57.829  49.422 34.388 1.00 36.84  ? 44  GLN A CG  1 
ATOM   376  C  CD  . GLN A 1 49  ? 57.799  50.450 35.510 1.00 40.63  ? 44  GLN A CD  1 
ATOM   377  O  OE1 . GLN A 1 49  ? 57.075  50.292 36.504 1.00 39.36  ? 44  GLN A OE1 1 
ATOM   378  N  NE2 . GLN A 1 49  ? 58.591  51.515 35.354 1.00 41.31  ? 44  GLN A NE2 1 
ATOM   379  N  N   . ILE A 1 50  ? 57.579  45.574 36.725 1.00 28.01  ? 45  ILE A N   1 
ATOM   380  C  CA  . ILE A 1 50  ? 57.892  44.220 37.135 1.00 26.74  ? 45  ILE A CA  1 
ATOM   381  C  C   . ILE A 1 50  ? 56.607  43.428 37.318 1.00 26.28  ? 45  ILE A C   1 
ATOM   382  O  O   . ILE A 1 50  ? 56.372  42.425 36.644 1.00 27.94  ? 45  ILE A O   1 
ATOM   383  C  CB  . ILE A 1 50  ? 58.683  44.228 38.460 1.00 27.67  ? 45  ILE A CB  1 
ATOM   384  C  CG1 . ILE A 1 50  ? 60.040  44.912 38.230 1.00 28.61  ? 45  ILE A CG1 1 
ATOM   385  C  CG2 . ILE A 1 50  ? 58.833  42.803 38.994 1.00 24.26  ? 45  ILE A CG2 1 
ATOM   386  C  CD1 . ILE A 1 50  ? 60.921  45.035 39.477 1.00 30.59  ? 45  ILE A CD1 1 
ATOM   387  N  N   . ALA A 1 51  ? 55.760  43.904 38.217 1.00 25.73  ? 46  ALA A N   1 
ATOM   388  C  CA  . ALA A 1 51  ? 54.501  43.239 38.513 1.00 24.70  ? 46  ALA A CA  1 
ATOM   389  C  C   . ALA A 1 51  ? 53.714  42.739 37.301 1.00 23.56  ? 46  ALA A C   1 
ATOM   390  O  O   . ALA A 1 51  ? 53.309  41.578 37.272 1.00 22.27  ? 46  ALA A O   1 
ATOM   391  C  CB  . ALA A 1 51  ? 53.619  44.160 39.360 1.00 25.20  ? 46  ALA A CB  1 
ATOM   392  N  N   . VAL A 1 52  ? 53.484  43.595 36.308 1.00 22.20  ? 47  VAL A N   1 
ATOM   393  C  CA  . VAL A 1 52  ? 52.703  43.152 35.164 1.00 23.94  ? 47  VAL A CA  1 
ATOM   394  C  C   . VAL A 1 52  ? 53.369  42.012 34.399 1.00 25.61  ? 47  VAL A C   1 
ATOM   395  O  O   . VAL A 1 52  ? 52.682  41.119 33.900 1.00 26.76  ? 47  VAL A O   1 
ATOM   396  C  CB  . VAL A 1 52  ? 52.335  44.331 34.186 1.00 22.31  ? 47  VAL A CB  1 
ATOM   397  C  CG1 . VAL A 1 52  ? 51.544  45.391 34.946 1.00 18.94  ? 47  VAL A CG1 1 
ATOM   398  C  CG2 . VAL A 1 52  ? 53.575  44.912 33.524 1.00 20.57  ? 47  VAL A CG2 1 
ATOM   399  N  N   . ARG A 1 53  ? 54.694  42.021 34.313 1.00 26.72  ? 48  ARG A N   1 
ATOM   400  C  CA  . ARG A 1 53  ? 55.387  40.934 33.625 1.00 27.82  ? 48  ARG A CA  1 
ATOM   401  C  C   . ARG A 1 53  ? 55.222  39.667 34.453 1.00 26.79  ? 48  ARG A C   1 
ATOM   402  O  O   . ARG A 1 53  ? 55.001  38.581 33.922 1.00 27.06  ? 48  ARG A O   1 
ATOM   403  C  CB  . ARG A 1 53  ? 56.871  41.259 33.449 1.00 27.25  ? 48  ARG A CB  1 
ATOM   404  C  CG  . ARG A 1 53  ? 57.136  42.386 32.454 1.00 31.08  ? 48  ARG A CG  1 
ATOM   405  C  CD  . ARG A 1 53  ? 58.439  42.148 31.699 1.00 36.53  ? 48  ARG A CD  1 
ATOM   406  N  NE  . ARG A 1 53  ? 59.623  42.333 32.535 1.00 40.04  ? 48  ARG A NE  1 
ATOM   407  C  CZ  . ARG A 1 53  ? 60.800  41.759 32.296 1.00 41.63  ? 48  ARG A CZ  1 
ATOM   408  N  NH1 . ARG A 1 53  ? 60.951  40.957 31.248 1.00 40.48  ? 48  ARG A NH1 1 
ATOM   409  N  NH2 . ARG A 1 53  ? 61.833  41.996 33.099 1.00 42.47  ? 48  ARG A NH2 1 
ATOM   410  N  N   . LEU A 1 54  ? 55.317  39.820 35.769 1.00 27.08  ? 49  LEU A N   1 
ATOM   411  C  CA  . LEU A 1 54  ? 55.159  38.697 36.684 1.00 25.08  ? 49  LEU A CA  1 
ATOM   412  C  C   . LEU A 1 54  ? 53.739  38.162 36.603 1.00 23.36  ? 49  LEU A C   1 
ATOM   413  O  O   . LEU A 1 54  ? 53.527  36.954 36.487 1.00 22.91  ? 49  LEU A O   1 
ATOM   414  C  CB  . LEU A 1 54  ? 55.462  39.150 38.114 1.00 25.71  ? 49  LEU A CB  1 
ATOM   415  C  CG  . LEU A 1 54  ? 56.807  38.774 38.752 1.00 27.31  ? 49  LEU A CG  1 
ATOM   416  C  CD1 . LEU A 1 54  ? 57.885  38.566 37.712 1.00 24.90  ? 49  LEU A CD1 1 
ATOM   417  C  CD2 . LEU A 1 54  ? 57.192  39.865 39.737 1.00 26.18  ? 49  LEU A CD2 1 
ATOM   418  N  N   . LEU A 1 55  ? 52.759  39.058 36.679 1.00 22.75  ? 50  LEU A N   1 
ATOM   419  C  CA  . LEU A 1 55  ? 51.359  38.645 36.604 1.00 21.72  ? 50  LEU A CA  1 
ATOM   420  C  C   . LEU A 1 55  ? 51.064  37.957 35.277 1.00 21.38  ? 50  LEU A C   1 
ATOM   421  O  O   . LEU A 1 55  ? 50.446  36.888 35.239 1.00 20.78  ? 50  LEU A O   1 
ATOM   422  C  CB  . LEU A 1 55  ? 50.438  39.851 36.779 1.00 21.56  ? 50  LEU A CB  1 
ATOM   423  C  CG  . LEU A 1 55  ? 50.284  40.270 38.239 1.00 22.74  ? 50  LEU A CG  1 
ATOM   424  C  CD1 . LEU A 1 55  ? 49.694  41.657 38.336 1.00 18.09  ? 50  LEU A CD1 1 
ATOM   425  C  CD2 . LEU A 1 55  ? 49.420  39.235 38.955 1.00 21.65  ? 50  LEU A CD2 1 
ATOM   426  N  N   . ALA A 1 56  ? 51.497  38.570 34.184 1.00 21.03  ? 51  ALA A N   1 
ATOM   427  C  CA  . ALA A 1 56  ? 51.274  37.980 32.872 1.00 23.60  ? 51  ALA A CA  1 
ATOM   428  C  C   . ALA A 1 56  ? 51.787  36.535 32.852 1.00 24.54  ? 51  ALA A C   1 
ATOM   429  O  O   . ALA A 1 56  ? 51.147  35.637 32.293 1.00 24.91  ? 51  ALA A O   1 
ATOM   430  C  CB  . ALA A 1 56  ? 51.986  38.800 31.803 1.00 21.89  ? 51  ALA A CB  1 
ATOM   431  N  N   . HIS A 1 57  ? 52.934  36.301 33.474 1.00 23.96  ? 52  HIS A N   1 
ATOM   432  C  CA  . HIS A 1 57  ? 53.485  34.959 33.471 1.00 24.30  ? 52  HIS A CA  1 
ATOM   433  C  C   . HIS A 1 57  ? 52.637  33.977 34.282 1.00 23.88  ? 52  HIS A C   1 
ATOM   434  O  O   . HIS A 1 57  ? 52.351  32.873 33.820 1.00 23.72  ? 52  HIS A O   1 
ATOM   435  C  CB  . HIS A 1 57  ? 54.923  34.975 33.979 1.00 24.63  ? 52  HIS A CB  1 
ATOM   436  C  CG  . HIS A 1 57  ? 55.704  33.768 33.571 1.00 26.73  ? 52  HIS A CG  1 
ATOM   437  N  ND1 . HIS A 1 57  ? 55.939  33.450 32.249 1.00 26.83  ? 52  HIS A ND1 1 
ATOM   438  C  CD2 . HIS A 1 57  ? 56.258  32.773 34.303 1.00 23.54  ? 52  HIS A CD2 1 
ATOM   439  C  CE1 . HIS A 1 57  ? 56.600  32.311 32.186 1.00 24.44  ? 52  HIS A CE1 1 
ATOM   440  N  NE2 . HIS A 1 57  ? 56.804  31.878 33.417 1.00 24.24  ? 52  HIS A NE2 1 
ATOM   441  N  N   . LYS A 1 58  ? 52.221  34.374 35.480 1.00 23.59  ? 53  LYS A N   1 
ATOM   442  C  CA  . LYS A 1 58  ? 51.393  33.510 36.317 1.00 22.86  ? 53  LYS A CA  1 
ATOM   443  C  C   . LYS A 1 58  ? 50.075  33.225 35.617 1.00 22.73  ? 53  LYS A C   1 
ATOM   444  O  O   . LYS A 1 58  ? 49.579  32.102 35.638 1.00 23.86  ? 53  LYS A O   1 
ATOM   445  C  CB  . LYS A 1 58  ? 51.106  34.170 37.671 1.00 23.49  ? 53  LYS A CB  1 
ATOM   446  C  CG  . LYS A 1 58  ? 52.315  34.313 38.578 1.00 26.65  ? 53  LYS A CG  1 
ATOM   447  C  CD  . LYS A 1 58  ? 52.615  33.031 39.353 1.00 26.27  ? 53  LYS A CD  1 
ATOM   448  C  CE  . LYS A 1 58  ? 53.837  33.227 40.239 1.00 26.37  ? 53  LYS A CE  1 
ATOM   449  N  NZ  . LYS A 1 58  ? 54.257  31.980 40.938 1.00 28.52  ? 53  LYS A NZ  1 
ATOM   450  N  N   . ILE A 1 59  ? 49.503  34.241 34.986 1.00 24.39  ? 54  ILE A N   1 
ATOM   451  C  CA  . ILE A 1 59  ? 48.229  34.057 34.297 1.00 23.83  ? 54  ILE A CA  1 
ATOM   452  C  C   . ILE A 1 59  ? 48.365  33.033 33.171 1.00 24.35  ? 54  ILE A C   1 
ATOM   453  O  O   . ILE A 1 59  ? 47.428  32.275 32.899 1.00 24.22  ? 54  ILE A O   1 
ATOM   454  C  CB  . ILE A 1 59  ? 47.693  35.413 33.765 1.00 23.92  ? 54  ILE A CB  1 
ATOM   455  C  CG1 . ILE A 1 59  ? 47.415  36.334 34.961 1.00 23.08  ? 54  ILE A CG1 1 
ATOM   456  C  CG2 . ILE A 1 59  ? 46.419  35.209 32.925 1.00 20.15  ? 54  ILE A CG2 1 
ATOM   457  C  CD1 . ILE A 1 59  ? 46.880  37.713 34.586 1.00 23.77  ? 54  ILE A CD1 1 
ATOM   458  N  N   . GLN A 1 60  ? 49.535  32.994 32.535 1.00 24.87  ? 55  GLN A N   1 
ATOM   459  C  CA  . GLN A 1 60  ? 49.776  32.036 31.457 1.00 25.28  ? 55  GLN A CA  1 
ATOM   460  C  C   . GLN A 1 60  ? 50.200  30.667 32.001 1.00 26.94  ? 55  GLN A C   1 
ATOM   461  O  O   . GLN A 1 60  ? 50.652  29.805 31.244 1.00 29.18  ? 55  GLN A O   1 
ATOM   462  C  CB  . GLN A 1 60  ? 50.862  32.559 30.516 1.00 24.90  ? 55  GLN A CB  1 
ATOM   463  C  CG  . GLN A 1 60  ? 50.528  33.897 29.884 1.00 24.98  ? 55  GLN A CG  1 
ATOM   464  C  CD  . GLN A 1 60  ? 51.553  34.322 28.869 1.00 24.55  ? 55  GLN A CD  1 
ATOM   465  O  OE1 . GLN A 1 60  ? 52.739  34.012 29.004 1.00 24.64  ? 55  GLN A OE1 1 
ATOM   466  N  NE2 . GLN A 1 60  ? 51.111  35.054 27.848 1.00 26.34  ? 55  GLN A NE2 1 
ATOM   467  N  N   . SER A 1 61  ? 50.065  30.465 33.307 1.00 26.30  ? 56  SER A N   1 
ATOM   468  C  CA  . SER A 1 61  ? 50.450  29.197 33.913 1.00 26.44  ? 56  SER A CA  1 
ATOM   469  C  C   . SER A 1 61  ? 49.577  28.063 33.401 1.00 25.83  ? 56  SER A C   1 
ATOM   470  O  O   . SER A 1 61  ? 48.400  28.256 33.117 1.00 25.57  ? 56  SER A O   1 
ATOM   471  C  CB  . SER A 1 61  ? 50.319  29.265 35.434 1.00 26.35  ? 56  SER A CB  1 
ATOM   472  O  OG  . SER A 1 61  ? 50.429  27.960 35.984 1.00 26.83  ? 56  SER A OG  1 
ATOM   473  N  N   . PRO A 1 62  ? 50.141  26.853 33.279 1.00 25.02  ? 57  PRO A N   1 
ATOM   474  C  CA  . PRO A 1 62  ? 49.288  25.765 32.786 1.00 25.83  ? 57  PRO A CA  1 
ATOM   475  C  C   . PRO A 1 62  ? 48.361  25.240 33.882 1.00 25.85  ? 57  PRO A C   1 
ATOM   476  O  O   . PRO A 1 62  ? 47.400  24.527 33.615 1.00 27.60  ? 57  PRO A O   1 
ATOM   477  C  CB  . PRO A 1 62  ? 50.301  24.720 32.316 1.00 23.22  ? 57  PRO A CB  1 
ATOM   478  C  CG  . PRO A 1 62  ? 51.427  24.892 33.293 1.00 25.33  ? 57  PRO A CG  1 
ATOM   479  C  CD  . PRO A 1 62  ? 51.538  26.413 33.447 1.00 23.22  ? 57  PRO A CD  1 
ATOM   480  N  N   . GLN A 1 63  ? 48.656  25.618 35.119 1.00 27.49  ? 58  GLN A N   1 
ATOM   481  C  CA  . GLN A 1 63  ? 47.891  25.179 36.276 1.00 27.98  ? 58  GLN A CA  1 
ATOM   482  C  C   . GLN A 1 63  ? 46.751  26.171 36.540 1.00 27.54  ? 58  GLN A C   1 
ATOM   483  O  O   . GLN A 1 63  ? 46.986  27.332 36.885 1.00 26.08  ? 58  GLN A O   1 
ATOM   484  C  CB  . GLN A 1 63  ? 48.842  25.088 37.471 1.00 30.25  ? 58  GLN A CB  1 
ATOM   485  C  CG  . GLN A 1 63  ? 48.595  23.920 38.400 1.00 31.91  ? 58  GLN A CG  1 
ATOM   486  C  CD  . GLN A 1 63  ? 47.295  24.058 39.142 1.00 34.99  ? 58  GLN A CD  1 
ATOM   487  O  OE1 . GLN A 1 63  ? 46.225  23.702 38.639 1.00 35.14  ? 58  GLN A OE1 1 
ATOM   488  N  NE2 . GLN A 1 63  ? 47.371  24.607 40.349 1.00 36.41  ? 58  GLN A NE2 1 
ATOM   489  N  N   . GLU A 1 64  ? 45.518  25.692 36.390 1.00 27.75  ? 59  GLU A N   1 
ATOM   490  C  CA  . GLU A 1 64  ? 44.310  26.507 36.548 1.00 28.77  ? 59  GLU A CA  1 
ATOM   491  C  C   . GLU A 1 64  ? 44.157  27.408 37.780 1.00 27.33  ? 59  GLU A C   1 
ATOM   492  O  O   . GLU A 1 64  ? 43.979  28.620 37.653 1.00 27.16  ? 59  GLU A O   1 
ATOM   493  C  CB  . GLU A 1 64  ? 43.078  25.613 36.442 1.00 30.91  ? 59  GLU A CB  1 
ATOM   494  C  CG  . GLU A 1 64  ? 41.885  26.326 35.835 1.00 34.15  ? 59  GLU A CG  1 
ATOM   495  C  CD  . GLU A 1 64  ? 40.567  25.621 36.105 1.00 35.98  ? 59  GLU A CD  1 
ATOM   496  O  OE1 . GLU A 1 64  ? 40.522  24.721 36.982 1.00 37.48  ? 59  GLU A OE1 1 
ATOM   497  O  OE2 . GLU A 1 64  ? 39.569  25.983 35.446 1.00 36.58  ? 59  GLU A OE2 1 
ATOM   498  N  N   . TRP A 1 65  ? 44.198  26.823 38.969 1.00 26.50  ? 60  TRP A N   1 
ATOM   499  C  CA  . TRP A 1 65  ? 44.041  27.590 40.209 1.00 25.72  ? 60  TRP A CA  1 
ATOM   500  C  C   . TRP A 1 65  ? 45.074  28.714 40.357 1.00 25.15  ? 60  TRP A C   1 
ATOM   501  O  O   . TRP A 1 65  ? 44.781  29.785 40.909 1.00 24.96  ? 60  TRP A O   1 
ATOM   502  C  CB  . TRP A 1 65  ? 44.134  26.636 41.403 1.00 24.65  ? 60  TRP A CB  1 
ATOM   503  C  CG  . TRP A 1 65  ? 43.827  27.244 42.755 1.00 25.62  ? 60  TRP A CG  1 
ATOM   504  C  CD1 . TRP A 1 65  ? 44.396  26.890 43.950 1.00 25.61  ? 60  TRP A CD1 1 
ATOM   505  C  CD2 . TRP A 1 65  ? 42.847  28.249 43.064 1.00 24.51  ? 60  TRP A CD2 1 
ATOM   506  N  NE1 . TRP A 1 65  ? 43.835  27.605 44.976 1.00 24.06  ? 60  TRP A NE1 1 
ATOM   507  C  CE2 . TRP A 1 65  ? 42.880  28.447 44.463 1.00 26.41  ? 60  TRP A CE2 1 
ATOM   508  C  CE3 . TRP A 1 65  ? 41.941  28.999 42.298 1.00 24.79  ? 60  TRP A CE3 1 
ATOM   509  C  CZ2 . TRP A 1 65  ? 42.037  29.368 45.116 1.00 26.56  ? 60  TRP A CZ2 1 
ATOM   510  C  CZ3 . TRP A 1 65  ? 41.104  29.912 42.947 1.00 24.48  ? 60  TRP A CZ3 1 
ATOM   511  C  CH2 . TRP A 1 65  ? 41.161  30.086 44.343 1.00 24.41  ? 60  TRP A CH2 1 
ATOM   512  N  N   . GLU A 1 66  ? 46.282  28.470 39.866 1.00 24.90  ? 61  GLU A N   1 
ATOM   513  C  CA  . GLU A 1 66  ? 47.362  29.450 39.948 1.00 26.09  ? 61  GLU A CA  1 
ATOM   514  C  C   . GLU A 1 66  ? 47.060  30.634 39.021 1.00 25.61  ? 61  GLU A C   1 
ATOM   515  O  O   . GLU A 1 66  ? 47.184  31.812 39.402 1.00 23.66  ? 61  GLU A O   1 
ATOM   516  C  CB  . GLU A 1 66  ? 48.684  28.777 39.572 1.00 25.89  ? 61  GLU A CB  1 
ATOM   517  C  CG  . GLU A 1 66  ? 49.877  29.713 39.513 1.00 26.44  ? 61  GLU A CG  1 
ATOM   518  C  CD  . GLU A 1 66  ? 51.196  28.955 39.420 1.00 29.83  ? 61  GLU A CD  1 
ATOM   519  O  OE1 . GLU A 1 66  ? 51.492  28.393 38.340 1.00 29.12  ? 61  GLU A OE1 1 
ATOM   520  O  OE2 . GLU A 1 66  ? 51.933  28.912 40.434 1.00 29.76  ? 61  GLU A OE2 1 
ATOM   521  N  N   . ALA A 1 67  ? 46.642  30.311 37.805 1.00 24.55  ? 62  ALA A N   1 
ATOM   522  C  CA  . ALA A 1 67  ? 46.300  31.332 36.835 1.00 25.29  ? 62  ALA A CA  1 
ATOM   523  C  C   . ALA A 1 67  ? 45.109  32.171 37.318 1.00 25.43  ? 62  ALA A C   1 
ATOM   524  O  O   . ALA A 1 67  ? 45.129  33.400 37.202 1.00 27.11  ? 62  ALA A O   1 
ATOM   525  C  CB  . ALA A 1 67  ? 45.980  30.678 35.497 1.00 23.69  ? 62  ALA A CB  1 
ATOM   526  N  N   . LEU A 1 68  ? 44.088  31.509 37.864 1.00 24.26  ? 63  LEU A N   1 
ATOM   527  C  CA  . LEU A 1 68  ? 42.877  32.178 38.348 1.00 25.38  ? 63  LEU A CA  1 
ATOM   528  C  C   . LEU A 1 68  ? 43.185  33.155 39.472 1.00 25.53  ? 63  LEU A C   1 
ATOM   529  O  O   . LEU A 1 68  ? 42.733  34.301 39.460 1.00 26.12  ? 63  LEU A O   1 
ATOM   530  C  CB  . LEU A 1 68  ? 41.862  31.139 38.837 1.00 28.48  ? 63  LEU A CB  1 
ATOM   531  C  CG  . LEU A 1 68  ? 40.579  30.860 38.032 1.00 31.46  ? 63  LEU A CG  1 
ATOM   532  C  CD1 . LEU A 1 68  ? 40.551  31.664 36.729 1.00 32.38  ? 63  LEU A CD1 1 
ATOM   533  C  CD2 . LEU A 1 68  ? 40.470  29.363 37.762 1.00 28.47  ? 63  LEU A CD2 1 
ATOM   534  N  N   . GLN A 1 69  ? 43.955  32.704 40.451 1.00 24.65  ? 64  GLN A N   1 
ATOM   535  C  CA  . GLN A 1 69  ? 44.328  33.579 41.551 1.00 23.57  ? 64  GLN A CA  1 
ATOM   536  C  C   . GLN A 1 69  ? 45.168  34.736 40.997 1.00 24.41  ? 64  GLN A C   1 
ATOM   537  O  O   . GLN A 1 69  ? 45.107  35.867 41.499 1.00 23.91  ? 64  GLN A O   1 
ATOM   538  C  CB  . GLN A 1 69  ? 45.124  32.797 42.604 1.00 22.18  ? 64  GLN A CB  1 
ATOM   539  C  CG  . GLN A 1 69  ? 44.287  31.840 43.448 1.00 22.31  ? 64  GLN A CG  1 
ATOM   540  C  CD  . GLN A 1 69  ? 45.124  31.088 44.471 1.00 25.86  ? 64  GLN A CD  1 
ATOM   541  O  OE1 . GLN A 1 69  ? 45.542  29.945 44.245 1.00 28.26  ? 64  GLN A OE1 1 
ATOM   542  N  NE2 . GLN A 1 69  ? 45.387  31.731 45.598 1.00 26.04  ? 64  GLN A NE2 1 
ATOM   543  N  N   . ALA A 1 70  ? 45.961  34.455 39.964 1.00 23.95  ? 65  ALA A N   1 
ATOM   544  C  CA  . ALA A 1 70  ? 46.782  35.501 39.367 1.00 24.23  ? 65  ALA A CA  1 
ATOM   545  C  C   . ALA A 1 70  ? 45.856  36.564 38.802 1.00 24.79  ? 65  ALA A C   1 
ATOM   546  O  O   . ALA A 1 70  ? 46.125  37.762 38.913 1.00 24.21  ? 65  ALA A O   1 
ATOM   547  C  CB  . ALA A 1 70  ? 47.641  34.929 38.265 1.00 24.76  ? 65  ALA A CB  1 
ATOM   548  N  N   . LEU A 1 71  ? 44.759  36.119 38.194 1.00 24.29  ? 66  LEU A N   1 
ATOM   549  C  CA  . LEU A 1 71  ? 43.795  37.048 37.610 1.00 24.74  ? 66  LEU A CA  1 
ATOM   550  C  C   . LEU A 1 71  ? 43.096  37.862 38.689 1.00 25.64  ? 66  LEU A C   1 
ATOM   551  O  O   . LEU A 1 71  ? 42.675  38.992 38.443 1.00 27.40  ? 66  LEU A O   1 
ATOM   552  C  CB  . LEU A 1 71  ? 42.759  36.286 36.772 1.00 22.55  ? 66  LEU A CB  1 
ATOM   553  C  CG  . LEU A 1 71  ? 43.305  35.805 35.423 1.00 21.44  ? 66  LEU A CG  1 
ATOM   554  C  CD1 . LEU A 1 71  ? 42.385  34.760 34.820 1.00 21.79  ? 66  LEU A CD1 1 
ATOM   555  C  CD2 . LEU A 1 71  ? 43.467  36.990 34.497 1.00 18.00  ? 66  LEU A CD2 1 
ATOM   556  N  N   . THR A 1 72  ? 42.963  37.287 39.882 1.00 24.57  ? 67  THR A N   1 
ATOM   557  C  CA  . THR A 1 72  ? 42.328  37.988 40.985 1.00 24.16  ? 67  THR A CA  1 
ATOM   558  C  C   . THR A 1 72  ? 43.291  39.052 41.512 1.00 24.56  ? 67  THR A C   1 
ATOM   559  O  O   . THR A 1 72  ? 42.885  40.184 41.813 1.00 25.27  ? 67  THR A O   1 
ATOM   560  C  CB  . THR A 1 72  ? 41.944  37.001 42.104 1.00 24.60  ? 67  THR A CB  1 
ATOM   561  O  OG1 . THR A 1 72  ? 40.866  36.187 41.640 1.00 23.12  ? 67  THR A OG1 1 
ATOM   562  C  CG2 . THR A 1 72  ? 41.518  37.732 43.386 1.00 23.81  ? 67  THR A CG2 1 
ATOM   563  N  N   . VAL A 1 73  ? 44.564  38.685 41.625 1.00 24.03  ? 68  VAL A N   1 
ATOM   564  C  CA  . VAL A 1 73  ? 45.587  39.619 42.083 1.00 24.50  ? 68  VAL A CA  1 
ATOM   565  C  C   . VAL A 1 73  ? 45.669  40.770 41.079 1.00 25.45  ? 68  VAL A C   1 
ATOM   566  O  O   . VAL A 1 73  ? 45.741  41.939 41.466 1.00 27.45  ? 68  VAL A O   1 
ATOM   567  C  CB  . VAL A 1 73  ? 46.967  38.926 42.205 1.00 24.75  ? 68  VAL A CB  1 
ATOM   568  C  CG1 . VAL A 1 73  ? 48.054  39.962 42.487 1.00 20.79  ? 68  VAL A CG1 1 
ATOM   569  C  CG2 . VAL A 1 73  ? 46.920  37.885 43.336 1.00 20.22  ? 68  VAL A CG2 1 
ATOM   570  N  N   . LEU A 1 74  ? 45.641  40.442 39.790 1.00 24.79  ? 69  LEU A N   1 
ATOM   571  C  CA  . LEU A 1 74  ? 45.675  41.463 38.741 1.00 23.79  ? 69  LEU A CA  1 
ATOM   572  C  C   . LEU A 1 74  ? 44.495  42.427 38.934 1.00 25.64  ? 69  LEU A C   1 
ATOM   573  O  O   . LEU A 1 74  ? 44.614  43.640 38.736 1.00 25.45  ? 69  LEU A O   1 
ATOM   574  C  CB  . LEU A 1 74  ? 45.578  40.804 37.357 1.00 20.00  ? 69  LEU A CB  1 
ATOM   575  C  CG  . LEU A 1 74  ? 45.380  41.734 36.154 1.00 17.33  ? 69  LEU A CG  1 
ATOM   576  C  CD1 . LEU A 1 74  ? 46.496  42.759 36.119 1.00 16.45  ? 69  LEU A CD1 1 
ATOM   577  C  CD2 . LEU A 1 74  ? 45.335  40.917 34.858 1.00 13.77  ? 69  LEU A CD2 1 
ATOM   578  N  N   . GLU A 1 75  ? 43.351  41.881 39.326 1.00 28.21  ? 70  GLU A N   1 
ATOM   579  C  CA  . GLU A 1 75  ? 42.165  42.696 39.544 1.00 29.17  ? 70  GLU A CA  1 
ATOM   580  C  C   . GLU A 1 75  ? 42.421  43.597 40.749 1.00 28.50  ? 70  GLU A C   1 
ATOM   581  O  O   . GLU A 1 75  ? 42.206  44.804 40.684 1.00 29.63  ? 70  GLU A O   1 
ATOM   582  C  CB  . GLU A 1 75  ? 40.963  41.789 39.780 1.00 33.56  ? 70  GLU A CB  1 
ATOM   583  C  CG  . GLU A 1 75  ? 39.628  42.495 39.898 1.00 40.72  ? 70  GLU A CG  1 
ATOM   584  C  CD  . GLU A 1 75  ? 38.465  41.508 39.908 1.00 45.96  ? 70  GLU A CD  1 
ATOM   585  O  OE1 . GLU A 1 75  ? 38.506  40.531 40.700 1.00 48.22  ? 70  GLU A OE1 1 
ATOM   586  O  OE2 . GLU A 1 75  ? 37.509  41.712 39.126 1.00 48.69  ? 70  GLU A OE2 1 
ATOM   587  N  N   . ALA A 1 76  ? 42.913  43.019 41.839 1.00 27.41  ? 71  ALA A N   1 
ATOM   588  C  CA  . ALA A 1 76  ? 43.208  43.802 43.037 1.00 26.93  ? 71  ALA A CA  1 
ATOM   589  C  C   . ALA A 1 76  ? 44.153  44.966 42.718 1.00 27.16  ? 71  ALA A C   1 
ATOM   590  O  O   . ALA A 1 76  ? 43.959  46.096 43.198 1.00 25.61  ? 71  ALA A O   1 
ATOM   591  C  CB  . ALA A 1 76  ? 43.827  42.908 44.101 1.00 26.63  ? 71  ALA A CB  1 
ATOM   592  N  N   . CYS A 1 77  ? 45.179  44.691 41.913 1.00 25.90  ? 72  CYS A N   1 
ATOM   593  C  CA  . CYS A 1 77  ? 46.141  45.728 41.540 1.00 25.83  ? 72  CYS A CA  1 
ATOM   594  C  C   . CYS A 1 77  ? 45.497  46.853 40.741 1.00 24.83  ? 72  CYS A C   1 
ATOM   595  O  O   . CYS A 1 77  ? 45.882  48.005 40.864 1.00 24.65  ? 72  CYS A O   1 
ATOM   596  C  CB  . CYS A 1 77  ? 47.299  45.124 40.738 1.00 26.06  ? 72  CYS A CB  1 
ATOM   597  S  SG  . CYS A 1 77  ? 48.364  44.011 41.710 1.00 25.24  ? 72  CYS A SG  1 
HETATM 598  N  N   . MSE A 1 78  ? 44.520  46.527 39.908 1.00 26.86  ? 73  MSE A N   1 
HETATM 599  C  CA  . MSE A 1 78  ? 43.860  47.569 39.138 1.00 27.81  ? 73  MSE A CA  1 
HETATM 600  C  C   . MSE A 1 78  ? 43.133  48.516 40.094 1.00 29.51  ? 73  MSE A C   1 
HETATM 601  O  O   . MSE A 1 78  ? 43.134  49.730 39.894 1.00 28.21  ? 73  MSE A O   1 
HETATM 602  C  CB  . MSE A 1 78  ? 42.863  46.962 38.151 1.00 27.48  ? 73  MSE A CB  1 
HETATM 603  C  CG  . MSE A 1 78  ? 43.504  46.134 37.057 1.00 25.96  ? 73  MSE A CG  1 
HETATM 604  SE SE  . MSE A 1 78  ? 44.695  47.190 35.975 1.00 30.56  ? 73  MSE A SE  1 
HETATM 605  C  CE  . MSE A 1 78  ? 43.445  47.841 34.655 1.00 30.61  ? 73  MSE A CE  1 
ATOM   606  N  N   . LYS A 1 79  ? 42.536  47.979 41.154 1.00 30.50  ? 74  LYS A N   1 
ATOM   607  C  CA  . LYS A 1 79  ? 41.811  48.851 42.070 1.00 33.05  ? 74  LYS A CA  1 
ATOM   608  C  C   . LYS A 1 79  ? 42.651  49.454 43.192 1.00 32.60  ? 74  LYS A C   1 
ATOM   609  O  O   . LYS A 1 79  ? 42.204  50.388 43.858 1.00 32.05  ? 74  LYS A O   1 
ATOM   610  C  CB  . LYS A 1 79  ? 40.601  48.113 42.674 1.00 36.06  ? 74  LYS A CB  1 
ATOM   611  C  CG  . LYS A 1 79  ? 40.877  47.334 43.962 1.00 41.54  ? 74  LYS A CG  1 
ATOM   612  C  CD  . LYS A 1 79  ? 39.559  46.919 44.651 1.00 46.34  ? 74  LYS A CD  1 
ATOM   613  C  CE  . LYS A 1 79  ? 39.779  46.206 46.009 1.00 48.22  ? 74  LYS A CE  1 
ATOM   614  N  NZ  . LYS A 1 79  ? 40.430  44.851 45.929 1.00 45.48  ? 74  LYS A NZ  1 
ATOM   615  N  N   . ASN A 1 80  ? 43.869  48.948 43.392 1.00 33.60  ? 75  ASN A N   1 
ATOM   616  C  CA  . ASN A 1 80  ? 44.724  49.438 44.481 1.00 32.82  ? 75  ASN A CA  1 
ATOM   617  C  C   . ASN A 1 80  ? 46.082  50.029 44.117 1.00 31.33  ? 75  ASN A C   1 
ATOM   618  O  O   . ASN A 1 80  ? 46.801  50.477 45.009 1.00 31.01  ? 75  ASN A O   1 
ATOM   619  C  CB  . ASN A 1 80  ? 44.981  48.312 45.493 1.00 34.97  ? 75  ASN A CB  1 
ATOM   620  C  CG  . ASN A 1 80  ? 43.706  47.759 46.094 1.00 36.53  ? 75  ASN A CG  1 
ATOM   621  O  OD1 . ASN A 1 80  ? 42.915  48.493 46.680 1.00 38.99  ? 75  ASN A OD1 1 
ATOM   622  N  ND2 . ASN A 1 80  ? 43.502  46.455 45.953 1.00 38.86  ? 75  ASN A ND2 1 
ATOM   623  N  N   . CYS A 1 81  ? 46.443  50.051 42.836 1.00 29.55  ? 76  CYS A N   1 
ATOM   624  C  CA  . CYS A 1 81  ? 47.760  50.561 42.460 1.00 28.04  ? 76  CYS A CA  1 
ATOM   625  C  C   . CYS A 1 81  ? 47.803  51.828 41.605 1.00 27.71  ? 76  CYS A C   1 
ATOM   626  O  O   . CYS A 1 81  ? 48.868  52.228 41.124 1.00 24.74  ? 76  CYS A O   1 
ATOM   627  C  CB  . CYS A 1 81  ? 48.556  49.433 41.805 1.00 27.27  ? 76  CYS A CB  1 
ATOM   628  S  SG  . CYS A 1 81  ? 48.693  48.014 42.915 1.00 31.11  ? 76  CYS A SG  1 
ATOM   629  N  N   . GLY A 1 82  ? 46.639  52.452 41.434 1.00 27.68  ? 77  GLY A N   1 
ATOM   630  C  CA  . GLY A 1 82  ? 46.535  53.697 40.696 1.00 27.10  ? 77  GLY A CA  1 
ATOM   631  C  C   . GLY A 1 82  ? 46.892  53.727 39.225 1.00 29.15  ? 77  GLY A C   1 
ATOM   632  O  O   . GLY A 1 82  ? 47.179  52.693 38.604 1.00 29.37  ? 77  GLY A O   1 
ATOM   633  N  N   . ARG A 1 83  ? 46.867  54.940 38.674 1.00 29.82  ? 78  ARG A N   1 
ATOM   634  C  CA  . ARG A 1 83  ? 47.177  55.172 37.274 1.00 31.77  ? 78  ARG A CA  1 
ATOM   635  C  C   . ARG A 1 83  ? 48.515  54.564 36.880 1.00 32.21  ? 78  ARG A C   1 
ATOM   636  O  O   . ARG A 1 83  ? 48.637  53.963 35.805 1.00 33.42  ? 78  ARG A O   1 
ATOM   637  C  CB  . ARG A 1 83  ? 47.211  56.670 36.963 1.00 33.94  ? 78  ARG A CB  1 
ATOM   638  C  CG  . ARG A 1 83  ? 47.505  56.953 35.498 1.00 39.96  ? 78  ARG A CG  1 
ATOM   639  C  CD  . ARG A 1 83  ? 47.819  58.414 35.225 1.00 48.05  ? 78  ARG A CD  1 
ATOM   640  N  NE  . ARG A 1 83  ? 46.688  59.308 35.470 1.00 53.86  ? 78  ARG A NE  1 
ATOM   641  C  CZ  . ARG A 1 83  ? 46.706  60.617 35.213 1.00 57.33  ? 78  ARG A CZ  1 
ATOM   642  N  NH1 . ARG A 1 83  ? 47.796  61.182 34.701 1.00 57.54  ? 78  ARG A NH1 1 
ATOM   643  N  NH2 . ARG A 1 83  ? 45.637  61.366 35.472 1.00 58.84  ? 78  ARG A NH2 1 
ATOM   644  N  N   . ARG A 1 84  ? 49.520  54.716 37.740 1.00 30.50  ? 79  ARG A N   1 
ATOM   645  C  CA  . ARG A 1 84  ? 50.839  54.184 37.434 1.00 29.09  ? 79  ARG A CA  1 
ATOM   646  C  C   . ARG A 1 84  ? 50.750  52.700 37.047 1.00 28.65  ? 79  ARG A C   1 
ATOM   647  O  O   . ARG A 1 84  ? 51.460  52.237 36.149 1.00 27.60  ? 79  ARG A O   1 
ATOM   648  C  CB  . ARG A 1 84  ? 51.789  54.408 38.620 1.00 29.76  ? 79  ARG A CB  1 
ATOM   649  C  CG  . ARG A 1 84  ? 51.444  53.687 39.915 1.00 30.39  ? 79  ARG A CG  1 
ATOM   650  C  CD  . ARG A 1 84  ? 52.307  54.221 41.063 1.00 29.34  ? 79  ARG A CD  1 
ATOM   651  N  NE  . ARG A 1 84  ? 53.740  54.185 40.762 1.00 29.34  ? 79  ARG A NE  1 
ATOM   652  C  CZ  . ARG A 1 84  ? 54.590  53.272 41.231 1.00 28.77  ? 79  ARG A CZ  1 
ATOM   653  N  NH1 . ARG A 1 84  ? 54.156  52.303 42.031 1.00 27.74  ? 79  ARG A NH1 1 
ATOM   654  N  NH2 . ARG A 1 84  ? 55.883  53.337 40.917 1.00 28.47  ? 79  ARG A NH2 1 
ATOM   655  N  N   . PHE A 1 85  ? 49.860  51.963 37.700 1.00 26.56  ? 80  PHE A N   1 
ATOM   656  C  CA  . PHE A 1 85  ? 49.695  50.556 37.371 1.00 28.13  ? 80  PHE A CA  1 
ATOM   657  C  C   . PHE A 1 85  ? 48.858  50.433 36.087 1.00 29.23  ? 80  PHE A C   1 
ATOM   658  O  O   . PHE A 1 85  ? 49.215  49.686 35.166 1.00 28.26  ? 80  PHE A O   1 
ATOM   659  C  CB  . PHE A 1 85  ? 49.002  49.821 38.511 1.00 25.47  ? 80  PHE A CB  1 
ATOM   660  C  CG  . PHE A 1 85  ? 48.963  48.347 38.323 1.00 26.29  ? 80  PHE A CG  1 
ATOM   661  C  CD1 . PHE A 1 85  ? 50.120  47.587 38.466 1.00 27.30  ? 80  PHE A CD1 1 
ATOM   662  C  CD2 . PHE A 1 85  ? 47.785  47.712 37.931 1.00 27.02  ? 80  PHE A CD2 1 
ATOM   663  C  CE1 . PHE A 1 85  ? 50.109  46.207 38.216 1.00 26.66  ? 80  PHE A CE1 1 
ATOM   664  C  CE2 . PHE A 1 85  ? 47.762  46.341 37.679 1.00 25.07  ? 80  PHE A CE2 1 
ATOM   665  C  CZ  . PHE A 1 85  ? 48.927  45.587 37.821 1.00 27.21  ? 80  PHE A CZ  1 
ATOM   666  N  N   . HIS A 1 86  ? 47.748  51.173 36.030 1.00 30.62  ? 81  HIS A N   1 
ATOM   667  C  CA  . HIS A 1 86  ? 46.870  51.167 34.854 1.00 29.84  ? 81  HIS A CA  1 
ATOM   668  C  C   . HIS A 1 86  ? 47.670  51.398 33.577 1.00 28.83  ? 81  HIS A C   1 
ATOM   669  O  O   . HIS A 1 86  ? 47.464  50.728 32.562 1.00 27.11  ? 81  HIS A O   1 
ATOM   670  C  CB  . HIS A 1 86  ? 45.816  52.279 34.930 1.00 30.13  ? 81  HIS A CB  1 
ATOM   671  C  CG  . HIS A 1 86  ? 44.907  52.190 36.114 1.00 29.53  ? 81  HIS A CG  1 
ATOM   672  N  ND1 . HIS A 1 86  ? 44.702  51.021 36.813 1.00 29.66  ? 81  HIS A ND1 1 
ATOM   673  C  CD2 . HIS A 1 86  ? 44.135  53.129 36.711 1.00 30.10  ? 81  HIS A CD2 1 
ATOM   674  C  CE1 . HIS A 1 86  ? 43.846  51.244 37.795 1.00 29.39  ? 81  HIS A CE1 1 
ATOM   675  N  NE2 . HIS A 1 86  ? 43.486  52.514 37.755 1.00 30.01  ? 81  HIS A NE2 1 
ATOM   676  N  N   . ASN A 1 87  ? 48.581  52.360 33.641 1.00 28.73  ? 82  ASN A N   1 
ATOM   677  C  CA  . ASN A 1 87  ? 49.402  52.716 32.495 1.00 31.09  ? 82  ASN A CA  1 
ATOM   678  C  C   . ASN A 1 87  ? 50.303  51.603 31.966 1.00 32.10  ? 82  ASN A C   1 
ATOM   679  O  O   . ASN A 1 87  ? 50.645  51.596 30.781 1.00 34.11  ? 82  ASN A O   1 
ATOM   680  C  CB  . ASN A 1 87  ? 50.226  53.965 32.824 1.00 30.29  ? 82  ASN A CB  1 
ATOM   681  C  CG  . ASN A 1 87  ? 49.383  55.249 32.804 1.00 34.50  ? 82  ASN A CG  1 
ATOM   682  O  OD1 . ASN A 1 87  ? 49.864  56.319 33.171 1.00 38.13  ? 82  ASN A OD1 1 
ATOM   683  N  ND2 . ASN A 1 87  ? 48.127  55.144 32.363 1.00 32.61  ? 82  ASN A ND2 1 
ATOM   684  N  N   . GLU A 1 88  ? 50.689  50.661 32.820 1.00 32.14  ? 83  GLU A N   1 
ATOM   685  C  CA  . GLU A 1 88  ? 51.539  49.570 32.356 1.00 32.70  ? 83  GLU A CA  1 
ATOM   686  C  C   . GLU A 1 88  ? 50.680  48.465 31.750 1.00 31.61  ? 83  GLU A C   1 
ATOM   687  O  O   . GLU A 1 88  ? 51.095  47.810 30.800 1.00 32.43  ? 83  GLU A O   1 
ATOM   688  C  CB  . GLU A 1 88  ? 52.410  49.025 33.495 1.00 33.32  ? 83  GLU A CB  1 
ATOM   689  C  CG  . GLU A 1 88  ? 53.410  50.039 34.032 1.00 36.00  ? 83  GLU A CG  1 
ATOM   690  C  CD  . GLU A 1 88  ? 54.337  50.598 32.951 1.00 39.92  ? 83  GLU A CD  1 
ATOM   691  O  OE1 . GLU A 1 88  ? 54.719  49.845 32.025 1.00 41.18  ? 83  GLU A OE1 1 
ATOM   692  O  OE2 . GLU A 1 88  ? 54.696  51.797 33.037 1.00 40.72  ? 83  GLU A OE2 1 
ATOM   693  N  N   . VAL A 1 89  ? 49.481  48.272 32.290 1.00 30.57  ? 84  VAL A N   1 
ATOM   694  C  CA  . VAL A 1 89  ? 48.553  47.267 31.769 1.00 29.64  ? 84  VAL A CA  1 
ATOM   695  C  C   . VAL A 1 89  ? 48.025  47.740 30.402 1.00 30.84  ? 84  VAL A C   1 
ATOM   696  O  O   . VAL A 1 89  ? 47.670  46.933 29.544 1.00 30.21  ? 84  VAL A O   1 
ATOM   697  C  CB  . VAL A 1 89  ? 47.349  47.063 32.736 1.00 27.52  ? 84  VAL A CB  1 
ATOM   698  C  CG1 . VAL A 1 89  ? 46.269  46.233 32.079 1.00 27.15  ? 84  VAL A CG1 1 
ATOM   699  C  CG2 . VAL A 1 89  ? 47.811  46.373 33.997 1.00 27.55  ? 84  VAL A CG2 1 
ATOM   700  N  N   . GLY A 1 90  ? 47.994  49.056 30.208 1.00 31.58  ? 85  GLY A N   1 
ATOM   701  C  CA  . GLY A 1 90  ? 47.503  49.616 28.962 1.00 33.25  ? 85  GLY A CA  1 
ATOM   702  C  C   . GLY A 1 90  ? 48.500  49.638 27.816 1.00 34.83  ? 85  GLY A C   1 
ATOM   703  O  O   . GLY A 1 90  ? 48.337  50.406 26.863 1.00 36.00  ? 85  GLY A O   1 
ATOM   704  N  N   . LYS A 1 91  ? 49.537  48.811 27.911 1.00 35.72  ? 86  LYS A N   1 
ATOM   705  C  CA  . LYS A 1 91  ? 50.552  48.714 26.862 1.00 35.89  ? 86  LYS A CA  1 
ATOM   706  C  C   . LYS A 1 91  ? 50.431  47.338 26.238 1.00 34.82  ? 86  LYS A C   1 
ATOM   707  O  O   . LYS A 1 91  ? 50.156  46.362 26.938 1.00 36.76  ? 86  LYS A O   1 
ATOM   708  C  CB  . LYS A 1 91  ? 51.964  48.859 27.434 1.00 36.52  ? 86  LYS A CB  1 
ATOM   709  C  CG  . LYS A 1 91  ? 52.332  50.240 27.899 1.00 37.33  ? 86  LYS A CG  1 
ATOM   710  C  CD  . LYS A 1 91  ? 53.793  50.253 28.280 1.00 40.40  ? 86  LYS A CD  1 
ATOM   711  C  CE  . LYS A 1 91  ? 54.248  51.634 28.693 1.00 43.20  ? 86  LYS A CE  1 
ATOM   712  N  NZ  . LYS A 1 91  ? 53.600  52.048 29.959 1.00 46.20  ? 86  LYS A NZ  1 
ATOM   713  N  N   . PHE A 1 92  ? 50.653  47.258 24.930 1.00 33.40  ? 87  PHE A N   1 
ATOM   714  C  CA  . PHE A 1 92  ? 50.562  45.995 24.204 1.00 31.38  ? 87  PHE A CA  1 
ATOM   715  C  C   . PHE A 1 92  ? 51.574  45.000 24.733 1.00 31.68  ? 87  PHE A C   1 
ATOM   716  O  O   . PHE A 1 92  ? 51.386  43.784 24.638 1.00 31.85  ? 87  PHE A O   1 
ATOM   717  C  CB  . PHE A 1 92  ? 50.782  46.236 22.712 1.00 31.15  ? 87  PHE A CB  1 
ATOM   718  C  CG  . PHE A 1 92  ? 49.731  47.107 22.081 1.00 29.75  ? 87  PHE A CG  1 
ATOM   719  C  CD1 . PHE A 1 92  ? 48.382  46.864 22.316 1.00 29.56  ? 87  PHE A CD1 1 
ATOM   720  C  CD2 . PHE A 1 92  ? 50.091  48.174 21.265 1.00 29.51  ? 87  PHE A CD2 1 
ATOM   721  C  CE1 . PHE A 1 92  ? 47.400  47.673 21.747 1.00 32.09  ? 87  PHE A CE1 1 
ATOM   722  C  CE2 . PHE A 1 92  ? 49.119  48.995 20.688 1.00 31.50  ? 87  PHE A CE2 1 
ATOM   723  C  CZ  . PHE A 1 92  ? 47.770  48.746 20.928 1.00 31.68  ? 87  PHE A CZ  1 
ATOM   724  N  N   . ARG A 1 93  ? 52.652  45.529 25.289 1.00 32.11  ? 88  ARG A N   1 
ATOM   725  C  CA  . ARG A 1 93  ? 53.700  44.708 25.875 1.00 32.96  ? 88  ARG A CA  1 
ATOM   726  C  C   . ARG A 1 93  ? 53.043  43.761 26.900 1.00 31.09  ? 88  ARG A C   1 
ATOM   727  O  O   . ARG A 1 93  ? 53.444  42.601 27.032 1.00 31.95  ? 88  ARG A O   1 
ATOM   728  C  CB  . ARG A 1 93  ? 54.724  45.634 26.531 1.00 36.56  ? 88  ARG A CB  1 
ATOM   729  C  CG  . ARG A 1 93  ? 55.948  44.979 27.124 1.00 42.76  ? 88  ARG A CG  1 
ATOM   730  C  CD  . ARG A 1 93  ? 56.922  46.068 27.588 1.00 47.49  ? 88  ARG A CD  1 
ATOM   731  N  NE  . ARG A 1 93  ? 56.282  47.030 28.492 1.00 51.56  ? 88  ARG A NE  1 
ATOM   732  C  CZ  . ARG A 1 93  ? 56.841  48.164 28.915 1.00 54.18  ? 88  ARG A CZ  1 
ATOM   733  N  NH1 . ARG A 1 93  ? 58.066  48.502 28.518 1.00 55.80  ? 88  ARG A NH1 1 
ATOM   734  N  NH2 . ARG A 1 93  ? 56.181  48.961 29.749 1.00 54.49  ? 88  ARG A NH2 1 
ATOM   735  N  N   . PHE A 1 94  ? 52.028  44.249 27.617 1.00 28.39  ? 89  PHE A N   1 
ATOM   736  C  CA  . PHE A 1 94  ? 51.319  43.405 28.588 1.00 26.26  ? 89  PHE A CA  1 
ATOM   737  C  C   . PHE A 1 94  ? 50.094  42.732 27.956 1.00 25.39  ? 89  PHE A C   1 
ATOM   738  O  O   . PHE A 1 94  ? 49.877  41.529 28.115 1.00 25.71  ? 89  PHE A O   1 
ATOM   739  C  CB  . PHE A 1 94  ? 50.838  44.211 29.805 1.00 23.06  ? 89  PHE A CB  1 
ATOM   740  C  CG  . PHE A 1 94  ? 49.929  43.421 30.726 1.00 21.48  ? 89  PHE A CG  1 
ATOM   741  C  CD1 . PHE A 1 94  ? 50.422  42.335 31.450 1.00 20.58  ? 89  PHE A CD1 1 
ATOM   742  C  CD2 . PHE A 1 94  ? 48.567  43.724 30.823 1.00 20.25  ? 89  PHE A CD2 1 
ATOM   743  C  CE1 . PHE A 1 94  ? 49.569  41.551 32.263 1.00 20.48  ? 89  PHE A CE1 1 
ATOM   744  C  CE2 . PHE A 1 94  ? 47.702  42.950 31.630 1.00 19.26  ? 89  PHE A CE2 1 
ATOM   745  C  CZ  . PHE A 1 94  ? 48.208  41.858 32.352 1.00 18.98  ? 89  PHE A CZ  1 
ATOM   746  N  N   . LEU A 1 95  ? 49.290  43.518 27.254 1.00 24.83  ? 90  LEU A N   1 
ATOM   747  C  CA  . LEU A 1 95  ? 48.072  43.014 26.618 1.00 27.00  ? 90  LEU A CA  1 
ATOM   748  C  C   . LEU A 1 95  ? 48.291  41.833 25.653 1.00 28.25  ? 90  LEU A C   1 
ATOM   749  O  O   . LEU A 1 95  ? 47.446  40.938 25.567 1.00 29.34  ? 90  LEU A O   1 
ATOM   750  C  CB  . LEU A 1 95  ? 47.367  44.168 25.896 1.00 24.66  ? 90  LEU A CB  1 
ATOM   751  C  CG  . LEU A 1 95  ? 47.020  45.380 26.772 1.00 23.37  ? 90  LEU A CG  1 
ATOM   752  C  CD1 . LEU A 1 95  ? 46.631  46.596 25.911 1.00 19.66  ? 90  LEU A CD1 1 
ATOM   753  C  CD2 . LEU A 1 95  ? 45.872  44.991 27.715 1.00 23.01  ? 90  LEU A CD2 1 
ATOM   754  N  N   . ASN A 1 96  ? 49.413  41.817 24.935 1.00 29.34  ? 91  ASN A N   1 
ATOM   755  C  CA  . ASN A 1 96  ? 49.678  40.716 24.002 1.00 30.33  ? 91  ASN A CA  1 
ATOM   756  C  C   . ASN A 1 96  ? 49.824  39.416 24.766 1.00 30.90  ? 91  ASN A C   1 
ATOM   757  O  O   . ASN A 1 96  ? 49.575  38.339 24.225 1.00 31.93  ? 91  ASN A O   1 
ATOM   758  C  CB  . ASN A 1 96  ? 50.961  40.952 23.188 1.00 29.36  ? 91  ASN A CB  1 
ATOM   759  C  CG  . ASN A 1 96  ? 50.823  42.090 22.180 1.00 31.05  ? 91  ASN A CG  1 
ATOM   760  O  OD1 . ASN A 1 96  ? 49.726  42.390 21.703 1.00 30.87  ? 91  ASN A OD1 1 
ATOM   761  N  ND2 . ASN A 1 96  ? 51.945  42.719 21.841 1.00 31.69  ? 91  ASN A ND2 1 
ATOM   762  N  N   . GLU A 1 97  ? 50.231  39.517 26.026 1.00 31.04  ? 92  GLU A N   1 
ATOM   763  C  CA  . GLU A 1 97  ? 50.416  38.335 26.853 1.00 31.09  ? 92  GLU A CA  1 
ATOM   764  C  C   . GLU A 1 97  ? 49.084  37.725 27.238 1.00 30.78  ? 92  GLU A C   1 
ATOM   765  O  O   . GLU A 1 97  ? 48.980  36.507 27.393 1.00 29.88  ? 92  GLU A O   1 
ATOM   766  C  CB  . GLU A 1 97  ? 51.237  38.680 28.100 1.00 32.93  ? 92  GLU A CB  1 
ATOM   767  C  CG  . GLU A 1 97  ? 52.662  39.121 27.763 1.00 35.93  ? 92  GLU A CG  1 
ATOM   768  C  CD  . GLU A 1 97  ? 53.377  38.132 26.841 1.00 39.20  ? 92  GLU A CD  1 
ATOM   769  O  OE1 . GLU A 1 97  ? 53.322  36.905 27.102 1.00 39.81  ? 92  GLU A OE1 1 
ATOM   770  O  OE2 . GLU A 1 97  ? 53.999  38.586 25.852 1.00 41.15  ? 92  GLU A OE2 1 
ATOM   771  N  N   . LEU A 1 98  ? 48.065  38.571 27.393 1.00 31.05  ? 93  LEU A N   1 
ATOM   772  C  CA  . LEU A 1 98  ? 46.724  38.094 27.733 1.00 30.60  ? 93  LEU A CA  1 
ATOM   773  C  C   . LEU A 1 98  ? 46.104  37.486 26.486 1.00 30.62  ? 93  LEU A C   1 
ATOM   774  O  O   . LEU A 1 98  ? 45.396  36.477 26.545 1.00 30.01  ? 93  LEU A O   1 
ATOM   775  C  CB  . LEU A 1 98  ? 45.842  39.243 28.204 1.00 29.19  ? 93  LEU A CB  1 
ATOM   776  C  CG  . LEU A 1 98  ? 46.151  39.850 29.567 1.00 29.74  ? 93  LEU A CG  1 
ATOM   777  C  CD1 . LEU A 1 98  ? 45.098  40.910 29.862 1.00 27.90  ? 93  LEU A CD1 1 
ATOM   778  C  CD2 . LEU A 1 98  ? 46.163  38.771 30.653 1.00 24.59  ? 93  LEU A CD2 1 
ATOM   779  N  N   . ILE A 1 99  ? 46.383  38.119 25.354 1.00 31.04  ? 94  ILE A N   1 
ATOM   780  C  CA  . ILE A 1 99  ? 45.870  37.663 24.075 1.00 33.71  ? 94  ILE A CA  1 
ATOM   781  C  C   . ILE A 1 99  ? 46.336  36.238 23.766 1.00 34.11  ? 94  ILE A C   1 
ATOM   782  O  O   . ILE A 1 99  ? 45.581  35.445 23.188 1.00 34.73  ? 94  ILE A O   1 
ATOM   783  C  CB  . ILE A 1 99  ? 46.306  38.625 22.952 1.00 33.95  ? 94  ILE A CB  1 
ATOM   784  C  CG1 . ILE A 1 99  ? 45.658  39.996 23.188 1.00 31.63  ? 94  ILE A CG1 1 
ATOM   785  C  CG2 . ILE A 1 99  ? 45.909  38.065 21.591 1.00 34.38  ? 94  ILE A CG2 1 
ATOM   786  C  CD1 . ILE A 1 99  ? 46.224  41.110 22.339 1.00 32.65  ? 94  ILE A CD1 1 
ATOM   787  N  N   . LYS A 1 100 ? 47.563  35.906 24.162 1.00 33.98  ? 95  LYS A N   1 
ATOM   788  C  CA  . LYS A 1 100 ? 48.093  34.560 23.928 1.00 33.95  ? 95  LYS A CA  1 
ATOM   789  C  C   . LYS A 1 100 ? 47.284  33.526 24.715 1.00 33.34  ? 95  LYS A C   1 
ATOM   790  O  O   . LYS A 1 100 ? 47.105  32.393 24.273 1.00 34.08  ? 95  LYS A O   1 
ATOM   791  C  CB  . LYS A 1 100 ? 49.560  34.465 24.363 1.00 33.53  ? 95  LYS A CB  1 
ATOM   792  C  CG  . LYS A 1 100 ? 50.560  35.259 23.534 1.00 33.69  ? 95  LYS A CG  1 
ATOM   793  C  CD  . LYS A 1 100 ? 51.968  35.070 24.118 1.00 35.15  ? 95  LYS A CD  1 
ATOM   794  C  CE  . LYS A 1 100 ? 53.047  35.709 23.257 1.00 36.12  ? 95  LYS A CE  1 
ATOM   795  N  NZ  . LYS A 1 100 ? 52.804  37.165 23.058 1.00 39.99  ? 95  LYS A NZ  1 
ATOM   796  N  N   . VAL A 1 101 ? 46.810  33.924 25.890 1.00 32.50  ? 96  VAL A N   1 
ATOM   797  C  CA  . VAL A 1 101 ? 46.032  33.041 26.746 1.00 33.27  ? 96  VAL A CA  1 
ATOM   798  C  C   . VAL A 1 101 ? 44.714  32.636 26.097 1.00 35.09  ? 96  VAL A C   1 
ATOM   799  O  O   . VAL A 1 101 ? 44.288  31.490 26.234 1.00 37.48  ? 96  VAL A O   1 
ATOM   800  C  CB  . VAL A 1 101 ? 45.720  33.718 28.112 1.00 31.88  ? 96  VAL A CB  1 
ATOM   801  C  CG1 . VAL A 1 101 ? 44.851  32.803 28.973 1.00 30.72  ? 96  VAL A CG1 1 
ATOM   802  C  CG2 . VAL A 1 101 ? 47.014  34.030 28.839 1.00 31.29  ? 96  VAL A CG2 1 
ATOM   803  N  N   . VAL A 1 102 ? 44.078  33.570 25.387 1.00 35.56  ? 97  VAL A N   1 
ATOM   804  C  CA  . VAL A 1 102 ? 42.793  33.310 24.741 1.00 36.91  ? 97  VAL A CA  1 
ATOM   805  C  C   . VAL A 1 102 ? 42.828  32.918 23.252 1.00 38.86  ? 97  VAL A C   1 
ATOM   806  O  O   . VAL A 1 102 ? 41.873  32.321 22.751 1.00 38.33  ? 97  VAL A O   1 
ATOM   807  C  CB  . VAL A 1 102 ? 41.836  34.525 24.898 1.00 36.21  ? 97  VAL A CB  1 
ATOM   808  C  CG1 . VAL A 1 102 ? 41.713  34.903 26.366 1.00 38.08  ? 97  VAL A CG1 1 
ATOM   809  C  CG2 . VAL A 1 102 ? 42.337  35.703 24.090 1.00 34.47  ? 97  VAL A CG2 1 
ATOM   810  N  N   . SER A 1 103 ? 43.900  33.255 22.540 1.00 39.82  ? 98  SER A N   1 
ATOM   811  C  CA  . SER A 1 103 ? 43.984  32.898 21.128 1.00 41.89  ? 98  SER A CA  1 
ATOM   812  C  C   . SER A 1 103 ? 44.475  31.468 20.940 1.00 43.90  ? 98  SER A C   1 
ATOM   813  O  O   . SER A 1 103 ? 45.514  31.085 21.480 1.00 44.87  ? 98  SER A O   1 
ATOM   814  C  CB  . SER A 1 103 ? 44.925  33.839 20.378 1.00 43.04  ? 98  SER A CB  1 
ATOM   815  O  OG  . SER A 1 103 ? 45.191  33.327 19.079 1.00 42.61  ? 98  SER A OG  1 
ATOM   816  N  N   . PRO A 1 104 ? 43.727  30.656 20.173 1.00 45.23  ? 99  PRO A N   1 
ATOM   817  C  CA  . PRO A 1 104 ? 44.087  29.256 19.907 1.00 46.02  ? 99  PRO A CA  1 
ATOM   818  C  C   . PRO A 1 104 ? 45.440  29.107 19.209 1.00 46.92  ? 99  PRO A C   1 
ATOM   819  O  O   . PRO A 1 104 ? 46.106  28.077 19.342 1.00 47.00  ? 99  PRO A O   1 
ATOM   820  C  CB  . PRO A 1 104 ? 42.933  28.766 19.042 1.00 46.26  ? 99  PRO A CB  1 
ATOM   821  C  CG  . PRO A 1 104 ? 41.766  29.559 19.588 1.00 46.58  ? 99  PRO A CG  1 
ATOM   822  C  CD  . PRO A 1 104 ? 42.360  30.943 19.703 1.00 44.55  ? 99  PRO A CD  1 
ATOM   823  N  N   . LYS A 1 105 ? 45.838  30.140 18.470 1.00 47.15  ? 100 LYS A N   1 
ATOM   824  C  CA  . LYS A 1 105 ? 47.113  30.137 17.763 1.00 47.96  ? 100 LYS A CA  1 
ATOM   825  C  C   . LYS A 1 105 ? 48.289  30.188 18.739 1.00 47.29  ? 100 LYS A C   1 
ATOM   826  O  O   . LYS A 1 105 ? 49.450  30.059 18.333 1.00 46.64  ? 100 LYS A O   1 
ATOM   827  C  CB  . LYS A 1 105 ? 47.201  31.332 16.805 1.00 51.17  ? 100 LYS A CB  1 
ATOM   828  C  CG  . LYS A 1 105 ? 48.538  31.420 16.055 1.00 56.19  ? 100 LYS A CG  1 
ATOM   829  C  CD  . LYS A 1 105 ? 48.719  32.757 15.332 1.00 59.11  ? 100 LYS A CD  1 
ATOM   830  C  CE  . LYS A 1 105 ? 50.083  32.838 14.649 1.00 59.88  ? 100 LYS A CE  1 
ATOM   831  N  NZ  . LYS A 1 105 ? 50.295  34.171 14.006 1.00 61.20  ? 100 LYS A NZ  1 
ATOM   832  N  N   . TYR A 1 106 ? 47.992  30.400 20.020 1.00 46.31  ? 101 TYR A N   1 
ATOM   833  C  CA  . TYR A 1 106 ? 49.036  30.439 21.041 1.00 45.62  ? 101 TYR A CA  1 
ATOM   834  C  C   . TYR A 1 106 ? 48.698  29.466 22.169 1.00 46.04  ? 101 TYR A C   1 
ATOM   835  O  O   . TYR A 1 106 ? 48.549  28.267 21.918 1.00 46.64  ? 101 TYR A O   1 
ATOM   836  C  CB  . TYR A 1 106 ? 49.230  31.864 21.574 1.00 45.12  ? 101 TYR A CB  1 
ATOM   837  C  CG  . TYR A 1 106 ? 49.642  32.845 20.494 1.00 44.44  ? 101 TYR A CG  1 
ATOM   838  C  CD1 . TYR A 1 106 ? 48.688  33.444 19.671 1.00 44.89  ? 101 TYR A CD1 1 
ATOM   839  C  CD2 . TYR A 1 106 ? 50.984  33.105 20.235 1.00 44.02  ? 101 TYR A CD2 1 
ATOM   840  C  CE1 . TYR A 1 106 ? 49.061  34.268 18.614 1.00 44.24  ? 101 TYR A CE1 1 
ATOM   841  C  CE2 . TYR A 1 106 ? 51.366  33.929 19.177 1.00 44.33  ? 101 TYR A CE2 1 
ATOM   842  C  CZ  . TYR A 1 106 ? 50.396  34.501 18.368 1.00 44.73  ? 101 TYR A CZ  1 
ATOM   843  O  OH  . TYR A 1 106 ? 50.755  35.271 17.284 1.00 46.79  ? 101 TYR A OH  1 
ATOM   844  N  N   . LEU A 1 107 ? 48.567  29.955 23.400 1.00 45.24  ? 102 LEU A N   1 
ATOM   845  C  CA  . LEU A 1 107 ? 48.252  29.067 24.525 1.00 44.67  ? 102 LEU A CA  1 
ATOM   846  C  C   . LEU A 1 107 ? 46.783  28.637 24.545 1.00 42.87  ? 102 LEU A C   1 
ATOM   847  O  O   . LEU A 1 107 ? 46.418  27.661 25.196 1.00 40.27  ? 102 LEU A O   1 
ATOM   848  C  CB  . LEU A 1 107 ? 48.597  29.757 25.847 1.00 43.41  ? 102 LEU A CB  1 
ATOM   849  C  CG  . LEU A 1 107 ? 50.024  30.298 25.959 1.00 43.98  ? 102 LEU A CG  1 
ATOM   850  C  CD1 . LEU A 1 107 ? 50.184  30.990 27.302 1.00 43.15  ? 102 LEU A CD1 1 
ATOM   851  C  CD2 . LEU A 1 107 ? 51.035  29.165 25.811 1.00 42.63  ? 102 LEU A CD2 1 
ATOM   852  N  N   . GLY A 1 108 ? 45.966  29.384 23.810 1.00 44.07  ? 103 GLY A N   1 
ATOM   853  C  CA  . GLY A 1 108 ? 44.532  29.155 23.723 1.00 45.44  ? 103 GLY A CA  1 
ATOM   854  C  C   . GLY A 1 108 ? 43.942  27.768 23.896 1.00 46.10  ? 103 GLY A C   1 
ATOM   855  O  O   . GLY A 1 108 ? 42.934  27.613 24.583 1.00 45.17  ? 103 GLY A O   1 
ATOM   856  N  N   . ASP A 1 109 ? 44.552  26.762 23.281 1.00 47.66  ? 104 ASP A N   1 
ATOM   857  C  CA  . ASP A 1 109 ? 44.032  25.404 23.366 1.00 49.92  ? 104 ASP A CA  1 
ATOM   858  C  C   . ASP A 1 109 ? 44.316  24.651 24.664 1.00 50.48  ? 104 ASP A C   1 
ATOM   859  O  O   . ASP A 1 109 ? 43.630  23.677 24.968 1.00 49.75  ? 104 ASP A O   1 
ATOM   860  C  CB  . ASP A 1 109 ? 44.520  24.582 22.167 1.00 53.35  ? 104 ASP A CB  1 
ATOM   861  C  CG  . ASP A 1 109 ? 44.033  25.145 20.835 1.00 55.61  ? 104 ASP A CG  1 
ATOM   862  O  OD1 . ASP A 1 109 ? 42.810  25.362 20.692 1.00 56.25  ? 104 ASP A OD1 1 
ATOM   863  O  OD2 . ASP A 1 109 ? 44.869  25.367 19.931 1.00 56.42  ? 104 ASP A OD2 1 
ATOM   864  N  N   . ARG A 1 110 ? 45.311  25.082 25.435 1.00 51.20  ? 105 ARG A N   1 
ATOM   865  C  CA  . ARG A 1 110 ? 45.600  24.396 26.695 1.00 51.83  ? 105 ARG A CA  1 
ATOM   866  C  C   . ARG A 1 110 ? 45.296  25.234 27.941 1.00 49.91  ? 105 ARG A C   1 
ATOM   867  O  O   . ARG A 1 110 ? 45.951  25.086 28.978 1.00 50.85  ? 105 ARG A O   1 
ATOM   868  C  CB  . ARG A 1 110 ? 47.055  23.920 26.737 1.00 54.70  ? 105 ARG A CB  1 
ATOM   869  C  CG  . ARG A 1 110 ? 47.355  22.712 25.851 1.00 58.76  ? 105 ARG A CG  1 
ATOM   870  C  CD  . ARG A 1 110 ? 48.752  22.178 26.142 1.00 62.25  ? 105 ARG A CD  1 
ATOM   871  N  NE  . ARG A 1 110 ? 49.754  23.243 26.087 1.00 66.01  ? 105 ARG A NE  1 
ATOM   872  C  CZ  . ARG A 1 110 ? 51.029  23.105 26.445 1.00 67.60  ? 105 ARG A CZ  1 
ATOM   873  N  NH1 . ARG A 1 110 ? 51.479  21.937 26.895 1.00 68.83  ? 105 ARG A NH1 1 
ATOM   874  N  NH2 . ARG A 1 110 ? 51.858  24.137 26.345 1.00 68.37  ? 105 ARG A NH2 1 
ATOM   875  N  N   . VAL A 1 111 ? 44.297  26.105 27.834 1.00 46.38  ? 106 VAL A N   1 
ATOM   876  C  CA  . VAL A 1 111 ? 43.884  26.957 28.948 1.00 42.87  ? 106 VAL A CA  1 
ATOM   877  C  C   . VAL A 1 111 ? 42.399  26.710 29.214 1.00 42.07  ? 106 VAL A C   1 
ATOM   878  O  O   . VAL A 1 111 ? 41.584  26.765 28.292 1.00 41.96  ? 106 VAL A O   1 
ATOM   879  C  CB  . VAL A 1 111 ? 44.095  28.455 28.610 1.00 42.57  ? 106 VAL A CB  1 
ATOM   880  C  CG1 . VAL A 1 111 ? 43.509  29.332 29.710 1.00 40.76  ? 106 VAL A CG1 1 
ATOM   881  C  CG2 . VAL A 1 111 ? 45.578  28.748 28.435 1.00 39.67  ? 106 VAL A CG2 1 
ATOM   882  N  N   . SER A 1 112 ? 42.043  26.439 30.467 1.00 41.15  ? 107 SER A N   1 
ATOM   883  C  CA  . SER A 1 112 ? 40.646  26.183 30.815 1.00 42.29  ? 107 SER A CA  1 
ATOM   884  C  C   . SER A 1 112 ? 39.743  27.315 30.336 1.00 42.86  ? 107 SER A C   1 
ATOM   885  O  O   . SER A 1 112 ? 40.211  28.418 30.047 1.00 42.41  ? 107 SER A O   1 
ATOM   886  C  CB  . SER A 1 112 ? 40.482  26.013 32.331 1.00 42.17  ? 107 SER A CB  1 
ATOM   887  O  OG  . SER A 1 112 ? 40.747  27.222 33.024 1.00 43.15  ? 107 SER A OG  1 
ATOM   888  N  N   . GLU A 1 113 ? 38.448  27.039 30.256 1.00 43.53  ? 108 GLU A N   1 
ATOM   889  C  CA  . GLU A 1 113 ? 37.499  28.042 29.806 1.00 45.02  ? 108 GLU A CA  1 
ATOM   890  C  C   . GLU A 1 113 ? 37.306  29.101 30.894 1.00 43.50  ? 108 GLU A C   1 
ATOM   891  O  O   . GLU A 1 113 ? 37.054  30.273 30.590 1.00 42.33  ? 108 GLU A O   1 
ATOM   892  C  CB  . GLU A 1 113 ? 36.164  27.382 29.450 1.00 48.39  ? 108 GLU A CB  1 
ATOM   893  C  CG  . GLU A 1 113 ? 35.189  28.300 28.705 1.00 56.15  ? 108 GLU A CG  1 
ATOM   894  C  CD  . GLU A 1 113 ? 35.773  28.876 27.409 1.00 60.32  ? 108 GLU A CD  1 
ATOM   895  O  OE1 . GLU A 1 113 ? 36.292  28.090 26.576 1.00 60.77  ? 108 GLU A OE1 1 
ATOM   896  O  OE2 . GLU A 1 113 ? 35.701  30.117 27.224 1.00 61.69  ? 108 GLU A OE2 1 
ATOM   897  N  N   . LYS A 1 114 ? 37.425  28.686 32.155 1.00 40.94  ? 109 LYS A N   1 
ATOM   898  C  CA  . LYS A 1 114 ? 37.289  29.617 33.272 1.00 39.90  ? 109 LYS A CA  1 
ATOM   899  C  C   . LYS A 1 114 ? 38.281  30.770 33.105 1.00 39.01  ? 109 LYS A C   1 
ATOM   900  O  O   . LYS A 1 114 ? 37.904  31.945 33.143 1.00 39.28  ? 109 LYS A O   1 
ATOM   901  C  CB  . LYS A 1 114 ? 37.579  28.918 34.604 1.00 38.78  ? 109 LYS A CB  1 
ATOM   902  C  CG  . LYS A 1 114 ? 36.416  28.195 35.232 1.00 41.33  ? 109 LYS A CG  1 
ATOM   903  C  CD  . LYS A 1 114 ? 36.772  27.766 36.660 1.00 45.42  ? 109 LYS A CD  1 
ATOM   904  C  CE  . LYS A 1 114 ? 35.604  27.059 37.359 1.00 49.38  ? 109 LYS A CE  1 
ATOM   905  N  NZ  . LYS A 1 114 ? 35.888  26.737 38.798 1.00 49.43  ? 109 LYS A NZ  1 
ATOM   906  N  N   . VAL A 1 115 ? 39.552  30.417 32.922 1.00 37.64  ? 110 VAL A N   1 
ATOM   907  C  CA  . VAL A 1 115 ? 40.625  31.396 32.757 1.00 37.10  ? 110 VAL A CA  1 
ATOM   908  C  C   . VAL A 1 115 ? 40.367  32.355 31.595 1.00 36.72  ? 110 VAL A C   1 
ATOM   909  O  O   . VAL A 1 115 ? 40.386  33.576 31.770 1.00 37.06  ? 110 VAL A O   1 
ATOM   910  C  CB  . VAL A 1 115 ? 41.995  30.688 32.537 1.00 35.58  ? 110 VAL A CB  1 
ATOM   911  C  CG1 . VAL A 1 115 ? 43.084  31.717 32.275 1.00 33.62  ? 110 VAL A CG1 1 
ATOM   912  C  CG2 . VAL A 1 115 ? 42.344  29.840 33.756 1.00 33.19  ? 110 VAL A CG2 1 
ATOM   913  N  N   . LYS A 1 116 ? 40.118  31.798 30.414 1.00 36.67  ? 111 LYS A N   1 
ATOM   914  C  CA  . LYS A 1 116 ? 39.857  32.602 29.222 1.00 37.02  ? 111 LYS A CA  1 
ATOM   915  C  C   . LYS A 1 116 ? 38.662  33.536 29.355 1.00 35.64  ? 111 LYS A C   1 
ATOM   916  O  O   . LYS A 1 116 ? 38.718  34.676 28.890 1.00 36.54  ? 111 LYS A O   1 
ATOM   917  C  CB  . LYS A 1 116 ? 39.686  31.693 27.995 1.00 38.13  ? 111 LYS A CB  1 
ATOM   918  C  CG  . LYS A 1 116 ? 41.009  31.086 27.514 1.00 40.56  ? 111 LYS A CG  1 
ATOM   919  C  CD  . LYS A 1 116 ? 40.864  30.277 26.237 1.00 41.49  ? 111 LYS A CD  1 
ATOM   920  C  CE  . LYS A 1 116 ? 40.175  28.938 26.473 1.00 41.22  ? 111 LYS A CE  1 
ATOM   921  N  NZ  . LYS A 1 116 ? 40.101  28.149 25.206 1.00 39.40  ? 111 LYS A NZ  1 
ATOM   922  N  N   . THR A 1 117 ? 37.583  33.080 29.987 1.00 33.85  ? 112 THR A N   1 
ATOM   923  C  CA  . THR A 1 117 ? 36.426  33.957 30.145 1.00 34.46  ? 112 THR A CA  1 
ATOM   924  C  C   . THR A 1 117 ? 36.693  35.066 31.177 1.00 32.65  ? 112 THR A C   1 
ATOM   925  O  O   . THR A 1 117 ? 36.252  36.203 30.994 1.00 32.04  ? 112 THR A O   1 
ATOM   926  C  CB  . THR A 1 117 ? 35.144  33.164 30.522 1.00 34.74  ? 112 THR A CB  1 
ATOM   927  O  OG1 . THR A 1 117 ? 35.334  32.474 31.761 1.00 37.44  ? 112 THR A OG1 1 
ATOM   928  C  CG2 . THR A 1 117 ? 34.825  32.159 29.434 1.00 35.92  ? 112 THR A CG2 1 
ATOM   929  N  N   . LYS A 1 118 ? 37.425  34.743 32.244 1.00 30.17  ? 113 LYS A N   1 
ATOM   930  C  CA  . LYS A 1 118 ? 37.760  35.741 33.261 1.00 29.02  ? 113 LYS A CA  1 
ATOM   931  C  C   . LYS A 1 118 ? 38.641  36.808 32.618 1.00 26.76  ? 113 LYS A C   1 
ATOM   932  O  O   . LYS A 1 118 ? 38.507  37.998 32.905 1.00 26.89  ? 113 LYS A O   1 
ATOM   933  C  CB  . LYS A 1 118 ? 38.507  35.097 34.432 1.00 30.79  ? 113 LYS A CB  1 
ATOM   934  C  CG  . LYS A 1 118 ? 38.782  36.044 35.602 1.00 34.89  ? 113 LYS A CG  1 
ATOM   935  C  CD  . LYS A 1 118 ? 37.491  36.499 36.284 1.00 39.39  ? 113 LYS A CD  1 
ATOM   936  C  CE  . LYS A 1 118 ? 37.770  37.374 37.507 1.00 41.66  ? 113 LYS A CE  1 
ATOM   937  N  NZ  . LYS A 1 118 ? 36.542  37.517 38.361 1.00 43.86  ? 113 LYS A NZ  1 
ATOM   938  N  N   . VAL A 1 119 ? 39.545  36.378 31.743 1.00 24.39  ? 114 VAL A N   1 
ATOM   939  C  CA  . VAL A 1 119 ? 40.419  37.312 31.042 1.00 23.32  ? 114 VAL A CA  1 
ATOM   940  C  C   . VAL A 1 119 ? 39.593  38.237 30.147 1.00 24.85  ? 114 VAL A C   1 
ATOM   941  O  O   . VAL A 1 119 ? 39.847  39.444 30.097 1.00 24.61  ? 114 VAL A O   1 
ATOM   942  C  CB  . VAL A 1 119 ? 41.453  36.569 30.170 1.00 22.77  ? 114 VAL A CB  1 
ATOM   943  C  CG1 . VAL A 1 119 ? 42.192  37.563 29.269 1.00 20.43  ? 114 VAL A CG1 1 
ATOM   944  C  CG2 . VAL A 1 119 ? 42.450  35.809 31.070 1.00 21.19  ? 114 VAL A CG2 1 
ATOM   945  N  N   . ILE A 1 120 ? 38.602  37.673 29.449 1.00 24.50  ? 115 ILE A N   1 
ATOM   946  C  CA  . ILE A 1 120 ? 37.740  38.454 28.560 1.00 24.73  ? 115 ILE A CA  1 
ATOM   947  C  C   . ILE A 1 120 ? 36.934  39.443 29.391 1.00 25.04  ? 115 ILE A C   1 
ATOM   948  O  O   . ILE A 1 120 ? 36.838  40.626 29.065 1.00 24.17  ? 115 ILE A O   1 
ATOM   949  C  CB  . ILE A 1 120 ? 36.751  37.543 27.780 1.00 26.94  ? 115 ILE A CB  1 
ATOM   950  C  CG1 . ILE A 1 120 ? 37.526  36.578 26.878 1.00 26.22  ? 115 ILE A CG1 1 
ATOM   951  C  CG2 . ILE A 1 120 ? 35.778  38.395 26.963 1.00 25.87  ? 115 ILE A CG2 1 
ATOM   952  C  CD1 . ILE A 1 120 ? 38.498  37.271 25.913 1.00 27.46  ? 115 ILE A CD1 1 
ATOM   953  N  N   . GLU A 1 121 ? 36.347  38.946 30.469 1.00 26.13  ? 116 GLU A N   1 
ATOM   954  C  CA  . GLU A 1 121 ? 35.570  39.785 31.369 1.00 27.85  ? 116 GLU A CA  1 
ATOM   955  C  C   . GLU A 1 121 ? 36.410  40.965 31.904 1.00 28.98  ? 116 GLU A C   1 
ATOM   956  O  O   . GLU A 1 121 ? 35.921  42.101 32.004 1.00 28.83  ? 116 GLU A O   1 
ATOM   957  C  CB  . GLU A 1 121 ? 35.063  38.922 32.514 1.00 30.44  ? 116 GLU A CB  1 
ATOM   958  C  CG  . GLU A 1 121 ? 34.455  39.688 33.656 1.00 36.07  ? 116 GLU A CG  1 
ATOM   959  C  CD  . GLU A 1 121 ? 34.605  38.934 34.945 1.00 38.18  ? 116 GLU A CD  1 
ATOM   960  O  OE1 . GLU A 1 121 ? 34.041  37.819 35.038 1.00 40.55  ? 116 GLU A OE1 1 
ATOM   961  O  OE2 . GLU A 1 121 ? 35.303  39.448 35.850 1.00 39.43  ? 116 GLU A OE2 1 
ATOM   962  N  N   . LEU A 1 122 ? 37.672  40.710 32.243 1.00 28.02  ? 117 LEU A N   1 
ATOM   963  C  CA  . LEU A 1 122 ? 38.533  41.785 32.731 1.00 28.49  ? 117 LEU A CA  1 
ATOM   964  C  C   . LEU A 1 122 ? 38.826  42.818 31.639 1.00 28.78  ? 117 LEU A C   1 
ATOM   965  O  O   . LEU A 1 122 ? 38.710  44.030 31.858 1.00 28.52  ? 117 LEU A O   1 
ATOM   966  C  CB  . LEU A 1 122 ? 39.861  41.230 33.254 1.00 28.22  ? 117 LEU A CB  1 
ATOM   967  C  CG  . LEU A 1 122 ? 39.829  40.436 34.562 1.00 30.42  ? 117 LEU A CG  1 
ATOM   968  C  CD1 . LEU A 1 122 ? 41.245  40.073 34.940 1.00 31.85  ? 117 LEU A CD1 1 
ATOM   969  C  CD2 . LEU A 1 122 ? 39.197  41.254 35.677 1.00 29.62  ? 117 LEU A CD2 1 
ATOM   970  N  N   . LEU A 1 123 ? 39.225  42.347 30.465 1.00 29.71  ? 118 LEU A N   1 
ATOM   971  C  CA  . LEU A 1 123 ? 39.530  43.266 29.383 1.00 30.72  ? 118 LEU A CA  1 
ATOM   972  C  C   . LEU A 1 123 ? 38.321  44.138 29.112 1.00 33.24  ? 118 LEU A C   1 
ATOM   973  O  O   . LEU A 1 123 ? 38.435  45.364 29.019 1.00 35.38  ? 118 LEU A O   1 
ATOM   974  C  CB  . LEU A 1 123 ? 39.896  42.509 28.108 1.00 31.16  ? 118 LEU A CB  1 
ATOM   975  C  CG  . LEU A 1 123 ? 41.328  41.999 27.943 1.00 30.98  ? 118 LEU A CG  1 
ATOM   976  C  CD1 . LEU A 1 123 ? 41.425  41.241 26.635 1.00 32.39  ? 118 LEU A CD1 1 
ATOM   977  C  CD2 . LEU A 1 123 ? 42.304  43.156 27.944 1.00 30.52  ? 118 LEU A CD2 1 
ATOM   978  N  N   . TYR A 1 124 ? 37.158  43.504 28.989 1.00 33.22  ? 119 TYR A N   1 
ATOM   979  C  CA  . TYR A 1 124 ? 35.943  44.246 28.716 1.00 32.35  ? 119 TYR A CA  1 
ATOM   980  C  C   . TYR A 1 124 ? 35.684  45.226 29.848 1.00 32.51  ? 119 TYR A C   1 
ATOM   981  O  O   . TYR A 1 124 ? 35.491  46.428 29.629 1.00 32.94  ? 119 TYR A O   1 
ATOM   982  C  CB  . TYR A 1 124 ? 34.756  43.295 28.560 1.00 31.92  ? 119 TYR A CB  1 
ATOM   983  C  CG  . TYR A 1 124 ? 33.474  44.020 28.245 1.00 31.54  ? 119 TYR A CG  1 
ATOM   984  C  CD1 . TYR A 1 124 ? 33.335  44.749 27.056 1.00 32.40  ? 119 TYR A CD1 1 
ATOM   985  C  CD2 . TYR A 1 124 ? 32.409  44.015 29.149 1.00 32.57  ? 119 TYR A CD2 1 
ATOM   986  C  CE1 . TYR A 1 124 ? 32.163  45.458 26.776 1.00 33.38  ? 119 TYR A CE1 1 
ATOM   987  C  CE2 . TYR A 1 124 ? 31.230  44.725 28.883 1.00 32.78  ? 119 TYR A CE2 1 
ATOM   988  C  CZ  . TYR A 1 124 ? 31.117  45.440 27.695 1.00 35.05  ? 119 TYR A CZ  1 
ATOM   989  O  OH  . TYR A 1 124 ? 29.956  46.129 27.423 1.00 38.64  ? 119 TYR A OH  1 
ATOM   990  N  N   . SER A 1 125 ? 35.682  44.712 31.067 1.00 32.43  ? 120 SER A N   1 
ATOM   991  C  CA  . SER A 1 125 ? 35.448  45.563 32.214 1.00 33.22  ? 120 SER A CA  1 
ATOM   992  C  C   . SER A 1 125 ? 36.354  46.793 32.146 1.00 32.57  ? 120 SER A C   1 
ATOM   993  O  O   . SER A 1 125 ? 35.929  47.899 32.486 1.00 31.64  ? 120 SER A O   1 
ATOM   994  C  CB  . SER A 1 125 ? 35.714  44.790 33.504 1.00 35.45  ? 120 SER A CB  1 
ATOM   995  O  OG  . SER A 1 125 ? 34.960  45.341 34.573 1.00 41.13  ? 120 SER A OG  1 
ATOM   996  N  N   . TRP A 1 126 ? 37.596  46.609 31.696 1.00 30.70  ? 121 TRP A N   1 
ATOM   997  C  CA  . TRP A 1 126 ? 38.533  47.733 31.613 1.00 31.11  ? 121 TRP A CA  1 
ATOM   998  C  C   . TRP A 1 126 ? 38.204  48.760 30.544 1.00 29.62  ? 121 TRP A C   1 
ATOM   999  O  O   . TRP A 1 126 ? 38.521  49.942 30.700 1.00 28.43  ? 121 TRP A O   1 
ATOM   1000 C  CB  . TRP A 1 126 ? 39.970  47.253 31.393 1.00 28.80  ? 121 TRP A CB  1 
ATOM   1001 C  CG  . TRP A 1 126 ? 40.471  46.404 32.493 1.00 27.53  ? 121 TRP A CG  1 
ATOM   1002 C  CD1 . TRP A 1 126 ? 39.998  46.355 33.773 1.00 26.57  ? 121 TRP A CD1 1 
ATOM   1003 C  CD2 . TRP A 1 126 ? 41.541  45.459 32.419 1.00 27.24  ? 121 TRP A CD2 1 
ATOM   1004 N  NE1 . TRP A 1 126 ? 40.705  45.426 34.502 1.00 27.45  ? 121 TRP A NE1 1 
ATOM   1005 C  CE2 . TRP A 1 126 ? 41.661  44.865 33.693 1.00 27.64  ? 121 TRP A CE2 1 
ATOM   1006 C  CE3 . TRP A 1 126 ? 42.408  45.052 31.397 1.00 27.22  ? 121 TRP A CE3 1 
ATOM   1007 C  CZ2 . TRP A 1 126 ? 42.618  43.885 33.973 1.00 28.68  ? 121 TRP A CZ2 1 
ATOM   1008 C  CZ3 . TRP A 1 126 ? 43.359  44.073 31.675 1.00 27.29  ? 121 TRP A CZ3 1 
ATOM   1009 C  CH2 . TRP A 1 126 ? 43.455  43.504 32.951 1.00 28.20  ? 121 TRP A CH2 1 
ATOM   1010 N  N   . THR A 1 127 ? 37.588  48.318 29.456 1.00 28.68  ? 122 THR A N   1 
ATOM   1011 C  CA  . THR A 1 127 ? 37.234  49.252 28.398 1.00 30.03  ? 122 THR A CA  1 
ATOM   1012 C  C   . THR A 1 127 ? 36.160  50.191 28.926 1.00 30.62  ? 122 THR A C   1 
ATOM   1013 O  O   . THR A 1 127 ? 36.108  51.351 28.549 1.00 31.53  ? 122 THR A O   1 
ATOM   1014 C  CB  . THR A 1 127 ? 36.717  48.522 27.137 1.00 29.65  ? 122 THR A CB  1 
ATOM   1015 O  OG1 . THR A 1 127 ? 35.568  47.727 27.470 1.00 29.47  ? 122 THR A OG1 1 
ATOM   1016 C  CG2 . THR A 1 127 ? 37.805  47.634 26.566 1.00 27.62  ? 122 THR A CG2 1 
HETATM 1017 N  N   . MSE A 1 128 ? 35.316  49.691 29.819 1.00 33.04  ? 123 MSE A N   1 
HETATM 1018 C  CA  . MSE A 1 128 ? 34.254  50.512 30.404 1.00 35.51  ? 123 MSE A CA  1 
HETATM 1019 C  C   . MSE A 1 128 ? 34.796  51.461 31.469 1.00 36.84  ? 123 MSE A C   1 
HETATM 1020 O  O   . MSE A 1 128 ? 34.487  52.657 31.481 1.00 35.93  ? 123 MSE A O   1 
HETATM 1021 C  CB  . MSE A 1 128 ? 33.182  49.630 31.057 1.00 36.65  ? 123 MSE A CB  1 
HETATM 1022 C  CG  . MSE A 1 128 ? 32.358  48.776 30.101 1.00 37.92  ? 123 MSE A CG  1 
HETATM 1023 SE SE  . MSE A 1 128 ? 31.376  49.810 28.799 1.00 41.07  ? 123 MSE A SE  1 
HETATM 1024 C  CE  . MSE A 1 128 ? 30.445  50.997 30.003 1.00 41.33  ? 123 MSE A CE  1 
ATOM   1025 N  N   . ALA A 1 129 ? 35.612  50.910 32.361 1.00 37.78  ? 124 ALA A N   1 
ATOM   1026 C  CA  . ALA A 1 129 ? 36.183  51.661 33.467 1.00 38.92  ? 124 ALA A CA  1 
ATOM   1027 C  C   . ALA A 1 129 ? 37.400  52.522 33.138 1.00 39.57  ? 124 ALA A C   1 
ATOM   1028 O  O   . ALA A 1 129 ? 37.594  53.575 33.744 1.00 39.46  ? 124 ALA A O   1 
ATOM   1029 C  CB  . ALA A 1 129 ? 36.523  50.699 34.598 1.00 37.56  ? 124 ALA A CB  1 
ATOM   1030 N  N   . LEU A 1 130 ? 38.222  52.076 32.195 1.00 41.89  ? 125 LEU A N   1 
ATOM   1031 C  CA  . LEU A 1 130 ? 39.432  52.814 31.814 1.00 44.25  ? 125 LEU A CA  1 
ATOM   1032 C  C   . LEU A 1 130 ? 39.391  53.295 30.363 1.00 46.72  ? 125 LEU A C   1 
ATOM   1033 O  O   . LEU A 1 130 ? 40.101  52.773 29.502 1.00 48.04  ? 125 LEU A O   1 
ATOM   1034 C  CB  . LEU A 1 130 ? 40.666  51.928 32.020 1.00 41.71  ? 125 LEU A CB  1 
ATOM   1035 C  CG  . LEU A 1 130 ? 41.405  51.993 33.356 1.00 41.43  ? 125 LEU A CG  1 
ATOM   1036 C  CD1 . LEU A 1 130 ? 40.439  51.878 34.507 1.00 42.64  ? 125 LEU A CD1 1 
ATOM   1037 C  CD2 . LEU A 1 130 ? 42.436  50.872 33.403 1.00 42.17  ? 125 LEU A CD2 1 
ATOM   1038 N  N   . PRO A 1 131 ? 38.574  54.316 30.077 1.00 49.25  ? 126 PRO A N   1 
ATOM   1039 C  CA  . PRO A 1 131 ? 38.458  54.847 28.716 1.00 50.68  ? 126 PRO A CA  1 
ATOM   1040 C  C   . PRO A 1 131 ? 39.715  55.551 28.198 1.00 51.00  ? 126 PRO A C   1 
ATOM   1041 O  O   . PRO A 1 131 ? 39.965  55.574 26.986 1.00 50.69  ? 126 PRO A O   1 
ATOM   1042 C  CB  . PRO A 1 131 ? 37.263  55.789 28.825 1.00 51.34  ? 126 PRO A CB  1 
ATOM   1043 C  CG  . PRO A 1 131 ? 37.431  56.349 30.210 1.00 51.95  ? 126 PRO A CG  1 
ATOM   1044 C  CD  . PRO A 1 131 ? 37.763  55.107 31.022 1.00 50.07  ? 126 PRO A CD  1 
ATOM   1045 N  N   . GLU A 1 132 ? 40.501  56.118 29.113 1.00 51.28  ? 127 GLU A N   1 
ATOM   1046 C  CA  . GLU A 1 132 ? 41.726  56.831 28.744 1.00 51.59  ? 127 GLU A CA  1 
ATOM   1047 C  C   . GLU A 1 132 ? 42.886  55.869 28.467 1.00 51.39  ? 127 GLU A C   1 
ATOM   1048 O  O   . GLU A 1 132 ? 44.029  56.293 28.247 1.00 52.05  ? 127 GLU A O   1 
ATOM   1049 C  CB  . GLU A 1 132 ? 42.135  57.812 29.849 1.00 53.34  ? 127 GLU A CB  1 
ATOM   1050 C  CG  . GLU A 1 132 ? 42.745  57.144 31.068 1.00 56.08  ? 127 GLU A CG  1 
ATOM   1051 C  CD  . GLU A 1 132 ? 41.775  56.212 31.774 1.00 57.29  ? 127 GLU A CD  1 
ATOM   1052 O  OE1 . GLU A 1 132 ? 40.547  56.351 31.567 1.00 58.48  ? 127 GLU A OE1 1 
ATOM   1053 O  OE2 . GLU A 1 132 ? 42.247  55.345 32.545 1.00 57.54  ? 127 GLU A OE2 1 
ATOM   1054 N  N   . GLU A 1 133 ? 42.590  54.574 28.499 1.00 49.19  ? 128 GLU A N   1 
ATOM   1055 C  CA  . GLU A 1 133 ? 43.594  53.554 28.226 1.00 46.91  ? 128 GLU A CA  1 
ATOM   1056 C  C   . GLU A 1 133 ? 43.186  53.011 26.863 1.00 44.95  ? 128 GLU A C   1 
ATOM   1057 O  O   . GLU A 1 133 ? 42.595  51.937 26.751 1.00 45.12  ? 128 GLU A O   1 
ATOM   1058 C  CB  . GLU A 1 133 ? 43.534  52.460 29.291 1.00 45.76  ? 128 GLU A CB  1 
ATOM   1059 C  CG  . GLU A 1 133 ? 44.890  51.977 29.769 1.00 46.46  ? 128 GLU A CG  1 
ATOM   1060 C  CD  . GLU A 1 133 ? 45.672  53.041 30.517 1.00 44.96  ? 128 GLU A CD  1 
ATOM   1061 O  OE1 . GLU A 1 133 ? 45.272  53.382 31.649 1.00 45.13  ? 128 GLU A OE1 1 
ATOM   1062 O  OE2 . GLU A 1 133 ? 46.686  53.533 29.974 1.00 43.80  ? 128 GLU A OE2 1 
ATOM   1063 N  N   . ALA A 1 134 ? 43.488  53.793 25.832 1.00 43.42  ? 129 ALA A N   1 
ATOM   1064 C  CA  . ALA A 1 134 ? 43.135  53.457 24.457 1.00 42.09  ? 129 ALA A CA  1 
ATOM   1065 C  C   . ALA A 1 134 ? 43.549  52.068 23.993 1.00 40.74  ? 129 ALA A C   1 
ATOM   1066 O  O   . ALA A 1 134 ? 42.744  51.342 23.417 1.00 43.13  ? 129 ALA A O   1 
ATOM   1067 C  CB  . ALA A 1 134 ? 43.707  54.506 23.512 1.00 39.92  ? 129 ALA A CB  1 
ATOM   1068 N  N   . LYS A 1 135 ? 44.798  51.695 24.244 1.00 40.19  ? 130 LYS A N   1 
ATOM   1069 C  CA  . LYS A 1 135 ? 45.305  50.393 23.814 1.00 38.32  ? 130 LYS A CA  1 
ATOM   1070 C  C   . LYS A 1 135 ? 44.503  49.183 24.285 1.00 36.76  ? 130 LYS A C   1 
ATOM   1071 O  O   . LYS A 1 135 ? 44.503  48.154 23.618 1.00 37.50  ? 130 LYS A O   1 
ATOM   1072 C  CB  . LYS A 1 135 ? 46.775  50.238 24.229 1.00 38.00  ? 130 LYS A CB  1 
ATOM   1073 C  CG  . LYS A 1 135 ? 47.720  51.147 23.458 1.00 34.64  ? 130 LYS A CG  1 
ATOM   1074 C  CD  . LYS A 1 135 ? 49.147  51.043 23.969 1.00 33.43  ? 130 LYS A CD  1 
ATOM   1075 C  CE  . LYS A 1 135 ? 50.067  51.997 23.219 1.00 31.07  ? 130 LYS A CE  1 
ATOM   1076 N  NZ  . LYS A 1 135 ? 51.464  51.973 23.734 1.00 30.61  ? 130 LYS A NZ  1 
ATOM   1077 N  N   . ILE A 1 136 ? 43.814  49.296 25.416 1.00 36.44  ? 131 ILE A N   1 
ATOM   1078 C  CA  . ILE A 1 136 ? 43.030  48.170 25.918 1.00 35.97  ? 131 ILE A CA  1 
ATOM   1079 C  C   . ILE A 1 136 ? 41.831  47.858 25.024 1.00 38.20  ? 131 ILE A C   1 
ATOM   1080 O  O   . ILE A 1 136 ? 41.516  46.683 24.802 1.00 38.65  ? 131 ILE A O   1 
ATOM   1081 C  CB  . ILE A 1 136 ? 42.534  48.410 27.364 1.00 34.56  ? 131 ILE A CB  1 
ATOM   1082 C  CG1 . ILE A 1 136 ? 43.730  48.540 28.313 1.00 33.38  ? 131 ILE A CG1 1 
ATOM   1083 C  CG2 . ILE A 1 136 ? 41.640  47.260 27.807 1.00 32.82  ? 131 ILE A CG2 1 
ATOM   1084 C  CD1 . ILE A 1 136 ? 43.347  48.671 29.777 1.00 31.75  ? 131 ILE A CD1 1 
ATOM   1085 N  N   . LYS A 1 137 ? 41.151  48.884 24.510 1.00 40.15  ? 132 LYS A N   1 
ATOM   1086 C  CA  . LYS A 1 137 ? 40.015  48.609 23.631 1.00 42.38  ? 132 LYS A CA  1 
ATOM   1087 C  C   . LYS A 1 137 ? 40.535  48.167 22.269 1.00 42.73  ? 132 LYS A C   1 
ATOM   1088 O  O   . LYS A 1 137 ? 39.890  47.382 21.578 1.00 43.07  ? 132 LYS A O   1 
ATOM   1089 C  CB  . LYS A 1 137 ? 39.071  49.816 23.498 1.00 42.55  ? 132 LYS A CB  1 
ATOM   1090 C  CG  . LYS A 1 137 ? 39.721  51.160 23.272 1.00 45.95  ? 132 LYS A CG  1 
ATOM   1091 C  CD  . LYS A 1 137 ? 39.482  52.082 24.471 1.00 47.85  ? 132 LYS A CD  1 
ATOM   1092 C  CE  . LYS A 1 137 ? 37.996  52.186 24.840 1.00 47.41  ? 132 LYS A CE  1 
ATOM   1093 N  NZ  . LYS A 1 137 ? 37.779  52.930 26.121 1.00 46.34  ? 132 LYS A NZ  1 
ATOM   1094 N  N   . ASP A 1 138 ? 41.714  48.653 21.892 1.00 43.55  ? 133 ASP A N   1 
ATOM   1095 C  CA  . ASP A 1 138 ? 42.309  48.237 20.629 1.00 42.91  ? 133 ASP A CA  1 
ATOM   1096 C  C   . ASP A 1 138 ? 42.493  46.723 20.690 1.00 41.69  ? 133 ASP A C   1 
ATOM   1097 O  O   . ASP A 1 138 ? 42.196  46.005 19.739 1.00 41.53  ? 133 ASP A O   1 
