data_1JSA
# 
_entry.id   1JSA 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.355 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1JSA         pdb_00001jsa 10.2210/pdb1jsa/pdb 
WWPDB D_1000174364 ?            ?                   
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1JSA 
_pdbx_database_status.recvd_initial_deposition_date   1997-06-04 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ames, J.B.'   1 
'Ishima, R.'   2 
'Tanaka, T.'   3 
'Gordon, J.I.' 4 
'Stryer, L.'   5 
'Ikura, M.'    6 
# 
_citation.id                        primary 
_citation.title                     'Molecular mechanics of calcium-myristoyl switches.' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            389 
_citation.page_first                198 
_citation.page_last                 202 
_citation.year                      1997 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   9296500 
_citation.pdbx_database_id_DOI      10.1038/38310 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Ames, J.B.'   1 ? 
primary 'Ishima, R.'   2 ? 
primary 'Tanaka, T.'   3 ? 
primary 'Gordon, J.I.' 4 ? 
primary 'Stryer, L.'   5 ? 
primary 'Ikura, M.'    6 ? 
# 
_cell.entry_id           1JSA 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1JSA 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man RECOVERIN       23235.209 1 ? ? ? ? 
2 non-polymer syn 'CALCIUM ION'   40.078    2 ? ? ? ? 
3 non-polymer syn 'MYRISTIC ACID' 228.371   1 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GNSKSGALSKEILEELQLNTKFTEEELSSWYQSFLKECPSGRITRQEFQTIYSKFFPEADPKAYAQHVFRSFDANSDGTL
DFKEYVIALHMTSAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVTAIFKMISPEDTKHLPEDENTPEKRAEKIWGFFGK
KDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKLKEKKL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GNSKSGALSKEILEELQLNTKFTEEELSSWYQSFLKECPSGRITRQEFQTIYSKFFPEADPKAYAQHVFRSFDANSDGTL
DFKEYVIALHMTSAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVTAIFKMISPEDTKHLPEDENTPEKRAEKIWGFFGK
KDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKLKEKKL
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ASN n 
1 3   SER n 
1 4   LYS n 
1 5   SER n 
1 6   GLY n 
1 7   ALA n 
1 8   LEU n 
1 9   SER n 
1 10  LYS n 
1 11  GLU n 
1 12  ILE n 
1 13  LEU n 
1 14  GLU n 
1 15  GLU n 
1 16  LEU n 
1 17  GLN n 
1 18  LEU n 
1 19  ASN n 
1 20  THR n 
1 21  LYS n 
1 22  PHE n 
1 23  THR n 
1 24  GLU n 
1 25  GLU n 
1 26  GLU n 
1 27  LEU n 
1 28  SER n 
1 29  SER n 
1 30  TRP n 
1 31  TYR n 
1 32  GLN n 
1 33  SER n 
1 34  PHE n 
1 35  LEU n 
1 36  LYS n 
1 37  GLU n 
1 38  CYS n 
1 39  PRO n 
1 40  SER n 
1 41  GLY n 
1 42  ARG n 
1 43  ILE n 
1 44  THR n 
1 45  ARG n 
1 46  GLN n 
1 47  GLU n 
1 48  PHE n 
1 49  GLN n 
1 50  THR n 
1 51  ILE n 
1 52  TYR n 
1 53  SER n 
1 54  LYS n 
1 55  PHE n 
1 56  PHE n 
1 57  PRO n 
1 58  GLU n 
1 59  ALA n 
1 60  ASP n 
1 61  PRO n 
1 62  LYS n 
1 63  ALA n 
1 64  TYR n 
1 65  ALA n 
1 66  GLN n 
1 67  HIS n 
1 68  VAL n 
1 69  PHE n 
1 70  ARG n 
1 71  SER n 
1 72  PHE n 
1 73  ASP n 
1 74  ALA n 
1 75  ASN n 
1 76  SER n 
1 77  ASP n 
1 78  GLY n 
1 79  THR n 
1 80  LEU n 
1 81  ASP n 
1 82  PHE n 
1 83  LYS n 
1 84  GLU n 
1 85  TYR n 
1 86  VAL n 
1 87  ILE n 
1 88  ALA n 
1 89  LEU n 
1 90  HIS n 
1 91  MET n 
1 92  THR n 
1 93  SER n 
1 94  ALA n 
1 95  GLY n 
1 96  LYS n 
1 97  THR n 
1 98  ASN n 
1 99  GLN n 
1 100 LYS n 
1 101 LEU n 
1 102 GLU n 
1 103 TRP n 
1 104 ALA n 
1 105 PHE n 
1 106 SER n 
1 107 LEU n 
1 108 TYR n 
1 109 ASP n 
1 110 VAL n 
1 111 ASP n 
1 112 GLY n 
1 113 ASN n 
1 114 GLY n 
1 115 THR n 
1 116 ILE n 
1 117 SER n 
1 118 LYS n 
1 119 ASN n 
1 120 GLU n 
1 121 VAL n 
1 122 LEU n 
1 123 GLU n 
1 124 ILE n 
1 125 VAL n 
1 126 THR n 
1 127 ALA n 
1 128 ILE n 
1 129 PHE n 
1 130 LYS n 
1 131 MET n 
1 132 ILE n 
1 133 SER n 
1 134 PRO n 
1 135 GLU n 
1 136 ASP n 
1 137 THR n 
1 138 LYS n 
1 139 HIS n 
1 140 LEU n 
1 141 PRO n 
1 142 GLU n 
1 143 ASP n 
1 144 GLU n 
1 145 ASN n 
1 146 THR n 
1 147 PRO n 
1 148 GLU n 
1 149 LYS n 
1 150 ARG n 