ATOM   1098 C  CB  . ASP A 1 138 ? 43.674  48.900 20.417 1.00 44.81  ? 133 ASP A CB  1 
ATOM   1099 C  CG  . ASP A 1 138 ? 43.564  50.336 19.930 1.00 48.35  ? 133 ASP A CG  1 
ATOM   1100 O  OD1 . ASP A 1 138 ? 42.493  50.711 19.399 1.00 48.95  ? 133 ASP A OD1 1 
ATOM   1101 O  OD2 . ASP A 1 138 ? 44.561  51.086 20.060 1.00 50.58  ? 133 ASP A OD2 1 
ATOM   1102 N  N   . ALA A 1 139 ? 42.986  46.244 21.827 1.00 40.13  ? 134 ALA A N   1 
ATOM   1103 C  CA  . ALA A 1 139 ? 43.213  44.819 22.007 1.00 37.95  ? 134 ALA A CA  1 
ATOM   1104 C  C   . ALA A 1 139 ? 41.895  44.077 22.105 1.00 37.25  ? 134 ALA A C   1 
ATOM   1105 O  O   . ALA A 1 139 ? 41.770  42.966 21.596 1.00 35.50  ? 134 ALA A O   1 
ATOM   1106 C  CB  . ALA A 1 139 ? 44.049  44.569 23.258 1.00 35.93  ? 134 ALA A CB  1 
ATOM   1107 N  N   . TYR A 1 140 ? 40.909  44.689 22.755 1.00 37.56  ? 135 TYR A N   1 
ATOM   1108 C  CA  . TYR A 1 140 ? 39.612  44.039 22.905 1.00 38.62  ? 135 TYR A CA  1 
ATOM   1109 C  C   . TYR A 1 140 ? 38.858  43.912 21.585 1.00 40.86  ? 135 TYR A C   1 
ATOM   1110 O  O   . TYR A 1 140 ? 38.407  42.824 21.223 1.00 39.43  ? 135 TYR A O   1 
ATOM   1111 C  CB  . TYR A 1 140 ? 38.732  44.794 23.899 1.00 35.69  ? 135 TYR A CB  1 
ATOM   1112 C  CG  . TYR A 1 140 ? 37.455  44.052 24.211 1.00 33.74  ? 135 TYR A CG  1 
ATOM   1113 C  CD1 . TYR A 1 140 ? 37.489  42.804 24.835 1.00 32.97  ? 135 TYR A CD1 1 
ATOM   1114 C  CD2 . TYR A 1 140 ? 36.215  44.564 23.831 1.00 33.76  ? 135 TYR A CD2 1 
ATOM   1115 C  CE1 . TYR A 1 140 ? 36.326  42.080 25.066 1.00 32.05  ? 135 TYR A CE1 1 
ATOM   1116 C  CE2 . TYR A 1 140 ? 35.040  43.846 24.060 1.00 32.57  ? 135 TYR A CE2 1 
ATOM   1117 C  CZ  . TYR A 1 140 ? 35.106  42.607 24.676 1.00 32.09  ? 135 TYR A CZ  1 
ATOM   1118 O  OH  . TYR A 1 140 ? 33.954  41.899 24.908 1.00 31.70  ? 135 TYR A OH  1 
ATOM   1119 N  N   . HIS A 1 141 ? 38.722  45.030 20.874 1.00 45.14  ? 136 HIS A N   1 
ATOM   1120 C  CA  . HIS A 1 141 ? 38.007  45.054 19.601 1.00 48.52  ? 136 HIS A CA  1 
ATOM   1121 C  C   . HIS A 1 141 ? 38.628  44.146 18.559 1.00 49.24  ? 136 HIS A C   1 
ATOM   1122 O  O   . HIS A 1 141 ? 37.938  43.620 17.687 1.00 49.13  ? 136 HIS A O   1 
ATOM   1123 C  CB  . HIS A 1 141 ? 37.913  46.489 19.079 1.00 51.51  ? 136 HIS A CB  1 
ATOM   1124 C  CG  . HIS A 1 141 ? 37.071  47.379 19.944 1.00 57.10  ? 136 HIS A CG  1 
ATOM   1125 N  ND1 . HIS A 1 141 ? 35.878  46.961 20.498 1.00 57.60  ? 136 HIS A ND1 1 
ATOM   1126 C  CD2 . HIS A 1 141 ? 37.249  48.658 20.355 1.00 57.70  ? 136 HIS A CD2 1 
ATOM   1127 C  CE1 . HIS A 1 141 ? 35.359  47.943 21.215 1.00 59.76  ? 136 HIS A CE1 1 
ATOM   1128 N  NE2 . HIS A 1 141 ? 36.172  48.984 21.145 1.00 59.73  ? 136 HIS A NE2 1 
HETATM 1129 N  N   . MSE A 1 142 ? 39.935  43.956 18.654 1.00 50.71  ? 137 MSE A N   1 
HETATM 1130 C  CA  . MSE A 1 142 ? 40.626  43.085 17.730 1.00 52.85  ? 137 MSE A CA  1 
HETATM 1131 C  C   . MSE A 1 142 ? 40.216  41.642 18.057 1.00 52.65  ? 137 MSE A C   1 
HETATM 1132 O  O   . MSE A 1 142 ? 40.089  40.806 17.161 1.00 52.45  ? 137 MSE A O   1 
HETATM 1133 C  CB  . MSE A 1 142 ? 42.136  43.286 17.871 1.00 57.35  ? 137 MSE A CB  1 
HETATM 1134 C  CG  . MSE A 1 142 ? 42.978  42.506 16.883 1.00 64.05  ? 137 MSE A CG  1 
HETATM 1135 SE SE  . MSE A 1 142 ? 43.646  40.861 17.634 1.00 74.07  ? 137 MSE A SE  1 
HETATM 1136 C  CE  . MSE A 1 142 ? 45.434  41.470 18.062 1.00 69.35  ? 137 MSE A CE  1 
ATOM   1137 N  N   . LEU A 1 143 ? 39.995  41.352 19.338 1.00 50.67  ? 138 LEU A N   1 
ATOM   1138 C  CA  . LEU A 1 143 ? 39.581  40.010 19.735 1.00 49.32  ? 138 LEU A CA  1 
ATOM   1139 C  C   . LEU A 1 143 ? 38.166  39.776 19.233 1.00 49.55  ? 138 LEU A C   1 
ATOM   1140 O  O   . LEU A 1 143 ? 37.742  38.632 19.038 1.00 49.21  ? 138 LEU A O   1 
ATOM   1141 C  CB  . LEU A 1 143 ? 39.613  39.845 21.258 1.00 48.04  ? 138 LEU A CB  1 
ATOM   1142 C  CG  . LEU A 1 143 ? 40.970  39.749 21.960 1.00 46.68  ? 138 LEU A CG  1 
ATOM   1143 C  CD1 . LEU A 1 143 ? 40.748  39.553 23.447 1.00 43.66  ? 138 LEU A CD1 1 
ATOM   1144 C  CD2 . LEU A 1 143 ? 41.778  38.589 21.387 1.00 46.40  ? 138 LEU A CD2 1 
ATOM   1145 N  N   . LYS A 1 144 ? 37.432  40.868 19.038 1.00 49.84  ? 139 LYS A N   1 
ATOM   1146 C  CA  . LYS A 1 144 ? 36.065  40.784 18.533 1.00 51.38  ? 139 LYS A CA  1 
ATOM   1147 C  C   . LYS A 1 144 ? 36.161  40.591 17.030 1.00 52.17  ? 139 LYS A C   1 
ATOM   1148 O  O   . LYS A 1 144 ? 35.601  39.652 16.466 1.00 51.73  ? 139 LYS A O   1 
ATOM   1149 C  CB  . LYS A 1 144 ? 35.285  42.067 18.830 1.00 51.06  ? 139 LYS A CB  1 
ATOM   1150 C  CG  . LYS A 1 144 ? 35.095  42.372 20.308 1.00 50.53  ? 139 LYS A CG  1 
ATOM   1151 C  CD  . LYS A 1 144 ? 33.856  43.227 20.540 1.00 50.35  ? 139 LYS A CD  1 
ATOM   1152 C  CE  . LYS A 1 144 ? 32.581  42.447 20.207 1.00 49.82  ? 139 LYS A CE  1 
ATOM   1153 N  NZ  . LYS A 1 144 ? 31.349  43.174 20.619 1.00 49.02  ? 139 LYS A NZ  1 
ATOM   1154 N  N   . ARG A 1 145 ? 36.900  41.491 16.395 1.00 54.27  ? 140 ARG A N   1 
ATOM   1155 C  CA  . ARG A 1 145 ? 37.113  41.459 14.957 1.00 55.75  ? 140 ARG A CA  1 
ATOM   1156 C  C   . ARG A 1 145 ? 37.602  40.085 14.510 1.00 55.11  ? 140 ARG A C   1 
ATOM   1157 O  O   . ARG A 1 145 ? 37.524  39.754 13.332 1.00 56.45  ? 140 ARG A O   1 
ATOM   1158 C  CB  . ARG A 1 145 ? 38.149  42.520 14.570 1.00 58.17  ? 140 ARG A CB  1 
ATOM   1159 C  CG  . ARG A 1 145 ? 38.320  42.734 13.073 1.00 61.77  ? 140 ARG A CG  1 
ATOM   1160 C  CD  . ARG A 1 145 ? 39.575  43.546 12.765 1.00 64.75  ? 140 ARG A CD  1 
ATOM   1161 N  NE  . ARG A 1 145 ? 40.798  42.794 13.050 1.00 67.22  ? 140 ARG A NE  1 
ATOM   1162 C  CZ  . ARG A 1 145 ? 42.031  43.274 12.902 1.00 68.42  ? 140 ARG A CZ  1 
ATOM   1163 N  NH1 . ARG A 1 145 ? 42.220  44.519 12.473 1.00 68.11  ? 140 ARG A NH1 1 
ATOM   1164 N  NH2 . ARG A 1 145 ? 43.078  42.508 13.187 1.00 68.66  ? 140 ARG A NH2 1 
ATOM   1165 N  N   . GLN A 1 146 ? 38.098  39.283 15.450 1.00 55.21  ? 141 GLN A N   1 
ATOM   1166 C  CA  . GLN A 1 146 ? 38.616  37.955 15.125 1.00 54.13  ? 141 GLN A CA  1 
ATOM   1167 C  C   . GLN A 1 146 ? 37.777  36.791 15.643 1.00 53.68  ? 141 GLN A C   1 
ATOM   1168 O  O   . GLN A 1 146 ? 38.229  35.640 15.623 1.00 53.80  ? 141 GLN A O   1 
ATOM   1169 C  CB  . GLN A 1 146 ? 40.037  37.798 15.660 1.00 55.52  ? 141 GLN A CB  1 
ATOM   1170 C  CG  . GLN A 1 146 ? 41.047  37.431 14.600 1.00 59.62  ? 141 GLN A CG  1 
ATOM   1171 C  CD  . GLN A 1 146 ? 41.497  38.627 13.784 1.00 61.55  ? 141 GLN A CD  1 
ATOM   1172 O  OE1 . GLN A 1 146 ? 42.105  39.561 14.312 1.00 61.52  ? 141 GLN A OE1 1 
ATOM   1173 N  NE2 . GLN A 1 146 ? 41.201  38.604 12.488 1.00 63.70  ? 141 GLN A NE2 1 
ATOM   1174 N  N   . GLY A 1 147 ? 36.571  37.082 16.123 1.00 51.67  ? 142 GLY A N   1 
ATOM   1175 C  CA  . GLY A 1 147 ? 35.708  36.021 16.613 1.00 49.87  ? 142 GLY A CA  1 
ATOM   1176 C  C   . GLY A 1 147 ? 36.104  35.319 17.902 1.00 49.33  ? 142 GLY A C   1 
ATOM   1177 O  O   . GLY A 1 147 ? 35.455  34.346 18.289 1.00 49.31  ? 142 GLY A O   1 
ATOM   1178 N  N   . ILE A 1 148 ? 37.164  35.773 18.567 1.00 49.10  ? 143 ILE A N   1 
ATOM   1179 C  CA  . ILE A 1 148 ? 37.550  35.155 19.833 1.00 48.87  ? 143 ILE A CA  1 
ATOM   1180 C  C   . ILE A 1 148 ? 36.504  35.597 20.856 1.00 48.49  ? 143 ILE A C   1 
ATOM   1181 O  O   . ILE A 1 148 ? 36.104  34.831 21.738 1.00 47.61  ? 143 ILE A O   1 
ATOM   1182 C  CB  . ILE A 1 148 ? 38.954  35.601 20.290 1.00 49.51  ? 143 ILE A CB  1 
ATOM   1183 C  CG1 . ILE A 1 148 ? 40.015  35.010 19.356 1.00 50.88  ? 143 ILE A CG1 1 
ATOM   1184 C  CG2 . ILE A 1 148 ? 39.212  35.131 21.712 1.00 49.15  ? 143 ILE A CG2 1 
ATOM   1185 C  CD1 . ILE A 1 148 ? 41.437  35.414 19.702 1.00 50.75  ? 143 ILE A CD1 1 
ATOM   1186 N  N   . VAL A 1 149 ? 36.063  36.844 20.720 1.00 47.45  ? 144 VAL A N   1 
ATOM   1187 C  CA  . VAL A 1 149 ? 35.029  37.398 21.582 1.00 47.23  ? 144 VAL A CA  1 
ATOM   1188 C  C   . VAL A 1 149 ? 33.834  37.700 20.675 1.00 47.54  ? 144 VAL A C   1 
ATOM   1189 O  O   . VAL A 1 149 ? 33.867  38.647 19.891 1.00 46.64  ? 144 VAL A O   1 
ATOM   1190 C  CB  . VAL A 1 149 ? 35.487  38.707 22.263 1.00 46.28  ? 144 VAL A CB  1 
ATOM   1191 C  CG1 . VAL A 1 149 ? 34.337  39.294 23.074 1.00 45.44  ? 144 VAL A CG1 1 
ATOM   1192 C  CG2 . VAL A 1 149 ? 36.680  38.440 23.162 1.00 42.62  ? 144 VAL A CG2 1 
ATOM   1193 N  N   . GLN A 1 150 ? 32.786  36.889 20.780 1.00 48.58  ? 145 GLN A N   1 
ATOM   1194 C  CA  . GLN A 1 150 ? 31.596  37.066 19.950 1.00 49.57  ? 145 GLN A CA  1 
ATOM   1195 C  C   . GLN A 1 150 ? 30.669  38.177 20.429 1.00 47.87  ? 145 GLN A C   1 
ATOM   1196 O  O   . GLN A 1 150 ? 30.251  39.030 19.643 1.00 50.54  ? 145 GLN A O   1 
ATOM   1197 C  CB  . GLN A 1 150 ? 30.846  35.739 19.856 1.00 51.41  ? 145 GLN A CB  1 
ATOM   1198 C  CG  . GLN A 1 150 ? 31.614  34.709 19.045 1.00 55.65  ? 145 GLN A CG  1 
ATOM   1199 C  CD  . GLN A 1 150 ? 31.475  33.307 19.590 1.00 57.86  ? 145 GLN A CD  1 
ATOM   1200 O  OE1 . GLN A 1 150 ? 30.376  32.750 19.637 1.00 60.38  ? 145 GLN A OE1 1 
ATOM   1201 N  NE2 . GLN A 1 150 ? 32.595  32.726 20.013 1.00 59.26  ? 145 GLN A NE2 1 
ATOM   1202 N  N   . SER A 1 151 ? 30.342  38.164 21.713 1.00 44.84  ? 146 SER A N   1 
ATOM   1203 C  CA  . SER A 1 151 ? 29.487  39.196 22.284 1.00 42.67  ? 146 SER A CA  1 
ATOM   1204 C  C   . SER A 1 151 ? 30.099  39.632 23.614 1.00 40.74  ? 146 SER A C   1 
ATOM   1205 O  O   . SER A 1 151 ? 30.625  38.805 24.357 1.00 40.86  ? 146 SER A O   1 
ATOM   1206 C  CB  . SER A 1 151 ? 28.081  38.651 22.509 1.00 41.69  ? 146 SER A CB  1 
ATOM   1207 O  OG  . SER A 1 151 ? 28.118  37.558 23.402 1.00 40.57  ? 146 SER A OG  1 
ATOM   1208 N  N   . ASP A 1 152 ? 30.044  40.929 23.906 1.00 38.76  ? 147 ASP A N   1 
ATOM   1209 C  CA  . ASP A 1 152 ? 30.601  41.445 25.153 1.00 35.69  ? 147 ASP A CA  1 
ATOM   1210 C  C   . ASP A 1 152 ? 29.991  40.686 26.316 1.00 32.76  ? 147 ASP A C   1 
ATOM   1211 O  O   . ASP A 1 152 ? 28.787  40.482 26.370 1.00 33.30  ? 147 ASP A O   1 
ATOM   1212 C  CB  . ASP A 1 152 ? 30.312  42.932 25.271 1.00 35.94  ? 147 ASP A CB  1 
ATOM   1213 C  CG  . ASP A 1 152 ? 30.758  43.696 24.046 1.00 37.89  ? 147 ASP A CG  1 
ATOM   1214 O  OD1 . ASP A 1 152 ? 31.928  43.524 23.627 1.00 38.65  ? 147 ASP A OD1 1 
ATOM   1215 O  OD2 . ASP A 1 152 ? 29.941  44.465 23.499 1.00 37.87  ? 147 ASP A OD2 1 
ATOM   1216 N  N   . PRO A 1 153 ? 30.821  40.246 27.267 1.00 31.75  ? 148 PRO A N   1 
ATOM   1217 C  CA  . PRO A 1 153 ? 30.261  39.498 28.395 1.00 30.16  ? 148 PRO A CA  1 
ATOM   1218 C  C   . PRO A 1 153 ? 29.690  40.353 29.506 1.00 29.29  ? 148 PRO A C   1 
ATOM   1219 O  O   . PRO A 1 153 ? 29.955  41.555 29.582 1.00 29.07  ? 148 PRO A O   1 
ATOM   1220 C  CB  . PRO A 1 153 ? 31.456  38.697 28.887 1.00 28.23  ? 148 PRO A CB  1 
ATOM   1221 C  CG  . PRO A 1 153 ? 32.581  39.705 28.730 1.00 27.39  ? 148 PRO A CG  1 
ATOM   1222 C  CD  . PRO A 1 153 ? 32.298  40.303 27.348 1.00 30.10  ? 148 PRO A CD  1 
ATOM   1223 N  N   . PRO A 1 154 ? 28.876  39.741 30.378 1.00 29.47  ? 149 PRO A N   1 
ATOM   1224 C  CA  . PRO A 1 154 ? 28.286  40.465 31.505 1.00 29.89  ? 149 PRO A CA  1 
ATOM   1225 C  C   . PRO A 1 154 ? 29.445  40.597 32.506 1.00 31.09  ? 149 PRO A C   1 
ATOM   1226 O  O   . PRO A 1 154 ? 30.330  39.732 32.548 1.00 30.96  ? 149 PRO A O   1 
ATOM   1227 C  CB  . PRO A 1 154 ? 27.205  39.507 31.990 1.00 30.40  ? 149 PRO A CB  1 
ATOM   1228 C  CG  . PRO A 1 154 ? 27.852  38.161 31.752 1.00 29.60  ? 149 PRO A CG  1 
ATOM   1229 C  CD  . PRO A 1 154 ? 28.428  38.335 30.361 1.00 28.38  ? 149 PRO A CD  1 
ATOM   1230 N  N   . ILE A 1 155 ? 29.462  41.661 33.300 1.00 31.59  ? 150 ILE A N   1 
ATOM   1231 C  CA  . ILE A 1 155 ? 30.558  41.838 34.248 1.00 30.93  ? 150 ILE A CA  1 
ATOM   1232 C  C   . ILE A 1 155 ? 30.103  42.306 35.624 1.00 31.14  ? 150 ILE A C   1 
ATOM   1233 O  O   . ILE A 1 155 ? 28.992  42.797 35.782 1.00 30.73  ? 150 ILE A O   1 
ATOM   1234 C  CB  . ILE A 1 155 ? 31.572  42.862 33.710 1.00 29.88  ? 150 ILE A CB  1 
ATOM   1235 C  CG1 . ILE A 1 155 ? 30.877  44.202 33.480 1.00 27.82  ? 150 ILE A CG1 1 
ATOM   1236 C  CG2 . ILE A 1 155 ? 32.181  42.360 32.406 1.00 28.71  ? 150 ILE A CG2 1 
ATOM   1237 C  CD1 . ILE A 1 155 ? 31.799  45.255 32.950 1.00 27.29  ? 150 ILE A CD1 1 
ATOM   1238 N  N   . PRO A 1 156 ? 30.954  42.129 36.648 1.00 32.44  ? 151 PRO A N   1 
ATOM   1239 C  CA  . PRO A 1 156 ? 30.601  42.563 38.005 1.00 31.82  ? 151 PRO A CA  1 
ATOM   1240 C  C   . PRO A 1 156 ? 30.557  44.084 37.966 1.00 32.51  ? 151 PRO A C   1 
ATOM   1241 O  O   . PRO A 1 156 ? 31.490  44.713 37.463 1.00 32.62  ? 151 PRO A O   1 
ATOM   1242 C  CB  . PRO A 1 156 ? 31.773  42.068 38.846 1.00 30.41  ? 151 PRO A CB  1 
ATOM   1243 C  CG  . PRO A 1 156 ? 32.304  40.895 38.056 1.00 32.29  ? 151 PRO A CG  1 
ATOM   1244 C  CD  . PRO A 1 156 ? 32.228  41.383 36.645 1.00 31.84  ? 151 PRO A CD  1 
ATOM   1245 N  N   . VAL A 1 157 ? 29.490  44.683 38.480 1.00 32.77  ? 152 VAL A N   1 
ATOM   1246 C  CA  . VAL A 1 157 ? 29.399  46.133 38.467 1.00 35.06  ? 152 VAL A CA  1 
ATOM   1247 C  C   . VAL A 1 157 ? 28.846  46.667 39.778 1.00 37.04  ? 152 VAL A C   1 
ATOM   1248 O  O   . VAL A 1 157 ? 28.133  45.967 40.489 1.00 38.81  ? 152 VAL A O   1 
ATOM   1249 C  CB  . VAL A 1 157 ? 28.460  46.632 37.340 1.00 35.51  ? 152 VAL A CB  1 
ATOM   1250 C  CG1 . VAL A 1 157 ? 28.790  45.950 36.034 1.00 36.32  ? 152 VAL A CG1 1 
ATOM   1251 C  CG2 . VAL A 1 157 ? 27.016  46.372 37.719 1.00 36.29  ? 152 VAL A CG2 1 
ATOM   1252 N  N   . ASP A 1 158 ? 29.184  47.911 40.094 1.00 37.79  ? 153 ASP A N   1 
ATOM   1253 C  CA  . ASP A 1 158 ? 28.659  48.552 41.283 1.00 40.32  ? 153 ASP A CA  1 
ATOM   1254 C  C   . ASP A 1 158 ? 28.513  50.041 40.961 1.00 42.13  ? 153 ASP A C   1 
ATOM   1255 O  O   . ASP A 1 158 ? 28.851  50.465 39.855 1.00 41.27  ? 153 ASP A O   1 
ATOM   1256 C  CB  . ASP A 1 158 ? 29.553  48.281 42.513 1.00 40.31  ? 153 ASP A CB  1 
ATOM   1257 C  CG  . ASP A 1 158 ? 30.854  49.079 42.521 1.00 41.73  ? 153 ASP A CG  1 
ATOM   1258 O  OD1 . ASP A 1 158 ? 31.010  50.033 41.727 1.00 40.57  ? 153 ASP A OD1 1 
ATOM   1259 O  OD2 . ASP A 1 158 ? 31.729  48.746 43.360 1.00 42.88  ? 153 ASP A OD2 1 
ATOM   1260 N  N   . ARG A 1 159 ? 27.989  50.825 41.898 1.00 45.04  ? 154 ARG A N   1 
ATOM   1261 C  CA  . ARG A 1 159 ? 27.785  52.255 41.668 1.00 47.24  ? 154 ARG A CA  1 
ATOM   1262 C  C   . ARG A 1 159 ? 29.071  53.037 41.349 1.00 48.71  ? 154 ARG A C   1 
ATOM   1263 O  O   . ARG A 1 159 ? 29.012  54.115 40.754 1.00 49.37  ? 154 ARG A O   1 
ATOM   1264 C  CB  . ARG A 1 159 ? 27.079  52.892 42.880 1.00 47.82  ? 154 ARG A CB  1 
ATOM   1265 C  CG  . ARG A 1 159 ? 25.585  52.551 43.055 1.00 49.69  ? 154 ARG A CG  1 
ATOM   1266 C  CD  . ARG A 1 159 ? 24.768  53.054 41.867 1.00 52.39  ? 154 ARG A CD  1 
ATOM   1267 N  NE  . ARG A 1 159 ? 23.336  53.223 42.127 1.00 51.63  ? 154 ARG A NE  1 
ATOM   1268 C  CZ  . ARG A 1 159 ? 22.556  52.320 42.712 1.00 52.96  ? 154 ARG A CZ  1 
ATOM   1269 N  NH1 . ARG A 1 159 ? 23.061  51.166 43.121 1.00 54.50  ? 154 ARG A NH1 1 
ATOM   1270 N  NH2 . ARG A 1 159 ? 21.261  52.565 42.869 1.00 52.61  ? 154 ARG A NH2 1 
ATOM   1271 N  N   . THR A 1 160 ? 30.228  52.507 41.734 1.00 49.37  ? 155 THR A N   1 
ATOM   1272 C  CA  . THR A 1 160 ? 31.484  53.209 41.475 1.00 51.27  ? 155 THR A CA  1 
ATOM   1273 C  C   . THR A 1 160 ? 31.996  52.974 40.065 1.00 53.22  ? 155 THR A C   1 
ATOM   1274 O  O   . THR A 1 160 ? 33.010  53.546 39.670 1.00 53.84  ? 155 THR A O   1 
ATOM   1275 C  CB  . THR A 1 160 ? 32.612  52.778 42.443 1.00 50.87  ? 155 THR A CB  1 
ATOM   1276 O  OG1 . THR A 1 160 ? 33.150  51.517 42.025 1.00 50.89  ? 155 THR A OG1 1 
ATOM   1277 C  CG2 . THR A 1 160 ? 32.080  52.647 43.861 1.00 51.08  ? 155 THR A CG2 1 
ATOM   1278 N  N   . LEU A 1 161 ? 31.311  52.127 39.305 1.00 55.63  ? 156 LEU A N   1 
ATOM   1279 C  CA  . LEU A 1 161 ? 31.757  51.851 37.946 1.00 56.88  ? 156 LEU A CA  1 
ATOM   1280 C  C   . LEU A 1 161 ? 30.951  52.608 36.897 1.00 58.12  ? 156 LEU A C   1 
ATOM   1281 O  O   . LEU A 1 161 ? 29.713  52.674 36.967 1.00 55.95  ? 156 LEU A O   1 
ATOM   1282 C  CB  . LEU A 1 161 ? 31.710  50.352 37.652 1.00 56.94  ? 156 LEU A CB  1 
ATOM   1283 C  CG  . LEU A 1 161 ? 32.256  50.031 36.260 1.00 57.88  ? 156 LEU A CG  1 
ATOM   1284 C  CD1 . LEU A 1 161 ? 33.542  50.827 36.034 1.00 59.51  ? 156 LEU A CD1 1 
ATOM   1285 C  CD2 . LEU A 1 161 ? 32.501  48.537 36.113 1.00 56.39  ? 156 LEU A CD2 1 
ATOM   1286 N  N   . ILE A 1 162 ? 31.673  53.175 35.929 1.00 58.42  ? 157 ILE A N   1 
ATOM   1287 C  CA  . ILE A 1 162 ? 31.070  53.954 34.852 1.00 59.09  ? 157 ILE A CA  1 
ATOM   1288 C  C   . ILE A 1 162 ? 31.207  53.284 33.485 1.00 58.05  ? 157 ILE A C   1 
ATOM   1289 O  O   . ILE A 1 162 ? 30.269  52.646 32.998 1.00 56.72  ? 157 ILE A O   1 
ATOM   1290 C  CB  . ILE A 1 162 ? 31.689  55.380 34.787 1.00 60.61  ? 157 ILE A CB  1 
ATOM   1291 C  CG1 . ILE A 1 162 ? 33.184  55.304 34.458 1.00 61.81  ? 157 ILE A CG1 1 
ATOM   1292 C  CG2 . ILE A 1 162 ? 31.506  56.085 36.128 1.00 60.57  ? 157 ILE A CG2 1 
ATOM   1293 C  CD1 . ILE A 1 162 ? 33.853  56.672 34.313 1.00 62.58  ? 157 ILE A CD1 1 
ATOM   1294 N  N   . SER B 2 5   ? 58.576  53.133 23.427 1.00 59.93  ? 305 SER E N   1 
ATOM   1295 C  CA  . SER B 2 5   ? 58.811  51.956 24.257 1.00 59.66  ? 305 SER E CA  1 
ATOM   1296 C  C   . SER B 2 5   ? 57.533  51.139 24.475 1.00 59.13  ? 305 SER E C   1 
ATOM   1297 O  O   . SER B 2 5   ? 56.798  51.360 25.446 1.00 59.37  ? 305 SER E O   1 
ATOM   1298 C  CB  . SER B 2 5   ? 59.391  52.375 25.614 1.00 59.76  ? 305 SER E CB  1 
ATOM   1299 O  OG  . SER B 2 5   ? 59.731  51.248 26.407 1.00 58.52  ? 305 SER E OG  1 
ATOM   1300 N  N   . ASP B 2 6   ? 57.276  50.211 23.554 1.00 57.10  ? 306 ASP E N   1 
ATOM   1301 C  CA  . ASP B 2 6   ? 56.122  49.306 23.608 1.00 55.58  ? 306 ASP E CA  1 
ATOM   1302 C  C   . ASP B 2 6   ? 56.099  48.494 22.319 1.00 55.80  ? 306 ASP E C   1 
ATOM   1303 O  O   . ASP B 2 6   ? 56.496  48.993 21.267 1.00 56.20  ? 306 ASP E O   1 
ATOM   1304 C  CB  . ASP B 2 6   ? 54.797  50.072 23.744 1.00 52.04  ? 306 ASP E CB  1 
ATOM   1305 C  CG  . ASP B 2 6   ? 53.613  49.149 24.051 1.00 48.03  ? 306 ASP E CG  1 
ATOM   1306 O  OD1 . ASP B 2 6   ? 53.839  47.950 24.329 1.00 44.92  ? 306 ASP E OD1 1 
ATOM   1307 O  OD2 . ASP B 2 6   ? 52.455  49.622 24.024 1.00 44.74  ? 306 ASP E OD2 1 
ATOM   1308 N  N   . GLU B 2 7   ? 55.649  47.245 22.397 1.00 56.50  ? 307 GLU E N   1 
ATOM   1309 C  CA  . GLU B 2 7   ? 55.588  46.410 21.207 1.00 57.84  ? 307 GLU E CA  1 
ATOM   1310 C  C   . GLU B 2 7   ? 54.292  46.650 20.436 1.00 57.45  ? 307 GLU E C   1 
ATOM   1311 O  O   . GLU B 2 7   ? 53.405  47.367 20.904 1.00 57.83  ? 307 GLU E O   1 
ATOM   1312 C  CB  . GLU B 2 7   ? 55.739  44.925 21.574 1.00 58.95  ? 307 GLU E CB  1 
ATOM   1313 C  CG  . GLU B 2 7   ? 54.762  44.382 22.606 1.00 63.37  ? 307 GLU E CG  1 
ATOM   1314 C  CD  . GLU B 2 7   ? 55.077  42.930 22.992 1.00 67.46  ? 307 GLU E CD  1 
ATOM   1315 O  OE1 . GLU B 2 7   ? 56.232  42.664 23.401 1.00 69.02  ? 307 GLU E OE1 1 
ATOM   1316 O  OE2 . GLU B 2 7   ? 54.181  42.057 22.891 1.00 67.17  ? 307 GLU E OE2 1 
ATOM   1317 N  N   . ASP B 2 8   ? 54.199  46.072 19.242 1.00 56.93  ? 308 ASP E N   1 
ATOM   1318 C  CA  . ASP B 2 8   ? 53.010  46.228 18.413 1.00 56.25  ? 308 ASP E CA  1 
ATOM   1319 C  C   . ASP B 2 8   ? 51.965  45.233 18.874 1.00 54.45  ? 308 ASP E C   1 
ATOM   1320 O  O   . ASP B 2 8   ? 52.303  44.203 19.455 1.00 54.01  ? 308 ASP E O   1 
ATOM   1321 C  CB  . ASP B 2 8   ? 53.336  45.948 16.942 1.00 58.90  ? 308 ASP E CB  1 
ATOM   1322 C  CG  . ASP B 2 8   ? 54.460  46.818 16.412 1.00 61.46  ? 308 ASP E CG  1 
ATOM   1323 O  OD1 . ASP B 2 8   ? 54.305  48.062 16.414 1.00 62.41  ? 308 ASP E OD1 1 
ATOM   1324 O  OD2 . ASP B 2 8   ? 55.497  46.253 15.994 1.00 62.14  ? 308 ASP E OD2 1 
ATOM   1325 N  N   . LEU B 2 9   ? 50.699  45.542 18.615 1.00 53.39  ? 309 LEU E N   1 
ATOM   1326 C  CA  . LEU B 2 9   ? 49.609  44.647 18.983 1.00 52.42  ? 309 LEU E CA  1 
ATOM   1327 C  C   . LEU B 2 9   ? 49.860  43.261 18.370 1.00 53.46  ? 309 LEU E C   1 
ATOM   1328 O  O   . LEU B 2 9   ? 50.237  43.144 17.202 1.00 51.96  ? 309 LEU E O   1 
ATOM   1329 C  CB  . LEU B 2 9   ? 48.281  45.222 18.488 1.00 50.04  ? 309 LEU E CB  1 
ATOM   1330 C  CG  . LEU B 2 9   ? 47.005  44.403 18.698 1.00 48.74  ? 309 LEU E CG  1 
ATOM   1331 C  CD1 . LEU B 2 9   ? 46.870  43.990 20.149 1.00 47.51  ? 309 LEU E CD1 1 
ATOM   1332 C  CD2 . LEU B 2 9   ? 45.806  45.230 18.265 1.00 48.34  ? 309 LEU E CD2 1 
ATOM   1333 N  N   . LEU B 2 10  ? 49.660  42.218 19.173 1.00 55.37  ? 310 LEU E N   1 
ATOM   1334 C  CA  . LEU B 2 10  ? 49.869  40.838 18.739 1.00 57.98  ? 310 LEU E CA  1 
ATOM   1335 C  C   . LEU B 2 10  ? 48.750  40.364 17.825 1.00 60.64  ? 310 LEU E C   1 
ATOM   1336 O  O   . LEU B 2 10  ? 47.838  39.668 18.274 1.00 61.98  ? 310 LEU E O   1 
ATOM   1337 C  CB  . LEU B 2 10  ? 49.941  39.905 19.954 1.00 56.81  ? 310 LEU E CB  1 
ATOM   1338 C  CG  . LEU B 2 10  ? 50.132  38.409 19.676 1.00 56.19  ? 310 LEU E CG  1 
ATOM   1339 C  CD1 . LEU B 2 10  ? 51.574  38.160 19.266 1.00 56.42  ? 310 LEU E CD1 1 
ATOM   1340 C  CD2 . LEU B 2 10  ? 49.793  37.589 20.917 1.00 54.28  ? 310 LEU E CD2 1 
ATOM   1341 N  N   . HIS B 2 11  ? 48.818  40.726 16.547 1.00 62.81  ? 311 HIS E N   1 
ATOM   1342 C  CA  . HIS B 2 11  ? 47.783  40.313 15.611 1.00 65.17  ? 311 HIS E CA  1 
ATOM   1343 C  C   . HIS B 2 11  ? 47.722  38.796 15.471 1.00 64.92  ? 311 HIS E C   1 
ATOM   1344 O  O   . HIS B 2 11  ? 48.649  38.163 14.961 1.00 64.35  ? 311 HIS E O   1 
ATOM   1345 C  CB  . HIS B 2 11  ? 47.992  40.977 14.244 1.00 68.35  ? 311 HIS E CB  1 
ATOM   1346 C  CG  . HIS B 2 11  ? 47.710  42.450 14.247 1.00 71.54  ? 311 HIS E CG  1 
ATOM   1347 N  ND1 . HIS B 2 11  ? 48.560  43.372 14.824 1.00 73.22  ? 311 HIS E ND1 1 
ATOM   1348 C  CD2 . HIS B 2 11  ? 46.651  43.157 13.782 1.00 72.92  ? 311 HIS E CD2 1 
ATOM   1349 C  CE1 . HIS B 2 11  ? 48.036  44.582 14.715 1.00 73.05  ? 311 HIS E CE1 1 
ATOM   1350 N  NE2 . HIS B 2 11  ? 46.878  44.479 14.087 1.00 73.37  ? 311 HIS E NE2 1 
ATOM   1351 N  N   . ILE B 2 12  ? 46.616  38.230 15.949 1.00 64.27  ? 312 ILE E N   1 
ATOM   1352 C  CA  . ILE B 2 12  ? 46.376  36.792 15.913 1.00 63.84  ? 312 ILE E CA  1 
ATOM   1353 C  C   . ILE B 2 12  ? 45.528  36.407 14.697 1.00 64.25  ? 312 ILE E C   1 
ATOM   1354 O  O   . ILE B 2 12  ? 45.179  37.321 13.917 1.00 64.54  ? 312 ILE E O   1 
ATOM   1355 C  CB  . ILE B 2 12  ? 45.666  36.329 17.217 1.00 62.51  ? 312 ILE E CB  1 
ATOM   1356 C  CG1 . ILE B 2 12  ? 44.436  37.194 17.499 1.00 61.50  ? 312 ILE E CG1 1 
ATOM   1357 C  CG2 . ILE B 2 12  ? 46.607  36.458 18.393 1.00 63.37  ? 312 ILE E CG2 1 
ATOM   1358 C  CD1 . ILE B 2 12  ? 43.219  36.803 16.724 1.00 59.80  ? 312 ILE E CD1 1 
ATOM   1359 O  OXT . ILE B 2 12  ? 45.225  35.205 14.532 1.00 63.38  ? 312 ILE E OXT 1 
HETATM 1360 N  N   . MSE C 1 3   ? 40.681  19.147 30.816 1.00 70.27  ? 203 MSE B N   1 
HETATM 1361 C  CA  . MSE C 1 3   ? 42.051  19.730 30.916 1.00 70.39  ? 203 MSE B CA  1 
HETATM 1362 C  C   . MSE C 1 3   ? 43.014  18.702 31.527 1.00 67.84  ? 203 MSE B C   1 
HETATM 1363 O  O   . MSE C 1 3   ? 44.224  18.753 31.294 1.00 68.24  ? 203 MSE B O   1 
HETATM 1364 C  CB  . MSE C 1 3   ? 42.017  21.002 31.776 1.00 74.32  ? 203 MSE B CB  1 
HETATM 1365 C  CG  . MSE C 1 3   ? 43.125  22.008 31.470 1.00 79.14  ? 203 MSE B CG  1 
HETATM 1366 SE SE  . MSE C 1 3   ? 42.971  22.809 29.694 1.00 87.24  ? 203 MSE B SE  1 
HETATM 1367 C  CE  . MSE C 1 3   ? 44.075  21.563 28.695 1.00 84.70  ? 203 MSE B CE  1 
ATOM   1368 N  N   . GLY C 1 4   ? 42.475  17.775 32.313 1.00 63.94  ? 204 GLY B N   1 
ATOM   1369 C  CA  . GLY C 1 4   ? 43.310  16.749 32.915 1.00 59.73  ? 204 GLY B CA  1 
ATOM   1370 C  C   . GLY C 1 4   ? 43.664  16.915 34.382 1.00 56.62  ? 204 GLY B C   1 
ATOM   1371 O  O   . GLY C 1 4   ? 43.072  17.718 35.107 1.00 56.65  ? 204 GLY B O   1 
ATOM   1372 N  N   . SER C 1 5   ? 44.645  16.137 34.821 1.00 53.73  ? 205 SER B N   1 
ATOM   1373 C  CA  . SER C 1 5   ? 45.097  16.175 36.204 1.00 50.83  ? 205 SER B CA  1 
ATOM   1374 C  C   . SER C 1 5   ? 45.793  17.495 36.515 1.00 48.02  ? 205 SER B C   1 
ATOM   1375 O  O   . SER C 1 5   ? 45.911  17.871 37.674 1.00 47.05  ? 205 SER B O   1 
ATOM   1376 C  CB  . SER C 1 5   ? 46.058  15.009 36.480 1.00 52.58  ? 205 SER B CB  1 
ATOM   1377 O  OG  . SER C 1 5   ? 45.448  13.753 36.223 1.00 52.00  ? 205 SER B OG  1 
HETATM 1378 N  N   . MSE C 1 6   ? 46.263  18.184 35.476 1.00 46.43  ? 1   MSE B N   1 
HETATM 1379 C  CA  . MSE C 1 6   ? 46.946  19.472 35.631 1.00 44.45  ? 1   MSE B CA  1 
HETATM 1380 C  C   . MSE C 1 6   ? 46.017  20.472 36.318 1.00 44.17  ? 1   MSE B C   1 
HETATM 1381 O  O   . MSE C 1 6   ? 46.430  21.238 37.195 1.00 41.48  ? 1   MSE B O   1 
HETATM 1382 C  CB  . MSE C 1 6   ? 47.344  20.025 34.263 1.00 42.75  ? 1   MSE B CB  1 
HETATM 1383 C  CG  . MSE C 1 6   ? 48.816  20.347 34.128 1.00 44.24  ? 1   MSE B CG  1 
HETATM 1384 SE SE  . MSE C 1 6   ? 49.452  21.748 35.309 1.00 37.70  ? 1   MSE B SE  1 
HETATM 1385 C  CE  . MSE C 1 6   ? 49.788  20.741 36.885 1.00 43.07  ? 1   MSE B CE  1 
ATOM   1386 N  N   . ALA C 1 7   ? 44.757  20.455 35.902 1.00 43.75  ? 2   ALA B N   1 
ATOM   1387 C  CA  . ALA C 1 7   ? 43.748  21.339 36.461 1.00 43.95  ? 2   ALA B CA  1 
ATOM   1388 C  C   . ALA C 1 7   ? 43.200  20.776 37.777 1.00 44.80  ? 2   ALA B C   1 
ATOM   1389 O  O   . ALA C 1 7   ? 42.328  21.383 38.410 1.00 44.04  ? 2   ALA B O   1 
ATOM   1390 C  CB  . ALA C 1 7   ? 42.617  21.521 35.454 1.00 43.01  ? 2   ALA B CB  1 
ATOM   1391 N  N   . GLU C 1 8   ? 43.717  19.620 38.188 1.00 46.21  ? 3   GLU B N   1 
ATOM   1392 C  CA  . GLU C 1 8   ? 43.261  18.979 39.420 1.00 47.04  ? 3   GLU B CA  1 
ATOM   1393 C  C   . GLU C 1 8   ? 44.230  19.146 40.596 1.00 45.67  ? 3   GLU B C   1 
ATOM   1394 O  O   . GLU C 1 8   ? 45.231  19.861 40.507 1.00 44.54  ? 3   GLU B O   1 
ATOM   1395 C  CB  . GLU C 1 8   ? 43.014  17.484 39.177 1.00 50.23  ? 3   GLU B CB  1 
ATOM   1396 C  CG  . GLU C 1 8   ? 42.265  16.793 40.323 1.00 57.16  ? 3   GLU B CG  1 
ATOM   1397 C  CD  . GLU C 1 8   ? 42.629  15.320 40.482 1.00 60.80  ? 3   GLU B CD  1 
ATOM   1398 O  OE1 . GLU C 1 8   ? 43.841  15.010 40.615 1.00 61.43  ? 3   GLU B OE1 1 
ATOM   1399 O  OE2 . GLU C 1 8   ? 41.698  14.479 40.485 1.00 62.18  ? 3   GLU B OE2 1 
ATOM   1400 N  N   . ALA C 1 9   ? 43.913  18.475 41.699 1.00 44.68  ? 4   ALA B N   1 
ATOM   1401 C  CA  . ALA C 1 9   ? 44.722  18.518 42.911 1.00 44.47  ? 4   ALA B CA  1 
ATOM   1402 C  C   . ALA C 1 9   ? 46.157  18.047 42.663 1.00 43.42  ? 4   ALA B C   1 
ATOM   1403 O  O   . ALA C 1 9   ? 47.102  18.513 43.310 1.00 41.31  ? 4   ALA B O   1 
ATOM   1404 C  CB  . ALA C 1 9   ? 44.070  17.660 43.993 1.00 43.94  ? 4   ALA B CB  1 
ATOM   1405 N  N   . GLU C 1 10  ? 46.322  17.119 41.729 1.00 44.00  ? 5   GLU B N   1 
ATOM   1406 C  CA  . GLU C 1 10  ? 47.653  16.616 41.429 1.00 44.04  ? 5   GLU B CA  1 
ATOM   1407 C  C   . GLU C 1 10  ? 48.541  17.743 40.894 1.00 41.98  ? 5   GLU B C   1 
ATOM   1408 O  O   . GLU C 1 10  ? 49.706  17.885 41.301 1.00 40.73  ? 5   GLU B O   1 
ATOM   1409 C  CB  . GLU C 1 10  ? 47.569  15.471 40.422 1.00 47.15  ? 5   GLU B CB  1 
ATOM   1410 C  CG  . GLU C 1 10  ? 48.931  14.921 40.028 1.00 56.13  ? 5   GLU B CG  1 
ATOM   1411 C  CD  . GLU C 1 10  ? 49.928  14.887 41.196 1.00 60.66  ? 5   GLU B CD  1 
ATOM   1412 O  OE1 . GLU C 1 10  ? 49.533  14.496 42.320 1.00 64.60  ? 5   GLU B OE1 1 
ATOM   1413 O  OE2 . GLU C 1 10  ? 51.115  15.230 40.987 1.00 62.47  ? 5   GLU B OE2 1 
ATOM   1414 N  N   . GLY C 1 11  ? 47.974  18.551 39.999 1.00 38.56  ? 6   GLY B N   1 
ATOM   1415 C  CA  . GLY C 1 11  ? 48.702  19.661 39.421 1.00 35.12  ? 6   GLY B CA  1 
ATOM   1416 C  C   . GLY C 1 11  ? 48.970  20.773 40.418 1.00 35.80  ? 6   GLY B C   1 
ATOM   1417 O  O   . GLY C 1 11  ? 50.057  21.349 40.442 1.00 36.33  ? 6   GLY B O   1 
ATOM   1418 N  N   . GLU C 1 12  ? 47.975  21.083 41.240 1.00 34.68  ? 7   GLU B N   1 
ATOM   1419 C  CA  . GLU C 1 12  ? 48.113  22.114 42.252 1.00 34.15  ? 7   GLU B CA  1 
ATOM   1420 C  C   . GLU C 1 12  ? 49.226  21.742 43.231 1.00 34.06  ? 7   GLU B C   1 
ATOM   1421 O  O   . GLU C 1 12  ? 50.060  22.575 43.598 1.00 35.54  ? 7   GLU B O   1 
ATOM   1422 C  CB  . GLU C 1 12  ? 46.790  22.284 43.006 1.00 33.18  ? 7   GLU B CB  1 
ATOM   1423 C  CG  . GLU C 1 12  ? 45.664  22.835 42.140 1.00 35.24  ? 7   GLU B CG  1 
ATOM   1424 C  CD  . GLU C 1 12  ? 44.271  22.686 42.767 1.00 37.27  ? 7   GLU B CD  1 
ATOM   1425 O  OE1 . GLU C 1 12  ? 44.173  22.471 44.000 1.00 36.73  ? 7   GLU B OE1 1 
ATOM   1426 O  OE2 . GLU C 1 12  ? 43.272  22.798 42.017 1.00 35.43  ? 7   GLU B OE2 1 
ATOM   1427 N  N   . SER C 1 13  ? 49.252  20.481 43.641 1.00 33.89  ? 8   SER B N   1 
ATOM   1428 C  CA  . SER C 1 13  ? 50.260  20.022 44.590 1.00 32.33  ? 8   SER B CA  1 
ATOM   1429 C  C   . SER C 1 13  ? 51.679  20.101 44.037 1.00 30.75  ? 8   SER B C   1 
ATOM   1430 O  O   . SER C 1 13  ? 52.589  20.601 44.701 1.00 29.86  ? 8   SER B O   1 
ATOM   1431 C  CB  . SER C 1 13  ? 49.952  18.591 45.027 1.00 33.42  ? 8   SER B CB  1 
ATOM   1432 O  OG  . SER C 1 13  ? 50.811  18.209 46.086 1.00 35.52  ? 8   SER B OG  1 
ATOM   1433 N  N   . LEU C 1 14  ? 51.876  19.604 42.822 1.00 29.89  ? 9   LEU B N   1 
ATOM   1434 C  CA  . LEU C 1 14  ? 53.197  19.649 42.214 1.00 28.41  ? 9   LEU B CA  1 
ATOM   1435 C  C   . LEU C 1 14  ? 53.703  21.090 42.054 1.00 27.71  ? 9   LEU B C   1 
ATOM   1436 O  O   . LEU C 1 14  ? 54.881  21.366 42.303 1.00 26.39  ? 9   LEU B O   1 
ATOM   1437 C  CB  . LEU C 1 14  ? 53.179  18.929 40.858 1.00 29.49  ? 9   LEU B CB  1 
ATOM   1438 C  CG  . LEU C 1 14  ? 53.187  17.394 40.938 1.00 29.39  ? 9   LEU B CG  1 
ATOM   1439 C  CD1 . LEU C 1 14  ? 53.058  16.762 39.548 1.00 26.34  ? 9   LEU B CD1 1 
ATOM   1440 C  CD2 . LEU C 1 14  ? 54.475  16.956 41.608 1.00 28.64  ? 9   LEU B CD2 1 
ATOM   1441 N  N   . GLU C 1 15  ? 52.826  22.014 41.655 1.00 26.52  ? 10  GLU B N   1 
ATOM   1442 C  CA  . GLU C 1 15  ? 53.245  23.404 41.482 1.00 27.20  ? 10  GLU B CA  1 
ATOM   1443 C  C   . GLU C 1 15  ? 53.549  24.047 42.826 1.00 28.51  ? 10  GLU B C   1 
ATOM   1444 O  O   . GLU C 1 15  ? 54.409  24.926 42.931 1.00 28.23  ? 10  GLU B O   1 
ATOM   1445 C  CB  . GLU C 1 15  ? 52.166  24.223 40.776 1.00 28.10  ? 10  GLU B CB  1 
ATOM   1446 C  CG  . GLU C 1 15  ? 52.456  25.734 40.721 1.00 28.07  ? 10  GLU B CG  1 
ATOM   1447 C  CD  . GLU C 1 15  ? 53.580  26.107 39.751 1.00 29.73  ? 10  GLU B CD  1 
ATOM   1448 O  OE1 . GLU C 1 15  ? 54.245  25.190 39.211 1.00 29.71  ? 10  GLU B OE1 1 
ATOM   1449 O  OE2 . GLU C 1 15  ? 53.797  27.324 39.528 1.00 26.31  ? 10  GLU B OE2 1 
ATOM   1450 N  N   . SER C 1 16  ? 52.838  23.613 43.856 1.00 28.06  ? 11  SER B N   1 
ATOM   1451 C  CA  . SER C 1 16  ? 53.057  24.165 45.176 1.00 30.39  ? 11  SER B CA  1 
ATOM   1452 C  C   . SER C 1 16  ? 54.491  23.832 45.623 1.00 31.09  ? 11  SER B C   1 
ATOM   1453 O  O   . SER C 1 16  ? 55.181  24.679 46.207 1.00 31.84  ? 11  SER B O   1 
ATOM   1454 C  CB  . SER C 1 16  ? 52.020  23.599 46.146 1.00 30.61  ? 11  SER B CB  1 
ATOM   1455 O  OG  . SER C 1 16  ? 51.952  24.389 47.315 1.00 34.79  ? 11  SER B OG  1 
ATOM   1456 N  N   . TRP C 1 17  ? 54.940  22.606 45.344 1.00 30.48  ? 12  TRP B N   1 
ATOM   1457 C  CA  . TRP C 1 17  ? 56.305  22.208 45.684 1.00 30.43  ? 12  TRP B CA  1 
ATOM   1458 C  C   . TRP C 1 17  ? 57.278  23.006 44.827 1.00 30.08  ? 12  TRP B C   1 
ATOM   1459 O  O   . TRP C 1 17  ? 58.212  23.619 45.340 1.00 32.36  ? 12  TRP B O   1 
ATOM   1460 C  CB  . TRP C 1 17  ? 56.545  20.717 45.424 1.00 32.11  ? 12  TRP B CB  1 
ATOM   1461 C  CG  . TRP C 1 17  ? 56.002  19.807 46.477 1.00 33.92  ? 12  TRP B CG  1 
ATOM   1462 C  CD1 . TRP C 1 17  ? 54.753  19.243 46.517 1.00 33.20  ? 12  TRP B CD1 1 
ATOM   1463 C  CD2 . TRP C 1 17  ? 56.682  19.363 47.662 1.00 32.96  ? 12  TRP B CD2 1 
ATOM   1464 N  NE1 . TRP C 1 17  ? 54.618  18.477 47.651 1.00 32.41  ? 12  TRP B NE1 1 
ATOM   1465 C  CE2 . TRP C 1 17  ? 55.784  18.532 48.373 1.00 32.78  ? 12  TRP B CE2 1 
ATOM   1466 C  CE3 . TRP C 1 17  ? 57.959  19.588 48.193 1.00 32.61  ? 12  TRP B CE3 1 
ATOM   1467 C  CZ2 . TRP C 1 17  ? 56.126  17.922 49.592 1.00 31.16  ? 12  TRP B CZ2 1 
ATOM   1468 C  CZ3 . TRP C 1 17  ? 58.300  18.979 49.412 1.00 32.96  ? 12  TRP B CZ3 1 
ATOM   1469 C  CH2 . TRP C 1 17  ? 57.381  18.157 50.093 1.00 31.03  ? 12  TRP B CH2 1 
ATOM   1470 N  N   . LEU C 1 18  ? 57.061  22.995 43.514 1.00 29.67  ? 13  LEU B N   1 
ATOM   1471 C  CA  . LEU C 1 18  ? 57.931  23.734 42.601 1.00 28.31  ? 13  LEU B CA  1 
ATOM   1472 C  C   . LEU C 1 18  ? 58.089  25.171 43.102 1.00 28.52  ? 13  LEU B C   1 
ATOM   1473 O  O   . LEU C 1 18  ? 59.177  25.753 43.016 1.00 27.71  ? 13  LEU B O   1 
ATOM   1474 C  CB  . LEU C 1 18  ? 57.357  23.724 41.177 1.00 25.25  ? 13  LEU B CB  1 
ATOM   1475 C  CG  . LEU C 1 18  ? 58.362  24.128 40.092 1.00 26.43  ? 13  LEU B CG  1 
ATOM   1476 C  CD1 . LEU C 1 18  ? 59.676  23.337 40.283 1.00 27.05  ? 13  LEU B CD1 1 
ATOM   1477 C  CD2 . LEU C 1 18  ? 57.780  23.868 38.718 1.00 23.23  ? 13  LEU B CD2 1 
ATOM   1478 N  N   . ASN C 1 19  ? 57.002  25.733 43.636 1.00 28.77  ? 14  ASN B N   1 
ATOM   1479 C  CA  . ASN C 1 19  ? 57.025  27.093 44.177 1.00 29.74  ? 14  ASN B CA  1 
ATOM   1480 C  C   . ASN C 1 19  ? 58.112  27.213 45.233 1.00 29.73  ? 14  ASN B C   1 
ATOM   1481 O  O   . ASN C 1 19  ? 58.990  28.078 45.148 1.00 27.69  ? 14  ASN B O   1 
ATOM   1482 C  CB  . ASN C 1 19  ? 55.675  27.435 44.801 1.00 30.34  ? 14  ASN B CB  1 
ATOM   1483 C  CG  . ASN C 1 19  ? 54.939  28.509 44.035 1.00 32.12  ? 14  ASN B CG  1 
ATOM   1484 O  OD1 . ASN C 1 19  ? 55.058  28.611 42.810 1.00 31.32  ? 14  ASN B OD1 1 
ATOM   1485 N  ND2 . ASN C 1 19  ? 54.159  29.313 44.750 1.00 35.21  ? 14  ASN B ND2 1 
ATOM   1486 N  N   . LYS C 1 20  ? 58.054  26.327 46.225 1.00 31.59  ? 15  LYS B N   1 
ATOM   1487 C  CA  . LYS C 1 20  ? 59.035  26.328 47.309 1.00 32.97  ? 15  LYS B CA  1 
ATOM   1488 C  C   . LYS C 1 20  ? 60.443  26.080 46.790 1.00 31.73  ? 15  LYS B C   1 
ATOM   1489 O  O   . LYS C 1 20  ? 61.394  26.749 47.207 1.00 30.82  ? 15  LYS B O   1 
ATOM   1490 C  CB  . LYS C 1 20  ? 58.672  25.270 48.361 1.00 36.14  ? 15  LYS B CB  1 
ATOM   1491 C  CG  . LYS C 1 20  ? 57.332  25.528 49.044 1.00 42.31  ? 15  LYS B CG  1 
ATOM   1492 C  CD  . LYS C 1 20  ? 57.301  25.023 50.489 1.00 46.24  ? 15  LYS B CD  1 
ATOM   1493 C  CE  . LYS C 1 20  ? 56.027  25.488 51.211 1.00 48.57  ? 15  LYS B CE  1 
ATOM   1494 N  NZ  . LYS C 1 20  ? 55.920  24.972 52.616 1.00 50.30  ? 15  LYS B NZ  1 
ATOM   1495 N  N   . ALA C 1 21  ? 60.569  25.125 45.870 1.00 29.93  ? 16  ALA B N   1 
ATOM   1496 C  CA  . ALA C 1 21  ? 61.860  24.772 45.283 1.00 28.14  ? 16  ALA B CA  1 
ATOM   1497 C  C   . ALA C 1 21  ? 62.465  25.869 44.401 1.00 27.42  ? 16  ALA B C   1 
ATOM   1498 O  O   . ALA C 1 21  ? 63.673  25.882 44.159 1.00 26.85  ? 16  ALA B O   1 
ATOM   1499 C  CB  . ALA C 1 21  ? 61.715  23.482 44.476 1.00 27.93  ? 16  ALA B CB  1 
ATOM   1500 N  N   . THR C 1 22  ? 61.644  26.794 43.920 1.00 28.28  ? 17  THR B N   1 
ATOM   1501 C  CA  . THR C 1 22  ? 62.159  27.850 43.046 1.00 28.84  ? 17  THR B CA  1 
ATOM   1502 C  C   . THR C 1 22  ? 61.815  29.253 43.526 1.00 29.56  ? 17  THR B C   1 
ATOM   1503 O  O   . THR C 1 22  ? 61.860  30.213 42.750 1.00 28.53  ? 17  THR B O   1 
ATOM   1504 C  CB  . THR C 1 22  ? 61.609  27.703 41.622 1.00 28.61  ? 17  THR B CB  1 
ATOM   1505 O  OG1 . THR C 1 22  ? 60.179  27.786 41.663 1.00 27.37  ? 17  THR B OG1 1 
ATOM   1506 C  CG2 . THR C 1 22  ? 62.017  26.368 41.019 1.00 25.80  ? 17  THR B CG2 1 
ATOM   1507 N  N   . ASN C 1 23  ? 61.465  29.362 44.804 1.00 30.36  ? 18  ASN B N   1 
ATOM   1508 C  CA  . ASN C 1 23  ? 61.116  30.643 45.410 1.00 31.29  ? 18  ASN B CA  1 
ATOM   1509 C  C   . ASN C 1 23  ? 62.270  31.638 45.234 1.00 31.43  ? 18  ASN B C   1 
ATOM   1510 O  O   . ASN C 1 23  ? 63.383  31.401 45.699 1.00 29.82  ? 18  ASN B O   1 
ATOM   1511 C  CB  . ASN C 1 23  ? 60.820  30.423 46.894 1.00 32.58  ? 18  ASN B CB  1 
ATOM   1512 C  CG  . ASN C 1 23  ? 60.184  31.628 47.556 1.00 33.10  ? 18  ASN B CG  1 
ATOM   1513 O  OD1 . ASN C 1 23  ? 59.776  31.555 48.709 1.00 35.80  ? 18  ASN B OD1 1 
ATOM   1514 N  ND2 . ASN C 1 23  ? 60.101  32.740 46.837 1.00 32.63  ? 18  ASN B ND2 1 
ATOM   1515 N  N   . PRO C 1 24  ? 62.014  32.768 44.556 1.00 33.12  ? 19  PRO B N   1 
ATOM   1516 C  CA  . PRO C 1 24  ? 63.071  33.767 44.344 1.00 34.44  ? 19  PRO B CA  1 
ATOM   1517 C  C   . PRO C 1 24  ? 63.690  34.260 45.656 1.00 35.73  ? 19  PRO B C   1 
ATOM   1518 O  O   . PRO C 1 24  ? 64.817  34.756 45.675 1.00 36.29  ? 19  PRO B O   1 
ATOM   1519 C  CB  . PRO C 1 24  ? 62.345  34.895 43.602 1.00 35.51  ? 19  PRO B CB  1 
ATOM   1520 C  CG  . PRO C 1 24  ? 61.166  34.194 42.946 1.00 34.31  ? 19  PRO B CG  1 
ATOM   1521 C  CD  . PRO C 1 24  ? 60.729  33.223 43.993 1.00 32.56  ? 19  PRO B CD  1 
ATOM   1522 N  N   . SER C 1 25  ? 62.950  34.142 46.753 1.00 37.07  ? 20  SER B N   1 
ATOM   1523 C  CA  . SER C 1 25  ? 63.461  34.597 48.042 1.00 38.79  ? 20  SER B CA  1 
ATOM   1524 C  C   . SER C 1 25  ? 64.601  33.713 48.541 1.00 39.96  ? 20  SER B C   1 
ATOM   1525 O  O   . SER C 1 25  ? 65.559  34.216 49.123 1.00 41.87  ? 20  SER B O   1 
ATOM   1526 C  CB  . SER C 1 25  ? 62.334  34.642 49.070 1.00 37.51  ? 20  SER B CB  1 
ATOM   1527 O  OG  . SER C 1 25  ? 61.636  33.415 49.094 1.00 40.02  ? 20  SER B OG  1 
ATOM   1528 N  N   . ASN C 1 26  ? 64.502  32.407 48.303 1.00 40.04  ? 21  ASN B N   1 
ATOM   1529 C  CA  . ASN C 1 26  ? 65.537  31.460 48.719 1.00 41.93  ? 21  ASN B CA  1 
ATOM   1530 C  C   . ASN C 1 26  ? 66.923  32.065 48.543 1.00 44.28  ? 21  ASN B C   1 
ATOM   1531 O  O   . ASN C 1 26  ? 67.248  32.595 47.477 1.00 44.37  ? 21  ASN B O   1 
ATOM   1532 C  CB  . ASN C 1 26  ? 65.446  30.174 47.894 1.00 40.16  ? 21  ASN B CB  1 
ATOM   1533 C  CG  . ASN C 1 26  ? 64.205  29.362 48.209 1.00 39.45  ? 21  ASN B CG  1 
ATOM   1534 O  OD1 . ASN C 1 26  ? 63.816  28.486 47.436 1.00 39.54  ? 21  ASN B OD1 1 
ATOM   1535 N  ND2 . ASN C 1 26  ? 63.585  29.636 49.354 1.00 37.48  ? 21  ASN B ND2 1 
ATOM   1536 N  N   . ARG C 1 27  ? 67.736  31.983 49.592 1.00 47.07  ? 22  ARG B N   1 
ATOM   1537 C  CA  . ARG C 1 27  ? 69.093  32.525 49.564 1.00 49.63  ? 22  ARG B CA  1 
ATOM   1538 C  C   . ARG C 1 27  ? 70.050  31.570 48.853 1.00 48.65  ? 22  ARG B C   1 
ATOM   1539 O  O   . ARG C 1 27  ? 71.163  31.951 48.488 1.00 48.37  ? 22  ARG B O   1 
ATOM   1540 C  CB  . ARG C 1 27  ? 69.577  32.796 50.995 1.00 54.77  ? 22  ARG B CB  1 
ATOM   1541 C  CG  . ARG C 1 27  ? 71.002  33.342 51.095 1.00 61.52  ? 22  ARG B CG  1 
ATOM   1542 C  CD  . ARG C 1 27  ? 71.439  33.540 52.548 1.00 65.12  ? 22  ARG B CD  1 
ATOM   1543 N  NE  . ARG C 1 27  ? 72.798  34.071 52.641 1.00 70.04  ? 22  ARG B NE  1 
ATOM   1544 C  CZ  . ARG C 1 27  ? 73.297  34.662 53.725 1.00 73.92  ? 22  ARG B CZ  1 
ATOM   1545 N  NH1 . ARG C 1 27  ? 72.544  34.797 54.813 1.00 75.30  ? 22  ARG B NH1 1 
ATOM   1546 N  NH2 . ARG C 1 27  ? 74.544  35.129 53.722 1.00 74.36  ? 22  ARG B NH2 1 
ATOM   1547 N  N   . GLN C 1 28  ? 69.605  30.328 48.672 1.00 48.51  ? 23  GLN B N   1 
ATOM   1548 C  CA  . GLN C 1 28  ? 70.374  29.292 47.980 1.00 47.92  ? 23  GLN B CA  1 
ATOM   1549 C  C   . GLN C 1 28  ? 69.481  28.096 47.711 1.00 45.89  ? 23  GLN B C   1 
ATOM   1550 O  O   . GLN C 1 28  ? 68.367  28.021 48.242 1.00 44.08  ? 23  GLN B O   1 
ATOM   1551 C  CB  . GLN C 1 28  ? 71.591  28.841 48.795 1.00 50.53  ? 23  GLN B CB  1 
ATOM   1552 C  CG  . GLN C 1 28  ? 72.876  29.607 48.468 1.00 57.49  ? 23  GLN B CG  1 
ATOM   1553 C  CD  . GLN C 1 28  ? 73.118  29.767 46.958 1.00 61.03  ? 23  GLN B CD  1 
ATOM   1554 O  OE1 . GLN C 1 28  ? 73.078  28.792 46.193 1.00 63.01  ? 23  GLN B OE1 1 
ATOM   1555 N  NE2 . GLN C 1 28  ? 73.378  31.004 46.529 1.00 59.79  ? 23  GLN B NE2 1 
ATOM   1556 N  N   . GLU C 1 29  ? 69.967  27.164 46.892 1.00 44.24  ? 24  GLU B N   1 
ATOM   1557 C  CA  . GLU C 1 29  ? 69.192  25.978 46.558 1.00 44.49  ? 24  GLU B CA  1 
ATOM   1558 C  C   . GLU C 1 29  ? 68.677  25.281 47.795 1.00 45.12  ? 24  GLU B C   1 
ATOM   1559 O  O   . GLU C 1 29  ? 69.446  24.940 48.691 1.00 47.13  ? 24  GLU B O   1 
ATOM   1560 C  CB  . GLU C 1 29  ? 70.014  24.998 45.722 1.00 43.12  ? 24  GLU B CB  1 
ATOM   1561 C  CG  . GLU C 1 29  ? 70.056  25.367 44.262 1.00 44.55  ? 24  GLU B CG  1 
ATOM   1562 C  CD  . GLU C 1 29  ? 71.402  25.884 43.833 1.00 47.09  ? 24  GLU B CD  1 
ATOM   1563 O  OE1 . GLU C 1 29  ? 72.041  26.618 44.627 1.00 48.23  ? 24  GLU B OE1 1 
ATOM   1564 O  OE2 . GLU C 1 29  ? 71.815  25.562 42.696 1.00 47.41  ? 24  GLU B OE2 1 
ATOM   1565 N  N   . ASP C 1 30  ? 67.365  25.085 47.833 1.00 45.64  ? 25  ASP B N   1 
ATOM   1566 C  CA  . ASP C 1 30  ? 66.691  24.428 48.945 1.00 45.66  ? 25  ASP B CA  1 
ATOM   1567 C  C   . ASP C 1 30  ? 66.452  22.971 48.545 1.00 45.44  ? 25  ASP B C   1 
ATOM   1568 O  O   . ASP C 1 30  ? 65.406  22.634 47.977 1.00 44.42  ? 25  ASP B O   1 
ATOM   1569 C  CB  . ASP C 1 30  ? 65.357  25.120 49.202 1.00 47.27  ? 25  ASP B CB  1 
ATOM   1570 C  CG  . ASP C 1 30  ? 64.833  24.876 50.595 1.00 50.03  ? 25  ASP B CG  1 
ATOM   1571 O  OD1 . ASP C 1 30  ? 64.686  23.693 50.993 1.00 49.85  ? 25  ASP B OD1 1 
ATOM   1572 O  OD2 . ASP C 1 30  ? 64.559  25.882 51.289 1.00 52.71  ? 25  ASP B OD2 1 
ATOM   1573 N  N   . TRP C 1 31  ? 67.419  22.111 48.855 1.00 44.55  ? 26  TRP B N   1 
ATOM   1574 C  CA  . TRP C 1 31  ? 67.340  20.705 48.491 1.00 43.15  ? 26  TRP B CA  1 
ATOM   1575 C  C   . TRP C 1 31  ? 66.213  19.882 49.079 1.00 44.59  ? 26  TRP B C   1 
ATOM   1576 O  O   . TRP C 1 31  ? 65.825  18.875 48.489 1.00 44.31  ? 26  TRP B O   1 
ATOM   1577 C  CB  . TRP C 1 31  ? 68.683  20.032 48.755 1.00 40.06  ? 26  TRP B CB  1 
ATOM   1578 C  CG  . TRP C 1 31  ? 69.705  20.524 47.810 1.00 36.12  ? 26  TRP B CG  1 
ATOM   1579 C  CD1 . TRP C 1 31  ? 70.570  21.561 48.006 1.00 36.75  ? 26  TRP B CD1 1 
ATOM   1580 C  CD2 . TRP C 1 31  ? 69.865  20.122 46.445 1.00 35.44  ? 26  TRP B CD2 1 
ATOM   1581 N  NE1 . TRP C 1 31  ? 71.252  21.838 46.845 1.00 35.93  ? 26  TRP B NE1 1 
ATOM   1582 C  CE2 . TRP C 1 31  ? 70.836  20.971 45.869 1.00 34.90  ? 26  TRP B CE2 1 
ATOM   1583 C  CE3 . TRP C 1 31  ? 69.273  19.130 45.648 1.00 34.70  ? 26  TRP B CE3 1 
ATOM   1584 C  CZ2 . TRP C 1 31  ? 71.228  20.861 44.532 1.00 33.45  ? 26  TRP B CZ2 1 
ATOM   1585 C  CZ3 . TRP C 1 31  ? 69.666  19.022 44.314 1.00 31.37  ? 26  TRP B CZ3 1 
ATOM   1586 C  CH2 . TRP C 1 31  ? 70.632  19.884 43.774 1.00 32.53  ? 26  TRP B CH2 1 
ATOM   1587 N  N   . GLU C 1 32  ? 65.678  20.290 50.224 1.00 47.16  ? 27  GLU B N   1 
ATOM   1588 C  CA  . GLU C 1 32  ? 64.575  19.540 50.820 1.00 49.40  ? 27  GLU B CA  1 
ATOM   1589 C  C   . GLU C 1 32  ? 63.349  19.632 49.910 1.00 48.97  ? 27  GLU B C   1 
ATOM   1590 O  O   . GLU C 1 32  ? 62.567  18.689 49.812 1.00 49.98  ? 27  GLU B O   1 
ATOM   1591 C  CB  . GLU C 1 32  ? 64.204  20.096 52.199 1.00 52.38  ? 27  GLU B CB  1 
ATOM   1592 C  CG  . GLU C 1 32  ? 65.381  20.318 53.134 1.00 58.98  ? 27  GLU B CG  1 
ATOM   1593 C  CD  . GLU C 1 32  ? 64.949  20.442 54.592 1.00 62.61  ? 27  GLU B CD  1 
ATOM   1594 O  OE1 . GLU C 1 32  ? 63.919  21.114 54.852 1.00 64.45  ? 27  GLU B OE1 1 
ATOM   1595 O  OE2 . GLU C 1 32  ? 65.644  19.874 55.472 1.00 62.17  ? 27  GLU B OE2 1 
ATOM   1596 N  N   . TYR C 1 33  ? 63.191  20.775 49.246 1.00 48.40  ? 28  TYR B N   1 
ATOM   1597 C  CA  . TYR C 1 33  ? 62.053  21.005 48.357 1.00 47.07  ? 28  TYR B CA  1 
ATOM   1598 C  C   . TYR C 1 33  ? 62.268  20.455 46.954 1.00 44.14  ? 28  TYR B C   1 
ATOM   1599 O  O   . TYR C 1 33  ? 61.314  20.034 46.288 1.00 42.74  ? 28  TYR B O   1 
ATOM   1600 C  CB  . TYR C 1 33  ? 61.746  22.503 48.316 1.00 49.77  ? 28  TYR B CB  1 
ATOM   1601 C  CG  . TYR C 1 33  ? 61.285  23.022 49.661 1.00 53.87  ? 28  TYR B CG  1 
ATOM   1602 C  CD1 . TYR C 1 33  ? 60.508  22.222 50.504 1.00 54.43  ? 28  TYR B CD1 1 
ATOM   1603 C  CD2 . TYR C 1 33  ? 61.629  24.302 50.099 1.00 55.38  ? 28  TYR B CD2 1 
ATOM   1604 C  CE1 . TYR C 1 33  ? 60.084  22.675 51.746 1.00 56.62  ? 28  TYR B CE1 1 
ATOM   1605 C  CE2 . TYR C 1 33  ? 61.211  24.769 51.349 1.00 57.69  ? 28  TYR B CE2 1 
ATOM   1606 C  CZ  . TYR C 1 33  ? 60.436  23.949 52.167 1.00 58.69  ? 28  TYR B CZ  1 
ATOM   1607 O  OH  . TYR C 1 33  ? 59.997  24.401 53.399 1.00 60.28  ? 28  TYR B OH  1 
ATOM   1608 N  N   . ILE C 1 34  ? 63.525  20.456 46.518 1.00 42.28  ? 29  ILE B N   1 
ATOM   1609 C  CA  . ILE C 1 34  ? 63.901  19.945 45.206 1.00 39.61  ? 29  ILE B CA  1 
ATOM   1610 C  C   . ILE C 1 34  ? 63.639  18.441 45.174 1.00 39.33  ? 29  ILE B C   1 
ATOM   1611 O  O   . ILE C 1 34  ? 62.840  17.958 44.360 1.00 38.52  ? 29  ILE B O   1 
ATOM   1612 C  CB  . ILE C 1 34  ? 65.382  20.205 44.931 1.00 39.42  ? 29  ILE B CB  1 
ATOM   1613 C  CG1 . ILE C 1 34  ? 65.626  21.710 44.837 1.00 39.51  ? 29  ILE B CG1 1 
ATOM   1614 C  CG2 . ILE C 1 34  ? 65.809  19.491 43.660 1.00 40.47  ? 29  ILE B CG2 1 
ATOM   1615 C  CD1 . ILE C 1 34  ? 67.079  22.079 44.592 1.00 39.43  ? 29  ILE B CD1 1 
ATOM   1616 N  N   . ILE C 1 35  ? 64.305  17.708 46.068 1.00 37.87  ? 30  ILE B N   1 
ATOM   1617 C  CA  . ILE C 1 35  ? 64.127  16.259 46.161 1.00 35.01  ? 30  ILE B CA  1 
ATOM   1618 C  C   . ILE C 1 35  ? 62.656  16.009 46.496 1.00 32.66  ? 30  ILE B C   1 
ATOM   1619 O  O   . ILE C 1 35  ? 62.059  15.011 46.070 1.00 30.33  ? 30  ILE B O   1 
ATOM   1620 C  CB  . ILE C 1 35  ? 64.990  15.632 47.291 1.00 35.73  ? 30  ILE B CB  1 
ATOM   1621 C  CG1 . ILE C 1 35  ? 66.432  16.164 47.248 1.00 38.11  ? 30  ILE B CG1 1 
ATOM   1622 C  CG2 . ILE C 1 35  ? 64.979  14.124 47.157 1.00 35.58  ? 30  ILE B CG2 1 
ATOM   1623 C  CD1 . ILE C 1 35  ? 67.208  15.860 45.970 1.00 37.78  ? 30  ILE B CD1 1 
ATOM   1624 N  N   . GLY C 1 36  ? 62.074  16.925 47.267 1.00 31.95  ? 31  GLY B N   1 
ATOM   1625 C  CA  . GLY C 1 36  ? 60.671  16.792 47.639 1.00 32.08  ? 31  GLY B CA  1 
ATOM   1626 C  C   . GLY C 1 36  ? 59.794  16.769 46.400 1.00 31.55  ? 31  GLY B C   1 
ATOM   1627 O  O   . GLY C 1 36  ? 58.844  15.982 46.293 1.00 29.24  ? 31  GLY B O   1 
ATOM   1628 N  N   . PHE C 1 37  ? 60.128  17.651 45.458 1.00 32.02  ? 32  PHE B N   1 
ATOM   1629 C  CA  . PHE C 1 37  ? 59.412  17.760 44.194 1.00 31.19  ? 32  PHE B CA  1 
ATOM   1630 C  C   . PHE C 1 37  ? 59.591  16.462 43.405 1.00 31.19  ? 32  PHE B C   1 
ATOM   1631 O  O   . PHE C 1 37  ? 58.616  15.883 42.901 1.00 29.61  ? 32  PHE B O   1 
ATOM   1632 C  CB  . PHE C 1 37  ? 59.958  18.946 43.392 1.00 30.56  ? 32  PHE B CB  1 
ATOM   1633 C  CG  . PHE C 1 37  ? 59.265  19.160 42.080 1.00 29.99  ? 32  PHE B CG  1 
ATOM   1634 C  CD1 . PHE C 1 37  ? 57.897  19.407 42.034 1.00 30.38  ? 32  PHE B CD1 1 
ATOM   1635 C  CD2 . PHE C 1 37  ? 59.981  19.116 40.890 1.00 28.33  ? 32  PHE B CD2 1 
ATOM   1636 C  CE1 . PHE C 1 37  ? 57.253  19.609 40.815 1.00 32.06  ? 32  PHE B CE1 1 
ATOM   1637 C  CE2 . PHE C 1 37  ? 59.355  19.315 39.676 1.00 27.65  ? 32  PHE B CE2 1 
ATOM   1638 C  CZ  . PHE C 1 37  ? 57.986  19.563 39.631 1.00 30.54  ? 32  PHE B CZ  1 
ATOM   1639 N  N   . CYS C 1 38  ? 60.837  16.002 43.311 1.00 30.55  ? 33  CYS B N   1 
ATOM   1640 C  CA  . CYS C 1 38  ? 61.143  14.766 42.592 1.00 31.43  ? 33  CYS B CA  1 
ATOM   1641 C  C   . CYS C 1 38  ? 60.349  13.603 43.141 1.00 32.58  ? 33  CYS B C   1 
ATOM   1642 O  O   . CYS C 1 38  ? 59.843  12.778 42.379 1.00 32.37  ? 33  CYS B O   1 
ATOM   1643 C  CB  . CYS C 1 38  ? 62.627  14.452 42.684 1.00 30.43  ? 33  CYS B CB  1 
ATOM   1644 S  SG  . CYS C 1 38  ? 63.627  15.591 41.722 1.00 32.19  ? 33  CYS B SG  1 
ATOM   1645 N  N   . ASP C 1 39  ? 60.241  13.537 44.466 1.00 34.86  ? 34  ASP B N   1 
ATOM   1646 C  CA  . ASP C 1 39  ? 59.480  12.476 45.103 1.00 35.96  ? 34  ASP B CA  1 
ATOM   1647 C  C   . ASP C 1 39  ? 58.026  12.520 44.660 1.00 36.01  ? 34  ASP B C   1 
ATOM   1648 O  O   . ASP C 1 39  ? 57.420  11.474 44.409 1.00 35.22  ? 34  ASP B O   1 
ATOM   1649 C  CB  . ASP C 1 39  ? 59.540  12.604 46.622 1.00 40.78  ? 34  ASP B CB  1 
ATOM   1650 C  CG  . ASP C 1 39  ? 60.805  12.013 47.208 1.00 44.36  ? 34  ASP B CG  1 
ATOM   1651 O  OD1 . ASP C 1 39  ? 61.166  10.884 46.814 1.00 47.40  ? 34  ASP B OD1 1 
ATOM   1652 O  OD2 . ASP C 1 39  ? 61.427  12.666 48.074 1.00 47.72  ? 34  ASP B OD2 1 
ATOM   1653 N  N   . GLN C 1 40  ? 57.464  13.728 44.572 1.00 35.36  ? 35  GLN B N   1 
ATOM   1654 C  CA  . GLN C 1 40  ? 56.065  13.890 44.154 1.00 34.14  ? 35  GLN B CA  1 
ATOM   1655 C  C   . GLN C 1 40  ? 55.872  13.370 42.745 1.00 33.03  ? 35  GLN B C   1 
ATOM   1656 O  O   . GLN C 1 40  ? 54.829  12.792 42.434 1.00 32.32  ? 35  GLN B O   1 
ATOM   1657 C  CB  . GLN C 1 40  ? 55.626  15.360 44.211 1.00 34.59  ? 35  GLN B CB  1 
ATOM   1658 C  CG  . GLN C 1 40  ? 55.446  15.912 45.611 1.00 34.65  ? 35  GLN B CG  1 
ATOM   1659 C  CD  . GLN C 1 40  ? 54.519  15.064 46.467 1.00 33.69  ? 35  GLN B CD  1 
ATOM   1660 O  OE1 . GLN C 1 40  ? 53.344  14.859 46.135 1.00 33.62  ? 35  GLN B OE1 1 
ATOM   1661 N  NE2 . GLN C 1 40  ? 55.047  14.567 47.580 1.00 33.75  ? 35  GLN B NE2 1 
ATOM   1662 N  N   . ILE C 1 41  ? 56.876  13.585 41.892 1.00 32.63  ? 36  ILE B N   1 
ATOM   1663 C  CA  . ILE C 1 41  ? 56.823  13.100 40.513 1.00 31.55  ? 36  ILE B CA  1 
ATOM   1664 C  C   . ILE C 1 41  ? 56.798  11.572 40.497 1.00 30.55  ? 36  ILE B C   1 
ATOM   1665 O  O   . ILE C 1 41  ? 56.029  10.966 39.745 1.00 28.37  ? 36  ILE B O   1 
ATOM   1666 C  CB  . ILE C 1 41  ? 58.060  13.524 39.686 1.00 31.69  ? 36  ILE B CB  1 
ATOM   1667 C  CG1 . ILE C 1 41  ? 58.151  15.042 39.593 1.00 33.26  ? 36  ILE B CG1 1 
ATOM   1668 C  CG2 . ILE C 1 41  ? 57.966  12.936 38.287 1.00 29.15  ? 36  ILE B CG2 1 
ATOM   1669 C  CD1 . ILE C 1 41  ? 56.908  15.656 39.041 1.00 37.82  ? 36  ILE B CD1 1 
ATOM   1670 N  N   . ASN C 1 42  ? 57.645  10.960 41.326 1.00 30.66  ? 37  ASN B N   1 
ATOM   1671 C  CA  . ASN C 1 42  ? 57.742  9.504  41.385 1.00 32.21  ? 37  ASN B CA  1 
ATOM   1672 C  C   . ASN C 1 42  ? 56.499  8.798  41.884 1.00 33.96  ? 37  ASN B C   1 
ATOM   1673 O  O   . ASN C 1 42  ? 56.169  7.710  41.403 1.00 34.37  ? 37  ASN B O   1 
ATOM   1674 C  CB  . ASN C 1 42  ? 58.935  9.066  42.238 1.00 30.60  ? 37  ASN B CB  1 
ATOM   1675 C  CG  . ASN C 1 42  ? 60.250  9.548  41.677 1.00 31.64  ? 37  ASN B CG  1 
ATOM   1676 O  OD1 . ASN C 1 42  ? 60.342  9.896  40.492 1.00 31.66  ? 37  ASN B OD1 1 
ATOM   1677 N  ND2 . ASN C 1 42  ? 61.280  9.572  42.516 1.00 29.02  ? 37  ASN B ND2 1 
ATOM   1678 N  N   . LYS C 1 43  ? 55.796  9.398  42.837 1.00 35.72  ? 38  LYS B N   1 
ATOM   1679 C  CA  . LYS C 1 43  ? 54.611  8.739  43.350 1.00 37.57  ? 38  LYS B CA  1 
ATOM   1680 C  C   . LYS C 1 43  ? 53.359  9.094  42.562 1.00 37.52  ? 38  LYS B C   1 
ATOM   1681 O  O   . LYS C 1 43  ? 52.300  8.494  42.762 1.00 38.37  ? 38  LYS B O   1 
ATOM   1682 C  CB  . LYS C 1 43  ? 54.419  9.057  44.835 1.00 40.40  ? 38  LYS B CB  1 
ATOM   1683 C  CG  . LYS C 1 43  ? 54.064  10.492 45.133 1.00 45.54  ? 38  LYS B CG  1 
ATOM   1684 C  CD  . LYS C 1 43  ? 53.799  10.703 46.626 1.00 50.13  ? 38  LYS B CD  1 
ATOM   1685 C  CE  . LYS C 1 43  ? 55.008  10.350 47.477 1.00 51.79  ? 38  LYS B CE  1 
ATOM   1686 N  NZ  . LYS C 1 43  ? 54.814  10.794 48.887 1.00 53.61  ? 38  LYS B NZ  1 
ATOM   1687 N  N   . GLU C 1 44  ? 53.468  10.041 41.640 1.00 37.66  ? 39  GLU B N   1 
ATOM   1688 C  CA  . GLU C 1 44  ? 52.292  10.419 40.876 1.00 38.65  ? 39  GLU B CA  1 
ATOM   1689 C  C   . GLU C 1 44  ? 52.181  9.837  39.472 1.00 39.06  ? 39  GLU B C   1 
ATOM   1690 O  O   . GLU C 1 44  ? 53.076  9.998  38.643 1.00 40.14  ? 39  GLU B O   1 
ATOM   1691 C  CB  . GLU C 1 44  ? 52.170  11.934 40.788 1.00 40.25  ? 39  GLU B CB  1 
ATOM   1692 C  CG  . GLU C 1 44  ? 50.755  12.319 40.481 1.00 44.12  ? 39  GLU B CG  1 
ATOM   1693 C  CD  . GLU C 1 44  ? 49.825  12.022 41.648 1.00 47.55  ? 39  GLU B CD  1 
ATOM   1694 O  OE1 . GLU C 1 44  ? 50.273  12.193 42.806 1.00 47.82  ? 39  GLU B OE1 1 
ATOM   1695 O  OE2 . GLU C 1 44  ? 48.649  11.638 41.417 1.00 49.09  ? 39  GLU B OE2 1 
ATOM   1696 N  N   . LEU C 1 45  ? 51.051  9.181  39.216 1.00 39.73  ? 40  LEU B N   1 
ATOM   1697 C  CA  . LEU C 1 45  ? 50.750  8.553  37.930 1.00 39.30  ? 40  LEU B CA  1 
ATOM   1698 C  C   . LEU C 1 45  ? 51.131  9.449  36.751 1.00 39.36  ? 40  LEU B C   1 
ATOM   1699 O  O   . LEU C 1 45  ? 51.813  9.008  35.818 1.00 39.31  ? 40  LEU B O   1 
ATOM   1700 C  CB  . LEU C 1 45  ? 49.252  8.247  37.854 1.00 40.13  ? 40  LEU B CB  1 
ATOM   1701 C  CG  . LEU C 1 45  ? 48.687  7.064  37.052 1.00 41.40  ? 40  LEU B CG  1 
ATOM   1702 C  CD1 . LEU C 1 45  ? 47.326  7.491  36.502 1.00 39.63  ? 40  LEU B CD1 1 
ATOM   1703 C  CD2 . LEU C 1 45  ? 49.600  6.655  35.907 1.00 39.76  ? 40  LEU B CD2 1 
ATOM   1704 N  N   . GLU C 1 46  ? 50.680  10.703 36.801 1.00 38.82  ? 41  GLU B N   1 
ATOM   1705 C  CA  . GLU C 1 46  ? 50.951  11.673 35.739 1.00 37.00  ? 41  GLU B CA  1 
ATOM   1706 C  C   . GLU C 1 46  ? 52.016  12.699 36.110 1.00 34.44  ? 41  GLU B C   1 
ATOM   1707 O  O   . GLU C 1 46  ? 52.090  13.774 35.508 1.00 32.65  ? 41  GLU B O   1 
ATOM   1708 C  CB  . GLU C 1 46  ? 49.665  12.396 35.349 1.00 39.28  ? 41  GLU B CB  1 
ATOM   1709 C  CG  . GLU C 1 46  ? 48.611  11.483 34.756 1.00 43.96  ? 41  GLU B CG  1 
ATOM   1710 C  CD  . GLU C 1 46  ? 47.513  12.260 34.066 1.00 49.50  ? 41  GLU B CD  1 
ATOM   1711 O  OE1 . GLU C 1 46  ? 47.823  12.984 33.091 1.00 51.86  ? 41  GLU B OE1 1 
ATOM   1712 O  OE2 . GLU C 1 46  ? 46.343  12.155 34.498 1.00 51.89  ? 41  GLU B OE2 1 
ATOM   1713 N  N   . GLY C 1 47  ? 52.839  12.349 37.095 1.00 32.01  ? 42  GLY B N   1 
ATOM   1714 C  CA  . GLY C 1 47  ? 53.902  13.228 37.548 1.00 32.05  ? 42  GLY B CA  1 
ATOM   1715 C  C   . GLY C 1 47  ? 54.784  13.795 36.445 1.00 31.93  ? 42  GLY B C   1 
ATOM   1716 O  O   . GLY C 1 47  ? 55.010  15.001 36.414 1.00 33.19  ? 42  GLY B O   1 
ATOM   1717 N  N   . PRO C 1 48  ? 55.318  12.961 35.535 1.00 31.62  ? 43  PRO B N   1 
ATOM   1718 C  CA  . PRO C 1 48  ? 56.172  13.478 34.459 1.00 29.77  ? 43  PRO B CA  1 
ATOM   1719 C  C   . PRO C 1 48  ? 55.481  14.436 33.485 1.00 29.38  ? 43  PRO B C   1 
ATOM   1720 O  O   . PRO C 1 48  ? 56.015  15.506 33.196 1.00 28.51  ? 43  PRO B O   1 
ATOM   1721 C  CB  . PRO C 1 48  ? 56.663  12.203 33.773 1.00 29.96  ? 43  PRO B CB  1 
ATOM   1722 C  CG  . PRO C 1 48  ? 56.751  11.235 34.922 1.00 29.95  ? 43  PRO B CG  1 
ATOM   1723 C  CD  . PRO C 1 48  ? 55.427  11.493 35.616 1.00 30.13  ? 43  PRO B CD  1 
ATOM   1724 N  N   . GLN C 1 49  ? 54.307  14.056 32.979 1.00 28.15  ? 44  GLN B N   1 
ATOM   1725 C  CA  . GLN C 1 49  ? 53.575  14.899 32.022 1.00 29.99  ? 44  GLN B CA  1 
ATOM   1726 C  C   . GLN C 1 49  ? 53.339  16.310 32.546 1.00 29.89  ? 44  GLN B C   1 
ATOM   1727 O  O   . GLN C 1 49  ? 53.569  17.301 31.844 1.00 30.28  ? 44  GLN B O   1 
ATOM   1728 C  CB  . GLN C 1 49  ? 52.215  14.282 31.668 1.00 31.29  ? 44  GLN B CB  1 
ATOM   1729 C  CG  . GLN C 1 49  ? 52.268  12.908 31.004 1.00 34.47  ? 44  GLN B CG  1 
ATOM   1730 C  CD  . GLN C 1 49  ? 52.127  11.766 31.998 1.00 35.05  ? 44  GLN B CD  1 
ATOM   1731 O  OE1 . GLN C 1 49  ? 52.940  11.613 32.914 1.00 35.79  ? 44  GLN B OE1 1 
ATOM   1732 N  NE2 . GLN C 1 49  ? 51.081  10.958 31.824 1.00 37.79  ? 44  GLN B NE2 1 
ATOM   1733 N  N   . ILE C 1 50  ? 52.873  16.376 33.785 1.00 29.32  ? 45  ILE B N   1 
ATOM   1734 C  CA  . ILE C 1 50  ? 52.581  17.622 34.475 1.00 30.22  ? 45  ILE B CA  1 
ATOM   1735 C  C   . ILE C 1 50  ? 53.846  18.430 34.791 1.00 29.52  ? 45  ILE B C   1 
ATOM   1736 O  O   . ILE C 1 50  ? 53.951  19.611 34.448 1.00 29.56  ? 45  ILE B O   1 
ATOM   1737 C  CB  . ILE C 1 50  ? 51.824  17.301 35.785 1.00 32.52  ? 45  ILE B CB  1 
ATOM   1738 C  CG1 . ILE C 1 50  ? 50.410  16.816 35.454 1.00 30.30  ? 45  ILE B CG1 1 
ATOM   1739 C  CG2 . ILE C 1 50  ? 51.817  18.505 36.714 1.00 32.75  ? 45  ILE B CG2 1 
ATOM   1740 C  CD1 . ILE C 1 50  ? 49.702  16.215 36.640 1.00 30.85  ? 45  ILE B CD1 1 
ATOM   1741 N  N   . ALA C 1 51  ? 54.803  17.780 35.444 1.00 28.58  ? 46  ALA B N   1 
ATOM   1742 C  CA  . ALA C 1 51  ? 56.067  18.405 35.828 1.00 26.25  ? 46  ALA B CA  1 
ATOM   1743 C  C   . ALA C 1 51  ? 56.854  19.066 34.698 1.00 26.56  ? 46  ALA B C   1 
ATOM   1744 O  O   . ALA C 1 51  ? 57.366  20.172 34.882 1.00 27.46  ? 46  ALA B O   1 
ATOM   1745 C  CB  . ALA C 1 51  ? 56.950  17.390 36.529 1.00 23.32  ? 46  ALA B CB  1 
ATOM   1746 N  N   . VAL C 1 52  ? 57.000  18.410 33.544 1.00 25.79  ? 47  VAL B N   1 
ATOM   1747 C  CA  . VAL C 1 52  ? 57.750  19.061 32.467 1.00 24.32  ? 47  VAL B CA  1 
ATOM   1748 C  C   . VAL C 1 52  ? 57.031  20.348 32.039 1.00 24.07  ? 47  VAL B C   1 
ATOM   1749 O  O   . VAL C 1 52  ? 57.679  21.347 31.716 1.00 22.74  ? 47  VAL B O   1 
ATOM   1750 C  CB  . VAL C 1 52  ? 57.974  18.133 31.231 1.00 24.70  ? 47  VAL B CB  1 
ATOM   1751 C  CG1 . VAL C 1 52  ? 58.902  16.978 31.619 1.00 24.16  ? 47  VAL B CG1 1 
ATOM   1752 C  CG2 . VAL C 1 52  ? 56.642  17.620 30.682 1.00 19.25  ? 47  VAL B CG2 1 
ATOM   1753 N  N   . ARG C 1 53  ? 55.699  20.334 32.050 1.00 22.89  ? 48  ARG B N   1 
ATOM   1754 C  CA  . ARG C 1 53  ? 54.949  21.534 31.697 1.00 25.94  ? 48  ARG B CA  1 
ATOM   1755 C  C   . ARG C 1 53  ? 55.145  22.600 32.774 1.00 25.15  ? 48  ARG B C   1 
ATOM   1756 O  O   . ARG C 1 53  ? 55.299  23.787 32.485 1.00 26.00  ? 48  ARG B O   1 
ATOM   1757 C  CB  . ARG C 1 53  ? 53.462  21.224 31.544 1.00 26.28  ? 48  ARG B CB  1 
ATOM   1758 C  CG  . ARG C 1 53  ? 53.145  20.505 30.248 1.00 32.28  ? 48  ARG B CG  1 
ATOM   1759 C  CD  . ARG C 1 53  ? 51.810  20.965 29.716 1.00 33.92  ? 48  ARG B CD  1 
ATOM   1760 N  NE  . ARG C 1 53  ? 50.699  20.268 30.339 1.00 37.59  ? 48  ARG B NE  1 
ATOM   1761 C  CZ  . ARG C 1 53  ? 49.440  20.699 30.316 1.00 40.28  ? 48  ARG B CZ  1 
ATOM   1762 N  NH1 . ARG C 1 53  ? 49.135  21.845 29.711 1.00 39.11  ? 48  ARG B NH1 1 
ATOM   1763 N  NH2 . ARG C 1 53  ? 48.481  19.960 30.861 1.00 39.96  ? 48  ARG B NH2 1 
ATOM   1764 N  N   . LEU C 1 54  ? 55.150  22.175 34.024 1.00 24.58  ? 49  LEU B N   1 
ATOM   1765 C  CA  . LEU C 1 54  ? 55.355  23.110 35.114 1.00 26.44  ? 49  LEU B CA  1 
ATOM   1766 C  C   . LEU C 1 54  ? 56.766  23.715 35.043 1.00 27.70  ? 49  LEU B C   1 
ATOM   1767 O  O   . LEU C 1 54  ? 56.925  24.940 35.081 1.00 29.77  ? 49  LEU B O   1 
ATOM   1768 C  CB  . LEU C 1 54  ? 55.123  22.391 36.451 1.00 25.09  ? 49  LEU B CB  1 
ATOM   1769 C  CG  . LEU C 1 54  ? 53.810  22.714 37.184 1.00 28.67  ? 49  LEU B CG  1 
ATOM   1770 C  CD1 . LEU C 1 54  ? 52.726  23.150 36.200 1.00 24.64  ? 49  LEU B CD1 1 
ATOM   1771 C  CD2 . LEU C 1 54  ? 53.374  21.510 38.004 1.00 24.35  ? 49  LEU B CD2 1 
ATOM   1772 N  N   . LEU C 1 55  ? 57.785  22.864 34.921 1.00 26.76  ? 50  LEU B N   1 
ATOM   1773 C  CA  . LEU C 1 55  ? 59.172  23.334 34.854 1.00 27.62  ? 50  LEU B CA  1 
ATOM   1774 C  C   . LEU C 1 55  ? 59.416  24.213 33.638 1.00 27.31  ? 50  LEU B C   1 
ATOM   1775 O  O   . LEU C 1 55  ? 60.074  25.255 33.744 1.00 28.69  ? 50  LEU B O   1 
ATOM   1776 C  CB  . LEU C 1 55  ? 60.160  22.153 34.826 1.00 27.54  ? 50  LEU B CB  1 
ATOM   1777 C  CG  . LEU C 1 55  ? 60.325  21.326 36.109 1.00 29.92  ? 50  LEU B CG  1 
ATOM   1778 C  CD1 . LEU C 1 55  ? 61.006  20.005 35.780 1.00 29.03  ? 50  LEU B CD1 1 
ATOM   1779 C  CD2 . LEU C 1 55  ? 61.123  22.118 37.149 1.00 28.63  ? 50  LEU B CD2 1 
ATOM   1780 N  N   . ALA C 1 56  ? 58.907  23.809 32.477 1.00 25.33  ? 51  ALA B N   1 
ATOM   1781 C  CA  . ALA C 1 56  ? 59.121  24.632 31.284 1.00 26.50  ? 51  ALA B CA  1 
ATOM   1782 C  C   . ALA C 1 56  ? 58.606  26.051 31.553 1.00 26.67  ? 51  ALA B C   1 
ATOM   1783 O  O   . ALA C 1 56  ? 59.222  27.048 31.141 1.00 23.03  ? 51  ALA B O   1 
ATOM   1784 C  CB  . ALA C 1 56  ? 58.399  24.038 30.078 1.00 23.87  ? 51  ALA B CB  1 
ATOM   1785 N  N   . HIS C 1 57  ? 57.485  26.138 32.267 1.00 25.58  ? 52  HIS B N   1 
ATOM   1786 C  CA  . HIS C 1 57  ? 56.913  27.436 32.545 1.00 26.04  ? 52  HIS B CA  1 
ATOM   1787 C  C   . HIS C 1 57  ? 57.775  28.237 33.518 1.00 26.93  ? 52  HIS B C   1 
ATOM   1788 O  O   . HIS C 1 57  ? 57.948  29.455 33.369 1.00 23.59  ? 52  HIS B O   1 
ATOM   1789 C  CB  . HIS C 1 57  ? 55.497  27.291 33.090 1.00 24.01  ? 52  HIS B CB  1 
ATOM   1790 C  CG  . HIS C 1 57  ? 54.721  28.567 33.047 1.00 25.30  ? 52  HIS B CG  1 
ATOM   1791 N  ND1 . HIS C 1 57  ? 54.462  29.235 31.868 1.00 26.49  ? 52  HIS B ND1 1 
ATOM   1792 C  CD2 . HIS C 1 57  ? 54.206  29.334 34.035 1.00 25.51  ? 52  HIS B CD2 1 
ATOM   1793 C  CE1 . HIS C 1 57  ? 53.825  30.361 32.133 1.00 26.00  ? 52  HIS B CE1 1 
ATOM   1794 N  NE2 . HIS C 1 57  ? 53.658  30.445 33.441 1.00 27.33  ? 52  HIS B NE2 1 
ATOM   1795 N  N   . LYS C 1 58  ? 58.339  27.554 34.505 1.00 27.18  ? 53  LYS B N   1 
ATOM   1796 C  CA  . LYS C 1 58  ? 59.167  28.242 35.484 1.00 27.99  ? 53  LYS B CA  1 
ATOM   1797 C  C   . LYS C 1 58  ? 60.500  28.660 34.857 1.00 27.30  ? 53  LYS B C   1 
ATOM   1798 O  O   . LYS C 1 58  ? 61.032  29.731 35.161 1.00 27.24  ? 53  LYS B O   1 
ATOM   1799 C  CB  . LYS C 1 58  ? 59.396  27.338 36.698 1.00 29.06  ? 53  LYS B CB  1 
ATOM   1800 C  CG  . LYS C 1 58  ? 59.738  28.090 37.984 1.00 32.03  ? 53  LYS B CG  1 
ATOM   1801 C  CD  . LYS C 1 58  ? 58.539  28.849 38.578 1.00 29.02  ? 53  LYS B CD  1 
ATOM   1802 C  CE  . LYS C 1 58  ? 57.527  27.919 39.243 1.00 30.63  ? 53  LYS B CE  1 
ATOM   1803 N  NZ  . LYS C 1 58  ? 56.625  28.678 40.178 1.00 27.88  ? 53  LYS B NZ  1 
ATOM   1804 N  N   . ILE C 1 59  ? 61.031  27.827 33.965 1.00 25.10  ? 54  ILE B N   1 
ATOM   1805 C  CA  . ILE C 1 59  ? 62.292  28.133 33.308 1.00 23.37  ? 54  ILE B CA  1 
ATOM   1806 C  C   . ILE C 1 59  ? 62.162  29.375 32.438 1.00 24.35  ? 54  ILE B C   1 
ATOM   1807 O  O   . ILE C 1 59  ? 63.152  30.083 32.195 1.00 23.35  ? 54  ILE B O   1 
ATOM   1808 C  CB  . ILE C 1 59  ? 62.764  26.958 32.424 1.00 24.25  ? 54  ILE B CB  1 
ATOM   1809 C  CG1 . ILE C 1 59  ? 63.085  25.750 33.304 1.00 22.11  ? 54  ILE B CG1 1 
ATOM   1810 C  CG2 . ILE C 1 59  ? 63.990  27.374 31.610 1.00 22.84  ? 54  ILE B CG2 1 
ATOM   1811 C  CD1 . ILE C 1 59  ? 63.260  24.461 32.537 1.00 23.46  ? 54  ILE B CD1 1 
ATOM   1812 N  N   . GLN C 1 60  ? 60.942  29.637 31.970 1.00 23.33  ? 55  GLN B N   1 
ATOM   1813 C  CA  . GLN C 1 60  ? 60.673  30.798 31.120 1.00 24.61  ? 55  GLN B CA  1 
ATOM   1814 C  C   . GLN C 1 60  ? 60.274  32.032 31.937 1.00 24.65  ? 55  GLN B C   1 
ATOM   1815 O  O   . GLN C 1 60  ? 59.864  33.049 31.376 1.00 25.42  ? 55  GLN B O   1 
ATOM   1816 C  CB  . GLN C 1 60  ? 59.546  30.486 30.112 1.00 24.36  ? 55  GLN B CB  1 
ATOM   1817 C  CG  . GLN C 1 60  ? 59.823  29.305 29.203 1.00 25.15  ? 55  GLN B CG  1 
ATOM   1818 C  CD  . GLN C 1 60  ? 58.617  28.903 28.384 1.00 27.81  ? 55  GLN B CD  1 
ATOM   1819 O  OE1 . GLN C 1 60  ? 57.475  29.090 28.808 1.00 28.82  ? 55  GLN B OE1 1 