1 151 ALA n 
1 152 GLU n 
1 153 LYS n 
1 154 ILE n 
1 155 TRP n 
1 156 GLY n 
1 157 PHE n 
1 158 PHE n 
1 159 GLY n 
1 160 LYS n 
1 161 LYS n 
1 162 ASP n 
1 163 ASP n 
1 164 ASP n 
1 165 LYS n 
1 166 LEU n 
1 167 THR n 
1 168 GLU n 
1 169 LYS n 
1 170 GLU n 
1 171 PHE n 
1 172 ILE n 
1 173 GLU n 
1 174 GLY n 
1 175 THR n 
1 176 LEU n 
1 177 ALA n 
1 178 ASN n 
1 179 LYS n 
1 180 GLU n 
1 181 ILE n 
1 182 LEU n 
1 183 ARG n 
1 184 LEU n 
1 185 ILE n 
1 186 GLN n 
1 187 PHE n 
1 188 GLU n 
1 189 PRO n 
1 190 GLN n 
1 191 LYS n 
1 192 VAL n 
1 193 LYS n 
1 194 GLU n 
1 195 LYS n 
1 196 LEU n 
1 197 LYS n 
1 198 GLU n 
1 199 LYS n 
1 200 LYS n 
1 201 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               cattle 
_entity_src_gen.gene_src_genus                     Bos 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Bos taurus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9913 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PTREC2 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RECO_BOVIN 
_struct_ref.pdbx_db_accession          P21457 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1JSA 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 201 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P21457 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  201 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       201 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'   ? 'Ca 2'           40.078  
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
MYR non-polymer         . 'MYRISTIC ACID' ? 'C14 H28 O2'     228.371 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_pdbx_nmr_ensemble.entry_id                             1JSA 
_pdbx_nmr_ensemble.conformers_calculated_total_number   ? 
_pdbx_nmr_ensemble.conformers_submitted_total_number    24 
_pdbx_nmr_ensemble.conformer_selection_criteria         ? 
# 
_pdbx_nmr_software.classification   refinement 
_pdbx_nmr_software.name             X-PLOR 
_pdbx_nmr_software.version          ? 
_pdbx_nmr_software.authors          BRUNGER 
_pdbx_nmr_software.ordinal          1 
# 
_exptl.entry_id          1JSA 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  1JSA 
_struct.title                     'MYRISTOYLATED RECOVERIN WITH TWO CALCIUMS BOUND, NMR, 24 STRUCTURES' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1JSA 
_struct_keywords.pdbx_keywords   'CALCIUM BINDING' 
_struct_keywords.text            'CALCIUM BINDING PROTEIN, CALCIUM-MYRISTOYL SWITCH, CALCIUM BINDING' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A Y N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LYS A 10  ? LEU A 16  ? LYS A 10  LEU A 16  1 ? 7  
HELX_P HELX_P2  2  GLU A 26  ? GLU A 37  ? GLU A 26  GLU A 37  1 ? 12 
HELX_P HELX_P3  3  PHE A 48  ? PHE A 55  ? PHE A 48  PHE A 55  5 ? 8  
HELX_P HELX_P4  4  LYS A 62  ? ALA A 65  ? LYS A 62  ALA A 65  1 ? 4  
HELX_P HELX_P5  5  HIS A 67  ? ARG A 70  ? HIS A 67  ARG A 70  1 ? 4  
HELX_P HELX_P6  6  PHE A 82  ? MET A 91  ? PHE A 82  MET A 91  1 ? 10 
HELX_P HELX_P7  7  GLU A 102 ? LEU A 107 ? GLU A 102 LEU A 107 5 ? 6  
HELX_P HELX_P8  8  LYS A 118 ? MET A 131 ? LYS A 118 MET A 131 1 ? 14 
HELX_P HELX_P9  9  PRO A 134 ? THR A 137 ? PRO A 134 THR A 137 1 ? 4  
HELX_P HELX_P10 10 GLU A 142 ? GLU A 144 ? GLU A 142 GLU A 144 5 ? 3  
HELX_P HELX_P11 11 PRO A 147 ? PHE A 158 ? PRO A 147 PHE A 158 1 ? 12 
HELX_P HELX_P12 12 GLU A 170 ? LEU A 176 ? GLU A 170 LEU A 176 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1  covale both ? A GLY 1   N   ? ? ? 1_555 D MYR . C1 ? ? A GLY 1   A MYR 502 1_555 ? ? ? ? ? ? ? 1.306 ? ? 
metalc1  metalc ?    ? A ASP 73  OD1 ? ? ? 1_555 B CA  . CA ? ? A ASP 73  A CA  500 1_555 ? ? ? ? ? ? ? 2.525 ? ? 
metalc2  metalc ?    ? A ASN 75  OD1 ? ? ? 1_555 B CA  . CA ? ? A ASN 75  A CA  500 1_555 ? ? ? ? ? ? ? 2.568 ? ? 
metalc3  metalc ?    ? A ASP 77  OD2 ? ? ? 1_555 B CA  . CA ? ? A ASP 77  A CA  500 1_555 ? ? ? ? ? ? ? 2.468 ? ? 
metalc4  metalc ?    ? A THR 79  O   ? ? ? 1_555 B CA  . CA ? ? A THR 79  A CA  500 1_555 ? ? ? ? ? ? ? 2.561 ? ? 