ATOM   1820 N  NE2 . GLN C 1 60  ? 58.861  28.320 27.214 1.00 28.47  ? 55  GLN B NE2 1 
ATOM   1821 N  N   . SER C 1 61  ? 60.388  31.958 33.255 1.00 24.44  ? 56  SER B N   1 
ATOM   1822 C  CA  . SER C 1 61  ? 60.015  33.104 34.069 1.00 25.76  ? 56  SER B CA  1 
ATOM   1823 C  C   . SER C 1 61  ? 60.861  34.334 33.759 1.00 26.98  ? 56  SER B C   1 
ATOM   1824 O  O   . SER C 1 61  ? 61.999  34.221 33.293 1.00 26.58  ? 56  SER B O   1 
ATOM   1825 C  CB  . SER C 1 61  ? 60.145  32.778 35.552 1.00 25.29  ? 56  SER B CB  1 
ATOM   1826 O  OG  . SER C 1 61  ? 60.092  33.977 36.308 1.00 26.93  ? 56  SER B OG  1 
ATOM   1827 N  N   . PRO C 1 62  ? 60.307  35.531 34.004 1.00 27.18  ? 57  PRO B N   1 
ATOM   1828 C  CA  . PRO C 1 62  ? 61.019  36.790 33.755 1.00 29.19  ? 57  PRO B CA  1 
ATOM   1829 C  C   . PRO C 1 62  ? 62.034  37.008 34.865 1.00 29.53  ? 57  PRO B C   1 
ATOM   1830 O  O   . PRO C 1 62  ? 63.015  37.728 34.699 1.00 32.54  ? 57  PRO B O   1 
ATOM   1831 C  CB  . PRO C 1 62  ? 59.908  37.848 33.813 1.00 29.13  ? 57  PRO B CB  1 
ATOM   1832 C  CG  . PRO C 1 62  ? 58.642  37.066 33.518 1.00 28.59  ? 57  PRO B CG  1 
ATOM   1833 C  CD  . PRO C 1 62  ? 58.883  35.783 34.277 1.00 27.49  ? 57  PRO B CD  1 
ATOM   1834 N  N   . GLN C 1 63  ? 61.775  36.383 36.008 1.00 28.82  ? 58  GLN B N   1 
ATOM   1835 C  CA  . GLN C 1 63  ? 62.638  36.512 37.174 1.00 28.46  ? 58  GLN B CA  1 
ATOM   1836 C  C   . GLN C 1 63  ? 63.765  35.484 37.052 1.00 29.20  ? 58  GLN B C   1 
ATOM   1837 O  O   . GLN C 1 63  ? 63.533  34.276 37.157 1.00 28.42  ? 58  GLN B O   1 
ATOM   1838 C  CB  . GLN C 1 63  ? 61.799  36.278 38.441 1.00 26.10  ? 58  GLN B CB  1 
ATOM   1839 C  CG  . GLN C 1 63  ? 62.297  36.990 39.692 1.00 26.78  ? 58  GLN B CG  1 
ATOM   1840 C  CD  . GLN C 1 63  ? 63.786  36.811 39.909 1.00 29.42  ? 58  GLN B CD  1 
ATOM   1841 O  OE1 . GLN C 1 63  ? 64.576  37.735 39.666 1.00 33.17  ? 58  GLN B OE1 1 
ATOM   1842 N  NE2 . GLN C 1 63  ? 64.186  35.617 40.350 1.00 24.14  ? 58  GLN B NE2 1 
ATOM   1843 N  N   . GLU C 1 64  ? 64.987  35.969 36.837 1.00 30.77  ? 59  GLU B N   1 
ATOM   1844 C  CA  . GLU C 1 64  ? 66.154  35.095 36.657 1.00 31.72  ? 59  GLU B CA  1 
ATOM   1845 C  C   . GLU C 1 64  ? 66.457  34.034 37.714 1.00 30.65  ? 59  GLU B C   1 
ATOM   1846 O  O   . GLU C 1 64  ? 66.674  32.871 37.380 1.00 30.61  ? 59  GLU B O   1 
ATOM   1847 C  CB  . GLU C 1 64  ? 67.420  35.930 36.456 1.00 33.50  ? 59  GLU B CB  1 
ATOM   1848 C  CG  . GLU C 1 64  ? 68.649  35.082 36.138 1.00 37.20  ? 59  GLU B CG  1 
ATOM   1849 C  CD  . GLU C 1 64  ? 69.928  35.895 36.084 1.00 38.53  ? 59  GLU B CD  1 
ATOM   1850 O  OE1 . GLU C 1 64  ? 70.212  36.597 37.076 1.00 41.91  ? 59  GLU B OE1 1 
ATOM   1851 O  OE2 . GLU C 1 64  ? 70.652  35.826 35.062 1.00 38.35  ? 59  GLU B OE2 1 
ATOM   1852 N  N   . TRP C 1 65  ? 66.501  34.420 38.982 1.00 30.75  ? 60  TRP B N   1 
ATOM   1853 C  CA  . TRP C 1 65  ? 66.820  33.456 40.030 1.00 29.80  ? 60  TRP B CA  1 
ATOM   1854 C  C   . TRP C 1 65  ? 65.770  32.338 40.052 1.00 29.64  ? 60  TRP B C   1 
ATOM   1855 O  O   . TRP C 1 65  ? 66.109  31.156 40.181 1.00 29.58  ? 60  TRP B O   1 
ATOM   1856 C  CB  . TRP C 1 65  ? 66.929  34.191 41.382 1.00 30.60  ? 60  TRP B CB  1 
ATOM   1857 C  CG  . TRP C 1 65  ? 67.239  33.342 42.599 1.00 29.44  ? 60  TRP B CG  1 
ATOM   1858 C  CD1 . TRP C 1 65  ? 66.642  33.439 43.825 1.00 29.22  ? 60  TRP B CD1 1 
ATOM   1859 C  CD2 . TRP C 1 65  ? 68.178  32.258 42.697 1.00 30.62  ? 60  TRP B CD2 1 
ATOM   1860 N  NE1 . TRP C 1 65  ? 67.137  32.479 44.677 1.00 31.47  ? 60  TRP B NE1 1 
ATOM   1861 C  CE2 . TRP C 1 65  ? 68.083  31.741 44.012 1.00 31.77  ? 60  TRP B CE2 1 
ATOM   1862 C  CE3 . TRP C 1 65  ? 69.086  31.671 41.805 1.00 31.36  ? 60  TRP B CE3 1 
ATOM   1863 C  CZ2 . TRP C 1 65  ? 68.865  30.663 44.456 1.00 32.08  ? 60  TRP B CZ2 1 
ATOM   1864 C  CZ3 . TRP C 1 65  ? 69.868  30.594 42.249 1.00 31.88  ? 60  TRP B CZ3 1 
ATOM   1865 C  CH2 . TRP C 1 65  ? 69.750  30.105 43.561 1.00 31.96  ? 60  TRP B CH2 1 
ATOM   1866 N  N   . GLU C 1 66  ? 64.501  32.701 39.891 1.00 29.36  ? 61  GLU B N   1 
ATOM   1867 C  CA  . GLU C 1 66  ? 63.431  31.707 39.884 1.00 29.26  ? 61  GLU B CA  1 
ATOM   1868 C  C   . GLU C 1 66  ? 63.638  30.736 38.724 1.00 29.60  ? 61  GLU B C   1 
ATOM   1869 O  O   . GLU C 1 66  ? 63.417  29.530 38.862 1.00 30.84  ? 61  GLU B O   1 
ATOM   1870 C  CB  . GLU C 1 66  ? 62.060  32.390 39.756 1.00 30.86  ? 61  GLU B CB  1 
ATOM   1871 C  CG  . GLU C 1 66  ? 60.875  31.436 39.486 1.00 29.32  ? 61  GLU B CG  1 
ATOM   1872 C  CD  . GLU C 1 66  ? 59.506  32.140 39.551 1.00 30.43  ? 61  GLU B CD  1 
ATOM   1873 O  OE1 . GLU C 1 66  ? 59.128  32.841 38.582 1.00 29.75  ? 61  GLU B OE1 1 
ATOM   1874 O  OE2 . GLU C 1 66  ? 58.804  32.000 40.576 1.00 29.31  ? 61  GLU B OE2 1 
ATOM   1875 N  N   . ALA C 1 67  ? 64.069  31.258 37.583 1.00 27.30  ? 62  ALA B N   1 
ATOM   1876 C  CA  . ALA C 1 67  ? 64.293  30.417 36.418 1.00 28.95  ? 62  ALA B CA  1 
ATOM   1877 C  C   . ALA C 1 67  ? 65.516  29.532 36.642 1.00 29.78  ? 62  ALA B C   1 
ATOM   1878 O  O   . ALA C 1 67  ? 65.507  28.348 36.313 1.00 30.62  ? 62  ALA B O   1 
ATOM   1879 C  CB  . ALA C 1 67  ? 64.480  31.281 35.178 1.00 26.40  ? 62  ALA B CB  1 
ATOM   1880 N  N   . LEU C 1 68  ? 66.566  30.118 37.209 1.00 30.68  ? 63  LEU B N   1 
ATOM   1881 C  CA  . LEU C 1 68  ? 67.806  29.394 37.500 1.00 31.50  ? 63  LEU B CA  1 
ATOM   1882 C  C   . LEU C 1 68  ? 67.552  28.193 38.419 1.00 30.03  ? 63  LEU B C   1 
ATOM   1883 O  O   . LEU C 1 68  ? 68.059  27.090 38.182 1.00 29.90  ? 63  LEU B O   1 
ATOM   1884 C  CB  . LEU C 1 68  ? 68.815  30.351 38.143 1.00 31.06  ? 63  LEU B CB  1 
ATOM   1885 C  CG  . LEU C 1 68  ? 70.095  30.654 37.366 1.00 32.52  ? 63  LEU B CG  1 
ATOM   1886 C  CD1 . LEU C 1 68  ? 69.901  30.381 35.883 1.00 32.67  ? 63  LEU B CD1 1 
ATOM   1887 C  CD2 . LEU C 1 68  ? 70.498  32.098 37.620 1.00 30.61  ? 63  LEU B CD2 1 
ATOM   1888 N  N   . GLN C 1 69  ? 66.770  28.404 39.472 1.00 27.44  ? 64  GLN B N   1 
ATOM   1889 C  CA  . GLN C 1 69  ? 66.464  27.305 40.369 1.00 26.48  ? 64  GLN B CA  1 
ATOM   1890 C  C   . GLN C 1 69  ? 65.638  26.257 39.621 1.00 26.94  ? 64  GLN B C   1 
ATOM   1891 O  O   . GLN C 1 69  ? 65.783  25.054 39.863 1.00 27.69  ? 64  GLN B O   1 
ATOM   1892 C  CB  . GLN C 1 69  ? 65.699  27.807 41.601 1.00 26.42  ? 64  GLN B CB  1 
ATOM   1893 C  CG  . GLN C 1 69  ? 66.482  28.803 42.443 1.00 28.00  ? 64  GLN B CG  1 
ATOM   1894 C  CD  . GLN C 1 69  ? 65.826  29.100 43.777 1.00 30.22  ? 64  GLN B CD  1 
ATOM   1895 O  OE1 . GLN C 1 69  ? 65.754  28.236 44.657 1.00 31.58  ? 64  GLN B OE1 1 
ATOM   1896 N  NE2 . GLN C 1 69  ? 65.339  30.327 43.937 1.00 30.95  ? 64  GLN B NE2 1 
ATOM   1897 N  N   . ALA C 1 70  ? 64.773  26.699 38.709 1.00 24.74  ? 65  ALA B N   1 
ATOM   1898 C  CA  . ALA C 1 70  ? 63.961  25.745 37.962 1.00 24.17  ? 65  ALA B CA  1 
ATOM   1899 C  C   . ALA C 1 70  ? 64.892  24.814 37.205 1.00 23.90  ? 65  ALA B C   1 
ATOM   1900 O  O   . ALA C 1 70  ? 64.699  23.595 37.189 1.00 25.74  ? 65  ALA B O   1 
ATOM   1901 C  CB  . ALA C 1 70  ? 63.029  26.468 36.990 1.00 22.88  ? 65  ALA B CB  1 
ATOM   1902 N  N   . LEU C 1 71  ? 65.914  25.381 36.578 1.00 22.19  ? 66  LEU B N   1 
ATOM   1903 C  CA  . LEU C 1 71  ? 66.855  24.555 35.840 1.00 24.42  ? 66  LEU B CA  1 
ATOM   1904 C  C   . LEU C 1 71  ? 67.560  23.488 36.693 1.00 24.24  ? 66  LEU B C   1 
ATOM   1905 O  O   . LEU C 1 71  ? 67.675  22.335 36.267 1.00 23.54  ? 66  LEU B O   1 
ATOM   1906 C  CB  . LEU C 1 71  ? 67.883  25.434 35.137 1.00 24.94  ? 66  LEU B CB  1 
ATOM   1907 C  CG  . LEU C 1 71  ? 67.292  26.165 33.927 1.00 25.46  ? 66  LEU B CG  1 
ATOM   1908 C  CD1 . LEU C 1 71  ? 68.318  27.101 33.314 1.00 24.28  ? 66  LEU B CD1 1 
ATOM   1909 C  CD2 . LEU C 1 71  ? 66.812  25.134 32.912 1.00 25.56  ? 66  LEU B CD2 1 
ATOM   1910 N  N   . THR C 1 72  ? 68.017  23.837 37.895 1.00 24.83  ? 67  THR B N   1 
ATOM   1911 C  CA  . THR C 1 72  ? 68.681  22.820 38.700 1.00 27.14  ? 67  THR B CA  1 
ATOM   1912 C  C   . THR C 1 72  ? 67.649  21.802 39.184 1.00 26.92  ? 67  THR B C   1 
ATOM   1913 O  O   . THR C 1 72  ? 67.988  20.644 39.443 1.00 27.67  ? 67  THR B O   1 
ATOM   1914 C  CB  . THR C 1 72  ? 69.477  23.420 39.914 1.00 29.50  ? 67  THR B CB  1 
ATOM   1915 O  OG1 . THR C 1 72  ? 68.614  23.581 41.041 1.00 33.59  ? 67  THR B OG1 1 
ATOM   1916 C  CG2 . THR C 1 72  ? 70.085  24.775 39.550 1.00 29.86  ? 67  THR B CG2 1 
ATOM   1917 N  N   . VAL C 1 73  ? 66.386  22.215 39.292 1.00 26.43  ? 68  VAL B N   1 
ATOM   1918 C  CA  . VAL C 1 73  ? 65.345  21.282 39.720 1.00 25.62  ? 68  VAL B CA  1 
ATOM   1919 C  C   . VAL C 1 73  ? 65.171  20.261 38.606 1.00 26.47  ? 68  VAL B C   1 
ATOM   1920 O  O   . VAL C 1 73  ? 65.046  19.054 38.860 1.00 27.10  ? 68  VAL B O   1 
ATOM   1921 C  CB  . VAL C 1 73  ? 63.994  21.974 39.961 1.00 25.16  ? 68  VAL B CB  1 
ATOM   1922 C  CG1 . VAL C 1 73  ? 62.906  20.927 40.111 1.00 24.12  ? 68  VAL B CG1 1 
ATOM   1923 C  CG2 . VAL C 1 73  ? 64.056  22.827 41.232 1.00 26.29  ? 68  VAL B CG2 1 
ATOM   1924 N  N   . LEU C 1 74  ? 65.163  20.755 37.369 1.00 26.20  ? 69  LEU B N   1 
ATOM   1925 C  CA  . LEU C 1 74  ? 65.039  19.899 36.193 1.00 25.52  ? 69  LEU B CA  1 
ATOM   1926 C  C   . LEU C 1 74  ? 66.182  18.879 36.223 1.00 26.37  ? 69  LEU B C   1 
ATOM   1927 O  O   . LEU C 1 74  ? 65.961  17.677 36.027 1.00 26.34  ? 69  LEU B O   1 
ATOM   1928 C  CB  . LEU C 1 74  ? 65.121  20.743 34.918 1.00 22.62  ? 69  LEU B CB  1 
ATOM   1929 C  CG  . LEU C 1 74  ? 65.143  20.009 33.574 1.00 22.00  ? 69  LEU B CG  1 
ATOM   1930 C  CD1 . LEU C 1 74  ? 63.868  19.252 33.366 1.00 18.72  ? 69  LEU B CD1 1 
ATOM   1931 C  CD2 . LEU C 1 74  ? 65.333  21.020 32.447 1.00 21.99  ? 69  LEU B CD2 1 
ATOM   1932 N  N   . GLU C 1 75  ? 67.402  19.350 36.484 1.00 27.04  ? 70  GLU B N   1 
ATOM   1933 C  CA  . GLU C 1 75  ? 68.551  18.442 36.552 1.00 29.98  ? 70  GLU B CA  1 
ATOM   1934 C  C   . GLU C 1 75  ? 68.303  17.356 37.594 1.00 29.35  ? 70  GLU B C   1 
ATOM   1935 O  O   . GLU C 1 75  ? 68.467  16.166 37.316 1.00 29.49  ? 70  GLU B O   1 
ATOM   1936 C  CB  . GLU C 1 75  ? 69.826  19.196 36.917 1.00 31.46  ? 70  GLU B CB  1 
ATOM   1937 C  CG  . GLU C 1 75  ? 70.316  20.162 35.866 1.00 35.09  ? 70  GLU B CG  1 
ATOM   1938 C  CD  . GLU C 1 75  ? 71.512  20.962 36.349 1.00 40.42  ? 70  GLU B CD  1 
ATOM   1939 O  OE1 . GLU C 1 75  ? 71.412  21.577 37.436 1.00 42.33  ? 70  GLU B OE1 1 
ATOM   1940 O  OE2 . GLU C 1 75  ? 72.550  20.983 35.647 1.00 42.49  ? 70  GLU B OE2 1 
ATOM   1941 N  N   . ALA C 1 76  ? 67.918  17.768 38.798 1.00 28.56  ? 71  ALA B N   1 
ATOM   1942 C  CA  . ALA C 1 76  ? 67.636  16.811 39.857 1.00 28.83  ? 71  ALA B CA  1 
ATOM   1943 C  C   . ALA C 1 76  ? 66.632  15.792 39.333 1.00 29.34  ? 71  ALA B C   1 
ATOM   1944 O  O   . ALA C 1 76  ? 66.791  14.593 39.547 1.00 30.71  ? 71  ALA B O   1 
ATOM   1945 C  CB  . ALA C 1 76  ? 67.064  17.523 41.088 1.00 27.99  ? 71  ALA B CB  1 
ATOM   1946 N  N   . CYS C 1 77  ? 65.604  16.267 38.635 1.00 28.60  ? 72  CYS B N   1 
ATOM   1947 C  CA  . CYS C 1 77  ? 64.587  15.368 38.098 1.00 29.06  ? 72  CYS B CA  1 
ATOM   1948 C  C   . CYS C 1 77  ? 65.137  14.347 37.109 1.00 29.54  ? 72  CYS B C   1 
ATOM   1949 O  O   . CYS C 1 77  ? 64.685  13.202 37.065 1.00 26.50  ? 72  CYS B O   1 
ATOM   1950 C  CB  . CYS C 1 77  ? 63.469  16.176 37.443 1.00 30.96  ? 72  CYS B CB  1 
ATOM   1951 S  SG  . CYS C 1 77  ? 62.370  16.951 38.649 1.00 31.87  ? 72  CYS B SG  1 
HETATM 1952 N  N   . MSE C 1 78  ? 66.111  14.767 36.311 1.00 30.74  ? 73  MSE B N   1 
HETATM 1953 C  CA  . MSE C 1 78  ? 66.721  13.881 35.333 1.00 32.19  ? 73  MSE B CA  1 
HETATM 1954 C  C   . MSE C 1 78  ? 67.435  12.721 36.033 1.00 34.03  ? 73  MSE B C   1 
HETATM 1955 O  O   . MSE C 1 78  ? 67.491  11.605 35.510 1.00 34.50  ? 73  MSE B O   1 
HETATM 1956 C  CB  . MSE C 1 78  ? 67.708  14.667 34.462 1.00 31.62  ? 73  MSE B CB  1 
HETATM 1957 C  CG  . MSE C 1 78  ? 67.060  15.751 33.594 1.00 31.45  ? 73  MSE B CG  1 
HETATM 1958 SE SE  . MSE C 1 78  ? 65.746  15.040 32.354 1.00 34.81  ? 73  MSE B SE  1 
HETATM 1959 C  CE  . MSE C 1 78  ? 66.930  14.449 30.942 1.00 35.79  ? 73  MSE B CE  1 
ATOM   1960 N  N   . LYS C 1 79  ? 67.965  12.980 37.224 1.00 34.95  ? 74  LYS B N   1 
ATOM   1961 C  CA  . LYS C 1 79  ? 68.672  11.948 37.971 1.00 36.29  ? 74  LYS B CA  1 
ATOM   1962 C  C   . LYS C 1 79  ? 67.793  11.128 38.913 1.00 36.66  ? 74  LYS B C   1 
ATOM   1963 O  O   . LYS C 1 79  ? 68.076  9.953  39.153 1.00 38.21  ? 74  LYS B O   1 
ATOM   1964 C  CB  . LYS C 1 79  ? 69.831  12.559 38.774 1.00 37.41  ? 74  LYS B CB  1 
ATOM   1965 C  CG  . LYS C 1 79  ? 70.977  13.081 37.923 1.00 38.69  ? 74  LYS B CG  1 
ATOM   1966 C  CD  . LYS C 1 79  ? 72.296  13.033 38.681 1.00 44.75  ? 74  LYS B CD  1 
ATOM   1967 C  CE  . LYS C 1 79  ? 73.471  13.442 37.780 1.00 48.10  ? 74  LYS B CE  1 
ATOM   1968 N  NZ  . LYS C 1 79  ? 74.815  13.010 38.289 1.00 46.81  ? 74  LYS B NZ  1 
ATOM   1969 N  N   . ASN C 1 80  ? 66.723  11.725 39.433 1.00 35.46  ? 75  ASN B N   1 
ATOM   1970 C  CA  . ASN C 1 80  ? 65.852  11.018 40.373 1.00 35.29  ? 75  ASN B CA  1 
ATOM   1971 C  C   . ASN C 1 80  ? 64.546  10.433 39.836 1.00 35.47  ? 75  ASN B C   1 
ATOM   1972 O  O   . ASN C 1 80  ? 63.997  9.503  40.432 1.00 37.26  ? 75  ASN B O   1 
ATOM   1973 C  CB  . ASN C 1 80  ? 65.493  11.935 41.545 1.00 36.38  ? 75  ASN B CB  1 
ATOM   1974 C  CG  . ASN C 1 80  ? 66.657  12.196 42.460 1.00 37.34  ? 75  ASN B CG  1 
ATOM   1975 O  OD1 . ASN C 1 80  ? 67.588  12.920 42.114 1.00 40.73  ? 75  ASN B OD1 1 
ATOM   1976 N  ND2 . ASN C 1 80  ? 66.617  11.598 43.644 1.00 40.47  ? 75  ASN B ND2 1 
ATOM   1977 N  N   . CYS C 1 81  ? 64.041  10.959 38.722 1.00 35.14  ? 76  CYS B N   1 
ATOM   1978 C  CA  . CYS C 1 81  ? 62.756  10.493 38.199 1.00 34.29  ? 76  CYS B CA  1 
ATOM   1979 C  C   . CYS C 1 81  ? 62.770  9.482  37.057 1.00 32.88  ? 76  CYS B C   1 
ATOM   1980 O  O   . CYS C 1 81  ? 61.753  9.251  36.410 1.00 31.21  ? 76  CYS B O   1 
ATOM   1981 C  CB  . CYS C 1 81  ? 61.901  11.714 37.834 1.00 34.49  ? 76  CYS B CB  1 
ATOM   1982 S  SG  . CYS C 1 81  ? 61.882  12.933 39.185 1.00 31.65  ? 76  CYS B SG  1 
ATOM   1983 N  N   . GLY C 1 82  ? 63.930  8.884  36.825 1.00 34.51  ? 77  GLY B N   1 
ATOM   1984 C  CA  . GLY C 1 82  ? 64.077  7.862  35.805 1.00 35.17  ? 77  GLY B CA  1 
ATOM   1985 C  C   . GLY C 1 82  ? 63.628  8.064  34.371 1.00 36.27  ? 77  GLY B C   1 
ATOM   1986 O  O   . GLY C 1 82  ? 63.546  9.173  33.845 1.00 37.12  ? 77  GLY B O   1 
ATOM   1987 N  N   . ARG C 1 83  ? 63.329  6.934  33.743 1.00 37.52  ? 78  ARG B N   1 
ATOM   1988 C  CA  . ARG C 1 83  ? 62.911  6.869  32.355 1.00 38.54  ? 78  ARG B CA  1 
ATOM   1989 C  C   . ARG C 1 83  ? 61.573  7.542  32.046 1.00 36.81  ? 78  ARG B C   1 
ATOM   1990 O  O   . ARG C 1 83  ? 61.448  8.231  31.034 1.00 37.55  ? 78  ARG B O   1 
ATOM   1991 C  CB  . ARG C 1 83  ? 62.872  5.400  31.924 1.00 41.24  ? 78  ARG B CB  1 
ATOM   1992 C  CG  . ARG C 1 83  ? 63.059  5.183  30.441 1.00 47.60  ? 78  ARG B CG  1 
ATOM   1993 C  CD  . ARG C 1 83  ? 63.000  3.703  30.081 1.00 52.06  ? 78  ARG B CD  1 
ATOM   1994 N  NE  . ARG C 1 83  ? 63.437  3.476  28.707 1.00 56.29  ? 78  ARG B NE  1 
ATOM   1995 C  CZ  . ARG C 1 83  ? 64.691  3.630  28.288 1.00 59.13  ? 78  ARG B CZ  1 
ATOM   1996 N  NH1 . ARG C 1 83  ? 65.639  4.007  29.141 1.00 59.48  ? 78  ARG B NH1 1 
ATOM   1997 N  NH2 . ARG C 1 83  ? 64.996  3.419  27.011 1.00 60.88  ? 78  ARG B NH2 1 
ATOM   1998 N  N   . ARG C 1 84  ? 60.569  7.343  32.896 1.00 34.74  ? 79  ARG B N   1 
ATOM   1999 C  CA  . ARG C 1 84  ? 59.267  7.962  32.648 1.00 33.14  ? 79  ARG B CA  1 
ATOM   2000 C  C   . ARG C 1 84  ? 59.368  9.480  32.512 1.00 32.08  ? 79  ARG B C   1 
ATOM   2001 O  O   . ARG C 1 84  ? 58.575  10.094 31.796 1.00 32.41  ? 79  ARG B O   1 
ATOM   2002 C  CB  . ARG C 1 84  ? 58.268  7.636  33.760 1.00 32.19  ? 79  ARG B CB  1 
ATOM   2003 C  CG  . ARG C 1 84  ? 58.849  6.930  34.958 1.00 32.81  ? 79  ARG B CG  1 
ATOM   2004 C  CD  . ARG C 1 84  ? 58.199  7.421  36.232 1.00 32.73  ? 79  ARG B CD  1 
ATOM   2005 N  NE  . ARG C 1 84  ? 56.740  7.413  36.167 1.00 32.25  ? 79  ARG B NE  1 
ATOM   2006 C  CZ  . ARG C 1 84  ? 55.966  8.192  36.921 1.00 29.84  ? 79  ARG B CZ  1 
ATOM   2007 N  NH1 . ARG C 1 84  ? 56.519  9.033  37.787 1.00 27.57  ? 79  ARG B NH1 1 
ATOM   2008 N  NH2 . ARG C 1 84  ? 54.645  8.134  36.812 1.00 29.54  ? 79  ARG B NH2 1 
ATOM   2009 N  N   . PHE C 1 85  ? 60.325  10.087 33.210 1.00 30.02  ? 80  PHE B N   1 
ATOM   2010 C  CA  . PHE C 1 85  ? 60.498  11.533 33.139 1.00 30.32  ? 80  PHE B CA  1 
ATOM   2011 C  C   . PHE C 1 85  ? 61.308  11.875 31.889 1.00 30.14  ? 80  PHE B C   1 
ATOM   2012 O  O   . PHE C 1 85  ? 61.073  12.898 31.242 1.00 29.52  ? 80  PHE B O   1 
ATOM   2013 C  CB  . PHE C 1 85  ? 61.223  12.051 34.385 1.00 29.80  ? 80  PHE B CB  1 
ATOM   2014 C  CG  . PHE C 1 85  ? 61.379  13.550 34.417 1.00 29.83  ? 80  PHE B CG  1 
ATOM   2015 C  CD1 . PHE C 1 85  ? 60.311  14.366 34.771 1.00 29.63  ? 80  PHE B CD1 1 
ATOM   2016 C  CD2 . PHE C 1 85  ? 62.598  14.148 34.079 1.00 30.39  ? 80  PHE B CD2 1 
ATOM   2017 C  CE1 . PHE C 1 85  ? 60.453  15.757 34.789 1.00 30.27  ? 80  PHE B CE1 1 
ATOM   2018 C  CE2 . PHE C 1 85  ? 62.749  15.540 34.095 1.00 27.01  ? 80  PHE B CE2 1 
ATOM   2019 C  CZ  . PHE C 1 85  ? 61.679  16.340 34.449 1.00 28.81  ? 80  PHE B CZ  1 
ATOM   2020 N  N   . HIS C 1 86  ? 62.269  11.016 31.561 1.00 29.68  ? 81  HIS B N   1 
ATOM   2021 C  CA  . HIS C 1 86  ? 63.099  11.223 30.380 1.00 30.75  ? 81  HIS B CA  1 
ATOM   2022 C  C   . HIS C 1 86  ? 62.192  11.208 29.157 1.00 31.85  ? 81  HIS B C   1 
ATOM   2023 O  O   . HIS C 1 86  ? 62.276  12.087 28.294 1.00 32.63  ? 81  HIS B O   1 
ATOM   2024 C  CB  . HIS C 1 86  ? 64.149  10.118 30.275 1.00 31.41  ? 81  HIS B CB  1 
ATOM   2025 C  CG  . HIS C 1 86  ? 65.133  10.116 31.404 1.00 30.42  ? 81  HIS B CG  1 
ATOM   2026 N  ND1 . HIS C 1 86  ? 66.025  9.086  31.613 1.00 31.16  ? 81  HIS B ND1 1 
ATOM   2027 C  CD2 . HIS C 1 86  ? 65.368  11.023 32.383 1.00 30.39  ? 81  HIS B CD2 1 
ATOM   2028 C  CE1 . HIS C 1 86  ? 66.768  9.358  32.672 1.00 31.49  ? 81  HIS B CE1 1 
ATOM   2029 N  NE2 . HIS C 1 86  ? 66.389  10.527 33.158 1.00 32.54  ? 81  HIS B NE2 1 
ATOM   2030 N  N   . ASN C 1 87  ? 61.308  10.218 29.094 1.00 30.86  ? 82  ASN B N   1 
ATOM   2031 C  CA  . ASN C 1 87  ? 60.379  10.123 27.983 1.00 31.67  ? 82  ASN B CA  1 
ATOM   2032 C  C   . ASN C 1 87  ? 59.631  11.435 27.758 1.00 32.09  ? 82  ASN B C   1 
ATOM   2033 O  O   . ASN C 1 87  ? 59.416  11.827 26.618 1.00 32.87  ? 82  ASN B O   1 
ATOM   2034 C  CB  . ASN C 1 87  ? 59.368  8.998  28.225 1.00 33.65  ? 82  ASN B CB  1 
ATOM   2035 C  CG  . ASN C 1 87  ? 59.961  7.604  27.996 1.00 35.66  ? 82  ASN B CG  1 
ATOM   2036 O  OD1 . ASN C 1 87  ? 59.320  6.594  28.295 1.00 35.25  ? 82  ASN B OD1 1 
ATOM   2037 N  ND2 . ASN C 1 87  ? 61.179  7.548  27.458 1.00 34.55  ? 82  ASN B ND2 1 
ATOM   2038 N  N   . GLU C 1 88  ? 59.235  12.121 28.832 1.00 30.72  ? 83  GLU B N   1 
ATOM   2039 C  CA  . GLU C 1 88  ? 58.493  13.368 28.671 1.00 29.41  ? 83  GLU B CA  1 
ATOM   2040 C  C   . GLU C 1 88  ? 59.387  14.495 28.198 1.00 28.34  ? 83  GLU B C   1 
ATOM   2041 O  O   . GLU C 1 88  ? 58.990  15.303 27.365 1.00 24.55  ? 83  GLU B O   1 
ATOM   2042 C  CB  . GLU C 1 88  ? 57.791  13.754 29.978 1.00 31.92  ? 83  GLU B CB  1 
ATOM   2043 C  CG  . GLU C 1 88  ? 56.728  12.746 30.413 1.00 34.51  ? 83  GLU B CG  1 
ATOM   2044 C  CD  . GLU C 1 88  ? 55.739  12.417 29.299 1.00 37.74  ? 83  GLU B CD  1 
ATOM   2045 O  OE1 . GLU C 1 88  ? 55.193  13.359 28.679 1.00 39.61  ? 83  GLU B OE1 1 
ATOM   2046 O  OE2 . GLU C 1 88  ? 55.504  11.214 29.045 1.00 36.75  ? 83  GLU B OE2 1 
ATOM   2047 N  N   . VAL C 1 89  ? 60.605  14.542 28.726 1.00 30.30  ? 84  VAL B N   1 
ATOM   2048 C  CA  . VAL C 1 89  ? 61.568  15.564 28.327 1.00 29.93  ? 84  VAL B CA  1 
ATOM   2049 C  C   . VAL C 1 89  ? 61.899  15.413 26.840 1.00 30.04  ? 84  VAL B C   1 
ATOM   2050 O  O   . VAL C 1 89  ? 62.100  16.400 26.131 1.00 29.76  ? 84  VAL B O   1 
ATOM   2051 C  CB  . VAL C 1 89  ? 62.879  15.447 29.152 1.00 30.75  ? 84  VAL B CB  1 
ATOM   2052 C  CG1 . VAL C 1 89  ? 63.953  16.385 28.584 1.00 30.02  ? 84  VAL B CG1 1 
ATOM   2053 C  CG2 . VAL C 1 89  ? 62.606  15.799 30.624 1.00 29.03  ? 84  VAL B CG2 1 
ATOM   2054 N  N   . GLY C 1 90  ? 61.932  14.165 26.379 1.00 30.84  ? 85  GLY B N   1 
ATOM   2055 C  CA  . GLY C 1 90  ? 62.256  13.881 24.994 1.00 31.02  ? 85  GLY B CA  1 
ATOM   2056 C  C   . GLY C 1 90  ? 61.116  14.114 24.030 1.00 31.85  ? 85  GLY B C   1 
ATOM   2057 O  O   . GLY C 1 90  ? 61.078  13.515 22.959 1.00 32.23  ? 85  GLY B O   1 
ATOM   2058 N  N   . LYS C 1 91  ? 60.182  14.976 24.410 1.00 32.72  ? 86  LYS B N   1 
ATOM   2059 C  CA  . LYS C 1 91  ? 59.037  15.297 23.562 1.00 33.35  ? 86  LYS B CA  1 
ATOM   2060 C  C   . LYS C 1 91  ? 59.186  16.736 23.056 1.00 33.32  ? 86  LYS B C   1 
ATOM   2061 O  O   . LYS C 1 91  ? 59.464  17.642 23.850 1.00 35.40  ? 86  LYS B O   1 
ATOM   2062 C  CB  . LYS C 1 91  ? 57.739  15.190 24.365 1.00 34.60  ? 86  LYS B CB  1 
ATOM   2063 C  CG  . LYS C 1 91  ? 56.911  13.942 24.142 1.00 36.02  ? 86  LYS B CG  1 
ATOM   2064 C  CD  . LYS C 1 91  ? 57.585  12.716 24.684 1.00 39.69  ? 86  LYS B CD  1 
ATOM   2065 C  CE  . LYS C 1 91  ? 56.631  11.527 24.696 1.00 39.50  ? 86  LYS B CE  1 
ATOM   2066 N  NZ  . LYS C 1 91  ? 55.455  11.763 25.587 1.00 39.36  ? 86  LYS B NZ  1 
ATOM   2067 N  N   . PHE C 1 92  ? 59.010  16.953 21.752 1.00 30.49  ? 87  PHE B N   1 
ATOM   2068 C  CA  . PHE C 1 92  ? 59.113  18.304 21.202 1.00 30.40  ? 87  PHE B CA  1 
ATOM   2069 C  C   . PHE C 1 92  ? 58.166  19.217 21.966 1.00 30.18  ? 87  PHE B C   1 
ATOM   2070 O  O   . PHE C 1 92  ? 58.374  20.430 22.040 1.00 28.41  ? 87  PHE B O   1 
ATOM   2071 C  CB  . PHE C 1 92  ? 58.739  18.319 19.719 1.00 30.23  ? 87  PHE B CB  1 
ATOM   2072 C  CG  . PHE C 1 92  ? 59.725  17.612 18.840 1.00 31.03  ? 87  PHE B CG  1 
ATOM   2073 C  CD1 . PHE C 1 92  ? 61.082  17.915 18.916 1.00 29.78  ? 87  PHE B CD1 1 
ATOM   2074 C  CD2 . PHE C 1 92  ? 59.298  16.632 17.945 1.00 29.93  ? 87  PHE B CD2 1 
ATOM   2075 C  CE1 . PHE C 1 92  ? 62.005  17.253 18.118 1.00 31.27  ? 87  PHE B CE1 1 
ATOM   2076 C  CE2 . PHE C 1 92  ? 60.208  15.962 17.141 1.00 31.65  ? 87  PHE B CE2 1 
ATOM   2077 C  CZ  . PHE C 1 92  ? 61.567  16.271 17.226 1.00 31.84  ? 87  PHE B CZ  1 
ATOM   2078 N  N   . ARG C 1 93  ? 57.127  18.608 22.527 1.00 30.91  ? 88  ARG B N   1 
ATOM   2079 C  CA  . ARG C 1 93  ? 56.126  19.316 23.300 1.00 33.48  ? 88  ARG B CA  1 
ATOM   2080 C  C   . ARG C 1 93  ? 56.799  20.036 24.466 1.00 33.93  ? 88  ARG B C   1 
ATOM   2081 O  O   . ARG C 1 93  ? 56.354  21.102 24.887 1.00 35.79  ? 88  ARG B O   1 
ATOM   2082 C  CB  . ARG C 1 93  ? 55.091  18.325 23.818 1.00 35.90  ? 88  ARG B CB  1 
ATOM   2083 C  CG  . ARG C 1 93  ? 53.957  18.960 24.576 1.00 43.84  ? 88  ARG B CG  1 
ATOM   2084 C  CD  . ARG C 1 93  ? 53.113  17.901 25.260 1.00 48.79  ? 88  ARG B CD  1 
ATOM   2085 N  NE  . ARG C 1 93  ? 52.610  16.895 24.324 1.00 53.87  ? 88  ARG B NE  1 
ATOM   2086 C  CZ  . ARG C 1 93  ? 51.836  17.158 23.270 1.00 56.31  ? 88  ARG B CZ  1 
ATOM   2087 N  NH1 . ARG C 1 93  ? 51.466  18.408 22.995 1.00 55.58  ? 88  ARG B NH1 1 
ATOM   2088 N  NH2 . ARG C 1 93  ? 51.418  16.162 22.496 1.00 56.22  ? 88  ARG B NH2 1 
ATOM   2089 N  N   . PHE C 1 94  ? 57.875  19.453 24.989 1.00 32.81  ? 89  PHE B N   1 
ATOM   2090 C  CA  . PHE C 1 94  ? 58.606  20.068 26.094 1.00 31.11  ? 89  PHE B CA  1 
ATOM   2091 C  C   . PHE C 1 94  ? 59.836  20.819 25.580 1.00 30.78  ? 89  PHE B C   1 
ATOM   2092 O  O   . PHE C 1 94  ? 60.122  21.926 26.025 1.00 30.65  ? 89  PHE B O   1 
ATOM   2093 C  CB  . PHE C 1 94  ? 59.052  19.010 27.112 1.00 30.11  ? 89  PHE B CB  1 
ATOM   2094 C  CG  . PHE C 1 94  ? 60.081  19.513 28.092 1.00 27.82  ? 89  PHE B CG  1 
ATOM   2095 C  CD1 . PHE C 1 94  ? 59.714  20.342 29.142 1.00 26.74  ? 89  PHE B CD1 1 
ATOM   2096 C  CD2 . PHE C 1 94  ? 61.427  19.204 27.921 1.00 27.53  ? 89  PHE B CD2 1 
ATOM   2097 C  CE1 . PHE C 1 94  ? 60.671  20.862 30.005 1.00 27.18  ? 89  PHE B CE1 1 
ATOM   2098 C  CE2 . PHE C 1 94  ? 62.392  19.719 28.778 1.00 28.54  ? 89  PHE B CE2 1 
ATOM   2099 C  CZ  . PHE C 1 94  ? 62.012  20.554 29.824 1.00 27.98  ? 89  PHE B CZ  1 
ATOM   2100 N  N   . LEU C 1 95  ? 60.555  20.211 24.642 1.00 29.09  ? 90  LEU B N   1 
ATOM   2101 C  CA  . LEU C 1 95  ? 61.756  20.816 24.078 1.00 29.06  ? 90  LEU B CA  1 
ATOM   2102 C  C   . LEU C 1 95  ? 61.501  22.157 23.380 1.00 29.72  ? 90  LEU B C   1 
ATOM   2103 O  O   . LEU C 1 95  ? 62.346  23.055 23.441 1.00 29.53  ? 90  LEU B O   1 
ATOM   2104 C  CB  . LEU C 1 95  ? 62.415  19.839 23.096 1.00 29.29  ? 90  LEU B CB  1 
ATOM   2105 C  CG  . LEU C 1 95  ? 62.769  18.449 23.656 1.00 30.47  ? 90  LEU B CG  1 
ATOM   2106 C  CD1 . LEU C 1 95  ? 63.091  17.483 22.523 1.00 28.72  ? 90  LEU B CD1 1 
ATOM   2107 C  CD2 . LEU C 1 95  ? 63.956  18.570 24.613 1.00 30.95  ? 90  LEU B CD2 1 
ATOM   2108 N  N   . ASN C 1 96  ? 60.355  22.293 22.713 1.00 29.28  ? 91  ASN B N   1 
ATOM   2109 C  CA  . ASN C 1 96  ? 60.027  23.539 22.015 1.00 28.84  ? 91  ASN B CA  1 
ATOM   2110 C  C   . ASN C 1 96  ? 59.905  24.689 23.001 1.00 29.42  ? 91  ASN B C   1 
ATOM   2111 O  O   . ASN C 1 96  ? 60.026  25.858 22.625 1.00 29.50  ? 91  ASN B O   1 
ATOM   2112 C  CB  . ASN C 1 96  ? 58.701  23.435 21.253 1.00 27.25  ? 91  ASN B CB  1 
ATOM   2113 C  CG  . ASN C 1 96  ? 58.781  22.544 20.033 1.00 26.26  ? 91  ASN B CG  1 
ATOM   2114 O  OD1 . ASN C 1 96  ? 59.852  22.303 19.476 1.00 28.60  ? 91  ASN B OD1 1 
ATOM   2115 N  ND2 . ASN C 1 96  ? 57.632  22.070 19.591 1.00 27.90  ? 91  ASN B ND2 1 
ATOM   2116 N  N   . GLU C 1 97  ? 59.635  24.364 24.261 1.00 28.59  ? 92  GLU B N   1 
ATOM   2117 C  CA  . GLU C 1 97  ? 59.524  25.410 25.267 1.00 30.25  ? 92  GLU B CA  1 
ATOM   2118 C  C   . GLU C 1 97  ? 60.931  25.886 25.662 1.00 30.20  ? 92  GLU B C   1 
ATOM   2119 O  O   . GLU C 1 97  ? 61.114  27.039 26.068 1.00 32.16  ? 92  GLU B O   1 
ATOM   2120 C  CB  . GLU C 1 97  ? 58.753  24.903 26.491 1.00 29.96  ? 92  GLU B CB  1 
ATOM   2121 C  CG  . GLU C 1 97  ? 57.344  24.417 26.185 1.00 30.41  ? 92  GLU B CG  1 
ATOM   2122 C  CD  . GLU C 1 97  ? 56.409  25.513 25.680 1.00 33.77  ? 92  GLU B CD  1 
ATOM   2123 O  OE1 . GLU C 1 97  ? 56.811  26.695 25.662 1.00 34.60  ? 92  GLU B OE1 1 
ATOM   2124 O  OE2 . GLU C 1 97  ? 55.256  25.191 25.304 1.00 36.12  ? 92  GLU B OE2 1 
ATOM   2125 N  N   . LEU C 1 98  ? 61.925  25.009 25.533 1.00 29.36  ? 93  LEU B N   1 
ATOM   2126 C  CA  . LEU C 1 98  ? 63.304  25.387 25.849 1.00 29.94  ? 93  LEU B CA  1 
ATOM   2127 C  C   . LEU C 1 98  ? 63.887  26.163 24.670 1.00 30.06  ? 93  LEU B C   1 
ATOM   2128 O  O   . LEU C 1 98  ? 64.716  27.061 24.851 1.00 29.17  ? 93  LEU B O   1 
ATOM   2129 C  CB  . LEU C 1 98  ? 64.172  24.157 26.106 1.00 28.89  ? 93  LEU B CB  1 
ATOM   2130 C  CG  . LEU C 1 98  ? 63.902  23.320 27.352 1.00 29.14  ? 93  LEU B CG  1 
ATOM   2131 C  CD1 . LEU C 1 98  ? 64.978  22.243 27.434 1.00 29.58  ? 93  LEU B CD1 1 
ATOM   2132 C  CD2 . LEU C 1 98  ? 63.917  24.193 28.607 1.00 26.26  ? 93  LEU B CD2 1 
ATOM   2133 N  N   . ILE C 1 99  ? 63.447  25.802 23.465 1.00 28.98  ? 94  ILE B N   1 
ATOM   2134 C  CA  . ILE C 1 99  ? 63.894  26.458 22.246 1.00 29.86  ? 94  ILE B CA  1 
ATOM   2135 C  C   . ILE C 1 99  ? 63.469  27.929 22.268 1.00 30.03  ? 94  ILE B C   1 
ATOM   2136 O  O   . ILE C 1 99  ? 64.206  28.807 21.818 1.00 30.09  ? 94  ILE B O   1 
ATOM   2137 C  CB  . ILE C 1 99  ? 63.296  25.759 21.008 1.00 29.78  ? 94  ILE B CB  1 
ATOM   2138 C  CG1 . ILE C 1 99  ? 63.914  24.367 20.860 1.00 30.31  ? 94  ILE B CG1 1 
ATOM   2139 C  CG2 . ILE C 1 99  ? 63.556  26.575 19.760 1.00 29.94  ? 94  ILE B CG2 1 
ATOM   2140 C  CD1 . ILE C 1 99  ? 63.300  23.537 19.752 1.00 29.09  ? 94  ILE B CD1 1 
ATOM   2141 N  N   . LYS C 1 100 ? 62.280  28.189 22.803 1.00 31.06  ? 95  LYS B N   1 
ATOM   2142 C  CA  . LYS C 1 100 ? 61.755  29.551 22.897 1.00 31.87  ? 95  LYS B CA  1 
ATOM   2143 C  C   . LYS C 1 100 ? 62.622  30.387 23.835 1.00 31.84  ? 95  LYS B C   1 
ATOM   2144 O  O   . LYS C 1 100 ? 62.723  31.603 23.692 1.00 32.19  ? 95  LYS B O   1 
ATOM   2145 C  CB  . LYS C 1 100 ? 60.300  29.517 23.393 1.00 31.39  ? 95  LYS B CB  1 
ATOM   2146 C  CG  . LYS C 1 100 ? 59.341  28.860 22.393 1.00 35.88  ? 95  LYS B CG  1 
ATOM   2147 C  CD  . LYS C 1 100 ? 58.009  28.388 23.005 1.00 37.04  ? 95  LYS B CD  1 
ATOM   2148 C  CE  . LYS C 1 100 ? 57.081  29.535 23.365 1.00 39.97  ? 95  LYS B CE  1 
ATOM   2149 N  NZ  . LYS C 1 100 ? 55.742  29.038 23.850 1.00 41.59  ? 95  LYS B NZ  1 
ATOM   2150 N  N   . VAL C 1 101 ? 63.278  29.718 24.775 1.00 32.72  ? 96  VAL B N   1 
ATOM   2151 C  CA  . VAL C 1 101 ? 64.125  30.394 25.754 1.00 33.69  ? 96  VAL B CA  1 
ATOM   2152 C  C   . VAL C 1 101 ? 65.385  31.010 25.159 1.00 34.15  ? 96  VAL B C   1 
ATOM   2153 O  O   . VAL C 1 101 ? 65.743  32.135 25.502 1.00 36.09  ? 96  VAL B O   1 
ATOM   2154 C  CB  . VAL C 1 101 ? 64.531  29.416 26.904 1.00 32.90  ? 96  VAL B CB  1 
ATOM   2155 C  CG1 . VAL C 1 101 ? 65.583  30.051 27.807 1.00 32.27  ? 96  VAL B CG1 1 
ATOM   2156 C  CG2 . VAL C 1 101 ? 63.305  29.056 27.728 1.00 32.40  ? 96  VAL B CG2 1 
ATOM   2157 N  N   . VAL C 1 102 ? 66.049  30.283 24.267 1.00 33.83  ? 97  VAL B N   1 
ATOM   2158 C  CA  . VAL C 1 102 ? 67.284  30.766 23.659 1.00 35.73  ? 97  VAL B CA  1 
ATOM   2159 C  C   . VAL C 1 102 ? 67.080  31.461 22.315 1.00 38.29  ? 97  VAL B C   1 
ATOM   2160 O  O   . VAL C 1 102 ? 67.938  32.229 21.872 1.00 39.48  ? 97  VAL B O   1 
ATOM   2161 C  CB  . VAL C 1 102 ? 68.281  29.612 23.471 1.00 33.92  ? 97  VAL B CB  1 
ATOM   2162 C  CG1 . VAL C 1 102 ? 68.569  28.979 24.811 1.00 34.88  ? 97  VAL B CG1 1 
ATOM   2163 C  CG2 . VAL C 1 102 ? 67.716  28.574 22.515 1.00 33.54  ? 97  VAL B CG2 1 
ATOM   2164 N  N   . SER C 1 103 ? 65.939  31.203 21.679 1.00 40.89  ? 98  SER B N   1 
ATOM   2165 C  CA  . SER C 1 103 ? 65.627  31.795 20.384 1.00 42.74  ? 98  SER B CA  1 
ATOM   2166 C  C   . SER C 1 103 ? 65.205  33.264 20.442 1.00 43.70  ? 98  SER B C   1 
ATOM   2167 O  O   . SER C 1 103 ? 64.189  33.611 21.049 1.00 43.59  ? 98  SER B O   1 
ATOM   2168 C  CB  . SER C 1 103 ? 64.530  30.990 19.698 1.00 44.25  ? 98  SER B CB  1 
ATOM   2169 O  OG  . SER C 1 103 ? 64.125  31.639 18.505 1.00 48.04  ? 98  SER B OG  1 
ATOM   2170 N  N   . PRO C 1 104 ? 65.990  34.150 19.806 1.00 44.73  ? 99  PRO B N   1 
ATOM   2171 C  CA  . PRO C 1 104 ? 65.686  35.584 19.788 1.00 45.54  ? 99  PRO B CA  1 
ATOM   2172 C  C   . PRO C 1 104 ? 64.324  35.890 19.171 1.00 46.78  ? 99  PRO B C   1 
ATOM   2173 O  O   . PRO C 1 104 ? 63.715  36.921 19.470 1.00 48.51  ? 99  PRO B O   1 
ATOM   2174 C  CB  . PRO C 1 104 ? 66.838  36.166 18.975 1.00 45.03  ? 99  PRO B CB  1 
ATOM   2175 C  CG  . PRO C 1 104 ? 67.981  35.280 19.353 1.00 43.52  ? 99  PRO B CG  1 
ATOM   2176 C  CD  . PRO C 1 104 ? 67.344  33.901 19.274 1.00 44.21  ? 99  PRO B CD  1 
ATOM   2177 N  N   . LYS C 1 105 ? 63.841  34.995 18.315 1.00 46.93  ? 100 LYS B N   1 
ATOM   2178 C  CA  . LYS C 1 105 ? 62.545  35.198 17.683 1.00 47.59  ? 100 LYS B CA  1 
ATOM   2179 C  C   . LYS C 1 105 ? 61.387  34.892 18.638 1.00 48.17  ? 100 LYS B C   1 
ATOM   2180 O  O   . LYS C 1 105 ? 60.219  35.002 18.258 1.00 48.35  ? 100 LYS B O   1 
ATOM   2181 C  CB  . LYS C 1 105 ? 62.428  34.340 16.421 1.00 48.86  ? 100 LYS B CB  1 
ATOM   2182 C  CG  . LYS C 1 105 ? 63.475  34.680 15.358 1.00 50.34  ? 100 LYS B CG  1 
ATOM   2183 C  CD  . LYS C 1 105 ? 63.301  33.856 14.083 1.00 50.03  ? 100 LYS B CD  1 
ATOM   2184 C  CE  . LYS C 1 105 ? 64.406  34.170 13.078 1.00 48.96  ? 100 LYS B CE  1 
ATOM   2185 N  NZ  . LYS C 1 105 ? 64.203  33.465 11.784 1.00 48.92  ? 100 LYS B NZ  1 
ATOM   2186 N  N   . TYR C 1 106 ? 61.713  34.509 19.874 1.00 47.08  ? 101 TYR B N   1 
ATOM   2187 C  CA  . TYR C 1 106 ? 60.692  34.213 20.883 1.00 46.34  ? 101 TYR B CA  1 
ATOM   2188 C  C   . TYR C 1 106 ? 60.996  34.906 22.201 1.00 45.57  ? 101 TYR B C   1 
ATOM   2189 O  O   . TYR C 1 106 ? 60.685  36.076 22.369 1.00 46.26  ? 101 TYR B O   1 
ATOM   2190 C  CB  . TYR C 1 106 ? 60.560  32.705 21.127 1.00 46.07  ? 101 TYR B CB  1 
ATOM   2191 C  CG  . TYR C 1 106 ? 59.971  31.941 19.965 1.00 46.19  ? 101 TYR B CG  1 
ATOM   2192 C  CD1 . TYR C 1 106 ? 60.771  31.535 18.900 1.00 47.31  ? 101 TYR B CD1 1 
ATOM   2193 C  CD2 . TYR C 1 106 ? 58.609  31.642 19.919 1.00 45.89  ? 101 TYR B CD2 1 
ATOM   2194 C  CE1 . TYR C 1 106 ? 60.234  30.849 17.818 1.00 47.53  ? 101 TYR B CE1 1 
ATOM   2195 C  CE2 . TYR C 1 106 ? 58.061  30.957 18.840 1.00 47.52  ? 101 TYR B CE2 1 
ATOM   2196 C  CZ  . TYR C 1 106 ? 58.884  30.563 17.792 1.00 48.50  ? 101 TYR B CZ  1 
ATOM   2197 O  OH  . TYR C 1 106 ? 58.362  29.883 16.713 1.00 51.33  ? 101 TYR B OH  1 
ATOM   2198 N  N   . LEU C 1 107 ? 61.617  34.186 23.132 1.00 46.22  ? 102 LEU B N   1 
ATOM   2199 C  CA  . LEU C 1 107 ? 61.946  34.742 24.447 1.00 44.96  ? 102 LEU B CA  1 
ATOM   2200 C  C   . LEU C 1 107 ? 63.420  35.134 24.592 1.00 44.88  ? 102 LEU B C   1 
ATOM   2201 O  O   . LEU C 1 107 ? 63.789  35.856 25.519 1.00 44.08  ? 102 LEU B O   1 
ATOM   2202 C  CB  . LEU C 1 107 ? 61.564  33.729 25.532 1.00 43.74  ? 102 LEU B CB  1 
ATOM   2203 C  CG  . LEU C 1 107 ? 60.099  33.267 25.520 1.00 44.07  ? 102 LEU B CG  1 
ATOM   2204 C  CD1 . LEU C 1 107 ? 59.951  31.973 26.292 1.00 43.79  ? 102 LEU B CD1 1 
ATOM   2205 C  CD2 . LEU C 1 107 ? 59.213  34.354 26.114 1.00 42.61  ? 102 LEU B CD2 1 
ATOM   2206 N  N   . GLY C 1 108 ? 64.256  34.663 23.673 1.00 44.87  ? 103 GLY B N   1 
ATOM   2207 C  CA  . GLY C 1 108 ? 65.675  34.965 23.728 1.00 47.15  ? 103 GLY B CA  1 
ATOM   2208 C  C   . GLY C 1 108 ? 66.086  36.349 24.213 1.00 48.85  ? 103 GLY B C   1 
ATOM   2209 O  O   . GLY C 1 108 ? 66.902  36.469 25.131 1.00 48.25  ? 103 GLY B O   1 
ATOM   2210 N  N   . ASP C 1 109 ? 65.538  37.397 23.601 1.00 50.72  ? 104 ASP B N   1 
ATOM   2211 C  CA  . ASP C 1 109 ? 65.882  38.768 23.984 1.00 52.30  ? 104 ASP B CA  1 
ATOM   2212 C  C   . ASP C 1 109 ? 65.076  39.263 25.183 1.00 52.89  ? 104 ASP B C   1 
ATOM   2213 O  O   . ASP C 1 109 ? 64.446  40.322 25.132 1.00 54.28  ? 104 ASP B O   1 
ATOM   2214 C  CB  . ASP C 1 109 ? 65.663  39.720 22.805 1.00 53.83  ? 104 ASP B CB  1 
ATOM   2215 C  CG  . ASP C 1 109 ? 66.296  39.218 21.521 1.00 55.72  ? 104 ASP B CG  1 
ATOM   2216 O  OD1 . ASP C 1 109 ? 67.476  38.802 21.558 1.00 53.01  ? 104 ASP B OD1 1 
ATOM   2217 O  OD2 . ASP C 1 109 ? 65.607  39.248 20.474 1.00 57.12  ? 104 ASP B OD2 1 
ATOM   2218 N  N   . ARG C 1 110 ? 65.104  38.494 26.263 1.00 52.20  ? 105 ARG B N   1 
ATOM   2219 C  CA  . ARG C 1 110 ? 64.383  38.843 27.476 1.00 51.22  ? 105 ARG B CA  1 
ATOM   2220 C  C   . ARG C 1 110 ? 64.849  37.879 28.560 1.00 49.43  ? 105 ARG B C   1 
ATOM   2221 O  O   . ARG C 1 110 ? 64.476  38.003 29.729 1.00 49.31  ? 105 ARG B O   1 
ATOM   2222 C  CB  . ARG C 1 110 ? 62.871  38.727 27.238 1.00 53.50  ? 105 ARG B CB  1 
ATOM   2223 C  CG  . ARG C 1 110 ? 62.000  39.191 28.401 1.00 56.50  ? 105 ARG B CG  1 
ATOM   2224 C  CD  . ARG C 1 110 ? 61.809  38.090 29.440 1.00 58.79  ? 105 ARG B CD  1 
ATOM   2225 N  NE  . ARG C 1 110 ? 60.801  37.109 29.049 1.00 60.00  ? 105 ARG B NE  1 
ATOM   2226 C  CZ  . ARG C 1 110 ? 60.570  35.979 29.713 1.00 61.12  ? 105 ARG B CZ  1 
ATOM   2227 N  NH1 . ARG C 1 110 ? 61.287  35.692 30.793 1.00 61.44  ? 105 ARG B NH1 1 
ATOM   2228 N  NH2 . ARG C 1 110 ? 59.609  35.151 29.318 1.00 60.50  ? 105 ARG B NH2 1 
ATOM   2229 N  N   . VAL C 1 111 ? 65.678  36.920 28.150 1.00 47.04  ? 106 VAL B N   1 
ATOM   2230 C  CA  . VAL C 1 111 ? 66.241  35.916 29.054 1.00 43.85  ? 106 VAL B CA  1 
ATOM   2231 C  C   . VAL C 1 111 ? 67.719  36.215 29.250 1.00 42.04  ? 106 VAL B C   1 
ATOM   2232 O  O   . VAL C 1 111 ? 68.410  36.592 28.300 1.00 42.66  ? 106 VAL B O   1 
ATOM   2233 C  CB  . VAL C 1 111 ? 66.088  34.487 28.477 1.00 42.91  ? 106 VAL B CB  1 
ATOM   2234 C  CG1 . VAL C 1 111 ? 66.852  33.502 29.330 1.00 41.74  ? 106 VAL B CG1 1 
ATOM   2235 C  CG2 . VAL C 1 111 ? 64.608  34.097 28.424 1.00 41.91  ? 106 VAL B CG2 1 
ATOM   2236 N  N   . SER C 1 112 ? 68.206  36.055 30.476 1.00 39.75  ? 107 SER B N   1 
ATOM   2237 C  CA  . SER C 1 112 ? 69.614  36.327 30.763 1.00 39.82  ? 107 SER B CA  1 
ATOM   2238 C  C   . SER C 1 112 ? 70.548  35.334 30.087 1.00 39.42  ? 107 SER B C   1 
ATOM   2239 O  O   . SER C 1 112 ? 70.152  34.221 29.734 1.00 38.31  ? 107 SER B O   1 
ATOM   2240 C  CB  . SER C 1 112 ? 69.879  36.294 32.268 1.00 39.90  ? 107 SER B CB  1 
ATOM   2241 O  OG  . SER C 1 112 ? 69.696  34.990 32.789 1.00 38.87  ? 107 SER B OG  1 
ATOM   2242 N  N   . GLU C 1 113 ? 71.795  35.744 29.912 1.00 39.76  ? 108 GLU B N   1 
ATOM   2243 C  CA  . GLU C 1 113 ? 72.772  34.880 29.287 1.00 41.88  ? 108 GLU B CA  1 
ATOM   2244 C  C   . GLU C 1 113 ? 72.951  33.653 30.180 1.00 40.31  ? 108 GLU B C   1 
ATOM   2245 O  O   . GLU C 1 113 ? 73.162  32.553 29.686 1.00 40.25  ? 108 GLU B O   1 
ATOM   2246 C  CB  . GLU C 1 113 ? 74.110  35.618 29.104 1.00 44.41  ? 108 GLU B CB  1 
ATOM   2247 C  CG  . GLU C 1 113 ? 74.705  35.494 27.690 1.00 49.23  ? 108 GLU B CG  1 
ATOM   2248 C  CD  . GLU C 1 113 ? 76.196  35.114 27.685 1.00 52.55  ? 108 GLU B CD  1 
ATOM   2249 O  OE1 . GLU C 1 113 ? 77.011  35.849 28.295 1.00 55.14  ? 108 GLU B OE1 1 
ATOM   2250 O  OE2 . GLU C 1 113 ? 76.555  34.083 27.064 1.00 50.92  ? 108 GLU B OE2 1 
ATOM   2251 N  N   . LYS C 1 114 ? 72.852  33.849 31.492 1.00 40.14  ? 109 LYS B N   1 
ATOM   2252 C  CA  . LYS C 1 114 ? 73.001  32.754 32.456 1.00 40.52  ? 109 LYS B CA  1 
ATOM   2253 C  C   . LYS C 1 114 ? 72.035  31.609 32.181 1.00 38.62  ? 109 LYS B C   1 
ATOM   2254 O  O   . LYS C 1 114 ? 72.447  30.457 32.042 1.00 37.24  ? 109 LYS B O   1 
ATOM   2255 C  CB  . LYS C 1 114 ? 72.764  33.254 33.883 1.00 43.48  ? 109 LYS B CB  1 
ATOM   2256 C  CG  . LYS C 1 114 ? 73.892  34.072 34.475 1.00 48.22  ? 109 LYS B CG  1 
ATOM   2257 C  CD  . LYS C 1 114 ? 73.465  34.673 35.812 1.00 52.15  ? 109 LYS B CD  1 
ATOM   2258 C  CE  . LYS C 1 114 ? 74.540  35.584 36.391 1.00 54.05  ? 109 LYS B CE  1 
ATOM   2259 N  NZ  . LYS C 1 114 ? 75.809  34.847 36.698 1.00 55.34  ? 109 LYS B NZ  1 
ATOM   2260 N  N   . VAL C 1 115 ? 70.748  31.944 32.121 1.00 36.48  ? 110 VAL B N   1 
ATOM   2261 C  CA  . VAL C 1 115 ? 69.688  30.978 31.867 1.00 35.63  ? 110 VAL B CA  1 
ATOM   2262 C  C   . VAL C 1 115 ? 69.819  30.331 30.488 1.00 35.64  ? 110 VAL B C   1 
ATOM   2263 O  O   . VAL C 1 115 ? 69.593  29.128 30.331 1.00 34.17  ? 110 VAL B O   1 
ATOM   2264 C  CB  . VAL C 1 115 ? 68.297  31.655 31.979 1.00 35.80  ? 110 VAL B CB  1 
ATOM   2265 C  CG1 . VAL C 1 115 ? 67.198  30.704 31.507 1.00 30.78  ? 110 VAL B CG1 1 
ATOM   2266 C  CG2 . VAL C 1 115 ? 68.051  32.088 33.425 1.00 33.80  ? 110 VAL B CG2 1 
ATOM   2267 N  N   . LYS C 1 116 ? 70.194  31.124 29.492 1.00 34.92  ? 111 LYS B N   1 
ATOM   2268 C  CA  . LYS C 1 116 ? 70.340  30.594 28.148 1.00 36.01  ? 111 LYS B CA  1 
ATOM   2269 C  C   . LYS C 1 116 ? 71.509  29.629 27.993 1.00 36.52  ? 111 LYS B C   1 
ATOM   2270 O  O   . LYS C 1 116 ? 71.364  28.589 27.340 1.00 36.29  ? 111 LYS B O   1 
ATOM   2271 C  CB  . LYS C 1 116 ? 70.429  31.738 27.136 1.00 34.82  ? 111 LYS B CB  1 
ATOM   2272 C  CG  . LYS C 1 116 ? 69.067  32.384 26.904 1.00 38.14  ? 111 LYS B CG  1 
ATOM   2273 C  CD  . LYS C 1 116 ? 69.079  33.460 25.814 1.00 39.03  ? 111 LYS B CD  1 
ATOM   2274 C  CE  . LYS C 1 116 ? 69.908  34.667 26.229 1.00 37.26  ? 111 LYS B CE  1 
ATOM   2275 N  NZ  . LYS C 1 116 ? 69.711  35.795 25.286 1.00 37.06  ? 111 LYS B NZ  1 
ATOM   2276 N  N   . THR C 1 117 ? 72.654  29.942 28.604 1.00 36.96  ? 112 THR B N   1 
ATOM   2277 C  CA  . THR C 1 117 ? 73.808  29.051 28.496 1.00 37.32  ? 112 THR B CA  1 
ATOM   2278 C  C   . THR C 1 117 ? 73.567  27.765 29.296 1.00 35.40  ? 112 THR B C   1 
ATOM   2279 O  O   . THR C 1 117 ? 74.102  26.707 28.959 1.00 36.18  ? 112 THR B O   1 
ATOM   2280 C  CB  . THR C 1 117 ? 75.148  29.742 28.955 1.00 39.91  ? 112 THR B CB  1 
ATOM   2281 O  OG1 . THR C 1 117 ? 75.139  29.966 30.372 1.00 44.48  ? 112 THR B OG1 1 
ATOM   2282 C  CG2 . THR C 1 117 ? 75.334  31.074 28.237 1.00 36.93  ? 112 THR B CG2 1 
ATOM   2283 N  N   . LYS C 1 118 ? 72.749  27.849 30.340 1.00 32.68  ? 113 LYS B N   1 
ATOM   2284 C  CA  . LYS C 1 118 ? 72.436  26.671 31.140 1.00 31.13  ? 113 LYS B CA  1 
ATOM   2285 C  C   . LYS C 1 118 ? 71.533  25.731 30.337 1.00 30.20  ? 113 LYS B C   1 
ATOM   2286 O  O   . LYS C 1 118 ? 71.656  24.512 30.407 1.00 28.62  ? 113 LYS B O   1 
ATOM   2287 C  CB  . LYS C 1 118 ? 71.731  27.076 32.439 1.00 30.93  ? 113 LYS B CB  1 
ATOM   2288 C  CG  . LYS C 1 118 ? 71.413  25.902 33.360 1.00 33.01  ? 113 LYS B CG  1 
ATOM   2289 C  CD  . LYS C 1 118 ? 72.663  25.090 33.727 1.00 31.11  ? 113 LYS B CD  1 
ATOM   2290 C  CE  . LYS C 1 118 ? 72.333  24.058 34.814 1.00 36.30  ? 113 LYS B CE  1 
ATOM   2291 N  NZ  . LYS C 1 118 ? 73.492  23.178 35.225 1.00 35.45  ? 113 LYS B NZ  1 
ATOM   2292 N  N   . VAL C 1 119 ? 70.614  26.311 29.577 1.00 30.07  ? 114 VAL B N   1 
ATOM   2293 C  CA  . VAL C 1 119 ? 69.705  25.524 28.754 1.00 29.93  ? 114 VAL B CA  1 
ATOM   2294 C  C   . VAL C 1 119 ? 70.489  24.768 27.682 1.00 32.50  ? 114 VAL B C   1 
ATOM   2295 O  O   . VAL C 1 119 ? 70.247  23.582 27.445 1.00 33.08  ? 114 VAL B O   1 
ATOM   2296 C  CB  . VAL C 1 119 ? 68.671  26.426 28.066 1.00 27.75  ? 114 VAL B CB  1 
ATOM   2297 C  CG1 . VAL C 1 119 ? 67.939  25.651 26.978 1.00 25.42  ? 114 VAL B CG1 1 
ATOM   2298 C  CG2 . VAL C 1 119 ? 67.702  26.967 29.100 1.00 25.48  ? 114 VAL B CG2 1 
ATOM   2299 N  N   . ILE C 1 120 ? 71.417  25.469 27.030 1.00 32.60  ? 115 ILE B N   1 
ATOM   2300 C  CA  . ILE C 1 120 ? 72.251  24.876 25.989 1.00 31.53  ? 115 ILE B CA  1 
ATOM   2301 C  C   . ILE C 1 120 ? 73.120  23.782 26.607 1.00 31.75  ? 115 ILE B C   1 
ATOM   2302 O  O   . ILE C 1 120 ? 73.277  22.696 26.043 1.00 30.21  ? 115 ILE B O   1 
ATOM   2303 C  CB  . ILE C 1 120 ? 73.149  25.951 25.340 1.00 31.23  ? 115 ILE B CB  1 
ATOM   2304 C  CG1 . ILE C 1 120 ? 72.270  26.993 24.637 1.00 29.98  ? 115 ILE B CG1 1 
ATOM   2305 C  CG2 . ILE C 1 120 ? 74.130  25.308 24.362 1.00 29.89  ? 115 ILE B CG2 1 
ATOM   2306 C  CD1 . ILE C 1 120 ? 71.345  26.417 23.576 1.00 31.09  ? 115 ILE B CD1 1 
ATOM   2307 N  N   . GLU C 1 121 ? 73.674  24.075 27.777 1.00 31.94  ? 116 GLU B N   1 
ATOM   2308 C  CA  . GLU C 1 121 ? 74.500  23.114 28.490 1.00 33.61  ? 116 GLU B CA  1 
ATOM   2309 C  C   . GLU C 1 121 ? 73.720  21.812 28.738 1.00 33.41  ? 116 GLU B C   1 
ATOM   2310 O  O   . GLU C 1 121 ? 74.219  20.720 28.465 1.00 34.32  ? 116 GLU B O   1 
ATOM   2311 C  CB  . GLU C 1 121 ? 74.953  23.713 29.824 1.00 36.58  ? 116 GLU B CB  1 
ATOM   2312 C  CG  . GLU C 1 121 ? 75.653  22.724 30.734 1.00 42.89  ? 116 GLU B CG  1 
ATOM   2313 C  CD  . GLU C 1 121 ? 75.759  23.218 32.169 1.00 45.80  ? 116 GLU B CD  1 
ATOM   2314 O  OE1 . GLU C 1 121 ? 76.503  24.196 32.416 1.00 46.34  ? 116 GLU B OE1 1 
ATOM   2315 O  OE2 . GLU C 1 121 ? 75.087  22.623 33.045 1.00 46.13  ? 116 GLU B OE2 1 
ATOM   2316 N  N   . LEU C 1 122 ? 72.496  21.928 29.253 1.00 31.96  ? 117 LEU B N   1 
ATOM   2317 C  CA  . LEU C 1 122 ? 71.655  20.759 29.526 1.00 30.41  ? 117 LEU B CA  1 
ATOM   2318 C  C   . LEU C 1 122 ? 71.303  19.967 28.263 1.00 30.33  ? 117 LEU B C   1 
ATOM   2319 O  O   . LEU C 1 122 ? 71.454  18.745 28.229 1.00 28.92  ? 117 LEU B O   1 
ATOM   2320 C  CB  . LEU C 1 122 ? 70.368  21.193 30.226 1.00 31.67  ? 117 LEU B CB  1 
ATOM   2321 C  CG  . LEU C 1 122 ? 70.569  21.639 31.677 1.00 32.67  ? 117 LEU B CG  1 
ATOM   2322 C  CD1 . LEU C 1 122 ? 69.336  22.364 32.180 1.00 31.71  ? 117 LEU B CD1 1 
ATOM   2323 C  CD2 . LEU C 1 122 ? 70.878  20.421 32.531 1.00 31.13  ? 117 LEU B CD2 1 
ATOM   2324 N  N   . LEU C 1 123 ? 70.822  20.658 27.233 1.00 28.27  ? 118 LEU B N   1 
ATOM   2325 C  CA  . LEU C 1 123 ? 70.467  19.998 25.982 1.00 27.84  ? 118 LEU B CA  1 
ATOM   2326 C  C   . LEU C 1 123 ? 71.633  19.191 25.423 1.00 28.70  ? 118 LEU B C   1 
ATOM   2327 O  O   . LEU C 1 123 ? 71.509  17.991 25.150 1.00 30.02  ? 118 LEU B O   1 
ATOM   2328 C  CB  . LEU C 1 123 ? 70.024  21.030 24.944 1.00 26.43  ? 118 LEU B CB  1 
ATOM   2329 C  CG  . LEU C 1 123 ? 68.607  21.565 25.140 1.00 26.11  ? 118 LEU B CG  1 
ATOM   2330 C  CD1 . LEU C 1 123 ? 68.347  22.723 24.181 1.00 25.48  ? 118 LEU B CD1 1 
ATOM   2331 C  CD2 . LEU C 1 123 ? 67.615  20.425 24.926 1.00 22.82  ? 118 LEU B CD2 1 
ATOM   2332 N  N   . TYR C 1 124 ? 72.770  19.848 25.244 1.00 28.44  ? 119 TYR B N   1 
ATOM   2333 C  CA  . TYR C 1 124 ? 73.924  19.154 24.717 1.00 29.48  ? 119 TYR B CA  1 
ATOM   2334 C  C   . TYR C 1 124 ? 74.227  17.991 25.640 1.00 28.56  ? 119 TYR B C   1 
ATOM   2335 O  O   . TYR C 1 124 ? 74.426  16.860 25.199 1.00 28.83  ? 119 TYR B O   1 
ATOM   2336 C  CB  . TYR C 1 124 ? 75.128  20.088 24.647 1.00 30.95  ? 119 TYR B CB  1 
ATOM   2337 C  CG  . TYR C 1 124 ? 76.378  19.385 24.174 1.00 33.37  ? 119 TYR B CG  1 
ATOM   2338 C  CD1 . TYR C 1 124 ? 76.398  18.709 22.954 1.00 34.34  ? 119 TYR B CD1 1 
ATOM   2339 C  CD2 . TYR C 1 124 ? 77.538  19.382 24.950 1.00 33.85  ? 119 TYR B CD2 1 
ATOM   2340 C  CE1 . TYR C 1 124 ? 77.544  18.040 22.518 1.00 34.23  ? 119 TYR B CE1 1 
ATOM   2341 C  CE2 . TYR C 1 124 ? 78.691  18.716 24.519 1.00 35.65  ? 119 TYR B CE2 1 
ATOM   2342 C  CZ  . TYR C 1 124 ? 78.682  18.046 23.305 1.00 33.97  ? 119 TYR B CZ  1 
ATOM   2343 O  OH  . TYR C 1 124 ? 79.800  17.359 22.891 1.00 37.41  ? 119 TYR B OH  1 
ATOM   2344 N  N   . SER C 1 125 ? 74.247  18.274 26.934 1.00 28.27  ? 120 SER B N   1 
ATOM   2345 C  CA  . SER C 1 125 ? 74.522  17.242 27.918 1.00 29.86  ? 120 SER B CA  1 
ATOM   2346 C  C   . SER C 1 125 ? 73.596  16.045 27.701 1.00 28.43  ? 120 SER B C   1 
ATOM   2347 O  O   . SER C 1 125 ? 74.018  14.898 27.832 1.00 29.88  ? 120 SER B O   1 
ATOM   2348 C  CB  . SER C 1 125 ? 74.343  17.806 29.328 1.00 32.06  ? 120 SER B CB  1 
ATOM   2349 O  OG  . SER C 1 125 ? 74.918  16.936 30.287 1.00 38.48  ? 120 SER B OG  1 
ATOM   2350 N  N   . TRP C 1 126 ? 72.342  16.303 27.343 1.00 26.51  ? 121 TRP B N   1 
ATOM   2351 C  CA  . TRP C 1 126 ? 71.402  15.214 27.117 1.00 26.39  ? 121 TRP B CA  1 
ATOM   2352 C  C   . TRP C 1 126 ? 71.636  14.459 25.819 1.00 26.63  ? 121 TRP B C   1 
ATOM   2353 O  O   . TRP C 1 126 ? 71.219  13.310 25.689 1.00 23.44  ? 121 TRP B O   1 
ATOM   2354 C  CB  . TRP C 1 126 ? 69.964  15.717 27.138 1.00 25.69  ? 121 TRP B CB  1 
ATOM   2355 C  CG  . TRP C 1 126 ? 69.574  16.303 28.440 1.00 26.87  ? 121 TRP B CG  1 
ATOM   2356 C  CD1 . TRP C 1 126 ? 70.144  16.057 29.662 1.00 24.58  ? 121 TRP B CD1 1 
ATOM   2357 C  CD2 . TRP C 1 126 ? 68.520  17.239 28.668 1.00 26.07  ? 121 TRP B CD2 1 
ATOM   2358 N  NE1 . TRP C 1 126 ? 69.510  16.785 30.632 1.00 25.80  ? 121 TRP B NE1 1 
ATOM   2359 C  CE2 . TRP C 1 126 ? 68.508  17.521 30.053 1.00 26.01  ? 121 TRP B CE2 1 
ATOM   2360 C  CE3 . TRP C 1 126 ? 67.584  17.870 27.835 1.00 26.58  ? 121 TRP B CE3 1 
ATOM   2361 C  CZ2 . TRP C 1 126 ? 67.596  18.405 30.627 1.00 28.23  ? 121 TRP B CZ2 1 
ATOM   2362 C  CZ3 . TRP C 1 126 ? 66.675  18.752 28.404 1.00 28.46  ? 121 TRP B CZ3 1 
ATOM   2363 C  CH2 . TRP C 1 126 ? 66.689  19.011 29.791 1.00 29.29  ? 121 TRP B CH2 1 
ATOM   2364 N  N   . THR C 1 127 ? 72.274  15.086 24.840 1.00 27.25  ? 122 THR B N   1 
ATOM   2365 C  CA  . THR C 1 127 ? 72.518  14.343 23.609 1.00 29.84  ? 122 THR B CA  1 
ATOM   2366 C  C   . THR C 1 127 ? 73.572  13.299 23.949 1.00 31.52  ? 122 THR B C   1 
ATOM   2367 O  O   . THR C 1 127 ? 73.618  12.225 23.350 1.00 30.76  ? 122 THR B O   1 
ATOM   2368 C  CB  . THR C 1 127 ? 73.026  15.248 22.468 1.00 28.90  ? 122 THR B CB  1 
ATOM   2369 O  OG1 . THR C 1 127 ? 74.260  15.856 22.855 1.00 31.57  ? 122 THR B OG1 1 
ATOM   2370 C  CG2 . THR C 1 127 ? 72.000  16.335 22.153 1.00 27.84  ? 122 THR B CG2 1 
HETATM 2371 N  N   . MSE C 1 128 ? 74.395  13.619 24.948 1.00 34.45  ? 123 MSE B N   1 
HETATM 2372 C  CA  . MSE C 1 128 ? 75.463  12.728 25.403 1.00 37.60  ? 123 MSE B CA  1 
HETATM 2373 C  C   . MSE C 1 128 ? 74.938  11.599 26.291 1.00 38.78  ? 123 MSE B C   1 
HETATM 2374 O  O   . MSE C 1 128 ? 75.190  10.417 26.028 1.00 39.34  ? 123 MSE B O   1 
HETATM 2375 C  CB  . MSE C 1 128 ? 76.525  13.510 26.197 1.00 40.46  ? 123 MSE B CB  1 
HETATM 2376 C  CG  . MSE C 1 128 ? 77.365  14.524 25.405 1.00 46.30  ? 123 MSE B CG  1 
HETATM 2377 SE SE  . MSE C 1 128 ? 78.542  13.749 24.066 1.00 54.77  ? 123 MSE B SE  1 
HETATM 2378 C  CE  . MSE C 1 128 ? 77.758  14.499 22.459 1.00 49.87  ? 123 MSE B CE  1 
ATOM   2379 N  N   . ALA C 1 129 ? 74.212  11.972 27.343 1.00 37.49  ? 124 ALA B N   1 
ATOM   2380 C  CA  . ALA C 1 129 ? 73.682  11.008 28.296 1.00 36.61  ? 124 ALA B CA  1 
ATOM   2381 C  C   . ALA C 1 129 ? 72.471  10.182 27.863 1.00 37.10  ? 124 ALA B C   1 
ATOM   2382 O  O   . ALA C 1 129 ? 72.376  9.011  28.217 1.00 37.92  ? 124 ALA B O   1 
ATOM   2383 C  CB  . ALA C 1 129 ? 73.360  11.721 29.600 1.00 36.13  ? 124 ALA B CB  1 
ATOM   2384 N  N   . LEU C 1 130 ? 71.542  10.779 27.121 1.00 36.95  ? 125 LEU B N   1 
ATOM   2385 C  CA  . LEU C 1 130 ? 70.332  10.067 26.704 1.00 37.61  ? 125 LEU B CA  1 
ATOM   2386 C  C   . LEU C 1 130 ? 70.294  9.657  25.243 1.00 38.25  ? 125 LEU B C   1 
ATOM   2387 O  O   . LEU C 1 130 ? 69.732  10.359 24.406 1.00 37.27  ? 125 LEU B O   1 
ATOM   2388 C  CB  . LEU C 1 130 ? 69.097  10.916 27.009 1.00 37.20  ? 125 LEU B CB  1 
ATOM   2389 C  CG  . LEU C 1 130 ? 68.936  11.305 28.473 1.00 37.83  ? 125 LEU B CG  1 
ATOM   2390 C  CD1 . LEU C 1 130 ? 67.665  12.120 28.647 1.00 35.45  ? 125 LEU B CD1 1 
ATOM   2391 C  CD2 . LEU C 1 130 ? 68.902  10.043 29.329 1.00 36.04  ? 125 LEU B CD2 1 
ATOM   2392 N  N   . PRO C 1 131 ? 70.866  8.492  24.923 1.00 40.56  ? 126 PRO B N   1 
ATOM   2393 C  CA  . PRO C 1 131 ? 70.915  7.959  23.558 1.00 42.35  ? 126 PRO B CA  1 
ATOM   2394 C  C   . PRO C 1 131 ? 69.526  7.597  23.036 1.00 44.20  ? 126 PRO B C   1 
ATOM   2395 O  O   . PRO C 1 131 ? 69.233  7.770  21.856 1.00 45.44  ? 126 PRO B O   1 
ATOM   2396 C  CB  . PRO C 1 131 ? 71.795  6.710  23.699 1.00 43.19  ? 126 PRO B CB  1 
ATOM   2397 C  CG  . PRO C 1 131 ? 72.555  6.929  24.982 1.00 42.58  ? 126 PRO B CG  1 
ATOM   2398 C  CD  . PRO C 1 131 ? 71.529  7.574  25.863 1.00 41.62  ? 126 PRO B CD  1 
ATOM   2399 N  N   . GLU C 1 132 ? 68.680  7.084  23.926 1.00 46.01  ? 127 GLU B N   1 
ATOM   2400 C  CA  . GLU C 1 132 ? 67.325  6.668  23.574 1.00 46.17  ? 127 GLU B CA  1 
ATOM   2401 C  C   . GLU C 1 132 ? 66.365  7.827  23.238 1.00 44.02  ? 127 GLU B C   1 
ATOM   2402 O  O   . GLU C 1 132 ? 65.260  7.592  22.748 1.00 45.27  ? 127 GLU B O   1 
ATOM   2403 C  CB  . GLU C 1 132 ? 66.741  5.826  24.716 1.00 49.54  ? 127 GLU B CB  1 
ATOM   2404 C  CG  . GLU C 1 132 ? 65.427  5.104  24.384 1.00 56.67  ? 127 GLU B CG  1 
ATOM   2405 C  CD  . GLU C 1 132 ? 65.625  3.852  23.528 1.00 60.66  ? 127 GLU B CD  1 
ATOM   2406 O  OE1 . GLU C 1 132 ? 66.253  3.951  22.447 1.00 61.80  ? 127 GLU B OE1 1 
ATOM   2407 O  OE2 . GLU C 1 132 ? 65.147  2.767  23.936 1.00 61.90  ? 127 GLU B OE2 1 
ATOM   2408 N  N   . GLU C 1 133 ? 66.769  9.070  23.494 1.00 39.96  ? 128 GLU B N   1 
ATOM   2409 C  CA  . GLU C 1 133 ? 65.899  10.213 23.194 1.00 36.58  ? 128 GLU B CA  1 
ATOM   2410 C  C   . GLU C 1 133 ? 66.422  10.950 21.965 1.00 35.01  ? 128 GLU B C   1 
ATOM   2411 O  O   . GLU C 1 133 ? 67.089  11.978 22.080 1.00 34.14  ? 128 GLU B O   1 
ATOM   2412 C  CB  . GLU C 1 133 ? 65.837  11.185 24.381 1.00 34.02  ? 128 GLU B CB  1 
ATOM   2413 C  CG  . GLU C 1 133 ? 65.331  10.595 25.704 1.00 32.16  ? 128 GLU B CG  1 
ATOM   2414 C  CD  . GLU C 1 133 ? 63.894  10.077 25.636 1.00 33.06  ? 128 GLU B CD  1 
ATOM   2415 O  OE1 . GLU C 1 133 ? 63.018  10.803 25.121 1.00 33.63  ? 128 GLU B OE1 1 
ATOM   2416 O  OE2 . GLU C 1 133 ? 63.630  8.947  26.114 1.00 32.23  ? 128 GLU B OE2 1 
ATOM   2417 N  N   . ALA C 1 134 ? 66.111  10.420 20.789 1.00 33.77  ? 129 ALA B N   1 
ATOM   2418 C  CA  . ALA C 1 134 ? 66.562  11.017 19.533 1.00 33.82  ? 129 ALA B CA  1 
ATOM   2419 C  C   . ALA C 1 134 ? 66.097  12.463 19.342 1.00 33.88  ? 129 ALA B C   1 
ATOM   2420 O  O   . ALA C 1 134 ? 66.873  13.326 18.905 1.00 32.76  ? 129 ALA B O   1 
ATOM   2421 C  CB  . ALA C 1 134 ? 66.091  10.161 18.354 1.00 32.05  ? 129 ALA B CB  1 
ATOM   2422 N  N   . LYS C 1 135 ? 64.832  12.721 19.668 1.00 32.59  ? 130 LYS B N   1 
ATOM   2423 C  CA  . LYS C 1 135 ? 64.260  14.053 19.520 1.00 31.10  ? 130 LYS B CA  1 
ATOM   2424 C  C   . LYS C 1 135 ? 65.080  15.168 20.154 1.00 30.33  ? 130 LYS B C   1 
ATOM   2425 O  O   . LYS C 1 135 ? 65.048  16.309 19.682 1.00 29.35  ? 130 LYS B O   1 
ATOM   2426 C  CB  . LYS C 1 135 ? 62.842  14.076 20.073 1.00 31.62  ? 130 LYS B CB  1 
ATOM   2427 C  CG  . LYS C 1 135 ? 61.857  13.272 19.232 1.00 33.30  ? 130 LYS B CG  1 
ATOM   2428 C  CD  . LYS C 1 135 ? 60.437  13.349 19.787 1.00 36.11  ? 130 LYS B CD  1 
ATOM   2429 C  CE  . LYS C 1 135 ? 59.503  12.384 19.057 1.00 37.61  ? 130 LYS B CE  1 
ATOM   2430 N  NZ  . LYS C 1 135 ? 58.109  12.376 19.612 1.00 36.91  ? 130 LYS B NZ  1 
ATOM   2431 N  N   . ILE C 1 136 ? 65.811  14.849 21.220 1.00 29.14  ? 131 ILE B N   1 
ATOM   2432 C  CA  . ILE C 1 136 ? 66.634  15.850 21.880 1.00 27.85  ? 131 ILE B CA  1 
ATOM   2433 C  C   . ILE C 1 136 ? 67.779  16.247 20.962 1.00 28.89  ? 131 ILE B C   1 
ATOM   2434 O  O   . ILE C 1 136 ? 68.207  17.402 20.966 1.00 29.94  ? 131 ILE B O   1 
ATOM   2435 C  CB  . ILE C 1 136 ? 67.194  15.330 23.232 1.00 27.89  ? 131 ILE B CB  1 
ATOM   2436 C  CG1 . ILE C 1 136 ? 66.034  15.111 24.218 1.00 26.44  ? 131 ILE B CG1 1 
ATOM   2437 C  CG2 . ILE C 1 136 ? 68.212  16.321 23.801 1.00 23.93  ? 131 ILE B CG2 1 
ATOM   2438 C  CD1 . ILE C 1 136 ? 66.462  14.613 25.602 1.00 22.70  ? 131 ILE B CD1 1 
ATOM   2439 N  N   . LYS C 1 137 ? 68.272  15.294 20.172 1.00 29.67  ? 132 LYS B N   1 
ATOM   2440 C  CA  . LYS C 1 137 ? 69.361  15.578 19.239 1.00 31.93  ? 132 LYS B CA  1 
ATOM   2441 C  C   . LYS C 1 137 ? 68.834  16.438 18.103 1.00 32.29  ? 132 LYS B C   1 
ATOM   2442 O  O   . LYS C 1 137 ? 69.493  17.384 17.667 1.00 31.45  ? 132 LYS B O   1 
ATOM   2443 C  CB  . LYS C 1 137 ? 69.953  14.284 18.666 1.00 33.95  ? 132 LYS B CB  1 
ATOM   2444 C  CG  . LYS C 1 137 ? 70.620  13.396 19.709 1.00 36.94  ? 132 LYS B CG  1 
ATOM   2445 C  CD  . LYS C 1 137 ? 71.430  12.284 19.076 1.00 38.74  ? 132 LYS B CD  1 
ATOM   2446 C  CE  . LYS C 1 137 ? 72.090  11.443 20.154 1.00 39.91  ? 132 LYS B CE  1 
ATOM   2447 N  NZ  . LYS C 1 137 ? 71.062  10.935 21.100 1.00 41.33  ? 132 LYS B NZ  1 
ATOM   2448 N  N   . ASP C 1 138 ? 67.642  16.101 17.625 1.00 32.91  ? 133 ASP B N   1 
ATOM   2449 C  CA  . ASP C 1 138 ? 67.031  16.857 16.550 1.00 35.33  ? 133 ASP B CA  1 
ATOM   2450 C  C   . ASP C 1 138 ? 66.888  18.318 16.942 1.00 33.94  ? 133 ASP B C   1 
ATOM   2451 O  O   . ASP C 1 138 ? 67.237  19.207 16.169 1.00 34.51  ? 133 ASP B O   1 
ATOM   2452 C  CB  . ASP C 1 138 ? 65.667  16.280 16.206 1.00 37.93  ? 133 ASP B CB  1 
ATOM   2453 C  CG  . ASP C 1 138 ? 65.758  14.857 15.736 1.00 43.22  ? 133 ASP B CG  1 
ATOM   2454 O  OD1 . ASP C 1 138 ? 66.813  14.506 15.151 1.00 44.86  ? 133 ASP B OD1 1 
ATOM   2455 O  OD2 . ASP C 1 138 ? 64.780  14.097 15.938 1.00 45.88  ? 133 ASP B OD2 1 
ATOM   2456 N  N   . ALA C 1 139 ? 66.385  18.562 18.145 1.00 31.50  ? 134 ALA B N   1 
ATOM   2457 C  CA  . ALA C 1 139 ? 66.210  19.929 18.619 1.00 32.19  ? 134 ALA B CA  1 
ATOM   2458 C  C   . ALA C 1 139 ? 67.569  20.584 18.721 1.00 31.49  ? 134 ALA B C   1 
ATOM   2459 O  O   . ALA C 1 139 ? 67.762  21.717 18.285 1.00 31.03  ? 134 ALA B O   1 
ATOM   2460 C  CB  . ALA C 1 139 ? 65.519  19.945 19.992 1.00 29.24  ? 134 ALA B CB  1 
ATOM   2461 N  N   . TYR C 1 140 ? 68.520  19.867 19.302 1.00 33.09  ? 135 TYR B N   1 
ATOM   2462 C  CA  . TYR C 1 140 ? 69.855  20.416 19.448 1.00 35.32  ? 135 TYR B CA  1 
ATOM   2463 C  C   . TYR C 1 140 ? 70.503  20.689 18.084 1.00 38.85  ? 135 TYR B C   1 
ATOM   2464 O  O   . TYR C 1 140 ? 71.049  21.775 17.857 1.00 38.77  ? 135 TYR B O   1 
ATOM   2465 C  CB  . TYR C 1 140 ? 70.736  19.467 20.253 1.00 33.31  ? 135 TYR B CB  1 
ATOM   2466 C  CG  . TYR C 1 140 ? 72.085  20.062 20.554 1.00 32.69  ? 135 TYR B CG  1 
ATOM   2467 C  CD1 . TYR C 1 140 ? 72.228  21.034 21.543 1.00 31.13  ? 135 TYR B CD1 1 
ATOM   2468 C  CD2 . TYR C 1 140 ? 73.207  19.708 19.804 1.00 31.42  ? 135 TYR B CD2 1 
ATOM   2469 C  CE1 . TYR C 1 140 ? 73.455  21.646 21.779 1.00 32.97  ? 135 TYR B CE1 1 
ATOM   2470 C  CE2 . TYR C 1 140 ? 74.438  20.312 20.030 1.00 32.88  ? 135 TYR B CE2 1 
ATOM   2471 C  CZ  . TYR C 1 140 ? 74.556  21.280 21.019 1.00 33.40  ? 135 TYR B CZ  1 
ATOM   2472 O  OH  . TYR C 1 140 ? 75.774  21.875 21.261 1.00 35.23  ? 135 TYR B OH  1 
ATOM   2473 N  N   . HIS C 1 141 ? 70.440  19.710 17.178 1.00 42.16  ? 136 HIS B N   1 
ATOM   2474 C  CA  . HIS C 1 141 ? 71.039  19.871 15.855 1.00 45.78  ? 136 HIS B CA  1 
ATOM   2475 C  C   . HIS C 1 141 ? 70.416  21.031 15.095 1.00 47.12  ? 136 HIS B C   1 
ATOM   2476 O  O   . HIS C 1 141 ? 71.088  21.697 14.303 1.00 48.03  ? 136 HIS B O   1 
ATOM   2477 C  CB  . HIS C 1 141 ? 70.911  18.591 15.022 1.00 48.01  ? 136 HIS B CB  1 
ATOM   2478 C  CG  . HIS C 1 141 ? 71.781  17.466 15.497 1.00 52.66  ? 136 HIS B CG  1 
ATOM   2479 N  ND1 . HIS C 1 141 ? 73.028  17.667 16.055 1.00 54.33  ? 136 HIS B ND1 1 
ATOM   2480 C  CD2 . HIS C 1 141 ? 71.592  16.124 15.478 1.00 52.77  ? 136 HIS B CD2 1 
ATOM   2481 C  CE1 . HIS C 1 141 ? 73.566  16.499 16.362 1.00 54.91  ? 136 HIS B CE1 1 
ATOM   2482 N  NE2 . HIS C 1 141 ? 72.714  15.546 16.022 1.00 55.53  ? 136 HIS B NE2 1 
HETATM 2483 N  N   . MSE C 1 142 ? 69.133  21.272 15.337 1.00 47.84  ? 137 MSE B N   1 
HETATM 2484 C  CA  . MSE C 1 142 ? 68.431  22.364 14.676 1.00 48.41  ? 137 MSE B CA  1 
HETATM 2485 C  C   . MSE C 1 142 ? 68.959  23.700 15.202 1.00 45.88  ? 137 MSE B C   1 
HETATM 2486 O  O   . MSE C 1 142 ? 69.215  24.625 14.427 1.00 42.88  ? 137 MSE B O   1 
HETATM 2487 C  CB  . MSE C 1 142 ? 66.924  22.238 14.914 1.00 53.81  ? 137 MSE B CB  1 
HETATM 2488 C  CG  . MSE C 1 142 ? 66.077  23.181 14.073 1.00 61.30  ? 137 MSE B CG  1 
HETATM 2489 SE SE  . MSE C 1 142 ? 65.277  24.558 15.148 1.00 71.66  ? 137 MSE B SE  1 
HETATM 2490 C  CE  . MSE C 1 142 ? 66.705  25.853 15.138 1.00 67.38  ? 137 MSE B CE  1 
ATOM   2491 N  N   . LEU C 1 143 ? 69.125  23.804 16.517 1.00 44.18  ? 138 LEU B N   1 
ATOM   2492 C  CA  . LEU C 1 143 ? 69.660  25.028 17.097 1.00 43.52  ? 138 LEU B CA  1 
ATOM   2493 C  C   . LEU C 1 143 ? 71.021  25.328 16.459 1.00 44.10  ? 138 LEU B C   1 
ATOM   2494 O  O   . LEU C 1 143 ? 71.289  26.462 16.058 1.00 42.87  ? 138 LEU B O   1 
ATOM   2495 C  CB  . LEU C 1 143 ? 69.810  24.887 18.616 1.00 42.47  ? 138 LEU B CB  1 
ATOM   2496 C  CG  . LEU C 1 143 ? 68.509  24.810 19.427 1.00 40.92  ? 138 LEU B CG  1 
ATOM   2497 C  CD1 . LEU C 1 143 ? 68.825  24.574 20.894 1.00 38.31  ? 138 LEU B CD1 1 
ATOM   2498 C  CD2 . LEU C 1 143 ? 67.719  26.101 19.246 1.00 39.98  ? 138 LEU B CD2 1 
ATOM   2499 N  N   . LYS C 1 144 ? 71.877  24.313 16.359 1.00 45.07  ? 139 LYS B N   1 
ATOM   2500 C  CA  . LYS C 1 144 ? 73.195  24.503 15.752 1.00 46.86  ? 139 LYS B CA  1 
ATOM   2501 C  C   . LYS C 1 144 ? 73.039  24.914 14.291 1.00 47.08  ? 139 LYS B C   1 
ATOM   2502 O  O   . LYS C 1 144 ? 73.512  25.970 13.872 1.00 47.68  ? 139 LYS B O   1 
ATOM   2503 C  CB  . LYS C 1 144 ? 74.019  23.217 15.824 1.00 46.57  ? 139 LYS B CB  1 
ATOM   2504 C  CG  . LYS C 1 144 ? 74.250  22.701 17.226 1.00 48.55  ? 139 LYS B CG  1 
ATOM   2505 C  CD  . LYS C 1 144 ? 75.282  21.584 17.236 1.00 49.89  ? 139 LYS B CD  1 
ATOM   2506 C  CE  . LYS C 1 144 ? 76.685  22.128 17.017 1.00 51.54  ? 139 LYS B CE  1 
ATOM   2507 N  NZ  . LYS C 1 144 ? 77.719  21.051 17.074 1.00 53.15  ? 139 LYS B NZ  1 
ATOM   2508 N  N   . ARG C 1 145 ? 72.368  24.063 13.527 1.00 48.42  ? 140 ARG B N   1 
ATOM   2509 C  CA  . ARG C 1 145 ? 72.119  24.285 12.106 1.00 50.79  ? 140 ARG B CA  1 
ATOM   2510 C  C   . ARG C 1 145 ? 71.478  25.647 11.829 1.00 51.71  ? 140 ARG B C   1 
ATOM   2511 O  O   . ARG C 1 145 ? 71.429  26.101 10.680 1.00 51.30  ? 140 ARG B O   1 
ATOM   2512 C  CB  . ARG C 1 145 ? 71.216  23.165 11.586 1.00 51.59  ? 140 ARG B CB  1 
ATOM   2513 C  CG  . ARG C 1 145 ? 70.728  23.302 10.155 1.00 54.53  ? 140 ARG B CG  1 
ATOM   2514 C  CD  . ARG C 1 145 ? 69.711  22.196 9.866  1.00 57.97  ? 140 ARG B CD  1 
ATOM   2515 N  NE  . ARG C 1 145 ? 68.580  22.249 10.799 1.00 59.25  ? 140 ARG B NE  1 
ATOM   2516 C  CZ  . ARG C 1 145 ? 67.730  21.247 11.013 1.00 59.66  ? 140 ARG B CZ  1 
ATOM   2517 N  NH1 . ARG C 1 145 ? 67.874  20.099 10.362 1.00 58.48  ? 140 ARG B NH1 1 
ATOM   2518 N  NH2 . ARG C 1 145 ? 66.732  21.391 11.880 1.00 58.90  ? 140 ARG B NH2 1 
ATOM   2519 N  N   . GLN C 1 146 ? 70.997  26.300 12.884 1.00 52.59  ? 141 GLN B N   1 
ATOM   2520 C  CA  . GLN C 1 146 ? 70.352  27.598 12.747 1.00 51.90  ? 141 GLN B CA  1 
ATOM   2521 C  C   . GLN C 1 146 ? 71.119  28.685 13.491 1.00 50.27  ? 141 GLN B C   1 
ATOM   2522 O  O   . GLN C 1 146 ? 70.590  29.763 13.752 1.00 50.41  ? 141 GLN B O   1 
ATOM   2523 C  CB  . GLN C 1 146 ? 68.914  27.523 13.265 1.00 55.58  ? 141 GLN B CB  1 
ATOM   2524 C  CG  . GLN C 1 146 ? 67.978  28.578 12.677 1.00 60.84  ? 141 GLN B CG  1 
ATOM   2525 C  CD  . GLN C 1 146 ? 67.708  28.379 11.181 1.00 63.23  ? 141 GLN B CD  1 
ATOM   2526 O  OE1 . GLN C 1 146 ? 67.017  29.187 10.551 1.00 63.38  ? 141 GLN B OE1 1 
ATOM   2527 N  NE2 . GLN C 1 146 ? 68.249  27.298 10.613 1.00 63.48  ? 141 GLN B NE2 1 
ATOM   2528 N  N   . GLY C 1 147 ? 72.361  28.387 13.852 1.00 48.39  ? 142 GLY B N   1 
ATOM   2529 C  CA  . GLY C 1 147 ? 73.190  29.368 14.531 1.00 47.69  ? 142 GLY B CA  1 
ATOM   2530 C  C   . GLY C 1 147 ? 72.954  29.773 15.981 1.00 47.72  ? 142 GLY B C   1 
ATOM   2531 O  O   . GLY C 1 147 ? 73.718  30.594 16.502 1.00 47.79  ? 142 GLY B O   1 
ATOM   2532 N  N   . ILE C 1 148 ? 71.928  29.244 16.647 1.00 47.11  ? 143 ILE B N   1 
ATOM   2533 C  CA  . ILE C 1 148 ? 71.721  29.617 18.047 1.00 46.48  ? 143 ILE B CA  1 
ATOM   2534 C  C   . ILE C 1 148 ? 72.890  29.053 18.846 1.00 45.66  ? 143 ILE B C   1 
ATOM   2535 O  O   . ILE C 1 148 ? 73.350  29.656 19.819 1.00 45.11  ? 143 ILE B O   1 
ATOM   2536 C  CB  . ILE C 1 148 ? 70.402  29.055 18.622 1.00 46.65  ? 143 ILE B CB  1 
ATOM   2537 C  CG1 . ILE C 1 148 ? 69.211  29.569 17.810 1.00 47.16  ? 143 ILE B CG1 1 
ATOM   2538 C  CG2 . ILE C 1 148 ? 70.247  29.489 20.069 1.00 45.12  ? 143 ILE B CG2 1 
ATOM   2539 C  CD1 . ILE C 1 148 ? 69.128  31.073 17.738 1.00 47.75  ? 143 ILE B CD1 1 
ATOM   2540 N  N   . VAL C 1 149 ? 73.370  27.889 18.421 1.00 45.25  ? 144 VAL B N   1 
ATOM   2541 C  CA  . VAL C 1 149 ? 74.506  27.248 19.076 1.00 46.10  ? 144 VAL B CA  1 
ATOM   2542 C  C   . VAL C 1 149 ? 75.672  27.212 18.096 1.00 45.53  ? 144 VAL B C   1 
ATOM   2543 O  O   . VAL C 1 149 ? 75.657  26.449 17.132 1.00 44.32  ? 144 VAL B O   1 
ATOM   2544 C  CB  . VAL C 1 149 ? 74.176  25.801 19.514 1.00 45.24  ? 144 VAL B CB  1 
ATOM   2545 C  CG1 . VAL C 1 149 ? 75.404  25.154 20.137 1.00 44.40  ? 144 VAL B CG1 1 
ATOM   2546 C  CG2 . VAL C 1 149 ? 73.032  25.811 20.506 1.00 45.49  ? 144 VAL B CG2 1 
ATOM   2547 N  N   . GLN C 1 150 ? 76.672  28.051 18.344 1.00 46.65  ? 145 GLN B N   1 
ATOM   2548 C  CA  . GLN C 1 150 ? 77.851  28.123 17.486 1.00 48.92  ? 145 GLN B CA  1 
ATOM   2549 C  C   . GLN C 1 150 ? 78.595  26.794 17.545 1.00 47.51  ? 145 GLN B C   1 
ATOM   2550 O  O   . GLN C 1 150 ? 78.596  26.026 16.577 1.00 47.73  ? 145 GLN B O   1 
ATOM   2551 C  CB  . GLN C 1 150 ? 78.769  29.264 17.949 1.00 52.49  ? 145 GLN B CB  1 
ATOM   2552 C  CG  . GLN C 1 150 ? 78.057  30.616 18.112 1.00 55.58  ? 145 GLN B CG  1 
ATOM   2553 C  CD  . GLN C 1 150 ? 77.592  31.220 16.790 1.00 58.32  ? 145 GLN B CD  1 
ATOM   2554 O  OE1 . GLN C 1 150 ? 76.992  30.537 15.952 1.00 59.09  ? 145 GLN B OE1 1 
ATOM   2555 N  NE2 . GLN C 1 150 ? 77.859  32.512 16.604 1.00 59.27  ? 145 GLN B NE2 1 
ATOM   2556 N  N   . SER C 1 151 ? 79.223  26.519 18.684 1.00 45.21  ? 146 SER B N   1 
ATOM   2557 C  CA  . SER C 1 151 ? 79.945  25.263 18.858 1.00 43.76  ? 146 SER B CA  1 
ATOM   2558 C  C   . SER C 1 151 ? 79.436  24.566 20.115 1.00 40.99  ? 146 SER B C   1 
ATOM   2559 O  O   . SER C 1 151 ? 78.820  25.204 20.970 1.00 41.70  ? 146 SER B O   1 
ATOM   2560 C  CB  . SER C 1 151 ? 81.446  25.527 18.990 1.00 44.67  ? 146 SER B CB  1 
ATOM   2561 O  OG  . SER C 1 151 ? 81.723  26.237 20.185 1.00 48.98  ? 146 SER B OG  1 
ATOM   2562 N  N   . ASP C 1 152 ? 79.677  23.263 20.227 1.00 37.55  ? 147 ASP B N   1 
ATOM   2563 C  CA  . ASP C 1 152 ? 79.241  22.539 21.412 1.00 34.88  ? 147 ASP B CA  1 
ATOM   2564 C  C   . ASP C 1 152 ? 79.843  23.185 22.652 1.00 33.26  ? 147 ASP B C   1 
ATOM   2565 O  O   . ASP C 1 152 ? 81.003  23.593 22.658 1.00 33.93  ? 147 ASP B O   1 
ATOM   2566 C  CB  . ASP C 1 152 ? 79.651  21.075 21.338 1.00 32.79  ? 147 ASP B CB  1 
ATOM   2567 C  CG  . ASP C 1 152 ? 78.939  20.343 20.233 1.00 34.08  ? 147 ASP B CG  1 
ATOM   2568 O  OD1 . ASP C 1 152 ? 77.749  20.634 20.007 1.00 36.17  ? 147 ASP B OD1 1 
ATOM   2569 O  OD2 . ASP C 1 152 ? 79.553  19.474 19.590 1.00 35.76  ? 147 ASP B OD2 1 
ATOM   2570 N  N   . PRO C 1 153 ? 79.050  23.307 23.722 1.00 31.70  ? 148 PRO B N   1 
ATOM   2571 C  CA  . PRO C 1 153 ? 79.582  23.923 24.938 1.00 30.09  ? 148 PRO B CA  1 
ATOM   2572 C  C   . PRO C 1 153 ? 80.214  22.926 25.899 1.00 29.66  ? 148 PRO B C   1 
ATOM   2573 O  O   . PRO C 1 153 ? 79.931  21.722 25.849 1.00 28.31  ? 148 PRO B O   1 
ATOM   2574 C  CB  . PRO C 1 153 ? 78.345  24.570 25.553 1.00 29.89  ? 148 PRO B CB  1 
ATOM   2575 C  CG  . PRO C 1 153 ? 77.282  23.545 25.256 1.00 29.23  ? 148 PRO B CG  1 
ATOM   2576 C  CD  . PRO C 1 153 ? 77.588  23.123 23.814 1.00 28.47  ? 148 PRO B CD  1 
ATOM   2577 N  N   . PRO C 1 154 ? 81.106  23.412 26.773 1.00 29.87  ? 149 PRO B N   1 
ATOM   2578 C  CA  . PRO C 1 154 ? 81.725  22.506 27.734 1.00 29.37  ? 149 PRO B CA  1 
ATOM   2579 C  C   . PRO C 1 154 ? 80.585  22.273 28.716 1.00 29.91  ? 149 PRO B C   1 
ATOM   2580 O  O   . PRO C 1 154 ? 79.644  23.079 28.775 1.00 28.49  ? 149 PRO B O   1 
ATOM   2581 C  CB  . PRO C 1 154 ? 82.851  23.348 28.324 1.00 30.74  ? 149 PRO B CB  1 
ATOM   2582 C  CG  . PRO C 1 154 ? 82.267  24.738 28.289 1.00 31.30  ? 149 PRO B CG  1 
ATOM   2583 C  CD  . PRO C 1 154 ? 81.645  24.777 26.909 1.00 29.78  ? 149 PRO B CD  1 
ATOM   2584 N  N   . ILE C 1 155 ? 80.651  21.195 29.484 1.00 29.87  ? 150 ILE B N   1 
ATOM   2585 C  CA  . ILE C 1 155 ? 79.576  20.892 30.409 1.00 30.32  ? 150 ILE B CA  1 
ATOM   2586 C  C   . ILE C 1 155 ? 80.101  20.196 31.642 1.00 31.36  ? 150 ILE B C   1 
ATOM   2587 O  O   . ILE C 1 155 ? 81.248  19.768 31.670 1.00 30.76  ? 150 ILE B O   1 
ATOM   2588 C  CB  . ILE C 1 155 ? 78.548  19.959 29.745 1.00 30.69  ? 150 ILE B CB  1 
ATOM   2589 C  CG1 . ILE C 1 155 ? 79.238  18.662 29.293 1.00 31.54  ? 150 ILE B CG1 1 
ATOM   2590 C  CG2 . ILE C 1 155 ? 77.924  20.641 28.556 1.00 31.63  ? 150 ILE B CG2 1 
ATOM   2591 C  CD1 . ILE C 1 155 ? 78.298  17.611 28.714 1.00 28.20  ? 150 ILE B CD1 1 
ATOM   2592 N  N   . PRO C 1 156 ? 79.266  20.089 32.691 1.00 33.01  ? 151 PRO B N   1 
ATOM   2593 C  CA  . PRO C 1 156 ? 79.698  19.416 33.918 1.00 32.15  ? 151 PRO B CA  1 
ATOM   2594 C  C   . PRO C 1 156 ? 79.764  17.943 33.550 1.00 33.90  ? 151 PRO B C   1 
ATOM   2595 O  O   . PRO C 1 156 ? 79.008  17.489 32.691 1.00 34.60  ? 151 PRO B O   1 
ATOM   2596 C  CB  . PRO C 1 156 ? 78.553  19.689 34.894 1.00 31.99  ? 151 PRO B CB  1 
ATOM   2597 C  CG  . PRO C 1 156 ? 77.910  20.942 34.364 1.00 30.62  ? 151 PRO B CG  1 
ATOM   2598 C  CD  . PRO C 1 156 ? 77.942  20.714 32.876 1.00 32.29  ? 151 PRO B CD  1 
ATOM   2599 N  N   . VAL C 1 157 ? 80.662  17.193 34.175 1.00 34.80  ? 152 VAL B N   1 
ATOM   2600 C  CA  . VAL C 1 157 ? 80.763  15.778 33.871 1.00 35.41  ? 152 VAL B CA  1 
ATOM   2601 C  C   . VAL C 1 157 ? 81.070  15.015 35.136 1.00 36.34  ? 152 VAL B C   1 
ATOM   2602 O  O   . VAL C 1 157 ? 81.499  15.602 36.126 1.00 37.75  ? 152 VAL B O   1 
ATOM   2603 C  CB  . VAL C 1 157 ? 81.883  15.495 32.848 1.00 36.36  ? 152 VAL B CB  1 
ATOM   2604 C  CG1 . VAL C 1 157 ? 81.694  16.361 31.619 1.00 35.48  ? 152 VAL B CG1 1 
ATOM   2605 C  CG2 . VAL C 1 157 ? 83.239  15.749 33.479 1.00 37.07  ? 152 VAL B CG2 1 
ATOM   2606 N  N   . ASP C 1 158 ? 80.842  13.707 35.090 1.00 37.15  ? 153 ASP B N   1 
ATOM   2607 C  CA  . ASP C 1 158 ? 81.107  12.812 36.204 1.00 38.33  ? 153 ASP B CA  1 
ATOM   2608 C  C   . ASP C 1 158 ? 81.136  11.393 35.626 1.00 40.95  ? 153 ASP B C   1 
ATOM   2609 O  O   . ASP C 1 158 ? 80.690  11.171 34.499 1.00 41.94  ? 153 ASP B O   1 
ATOM   2610 C  CB  . ASP C 1 158 ? 80.022  12.971 37.283 1.00 37.98  ? 153 ASP B CB  1 
ATOM   2611 C  CG  . ASP C 1 158 ? 78.662  12.438 36.850 1.00 39.21  ? 153 ASP B CG  1 
ATOM   2612 O  OD1 . ASP C 1 158 ? 78.606  11.378 36.196 1.00 39.68  ? 153 ASP B OD1 1 
ATOM   2613 O  OD2 . ASP C 1 158 ? 77.635  13.071 37.185 1.00 41.00  ? 153 ASP B OD2 1 
ATOM   2614 N  N   . ARG C 1 159 ? 81.662  10.437 36.384 1.00 43.40  ? 154 ARG B N   1 
ATOM   2615 C  CA  . ARG C 1 159 ? 81.757  9.053  35.917 1.00 45.61  ? 154 ARG B CA  1 
ATOM   2616 C  C   . ARG C 1 159 ? 80.434  8.502  35.386 1.00 47.55  ? 154 ARG B C   1 
ATOM   2617 O  O   . ARG C 1 159 ? 80.424  7.586  34.560 1.00 50.09  ? 154 ARG B O   1 
ATOM   2618 C  CB  . ARG C 1 159 ? 82.257  8.157  37.047 1.00 45.38  ? 154 ARG B CB  1 
ATOM   2619 C  CG  . ARG C 1 159 ? 83.527  8.655  37.703 1.00 43.31  ? 154 ARG B CG  1 
ATOM   2620 C  CD  . ARG C 1 159 ? 84.692  8.388  36.823 1.00 42.85  ? 154 ARG B CD  1 
ATOM   2621 N  NE  . ARG C 1 159 ? 85.873  9.116  37.245 1.00 41.08  ? 154 ARG B NE  1 
ATOM   2622 C  CZ  . ARG C 1 159 ? 87.033  9.037  36.611 1.00 40.44  ? 154 ARG B CZ  1 
ATOM   2623 N  NH1 . ARG C 1 159 ? 87.142  8.256  35.544 1.00 38.29  ? 154 ARG B NH1 1 
ATOM   2624 N  NH2 . ARG C 1 159 ? 88.070  9.746  37.029 1.00 40.51  ? 154 ARG B NH2 1 
ATOM   2625 N  N   . THR C 1 160 ? 79.321  9.046  35.869 1.00 48.05  ? 155 THR B N   1 
ATOM   2626 C  CA  . THR C 1 160 ? 78.003  8.612  35.418 1.00 47.96  ? 155 THR B CA  1 
ATOM   2627 C  C   . THR C 1 160 ? 77.841  9.140  33.999 1.00 49.40  ? 155 THR B C   1 
ATOM   2628 O  O   . THR C 1 160 ? 76.733  9.339  33.501 1.00 51.51  ? 155 THR B O   1 
ATOM   2629 C  CB  . THR C 1 160 ? 76.899  9.166  36.351 1.00 46.26  ? 155 THR B CB  1 
ATOM   2630 O  OG1 . THR C 1 160 ? 76.993  8.505  37.618 1.00 45.10  ? 155 THR B OG1 1 
ATOM   2631 C  CG2 . THR C 1 160 ? 75.513  8.933  35.778 1.00 47.82  ? 155 THR B CG2 1 
ATOM   2632 N  N   . LEU C 1 161 ? 78.985  9.357  33.359 1.00 49.83  ? 156 LEU B N   1 
ATOM   2633 C  CA  . LEU C 1 161 ? 79.066  9.865  31.997 1.00 49.79  ? 156 LEU B CA  1 
ATOM   2634 C  C   . LEU C 1 161 ? 80.503  9.763  31.487 1.00 49.12  ? 156 LEU B C   1 
ATOM   2635 O  O   . LEU C 1 161 ? 80.909  8.737  30.938 1.00 49.59  ? 156 LEU B O   1 
ATOM   2636 C  CB  . LEU C 1 161 ? 78.609  11.325 31.948 1.00 48.44  ? 156 LEU B CB  1 
ATOM   2637 C  CG  . LEU C 1 161 ? 77.109  11.574 31.917 1.00 47.53  ? 156 LEU B CG  1 
ATOM   2638 C  CD1 . LEU C 1 161 ? 76.845  13.053 31.655 1.00 47.26  ? 156 LEU B CD1 1 
ATOM   2639 C  CD2 . LEU C 1 161 ? 76.492  10.712 30.812 1.00 47.02  ? 156 LEU B CD2 1 
ATOM   2640 N  N   . SER D 2 5   ? 50.880  12.369 18.811 1.00 59.80  ? 305 SER F N   1 
ATOM   2641 C  CA  . SER D 2 5   ? 51.017  12.284 20.260 1.00 60.18  ? 305 SER F CA  1 
ATOM   2642 C  C   . SER D 2 5   ? 52.226  13.096 20.735 1.00 59.39  ? 305 SER F C   1 
ATOM   2643 O  O   . SER D 2 5   ? 52.926  12.707 21.674 1.00 60.19  ? 305 SER F O   1 
ATOM   2644 C  CB  . SER D 2 5   ? 51.170  10.820 20.686 1.00 61.41  ? 305 SER F CB  1 
ATOM   2645 O  OG  . SER D 2 5   ? 51.100  10.685 22.098 1.00 63.22  ? 305 SER F OG  1 
ATOM   2646 N  N   . ASP D 2 6   ? 52.455  14.225 20.071 1.00 56.92  ? 306 ASP F N   1 
ATOM   2647 C  CA  . ASP D 2 6   ? 53.554  15.136 20.382 1.00 54.65  ? 306 ASP F CA  1 
ATOM   2648 C  C   . ASP D 2 6   ? 53.544  16.172 19.275 1.00 54.14  ? 306 ASP F C   1 
ATOM   2649 O  O   . ASP D 2 6   ? 53.395  15.823 18.106 1.00 54.63  ? 306 ASP F O   1 
ATOM   2650 C  CB  . ASP D 2 6   ? 54.902  14.406 20.374 1.00 53.08  ? 306 ASP F CB  1 
ATOM   2651 C  CG  . ASP D 2 6   ? 56.068  15.312 20.782 1.00 52.15  ? 306 ASP F CG  1 
ATOM   2652 O  OD1 . ASP D 2 6   ? 55.822  16.433 21.284 1.00 49.38  ? 306 ASP F OD1 1 
ATOM   2653 O  OD2 . ASP D 2 6   ? 57.236  14.897 20.605 1.00 50.55  ? 306 ASP F OD2 1 
ATOM   2654 N  N   . GLU D 2 7   ? 53.692  17.444 19.622 1.00 53.80  ? 307 GLU F N   1 
ATOM   2655 C  CA  . GLU D 2 7   ? 53.682  18.456 18.585 1.00 54.14  ? 307 GLU F CA  1 
ATOM   2656 C  C   . GLU D 2 7   ? 54.966  18.389 17.782 1.00 53.60  ? 307 GLU F C   1 
ATOM   2657 O  O   . GLU D 2 7   ? 55.941  17.768 18.207 1.00 53.58  ? 307 GLU F O   1 
ATOM   2658 C  CB  . GLU D 2 7   ? 53.481  19.851 19.177 1.00 55.92  ? 307 GLU F CB  1 
ATOM   2659 C  CG  . GLU D 2 7   ? 54.421  20.227 20.294 1.00 57.92  ? 307 GLU F CG  1 
ATOM   2660 C  CD  . GLU D 2 7   ? 54.152  21.637 20.792 1.00 60.49  ? 307 GLU F CD  1 
ATOM   2661 O  OE1 . GLU D 2 7   ? 52.969  21.937 21.064 1.00 62.25  ? 307 GLU F OE1 1 
ATOM   2662 O  OE2 . GLU D 2 7   ? 55.109  22.440 20.914 1.00 59.36  ? 307 GLU F OE2 1 
ATOM   2663 N  N   . ASP D 2 8   ? 54.951  19.015 16.610 1.00 52.79  ? 308 ASP F N   1 
ATOM   2664 C  CA  . ASP D 2 8   ? 56.104  19.023 15.720 1.00 52.25  ? 308 ASP F CA  1 
ATOM   2665 C  C   . ASP D 2 8   ? 57.183  19.952 16.248 1.00 51.13  ? 308 ASP F C   1 
ATOM   2666 O  O   . ASP D 2 8   ? 56.892  20.925 16.947 1.00 49.06  ? 308 ASP F O   1 
ATOM   2667 C  CB  . ASP D 2 8   ? 55.674  19.469 14.320 1.00 54.56  ? 308 ASP F CB  1 
ATOM   2668 C  CG  . ASP D 2 8   ? 54.650  18.529 13.689 1.00 57.03  ? 308 ASP F CG  1 
ATOM   2669 O  OD1 . ASP D 2 8   ? 54.541  17.361 14.135 1.00 58.10  ? 308 ASP F OD1 1 
ATOM   2670 O  OD2 . ASP D 2 8   ? 53.957  18.957 12.737 1.00 57.26  ? 308 ASP F OD2 1 
ATOM   2671 N  N   . LEU D 2 9   ? 58.433  19.646 15.915 1.00 51.32  ? 309 LEU F N   1 
ATOM   2672 C  CA  . LEU D 2 9   ? 59.552  20.464 16.358 1.00 51.68  ? 309 LEU F CA  1 
ATOM   2673 C  C   . LEU D 2 9   ? 59.353  21.909 15.924 1.00 53.74  ? 309 LEU F C   1 
ATOM   2674 O  O   . LEU D 2 9   ? 58.987  22.182 14.780 1.00 54.56  ? 309 LEU F O   1 
ATOM   2675 C  CB  . LEU D 2 9   ? 60.861  19.938 15.771 1.00 49.83  ? 309 LEU F CB  1 
ATOM   2676 C  CG  . LEU D 2 9   ? 62.107  20.808 15.994 1.00 49.69  ? 309 LEU F CG  1 
ATOM   2677 C  CD1 . LEU D 2 9   ? 62.407  20.919 17.486 1.00 47.53  ? 309 LEU F CD1 1 
ATOM   2678 C  CD2 . LEU D 2 9   ? 63.296  20.201 15.248 1.00 47.99  ? 309 LEU F CD2 1 
ATOM   2679 N  N   . LEU D 2 10  ? 59.591  22.837 16.842 1.00 55.67  ? 310 LEU F N   1 
ATOM   2680 C  CA  . LEU D 2 10  ? 59.449  24.249 16.536 1.00 57.41  ? 310 LEU F CA  1 
ATOM   2681 C  C   . LEU D 2 10  ? 60.687  24.681 15.759 1.00 60.89  ? 310 LEU F C   1 
ATOM   2682 O  O   . LEU D 2 10  ? 61.813  24.363 16.151 1.00 61.94  ? 310 LEU F O   1 
ATOM   2683 C  CB  . LEU D 2 10  ? 59.351  25.062 17.829 1.00 55.92  ? 310 LEU F CB  1 
ATOM   2684 C  CG  . LEU D 2 10  ? 59.067  26.559 17.671 1.00 56.06  ? 310 LEU F CG  1 
ATOM   2685 C  CD1 . LEU D 2 10  ? 57.595  26.748 17.314 1.00 55.39  ? 310 LEU F CD1 1 
ATOM   2686 C  CD2 . LEU D 2 10  ? 59.395  27.302 18.959 1.00 54.32  ? 310 LEU F CD2 1 
ATOM   2687 N  N   . HIS D 2 11  ? 60.484  25.385 14.649 1.00 63.58  ? 311 HIS F N   1 
ATOM   2688 C  CA  . HIS D 2 11  ? 61.609  25.873 13.854 1.00 66.12  ? 311 HIS F CA  1 
ATOM   2689 C  C   . HIS D 2 11  ? 61.740  27.380 14.057 1.00 66.94  ? 311 HIS F C   1 
ATOM   2690 O  O   . HIS D 2 11  ? 60.809  28.146 13.792 1.00 67.11  ? 311 HIS F O   1 
ATOM   2691 C  CB  . HIS D 2 11  ? 61.417  25.530 12.368 1.00 67.25  ? 311 HIS F CB  1 
ATOM   2692 C  CG  . HIS D 2 11  ? 61.658  24.085 12.049 1.00 68.83  ? 311 HIS F CG  1 
ATOM   2693 N  ND1 . HIS D 2 11  ? 62.912  23.511 12.098 1.00 69.94  ? 311 HIS F ND1 1 
ATOM   2694 C  CD2 . HIS D 2 11  ? 60.801  23.086 11.725 1.00 69.24  ? 311 HIS F CD2 1 
ATOM   2695 C  CE1 . HIS D 2 11  ? 62.816  22.223 11.819 1.00 69.53  ? 311 HIS F CE1 1 
ATOM   2696 N  NE2 . HIS D 2 11  ? 61.546  21.939 11.590 1.00 69.16  ? 311 HIS F NE2 1 
ATOM   2697 N  N   . ILE D 2 12  ? 62.900  27.793 14.554 1.00 67.45  ? 312 ILE F N   1 
ATOM   2698 C  CA  . ILE D 2 12  ? 63.163  29.199 14.823 1.00 68.36  ? 312 ILE F CA  1 
ATOM   2699 C  C   . ILE D 2 12  ? 64.003  29.846 13.725 1.00 68.42  ? 312 ILE F C   1 
ATOM   2700 O  O   . ILE D 2 12  ? 64.113  29.238 12.637 1.00 68.74  ? 312 ILE F O   1 
ATOM   2701 C  CB  . ILE D 2 12  ? 63.878  29.364 16.182 1.00 69.05  ? 312 ILE F CB  1 
ATOM   2702 C  CG1 . ILE D 2 12  ? 65.206  28.605 16.174 1.00 69.55  ? 312 ILE F CG1 1 
ATOM   2703 C  CG2 . ILE D 2 12  ? 62.990  28.828 17.298 1.00 68.70  ? 312 ILE F CG2 1 
ATOM   2704 C  CD1 . ILE D 2 12  ? 65.976  28.711 17.475 1.00 70.54  ? 312 ILE F CD1 1 
ATOM   2705 O  OXT . ILE D 2 12  ? 64.525  30.959 13.962 1.00 67.73  ? 312 ILE F OXT 1 
HETATM 2706 N  N   . MSE E 1 3   ? 96.369  63.299 54.650 1.00 74.12  ? 203 MSE C N   1 
HETATM 2707 C  CA  . MSE E 1 3   ? 95.087  62.693 55.124 1.00 73.96  ? 203 MSE C CA  1 
HETATM 2708 C  C   . MSE E 1 3   ? 93.853  63.533 54.744 1.00 71.00  ? 203 MSE C C   1 
HETATM 2709 O  O   . MSE E 1 3   ? 92.963  63.768 55.567 1.00 71.39  ? 203 MSE C O   1 
HETATM 2710 C  CB  . MSE E 1 3   ? 95.136  62.485 56.645 1.00 77.80  ? 203 MSE C CB  1 
HETATM 2711 C  CG  . MSE E 1 3   ? 93.908  61.779 57.216 1.00 83.81  ? 203 MSE C CG  1 
HETATM 2712 SE SE  . MSE E 1 3   ? 93.976  61.448 59.130 1.00 92.72  ? 203 MSE C SE  1 
HETATM 2713 C  CE  . MSE E 1 3   ? 93.598  63.245 59.769 1.00 88.12  ? 203 MSE C CE  1 
ATOM   2714 N  N   . GLY E 1 4   ? 93.815  63.987 53.493 1.00 67.25  ? 204 GLY C N   1 
ATOM   2715 C  CA  . GLY E 1 4   ? 92.687  64.764 53.002 1.00 61.78  ? 204 GLY C CA  1 
ATOM   2716 C  C   . GLY E 1 4   ? 92.572  66.213 53.436 1.00 57.94  ? 204 GLY C C   1 
ATOM   2717 O  O   . GLY E 1 4   ? 93.282  66.680 54.327 1.00 57.24  ? 204 GLY C O   1 
ATOM   2718 N  N   . SER E 1 5   ? 91.654  66.926 52.793 1.00 54.31  ? 205 SER C N   1 
ATOM   2719 C  CA  . SER E 1 5   ? 91.419  68.330 53.093 1.00 50.69  ? 205 SER C CA  1 
ATOM   2720 C  C   . SER E 1 5   ? 90.671  68.479 54.412 1.00 47.99  ? 205 SER C C   1 
ATOM   2721 O  O   . SER E 1 5   ? 90.460  69.593 54.892 1.00 46.08  ? 205 SER C O   1 
ATOM   2722 C  CB  . SER E 1 5   ? 90.607  68.967 51.970 1.00 52.55  ? 205 SER C CB  1 
ATOM   2723 O  OG  . SER E 1 5   ? 91.204  68.704 50.712 1.00 53.78  ? 205 SER C OG  1 
HETATM 2724 N  N   . MSE E 1 6   ? 90.268  67.345 54.984 1.00 45.66  ? 1   MSE C N   1 
HETATM 2725 C  CA  . MSE E 1 6   ? 89.543  67.315 56.253 1.00 41.76  ? 1   MSE C CA  1 
HETATM 2726 C  C   . MSE E 1 6   ? 90.392  67.892 57.380 1.00 41.00  ? 1   MSE C C   1 
HETATM 2727 O  O   . MSE E 1 6   ? 89.882  68.603 58.252 1.00 39.34  ? 1   MSE C O   1 
HETATM 2728 C  CB  . MSE E 1 6   ? 89.134  65.877 56.592 1.00 40.45  ? 1   MSE C CB  1 
HETATM 2729 C  CG  . MSE E 1 6   ? 88.560  65.691 57.998 1.00 37.40  ? 1   MSE C CG  1 
HETATM 2730 SE SE  . MSE E 1 6   ? 86.956  66.725 58.350 1.00 36.20  ? 1   MSE C SE  1 
HETATM 2731 C  CE  . MSE E 1 6   ? 85.673  65.574 57.435 1.00 35.14  ? 1   MSE C CE  1 
ATOM   2732 N  N   . ALA E 1 7   ? 91.685  67.584 57.367 1.00 41.25  ? 2   ALA C N   1 
ATOM   2733 C  CA  . ALA E 1 7   ? 92.588  68.100 58.391 1.00 41.70  ? 2   ALA C CA  1 
ATOM   2734 C  C   . ALA E 1 7   ? 93.167  69.437 57.944 1.00 41.77  ? 2   ALA C C   1 
ATOM   2735 O  O   . ALA E 1 7   ? 93.973  70.034 58.647 1.00 41.50  ? 2   ALA C O   1 
ATOM   2736 C  CB  . ALA E 1 7   ? 93.713  67.108 58.660 1.00 41.59  ? 2   ALA C CB  1 
ATOM   2737 N  N   . GLU E 1 8   ? 92.743  69.901 56.774 1.00 43.14  ? 3   GLU C N   1 
ATOM   2738 C  CA  . GLU E 1 8   ? 93.222  71.165 56.232 1.00 44.00  ? 3   GLU C CA  1 
ATOM   2739 C  C   . GLU E 1 8   ? 92.297  72.327 56.557 1.00 43.45  ? 3   GLU C C   1 
ATOM   2740 O  O   . GLU E 1 8   ? 91.450  72.231 57.445 1.00 43.06  ? 3   GLU C O   1 
ATOM   2741 C  CB  . GLU E 1 8   ? 93.386  71.053 54.715 1.00 47.72  ? 3   GLU C CB  1 
ATOM   2742 C  CG  . GLU E 1 8   ? 94.502  70.114 54.297 1.00 51.41  ? 3   GLU C CG  1 
ATOM   2743 C  CD  . GLU E 1 8   ? 95.848  70.554 54.849 1.00 55.10  ? 3   GLU C CD  1 
ATOM   2744 O  OE1 . GLU E 1 8   ? 96.284  71.674 54.504 1.00 55.60  ? 3   GLU C OE1 1 
ATOM   2745 O  OE2 . GLU E 1 8   ? 96.466  69.788 55.629 1.00 56.65  ? 3   GLU C OE2 1 
ATOM   2746 N  N   . ALA E 1 9   ? 92.474  73.427 55.828 1.00 43.70  ? 4   ALA C N   1 
ATOM   2747 C  CA  . ALA E 1 9   ? 91.670  74.633 56.016 1.00 44.23  ? 4   ALA C CA  1 
ATOM   2748 C  C   . ALA E 1 9   ? 90.221  74.371 55.638 1.00 44.42  ? 4   ALA C C   1 
ATOM   2749 O  O   . ALA E 1 9   ? 89.304  74.844 56.316 1.00 44.15  ? 4   ALA C O   1 
ATOM   2750 C  CB  . ALA E 1 9   ? 92.228  75.774 55.171 1.00 43.89  ? 4   ALA C CB  1 
ATOM   2751 N  N   . GLU E 1 10  ? 90.026  73.632 54.542 1.00 44.19  ? 5   GLU C N   1 
ATOM   2752 C  CA  . GLU E 1 10  ? 88.691  73.276 54.071 1.00 43.20  ? 5   GLU C CA  1 
ATOM   2753 C  C   . GLU E 1 10  ? 87.874  72.700 55.224 1.00 40.86  ? 5   GLU C C   1 
ATOM   2754 O  O   . GLU E 1 10  ? 86.823  73.240 55.584 1.00 40.13  ? 5   GLU C O   1 
ATOM   2755 C  CB  . GLU E 1 10  ? 88.776  72.236 52.945 1.00 47.31  ? 5   GLU C CB  1 
ATOM   2756 C  CG  . GLU E 1 10  ? 88.998  72.812 51.555 1.00 53.39  ? 5   GLU C CG  1 
ATOM   2757 C  CD  . GLU E 1 10  ? 90.360  73.465 51.392 1.00 57.68  ? 5   GLU C CD  1 
ATOM   2758 O  OE1 . GLU E 1 10  ? 91.380  72.746 51.531 1.00 59.00  ? 5   GLU C OE1 1 
ATOM   2759 O  OE2 . GLU E 1 10  ? 90.409  74.694 51.123 1.00 59.45  ? 5   GLU C OE2 1 
ATOM   2760 N  N   . GLY E 1 11  ? 88.370  71.604 55.799 1.00 37.87  ? 6   GLY C N   1 
ATOM   2761 C  CA  . GLY E 1 11  ? 87.689  70.956 56.902 1.00 34.54  ? 6   GLY C CA  1 
ATOM   2762 C  C   . GLY E 1 11  ? 87.469  71.866 58.095 1.00 35.46  ? 6   GLY C C   1 
ATOM   2763 O  O   . GLY E 1 11  ? 86.392  71.865 58.704 1.00 35.64  ? 6   GLY C O   1 
ATOM   2764 N  N   . GLU E 1 12  ? 88.490  72.637 58.447 1.00 34.58  ? 7   GLU C N   1 
ATOM   2765 C  CA  . GLU E 1 12  ? 88.383  73.554 59.574 1.00 34.74  ? 7   GLU C CA  1 
ATOM   2766 C  C   . GLU E 1 12  ? 87.254  74.532 59.343 1.00 33.78  ? 7   GLU C C   1 
ATOM   2767 O  O   . GLU E 1 12  ? 86.432  74.761 60.229 1.00 35.61  ? 7   GLU C O   1 
ATOM   2768 C  CB  . GLU E 1 12  ? 89.689  74.338 59.759 1.00 36.13  ? 7   GLU C CB  1 
ATOM   2769 C  CG  . GLU E 1 12  ? 90.701  73.664 60.642 1.00 39.55  ? 7   GLU C CG  1 
ATOM   2770 C  CD  . GLU E 1 12  ? 92.101  74.218 60.456 1.00 43.31  ? 7   GLU C CD  1 
ATOM   2771 O  OE1 . GLU E 1 12  ? 92.278  75.464 60.487 1.00 42.23  ? 7   GLU C OE1 1 
ATOM   2772 O  OE2 . GLU E 1 12  ? 93.027  73.395 60.281 1.00 45.10  ? 7   GLU C OE2 1 
ATOM   2773 N  N   . SER E 1 13  ? 87.223  75.115 58.147 1.00 32.81  ? 8   SER C N   1 
ATOM   2774 C  CA  . SER E 1 13  ? 86.201  76.091 57.786 1.00 32.17  ? 8   SER C CA  1 
ATOM   2775 C  C   . SER E 1 13  ? 84.790  75.502 57.813 1.00 32.01  ? 8   SER C C   1 
ATOM   2776 O  O   . SER E 1 13  ? 83.884  76.066 58.431 1.00 31.64  ? 8   SER C O   1 
ATOM   2777 C  CB  . SER E 1 13  ? 86.492  76.667 56.390 1.00 33.28  ? 8   SER C CB  1 
ATOM   2778 O  OG  . SER E 1 13  ? 85.528  77.647 56.028 1.00 29.78  ? 8   SER C OG  1 
ATOM   2779 N  N   . LEU E 1 14  ? 84.601  74.370 57.138 1.00 31.66  ? 9   LEU C N   1 
ATOM   2780 C  CA  . LEU E 1 14  ? 83.288  73.729 57.096 1.00 31.00  ? 9   LEU C CA  1 
ATOM   2781 C  C   . LEU E 1 14  ? 82.738  73.399 58.493 1.00 30.03  ? 9   LEU C C   1 
ATOM   2782 O  O   . LEU E 1 14  ? 81.543  73.571 58.755 1.00 29.15  ? 9   LEU C O   1 
ATOM   2783 C  CB  . LEU E 1 14  ? 83.353  72.472 56.216 1.00 30.54  ? 9   LEU C CB  1 
ATOM   2784 C  CG  . LEU E 1 14  ? 83.426  72.764 54.706 1.00 30.20  ? 9   LEU C CG  1 
ATOM   2785 C  CD1 . LEU E 1 14  ? 83.586  71.479 53.889 1.00 29.17  ? 9   LEU C CD1 1 
ATOM   2786 C  CD2 . LEU E 1 14  ? 82.154  73.483 54.293 1.00 29.76  ? 9   LEU C CD2 1 
ATOM   2787 N  N   . GLU E 1 15  ? 83.610  72.955 59.394 1.00 29.32  ? 10  GLU C N   1 
ATOM   2788 C  CA  . GLU E 1 15  ? 83.190  72.627 60.753 1.00 29.72  ? 10  GLU C CA  1 
ATOM   2789 C  C   . GLU E 1 15  ? 82.875  73.902 61.551 1.00 30.88  ? 10  GLU C C   1 
ATOM   2790 O  O   . GLU E 1 15  ? 82.003  73.886 62.431 1.00 31.76  ? 10  GLU C O   1 
ATOM   2791 C  CB  . GLU E 1 15  ? 84.275  71.789 61.450 1.00 30.73  ? 10  GLU C CB  1 
ATOM   2792 C  CG  . GLU E 1 15  ? 83.990  71.432 62.907 1.00 28.01  ? 10  GLU C CG  1 
ATOM   2793 C  CD  . GLU E 1 15  ? 82.784  70.546 63.067 1.00 29.09  ? 10  GLU C CD  1 
ATOM   2794 O  OE1 . GLU E 1 15  ? 82.219  70.111 62.040 1.00 29.88  ? 10  GLU C OE1 1 
ATOM   2795 O  OE2 . GLU E 1 15  ? 82.393  70.282 64.224 1.00 31.14  ? 10  GLU C OE2 1 
ATOM   2796 N  N   . SER E 1 16  ? 83.567  75.004 61.249 1.00 30.92  ? 11  SER C N   1 
ATOM   2797 C  CA  . SER E 1 16  ? 83.293  76.275 61.937 1.00 31.60  ? 11  SER C CA  1 
ATOM   2798 C  C   . SER E 1 16  ? 81.858  76.658 61.621 1.00 30.66  ? 11  SER C C   1 
ATOM   2799 O  O   . SER E 1 16  ? 81.076  76.970 62.520 1.00 29.94  ? 11  SER C O   1 
ATOM   2800 C  CB  . SER E 1 16  ? 84.210  77.391 61.437 1.00 33.30  ? 11  SER C CB  1 
ATOM   2801 O  OG  . SER E 1 16  ? 85.567  77.031 61.568 1.00 38.84  ? 11  SER C OG  1 
ATOM   2802 N  N   . TRP E 1 17  ? 81.521  76.639 60.331 1.00 30.61  ? 12  TRP C N   1 
ATOM   2803 C  CA  . TRP E 1 17  ? 80.166  76.945 59.892 1.00 32.91  ? 12  TRP C CA  1 
ATOM   2804 C  C   . TRP E 1 17  ? 79.186  75.986 60.555 1.00 33.33  ? 12  TRP C C   1 
ATOM   2805 O  O   . TRP E 1 17  ? 78.156  76.406 61.085 1.00 34.94  ? 12  TRP C O   1 
ATOM   2806 C  CB  . TRP E 1 17  ? 80.026  76.800 58.373 1.00 36.35  ? 12  TRP C CB  1 
ATOM   2807 C  CG  . TRP E 1 17  ? 80.512  77.976 57.576 1.00 41.19  ? 12  TRP C CG  1 
ATOM   2808 C  CD1 . TRP E 1 17  ? 81.746  78.134 57.005 1.00 42.64  ? 12  TRP C CD1 1 
ATOM   2809 C  CD2 . TRP E 1 17  ? 79.771  79.168 57.268 1.00 42.63  ? 12  TRP C CD2 1 
ATOM   2810 N  NE1 . TRP E 1 17  ? 81.819  79.352 56.361 1.00 42.98  ? 12  TRP C NE1 1 
ATOM   2811 C  CE2 . TRP E 1 17  ? 80.622  80.005 56.507 1.00 43.38  ? 12  TRP C CE2 1 
ATOM   2812 C  CE3 . TRP E 1 17  ? 78.473  79.610 57.564 1.00 42.83  ? 12  TRP C CE3 1 
ATOM   2813 C  CZ2 . TRP E 1 17  ? 80.215  81.260 56.038 1.00 44.09  ? 12  TRP C CZ2 1 
ATOM   2814 C  CZ3 . TRP E 1 17  ? 78.067  80.860 57.097 1.00 43.80  ? 12  TRP C CZ3 1 
ATOM   2815 C  CH2 . TRP E 1 17  ? 78.938  81.670 56.342 1.00 44.16  ? 12  TRP C CH2 1 
ATOM   2816 N  N   . LEU E 1 18  ? 79.511  74.693 60.531 1.00 32.94  ? 13  LEU C N   1 
ATOM   2817 C  CA  . LEU E 1 18  ? 78.633  73.691 61.119 1.00 31.67  ? 13  LEU C CA  1 
ATOM   2818 C  C   . LEU E 1 18  ? 78.430  73.938 62.611 1.00 32.57  ? 13  LEU C C   1 
ATOM   2819 O  O   . LEU E 1 18  ? 77.349  73.669 63.155 1.00 31.19  ? 13  LEU C O   1 
ATOM   2820 C  CB  . LEU E 1 18  ? 79.184  72.283 60.877 1.00 31.22  ? 13  LEU C CB  1 
ATOM   2821 C  CG  . LEU E 1 18  ? 78.098  71.204 60.908 1.00 29.41  ? 13  LEU C CG  1 
ATOM   2822 C  CD1 . LEU E 1 18  ? 77.019  71.570 59.901 1.00 26.83  ? 13  LEU C CD1 1 
ATOM   2823 C  CD2 . LEU E 1 18  ? 78.679  69.846 60.594 1.00 30.08  ? 13  LEU C CD2 1 
ATOM   2824 N  N   . ASN E 1 19  ? 79.459  74.464 63.273 1.00 33.45  ? 14  ASN C N   1 
ATOM   2825 C  CA  . ASN E 1 19  ? 79.353  74.766 64.699 1.00 33.39  ? 14  ASN C CA  1 
ATOM   2826 C  C   . ASN E 1 19  ? 78.312  75.860 64.900 1.00 33.35  ? 14  ASN C C   1 
ATOM   2827 O  O   . ASN E 1 19  ? 77.440  75.762 65.773 1.00 31.60  ? 14  ASN C O   1 
ATOM   2828 C  CB  . ASN E 1 19  ? 80.708  75.212 65.250 1.00 35.24  ? 14  ASN C CB  1 
ATOM   2829 C  CG  . ASN E 1 19  ? 81.512  74.055 65.825 1.00 36.50  ? 14  ASN C CG  1 
ATOM   2830 O  OD1 . ASN E 1 19  ? 81.516  72.952 65.273 1.00 38.61  ? 14  ASN C OD1 1 
ATOM   2831 N  ND2 . ASN E 1 19  ? 82.204  74.304 66.931 1.00 35.85  ? 14  ASN C ND2 1 
ATOM   2832 N  N   . LYS E 1 20  ? 78.395  76.894 64.068 1.00 34.54  ? 15  LYS C N   1 
ATOM   2833 C  CA  . LYS E 1 20  ? 77.454  78.006 64.136 1.00 35.46  ? 15  LYS C CA  1 
ATOM   2834 C  C   . LYS E 1 20  ? 76.063  77.568 63.691 1.00 33.83  ? 15  LYS C C   1 
ATOM   2835 O  O   . LYS E 1 20  ? 75.053  78.016 64.241 1.00 33.53  ? 15  LYS C O   1 
ATOM   2836 C  CB  . LYS E 1 20  ? 77.958  79.175 63.280 1.00 38.58  ? 15  LYS C CB  1 
ATOM   2837 C  CG  . LYS E 1 20  ? 79.173  79.880 63.894 1.00 41.36  ? 15  LYS C CG  1 
ATOM   2838 C  CD  . LYS E 1 20  ? 79.843  80.891 62.951 1.00 43.49  ? 15  LYS C CD  1 
ATOM   2839 C  CE  . LYS E 1 20  ? 80.962  81.642 63.692 1.00 44.71  ? 15  LYS C CE  1 
ATOM   2840 N  NZ  . LYS E 1 20  ? 81.682  82.653 62.867 1.00 45.33  ? 15  LYS C NZ  1 
ATOM   2841 N  N   . ALA E 1 21  ? 76.010  76.668 62.717 1.00 32.77  ? 16  ALA C N   1 
ATOM   2842 C  CA  . ALA E 1 21  ? 74.730  76.175 62.222 1.00 31.77  ? 16  ALA C CA  1 
ATOM   2843 C  C   . ALA E 1 21  ? 74.042  75.174 63.161 1.00 31.61  ? 16  ALA C C   1 
ATOM   2844 O  O   . ALA E 1 21  ? 72.863  74.883 62.983 1.00 31.61  ? 16  ALA C O   1 
ATOM   2845 C  CB  . ALA E 1 21  ? 74.917  75.552 60.846 1.00 32.35  ? 16  ALA C CB  1 
ATOM   2846 N  N   . THR E 1 22  ? 74.761  74.640 64.152 1.00 30.47  ? 17  THR C N   1 
ATOM   2847 C  CA  . THR E 1 22  ? 74.162  73.676 65.081 1.00 28.96  ? 17  THR C CA  1 
ATOM   2848 C  C   . THR E 1 22  ? 74.481  73.995 66.535 1.00 29.56  ? 17  THR C C   1 
ATOM   2849 O  O   . THR E 1 22  ? 74.419  73.132 67.408 1.00 28.03  ? 17  THR C O   1 
ATOM   2850 C  CB  . THR E 1 22  ? 74.629  72.232 64.788 1.00 28.18  ? 17  THR C CB  1 
ATOM   2851 O  OG1 . THR E 1 22  ? 76.034  72.113 65.060 1.00 23.79  ? 17  THR C OG1 1 
ATOM   2852 C  CG2 . THR E 1 22  ? 74.361  71.878 63.329 1.00 26.90  ? 17  THR C CG2 1 
ATOM   2853 N  N   . ASN E 1 23  ? 74.835  75.246 66.784 1.00 32.61  ? 18  ASN C N   1 
ATOM   2854 C  CA  . ASN E 1 23  ? 75.155  75.715 68.124 1.00 33.38  ? 18  ASN C CA  1 
ATOM   2855 C  C   . ASN E 1 23  ? 73.971  75.436 69.059 1.00 33.86  ? 18  ASN C C   1 
ATOM   2856 O  O   . ASN E 1 23  ? 72.874  75.944 68.847 1.00 34.02  ? 18  ASN C O   1 
ATOM   2857 C  CB  . ASN E 1 23  ? 75.438  77.210 68.037 1.00 34.98  ? 18  ASN C CB  1 
ATOM   2858 C  CG  . ASN E 1 23  ? 75.982  77.787 69.321 1.00 37.71  ? 18  ASN C CG  1 
ATOM   2859 O  OD1 . ASN E 1 23  ? 76.574  78.867 69.308 1.00 39.52  ? 18  ASN C OD1 1 
ATOM   2860 N  ND2 . ASN E 1 23  ? 75.778  77.086 70.438 1.00 36.82  ? 18  ASN C ND2 1 
ATOM   2861 N  N   . PRO E 1 24  ? 74.176  74.611 70.099 1.00 34.76  ? 19  PRO C N   1 
ATOM   2862 C  CA  . PRO E 1 24  ? 73.111  74.275 71.050 1.00 36.04  ? 19  PRO C CA  1 
ATOM   2863 C  C   . PRO E 1 24  ? 72.522  75.477 71.783 1.00 38.66  ? 19  PRO C C   1 
ATOM   2864 O  O   . PRO E 1 24  ? 71.472  75.359 72.429 1.00 40.06  ? 19  PRO C O   1 
ATOM   2865 C  CB  . PRO E 1 24  ? 73.798  73.309 72.012 1.00 35.72  ? 19  PRO C CB  1 
ATOM   2866 C  CG  . PRO E 1 24  ? 74.818  72.655 71.158 1.00 34.29  ? 19  PRO C CG  1 
ATOM   2867 C  CD  . PRO E 1 24  ? 75.385  73.823 70.388 1.00 35.41  ? 19  PRO C CD  1 
ATOM   2868 N  N   . SER E 1 25  ? 73.191  76.627 71.707 1.00 38.70  ? 20  SER C N   1 
ATOM   2869 C  CA  . SER E 1 25  ? 72.669  77.809 72.384 1.00 40.75  ? 20  SER C CA  1 
ATOM   2870 C  C   . SER E 1 25  ? 71.661  78.551 71.501 1.00 40.95  ? 20  SER C C   1 
ATOM   2871 O  O   . SER E 1 25  ? 71.035  79.513 71.941 1.00 40.79  ? 20  SER C O   1 
ATOM   2872 C  CB  . SER E 1 25  ? 73.807  78.753 72.813 1.00 40.10  ? 20  SER C CB  1 
ATOM   2873 O  OG  . SER E 1 25  ? 74.464  79.327 71.696 1.00 44.63  ? 20  SER C OG  1 
ATOM   2874 N  N   . ASN E 1 26  ? 71.508  78.103 70.256 1.00 41.51  ? 21  ASN C N   1 
ATOM   2875 C  CA  . ASN E 1 26  ? 70.547  78.711 69.337 1.00 41.87  ? 21  ASN C CA  1 
ATOM   2876 C  C   . ASN E 1 26  ? 69.148  78.552 69.922 1.00 43.30  ? 21  ASN C C   1 
ATOM   2877 O  O   . ASN E 1 26  ? 68.824  77.511 70.506 1.00 43.52  ? 21  ASN C O   1 
ATOM   2878 C  CB  . ASN E 1 26  ? 70.583  78.016 67.979 1.00 39.85  ? 21  ASN C CB  1 
ATOM   2879 C  CG  . ASN E 1 26  ? 71.739  78.464 67.119 1.00 39.49  ? 21  ASN C CG  1 
ATOM   2880 O  OD1 . ASN E 1 26  ? 72.041  77.836 66.098 1.00 38.75  ? 21  ASN C OD1 1 
ATOM   2881 N  ND2 . ASN E 1 26  ? 72.387  79.559 67.510 1.00 36.05  ? 21  ASN C ND2 1 
ATOM   2882 N  N   . ARG E 1 27  ? 68.323  79.581 69.770 1.00 44.44  ? 22  ARG C N   1 
ATOM   2883 C  CA  . ARG E 1 27  ? 66.955  79.535 70.273 1.00 46.35  ? 22  ARG C CA  1 
ATOM   2884 C  C   . ARG E 1 27  ? 66.131  78.790 69.230 1.00 45.79  ? 22  ARG C C   1 
ATOM   2885 O  O   . ARG E 1 27  ? 65.263  77.980 69.560 1.00 45.34  ? 22  ARG C O   1 
ATOM   2886 C  CB  . ARG E 1 27  ? 66.424  80.956 70.458 1.00 49.96  ? 22  ARG C CB  1 
ATOM   2887 C  CG  . ARG E 1 27  ? 67.320  81.834 71.333 1.00 54.80  ? 22  ARG C CG  1 
ATOM   2888 C  CD  . ARG E 1 27  ? 67.267  83.296 70.887 1.00 58.91  ? 22  ARG C CD  1 
ATOM   2889 N  NE  . ARG E 1 27  ? 67.796  83.474 69.533 1.00 62.21  ? 22  ARG C NE  1 
ATOM   2890 C  CZ  . ARG E 1 27  ? 67.700  84.601 68.830 1.00 63.51  ? 22  ARG C CZ  1 
ATOM   2891 N  NH1 . ARG E 1 27  ? 67.084  85.657 69.345 1.00 63.97  ? 22  ARG C NH1 1 
ATOM   2892 N  NH2 . ARG E 1 27  ? 68.213  84.672 67.608 1.00 64.29  ? 22  ARG C NH2 1 
ATOM   2893 N  N   . GLN E 1 28  ? 66.431  79.063 67.966 1.00 45.97  ? 23  GLN C N   1 
ATOM   2894 C  CA  . GLN E 1 28  ? 65.749  78.423 66.845 1.00 47.18  ? 23  GLN C CA  1 
ATOM   2895 C  C   . GLN E 1 28  ? 66.757  78.176 65.720 1.00 46.88  ? 23  GLN C C   1 
ATOM   2896 O  O   . GLN E 1 28  ? 67.935  78.524 65.854 1.00 46.54  ? 23  GLN C O   1 
ATOM   2897 C  CB  . GLN E 1 28  ? 64.605  79.312 66.343 1.00 47.67  ? 23  GLN C CB  1 
ATOM   2898 C  CG  . GLN E 1 28  ? 65.016  80.718 65.911 1.00 51.04  ? 23  GLN C CG  1 
ATOM   2899 C  CD  . GLN E 1 28  ? 63.867  81.483 65.240 1.00 55.90  ? 23  GLN C CD  1 
ATOM   2900 O  OE1 . GLN E 1 28  ? 62.749  81.556 65.772 1.00 57.20  ? 23  GLN C OE1 1 
ATOM   2901 N  NE2 . GLN E 1 28  ? 64.140  82.059 64.069 1.00 57.15  ? 23  GLN C NE2 1 
ATOM   2902 N  N   . GLU E 1 29  ? 66.311  77.568 64.623 1.00 46.89  ? 24  GLU C N   1 
ATOM   2903 C  CA  . GLU E 1 29  ? 67.210  77.316 63.499 1.00 46.61  ? 24  GLU C CA  1 
ATOM   2904 C  C   . GLU E 1 29  ? 67.722  78.647 62.993 1.00 45.77  ? 24  GLU C C   1 
ATOM   2905 O  O   . GLU E 1 29  ? 66.981  79.627 62.938 1.00 45.43  ? 24  GLU C O   1 
ATOM   2906 C  CB  . GLU E 1 29  ? 66.499  76.591 62.355 1.00 47.68  ? 24  GLU C CB  1 
ATOM   2907 C  CG  . GLU E 1 29  ? 66.233  75.125 62.600 1.00 50.97  ? 24  GLU C CG  1 
ATOM   2908 C  CD  . GLU E 1 29  ? 64.981  74.883 63.406 1.00 54.58  ? 24  GLU C CD  1 
ATOM   2909 O  OE1 . GLU E 1 29  ? 64.893  75.390 64.548 1.00 57.16  ? 24  GLU C OE1 1 
ATOM   2910 O  OE2 . GLU E 1 29  ? 64.081  74.180 62.892 1.00 56.07  ? 24  GLU C OE2 1 
ATOM   2911 N  N   . ASP E 1 30  ? 68.991  78.676 62.617 1.00 46.28  ? 25  ASP C N   1 
ATOM   2912 C  CA  . ASP E 1 30  ? 69.615  79.894 62.123 1.00 47.25  ? 25  ASP C CA  1 
ATOM   2913 C  C   . ASP E 1 30  ? 69.992  79.686 60.656 1.00 46.89  ? 25  ASP C C   1 
ATOM   2914 O  O   . ASP E 1 30  ? 71.114  79.278 60.336 1.00 46.95  ? 25  ASP C O   1 
ATOM   2915 C  CB  . ASP E 1 30  ? 70.848  80.199 62.975 1.00 49.31  ? 25  ASP C CB  1 
ATOM   2916 C  CG  . ASP E 1 30  ? 71.402  81.583 62.737 1.00 52.65  ? 25  ASP C CG  1 
ATOM   2917 O  OD1 . ASP E 1 30  ? 70.944  82.268 61.793 1.00 53.85  ? 25  ASP C OD1 1 
ATOM   2918 O  OD2 . ASP E 1 30  ? 72.309  81.982 63.501 1.00 55.20  ? 25  ASP C OD2 1 
ATOM   2919 N  N   . TRP E 1 31  ? 69.041  79.979 59.770 1.00 45.99  ? 26  TRP C N   1 
ATOM   2920 C  CA  . TRP E 1 31  ? 69.230  79.801 58.335 1.00 44.92  ? 26  TRP C CA  1 
ATOM   2921 C  C   . TRP E 1 31  ? 70.370  80.591 57.729 1.00 45.40  ? 26  TRP C C   1 
ATOM   2922 O  O   . TRP E 1 31  ? 70.859  80.266 56.647 1.00 45.06  ? 26  TRP C O   1 
ATOM   2923 C  CB  . TRP E 1 31  ? 67.916  80.085 57.605 1.00 42.79  ? 26  TRP C CB  1 
ATOM   2924 C  CG  . TRP E 1 31  ? 66.883  79.086 58.010 1.00 40.67  ? 26  TRP C CG  1 
ATOM   2925 C  CD1 . TRP E 1 31  ? 65.926  79.238 58.975 1.00 39.97  ? 26  TRP C CD1 1 
ATOM   2926 C  CD2 . TRP E 1 31  ? 66.808  77.718 57.584 1.00 38.87  ? 26  TRP C CD2 1 
ATOM   2927 N  NE1 . TRP E 1 31  ? 65.268  78.047 59.182 1.00 38.29  ? 26  TRP C NE1 1 
ATOM   2928 C  CE2 . TRP E 1 31  ? 65.789  77.098 58.342 1.00 38.38  ? 26  TRP C CE2 1 
ATOM   2929 C  CE3 . TRP E 1 31  ? 67.507  76.954 56.638 1.00 37.85  ? 26  TRP C CE3 1 
ATOM   2930 C  CZ2 . TRP E 1 31  ? 65.452  75.748 58.185 1.00 36.21  ? 26  TRP C CZ2 1 
ATOM   2931 C  CZ3 . TRP E 1 31  ? 67.169  75.611 56.484 1.00 37.47  ? 26  TRP C CZ3 1 
ATOM   2932 C  CH2 . TRP E 1 31  ? 66.151  75.024 57.255 1.00 36.14  ? 26  TRP C CH2 1 
ATOM   2933 N  N   . GLU E 1 32  ? 70.801  81.626 58.431 1.00 46.76  ? 27  GLU C N   1 
ATOM   2934 C  CA  . GLU E 1 32  ? 71.917  82.430 57.959 1.00 47.57  ? 27  GLU C CA  1 
ATOM   2935 C  C   . GLU E 1 32  ? 73.108  81.485 57.820 1.00 46.14  ? 27  GLU C C   1 
ATOM   2936 O  O   . GLU E 1 32  ? 73.759  81.410 56.771 1.00 46.23  ? 27  GLU C O   1 
ATOM   2937 C  CB  . GLU E 1 32  ? 72.228  83.519 58.991 1.00 51.10  ? 27  GLU C CB  1 
ATOM   2938 C  CG  . GLU E 1 32  ? 73.567  84.214 58.805 1.00 55.63  ? 27  GLU C CG  1 
ATOM   2939 C  CD  . GLU E 1 32  ? 73.904  85.139 59.966 1.00 59.34  ? 27  GLU C CD  1 
ATOM   2940 O  OE1 . GLU E 1 32  ? 73.088  85.236 60.919 1.00 59.40  ? 27  GLU C OE1 1 
ATOM   2941 O  OE2 . GLU E 1 32  ? 74.988  85.767 59.919 1.00 60.50  ? 27  GLU C OE2 1 
ATOM   2942 N  N   . TYR E 1 33  ? 73.369  80.751 58.895 1.00 43.78  ? 28  TYR C N   1 
ATOM   2943 C  CA  . TYR E 1 33  ? 74.477  79.806 58.946 1.00 42.85  ? 28  TYR C CA  1 
ATOM   2944 C  C   . TYR E 1 33  ? 74.196  78.482 58.226 1.00 40.69  ? 28  TYR C C   1 
ATOM   2945 O  O   . TYR E 1 33  ? 75.095  77.905 57.616 1.00 38.88  ? 28  TYR C O   1 
ATOM   2946 C  CB  . TYR E 1 33  ? 74.847  79.551 60.407 1.00 42.99  ? 28  TYR C CB  1 
ATOM   2947 C  CG  . TYR E 1 33  ? 75.424  80.767 61.103 1.00 44.57  ? 28  TYR C CG  1 
ATOM   2948 C  CD1 . TYR E 1 33  ? 76.483  81.478 60.540 1.00 43.78  ? 28  TYR C CD1 1 
ATOM   2949 C  CD2 . TYR E 1 33  ? 74.933  81.185 62.344 1.00 45.13  ? 28  TYR C CD2 1 
ATOM   2950 C  CE1 . TYR E 1 33  ? 77.046  82.572 61.194 1.00 46.38  ? 28  TYR C CE1 1 
ATOM   2951 C  CE2 . TYR E 1 33  ? 75.486  82.282 63.011 1.00 45.30  ? 28  TYR C CE2 1 
ATOM   2952 C  CZ  . TYR E 1 33  ? 76.545  82.971 62.431 1.00 47.09  ? 28  TYR C CZ  1 
ATOM   2953 O  OH  . TYR E 1 33  ? 77.111  84.046 63.090 1.00 46.01  ? 28  TYR C OH  1 
ATOM   2954 N  N   . ILE E 1 34  ? 72.953  78.006 58.299 1.00 39.14  ? 29  ILE C N   1 
ATOM   2955 C  CA  . ILE E 1 34  ? 72.577  76.756 57.643 1.00 37.35  ? 29  ILE C CA  1 
ATOM   2956 C  C   . ILE E 1 34  ? 72.847  76.874 56.151 1.00 36.85  ? 29  ILE C C   1 
ATOM   2957 O  O   . ILE E 1 34  ? 73.503  76.014 55.559 1.00 36.34  ? 29  ILE C O   1 
ATOM   2958 C  CB  . ILE E 1 34  ? 71.080  76.430 57.852 1.00 36.26  ? 29  ILE C CB  1 
ATOM   2959 C  CG1 . ILE E 1 34  ? 70.815  76.103 59.325 1.00 35.57  ? 29  ILE C CG1 1 
ATOM   2960 C  CG2 . ILE E 1 34  ? 70.678  75.251 56.982 1.00 35.34  ? 29  ILE C CG2 1 
ATOM   2961 C  CD1 . ILE E 1 34  ? 69.341  76.003 59.685 1.00 32.33  ? 29  ILE C CD1 1 
ATOM   2962 N  N   . ILE E 1 35  ? 72.345  77.944 55.542 1.00 36.79  ? 30  ILE C N   1 
ATOM   2963 C  CA  . ILE E 1 35  ? 72.551  78.151 54.112 1.00 36.28  ? 30  ILE C CA  1 
ATOM   2964 C  C   . ILE E 1 35  ? 74.022  78.416 53.830 1.00 33.91  ? 30  ILE C C   1 
ATOM   2965 O  O   . ILE E 1 35  ? 74.551  77.964 52.820 1.00 35.00  ? 30  ILE C O   1 
ATOM   2966 C  CB  . ILE E 1 35  ? 71.713  79.331 53.569 1.00 36.44  ? 30  ILE C CB  1 
ATOM   2967 C  CG1 . ILE E 1 35  ? 70.242  79.160 53.970 1.00 38.32  ? 30  ILE C CG1 1 
ATOM   2968 C  CG2 . ILE E 1 35  ? 71.817  79.380 52.048 1.00 35.15  ? 30  ILE C CG2 1 
ATOM   2969 C  CD1 . ILE E 1 35  ? 69.609  77.844 53.506 1.00 36.48  ? 30  ILE C CD1 1 
ATOM   2970 N  N   . GLY E 1 36  ? 74.680  79.145 54.724 1.00 33.51  ? 31  GLY C N   1 
ATOM   2971 C  CA  . GLY E 1 36  ? 76.097  79.426 54.545 1.00 32.90  ? 31  GLY C CA  1 
ATOM   2972 C  C   . GLY E 1 36  ? 76.873  78.135 54.335 1.00 33.62  ? 31  GLY C C   1 
ATOM   2973 O  O   . GLY E 1 36  ? 77.672  78.016 53.396 1.00 33.76  ? 31  GLY C O   1 
ATOM   2974 N  N   . PHE E 1 37  ? 76.631  77.164 55.212 1.00 32.09  ? 32  PHE C N   1 
ATOM   2975 C  CA  . PHE E 1 37  ? 77.284  75.860 55.138 1.00 33.99  ? 32  PHE C CA  1 
ATOM   2976 C  C   . PHE E 1 37  ? 77.032  75.248 53.756 1.00 34.95  ? 32  PHE C C   1 
ATOM   2977 O  O   . PHE E 1 37  ? 77.959  74.802 53.077 1.00 33.71  ? 32  PHE C O   1 
ATOM   2978 C  CB  . PHE E 1 37  ? 76.718  74.950 56.232 1.00 34.45  ? 32  PHE C CB  1 
ATOM   2979 C  CG  . PHE E 1 37  ? 77.401  73.613 56.345 1.00 35.89  ? 32  PHE C CG  1 
ATOM   2980 C  CD1 . PHE E 1 37  ? 78.702  73.515 56.838 1.00 34.70  ? 32  PHE C CD1 1 
ATOM   2981 C  CD2 . PHE E 1 37  ? 76.718  72.438 56.019 1.00 35.46  ? 32  PHE C CD2 1 
ATOM   2982 C  CE1 . PHE E 1 37  ? 79.309  72.266 57.010 1.00 34.80  ? 32  PHE C CE1 1 
ATOM   2983 C  CE2 . PHE E 1 37  ? 77.322  71.185 56.188 1.00 35.52  ? 32  PHE C CE2 1 
ATOM   2984 C  CZ  . PHE E 1 37  ? 78.618  71.101 56.686 1.00 33.52  ? 32  PHE C CZ  1 
ATOM   2985 N  N   . CYS E 1 38  ? 75.770  75.234 53.339 1.00 36.30  ? 33  CYS C N   1 
ATOM   2986 C  CA  . CYS E 1 38  ? 75.422  74.683 52.042 1.00 37.50  ? 33  CYS C CA  1 
ATOM   2987 C  C   . CYS E 1 38  ? 76.227  75.378 50.964 1.00 38.18  ? 33  CYS C C   1 
ATOM   2988 O  O   . CYS E 1 38  ? 76.794  74.726 50.090 1.00 37.64  ? 33  CYS C O   1 
ATOM   2989 C  CB  . CYS E 1 38  ? 73.931  74.864 51.764 1.00 36.05  ? 33  CYS C CB  1 
ATOM   2990 S  SG  . CYS E 1 38  ? 72.864  73.888 52.856 1.00 41.29  ? 33  CYS C SG  1 
ATOM   2991 N  N   . ASP E 1 39  ? 76.286  76.706 51.031 1.00 39.96  ? 34  ASP C N   1 
ATOM   2992 C  CA  . ASP E 1 39  ? 77.028  77.467 50.029 1.00 41.92  ? 34  ASP C CA  1 
ATOM   2993 C  C   . ASP E 1 39  ? 78.518  77.141 50.038 1.00 40.91  ? 34  ASP C C   1 
ATOM   2994 O  O   . ASP E 1 39  ? 79.130  77.014 48.976 1.00 42.84  ? 34  ASP C O   1 
ATOM   2995 C  CB  . ASP E 1 39  ? 76.782  78.971 50.203 1.00 44.27  ? 34  ASP C CB  1 
ATOM   2996 C  CG  . ASP E 1 39  ? 75.343  79.366 49.851 1.00 46.73  ? 34  ASP C CG  1 
ATOM   2997 O  OD1 . ASP E 1 39  ? 74.718  78.657 49.026 1.00 46.12  ? 34  ASP C OD1 1 
ATOM   2998 O  OD2 . ASP E 1 39  ? 74.840  80.381 50.383 1.00 48.08  ? 34  ASP C OD2 1 
ATOM   2999 N  N   . GLN E 1 40  ? 79.105  76.997 51.221 1.00 39.37  ? 35  GLN C N   1 
ATOM   3000 C  CA  . GLN E 1 40  ? 80.511  76.630 51.302 1.00 38.92  ? 35  GLN C CA  1 
ATOM   3001 C  C   . GLN E 1 40  ? 80.672  75.315 50.532 1.00 37.98  ? 35  GLN C C   1 
ATOM   3002 O  O   . GLN E 1 40  ? 81.542  75.180 49.666 1.00 38.92  ? 35  GLN C O   1 
ATOM   3003 C  CB  . GLN E 1 40  ? 80.933  76.408 52.757 1.00 41.20  ? 35  GLN C CB  1 
ATOM   3004 C  CG  . GLN E 1 40  ? 80.963  77.652 53.625 1.00 44.47  ? 35  GLN C CG  1 
ATOM   3005 C  CD  . GLN E 1 40  ? 82.015  78.652 53.178 1.00 47.81  ? 35  GLN C CD  1 
ATOM   3006 O  OE1 . GLN E 1 40  ? 81.909  79.247 52.105 1.00 47.86  ? 35  GLN C OE1 1 
ATOM   3007 N  NE2 . GLN E 1 40  ? 83.043  78.836 53.999 1.00 49.85  ? 35  GLN C NE2 1 
ATOM   3008 N  N   . ILE E 1 41  ? 79.816  74.349 50.850 1.00 35.28  ? 36  ILE C N   1 
ATOM   3009 C  CA  . ILE E 1 41  ? 79.859  73.041 50.204 1.00 35.42  ? 36  ILE C CA  1 
ATOM   3010 C  C   . ILE E 1 41  ? 79.797  73.135 48.675 1.00 35.23  ? 36  ILE C C   1 
ATOM   3011 O  O   . ILE E 1 41  ? 80.486  72.399 47.967 1.00 31.68  ? 36  ILE C O   1 
ATOM   3012 C  CB  . ILE E 1 41  ? 78.688  72.143 50.688 1.00 33.25  ? 36  ILE C CB  1 
ATOM   3013 C  CG1 . ILE E 1 41  ? 78.815  71.874 52.185 1.00 32.86  ? 36  ILE C CG1 1 
ATOM   3014 C  CG2 . ILE E 1 41  ? 78.682  70.831 49.920 1.00 32.59  ? 36  ILE C CG2 1 
ATOM   3015 C  CD1 . ILE E 1 41  ? 77.602  71.163 52.789 1.00 33.11  ? 36  ILE C CD1 1 
ATOM   3016 N  N   . ASN E 1 42  ? 78.962  74.041 48.174 1.00 36.72  ? 37  ASN C N   1 
ATOM   3017 C  CA  . ASN E 1 42  ? 78.796  74.212 46.733 1.00 37.71  ? 37  ASN C CA  1 
ATOM   3018 C  C   . ASN E 1 42  ? 80.043  74.801 46.078 1.00 37.94  ? 37  ASN C C   1 
ATOM   3019 O  O   . ASN E 1 42  ? 80.305  74.561 44.900 1.00 36.81  ? 37  ASN C O   1 
ATOM   3020 C  CB  . ASN E 1 42  ? 77.562  75.089 46.447 1.00 35.76  ? 37  ASN C CB  1 
ATOM   3021 C  CG  . ASN E 1 42  ? 76.245  74.373 46.757 1.00 35.97  ? 37  ASN C CG  1 
ATOM   3022 O  OD1 . ASN E 1 42  ? 75.175  74.983 46.766 1.00 36.72  ? 37  ASN C OD1 1 
ATOM   3023 N  ND2 . ASN E 1 42  ? 76.324  73.072 47.005 1.00 32.91  ? 37  ASN C ND2 1 
ATOM   3024 N  N   . LYS E 1 43  ? 80.817  75.561 46.847 1.00 39.61  ? 38  LYS C N   1 
ATOM   3025 C  CA  . LYS E 1 43  ? 82.047  76.163 46.328 1.00 41.28  ? 38  LYS C CA  1 
ATOM   3026 C  C   . LYS E 1 43  ? 83.296  75.280 46.507 1.00 41.14  ? 38  LYS C C   1 
ATOM   3027 O  O   . LYS E 1 43  ? 84.240  75.372 45.721 1.00 41.19  ? 38  LYS C O   1 
ATOM   3028 C  CB  . LYS E 1 43  ? 82.284  77.523 46.995 1.00 43.35  ? 38  LYS C CB  1 
ATOM   3029 C  CG  . LYS E 1 43  ? 82.028  78.726 46.085 1.00 45.86  ? 38  LYS C CG  1 
ATOM   3030 C  CD  . LYS E 1 43  ? 80.621  78.705 45.522 1.00 47.00  ? 38  LYS C CD  1 
ATOM   3031 C  CE  . LYS E 1 43  ? 80.452  79.733 44.417 1.00 47.75  ? 38  LYS C CE  1 
ATOM   3032 N  NZ  . LYS E 1 43  ? 80.559  81.122 44.929 1.00 47.65  ? 38  LYS C NZ  1 
ATOM   3033 N  N   . GLU E 1 44  ? 83.298  74.420 47.526 1.00 39.79  ? 39  GLU C N   1 
ATOM   3034 C  CA  . GLU E 1 44  ? 84.450  73.554 47.794 1.00 39.34  ? 39  GLU C CA  1 
ATOM   3035 C  C   . GLU E 1 44  ? 84.524  72.258 46.997 1.00 37.81  ? 39  GLU C C   1 
ATOM   3036 O  O   . GLU E 1 44  ? 83.529  71.559 46.813 1.00 36.59  ? 39  GLU C O   1 
ATOM   3037 C  CB  . GLU E 1 44  ? 84.538  73.257 49.293 1.00 39.76  ? 39  GLU C CB  1 
ATOM   3038 C  CG  . GLU E 1 44  ? 85.036  74.461 50.099 1.00 43.59  ? 39  GLU C CG  1 
ATOM   3039 C  CD  . GLU E 1 44  ? 86.530  74.733 49.912 1.00 44.66  ? 39  GLU C CD  1 
ATOM   3040 O  OE1 . GLU E 1 44  ? 87.130  74.225 48.937 1.00 46.53  ? 39  GLU C OE1 1 
ATOM   3041 O  OE2 . GLU E 1 44  ? 87.109  75.463 50.741 1.00 47.86  ? 39  GLU C OE2 1 
ATOM   3042 N  N   . LEU E 1 45  ? 85.732  71.950 46.533 1.00 38.61  ? 40  LEU C N   1 
ATOM   3043 C  CA  . LEU E 1 45  ? 85.991  70.765 45.729 1.00 38.56  ? 40  LEU C CA  1 
ATOM   3044 C  C   . LEU E 1 45  ? 85.692  69.465 46.458 1.00 39.67  ? 40  LEU C C   1 
ATOM   3045 O  O   . LEU E 1 45  ? 85.108  68.542 45.884 1.00 41.37  ? 40  LEU C O   1 
ATOM   3046 C  CB  . LEU E 1 45  ? 87.445  70.763 45.260 1.00 38.28  ? 40  LEU C CB  1 
ATOM   3047 C  CG  . LEU E 1 45  ? 87.857  69.495 44.504 1.00 37.97  ? 40  LEU C CG  1 
ATOM   3048 C  CD1 . LEU E 1 45  ? 87.012  69.349 43.245 1.00 36.96  ? 40  LEU C CD1 1 
ATOM   3049 C  CD2 . LEU E 1 45  ? 89.332  69.564 44.162 1.00 37.66  ? 40  LEU C CD2 1 
ATOM   3050 N  N   . GLU E 1 46  ? 86.110  69.384 47.715 1.00 39.80  ? 41  GLU C N   1 
ATOM   3051 C  CA  . GLU E 1 46  ? 85.865  68.193 48.514 1.00 40.48  ? 41  GLU C CA  1 
ATOM   3052 C  C   . GLU E 1 46  ? 84.756  68.494 49.517 1.00 39.08  ? 41  GLU C C   1 
ATOM   3053 O  O   . GLU E 1 46  ? 84.595  67.804 50.526 1.00 39.68  ? 41  GLU C O   1 
ATOM   3054 C  CB  . GLU E 1 46  ? 87.148  67.765 49.237 1.00 43.08  ? 41  GLU C CB  1 
ATOM   3055 C  CG  . GLU E 1 46  ? 88.255  67.300 48.289 1.00 47.74  ? 41  GLU C CG  1 
ATOM   3056 C  CD  . GLU E 1 46  ? 88.899  65.985 48.730 1.00 51.28  ? 41  GLU C CD  1 
ATOM   3057 O  OE1 . GLU E 1 46  ? 89.806  66.009 49.601 1.00 50.83  ? 41  GLU C OE1 1 
ATOM   3058 O  OE2 . GLU E 1 46  ? 88.482  64.922 48.204 1.00 52.49  ? 41  GLU C OE2 1 
ATOM   3059 N  N   . GLY E 1 47  ? 83.985  69.533 49.220 1.00 37.60  ? 42  GLY C N   1 
ATOM   3060 C  CA  . GLY E 1 47  ? 82.901  69.926 50.099 1.00 35.88  ? 42  GLY C CA  1 
ATOM   3061 C  C   . GLY E 1 47  ? 81.969  68.803 50.516 1.00 35.50  ? 42  GLY C C   1 
ATOM   3062 O  O   . GLY E 1 47  ? 81.788  68.576 51.708 1.00 35.39  ? 42  GLY C O   1 
ATOM   3063 N  N   . PRO E 1 48  ? 81.361  68.077 49.561 1.00 34.91  ? 43  PRO C N   1 
ATOM   3064 C  CA  . PRO E 1 48  ? 80.444  66.983 49.889 1.00 33.46  ? 43  PRO C CA  1 
ATOM   3065 C  C   . PRO E 1 48  ? 81.057  65.868 50.722 1.00 34.24  ? 43  PRO C C   1 
ATOM   3066 O  O   . PRO E 1 48  ? 80.479  65.453 51.730 1.00 34.74  ? 43  PRO C O   1 
ATOM   3067 C  CB  . PRO E 1 48  ? 79.989  66.493 48.518 1.00 34.33  ? 43  PRO C CB  1 
ATOM   3068 C  CG  . PRO E 1 48  ? 80.096  67.734 47.658 1.00 34.47  ? 43  PRO C CG  1 
ATOM   3069 C  CD  . PRO E 1 48  ? 81.418  68.291 48.104 1.00 33.69  ? 43  PRO C CD  1 
ATOM   3070 N  N   . GLN E 1 49  ? 82.219  65.371 50.308 1.00 33.69  ? 44  GLN C N   1 
ATOM   3071 C  CA  . GLN E 1 49  ? 82.855  64.288 51.051 1.00 34.07  ? 44  GLN C CA  1 
ATOM   3072 C  C   . GLN E 1 49  ? 83.138  64.711 52.485 1.00 33.90  ? 44  GLN C C   1 
ATOM   3073 O  O   . GLN E 1 49  ? 83.005  63.919 53.418 1.00 34.93  ? 44  GLN C O   1 
ATOM   3074 C  CB  . GLN E 1 49  ? 84.166  63.856 50.391 1.00 34.91  ? 44  GLN C CB  1 
ATOM   3075 C  CG  . GLN E 1 49  ? 84.044  63.486 48.932 1.00 37.99  ? 44  GLN C CG  1 
ATOM   3076 C  CD  . GLN E 1 49  ? 84.350  64.652 48.009 1.00 41.87  ? 44  GLN C CD  1 
ATOM   3077 O  OE1 . GLN E 1 49  ? 83.652  65.679 48.016 1.00 42.21  ? 44  GLN C OE1 1 
ATOM   3078 N  NE2 . GLN E 1 49  ? 85.408  64.504 47.207 1.00 42.92  ? 44  GLN C NE2 1 
ATOM   3079 N  N   . ILE E 1 50  ? 83.522  65.969 52.663 1.00 32.66  ? 45  ILE C N   1 
ATOM   3080 C  CA  . ILE E 1 50  ? 83.834  66.468 53.990 1.00 30.76  ? 45  ILE C CA  1 
ATOM   3081 C  C   . ILE E 1 50  ? 82.592  66.743 54.823 1.00 29.08  ? 45  ILE C C   1 
ATOM   3082 O  O   . ILE E 1 50  ? 82.537  66.400 56.003 1.00 28.25  ? 45  ILE C O   1 
ATOM   3083 C  CB  . ILE E 1 50  ? 84.689  67.740 53.898 1.00 29.24  ? 45  ILE C CB  1 
ATOM   3084 C  CG1 . ILE E 1 50  ? 86.097  67.362 53.428 1.00 31.31  ? 45  ILE C CG1 1 
ATOM   3085 C  CG2 . ILE E 1 50  ? 84.713  68.457 55.240 1.00 29.47  ? 45  ILE C CG2 1 
ATOM   3086 C  CD1 . ILE E 1 50  ? 87.056  68.551 53.271 1.00 32.58  ? 45  ILE C CD1 1 
ATOM   3087 N  N   . ALA E 1 51  ? 81.598  67.363 54.204 1.00 27.51  ? 46  ALA C N   1 
ATOM   3088 C  CA  . ALA E 1 51  ? 80.365  67.695 54.890 1.00 26.37  ? 46  ALA C CA  1 
ATOM   3089 C  C   . ALA E 1 51  ? 79.627  66.475 55.442 1.00 25.68  ? 46  ALA C C   1 
ATOM   3090 O  O   . ALA E 1 51  ? 79.149  66.515 56.571 1.00 25.42  ? 46  ALA C O   1 
ATOM   3091 C  CB  . ALA E 1 51  ? 79.447  68.470 53.955 1.00 28.15  ? 46  ALA C CB  1 
ATOM   3092 N  N   . VAL E 1 52  ? 79.526  65.400 54.661 1.00 24.36  ? 47  VAL C N   1 
ATOM   3093 C  CA  . VAL E 1 52  ? 78.806  64.211 55.125 1.00 25.26  ? 47  VAL C CA  1 
ATOM   3094 C  C   . VAL E 1 52  ? 79.452  63.559 56.342 1.00 24.60  ? 47  VAL C C   1 
ATOM   3095 O  O   . VAL E 1 52  ? 78.761  63.020 57.210 1.00 25.96  ? 47  VAL C O   1 
ATOM   3096 C  CB  . VAL E 1 52  ? 78.645  63.137 54.008 1.00 24.43  ? 47  VAL C CB  1 
ATOM   3097 C  CG1 . VAL E 1 52  ? 77.789  63.692 52.879 1.00 24.73  ? 47  VAL C CG1 1 
ATOM   3098 C  CG2 . VAL E 1 52  ? 80.007  62.693 53.495 1.00 24.44  ? 47  VAL C CG2 1 
ATOM   3099 N  N   . ARG E 1 53  ? 80.770  63.598 56.423 1.00 24.07  ? 48  ARG C N   1 
ATOM   3100 C  CA  . ARG E 1 53  ? 81.426  63.015 57.584 1.00 24.60  ? 48  ARG C CA  1 
ATOM   3101 C  C   . ARG E 1 53  ? 81.186  63.898 58.801 1.00 23.52  ? 48  ARG C C   1 
ATOM   3102 O  O   . ARG E 1 53  ? 80.946  63.390 59.897 1.00 22.43  ? 48  ARG C O   1 
ATOM   3103 C  CB  . ARG E 1 53  ? 82.926  62.854 57.337 1.00 25.46  ? 48  ARG C CB  1 
ATOM   3104 C  CG  . ARG E 1 53  ? 83.229  61.818 56.275 1.00 29.72  ? 48  ARG C CG  1 
ATOM   3105 C  CD  . ARG E 1 53  ? 84.494  61.045 56.601 1.00 31.19  ? 48  ARG C CD  1 
ATOM   3106 N  NE  . ARG E 1 53  ? 85.707  61.832 56.409 1.00 32.04  ? 48  ARG C NE  1 
ATOM   3107 C  CZ  . ARG E 1 53  ? 86.789  61.721 57.178 1.00 33.01  ? 48  ARG C CZ  1 
ATOM   3108 N  NH1 . ARG E 1 53  ? 86.804  60.860 58.201 1.00 29.85  ? 48  ARG C NH1 1 
ATOM   3109 N  NH2 . ARG E 1 53  ? 87.865  62.448 56.910 1.00 31.40  ? 48  ARG C NH2 1 
ATOM   3110 N  N   . LEU E 1 54  ? 81.244  65.216 58.604 1.00 22.98  ? 49  LEU C N   1 
ATOM   3111 C  CA  . LEU E 1 54  ? 81.029  66.170 59.691 1.00 23.22  ? 49  LEU C CA  1 
ATOM   3112 C  C   . LEU E 1 54  ? 79.588  66.111 60.204 1.00 23.78  ? 49  LEU C C   1 
ATOM   3113 O  O   . LEU E 1 54  ? 79.348  66.148 61.419 1.00 24.44  ? 49  LEU C O   1 
ATOM   3114 C  CB  . LEU E 1 54  ? 81.336  67.605 59.229 1.00 23.42  ? 49  LEU C CB  1 
ATOM   3115 C  CG  . LEU E 1 54  ? 82.775  68.006 58.872 1.00 24.79  ? 49  LEU C CG  1 
ATOM   3116 C  CD1 . LEU E 1 54  ? 82.806  69.455 58.373 1.00 21.18  ? 49  LEU C CD1 1 
ATOM   3117 C  CD2 . LEU E 1 54  ? 83.669  67.859 60.104 1.00 25.29  ? 49  LEU C CD2 1 
ATOM   3118 N  N   . LEU E 1 55  ? 78.632  66.038 59.281 1.00 22.08  ? 50  LEU C N   1 
ATOM   3119 C  CA  . LEU E 1 55  ? 77.220  65.983 59.642 1.00 22.76  ? 50  LEU C CA  1 
ATOM   3120 C  C   . LEU E 1 55  ? 76.924  64.674 60.353 1.00 23.43  ? 50  LEU C C   1 
ATOM   3121 O  O   . LEU E 1 55  ? 76.162  64.638 61.332 1.00 23.14  ? 50  LEU C O   1 
ATOM   3122 C  CB  . LEU E 1 55  ? 76.341  66.102 58.388 1.00 22.81  ? 50  LEU C CB  1 
ATOM   3123 C  CG  . LEU E 1 55  ? 76.205  67.498 57.765 1.00 24.22  ? 50  LEU C CG  1 
ATOM   3124 C  CD1 . LEU E 1 55  ? 75.765  67.405 56.288 1.00 21.05  ? 50  LEU C CD1 1 
ATOM   3125 C  CD2 . LEU E 1 55  ? 75.209  68.302 58.583 1.00 19.48  ? 50  LEU C CD2 1 
ATOM   3126 N  N   . ALA E 1 56  ? 77.519  63.596 59.845 1.00 22.90  ? 51  ALA C N   1 
ATOM   3127 C  CA  . ALA E 1 56  ? 77.336  62.278 60.434 1.00 23.84  ? 51  ALA C CA  1 
ATOM   3128 C  C   . ALA E 1 56  ? 77.711  62.372 61.906 1.00 24.64  ? 51  ALA C C   1 
ATOM   3129 O  O   . ALA E 1 56  ? 77.001  61.872 62.784 1.00 24.54  ? 51  ALA C O   1 
ATOM   3130 C  CB  . ALA E 1 56  ? 78.232  61.255 59.739 1.00 22.11  ? 51  ALA C CB  1 
ATOM   3131 N  N   . HIS E 1 57  ? 78.834  63.027 62.166 1.00 22.87  ? 52  HIS C N   1 
ATOM   3132 C  CA  . HIS E 1 57  ? 79.312  63.173 63.519 1.00 23.58  ? 52  HIS C CA  1 
ATOM   3133 C  C   . HIS E 1 57  ? 78.392  64.059 64.368 1.00 23.79  ? 52  HIS C C   1 
ATOM   3134 O  O   . HIS E 1 57  ? 78.110  63.718 65.516 1.00 24.45  ? 52  HIS C O   1 
ATOM   3135 C  CB  . HIS E 1 57  ? 80.739  63.723 63.510 1.00 23.37  ? 52  HIS C CB  1 
ATOM   3136 C  CG  . HIS E 1 57  ? 81.472  63.481 64.787 1.00 26.14  ? 52  HIS C CG  1 
ATOM   3137 N  ND1 . HIS E 1 57  ? 81.818  62.214 65.212 1.00 27.47  ? 52  HIS C ND1 1 
ATOM   3138 C  CD2 . HIS E 1 57  ? 81.857  64.328 65.770 1.00 27.73  ? 52  HIS C CD2 1 
ATOM   3139 C  CE1 . HIS E 1 57  ? 82.384  62.292 66.404 1.00 27.31  ? 52  HIS C CE1 1 
ATOM   3140 N  NE2 . HIS E 1 57  ? 82.419  63.564 66.765 1.00 29.41  ? 52  HIS C NE2 1 
ATOM   3141 N  N   . LYS E 1 58  ? 77.925  65.186 63.824 1.00 22.58  ? 53  LYS C N   1 
ATOM   3142 C  CA  . LYS E 1 58  ? 77.027  66.065 64.584 1.00 24.50  ? 53  LYS C CA  1 
ATOM   3143 C  C   . LYS E 1 58  ? 75.718  65.353 64.911 1.00 25.20  ? 53  LYS C C   1 
ATOM   3144 O  O   . LYS E 1 58  ? 75.139  65.552 65.981 1.00 27.01  ? 53  LYS C O   1 
ATOM   3145 C  CB  . LYS E 1 58  ? 76.703  67.342 63.801 1.00 22.90  ? 53  LYS C CB  1 
ATOM   3146 C  CG  . LYS E 1 58  ? 77.719  68.486 63.953 1.00 29.26  ? 53  LYS C CG  1 
ATOM   3147 C  CD  . LYS E 1 58  ? 77.670  69.124 65.341 1.00 26.29  ? 53  LYS C CD  1 
ATOM   3148 C  CE  . LYS E 1 58  ? 78.376  70.472 65.358 1.00 27.68  ? 53  LYS C CE  1 
ATOM   3149 N  NZ  . LYS E 1 58  ? 79.850  70.410 65.269 1.00 27.57  ? 53  LYS C NZ  1 
ATOM   3150 N  N   . ILE E 1 59  ? 75.243  64.535 63.976 1.00 25.25  ? 54  ILE C N   1 
ATOM   3151 C  CA  . ILE E 1 59  ? 73.994  63.800 64.167 1.00 25.59  ? 54  ILE C CA  1 
ATOM   3152 C  C   . ILE E 1 59  ? 74.129  62.745 65.258 1.00 25.63  ? 54  ILE C C   1 
ATOM   3153 O  O   . ILE E 1 59  ? 73.139  62.351 65.882 1.00 25.91  ? 54  ILE C O   1 
ATOM   3154 C  CB  . ILE E 1 59  ? 73.544  63.137 62.842 1.00 24.56  ? 54  ILE C CB  1 
ATOM   3155 C  CG1 . ILE E 1 59  ? 73.210  64.242 61.826 1.00 24.09  ? 54  ILE C CG1 1 
ATOM   3156 C  CG2 . ILE E 1 59  ? 72.343  62.201 63.088 1.00 21.58  ? 54  ILE C CG2 1 
ATOM   3157 C  CD1 . ILE E 1 59  ? 73.168  63.797 60.356 1.00 23.49  ? 54  ILE C CD1 1 
ATOM   3158 N  N   . GLN E 1 60  ? 75.357  62.292 65.490 1.00 25.41  ? 55  GLN C N   1 
ATOM   3159 C  CA  . GLN E 1 60  ? 75.608  61.296 66.519 1.00 25.83  ? 55  GLN C CA  1 
ATOM   3160 C  C   . GLN E 1 60  ? 75.986  61.992 67.829 1.00 27.05  ? 55  GLN C C   1 
ATOM   3161 O  O   . GLN E 1 60  ? 76.483  61.361 68.759 1.00 27.48  ? 55  GLN C O   1 
ATOM   3162 C  CB  . GLN E 1 60  ? 76.731  60.344 66.085 1.00 24.89  ? 55  GLN C CB  1 
ATOM   3163 C  CG  . GLN E 1 60  ? 76.528  59.707 64.723 1.00 24.60  ? 55  GLN C CG  1 
ATOM   3164 C  CD  . GLN E 1 60  ? 77.663  58.768 64.337 1.00 26.70  ? 55  GLN C CD  1 
ATOM   3165 O  OE1 . GLN E 1 60  ? 78.835  59.041 64.614 1.00 28.54  ? 55  GLN C OE1 1 
ATOM   3166 N  NE2 . GLN E 1 60  ? 77.322  57.663 63.677 1.00 27.94  ? 55  GLN C NE2 1 
ATOM   3167 N  N   . SER E 1 61  ? 75.759  63.299 67.903 1.00 28.92  ? 56  SER C N   1 
ATOM   3168 C  CA  . SER E 1 61  ? 76.073  64.037 69.120 1.00 30.76  ? 56  SER C CA  1 
ATOM   3169 C  C   . SER E 1 61  ? 75.143  63.590 70.237 1.00 31.28  ? 56  SER C C   1 
ATOM   3170 O  O   . SER E 1 61  ? 73.989  63.256 69.988 1.00 32.15  ? 56  SER C O   1 
ATOM   3171 C  CB  . SER E 1 61  ? 75.901  65.538 68.911 1.00 29.96  ? 56  SER C CB  1 
ATOM   3172 O  OG  . SER E 1 61  ? 76.079  66.225 70.141 1.00 33.08  ? 56  SER C OG  1 
ATOM   3173 N  N   . PRO E 1 62  ? 75.639  63.565 71.485 1.00 32.18  ? 57  PRO C N   1 
ATOM   3174 C  CA  . PRO E 1 62  ? 74.815  63.151 72.628 1.00 32.26  ? 57  PRO C CA  1 
ATOM   3175 C  C   . PRO E 1 62  ? 73.817  64.255 72.999 1.00 31.48  ? 57  PRO C C   1 
ATOM   3176 O  O   . PRO E 1 62  ? 72.854  64.012 73.724 1.00 32.43  ? 57  PRO C O   1 
ATOM   3177 C  CB  . PRO E 1 62  ? 75.841  62.927 73.746 1.00 32.97  ? 57  PRO C CB  1 
ATOM   3178 C  CG  . PRO E 1 62  ? 77.169  62.820 73.029 1.00 34.02  ? 57  PRO C CG  1 
ATOM   3179 C  CD  . PRO E 1 62  ? 77.030  63.795 71.905 1.00 33.19  ? 57  PRO C CD  1 
ATOM   3180 N  N   . GLN E 1 63  ? 74.062  65.462 72.495 1.00 29.73  ? 58  GLN C N   1 
ATOM   3181 C  CA  . GLN E 1 63  ? 73.210  66.616 72.775 1.00 30.16  ? 58  GLN C CA  1 
ATOM   3182 C  C   . GLN E 1 63  ? 72.092  66.705 71.730 1.00 30.44  ? 58  GLN C C   1 
ATOM   3183 O  O   . GLN E 1 63  ? 72.334  67.036 70.568 1.00 29.97  ? 58  GLN C O   1 
ATOM   3184 C  CB  . GLN E 1 63  ? 74.063  67.891 72.757 1.00 29.96  ? 58  GLN C CB  1 
ATOM   3185 C  CG  . GLN E 1 63  ? 73.607  68.974 73.719 1.00 31.16  ? 58  GLN C CG  1 
ATOM   3186 C  CD  . GLN E 1 63  ? 72.168  69.395 73.484 1.00 30.76  ? 58  GLN C CD  1 
ATOM   3187 O  OE1 . GLN E 1 63  ? 71.273  69.060 74.262 1.00 31.55  ? 58  GLN C OE1 1 
ATOM   3188 N  NE2 . GLN E 1 63  ? 71.939  70.123 72.402 1.00 28.72  ? 58  GLN C NE2 1 
ATOM   3189 N  N   . GLU E 1 64  ? 70.864  66.423 72.159 1.00 31.40  ? 59  GLU C N   1 
ATOM   3190 C  CA  . GLU E 1 64  ? 69.704  66.425 71.270 1.00 31.68  ? 59  GLU C CA  1 
ATOM   3191 C  C   . GLU E 1 64  ? 69.513  67.618 70.327 1.00 30.50  ? 59  GLU C C   1 
ATOM   3192 O  O   . GLU E 1 64  ? 69.304  67.424 69.126 1.00 30.44  ? 59  GLU C O   1 
ATOM   3193 C  CB  . GLU E 1 64  ? 68.422  66.227 72.083 1.00 33.17  ? 59  GLU C CB  1 
ATOM   3194 C  CG  . GLU E 1 64  ? 67.166  66.260 71.217 1.00 36.69  ? 59  GLU C CG  1 
ATOM   3195 C  CD  . GLU E 1 64  ? 65.894  66.106 72.011 1.00 38.55  ? 59  GLU C CD  1 
ATOM   3196 O  OE1 . GLU E 1 64  ? 65.596  64.983 72.472 1.00 41.95  ? 59  GLU C OE1 1 
ATOM   3197 O  OE2 . GLU E 1 64  ? 65.191  67.119 72.180 1.00 42.59  ? 59  GLU C OE2 1 
ATOM   3198 N  N   . TRP E 1 65  ? 69.567  68.835 70.857 1.00 28.76  ? 60  TRP C N   1 
ATOM   3199 C  CA  . TRP E 1 65  ? 69.371  70.041 70.037 1.00 29.07  ? 60  TRP C CA  1 
ATOM   3200 C  C   . TRP E 1 65  ? 70.510  70.278 69.020 1.00 28.75  ? 60  TRP C C   1 
ATOM   3201 O  O   . TRP E 1 65  ? 70.315  70.963 67.999 1.00 28.84  ? 60  TRP C O   1 
ATOM   3202 C  CB  . TRP E 1 65  ? 69.209  71.271 70.949 1.00 28.49  ? 60  TRP C CB  1 
ATOM   3203 C  CG  . TRP E 1 65  ? 68.926  72.570 70.219 1.00 29.89  ? 60  TRP C CG  1 
ATOM   3204 C  CD1 . TRP E 1 65  ? 69.511  73.785 70.455 1.00 28.09  ? 60  TRP C CD1 1 
ATOM   3205 C  CD2 . TRP E 1 65  ? 67.989  72.779 69.149 1.00 27.89  ? 60  TRP C CD2 1 
ATOM   3206 N  NE1 . TRP E 1 65  ? 69.006  74.731 69.599 1.00 27.17  ? 60  TRP C NE1 1 
ATOM   3207 C  CE2 . TRP E 1 65  ? 68.067  74.145 68.788 1.00 28.72  ? 60  TRP C CE2 1 
ATOM   3208 C  CE3 . TRP E 1 65  ? 67.091  71.946 68.462 1.00 28.13  ? 60  TRP C CE3 1 
ATOM   3209 C  CZ2 . TRP E 1 65  ? 67.275  74.705 67.761 1.00 28.53  ? 60  TRP C CZ2 1 
ATOM   3210 C  CZ3 . TRP E 1 65  ? 66.299  72.502 67.436 1.00 26.61  ? 60  TRP C CZ3 1 
ATOM   3211 C  CH2 . TRP E 1 65  ? 66.401  73.869 67.100 1.00 26.80  ? 60  TRP C CH2 1 
ATOM   3212 N  N   . GLU E 1 66  ? 71.693  69.729 69.294 1.00 24.15  ? 61  GLU C N   1 
ATOM   3213 C  CA  . GLU E 1 66  ? 72.812  69.884 68.369 1.00 25.43  ? 61  GLU C CA  1 
ATOM   3214 C  C   . GLU E 1 66  ? 72.564  68.933 67.204 1.00 25.65  ? 61  GLU C C   1 
ATOM   3215 O  O   . GLU E 1 66  ? 72.770  69.278 66.029 1.00 23.56  ? 61  GLU C O   1 
ATOM   3216 C  CB  . GLU E 1 66  ? 74.136  69.504 69.037 1.00 27.41  ? 61  GLU C CB  1 
ATOM   3217 C  CG  . GLU E 1 66  ? 75.363  69.907 68.232 1.00 27.65  ? 61  GLU C CG  1 
ATOM   3218 C  CD  . GLU E 1 66  ? 76.673  69.527 68.915 1.00 31.43  ? 61  GLU C CD  1 
ATOM   3219 O  OE1 . GLU E 1 66  ? 76.695  68.529 69.672 1.00 31.13  ? 61  GLU C OE1 1 
ATOM   3220 O  OE2 . GLU E 1 66  ? 77.692  70.222 68.683 1.00 32.42  ? 61  GLU C OE2 1 
ATOM   3221 N  N   . ALA E 1 67  ? 72.120  67.727 67.553 1.00 24.21  ? 62  ALA C N   1 
ATOM   3222 C  CA  . ALA E 1 67  ? 71.830  66.693 66.576 1.00 22.80  ? 62  ALA C CA  1 
ATOM   3223 C  C   . ALA E 1 67  ? 70.626  67.060 65.724 1.00 22.40  ? 62  ALA C C   1 
ATOM   3224 O  O   . ALA E 1 67  ? 70.674  66.943 64.506 1.00 23.60  ? 62  ALA C O   1 
ATOM   3225 C  CB  . ALA E 1 67  ? 71.593  65.378 67.277 1.00 20.78  ? 62  ALA C CB  1 
ATOM   3226 N  N   . LEU E 1 68  ? 69.546  67.511 66.353 1.00 22.79  ? 63  LEU C N   1 
ATOM   3227 C  CA  . LEU E 1 68  ? 68.359  67.883 65.589 1.00 24.51  ? 63  LEU C CA  1 
ATOM   3228 C  C   . LEU E 1 68  ? 68.710  68.973 64.593 1.00 25.10  ? 63  LEU C C   1 
ATOM   3229 O  O   . LEU E 1 68  ? 68.261  68.942 63.446 1.00 26.44  ? 63  LEU C O   1 
ATOM   3230 C  CB  . LEU E 1 68  ? 67.226  68.348 66.519 1.00 24.58  ? 63  LEU C CB  1 
ATOM   3231 C  CG  . LEU E 1 68  ? 66.522  67.204 67.268 1.00 24.28  ? 63  LEU C CG  1 
ATOM   3232 C  CD1 . LEU E 1 68  ? 65.702  67.759 68.410 1.00 22.52  ? 63  LEU C CD1 1 
ATOM   3233 C  CD2 . LEU E 1 68  ? 65.658  66.397 66.297 1.00 23.74  ? 63  LEU C CD2 1 
ATOM   3234 N  N   . GLN E 1 69  ? 69.515  69.939 65.019 1.00 25.41  ? 64  GLN C N   1 
ATOM   3235 C  CA  . GLN E 1 69  ? 69.921  70.997 64.111 1.00 24.76  ? 64  GLN C CA  1 
ATOM   3236 C  C   . GLN E 1 69  ? 70.774  70.392 62.998 1.00 25.85  ? 64  GLN C C   1 
ATOM   3237 O  O   . GLN E 1 69  ? 70.629  70.750 61.824 1.00 28.87  ? 64  GLN C O   1 
ATOM   3238 C  CB  . GLN E 1 69  ? 70.682  72.081 64.871 1.00 25.61  ? 64  GLN C CB  1 
ATOM   3239 C  CG  . GLN E 1 69  ? 69.743  73.117 65.495 1.00 27.89  ? 64  GLN C CG  1 
ATOM   3240 C  CD  . GLN E 1 69  ? 70.472  74.189 66.271 1.00 29.00  ? 64  GLN C CD  1 
ATOM   3241 O  OE1 . GLN E 1 69  ? 70.951  73.950 67.384 1.00 32.42  ? 64  GLN C OE1 1 
ATOM   3242 N  NE2 . GLN E 1 69  ? 70.571  75.376 65.688 1.00 26.87  ? 64  GLN C NE2 1 
ATOM   3243 N  N   . ALA E 1 70  ? 71.647  69.455 63.351 1.00 24.48  ? 65  ALA C N   1 
ATOM   3244 C  CA  . ALA E 1 70  ? 72.489  68.810 62.348 1.00 24.43  ? 65  ALA C CA  1 
ATOM   3245 C  C   . ALA E 1 70  ? 71.607  68.135 61.290 1.00 24.40  ? 65  ALA C C   1 
ATOM   3246 O  O   . ALA E 1 70  ? 71.933  68.149 60.104 1.00 24.00  ? 65  ALA C O   1 
ATOM   3247 C  CB  . ALA E 1 70  ? 73.403  67.781 63.008 1.00 22.20  ? 65  ALA C CB  1 
ATOM   3248 N  N   . LEU E 1 71  ? 70.493  67.545 61.721 1.00 23.16  ? 66  LEU C N   1 
ATOM   3249 C  CA  . LEU E 1 71  ? 69.581  66.877 60.795 1.00 22.89  ? 66  LEU C CA  1 
ATOM   3250 C  C   . LEU E 1 71  ? 68.888  67.891 59.886 1.00 24.01  ? 66  LEU C C   1 
ATOM   3251 O  O   . LEU E 1 71  ? 68.623  67.610 58.710 1.00 23.30  ? 66  LEU C O   1 
ATOM   3252 C  CB  . LEU E 1 71  ? 68.554  66.060 61.575 1.00 23.27  ? 66  LEU C CB  1 
ATOM   3253 C  CG  . LEU E 1 71  ? 69.139  64.778 62.193 1.00 22.64  ? 66  LEU C CG  1 
ATOM   3254 C  CD1 . LEU E 1 71  ? 68.196  64.183 63.246 1.00 19.80  ? 66  LEU C CD1 1 
ATOM   3255 C  CD2 . LEU E 1 71  ? 69.418  63.781 61.078 1.00 20.02  ? 66  LEU C CD2 1 
ATOM   3256 N  N   . THR E 1 72  ? 68.601  69.074 60.418 1.00 23.97  ? 67  THR C N   1 
ATOM   3257 C  CA  . THR E 1 72  ? 67.979  70.116 59.609 1.00 25.13  ? 67  THR C CA  1 
ATOM   3258 C  C   . THR E 1 72  ? 68.997  70.607 58.572 1.00 26.50  ? 67  THR C C   1 
ATOM   3259 O  O   . THR E 1 72  ? 68.639  70.955 57.437 1.00 27.54  ? 67  THR C O   1 
ATOM   3260 C  CB  . THR E 1 72  ? 67.513  71.310 60.481 1.00 25.88  ? 67  THR C CB  1 
ATOM   3261 O  OG1 . THR E 1 72  ? 66.381  70.908 61.274 1.00 27.13  ? 67  THR C OG1 1 
ATOM   3262 C  CG2 . THR E 1 72  ? 67.115  72.496 59.603 1.00 24.85  ? 67  THR C CG2 1 
ATOM   3263 N  N   . VAL E 1 73  ? 70.269  70.628 58.963 1.00 24.63  ? 68  VAL C N   1 