metalc5  metalc ?    ? A GLU 84  OE1 ? ? ? 1_555 B CA  . CA ? ? A GLU 84  A CA  500 1_555 ? ? ? ? ? ? ? 2.527 ? ? 
metalc6  metalc ?    ? A GLU 84  OE2 ? ? ? 1_555 B CA  . CA ? ? A GLU 84  A CA  500 1_555 ? ? ? ? ? ? ? 2.507 ? ? 
metalc7  metalc ?    ? A ASP 109 OD1 ? ? ? 1_555 C CA  . CA ? ? A ASP 109 A CA  501 1_555 ? ? ? ? ? ? ? 2.506 ? ? 
metalc8  metalc ?    ? A ASP 111 OD1 ? ? ? 1_555 C CA  . CA ? ? A ASP 111 A CA  501 1_555 ? ? ? ? ? ? ? 2.511 ? ? 
metalc9  metalc ?    ? A ASN 113 OD1 ? ? ? 1_555 C CA  . CA ? ? A ASN 113 A CA  501 1_555 ? ? ? ? ? ? ? 2.484 ? ? 
metalc10 metalc ?    ? A THR 115 O   ? ? ? 1_555 C CA  . CA ? ? A THR 115 A CA  501 1_555 ? ? ? ? ? ? ? 2.505 ? ? 
metalc11 metalc ?    ? A GLU 120 OE1 ? ? ? 1_555 C CA  . CA ? ? A GLU 120 A CA  501 1_555 ? ? ? ? ? ? ? 2.483 ? ? 
metalc12 metalc ?    ? A GLU 120 OE2 ? ? ? 1_555 C CA  . CA ? ? A GLU 120 A CA  501 1_555 ? ? ? ? ? ? ? 2.497 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     A 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 115 ? ILE A 116 ? THR A 115 ILE A 116 
A 2 LEU A 166 ? THR A 167 ? LEU A 166 THR A 167 
# 
_pdbx_struct_sheet_hbond.sheet_id                A 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   ILE 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    116 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    ILE 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     116 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   LEU 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    166 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    LEU 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     166 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A CA  500 ? 5 'BINDING SITE FOR RESIDUE CA A 500'  
AC2 Software A CA  501 ? 5 'BINDING SITE FOR RESIDUE CA A 501'  
AC3 Software A MYR 502 ? 1 'BINDING SITE FOR RESIDUE MYR A 502' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 ASP A 73  ? ASP A 73  . ? 1_555 ? 
2  AC1 5 ASN A 75  ? ASN A 75  . ? 1_555 ? 
3  AC1 5 ASP A 77  ? ASP A 77  . ? 1_555 ? 
4  AC1 5 THR A 79  ? THR A 79  . ? 1_555 ? 
5  AC1 5 GLU A 84  ? GLU A 84  . ? 1_555 ? 
6  AC2 5 ASP A 109 ? ASP A 109 . ? 1_555 ? 
7  AC2 5 ASP A 111 ? ASP A 111 . ? 1_555 ? 
8  AC2 5 ASN A 113 ? ASN A 113 . ? 1_555 ? 
9  AC2 5 THR A 115 ? THR A 115 . ? 1_555 ? 
10 AC2 5 GLU A 120 ? GLU A 120 . ? 1_555 ? 
11 AC3 1 GLY A 1   ? GLY A 1   . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1JSA 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1JSA 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
H  
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N    . GLY A 1 1   ? -35.088 23.327 32.125 1.00 0.00 ? 1   GLY A N    1  
ATOM   2     C  CA   . GLY A 1 1   ? -35.665 24.635 31.709 1.00 0.00 ? 1   GLY A CA   1  
ATOM   3     C  C    . GLY A 1 1   ? -34.569 25.700 31.634 1.00 0.00 ? 1   GLY A C    1  
ATOM   4     O  O    . GLY A 1 1   ? -34.848 26.869 31.457 1.00 0.00 ? 1   GLY A O    1  
ATOM   5     H  H    . GLY A 1 1   ? -34.267 23.295 32.659 1.00 0.00 ? 1   GLY A H    1  
ATOM   6     H  HA2  . GLY A 1 1   ? -36.127 24.529 30.739 1.00 0.00 ? 1   GLY A HA2  1  
ATOM   7     H  HA3  . GLY A 1 1   ? -36.411 24.941 32.428 1.00 0.00 ? 1   GLY A HA3  1  
ATOM   8     N  N    . ASN A 1 2   ? -33.343 25.270 31.771 1.00 0.00 ? 2   ASN A N    1  
ATOM   9     C  CA   . ASN A 1 2   ? -32.219 26.239 31.709 1.00 0.00 ? 2   ASN A CA   1  