ATOM   3264 C  CA  . VAL E 1 73  ? 71.314  71.062 58.057 1.00 23.85  ? 68  VAL C CA  1 
ATOM   3265 C  C   . VAL E 1 73  ? 71.489  70.028 56.969 1.00 24.52  ? 68  VAL C C   1 
ATOM   3266 O  O   . VAL E 1 73  ? 71.621  70.365 55.791 1.00 27.95  ? 68  VAL C O   1 
ATOM   3267 C  CB  . VAL E 1 73  ? 72.664  71.258 58.791 1.00 23.08  ? 68  VAL C CB  1 
ATOM   3268 C  CG1 . VAL E 1 73  ? 73.780  71.523 57.774 1.00 17.57  ? 68  VAL C CG1 1 
ATOM   3269 C  CG2 . VAL E 1 73  ? 72.550  72.444 59.757 1.00 21.86  ? 68  VAL C CG2 1 
ATOM   3270 N  N   . LEU E 1 74  ? 71.495  68.765 57.360 1.00 23.91  ? 69  LEU C N   1 
ATOM   3271 C  CA  . LEU E 1 74  ? 71.637  67.694 56.394 1.00 25.35  ? 69  LEU C CA  1 
ATOM   3272 C  C   . LEU E 1 74  ? 70.559  67.797 55.320 1.00 26.67  ? 69  LEU C C   1 
ATOM   3273 O  O   . LEU E 1 74  ? 70.863  67.697 54.136 1.00 27.34  ? 69  LEU C O   1 
ATOM   3274 C  CB  . LEU E 1 74  ? 71.548  66.327 57.088 1.00 24.45  ? 69  LEU C CB  1 
ATOM   3275 C  CG  . LEU E 1 74  ? 71.464  65.087 56.188 1.00 24.27  ? 69  LEU C CG  1 
ATOM   3276 C  CD1 . LEU E 1 74  ? 72.749  64.927 55.389 1.00 23.82  ? 69  LEU C CD1 1 
ATOM   3277 C  CD2 . LEU E 1 74  ? 71.209  63.847 57.049 1.00 22.82  ? 69  LEU C CD2 1 
ATOM   3278 N  N   . GLU E 1 75  ? 69.300  68.016 55.699 1.00 29.04  ? 70  GLU C N   1 
ATOM   3279 C  CA  . GLU E 1 75  ? 68.295  68.076 54.648 1.00 31.18  ? 70  GLU C CA  1 
ATOM   3280 C  C   . GLU E 1 75  ? 68.307  69.357 53.824 1.00 29.44  ? 70  GLU C C   1 
ATOM   3281 O  O   . GLU E 1 75  ? 67.775  69.377 52.720 1.00 28.73  ? 70  GLU C O   1 
ATOM   3282 C  CB  . GLU E 1 75  ? 66.879  67.749 55.173 1.00 33.93  ? 70  GLU C CB  1 
ATOM   3283 C  CG  . GLU E 1 75  ? 66.160  68.779 56.002 1.00 41.34  ? 70  GLU C CG  1 
ATOM   3284 C  CD  . GLU E 1 75  ? 64.709  68.359 56.298 1.00 46.87  ? 70  GLU C CD  1 
ATOM   3285 O  OE1 . GLU E 1 75  ? 63.933  68.166 55.331 1.00 49.73  ? 70  GLU C OE1 1 
ATOM   3286 O  OE2 . GLU E 1 75  ? 64.339  68.217 57.490 1.00 48.33  ? 70  GLU C OE2 1 
ATOM   3287 N  N   . ALA E 1 76  ? 68.915  70.424 54.332 1.00 29.46  ? 71  ALA C N   1 
ATOM   3288 C  CA  . ALA E 1 76  ? 68.994  71.646 53.531 1.00 28.23  ? 71  ALA C CA  1 
ATOM   3289 C  C   . ALA E 1 76  ? 70.056  71.337 52.477 1.00 29.41  ? 71  ALA C C   1 
ATOM   3290 O  O   . ALA E 1 76  ? 69.953  71.767 51.324 1.00 30.40  ? 71  ALA C O   1 
ATOM   3291 C  CB  . ALA E 1 76  ? 69.419  72.829 54.375 1.00 26.10  ? 71  ALA C CB  1 
ATOM   3292 N  N   . CYS E 1 77  ? 71.082  70.584 52.879 1.00 27.69  ? 72  CYS C N   1 
ATOM   3293 C  CA  . CYS E 1 77  ? 72.123  70.202 51.942 1.00 28.49  ? 72  CYS C CA  1 
ATOM   3294 C  C   . CYS E 1 77  ? 71.516  69.347 50.836 1.00 28.53  ? 72  CYS C C   1 
ATOM   3295 O  O   . CYS E 1 77  ? 71.905  69.467 49.675 1.00 27.86  ? 72  CYS C O   1 
ATOM   3296 C  CB  . CYS E 1 77  ? 73.233  69.422 52.647 1.00 28.96  ? 72  CYS C CB  1 
ATOM   3297 S  SG  . CYS E 1 77  ? 74.235  70.450 53.723 1.00 30.83  ? 72  CYS C SG  1 
HETATM 3298 N  N   . MSE E 1 78  ? 70.569  68.480 51.194 1.00 28.38  ? 73  MSE C N   1 
HETATM 3299 C  CA  . MSE E 1 78  ? 69.914  67.639 50.193 1.00 29.42  ? 73  MSE C CA  1 
HETATM 3300 C  C   . MSE E 1 78  ? 69.156  68.517 49.207 1.00 30.61  ? 73  MSE C C   1 
HETATM 3301 O  O   . MSE E 1 78  ? 69.068  68.190 48.025 1.00 31.26  ? 73  MSE C O   1 
HETATM 3302 C  CB  . MSE E 1 78  ? 68.924  66.669 50.839 1.00 28.11  ? 73  MSE C CB  1 
HETATM 3303 C  CG  . MSE E 1 78  ? 69.546  65.618 51.749 1.00 28.18  ? 73  MSE C CG  1 
HETATM 3304 SE SE  . MSE E 1 78  ? 70.865  64.531 50.879 1.00 30.56  ? 73  MSE C SE  1 
HETATM 3305 C  CE  . MSE E 1 78  ? 69.731  63.246 49.978 1.00 26.79  ? 73  MSE C CE  1 
ATOM   3306 N  N   . LYS E 1 79  ? 68.618  69.634 49.692 1.00 31.54  ? 74  LYS C N   1 
ATOM   3307 C  CA  . LYS E 1 79  ? 67.857  70.544 48.844 1.00 34.30  ? 74  LYS C CA  1 
ATOM   3308 C  C   . LYS E 1 79  ? 68.676  71.575 48.079 1.00 34.24  ? 74  LYS C C   1 
ATOM   3309 O  O   . LYS E 1 79  ? 68.228  72.069 47.049 1.00 33.92  ? 74  LYS C O   1 
ATOM   3310 C  CB  . LYS E 1 79  ? 66.793  71.283 49.668 1.00 36.93  ? 74  LYS C CB  1 
ATOM   3311 C  CG  . LYS E 1 79  ? 65.555  70.450 49.972 1.00 43.55  ? 74  LYS C CG  1 
ATOM   3312 C  CD  . LYS E 1 79  ? 64.534  71.225 50.801 1.00 46.99  ? 74  LYS C CD  1 
ATOM   3313 C  CE  . LYS E 1 79  ? 63.344  70.339 51.167 1.00 49.01  ? 74  LYS C CE  1 
ATOM   3314 N  NZ  . LYS E 1 79  ? 62.437  70.996 52.156 1.00 50.38  ? 74  LYS C NZ  1 
ATOM   3315 N  N   . ASN E 1 80  ? 69.873  71.891 48.559 1.00 34.79  ? 75  ASN C N   1 
ATOM   3316 C  CA  . ASN E 1 80  ? 70.686  72.915 47.902 1.00 35.04  ? 75  ASN C CA  1 
ATOM   3317 C  C   . ASN E 1 80  ? 72.034  72.508 47.310 1.00 34.26  ? 75  ASN C C   1 
ATOM   3318 O  O   . ASN E 1 80  ? 72.657  73.307 46.610 1.00 36.90  ? 75  ASN C O   1 
ATOM   3319 C  CB  . ASN E 1 80  ? 70.926  74.060 48.886 1.00 36.61  ? 75  ASN C CB  1 
ATOM   3320 C  CG  . ASN E 1 80  ? 69.642  74.603 49.464 1.00 35.45  ? 75  ASN C CG  1 
ATOM   3321 O  OD1 . ASN E 1 80  ? 69.616  75.087 50.593 1.00 36.46  ? 75  ASN C OD1 1 
ATOM   3322 N  ND2 . ASN E 1 80  ? 68.567  74.534 48.689 1.00 36.88  ? 75  ASN C ND2 1 
ATOM   3323 N  N   . CYS E 1 81  ? 72.495  71.289 47.566 1.00 32.96  ? 76  CYS C N   1 
ATOM   3324 C  CA  . CYS E 1 81  ? 73.801  70.893 47.052 1.00 31.27  ? 76  CYS C CA  1 
ATOM   3325 C  C   . CYS E 1 81  ? 73.782  69.871 45.919 1.00 31.15  ? 76  CYS C C   1 
ATOM   3326 O  O   . CYS E 1 81  ? 74.825  69.383 45.497 1.00 32.08  ? 76  CYS C O   1 
ATOM   3327 C  CB  . CYS E 1 81  ? 74.671  70.416 48.219 1.00 30.16  ? 76  CYS C CB  1 
ATOM   3328 S  SG  . CYS E 1 81  ? 74.720  71.647 49.581 1.00 32.03  ? 76  CYS C SG  1 
ATOM   3329 N  N   . GLY E 1 82  ? 72.589  69.559 45.431 1.00 31.90  ? 77  GLY C N   1 
ATOM   3330 C  CA  . GLY E 1 82  ? 72.429  68.636 44.319 1.00 33.62  ? 77  GLY C CA  1 
ATOM   3331 C  C   . GLY E 1 82  ? 73.107  67.272 44.275 1.00 35.18  ? 77  GLY C C   1 
ATOM   3332 O  O   . GLY E 1 82  ? 73.458  66.676 45.297 1.00 34.68  ? 77  GLY C O   1 
ATOM   3333 N  N   . ARG E 1 83  ? 73.259  66.778 43.046 1.00 36.34  ? 78  ARG C N   1 
ATOM   3334 C  CA  . ARG E 1 83  ? 73.869  65.485 42.745 1.00 37.60  ? 78  ARG C CA  1 
ATOM   3335 C  C   . ARG E 1 83  ? 75.133  65.204 43.546 1.00 35.96  ? 78  ARG C C   1 
ATOM   3336 O  O   . ARG E 1 83  ? 75.216  64.183 44.225 1.00 34.95  ? 78  ARG C O   1 
ATOM   3337 C  CB  . ARG E 1 83  ? 74.201  65.405 41.252 1.00 41.47  ? 78  ARG C CB  1 
ATOM   3338 C  CG  . ARG E 1 83  ? 74.601  64.017 40.778 1.00 47.23  ? 78  ARG C CG  1 
ATOM   3339 C  CD  . ARG E 1 83  ? 73.366  63.182 40.530 1.00 52.90  ? 78  ARG C CD  1 
ATOM   3340 N  NE  . ARG E 1 83  ? 72.543  63.785 39.483 1.00 57.79  ? 78  ARG C NE  1 
ATOM   3341 C  CZ  . ARG E 1 83  ? 71.302  63.406 39.186 1.00 60.35  ? 78  ARG C CZ  1 
ATOM   3342 N  NH1 . ARG E 1 83  ? 70.724  62.417 39.862 1.00 60.52  ? 78  ARG C NH1 1 
ATOM   3343 N  NH2 . ARG E 1 83  ? 70.641  64.013 38.205 1.00 60.92  ? 78  ARG C NH2 1 
ATOM   3344 N  N   . ARG E 1 84  ? 76.117  66.102 43.435 1.00 35.26  ? 79  ARG C N   1 
ATOM   3345 C  CA  . ARG E 1 84  ? 77.397  65.981 44.141 1.00 35.00  ? 79  ARG C CA  1 
ATOM   3346 C  C   . ARG E 1 84  ? 77.168  65.464 45.543 1.00 33.81  ? 79  ARG C C   1 
ATOM   3347 O  O   . ARG E 1 84  ? 77.829  64.537 46.007 1.00 33.74  ? 79  ARG C O   1 
ATOM   3348 C  CB  . ARG E 1 84  ? 78.074  67.341 44.334 1.00 35.40  ? 79  ARG C CB  1 
ATOM   3349 C  CG  . ARG E 1 84  ? 78.532  68.089 43.131 1.00 36.29  ? 79  ARG C CG  1 
ATOM   3350 C  CD  . ARG E 1 84  ? 79.195  69.381 43.614 1.00 32.13  ? 79  ARG C CD  1 
ATOM   3351 N  NE  . ARG E 1 84  ? 80.519  69.147 44.182 1.00 27.68  ? 79  ARG C NE  1 
ATOM   3352 C  CZ  . ARG E 1 84  ? 81.052  69.874 45.161 1.00 29.10  ? 79  ARG C CZ  1 
ATOM   3353 N  NH1 . ARG E 1 84  ? 80.359  70.875 45.693 1.00 28.05  ? 79  ARG C NH1 1 
ATOM   3354 N  NH2 . ARG E 1 84  ? 82.291  69.628 45.586 1.00 27.93  ? 79  ARG C NH2 1 
ATOM   3355 N  N   . PHE E 1 85  ? 76.244  66.128 46.224 1.00 33.11  ? 80  PHE C N   1 
ATOM   3356 C  CA  . PHE E 1 85  ? 75.923  65.802 47.592 1.00 33.08  ? 80  PHE C CA  1 
ATOM   3357 C  C   . PHE E 1 85  ? 75.097  64.526 47.731 1.00 33.06  ? 80  PHE C C   1 
ATOM   3358 O  O   . PHE E 1 85  ? 75.356  63.725 48.635 1.00 32.28  ? 80  PHE C O   1 
ATOM   3359 C  CB  . PHE E 1 85  ? 75.192  66.974 48.236 1.00 32.50  ? 80  PHE C CB  1 
ATOM   3360 C  CG  . PHE E 1 85  ? 75.237  66.953 49.728 1.00 34.14  ? 80  PHE C CG  1 
ATOM   3361 C  CD1 . PHE E 1 85  ? 76.378  67.370 50.403 1.00 31.53  ? 80  PHE C CD1 1 
ATOM   3362 C  CD2 . PHE E 1 85  ? 74.149  66.479 50.464 1.00 34.22  ? 80  PHE C CD2 1 
ATOM   3363 C  CE1 . PHE E 1 85  ? 76.439  67.316 51.791 1.00 34.30  ? 80  PHE C CE1 1 
ATOM   3364 C  CE2 . PHE E 1 85  ? 74.201  66.420 51.857 1.00 34.55  ? 80  PHE C CE2 1 
ATOM   3365 C  CZ  . PHE E 1 85  ? 75.349  66.839 52.522 1.00 34.22  ? 80  PHE C CZ  1 
ATOM   3366 N  N   . HIS E 1 86  ? 74.112  64.329 46.851 1.00 33.20  ? 81  HIS C N   1 
ATOM   3367 C  CA  . HIS E 1 86  ? 73.275  63.126 46.926 1.00 32.41  ? 81  HIS C CA  1 
ATOM   3368 C  C   . HIS E 1 86  ? 74.132  61.869 46.818 1.00 33.65  ? 81  HIS C C   1 
ATOM   3369 O  O   . HIS E 1 86  ? 73.872  60.875 47.499 1.00 33.60  ? 81  HIS C O   1 
ATOM   3370 C  CB  . HIS E 1 86  ? 72.212  63.100 45.818 1.00 31.25  ? 81  HIS C CB  1 
ATOM   3371 C  CG  . HIS E 1 86  ? 71.307  64.292 45.805 1.00 30.29  ? 81  HIS C CG  1 
ATOM   3372 N  ND1 . HIS E 1 86  ? 70.917  64.946 46.953 1.00 33.73  ? 81  HIS C ND1 1 
ATOM   3373 C  CD2 . HIS E 1 86  ? 70.720  64.953 44.781 1.00 31.45  ? 81  HIS C CD2 1 
ATOM   3374 C  CE1 . HIS E 1 86  ? 70.132  65.962 46.637 1.00 33.11  ? 81  HIS C CE1 1 
ATOM   3375 N  NE2 . HIS E 1 86  ? 69.997  65.989 45.324 1.00 32.87  ? 81  HIS C NE2 1 
ATOM   3376 N  N   . ASN E 1 87  ? 75.163  61.920 45.975 1.00 33.81  ? 82  ASN C N   1 
ATOM   3377 C  CA  . ASN E 1 87  ? 76.047  60.774 45.786 1.00 35.60  ? 82  ASN C CA  1 
ATOM   3378 C  C   . ASN E 1 87  ? 76.863  60.390 47.018 1.00 34.83  ? 82  ASN C C   1 
ATOM   3379 O  O   . ASN E 1 87  ? 77.157  59.208 47.210 1.00 34.56  ? 82  ASN C O   1 
ATOM   3380 C  CB  . ASN E 1 87  ? 77.008  61.022 44.622 1.00 39.50  ? 82  ASN C CB  1 
ATOM   3381 C  CG  . ASN E 1 87  ? 76.286  61.350 43.333 1.00 44.37  ? 82  ASN C CG  1 
ATOM   3382 O  OD1 . ASN E 1 87  ? 75.194  60.828 43.064 1.00 47.05  ? 82  ASN C OD1 1 
ATOM   3383 N  ND2 . ASN E 1 87  ? 76.899  62.209 42.511 1.00 46.29  ? 82  ASN C ND2 1 
ATOM   3384 N  N   . GLU E 1 88  ? 77.240  61.373 47.841 1.00 32.74  ? 83  GLU C N   1 
ATOM   3385 C  CA  . GLU E 1 88  ? 78.025  61.100 49.047 1.00 31.42  ? 83  GLU C CA  1 
ATOM   3386 C  C   . GLU E 1 88  ? 77.150  60.510 50.145 1.00 30.09  ? 83  GLU C C   1 
ATOM   3387 O  O   . GLU E 1 88  ? 77.574  59.627 50.894 1.00 27.96  ? 83  GLU C O   1 
ATOM   3388 C  CB  . GLU E 1 88  ? 78.708  62.377 49.557 1.00 32.36  ? 83  GLU C CB  1 
ATOM   3389 C  CG  . GLU E 1 88  ? 79.812  62.909 48.648 1.00 33.87  ? 83  GLU C CG  1 
ATOM   3390 C  CD  . GLU E 1 88  ? 80.879  61.865 48.346 1.00 37.60  ? 83  GLU C CD  1 
ATOM   3391 O  OE1 . GLU E 1 88  ? 81.420  61.265 49.302 1.00 39.23  ? 83  GLU C OE1 1 
ATOM   3392 O  OE2 . GLU E 1 88  ? 81.180  61.645 47.145 1.00 39.12  ? 83  GLU C OE2 1 
ATOM   3393 N  N   . VAL E 1 89  ? 75.926  61.007 50.240 1.00 30.38  ? 84  VAL C N   1 
ATOM   3394 C  CA  . VAL E 1 89  ? 74.981  60.516 51.230 1.00 30.19  ? 84  VAL C CA  1 
ATOM   3395 C  C   . VAL E 1 89  ? 74.551  59.108 50.834 1.00 31.57  ? 84  VAL C C   1 
ATOM   3396 O  O   . VAL E 1 89  ? 74.292  58.254 51.688 1.00 31.00  ? 84  VAL C O   1 
ATOM   3397 C  CB  . VAL E 1 89  ? 73.741  61.417 51.289 1.00 30.64  ? 84  VAL C CB  1 
ATOM   3398 C  CG1 . VAL E 1 89  ? 72.642  60.751 52.109 1.00 29.92  ? 84  VAL C CG1 1 
ATOM   3399 C  CG2 . VAL E 1 89  ? 74.122  62.770 51.879 1.00 29.25  ? 84  VAL C CG2 1 
ATOM   3400 N  N   . GLY E 1 90  ? 74.491  58.874 49.527 1.00 31.51  ? 85  GLY C N   1 
ATOM   3401 C  CA  . GLY E 1 90  ? 74.078  57.577 49.023 1.00 31.00  ? 85  GLY C CA  1 
ATOM   3402 C  C   . GLY E 1 90  ? 75.135  56.496 49.072 1.00 30.07  ? 85  GLY C C   1 
ATOM   3403 O  O   . GLY E 1 90  ? 75.114  55.586 48.245 1.00 29.78  ? 85  GLY C O   1 
ATOM   3404 N  N   . LYS E 1 91  ? 76.062  56.594 50.024 1.00 29.68  ? 86  LYS C N   1 
ATOM   3405 C  CA  . LYS E 1 91  ? 77.113  55.588 50.175 1.00 29.49  ? 86  LYS C CA  1 
ATOM   3406 C  C   . LYS E 1 91  ? 76.970  55.011 51.569 1.00 28.75  ? 86  LYS C C   1 
ATOM   3407 O  O   . LYS E 1 91  ? 76.535  55.710 52.483 1.00 30.63  ? 86  LYS C O   1 
ATOM   3408 C  CB  . LYS E 1 91  ? 78.508  56.209 50.018 1.00 31.15  ? 86  LYS C CB  1 
ATOM   3409 C  CG  . LYS E 1 91  ? 78.800  56.759 48.640 1.00 32.17  ? 86  LYS C CG  1 
ATOM   3410 C  CD  . LYS E 1 91  ? 80.284  57.037 48.476 1.00 37.67  ? 86  LYS C CD  1 
ATOM   3411 C  CE  . LYS E 1 91  ? 80.564  57.724 47.152 1.00 37.31  ? 86  LYS C CE  1 
ATOM   3412 N  NZ  . LYS E 1 91  ? 79.858  56.989 46.057 1.00 41.02  ? 86  LYS C NZ  1 
ATOM   3413 N  N   . PHE E 1 92  ? 77.335  53.748 51.745 1.00 26.94  ? 87  PHE C N   1 
ATOM   3414 C  CA  . PHE E 1 92  ? 77.201  53.124 53.055 1.00 27.70  ? 87  PHE C CA  1 
ATOM   3415 C  C   . PHE E 1 92  ? 78.104  53.783 54.075 1.00 27.96  ? 87  PHE C C   1 
ATOM   3416 O  O   . PHE E 1 92  ? 77.810  53.785 55.270 1.00 28.81  ? 87  PHE C O   1 
ATOM   3417 C  CB  . PHE E 1 92  ? 77.502  51.620 52.972 1.00 26.28  ? 87  PHE C CB  1 
ATOM   3418 C  CG  . PHE E 1 92  ? 76.445  50.831 52.238 1.00 27.23  ? 87  PHE C CG  1 
ATOM   3419 C  CD1 . PHE E 1 92  ? 75.108  50.916 52.619 1.00 26.84  ? 87  PHE C CD1 1 
ATOM   3420 C  CD2 . PHE E 1 92  ? 76.784  50.015 51.160 1.00 26.88  ? 87  PHE C CD2 1 
ATOM   3421 C  CE1 . PHE E 1 92  ? 74.121  50.201 51.938 1.00 27.73  ? 87  PHE C CE1 1 
ATOM   3422 C  CE2 . PHE E 1 92  ? 75.816  49.299 50.479 1.00 27.06  ? 87  PHE C CE2 1 
ATOM   3423 C  CZ  . PHE E 1 92  ? 74.477  49.391 50.867 1.00 28.42  ? 87  PHE C CZ  1 
ATOM   3424 N  N   . ARG E 1 93  ? 79.202  54.349 53.593 1.00 29.09  ? 88  ARG C N   1 
ATOM   3425 C  CA  . ARG E 1 93  ? 80.164  55.020 54.451 1.00 31.06  ? 88  ARG C CA  1 
ATOM   3426 C  C   . ARG E 1 93  ? 79.458  56.060 55.320 1.00 29.85  ? 88  ARG C C   1 
ATOM   3427 O  O   . ARG E 1 93  ? 79.775  56.221 56.497 1.00 30.59  ? 88  ARG C O   1 
ATOM   3428 C  CB  . ARG E 1 93  ? 81.226  55.680 53.581 1.00 35.36  ? 88  ARG C CB  1 
ATOM   3429 C  CG  . ARG E 1 93  ? 82.435  56.189 54.325 1.00 43.75  ? 88  ARG C CG  1 
ATOM   3430 C  CD  . ARG E 1 93  ? 83.630  56.205 53.373 1.00 51.02  ? 88  ARG C CD  1 
ATOM   3431 N  NE  . ARG E 1 93  ? 83.327  56.884 52.110 1.00 55.19  ? 88  ARG C NE  1 
ATOM   3432 C  CZ  . ARG E 1 93  ? 83.932  56.615 50.955 1.00 56.55  ? 88  ARG C CZ  1 
ATOM   3433 N  NH1 . ARG E 1 93  ? 84.869  55.675 50.898 1.00 56.77  ? 88  ARG C NH1 1 
ATOM   3434 N  NH2 . ARG E 1 93  ? 83.608  57.290 49.858 1.00 57.32  ? 88  ARG C NH2 1 
ATOM   3435 N  N   . PHE E 1 94  ? 78.495  56.760 54.731 1.00 27.74  ? 89  PHE C N   1 
ATOM   3436 C  CA  . PHE E 1 94  ? 77.732  57.771 55.441 1.00 24.89  ? 89  PHE C CA  1 
ATOM   3437 C  C   . PHE E 1 94  ? 76.486  57.139 56.065 1.00 26.15  ? 89  PHE C C   1 
ATOM   3438 O  O   . PHE E 1 94  ? 76.245  57.269 57.264 1.00 26.25  ? 89  PHE C O   1 
ATOM   3439 C  CB  . PHE E 1 94  ? 77.313  58.885 54.481 1.00 22.15  ? 89  PHE C CB  1 
ATOM   3440 C  CG  . PHE E 1 94  ? 76.293  59.819 55.059 1.00 22.91  ? 89  PHE C CG  1 
ATOM   3441 C  CD1 . PHE E 1 94  ? 76.643  60.724 56.053 1.00 22.70  ? 89  PHE C CD1 1 
ATOM   3442 C  CD2 . PHE E 1 94  ? 74.957  59.735 54.669 1.00 24.83  ? 89  PHE C CD2 1 
ATOM   3443 C  CE1 . PHE E 1 94  ? 75.683  61.528 56.657 1.00 23.80  ? 89  PHE C CE1 1 
ATOM   3444 C  CE2 . PHE E 1 94  ? 73.980  60.537 55.268 1.00 23.10  ? 89  PHE C CE2 1 
ATOM   3445 C  CZ  . PHE E 1 94  ? 74.348  61.435 56.267 1.00 24.47  ? 89  PHE C CZ  1 
ATOM   3446 N  N   . LEU E 1 95  ? 75.704  56.458 55.232 1.00 26.43  ? 90  LEU C N   1 
ATOM   3447 C  CA  . LEU E 1 95  ? 74.476  55.790 55.643 1.00 26.57  ? 90  LEU C CA  1 
ATOM   3448 C  C   . LEU E 1 95  ? 74.635  54.873 56.870 1.00 27.71  ? 90  LEU C C   1 
ATOM   3449 O  O   . LEU E 1 95  ? 73.688  54.716 57.641 1.00 27.98  ? 90  LEU C O   1 
ATOM   3450 C  CB  . LEU E 1 95  ? 73.917  54.995 54.453 1.00 27.30  ? 90  LEU C CB  1 
ATOM   3451 C  CG  . LEU E 1 95  ? 72.700  55.437 53.612 1.00 26.61  ? 90  LEU C CG  1 
ATOM   3452 C  CD1 . LEU E 1 95  ? 72.496  56.940 53.622 1.00 24.09  ? 90  LEU C CD1 1 
ATOM   3453 C  CD2 . LEU E 1 95  ? 72.894  54.918 52.182 1.00 23.74  ? 90  LEU C CD2 1 
ATOM   3454 N  N   . ASN E 1 96  ? 75.812  54.268 57.056 1.00 27.44  ? 91  ASN C N   1 
ATOM   3455 C  CA  . ASN E 1 96  ? 76.037  53.393 58.215 1.00 27.88  ? 91  ASN C CA  1 
ATOM   3456 C  C   . ASN E 1 96  ? 76.107  54.187 59.528 1.00 28.89  ? 91  ASN C C   1 
ATOM   3457 O  O   . ASN E 1 96  ? 75.771  53.674 60.599 1.00 27.00  ? 91  ASN C O   1 
ATOM   3458 C  CB  . ASN E 1 96  ? 77.343  52.606 58.082 1.00 27.50  ? 91  ASN C CB  1 
ATOM   3459 C  CG  . ASN E 1 96  ? 77.252  51.456 57.107 1.00 27.42  ? 91  ASN C CG  1 
ATOM   3460 O  OD1 . ASN E 1 96  ? 76.166  50.951 56.805 1.00 27.51  ? 91  ASN C OD1 1 
ATOM   3461 N  ND2 . ASN E 1 96  ? 78.409  51.011 56.625 1.00 26.07  ? 91  ASN C ND2 1 
ATOM   3462 N  N   . GLU E 1 97  ? 76.575  55.428 59.450 1.00 29.08  ? 92  GLU C N   1 
ATOM   3463 C  CA  . GLU E 1 97  ? 76.669  56.262 60.640 1.00 30.18  ? 92  GLU C CA  1 
ATOM   3464 C  C   . GLU E 1 97  ? 75.244  56.599 61.073 1.00 30.48  ? 92  GLU C C   1 
ATOM   3465 O  O   . GLU E 1 97  ? 74.985  56.848 62.252 1.00 30.42  ? 92  GLU C O   1 
ATOM   3466 C  CB  . GLU E 1 97  ? 77.482  57.526 60.336 1.00 31.63  ? 92  GLU C CB  1 
ATOM   3467 C  CG  . GLU E 1 97  ? 78.860  57.230 59.730 1.00 34.96  ? 92  GLU C CG  1 
ATOM   3468 C  CD  . GLU E 1 97  ? 79.879  56.615 60.720 1.00 42.07  ? 92  GLU C CD  1 
ATOM   3469 O  OE1 . GLU E 1 97  ? 79.519  55.744 61.554 1.00 39.99  ? 92  GLU C OE1 1 
ATOM   3470 O  OE2 . GLU E 1 97  ? 81.071  57.002 60.646 1.00 47.73  ? 92  GLU C OE2 1 
ATOM   3471 N  N   . LEU E 1 98  ? 74.316  56.576 60.115 1.00 30.91  ? 93  LEU C N   1 
ATOM   3472 C  CA  . LEU E 1 98  ? 72.909  56.848 60.399 1.00 29.71  ? 93  LEU C CA  1 
ATOM   3473 C  C   . LEU E 1 98  ? 72.225  55.630 61.010 1.00 29.20  ? 93  LEU C C   1 
ATOM   3474 O  O   . LEU E 1 98  ? 71.370  55.771 61.891 1.00 27.87  ? 93  LEU C O   1 
ATOM   3475 C  CB  . LEU E 1 98  ? 72.154  57.258 59.124 1.00 31.23  ? 93  LEU C CB  1 
ATOM   3476 C  CG  . LEU E 1 98  ? 72.406  58.651 58.522 1.00 32.56  ? 93  LEU C CG  1 
ATOM   3477 C  CD1 . LEU E 1 98  ? 71.409  58.876 57.391 1.00 32.83  ? 93  LEU C CD1 1 
ATOM   3478 C  CD2 . LEU E 1 98  ? 72.234  59.742 59.578 1.00 30.98  ? 93  LEU C CD2 1 
ATOM   3479 N  N   . ILE E 1 99  ? 72.578  54.435 60.544 1.00 28.77  ? 94  ILE C N   1 
ATOM   3480 C  CA  . ILE E 1 99  ? 71.955  53.245 61.099 1.00 32.42  ? 94  ILE C CA  1 
ATOM   3481 C  C   . ILE E 1 99  ? 72.422  53.061 62.548 1.00 32.26  ? 94  ILE C C   1 
ATOM   3482 O  O   . ILE E 1 99  ? 71.688  52.527 63.386 1.00 34.81  ? 94  ILE C O   1 
ATOM   3483 C  CB  . ILE E 1 99  ? 72.267  51.972 60.249 1.00 34.39  ? 94  ILE C CB  1 
ATOM   3484 C  CG1 . ILE E 1 99  ? 73.669  51.454 60.544 1.00 37.73  ? 94  ILE C CG1 1 
ATOM   3485 C  CG2 . ILE E 1 99  ? 72.150  52.282 58.770 1.00 34.75  ? 94  ILE C CG2 1 
ATOM   3486 C  CD1 . ILE E 1 99  ? 73.721  50.527 61.737 1.00 39.22  ? 94  ILE C CD1 1 
ATOM   3487 N  N   . LYS E 1 100 ? 73.637  53.515 62.843 1.00 31.80  ? 95  LYS C N   1 
ATOM   3488 C  CA  . LYS E 1 100 ? 74.192  53.423 64.192 1.00 31.47  ? 95  LYS C CA  1 
ATOM   3489 C  C   . LYS E 1 100 ? 73.411  54.258 65.203 1.00 29.96  ? 95  LYS C C   1 
ATOM   3490 O  O   . LYS E 1 100 ? 73.333  53.889 66.370 1.00 30.17  ? 95  LYS C O   1 
ATOM   3491 C  CB  . LYS E 1 100 ? 75.674  53.849 64.201 1.00 32.35  ? 95  LYS C CB  1 
ATOM   3492 C  CG  . LYS E 1 100 ? 76.610  52.771 63.668 1.00 35.83  ? 95  LYS C CG  1 
ATOM   3493 C  CD  . LYS E 1 100 ? 77.957  53.299 63.166 1.00 36.39  ? 95  LYS C CD  1 
ATOM   3494 C  CE  . LYS E 1 100 ? 78.881  53.718 64.292 1.00 39.28  ? 95  LYS C CE  1 
ATOM   3495 N  NZ  . LYS E 1 100 ? 80.227  54.108 63.762 1.00 40.08  ? 95  LYS C NZ  1 
ATOM   3496 N  N   . VAL E 1 101 ? 72.828  55.376 64.779 1.00 30.33  ? 96  VAL C N   1 
ATOM   3497 C  CA  . VAL E 1 101 ? 72.070  56.198 65.723 1.00 31.95  ? 96  VAL C CA  1 
ATOM   3498 C  C   . VAL E 1 101 ? 70.680  55.616 66.013 1.00 32.47  ? 96  VAL C C   1 
ATOM   3499 O  O   . VAL E 1 101 ? 70.097  55.886 67.058 1.00 32.79  ? 96  VAL C O   1 
ATOM   3500 C  CB  . VAL E 1 101 ? 71.892  57.669 65.218 1.00 32.88  ? 96  VAL C CB  1 
ATOM   3501 C  CG1 . VAL E 1 101 ? 73.242  58.244 64.787 1.00 33.27  ? 96  VAL C CG1 1 
ATOM   3502 C  CG2 . VAL E 1 101 ? 70.910  57.724 64.077 1.00 32.49  ? 96  VAL C CG2 1 
ATOM   3503 N  N   . VAL E 1 102 ? 70.153  54.807 65.100 1.00 32.95  ? 97  VAL C N   1 
ATOM   3504 C  CA  . VAL E 1 102 ? 68.825  54.239 65.295 1.00 34.89  ? 97  VAL C CA  1 
ATOM   3505 C  C   . VAL E 1 102 ? 68.846  52.783 65.742 1.00 37.97  ? 97  VAL C C   1 
ATOM   3506 O  O   . VAL E 1 102 ? 67.792  52.186 65.952 1.00 39.88  ? 97  VAL C O   1 
ATOM   3507 C  CB  . VAL E 1 102 ? 67.974  54.349 64.002 1.00 33.69  ? 97  VAL C CB  1 
ATOM   3508 C  CG1 . VAL E 1 102 ? 67.744  55.817 63.650 1.00 31.57  ? 97  VAL C CG1 1 
ATOM   3509 C  CG2 . VAL E 1 102 ? 68.677  53.637 62.855 1.00 28.62  ? 97  VAL C CG2 1 
ATOM   3510 N  N   . SER E 1 103 ? 70.035  52.205 65.877 1.00 39.58  ? 98  SER C N   1 
ATOM   3511 C  CA  . SER E 1 103 ? 70.143  50.818 66.318 1.00 41.77  ? 98  SER C CA  1 
ATOM   3512 C  C   . SER E 1 103 ? 70.624  50.710 67.773 1.00 42.75  ? 98  SER C C   1 
ATOM   3513 O  O   . SER E 1 103 ? 71.658  51.281 68.145 1.00 41.50  ? 98  SER C O   1 
ATOM   3514 C  CB  . SER E 1 103 ? 71.099  50.041 65.412 1.00 42.26  ? 98  SER C CB  1 
ATOM   3515 O  OG  . SER E 1 103 ? 71.293  48.727 65.915 1.00 42.78  ? 98  SER C OG  1 
ATOM   3516 N  N   . PRO E 1 104 ? 69.872  49.973 68.611 1.00 43.64  ? 99  PRO C N   1 
ATOM   3517 C  CA  . PRO E 1 104 ? 70.188  49.764 70.031 1.00 44.41  ? 99  PRO C CA  1 
ATOM   3518 C  C   . PRO E 1 104 ? 71.574  49.161 70.210 1.00 44.75  ? 99  PRO C C   1 
ATOM   3519 O  O   . PRO E 1 104 ? 72.247  49.396 71.217 1.00 45.20  ? 99  PRO C O   1 
ATOM   3520 C  CB  . PRO E 1 104 ? 69.094  48.799 70.495 1.00 44.16  ? 99  PRO C CB  1 
ATOM   3521 C  CG  . PRO E 1 104 ? 67.941  49.136 69.609 1.00 44.49  ? 99  PRO C CG  1 
ATOM   3522 C  CD  . PRO E 1 104 ? 68.612  49.294 68.256 1.00 44.46  ? 99  PRO C CD  1 
ATOM   3523 N  N   . LYS E 1 105 ? 71.991  48.373 69.224 1.00 44.81  ? 100 LYS C N   1 
ATOM   3524 C  CA  . LYS E 1 105 ? 73.288  47.723 69.267 1.00 44.74  ? 100 LYS C CA  1 
ATOM   3525 C  C   . LYS E 1 105 ? 74.435  48.719 69.107 1.00 44.47  ? 100 LYS C C   1 
ATOM   3526 O  O   . LYS E 1 105 ? 75.612  48.343 69.135 1.00 43.55  ? 100 LYS C O   1 
ATOM   3527 C  CB  . LYS E 1 105 ? 73.343  46.631 68.198 1.00 45.83  ? 100 LYS C CB  1 
ATOM   3528 C  CG  . LYS E 1 105 ? 72.255  45.578 68.418 1.00 48.83  ? 100 LYS C CG  1 
ATOM   3529 C  CD  . LYS E 1 105 ? 72.317  44.401 67.446 1.00 49.33  ? 100 LYS C CD  1 
ATOM   3530 C  CE  . LYS E 1 105 ? 71.185  43.418 67.745 1.00 49.81  ? 100 LYS C CE  1 
ATOM   3531 N  NZ  . LYS E 1 105 ? 71.210  42.205 66.876 1.00 50.83  ? 100 LYS C NZ  1 
ATOM   3532 N  N   . TYR E 1 106 ? 74.083  49.993 68.957 1.00 43.93  ? 101 TYR C N   1 
ATOM   3533 C  CA  . TYR E 1 106 ? 75.076  51.048 68.813 1.00 43.58  ? 101 TYR C CA  1 
ATOM   3534 C  C   . TYR E 1 106 ? 74.756  52.244 69.702 1.00 43.82  ? 101 TYR C C   1 
ATOM   3535 O  O   . TYR E 1 106 ? 74.949  52.191 70.915 1.00 44.75  ? 101 TYR C O   1 
ATOM   3536 C  CB  . TYR E 1 106 ? 75.180  51.493 67.355 1.00 43.11  ? 101 TYR C CB  1 
ATOM   3537 C  CG  . TYR E 1 106 ? 75.768  50.432 66.459 1.00 44.58  ? 101 TYR C CG  1 
ATOM   3538 C  CD1 . TYR E 1 106 ? 74.984  49.391 65.966 1.00 45.12  ? 101 TYR C CD1 1 
ATOM   3539 C  CD2 . TYR E 1 106 ? 77.130  50.432 66.156 1.00 45.98  ? 101 TYR C CD2 1 
ATOM   3540 C  CE1 . TYR E 1 106 ? 75.545  48.371 65.194 1.00 46.01  ? 101 TYR C CE1 1 
ATOM   3541 C  CE2 . TYR E 1 106 ? 77.701  49.420 65.388 1.00 46.99  ? 101 TYR C CE2 1 
ATOM   3542 C  CZ  . TYR E 1 106 ? 76.903  48.392 64.910 1.00 47.44  ? 101 TYR C CZ  1 
ATOM   3543 O  OH  . TYR E 1 106 ? 77.466  47.389 64.151 1.00 47.95  ? 101 TYR C OH  1 
ATOM   3544 N  N   . LEU E 1 107 ? 74.258  53.318 69.100 1.00 43.21  ? 102 LEU C N   1 
ATOM   3545 C  CA  . LEU E 1 107 ? 73.929  54.519 69.850 1.00 42.21  ? 102 LEU C CA  1 
ATOM   3546 C  C   . LEU E 1 107 ? 72.436  54.629 70.155 1.00 43.40  ? 102 LEU C C   1 
ATOM   3547 O  O   . LEU E 1 107 ? 72.017  55.514 70.897 1.00 43.19  ? 102 LEU C O   1 
ATOM   3548 C  CB  . LEU E 1 107 ? 74.377  55.752 69.065 1.00 40.16  ? 102 LEU C CB  1 
ATOM   3549 C  CG  . LEU E 1 107 ? 75.752  55.700 68.393 1.00 40.16  ? 102 LEU C CG  1 
ATOM   3550 C  CD1 . LEU E 1 107 ? 75.993  57.017 67.667 1.00 40.09  ? 102 LEU C CD1 1 
ATOM   3551 C  CD2 . LEU E 1 107 ? 76.845  55.438 69.418 1.00 40.26  ? 102 LEU C CD2 1 
ATOM   3552 N  N   . GLY E 1 108 ? 71.642  53.728 69.580 1.00 45.13  ? 103 GLY C N   1 
ATOM   3553 C  CA  . GLY E 1 108 ? 70.201  53.745 69.776 1.00 46.65  ? 103 GLY C CA  1 
ATOM   3554 C  C   . GLY E 1 108 ? 69.698  53.943 71.197 1.00 49.89  ? 103 GLY C C   1 
ATOM   3555 O  O   . GLY E 1 108 ? 68.788  54.751 71.426 1.00 50.43  ? 103 GLY C O   1 
ATOM   3556 N  N   . ASP E 1 109 ? 70.269  53.213 72.155 1.00 51.24  ? 104 ASP C N   1 
ATOM   3557 C  CA  . ASP E 1 109 ? 69.848  53.326 73.553 1.00 51.68  ? 104 ASP C CA  1 
ATOM   3558 C  C   . ASP E 1 109 ? 70.059  54.713 74.151 1.00 51.66  ? 104 ASP C C   1 
ATOM   3559 O  O   . ASP E 1 109 ? 69.351  55.100 75.074 1.00 50.86  ? 104 ASP C O   1 
ATOM   3560 C  CB  . ASP E 1 109 ? 70.599  52.329 74.443 1.00 53.02  ? 104 ASP C CB  1 
ATOM   3561 C  CG  . ASP E 1 109 ? 70.283  50.886 74.116 1.00 55.34  ? 104 ASP C CG  1 
ATOM   3562 O  OD1 . ASP E 1 109 ? 69.107  50.585 73.822 1.00 55.22  ? 104 ASP C OD1 1 
ATOM   3563 O  OD2 . ASP E 1 109 ? 71.214  50.047 74.176 1.00 56.63  ? 104 ASP C OD2 1 
ATOM   3564 N  N   . ARG E 1 110 ? 71.030  55.457 73.628 1.00 52.27  ? 105 ARG C N   1 
ATOM   3565 C  CA  . ARG E 1 110 ? 71.355  56.777 74.166 1.00 52.51  ? 105 ARG C CA  1 
ATOM   3566 C  C   . ARG E 1 110 ? 71.002  57.983 73.293 1.00 52.00  ? 105 ARG C C   1 
ATOM   3567 O  O   . ARG E 1 110 ? 71.525  59.086 73.507 1.00 52.63  ? 105 ARG C O   1 
ATOM   3568 C  CB  . ARG E 1 110 ? 72.843  56.810 74.516 1.00 53.75  ? 105 ARG C CB  1 
ATOM   3569 C  CG  . ARG E 1 110 ? 73.286  55.589 75.306 1.00 56.78  ? 105 ARG C CG  1 
ATOM   3570 C  CD  . ARG E 1 110 ? 74.502  54.926 74.677 1.00 60.10  ? 105 ARG C CD  1 
ATOM   3571 N  NE  . ARG E 1 110 ? 74.499  53.480 74.887 1.00 62.11  ? 105 ARG C NE  1 
ATOM   3572 C  CZ  . ARG E 1 110 ? 75.489  52.667 74.533 1.00 63.01  ? 105 ARG C CZ  1 
ATOM   3573 N  NH1 . ARG E 1 110 ? 76.577  53.157 73.948 1.00 62.14  ? 105 ARG C NH1 1 
ATOM   3574 N  NH2 . ARG E 1 110 ? 75.385  51.360 74.756 1.00 63.47  ? 105 ARG C NH2 1 
ATOM   3575 N  N   . VAL E 1 111 ? 70.129  57.780 72.310 1.00 49.84  ? 106 VAL C N   1 
ATOM   3576 C  CA  . VAL E 1 111 ? 69.705  58.876 71.439 1.00 47.99  ? 106 VAL C CA  1 
ATOM   3577 C  C   . VAL E 1 111 ? 68.197  59.054 71.629 1.00 47.37  ? 106 VAL C C   1 
ATOM   3578 O  O   . VAL E 1 111 ? 67.461  58.075 71.810 1.00 46.62  ? 106 VAL C O   1 
ATOM   3579 C  CB  . VAL E 1 111 ? 70.029  58.587 69.949 1.00 46.56  ? 106 VAL C CB  1 
ATOM   3580 C  CG1 . VAL E 1 111 ? 71.524  58.346 69.780 1.00 42.81  ? 106 VAL C CG1 1 
ATOM   3581 C  CG2 . VAL E 1 111 ? 69.247  57.391 69.467 1.00 46.80  ? 106 VAL C CG2 1 
ATOM   3582 N  N   . SER E 1 112 ? 67.736  60.300 71.602 1.00 46.64  ? 107 SER C N   1 
ATOM   3583 C  CA  . SER E 1 112 ? 66.318  60.575 71.813 1.00 46.02  ? 107 SER C CA  1 
ATOM   3584 C  C   . SER E 1 112 ? 65.404  60.048 70.715 1.00 44.72  ? 107 SER C C   1 
ATOM   3585 O  O   . SER E 1 112 ? 65.836  59.776 69.593 1.00 43.08  ? 107 SER C O   1 
ATOM   3586 C  CB  . SER E 1 112 ? 66.080  62.081 72.006 1.00 46.13  ? 107 SER C CB  1 
ATOM   3587 O  OG  . SER E 1 112 ? 66.424  62.818 70.847 1.00 46.92  ? 107 SER C OG  1 
ATOM   3588 N  N   . GLU E 1 113 ? 64.130  59.907 71.065 1.00 44.98  ? 108 GLU C N   1 
ATOM   3589 C  CA  . GLU E 1 113 ? 63.123  59.417 70.144 1.00 44.78  ? 108 GLU C CA  1 
ATOM   3590 C  C   . GLU E 1 113 ? 62.914  60.450 69.035 1.00 43.36  ? 108 GLU C C   1 
ATOM   3591 O  O   . GLU E 1 113 ? 62.660  60.097 67.882 1.00 43.23  ? 108 GLU C O   1 
ATOM   3592 C  CB  . GLU E 1 113 ? 61.814  59.173 70.899 1.00 47.71  ? 108 GLU C CB  1 
ATOM   3593 C  CG  . GLU E 1 113 ? 61.015  57.985 70.391 1.00 52.54  ? 108 GLU C CG  1 
ATOM   3594 C  CD  . GLU E 1 113 ? 61.852  56.711 70.326 1.00 56.13  ? 108 GLU C CD  1 
ATOM   3595 O  OE1 . GLU E 1 113 ? 62.420  56.314 71.371 1.00 55.90  ? 108 GLU C OE1 1 
ATOM   3596 O  OE2 . GLU E 1 113 ? 61.944  56.112 69.226 1.00 57.83  ? 108 GLU C OE2 1 
ATOM   3597 N  N   . LYS E 1 114 ? 63.038  61.725 69.384 1.00 40.05  ? 109 LYS C N   1 
ATOM   3598 C  CA  . LYS E 1 114 ? 62.860  62.782 68.403 1.00 39.56  ? 109 LYS C CA  1 
ATOM   3599 C  C   . LYS E 1 114 ? 63.921  62.687 67.299 1.00 38.18  ? 109 LYS C C   1 
ATOM   3600 O  O   . LYS E 1 114 ? 63.613  62.822 66.111 1.00 37.38  ? 109 LYS C O   1 
ATOM   3601 C  CB  . LYS E 1 114 ? 62.920  64.151 69.088 1.00 39.95  ? 109 LYS C CB  1 
ATOM   3602 C  CG  . LYS E 1 114 ? 62.402  65.286 68.212 1.00 43.06  ? 109 LYS C CG  1 
ATOM   3603 C  CD  . LYS E 1 114 ? 62.242  66.594 68.982 1.00 43.85  ? 109 LYS C CD  1 
ATOM   3604 C  CE  . LYS E 1 114 ? 61.671  67.685 68.077 1.00 47.35  ? 109 LYS C CE  1 
ATOM   3605 N  NZ  . LYS E 1 114 ? 61.666  69.040 68.725 1.00 50.68  ? 109 LYS C NZ  1 
ATOM   3606 N  N   . VAL E 1 115 ? 65.166  62.444 67.699 1.00 36.02  ? 110 VAL C N   1 
ATOM   3607 C  CA  . VAL E 1 115 ? 66.271  62.327 66.755 1.00 33.82  ? 110 VAL C CA  1 
ATOM   3608 C  C   . VAL E 1 115 ? 66.125  61.080 65.887 1.00 33.27  ? 110 VAL C C   1 
ATOM   3609 O  O   . VAL E 1 115 ? 66.243  61.150 64.664 1.00 33.12  ? 110 VAL C O   1 
ATOM   3610 C  CB  . VAL E 1 115 ? 67.640  62.271 67.496 1.00 33.81  ? 110 VAL C CB  1 
ATOM   3611 C  CG1 . VAL E 1 115 ? 68.786  62.026 66.500 1.00 31.65  ? 110 VAL C CG1 1 
ATOM   3612 C  CG2 . VAL E 1 115 ? 67.867  63.566 68.254 1.00 30.76  ? 110 VAL C CG2 1 
ATOM   3613 N  N   . LYS E 1 116 ? 65.863  59.938 66.512 1.00 31.87  ? 111 LYS C N   1 
ATOM   3614 C  CA  . LYS E 1 116 ? 65.719  58.713 65.745 1.00 32.08  ? 111 LYS C CA  1 
ATOM   3615 C  C   . LYS E 1 116 ? 64.605  58.787 64.704 1.00 31.10  ? 111 LYS C C   1 
ATOM   3616 O  O   . LYS E 1 116 ? 64.803  58.395 63.561 1.00 29.79  ? 111 LYS C O   1 
ATOM   3617 C  CB  . LYS E 1 116 ? 65.495  57.513 66.672 1.00 32.02  ? 111 LYS C CB  1 
ATOM   3618 C  CG  . LYS E 1 116 ? 66.731  57.136 67.467 1.00 34.58  ? 111 LYS C CG  1 
ATOM   3619 C  CD  . LYS E 1 116 ? 66.696  55.685 67.936 1.00 37.00  ? 111 LYS C CD  1 
ATOM   3620 C  CE  . LYS E 1 116 ? 65.731  55.458 69.098 1.00 39.78  ? 111 LYS C CE  1 
ATOM   3621 N  NZ  . LYS E 1 116 ? 66.256  55.971 70.390 1.00 39.14  ? 111 LYS C NZ  1 
ATOM   3622 N  N   . THR E 1 117 ? 63.441  59.297 65.089 1.00 32.11  ? 112 THR C N   1 
ATOM   3623 C  CA  . THR E 1 117 ? 62.327  59.387 64.154 1.00 32.88  ? 112 THR C CA  1 
ATOM   3624 C  C   . THR E 1 117 ? 62.656  60.324 62.995 1.00 30.91  ? 112 THR C C   1 
ATOM   3625 O  O   . THR E 1 117 ? 62.190  60.128 61.874 1.00 31.17  ? 112 THR C O   1 
ATOM   3626 C  CB  . THR E 1 117 ? 61.056  59.889 64.846 1.00 36.35  ? 112 THR C CB  1 
ATOM   3627 O  OG1 . THR E 1 117 ? 61.194  61.284 65.144 1.00 40.31  ? 112 THR C OG1 1 
ATOM   3628 C  CG2 . THR E 1 117 ? 60.812  59.111 66.134 1.00 35.27  ? 112 THR C CG2 1 
ATOM   3629 N  N   . LYS E 1 118 ? 63.455  61.346 63.264 1.00 29.13  ? 113 LYS C N   1 
ATOM   3630 C  CA  . LYS E 1 118 ? 63.842  62.278 62.217 1.00 28.43  ? 113 LYS C CA  1 
ATOM   3631 C  C   . LYS E 1 118 ? 64.715  61.543 61.200 1.00 28.07  ? 113 LYS C C   1 
ATOM   3632 O  O   . LYS E 1 118 ? 64.505  61.651 59.990 1.00 28.73  ? 113 LYS C O   1 
ATOM   3633 C  CB  . LYS E 1 118 ? 64.621  63.444 62.810 1.00 29.05  ? 113 LYS C CB  1 
ATOM   3634 C  CG  . LYS E 1 118 ? 64.907  64.546 61.818 1.00 33.47  ? 113 LYS C CG  1 
ATOM   3635 C  CD  . LYS E 1 118 ? 63.607  65.116 61.270 1.00 35.80  ? 113 LYS C CD  1 
ATOM   3636 C  CE  . LYS E 1 118 ? 63.866  66.173 60.199 1.00 39.85  ? 113 LYS C CE  1 
ATOM   3637 N  NZ  . LYS E 1 118 ? 62.581  66.587 59.515 1.00 44.02  ? 113 LYS C NZ  1 
ATOM   3638 N  N   . VAL E 1 119 ? 65.695  60.791 61.696 1.00 25.81  ? 114 VAL C N   1 
ATOM   3639 C  CA  . VAL E 1 119 ? 66.590  60.046 60.825 1.00 25.11  ? 114 VAL C CA  1 
ATOM   3640 C  C   . VAL E 1 119 ? 65.787  59.156 59.890 1.00 25.67  ? 114 VAL C C   1 
ATOM   3641 O  O   . VAL E 1 119 ? 65.968  59.176 58.675 1.00 23.78  ? 114 VAL C O   1 
ATOM   3642 C  CB  . VAL E 1 119 ? 67.555  59.142 61.638 1.00 24.78  ? 114 VAL C CB  1 
ATOM   3643 C  CG1 . VAL E 1 119 ? 68.293  58.198 60.698 1.00 21.95  ? 114 VAL C CG1 1 
ATOM   3644 C  CG2 . VAL E 1 119 ? 68.553  59.992 62.400 1.00 23.58  ? 114 VAL C CG2 1 
ATOM   3645 N  N   . ILE E 1 120 ? 64.897  58.371 60.484 1.00 27.21  ? 115 ILE C N   1 
ATOM   3646 C  CA  . ILE E 1 120 ? 64.060  57.446 59.745 1.00 27.66  ? 115 ILE C CA  1 
ATOM   3647 C  C   . ILE E 1 120 ? 63.173  58.194 58.767 1.00 28.47  ? 115 ILE C C   1 
ATOM   3648 O  O   . ILE E 1 120 ? 62.990  57.771 57.626 1.00 29.77  ? 115 ILE C O   1 
ATOM   3649 C  CB  . ILE E 1 120 ? 63.216  56.617 60.722 1.00 28.32  ? 115 ILE C CB  1 
ATOM   3650 C  CG1 . ILE E 1 120 ? 64.134  55.627 61.445 1.00 26.61  ? 115 ILE C CG1 1 
ATOM   3651 C  CG2 . ILE E 1 120 ? 62.079  55.908 59.986 1.00 27.12  ? 115 ILE C CG2 1 
ATOM   3652 C  CD1 . ILE E 1 120 ? 63.440  54.838 62.523 1.00 30.20  ? 115 ILE C CD1 1 
ATOM   3653 N  N   . GLU E 1 121 ? 62.633  59.316 59.213 1.00 27.72  ? 116 GLU C N   1 
ATOM   3654 C  CA  . GLU E 1 121 ? 61.786  60.123 58.359 1.00 28.70  ? 116 GLU C CA  1 
ATOM   3655 C  C   . GLU E 1 121 ? 62.583  60.560 57.131 1.00 28.92  ? 116 GLU C C   1 
ATOM   3656 O  O   . GLU E 1 121 ? 62.138  60.386 55.992 1.00 30.19  ? 116 GLU C O   1 
ATOM   3657 C  CB  . GLU E 1 121 ? 61.305  61.340 59.135 1.00 32.35  ? 116 GLU C CB  1 
ATOM   3658 C  CG  . GLU E 1 121 ? 60.444  62.278 58.345 1.00 36.34  ? 116 GLU C CG  1 
ATOM   3659 C  CD  . GLU E 1 121 ? 60.276  63.590 59.053 1.00 40.40  ? 116 GLU C CD  1 
ATOM   3660 O  OE1 . GLU E 1 121 ? 59.782  63.583 60.207 1.00 41.51  ? 116 GLU C OE1 1 
ATOM   3661 O  OE2 . GLU E 1 121 ? 60.652  64.624 58.455 1.00 44.25  ? 116 GLU C OE2 1 
ATOM   3662 N  N   . LEU E 1 122 ? 63.768  61.120 57.350 1.00 27.09  ? 117 LEU C N   1 
ATOM   3663 C  CA  . LEU E 1 122 ? 64.585  61.548 56.219 1.00 29.02  ? 117 LEU C CA  1 
ATOM   3664 C  C   . LEU E 1 122 ? 64.934  60.387 55.286 1.00 28.68  ? 117 LEU C C   1 
ATOM   3665 O  O   . LEU E 1 122 ? 64.833  60.505 54.067 1.00 30.19  ? 117 LEU C O   1 
ATOM   3666 C  CB  . LEU E 1 122 ? 65.875  62.203 56.704 1.00 28.13  ? 117 LEU C CB  1 
ATOM   3667 C  CG  . LEU E 1 122 ? 65.712  63.540 57.414 1.00 27.64  ? 117 LEU C CG  1 
ATOM   3668 C  CD1 . LEU E 1 122 ? 67.081  64.069 57.719 1.00 26.46  ? 117 LEU C CD1 1 
ATOM   3669 C  CD2 . LEU E 1 122 ? 64.937  64.520 56.540 1.00 28.99  ? 117 LEU C CD2 1 
ATOM   3670 N  N   . LEU E 1 123 ? 65.346  59.269 55.868 1.00 28.77  ? 118 LEU C N   1 
ATOM   3671 C  CA  . LEU E 1 123 ? 65.718  58.094 55.098 1.00 28.70  ? 118 LEU C CA  1 
ATOM   3672 C  C   . LEU E 1 123 ? 64.562  57.628 54.208 1.00 29.67  ? 118 LEU C C   1 
ATOM   3673 O  O   . LEU E 1 123 ? 64.763  57.299 53.036 1.00 28.29  ? 118 LEU C O   1 
ATOM   3674 C  CB  . LEU E 1 123 ? 66.131  56.987 56.053 1.00 29.34  ? 118 LEU C CB  1 
ATOM   3675 C  CG  . LEU E 1 123 ? 67.384  56.167 55.765 1.00 32.04  ? 118 LEU C CG  1 
ATOM   3676 C  CD1 . LEU E 1 123 ? 68.549  57.037 55.351 1.00 30.60  ? 118 LEU C CD1 1 
ATOM   3677 C  CD2 . LEU E 1 123 ? 67.726  55.405 57.030 1.00 35.02  ? 118 LEU C CD2 1 
ATOM   3678 N  N   . TYR E 1 124 ? 63.346  57.596 54.751 1.00 29.27  ? 119 TYR C N   1 
ATOM   3679 C  CA  . TYR E 1 124 ? 62.217  57.175 53.933 1.00 29.19  ? 119 TYR C CA  1 
ATOM   3680 C  C   . TYR E 1 124 ? 61.957  58.203 52.832 1.00 28.77  ? 119 TYR C C   1 
ATOM   3681 O  O   . TYR E 1 124 ? 61.655  57.836 51.700 1.00 27.99  ? 119 TYR C O   1 
ATOM   3682 C  CB  . TYR E 1 124 ? 60.955  56.987 54.778 1.00 29.93  ? 119 TYR C CB  1 
ATOM   3683 C  CG  . TYR E 1 124 ? 59.760  56.537 53.957 1.00 28.14  ? 119 TYR C CG  1 
ATOM   3684 C  CD1 . TYR E 1 124 ? 59.819  55.368 53.192 1.00 27.80  ? 119 TYR C CD1 1 
ATOM   3685 C  CD2 . TYR E 1 124 ? 58.578  57.285 53.930 1.00 27.66  ? 119 TYR C CD2 1 
ATOM   3686 C  CE1 . TYR E 1 124 ? 58.728  54.951 52.416 1.00 27.79  ? 119 TYR C CE1 1 
ATOM   3687 C  CE2 . TYR E 1 124 ? 57.477  56.876 53.154 1.00 29.03  ? 119 TYR C CE2 1 
ATOM   3688 C  CZ  . TYR E 1 124 ? 57.564  55.709 52.403 1.00 28.96  ? 119 TYR C CZ  1 
ATOM   3689 O  OH  . TYR E 1 124 ? 56.494  55.297 51.641 1.00 31.07  ? 119 TYR C OH  1 
ATOM   3690 N  N   . SER E 1 125 ? 62.076  59.486 53.166 1.00 28.37  ? 120 SER C N   1 
ATOM   3691 C  CA  . SER E 1 125 ? 61.867  60.551 52.186 1.00 30.36  ? 120 SER C CA  1 
ATOM   3692 C  C   . SER E 1 125 ? 62.778  60.356 50.990 1.00 28.63  ? 120 SER C C   1 
ATOM   3693 O  O   . SER E 1 125 ? 62.369  60.557 49.844 1.00 28.85  ? 120 SER C O   1 
ATOM   3694 C  CB  . SER E 1 125 ? 62.178  61.913 52.801 1.00 32.10  ? 120 SER C CB  1 
ATOM   3695 O  OG  . SER E 1 125 ? 61.422  62.106 53.980 1.00 41.54  ? 120 SER C OG  1 
ATOM   3696 N  N   . TRP E 1 126 ? 64.022  59.979 51.266 1.00 27.08  ? 121 TRP C N   1 
ATOM   3697 C  CA  . TRP E 1 126 ? 65.013  59.769 50.217 1.00 27.37  ? 121 TRP C CA  1 
ATOM   3698 C  C   . TRP E 1 126 ? 64.726  58.579 49.310 1.00 27.05  ? 121 TRP C C   1 
ATOM   3699 O  O   . TRP E 1 126 ? 65.080  58.588 48.130 1.00 24.93  ? 121 TRP C O   1 
ATOM   3700 C  CB  . TRP E 1 126 ? 66.405  59.627 50.839 1.00 25.35  ? 121 TRP C CB  1 
ATOM   3701 C  CG  . TRP E 1 126 ? 66.806  60.852 51.590 1.00 23.66  ? 121 TRP C CG  1 
ATOM   3702 C  CD1 . TRP E 1 126 ? 66.279  62.106 51.452 1.00 22.33  ? 121 TRP C CD1 1 
ATOM   3703 C  CD2 . TRP E 1 126 ? 67.825  60.952 52.582 1.00 22.39  ? 121 TRP C CD2 1 
ATOM   3704 N  NE1 . TRP E 1 126 ? 66.910  62.985 52.302 1.00 22.54  ? 121 TRP C NE1 1 
ATOM   3705 C  CE2 . TRP E 1 126 ? 67.866  62.302 53.006 1.00 22.40  ? 121 TRP C CE2 1 
ATOM   3706 C  CE3 . TRP E 1 126 ? 68.711  60.032 53.158 1.00 22.78  ? 121 TRP C CE3 1 
ATOM   3707 C  CZ2 . TRP E 1 126 ? 68.759  62.755 53.977 1.00 23.32  ? 121 TRP C CZ2 1 
ATOM   3708 C  CZ3 . TRP E 1 126 ? 69.601  60.483 54.130 1.00 24.56  ? 121 TRP C CZ3 1 
ATOM   3709 C  CH2 . TRP E 1 126 ? 69.617  61.834 54.527 1.00 25.09  ? 121 TRP C CH2 1 
ATOM   3710 N  N   . THR E 1 127 ? 64.093  57.549 49.854 1.00 28.03  ? 122 THR C N   1 
ATOM   3711 C  CA  . THR E 1 127 ? 63.775  56.388 49.040 1.00 30.72  ? 122 THR C CA  1 
ATOM   3712 C  C   . THR E 1 127 ? 62.686  56.834 48.087 1.00 31.88  ? 122 THR C C   1 
ATOM   3713 O  O   . THR E 1 127 ? 62.612  56.382 46.948 1.00 33.21  ? 122 THR C O   1 
ATOM   3714 C  CB  . THR E 1 127 ? 63.248  55.233 49.884 1.00 30.11  ? 122 THR C CB  1 
ATOM   3715 O  OG1 . THR E 1 127 ? 62.153  55.704 50.675 1.00 33.23  ? 122 THR C OG1 1 
ATOM   3716 C  CG2 . THR E 1 127 ? 64.343  54.683 50.793 1.00 28.85  ? 122 THR C CG2 1 
HETATM 3717 N  N   . MSE E 1 128 ? 61.845  57.745 48.558 1.00 32.60  ? 123 MSE C N   1 
HETATM 3718 C  CA  . MSE E 1 128 ? 60.766  58.262 47.733 1.00 34.24  ? 123 MSE C CA  1 
HETATM 3719 C  C   . MSE E 1 128 ? 61.271  59.284 46.717 1.00 34.21  ? 123 MSE C C   1 
HETATM 3720 O  O   . MSE E 1 128 ? 61.017  59.155 45.518 1.00 33.15  ? 123 MSE C O   1 
HETATM 3721 C  CB  . MSE E 1 128 ? 59.685  58.901 48.617 1.00 36.02  ? 123 MSE C CB  1 
HETATM 3722 C  CG  . MSE E 1 128 ? 58.820  57.893 49.387 1.00 38.91  ? 123 MSE C CG  1 
HETATM 3723 SE SE  . MSE E 1 128 ? 57.792  56.769 48.194 1.00 41.98  ? 123 MSE C SE  1 
HETATM 3724 C  CE  . MSE E 1 128 ? 58.646  55.069 48.486 1.00 41.90  ? 123 MSE C CE  1 
ATOM   3725 N  N   . ALA E 1 129 ? 62.001  60.285 47.200 1.00 33.81  ? 124 ALA C N   1 
ATOM   3726 C  CA  . ALA E 1 129 ? 62.511  61.345 46.341 1.00 34.71  ? 124 ALA C CA  1 
ATOM   3727 C  C   . ALA E 1 129 ? 63.797  61.034 45.577 1.00 36.03  ? 124 ALA C C   1 
ATOM   3728 O  O   . ALA E 1 129 ? 64.070  61.661 44.560 1.00 36.55  ? 124 ALA C O   1 
ATOM   3729 C  CB  . ALA E 1 129 ? 62.697  62.619 47.161 1.00 33.42  ? 124 ALA C CB  1 
ATOM   3730 N  N   . LEU E 1 130 ? 64.581  60.072 46.052 1.00 38.46  ? 125 LEU C N   1 
ATOM   3731 C  CA  . LEU E 1 130 ? 65.845  59.724 45.399 1.00 39.38  ? 125 LEU C CA  1 
ATOM   3732 C  C   . LEU E 1 130 ? 65.968  58.258 45.007 1.00 41.05  ? 125 LEU C C   1 
ATOM   3733 O  O   . LEU E 1 130 ? 66.890  57.571 45.443 1.00 38.96  ? 125 LEU C O   1 
ATOM   3734 C  CB  . LEU E 1 130 ? 67.014  60.083 46.317 1.00 39.35  ? 125 LEU C CB  1 
ATOM   3735 C  CG  . LEU E 1 130 ? 67.777  61.381 46.045 1.00 40.13  ? 125 LEU C CG  1 
ATOM   3736 C  CD1 . LEU E 1 130 ? 66.820  62.519 45.728 1.00 39.30  ? 125 LEU C CD1 1 
ATOM   3737 C  CD2 . LEU E 1 130 ? 68.640  61.699 47.264 1.00 38.68  ? 125 LEU C CD2 1 
ATOM   3738 N  N   . PRO E 1 131 ? 65.050  57.761 44.165 1.00 44.60  ? 126 PRO C N   1 
ATOM   3739 C  CA  . PRO E 1 131 ? 65.076  56.360 43.724 1.00 46.09  ? 126 PRO C CA  1 
ATOM   3740 C  C   . PRO E 1 131 ? 66.408  55.930 43.092 1.00 47.44  ? 126 PRO C C   1 
ATOM   3741 O  O   . PRO E 1 131 ? 66.727  54.741 43.057 1.00 48.43  ? 126 PRO C O   1 
ATOM   3742 C  CB  . PRO E 1 131 ? 63.918  56.296 42.733 1.00 45.68  ? 126 PRO C CB  1 
ATOM   3743 C  CG  . PRO E 1 131 ? 62.950  57.293 43.291 1.00 46.20  ? 126 PRO C CG  1 
ATOM   3744 C  CD  . PRO E 1 131 ? 63.865  58.452 43.626 1.00 46.07  ? 126 PRO C CD  1 
ATOM   3745 N  N   . GLU E 1 132 ? 67.170  56.906 42.598 1.00 48.34  ? 127 GLU C N   1 
ATOM   3746 C  CA  . GLU E 1 132 ? 68.469  56.670 41.962 1.00 49.28  ? 127 GLU C CA  1 
ATOM   3747 C  C   . GLU E 1 132 ? 69.489  56.105 42.949 1.00 48.48  ? 127 GLU C C   1 
ATOM   3748 O  O   . GLU E 1 132 ? 70.356  55.305 42.585 1.00 48.56  ? 127 GLU C O   1 
ATOM   3749 C  CB  . GLU E 1 132 ? 69.015  57.989 41.385 1.00 52.64  ? 127 GLU C CB  1 
ATOM   3750 C  CG  . GLU E 1 132 ? 70.470  57.920 40.900 1.00 58.13  ? 127 GLU C CG  1 
ATOM   3751 C  CD  . GLU E 1 132 ? 71.241  59.231 41.098 1.00 62.68  ? 127 GLU C CD  1 
ATOM   3752 O  OE1 . GLU E 1 132 ? 70.654  60.205 41.635 1.00 64.50  ? 127 GLU C OE1 1 
ATOM   3753 O  OE2 . GLU E 1 132 ? 72.441  59.283 40.721 1.00 63.27  ? 127 GLU C OE2 1 
ATOM   3754 N  N   . GLU E 1 133 ? 69.383  56.544 44.199 1.00 46.98  ? 128 GLU C N   1 
ATOM   3755 C  CA  . GLU E 1 133 ? 70.290  56.115 45.250 1.00 44.74  ? 128 GLU C CA  1 
ATOM   3756 C  C   . GLU E 1 133 ? 69.871  54.772 45.843 1.00 42.58  ? 128 GLU C C   1 
ATOM   3757 O  O   . GLU E 1 133 ? 69.161  54.711 46.847 1.00 41.90  ? 128 GLU C O   1 
ATOM   3758 C  CB  . GLU E 1 133 ? 70.343  57.188 46.337 1.00 45.52  ? 128 GLU C CB  1 
ATOM   3759 C  CG  . GLU E 1 133 ? 70.822  58.553 45.845 1.00 46.29  ? 128 GLU C CG  1 
ATOM   3760 C  CD  . GLU E 1 133 ? 72.216  58.511 45.222 1.00 47.81  ? 128 GLU C CD  1 
ATOM   3761 O  OE1 . GLU E 1 133 ? 73.023  57.637 45.611 1.00 45.47  ? 128 GLU C OE1 1 
ATOM   3762 O  OE2 . GLU E 1 133 ? 72.511  59.367 44.354 1.00 49.49  ? 128 GLU C OE2 1 
ATOM   3763 N  N   . ALA E 1 134 ? 70.336  53.701 45.211 1.00 41.06  ? 129 ALA C N   1 
ATOM   3764 C  CA  . ALA E 1 134 ? 70.028  52.332 45.623 1.00 40.32  ? 129 ALA C CA  1 
ATOM   3765 C  C   . ALA E 1 134 ? 70.420  52.001 47.065 1.00 38.63  ? 129 ALA C C   1 
ATOM   3766 O  O   . ALA E 1 134 ? 69.647  51.378 47.811 1.00 37.90  ? 129 ALA C O   1 
ATOM   3767 C  CB  . ALA E 1 134 ? 70.706  51.347 44.670 1.00 38.06  ? 129 ALA C CB  1 
ATOM   3768 N  N   . LYS E 1 135 ? 71.621  52.407 47.454 1.00 36.09  ? 130 LYS C N   1 
ATOM   3769 C  CA  . LYS E 1 135 ? 72.098  52.124 48.796 1.00 34.40  ? 130 LYS C CA  1 
ATOM   3770 C  C   . LYS E 1 135 ? 71.204  52.684 49.891 1.00 33.82  ? 130 LYS C C   1 
ATOM   3771 O  O   . LYS E 1 135 ? 71.134  52.115 50.980 1.00 34.41  ? 130 LYS C O   1 
ATOM   3772 C  CB  . LYS E 1 135 ? 73.531  52.622 48.951 1.00 35.89  ? 130 LYS C CB  1 
ATOM   3773 C  CG  . LYS E 1 135 ? 74.512  51.786 48.138 1.00 33.89  ? 130 LYS C CG  1 
ATOM   3774 C  CD  . LYS E 1 135 ? 75.863  52.441 48.050 1.00 34.16  ? 130 LYS C CD  1 
ATOM   3775 C  CE  . LYS E 1 135 ? 76.817  51.582 47.244 1.00 33.03  ? 130 LYS C CE  1 
ATOM   3776 N  NZ  . LYS E 1 135 ? 78.136  52.254 47.123 1.00 35.17  ? 130 LYS C NZ  1 
ATOM   3777 N  N   . ILE E 1 136 ? 70.504  53.781 49.616 1.00 33.09  ? 131 ILE C N   1 
ATOM   3778 C  CA  . ILE E 1 136 ? 69.615  54.342 50.625 1.00 32.37  ? 131 ILE C CA  1 
ATOM   3779 C  C   . ILE E 1 136 ? 68.453  53.375 50.814 1.00 33.06  ? 131 ILE C C   1 
ATOM   3780 O  O   . ILE E 1 136 ? 67.988  53.173 51.937 1.00 32.50  ? 131 ILE C O   1 
ATOM   3781 C  CB  . ILE E 1 136 ? 69.075  55.743 50.226 1.00 31.64  ? 131 ILE C CB  1 
ATOM   3782 C  CG1 . ILE E 1 136 ? 70.230  56.745 50.123 1.00 30.80  ? 131 ILE C CG1 1 
ATOM   3783 C  CG2 . ILE E 1 136 ? 68.078  56.228 51.268 1.00 29.43  ? 131 ILE C CG2 1 
ATOM   3784 C  CD1 . ILE E 1 136 ? 69.793  58.166 49.760 1.00 27.24  ? 131 ILE C CD1 1 
ATOM   3785 N  N   . LYS E 1 137 ? 67.992  52.774 49.717 1.00 34.56  ? 132 LYS C N   1 
ATOM   3786 C  CA  . LYS E 1 137 ? 66.903  51.794 49.771 1.00 36.02  ? 132 LYS C CA  1 
ATOM   3787 C  C   . LYS E 1 137 ? 67.403  50.556 50.504 1.00 35.84  ? 132 LYS C C   1 
ATOM   3788 O  O   . LYS E 1 137 ? 66.706  49.997 51.349 1.00 36.68  ? 132 LYS C O   1 
ATOM   3789 C  CB  . LYS E 1 137 ? 66.478  51.364 48.369 1.00 37.70  ? 132 LYS C CB  1 
ATOM   3790 C  CG  . LYS E 1 137 ? 66.105  52.495 47.449 1.00 42.08  ? 132 LYS C CG  1 
ATOM   3791 C  CD  . LYS E 1 137 ? 64.669  52.949 47.629 1.00 44.53  ? 132 LYS C CD  1 
ATOM   3792 C  CE  . LYS E 1 137 ? 64.323  54.027 46.599 1.00 44.75  ? 132 LYS C CE  1 
ATOM   3793 N  NZ  . LYS E 1 137 ? 64.706  53.617 45.211 1.00 46.08  ? 132 LYS C NZ  1 
ATOM   3794 N  N   . ASP E 1 138 ? 68.611  50.119 50.162 1.00 36.46  ? 133 ASP C N   1 
ATOM   3795 C  CA  . ASP E 1 138 ? 69.196  48.941 50.799 1.00 36.85  ? 133 ASP C CA  1 
ATOM   3796 C  C   . ASP E 1 138 ? 69.307  49.101 52.307 1.00 34.64  ? 133 ASP C C   1 
ATOM   3797 O  O   . ASP E 1 138 ? 69.072  48.153 53.049 1.00 34.10  ? 133 ASP C O   1 
ATOM   3798 C  CB  . ASP E 1 138 ? 70.587  48.649 50.235 1.00 40.04  ? 133 ASP C CB  1 
ATOM   3799 C  CG  . ASP E 1 138 ? 70.540  48.002 48.863 1.00 45.70  ? 133 ASP C CG  1 
ATOM   3800 O  OD1 . ASP E 1 138 ? 69.609  47.190 48.624 1.00 47.10  ? 133 ASP C OD1 1 
ATOM   3801 O  OD2 . ASP E 1 138 ? 71.443  48.291 48.035 1.00 47.26  ? 133 ASP C OD2 1 
ATOM   3802 N  N   . ALA E 1 139 ? 69.677  50.300 52.752 1.00 32.48  ? 134 ALA C N   1 
ATOM   3803 C  CA  . ALA E 1 139 ? 69.828  50.583 54.175 1.00 29.64  ? 134 ALA C CA  1 
ATOM   3804 C  C   . ALA E 1 139 ? 68.475  50.623 54.844 1.00 29.13  ? 134 ALA C C   1 
ATOM   3805 O  O   . ALA E 1 139 ? 68.276  50.024 55.905 1.00 27.78  ? 134 ALA C O   1 
ATOM   3806 C  CB  . ALA E 1 139 ? 70.546  51.913 54.381 1.00 27.04  ? 134 ALA C CB  1 
ATOM   3807 N  N   . TYR E 1 140 ? 67.539  51.328 54.217 1.00 29.91  ? 135 TYR C N   1 
ATOM   3808 C  CA  . TYR E 1 140 ? 66.202  51.441 54.774 1.00 30.11  ? 135 TYR C CA  1 
ATOM   3809 C  C   . TYR E 1 140 ? 65.509  50.087 54.872 1.00 31.94  ? 135 TYR C C   1 
ATOM   3810 O  O   . TYR E 1 140 ? 64.863  49.797 55.877 1.00 32.03  ? 135 TYR C O   1 
ATOM   3811 C  CB  . TYR E 1 140 ? 65.347  52.386 53.931 1.00 28.17  ? 135 TYR C CB  1 
ATOM   3812 C  CG  . TYR E 1 140 ? 63.989  52.690 54.544 1.00 25.70  ? 135 TYR C CG  1 
ATOM   3813 C  CD1 . TYR E 1 140 ? 63.883  53.466 55.693 1.00 22.20  ? 135 TYR C CD1 1 
ATOM   3814 C  CD2 . TYR E 1 140 ? 62.815  52.198 53.969 1.00 25.06  ? 135 TYR C CD2 1 
ATOM   3815 C  CE1 . TYR E 1 140 ? 62.650  53.746 56.258 1.00 26.86  ? 135 TYR C CE1 1 
ATOM   3816 C  CE2 . TYR E 1 140 ? 61.566  52.471 54.526 1.00 26.05  ? 135 TYR C CE2 1 
ATOM   3817 C  CZ  . TYR E 1 140 ? 61.494  53.245 55.671 1.00 27.75  ? 135 TYR C CZ  1 
ATOM   3818 O  OH  . TYR E 1 140 ? 60.275  53.504 56.244 1.00 27.00  ? 135 TYR C OH  1 
ATOM   3819 N  N   . HIS E 1 141 ? 65.635  49.259 53.840 1.00 35.10  ? 136 HIS C N   1 
ATOM   3820 C  CA  . HIS E 1 141 ? 64.980  47.952 53.857 1.00 40.32  ? 136 HIS C CA  1 
ATOM   3821 C  C   . HIS E 1 141 ? 65.467  47.105 55.017 1.00 41.85  ? 136 HIS C C   1 
ATOM   3822 O  O   . HIS E 1 141 ? 64.675  46.592 55.808 1.00 42.78  ? 136 HIS C O   1 
ATOM   3823 C  CB  . HIS E 1 141 ? 65.202  47.205 52.538 1.00 40.79  ? 136 HIS C CB  1 
ATOM   3824 C  CG  . HIS E 1 141 ? 64.352  47.710 51.415 1.00 45.89  ? 136 HIS C CG  1 
ATOM   3825 N  ND1 . HIS E 1 141 ? 63.245  48.508 51.623 1.00 47.88  ? 136 HIS C ND1 1 
ATOM   3826 C  CD2 . HIS E 1 141 ? 64.432  47.519 50.077 1.00 46.36  ? 136 HIS C CD2 1 
ATOM   3827 C  CE1 . HIS E 1 141 ? 62.682  48.788 50.461 1.00 46.88  ? 136 HIS C CE1 1 
ATOM   3828 N  NE2 . HIS E 1 141 ? 63.383  48.199 49.507 1.00 46.46  ? 136 HIS C NE2 1 
HETATM 3829 N  N   . MSE E 1 142 ? 66.777  46.962 55.120 1.00 44.14  ? 137 MSE C N   1 
HETATM 3830 C  CA  . MSE E 1 142 ? 67.351  46.181 56.195 1.00 47.09  ? 137 MSE C CA  1 
HETATM 3831 C  C   . MSE E 1 142 ? 66.788  46.633 57.556 1.00 45.81  ? 137 MSE C C   1 
HETATM 3832 O  O   . MSE E 1 142 ? 66.417  45.801 58.388 1.00 45.59  ? 137 MSE C O   1 
HETATM 3833 C  CB  . MSE E 1 142 ? 68.866  46.318 56.159 1.00 51.66  ? 137 MSE C CB  1 
HETATM 3834 C  CG  . MSE E 1 142 ? 69.574  45.371 57.084 1.00 60.81  ? 137 MSE C CG  1 
HETATM 3835 SE SE  . MSE E 1 142 ? 70.700  46.385 58.239 1.00 73.09  ? 137 MSE C SE  1 
HETATM 3836 C  CE  . MSE E 1 142 ? 69.379  46.850 59.581 1.00 67.19  ? 137 MSE C CE  1 
ATOM   3837 N  N   . LEU E 1 143 ? 66.714  47.946 57.775 1.00 42.99  ? 138 LEU C N   1 
ATOM   3838 C  CA  . LEU E 1 143 ? 66.173  48.473 59.023 1.00 40.99  ? 138 LEU C CA  1 
ATOM   3839 C  C   . LEU E 1 143 ? 64.726  48.018 59.200 1.00 41.67  ? 138 LEU C C   1 
ATOM   3840 O  O   . LEU E 1 143 ? 64.206  47.975 60.320 1.00 40.82  ? 138 LEU C O   1 
ATOM   3841 C  CB  . LEU E 1 143 ? 66.229  50.005 59.043 1.00 37.91  ? 138 LEU C CB  1 
ATOM   3842 C  CG  . LEU E 1 143 ? 67.602  50.663 59.193 1.00 38.40  ? 138 LEU C CG  1 
ATOM   3843 C  CD1 . LEU E 1 143 ? 67.463  52.175 59.043 1.00 35.85  ? 138 LEU C CD1 1 
ATOM   3844 C  CD2 . LEU E 1 143 ? 68.206  50.300 60.554 1.00 35.52  ? 138 LEU C CD2 1 
ATOM   3845 N  N   . LYS E 1 144 ? 64.065  47.700 58.091 1.00 42.14  ? 139 LYS C N   1 
ATOM   3846 C  CA  . LYS E 1 144 ? 62.690  47.234 58.165 1.00 43.06  ? 139 LYS C CA  1 
ATOM   3847 C  C   . LYS E 1 144 ? 62.731  45.747 58.469 1.00 42.89  ? 139 LYS C C   1 
ATOM   3848 O  O   . LYS E 1 144 ? 61.949  45.249 59.272 1.00 42.47  ? 139 LYS C O   1 
ATOM   3849 C  CB  . LYS E 1 144 ? 61.952  47.480 56.847 1.00 44.34  ? 139 LYS C CB  1 
ATOM   3850 C  CG  . LYS E 1 144 ? 61.875  48.944 56.441 1.00 46.87  ? 139 LYS C CG  1 
ATOM   3851 C  CD  . LYS E 1 144 ? 60.577  49.249 55.715 1.00 48.90  ? 139 LYS C CD  1 
ATOM   3852 C  CE  . LYS E 1 144 ? 59.381  49.077 56.647 1.00 50.33  ? 139 LYS C CE  1 
ATOM   3853 N  NZ  . LYS E 1 144 ? 58.093  49.424 55.988 1.00 49.90  ? 139 LYS C NZ  1 
ATOM   3854 N  N   . ARG E 1 145 ? 63.659  45.048 57.823 1.00 43.33  ? 140 ARG C N   1 
ATOM   3855 C  CA  . ARG E 1 145 ? 63.824  43.610 58.017 1.00 44.58  ? 140 ARG C CA  1 
ATOM   3856 C  C   . ARG E 1 145 ? 64.260  43.308 59.435 1.00 44.37  ? 140 ARG C C   1 
ATOM   3857 O  O   . ARG E 1 145 ? 64.004  42.221 59.951 1.00 45.08  ? 140 ARG C O   1 
ATOM   3858 C  CB  . ARG E 1 145 ? 64.888  43.049 57.077 1.00 44.03  ? 140 ARG C CB  1 
ATOM   3859 C  CG  . ARG E 1 145 ? 64.409  42.628 55.724 1.00 45.26  ? 140 ARG C CG  1 
ATOM   3860 C  CD  . ARG E 1 145 ? 65.584  42.025 54.975 1.00 50.53  ? 140 ARG C CD  1 
ATOM   3861 N  NE  . ARG E 1 145 ? 66.687  42.982 54.876 1.00 55.38  ? 140 ARG C NE  1 
ATOM   3862 C  CZ  . ARG E 1 145 ? 67.916  42.679 54.469 1.00 57.17  ? 140 ARG C CZ  1 
ATOM   3863 N  NH1 . ARG E 1 145 ? 68.217  41.432 54.120 1.00 57.63  ? 140 ARG C NH1 1 
ATOM   3864 N  NH2 . ARG E 1 145 ? 68.847  43.625 54.411 1.00 57.47  ? 140 ARG C NH2 1 
ATOM   3865 N  N   . GLN E 1 146 ? 64.945  44.263 60.052 1.00 44.03  ? 141 GLN C N   1 
ATOM   3866 C  CA  . GLN E 1 146 ? 65.427  44.075 61.410 1.00 44.49  ? 141 GLN C CA  1 
ATOM   3867 C  C   . GLN E 1 146 ? 64.476  44.626 62.465 1.00 42.99  ? 141 GLN C C   1 
ATOM   3868 O  O   . GLN E 1 146 ? 64.771  44.577 63.658 1.00 43.97  ? 141 GLN C O   1 
ATOM   3869 C  CB  . GLN E 1 146 ? 66.821  44.691 61.563 1.00 45.86  ? 141 GLN C CB  1 
ATOM   3870 C  CG  . GLN E 1 146 ? 67.903  43.938 60.783 1.00 49.08  ? 141 GLN C CG  1 
ATOM   3871 C  CD  . GLN E 1 146 ? 68.050  42.480 61.223 1.00 51.57  ? 141 GLN C CD  1 
ATOM   3872 O  OE1 . GLN E 1 146 ? 68.344  42.193 62.390 1.00 52.13  ? 141 GLN C OE1 1 
ATOM   3873 N  NE2 . GLN E 1 146 ? 67.846  41.554 60.287 1.00 51.22  ? 141 GLN C NE2 1 
ATOM   3874 N  N   . GLY E 1 147 ? 63.333  45.142 62.026 1.00 40.76  ? 142 GLY C N   1 
ATOM   3875 C  CA  . GLY E 1 147 ? 62.360  45.662 62.963 1.00 38.78  ? 142 GLY C CA  1 
ATOM   3876 C  C   . GLY E 1 147 ? 62.625  47.026 63.579 1.00 39.49  ? 142 GLY C C   1 
ATOM   3877 O  O   . GLY E 1 147 ? 61.831  47.476 64.415 1.00 39.63  ? 142 GLY C O   1 
ATOM   3878 N  N   . ILE E 1 148 ? 63.718  47.693 63.208 1.00 38.35  ? 143 ILE C N   1 
ATOM   3879 C  CA  . ILE E 1 148 ? 63.972  49.023 63.764 1.00 39.22  ? 143 ILE C CA  1 
ATOM   3880 C  C   . ILE E 1 148 ? 62.849  49.948 63.270 1.00 38.19  ? 143 ILE C C   1 
ATOM   3881 O  O   . ILE E 1 148 ? 62.387  50.835 63.986 1.00 37.75  ? 143 ILE C O   1 
ATOM   3882 C  CB  . ILE E 1 148 ? 65.358  49.593 63.331 1.00 40.61  ? 143 ILE C CB  1 
ATOM   3883 C  CG1 . ILE E 1 148 ? 66.494  48.900 64.097 1.00 41.44  ? 143 ILE C CG1 1 
ATOM   3884 C  CG2 . ILE E 1 148 ? 65.421  51.091 63.633 1.00 40.57  ? 143 ILE C CG2 1 
ATOM   3885 C  CD1 . ILE E 1 148 ? 66.623  47.410 63.843 1.00 43.44  ? 143 ILE C CD1 1 
ATOM   3886 N  N   . VAL E 1 149 ? 62.417  49.729 62.034 1.00 38.25  ? 144 VAL C N   1 
ATOM   3887 C  CA  . VAL E 1 149 ? 61.327  50.502 61.457 1.00 38.75  ? 144 VAL C CA  1 
ATOM   3888 C  C   . VAL E 1 149 ? 60.162  49.535 61.294 1.00 40.07  ? 144 VAL C C   1 
ATOM   3889 O  O   . VAL E 1 149 ? 60.217  48.634 60.461 1.00 39.88  ? 144 VAL C O   1 
ATOM   3890 C  CB  . VAL E 1 149 ? 61.689  51.063 60.065 1.00 37.47  ? 144 VAL C CB  1 
ATOM   3891 C  CG1 . VAL E 1 149 ? 60.480  51.781 59.455 1.00 34.70  ? 144 VAL C CG1 1 
ATOM   3892 C  CG2 . VAL E 1 149 ? 62.855  52.006 60.181 1.00 36.50  ? 144 VAL C CG2 1 
ATOM   3893 N  N   . GLN E 1 150 ? 59.115  49.717 62.093 1.00 42.28  ? 145 GLN C N   1 
ATOM   3894 C  CA  . GLN E 1 150 ? 57.944  48.847 62.025 1.00 45.17  ? 145 GLN C CA  1 
ATOM   3895 C  C   . GLN E 1 150 ? 57.134  49.107 60.755 1.00 45.00  ? 145 GLN C C   1 
ATOM   3896 O  O   . GLN E 1 150 ? 56.813  48.173 60.011 1.00 44.98  ? 145 GLN C O   1 
ATOM   3897 C  CB  . GLN E 1 150 ? 57.069  49.065 63.258 1.00 48.27  ? 145 GLN C CB  1 
ATOM   3898 C  CG  . GLN E 1 150 ? 57.771  48.725 64.558 1.00 53.00  ? 145 GLN C CG  1 
ATOM   3899 C  CD  . GLN E 1 150 ? 57.306  49.595 65.710 1.00 56.93  ? 145 GLN C CD  1 
ATOM   3900 O  OE1 . GLN E 1 150 ? 56.113  49.632 66.038 1.00 58.58  ? 145 GLN C OE1 1 
ATOM   3901 N  NE2 . GLN E 1 150 ? 58.248  50.309 66.334 1.00 56.91  ? 145 GLN C NE2 1 
ATOM   3902 N  N   . SER E 1 151 ? 56.806  50.376 60.520 1.00 43.80  ? 146 SER C N   1 
ATOM   3903 C  CA  . SER E 1 151 ? 56.051  50.777 59.335 1.00 41.90  ? 146 SER C CA  1 
ATOM   3904 C  C   . SER E 1 151 ? 56.615  52.087 58.778 1.00 40.44  ? 146 SER C C   1 
ATOM   3905 O  O   . SER E 1 151 ? 57.258  52.854 59.508 1.00 39.42  ? 146 SER C O   1 
ATOM   3906 C  CB  . SER E 1 151 ? 54.565  50.954 59.681 1.00 43.31  ? 146 SER C CB  1 
ATOM   3907 O  OG  . SER E 1 151 ? 54.368  51.992 60.627 1.00 44.05  ? 146 SER C OG  1 
ATOM   3908 N  N   . ASP E 1 152 ? 56.387  52.340 57.489 1.00 37.27  ? 147 ASP C N   1 
ATOM   3909 C  CA  . ASP E 1 152 ? 56.882  53.571 56.880 1.00 34.90  ? 147 ASP C CA  1 
ATOM   3910 C  C   . ASP E 1 152 ? 56.266  54.771 57.583 1.00 31.81  ? 147 ASP C C   1 
ATOM   3911 O  O   . ASP E 1 152 ? 55.103  54.750 57.950 1.00 31.59  ? 147 ASP C O   1 
ATOM   3912 C  CB  . ASP E 1 152 ? 56.558  53.607 55.384 1.00 34.68  ? 147 ASP C CB  1 
ATOM   3913 C  CG  . ASP E 1 152 ? 57.258  52.501 54.619 1.00 35.03  ? 147 ASP C CG  1 
ATOM   3914 O  OD1 . ASP E 1 152 ? 58.350  52.082 55.059 1.00 36.09  ? 147 ASP C OD1 1 
ATOM   3915 O  OD2 . ASP E 1 152 ? 56.735  52.055 53.580 1.00 36.02  ? 147 ASP C OD2 1 
ATOM   3916 N  N   . PRO E 1 153 ? 57.054  55.829 57.805 1.00 29.80  ? 148 PRO C N   1 
ATOM   3917 C  CA  . PRO E 1 153 ? 56.505  57.006 58.483 1.00 27.43  ? 148 PRO C CA  1 
ATOM   3918 C  C   . PRO E 1 153 ? 55.973  58.064 57.528 1.00 27.69  ? 148 PRO C C   1 
ATOM   3919 O  O   . PRO E 1 153 ? 56.279  58.056 56.325 1.00 24.17  ? 148 PRO C O   1 
ATOM   3920 C  CB  . PRO E 1 153 ? 57.702  57.533 59.249 1.00 27.68  ? 148 PRO C CB  1 
ATOM   3921 C  CG  . PRO E 1 153 ? 58.814  57.323 58.223 1.00 25.47  ? 148 PRO C CG  1 
ATOM   3922 C  CD  . PRO E 1 153 ? 58.530  55.899 57.741 1.00 26.09  ? 148 PRO C CD  1 
ATOM   3923 N  N   . PRO E 1 154 ? 55.152  58.989 58.053 1.00 26.50  ? 149 PRO C N   1 
ATOM   3924 C  CA  . PRO E 1 154 ? 54.616  60.045 57.195 1.00 27.52  ? 149 PRO C CA  1 
ATOM   3925 C  C   . PRO E 1 154 ? 55.742  61.064 57.007 1.00 27.37  ? 149 PRO C C   1 
ATOM   3926 O  O   . PRO E 1 154 ? 56.605  61.208 57.874 1.00 28.20  ? 149 PRO C O   1 
ATOM   3927 C  CB  . PRO E 1 154 ? 53.433  60.580 58.005 1.00 27.32  ? 149 PRO C CB  1 
ATOM   3928 C  CG  . PRO E 1 154 ? 53.865  60.365 59.412 1.00 26.94  ? 149 PRO C CG  1 
ATOM   3929 C  CD  . PRO E 1 154 ? 54.509  59.002 59.378 1.00 24.86  ? 149 PRO C CD  1 
ATOM   3930 N  N   . ILE E 1 155 ? 55.759  61.761 55.882 1.00 26.19  ? 150 ILE C N   1 
ATOM   3931 C  CA  . ILE E 1 155 ? 56.828  62.717 55.654 1.00 26.34  ? 150 ILE C CA  1 
ATOM   3932 C  C   . ILE E 1 155 ? 56.319  64.051 55.126 1.00 27.20  ? 150 ILE C C   1 
ATOM   3933 O  O   . ILE E 1 155 ? 55.195  64.143 54.628 1.00 26.07  ? 150 ILE C O   1 
ATOM   3934 C  CB  . ILE E 1 155 ? 57.848  62.146 54.649 1.00 25.09  ? 150 ILE C CB  1 
ATOM   3935 C  CG1 . ILE E 1 155 ? 57.155  61.882 53.308 1.00 23.32  ? 150 ILE C CG1 1 
ATOM   3936 C  CG2 . ILE E 1 155 ? 58.447  60.859 55.198 1.00 22.48  ? 150 ILE C CG2 1 
ATOM   3937 C  CD1 . ILE E 1 155 ? 58.057  61.295 52.242 1.00 23.81  ? 150 ILE C CD1 1 
ATOM   3938 N  N   . PRO E 1 156 ? 57.137  65.109 55.248 1.00 27.22  ? 151 PRO C N   1 
ATOM   3939 C  CA  . PRO E 1 156 ? 56.737  66.433 54.758 1.00 27.70  ? 151 PRO C CA  1 
ATOM   3940 C  C   . PRO E 1 156 ? 56.522  66.262 53.272 1.00 27.03  ? 151 PRO C C   1 
ATOM   3941 O  O   . PRO E 1 156 ? 57.230  65.472 52.641 1.00 25.41  ? 151 PRO C O   1 
ATOM   3942 C  CB  . PRO E 1 156 ? 57.960  67.302 55.055 1.00 27.84  ? 151 PRO C CB  1 
ATOM   3943 C  CG  . PRO E 1 156 ? 58.562  66.641 56.265 1.00 29.87  ? 151 PRO C CG  1 
ATOM   3944 C  CD  . PRO E 1 156 ? 58.439  65.165 55.935 1.00 28.04  ? 151 PRO C CD  1 
ATOM   3945 N  N   . VAL E 1 157 ? 55.569  66.993 52.700 1.00 28.67  ? 152 VAL C N   1 
ATOM   3946 C  CA  . VAL E 1 157 ? 55.287  66.855 51.269 1.00 31.18  ? 152 VAL C CA  1 
ATOM   3947 C  C   . VAL E 1 157 ? 54.851  68.136 50.560 1.00 32.35  ? 152 VAL C C   1 
ATOM   3948 O  O   . VAL E 1 157 ? 54.255  69.024 51.163 1.00 33.47  ? 152 VAL C O   1 
ATOM   3949 C  CB  . VAL E 1 157 ? 54.157  65.809 51.040 1.00 32.51  ? 152 VAL C CB  1 
ATOM   3950 C  CG1 . VAL E 1 157 ? 53.904  65.615 49.555 1.00 31.77  ? 152 VAL C CG1 1 
ATOM   3951 C  CG2 . VAL E 1 157 ? 54.527  64.487 51.687 1.00 33.70  ? 152 VAL C CG2 1 
ATOM   3952 N  N   . ASP E 1 158 ? 55.175  68.231 49.275 1.00 34.72  ? 153 ASP C N   1 
ATOM   3953 C  CA  . ASP E 1 158 ? 54.728  69.346 48.444 1.00 36.08  ? 153 ASP C CA  1 
ATOM   3954 C  C   . ASP E 1 158 ? 54.639  68.769 47.041 1.00 36.31  ? 153 ASP C C   1 
ATOM   3955 O  O   . ASP E 1 158 ? 54.953  67.591 46.841 1.00 35.38  ? 153 ASP C O   1 
ATOM   3956 C  CB  . ASP E 1 158 ? 55.653  70.581 48.514 1.00 35.84  ? 153 ASP C CB  1 
ATOM   3957 C  CG  . ASP E 1 158 ? 57.027  70.345 47.927 1.00 39.57  ? 153 ASP C CG  1 
ATOM   3958 O  OD1 . ASP E 1 158 ? 57.149  69.613 46.918 1.00 39.22  ? 153 ASP C OD1 1 
ATOM   3959 O  OD2 . ASP E 1 158 ? 57.995  70.928 48.469 1.00 41.11  ? 153 ASP C OD2 1 
ATOM   3960 N  N   . ARG E 1 159 ? 54.210  69.567 46.072 1.00 38.08  ? 154 ARG C N   1 
ATOM   3961 C  CA  . ARG E 1 159 ? 54.055  69.047 44.720 1.00 40.25  ? 154 ARG C CA  1 
ATOM   3962 C  C   . ARG E 1 159 ? 55.312  68.755 43.901 1.00 41.00  ? 154 ARG C C   1 
ATOM   3963 O  O   . ARG E 1 159 ? 55.215  68.226 42.789 1.00 41.42  ? 154 ARG C O   1 
ATOM   3964 C  CB  . ARG E 1 159 ? 53.098  69.941 43.940 1.00 41.19  ? 154 ARG C CB  1 
ATOM   3965 C  CG  . ARG E 1 159 ? 51.690  69.900 44.513 1.00 43.06  ? 154 ARG C CG  1 
ATOM   3966 C  CD  . ARG E 1 159 ? 50.735  70.792 43.750 1.00 43.30  ? 154 ARG C CD  1 
ATOM   3967 N  NE  . ARG E 1 159 ? 49.512  71.036 44.506 1.00 42.59  ? 154 ARG C NE  1 
ATOM   3968 C  CZ  . ARG E 1 159 ? 48.565  70.129 44.725 1.00 42.63  ? 154 ARG C CZ  1 
ATOM   3969 N  NH1 . ARG E 1 159 ? 48.686  68.895 44.242 1.00 39.26  ? 154 ARG C NH1 1 
ATOM   3970 N  NH2 . ARG E 1 159 ? 47.490  70.466 45.429 1.00 39.59  ? 154 ARG C NH2 1 
ATOM   3971 N  N   . THR E 1 160 ? 56.489  69.087 44.426 1.00 41.98  ? 155 THR C N   1 
ATOM   3972 C  CA  . THR E 1 160 ? 57.721  68.764 43.705 1.00 42.17  ? 155 THR C CA  1 
ATOM   3973 C  C   . THR E 1 160 ? 57.983  67.310 44.097 1.00 44.45  ? 155 THR C C   1 
ATOM   3974 O  O   . THR E 1 160 ? 59.119  66.835 44.100 1.00 45.12  ? 155 THR C O   1 
ATOM   3975 C  CB  . THR E 1 160 ? 58.929  69.660 44.119 1.00 39.57  ? 155 THR C CB  1 
ATOM   3976 O  OG1 . THR E 1 160 ? 59.222  69.474 45.506 1.00 39.45  ? 155 THR C OG1 1 
ATOM   3977 C  CG2 . THR E 1 160 ? 58.621  71.128 43.872 1.00 36.78  ? 155 THR C CG2 1 
ATOM   3978 N  N   . LEU E 1 161 ? 56.886  66.631 44.439 1.00 46.83  ? 156 LEU C N   1 
ATOM   3979 C  CA  . LEU E 1 161 ? 56.866  65.224 44.843 1.00 47.81  ? 156 LEU C CA  1 
ATOM   3980 C  C   . LEU E 1 161 ? 55.451  64.671 44.659 1.00 47.57  ? 156 LEU C C   1 
ATOM   3981 O  O   . LEU E 1 161 ? 55.163  63.953 43.696 1.00 48.54  ? 156 LEU C O   1 
ATOM   3982 C  CB  . LEU E 1 161 ? 57.277  65.070 46.313 1.00 47.19  ? 156 LEU C CB  1 
ATOM   3983 C  CG  . LEU E 1 161 ? 58.753  65.204 46.681 1.00 47.00  ? 156 LEU C CG  1 
ATOM   3984 C  CD1 . LEU E 1 161 ? 58.907  64.962 48.179 1.00 47.94  ? 156 LEU C CD1 1 
ATOM   3985 C  CD2 . LEU E 1 161 ? 59.589  64.192 45.891 1.00 46.94  ? 156 LEU C CD2 1 
ATOM   3986 N  N   . SER F 2 5   ? 85.162  51.195 46.591 1.00 60.78  ? 305 SER G N   1 
ATOM   3987 C  CA  . SER F 2 5   ? 85.749  52.122 47.554 1.00 60.51  ? 305 SER G CA  1 
ATOM   3988 C  C   . SER F 2 5   ? 84.770  52.432 48.688 1.00 59.56  ? 305 SER G C   1 
ATOM   3989 O  O   . SER F 2 5   ? 85.143  53.052 49.688 1.00 60.90  ? 305 SER G O   1 
ATOM   3990 C  CB  . SER F 2 5   ? 86.163  53.428 46.855 1.00 61.11  ? 305 SER G CB  1 
ATOM   3991 O  OG  . SER F 2 5   ? 86.811  54.317 47.755 1.00 60.50  ? 305 SER G OG  1 
ATOM   3992 N  N   . ASP F 2 6   ? 83.517  52.009 48.531 1.00 56.63  ? 306 ASP G N   1 
ATOM   3993 C  CA  . ASP F 2 6   ? 82.516  52.246 49.564 1.00 53.87  ? 306 ASP G CA  1 
ATOM   3994 C  C   . ASP F 2 6   ? 82.704  51.209 50.669 1.00 53.04  ? 306 ASP G C   1 
ATOM   3995 O  O   . ASP F 2 6   ? 83.539  50.315 50.564 1.00 52.21  ? 306 ASP G O   1 
ATOM   3996 C  CB  . ASP F 2 6   ? 81.095  52.133 48.985 1.00 50.20  ? 306 ASP G CB  1 
ATOM   3997 C  CG  . ASP F 2 6   ? 80.029  52.739 49.904 1.00 48.57  ? 306 ASP G CG  1 
ATOM   3998 O  OD1 . ASP F 2 6   ? 80.393  53.341 50.939 1.00 46.98  ? 306 ASP G OD1 1 
ATOM   3999 O  OD2 . ASP F 2 6   ? 78.822  52.624 49.591 1.00 47.10  ? 306 ASP G OD2 1 
ATOM   4000 N  N   . GLU F 2 7   ? 81.932  51.345 51.736 1.00 53.45  ? 307 GLU G N   1 
ATOM   4001 C  CA  . GLU F 2 7   ? 81.994  50.411 52.844 1.00 53.12  ? 307 GLU G CA  1 
ATOM   4002 C  C   . GLU F 2 7   ? 80.882  49.411 52.563 1.00 51.88  ? 307 GLU G C   1 
ATOM   4003 O  O   . GLU F 2 7   ? 80.167  49.548 51.573 1.00 51.25  ? 307 GLU G O   1 
ATOM   4004 C  CB  . GLU F 2 7   ? 81.705  51.138 54.158 1.00 54.60  ? 307 GLU G CB  1 
ATOM   4005 C  CG  . GLU F 2 7   ? 82.617  50.749 55.303 1.00 58.74  ? 307 GLU G CG  1 
ATOM   4006 C  CD  . GLU F 2 7   ? 83.874  51.597 55.359 1.00 61.10  ? 307 GLU G CD  1 
ATOM   4007 O  OE1 . GLU F 2 7   ? 83.973  52.571 54.579 1.00 63.08  ? 307 GLU G OE1 1 
ATOM   4008 O  OE2 . GLU F 2 7   ? 84.760  51.295 56.188 1.00 62.28  ? 307 GLU G OE2 1 
ATOM   4009 N  N   . ASP F 2 8   ? 80.746  48.402 53.417 1.00 51.48  ? 308 ASP G N   1 
ATOM   4010 C  CA  . ASP F 2 8   ? 79.678  47.420 53.256 1.00 50.59  ? 308 ASP G CA  1 
ATOM   4011 C  C   . ASP F 2 8   ? 78.545  47.876 54.170 1.00 48.70  ? 308 ASP G C   1 
ATOM   4012 O  O   . ASP F 2 8   ? 78.797  48.543 55.174 1.00 47.63  ? 308 ASP G O   1 
ATOM   4013 C  CB  . ASP F 2 8   ? 80.145  46.023 53.675 1.00 52.49  ? 308 ASP G CB  1 
ATOM   4014 C  CG  . ASP F 2 8   ? 81.255  45.484 52.791 1.00 55.67  ? 308 ASP G CG  1 
ATOM   4015 O  OD1 . ASP F 2 8   ? 81.133  45.585 51.547 1.00 56.32  ? 308 ASP G OD1 1 
ATOM   4016 O  OD2 . ASP F 2 8   ? 82.244  44.948 53.341 1.00 55.73  ? 308 ASP G OD2 1 
ATOM   4017 N  N   . LEU F 2 9   ? 77.306  47.536 53.824 1.00 46.84  ? 309 LEU G N   1 
ATOM   4018 C  CA  . LEU F 2 9   ? 76.170  47.929 54.654 1.00 46.90  ? 309 LEU G CA  1 
ATOM   4019 C  C   . LEU F 2 9   ? 76.381  47.390 56.060 1.00 47.97  ? 309 LEU G C   1 
ATOM   4020 O  O   . LEU F 2 9   ? 76.689  46.216 56.245 1.00 47.24  ? 309 LEU G O   1 
ATOM   4021 C  CB  . LEU F 2 9   ? 74.859  47.372 54.088 1.00 44.99  ? 309 LEU G CB  1 
ATOM   4022 C  CG  . LEU F 2 9   ? 73.575  47.607 54.901 1.00 43.32  ? 309 LEU G CG  1 
ATOM   4023 C  CD1 . LEU F 2 9   ? 73.292  49.091 55.025 1.00 39.20  ? 309 LEU G CD1 1 
ATOM   4024 C  CD2 . LEU F 2 9   ? 72.403  46.908 54.221 1.00 41.55  ? 309 LEU G CD2 1 
ATOM   4025 N  N   . LEU F 2 10  ? 76.225  48.251 57.053 1.00 49.62  ? 310 LEU G N   1 
ATOM   4026 C  CA  . LEU F 2 10  ? 76.405  47.822 58.426 1.00 52.07  ? 310 LEU G CA  1 
ATOM   4027 C  C   . LEU F 2 10  ? 75.295  46.844 58.785 1.00 54.66  ? 310 LEU G C   1 
ATOM   4028 O  O   . LEU F 2 10  ? 74.120  47.084 58.480 1.00 53.82  ? 310 LEU G O   1 
ATOM   4029 C  CB  . LEU F 2 10  ? 76.375  49.028 59.370 1.00 51.10  ? 310 LEU G CB  1 
ATOM   4030 C  CG  . LEU F 2 10  ? 76.632  48.703 60.841 1.00 50.21  ? 310 LEU G CG  1 
ATOM   4031 C  CD1 . LEU F 2 10  ? 77.876  47.846 60.958 1.00 51.92  ? 310 LEU G CD1 1 
ATOM   4032 C  CD2 . LEU F 2 10  ? 76.797  49.977 61.637 1.00 50.10  ? 310 LEU G CD2 1 
ATOM   4033 N  N   . HIS F 2 11  ? 75.670  45.739 59.426 1.00 57.93  ? 311 HIS G N   1 
ATOM   4034 C  CA  . HIS F 2 11  ? 74.700  44.729 59.830 1.00 61.67  ? 311 HIS G CA  1 
ATOM   4035 C  C   . HIS F 2 11  ? 74.166  44.939 61.242 1.00 62.80  ? 311 HIS G C   1 
ATOM   4036 O  O   . HIS F 2 11  ? 74.929  45.005 62.208 1.00 62.71  ? 311 HIS G O   1 
ATOM   4037 C  CB  . HIS F 2 11  ? 75.310  43.333 59.704 1.00 64.38  ? 311 HIS G CB  1 
ATOM   4038 C  CG  . HIS F 2 11  ? 75.001  42.659 58.403 1.00 68.17  ? 311 HIS G CG  1 
ATOM   4039 N  ND1 . HIS F 2 11  ? 75.647  41.516 57.983 1.00 69.64  ? 311 HIS G ND1 1 
ATOM   4040 C  CD2 . HIS F 2 11  ? 74.098  42.958 57.438 1.00 69.66  ? 311 HIS G CD2 1 
ATOM   4041 C  CE1 . HIS F 2 11  ? 75.155  41.138 56.815 1.00 70.90  ? 311 HIS G CE1 1 
ATOM   4042 N  NE2 . HIS F 2 11  ? 74.213  41.996 56.463 1.00 71.96  ? 311 HIS G NE2 1 
ATOM   4043 N  N   . ILE F 2 12  ? 72.844  45.057 61.346 1.00 64.14  ? 312 ILE G N   1 
ATOM   4044 C  CA  . ILE F 2 12  ? 72.173  45.252 62.627 1.00 65.77  ? 312 ILE G CA  1 
ATOM   4045 C  C   . ILE F 2 12  ? 71.436  43.978 63.032 1.00 66.06  ? 312 ILE G C   1 
ATOM   4046 O  O   . ILE F 2 12  ? 71.169  43.142 62.136 1.00 66.45  ? 312 ILE G O   1 
ATOM   4047 C  CB  . ILE F 2 12  ? 71.155  46.423 62.548 1.00 66.68  ? 312 ILE G CB  1 
ATOM   4048 C  CG1 . ILE F 2 12  ? 71.910  47.736 62.359 1.00 67.20  ? 312 ILE G CG1 1 
ATOM   4049 C  CG2 . ILE F 2 12  ? 70.304  46.490 63.817 1.00 66.89  ? 312 ILE G CG2 1 
ATOM   4050 C  CD1 . ILE F 2 12  ? 72.911  48.003 63.459 1.00 67.39  ? 312 ILE G CD1 1 
ATOM   4051 O  OXT . ILE F 2 12  ? 71.126  43.837 64.236 1.00 66.51  ? 312 ILE G OXT 1 
ATOM   4052 N  N   . ALA G 1 2   ? 64.593  60.194 80.754 1.00 73.00  ? 202 ALA D N   1 
ATOM   4053 C  CA  . ALA G 1 2   ? 64.514  60.387 79.278 1.00 73.54  ? 202 ALA D CA  1 
ATOM   4054 C  C   . ALA G 1 2   ? 65.677  61.243 78.774 1.00 73.81  ? 202 ALA D C   1 
ATOM   4055 O  O   . ALA G 1 2   ? 65.483  62.401 78.388 1.00 74.44  ? 202 ALA D O   1 
ATOM   4056 C  CB  . ALA G 1 2   ? 63.180  61.042 78.906 1.00 72.88  ? 202 ALA D CB  1 
HETATM 4057 N  N   . MSE G 1 3   ? 66.877  60.664 78.786 1.00 73.49  ? 203 MSE D N   1 
HETATM 4058 C  CA  . MSE G 1 3   ? 68.108  61.325 78.330 1.00 73.22  ? 203 MSE D CA  1 
HETATM 4059 C  C   . MSE G 1 3   ? 68.839  62.139 79.391 1.00 70.11  ? 203 MSE D C   1 
HETATM 4060 O  O   . MSE G 1 3   ? 70.046  62.372 79.276 1.00 70.68  ? 203 MSE D O   1 
HETATM 4061 C  CB  . MSE G 1 3   ? 67.835  62.224 77.114 1.00 76.80  ? 203 MSE D CB  1 
HETATM 4062 C  CG  . MSE G 1 3   ? 67.390  61.469 75.875 1.00 82.32  ? 203 MSE D CG  1 
HETATM 4063 SE SE  . MSE G 1 3   ? 68.509  59.923 75.566 1.00 90.98  ? 203 MSE D SE  1 
HETATM 4064 C  CE  . MSE G 1 3   ? 70.239  60.821 75.571 1.00 88.72  ? 203 MSE D CE  1 
ATOM   4065 N  N   . GLY G 1 4   ? 68.110  62.573 80.417 1.00 66.12  ? 204 GLY D N   1 
ATOM   4066 C  CA  . GLY G 1 4   ? 68.716  63.358 81.476 1.00 61.24  ? 204 GLY D CA  1 
ATOM   4067 C  C   . GLY G 1 4   ? 69.037  64.778 81.054 1.00 57.75  ? 204 GLY D C   1 
ATOM   4068 O  O   . GLY G 1 4   ? 68.720  65.194 79.941 1.00 56.68  ? 204 GLY D O   1 
ATOM   4069 N  N   . SER G 1 5   ? 69.680  65.520 81.951 1.00 55.60  ? 205 SER D N   1 
ATOM   4070 C  CA  . SER G 1 5   ? 70.055  66.911 81.703 1.00 53.05  ? 205 SER D CA  1 
ATOM   4071 C  C   . SER G 1 5   ? 70.850  67.132 80.418 1.00 50.75  ? 205 SER D C   1 
ATOM   4072 O  O   . SER G 1 5   ? 71.008  68.271 79.977 1.00 49.62  ? 205 SER D O   1 
ATOM   4073 C  CB  . SER G 1 5   ? 70.868  67.446 82.884 1.00 54.01  ? 205 SER D CB  1 
ATOM   4074 O  OG  . SER G 1 5   ? 70.192  67.216 84.107 1.00 55.37  ? 205 SER D OG  1 
HETATM 4075 N  N   . MSE G 1 6   ? 71.365  66.056 79.827 1.00 49.02  ? 1   MSE D N   1 
HETATM 4076 C  CA  . MSE G 1 6   ? 72.132  66.186 78.595 1.00 46.88  ? 1   MSE D CA  1 
HETATM 4077 C  C   . MSE G 1 6   ? 71.264  66.799 77.500 1.00 47.24  ? 1   MSE D C   1 
HETATM 4078 O  O   . MSE G 1 6   ? 71.722  67.637 76.719 1.00 48.21  ? 1   MSE D O   1 
HETATM 4079 C  CB  . MSE G 1 6   ? 72.656  64.823 78.140 1.00 44.23  ? 1   MSE D CB  1 
HETATM 4080 C  CG  . MSE G 1 6   ? 73.220  64.806 76.712 1.00 41.51  ? 1   MSE D CG  1 
HETATM 4081 SE SE  . MSE G 1 6   ? 74.786  65.927 76.414 1.00 39.08  ? 1   MSE D SE  1 
HETATM 4082 C  CE  . MSE G 1 6   ? 76.102  64.681 77.096 1.00 35.62  ? 1   MSE D CE  1 
ATOM   4083 N  N   . ALA G 1 7   ? 70.004  66.385 77.447 1.00 46.93  ? 2   ALA D N   1 
ATOM   4084 C  CA  . ALA G 1 7   ? 69.090  66.898 76.441 1.00 47.71  ? 2   ALA D CA  1 
ATOM   4085 C  C   . ALA G 1 7   ? 68.452  68.210 76.887 1.00 48.84  ? 2   ALA D C   1 
ATOM   4086 O  O   . ALA G 1 7   ? 67.664  68.810 76.149 1.00 48.80  ? 2   ALA D O   1 
ATOM   4087 C  CB  . ALA G 1 7   ? 68.010  65.865 76.145 1.00 47.97  ? 2   ALA D CB  1 
ATOM   4088 N  N   . GLU G 1 8   ? 68.795  68.659 78.092 1.00 48.66  ? 3   GLU D N   1 
ATOM   4089 C  CA  . GLU G 1 8   ? 68.234  69.895 78.616 1.00 48.09  ? 3   GLU D CA  1 
ATOM   4090 C  C   . GLU G 1 8   ? 69.190  71.060 78.432 1.00 46.98  ? 3   GLU D C   1 
ATOM   4091 O  O   . GLU G 1 8   ? 70.190  70.941 77.726 1.00 46.47  ? 3   GLU D O   1 
ATOM   4092 C  CB  . GLU G 1 8   ? 67.892  69.740 80.101 1.00 49.29  ? 3   GLU D CB  1 
ATOM   4093 C  CG  . GLU G 1 8   ? 66.509  70.265 80.438 1.00 53.20  ? 3   GLU D CG  1 
ATOM   4094 C  CD  . GLU G 1 8   ? 65.420  69.397 79.842 1.00 54.16  ? 3   GLU D CD  1 
ATOM   4095 O  OE1 . GLU G 1 8   ? 65.712  68.217 79.555 1.00 54.76  ? 3   GLU D OE1 1 
ATOM   4096 O  OE2 . GLU G 1 8   ? 64.279  69.884 79.668 1.00 55.82  ? 3   GLU D OE2 1 
ATOM   4097 N  N   . ALA G 1 9   ? 68.880  72.182 79.078 1.00 45.78  ? 4   ALA D N   1 
ATOM   4098 C  CA  . ALA G 1 9   ? 69.707  73.384 78.983 1.00 45.64  ? 4   ALA D CA  1 
ATOM   4099 C  C   . ALA G 1 9   ? 71.120  73.173 79.519 1.00 44.72  ? 4   ALA D C   1 
ATOM   4100 O  O   . ALA G 1 9   ? 72.067  73.809 79.052 1.00 44.53  ? 4   ALA D O   1 
ATOM   4101 C  CB  . ALA G 1 9   ? 69.039  74.536 79.724 1.00 45.88  ? 4   ALA D CB  1 
ATOM   4102 N  N   . GLU G 1 10  ? 71.256  72.294 80.509 1.00 43.53  ? 5   GLU D N   1 
ATOM   4103 C  CA  . GLU G 1 10  ? 72.558  71.994 81.101 1.00 43.63  ? 5   GLU D CA  1 
ATOM   4104 C  C   . GLU G 1 10  ? 73.559  71.544 80.027 1.00 41.82  ? 5   GLU D C   1 
ATOM   4105 O  O   . GLU G 1 10  ? 74.651  72.100 79.912 1.00 40.58  ? 5   GLU D O   1 
ATOM   4106 C  CB  . GLU G 1 10  ? 72.406  70.897 82.161 1.00 46.75  ? 5   GLU D CB  1 
ATOM   4107 C  CG  . GLU G 1 10  ? 71.699  71.338 83.444 1.00 52.70  ? 5   GLU D CG  1 
ATOM   4108 C  CD  . GLU G 1 10  ? 70.333  71.978 83.203 1.00 55.77  ? 5   GLU D CD  1 
ATOM   4109 O  OE1 . GLU G 1 10  ? 69.397  71.270 82.746 1.00 56.33  ? 5   GLU D OE1 1 
ATOM   4110 O  OE2 . GLU G 1 10  ? 70.202  73.199 83.475 1.00 56.51  ? 5   GLU D OE2 1 
ATOM   4111 N  N   . GLY G 1 11  ? 73.168  70.546 79.236 1.00 39.82  ? 6   GLY D N   1 
ATOM   4112 C  CA  . GLY G 1 11  ? 74.033  70.036 78.190 1.00 37.69  ? 6   GLY D CA  1 
ATOM   4113 C  C   . GLY G 1 11  ? 74.209  70.958 76.998 1.00 37.17  ? 6   GLY D C   1 
ATOM   4114 O  O   . GLY G 1 11  ? 75.269  70.971 76.375 1.00 35.37  ? 6   GLY D O   1 
ATOM   4115 N  N   . GLU G 1 12  ? 73.177  71.727 76.665 1.00 37.12  ? 7   GLU D N   1 
ATOM   4116 C  CA  . GLU G 1 12  ? 73.271  72.646 75.534 1.00 37.53  ? 7   GLU D CA  1 
ATOM   4117 C  C   . GLU G 1 12  ? 74.316  73.696 75.858 1.00 35.77  ? 7   GLU D C   1 
ATOM   4118 O  O   . GLU G 1 12  ? 75.154  74.043 75.021 1.00 35.54  ? 7   GLU D O   1 
ATOM   4119 C  CB  . GLU G 1 12  ? 71.927  73.341 75.279 1.00 38.91  ? 7   GLU D CB  1 
ATOM   4120 C  CG  . GLU G 1 12  ? 70.727  72.423 75.360 1.00 40.03  ? 7   GLU D CG  1 
ATOM   4121 C  CD  . GLU G 1 12  ? 69.437  73.115 74.961 1.00 42.27  ? 7   GLU D CD  1 
ATOM   4122 O  OE1 . GLU G 1 12  ? 69.297  74.326 75.246 1.00 43.46  ? 7   GLU D OE1 1 
ATOM   4123 O  OE2 . GLU G 1 12  ? 68.558  72.443 74.372 1.00 42.23  ? 7   GLU D OE2 1 
ATOM   4124 N  N   . SER G 1 13  ? 74.245  74.195 77.089 1.00 34.80  ? 8   SER D N   1 
ATOM   4125 C  CA  . SER G 1 13  ? 75.158  75.216 77.588 1.00 33.79  ? 8   SER D CA  1 
ATOM   4126 C  C   . SER G 1 13  ? 76.587  74.691 77.550 1.00 31.73  ? 8   SER D C   1 
ATOM   4127 O  O   . SER G 1 13  ? 77.477  75.326 76.983 1.00 29.46  ? 8   SER D O   1 
ATOM   4128 C  CB  . SER G 1 13  ? 74.771  75.586 79.026 1.00 35.27  ? 8   SER D CB  1 
ATOM   4129 O  OG  . SER G 1 13  ? 75.549  76.666 79.511 1.00 38.58  ? 8   SER D OG  1 
ATOM   4130 N  N   . LEU G 1 14  ? 76.798  73.526 78.164 1.00 31.04  ? 9   LEU D N   1 
ATOM   4131 C  CA  . LEU G 1 14  ? 78.119  72.893 78.195 1.00 29.09  ? 9   LEU D CA  1 
ATOM   4132 C  C   . LEU G 1 14  ? 78.661  72.699 76.777 1.00 26.32  ? 9   LEU D C   1 
ATOM   4133 O  O   . LEU G 1 14  ? 79.782  73.107 76.469 1.00 27.11  ? 9   LEU D O   1 
ATOM   4134 C  CB  . LEU G 1 14  ? 78.031  71.554 78.943 1.00 29.32  ? 9   LEU D CB  1 
ATOM   4135 C  CG  . LEU G 1 14  ? 78.119  71.700 80.466 1.00 27.23  ? 9   LEU D CG  1 
ATOM   4136 C  CD1 . LEU G 1 14  ? 77.578  70.486 81.206 1.00 28.28  ? 9   LEU D CD1 1 
ATOM   4137 C  CD2 . LEU G 1 14  ? 79.572  71.933 80.807 1.00 30.02  ? 9   LEU D CD2 1 
ATOM   4138 N  N   . GLU G 1 15  ? 77.859  72.115 75.899 1.00 24.38  ? 10  GLU D N   1 
ATOM   4139 C  CA  . GLU G 1 15  ? 78.304  71.908 74.524 1.00 26.47  ? 10  GLU D CA  1 
ATOM   4140 C  C   . GLU G 1 15  ? 78.532  73.243 73.811 1.00 27.10  ? 10  GLU D C   1 
ATOM   4141 O  O   . GLU G 1 15  ? 79.397  73.348 72.947 1.00 28.46  ? 10  GLU D O   1 
ATOM   4142 C  CB  . GLU G 1 15  ? 77.280  71.077 73.747 1.00 24.78  ? 10  GLU D CB  1 
ATOM   4143 C  CG  . GLU G 1 15  ? 77.617  70.911 72.260 1.00 26.18  ? 10  GLU D CG  1 
ATOM   4144 C  CD  . GLU G 1 15  ? 78.912  70.154 72.024 1.00 25.51  ? 10  GLU D CD  1 
ATOM   4145 O  OE1 . GLU G 1 15  ? 79.401  69.519 72.979 1.00 28.82  ? 10  GLU D OE1 1 
ATOM   4146 O  OE2 . GLU G 1 15  ? 79.434  70.181 70.882 1.00 22.83  ? 10  GLU D OE2 1 
ATOM   4147 N  N   . SER G 1 16  ? 77.750  74.258 74.160 1.00 28.67  ? 11  SER D N   1 
ATOM   4148 C  CA  . SER G 1 16  ? 77.906  75.574 73.543 1.00 32.16  ? 11  SER D CA  1 
ATOM   4149 C  C   . SER G 1 16  ? 79.303  76.118 73.893 1.00 32.43  ? 11  SER D C   1 
ATOM   4150 O  O   . SER G 1 16  ? 80.014  76.667 73.047 1.00 31.40  ? 11  SER D O   1 
ATOM   4151 C  CB  . SER G 1 16  ? 76.811  76.521 74.049 1.00 33.90  ? 11  SER D CB  1 
ATOM   4152 O  OG  . SER G 1 16  ? 76.879  77.777 73.400 1.00 38.92  ? 11  SER D OG  1 
ATOM   4153 N  N   . TRP G 1 17  ? 79.695  75.946 75.150 1.00 34.10  ? 12  TRP D N   1 
ATOM   4154 C  CA  . TRP G 1 17  ? 81.014  76.375 75.605 1.00 34.31  ? 12  TRP D CA  1 
ATOM   4155 C  C   . TRP G 1 17  ? 82.110  75.546 74.933 1.00 33.79  ? 12  TRP D C   1 
ATOM   4156 O  O   . TRP G 1 17  ? 83.142  76.082 74.517 1.00 33.68  ? 12  TRP D O   1 
ATOM   4157 C  CB  . TRP G 1 17  ? 81.148  76.202 77.119 1.00 35.70  ? 12  TRP D CB  1 
ATOM   4158 C  CG  . TRP G 1 17  ? 80.542  77.293 77.951 1.00 36.42  ? 12  TRP D CG  1 
ATOM   4159 C  CD1 . TRP G 1 17  ? 79.282  77.324 78.479 1.00 37.35  ? 12  TRP D CD1 1 
ATOM   4160 C  CD2 . TRP G 1 17  ? 81.209  78.467 78.430 1.00 36.43  ? 12  TRP D CD2 1 
ATOM   4161 N  NE1 . TRP G 1 17  ? 79.126  78.440 79.272 1.00 39.51  ? 12  TRP D NE1 1 
ATOM   4162 C  CE2 . TRP G 1 17  ? 80.294  79.159 79.259 1.00 38.47  ? 12  TRP D CE2 1 
ATOM   4163 C  CE3 . TRP G 1 17  ? 82.492  78.999 78.244 1.00 35.97  ? 12  TRP D CE3 1 
ATOM   4164 C  CZ2 . TRP G 1 17  ? 80.625  80.358 79.901 1.00 36.81  ? 12  TRP D CZ2 1 
ATOM   4165 C  CZ3 . TRP G 1 17  ? 82.823  80.194 78.883 1.00 36.48  ? 12  TRP D CZ3 1 
ATOM   4166 C  CH2 . TRP G 1 17  ? 81.891  80.859 79.702 1.00 36.81  ? 12  TRP D CH2 1 
ATOM   4167 N  N   . LEU G 1 18  ? 81.892  74.233 74.840 1.00 32.88  ? 13  LEU D N   1 
ATOM   4168 C  CA  . LEU G 1 18  ? 82.883  73.350 74.225 1.00 29.77  ? 13  LEU D CA  1 
ATOM   4169 C  C   . LEU G 1 18  ? 83.089  73.727 72.762 1.00 29.95  ? 13  LEU D C   1 
ATOM   4170 O  O   . LEU G 1 18  ? 84.223  73.730 72.270 1.00 29.59  ? 13  LEU D O   1 
ATOM   4171 C  CB  . LEU G 1 18  ? 82.449  71.887 74.349 1.00 30.68  ? 13  LEU D CB  1 
ATOM   4172 C  CG  . LEU G 1 18  ? 83.536  70.845 74.076 1.00 29.43  ? 13  LEU D CG  1 
ATOM   4173 C  CD1 . LEU G 1 18  ? 84.734  71.132 74.976 1.00 30.50  ? 13  LEU D CD1 1 
ATOM   4174 C  CD2 . LEU G 1 18  ? 82.994  69.444 74.347 1.00 29.48  ? 13  LEU D CD2 1 
ATOM   4175 N  N   . ASN G 1 19  ? 82.004  74.064 72.064 1.00 30.33  ? 14  ASN D N   1 
ATOM   4176 C  CA  . ASN G 1 19  ? 82.122  74.475 70.656 1.00 32.02  ? 14  ASN D CA  1 
ATOM   4177 C  C   . ASN G 1 19  ? 83.169  75.576 70.500 1.00 31.18  ? 14  ASN D C   1 
ATOM   4178 O  O   . ASN G 1 19  ? 84.036  75.507 69.625 1.00 31.16  ? 14  ASN D O   1 
ATOM   4179 C  CB  . ASN G 1 19  ? 80.790  75.010 70.109 1.00 31.09  ? 14  ASN D CB  1 
ATOM   4180 C  CG  . ASN G 1 19  ? 79.938  73.927 69.459 1.00 32.39  ? 14  ASN D CG  1 
ATOM   4181 O  OD1 . ASN G 1 19  ? 78.961  74.225 68.754 1.00 32.19  ? 14  ASN D OD1 1 
ATOM   4182 N  ND2 . ASN G 1 19  ? 80.295  72.667 69.694 1.00 28.62  ? 14  ASN D ND2 1 
ATOM   4183 N  N   . LYS G 1 20  ? 83.079  76.593 71.353 1.00 30.25  ? 15  LYS D N   1 
ATOM   4184 C  CA  . LYS G 1 20  ? 84.003  77.717 71.292 1.00 30.03  ? 15  LYS D CA  1 
ATOM   4185 C  C   . LYS G 1 20  ? 85.420  77.339 71.700 1.00 30.25  ? 15  LYS D C   1 
ATOM   4186 O  O   . LYS G 1 20  ? 86.395  77.837 71.127 1.00 26.38  ? 15  LYS D O   1 
ATOM   4187 C  CB  . LYS G 1 20  ? 83.502  78.861 72.179 1.00 33.01  ? 15  LYS D CB  1 
ATOM   4188 C  CG  . LYS G 1 20  ? 82.301  79.606 71.615 1.00 36.57  ? 15  LYS D CG  1 
ATOM   4189 C  CD  . LYS G 1 20  ? 81.988  80.842 72.428 1.00 39.06  ? 15  LYS D CD  1 
ATOM   4190 C  CE  . LYS G 1 20  ? 80.764  81.564 71.869 1.00 43.68  ? 15  LYS D CE  1 
ATOM   4191 N  NZ  . LYS G 1 20  ? 81.000  82.074 70.483 1.00 44.96  ? 15  LYS D NZ  1 
ATOM   4192 N  N   . ALA G 1 21  ? 85.529  76.455 72.692 1.00 30.77  ? 16  ALA D N   1 
ATOM   4193 C  CA  . ALA G 1 21  ? 86.828  76.015 73.184 1.00 29.90  ? 16  ALA D CA  1 
ATOM   4194 C  C   . ALA G 1 21  ? 87.516  75.098 72.192 1.00 30.12  ? 16  ALA D C   1 
ATOM   4195 O  O   . ALA G 1 21  ? 88.724  74.927 72.241 1.00 32.43  ? 16  ALA D O   1 
ATOM   4196 C  CB  . ALA G 1 21  ? 86.663  75.302 74.518 1.00 29.53  ? 16  ALA D CB  1 
ATOM   4197 N  N   . THR G 1 22  ? 86.751  74.510 71.282 1.00 30.94  ? 17  THR D N   1 
ATOM   4198 C  CA  . THR G 1 22  ? 87.326  73.590 70.303 1.00 31.77  ? 17  THR D CA  1 
ATOM   4199 C  C   . THR G 1 22  ? 86.997  74.022 68.877 1.00 33.90  ? 17  THR D C   1 
ATOM   4200 O  O   . THR G 1 22  ? 87.156  73.252 67.926 1.00 32.19  ? 17  THR D O   1 
ATOM   4201 C  CB  . THR G 1 22  ? 86.796  72.158 70.522 1.00 29.58  ? 17  THR D CB  1 
ATOM   4202 O  OG1 . THR G 1 22  ? 85.387  72.133 70.288 1.00 28.46  ? 17  THR D OG1 1 
ATOM   4203 C  CG2 . THR G 1 22  ? 87.044  71.712 71.944 1.00 28.24  ? 17  THR D CG2 1 
ATOM   4204 N  N   . ASN G 1 23  ? 86.526  75.260 68.747 1.00 35.61  ? 18  ASN D N   1 
ATOM   4205 C  CA  . ASN G 1 23  ? 86.174  75.826 67.456 1.00 35.93  ? 18  ASN D CA  1 
ATOM   4206 C  C   . ASN G 1 23  ? 87.385  75.735 66.537 1.00 36.01  ? 18  ASN D C   1 
ATOM   4207 O  O   . ASN G 1 23  ? 88.447  76.287 66.839 1.00 37.80  ? 18  ASN D O   1 
ATOM   4208 C  CB  . ASN G 1 23  ? 85.752  77.283 67.650 1.00 38.31  ? 18  ASN D CB  1 
ATOM   4209 C  CG  . ASN G 1 23  ? 85.383  77.971 66.353 1.00 39.40  ? 18  ASN D CG  1 
ATOM   4210 O  OD1 . ASN G 1 23  ? 84.883  79.097 66.365 1.00 43.26  ? 18  ASN D OD1 1 
ATOM   4211 N  ND2 . ASN G 1 23  ? 85.634  77.311 65.230 1.00 39.63  ? 18  ASN D ND2 1 
ATOM   4212 N  N   . PRO G 1 24  ? 87.241  75.039 65.397 1.00 34.98  ? 19  PRO D N   1 
ATOM   4213 C  CA  . PRO G 1 24  ? 88.321  74.864 64.418 1.00 34.37  ? 19  PRO D CA  1 
ATOM   4214 C  C   . PRO G 1 24  ? 88.915  76.172 63.886 1.00 35.30  ? 19  PRO D C   1 
ATOM   4215 O  O   . PRO G 1 24  ? 90.017  76.180 63.334 1.00 34.84  ? 19  PRO D O   1 
ATOM   4216 C  CB  . PRO G 1 24  ? 87.656  74.041 63.311 1.00 34.51  ? 19  PRO D CB  1 
ATOM   4217 C  CG  . PRO G 1 24  ? 86.618  73.260 64.044 1.00 34.31  ? 19  PRO D CG  1 
ATOM   4218 C  CD  . PRO G 1 24  ? 86.038  74.298 64.981 1.00 33.87  ? 19  PRO D CD  1 
ATOM   4219 N  N   . SER G 1 25  ? 88.188  77.276 64.034 1.00 36.72  ? 20  SER D N   1 
ATOM   4220 C  CA  . SER G 1 25  ? 88.696  78.564 63.562 1.00 39.00  ? 20  SER D CA  1 
ATOM   4221 C  C   . SER G 1 25  ? 89.823  79.086 64.459 1.00 38.39  ? 20  SER D C   1 
ATOM   4222 O  O   . SER G 1 25  ? 90.757  79.733 63.981 1.00 37.80  ? 20  SER D O   1 
ATOM   4223 C  CB  . SER G 1 25  ? 87.572  79.599 63.503 1.00 38.88  ? 20  SER D CB  1 
ATOM   4224 O  OG  . SER G 1 25  ? 86.722  79.350 62.400 1.00 40.78  ? 20  SER D OG  1 
ATOM   4225 N  N   . ASN G 1 26  ? 89.727  78.802 65.757 1.00 38.11  ? 21  ASN D N   1 
ATOM   4226 C  CA  . ASN G 1 26  ? 90.742  79.243 66.709 1.00 38.48  ? 21  ASN D CA  1 
ATOM   4227 C  C   . ASN G 1 26  ? 92.116  79.081 66.065 1.00 39.32  ? 21  ASN D C   1 
ATOM   4228 O  O   . ASN G 1 26  ? 92.497  77.974 65.684 1.00 37.59  ? 21  ASN D O   1 
ATOM   4229 C  CB  . ASN G 1 26  ? 90.666  78.401 67.985 1.00 35.71  ? 21  ASN D CB  1 
ATOM   4230 C  CG  . ASN G 1 26  ? 89.371  78.601 68.741 1.00 34.12  ? 21  ASN D CG  1 
ATOM   4231 O  OD1 . ASN G 1 26  ? 89.049  77.833 69.651 1.00 33.57  ? 21  ASN D OD1 1 
ATOM   4232 N  ND2 . ASN G 1 26  ? 88.624  79.641 68.383 1.00 33.76  ? 21  ASN D ND2 1 
ATOM   4233 N  N   . ARG G 1 27  ? 92.845  80.185 65.919 1.00 41.77  ? 22  ARG D N   1 
ATOM   4234 C  CA  . ARG G 1 27  ? 94.171  80.128 65.311 1.00 44.74  ? 22  ARG D CA  1 
ATOM   4235 C  C   . ARG G 1 27  ? 95.097  79.483 66.321 1.00 44.80  ? 22  ARG D C   1 
ATOM   4236 O  O   . ARG G 1 27  ? 96.102  78.870 65.968 1.00 45.32  ? 22  ARG D O   1 
ATOM   4237 C  CB  . ARG G 1 27  ? 94.691  81.530 64.968 1.00 47.75  ? 22  ARG D CB  1 
ATOM   4238 C  CG  . ARG G 1 27  ? 93.863  82.327 63.962 1.00 51.63  ? 22  ARG D CG  1 
ATOM   4239 C  CD  . ARG G 1 27  ? 92.476  82.643 64.513 1.00 56.98  ? 22  ARG D CD  1 
ATOM   4240 N  NE  . ARG G 1 27  ? 92.495  82.832 65.966 1.00 58.76  ? 22  ARG D NE  1 
ATOM   4241 C  CZ  . ARG G 1 27  ? 91.430  83.152 66.696 1.00 58.89  ? 22  ARG D CZ  1 
ATOM   4242 N  NH1 . ARG G 1 27  ? 90.247  83.327 66.114 1.00 58.91  ? 22  ARG D NH1 1 
ATOM   4243 N  NH2 . ARG G 1 27  ? 91.549  83.289 68.011 1.00 59.85  ? 22  ARG D NH2 1 
ATOM   4244 N  N   . GLN G 1 28  ? 94.731  79.629 67.587 1.00 46.23  ? 23  GLN D N   1 
ATOM   4245 C  CA  . GLN G 1 28  ? 95.490  79.082 68.697 1.00 48.17  ? 23  GLN D CA  1 
ATOM   4246 C  C   . GLN G 1 28  ? 94.482  78.679 69.755 1.00 47.90  ? 23  GLN D C   1 
ATOM   4247 O  O   . GLN G 1 28  ? 93.278  78.793 69.543 1.00 47.66  ? 23  GLN D O   1 
ATOM   4248 C  CB  . GLN G 1 28  ? 96.439  80.140 69.257 1.00 51.55  ? 23  GLN D CB  1 
ATOM   4249 C  CG  . GLN G 1 28  ? 95.736  81.405 69.726 1.00 56.74  ? 23  GLN D CG  1 
ATOM   4250 C  CD  . GLN G 1 28  ? 96.702  82.554 69.929 1.00 60.69  ? 23  GLN D CD  1 
ATOM   4251 O  OE1 . GLN G 1 28  ? 97.287  83.065 68.967 1.00 62.13  ? 23  GLN D OE1 1 
ATOM   4252 N  NE2 . GLN G 1 28  ? 96.884  82.963 71.184 1.00 60.80  ? 23  GLN D NE2 1 
ATOM   4253 N  N   . GLU G 1 29  ? 94.970  78.235 70.903 1.00 48.09  ? 24  GLU D N   1 
ATOM   4254 C  CA  . GLU G 1 29  ? 94.087  77.793 71.969 1.00 48.75  ? 24  GLU D CA  1 
ATOM   4255 C  C   . GLU G 1 29  ? 93.520  78.935 72.808 1.00 49.63  ? 24  GLU D C   1 
ATOM   4256 O  O   . GLU G 1 29  ? 94.254  79.635 73.507 1.00 51.17  ? 24  GLU D O   1 
ATOM   4257 C  CB  . GLU G 1 29  ? 94.841  76.784 72.831 1.00 48.42  ? 24  GLU D CB  1 
ATOM   4258 C  CG  . GLU G 1 29  ? 95.434  75.679 71.968 1.00 50.09  ? 24  GLU D CG  1 
ATOM   4259 C  CD  . GLU G 1 29  ? 96.536  74.904 72.647 1.00 51.79  ? 24  GLU D CD  1 
ATOM   4260 O  OE1 . GLU G 1 29  ? 96.711  75.061 73.875 1.00 54.66  ? 24  GLU D OE1 1 
ATOM   4261 O  OE2 . GLU G 1 29  ? 97.227  74.130 71.948 1.00 52.38  ? 24  GLU D OE2 1 
ATOM   4262 N  N   . ASP G 1 30  ? 92.205  79.127 72.714 1.00 48.97  ? 25  ASP D N   1 
ATOM   4263 C  CA  . ASP G 1 30  ? 91.518  80.170 73.462 1.00 47.80  ? 25  ASP D CA  1 
ATOM   4264 C  C   . ASP G 1 30  ? 91.318  79.658 74.885 1.00 46.99  ? 25  ASP D C   1 
ATOM   4265 O  O   . ASP G 1 30  ? 90.337  78.952 75.171 1.00 46.08  ? 25  ASP D O   1 
ATOM   4266 C  CB  . ASP G 1 30  ? 90.163  80.472 72.822 1.00 49.51  ? 25  ASP D CB  1 
ATOM   4267 C  CG  . ASP G 1 30  ? 89.447  81.631 73.492 1.00 52.52  ? 25  ASP D CG  1 
ATOM   4268 O  OD1 . ASP G 1 30  ? 89.416  81.673 74.742 1.00 53.79  ? 25  ASP D OD1 1 
ATOM   4269 O  OD2 . ASP G 1 30  ? 88.902  82.499 72.774 1.00 55.35  ? 25  ASP D OD2 1 
ATOM   4270 N  N   . TRP G 1 31  ? 92.246  80.018 75.770 1.00 44.64  ? 26  TRP D N   1 
ATOM   4271 C  CA  . TRP G 1 31  ? 92.201  79.578 77.159 1.00 43.37  ? 26  TRP D CA  1 
ATOM   4272 C  C   . TRP G 1 31  ? 91.049  80.110 77.995 1.00 44.49  ? 26  TRP D C   1 
ATOM   4273 O  O   . TRP G 1 31  ? 90.732  79.533 79.039 1.00 45.87  ? 26  TRP D O   1 
ATOM   4274 C  CB  . TRP G 1 31  ? 93.532  79.874 77.858 1.00 41.01  ? 26  TRP D CB  1 
ATOM   4275 C  CG  . TRP G 1 31  ? 94.631  78.932 77.428 1.00 38.80  ? 26  TRP D CG  1 
ATOM   4276 C  CD1 . TRP G 1 31  ? 95.592  79.163 76.483 1.00 37.00  ? 26  TRP D CD1 1 
ATOM   4277 C  CD2 . TRP G 1 31  ? 94.832  77.586 77.882 1.00 36.96  ? 26  TRP D CD2 1 
ATOM   4278 N  NE1 . TRP G 1 31  ? 96.375  78.045 76.321 1.00 37.99  ? 26  TRP D NE1 1 
ATOM   4279 C  CE2 . TRP G 1 31  ? 95.931  77.063 77.166 1.00 36.26  ? 26  TRP D CE2 1 
ATOM   4280 C  CE3 . TRP G 1 31  ? 94.189  76.772 78.825 1.00 36.84  ? 26  TRP D CE3 1 
ATOM   4281 C  CZ2 . TRP G 1 31  ? 96.401  75.760 77.360 1.00 36.07  ? 26  TRP D CZ2 1 
ATOM   4282 C  CZ3 . TRP G 1 31  ? 94.660  75.470 79.020 1.00 36.04  ? 26  TRP D CZ3 1 
ATOM   4283 C  CH2 . TRP G 1 31  ? 95.755  74.980 78.288 1.00 35.49  ? 26  TRP D CH2 1 
ATOM   4284 N  N   . GLU G 1 32  ? 90.417  81.197 77.560 1.00 44.25  ? 27  GLU D N   1 
ATOM   4285 C  CA  . GLU G 1 32  ? 89.283  81.728 78.307 1.00 44.81  ? 27  GLU D CA  1 
ATOM   4286 C  C   . GLU G 1 32  ? 88.098  80.780 78.166 1.00 44.64  ? 27  GLU D C   1 
ATOM   4287 O  O   . GLU G 1 32  ? 87.368  80.521 79.131 1.00 44.07  ? 27  GLU D O   1 
ATOM   4288 C  CB  . GLU G 1 32  ? 88.897  83.118 77.806 1.00 48.50  ? 27  GLU D CB  1 
ATOM   4289 C  CG  . GLU G 1 32  ? 89.651  84.243 78.498 1.00 53.64  ? 27  GLU D CG  1 
ATOM   4290 C  CD  . GLU G 1 32  ? 89.147  85.612 78.091 1.00 56.43  ? 27  GLU D CD  1 
ATOM   4291 O  OE1 . GLU G 1 32  ? 87.910  85.802 78.086 1.00 57.11  ? 27  GLU D OE1 1 
ATOM   4292 O  OE2 . GLU G 1 32  ? 89.985  86.495 77.784 1.00 57.54  ? 27  GLU D OE2 1 
ATOM   4293 N  N   . TYR G 1 33  ? 87.910  80.259 76.958 1.00 43.90  ? 28  TYR D N   1 
ATOM   4294 C  CA  . TYR G 1 33  ? 86.823  79.324 76.709 1.00 43.44  ? 28  TYR D CA  1 
ATOM   4295 C  C   . TYR G 1 33  ? 87.141  77.981 77.363 1.00 41.46  ? 28  TYR D C   1 
ATOM   4296 O  O   . TYR G 1 33  ? 86.233  77.277 77.798 1.00 40.24  ? 28  TYR D O   1 
ATOM   4297 C  CB  . TYR G 1 33  ? 86.606  79.154 75.203 1.00 45.64  ? 28  TYR D CB  1 
ATOM   4298 C  CG  . TYR G 1 33  ? 86.050  80.392 74.531 1.00 48.62  ? 28  TYR D CG  1 
ATOM   4299 C  CD1 . TYR G 1 33  ? 85.177  81.247 75.208 1.00 50.08  ? 28  TYR D CD1 1 
ATOM   4300 C  CD2 . TYR G 1 33  ? 86.410  80.721 73.224 1.00 50.36  ? 28  TYR D CD2 1 
ATOM   4301 C  CE1 . TYR G 1 33  ? 84.679  82.402 74.597 1.00 51.96  ? 28  TYR D CE1 1 
ATOM   4302 C  CE2 . TYR G 1 33  ? 85.921  81.874 72.605 1.00 50.78  ? 28  TYR D CE2 1 
ATOM   4303 C  CZ  . TYR G 1 33  ? 85.058  82.709 73.294 1.00 52.00  ? 28  TYR D CZ  1 
ATOM   4304 O  OH  . TYR G 1 33  ? 84.575  83.847 72.681 1.00 52.44  ? 28  TYR D OH  1 
ATOM   4305 N  N   . ILE G 1 34  ? 88.430  77.641 77.441 1.00 39.52  ? 29  ILE D N   1 
ATOM   4306 C  CA  . ILE G 1 34  ? 88.864  76.388 78.060 1.00 39.74  ? 29  ILE D CA  1 
ATOM   4307 C  C   . ILE G 1 34  ? 88.499  76.402 79.547 1.00 40.31  ? 29  ILE D C   1 
ATOM   4308 O  O   . ILE G 1 34  ? 87.762  75.534 80.027 1.00 39.17  ? 29  ILE D O   1 
ATOM   4309 C  CB  . ILE G 1 34  ? 90.406  76.181 77.967 1.00 40.03  ? 29  ILE D CB  1 
ATOM   4310 C  CG1 . ILE G 1 34  ? 90.900  76.354 76.529 1.00 39.02  ? 29  ILE D CG1 1 
ATOM   4311 C  CG2 . ILE G 1 34  ? 90.773  74.805 78.490 1.00 40.05  ? 29  ILE D CG2 1 
ATOM   4312 C  CD1 . ILE G 1 34  ? 90.289  75.408 75.544 1.00 42.32  ? 29  ILE D CD1 1 
ATOM   4313 N  N   . ILE G 1 35  ? 89.017  77.393 80.271 1.00 40.44  ? 30  ILE D N   1 
ATOM   4314 C  CA  . ILE G 1 35  ? 88.749  77.517 81.704 1.00 41.97  ? 30  ILE D CA  1 
ATOM   4315 C  C   . ILE G 1 35  ? 87.256  77.713 81.983 1.00 41.71  ? 30  ILE D C   1 
ATOM   4316 O  O   . ILE G 1 35  ? 86.707  77.135 82.931 1.00 41.28  ? 30  ILE D O   1 
ATOM   4317 C  CB  . ILE G 1 35  ? 89.550  78.696 82.328 1.00 43.93  ? 30  ILE D CB  1 
ATOM   4318 C  CG1 . ILE G 1 35  ? 91.055  78.466 82.139 1.00 43.98  ? 30  ILE D CG1 1 
ATOM   4319 C  CG2 . ILE G 1 35  ? 89.225  78.830 83.818 1.00 43.49  ? 30  ILE D CG2 1 
ATOM   4320 C  CD1 . ILE G 1 35  ? 91.575  77.160 82.738 1.00 45.13  ? 30  ILE D CD1 1 
ATOM   4321 N  N   . GLY G 1 36  ? 86.601  78.529 81.163 1.00 40.89  ? 31  GLY D N   1 
ATOM   4322 C  CA  . GLY G 1 36  ? 85.179  78.748 81.347 1.00 40.44  ? 31  GLY D CA  1 
ATOM   4323 C  C   . GLY G 1 36  ? 84.435  77.422 81.304 1.00 40.10  ? 31  GLY D C   1 
ATOM   4324 O  O   . GLY G 1 36  ? 83.575  77.144 82.146 1.00 40.35  ? 31  GLY D O   1 
ATOM   4325 N  N   . PHE G 1 37  ? 84.765  76.600 80.312 1.00 38.47  ? 32  PHE D N   1 
ATOM   4326 C  CA  . PHE G 1 37  ? 84.137  75.296 80.173 1.00 36.84  ? 32  PHE D CA  1 
ATOM   4327 C  C   . PHE G 1 37  ? 84.372  74.530 81.475 1.00 36.11  ? 32  PHE D C   1 
ATOM   4328 O  O   . PHE G 1 37  ? 83.468  73.887 81.998 1.00 35.38  ? 32  PHE D O   1 
ATOM   4329 C  CB  . PHE G 1 37  ? 84.750  74.540 78.988 1.00 36.97  ? 32  PHE D CB  1 
ATOM   4330 C  CG  . PHE G 1 37  ? 84.241  73.135 78.832 1.00 36.38  ? 32  PHE D CG  1 
ATOM   4331 C  CD1 . PHE G 1 37  ? 82.962  72.892 78.344 1.00 34.65  ? 32  PHE D CD1 1 
ATOM   4332 C  CD2 . PHE G 1 37  ? 85.042  72.049 79.186 1.00 37.08  ? 32  PHE D CD2 1 
ATOM   4333 C  CE1 . PHE G 1 37  ? 82.482  71.585 78.208 1.00 35.94  ? 32  PHE D CE1 1 
ATOM   4334 C  CE2 . PHE G 1 37  ? 84.572  70.736 79.054 1.00 36.67  ? 32  PHE D CE2 1 
ATOM   4335 C  CZ  . PHE G 1 37  ? 83.289  70.504 78.564 1.00 35.90  ? 32  PHE D CZ  1 
ATOM   4336 N  N   . CYS G 1 38  ? 85.590  74.611 82.005 1.00 36.98  ? 33  CYS D N   1 
ATOM   4337 C  CA  . CYS G 1 38  ? 85.914  73.933 83.261 1.00 36.13  ? 33  CYS D CA  1 
ATOM   4338 C  C   . CYS G 1 38  ? 85.063  74.491 84.409 1.00 36.27  ? 33  CYS D C   1 
ATOM   4339 O  O   . CYS G 1 38  ? 84.512  73.733 85.219 1.00 32.89  ? 33  CYS D O   1 
ATOM   4340 C  CB  . CYS G 1 38  ? 87.393  74.110 83.592 1.00 34.00  ? 33  CYS D CB  1 
ATOM   4341 S  SG  . CYS G 1 38  ? 88.505  73.232 82.496 1.00 36.51  ? 33  CYS D SG  1 
ATOM   4342 N  N   . ASP G 1 39  ? 84.968  75.819 84.472 1.00 37.71  ? 34  ASP D N   1 
ATOM   4343 C  CA  . ASP G 1 39  ? 84.179  76.481 85.504 1.00 39.27  ? 34  ASP D CA  1 
ATOM   4344 C  C   . ASP G 1 39  ? 82.737  76.040 85.354 1.00 39.13  ? 34  ASP D C   1 
ATOM   4345 O  O   . ASP G 1 39  ? 82.044  75.774 86.337 1.00 39.25  ? 34  ASP D O   1 
ATOM   4346 C  CB  . ASP G 1 39  ? 84.261  78.001 85.359 1.00 41.81  ? 34  ASP D CB  1 
ATOM   4347 C  CG  . ASP G 1 39  ? 83.304  78.722 86.299 1.00 45.56  ? 34  ASP D CG  1 
ATOM   4348 O  OD1 . ASP G 1 39  ? 83.418  78.514 87.533 1.00 46.50  ? 34  ASP D OD1 1 
ATOM   4349 O  OD2 . ASP G 1 39  ? 82.440  79.488 85.807 1.00 45.38  ? 34  ASP D OD2 1 
ATOM   4350 N  N   . GLN G 1 40  ? 82.291  75.966 84.108 1.00 38.98  ? 35  GLN D N   1 
ATOM   4351 C  CA  . GLN G 1 40  ? 80.936  75.538 83.818 1.00 40.46  ? 35  GLN D CA  1 
ATOM   4352 C  C   . GLN G 1 40  ? 80.717  74.134 84.402 1.00 40.02  ? 35  GLN D C   1 
ATOM   4353 O  O   . GLN G 1 40  ? 79.727  73.887 85.105 1.00 41.04  ? 35  GLN D O   1 
ATOM   4354 C  CB  . GLN G 1 40  ? 80.716  75.547 82.304 1.00 42.86  ? 35  GLN D CB  1 
ATOM   4355 C  CG  . GLN G 1 40  ? 79.357  75.022 81.858 1.00 47.67  ? 35  GLN D CG  1 
ATOM   4356 C  CD  . GLN G 1 40  ? 78.194  75.911 82.287 1.00 48.65  ? 35  GLN D CD  1 
ATOM   4357 O  OE1 . GLN G 1 40  ? 77.022  75.598 82.002 1.00 47.30  ? 35  GLN D OE1 1 
ATOM   4358 N  NE2 . GLN G 1 40  ? 78.507  77.026 82.967 1.00 44.10  ? 35  GLN D NE2 1 
ATOM   4359 N  N   . ILE G 1 41  ? 81.650  73.222 84.136 1.00 38.03  ? 36  ILE D N   1 
ATOM   4360 C  CA  . ILE G 1 41  ? 81.548  71.854 84.657 1.00 36.26  ? 36  ILE D CA  1 
ATOM   4361 C  C   . ILE G 1 41  ? 81.452  71.830 86.193 1.00 35.01  ? 36  ILE D C   1 
ATOM   4362 O  O   . ILE G 1 41  ? 80.676  71.064 86.767 1.00 33.55  ? 36  ILE D O   1 
ATOM   4363 C  CB  . ILE G 1 41  ? 82.774  70.998 84.220 1.00 35.60  ? 36  ILE D CB  1 
ATOM   4364 C  CG1 . ILE G 1 41  ? 82.789  70.853 82.696 1.00 34.44  ? 36  ILE D CG1 1 
ATOM   4365 C  CG2 . ILE G 1 41  ? 82.732  69.628 84.893 1.00 32.34  ? 36  ILE D CG2 1 
ATOM   4366 C  CD1 . ILE G 1 41  ? 83.978  70.088 82.180 1.00 36.63  ? 36  ILE D CD1 1 
ATOM   4367 N  N   . ASN G 1 42  ? 82.239  72.683 86.842 1.00 34.60  ? 37  ASN D N   1 
ATOM   4368 C  CA  . ASN G 1 42  ? 82.280  72.768 88.300 1.00 34.79  ? 37  ASN D CA  1 
ATOM   4369 C  C   . ASN G 1 42  ? 80.999  73.289 88.948 1.00 36.34  ? 37  ASN D C   1 
ATOM   4370 O  O   . ASN G 1 42  ? 80.769  73.073 90.143 1.00 35.59  ? 37  ASN D O   1 
ATOM   4371 C  CB  . ASN G 1 42  ? 83.456  73.654 88.731 1.00 32.77  ? 37  ASN D CB  1 
ATOM   4372 C  CG  . ASN G 1 42  ? 84.807  73.015 88.449 1.00 31.55  ? 37  ASN D CG  1 
ATOM   4373 O  OD1 . ASN G 1 42  ? 85.840  73.686 88.498 1.00 30.91  ? 37  ASN D OD1 1 
ATOM   4374 N  ND2 . ASN G 1 42  ? 84.809  71.715 88.164 1.00 27.27  ? 37  ASN D ND2 1 
ATOM   4375 N  N   . LYS G 1 43  ? 80.162  73.975 88.174 1.00 37.41  ? 38  LYS D N   1 
ATOM   4376 C  CA  . LYS G 1 43  ? 78.927  74.516 88.728 1.00 37.99  ? 38  LYS D CA  1 
ATOM   4377 C  C   . LYS G 1 43  ? 77.681  73.689 88.433 1.00 38.39  ? 38  LYS D C   1 
ATOM   4378 O  O   . LYS G 1 43  ? 76.710  73.746 89.182 1.00 38.24  ? 38  LYS D O   1 
ATOM   4379 C  CB  . LYS G 1 43  ? 78.740  75.961 88.255 1.00 37.59  ? 38  LYS D CB  1 
ATOM   4380 C  CG  . LYS G 1 43  ? 79.795  76.914 88.826 1.00 37.25  ? 38  LYS D CG  1 
ATOM   4381 C  CD  . LYS G 1 43  ? 79.658  78.311 88.258 1.00 38.38  ? 38  LYS D CD  1 
ATOM   4382 C  CE  . LYS G 1 43  ? 80.779  79.244 88.718 1.00 38.35  ? 38  LYS D CE  1 
ATOM   4383 N  NZ  . LYS G 1 43  ? 80.796  79.479 90.187 1.00 38.16  ? 38  LYS D NZ  1 
ATOM   4384 N  N   . GLU G 1 44  ? 77.710  72.913 87.354 1.00 40.07  ? 39  GLU D N   1 
ATOM   4385 C  CA  . GLU G 1 44  ? 76.566  72.084 86.987 1.00 38.96  ? 39  GLU D CA  1 
ATOM   4386 C  C   . GLU G 1 44  ? 76.511  70.809 87.826 1.00 38.98  ? 39  GLU D C   1 
ATOM   4387 O  O   . GLU G 1 44  ? 77.508  70.111 87.977 1.00 38.64  ? 39  GLU D O   1 
ATOM   4388 C  CB  . GLU G 1 44  ? 76.637  71.733 85.503 1.00 40.19  ? 39  GLU D CB  1 
ATOM   4389 C  CG  . GLU G 1 44  ? 76.355  72.904 84.570 1.00 42.19  ? 39  GLU D CG  1 
ATOM   4390 C  CD  . GLU G 1 44  ? 75.029  73.590 84.872 1.00 42.63  ? 39  GLU D CD  1 
ATOM   4391 O  OE1 . GLU G 1 44  ? 74.072  72.893 85.268 1.00 43.60  ? 39  GLU D OE1 1 
ATOM   4392 O  OE2 . GLU G 1 44  ? 74.938  74.826 84.704 1.00 43.36  ? 39  GLU D OE2 1 
ATOM   4393 N  N   . LEU G 1 45  ? 75.337  70.507 88.366 1.00 40.36  ? 40  LEU D N   1 
ATOM   4394 C  CA  . LEU G 1 45  ? 75.149  69.325 89.207 1.00 41.43  ? 40  LEU D CA  1 
ATOM   4395 C  C   . LEU G 1 45  ? 75.643  68.039 88.539 1.00 42.37  ? 40  LEU D C   1 
ATOM   4396 O  O   . LEU G 1 45  ? 76.229  67.166 89.190 1.00 41.76  ? 40  LEU D O   1 
ATOM   4397 C  CB  . LEU G 1 45  ? 73.667  69.180 89.568 1.00 41.18  ? 40  LEU D CB  1 
ATOM   4398 C  CG  . LEU G 1 45  ? 73.291  68.299 90.771 1.00 43.79  ? 40  LEU D CG  1 
ATOM   4399 C  CD1 . LEU G 1 45  ? 73.550  66.824 90.493 1.00 43.49  ? 40  LEU D CD1 1 
ATOM   4400 C  CD2 . LEU G 1 45  ? 74.088  68.763 91.984 1.00 43.59  ? 40  LEU D CD2 1 
ATOM   4401 N  N   . GLU G 1 46  ? 75.396  67.917 87.241 1.00 42.42  ? 41  GLU D N   1 
ATOM   4402 C  CA  . GLU G 1 46  ? 75.824  66.732 86.518 1.00 43.43  ? 41  GLU D CA  1 
ATOM   4403 C  C   . GLU G 1 46  ? 76.807  67.137 85.432 1.00 41.46  ? 41  GLU D C   1 
ATOM   4404 O  O   . GLU G 1 46  ? 76.898  66.486 84.391 1.00 40.76  ? 41  GLU D O   1 
ATOM   4405 C  CB  . GLU G 1 46  ? 74.614  66.031 85.900 1.00 46.66  ? 41  GLU D CB  1 
ATOM   4406 C  CG  . GLU G 1 46  ? 73.468  65.845 86.881 1.00 51.45  ? 41  GLU D CG  1 
ATOM   4407 C  CD  . GLU G 1 46  ? 72.327  65.035 86.308 1.00 54.19  ? 41  GLU D CD  1 
ATOM   4408 O  OE1 . GLU G 1 46  ? 71.926  65.308 85.153 1.00 56.17  ? 41  GLU D OE1 1 
ATOM   4409 O  OE2 . GLU G 1 46  ? 71.825  64.133 87.019 1.00 55.52  ? 41  GLU D OE2 1 
ATOM   4410 N  N   . GLY G 1 47  ? 77.541  68.217 85.693 1.00 38.71  ? 42  GLY D N   1 
ATOM   4411 C  CA  . GLY G 1 47  ? 78.515  68.713 84.739 1.00 36.64  ? 42  GLY D CA  1 
ATOM   4412 C  C   . GLY G 1 47  ? 79.538  67.672 84.331 1.00 35.80  ? 42  GLY D C   1 
ATOM   4413 O  O   . GLY G 1 47  ? 79.825  67.517 83.139 1.00 36.99  ? 42  GLY D O   1 
ATOM   4414 N  N   . PRO G 1 48  ? 80.113  66.939 85.297 1.00 33.69  ? 43  PRO D N   1 
ATOM   4415 C  CA  . PRO G 1 48  ? 81.112  65.919 84.968 1.00 32.33  ? 43  PRO D CA  1 
ATOM   4416 C  C   . PRO G 1 48  ? 80.599  64.831 84.024 1.00 31.56  ? 43  PRO D C   1 
ATOM   4417 O  O   . PRO G 1 48  ? 81.176  64.630 82.956 1.00 29.53  ? 43  PRO D O   1 
ATOM   4418 C  CB  . PRO G 1 48  ? 81.508  65.368 86.340 1.00 32.23  ? 43  PRO D CB  1 
ATOM   4419 C  CG  . PRO G 1 48  ? 81.302  66.543 87.246 1.00 32.46  ? 43  PRO D CG  1 
ATOM   4420 C  CD  . PRO G 1 48  ? 79.992  67.102 86.757 1.00 32.16  ? 43  PRO D CD  1 
ATOM   4421 N  N   . GLN G 1 49  ? 79.524  64.133 84.406 1.00 31.78  ? 44  GLN D N   1 
ATOM   4422 C  CA  . GLN G 1 49  ? 78.996  63.066 83.554 1.00 33.78  ? 44  GLN D CA  1 
ATOM   4423 C  C   . GLN G 1 49  ? 78.596  63.540 82.162 1.00 33.46  ? 44  GLN D C   1 
ATOM   4424 O  O   . GLN G 1 49  ? 78.693  62.786 81.191 1.00 33.96  ? 44  GLN D O   1 
ATOM   4425 C  CB  . GLN G 1 49  ? 77.815  62.338 84.214 1.00 36.18  ? 44  GLN D CB  1 
ATOM   4426 C  CG  . GLN G 1 49  ? 76.990  63.186 85.149 1.00 41.04  ? 44  GLN D CG  1 
ATOM   4427 C  CD  . GLN G 1 49  ? 77.633  63.312 86.511 1.00 42.47  ? 44  GLN D CD  1 
ATOM   4428 O  OE1 . GLN G 1 49  ? 77.654  62.353 87.286 1.00 42.66  ? 44  GLN D OE1 1 
ATOM   4429 N  NE2 . GLN G 1 49  ? 78.176  64.491 86.807 1.00 40.98  ? 44  GLN D NE2 1 
ATOM   4430 N  N   . ILE G 1 50  ? 78.153  64.786 82.051 1.00 32.48  ? 45  ILE D N   1 
ATOM   4431 C  CA  . ILE G 1 50  ? 77.776  65.314 80.742 1.00 32.32  ? 45  ILE D CA  1 
ATOM   4432 C  C   . ILE G 1 50  ? 79.031  65.681 79.938 1.00 32.16  ? 45  ILE D C   1 
ATOM   4433 O  O   . ILE G 1 50  ? 79.180  65.281 78.777 1.00 32.19  ? 45  ILE D O   1 
ATOM   4434 C  CB  . ILE G 1 50  ? 76.877  66.574 80.876 1.00 31.13  ? 45  ILE D CB  1 
ATOM   4435 C  CG1 . ILE G 1 50  ? 75.514  66.185 81.455 1.00 29.37  ? 45  ILE D CG1 1 
ATOM   4436 C  CG2 . ILE G 1 50  ? 76.721  67.251 79.523 1.00 28.22  ? 45  ILE D CG2 1 
ATOM   4437 C  CD1 . ILE G 1 50  ? 74.557  67.367 81.630 1.00 31.17  ? 45  ILE D CD1 1 
ATOM   4438 N  N   . ALA G 1 51  ? 79.933  66.434 80.569 1.00 29.67  ? 46  ALA D N   1 
ATOM   4439 C  CA  . ALA G 1 51  ? 81.166  66.876 79.927 1.00 28.19  ? 46  ALA D CA  1 
ATOM   4440 C  C   . ALA G 1 51  ? 82.044  65.765 79.327 1.00 27.88  ? 46  ALA D C   1 
ATOM   4441 O  O   . ALA G 1 51  ? 82.634  65.941 78.259 1.00 28.13  ? 46  ALA D O   1 
ATOM   4442 C  CB  . ALA G 1 51  ? 81.979  67.695 80.912 1.00 29.76  ? 46  ALA D CB  1 
ATOM   4443 N  N   . VAL G 1 52  ? 82.154  64.631 80.001 1.00 26.20  ? 47  VAL D N   1 
ATOM   4444 C  CA  . VAL G 1 52  ? 82.983  63.555 79.466 1.00 28.18  ? 47  VAL D CA  1 
ATOM   4445 C  C   . VAL G 1 52  ? 82.371  62.940 78.205 1.00 29.24  ? 47  VAL D C   1 
ATOM   4446 O  O   . VAL G 1 52  ? 83.095  62.358 77.380 1.00 27.24  ? 47  VAL D O   1 
ATOM   4447 C  CB  . VAL G 1 52  ? 83.223  62.435 80.510 1.00 28.15  ? 47  VAL D CB  1 
ATOM   4448 C  CG1 . VAL G 1 52  ? 83.912  63.026 81.751 1.00 25.65  ? 47  VAL D CG1 1 
ATOM   4449 C  CG2 . VAL G 1 52  ? 81.891  61.769 80.886 1.00 25.81  ? 47  VAL D CG2 1 
ATOM   4450 N  N   . ARG G 1 53  ? 81.050  63.051 78.049 1.00 28.65  ? 48  ARG D N   1 
ATOM   4451 C  CA  . ARG G 1 53  ? 80.420  62.505 76.843 1.00 31.20  ? 48  ARG D CA  1 
ATOM   4452 C  C   . ARG G 1 53  ? 80.621  63.500 75.708 1.00 29.33  ? 48  ARG D C   1 
ATOM   4453 O  O   . ARG G 1 53  ? 80.833  63.110 74.559 1.00 30.87  ? 48  ARG D O   1 
ATOM   4454 C  CB  . ARG G 1 53  ? 78.919  62.228 77.047 1.00 33.80  ? 48  ARG D CB  1 
ATOM   4455 C  CG  . ARG G 1 53  ? 78.623  60.975 77.874 1.00 37.09  ? 48  ARG D CG  1 
ATOM   4456 C  CD  . ARG G 1 53  ? 77.349  60.281 77.407 1.00 40.27  ? 48  ARG D CD  1 
ATOM   4457 N  NE  . ARG G 1 53  ? 76.134  60.951 77.857 1.00 41.93  ? 48  ARG D NE  1 
ATOM   4458 C  CZ  . ARG G 1 53  ? 74.938  60.786 77.295 1.00 43.96  ? 48  ARG D CZ  1 
ATOM   4459 N  NH1 . ARG G 1 53  ? 74.794  59.975 76.251 1.00 42.52  ? 48  ARG D NH1 1 
ATOM   4460 N  NH2 . ARG G 1 53  ? 73.879  61.423 77.784 1.00 44.22  ? 48  ARG D NH2 1 
ATOM   4461 N  N   . LEU G 1 54  ? 80.570  64.786 76.038 1.00 27.27  ? 49  LEU D N   1 
ATOM   4462 C  CA  . LEU G 1 54  ? 80.779  65.832 75.049 1.00 24.57  ? 49  LEU D CA  1 
ATOM   4463 C  C   . LEU G 1 54  ? 82.241  65.832 74.637 1.00 21.76  ? 49  LEU D C   1 
ATOM   4464 O  O   . LEU G 1 54  ? 82.554  65.953 73.456 1.00 23.31  ? 49  LEU D O   1 
ATOM   4465 C  CB  . LEU G 1 54  ? 80.437  67.204 75.628 1.00 23.33  ? 49  LEU D CB  1 
ATOM   4466 C  CG  . LEU G 1 54  ? 78.989  67.447 76.030 1.00 25.98  ? 49  LEU D CG  1 
ATOM   4467 C  CD1 . LEU G 1 54  ? 78.860  68.853 76.633 1.00 24.37  ? 49  LEU D CD1 1 
ATOM   4468 C  CD2 . LEU G 1 54  ? 78.090  67.296 74.794 1.00 23.48  ? 49  LEU D CD2 1 
ATOM   4469 N  N   . LEU G 1 55  ? 83.135  65.706 75.610 1.00 19.33  ? 50  LEU D N   1 
ATOM   4470 C  CA  . LEU G 1 55  ? 84.569  65.712 75.322 1.00 21.54  ? 50  LEU D CA  1 
ATOM   4471 C  C   . LEU G 1 55  ? 84.940  64.505 74.473 1.00 21.64  ? 50  LEU D C   1 
ATOM   4472 O  O   . LEU G 1 55  ? 85.620  64.647 73.455 1.00 19.01  ? 50  LEU D O   1 
ATOM   4473 C  CB  . LEU G 1 55  ? 85.389  65.725 76.627 1.00 22.86  ? 50  LEU D CB  1 
ATOM   4474 C  CG  . LEU G 1 55  ? 85.630  67.116 77.248 1.00 22.62  ? 50  LEU D CG  1 
ATOM   4475 C  CD1 . LEU G 1 55  ? 86.088  67.012 78.695 1.00 20.19  ? 50  LEU D CD1 1 
ATOM   4476 C  CD2 . LEU G 1 55  ? 86.674  67.840 76.423 1.00 22.15  ? 50  LEU D CD2 1 
ATOM   4477 N  N   . ALA G 1 56  ? 84.485  63.325 74.888 1.00 21.90  ? 51  ALA D N   1 
ATOM   4478 C  CA  . ALA G 1 56  ? 84.760  62.092 74.153 1.00 24.62  ? 51  ALA D CA  1 
ATOM   4479 C  C   . ALA G 1 56  ? 84.297  62.177 72.698 1.00 26.81  ? 51  ALA D C   1 
ATOM   4480 O  O   . ALA G 1 56  ? 84.930  61.595 71.811 1.00 27.99  ? 51  ALA D O   1 
ATOM   4481 C  CB  . ALA G 1 56  ? 84.078  60.909 74.832 1.00 23.49  ? 51  ALA D CB  1 
ATOM   4482 N  N   . HIS G 1 57  ? 83.193  62.882 72.447 1.00 26.02  ? 52  HIS D N   1 
ATOM   4483 C  CA  . HIS G 1 57  ? 82.694  63.013 71.082 1.00 26.05  ? 52  HIS D CA  1 
ATOM   4484 C  C   . HIS G 1 57  ? 83.565  63.994 70.283 1.00 25.54  ? 52  HIS D C   1 
ATOM   4485 O  O   . HIS G 1 57  ? 83.886  63.731 69.129 1.00 26.46  ? 52  HIS D O   1 
ATOM   4486 C  CB  . HIS G 1 57  ? 81.228  63.475 71.090 1.00 27.99  ? 52  HIS D CB  1 
ATOM   4487 C  CG  . HIS G 1 57  ? 80.507  63.227 69.802 1.00 27.04  ? 52  HIS D CG  1 
ATOM   4488 N  ND1 . HIS G 1 57  ? 80.197  61.961 69.353 1.00 27.46  ? 52  HIS D ND1 1 
ATOM   4489 C  CD2 . HIS G 1 57  ? 80.043  64.083 68.860 1.00 28.30  ? 52  HIS D CD2 1 
ATOM   4490 C  CE1 . HIS G 1 57  ? 79.574  62.047 68.190 1.00 26.80  ? 52  HIS D CE1 1 
ATOM   4491 N  NE2 . HIS G 1 57  ? 79.468  63.324 67.869 1.00 27.68  ? 52  HIS D NE2 1 
ATOM   4492 N  N   . LYS G 1 58  ? 83.954  65.121 70.880 1.00 24.58  ? 53  LYS D N   1 
ATOM   4493 C  CA  . LYS G 1 58  ? 84.809  66.073 70.161 1.00 24.91  ? 53  LYS D CA  1 
ATOM   4494 C  C   . LYS G 1 58  ? 86.131  65.403 69.794 1.00 24.46  ? 53  LYS D C   1 
ATOM   4495 O  O   . LYS G 1 58  ? 86.638  65.556 68.685 1.00 26.27  ? 53  LYS D O   1 
ATOM   4496 C  CB  . LYS G 1 58  ? 85.125  67.300 71.017 1.00 26.18  ? 53  LYS D CB  1 
ATOM   4497 C  CG  . LYS G 1 58  ? 83.979  68.255 71.211 1.00 27.60  ? 53  LYS D CG  1 
ATOM   4498 C  CD  . LYS G 1 58  ? 83.718  69.086 69.969 1.00 25.13  ? 53  LYS D CD  1 
ATOM   4499 C  CE  . LYS G 1 58  ? 82.552  70.041 70.247 1.00 26.09  ? 53  LYS D CE  1 
ATOM   4500 N  NZ  . LYS G 1 58  ? 82.094  70.781 69.040 1.00 24.07  ? 53  LYS D NZ  1 
ATOM   4501 N  N   . ILE G 1 59  ? 86.692  64.670 70.745 1.00 23.16  ? 54  ILE D N   1 
ATOM   4502 C  CA  . ILE G 1 59  ? 87.949  63.974 70.534 1.00 23.27  ? 54  ILE D CA  1 
ATOM   4503 C  C   . ILE G 1 59  ? 87.820  63.000 69.355 1.00 24.57  ? 54  ILE D C   1 
ATOM   4504 O  O   . ILE G 1 59  ? 88.787  62.737 68.641 1.00 25.53  ? 54  ILE D O   1 
ATOM   4505 C  CB  . ILE G 1 59  ? 88.364  63.226 71.828 1.00 23.02  ? 54  ILE D CB  1 
ATOM   4506 C  CG1 . ILE G 1 59  ? 88.608  64.257 72.945 1.00 23.43  ? 54  ILE D CG1 1 
ATOM   4507 C  CG2 . ILE G 1 59  ? 89.605  62.362 71.577 1.00 21.11  ? 54  ILE D CG2 1 
ATOM   4508 C  CD1 . ILE G 1 59  ? 88.836  63.660 74.334 1.00 24.30  ? 54  ILE D CD1 1 
ATOM   4509 N  N   . GLN G 1 60  ? 86.617  62.486 69.137 1.00 24.40  ? 55  GLN D N   1 
ATOM   4510 C  CA  . GLN G 1 60  ? 86.392  61.556 68.038 1.00 25.03  ? 55  GLN D CA  1 
ATOM   4511 C  C   . GLN G 1 60  ? 86.068  62.281 66.735 1.00 25.67  ? 55  GLN D C   1 
ATOM   4512 O  O   . GLN G 1 60  ? 85.734  61.641 65.731 1.00 25.54  ? 55  GLN D O   1 
ATOM   4513 C  CB  . GLN G 1 60  ? 85.255  60.592 68.385 1.00 21.74  ? 55  GLN D CB  1 
ATOM   4514 C  CG  . GLN G 1 60  ? 85.591  59.600 69.484 1.00 20.06  ? 55  GLN D CG  1 
ATOM   4515 C  CD  . GLN G 1 60  ? 84.402  58.753 69.890 1.00 20.50  ? 55  GLN D CD  1 
ATOM   4516 O  OE1 . GLN G 1 60  ? 84.548  57.774 70.609 1.00 25.89  ? 55  GLN D OE1 1 
ATOM   4517 N  NE2 . GLN G 1 60  ? 83.216  59.132 69.439 1.00 23.25  ? 55  GLN D NE2 1 
ATOM   4518 N  N   . SER G 1 61  ? 86.161  63.608 66.749 1.00 26.02  ? 56  SER D N   1 
ATOM   4519 C  CA  . SER G 1 61  ? 85.871  64.393 65.551 1.00 27.81  ? 56  SER D CA  1 
ATOM   4520 C  C   . SER G 1 61  ? 86.777  64.032 64.384 1.00 27.64  ? 56  SER D C   1 
ATOM   4521 O  O   . SER G 1 61  ? 87.936  63.704 64.571 1.00 29.28  ? 56  SER D O   1 
ATOM   4522 C  CB  . SER G 1 61  ? 86.018  65.880 65.825 1.00 25.52  ? 56  SER D CB  1 
ATOM   4523 O  OG  . SER G 1 61  ? 85.817  66.599 64.620 1.00 26.17  ? 56  SER D OG  1 
ATOM   4524 N  N   . PRO G 1 62  ? 86.248  64.076 63.157 1.00 29.48  ? 57  PRO D N   1 
ATOM   4525 C  CA  . PRO G 1 62  ? 87.065  63.743 61.982 1.00 29.02  ? 57  PRO D CA  1 
ATOM   4526 C  C   . PRO G 1 62  ? 88.030  64.879 61.642 1.00 29.21  ? 57  PRO D C   1 
ATOM   4527 O  O   . PRO G 1 62  ? 88.998  64.682 60.908 1.00 29.51  ? 57  PRO D O   1 
ATOM   4528 C  CB  . PRO G 1 62  ? 86.023  63.536 60.878 1.00 29.54  ? 57  PRO D CB  1 
ATOM   4529 C  CG  . PRO G 1 62  ? 84.764  63.168 61.639 1.00 30.90  ? 57  PRO D CG  1 
ATOM   4530 C  CD  . PRO G 1 62  ? 84.813  64.105 62.814 1.00 29.46  ? 57  PRO D CD  1 
ATOM   4531 N  N   . GLN G 1 63  ? 87.750  66.065 62.182 1.00 29.45  ? 58  GLN D N   1 
ATOM   4532 C  CA  . GLN G 1 63  ? 88.556  67.266 61.950 1.00 29.64  ? 58  GLN D CA  1 
ATOM   4533 C  C   . GLN G 1 63  ? 89.594  67.373 63.064 1.00 31.35  ? 58  GLN D C   1 
ATOM   4534 O  O   . GLN G 1 63  ? 89.269  67.751 64.189 1.00 32.47  ? 58  GLN D O   1 
ATOM   4535 C  CB  . GLN G 1 63  ? 87.643  68.497 61.954 1.00 30.00  ? 58  GLN D CB  1 
ATOM   4536 C  CG  . GLN G 1 63  ? 88.143  69.671 61.113 1.00 31.13  ? 58  GLN D CG  1 
ATOM   4537 C  CD  . GLN G 1 63  ? 89.525  70.135 61.532 1.00 29.47  ? 58  GLN D CD  1 
ATOM   4538 O  OE1 . GLN G 1 63  ? 90.483  70.043 60.762 1.00 30.81  ? 58  GLN D OE1 1 
ATOM   4539 N  NE2 . GLN G 1 63  ? 89.639  70.624 62.760 1.00 26.05  ? 58  GLN D NE2 1 
ATOM   4540 N  N   . GLU G 1 64  ? 90.844  67.049 62.731 1.00 33.19  ? 59  GLU D N   1 
ATOM   4541 C  CA  . GLU G 1 64  ? 91.964  67.030 63.677 1.00 33.16  ? 59  GLU D CA  1 
ATOM   4542 C  C   . GLU G 1 64  ? 92.172  68.178 64.661 1.00 32.29  ? 59  GLU D C   1 
ATOM   4543 O  O   . GLU G 1 64  ? 92.388  67.933 65.854 1.00 31.08  ? 59  GLU D O   1 
ATOM   4544 C  CB  . GLU G 1 64  ? 93.279  66.797 62.922 1.00 36.41  ? 59  GLU D CB  1 
ATOM   4545 C  CG  . GLU G 1 64  ? 94.509  67.061 63.779 1.00 40.51  ? 59  GLU D CG  1 
ATOM   4546 C  CD  . GLU G 1 64  ? 95.813  66.904 63.031 1.00 42.46  ? 59  GLU D CD  1 
ATOM   4547 O  OE1 . GLU G 1 64  ? 96.257  65.754 62.844 1.00 43.73  ? 59  GLU D OE1 1 
ATOM   4548 O  OE2 . GLU G 1 64  ? 96.395  67.937 62.631 1.00 46.01  ? 59  GLU D OE2 1 
ATOM   4549 N  N   . TRP G 1 65  ? 92.145  69.417 64.179 1.00 30.72  ? 60  TRP D N   1 
ATOM   4550 C  CA  . TRP G 1 65  ? 92.358  70.553 65.068 1.00 30.42  ? 60  TRP D CA  1 
ATOM   4551 C  C   . TRP G 1 65  ? 91.278  70.572 66.142 1.00 30.60  ? 60  TRP D C   1 
ATOM   4552 O  O   . TRP G 1 65  ? 91.567  70.747 67.330 1.00 31.40  ? 60  TRP D O   1 
ATOM   4553 C  CB  . TRP G 1 65  ? 92.337  71.861 64.269 1.00 32.93  ? 60  TRP D CB  1 
ATOM   4554 C  CG  . TRP G 1 65  ? 92.658  73.121 65.071 1.00 33.50  ? 60  TRP D CG  1 
ATOM   4555 C  CD1 . TRP G 1 65  ? 92.103  74.360 64.901 1.00 31.94  ? 60  TRP D CD1 1 
ATOM   4556 C  CD2 . TRP G 1 65  ? 93.627  73.263 66.121 1.00 33.11  ? 60  TRP D CD2 1 
ATOM   4557 N  NE1 . TRP G 1 65  ? 92.661  75.256 65.771 1.00 31.66  ? 60  TRP D NE1 1 
ATOM   4558 C  CE2 . TRP G 1 65  ? 93.600  74.614 66.533 1.00 33.36  ? 60  TRP D CE2 1 
ATOM   4559 C  CE3 . TRP G 1 65  ? 94.518  72.381 66.753 1.00 34.68  ? 60  TRP D CE3 1 
ATOM   4560 C  CZ2 . TRP G 1 65  ? 94.432  75.110 67.554 1.00 35.20  ? 60  TRP D CZ2 1 
ATOM   4561 C  CZ3 . TRP G 1 65  ? 95.350  72.876 67.770 1.00 33.42  ? 60  TRP D CZ3 1 
ATOM   4562 C  CH2 . TRP G 1 65  ? 95.297  74.228 68.157 1.00 31.74  ? 60  TRP D CH2 1 
ATOM   4563 N  N   . GLU G 1 66  ? 90.030  70.380 65.726 1.00 30.15  ? 61  GLU D N   1 
ATOM   4564 C  CA  . GLU G 1 66  ? 88.917  70.379 66.666 1.00 29.45  ? 61  GLU D CA  1 
ATOM   4565 C  C   . GLU G 1 66  ? 89.144  69.313 67.731 1.00 27.53  ? 61  GLU D C   1 
ATOM   4566 O  O   . GLU G 1 66  ? 88.904  69.543 68.921 1.00 26.55  ? 61  GLU D O   1 
ATOM   4567 C  CB  . GLU G 1 66  ? 87.594  70.128 65.924 1.00 31.21  ? 61  GLU D CB  1 
ATOM   4568 C  CG  . GLU G 1 66  ? 86.408  69.752 66.823 1.00 30.03  ? 61  GLU D CG  1 
ATOM   4569 C  CD  . GLU G 1 66  ? 85.077  69.773 66.074 1.00 32.35  ? 61  GLU D CD  1 
ATOM   4570 O  OE1 . GLU G 1 66  ? 84.746  68.778 65.390 1.00 33.10  ? 61  GLU D OE1 1 
ATOM   4571 O  OE2 . GLU G 1 66  ? 84.362  70.794 66.154 1.00 33.10  ? 61  GLU D OE2 1 
ATOM   4572 N  N   . ALA G 1 67  ? 89.617  68.151 67.293 1.00 25.54  ? 62  ALA D N   1 
ATOM   4573 C  CA  . ALA G 1 67  ? 89.899  67.034 68.192 1.00 25.14  ? 62  ALA D CA  1 
ATOM   4574 C  C   . ALA G 1 67  ? 91.112  67.318 69.075 1.00 24.25  ? 62  ALA D C   1 
ATOM   4575 O  O   . ALA G 1 67  ? 91.127  66.946 70.243 1.00 24.00  ? 62  ALA D O   1 
ATOM   4576 C  CB  . ALA G 1 67  ? 90.133  65.754 67.381 1.00 24.77  ? 62  ALA D CB  1 
ATOM   4577 N  N   . LEU G 1 68  ? 92.133  67.966 68.520 1.00 26.19  ? 63  LEU D N   1 
ATOM   4578 C  CA  . LEU G 1 68  ? 93.328  68.277 69.310 1.00 27.47  ? 63  LEU D CA  1 
ATOM   4579 C  C   . LEU G 1 68  ? 92.930  69.233 70.426 1.00 27.81  ? 63  LEU D C   1 
ATOM   4580 O  O   . LEU G 1 68  ? 93.247  69.017 71.596 1.00 27.49  ? 63  LEU D O   1 
ATOM   4581 C  CB  . LEU G 1 68  ? 94.404  68.938 68.452 1.00 27.92  ? 63  LEU D CB  1 
ATOM   4582 C  CG  . LEU G 1 68  ? 95.697  68.192 68.077 1.00 31.04  ? 63  LEU D CG  1 
ATOM   4583 C  CD1 . LEU G 1 68  ? 95.990  67.038 69.047 1.00 29.28  ? 63  LEU D CD1 1 
ATOM   4584 C  CD2 . LEU G 1 68  ? 95.575  67.683 66.662 1.00 30.43  ? 63  LEU D CD2 1 
ATOM   4585 N  N   . GLN G 1 69  ? 92.232  70.299 70.059 1.00 26.33  ? 64  GLN D N   1 
ATOM   4586 C  CA  . GLN G 1 69  ? 91.798  71.259 71.047 1.00 25.39  ? 64  GLN D CA  1 
ATOM   4587 C  C   . GLN G 1 69  ? 90.979  70.566 72.120 1.00 26.60  ? 64  GLN D C   1 
ATOM   4588 O  O   . GLN G 1 69  ? 91.199  70.784 73.318 1.00 29.16  ? 64  GLN D O   1 
ATOM   4589 C  CB  . GLN G 1 69  ? 90.985  72.354 70.376 1.00 25.84  ? 64  GLN D CB  1 
ATOM   4590 C  CG  . GLN G 1 69  ? 91.847  73.301 69.572 1.00 24.86  ? 64  GLN D CG  1 
ATOM   4591 C  CD  . GLN G 1 69  ? 91.025  74.305 68.818 1.00 27.18  ? 64  GLN D CD  1 
ATOM   4592 O  OE1 . GLN G 1 69  ? 90.596  74.049 67.690 1.00 29.06  ? 64  GLN D OE1 1 
ATOM   4593 N  NE2 . GLN G 1 69  ? 90.776  75.455 69.440 1.00 26.54  ? 64  GLN D NE2 1 
ATOM   4594 N  N   . ALA G 1 70  ? 90.035  69.728 71.703 1.00 25.18  ? 65  ALA D N   1 
ATOM   4595 C  CA  . ALA G 1 70  ? 89.205  69.009 72.664 1.00 24.45  ? 65  ALA D CA  1 
ATOM   4596 C  C   . ALA G 1 70  ? 90.082  68.253 73.664 1.00 24.82  ? 65  ALA D C   1 
ATOM   4597 O  O   . ALA G 1 70  ? 89.750  68.145 74.848 1.00 24.57  ? 65  ALA D O   1 
ATOM   4598 C  CB  . ALA G 1 70  ? 88.295  68.031 71.937 1.00 23.66  ? 65  ALA D CB  1 
ATOM   4599 N  N   . LEU G 1 71  ? 91.203  67.723 73.185 1.00 24.32  ? 66  LEU D N   1 
ATOM   4600 C  CA  . LEU G 1 71  ? 92.095  66.975 74.051 1.00 24.44  ? 66  LEU D CA  1 
ATOM   4601 C  C   . LEU G 1 71  ? 92.796  67.867 75.071 1.00 24.45  ? 66  LEU D C   1 
ATOM   4602 O  O   . LEU G 1 71  ? 93.035  67.444 76.205 1.00 23.98  ? 66  LEU D O   1 
ATOM   4603 C  CB  . LEU G 1 71  ? 93.118  66.188 73.216 1.00 22.23  ? 66  LEU D CB  1 
ATOM   4604 C  CG  . LEU G 1 71  ? 92.588  64.884 72.595 1.00 22.41  ? 66  LEU D CG  1 
ATOM   4605 C  CD1 . LEU G 1 71  ? 93.599  64.281 71.615 1.00 23.31  ? 66  LEU D CD1 1 
ATOM   4606 C  CD2 . LEU G 1 71  ? 92.292  63.900 73.695 1.00 21.88  ? 66  LEU D CD2 1 
ATOM   4607 N  N   . THR G 1 72  ? 93.134  69.095 74.696 1.00 25.87  ? 67  THR D N   1 
ATOM   4608 C  CA  . THR G 1 72  ? 93.794  69.952 75.673 1.00 29.16  ? 67  THR D CA  1 
ATOM   4609 C  C   . THR G 1 72  ? 92.755  70.422 76.685 1.00 28.66  ? 67  THR D C   1 
ATOM   4610 O  O   . THR G 1 72  ? 93.089  70.692 77.839 1.00 30.97  ? 67  THR D O   1 
ATOM   4611 C  CB  . THR G 1 72  ? 94.525  71.159 75.024 1.00 29.24  ? 67  THR D CB  1 
ATOM   4612 O  OG1 . THR G 1 72  ? 93.571  72.089 74.510 1.00 33.11  ? 67  THR D OG1 1 
ATOM   4613 C  CG2 . THR G 1 72  ? 95.424  70.675 73.892 1.00 26.86  ? 67  THR D CG2 1 
ATOM   4614 N  N   . VAL G 1 73  ? 91.495  70.499 76.260 1.00 28.42  ? 68  VAL D N   1 
ATOM   4615 C  CA  . VAL G 1 73  ? 90.414  70.884 77.168 1.00 27.96  ? 68  VAL D CA  1 
ATOM   4616 C  C   . VAL G 1 73  ? 90.234  69.752 78.199 1.00 28.96  ? 68  VAL D C   1 
ATOM   4617 O  O   . VAL G 1 73  ? 89.938  69.997 79.381 1.00 27.83  ? 68  VAL D O   1 
ATOM   4618 C  CB  . VAL G 1 73  ? 89.073  71.096 76.410 1.00 27.17  ? 68  VAL D CB  1 
ATOM   4619 C  CG1 . VAL G 1 73  ? 87.950  71.331 77.407 1.00 26.09  ? 68  VAL D CG1 1 
ATOM   4620 C  CG2 . VAL G 1 73  ? 89.182  72.290 75.457 1.00 25.68  ? 68  VAL D CG2 1 
ATOM   4621 N  N   . LEU G 1 74  ? 90.402  68.509 77.744 1.00 27.78  ? 69  LEU D N   1 
ATOM   4622 C  CA  . LEU G 1 74  ? 90.288  67.357 78.634 1.00 28.15  ? 69  LEU D CA  1 
ATOM   4623 C  C   . LEU G 1 74  ? 91.386  67.453 79.691 1.00 28.75  ? 69  LEU D C   1 
ATOM   4624 O  O   . LEU G 1 74  ? 91.144  67.237 80.879 1.00 29.07  ? 69  LEU D O   1 
ATOM   4625 C  CB  . LEU G 1 74  ? 90.452  66.049 77.852 1.00 26.46  ? 69  LEU D CB  1 
ATOM   4626 C  CG  . LEU G 1 74  ? 90.460  64.786 78.714 1.00 26.64  ? 69  LEU D CG  1 
ATOM   4627 C  CD1 . LEU G 1 74  ? 89.203  64.735 79.564 1.00 26.14  ? 69  LEU D CD1 1 
ATOM   4628 C  CD2 . LEU G 1 74  ? 90.556  63.559 77.823 1.00 28.15  ? 69  LEU D CD2 1 
ATOM   4629 N  N   . GLU G 1 75  ? 92.595  67.781 79.246 1.00 28.89  ? 70  GLU D N   1 
ATOM   4630 C  CA  . GLU G 1 75  ? 93.736  67.917 80.142 1.00 31.39  ? 70  GLU D CA  1 
ATOM   4631 C  C   . GLU G 1 75  ? 93.455  69.029 81.159 1.00 30.69  ? 70  GLU D C   1 
ATOM   4632 O  O   . GLU G 1 75  ? 93.700  68.869 82.351 1.00 30.04  ? 70  GLU D O   1 
ATOM   4633 C  CB  . GLU G 1 75  ? 94.988  68.239 79.327 1.00 34.49  ? 70  GLU D CB  1 
ATOM   4634 C  CG  . GLU G 1 75  ? 96.297  67.791 79.955 1.00 39.76  ? 70  GLU D CG  1 
ATOM   4635 C  CD  . GLU G 1 75  ? 97.467  67.889 78.983 1.00 43.68  ? 70  GLU D CD  1 
ATOM   4636 O  OE1 . GLU G 1 75  ? 97.244  68.296 77.820 1.00 45.76  ? 70  GLU D OE1 1 
ATOM   4637 O  OE2 . GLU G 1 75  ? 98.608  67.552 79.377 1.00 46.32  ? 70  GLU D OE2 1 
ATOM   4638 N  N   . ALA G 1 76  ? 92.914  70.147 80.686 1.00 30.55  ? 71  ALA D N   1 
ATOM   4639 C  CA  . ALA G 1 76  ? 92.597  71.258 81.574 1.00 31.38  ? 71  ALA D CA  1 
ATOM   4640 C  C   . ALA G 1 76  ? 91.553  70.836 82.609 1.00 32.19  ? 71  ALA D C   1 
ATOM   4641 O  O   . ALA G 1 76  ? 91.627  71.243 83.772 1.00 33.11  ? 71  ALA D O   1 
ATOM   4642 C  CB  . ALA G 1 76  ? 92.098  72.455 80.766 1.00 28.94  ? 71  ALA D CB  1 
ATOM   4643 N  N   . CYS G 1 77  ? 90.588  70.015 82.194 1.00 32.15  ? 72  CYS D N   1 
ATOM   4644 C  CA  . CYS G 1 77  ? 89.545  69.537 83.106 1.00 32.17  ? 72  CYS D CA  1 
ATOM   4645 C  C   . CYS G 1 77  ? 90.085  68.613 84.190 1.00 31.35  ? 72  CYS D C   1 
ATOM   4646 O  O   . CYS G 1 77  ? 89.585  68.613 85.319 1.00 30.72  ? 72  CYS D O   1 
ATOM   4647 C  CB  . CYS G 1 77  ? 88.446  68.794 82.343 1.00 32.72  ? 72  CYS D CB  1 
ATOM   4648 S  SG  . CYS G 1 77  ? 87.376  69.854 81.382 1.00 34.07  ? 72  CYS D SG  1 
HETATM 4649 N  N   . MSE G 1 78  ? 91.086  67.809 83.843 1.00 30.36  ? 73  MSE D N   1 
HETATM 4650 C  CA  . MSE G 1 78  ? 91.676  66.896 84.810 1.00 30.34  ? 73  MSE D CA  1 
HETATM 4651 C  C   . MSE G 1 78  ? 92.330  67.674 85.948 1.00 32.08  ? 73  MSE D C   1 
HETATM 4652 O  O   . MSE G 1 78  ? 92.505  67.145 87.044 1.00 32.57  ? 73  MSE D O   1 
HETATM 4653 C  CB  . MSE G 1 78  ? 92.712  65.997 84.137 1.00 28.95  ? 73  MSE D CB  1 
HETATM 4654 C  CG  . MSE G 1 78  ? 92.129  65.018 83.139 1.00 30.91  ? 73  MSE D CG  1 
HETATM 4655 SE SE  . MSE G 1 78  ? 90.865  63.776 83.930 1.00 35.66  ? 73  MSE D SE  1 
HETATM 4656 C  CE  . MSE G 1 78  ? 92.095  62.376 84.417 1.00 29.38  ? 73  MSE D CE  1 
ATOM   4657 N  N   . LYS G 1 79  ? 92.690  68.929 85.688 1.00 33.24  ? 74  LYS D N   1 
ATOM   4658 C  CA  . LYS G 1 79  ? 93.318  69.761 86.706 1.00 35.01  ? 74  LYS D CA  1 
ATOM   4659 C  C   . LYS G 1 79  ? 92.336  70.669 87.439 1.00 33.95  ? 74  LYS D C   1 
ATOM   4660 O  O   . LYS G 1 79  ? 92.447  70.870 88.649 1.00 33.99  ? 74  LYS D O   1 
ATOM   4661 C  CB  . LYS G 1 79  ? 94.432  70.614 86.084 1.00 37.54  ? 74  LYS D CB  1 
ATOM   4662 C  CG  . LYS G 1 79  ? 95.648  69.801 85.647 1.00 40.53  ? 74  LYS D CG  1 
ATOM   4663 C  CD  . LYS G 1 79  ? 96.783  70.684 85.149 1.00 44.65  ? 74  LYS D CD  1 
ATOM   4664 C  CE  . LYS G 1 79  ? 97.983  70.620 86.090 1.00 45.30  ? 74  LYS D CE  1 
ATOM   4665 N  NZ  . LYS G 1 79  ? 98.504  69.230 86.210 1.00 44.47  ? 74  LYS D NZ  1 
ATOM   4666 N  N   . ASN G 1 80  ? 91.358  71.198 86.717 1.00 33.38  ? 75  ASN D N   1 
ATOM   4667 C  CA  . ASN G 1 80  ? 90.399  72.108 87.324 1.00 32.55  ? 75  ASN D CA  1 
ATOM   4668 C  C   . ASN G 1 80  ? 89.075  71.542 87.789 1.00 32.79  ? 75  ASN D C   1 
ATOM   4669 O  O   . ASN G 1 80  ? 88.299  72.258 88.420 1.00 35.75  ? 75  ASN D O   1 
ATOM   4670 C  CB  . ASN G 1 80  ? 90.112  73.259 86.369 1.00 31.93  ? 75  ASN D CB  1 
ATOM   4671 C  CG  . ASN G 1 80  ? 91.355  74.006 85.990 1.00 35.69  ? 75  ASN D CG  1 
ATOM   4672 O  OD1 . ASN G 1 80  ? 92.063  73.626 85.050 1.00 34.62  ? 75  ASN D OD1 1 
ATOM   4673 N  ND2 . ASN G 1 80  ? 91.655  75.070 86.738 1.00 37.05  ? 75  ASN D ND2 1 
ATOM   4674 N  N   . CYS G 1 81  ? 88.801  70.271 87.523 1.00 31.81  ? 76  CYS D N   1 
ATOM   4675 C  CA  . CYS G 1 81  ? 87.500  69.749 87.910 1.00 30.75  ? 76  CYS D CA  1 
ATOM   4676 C  C   . CYS G 1 81  ? 87.449  68.732 89.030 1.00 30.26  ? 76  CYS D C   1 
ATOM   4677 O  O   . CYS G 1 81  ? 86.380  68.241 89.379 1.00 29.10  ? 76  CYS D O   1 
ATOM   4678 C  CB  . CYS G 1 81  ? 86.786  69.235 86.663 1.00 30.29  ? 76  CYS D CB  1 
ATOM   4679 S  SG  . CYS G 1 81  ? 86.643  70.543 85.417 1.00 27.02  ? 76  CYS D SG  1 
ATOM   4680 N  N   . GLY G 1 82  ? 88.610  68.430 89.593 1.00 31.62  ? 77  GLY D N   1 
ATOM   4681 C  CA  . GLY G 1 82  ? 88.693  67.511 90.713 1.00 32.77  ? 77  GLY D CA  1 
ATOM   4682 C  C   . GLY G 1 82  ? 88.039  66.145 90.665 1.00 34.18  ? 77  GLY D C   1 
ATOM   4683 O  O   . GLY G 1 82  ? 87.568  65.672 89.626 1.00 33.15  ? 77  GLY D O   1 
ATOM   4684 N  N   . ARG G 1 83  ? 88.037  65.514 91.837 1.00 36.48  ? 78  ARG D N   1 
ATOM   4685 C  CA  . ARG G 1 83  ? 87.480  64.181 92.058 1.00 38.98  ? 78  ARG D CA  1 
ATOM   4686 C  C   . ARG G 1 83  ? 86.240  63.873 91.209 1.00 38.21  ? 78  ARG D C   1 
ATOM   4687 O  O   . ARG G 1 83  ? 86.165  62.810 90.586 1.00 38.10  ? 78  ARG D O   1 
ATOM   4688 C  CB  . ARG G 1 83  ? 87.135  64.024 93.543 1.00 42.87  ? 78  ARG D CB  1 
ATOM   4689 C  CG  . ARG G 1 83  ? 87.628  62.747 94.195 1.00 48.77  ? 78  ARG D CG  1 
ATOM   4690 C  CD  . ARG G 1 83  ? 89.145  62.643 94.104 1.00 55.43  ? 78  ARG D CD  1 
ATOM   4691 N  NE  . ARG G 1 83  ? 89.576  61.811 92.979 1.00 59.37  ? 78  ARG D NE  1 
ATOM   4692 C  CZ  . ARG G 1 83  ? 90.846  61.596 92.649 1.00 59.55  ? 78  ARG D CZ  1 
ATOM   4693 N  NH1 . ARG G 1 83  ? 91.820  62.161 93.353 1.00 59.73  ? 78  ARG D NH1 1 
ATOM   4694 N  NH2 . ARG G 1 83  ? 91.140  60.794 91.633 1.00 60.96  ? 78  ARG D NH2 1 
ATOM   4695 N  N   . ARG G 1 84  ? 85.279  64.803 91.194 1.00 36.67  ? 79  ARG D N   1 
ATOM   4696 C  CA  . ARG G 1 84  ? 84.027  64.641 90.444 1.00 33.86  ? 79  ARG D CA  1 
ATOM   4697 C  C   . ARG G 1 84  ? 84.295  64.208 89.020 1.00 32.52  ? 79  ARG D C   1 
ATOM   4698 O  O   . ARG G 1 84  ? 83.684  63.259 88.514 1.00 32.12  ? 79  ARG D O   1 
ATOM   4699 C  CB  . ARG G 1 84  ? 83.247  65.954 90.353 1.00 32.58  ? 79  ARG D CB  1 
ATOM   4700 C  CG  . ARG G 1 84  ? 83.182  66.789 91.596 1.00 35.04  ? 79  ARG D CG  1 
ATOM   4701 C  CD  . ARG G 1 84  ? 82.363  68.038 91.301 1.00 32.14  ? 79  ARG D CD  1 
ATOM   4702 N  NE  . ARG G 1 84  ? 80.982  67.704 90.957 1.00 29.57  ? 79  ARG D NE  1 
ATOM   4703 C  CZ  . ARG G 1 84  ? 80.253  68.374 90.068 1.00 30.18  ? 79  ARG D CZ  1 
ATOM   4704 N  NH1 . ARG G 1 84  ? 80.781  69.411 89.421 1.00 27.81  ? 79  ARG D NH1 1 
ATOM   4705 N  NH2 . ARG G 1 84  ? 78.986  68.033 89.852 1.00 29.38  ? 79  ARG D NH2 1 
ATOM   4706 N  N   . PHE G 1 85  ? 85.198  64.943 88.372 1.00 30.68  ? 80  PHE D N   1 
ATOM   4707 C  CA  . PHE G 1 85  ? 85.555  64.684 86.991 1.00 30.01  ? 80  PHE D CA  1 