ATOM   10    C  C    . ASN A 1 2   ? -30.991 25.601 31.071 1.00 0.00 ? 2   ASN A C    1  
ATOM   11    O  O    . ASN A 1 2   ? -30.700 24.442 31.296 1.00 0.00 ? 2   ASN A O    1  
ATOM   12    C  CB   . ASN A 1 2   ? -31.869 26.668 33.144 1.00 0.00 ? 2   ASN A CB   1  
ATOM   13    C  CG   . ASN A 1 2   ? -31.574 25.426 33.986 1.00 0.00 ? 2   ASN A CG   1  
ATOM   14    O  OD1  . ASN A 1 2   ? -32.334 24.479 34.002 1.00 0.00 ? 2   ASN A OD1  1  
ATOM   15    N  ND2  . ASN A 1 2   ? -30.484 25.390 34.702 1.00 0.00 ? 2   ASN A ND2  1  
ATOM   16    H  H    . ASN A 1 2   ? -33.166 24.317 31.911 1.00 0.00 ? 2   ASN A H    1  
ATOM   17    H  HA   . ASN A 1 2   ? -32.523 27.097 31.112 1.00 0.00 ? 2   ASN A HA   1  
ATOM   18    H  HB2  . ASN A 1 2   ? -30.998 27.306 33.132 1.00 0.00 ? 2   ASN A HB2  1  
ATOM   19    H  HB3  . ASN A 1 2   ? -32.700 27.204 33.578 1.00 0.00 ? 2   ASN A HB3  1  
ATOM   20    H  HD21 . ASN A 1 2   ? -29.867 26.151 34.692 1.00 0.00 ? 2   ASN A HD21 1  
ATOM   21    H  HD22 . ASN A 1 2   ? -30.281 24.602 35.247 1.00 0.00 ? 2   ASN A HD22 1  
ATOM   22    N  N    . SER A 1 3   ? -30.291 26.371 30.284 1.00 0.00 ? 3   SER A N    1  
ATOM   23    C  CA   . SER A 1 3   ? -29.079 25.830 29.621 1.00 0.00 ? 3   SER A CA   1  
ATOM   24    C  C    . SER A 1 3   ? -27.955 25.607 30.626 1.00 0.00 ? 3   SER A C    1  
ATOM   25    O  O    . SER A 1 3   ? -27.516 26.529 31.285 1.00 0.00 ? 3   SER A O    1  
ATOM   26    C  CB   . SER A 1 3   ? -28.610 26.847 28.571 1.00 0.00 ? 3   SER A CB   1  
ATOM   27    O  OG   . SER A 1 3   ? -29.468 26.620 27.461 1.00 0.00 ? 3   SER A OG   1  
ATOM   28    H  H    . SER A 1 3   ? -30.563 27.299 30.132 1.00 0.00 ? 3   SER A H    1  
ATOM   29    H  HA   . SER A 1 3   ? -29.328 24.877 29.153 1.00 0.00 ? 3   SER A HA   1  
ATOM   30    H  HB2  . SER A 1 3   ? -28.728 27.857 28.936 1.00 0.00 ? 3   SER A HB2  1  
ATOM   31    H  HB3  . SER A 1 3   ? -27.581 26.662 28.292 1.00 0.00 ? 3   SER A HB3  1  
ATOM   32    H  HG   . SER A 1 3   ? -30.313 27.033 27.652 1.00 0.00 ? 3   SER A HG   1  
ATOM   33    N  N    . LYS A 1 4   ? -27.510 24.383 30.724 1.00 0.00 ? 4   LYS A N    1  
ATOM   34    C  CA   . LYS A 1 4   ? -26.416 24.072 31.677 1.00 0.00 ? 4   LYS A CA   1  
ATOM   35    C  C    . LYS A 1 4   ? -25.067 24.076 30.967 1.00 0.00 ? 4   LYS A C    1  
ATOM   36    O  O    . LYS A 1 4   ? -24.998 23.884 29.768 1.00 0.00 ? 4   LYS A O    1  
ATOM   37    C  CB   . LYS A 1 4   ? -26.668 22.670 32.252 1.00 0.00 ? 4   LYS A CB   1  
ATOM   38    C  CG   . LYS A 1 4   ? -26.078 22.588 33.661 1.00 0.00 ? 4   LYS A CG   1  
ATOM   39    C  CD   . LYS A 1 4   ? -26.532 21.281 34.317 1.00 0.00 ? 4   LYS A CD   1  
ATOM   40    C  CE   . LYS A 1 4   ? -26.168 21.310 35.801 1.00 0.00 ? 4   LYS A CE   1  
ATOM   41    N  NZ   . LYS A 1 4   ? -27.378 21.580 36.628 1.00 0.00 ? 4   LYS A NZ   1  
ATOM   42    H  H    . LYS A 1 4   ? -27.898 23.673 30.171 1.00 0.00 ? 4   LYS A H    1  
ATOM   43    H  HA   . LYS A 1 4   ? -26.407 24.821 32.467 1.00 0.00 ? 4   LYS A HA   1  
ATOM   44    H  HB2  . LYS A 1 4   ? -27.731 22.480 32.293 1.00 0.00 ? 4   LYS A HB2  1  
ATOM   45    H  HB3  . LYS A 1 4   ? -26.201 21.930 31.621 1.00 0.00 ? 4   LYS A HB3  1  
ATOM   46    H  HG2  . LYS A 1 4   ? -25.000 22.611 33.606 1.00 0.00 ? 4   LYS A HG2  1  
ATOM   47    H  HG3  . LYS A 1 4   ? -26.421 23.427 34.249 1.00 0.00 ? 4   LYS A HG3  1  
ATOM   48    H  HD2  . LYS A 1 4   ? -27.602 21.173 34.207 1.00 0.00 ? 4   LYS A HD2  1  
ATOM   49    H  HD3  . LYS A 1 4   ? -26.041 20.447 33.839 1.00 0.00 ? 4   LYS A HD3  1  
ATOM   50    H  HE2  . LYS A 1 4   ? -25.749 20.358 36.090 1.00 0.00 ? 4   LYS A HE2  1  
ATOM   51    H  HE3  . LYS A 1 4   ? -25.437 22.086 35.979 1.00 0.00 ? 4   LYS A HE3  1  
ATOM   52    H  HZ1  . LYS A 1 4   ? -28.195 21.739 36.006 1.00 0.00 ? 4   LYS A HZ1  1  
ATOM   53    H  HZ2  . LYS A 1 4   ? -27.564 20.765 37.246 1.00 0.00 ? 4   LYS A HZ2  1  
ATOM   54    H  HZ3  . LYS A 1 4   ? -27.217 22.427 37.212 1.00 0.00 ? 4   LYS A HZ3  1  
ATOM   55    N  N    . SER A 1 5   ? -24.017 24.299 31.727 1.00 0.00 ? 5   SER A N    1  
ATOM   56    C  CA   . SER A 1 5   ? -22.650 24.322 31.123 1.00 0.00 ? 5   SER A CA   1  
ATOM   57    C  C    . SER A 1 5   ? -21.736 23.328 31.825 1.00 0.00 ? 5   SER A C    1  
ATOM   58    O  O    . SER A 1 5   ? -20.974 22.627 31.185 1.00 0.00 ? 5   SER A O    1  
ATOM   59    C  CB   . SER A 1 5   ? -22.067 25.733 31.300 1.00 0.00 ? 5   SER A CB   1  
ATOM   60    O  OG   . SER A 1 5   ? -22.826 26.295 32.360 1.00 0.00 ? 5   SER A OG   1  
ATOM   61    H  H    . SER A 1 5   ? -24.131 24.450 32.689 1.00 0.00 ? 5   SER A H    1  
ATOM   62    H  HA   . SER A 1 5   ? -22.715 24.059 30.071 1.00 0.00 ? 5   SER A HA   1  
ATOM   63    H  HB2  . SER A 1 5   ? -21.022 25.684 31.573 1.00 0.00 ? 5   SER A HB2  1  
ATOM   64    H  HB3  . SER A 1 5   ? -22.195 26.315 30.400 1.00 0.00 ? 5   SER A HB3  1  
ATOM   65    H  HG   . SER A 1 5   ? -22.521 27.195 32.498 1.00 0.00 ? 5   SER A HG   1  
ATOM   66    N  N    . GLY A 1 6   ? -21.829 23.290 33.133 1.00 0.00 ? 6   GLY A N    1  
ATOM   67    C  CA   . GLY A 1 6   ? -20.971 22.346 33.917 1.00 0.00 ? 6   GLY A CA   1  
ATOM   68    C  C    . GLY A 1 6   ? -20.116 23.120 34.920 1.00 0.00 ? 6   GLY A C    1  
ATOM   69    O  O    . GLY A 1 6   ? -19.063 22.667 35.325 1.00 0.00 ? 6   GLY A O    1  
ATOM   70    H  H    . GLY A 1 6   ? -22.460 23.878 33.597 1.00 0.00 ? 6   GLY A H    1  
ATOM   71    H  HA2  . GLY A 1 6   ? -21.602 21.651 34.449 1.00 0.00 ? 6   GLY A HA2  1  
ATOM   72    H  HA3  . GLY A 1 6   ? -20.325 21.799 33.249 1.00 0.00 ? 6   GLY A HA3  1  
ATOM   73    N  N    . ALA A 1 7   ? -20.588 24.276 35.300 1.00 0.00 ? 7   ALA A N    1  
ATOM   74    C  CA   . ALA A 1 7   ? -19.822 25.095 36.271 1.00 0.00 ? 7   ALA A CA   1  
ATOM   75    C  C    . ALA A 1 7   ? -18.550 25.637 35.634 1.00 0.00 ? 7   ALA A C    1  
ATOM   76    O  O    . ALA A 1 7   ? -17.725 26.233 36.298 1.00 0.00 ? 7   ALA A O    1  
ATOM   77    C  CB   . ALA A 1 7   ? -19.440 24.204 37.462 1.00 0.00 ? 7   ALA A CB   1  
ATOM   78    H  H    . ALA A 1 7   ? -21.440 24.603 34.944 1.00 0.00 ? 7   ALA A H    1  
ATOM   79    H  HA   . ALA A 1 7   ? -20.440 25.930 36.595 1.00 0.00 ? 7   ALA A HA   1  
ATOM   80    H  HB1  . ALA A 1 7   ? -20.102 23.354 37.509 1.00 0.00 ? 7   ALA A HB1  1  
ATOM   81    H  HB2  . ALA A 1 7   ? -18.422 23.856 37.343 1.00 0.00 ? 7   ALA A HB2  1  
ATOM   82    H  HB3  . ALA A 1 7   ? -19.518 24.767 38.380 1.00 0.00 ? 7   ALA A HB3  1  
ATOM   83    N  N    . LEU A 1 8   ? -18.415 25.422 34.354 1.00 0.00 ? 8   LEU A N    1  
ATOM   84    C  CA   . LEU A 1 8   ? -17.203 25.917 33.655 1.00 0.00 ? 8   LEU A CA   1  
ATOM   85    C  C    . LEU A 1 8   ? -17.348 25.787 32.154 1.00 0.00 ? 8   LEU A C    1  
ATOM   86    O  O    . LEU A 1 8   ? -17.832 24.793 31.651 1.00 0.00 ? 8   LEU A O    1  