ATOM   4708 C  C   . PHE G 1 85  ? 86.393  63.404 86.862 1.00 29.78  ? 80  PHE D C   1 
ATOM   4709 O  O   . PHE G 1 85  ? 86.164  62.587 85.966 1.00 30.43  ? 80  PHE D O   1 
ATOM   4710 C  CB  . PHE G 1 85  ? 86.316  65.883 86.428 1.00 28.30  ? 80  PHE D CB  1 
ATOM   4711 C  CG  . PHE G 1 85  ? 86.387  65.894 84.931 1.00 29.33  ? 80  PHE D CG  1 
ATOM   4712 C  CD1 . PHE G 1 85  ? 85.262  66.209 84.176 1.00 28.50  ? 80  PHE D CD1 1 
ATOM   4713 C  CD2 . PHE G 1 85  ? 87.561  65.536 84.271 1.00 27.38  ? 80  PHE D CD2 1 
ATOM   4714 C  CE1 . PHE G 1 85  ? 85.304  66.165 82.781 1.00 28.86  ? 80  PHE D CE1 1 
ATOM   4715 C  CE2 . PHE G 1 85  ? 87.614  65.488 82.881 1.00 25.48  ? 80  PHE D CE2 1 
ATOM   4716 C  CZ  . PHE G 1 85  ? 86.484  65.802 82.134 1.00 27.72  ? 80  PHE D CZ  1 
ATOM   4717 N  N   . HIS G 1 86  ? 87.354  63.226 87.762 1.00 29.48  ? 81  HIS D N   1 
ATOM   4718 C  CA  . HIS G 1 86  ? 88.200  62.040 87.730 1.00 31.16  ? 81  HIS D CA  1 
ATOM   4719 C  C   . HIS G 1 86  ? 87.368  60.761 87.770 1.00 33.60  ? 81  HIS D C   1 
ATOM   4720 O  O   . HIS G 1 86  ? 87.633  59.825 87.011 1.00 32.70  ? 81  HIS D O   1 
ATOM   4721 C  CB  . HIS G 1 86  ? 89.179  62.049 88.906 1.00 28.96  ? 81  HIS D CB  1 
ATOM   4722 C  CG  . HIS G 1 86  ? 90.104  63.225 88.908 1.00 27.15  ? 81  HIS D CG  1 
ATOM   4723 N  ND1 . HIS G 1 86  ? 90.292  64.024 87.801 1.00 26.92  ? 81  HIS D ND1 1 
ATOM   4724 C  CD2 . HIS G 1 86  ? 90.908  63.727 89.876 1.00 26.87  ? 81  HIS D CD2 1 
ATOM   4725 C  CE1 . HIS G 1 86  ? 91.169  64.970 88.088 1.00 27.33  ? 81  HIS D CE1 1 
ATOM   4726 N  NE2 . HIS G 1 86  ? 91.558  64.812 89.340 1.00 27.36  ? 81  HIS D NE2 1 
ATOM   4727 N  N   . ASN G 1 87  ? 86.358  60.728 88.643 1.00 35.54  ? 82  ASN D N   1 
ATOM   4728 C  CA  . ASN G 1 87  ? 85.497  59.549 88.776 1.00 37.38  ? 82  ASN D CA  1 
ATOM   4729 C  C   . ASN G 1 87  ? 84.769  59.199 87.490 1.00 35.97  ? 82  ASN D C   1 
ATOM   4730 O  O   . ASN G 1 87  ? 84.531  58.023 87.209 1.00 36.20  ? 82  ASN D O   1 
ATOM   4731 C  CB  . ASN G 1 87  ? 84.451  59.735 89.891 1.00 41.62  ? 82  ASN D CB  1 
ATOM   4732 C  CG  . ASN G 1 87  ? 85.074  59.828 91.280 1.00 45.31  ? 82  ASN D CG  1 
ATOM   4733 O  OD1 . ASN G 1 87  ? 86.044  59.128 91.589 1.00 48.26  ? 82  ASN D OD1 1 
ATOM   4734 N  ND2 . ASN G 1 87  ? 84.505  60.683 92.132 1.00 46.58  ? 82  ASN D ND2 1 
ATOM   4735 N  N   . GLU G 1 88  ? 84.396  60.210 86.711 1.00 35.60  ? 83  GLU D N   1 
ATOM   4736 C  CA  . GLU G 1 88  ? 83.684  59.955 85.458 1.00 34.74  ? 83  GLU D CA  1 
ATOM   4737 C  C   . GLU G 1 88  ? 84.661  59.551 84.359 1.00 34.06  ? 83  GLU D C   1 
ATOM   4738 O  O   . GLU G 1 88  ? 84.300  58.835 83.420 1.00 33.81  ? 83  GLU D O   1 
ATOM   4739 C  CB  . GLU G 1 88  ? 82.874  61.185 85.031 1.00 35.20  ? 83  GLU D CB  1 
ATOM   4740 C  CG  . GLU G 1 88  ? 81.697  61.470 85.942 1.00 37.93  ? 83  GLU D CG  1 
ATOM   4741 C  CD  . GLU G 1 88  ? 80.734  60.303 86.000 1.00 41.50  ? 83  GLU D CD  1 
ATOM   4742 O  OE1 . GLU G 1 88  ? 80.412  59.733 84.925 1.00 43.28  ? 83  GLU D OE1 1 
ATOM   4743 O  OE2 . GLU G 1 88  ? 80.297  59.959 87.121 1.00 42.11  ? 83  GLU D OE2 1 
ATOM   4744 N  N   . VAL G 1 89  ? 85.902  60.006 84.474 1.00 31.99  ? 84  VAL D N   1 
ATOM   4745 C  CA  . VAL G 1 89  ? 86.896  59.641 83.487 1.00 31.96  ? 84  VAL D CA  1 
ATOM   4746 C  C   . VAL G 1 89  ? 87.302  58.188 83.726 1.00 31.98  ? 84  VAL D C   1 
ATOM   4747 O  O   . VAL G 1 89  ? 87.541  57.432 82.786 1.00 30.93  ? 84  VAL D O   1 
ATOM   4748 C  CB  . VAL G 1 89  ? 88.127  60.556 83.585 1.00 33.11  ? 84  VAL D CB  1 
ATOM   4749 C  CG1 . VAL G 1 89  ? 89.286  59.972 82.780 1.00 30.74  ? 84  VAL D CG1 1 
ATOM   4750 C  CG2 . VAL G 1 89  ? 87.762  61.956 83.064 1.00 33.12  ? 84  VAL D CG2 1 
ATOM   4751 N  N   . GLY G 1 90  ? 87.344  57.802 84.996 1.00 31.55  ? 85  GLY D N   1 
ATOM   4752 C  CA  . GLY G 1 90  ? 87.732  56.456 85.349 1.00 32.76  ? 85  GLY D CA  1 
ATOM   4753 C  C   . GLY G 1 90  ? 86.684  55.397 85.067 1.00 34.18  ? 85  GLY D C   1 
ATOM   4754 O  O   . GLY G 1 90  ? 86.730  54.302 85.643 1.00 36.68  ? 85  GLY D O   1 
ATOM   4755 N  N   . LYS G 1 91  ? 85.729  55.706 84.199 1.00 32.41  ? 86  LYS D N   1 
ATOM   4756 C  CA  . LYS G 1 91  ? 84.702  54.731 83.867 1.00 30.97  ? 86  LYS D CA  1 
ATOM   4757 C  C   . LYS G 1 91  ? 84.871  54.267 82.432 1.00 29.70  ? 86  LYS D C   1 
ATOM   4758 O  O   . LYS G 1 91  ? 85.198  55.057 81.542 1.00 29.72  ? 86  LYS D O   1 
ATOM   4759 C  CB  . LYS G 1 91  ? 83.308  55.321 84.073 1.00 32.47  ? 86  LYS D CB  1 
ATOM   4760 C  CG  . LYS G 1 91  ? 82.904  55.460 85.542 1.00 36.47  ? 86  LYS D CG  1 
ATOM   4761 C  CD  . LYS G 1 91  ? 81.516  56.077 85.677 1.00 37.82  ? 86  LYS D CD  1 
ATOM   4762 C  CE  . LYS G 1 91  ? 81.117  56.284 87.133 1.00 39.42  ? 86  LYS D CE  1 
ATOM   4763 N  NZ  . LYS G 1 91  ? 79.743  56.888 87.234 1.00 39.12  ? 86  LYS D NZ  1 
ATOM   4764 N  N   . PHE G 1 92  ? 84.665  52.976 82.217 1.00 28.93  ? 87  PHE D N   1 
ATOM   4765 C  CA  . PHE G 1 92  ? 84.794  52.394 80.893 1.00 30.68  ? 87  PHE D CA  1 
ATOM   4766 C  C   . PHE G 1 92  ? 83.878  53.070 79.882 1.00 30.96  ? 87  PHE D C   1 
ATOM   4767 O  O   . PHE G 1 92  ? 84.210  53.136 78.697 1.00 29.78  ? 87  PHE D O   1 
ATOM   4768 C  CB  . PHE G 1 92  ? 84.477  50.894 80.932 1.00 32.25  ? 87  PHE D CB  1 
ATOM   4769 C  CG  . PHE G 1 92  ? 85.560  50.055 81.535 1.00 32.19  ? 87  PHE D CG  1 
ATOM   4770 C  CD1 . PHE G 1 92  ? 86.860  50.125 81.050 1.00 32.81  ? 87  PHE D CD1 1 
ATOM   4771 C  CD2 . PHE G 1 92  ? 85.277  49.178 82.581 1.00 33.35  ? 87  PHE D CD2 1 
ATOM   4772 C  CE1 . PHE G 1 92  ? 87.862  49.335 81.597 1.00 33.21  ? 87  PHE D CE1 1 
ATOM   4773 C  CE2 . PHE G 1 92  ? 86.271  48.381 83.134 1.00 31.58  ? 87  PHE D CE2 1 
ATOM   4774 C  CZ  . PHE G 1 92  ? 87.563  48.459 82.644 1.00 32.75  ? 87  PHE D CZ  1 
ATOM   4775 N  N   . ARG G 1 93  ? 82.722  53.558 80.328 1.00 32.55  ? 88  ARG D N   1 
ATOM   4776 C  CA  . ARG G 1 93  ? 81.826  54.213 79.383 1.00 36.31  ? 88  ARG D CA  1 
ATOM   4777 C  C   . ARG G 1 93  ? 82.473  55.453 78.781 1.00 34.20  ? 88  ARG D C   1 
ATOM   4778 O  O   . ARG G 1 93  ? 82.000  55.969 77.775 1.00 35.25  ? 88  ARG D O   1 
ATOM   4779 C  CB  . ARG G 1 93  ? 80.449  54.524 79.999 1.00 39.17  ? 88  ARG D CB  1 
ATOM   4780 C  CG  . ARG G 1 93  ? 80.431  55.262 81.314 1.00 46.60  ? 88  ARG D CG  1 
ATOM   4781 C  CD  . ARG G 1 93  ? 79.024  55.166 81.914 1.00 51.71  ? 88  ARG D CD  1 
ATOM   4782 N  NE  . ARG G 1 93  ? 78.822  56.070 83.045 1.00 57.02  ? 88  ARG D NE  1 
ATOM   4783 C  CZ  . ARG G 1 93  ? 77.755  56.039 83.838 1.00 59.37  ? 88  ARG D CZ  1 
ATOM   4784 N  NH1 . ARG G 1 93  ? 76.798  55.143 83.624 1.00 61.38  ? 88  ARG D NH1 1 
ATOM   4785 N  NH2 . ARG G 1 93  ? 77.638  56.907 84.838 1.00 60.61  ? 88  ARG D NH2 1 
ATOM   4786 N  N   . PHE G 1 94  ? 83.565  55.917 79.385 1.00 31.70  ? 89  PHE D N   1 
ATOM   4787 C  CA  . PHE G 1 94  ? 84.300  57.049 78.830 1.00 29.75  ? 89  PHE D CA  1 
ATOM   4788 C  C   . PHE G 1 94  ? 85.575  56.522 78.138 1.00 30.83  ? 89  PHE D C   1 
ATOM   4789 O  O   . PHE G 1 94  ? 85.856  56.844 76.974 1.00 31.09  ? 89  PHE D O   1 
ATOM   4790 C  CB  . PHE G 1 94  ? 84.710  58.044 79.909 1.00 27.08  ? 89  PHE D CB  1 
ATOM   4791 C  CG  . PHE G 1 94  ? 85.630  59.117 79.402 1.00 25.86  ? 89  PHE D CG  1 
ATOM   4792 C  CD1 . PHE G 1 94  ? 85.166  60.088 78.524 1.00 26.08  ? 89  PHE D CD1 1 
ATOM   4793 C  CD2 . PHE G 1 94  ? 86.972  59.125 79.762 1.00 27.16  ? 89  PHE D CD2 1 
ATOM   4794 C  CE1 . PHE G 1 94  ? 86.022  61.053 78.009 1.00 27.16  ? 89  PHE D CE1 1 
ATOM   4795 C  CE2 . PHE G 1 94  ? 87.843  60.082 79.255 1.00 26.88  ? 89  PHE D CE2 1 
ATOM   4796 C  CZ  . PHE G 1 94  ? 87.364  61.053 78.373 1.00 29.12  ? 89  PHE D CZ  1 
ATOM   4797 N  N   . LEU G 1 95  ? 86.346  55.715 78.865 1.00 29.33  ? 90  LEU D N   1 
ATOM   4798 C  CA  . LEU G 1 95  ? 87.573  55.142 78.324 1.00 28.83  ? 90  LEU D CA  1 
ATOM   4799 C  C   . LEU G 1 95  ? 87.337  54.390 77.015 1.00 27.94  ? 90  LEU D C   1 
ATOM   4800 O  O   . LEU G 1 95  ? 88.162  54.459 76.103 1.00 26.96  ? 90  LEU D O   1 
ATOM   4801 C  CB  . LEU G 1 95  ? 88.212  54.201 79.348 1.00 26.75  ? 90  LEU D CB  1 
ATOM   4802 C  CG  . LEU G 1 95  ? 88.655  54.904 80.632 1.00 26.60  ? 90  LEU D CG  1 
ATOM   4803 C  CD1 . LEU G 1 95  ? 89.003  53.875 81.699 1.00 25.30  ? 90  LEU D CD1 1 
ATOM   4804 C  CD2 . LEU G 1 95  ? 89.851  55.818 80.319 1.00 26.39  ? 90  LEU D CD2 1 
ATOM   4805 N  N   . ASN G 1 96  ? 86.218  53.675 76.920 1.00 28.25  ? 91  ASN D N   1 
ATOM   4806 C  CA  . ASN G 1 96  ? 85.916  52.917 75.707 1.00 28.89  ? 91  ASN D CA  1 
ATOM   4807 C  C   . ASN G 1 96  ? 85.922  53.829 74.487 1.00 29.13  ? 91  ASN D C   1 
ATOM   4808 O  O   . ASN G 1 96  ? 86.391  53.449 73.411 1.00 29.66  ? 91  ASN D O   1 
ATOM   4809 C  CB  . ASN G 1 96  ? 84.561  52.206 75.830 1.00 27.69  ? 91  ASN D CB  1 
ATOM   4810 C  CG  . ASN G 1 96  ? 84.640  50.940 76.677 1.00 27.45  ? 91  ASN D CG  1 
ATOM   4811 O  OD1 . ASN G 1 96  ? 85.726  50.470 77.007 1.00 28.25  ? 91  ASN D OD1 1 
ATOM   4812 N  ND2 . ASN G 1 96  ? 83.489  50.378 77.018 1.00 27.83  ? 91  ASN D ND2 1 
ATOM   4813 N  N   . GLU G 1 97  ? 85.415  55.042 74.661 1.00 28.67  ? 92  GLU D N   1 
ATOM   4814 C  CA  . GLU G 1 97  ? 85.381  56.009 73.574 1.00 28.67  ? 92  GLU D CA  1 
ATOM   4815 C  C   . GLU G 1 97  ? 86.796  56.418 73.175 1.00 28.03  ? 92  GLU D C   1 
ATOM   4816 O  O   . GLU G 1 97  ? 87.070  56.711 72.009 1.00 25.79  ? 92  GLU D O   1 
ATOM   4817 C  CB  . GLU G 1 97  ? 84.564  57.224 74.002 1.00 29.25  ? 92  GLU D CB  1 
ATOM   4818 C  CG  . GLU G 1 97  ? 83.167  56.834 74.451 1.00 30.71  ? 92  GLU D CG  1 
ATOM   4819 C  CD  . GLU G 1 97  ? 82.372  56.096 73.364 1.00 34.36  ? 92  GLU D CD  1 
ATOM   4820 O  OE1 . GLU G 1 97  ? 82.771  56.124 72.172 1.00 32.00  ? 92  GLU D OE1 1 
ATOM   4821 O  OE2 . GLU G 1 97  ? 81.330  55.489 73.711 1.00 36.96  ? 92  GLU D OE2 1 
ATOM   4822 N  N   . LEU G 1 98  ? 87.700  56.433 74.147 1.00 28.66  ? 93  LEU D N   1 
ATOM   4823 C  CA  . LEU G 1 98  ? 89.081  56.787 73.858 1.00 30.27  ? 93  LEU D CA  1 
ATOM   4824 C  C   . LEU G 1 98  ? 89.811  55.654 73.141 1.00 31.16  ? 93  LEU D C   1 
ATOM   4825 O  O   . LEU G 1 98  ? 90.661  55.906 72.277 1.00 29.37  ? 93  LEU D O   1 
ATOM   4826 C  CB  . LEU G 1 98  ? 89.840  57.135 75.140 1.00 29.03  ? 93  LEU D CB  1 
ATOM   4827 C  CG  . LEU G 1 98  ? 89.513  58.464 75.815 1.00 29.99  ? 93  LEU D CG  1 
ATOM   4828 C  CD1 . LEU G 1 98  ? 90.504  58.681 76.956 1.00 28.40  ? 93  LEU D CD1 1 
ATOM   4829 C  CD2 . LEU G 1 98  ? 89.592  59.609 74.802 1.00 26.71  ? 93  LEU D CD2 1 
ATOM   4830 N  N   . ILE G 1 99  ? 89.495  54.405 73.477 1.00 32.19  ? 94  ILE D N   1 
ATOM   4831 C  CA  . ILE G 1 99  ? 90.200  53.323 72.804 1.00 35.50  ? 94  ILE D CA  1 
ATOM   4832 C  C   . ILE G 1 99  ? 89.743  53.228 71.357 1.00 33.61  ? 94  ILE D C   1 
ATOM   4833 O  O   . ILE G 1 99  ? 90.520  52.849 70.490 1.00 33.57  ? 94  ILE D O   1 
ATOM   4834 C  CB  . ILE G 1 99  ? 90.031  51.946 73.517 1.00 37.12  ? 94  ILE D CB  1 
ATOM   4835 C  CG1 . ILE G 1 99  ? 88.923  51.131 72.867 1.00 39.63  ? 94  ILE D CG1 1 
ATOM   4836 C  CG2 . ILE G 1 99  ? 89.711  52.148 74.988 1.00 37.99  ? 94  ILE D CG2 1 
ATOM   4837 C  CD1 . ILE G 1 99  ? 88.850  49.726 73.417 1.00 42.86  ? 94  ILE D CD1 1 
ATOM   4838 N  N   . LYS G 1 100 ? 88.488  53.588 71.100 1.00 33.83  ? 95  LYS D N   1 
ATOM   4839 C  CA  . LYS G 1 100 ? 87.944  53.555 69.744 1.00 33.64  ? 95  LYS D CA  1 
ATOM   4840 C  C   . LYS G 1 100 ? 88.774  54.448 68.844 1.00 33.24  ? 95  LYS D C   1 
ATOM   4841 O  O   . LYS G 1 100 ? 89.006  54.126 67.680 1.00 33.54  ? 95  LYS D O   1 
ATOM   4842 C  CB  . LYS G 1 100 ? 86.497  54.054 69.718 1.00 34.40  ? 95  LYS D CB  1 
ATOM   4843 C  CG  . LYS G 1 100 ? 85.480  53.132 70.354 1.00 37.19  ? 95  LYS D CG  1 
ATOM   4844 C  CD  . LYS G 1 100 ? 84.071  53.651 70.076 1.00 40.19  ? 95  LYS D CD  1 
ATOM   4845 C  CE  . LYS G 1 100 ? 83.008  52.825 70.785 1.00 42.45  ? 95  LYS D CE  1 
ATOM   4846 N  NZ  . LYS G 1 100 ? 81.633  53.390 70.565 1.00 44.25  ? 95  LYS D NZ  1 
ATOM   4847 N  N   . VAL G 1 101 ? 89.220  55.574 69.397 1.00 33.50  ? 96  VAL D N   1 
ATOM   4848 C  CA  . VAL G 1 101 ? 90.023  56.539 68.651 1.00 32.89  ? 96  VAL D CA  1 
ATOM   4849 C  C   . VAL G 1 101 ? 91.377  55.985 68.214 1.00 33.47  ? 96  VAL D C   1 
ATOM   4850 O  O   . VAL G 1 101 ? 91.872  56.336 67.136 1.00 34.77  ? 96  VAL D O   1 
ATOM   4851 C  CB  . VAL G 1 101 ? 90.244  57.852 69.488 1.00 32.12  ? 96  VAL D CB  1 
ATOM   4852 C  CG1 . VAL G 1 101 ? 91.323  58.732 68.856 1.00 31.36  ? 96  VAL D CG1 1 
ATOM   4853 C  CG2 . VAL G 1 101 ? 88.962  58.640 69.556 1.00 29.39  ? 96  VAL D CG2 1 
ATOM   4854 N  N   . VAL G 1 102 ? 91.972  55.120 69.034 1.00 34.51  ? 97  VAL D N   1 
ATOM   4855 C  CA  . VAL G 1 102 ? 93.292  54.557 68.725 1.00 36.50  ? 97  VAL D CA  1 
ATOM   4856 C  C   . VAL G 1 102 ? 93.298  53.115 68.201 1.00 38.07  ? 97  VAL D C   1 
ATOM   4857 O  O   . VAL G 1 102 ? 94.351  52.593 67.819 1.00 38.48  ? 97  VAL D O   1 
ATOM   4858 C  CB  . VAL G 1 102 ? 94.219  54.610 69.960 1.00 35.72  ? 97  VAL D CB  1 
ATOM   4859 C  CG1 . VAL G 1 102 ? 94.332  56.037 70.461 1.00 35.46  ? 97  VAL D CG1 1 
ATOM   4860 C  CG2 . VAL G 1 102 ? 93.680  53.704 71.056 1.00 35.97  ? 97  VAL D CG2 1 
ATOM   4861 N  N   . SER G 1 103 ? 92.134  52.473 68.194 1.00 38.78  ? 98  SER D N   1 
ATOM   4862 C  CA  . SER G 1 103 ? 92.017  51.100 67.719 1.00 39.38  ? 98  SER D CA  1 
ATOM   4863 C  C   . SER G 1 103 ? 91.651  51.074 66.240 1.00 40.28  ? 98  SER D C   1 
ATOM   4864 O  O   . SER G 1 103 ? 90.649  51.667 65.832 1.00 40.69  ? 98  SER D O   1 
ATOM   4865 C  CB  . SER G 1 103 ? 90.948  50.358 68.516 1.00 39.73  ? 98  SER D CB  1 
ATOM   4866 O  OG  . SER G 1 103 ? 90.572  49.169 67.841 1.00 43.49  ? 98  SER D OG  1 
ATOM   4867 N  N   . PRO G 1 104 ? 92.457  50.385 65.414 1.00 40.63  ? 99  PRO D N   1 
ATOM   4868 C  CA  . PRO G 1 104 ? 92.206  50.291 63.971 1.00 40.89  ? 99  PRO D CA  1 
ATOM   4869 C  C   . PRO G 1 104 ? 90.826  49.720 63.658 1.00 41.96  ? 99  PRO D C   1 
ATOM   4870 O  O   . PRO G 1 104 ? 90.219  50.071 62.647 1.00 42.24  ? 99  PRO D O   1 
ATOM   4871 C  CB  . PRO G 1 104 ? 93.325  49.376 63.485 1.00 40.78  ? 99  PRO D CB  1 
ATOM   4872 C  CG  . PRO G 1 104 ? 94.436  49.654 64.457 1.00 41.88  ? 99  PRO D CG  1 
ATOM   4873 C  CD  . PRO G 1 104 ? 93.703  49.686 65.774 1.00 40.68  ? 99  PRO D CD  1 
ATOM   4874 N  N   . LYS G 1 105 ? 90.335  48.844 64.533 1.00 43.39  ? 100 LYS D N   1 
ATOM   4875 C  CA  . LYS G 1 105 ? 89.025  48.217 64.352 1.00 45.34  ? 100 LYS D CA  1 
ATOM   4876 C  C   . LYS G 1 105 ? 87.885  49.229 64.353 1.00 45.37  ? 100 LYS D C   1 
ATOM   4877 O  O   . LYS G 1 105 ? 86.764  48.912 63.950 1.00 46.12  ? 100 LYS D O   1 
ATOM   4878 C  CB  . LYS G 1 105 ? 88.782  47.171 65.445 1.00 46.10  ? 100 LYS D CB  1 
ATOM   4879 C  CG  . LYS G 1 105 ? 89.929  46.189 65.595 1.00 50.31  ? 100 LYS D CG  1 
ATOM   4880 C  CD  . LYS G 1 105 ? 90.397  45.676 64.231 1.00 53.76  ? 100 LYS D CD  1 
ATOM   4881 C  CE  . LYS G 1 105 ? 91.792  45.071 64.311 1.00 55.77  ? 100 LYS D CE  1 
ATOM   4882 N  NZ  . LYS G 1 105 ? 92.351  44.797 62.955 1.00 57.49  ? 100 LYS D NZ  1 
ATOM   4883 N  N   . TYR G 1 106 ? 88.174  50.443 64.815 1.00 44.64  ? 101 TYR D N   1 
ATOM   4884 C  CA  . TYR G 1 106 ? 87.174  51.504 64.852 1.00 44.46  ? 101 TYR D CA  1 
ATOM   4885 C  C   . TYR G 1 106 ? 87.699  52.748 64.143 1.00 44.80  ? 101 TYR D C   1 
ATOM   4886 O  O   . TYR G 1 106 ? 88.167  52.674 63.006 1.00 45.51  ? 101 TYR D O   1 
ATOM   4887 C  CB  . TYR G 1 106 ? 86.804  51.848 66.296 1.00 43.75  ? 101 TYR D CB  1 
ATOM   4888 C  CG  . TYR G 1 106 ? 86.299  50.671 67.098 1.00 43.90  ? 101 TYR D CG  1 
ATOM   4889 C  CD1 . TYR G 1 106 ? 87.185  49.743 67.637 1.00 44.91  ? 101 TYR D CD1 1 
ATOM   4890 C  CD2 . TYR G 1 106 ? 84.935  50.477 67.306 1.00 45.28  ? 101 TYR D CD2 1 
ATOM   4891 C  CE1 . TYR G 1 106 ? 86.733  48.649 68.362 1.00 44.95  ? 101 TYR D CE1 1 
ATOM   4892 C  CE2 . TYR G 1 106 ? 84.469  49.383 68.032 1.00 46.16  ? 101 TYR D CE2 1 
ATOM   4893 C  CZ  . TYR G 1 106 ? 85.380  48.476 68.556 1.00 45.82  ? 101 TYR D CZ  1 
ATOM   4894 O  OH  . TYR G 1 106 ? 84.939  47.401 69.281 1.00 48.04  ? 101 TYR D OH  1 
ATOM   4895 N  N   . LEU G 1 107 ? 87.643  53.885 64.825 1.00 44.30  ? 102 LEU D N   1 
ATOM   4896 C  CA  . LEU G 1 107 ? 88.096  55.148 64.251 1.00 43.74  ? 102 LEU D CA  1 
ATOM   4897 C  C   . LEU G 1 107 ? 89.584  55.114 63.885 1.00 43.91  ? 102 LEU D C   1 
ATOM   4898 O  O   . LEU G 1 107 ? 90.050  55.893 63.044 1.00 41.72  ? 102 LEU D O   1 
ATOM   4899 C  CB  . LEU G 1 107 ? 87.809  56.280 65.243 1.00 41.22  ? 102 LEU D CB  1 
ATOM   4900 C  CG  . LEU G 1 107 ? 86.489  56.092 66.007 1.00 39.13  ? 102 LEU D CG  1 
ATOM   4901 C  CD1 . LEU G 1 107 ? 86.256  57.290 66.909 1.00 37.10  ? 102 LEU D CD1 1 
ATOM   4902 C  CD2 . LEU G 1 107 ? 85.326  55.912 65.033 1.00 35.30  ? 102 LEU D CD2 1 
ATOM   4903 N  N   . GLY G 1 108 ? 90.300  54.188 64.521 1.00 44.65  ? 103 GLY D N   1 
ATOM   4904 C  CA  . GLY G 1 108 ? 91.729  54.000 64.321 1.00 46.58  ? 103 GLY D CA  1 
ATOM   4905 C  C   . GLY G 1 108 ? 92.475  54.665 63.176 1.00 48.60  ? 103 GLY D C   1 
ATOM   4906 O  O   . GLY G 1 108 ? 93.075  55.726 63.356 1.00 49.50  ? 103 GLY D O   1 
ATOM   4907 N  N   . ASP G 1 109 ? 92.470  54.037 62.003 1.00 50.35  ? 104 ASP D N   1 
ATOM   4908 C  CA  . ASP G 1 109 ? 93.190  54.589 60.858 1.00 52.68  ? 104 ASP D CA  1 
ATOM   4909 C  C   . ASP G 1 109 ? 92.403  55.651 60.106 1.00 53.21  ? 104 ASP D C   1 
ATOM   4910 O  O   . ASP G 1 109 ? 92.644  55.907 58.925 1.00 52.88  ? 104 ASP D O   1 
ATOM   4911 C  CB  . ASP G 1 109 ? 93.630  53.469 59.906 1.00 53.67  ? 104 ASP D CB  1 
ATOM   4912 C  CG  . ASP G 1 109 ? 92.501  52.537 59.543 1.00 55.11  ? 104 ASP D CG  1 
ATOM   4913 O  OD1 . ASP G 1 109 ? 91.488  53.029 59.005 1.00 56.45  ? 104 ASP D OD1 1 
ATOM   4914 O  OD2 . ASP G 1 109 ? 92.626  51.316 59.797 1.00 53.88  ? 104 ASP D OD2 1 
ATOM   4915 N  N   . ARG G 1 110 ? 91.457  56.264 60.807 1.00 53.92  ? 105 ARG D N   1 
ATOM   4916 C  CA  . ARG G 1 110 ? 90.651  57.337 60.248 1.00 53.96  ? 105 ARG D CA  1 
ATOM   4917 C  C   . ARG G 1 110 ? 91.109  58.576 61.007 1.00 52.13  ? 105 ARG D C   1 
ATOM   4918 O  O   . ARG G 1 110 ? 90.686  59.694 60.713 1.00 51.38  ? 105 ARG D O   1 
ATOM   4919 C  CB  . ARG G 1 110 ? 89.163  57.106 60.521 1.00 57.32  ? 105 ARG D CB  1 
ATOM   4920 C  CG  . ARG G 1 110 ? 88.601  55.782 60.014 1.00 61.93  ? 105 ARG D CG  1 
ATOM   4921 C  CD  . ARG G 1 110 ? 87.083  55.759 60.178 1.00 64.07  ? 105 ARG D CD  1 
ATOM   4922 N  NE  . ARG G 1 110 ? 86.460  56.827 59.398 1.00 67.83  ? 105 ARG D NE  1 
ATOM   4923 C  CZ  . ARG G 1 110 ? 85.216  57.264 59.573 1.00 69.02  ? 105 ARG D CZ  1 
ATOM   4924 N  NH1 . ARG G 1 110 ? 84.447  56.726 60.513 1.00 69.39  ? 105 ARG D NH1 1 
ATOM   4925 N  NH2 . ARG G 1 110 ? 84.741  58.241 58.806 1.00 69.56  ? 105 ARG D NH2 1 
ATOM   4926 N  N   . VAL G 1 111 ? 91.981  58.354 61.990 1.00 50.21  ? 106 VAL D N   1 
ATOM   4927 C  CA  . VAL G 1 111 ? 92.499  59.430 62.829 1.00 48.21  ? 106 VAL D CA  1 
ATOM   4928 C  C   . VAL G 1 111 ? 94.005  59.627 62.662 1.00 47.09  ? 106 VAL D C   1 
ATOM   4929 O  O   . VAL G 1 111 ? 94.731  58.690 62.324 1.00 46.57  ? 106 VAL D O   1 
ATOM   4930 C  CB  . VAL G 1 111 ? 92.177  59.162 64.320 1.00 47.01  ? 106 VAL D CB  1 
ATOM   4931 C  CG1 . VAL G 1 111 ? 92.572  60.365 65.167 1.00 46.59  ? 106 VAL D CG1 1 
ATOM   4932 C  CG2 . VAL G 1 111 ? 90.689  58.862 64.482 1.00 45.50  ? 106 VAL D CG2 1 
ATOM   4933 N  N   . SER G 1 112 ? 94.460  60.855 62.900 1.00 46.55  ? 107 SER D N   1 
ATOM   4934 C  CA  . SER G 1 112 ? 95.876  61.210 62.770 1.00 46.26  ? 107 SER D CA  1 
ATOM   4935 C  C   . SER G 1 112 ? 96.724  60.646 63.901 1.00 46.00  ? 107 SER D C   1 
ATOM   4936 O  O   . SER G 1 112 ? 96.198  60.131 64.891 1.00 47.15  ? 107 SER D O   1 
ATOM   4937 C  CB  . SER G 1 112 ? 96.042  62.738 62.732 1.00 44.87  ? 107 SER D CB  1 
ATOM   4938 O  OG  . SER G 1 112 ? 95.649  63.342 63.958 1.00 40.99  ? 107 SER D OG  1 
ATOM   4939 N  N   . GLU G 1 113 ? 98.040  60.745 63.745 1.00 45.54  ? 108 GLU D N   1 
ATOM   4940 C  CA  . GLU G 1 113 ? 98.967  60.261 64.756 1.00 44.48  ? 108 GLU D CA  1 
ATOM   4941 C  C   . GLU G 1 113 ? 99.011  61.225 65.926 1.00 41.61  ? 108 GLU D C   1 
ATOM   4942 O  O   . GLU G 1 113 ? 99.102  60.810 67.079 1.00 41.70  ? 108 GLU D O   1 
ATOM   4943 C  CB  . GLU G 1 113 ? 100.369 60.119 64.171 1.00 46.76  ? 108 GLU D CB  1 
ATOM   4944 C  CG  . GLU G 1 113 ? 100.478 59.047 63.111 1.00 52.77  ? 108 GLU D CG  1 
ATOM   4945 C  CD  . GLU G 1 113 ? 99.773  57.761 63.516 1.00 55.52  ? 108 GLU D CD  1 
ATOM   4946 O  OE1 . GLU G 1 113 ? 98.528  57.710 63.415 1.00 58.60  ? 108 GLU D OE1 1 
ATOM   4947 O  OE2 . GLU G 1 113 ? 100.457 56.806 63.946 1.00 55.48  ? 108 GLU D OE2 1 
ATOM   4948 N  N   . LYS G 1 114 ? 98.949  62.516 65.626 1.00 38.68  ? 109 LYS D N   1 
ATOM   4949 C  CA  . LYS G 1 114 ? 98.989  63.524 66.671 1.00 37.03  ? 109 LYS D CA  1 
ATOM   4950 C  C   . LYS G 1 114 ? 97.917  63.247 67.705 1.00 34.40  ? 109 LYS D C   1 
ATOM   4951 O  O   . LYS G 1 114 ? 98.200  63.148 68.896 1.00 32.95  ? 109 LYS D O   1 
ATOM   4952 C  CB  . LYS G 1 114 ? 98.776  64.920 66.086 1.00 38.64  ? 109 LYS D CB  1 
ATOM   4953 C  CG  . LYS G 1 114 ? 99.831  65.344 65.090 1.00 41.68  ? 109 LYS D CG  1 
ATOM   4954 C  CD  . LYS G 1 114 ? 99.911  66.865 64.991 1.00 45.56  ? 109 LYS D CD  1 
ATOM   4955 C  CE  . LYS G 1 114 ? 100.276 67.481 66.343 1.00 47.85  ? 109 LYS D CE  1 
ATOM   4956 N  NZ  . LYS G 1 114 ? 100.624 68.937 66.241 1.00 51.34  ? 109 LYS D NZ  1 
ATOM   4957 N  N   . VAL G 1 115 ? 96.680  63.120 67.240 1.00 34.34  ? 110 VAL D N   1 
ATOM   4958 C  CA  . VAL G 1 115 ? 95.555  62.859 68.135 1.00 33.56  ? 110 VAL D CA  1 
ATOM   4959 C  C   . VAL G 1 115 ? 95.736  61.561 68.918 1.00 32.58  ? 110 VAL D C   1 
ATOM   4960 O  O   . VAL G 1 115 ? 95.538  61.537 70.130 1.00 32.88  ? 110 VAL D O   1 
ATOM   4961 C  CB  . VAL G 1 115 ? 94.203  62.812 67.353 1.00 33.03  ? 110 VAL D CB  1 
ATOM   4962 C  CG1 . VAL G 1 115 ? 93.083  62.294 68.252 1.00 29.35  ? 110 VAL D CG1 1 
ATOM   4963 C  CG2 . VAL G 1 115 ? 93.851  64.210 66.844 1.00 29.36  ? 110 VAL D CG2 1 
ATOM   4964 N  N   . LYS G 1 116 ? 96.125  60.494 68.228 1.00 31.27  ? 111 LYS D N   1 
ATOM   4965 C  CA  . LYS G 1 116 ? 96.312  59.200 68.873 1.00 30.73  ? 111 LYS D CA  1 
ATOM   4966 C  C   . LYS G 1 116 ? 97.470  59.138 69.859 1.00 29.29  ? 111 LYS D C   1 
ATOM   4967 O  O   . LYS G 1 116 ? 97.361  58.495 70.902 1.00 26.61  ? 111 LYS D O   1 
ATOM   4968 C  CB  . LYS G 1 116 ? 96.457  58.108 67.812 1.00 31.73  ? 111 LYS D CB  1 
ATOM   4969 C  CG  . LYS G 1 116 ? 95.170  57.881 67.035 1.00 33.82  ? 111 LYS D CG  1 
ATOM   4970 C  CD  . LYS G 1 116 ? 95.281  56.765 66.016 1.00 34.94  ? 111 LYS D CD  1 
ATOM   4971 C  CE  . LYS G 1 116 ? 96.091  57.196 64.818 1.00 36.88  ? 111 LYS D CE  1 
ATOM   4972 N  NZ  . LYS G 1 116 ? 96.039  56.175 63.727 1.00 37.47  ? 111 LYS D NZ  1 
ATOM   4973 N  N   . THR G 1 117 ? 98.578  59.802 69.553 1.00 29.90  ? 112 THR D N   1 
ATOM   4974 C  CA  . THR G 1 117 ? 99.708  59.775 70.477 1.00 31.45  ? 112 THR D CA  1 
ATOM   4975 C  C   . THR G 1 117 ? 99.339  60.584 71.714 1.00 29.36  ? 112 THR D C   1 
ATOM   4976 O  O   . THR G 1 117 ? 99.691  60.222 72.834 1.00 29.86  ? 112 THR D O   1 
ATOM   4977 C  CB  . THR G 1 117 ? 100.982 60.377 69.856 1.00 32.70  ? 112 THR D CB  1 
ATOM   4978 O  OG1 . THR G 1 117 ? 100.824 61.794 69.725 1.00 38.78  ? 112 THR D OG1 1 
ATOM   4979 C  CG2 . THR G 1 117 ? 101.247 59.767 68.497 1.00 30.78  ? 112 THR D CG2 1 
ATOM   4980 N  N   . LYS G 1 118 ? 98.617  61.678 71.502 1.00 29.64  ? 113 LYS D N   1 
ATOM   4981 C  CA  . LYS G 1 118 ? 98.173  62.546 72.595 1.00 29.00  ? 113 LYS D CA  1 
ATOM   4982 C  C   . LYS G 1 118 ? 97.242  61.779 73.533 1.00 27.17  ? 113 LYS D C   1 
ATOM   4983 O  O   . LYS G 1 118 ? 97.344  61.899 74.752 1.00 27.69  ? 113 LYS D O   1 
ATOM   4984 C  CB  . LYS G 1 118 ? 97.466  63.785 72.027 1.00 30.19  ? 113 LYS D CB  1 
ATOM   4985 C  CG  . LYS G 1 118 ? 96.969  64.779 73.069 1.00 32.95  ? 113 LYS D CG  1 
ATOM   4986 C  CD  . LYS G 1 118 ? 98.108  65.385 73.883 1.00 34.64  ? 113 LYS D CD  1 
ATOM   4987 C  CE  . LYS G 1 118 ? 97.563  66.393 74.903 1.00 37.69  ? 113 LYS D CE  1 
ATOM   4988 N  NZ  . LYS G 1 118 ? 98.601  66.849 75.893 1.00 38.85  ? 113 LYS D NZ  1 
ATOM   4989 N  N   . VAL G 1 119 ? 96.340  60.987 72.962 1.00 26.37  ? 114 VAL D N   1 
ATOM   4990 C  CA  . VAL G 1 119 ? 95.415  60.183 73.753 1.00 25.93  ? 114 VAL D CA  1 
ATOM   4991 C  C   . VAL G 1 119 ? 96.216  59.209 74.605 1.00 26.45  ? 114 VAL D C   1 
ATOM   4992 O  O   . VAL G 1 119 ? 95.984  59.071 75.808 1.00 27.06  ? 114 VAL D O   1 
ATOM   4993 C  CB  . VAL G 1 119 ? 94.461  59.356 72.858 1.00 24.39  ? 114 VAL D CB  1 
ATOM   4994 C  CG1 . VAL G 1 119 ? 93.641  58.401 73.722 1.00 24.02  ? 114 VAL D CG1 1 
ATOM   4995 C  CG2 . VAL G 1 119 ? 93.534  60.272 72.083 1.00 22.10  ? 114 VAL D CG2 1 
ATOM   4996 N  N   . ILE G 1 120 ? 97.158  58.529 73.965 1.00 28.58  ? 115 ILE D N   1 
ATOM   4997 C  CA  . ILE G 1 120 ? 98.018  57.567 74.640 1.00 29.82  ? 115 ILE D CA  1 
ATOM   4998 C  C   . ILE G 1 120 ? 98.785  58.289 75.730 1.00 30.74  ? 115 ILE D C   1 
ATOM   4999 O  O   . ILE G 1 120 ? 98.893  57.813 76.858 1.00 30.55  ? 115 ILE D O   1 
ATOM   5000 C  CB  . ILE G 1 120 ? 99.036  56.955 73.658 1.00 30.68  ? 115 ILE D CB  1 
ATOM   5001 C  CG1 . ILE G 1 120 ? 98.309  56.104 72.612 1.00 31.23  ? 115 ILE D CG1 1 
ATOM   5002 C  CG2 . ILE G 1 120 ? 100.079 56.159 74.426 1.00 31.52  ? 115 ILE D CG2 1 
ATOM   5003 C  CD1 . ILE G 1 120 ? 97.381  55.052 73.216 1.00 32.64  ? 115 ILE D CD1 1 
ATOM   5004 N  N   . GLU G 1 121 ? 99.321  59.445 75.367 1.00 31.51  ? 116 GLU D N   1 
ATOM   5005 C  CA  . GLU G 1 121 ? 100.083 60.276 76.284 1.00 33.65  ? 116 GLU D CA  1 
ATOM   5006 C  C   . GLU G 1 121 ? 99.237  60.580 77.528 1.00 33.09  ? 116 GLU D C   1 
ATOM   5007 O  O   . GLU G 1 121 ? 99.733  60.550 78.660 1.00 31.53  ? 116 GLU D O   1 
ATOM   5008 C  CB  . GLU G 1 121 ? 100.457 61.563 75.561 1.00 36.88  ? 116 GLU D CB  1 
ATOM   5009 C  CG  . GLU G 1 121 ? 101.479 62.405 76.248 1.00 43.70  ? 116 GLU D CG  1 
ATOM   5010 C  CD  . GLU G 1 121 ? 101.707 63.701 75.508 1.00 47.54  ? 116 GLU D CD  1 
ATOM   5011 O  OE1 . GLU G 1 121 ? 102.007 63.639 74.295 1.00 50.50  ? 116 GLU D OE1 1 
ATOM   5012 O  OE2 . GLU G 1 121 ? 101.583 64.775 76.135 1.00 49.87  ? 116 GLU D OE2 1 
ATOM   5013 N  N   . LEU G 1 122 ? 97.955  60.867 77.315 1.00 30.82  ? 117 LEU D N   1 
ATOM   5014 C  CA  . LEU G 1 122 ? 97.051  61.150 78.424 1.00 29.84  ? 117 LEU D CA  1 
ATOM   5015 C  C   . LEU G 1 122 ? 96.749  59.908 79.266 1.00 29.62  ? 117 LEU D C   1 
ATOM   5016 O  O   . LEU G 1 122 ? 96.867  59.952 80.498 1.00 29.15  ? 117 LEU D O   1 
ATOM   5017 C  CB  . LEU G 1 122 ? 95.743  61.752 77.913 1.00 28.60  ? 117 LEU D CB  1 
ATOM   5018 C  CG  . LEU G 1 122 ? 95.834  63.176 77.371 1.00 28.86  ? 117 LEU D CG  1 
ATOM   5019 C  CD1 . LEU G 1 122 ? 94.485  63.595 76.838 1.00 29.63  ? 117 LEU D CD1 1 
ATOM   5020 C  CD2 . LEU G 1 122 ? 96.288  64.113 78.464 1.00 28.95  ? 117 LEU D CD2 1 
ATOM   5021 N  N   . LEU G 1 123 ? 96.351  58.811 78.623 1.00 28.47  ? 118 LEU D N   1 
ATOM   5022 C  CA  . LEU G 1 123 ? 96.054  57.583 79.368 1.00 30.70  ? 118 LEU D CA  1 
ATOM   5023 C  C   . LEU G 1 123 ? 97.221  57.222 80.274 1.00 31.23  ? 118 LEU D C   1 
ATOM   5024 O  O   . LEU G 1 123 ? 97.047  56.997 81.478 1.00 31.62  ? 118 LEU D O   1 
ATOM   5025 C  CB  . LEU G 1 123 ? 95.799  56.400 78.432 1.00 31.45  ? 118 LEU D CB  1 
ATOM   5026 C  CG  . LEU G 1 123 ? 94.346  56.072 78.101 1.00 33.61  ? 118 LEU D CG  1 
ATOM   5027 C  CD1 . LEU G 1 123 ? 93.535  55.986 79.386 1.00 33.44  ? 118 LEU D CD1 1 
ATOM   5028 C  CD2 . LEU G 1 123 ? 93.787  57.146 77.200 1.00 34.66  ? 118 LEU D CD2 1 
ATOM   5029 N  N   . TYR G 1 124 ? 98.407  57.158 79.677 1.00 29.40  ? 119 TYR D N   1 
ATOM   5030 C  CA  . TYR G 1 124 ? 99.615  56.834 80.405 1.00 31.07  ? 119 TYR D CA  1 
ATOM   5031 C  C   . TYR G 1 124 ? 99.749  57.724 81.643 1.00 30.84  ? 119 TYR D C   1 
ATOM   5032 O  O   . TYR G 1 124 ? 99.911  57.226 82.761 1.00 29.86  ? 119 TYR D O   1 
ATOM   5033 C  CB  . TYR G 1 124 ? 100.844 57.000 79.494 1.00 31.50  ? 119 TYR D CB  1 
ATOM   5034 C  CG  . TYR G 1 124 ? 102.127 56.528 80.139 1.00 35.07  ? 119 TYR D CG  1 
ATOM   5035 C  CD1 . TYR G 1 124 ? 102.180 55.300 80.802 1.00 36.98  ? 119 TYR D CD1 1 
ATOM   5036 C  CD2 . TYR G 1 124 ? 103.283 57.315 80.113 1.00 36.89  ? 119 TYR D CD2 1 
ATOM   5037 C  CE1 . TYR G 1 124 ? 103.355 54.865 81.433 1.00 40.18  ? 119 TYR D CE1 1 
ATOM   5038 C  CE2 . TYR G 1 124 ? 104.465 56.892 80.738 1.00 37.36  ? 119 TYR D CE2 1 
ATOM   5039 C  CZ  . TYR G 1 124 ? 104.492 55.667 81.397 1.00 40.71  ? 119 TYR D CZ  1 
ATOM   5040 O  OH  . TYR G 1 124 ? 105.642 55.235 82.028 1.00 43.61  ? 119 TYR D OH  1 
ATOM   5041 N  N   . SER G 1 125 ? 99.660  59.036 81.447 1.00 30.04  ? 120 SER D N   1 
ATOM   5042 C  CA  . SER G 1 125 ? 99.786  59.968 82.560 1.00 32.01  ? 120 SER D CA  1 
ATOM   5043 C  C   . SER G 1 125 ? 98.774  59.713 83.664 1.00 31.54  ? 120 SER D C   1 
ATOM   5044 O  O   . SER G 1 125 ? 99.064  59.950 84.834 1.00 32.05  ? 120 SER D O   1 
ATOM   5045 C  CB  . SER G 1 125 ? 99.655  61.413 82.073 1.00 32.91  ? 120 SER D CB  1 
ATOM   5046 O  OG  . SER G 1 125 ? 100.729 61.746 81.205 1.00 35.72  ? 120 SER D OG  1 
ATOM   5047 N  N   . TRP G 1 126 ? 97.593  59.220 83.307 1.00 32.64  ? 121 TRP D N   1 
ATOM   5048 C  CA  . TRP G 1 126 ? 96.566  58.968 84.316 1.00 33.70  ? 121 TRP D CA  1 
ATOM   5049 C  C   . TRP G 1 126 ? 96.804  57.722 85.150 1.00 34.59  ? 121 TRP D C   1 
ATOM   5050 O  O   . TRP G 1 126 ? 96.422  57.678 86.324 1.00 34.50  ? 121 TRP D O   1 
ATOM   5051 C  CB  . TRP G 1 126 ? 95.178  58.894 83.679 1.00 32.05  ? 121 TRP D CB  1 
ATOM   5052 C  CG  . TRP G 1 126 ? 94.790  60.166 82.983 1.00 31.25  ? 121 TRP D CG  1 
ATOM   5053 C  CD1 . TRP G 1 126 ? 95.317  61.416 83.190 1.00 29.42  ? 121 TRP D CD1 1 
ATOM   5054 C  CD2 . TRP G 1 126 ? 93.817  60.306 81.946 1.00 28.95  ? 121 TRP D CD2 1 
ATOM   5055 N  NE1 . TRP G 1 126 ? 94.733  62.321 82.335 1.00 28.60  ? 121 TRP D NE1 1 
ATOM   5056 C  CE2 . TRP G 1 126 ? 93.808  61.666 81.562 1.00 29.24  ? 121 TRP D CE2 1 
ATOM   5057 C  CE3 . TRP G 1 126 ? 92.951  59.413 81.299 1.00 30.04  ? 121 TRP D CE3 1 
ATOM   5058 C  CZ2 . TRP G 1 126 ? 92.966  62.153 80.559 1.00 30.25  ? 121 TRP D CZ2 1 
ATOM   5059 C  CZ3 . TRP G 1 126 ? 92.115  59.899 80.299 1.00 30.49  ? 121 TRP D CZ3 1 
ATOM   5060 C  CH2 . TRP G 1 126 ? 92.130  61.256 79.941 1.00 30.38  ? 121 TRP D CH2 1 
ATOM   5061 N  N   . THR G 1 127 ? 97.428  56.707 84.563 1.00 35.35  ? 122 THR D N   1 
ATOM   5062 C  CA  . THR G 1 127 ? 97.686  55.488 85.317 1.00 37.01  ? 122 THR D CA  1 
ATOM   5063 C  C   . THR G 1 127 ? 98.622  55.847 86.469 1.00 37.94  ? 122 THR D C   1 
ATOM   5064 O  O   . THR G 1 127 ? 98.622  55.191 87.507 1.00 37.37  ? 122 THR D O   1 
ATOM   5065 C  CB  . THR G 1 127 ? 98.337  54.392 84.435 1.00 36.52  ? 122 THR D CB  1 
ATOM   5066 O  OG1 . THR G 1 127 ? 99.660  54.790 84.061 1.00 37.93  ? 122 THR D OG1 1 
ATOM   5067 C  CG2 . THR G 1 127 ? 97.509  54.164 83.174 1.00 35.99  ? 122 THR D CG2 1 
HETATM 5068 N  N   . MSE G 1 128 ? 99.400  56.912 86.276 1.00 40.10  ? 123 MSE D N   1 
HETATM 5069 C  CA  . MSE G 1 128 ? 100.346 57.401 87.281 1.00 42.20  ? 123 MSE D CA  1 
HETATM 5070 C  C   . MSE G 1 128 ? 99.692  58.364 88.264 1.00 41.78  ? 123 MSE D C   1 
HETATM 5071 O  O   . MSE G 1 128 ? 99.801  58.202 89.482 1.00 41.34  ? 123 MSE D O   1 
HETATM 5072 C  CB  . MSE G 1 128 ? 101.498 58.140 86.608 1.00 46.16  ? 123 MSE D CB  1 
HETATM 5073 C  CG  . MSE G 1 128 ? 102.438 57.275 85.797 1.00 52.59  ? 123 MSE D CG  1 
HETATM 5074 SE SE  . MSE G 1 128 ? 103.446 58.387 84.560 1.00 63.81  ? 123 MSE D SE  1 
HETATM 5075 C  CE  . MSE G 1 128 ? 104.104 59.728 85.806 1.00 59.45  ? 123 MSE D CE  1 
ATOM   5076 N  N   . ALA G 1 129 ? 99.026  59.378 87.721 1.00 41.11  ? 124 ALA D N   1 
ATOM   5077 C  CA  . ALA G 1 129 ? 98.376  60.399 88.531 1.00 41.98  ? 124 ALA D CA  1 
ATOM   5078 C  C   . ALA G 1 129 ? 97.178  59.883 89.322 1.00 42.41  ? 124 ALA D C   1 
ATOM   5079 O  O   . ALA G 1 129 ? 96.942  60.319 90.449 1.00 42.70  ? 124 ALA D O   1 
ATOM   5080 C  CB  . ALA G 1 129 ? 97.953  61.577 87.641 1.00 41.63  ? 124 ALA D CB  1 
ATOM   5081 N  N   . LEU G 1 130 ? 96.423  58.960 88.734 1.00 43.11  ? 125 LEU D N   1 
ATOM   5082 C  CA  . LEU G 1 130 ? 95.243  58.405 89.392 1.00 42.98  ? 125 LEU D CA  1 
ATOM   5083 C  C   . LEU G 1 130 ? 95.382  56.898 89.588 1.00 43.87  ? 125 LEU D C   1 
ATOM   5084 O  O   . LEU G 1 130 ? 94.674  56.106 88.958 1.00 40.92  ? 125 LEU D O   1 
ATOM   5085 C  CB  . LEU G 1 130 ? 93.986  58.714 88.565 1.00 42.61  ? 125 LEU D CB  1 
ATOM   5086 C  CG  . LEU G 1 130 ? 93.685  60.198 88.308 1.00 43.03  ? 125 LEU D CG  1 
ATOM   5087 C  CD1 . LEU G 1 130 ? 92.499  60.339 87.375 1.00 40.57  ? 125 LEU D CD1 1 
ATOM   5088 C  CD2 . LEU G 1 130 ? 93.402  60.905 89.635 1.00 43.67  ? 125 LEU D CD2 1 
ATOM   5089 N  N   . PRO G 1 131 ? 96.301  56.483 90.474 1.00 46.36  ? 126 PRO D N   1 
ATOM   5090 C  CA  . PRO G 1 131 ? 96.545  55.065 90.761 1.00 47.96  ? 126 PRO D CA  1 
ATOM   5091 C  C   . PRO G 1 131 ? 95.308  54.378 91.320 1.00 49.63  ? 126 PRO D C   1 
ATOM   5092 O  O   . PRO G 1 131 ? 95.177  53.155 91.232 1.00 50.87  ? 126 PRO D O   1 
ATOM   5093 C  CB  . PRO G 1 131 ? 97.679  55.104 91.786 1.00 48.39  ? 126 PRO D CB  1 
ATOM   5094 C  CG  . PRO G 1 131 ? 98.381  56.388 91.483 1.00 47.54  ? 126 PRO D CG  1 
ATOM   5095 C  CD  . PRO G 1 131 ? 97.225  57.331 91.245 1.00 46.80  ? 126 PRO D CD  1 
ATOM   5096 N  N   . GLU G 1 132 ? 94.402  55.162 91.896 1.00 50.52  ? 127 GLU D N   1 
ATOM   5097 C  CA  . GLU G 1 132 ? 93.188  54.595 92.468 1.00 52.22  ? 127 GLU D CA  1 
ATOM   5098 C  C   . GLU G 1 132 ? 92.135  54.208 91.419 1.00 50.94  ? 127 GLU D C   1 
ATOM   5099 O  O   . GLU G 1 132 ? 91.270  53.368 91.689 1.00 51.10  ? 127 GLU D O   1 
ATOM   5100 C  CB  . GLU G 1 132 ? 92.584  55.560 93.498 1.00 55.66  ? 127 GLU D CB  1 
ATOM   5101 C  CG  . GLU G 1 132 ? 92.341  56.973 92.991 1.00 62.50  ? 127 GLU D CG  1 
ATOM   5102 C  CD  . GLU G 1 132 ? 93.582  57.844 93.044 1.00 65.19  ? 127 GLU D CD  1 
ATOM   5103 O  OE1 . GLU G 1 132 ? 94.036  58.170 94.165 1.00 67.76  ? 127 GLU D OE1 1 
ATOM   5104 O  OE2 . GLU G 1 132 ? 94.103  58.202 91.965 1.00 67.85  ? 127 GLU D OE2 1 
ATOM   5105 N  N   . GLU G 1 133 ? 92.212  54.810 90.230 1.00 48.54  ? 128 GLU D N   1 
ATOM   5106 C  CA  . GLU G 1 133 ? 91.274  54.510 89.145 1.00 45.76  ? 128 GLU D CA  1 
ATOM   5107 C  C   . GLU G 1 133 ? 91.776  53.277 88.397 1.00 44.21  ? 128 GLU D C   1 
ATOM   5108 O  O   . GLU G 1 133 ? 92.584  53.376 87.475 1.00 44.08  ? 128 GLU D O   1 
ATOM   5109 C  CB  . GLU G 1 133 ? 91.172  55.693 88.181 1.00 46.66  ? 128 GLU D CB  1 
ATOM   5110 C  CG  . GLU G 1 133 ? 90.602  56.972 88.786 1.00 48.23  ? 128 GLU D CG  1 
ATOM   5111 C  CD  . GLU G 1 133 ? 89.183  56.797 89.311 1.00 50.37  ? 128 GLU D CD  1 
ATOM   5112 O  OE1 . GLU G 1 133 ? 88.392  56.065 88.672 1.00 51.16  ? 128 GLU D OE1 1 
ATOM   5113 O  OE2 . GLU G 1 133 ? 88.854  57.401 90.356 1.00 49.97  ? 128 GLU D OE2 1 
ATOM   5114 N  N   . ALA G 1 134 ? 91.276  52.114 88.794 1.00 43.21  ? 129 ALA D N   1 
ATOM   5115 C  CA  . ALA G 1 134 ? 91.701  50.850 88.205 1.00 42.21  ? 129 ALA D CA  1 
ATOM   5116 C  C   . ALA G 1 134 ? 91.372  50.654 86.730 1.00 41.53  ? 129 ALA D C   1 
ATOM   5117 O  O   . ALA G 1 134 ? 92.153  50.049 85.987 1.00 41.20  ? 129 ALA D O   1 
ATOM   5118 C  CB  . ALA G 1 134 ? 91.125  49.698 89.016 1.00 42.19  ? 129 ALA D CB  1 
ATOM   5119 N  N   . LYS G 1 135 ? 90.219  51.155 86.304 1.00 40.21  ? 130 LYS D N   1 
ATOM   5120 C  CA  . LYS G 1 135 ? 89.805  50.988 84.920 1.00 37.74  ? 130 LYS D CA  1 
ATOM   5121 C  C   . LYS G 1 135 ? 90.699  51.735 83.943 1.00 36.24  ? 130 LYS D C   1 
ATOM   5122 O  O   . LYS G 1 135 ? 90.822  51.339 82.788 1.00 34.72  ? 130 LYS D O   1 
ATOM   5123 C  CB  . LYS G 1 135 ? 88.345  51.414 84.762 1.00 40.29  ? 130 LYS D CB  1 
ATOM   5124 C  CG  . LYS G 1 135 ? 87.396  50.609 85.641 1.00 38.82  ? 130 LYS D CG  1 
ATOM   5125 C  CD  . LYS G 1 135 ? 85.946  51.014 85.419 1.00 42.12  ? 130 LYS D CD  1 
ATOM   5126 C  CE  . LYS G 1 135 ? 85.007  50.233 86.335 1.00 41.81  ? 130 LYS D CE  1 
ATOM   5127 N  NZ  . LYS G 1 135 ? 83.609  50.760 86.288 1.00 43.26  ? 130 LYS D NZ  1 
ATOM   5128 N  N   . ILE G 1 136 ? 91.333  52.813 84.393 1.00 36.16  ? 131 ILE D N   1 
ATOM   5129 C  CA  . ILE G 1 136 ? 92.219  53.535 83.494 1.00 34.92  ? 131 ILE D CA  1 
ATOM   5130 C  C   . ILE G 1 136 ? 93.415  52.634 83.218 1.00 36.09  ? 131 ILE D C   1 
ATOM   5131 O  O   . ILE G 1 136 ? 93.931  52.599 82.099 1.00 36.27  ? 131 ILE D O   1 
ATOM   5132 C  CB  . ILE G 1 136 ? 92.695  54.862 84.094 1.00 34.85  ? 131 ILE D CB  1 
ATOM   5133 C  CG1 . ILE G 1 136 ? 91.482  55.743 84.406 1.00 33.47  ? 131 ILE D CG1 1 
ATOM   5134 C  CG2 . ILE G 1 136 ? 93.632  55.572 83.111 1.00 31.62  ? 131 ILE D CG2 1 
ATOM   5135 C  CD1 . ILE G 1 136 ? 91.828  57.090 84.994 1.00 34.44  ? 131 ILE D CD1 1 
ATOM   5136 N  N   . LYS G 1 137 ? 93.844  51.888 84.234 1.00 36.86  ? 132 LYS D N   1 
ATOM   5137 C  CA  . LYS G 1 137 ? 94.966  50.970 84.066 1.00 37.47  ? 132 LYS D CA  1 
ATOM   5138 C  C   . LYS G 1 137 ? 94.550  49.779 83.194 1.00 36.99  ? 132 LYS D C   1 
ATOM   5139 O  O   . LYS G 1 137 ? 95.269  49.395 82.270 1.00 35.49  ? 132 LYS D O   1 
ATOM   5140 C  CB  . LYS G 1 137 ? 95.456  50.451 85.420 1.00 39.44  ? 132 LYS D CB  1 
ATOM   5141 C  CG  . LYS G 1 137 ? 96.030  51.501 86.352 1.00 40.07  ? 132 LYS D CG  1 
ATOM   5142 C  CD  . LYS G 1 137 ? 96.908  50.833 87.399 1.00 42.16  ? 132 LYS D CD  1 
ATOM   5143 C  CE  . LYS G 1 137 ? 96.890  51.571 88.732 1.00 43.59  ? 132 LYS D CE  1 
ATOM   5144 N  NZ  . LYS G 1 137 ? 97.257  53.005 88.611 1.00 45.85  ? 132 LYS D NZ  1 
ATOM   5145 N  N   . ASP G 1 138 ? 93.390  49.198 83.489 1.00 37.21  ? 133 ASP D N   1 
ATOM   5146 C  CA  . ASP G 1 138 ? 92.897  48.059 82.716 1.00 38.06  ? 133 ASP D CA  1 
ATOM   5147 C  C   . ASP G 1 138 ? 92.841  48.421 81.245 1.00 36.96  ? 133 ASP D C   1 
ATOM   5148 O  O   . ASP G 1 138 ? 93.185  47.617 80.377 1.00 37.05  ? 133 ASP D O   1 
ATOM   5149 C  CB  . ASP G 1 138 ? 91.496  47.650 83.178 1.00 40.67  ? 133 ASP D CB  1 
ATOM   5150 C  CG  . ASP G 1 138 ? 91.497  46.999 84.548 1.00 45.00  ? 133 ASP D CG  1 
ATOM   5151 O  OD1 . ASP G 1 138 ? 92.586  46.861 85.153 1.00 46.17  ? 133 ASP D OD1 1 
ATOM   5152 O  OD2 . ASP G 1 138 ? 90.399  46.625 85.022 1.00 48.29  ? 133 ASP D OD2 1 
ATOM   5153 N  N   . ALA G 1 139 ? 92.398  49.641 80.972 1.00 35.32  ? 134 ALA D N   1 
ATOM   5154 C  CA  . ALA G 1 139 ? 92.296  50.114 79.607 1.00 34.32  ? 134 ALA D CA  1 
ATOM   5155 C  C   . ALA G 1 139 ? 93.685  50.300 79.002 1.00 34.02  ? 134 ALA D C   1 
ATOM   5156 O  O   . ALA G 1 139 ? 93.969  49.783 77.917 1.00 35.37  ? 134 ALA D O   1 
ATOM   5157 C  CB  . ALA G 1 139 ? 91.516  51.425 79.565 1.00 32.08  ? 134 ALA D CB  1 
ATOM   5158 N  N   . TYR G 1 140 ? 94.556  51.021 79.701 1.00 32.81  ? 135 TYR D N   1 
ATOM   5159 C  CA  . TYR G 1 140 ? 95.901  51.261 79.185 1.00 32.49  ? 135 TYR D CA  1 
ATOM   5160 C  C   . TYR G 1 140 ? 96.699  49.975 78.969 1.00 34.00  ? 135 TYR D C   1 
ATOM   5161 O  O   . TYR G 1 140 ? 97.394  49.833 77.957 1.00 33.77  ? 135 TYR D O   1 
ATOM   5162 C  CB  . TYR G 1 140 ? 96.691  52.182 80.126 1.00 29.15  ? 135 TYR D CB  1 
ATOM   5163 C  CG  . TYR G 1 140 ? 98.056  52.555 79.592 1.00 25.84  ? 135 TYR D CG  1 
ATOM   5164 C  CD1 . TYR G 1 140 ? 98.182  53.368 78.467 1.00 24.17  ? 135 TYR D CD1 1 
ATOM   5165 C  CD2 . TYR G 1 140 ? 99.220  52.076 80.191 1.00 25.60  ? 135 TYR D CD2 1 
ATOM   5166 C  CE1 . TYR G 1 140 ? 99.426  53.696 77.948 1.00 23.20  ? 135 TYR D CE1 1 
ATOM   5167 C  CE2 . TYR G 1 140 ? 100.482 52.405 79.677 1.00 25.63  ? 135 TYR D CE2 1 
ATOM   5168 C  CZ  . TYR G 1 140 ? 100.571 53.217 78.552 1.00 26.11  ? 135 TYR D CZ  1 
ATOM   5169 O  OH  . TYR G 1 140 ? 101.800 53.558 78.022 1.00 27.88  ? 135 TYR D OH  1 
ATOM   5170 N  N   . HIS G 1 141 ? 96.614  49.045 79.918 1.00 35.47  ? 136 HIS D N   1 
ATOM   5171 C  CA  . HIS G 1 141 ? 97.364  47.794 79.810 1.00 38.04  ? 136 HIS D CA  1 
ATOM   5172 C  C   . HIS G 1 141 ? 96.888  46.955 78.646 1.00 39.09  ? 136 HIS D C   1 
ATOM   5173 O  O   . HIS G 1 141 ? 97.675  46.247 78.012 1.00 38.90  ? 136 HIS D O   1 
ATOM   5174 C  CB  . HIS G 1 141 ? 97.250  46.976 81.094 1.00 38.17  ? 136 HIS D CB  1 
ATOM   5175 C  CG  . HIS G 1 141 ? 97.854  47.647 82.286 1.00 40.24  ? 136 HIS D CG  1 
ATOM   5176 N  ND1 . HIS G 1 141 ? 99.084  48.268 82.244 1.00 41.06  ? 136 HIS D ND1 1 
ATOM   5177 C  CD2 . HIS G 1 141 ? 97.409  47.779 83.557 1.00 40.40  ? 136 HIS D CD2 1 
ATOM   5178 C  CE1 . HIS G 1 141 ? 99.372  48.755 83.438 1.00 41.53  ? 136 HIS D CE1 1 
ATOM   5179 N  NE2 . HIS G 1 141 ? 98.372  48.472 84.254 1.00 43.08  ? 136 HIS D NE2 1 
HETATM 5180 N  N   . MSE G 1 142 ? 95.594  47.035 78.366 1.00 40.59  ? 137 MSE D N   1 
HETATM 5181 C  CA  . MSE G 1 142 ? 95.028  46.272 77.270 1.00 41.45  ? 137 MSE D CA  1 
HETATM 5182 C  C   . MSE G 1 142 ? 95.597  46.765 75.942 1.00 39.83  ? 137 MSE D C   1 
HETATM 5183 O  O   . MSE G 1 142 ? 95.962  45.971 75.071 1.00 37.91  ? 137 MSE D O   1 
HETATM 5184 C  CB  . MSE G 1 142 ? 93.518  46.405 77.274 1.00 46.08  ? 137 MSE D CB  1 
HETATM 5185 C  CG  . MSE G 1 142 ? 92.856  45.397 76.385 1.00 53.85  ? 137 MSE D CG  1 
HETATM 5186 SE SE  . MSE G 1 142 ? 91.577  46.264 75.292 1.00 67.87  ? 137 MSE D SE  1 
HETATM 5187 C  CE  . MSE G 1 142 ? 92.779  46.855 73.892 1.00 60.13  ? 137 MSE D CE  1 
ATOM   5188 N  N   . LEU G 1 143 ? 95.677  48.083 75.795 1.00 38.55  ? 138 LEU D N   1 
ATOM   5189 C  CA  . LEU G 1 143 ? 96.223  48.685 74.583 1.00 37.74  ? 138 LEU D CA  1 
ATOM   5190 C  C   . LEU G 1 143 ? 97.667  48.223 74.335 1.00 38.41  ? 138 LEU D C   1 
ATOM   5191 O  O   . LEU G 1 143 ? 98.129  48.179 73.189 1.00 39.93  ? 138 LEU D O   1 
ATOM   5192 C  CB  . LEU G 1 143 ? 96.169  50.212 74.690 1.00 35.12  ? 138 LEU D CB  1 
ATOM   5193 C  CG  . LEU G 1 143 ? 94.760  50.805 74.802 1.00 33.77  ? 138 LEU D CG  1 
ATOM   5194 C  CD1 . LEU G 1 143 ? 94.838  52.312 75.001 1.00 29.87  ? 138 LEU D CD1 1 
ATOM   5195 C  CD2 . LEU G 1 143 ? 93.974  50.467 73.549 1.00 29.77  ? 138 LEU D CD2 1 
ATOM   5196 N  N   . LYS G 1 144 ? 98.378  47.882 75.407 1.00 38.49  ? 139 LYS D N   1 
ATOM   5197 C  CA  . LYS G 1 144 ? 99.757  47.411 75.280 1.00 39.12  ? 139 LYS D CA  1 
ATOM   5198 C  C   . LYS G 1 144 ? 99.799  45.926 74.927 1.00 38.62  ? 139 LYS D C   1 
ATOM   5199 O  O   . LYS G 1 144 ? 100.682 45.489 74.196 1.00 38.87  ? 139 LYS D O   1 
ATOM   5200 C  CB  . LYS G 1 144 ? 100.537 47.647 76.578 1.00 38.48  ? 139 LYS D CB  1 
ATOM   5201 C  CG  . LYS G 1 144 ? 100.593 49.091 77.003 1.00 38.71  ? 139 LYS D CG  1 
ATOM   5202 C  CD  . LYS G 1 144 ? 101.521 49.273 78.183 1.00 41.44  ? 139 LYS D CD  1 
ATOM   5203 C  CE  . LYS G 1 144 ? 102.960 49.005 77.793 1.00 40.25  ? 139 LYS D CE  1 
ATOM   5204 N  NZ  . LYS G 1 144 ? 103.884 49.376 78.896 1.00 41.08  ? 139 LYS D NZ  1 
ATOM   5205 N  N   . ARG G 1 145 ? 98.855  45.150 75.452 1.00 39.07  ? 140 ARG D N   1 
ATOM   5206 C  CA  . ARG G 1 145 ? 98.811  43.722 75.147 1.00 41.15  ? 140 ARG D CA  1 
ATOM   5207 C  C   . ARG G 1 145 ? 98.354  43.502 73.710 1.00 41.14  ? 140 ARG D C   1 
ATOM   5208 O  O   . ARG G 1 145 ? 98.726  42.511 73.083 1.00 41.65  ? 140 ARG D O   1 
ATOM   5209 C  CB  . ARG G 1 145 ? 97.862  42.977 76.090 1.00 40.76  ? 140 ARG D CB  1 
ATOM   5210 C  CG  . ARG G 1 145 ? 98.228  43.075 77.555 1.00 42.90  ? 140 ARG D CG  1 
ATOM   5211 C  CD  . ARG G 1 145 ? 97.533  41.985 78.351 1.00 44.43  ? 140 ARG D CD  1 
ATOM   5212 N  NE  . ARG G 1 145 ? 96.081  42.058 78.220 1.00 47.94  ? 140 ARG D NE  1 
ATOM   5213 C  CZ  . ARG G 1 145 ? 95.300  42.857 78.941 1.00 47.97  ? 140 ARG D CZ  1 
ATOM   5214 N  NH1 . ARG G 1 145 ? 95.830  43.655 79.855 1.00 47.96  ? 140 ARG D NH1 1 
ATOM   5215 N  NH2 . ARG G 1 145 ? 93.985  42.857 78.746 1.00 49.73  ? 140 ARG D NH2 1 
ATOM   5216 N  N   . GLN G 1 146 ? 97.547  44.429 73.195 1.00 42.11  ? 141 GLN D N   1 
ATOM   5217 C  CA  . GLN G 1 146 ? 97.036  44.339 71.827 1.00 42.63  ? 141 GLN D CA  1 
ATOM   5218 C  C   . GLN G 1 146 ? 98.031  44.911 70.828 1.00 41.03  ? 141 GLN D C   1 
ATOM   5219 O  O   . GLN G 1 146 ? 97.841  44.785 69.623 1.00 40.70  ? 141 GLN D O   1 
ATOM   5220 C  CB  . GLN G 1 146 ? 95.701  45.087 71.686 1.00 45.38  ? 141 GLN D CB  1 
ATOM   5221 C  CG  . GLN G 1 146 ? 94.534  44.496 72.469 1.00 50.46  ? 141 GLN D CG  1 
ATOM   5222 C  CD  . GLN G 1 146 ? 94.015  43.181 71.893 1.00 54.90  ? 141 GLN D CD  1 
ATOM   5223 O  OE1 . GLN G 1 146 ? 92.971  42.666 72.323 1.00 56.04  ? 141 GLN D OE1 1 
ATOM   5224 N  NE2 . GLN G 1 146 ? 94.737  42.633 70.919 1.00 55.89  ? 141 GLN D NE2 1 
ATOM   5225 N  N   . GLY G 1 147 ? 99.084  45.550 71.328 1.00 40.92  ? 142 GLY D N   1 
ATOM   5226 C  CA  . GLY G 1 147 ? 100.088 46.112 70.440 1.00 39.47  ? 142 GLY D CA  1 
ATOM   5227 C  C   . GLY G 1 147 ? 99.812  47.515 69.922 1.00 40.17  ? 142 GLY D C   1 
ATOM   5228 O  O   . GLY G 1 147 ? 100.581 48.041 69.109 1.00 37.82  ? 142 GLY D O   1 
ATOM   5229 N  N   . ILE G 1 148 ? 98.720  48.127 70.372 1.00 40.99  ? 143 ILE D N   1 
ATOM   5230 C  CA  . ILE G 1 148 ? 98.401  49.486 69.932 1.00 43.25  ? 143 ILE D CA  1 
ATOM   5231 C  C   . ILE G 1 148 ? 99.458  50.442 70.488 1.00 42.75  ? 143 ILE D C   1 
ATOM   5232 O  O   . ILE G 1 148 ? 99.875  51.392 69.815 1.00 42.75  ? 143 ILE D O   1 
ATOM   5233 C  CB  . ILE G 1 148 ? 97.002  49.939 70.418 1.00 43.76  ? 143 ILE D CB  1 
ATOM   5234 C  CG1 . ILE G 1 148 ? 95.920  49.041 69.811 1.00 43.50  ? 143 ILE D CG1 1 
ATOM   5235 C  CG2 . ILE G 1 148 ? 96.763  51.385 70.020 1.00 42.66  ? 143 ILE D CG2 1 
ATOM   5236 C  CD1 . ILE G 1 148 ? 95.932  49.030 68.301 1.00 44.08  ? 143 ILE D CD1 1 
ATOM   5237 N  N   . VAL G 1 149 ? 99.870  50.189 71.726 1.00 41.91  ? 144 VAL D N   1 
ATOM   5238 C  CA  . VAL G 1 149 ? 100.907 50.985 72.372 1.00 41.95  ? 144 VAL D CA  1 
ATOM   5239 C  C   . VAL G 1 149 ? 102.119 50.064 72.471 1.00 41.76  ? 144 VAL D C   1 
ATOM   5240 O  O   . VAL G 1 149 ? 102.107 49.092 73.229 1.00 40.41  ? 144 VAL D O   1 
ATOM   5241 C  CB  . VAL G 1 149 ? 100.494 51.438 73.798 1.00 41.85  ? 144 VAL D CB  1 
ATOM   5242 C  CG1 . VAL G 1 149 ? 101.659 52.150 74.478 1.00 41.60  ? 144 VAL D CG1 1 
ATOM   5243 C  CG2 . VAL G 1 149 ? 99.302  52.369 73.720 1.00 40.64  ? 144 VAL D CG2 1 
ATOM   5244 N  N   . GLN G 1 150 ? 103.148 50.369 71.682 1.00 42.85  ? 145 GLN D N   1 
ATOM   5245 C  CA  . GLN G 1 150 ? 104.380 49.583 71.640 1.00 44.68  ? 145 GLN D CA  1 
ATOM   5246 C  C   . GLN G 1 150 ? 105.183 49.678 72.938 1.00 43.61  ? 145 GLN D C   1 
ATOM   5247 O  O   . GLN G 1 150 ? 105.737 48.686 73.413 1.00 44.90  ? 145 GLN D O   1 
ATOM   5248 C  CB  . GLN G 1 150 ? 105.252 50.059 70.475 1.00 48.61  ? 145 GLN D CB  1 
ATOM   5249 C  CG  . GLN G 1 150 ? 105.574 49.002 69.423 1.00 52.46  ? 145 GLN D CG  1 
ATOM   5250 C  CD  . GLN G 1 150 ? 104.340 48.484 68.704 1.00 55.58  ? 145 GLN D CD  1 
ATOM   5251 O  OE1 . GLN G 1 150 ? 103.585 47.660 69.239 1.00 56.91  ? 145 GLN D OE1 1 
ATOM   5252 N  NE2 . GLN G 1 150 ? 104.123 48.971 67.484 1.00 55.69  ? 145 GLN D NE2 1 
ATOM   5253 N  N   . SER G 1 151 ? 105.255 50.882 73.493 1.00 41.38  ? 146 SER D N   1 
ATOM   5254 C  CA  . SER G 1 151 ? 105.984 51.126 74.732 1.00 38.76  ? 146 SER D CA  1 
ATOM   5255 C  C   . SER G 1 151 ? 105.512 52.453 75.321 1.00 38.18  ? 146 SER D C   1 
ATOM   5256 O  O   . SER G 1 151 ? 105.024 53.322 74.594 1.00 35.73  ? 146 SER D O   1 
ATOM   5257 C  CB  . SER G 1 151 ? 107.486 51.195 74.457 1.00 37.86  ? 146 SER D CB  1 
ATOM   5258 O  OG  . SER G 1 151 ? 107.800 52.313 73.643 1.00 35.47  ? 146 SER D OG  1 
ATOM   5259 N  N   . ASP G 1 152 ? 105.654 52.603 76.635 1.00 37.14  ? 147 ASP D N   1 
ATOM   5260 C  CA  . ASP G 1 152 ? 105.242 53.823 77.304 1.00 34.61  ? 147 ASP D CA  1 
ATOM   5261 C  C   . ASP G 1 152 ? 105.891 55.009 76.625 1.00 33.53  ? 147 ASP D C   1 
ATOM   5262 O  O   . ASP G 1 152 ? 107.096 55.037 76.394 1.00 31.83  ? 147 ASP D O   1 
ATOM   5263 C  CB  . ASP G 1 152 ? 105.631 53.766 78.770 1.00 35.61  ? 147 ASP D CB  1 
ATOM   5264 C  CG  . ASP G 1 152 ? 105.121 52.515 79.437 1.00 36.93  ? 147 ASP D CG  1 
ATOM   5265 O  OD1 . ASP G 1 152 ? 103.950 52.160 79.170 1.00 36.95  ? 147 ASP D OD1 1 
ATOM   5266 O  OD2 . ASP G 1 152 ? 105.880 51.891 80.215 1.00 37.51  ? 147 ASP D OD2 1 
ATOM   5267 N  N   . PRO G 1 153 ? 105.086 56.011 76.278 1.00 32.39  ? 148 PRO D N   1 
ATOM   5268 C  CA  . PRO G 1 153 ? 105.652 57.175 75.613 1.00 31.73  ? 148 PRO D CA  1 
ATOM   5269 C  C   . PRO G 1 153 ? 106.277 58.161 76.581 1.00 31.92  ? 148 PRO D C   1 
ATOM   5270 O  O   . PRO G 1 153 ? 106.061 58.100 77.799 1.00 30.29  ? 148 PRO D O   1 
ATOM   5271 C  CB  . PRO G 1 153 ? 104.446 57.774 74.919 1.00 31.52  ? 148 PRO D CB  1 
ATOM   5272 C  CG  . PRO G 1 153 ? 103.377 57.576 75.971 1.00 31.45  ? 148 PRO D CG  1 
ATOM   5273 C  CD  . PRO G 1 153 ? 103.624 56.136 76.409 1.00 31.18  ? 148 PRO D CD  1 
ATOM   5274 N  N   . PRO G 1 154 ? 107.092 59.070 76.046 1.00 30.86  ? 149 PRO D N   1 
ATOM   5275 C  CA  . PRO G 1 154 ? 107.727 60.078 76.890 1.00 32.74  ? 149 PRO D CA  1 
ATOM   5276 C  C   . PRO G 1 154 ? 106.594 61.045 77.242 1.00 33.40  ? 149 PRO D C   1 
ATOM   5277 O  O   . PRO G 1 154 ? 105.618 61.161 76.487 1.00 32.37  ? 149 PRO D O   1 
ATOM   5278 C  CB  . PRO G 1 154 ? 108.745 60.721 75.948 1.00 32.72  ? 149 PRO D CB  1 
ATOM   5279 C  CG  . PRO G 1 154 ? 109.072 59.598 74.992 1.00 33.47  ? 149 PRO D CG  1 
ATOM   5280 C  CD  . PRO G 1 154 ? 107.714 59.029 74.714 1.00 30.30  ? 149 PRO D CD  1 
ATOM   5281 N  N   . ILE G 1 155 ? 106.696 61.726 78.376 1.00 33.29  ? 150 ILE D N   1 
ATOM   5282 C  CA  . ILE G 1 155 ? 105.650 62.669 78.725 1.00 34.95  ? 150 ILE D CA  1 
ATOM   5283 C  C   . ILE G 1 155 ? 106.249 63.940 79.268 1.00 34.17  ? 150 ILE D C   1 
ATOM   5284 O  O   . ILE G 1 155 ? 107.393 63.953 79.728 1.00 33.86  ? 150 ILE D O   1 
ATOM   5285 C  CB  . ILE G 1 155 ? 104.686 62.105 79.779 1.00 36.72  ? 150 ILE D CB  1 
ATOM   5286 C  CG1 . ILE G 1 155 ? 105.441 61.854 81.082 1.00 35.73  ? 150 ILE D CG1 1 
ATOM   5287 C  CG2 . ILE G 1 155 ? 104.017 60.826 79.250 1.00 38.29  ? 150 ILE D CG2 1 
ATOM   5288 C  CD1 . ILE G 1 155 ? 104.554 61.384 82.209 1.00 35.69  ? 150 ILE D CD1 1 
ATOM   5289 N  N   . PRO G 1 156 ? 105.486 65.038 79.202 1.00 33.66  ? 151 PRO D N   1 
ATOM   5290 C  CA  . PRO G 1 156 ? 105.941 66.339 79.698 1.00 32.71  ? 151 PRO D CA  1 
ATOM   5291 C  C   . PRO G 1 156 ? 106.174 66.231 81.197 1.00 32.76  ? 151 PRO D C   1 
ATOM   5292 O  O   . PRO G 1 156 ? 105.494 65.461 81.880 1.00 32.89  ? 151 PRO D O   1 
ATOM   5293 C  CB  . PRO G 1 156 ? 104.772 67.264 79.367 1.00 31.78  ? 151 PRO D CB  1 
ATOM   5294 C  CG  . PRO G 1 156 ? 104.172 66.622 78.134 1.00 33.08  ? 151 PRO D CG  1 
ATOM   5295 C  CD  . PRO G 1 156 ? 104.194 65.156 78.503 1.00 33.53  ? 151 PRO D CD  1 
ATOM   5296 N  N   . VAL G 1 157 ? 107.130 66.993 81.710 1.00 32.57  ? 152 VAL D N   1 
ATOM   5297 C  CA  . VAL G 1 157 ? 107.420 66.958 83.136 1.00 35.11  ? 152 VAL D CA  1 
ATOM   5298 C  C   . VAL G 1 157 ? 106.417 67.741 83.993 1.00 35.92  ? 152 VAL D C   1 
ATOM   5299 O  O   . VAL G 1 157 ? 106.419 68.978 83.991 1.00 36.71  ? 152 VAL D O   1 
ATOM   5300 C  CB  . VAL G 1 157 ? 108.832 67.499 83.415 1.00 35.03  ? 152 VAL D CB  1 
ATOM   5301 C  CG1 . VAL G 1 157 ? 109.020 67.750 84.905 1.00 35.05  ? 152 VAL D CG1 1 
ATOM   5302 C  CG2 . VAL G 1 157 ? 109.861 66.496 82.927 1.00 35.66  ? 152 VAL D CG2 1 
ATOM   5303 N  N   . ASP G 1 158 ? 105.562 67.017 84.716 1.00 34.52  ? 153 ASP D N   1 
ATOM   5304 C  CA  . ASP G 1 158 ? 104.580 67.638 85.604 1.00 34.22  ? 153 ASP D CA  1 
ATOM   5305 C  C   . ASP G 1 158 ? 104.687 66.943 86.942 1.00 34.24  ? 153 ASP D C   1 
ATOM   5306 O  O   . ASP G 1 158 ? 104.229 65.809 87.107 1.00 34.21  ? 153 ASP D O   1 
ATOM   5307 C  CB  . ASP G 1 158 ? 103.158 67.498 85.058 1.00 35.26  ? 153 ASP D CB  1 
ATOM   5308 C  CG  . ASP G 1 158 ? 102.121 68.226 85.921 1.00 36.79  ? 153 ASP D CG  1 
ATOM   5309 O  OD1 . ASP G 1 158 ? 102.435 68.595 87.076 1.00 36.46  ? 153 ASP D OD1 1 
ATOM   5310 O  OD2 . ASP G 1 158 ? 100.983 68.425 85.443 1.00 37.53  ? 153 ASP D OD2 1 
ATOM   5311 N  N   . ARG G 1 159 ? 105.292 67.636 87.900 1.00 34.32  ? 154 ARG D N   1 
ATOM   5312 C  CA  . ARG G 1 159 ? 105.513 67.086 89.224 1.00 34.96  ? 154 ARG D CA  1 
ATOM   5313 C  C   . ARG G 1 159 ? 104.269 66.841 90.069 1.00 36.99  ? 154 ARG D C   1 
ATOM   5314 O  O   . ARG G 1 159 ? 104.353 66.204 91.116 1.00 37.14  ? 154 ARG D O   1 
ATOM   5315 C  CB  . ARG G 1 159 ? 106.521 67.966 89.958 1.00 34.75  ? 154 ARG D CB  1 
ATOM   5316 C  CG  . ARG G 1 159 ? 107.916 67.883 89.325 1.00 36.75  ? 154 ARG D CG  1 
ATOM   5317 C  CD  . ARG G 1 159 ? 108.811 69.047 89.707 1.00 36.83  ? 154 ARG D CD  1 
ATOM   5318 N  NE  . ARG G 1 159 ? 110.105 68.983 89.026 1.00 39.24  ? 154 ARG D NE  1 
ATOM   5319 C  CZ  . ARG G 1 159 ? 111.169 68.333 89.490 1.00 40.53  ? 154 ARG D CZ  1 
ATOM   5320 N  NH1 . ARG G 1 159 ? 111.101 67.688 90.649 1.00 40.08  ? 154 ARG D NH1 1 
ATOM   5321 N  NH2 . ARG G 1 159 ? 112.303 68.325 88.797 1.00 40.75  ? 154 ARG D NH2 1 
ATOM   5322 N  N   . THR G 1 160 ? 103.116 67.329 89.619 1.00 39.30  ? 155 THR D N   1 
ATOM   5323 C  CA  . THR G 1 160 ? 101.873 67.104 90.353 1.00 42.16  ? 155 THR D CA  1 
ATOM   5324 C  C   . THR G 1 160 ? 101.347 65.687 90.080 1.00 46.47  ? 155 THR D C   1 
ATOM   5325 O  O   . THR G 1 160 ? 100.361 65.266 90.681 1.00 46.84  ? 155 THR D O   1 
ATOM   5326 C  CB  . THR G 1 160 ? 100.766 68.114 89.957 1.00 39.99  ? 155 THR D CB  1 
ATOM   5327 O  OG1 . THR G 1 160 ? 100.465 67.976 88.566 1.00 38.90  ? 155 THR D OG1 1 
ATOM   5328 C  CG2 . THR G 1 160 ? 101.206 69.544 90.239 1.00 39.28  ? 155 THR D CG2 1 
ATOM   5329 N  N   . LEU G 1 161 ? 101.996 64.961 89.166 1.00 50.15  ? 156 LEU D N   1 
ATOM   5330 C  CA  . LEU G 1 161 ? 101.595 63.588 88.842 1.00 53.76  ? 156 LEU D CA  1 
ATOM   5331 C  C   . LEU G 1 161 ? 102.118 62.671 89.946 1.00 55.59  ? 156 LEU D C   1 
ATOM   5332 O  O   . LEU G 1 161 ? 102.808 61.685 89.680 1.00 54.69  ? 156 LEU D O   1 
ATOM   5333 C  CB  . LEU G 1 161 ? 102.172 63.161 87.482 1.00 54.32  ? 156 LEU D CB  1 
ATOM   5334 C  CG  . LEU G 1 161 ? 101.722 63.973 86.257 1.00 54.83  ? 156 LEU D CG  1 
ATOM   5335 C  CD1 . LEU G 1 161 ? 102.443 63.491 85.005 1.00 54.55  ? 156 LEU D CD1 1 
ATOM   5336 C  CD2 . LEU G 1 161 ? 100.222 63.839 86.082 1.00 54.36  ? 156 LEU D CD2 1 
ATOM   5337 N  N   . ILE G 1 162 ? 101.776 63.034 91.185 1.00 59.05  ? 157 ILE D N   1 
ATOM   5338 C  CA  . ILE G 1 162 ? 102.169 62.330 92.408 1.00 59.59  ? 157 ILE D CA  1 
ATOM   5339 C  C   . ILE G 1 162 ? 103.567 61.737 92.296 1.00 59.89  ? 157 ILE D C   1 
ATOM   5340 O  O   . ILE G 1 162 ? 104.533 62.461 92.057 1.00 59.86  ? 157 ILE D O   1 
ATOM   5341 C  CB  . ILE G 1 162 ? 101.160 61.206 92.771 1.00 60.60  ? 157 ILE D CB  1 
ATOM   5342 C  CG1 . ILE G 1 162 ? 99.733  61.770 92.807 1.00 60.83  ? 157 ILE D CG1 1 
ATOM   5343 C  CG2 . ILE G 1 162 ? 101.499 60.627 94.139 1.00 61.14  ? 157 ILE D CG2 1 
ATOM   5344 C  CD1 . ILE G 1 162 ? 98.672  60.747 93.167 1.00 60.44  ? 157 ILE D CD1 1 
ATOM   5345 N  N   . ASP H 2 4   ? 78.573  47.873 89.176 1.00 67.09  ? 304 ASP H N   1 
ATOM   5346 C  CA  . ASP H 2 4   ? 78.798  49.049 88.342 1.00 67.19  ? 304 ASP H CA  1 
ATOM   5347 C  C   . ASP H 2 4   ? 77.728  49.207 87.261 1.00 67.13  ? 304 ASP H C   1 
ATOM   5348 O  O   . ASP H 2 4   ? 77.341  48.238 86.594 1.00 66.77  ? 304 ASP H O   1 
ATOM   5349 C  CB  . ASP H 2 4   ? 80.169  48.979 87.657 1.00 67.42  ? 304 ASP H CB  1 
ATOM   5350 C  CG  . ASP H 2 4   ? 81.322  49.025 88.636 1.00 68.36  ? 304 ASP H CG  1 
ATOM   5351 O  OD1 . ASP H 2 4   ? 81.392  49.985 89.435 1.00 70.67  ? 304 ASP H OD1 1 
ATOM   5352 O  OD2 . ASP H 2 4   ? 82.167  48.104 88.597 1.00 68.64  ? 304 ASP H OD2 1 
ATOM   5353 N  N   . SER H 2 5   ? 77.251  50.437 87.096 1.00 65.86  ? 305 SER H N   1 
ATOM   5354 C  CA  . SER H 2 5   ? 76.259  50.739 86.076 1.00 64.17  ? 305 SER H CA  1 
ATOM   5355 C  C   . SER H 2 5   ? 77.074  51.036 84.827 1.00 61.89  ? 305 SER H C   1 
ATOM   5356 O  O   . SER H 2 5   ? 76.532  51.315 83.754 1.00 62.65  ? 305 SER H O   1 
ATOM   5357 C  CB  . SER H 2 5   ? 75.444  51.971 86.474 1.00 65.02  ? 305 SER H CB  1 
ATOM   5358 O  OG  . SER H 2 5   ? 74.542  52.334 85.442 1.00 67.89  ? 305 SER H OG  1 
ATOM   5359 N  N   . ASP H 2 6   ? 78.391  50.962 84.994 1.00 58.19  ? 306 ASP H N   1 
ATOM   5360 C  CA  . ASP H 2 6   ? 79.341  51.229 83.929 1.00 55.20  ? 306 ASP H CA  1 
ATOM   5361 C  C   . ASP H 2 6   ? 79.421  50.106 82.904 1.00 54.73  ? 306 ASP H C   1 
ATOM   5362 O  O   . ASP H 2 6   ? 79.079  48.956 83.183 1.00 54.69  ? 306 ASP H O   1 
ATOM   5363 C  CB  . ASP H 2 6   ? 80.728  51.479 84.532 1.00 52.72  ? 306 ASP H CB  1 
ATOM   5364 C  CG  . ASP H 2 6   ? 81.756  51.878 83.489 1.00 49.65  ? 306 ASP H CG  1 
ATOM   5365 O  OD1 . ASP H 2 6   ? 81.377  52.598 82.539 1.00 47.52  ? 306 ASP H OD1 1 
ATOM   5366 O  OD2 . ASP H 2 6   ? 82.939  51.486 83.626 1.00 46.44  ? 306 ASP H OD2 1 
ATOM   5367 N  N   . GLU H 2 7   ? 79.879  50.452 81.707 1.00 54.22  ? 307 GLU H N   1 
ATOM   5368 C  CA  . GLU H 2 7   ? 80.021  49.473 80.641 1.00 53.01  ? 307 GLU H CA  1 
ATOM   5369 C  C   . GLU H 2 7   ? 81.200  48.555 80.964 1.00 50.36  ? 307 GLU H C   1 
ATOM   5370 O  O   . GLU H 2 7   ? 81.864  48.711 81.994 1.00 47.96  ? 307 GLU H O   1 
ATOM   5371 C  CB  . GLU H 2 7   ? 80.274  50.180 79.305 1.00 54.77  ? 307 GLU H CB  1 
ATOM   5372 C  CG  . GLU H 2 7   ? 79.287  51.301 78.973 1.00 59.19  ? 307 GLU H CG  1 
ATOM   5373 C  CD  . GLU H 2 7   ? 77.838  50.831 78.918 1.00 61.99  ? 307 GLU H CD  1 
ATOM   5374 O  OE1 . GLU H 2 7   ? 77.253  50.562 79.993 1.00 63.37  ? 307 GLU H OE1 1 
ATOM   5375 O  OE2 . GLU H 2 7   ? 77.285  50.728 77.797 1.00 61.99  ? 307 GLU H OE2 1 
ATOM   5376 N  N   . ASP H 2 8   ? 81.439  47.587 80.086 1.00 48.68  ? 308 ASP H N   1 
ATOM   5377 C  CA  . ASP H 2 8   ? 82.550  46.658 80.240 1.00 47.05  ? 308 ASP H CA  1 
ATOM   5378 C  C   . ASP H 2 8   ? 83.633  47.129 79.289 1.00 46.12  ? 308 ASP H C   1 
ATOM   5379 O  O   . ASP H 2 8   ? 83.340  47.734 78.252 1.00 43.29  ? 308 ASP H O   1 
ATOM   5380 C  CB  . ASP H 2 8   ? 82.126  45.240 79.861 1.00 49.20  ? 308 ASP H CB  1 
ATOM   5381 C  CG  . ASP H 2 8   ? 81.133  44.645 80.842 1.00 51.84  ? 308 ASP H CG  1 
ATOM   5382 O  OD1 . ASP H 2 8   ? 81.570  44.124 81.894 1.00 53.92  ? 308 ASP H OD1 1 
ATOM   5383 O  OD2 . ASP H 2 8   ? 79.914  44.707 80.563 1.00 51.36  ? 308 ASP H OD2 1 
ATOM   5384 N  N   . LEU H 2 9   ? 84.883  46.865 79.646 1.00 45.46  ? 309 LEU H N   1 
ATOM   5385 C  CA  . LEU H 2 9   ? 85.994  47.267 78.807 1.00 47.12  ? 309 LEU H CA  1 
ATOM   5386 C  C   . LEU H 2 9   ? 85.754  46.780 77.386 1.00 49.15  ? 309 LEU H C   1 
ATOM   5387 O  O   . LEU H 2 9   ? 85.350  45.639 77.172 1.00 50.37  ? 309 LEU H O   1 
ATOM   5388 C  CB  . LEU H 2 9   ? 87.299  46.678 79.339 1.00 45.72  ? 309 LEU H CB  1 
ATOM   5389 C  CG  . LEU H 2 9   ? 88.557  46.966 78.512 1.00 46.95  ? 309 LEU H CG  1 
ATOM   5390 C  CD1 . LEU H 2 9   ? 88.782  48.471 78.391 1.00 43.98  ? 309 LEU H CD1 1 
ATOM   5391 C  CD2 . LEU H 2 9   ? 89.757  46.303 79.182 1.00 48.22  ? 309 LEU H CD2 1 
ATOM   5392 N  N   . LEU H 2 10  ? 85.979  47.653 76.416 1.00 50.62  ? 310 LEU H N   1 
ATOM   5393 C  CA  . LEU H 2 10  ? 85.809  47.279 75.022 1.00 53.67  ? 310 LEU H CA  1 
ATOM   5394 C  C   . LEU H 2 10  ? 87.036  46.437 74.682 1.00 57.06  ? 310 LEU H C   1 
ATOM   5395 O  O   . LEU H 2 10  ? 88.135  46.738 75.146 1.00 57.97  ? 310 LEU H O   1 
ATOM   5396 C  CB  . LEU H 2 10  ? 85.776  48.540 74.152 1.00 51.38  ? 310 LEU H CB  1 
ATOM   5397 C  CG  . LEU H 2 10  ? 85.555  48.437 72.641 1.00 51.05  ? 310 LEU H CG  1 
ATOM   5398 C  CD1 . LEU H 2 10  ? 84.132  47.975 72.337 1.00 48.82  ? 310 LEU H CD1 1 
ATOM   5399 C  CD2 . LEU H 2 10  ? 85.802  49.799 72.016 1.00 50.37  ? 310 LEU H CD2 1 
ATOM   5400 N  N   . HIS H 2 11  ? 86.858  45.373 73.903 1.00 61.19  ? 311 HIS H N   1 
ATOM   5401 C  CA  . HIS H 2 11  ? 87.997  44.537 73.515 1.00 64.67  ? 311 HIS H CA  1 
ATOM   5402 C  C   . HIS H 2 11  ? 88.332  44.749 72.041 1.00 65.42  ? 311 HIS H C   1 
ATOM   5403 O  O   . HIS H 2 11  ? 87.454  44.660 71.177 1.00 63.74  ? 311 HIS H O   1 
ATOM   5404 C  CB  . HIS H 2 11  ? 87.705  43.053 73.771 1.00 68.09  ? 311 HIS H CB  1 
ATOM   5405 C  CG  . HIS H 2 11  ? 87.895  42.632 75.199 1.00 71.75  ? 311 HIS H CG  1 
ATOM   5406 N  ND1 . HIS H 2 11  ? 87.660  41.343 75.634 1.00 72.77  ? 311 HIS H ND1 1 
ATOM   5407 C  CD2 . HIS H 2 11  ? 88.297  43.329 76.291 1.00 72.35  ? 311 HIS H CD2 1 
ATOM   5408 C  CE1 . HIS H 2 11  ? 87.906  41.266 76.930 1.00 73.46  ? 311 HIS H CE1 1 
ATOM   5409 N  NE2 . HIS H 2 11  ? 88.294  42.457 77.353 1.00 73.16  ? 311 HIS H NE2 1 
ATOM   5410 N  N   . ILE H 2 12  ? 89.603  45.043 71.767 1.00 66.88  ? 312 ILE H N   1 
ATOM   5411 C  CA  . ILE H 2 12  ? 90.075  45.277 70.402 1.00 68.31  ? 312 ILE H CA  1 
ATOM   5412 C  C   . ILE H 2 12  ? 90.682  44.002 69.812 1.00 69.67  ? 312 ILE H C   1 
ATOM   5413 O  O   . ILE H 2 12  ? 90.985  43.072 70.601 1.00 69.27  ? 312 ILE H O   1 
ATOM   5414 C  CB  . ILE H 2 12  ? 91.153  46.397 70.366 1.00 68.27  ? 312 ILE H CB  1 
ATOM   5415 C  CG1 . ILE H 2 12  ? 90.606  47.663 71.018 1.00 67.46  ? 312 ILE H CG1 1 
ATOM   5416 C  CG2 . ILE H 2 12  ? 91.570  46.691 68.929 1.00 67.66  ? 312 ILE H CG2 1 
ATOM   5417 C  CD1 . ILE H 2 12  ? 89.292  48.116 70.430 1.00 68.73  ? 312 ILE H CD1 1 
ATOM   5418 O  OXT . ILE H 2 12  ? 90.858  43.959 68.571 1.00 70.27  ? 312 ILE H OXT 1 
HETATM 5419 O  O   . HOH I 3 .   ? 46.459  26.213 39.246 1.00 41.80  ? 206 HOH A O   1 
HETATM 5420 O  O   . HOH I 3 .   ? 40.247  41.027 42.979 1.00 34.43  ? 207 HOH A O   1 
HETATM 5421 O  O   . HOH I 3 .   ? 52.083  30.423 42.481 1.00 17.18  ? 208 HOH A O   1 
HETATM 5422 O  O   . HOH I 3 .   ? 52.215  35.640 13.177 1.00 82.05  ? 209 HOH A O   1 
HETATM 5423 O  O   . HOH I 3 .   ? 55.368  30.837 38.707 1.00 17.91  ? 210 HOH A O   1 
HETATM 5424 O  O   . HOH I 3 .   ? 45.080  23.553 34.241 1.00 30.84  ? 211 HOH A O   1 
HETATM 5425 O  O   . HOH I 3 .   ? 50.256  30.957 50.162 1.00 33.02  ? 212 HOH A O   1 
HETATM 5426 O  O   . HOH I 3 .   ? 55.402  34.922 37.546 1.00 24.03  ? 213 HOH A O   1 
HETATM 5427 O  O   . HOH I 3 .   ? 40.114  25.879 44.986 1.00 50.41  ? 214 HOH A O   1 
HETATM 5428 O  O   . HOH I 3 .   ? 39.600  43.214 44.147 1.00 38.42  ? 215 HOH A O   1 
HETATM 5429 O  O   . HOH I 3 .   ? 28.348  43.668 28.815 1.00 39.81  ? 216 HOH A O   1 