ATOM   87    C  CB   . LEU A 1 8   ? -16.004 25.075 34.104 1.00 0.00 ? 8   LEU A CB   1  
ATOM   88    C  CG   . LEU A 1 8   ? -16.154 23.650 33.555 1.00 0.00 ? 8   LEU A CG   1  
ATOM   89    C  CD1  . LEU A 1 8   ? -15.522 23.559 32.157 1.00 0.00 ? 8   LEU A CD1  1  
ATOM   90    C  CD2  . LEU A 1 8   ? -15.432 22.686 34.487 1.00 0.00 ? 8   LEU A CD2  1  
ATOM   91    H  H    . LEU A 1 8   ? -19.108 24.937 33.859 1.00 0.00 ? 8   LEU A H    1  
ATOM   92    H  HA   . LEU A 1 8   ? -17.049 26.974 33.902 1.00 0.00 ? 8   LEU A HA   1  
ATOM   93    H  HB2  . LEU A 1 8   ? -15.092 25.516 33.732 1.00 0.00 ? 8   LEU A HB2  1  
ATOM   94    H  HB3  . LEU A 1 8   ? -15.968 25.045 35.183 1.00 0.00 ? 8   LEU A HB3  1  
ATOM   95    H  HG   . LEU A 1 8   ? -17.202 23.389 33.500 1.00 0.00 ? 8   LEU A HG   1  
ATOM   96    H  HD11 . LEU A 1 8   ? -15.284 24.546 31.793 1.00 0.00 ? 8   LEU A HD11 1  
ATOM   97    H  HD12 . LEU A 1 8   ? -14.616 22.971 32.205 1.00 0.00 ? 8   LEU A HD12 1  
ATOM   98    H  HD13 . LEU A 1 8   ? -16.213 23.086 31.475 1.00 0.00 ? 8   LEU A HD13 1  
ATOM   99    H  HD21 . LEU A 1 8   ? -15.799 22.809 35.494 1.00 0.00 ? 8   LEU A HD21 1  
ATOM   100   H  HD22 . LEU A 1 8   ? -15.606 21.670 34.165 1.00 0.00 ? 8   LEU A HD22 1  
ATOM   101   H  HD23 . LEU A 1 8   ? -14.373 22.892 34.465 1.00 0.00 ? 8   LEU A HD23 1  
ATOM   102   N  N    . SER A 1 9   ? -16.926 26.797 31.473 1.00 0.00 ? 9   SER A N    1  
ATOM   103   C  CA   . SER A 1 9   ? -17.014 26.789 30.016 1.00 0.00 ? 9   SER A CA   1  
ATOM   104   C  C    . SER A 1 9   ? -16.651 28.154 29.484 1.00 0.00 ? 9   SER A C    1  
ATOM   105   O  O    . SER A 1 9   ? -15.968 28.274 28.494 1.00 0.00 ? 9   SER A O    1  
ATOM   106   C  CB   . SER A 1 9   ? -18.450 26.467 29.626 1.00 0.00 ? 9   SER A CB   1  
ATOM   107   O  OG   . SER A 1 9   ? -19.216 26.897 30.742 1.00 0.00 ? 9   SER A OG   1  
ATOM   108   H  H    . SER A 1 9   ? -16.561 27.569 31.927 1.00 0.00 ? 9   SER A H    1  
ATOM   109   H  HA   . SER A 1 9   ? -16.317 26.048 29.615 1.00 0.00 ? 9   SER A HA   1  
ATOM   110   H  HB2  . SER A 1 9   ? -18.733 27.013 28.744 1.00 0.00 ? 9   SER A HB2  1  
ATOM   111   H  HB3  . SER A 1 9   ? -18.572 25.409 29.475 1.00 0.00 ? 9   SER A HB3  1  
ATOM   112   H  HG   . SER A 1 9   ? -20.144 26.831 30.507 1.00 0.00 ? 9   SER A HG   1  
ATOM   113   N  N    . LYS A 1 10  ? -17.124 29.167 30.158 1.00 0.00 ? 10  LYS A N    1  
ATOM   114   C  CA   . LYS A 1 10  ? -16.818 30.540 29.713 1.00 0.00 ? 10  LYS A CA   1  
ATOM   115   C  C    . LYS A 1 10  ? -15.498 30.995 30.314 1.00 0.00 ? 10  LYS A C    1  
ATOM   116   O  O    . LYS A 1 10  ? -14.814 31.830 29.758 1.00 0.00 ? 10  LYS A O    1  
ATOM   117   C  CB   . LYS A 1 10  ? -17.940 31.474 30.196 1.00 0.00 ? 10  LYS A CB   1  
ATOM   118   C  CG   . LYS A 1 10  ? -17.984 31.461 31.723 1.00 0.00 ? 10  LYS A CG   1  
ATOM   119   C  CD   . LYS A 1 10  ? -19.246 32.189 32.195 1.00 0.00 ? 10  LYS A CD   1  
ATOM   120   C  CE   . LYS A 1 10  ? -20.480 31.408 31.734 1.00 0.00 ? 10  LYS A CE   1  
ATOM   121   N  NZ   . LYS A 1 10  ? -20.144 29.970 31.529 1.00 0.00 ? 10  LYS A NZ   1  
ATOM   122   H  H    . LYS A 1 10  ? -17.677 29.016 30.952 1.00 0.00 ? 10  LYS A H    1  
ATOM   123   H  HA   . LYS A 1 10  ? -16.739 30.552 28.626 1.00 0.00 ? 10  LYS A HA   1  
ATOM   124   H  HB2  . LYS A 1 10  ? -17.749 32.479 29.846 1.00 0.00 ? 10  LYS A HB2  1  
ATOM   125   H  HB3  . LYS A 1 10  ? -18.887 31.136 29.803 1.00 0.00 ? 10  LYS A HB3  1  
ATOM   126   H  HG2  . LYS A 1 10  ? -17.999 30.441 32.077 1.00 0.00 ? 10  LYS A HG2  1  
ATOM   127   H  HG3  . LYS A 1 10  ? -17.109 31.959 32.115 1.00 0.00 ? 10  LYS A HG3  1  
ATOM   128   H  HD2  . LYS A 1 10  ? -19.242 32.259 33.272 1.00 0.00 ? 10  LYS A HD2  1  
ATOM   129   H  HD3  . LYS A 1 10  ? -19.269 33.185 31.775 1.00 0.00 ? 10  LYS A HD3  1  
ATOM   130   H  HE2  . LYS A 1 10  ? -21.256 31.485 32.482 1.00 0.00 ? 10  LYS A HE2  1  
ATOM   131   H  HE3  . LYS A 1 10  ? -20.844 31.821 30.804 1.00 0.00 ? 10  LYS A HE3  1  
ATOM   132   H  HZ1  . LYS A 1 10  ? -19.279 29.894 30.958 1.00 0.00 ? 10  LYS A HZ1  1  
ATOM   133   H  HZ2  . LYS A 1 10  ? -19.992 29.516 32.453 1.00 0.00 ? 10  LYS A HZ2  1  
ATOM   134   H  HZ3  . LYS A 1 10  ? -20.928 29.497 31.036 1.00 0.00 ? 10  LYS A HZ3  1  
ATOM   135   N  N    . GLU A 1 11  ? -15.159 30.429 31.449 1.00 0.00 ? 11  GLU A N    1  
ATOM   136   C  CA   . GLU A 1 11  ? -13.884 30.817 32.100 1.00 0.00 ? 11  GLU A CA   1  
ATOM   137   C  C    . GLU A 1 11  ? -12.718 30.152 31.391 1.00 0.00 ? 11  GLU A C    1  
ATOM   138   O  O    . GLU A 1 11  ? -11.641 30.706 31.291 1.00 0.00 ? 11  GLU A O    1  
ATOM   139   C  CB   . GLU A 1 11  ? -13.914 30.333 33.560 1.00 0.00 ? 11  GLU A CB   1  
ATOM   140   C  CG   . GLU A 1 11  ? -12.996 31.221 34.405 1.00 0.00 ? 11  GLU A CG   1  
ATOM   141   C  CD   . GLU A 1 11  ? -13.026 30.738 35.858 1.00 0.00 ? 11  GLU A CD   1  
ATOM   142   O  OE1  . GLU A 1 11  ? -13.803 29.833 36.113 1.00 0.00 ? 11  GLU A OE1  1  
ATOM   143   O  OE2  . GLU A 1 11  ? -12.266 31.300 36.630 1.00 0.00 ? 11  GLU A OE2  1  
ATOM   144   H  H    . GLU A 1 11  ? -15.746 29.749 31.867 1.00 0.00 ? 11  GLU A H    1  
ATOM   145   H  HA   . GLU A 1 11  ? -13.767 31.900 32.047 1.00 0.00 ? 11  GLU A HA   1  
ATOM   146   H  HB2  . GLU A 1 11  ? -14.922 30.387 33.939 1.00 0.00 ? 11  GLU A HB2  1  
ATOM   147   H  HB3  . GLU A 1 11  ? -13.572 29.310 33.608 1.00 0.00 ? 11  GLU A HB3  1  
ATOM   148   H  HG2  . GLU A 1 11  ? -11.985 31.164 34.031 1.00 0.00 ? 11  GLU A HG2  1  
ATOM   149   H  HG3  . GLU A 1 11  ? -13.336 32.246 34.363 1.00 0.00 ? 11  GLU A HG3  1  
ATOM   150   N  N    . ILE A 1 12  ? -12.962 28.968 30.908 1.00 0.00 ? 12  ILE A N    1  
ATOM   151   C  CA   . ILE A 1 12  ? -11.900 28.225 30.194 1.00 0.00 ? 12  ILE A CA   1  
ATOM   152   C  C    . ILE A 1 12  ? -11.795 28.688 28.767 1.00 0.00 ? 12  ILE A C    1  
ATOM   153   O  O    . ILE A 1 12  ? -10.734 29.056 28.327 1.00 0.00 ? 12  ILE A O    1  
ATOM   154   C  CB   . ILE A 1 12  ? -12.265 26.745 30.224 1.00 0.00 ? 12  ILE A CB   1  
ATOM   155   C  CG1  . ILE A 1 12  ? -12.873 26.407 31.580 1.00 0.00 ? 12  ILE A CG1  1  
ATOM   156   C  CG2  . ILE A 1 12  ? -10.984 25.913 30.032 1.00 0.00 ? 12  ILE A CG2  1  
ATOM   157   C  CD1  . ILE A 1 12  ? -12.709 24.912 31.856 1.00 0.00 ? 12  ILE A CD1  1  
ATOM   158   H  H    . ILE A 1 12  ? -13.851 28.570 31.015 1.00 0.00 ? 12  ILE A H    1  
ATOM   159   H  HA   . ILE A 1 12  ? -10.938 28.403 30.683 1.00 0.00 ? 12  ILE A HA   1  
ATOM   160   H  HB   . ILE A 1 12  ? -12.995 26.536 29.436 1.00 0.00 ? 12  ILE A HB   1  
ATOM   161   H  HG12 . ILE A 1 12  ? -12.373 26.975 32.350 1.00 0.00 ? 12  ILE A HG12 1  
ATOM   162   H  HG13 . ILE A 1 12  ? -13.922 26.662 31.578 1.00 0.00 ? 12  ILE A HG13 1  