HETATM 5430 O  O   . HOH I 3 .   ? 51.206  51.466 42.295 1.00 23.99  ? 217 HOH A O   1 
HETATM 5431 O  O   . HOH I 3 .   ? 39.691  44.394 37.678 1.00 37.31  ? 218 HOH A O   1 
HETATM 5432 O  O   . HOH I 3 .   ? 54.134  53.314 35.497 1.00 24.45  ? 219 HOH A O   1 
HETATM 5433 O  O   . HOH I 3 .   ? 61.201  47.926 42.296 1.00 45.83  ? 220 HOH A O   1 
HETATM 5434 O  O   . HOH I 3 .   ? 33.835  36.746 30.093 1.00 30.25  ? 221 HOH A O   1 
HETATM 5435 O  O   . HOH I 3 .   ? 46.700  30.042 31.984 1.00 24.32  ? 222 HOH A O   1 
HETATM 5436 O  O   . HOH I 3 .   ? 35.502  32.314 34.790 1.00 26.48  ? 223 HOH A O   1 
HETATM 5437 O  O   . HOH I 3 .   ? 58.643  43.896 47.047 1.00 37.41  ? 224 HOH A O   1 
HETATM 5438 O  O   . HOH I 3 .   ? 62.293  51.591 44.315 1.00 44.06  ? 225 HOH A O   1 
HETATM 5439 O  O   . HOH I 3 .   ? 53.518  29.916 19.131 1.00 39.47  ? 226 HOH A O   1 
HETATM 5440 O  O   . HOH I 3 .   ? 37.829  23.822 30.182 1.00 41.50  ? 227 HOH A O   1 
HETATM 5441 O  O   . HOH I 3 .   ? 55.946  53.182 37.606 1.00 40.74  ? 228 HOH A O   1 
HETATM 5442 O  O   . HOH I 3 .   ? 42.006  25.935 26.117 1.00 51.16  ? 229 HOH A O   1 
HETATM 5443 O  O   . HOH I 3 .   ? 31.946  37.034 36.287 1.00 44.78  ? 230 HOH A O   1 
HETATM 5444 O  O   . HOH I 3 .   ? 71.869  39.995 38.685 1.00 55.38  ? 231 HOH A O   1 
HETATM 5445 O  O   . HOH I 3 .   ? 53.994  47.436 30.784 1.00 33.58  ? 232 HOH A O   1 
HETATM 5446 O  O   . HOH I 3 .   ? 45.111  34.269 47.162 1.00 42.31  ? 233 HOH A O   1 
HETATM 5447 O  O   . HOH I 3 .   ? 31.034  36.624 26.325 1.00 36.51  ? 234 HOH A O   1 
HETATM 5448 O  O   . HOH I 3 .   ? 50.539  40.183 50.795 1.00 101.71 ? 235 HOH A O   1 
HETATM 5449 O  O   . HOH I 3 .   ? 46.327  52.520 27.031 1.00 33.63  ? 236 HOH A O   1 
HETATM 5450 O  O   . HOH I 3 .   ? 57.531  55.424 38.899 1.00 49.21  ? 237 HOH A O   1 
HETATM 5451 O  O   . HOH I 3 .   ? 54.209  29.260 37.119 1.00 39.84  ? 238 HOH A O   1 
HETATM 5452 O  O   . HOH I 3 .   ? 40.438  35.222 38.395 1.00 40.67  ? 239 HOH A O   1 
HETATM 5453 O  O   . HOH I 3 .   ? 55.134  36.068 29.819 1.00 32.64  ? 240 HOH A O   1 
HETATM 5454 O  O   . HOH I 3 .   ? 59.263  41.963 28.437 1.00 47.28  ? 241 HOH A O   1 
HETATM 5455 O  O   . HOH I 3 .   ? 57.142  45.751 31.839 1.00 40.79  ? 242 HOH A O   1 
HETATM 5456 O  O   . HOH I 3 .   ? 38.036  31.359 44.327 1.00 47.21  ? 243 HOH A O   1 
HETATM 5457 O  O   . HOH I 3 .   ? 51.018  53.245 26.126 1.00 38.39  ? 244 HOH A O   1 
HETATM 5458 O  O   . HOH I 3 .   ? 39.708  25.974 42.397 1.00 34.93  ? 245 HOH A O   1 
HETATM 5459 O  O   . HOH I 3 .   ? 46.554  26.722 21.659 1.00 35.42  ? 246 HOH A O   1 
HETATM 5460 O  O   . HOH I 3 .   ? 49.700  56.522 40.045 1.00 38.05  ? 247 HOH A O   1 
HETATM 5461 O  O   . HOH I 3 .   ? 37.882  26.176 40.657 1.00 39.86  ? 248 HOH A O   1 
HETATM 5462 O  O   . HOH I 3 .   ? 40.696  25.465 39.860 1.00 37.83  ? 249 HOH A O   1 
HETATM 5463 O  O   . HOH I 3 .   ? 28.565  42.373 21.579 1.00 39.52  ? 250 HOH A O   1 
HETATM 5464 O  O   . HOH I 3 .   ? 67.482  37.154 40.234 1.00 36.22  ? 251 HOH A O   1 
HETATM 5465 O  O   . HOH I 3 .   ? 37.063  25.681 32.410 1.00 43.78  ? 252 HOH A O   1 
HETATM 5466 O  O   . HOH I 3 .   ? 42.147  35.625 52.945 1.00 37.35  ? 253 HOH A O   1 
HETATM 5467 O  O   . HOH I 3 .   ? 57.185  37.105 50.873 1.00 48.75  ? 254 HOH A O   1 
HETATM 5468 O  O   . HOH I 3 .   ? 54.443  42.059 29.574 1.00 42.23  ? 255 HOH A O   1 
HETATM 5469 O  O   . HOH I 3 .   ? 41.067  33.565 42.608 1.00 36.90  ? 256 HOH A O   1 
HETATM 5470 O  O   . HOH I 3 .   ? 35.925  42.193 35.564 1.00 39.17  ? 257 HOH A O   1 
HETATM 5471 O  O   . HOH I 3 .   ? 69.626  44.012 44.655 1.00 50.48  ? 258 HOH A O   1 
HETATM 5472 O  O   . HOH J 3 .   ? 55.226  50.042 18.079 1.00 27.05  ? 97  HOH E O   1 
HETATM 5473 O  O   . HOH J 3 .   ? 58.266  44.377 22.784 1.00 52.52  ? 124 HOH E O   1 
HETATM 5474 O  O   . HOH J 3 .   ? 62.114  49.434 27.819 1.00 49.55  ? 144 HOH E O   1 
HETATM 5475 O  O   . HOH J 3 .   ? 54.396  53.075 25.760 1.00 51.14  ? 153 HOH E O   1 
HETATM 5476 O  O   . HOH K 3 .   ? 60.548  10.076 24.535 1.00 38.47  ? 206 HOH B O   1 
HETATM 5477 O  O   . HOH K 3 .   ? 58.639  30.010 42.111 1.00 17.65  ? 207 HOH B O   1 
HETATM 5478 O  O   . HOH K 3 .   ? 69.753  12.498 23.033 1.00 29.42  ? 208 HOH B O   1 
HETATM 5479 O  O   . HOH K 3 .   ? 52.581  17.095 29.356 1.00 39.68  ? 209 HOH B O   1 
HETATM 5480 O  O   . HOH K 3 .   ? 82.064  19.824 24.626 1.00 22.76  ? 210 HOH B O   1 
HETATM 5481 O  O   . HOH K 3 .   ? 42.822  23.928 39.582 1.00 29.37  ? 211 HOH B O   1 
HETATM 5482 O  O   . HOH K 3 .   ? 67.321  35.770 47.514 1.00 40.69  ? 212 HOH B O   1 
HETATM 5483 O  O   . HOH K 3 .   ? 63.078  37.743 22.499 1.00 42.42  ? 213 HOH B O   1 
HETATM 5484 O  O   . HOH K 3 .   ? 70.854  13.538 16.075 1.00 70.28  ? 214 HOH B O   1 
HETATM 5485 O  O   . HOH K 3 .   ? 57.762  14.306 48.230 1.00 30.64  ? 215 HOH B O   1 
HETATM 5486 O  O   . HOH K 3 .   ? 78.236  18.182 17.802 1.00 39.85  ? 216 HOH B O   1 
HETATM 5487 O  O   . HOH K 3 .   ? 70.178  35.530 39.706 1.00 58.44  ? 217 HOH B O   1 
HETATM 5488 O  O   . HOH K 3 .   ? 65.892  25.591 45.424 1.00 27.00  ? 218 HOH B O   1 
HETATM 5489 O  O   . HOH K 3 .   ? 55.231  26.574 36.944 1.00 17.52  ? 219 HOH B O   1 
HETATM 5490 O  O   . HOH K 3 .   ? 50.333  7.149  44.049 1.00 50.80  ? 220 HOH B O   1 
HETATM 5491 O  O   . HOH K 3 .   ? 56.325  16.263 27.013 1.00 27.00  ? 221 HOH B O   1 
HETATM 5492 O  O   . HOH K 3 .   ? 72.723  23.738 38.092 1.00 50.46  ? 222 HOH B O   1 
HETATM 5493 O  O   . HOH K 3 .   ? 76.079  18.999 15.684 1.00 45.75  ? 223 HOH B O   1 
HETATM 5494 O  O   . HOH K 3 .   ? 67.541  12.154 15.721 1.00 44.96  ? 224 HOH B O   1 
HETATM 5495 O  O   . HOH K 3 .   ? 73.416  16.240 37.007 1.00 57.17  ? 225 HOH B O   1 
HETATM 5496 O  O   . HOH K 3 .   ? 65.372  38.900 35.481 1.00 27.34  ? 226 HOH B O   1 
HETATM 5497 O  O   . HOH K 3 .   ? 45.436  13.934 32.832 1.00 48.66  ? 227 HOH B O   1 
HETATM 5498 O  O   . HOH K 3 .   ? 66.056  6.570  30.047 1.00 30.24  ? 228 HOH B O   1 
HETATM 5499 O  O   . HOH K 3 .   ? 62.978  11.236 21.916 1.00 34.71  ? 229 HOH B O   1 
HETATM 5500 O  O   . HOH K 3 .   ? 68.817  15.993 12.816 1.00 35.04  ? 230 HOH B O   1 
HETATM 5501 O  O   . HOH K 3 .   ? 59.694  3.221  32.566 1.00 52.34  ? 231 HOH B O   1 
HETATM 5502 O  O   . HOH K 3 .   ? 68.545  6.934  26.907 1.00 42.75  ? 232 HOH B O   1 
HETATM 5503 O  O   . HOH K 3 .   ? 66.367  24.117 9.487  1.00 46.05  ? 233 HOH B O   1 
HETATM 5504 O  O   . HOH K 3 .   ? 54.822  23.331 23.673 1.00 36.77  ? 234 HOH B O   1 
HETATM 5505 O  O   . HOH K 3 .   ? 72.413  28.605 38.904 1.00 43.96  ? 235 HOH B O   1 
HETATM 5506 O  O   . HOH K 3 .   ? 71.254  17.446 40.106 1.00 44.55  ? 236 HOH B O   1 
HETATM 5507 O  O   . HOH K 3 .   ? 61.173  28.605 49.772 1.00 36.40  ? 237 HOH B O   1 
HETATM 5508 O  O   . HOH K 3 .   ? 39.371  22.205 38.798 1.00 56.90  ? 238 HOH B O   1 
HETATM 5509 O  O   . HOH K 3 .   ? 76.630  17.789 32.153 1.00 24.56  ? 239 HOH B O   1 
HETATM 5510 O  O   . HOH K 3 .   ? 63.500  32.666 31.626 1.00 29.91  ? 240 HOH B O   1 
HETATM 5511 O  O   . HOH K 3 .   ? 76.712  13.907 39.876 1.00 39.74  ? 241 HOH B O   1 
HETATM 5512 O  O   . HOH K 3 .   ? 74.737  29.454 33.511 1.00 34.88  ? 242 HOH B O   1 
HETATM 5513 O  O   . HOH K 3 .   ? 81.183  21.560 17.667 1.00 51.28  ? 243 HOH B O   1 
HETATM 5514 O  O   . HOH K 3 .   ? 56.154  9.375  30.630 1.00 41.27  ? 244 HOH B O   1 
HETATM 5515 O  O   . HOH K 3 .   ? 73.745  36.530 32.769 1.00 43.30  ? 245 HOH B O   1 
HETATM 5516 O  O   . HOH K 3 .   ? 59.030  9.537  38.310 1.00 23.38  ? 246 HOH B O   1 
HETATM 5517 O  O   . HOH K 3 .   ? 56.691  32.631 37.550 1.00 33.52  ? 247 HOH B O   1 
HETATM 5518 O  O   . HOH K 3 .   ? 73.863  10.468 37.768 1.00 46.25  ? 248 HOH B O   1 
HETATM 5519 O  O   . HOH K 3 .   ? 74.949  31.434 38.114 1.00 40.75  ? 249 HOH B O   1 
HETATM 5520 O  O   . HOH K 3 .   ? 67.213  18.621 13.150 1.00 41.96  ? 250 HOH B O   1 
HETATM 5521 O  O   . HOH K 3 .   ? 82.758  7.114  32.238 1.00 46.79  ? 251 HOH B O   1 
HETATM 5522 O  O   . HOH K 3 .   ? 55.491  21.234 27.650 1.00 41.89  ? 252 HOH B O   1 
HETATM 5523 O  O   . HOH K 3 .   ? 70.594  15.821 35.594 1.00 43.13  ? 253 HOH B O   1 
HETATM 5524 O  O   . HOH K 3 .   ? 48.699  11.761 38.499 1.00 36.66  ? 254 HOH B O   1 
HETATM 5525 O  O   . HOH K 3 .   ? 53.486  26.943 25.404 1.00 39.18  ? 255 HOH B O   1 
HETATM 5526 O  O   . HOH K 3 .   ? 49.657  17.806 31.747 1.00 38.91  ? 256 HOH B O   1 
HETATM 5527 O  O   . HOH K 3 .   ? 54.111  15.168 27.552 1.00 38.82  ? 257 HOH B O   1 
HETATM 5528 O  O   . HOH K 3 .   ? 59.255  7.635  25.250 1.00 42.32  ? 258 HOH B O   1 
HETATM 5529 O  O   . HOH K 3 .   ? 53.600  6.689  34.044 1.00 53.96  ? 259 HOH B O   1 
HETATM 5530 O  O   . HOH K 3 .   ? 48.104  14.509 44.591 1.00 42.66  ? 260 HOH B O   1 
HETATM 5531 O  O   . HOH K 3 .   ? 46.051  20.748 30.683 1.00 32.97  ? 261 HOH B O   1 
HETATM 5532 O  O   . HOH K 3 .   ? 60.886  4.986  34.418 1.00 34.16  ? 262 HOH B O   1 
HETATM 5533 O  O   . HOH K 3 .   ? 71.208  15.643 41.767 1.00 39.80  ? 263 HOH B O   1 
HETATM 5534 O  O   . HOH K 3 .   ? 61.018  8.989  45.033 1.00 35.81  ? 264 HOH B O   1 
HETATM 5535 O  O   . HOH K 3 .   ? 53.972  26.346 47.971 1.00 49.56  ? 265 HOH B O   1 
HETATM 5536 O  O   . HOH L 3 .   ? 55.251  21.980 2.778  1.00 36.88  ? 64  HOH F O   1 
HETATM 5537 O  O   . HOH L 3 .   ? 65.023  25.717 11.423 1.00 66.65  ? 83  HOH F O   1 
HETATM 5538 O  O   . HOH L 3 .   ? 48.743  12.701 23.120 1.00 51.47  ? 147 HOH F O   1 
HETATM 5539 O  O   . HOH L 3 .   ? 61.048  31.934 14.525 1.00 51.30  ? 177 HOH F O   1 
HETATM 5540 O  O   . HOH M 3 .   ? 77.521  72.298 67.305 1.00 21.58  ? 206 HOH C O   1 
HETATM 5541 O  O   . HOH M 3 .   ? 88.546  77.082 52.784 1.00 31.99  ? 207 HOH C O   1 
HETATM 5542 O  O   . HOH M 3 .   ? 72.624  51.822 72.141 1.00 39.62  ? 208 HOH C O   1 
HETATM 5543 O  O   . HOH M 3 .   ? 76.113  57.130 45.623 1.00 37.42  ? 209 HOH C O   1 
HETATM 5544 O  O   . HOH M 3 .   ? 81.324  59.674 63.098 1.00 31.64  ? 210 HOH C O   1 
HETATM 5545 O  O   . HOH M 3 .   ? 80.107  59.020 52.145 1.00 25.19  ? 211 HOH C O   1 
HETATM 5546 O  O   . HOH M 3 .   ? 59.846  58.599 61.481 1.00 29.64  ? 212 HOH C O   1 
HETATM 5547 O  O   . HOH M 3 .   ? 65.622  72.959 53.997 1.00 43.58  ? 213 HOH C O   1 
HETATM 5548 O  O   . HOH M 3 .   ? 53.856  68.242 54.580 1.00 25.69  ? 214 HOH C O   1 
HETATM 5549 O  O   . HOH M 3 .   ? 75.359  79.942 66.259 1.00 33.78  ? 215 HOH C O   1 
HETATM 5550 O  O   . HOH M 3 .   ? 82.971  61.402 52.486 1.00 36.50  ? 216 HOH C O   1 
HETATM 5551 O  O   . HOH M 3 .   ? 80.971  67.646 63.135 1.00 21.20  ? 217 HOH C O   1 
HETATM 5552 O  O   . HOH M 3 .   ? 84.183  76.559 54.281 1.00 32.52  ? 218 HOH C O   1 
HETATM 5553 O  O   . HOH M 3 .   ? 70.499  76.394 63.269 1.00 32.39  ? 219 HOH C O   1 
HETATM 5554 O  O   . HOH M 3 .   ? 87.001  63.307 54.472 1.00 46.97  ? 220 HOH C O   1 
HETATM 5555 O  O   . HOH M 3 .   ? 58.718  50.704 51.843 1.00 35.39  ? 221 HOH C O   1 
HETATM 5556 O  O   . HOH M 3 .   ? 73.144  54.997 46.763 1.00 19.10  ? 222 HOH C O   1 
HETATM 5557 O  O   . HOH M 3 .   ? 63.071  44.569 52.047 1.00 48.12  ? 223 HOH C O   1 
HETATM 5558 O  O   . HOH M 3 .   ? 89.885  62.794 58.370 1.00 48.18  ? 224 HOH C O   1 
HETATM 5559 O  O   . HOH M 3 .   ? 74.942  56.954 42.041 1.00 48.43  ? 225 HOH C O   1 
HETATM 5560 O  O   . HOH M 3 .   ? 49.481  62.214 42.858 1.00 47.02  ? 226 HOH C O   1 
HETATM 5561 O  O   . HOH M 3 .   ? 66.109  59.423 42.074 1.00 63.29  ? 227 HOH C O   1 
HETATM 5562 O  O   . HOH M 3 .   ? 66.792  55.817 47.506 1.00 43.14  ? 228 HOH C O   1 
HETATM 5563 O  O   . HOH M 3 .   ? 66.194  71.904 63.651 1.00 29.03  ? 229 HOH C O   1 
HETATM 5564 O  O   . HOH M 3 .   ? 70.547  65.023 74.401 1.00 31.66  ? 230 HOH C O   1 
HETATM 5565 O  O   . HOH M 3 .   ? 57.110  55.198 61.601 1.00 42.03  ? 231 HOH C O   1 
HETATM 5566 O  O   . HOH M 3 .   ? 62.050  63.970 55.995 1.00 49.63  ? 232 HOH C O   1 
HETATM 5567 O  O   . HOH M 3 .   ? 65.783  69.451 71.748 1.00 43.97  ? 233 HOH C O   1 
HETATM 5568 O  O   . HOH M 3 .   ? 74.172  54.287 44.555 1.00 39.19  ? 234 HOH C O   1 
HETATM 5569 O  O   . HOH M 3 .   ? 77.592  70.875 46.516 1.00 24.54  ? 235 HOH C O   1 
HETATM 5570 O  O   . HOH M 3 .   ? 74.103  80.935 68.786 1.00 43.85  ? 236 HOH C O   1 
HETATM 5571 O  O   . HOH M 3 .   ? 93.215  70.843 61.154 1.00 29.72  ? 237 HOH C O   1 
HETATM 5572 O  O   . HOH M 3 .   ? 90.850  61.930 56.237 1.00 42.48  ? 238 HOH C O   1 
HETATM 5573 O  O   . HOH M 3 .   ? 69.399  45.635 52.558 1.00 38.02  ? 239 HOH C O   1 
HETATM 5574 O  O   . HOH M 3 .   ? 62.790  72.665 60.773 1.00 40.08  ? 240 HOH C O   1 
HETATM 5575 O  O   . HOH M 3 .   ? 65.762  71.724 56.409 1.00 19.37  ? 241 HOH C O   1 
HETATM 5576 O  O   . HOH M 3 .   ? 82.401  59.434 50.679 1.00 37.99  ? 242 HOH C O   1 
HETATM 5577 O  O   . HOH M 3 .   ? 79.194  77.749 68.498 1.00 20.66  ? 243 HOH C O   1 
HETATM 5578 O  O   . HOH M 3 .   ? 65.589  44.215 52.515 1.00 43.60  ? 244 HOH C O   1 
HETATM 5579 O  O   . HOH M 3 .   ? 70.367  63.346 42.729 1.00 32.21  ? 245 HOH C O   1 
HETATM 5580 O  O   . HOH M 3 .   ? 81.534  78.222 67.473 1.00 55.77  ? 246 HOH C O   1 
HETATM 5581 O  O   . HOH M 3 .   ? 87.888  74.042 46.432 1.00 49.04  ? 247 HOH C O   1 
HETATM 5582 O  O   . HOH M 3 .   ? 68.791  41.028 56.947 1.00 51.62  ? 248 HOH C O   1 
HETATM 5583 O  O   . HOH M 3 .   ? 82.163  78.703 64.700 1.00 39.64  ? 249 HOH C O   1 
HETATM 5584 O  O   . HOH M 3 .   ? 72.550  61.412 68.023 1.00 33.55  ? 250 HOH C O   1 
HETATM 5585 O  O   . HOH M 3 .   ? 80.769  68.551 67.346 1.00 24.91  ? 251 HOH C O   1 
HETATM 5586 O  O   . HOH M 3 .   ? 67.873  45.186 49.380 1.00 54.76  ? 252 HOH C O   1 
HETATM 5587 O  O   . HOH M 3 .   ? 83.943  80.968 64.067 1.00 46.95  ? 253 HOH C O   1 
HETATM 5588 O  O   . HOH M 3 .   ? 75.113  77.962 46.534 1.00 38.45  ? 254 HOH C O   1 
HETATM 5589 O  O   . HOH M 3 .   ? 89.905  70.084 48.818 1.00 47.67  ? 255 HOH C O   1 
HETATM 5590 O  O   . HOH M 3 .   ? 77.931  59.737 71.055 1.00 33.27  ? 256 HOH C O   1 
HETATM 5591 O  O   . HOH M 3 .   ? 63.478  64.839 74.138 1.00 41.91  ? 257 HOH C O   1 
HETATM 5592 O  O   . HOH M 3 .   ? 63.100  71.160 67.885 1.00 51.85  ? 258 HOH C O   1 
HETATM 5593 O  O   . HOH M 3 .   ? 79.144  67.192 69.576 1.00 34.64  ? 259 HOH C O   1 
HETATM 5594 O  O   . HOH M 3 .   ? 60.359  72.227 48.508 1.00 48.93  ? 260 HOH C O   1 
HETATM 5595 O  O   . HOH M 3 .   ? 65.275  68.421 62.123 1.00 28.77  ? 261 HOH C O   1 
HETATM 5596 O  O   . HOH M 3 .   ? 54.508  50.810 56.139 1.00 45.56  ? 262 HOH C O   1 
HETATM 5597 O  O   . HOH M 3 .   ? 79.972  63.529 42.674 1.00 39.14  ? 263 HOH C O   1 
HETATM 5598 O  O   . HOH M 3 .   ? 61.369  64.789 65.138 1.00 37.26  ? 264 HOH C O   1 
HETATM 5599 O  O   . HOH M 3 .   ? 89.964  63.760 53.524 1.00 34.97  ? 265 HOH C O   1 
HETATM 5600 O  O   . HOH M 3 .   ? 63.036  60.321 74.435 1.00 50.68  ? 266 HOH C O   1 
HETATM 5601 O  O   . HOH M 3 .   ? 57.445  62.087 60.173 1.00 43.16  ? 267 HOH C O   1 
HETATM 5602 O  O   . HOH M 3 .   ? 75.876  68.301 41.795 1.00 37.70  ? 268 HOH C O   1 
HETATM 5603 O  O   . HOH M 3 .   ? 61.557  67.691 45.379 1.00 54.29  ? 269 HOH C O   1 
HETATM 5604 O  O   . HOH M 3 .   ? 65.696  74.928 52.437 1.00 38.53  ? 270 HOH C O   1 
HETATM 5605 O  O   . HOH M 3 .   ? 82.122  60.202 60.483 1.00 50.90  ? 271 HOH C O   1 
HETATM 5606 O  O   . HOH N 3 .   ? 88.578  56.739 50.032 1.00 50.48  ? 132 HOH G O   1 
HETATM 5607 O  O   . HOH O 3 .   ? 83.832  72.403 67.934 1.00 15.15  ? 206 HOH D O   1 
HETATM 5608 O  O   . HOH O 3 .   ? 88.483  53.602 87.657 1.00 21.51  ? 207 HOH D O   1 
HETATM 5609 O  O   . HOH O 3 .   ? 68.467  70.073 73.802 1.00 31.89  ? 208 HOH D O   1 
HETATM 5610 O  O   . HOH O 3 .   ? 89.708  62.048 66.358 1.00 26.41  ? 209 HOH D O   1 
HETATM 5611 O  O   . HOH O 3 .   ? 82.324  67.419 65.488 1.00 29.03  ? 210 HOH D O   1 
HETATM 5612 O  O   . HOH O 3 .   ? 97.995  69.206 70.910 1.00 38.45  ? 211 HOH D O   1 
HETATM 5613 O  O   . HOH O 3 .   ? 101.120 60.497 59.892 1.00 50.45  ? 212 HOH D O   1 
HETATM 5614 O  O   . HOH O 3 .   ? 81.657  58.445 82.685 1.00 35.04  ? 213 HOH D O   1 
HETATM 5615 O  O   . HOH O 3 .   ? 74.636  61.971 80.694 1.00 47.32  ? 214 HOH D O   1 
HETATM 5616 O  O   . HOH O 3 .   ? 93.161  45.056 81.132 1.00 31.11  ? 215 HOH D O   1 
HETATM 5617 O  O   . HOH O 3 .   ? 77.592  58.955 88.266 1.00 49.81  ? 216 HOH D O   1 
HETATM 5618 O  O   . HOH O 3 .   ? 107.589 56.939 79.843 1.00 27.40  ? 217 HOH D O   1 
HETATM 5619 O  O   . HOH O 3 .   ? 80.971  67.497 71.719 1.00 31.51  ? 218 HOH D O   1 
HETATM 5620 O  O   . HOH O 3 .   ? 79.048  78.282 71.151 1.00 59.87  ? 219 HOH D O   1 
HETATM 5621 O  O   . HOH O 3 .   ? 100.845 68.250 78.807 1.00 35.08  ? 220 HOH D O   1 
HETATM 5622 O  O   . HOH O 3 .   ? 98.640  60.594 60.155 1.00 58.17  ? 221 HOH D O   1 
HETATM 5623 O  O   . HOH O 3 .   ? 89.619  52.421 60.668 1.00 53.70  ? 222 HOH D O   1 
HETATM 5624 O  O   . HOH O 3 .   ? 100.238 65.110 78.516 1.00 37.41  ? 223 HOH D O   1 
HETATM 5625 O  O   . HOH O 3 .   ? 81.163  61.802 89.401 1.00 37.97  ? 224 HOH D O   1 
HETATM 5626 O  O   . HOH O 3 .   ? 103.737 54.825 72.931 1.00 52.06  ? 225 HOH D O   1 
HETATM 5627 O  O   . HOH O 3 .   ? 84.078  69.216 88.703 1.00 22.17  ? 226 HOH D O   1 
HETATM 5628 O  O   . HOH O 3 .   ? 98.704  73.002 74.569 1.00 33.49  ? 227 HOH D O   1 
HETATM 5629 O  O   . HOH O 3 .   ? 100.432 64.520 69.652 1.00 34.40  ? 228 HOH D O   1 
HETATM 5630 O  O   . HOH O 3 .   ? 74.906  58.666 73.304 1.00 68.63  ? 229 HOH D O   1 
HETATM 5631 O  O   . HOH O 3 .   ? 71.995  62.735 81.161 1.00 43.04  ? 230 HOH D O   1 
HETATM 5632 O  O   . HOH O 3 .   ? 78.427  83.407 69.623 1.00 60.93  ? 231 HOH D O   1 
HETATM 5633 O  O   . HOH O 3 .   ? 68.904  76.872 74.144 1.00 39.00  ? 232 HOH D O   1 
HETATM 5634 O  O   . HOH O 3 .   ? 87.268  82.190 66.394 1.00 56.76  ? 233 HOH D O   1 
HETATM 5635 O  O   . HOH O 3 .   ? 93.837  46.466 66.319 1.00 44.19  ? 234 HOH D O   1 
HETATM 5636 O  O   . HOH O 3 .   ? 71.823  69.069 85.207 1.00 71.90  ? 235 HOH D O   1 
HETATM 5637 O  O   . HOH O 3 .   ? 95.582  70.357 62.734 1.00 30.25  ? 236 HOH D O   1 
HETATM 5638 O  O   . HOH O 3 .   ? 96.170  68.252 72.434 1.00 27.08  ? 237 HOH D O   1 
HETATM 5639 O  O   . HOH O 3 .   ? 73.985  69.946 84.790 1.00 35.06  ? 238 HOH D O   1 
HETATM 5640 O  O   . HOH O 3 .   ? 78.484  60.242 81.526 1.00 36.15  ? 239 HOH D O   1 
HETATM 5641 O  O   . HOH O 3 .   ? 75.444  64.643 90.036 1.00 31.15  ? 240 HOH D O   1 
HETATM 5642 O  O   . HOH O 3 .   ? 95.017  54.568 86.749 1.00 45.05  ? 241 HOH D O   1 
HETATM 5643 O  O   . HOH O 3 .   ? 80.730  51.207 71.918 1.00 37.27  ? 242 HOH D O   1 
HETATM 5644 O  O   . HOH O 3 .   ? 102.666 64.751 68.344 1.00 47.42  ? 243 HOH D O   1 
HETATM 5645 O  O   . HOH O 3 .   ? 96.995  71.439 60.865 1.00 39.70  ? 244 HOH D O   1 
HETATM 5646 O  O   . HOH O 3 .   ? 91.122  76.510 72.089 1.00 42.27  ? 245 HOH D O   1 
HETATM 5647 O  O   . HOH O 3 .   ? 95.730  64.927 81.927 1.00 28.89  ? 246 HOH D O   1 
HETATM 5648 O  O   . HOH O 3 .   ? 92.508  78.257 62.849 1.00 43.25  ? 247 HOH D O   1 
HETATM 5649 O  O   . HOH O 3 .   ? 91.998  58.765 95.763 1.00 49.13  ? 248 HOH D O   1 
HETATM 5650 O  O   . HOH O 3 .   ? 92.606  63.516 62.637 1.00 42.42  ? 249 HOH D O   1 
HETATM 5651 O  O   . HOH O 3 .   ? 81.707  60.867 91.997 1.00 45.02  ? 250 HOH D O   1 
HETATM 5652 O  O   . HOH O 3 .   ? 98.434  65.123 81.138 1.00 40.13  ? 251 HOH D O   1 
HETATM 5653 O  O   . HOH O 3 .   ? 81.824  82.022 90.902 1.00 46.40  ? 252 HOH D O   1 
HETATM 5654 O  O   . HOH O 3 .   ? 102.081 68.556 81.245 1.00 41.47  ? 253 HOH D O   1 
HETATM 5655 O  O   . HOH P 3 .   ? 73.968  54.341 84.014 1.00 68.40  ? 43  HOH H O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   201 ?   ?   ?   A . n 
A 1 2   ALA 2   202 202 ALA ALA A . n 
A 1 3   MSE 3   203 203 MSE MSE A . n 
A 1 4   GLY 4   204 204 GLY GLY A . n 
A 1 5   SER 5   205 205 SER SER A . n 
A 1 6   MSE 6   1   1   MSE MSE A . n 
A 1 7   ALA 7   2   2   ALA ALA A . n 
A 1 8   GLU 8   3   3   GLU GLU A . n 
A 1 9   ALA 9   4   4   ALA ALA A . n 
A 1 10  GLU 10  5   5   GLU GLU A . n 
A 1 11  GLY 11  6   6   GLY GLY A . n 
A 1 12  GLU 12  7   7   GLU GLU A . n 
A 1 13  SER 13  8   8   SER SER A . n 
A 1 14  LEU 14  9   9   LEU LEU A . n 
A 1 15  GLU 15  10  10  GLU GLU A . n 
A 1 16  SER 16  11  11  SER SER A . n 
A 1 17  TRP 17  12  12  TRP TRP A . n 
A 1 18  LEU 18  13  13  LEU LEU A . n 
A 1 19  ASN 19  14  14  ASN ASN A . n 
A 1 20  LYS 20  15  15  LYS LYS A . n 
A 1 21  ALA 21  16  16  ALA ALA A . n 
A 1 22  THR 22  17  17  THR THR A . n 
A 1 23  ASN 23  18  18  ASN ASN A . n 
A 1 24  PRO 24  19  19  PRO PRO A . n 
A 1 25  SER 25  20  20  SER SER A . n 
A 1 26  ASN 26  21  21  ASN ASN A . n 
A 1 27  ARG 27  22  22  ARG ARG A . n 
A 1 28  GLN 28  23  23  GLN GLN A . n 
A 1 29  GLU 29  24  24  GLU GLU A . n 
A 1 30  ASP 30  25  25  ASP ASP A . n 
A 1 31  TRP 31  26  26  TRP TRP A . n 
A 1 32  GLU 32  27  27  GLU GLU A . n 
A 1 33  TYR 33  28  28  TYR TYR A . n 
A 1 34  ILE 34  29  29  ILE ILE A . n 
A 1 35  ILE 35  30  30  ILE ILE A . n 
A 1 36  GLY 36  31  31  GLY GLY A . n 
A 1 37  PHE 37  32  32  PHE PHE A . n 
A 1 38  CYS 38  33  33  CYS CYS A . n 
A 1 39  ASP 39  34  34  ASP ASP A . n 
A 1 40  GLN 40  35  35  GLN GLN A . n 
A 1 41  ILE 41  36  36  ILE ILE A . n 
A 1 42  ASN 42  37  37  ASN ASN A . n 
A 1 43  LYS 43  38  38  LYS LYS A . n 
A 1 44  GLU 44  39  39  GLU GLU A . n 
A 1 45  LEU 45  40  40  LEU LEU A . n 
A 1 46  GLU 46  41  41  GLU GLU A . n 
A 1 47  GLY 47  42  42  GLY GLY A . n 
A 1 48  PRO 48  43  43  PRO PRO A . n 
A 1 49  GLN 49  44  44  GLN GLN A . n 
A 1 50  ILE 50  45  45  ILE ILE A . n 
A 1 51  ALA 51  46  46  ALA ALA A . n 
A 1 52  VAL 52  47  47  VAL VAL A . n 
A 1 53  ARG 53  48  48  ARG ARG A . n 
A 1 54  LEU 54  49  49  LEU LEU A . n 
A 1 55  LEU 55  50  50  LEU LEU A . n 
A 1 56  ALA 56  51  51  ALA ALA A . n 
A 1 57  HIS 57  52  52  HIS HIS A . n 
A 1 58  LYS 58  53  53  LYS LYS A . n 
A 1 59  ILE 59  54  54  ILE ILE A . n 
A 1 60  GLN 60  55  55  GLN GLN A . n 
A 1 61  SER 61  56  56  SER SER A . n 
A 1 62  PRO 62  57  57  PRO PRO A . n 
A 1 63  GLN 63  58  58  GLN GLN A . n 
A 1 64  GLU 64  59  59  GLU GLU A . n 
A 1 65  TRP 65  60  60  TRP TRP A . n 
A 1 66  GLU 66  61  61  GLU GLU A . n 
A 1 67  ALA 67  62  62  ALA ALA A . n 
A 1 68  LEU 68  63  63  LEU LEU A . n 
A 1 69  GLN 69  64  64  GLN GLN A . n 
A 1 70  ALA 70  65  65  ALA ALA A . n 
A 1 71  LEU 71  66  66  LEU LEU A . n 
A 1 72  THR 72  67  67  THR THR A . n 
A 1 73  VAL 73  68  68  VAL VAL A . n 
A 1 74  LEU 74  69  69  LEU LEU A . n 
A 1 75  GLU 75  70  70  GLU GLU A . n 
A 1 76  ALA 76  71  71  ALA ALA A . n 
A 1 77  CYS 77  72  72  CYS CYS A . n 
A 1 78  MSE 78  73  73  MSE MSE A . n 
A 1 79  LYS 79  74  74  LYS LYS A . n 
A 1 80  ASN 80  75  75  ASN ASN A . n 
A 1 81  CYS 81  76  76  CYS CYS A . n 
A 1 82  GLY 82  77  77  GLY GLY A . n 
A 1 83  ARG 83  78  78  ARG ARG A . n 
A 1 84  ARG 84  79  79  ARG ARG A . n 
A 1 85  PHE 85  80  80  PHE PHE A . n 
A 1 86  HIS 86  81  81  HIS HIS A . n 
A 1 87  ASN 87  82  82  ASN ASN A . n 
A 1 88  GLU 88  83  83  GLU GLU A . n 
A 1 89  VAL 89  84  84  VAL VAL A . n 
A 1 90  GLY 90  85  85  GLY GLY A . n 
A 1 91  LYS 91  86  86  LYS LYS A . n 
A 1 92  PHE 92  87  87  PHE PHE A . n 
A 1 93  ARG 93  88  88  ARG ARG A . n 
A 1 94  PHE 94  89  89  PHE PHE A . n 
A 1 95  LEU 95  90  90  LEU LEU A . n 
A 1 96  ASN 96  91  91  ASN ASN A . n 
A 1 97  GLU 97  92  92  GLU GLU A . n 
A 1 98  LEU 98  93  93  LEU LEU A . n 
A 1 99  ILE 99  94  94  ILE ILE A . n 
A 1 100 LYS 100 95  95  LYS LYS A . n 
A 1 101 VAL 101 96  96  VAL VAL A . n 
A 1 102 VAL 102 97  97  VAL VAL A . n 
A 1 103 SER 103 98  98  SER SER A . n 
A 1 104 PRO 104 99  99  PRO PRO A . n 
A 1 105 LYS 105 100 100 LYS LYS A . n 
A 1 106 TYR 106 101 101 TYR TYR A . n 
A 1 107 LEU 107 102 102 LEU LEU A . n 
A 1 108 GLY 108 103 103 GLY GLY A . n 
A 1 109 ASP 109 104 104 ASP ASP A . n 
A 1 110 ARG 110 105 105 ARG ARG A . n 
A 1 111 VAL 111 106 106 VAL VAL A . n 
A 1 112 SER 112 107 107 SER SER A . n 
A 1 113 GLU 113 108 108 GLU GLU A . n 
A 1 114 LYS 114 109 109 LYS LYS A . n 
A 1 115 VAL 115 110 110 VAL VAL A . n 
A 1 116 LYS 116 111 111 LYS LYS A . n 
A 1 117 THR 117 112 112 THR THR A . n 
A 1 118 LYS 118 113 113 LYS LYS A . n 
A 1 119 VAL 119 114 114 VAL VAL A . n 
A 1 120 ILE 120 115 115 ILE ILE A . n 
A 1 121 GLU 121 116 116 GLU GLU A . n 
A 1 122 LEU 122 117 117 LEU LEU A . n 
A 1 123 LEU 123 118 118 LEU LEU A . n 
A 1 124 TYR 124 119 119 TYR TYR A . n 
A 1 125 SER 125 120 120 SER SER A . n 
A 1 126 TRP 126 121 121 TRP TRP A . n 
A 1 127 THR 127 122 122 THR THR A . n 
A 1 128 MSE 128 123 123 MSE MSE A . n 
A 1 129 ALA 129 124 124 ALA ALA A . n 
A 1 130 LEU 130 125 125 LEU LEU A . n 
A 1 131 PRO 131 126 126 PRO PRO A . n 
A 1 132 GLU 132 127 127 GLU GLU A . n 
A 1 133 GLU 133 128 128 GLU GLU A . n 
A 1 134 ALA 134 129 129 ALA ALA A . n 
A 1 135 LYS 135 130 130 LYS LYS A . n 
A 1 136 ILE 136 131 131 ILE ILE A . n 
A 1 137 LYS 137 132 132 LYS LYS A . n 
A 1 138 ASP 138 133 133 ASP ASP A . n 
A 1 139 ALA 139 134 134 ALA ALA A . n 
A 1 140 TYR 140 135 135 TYR TYR A . n 
A 1 141 HIS 141 136 136 HIS HIS A . n 
A 1 142 MSE 142 137 137 MSE MSE A . n 
A 1 143 LEU 143 138 138 LEU LEU A . n 
A 1 144 LYS 144 139 139 LYS LYS A . n 
A 1 145 ARG 145 140 140 ARG ARG A . n 
A 1 146 GLN 146 141 141 GLN GLN A . n 
A 1 147 GLY 147 142 142 GLY GLY A . n 
A 1 148 ILE 148 143 143 ILE ILE A . n 
A 1 149 VAL 149 144 144 VAL VAL A . n 
A 1 150 GLN 150 145 145 GLN GLN A . n 
A 1 151 SER 151 146 146 SER SER A . n 
A 1 152 ASP 152 147 147 ASP ASP A . n 
A 1 153 PRO 153 148 148 PRO PRO A . n 
A 1 154 PRO 154 149 149 PRO PRO A . n 
A 1 155 ILE 155 150 150 ILE ILE A . n 
A 1 156 PRO 156 151 151 PRO PRO A . n 
A 1 157 VAL 157 152 152 VAL VAL A . n 
A 1 158 ASP 158 153 153 ASP ASP A . n 
A 1 159 ARG 159 154 154 ARG ARG A . n 
A 1 160 THR 160 155 155 THR THR A . n 
A 1 161 LEU 161 156 156 LEU LEU A . n 
A 1 162 ILE 162 157 157 ILE ILE A . n 
A 1 163 PRO 163 158 ?   ?   ?   A . n 
A 1 164 SER 164 159 ?   ?   ?   A . n 
A 1 165 PRO 165 160 ?   ?   ?   A . n 
A 1 166 PRO 166 161 ?   ?   ?   A . n 
A 1 167 PRO 167 162 ?   ?   ?   A . n 
A 1 168 ARG 168 163 ?   ?   ?   A . n 
A 1 169 PRO 169 164 ?   ?   ?   A . n 
A 1 170 LYS 170 165 ?   ?   ?   A . n 
A 1 171 ASN 171 166 ?   ?   ?   A . n 
B 2 1   PHE 1   301 ?   ?   ?   E . n 
B 2 2   HIS 2   302 ?   ?   ?   E . n 
B 2 3   ASP 3   303 ?   ?   ?   E . n 
B 2 4   ASP 4   304 ?   ?   ?   E . n 
B 2 5   SER 5   305 305 SER SER E . n 
B 2 6   ASP 6   306 306 ASP ASP E . n 
B 2 7   GLU 7   307 307 GLU GLU E . n 
B 2 8   ASP 8   308 308 ASP ASP E . n 
B 2 9   LEU 9   309 309 LEU LEU E . n 
B 2 10  LEU 10  310 310 LEU LEU E . n 
B 2 11  HIS 11  311 311 HIS HIS E . n 
B 2 12  ILE 12  312 312 ILE ILE E . n 
C 1 1   GLY 1   201 ?   ?   ?   B . n 
C 1 2   ALA 2   202 ?   ?   ?   B . n 
C 1 3   MSE 3   203 203 MSE MSE B . n 
C 1 4   GLY 4   204 204 GLY GLY B . n 
C 1 5   SER 5   205 205 SER SER B . n 
C 1 6   MSE 6   1   1   MSE MSE B . n 
C 1 7   ALA 7   2   2   ALA ALA B . n 
C 1 8   GLU 8   3   3   GLU GLU B . n 
C 1 9   ALA 9   4   4   ALA ALA B . n 
C 1 10  GLU 10  5   5   GLU GLU B . n 
C 1 11  GLY 11  6   6   GLY GLY B . n 
C 1 12  GLU 12  7   7   GLU GLU B . n 
C 1 13  SER 13  8   8   SER SER B . n 
C 1 14  LEU 14  9   9   LEU LEU B . n 
C 1 15  GLU 15  10  10  GLU GLU B . n 
C 1 16  SER 16  11  11  SER SER B . n 
C 1 17  TRP 17  12  12  TRP TRP B . n 
C 1 18  LEU 18  13  13  LEU LEU B . n 
C 1 19  ASN 19  14  14  ASN ASN B . n 
C 1 20  LYS 20  15  15  LYS LYS B . n 
C 1 21  ALA 21  16  16  ALA ALA B . n 
C 1 22  THR 22  17  17  THR THR B . n 
C 1 23  ASN 23  18  18  ASN ASN B . n 
C 1 24  PRO 24  19  19  PRO PRO B . n 
C 1 25  SER 25  20  20  SER SER B . n 
C 1 26  ASN 26  21  21  ASN ASN B . n 
C 1 27  ARG 27  22  22  ARG ARG B . n 
C 1 28  GLN 28  23  23  GLN GLN B . n 
C 1 29  GLU 29  24  24  GLU GLU B . n 
C 1 30  ASP 30  25  25  ASP ASP B . n 
C 1 31  TRP 31  26  26  TRP TRP B . n 
C 1 32  GLU 32  27  27  GLU GLU B . n 
C 1 33  TYR 33  28  28  TYR TYR B . n 
C 1 34  ILE 34  29  29  ILE ILE B . n 
C 1 35  ILE 35  30  30  ILE ILE B . n 
C 1 36  GLY 36  31  31  GLY GLY B . n 
C 1 37  PHE 37  32  32  PHE PHE B . n 
C 1 38  CYS 38  33  33  CYS CYS B . n 
C 1 39  ASP 39  34  34  ASP ASP B . n 
C 1 40  GLN 40  35  35  GLN GLN B . n 
C 1 41  ILE 41  36  36  ILE ILE B . n 
C 1 42  ASN 42  37  37  ASN ASN B . n 
C 1 43  LYS 43  38  38  LYS LYS B . n 
C 1 44  GLU 44  39  39  GLU GLU B . n 
C 1 45  LEU 45  40  40  LEU LEU B . n 
C 1 46  GLU 46  41  41  GLU GLU B . n 
C 1 47  GLY 47  42  42  GLY GLY B . n 
C 1 48  PRO 48  43  43  PRO PRO B . n 
C 1 49  GLN 49  44  44  GLN GLN B . n 
C 1 50  ILE 50  45  45  ILE ILE B . n 
C 1 51  ALA 51  46  46  ALA ALA B . n 
C 1 52  VAL 52  47  47  VAL VAL B . n 
C 1 53  ARG 53  48  48  ARG ARG B . n 
C 1 54  LEU 54  49  49  LEU LEU B . n 
C 1 55  LEU 55  50  50  LEU LEU B . n 
C 1 56  ALA 56  51  51  ALA ALA B . n 
C 1 57  HIS 57  52  52  HIS HIS B . n 
C 1 58  LYS 58  53  53  LYS LYS B . n 
C 1 59  ILE 59  54  54  ILE ILE B . n 
C 1 60  GLN 60  55  55  GLN GLN B . n 
C 1 61  SER 61  56  56  SER SER B . n 
C 1 62  PRO 62  57  57  PRO PRO B . n 
C 1 63  GLN 63  58  58  GLN GLN B . n 
C 1 64  GLU 64  59  59  GLU GLU B . n 
C 1 65  TRP 65  60  60  TRP TRP B . n 
C 1 66  GLU 66  61  61  GLU GLU B . n 
C 1 67  ALA 67  62  62  ALA ALA B . n 
C 1 68  LEU 68  63  63  LEU LEU B . n 
C 1 69  GLN 69  64  64  GLN GLN B . n 
C 1 70  ALA 70  65  65  ALA ALA B . n 
C 1 71  LEU 71  66  66  LEU LEU B . n 
C 1 72  THR 72  67  67  THR THR B . n 
C 1 73  VAL 73  68  68  VAL VAL B . n 
C 1 74  LEU 74  69  69  LEU LEU B . n 
C 1 75  GLU 75  70  70  GLU GLU B . n 
C 1 76  ALA 76  71  71  ALA ALA B . n 
C 1 77  CYS 77  72  72  CYS CYS B . n 
C 1 78  MSE 78  73  73  MSE MSE B . n 
C 1 79  LYS 79  74  74  LYS LYS B . n 
C 1 80  ASN 80  75  75  ASN ASN B . n 
C 1 81  CYS 81  76  76  CYS CYS B . n 
C 1 82  GLY 82  77  77  GLY GLY B . n 
C 1 83  ARG 83  78  78  ARG ARG B . n 
C 1 84  ARG 84  79  79  ARG ARG B . n 
C 1 85  PHE 85  80  80  PHE PHE B . n 
C 1 86  HIS 86  81  81  HIS HIS B . n 
C 1 87  ASN 87  82  82  ASN ASN B . n 
C 1 88  GLU 88  83  83  GLU GLU B . n 
C 1 89  VAL 89  84  84  VAL VAL B . n 
C 1 90  GLY 90  85  85  GLY GLY B . n 
C 1 91  LYS 91  86  86  LYS LYS B . n 
C 1 92  PHE 92  87  87  PHE PHE B . n 
C 1 93  ARG 93  88  88  ARG ARG B . n 
C 1 94  PHE 94  89  89  PHE PHE B . n 
C 1 95  LEU 95  90  90  LEU LEU B . n 
C 1 96  ASN 96  91  91  ASN ASN B . n 
C 1 97  GLU 97  92  92  GLU GLU B . n 
C 1 98  LEU 98  93  93  LEU LEU B . n 
C 1 99  ILE 99  94  94  ILE ILE B . n 
C 1 100 LYS 100 95  95  LYS LYS B . n 
C 1 101 VAL 101 96  96  VAL VAL B . n 
C 1 102 VAL 102 97  97  VAL VAL B . n 
C 1 103 SER 103 98  98  SER SER B . n 
C 1 104 PRO 104 99  99  PRO PRO B . n 
C 1 105 LYS 105 100 100 LYS LYS B . n 
C 1 106 TYR 106 101 101 TYR TYR B . n 
C 1 107 LEU 107 102 102 LEU LEU B . n 
C 1 108 GLY 108 103 103 GLY GLY B . n 
C 1 109 ASP 109 104 104 ASP ASP B . n 
C 1 110 ARG 110 105 105 ARG ARG B . n 
C 1 111 VAL 111 106 106 VAL VAL B . n 
C 1 112 SER 112 107 107 SER SER B . n 
C 1 113 GLU 113 108 108 GLU GLU B . n 
C 1 114 LYS 114 109 109 LYS LYS B . n 
C 1 115 VAL 115 110 110 VAL VAL B . n 
C 1 116 LYS 116 111 111 LYS LYS B . n 
C 1 117 THR 117 112 112 THR THR B . n 
C 1 118 LYS 118 113 113 LYS LYS B . n 
C 1 119 VAL 119 114 114 VAL VAL B . n 
C 1 120 ILE 120 115 115 ILE ILE B . n 
C 1 121 GLU 121 116 116 GLU GLU B . n 
C 1 122 LEU 122 117 117 LEU LEU B . n 
C 1 123 LEU 123 118 118 LEU LEU B . n 
C 1 124 TYR 124 119 119 TYR TYR B . n 
C 1 125 SER 125 120 120 SER SER B . n 
C 1 126 TRP 126 121 121 TRP TRP B . n 
C 1 127 THR 127 122 122 THR THR B . n 
C 1 128 MSE 128 123 123 MSE MSE B . n 
C 1 129 ALA 129 124 124 ALA ALA B . n 
C 1 130 LEU 130 125 125 LEU LEU B . n 
C 1 131 PRO 131 126 126 PRO PRO B . n 
C 1 132 GLU 132 127 127 GLU GLU B . n 
C 1 133 GLU 133 128 128 GLU GLU B . n 
C 1 134 ALA 134 129 129 ALA ALA B . n 
C 1 135 LYS 135 130 130 LYS LYS B . n 
C 1 136 ILE 136 131 131 ILE ILE B . n 
C 1 137 LYS 137 132 132 LYS LYS B . n 
C 1 138 ASP 138 133 133 ASP ASP B . n 
C 1 139 ALA 139 134 134 ALA ALA B . n 
C 1 140 TYR 140 135 135 TYR TYR B . n 
C 1 141 HIS 141 136 136 HIS HIS B . n 
C 1 142 MSE 142 137 137 MSE MSE B . n 
C 1 143 LEU 143 138 138 LEU LEU B . n 
C 1 144 LYS 144 139 139 LYS LYS B . n 
C 1 145 ARG 145 140 140 ARG ARG B . n 
C 1 146 GLN 146 141 141 GLN GLN B . n 
C 1 147 GLY 147 142 142 GLY GLY B . n 
C 1 148 ILE 148 143 143 ILE ILE B . n 
C 1 149 VAL 149 144 144 VAL VAL B . n 
C 1 150 GLN 150 145 145 GLN GLN B . n 
C 1 151 SER 151 146 146 SER SER B . n 
C 1 152 ASP 152 147 147 ASP ASP B . n 
C 1 153 PRO 153 148 148 PRO PRO B . n 
C 1 154 PRO 154 149 149 PRO PRO B . n 
C 1 155 ILE 155 150 150 ILE ILE B . n 
C 1 156 PRO 156 151 151 PRO PRO B . n 
C 1 157 VAL 157 152 152 VAL VAL B . n 
C 1 158 ASP 158 153 153 ASP ASP B . n 
C 1 159 ARG 159 154 154 ARG ARG B . n 
C 1 160 THR 160 155 155 THR THR B . n 
C 1 161 LEU 161 156 156 LEU LEU B . n 
C 1 162 ILE 162 157 ?   ?   ?   B . n 
C 1 163 PRO 163 158 ?   ?   ?   B . n 
C 1 164 SER 164 159 ?   ?   ?   B . n 
C 1 165 PRO 165 160 ?   ?   ?   B . n 
C 1 166 PRO 166 161 ?   ?   ?   B . n 
C 1 167 PRO 167 162 ?   ?   ?   B . n 
C 1 168 ARG 168 163 ?   ?   ?   B . n 
C 1 169 PRO 169 164 ?   ?   ?   B . n 
C 1 170 LYS 170 165 ?   ?   ?   B . n 
C 1 171 ASN 171 166 ?   ?   ?   B . n 
D 2 1   PHE 1   301 ?   ?   ?   F . n 
D 2 2   HIS 2   302 ?   ?   ?   F . n 
D 2 3   ASP 3   303 ?   ?   ?   F . n 
D 2 4   ASP 4   304 ?   ?   ?   F . n 
D 2 5   SER 5   305 305 SER SER F . n 
D 2 6   ASP 6   306 306 ASP ASP F . n 
D 2 7   GLU 7   307 307 GLU GLU F . n 
D 2 8   ASP 8   308 308 ASP ASP F . n 
D 2 9   LEU 9   309 309 LEU LEU F . n 
D 2 10  LEU 10  310 310 LEU LEU F . n 
D 2 11  HIS 11  311 311 HIS HIS F . n 
D 2 12  ILE 12  312 312 ILE ILE F . n 
E 1 1   GLY 1   201 ?   ?   ?   C . n 
E 1 2   ALA 2   202 ?   ?   ?   C . n 
E 1 3   MSE 3   203 203 MSE MSE C . n 
E 1 4   GLY 4   204 204 GLY GLY C . n 
E 1 5   SER 5   205 205 SER SER C . n 
E 1 6   MSE 6   1   1   MSE MSE C . n 
E 1 7   ALA 7   2   2   ALA ALA C . n 
E 1 8   GLU 8   3   3   GLU GLU C . n 
E 1 9   ALA 9   4   4   ALA ALA C . n 
E 1 10  GLU 10  5   5   GLU GLU C . n 
E 1 11  GLY 11  6   6   GLY GLY C . n 
E 1 12  GLU 12  7   7   GLU GLU C . n 
E 1 13  SER 13  8   8   SER SER C . n 
E 1 14  LEU 14  9   9   LEU LEU C . n 
E 1 15  GLU 15  10  10  GLU GLU C . n 
E 1 16  SER 16  11  11  SER SER C . n 
E 1 17  TRP 17  12  12  TRP TRP C . n 
E 1 18  LEU 18  13  13  LEU LEU C . n 
E 1 19  ASN 19  14  14  ASN ASN C . n 
E 1 20  LYS 20  15  15  LYS LYS C . n 
E 1 21  ALA 21  16  16  ALA ALA C . n 
E 1 22  THR 22  17  17  THR THR C . n 
E 1 23  ASN 23  18  18  ASN ASN C . n 
E 1 24  PRO 24  19  19  PRO PRO C . n 
E 1 25  SER 25  20  20  SER SER C . n 
E 1 26  ASN 26  21  21  ASN ASN C . n 
E 1 27  ARG 27  22  22  ARG ARG C . n 
E 1 28  GLN 28  23  23  GLN GLN C . n 
E 1 29  GLU 29  24  24  GLU GLU C . n 
E 1 30  ASP 30  25  25  ASP ASP C . n 
E 1 31  TRP 31  26  26  TRP TRP C . n 
E 1 32  GLU 32  27  27  GLU GLU C . n 
E 1 33  TYR 33  28  28  TYR TYR C . n 
E 1 34  ILE 34  29  29  ILE ILE C . n 
E 1 35  ILE 35  30  30  ILE ILE C . n 
E 1 36  GLY 36  31  31  GLY GLY C . n 
E 1 37  PHE 37  32  32  PHE PHE C . n 
E 1 38  CYS 38  33  33  CYS CYS C . n 
E 1 39  ASP 39  34  34  ASP ASP C . n 
E 1 40  GLN 40  35  35  GLN GLN C . n 
E 1 41  ILE 41  36  36  ILE ILE C . n 
E 1 42  ASN 42  37  37  ASN ASN C . n 
E 1 43  LYS 43  38  38  LYS LYS C . n 
E 1 44  GLU 44  39  39  GLU GLU C . n 
E 1 45  LEU 45  40  40  LEU LEU C . n 
E 1 46  GLU 46  41  41  GLU GLU C . n 
E 1 47  GLY 47  42  42  GLY GLY C . n 
E 1 48  PRO 48  43  43  PRO PRO C . n 
E 1 49  GLN 49  44  44  GLN GLN C . n 
E 1 50  ILE 50  45  45  ILE ILE C . n 
E 1 51  ALA 51  46  46  ALA ALA C . n 
E 1 52  VAL 52  47  47  VAL VAL C . n 
E 1 53  ARG 53  48  48  ARG ARG C . n 
E 1 54  LEU 54  49  49  LEU LEU C . n 
E 1 55  LEU 55  50  50  LEU LEU C . n 
E 1 56  ALA 56  51  51  ALA ALA C . n 
E 1 57  HIS 57  52  52  HIS HIS C . n 
E 1 58  LYS 58  53  53  LYS LYS C . n 
E 1 59  ILE 59  54  54  ILE ILE C . n 
E 1 60  GLN 60  55  55  GLN GLN C . n 
E 1 61  SER 61  56  56  SER SER C . n 
E 1 62  PRO 62  57  57  PRO PRO C . n 
E 1 63  GLN 63  58  58  GLN GLN C . n 
E 1 64  GLU 64  59  59  GLU GLU C . n 
E 1 65  TRP 65  60  60  TRP TRP C . n 
E 1 66  GLU 66  61  61  GLU GLU C . n 
E 1 67  ALA 67  62  62  ALA ALA C . n 
E 1 68  LEU 68  63  63  LEU LEU C . n 
E 1 69  GLN 69  64  64  GLN GLN C . n 
E 1 70  ALA 70  65  65  ALA ALA C . n 
E 1 71  LEU 71  66  66  LEU LEU C . n 
E 1 72  THR 72  67  67  THR THR C . n 
E 1 73  VAL 73  68  68  VAL VAL C . n 
E 1 74  LEU 74  69  69  LEU LEU C . n 
E 1 75  GLU 75  70  70  GLU GLU C . n 
E 1 76  ALA 76  71  71  ALA ALA C . n 
E 1 77  CYS 77  72  72  CYS CYS C . n 
E 1 78  MSE 78  73  73  MSE MSE C . n 
E 1 79  LYS 79  74  74  LYS LYS C . n 
E 1 80  ASN 80  75  75  ASN ASN C . n 
E 1 81  CYS 81  76  76  CYS CYS C . n 
E 1 82  GLY 82  77  77  GLY GLY C . n 
E 1 83  ARG 83  78  78  ARG ARG C . n 
E 1 84  ARG 84  79  79  ARG ARG C . n 
E 1 85  PHE 85  80  80  PHE PHE C . n 
E 1 86  HIS 86  81  81  HIS HIS C . n 
E 1 87  ASN 87  82  82  ASN ASN C . n 
E 1 88  GLU 88  83  83  GLU GLU C . n 
E 1 89  VAL 89  84  84  VAL VAL C . n 
E 1 90  GLY 90  85  85  GLY GLY C . n 
E 1 91  LYS 91  86  86  LYS LYS C . n 
E 1 92  PHE 92  87  87  PHE PHE C . n 
E 1 93  ARG 93  88  88  ARG ARG C . n 
E 1 94  PHE 94  89  89  PHE PHE C . n 
E 1 95  LEU 95  90  90  LEU LEU C . n 
E 1 96  ASN 96  91  91  ASN ASN C . n 
E 1 97  GLU 97  92  92  GLU GLU C . n 
E 1 98  LEU 98  93  93  LEU LEU C . n 
E 1 99  ILE 99  94  94  ILE ILE C . n 
E 1 100 LYS 100 95  95  LYS LYS C . n 
E 1 101 VAL 101 96  96  VAL VAL C . n 
E 1 102 VAL 102 97  97  VAL VAL C . n 
E 1 103 SER 103 98  98  SER SER C . n 
E 1 104 PRO 104 99  99  PRO PRO C . n 
E 1 105 LYS 105 100 100 LYS LYS C . n 
E 1 106 TYR 106 101 101 TYR TYR C . n 
E 1 107 LEU 107 102 102 LEU LEU C . n 
E 1 108 GLY 108 103 103 GLY GLY C . n 
E 1 109 ASP 109 104 104 ASP ASP C . n 
E 1 110 ARG 110 105 105 ARG ARG C . n 
E 1 111 VAL 111 106 106 VAL VAL C . n 
E 1 112 SER 112 107 107 SER SER C . n 
E 1 113 GLU 113 108 108 GLU GLU C . n 
E 1 114 LYS 114 109 109 LYS LYS C . n 
E 1 115 VAL 115 110 110 VAL VAL C . n 
E 1 116 LYS 116 111 111 LYS LYS C . n 
E 1 117 THR 117 112 112 THR THR C . n 
E 1 118 LYS 118 113 113 LYS LYS C . n 
E 1 119 VAL 119 114 114 VAL VAL C . n 
E 1 120 ILE 120 115 115 ILE ILE C . n 
E 1 121 GLU 121 116 116 GLU GLU C . n 
E 1 122 LEU 122 117 117 LEU LEU C . n 
E 1 123 LEU 123 118 118 LEU LEU C . n 
E 1 124 TYR 124 119 119 TYR TYR C . n 
E 1 125 SER 125 120 120 SER SER C . n 
E 1 126 TRP 126 121 121 TRP TRP C . n 
E 1 127 THR 127 122 122 THR THR C . n 
E 1 128 MSE 128 123 123 MSE MSE C . n 
E 1 129 ALA 129 124 124 ALA ALA C . n 
E 1 130 LEU 130 125 125 LEU LEU C . n 
E 1 131 PRO 131 126 126 PRO PRO C . n 
E 1 132 GLU 132 127 127 GLU GLU C . n 
E 1 133 GLU 133 128 128 GLU GLU C . n 
E 1 134 ALA 134 129 129 ALA ALA C . n 
E 1 135 LYS 135 130 130 LYS LYS C . n 
E 1 136 ILE 136 131 131 ILE ILE C . n 
E 1 137 LYS 137 132 132 LYS LYS C . n 
E 1 138 ASP 138 133 133 ASP ASP C . n 
E 1 139 ALA 139 134 134 ALA ALA C . n 
E 1 140 TYR 140 135 135 TYR TYR C . n 
E 1 141 HIS 141 136 136 HIS HIS C . n 
E 1 142 MSE 142 137 137 MSE MSE C . n 
E 1 143 LEU 143 138 138 LEU LEU C . n 
E 1 144 LYS 144 139 139 LYS LYS C . n 
E 1 145 ARG 145 140 140 ARG ARG C . n 
E 1 146 GLN 146 141 141 GLN GLN C . n 
E 1 147 GLY 147 142 142 GLY GLY C . n 
E 1 148 ILE 148 143 143 ILE ILE C . n 
E 1 149 VAL 149 144 144 VAL VAL C . n 
E 1 150 GLN 150 145 145 GLN GLN C . n 
E 1 151 SER 151 146 146 SER SER C . n 
E 1 152 ASP 152 147 147 ASP ASP C . n 
E 1 153 PRO 153 148 148 PRO PRO C . n 
E 1 154 PRO 154 149 149 PRO PRO C . n 
E 1 155 ILE 155 150 150 ILE ILE C . n 
E 1 156 PRO 156 151 151 PRO PRO C . n 
E 1 157 VAL 157 152 152 VAL VAL C . n 
E 1 158 ASP 158 153 153 ASP ASP C . n 
E 1 159 ARG 159 154 154 ARG ARG C . n 
E 1 160 THR 160 155 155 THR THR C . n 
E 1 161 LEU 161 156 156 LEU LEU C . n 
E 1 162 ILE 162 157 ?   ?   ?   C . n 
E 1 163 PRO 163 158 ?   ?   ?   C . n 
E 1 164 SER 164 159 ?   ?   ?   C . n 
E 1 165 PRO 165 160 ?   ?   ?   C . n 
E 1 166 PRO 166 161 ?   ?   ?   C . n 
E 1 167 PRO 167 162 ?   ?   ?   C . n 
E 1 168 ARG 168 163 ?   ?   ?   C . n 
E 1 169 PRO 169 164 ?   ?   ?   C . n 
E 1 170 LYS 170 165 ?   ?   ?   C . n 
E 1 171 ASN 171 166 ?   ?   ?   C . n 
F 2 1   PHE 1   301 ?   ?   ?   G . n 
F 2 2   HIS 2   302 ?   ?   ?   G . n 
F 2 3   ASP 3   303 ?   ?   ?   G . n 
F 2 4   ASP 4   304 ?   ?   ?   G . n 
F 2 5   SER 5   305 305 SER SER G . n 
F 2 6   ASP 6   306 306 ASP ASP G . n 
F 2 7   GLU 7   307 307 GLU GLU G . n 
F 2 8   ASP 8   308 308 ASP ASP G . n 
F 2 9   LEU 9   309 309 LEU LEU G . n 
F 2 10  LEU 10  310 310 LEU LEU G . n 
F 2 11  HIS 11  311 311 HIS HIS G . n 
F 2 12  ILE 12  312 312 ILE ILE G . n 
G 1 1   GLY 1   201 ?   ?   ?   D . n 
G 1 2   ALA 2   202 202 ALA ALA D . n 
G 1 3   MSE 3   203 203 MSE MSE D . n 
G 1 4   GLY 4   204 204 GLY GLY D . n 
G 1 5   SER 5   205 205 SER SER D . n 
G 1 6   MSE 6   1   1   MSE MSE D . n 
G 1 7   ALA 7   2   2   ALA ALA D . n 
G 1 8   GLU 8   3   3   GLU GLU D . n 
G 1 9   ALA 9   4   4   ALA ALA D . n 
G 1 10  GLU 10  5   5   GLU GLU D . n 
G 1 11  GLY 11  6   6   GLY GLY D . n 
G 1 12  GLU 12  7   7   GLU GLU D . n 
G 1 13  SER 13  8   8   SER SER D . n 
G 1 14  LEU 14  9   9   LEU LEU D . n 
G 1 15  GLU 15  10  10  GLU GLU D . n 
G 1 16  SER 16  11  11  SER SER D . n 
G 1 17  TRP 17  12  12  TRP TRP D . n 
G 1 18  LEU 18  13  13  LEU LEU D . n 
G 1 19  ASN 19  14  14  ASN ASN D . n 
G 1 20  LYS 20  15  15  LYS LYS D . n 
G 1 21  ALA 21  16  16  ALA ALA D . n 
G 1 22  THR 22  17  17  THR THR D . n 
G 1 23  ASN 23  18  18  ASN ASN D . n 
G 1 24  PRO 24  19  19  PRO PRO D . n 
G 1 25  SER 25  20  20  SER SER D . n 
G 1 26  ASN 26  21  21  ASN ASN D . n 
G 1 27  ARG 27  22  22  ARG ARG D . n 
G 1 28  GLN 28  23  23  GLN GLN D . n 
G 1 29  GLU 29  24  24  GLU GLU D . n 
G 1 30  ASP 30  25  25  ASP ASP D . n 
G 1 31  TRP 31  26  26  TRP TRP D . n 
G 1 32  GLU 32  27  27  GLU GLU D . n 
G 1 33  TYR 33  28  28  TYR TYR D . n 
G 1 34  ILE 34  29  29  ILE ILE D . n 
G 1 35  ILE 35  30  30  ILE ILE D . n 
G 1 36  GLY 36  31  31  GLY GLY D . n 
G 1 37  PHE 37  32  32  PHE PHE D . n 
G 1 38  CYS 38  33  33  CYS CYS D . n 
G 1 39  ASP 39  34  34  ASP ASP D . n 
G 1 40  GLN 40  35  35  GLN GLN D . n 
G 1 41  ILE 41  36  36  ILE ILE D . n 
G 1 42  ASN 42  37  37  ASN ASN D . n 
G 1 43  LYS 43  38  38  LYS LYS D . n 
G 1 44  GLU 44  39  39  GLU GLU D . n 
G 1 45  LEU 45  40  40  LEU LEU D . n 
G 1 46  GLU 46  41  41  GLU GLU D . n 
G 1 47  GLY 47  42  42  GLY GLY D . n 
G 1 48  PRO 48  43  43  PRO PRO D . n 
G 1 49  GLN 49  44  44  GLN GLN D . n 
G 1 50  ILE 50  45  45  ILE ILE D . n 
G 1 51  ALA 51  46  46  ALA ALA D . n 
G 1 52  VAL 52  47  47  VAL VAL D . n 
G 1 53  ARG 53  48  48  ARG ARG D . n 
G 1 54  LEU 54  49  49  LEU LEU D . n 
G 1 55  LEU 55  50  50  LEU LEU D . n 
G 1 56  ALA 56  51  51  ALA ALA D . n 
G 1 57  HIS 57  52  52  HIS HIS D . n 
G 1 58  LYS 58  53  53  LYS LYS D . n 
G 1 59  ILE 59  54  54  ILE ILE D . n 
G 1 60  GLN 60  55  55  GLN GLN D . n 
G 1 61  SER 61  56  56  SER SER D . n 
G 1 62  PRO 62  57  57  PRO PRO D . n 
G 1 63  GLN 63  58  58  GLN GLN D . n 
G 1 64  GLU 64  59  59  GLU GLU D . n 
G 1 65  TRP 65  60  60  TRP TRP D . n 
G 1 66  GLU 66  61  61  GLU GLU D . n 
G 1 67  ALA 67  62  62  ALA ALA D . n 
G 1 68  LEU 68  63  63  LEU LEU D . n 
G 1 69  GLN 69  64  64  GLN GLN D . n 
G 1 70  ALA 70  65  65  ALA ALA D . n 
G 1 71  LEU 71  66  66  LEU LEU D . n 
G 1 72  THR 72  67  67  THR THR D . n 
G 1 73  VAL 73  68  68  VAL VAL D . n 
G 1 74  LEU 74  69  69  LEU LEU D . n 
G 1 75  GLU 75  70  70  GLU GLU D . n 
G 1 76  ALA 76  71  71  ALA ALA D . n 
G 1 77  CYS 77  72  72  CYS CYS D . n 
G 1 78  MSE 78  73  73  MSE MSE D . n 
G 1 79  LYS 79  74  74  LYS LYS D . n 
G 1 80  ASN 80  75  75  ASN ASN D . n 
G 1 81  CYS 81  76  76  CYS CYS D . n 
G 1 82  GLY 82  77  77  GLY GLY D . n 
G 1 83  ARG 83  78  78  ARG ARG D . n 
G 1 84  ARG 84  79  79  ARG ARG D . n 
G 1 85  PHE 85  80  80  PHE PHE D . n 
G 1 86  HIS 86  81  81  HIS HIS D . n 
G 1 87  ASN 87  82  82  ASN ASN D . n 
G 1 88  GLU 88  83  83  GLU GLU D . n 
G 1 89  VAL 89  84  84  VAL VAL D . n 
G 1 90  GLY 90  85  85  GLY GLY D . n 
G 1 91  LYS 91  86  86  LYS LYS D . n 
G 1 92  PHE 92  87  87  PHE PHE D . n 
G 1 93  ARG 93  88  88  ARG ARG D . n 
G 1 94  PHE 94  89  89  PHE PHE D . n 
G 1 95  LEU 95  90  90  LEU LEU D . n 
G 1 96  ASN 96  91  91  ASN ASN D . n 
G 1 97  GLU 97  92  92  GLU GLU D . n 
G 1 98  LEU 98  93  93  LEU LEU D . n 
G 1 99  ILE 99  94  94  ILE ILE D . n 
G 1 100 LYS 100 95  95  LYS LYS D . n 
G 1 101 VAL 101 96  96  VAL VAL D . n 
G 1 102 VAL 102 97  97  VAL VAL D . n 
G 1 103 SER 103 98  98  SER SER D . n 
G 1 104 PRO 104 99  99  PRO PRO D . n 
G 1 105 LYS 105 100 100 LYS LYS D . n 
G 1 106 TYR 106 101 101 TYR TYR D . n 
G 1 107 LEU 107 102 102 LEU LEU D . n 
G 1 108 GLY 108 103 103 GLY GLY D . n 
G 1 109 ASP 109 104 104 ASP ASP D . n 
G 1 110 ARG 110 105 105 ARG ARG D . n 
G 1 111 VAL 111 106 106 VAL VAL D . n 
G 1 112 SER 112 107 107 SER SER D . n 
G 1 113 GLU 113 108 108 GLU GLU D . n 
G 1 114 LYS 114 109 109 LYS LYS D . n 
G 1 115 VAL 115 110 110 VAL VAL D . n 
G 1 116 LYS 116 111 111 LYS LYS D . n 
G 1 117 THR 117 112 112 THR THR D . n 
G 1 118 LYS 118 113 113 LYS LYS D . n 
G 1 119 VAL 119 114 114 VAL VAL D . n 
G 1 120 ILE 120 115 115 ILE ILE D . n 
G 1 121 GLU 121 116 116 GLU GLU D . n 
G 1 122 LEU 122 117 117 LEU LEU D . n 
G 1 123 LEU 123 118 118 LEU LEU D . n 
G 1 124 TYR 124 119 119 TYR TYR D . n 
G 1 125 SER 125 120 120 SER SER D . n 
G 1 126 TRP 126 121 121 TRP TRP D . n 
G 1 127 THR 127 122 122 THR THR D . n 
G 1 128 MSE 128 123 123 MSE MSE D . n 
G 1 129 ALA 129 124 124 ALA ALA D . n 
G 1 130 LEU 130 125 125 LEU LEU D . n 
G 1 131 PRO 131 126 126 PRO PRO D . n 
G 1 132 GLU 132 127 127 GLU GLU D . n 
G 1 133 GLU 133 128 128 GLU GLU D . n 
G 1 134 ALA 134 129 129 ALA ALA D . n 
G 1 135 LYS 135 130 130 LYS LYS D . n 
G 1 136 ILE 136 131 131 ILE ILE D . n 
G 1 137 LYS 137 132 132 LYS LYS D . n 
G 1 138 ASP 138 133 133 ASP ASP D . n 
G 1 139 ALA 139 134 134 ALA ALA D . n 
G 1 140 TYR 140 135 135 TYR TYR D . n 
G 1 141 HIS 141 136 136 HIS HIS D . n 
G 1 142 MSE 142 137 137 MSE MSE D . n 
G 1 143 LEU 143 138 138 LEU LEU D . n 
G 1 144 LYS 144 139 139 LYS LYS D . n 
G 1 145 ARG 145 140 140 ARG ARG D . n 
G 1 146 GLN 146 141 141 GLN GLN D . n 
G 1 147 GLY 147 142 142 GLY GLY D . n 
G 1 148 ILE 148 143 143 ILE ILE D . n 
G 1 149 VAL 149 144 144 VAL VAL D . n 
G 1 150 GLN 150 145 145 GLN GLN D . n 
G 1 151 SER 151 146 146 SER SER D . n 
G 1 152 ASP 152 147 147 ASP ASP D . n 
G 1 153 PRO 153 148 148 PRO PRO D . n 
G 1 154 PRO 154 149 149 PRO PRO D . n 
G 1 155 ILE 155 150 150 ILE ILE D . n 
G 1 156 PRO 156 151 151 PRO PRO D . n 
G 1 157 VAL 157 152 152 VAL VAL D . n 
G 1 158 ASP 158 153 153 ASP ASP D . n 
G 1 159 ARG 159 154 154 ARG ARG D . n 
G 1 160 THR 160 155 155 THR THR D . n 
G 1 161 LEU 161 156 156 LEU LEU D . n 
G 1 162 ILE 162 157 157 ILE ILE D . n 
G 1 163 PRO 163 158 ?   ?   ?   D . n 
G 1 164 SER 164 159 ?   ?   ?   D . n 
G 1 165 PRO 165 160 ?   ?   ?   D . n 
G 1 166 PRO 166 161 ?   ?   ?   D . n 
G 1 167 PRO 167 162 ?   ?   ?   D . n 
G 1 168 ARG 168 163 ?   ?   ?   D . n 
G 1 169 PRO 169 164 ?   ?   ?   D . n 
G 1 170 LYS 170 165 ?   ?   ?   D . n 
G 1 171 ASN 171 166 ?   ?   ?   D . n 
H 2 1   PHE 1   301 ?   ?   ?   H . n 
H 2 2   HIS 2   302 ?   ?   ?   H . n 
H 2 3   ASP 3   303 ?   ?   ?   H . n 
H 2 4   ASP 4   304 304 ASP ASP H . n 
H 2 5   SER 5   305 305 SER SER H . n 
H 2 6   ASP 6   306 306 ASP ASP H . n 
H 2 7   GLU 7   307 307 GLU GLU H . n 
H 2 8   ASP 8   308 308 ASP ASP H . n 
H 2 9   LEU 9   309 309 LEU LEU H . n 
H 2 10  LEU 10  310 310 LEU LEU H . n 
H 2 11  HIS 11  311 311 HIS HIS H . n 
H 2 12  ILE 12  312 312 ILE ILE H . n 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1  A MSE 3   A MSE 203 ? MET SELENOMETHIONINE 
2  A MSE 6   A MSE 1   ? MET SELENOMETHIONINE 
3  A MSE 78  A MSE 73  ? MET SELENOMETHIONINE 
4  A MSE 128 A MSE 123 ? MET SELENOMETHIONINE 
5  A MSE 142 A MSE 137 ? MET SELENOMETHIONINE 
6  C MSE 3   B MSE 203 ? MET SELENOMETHIONINE 
7  C MSE 6   B MSE 1   ? MET SELENOMETHIONINE 
8  C MSE 78  B MSE 73  ? MET SELENOMETHIONINE 
9  C MSE 128 B MSE 123 ? MET SELENOMETHIONINE 
10 C MSE 142 B MSE 137 ? MET SELENOMETHIONINE 
11 E MSE 3   C MSE 203 ? MET SELENOMETHIONINE 
12 E MSE 6   C MSE 1   ? MET SELENOMETHIONINE 
13 E MSE 78  C MSE 73  ? MET SELENOMETHIONINE 
14 E MSE 128 C MSE 123 ? MET SELENOMETHIONINE 
15 E MSE 142 C MSE 137 ? MET SELENOMETHIONINE 
16 G MSE 3   D MSE 203 ? MET SELENOMETHIONINE 
17 G MSE 6   D MSE 1   ? MET SELENOMETHIONINE 
18 G MSE 78  D MSE 73  ? MET SELENOMETHIONINE 
19 G MSE 128 D MSE 123 ? MET SELENOMETHIONINE 
20 G MSE 142 D MSE 137 ? MET SELENOMETHIONINE 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1  author_and_software_defined_assembly PISA dimeric    2 
2  author_and_software_defined_assembly PISA dimeric    2 
3  author_and_software_defined_assembly PISA dimeric    2 
4  author_and_software_defined_assembly PISA dimeric    2 
5  software_defined_assembly            PISA octameric  8 
6  software_defined_assembly            PISA octameric  8 
7  software_defined_assembly            PISA octameric  8 
8  software_defined_assembly            PISA octameric  8 
9  software_defined_assembly            PISA tetrameric 4 
10 software_defined_assembly            PISA tetrameric 4 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1  1 A,B,I,J         
2  1 C,D,K,L         
3  1 E,F,M,N         
4  1 G,H,O,P         
5  1 A,B,C,D,I,J,K,L 
5  2 E,F,G,H,M,N,O,P 
6  1 A,B,C,D,I,J,K,L 
6  3 E,F,G,H,M,N,O,P 
7  1 A,B,C,D,I,J,K,L 
7  4 E,F,G,H,M,N,O,P 
8  1 A,B,C,D,I,J,K,L 
8  5 E,F,G,H,M,N,O,P 
9  1 E,F,G,H,M,N,O,P 
10 1 A,B,C,D,I,J,K,L 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1  'ABSA (A^2)' 1080  ? 
1  MORE         -5    ? 
1  'SSA (A^2)'  9010  ? 
2  'ABSA (A^2)' 1100  ? 
2  MORE         -5    ? 
2  'SSA (A^2)'  8890  ? 
3  'ABSA (A^2)' 1060  ? 
3  MORE         -6    ? 
3  'SSA (A^2)'  9090  ? 
4  'ABSA (A^2)' 1070  ? 
4  MORE         -7    ? 
4  'SSA (A^2)'  9050  ? 
5  'ABSA (A^2)' 10380 ? 
5  MORE         -48   ? 
5  'SSA (A^2)'  29980 ? 
6  'ABSA (A^2)' 9780  ? 
6  MORE         -46   ? 
6  'SSA (A^2)'  30570 ? 
7  'ABSA (A^2)' 9280  ? 
7  MORE         -45   ? 
7  'SSA (A^2)'  31070 ? 
8  'ABSA (A^2)' 9250  ? 
8  MORE         -44   ? 
8  'SSA (A^2)'  31100 ? 
9  'ABSA (A^2)' 4380  ? 
9  MORE         -22   ? 
9  'SSA (A^2)'  15890 ? 
10 'ABSA (A^2)' 4440  ? 
10 MORE         -21   ? 
10 'SSA (A^2)'  15640 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z             1.0000000000  0.0000000000 0.0000000000 0.0000000000   0.0000000000 
1.0000000000  0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 3_647 -x+3/2,y-1/2,-z+2 -1.0000000000 0.0000000000 0.0000000000 162.4500000000 0.0000000000 
1.0000000000  0.0000000000 -62.6500000000 0.0000000000 0.0000000000 -1.0000000000 129.2000000000 
3 'crystal symmetry operation' 2_665 -x+1,-y+1,z       -1.0000000000 0.0000000000 0.0000000000 108.3000000000 0.0000000000 
-1.0000000000 0.0000000000 125.3000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
4 'crystal symmetry operation' 4_457 x-1/2,-y+1/2,-z+2 1.0000000000  0.0000000000 0.0000000000 -54.1500000000 0.0000000000 
-1.0000000000 0.0000000000 62.6500000000  0.0000000000 0.0000000000 -1.0000000000 129.2000000000 
5 'crystal symmetry operation' 2_664 -x+1,-y+1,z-1     -1.0000000000 0.0000000000 0.0000000000 108.3000000000 0.0000000000 
-1.0000000000 0.0000000000 125.3000000000 0.0000000000 0.0000000000 1.0000000000  -64.6000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-02-27 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
SOLVE     phasing          .   ? 1 
RESOLVE   'model building' .   ? 2 
CNS       refinement       1.0 ? 3 
DENZO     'data reduction' .   ? 4 
SCALEPACK 'data scaling'   .   ? 5 
RESOLVE   phasing          .   ? 6 
# 
_pdbx_database_remark.id     300 
_pdbx_database_remark.text   
;BIOMOLECULE: 1, 2, 3, 4
THIS ENTRY CONTAINS THE CRYSTALLOGRAPHIC ASYMMETRIC UNIT
WHICH CONSISTS OF 8 CHAIN(S). SEE REMARK 350 FOR
INFORMATION ON GENERATING THE BIOLOGICAL MOLECULE(S).
The authors have gel filtration and analytical 
ultracentrifugation data that suggest that the asymmetric
unit contains 4 biological units 
(chains A/E, B/F, C/G, D/H).  The authors think the 
apparent dimer in the crystal is due to crystallization.
;
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   NE2 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   GLN 
_pdbx_validate_close_contact.auth_seq_id_1    58 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    206 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.15 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 TYR A 101 ? ? -126.79 -120.85 
2  1 LEU A 125 ? ? -116.48 73.02   
3  1 GLU A 128 ? ? -108.56 76.30   
4  1 ASP E 306 ? ? 174.48  146.57  
5  1 ASN B 21  ? ? -37.92  130.09  
6  1 TYR B 101 ? ? -131.93 -96.93  
7  1 ARG B 105 ? ? -169.92 -5.10   
8  1 GLN B 145 ? ? -64.12  -70.81  
9  1 THR B 155 ? ? -71.90  24.69   
10 1 ASP F 306 ? ? 172.64  135.98  
11 1 LYS C 100 ? ? -69.98  0.00    
12 1 TYR C 101 ? ? -133.84 -104.64 
13 1 MSE D 203 ? ? 87.66   -23.48  
14 1 TYR D 101 ? ? -126.59 -127.49 
15 1 LEU D 125 ? ? -119.28 68.80   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 201 ? A GLY 1   
2  1 Y 1 A PRO 158 ? A PRO 163 
3  1 Y 1 A SER 159 ? A SER 164 
4  1 Y 1 A PRO 160 ? A PRO 165 
5  1 Y 1 A PRO 161 ? A PRO 166 
6  1 Y 1 A PRO 162 ? A PRO 167 
7  1 Y 1 A ARG 163 ? A ARG 168 
8  1 Y 1 A PRO 164 ? A PRO 169 
9  1 Y 1 A LYS 165 ? A LYS 170 
10 1 Y 1 A ASN 166 ? A ASN 171 
11 1 Y 1 E PHE 301 ? B PHE 1   
12 1 Y 1 E HIS 302 ? B HIS 2   
13 1 Y 1 E ASP 303 ? B ASP 3   
14 1 Y 1 E ASP 304 ? B ASP 4   
15 1 Y 1 B GLY 201 ? C GLY 1   
16 1 Y 1 B ALA 202 ? C ALA 2   
17 1 Y 1 B ILE 157 ? C ILE 162 
18 1 Y 1 B PRO 158 ? C PRO 163 
19 1 Y 1 B SER 159 ? C SER 164 
20 1 Y 1 B PRO 160 ? C PRO 165 
21 1 Y 1 B PRO 161 ? C PRO 166 
22 1 Y 1 B PRO 162 ? C PRO 167 
23 1 Y 1 B ARG 163 ? C ARG 168 
24 1 Y 1 B PRO 164 ? C PRO 169 
25 1 Y 1 B LYS 165 ? C LYS 170 
26 1 Y 1 B ASN 166 ? C ASN 171 
27 1 Y 1 F PHE 301 ? D PHE 1   
28 1 Y 1 F HIS 302 ? D HIS 2   
29 1 Y 1 F ASP 303 ? D ASP 3   
30 1 Y 1 F ASP 304 ? D ASP 4   
31 1 Y 1 C GLY 201 ? E GLY 1   
32 1 Y 1 C ALA 202 ? E ALA 2   
33 1 Y 1 C ILE 157 ? E ILE 162 
34 1 Y 1 C PRO 158 ? E PRO 163 
35 1 Y 1 C SER 159 ? E SER 164 
36 1 Y 1 C PRO 160 ? E PRO 165 
37 1 Y 1 C PRO 161 ? E PRO 166 
38 1 Y 1 C PRO 162 ? E PRO 167 
39 1 Y 1 C ARG 163 ? E ARG 168 
40 1 Y 1 C PRO 164 ? E PRO 169 
41 1 Y 1 C LYS 165 ? E LYS 170 
42 1 Y 1 C ASN 166 ? E ASN 171 
43 1 Y 1 G PHE 301 ? F PHE 1   
44 1 Y 1 G HIS 302 ? F HIS 2   
45 1 Y 1 G ASP 303 ? F ASP 3   
46 1 Y 1 G ASP 304 ? F ASP 4   
47 1 Y 1 D GLY 201 ? G GLY 1   
48 1 Y 1 D PRO 158 ? G PRO 163 
49 1 Y 1 D SER 159 ? G SER 164 
50 1 Y 1 D PRO 160 ? G PRO 165 
51 1 Y 1 D PRO 161 ? G PRO 166 
52 1 Y 1 D PRO 162 ? G PRO 167 
53 1 Y 1 D ARG 163 ? G ARG 168 
54 1 Y 1 D PRO 164 ? G PRO 169 
55 1 Y 1 D LYS 165 ? G LYS 170 
56 1 Y 1 D ASN 166 ? G ASN 171 
57 1 Y 1 H PHE 301 ? H PHE 1   
58 1 Y 1 H HIS 302 ? H HIS 2   
59 1 Y 1 H ASP 303 ? H ASP 3   
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
I 3 HOH 1  206 1   HOH HOH A . 
I 3 HOH 2  207 2   HOH HOH A . 
I 3 HOH 3  208 3   HOH HOH A . 
I 3 HOH 4  209 6   HOH HOH A . 
I 3 HOH 5  210 12  HOH HOH A . 
I 3 HOH 6  211 15  HOH HOH A . 
I 3 HOH 7  212 20  HOH HOH A . 
I 3 HOH 8  213 24  HOH HOH A . 
I 3 HOH 9  214 27  HOH HOH A . 
I 3 HOH 10 215 39  HOH HOH A . 
I 3 HOH 11 216 40  HOH HOH A . 
I 3 HOH 12 217 45  HOH HOH A . 
I 3 HOH 13 218 47  HOH HOH A . 
I 3 HOH 14 219 50  HOH HOH A . 
I 3 HOH 15 220 53  HOH HOH A . 
I 3 HOH 16 221 56  HOH HOH A . 
I 3 HOH 17 222 60  HOH HOH A . 
I 3 HOH 18 223 63  HOH HOH A . 
I 3 HOH 19 224 65  HOH HOH A . 
I 3 HOH 20 225 68  HOH HOH A . 
I 3 HOH 21 226 69  HOH HOH A . 
I 3 HOH 22 227 74  HOH HOH A . 
I 3 HOH 23 228 77  HOH HOH A . 
I 3 HOH 24 229 79  HOH HOH A . 
I 3 HOH 25 230 86  HOH HOH A . 
I 3 HOH 26 231 87  HOH HOH A . 
I 3 HOH 27 232 88  HOH HOH A . 
I 3 HOH 28 233 94  HOH HOH A . 
I 3 HOH 29 234 111 HOH HOH A . 
I 3 HOH 30 235 119 HOH HOH A . 
I 3 HOH 31 236 122 HOH HOH A . 
I 3 HOH 32 237 125 HOH HOH A . 
I 3 HOH 33 238 128 HOH HOH A . 
I 3 HOH 34 239 129 HOH HOH A . 
I 3 HOH 35 240 130 HOH HOH A . 
I 3 HOH 36 241 133 HOH HOH A . 
I 3 HOH 37 242 140 HOH HOH A . 
I 3 HOH 38 243 141 HOH HOH A . 
I 3 HOH 39 244 151 HOH HOH A . 
I 3 HOH 40 245 152 HOH HOH A . 
I 3 HOH 41 246 155 HOH HOH A . 
I 3 HOH 42 247 165 HOH HOH A . 
I 3 HOH 43 248 166 HOH HOH A . 
I 3 HOH 44 249 172 HOH HOH A . 
I 3 HOH 45 250 183 HOH HOH A . 
I 3 HOH 46 251 184 HOH HOH A . 
I 3 HOH 47 252 199 HOH HOH A . 
I 3 HOH 48 253 206 HOH HOH A . 
I 3 HOH 49 254 209 HOH HOH A . 
I 3 HOH 50 255 222 HOH HOH A . 
I 3 HOH 51 256 224 HOH HOH A . 
I 3 HOH 52 257 225 HOH HOH A . 
I 3 HOH 53 258 237 HOH HOH A . 
J 3 HOH 1  97  97  HOH HOH E . 
J 3 HOH 2  124 124 HOH HOH E . 
J 3 HOH 3  144 144 HOH HOH E . 
J 3 HOH 4  153 153 HOH HOH E . 
K 3 HOH 1  206 5   HOH HOH B . 
K 3 HOH 2  207 7   HOH HOH B . 
K 3 HOH 3  208 13  HOH HOH B . 
K 3 HOH 4  209 17  HOH HOH B . 
K 3 HOH 5  210 18  HOH HOH B . 
K 3 HOH 6  211 19  HOH HOH B . 
K 3 HOH 7  212 23  HOH HOH B . 
K 3 HOH 8  213 30  HOH HOH B . 
K 3 HOH 9  214 31  HOH HOH B . 
K 3 HOH 10 215 32  HOH HOH B . 
K 3 HOH 11 216 38  HOH HOH B . 
K 3 HOH 12 217 42  HOH HOH B . 
K 3 HOH 13 218 54  HOH HOH B . 
K 3 HOH 14 219 57  HOH HOH B . 
K 3 HOH 15 220 58  HOH HOH B . 
K 3 HOH 16 221 59  HOH HOH B . 
K 3 HOH 17 222 66  HOH HOH B . 
K 3 HOH 18 223 67  HOH HOH B . 
K 3 HOH 19 224 73  HOH HOH B . 
K 3 HOH 20 225 75  HOH HOH B . 
K 3 HOH 21 226 80  HOH HOH B . 
K 3 HOH 22 227 90  HOH HOH B . 
K 3 HOH 23 228 91  HOH HOH B . 
K 3 HOH 24 229 95  HOH HOH B . 
K 3 HOH 25 230 96  HOH HOH B . 
K 3 HOH 26 231 101 HOH HOH B . 
K 3 HOH 27 232 105 HOH HOH B . 
K 3 HOH 28 233 106 HOH HOH B . 
K 3 HOH 29 234 114 HOH HOH B . 
K 3 HOH 30 235 115 HOH HOH B . 
K 3 HOH 31 236 117 HOH HOH B . 
K 3 HOH 32 237 120 HOH HOH B . 
K 3 HOH 33 238 123 HOH HOH B . 
K 3 HOH 34 239 127 HOH HOH B . 
K 3 HOH 35 240 131 HOH HOH B . 
K 3 HOH 36 241 135 HOH HOH B . 
K 3 HOH 37 242 136 HOH HOH B . 
K 3 HOH 38 243 137 HOH HOH B . 
K 3 HOH 39 244 148 HOH HOH B . 
K 3 HOH 40 245 154 HOH HOH B . 
K 3 HOH 41 246 162 HOH HOH B . 
K 3 HOH 42 247 164 HOH HOH B . 
K 3 HOH 43 248 169 HOH HOH B . 
K 3 HOH 44 249 173 HOH HOH B . 
K 3 HOH 45 250 174 HOH HOH B . 
K 3 HOH 46 251 175 HOH HOH B . 
K 3 HOH 47 252 185 HOH HOH B . 
K 3 HOH 48 253 186 HOH HOH B . 
K 3 HOH 49 254 190 HOH HOH B . 
K 3 HOH 50 255 191 HOH HOH B . 
K 3 HOH 51 256 196 HOH HOH B . 
K 3 HOH 52 257 203 HOH HOH B . 
K 3 HOH 53 258 205 HOH HOH B . 
K 3 HOH 54 259 214 HOH HOH B . 
K 3 HOH 55 260 220 HOH HOH B . 
K 3 HOH 56 261 223 HOH HOH B . 
K 3 HOH 57 262 226 HOH HOH B . 
K 3 HOH 58 263 227 HOH HOH B . 
K 3 HOH 59 264 232 HOH HOH B . 
K 3 HOH 60 265 236 HOH HOH B . 
L 3 HOH 1  64  64  HOH HOH F . 
L 3 HOH 2  83  83  HOH HOH F . 
L 3 HOH 3  147 147 HOH HOH F . 
L 3 HOH 4  177 177 HOH HOH F . 
M 3 HOH 1  206 8   HOH HOH C . 
M 3 HOH 2  207 10  HOH HOH C . 
M 3 HOH 3  208 16  HOH HOH C . 
M 3 HOH 4  209 22  HOH HOH C . 
M 3 HOH 5  210 25  HOH HOH C . 
M 3 HOH 6  211 26  HOH HOH C . 
M 3 HOH 7  212 33  HOH HOH C . 
M 3 HOH 8  213 34  HOH HOH C . 
M 3 HOH 9  214 35  HOH HOH C . 
M 3 HOH 10 215 37  HOH HOH C . 
M 3 HOH 11 216 46  HOH HOH C . 
M 3 HOH 12 217 48  HOH HOH C . 
M 3 HOH 13 218 51  HOH HOH C . 
M 3 HOH 14 219 52  HOH HOH C . 
M 3 HOH 15 220 55  HOH HOH C . 
M 3 HOH 16 221 61  HOH HOH C . 
M 3 HOH 17 222 62  HOH HOH C . 
M 3 HOH 18 223 72  HOH HOH C . 
M 3 HOH 19 224 78  HOH HOH C . 
M 3 HOH 20 225 81  HOH HOH C . 
M 3 HOH 21 226 82  HOH HOH C . 
M 3 HOH 22 227 89  HOH HOH C . 
M 3 HOH 23 228 93  HOH HOH C . 
M 3 HOH 24 229 98  HOH HOH C . 
M 3 HOH 25 230 100 HOH HOH C . 
M 3 HOH 26 231 103 HOH HOH C . 
M 3 HOH 27 232 104 HOH HOH C . 
M 3 HOH 28 233 107 HOH HOH C . 
M 3 HOH 29 234 108 HOH HOH C . 
M 3 HOH 30 235 109 HOH HOH C . 
M 3 HOH 31 236 112 HOH HOH C . 
M 3 HOH 32 237 116 HOH HOH C . 
M 3 HOH 33 238 121 HOH HOH C . 
M 3 HOH 34 239 143 HOH HOH C . 
M 3 HOH 35 240 156 HOH HOH C . 
M 3 HOH 36 241 158 HOH HOH C . 
M 3 HOH 37 242 159 HOH HOH C . 
M 3 HOH 38 243 160 HOH HOH C . 
M 3 HOH 39 244 161 HOH HOH C . 
M 3 HOH 40 245 163 HOH HOH C . 
M 3 HOH 41 246 167 HOH HOH C . 
M 3 HOH 42 247 170 HOH HOH C . 
M 3 HOH 43 248 178 HOH HOH C . 
M 3 HOH 44 249 179 HOH HOH C . 
M 3 HOH 45 250 180 HOH HOH C . 
M 3 HOH 46 251 181 HOH HOH C . 
M 3 HOH 47 252 182 HOH HOH C . 
M 3 HOH 48 253 187 HOH HOH C . 
M 3 HOH 49 254 188 HOH HOH C . 
M 3 HOH 50 255 189 HOH HOH C . 
M 3 HOH 51 256 192 HOH HOH C . 
M 3 HOH 52 257 193 HOH HOH C . 
M 3 HOH 53 258 195 HOH HOH C . 
M 3 HOH 54 259 197 HOH HOH C . 
M 3 HOH 55 260 204 HOH HOH C . 
M 3 HOH 56 261 207 HOH HOH C . 
M 3 HOH 57 262 208 HOH HOH C . 
M 3 HOH 58 263 210 HOH HOH C . 
M 3 HOH 59 264 211 HOH HOH C . 
M 3 HOH 60 265 212 HOH HOH C . 
M 3 HOH 61 266 218 HOH HOH C . 
M 3 HOH 62 267 221 HOH HOH C . 
M 3 HOH 63 268 228 HOH HOH C . 
M 3 HOH 64 269 231 HOH HOH C . 
M 3 HOH 65 270 234 HOH HOH C . 
M 3 HOH 66 271 235 HOH HOH C . 
N 3 HOH 1  132 132 HOH HOH G . 
O 3 HOH 1  206 4   HOH HOH D . 
O 3 HOH 2  207 9   HOH HOH D . 
O 3 HOH 3  208 11  HOH HOH D . 
O 3 HOH 4  209 14  HOH HOH D . 
O 3 HOH 5  210 21  HOH HOH D . 
O 3 HOH 6  211 28  HOH HOH D . 
O 3 HOH 7  212 29  HOH HOH D . 
O 3 HOH 8  213 36  HOH HOH D . 
O 3 HOH 9  214 41  HOH HOH D . 
O 3 HOH 10 215 44  HOH HOH D . 
O 3 HOH 11 216 49  HOH HOH D . 
O 3 HOH 12 217 70  HOH HOH D . 
O 3 HOH 13 218 71  HOH HOH D . 
O 3 HOH 14 219 76  HOH HOH D . 
O 3 HOH 15 220 84  HOH HOH D . 
O 3 HOH 16 221 85  HOH HOH D . 
O 3 HOH 17 222 92  HOH HOH D . 
O 3 HOH 18 223 99  HOH HOH D . 
O 3 HOH 19 224 102 HOH HOH D . 
O 3 HOH 20 225 110 HOH HOH D . 
O 3 HOH 21 226 113 HOH HOH D . 
O 3 HOH 22 227 118 HOH HOH D . 
O 3 HOH 23 228 126 HOH HOH D . 
O 3 HOH 24 229 134 HOH HOH D . 
O 3 HOH 25 230 138 HOH HOH D . 
O 3 HOH 26 231 139 HOH HOH D . 
O 3 HOH 27 232 142 HOH HOH D . 
O 3 HOH 28 233 145 HOH HOH D . 
O 3 HOH 29 234 146 HOH HOH D . 
O 3 HOH 30 235 149 HOH HOH D . 
O 3 HOH 31 236 150 HOH HOH D . 
O 3 HOH 32 237 157 HOH HOH D . 
O 3 HOH 33 238 168 HOH HOH D . 
O 3 HOH 34 239 171 HOH HOH D . 
O 3 HOH 35 240 176 HOH HOH D . 
O 3 HOH 36 241 194 HOH HOH D . 
O 3 HOH 37 242 198 HOH HOH D . 
O 3 HOH 38 243 200 HOH HOH D . 
O 3 HOH 39 244 201 HOH HOH D . 
O 3 HOH 40 245 202 HOH HOH D . 
O 3 HOH 41 246 213 HOH HOH D . 
O 3 HOH 42 247 215 HOH HOH D . 
O 3 HOH 43 248 216 HOH HOH D . 
O 3 HOH 44 249 217 HOH HOH D . 
O 3 HOH 45 250 219 HOH HOH D . 
O 3 HOH 46 251 229 HOH HOH D . 
O 3 HOH 47 252 230 HOH HOH D . 
O 3 HOH 48 253 233 HOH HOH D . 
P 3 HOH 1  43  43  HOH HOH H . 
#