ATOM   163   H  HG21 . ILE A 1 12  ? -10.447 26.266 29.165 1.00 0.00 ? 12  ILE A HG21 1  
ATOM   164   H  HG22 . ILE A 1 12  ? -10.354 26.006 30.904 1.00 0.00 ? 12  ILE A HG22 1  
ATOM   165   H  HG23 . ILE A 1 12  ? -11.244 24.873 29.890 1.00 0.00 ? 12  ILE A HG23 1  
ATOM   166   H  HD11 . ILE A 1 12  ? -13.057 24.344 31.006 1.00 0.00 ? 12  ILE A HD11 1  
ATOM   167   H  HD12 . ILE A 1 12  ? -11.670 24.684 32.037 1.00 0.00 ? 12  ILE A HD12 1  
ATOM   168   H  HD13 . ILE A 1 12  ? -13.287 24.639 32.726 1.00 0.00 ? 12  ILE A HD13 1  
ATOM   169   N  N    . LEU A 1 13  ? -12.885 28.674 28.053 1.00 0.00 ? 13  LEU A N    1  
ATOM   170   C  CA   . LEU A 1 13  ? -12.791 29.127 26.658 1.00 0.00 ? 13  LEU A CA   1  
ATOM   171   C  C    . LEU A 1 13  ? -12.079 30.457 26.621 1.00 0.00 ? 13  LEU A C    1  
ATOM   172   O  O    . LEU A 1 13  ? -11.449 30.795 25.658 1.00 0.00 ? 13  LEU A O    1  
ATOM   173   C  CB   . LEU A 1 13  ? -14.189 29.309 26.068 1.00 0.00 ? 13  LEU A CB   1  
ATOM   174   C  CG   . LEU A 1 13  ? -14.597 28.029 25.336 1.00 0.00 ? 13  LEU A CG   1  
ATOM   175   C  CD1  . LEU A 1 13  ? -15.985 28.222 24.732 1.00 0.00 ? 13  LEU A CD1  1  
ATOM   176   C  CD2  . LEU A 1 13  ? -13.594 27.746 24.211 1.00 0.00 ? 13  LEU A CD2  1  
ATOM   177   H  H    . LEU A 1 13  ? -13.737 28.374 28.433 1.00 0.00 ? 13  LEU A H    1  
ATOM   178   H  HA   . LEU A 1 13  ? -12.212 28.394 26.090 1.00 0.00 ? 13  LEU A HA   1  
ATOM   179   H  HB2  . LEU A 1 13  ? -14.889 29.523 26.853 1.00 0.00 ? 13  LEU A HB2  1  
ATOM   180   H  HB3  . LEU A 1 13  ? -14.177 30.135 25.371 1.00 0.00 ? 13  LEU A HB3  1  
ATOM   181   H  HG   . LEU A 1 13  ? -14.613 27.200 26.030 1.00 0.00 ? 13  LEU A HG   1  
ATOM   182   H  HD11 . LEU A 1 13  ? -16.560 28.898 25.347 1.00 0.00 ? 13  LEU A HD11 1  
ATOM   183   H  HD12 . LEU A 1 13  ? -15.895 28.636 23.738 1.00 0.00 ? 13  LEU A HD12 1  
ATOM   184   H  HD13 . LEU A 1 13  ? -16.493 27.271 24.678 1.00 0.00 ? 13  LEU A HD13 1  
ATOM   185   H  HD21 . LEU A 1 13  ? -13.034 28.643 23.986 1.00 0.00 ? 13  LEU A HD21 1  
ATOM   186   H  HD22 . LEU A 1 13  ? -12.909 26.969 24.520 1.00 0.00 ? 13  LEU A HD22 1  
ATOM   187   H  HD23 . LEU A 1 13  ? -14.120 27.423 23.325 1.00 0.00 ? 13  LEU A HD23 1  
ATOM   188   N  N    . GLU A 1 14  ? -12.204 31.202 27.687 1.00 0.00 ? 14  GLU A N    1  
ATOM   189   C  CA   . GLU A 1 14  ? -11.535 32.515 27.724 1.00 0.00 ? 14  GLU A CA   1  
ATOM   190   C  C    . GLU A 1 14  ? -10.085 32.334 27.328 1.00 0.00 ? 14  GLU A C    1  
ATOM   191   O  O    . GLU A 1 14  ? -9.404  33.276 26.974 1.00 0.00 ? 14  GLU A O    1  
ATOM   192   C  CB   . GLU A 1 14  ? -11.599 33.057 29.163 1.00 0.00 ? 14  GLU A CB   1  
ATOM   193   C  CG   . GLU A 1 14  ? -11.324 34.562 29.144 1.00 0.00 ? 14  GLU A CG   1  
ATOM   194   C  CD   . GLU A 1 14  ? -12.416 35.265 28.336 1.00 0.00 ? 14  GLU A CD   1  
ATOM   195   O  OE1  . GLU A 1 14  ? -13.522 35.311 28.848 1.00 0.00 ? 14  GLU A OE1  1  
ATOM   196   O  OE2  . GLU A 1 14  ? -12.082 35.715 27.254 1.00 0.00 ? 14  GLU A OE2  1  
ATOM   197   H  H    . GLU A 1 14  ? -12.737 30.895 28.449 1.00 0.00 ? 14  GLU A H    1  
ATOM   198   H  HA   . GLU A 1 14  ? -12.021 33.191 27.022 1.00 0.00 ? 14  GLU A HA   1  
ATOM   199   H  HB2  . GLU A 1 14  ? -12.580 32.873 29.576 1.00 0.00 ? 14  GLU A HB2  1  
ATOM   200   H  HB3  . GLU A 1 14  ? -10.859 32.560 29.771 1.00 0.00 ? 14  GLU A HB3  1  
ATOM   201   H  HG2  . GLU A 1 14  ? -11.324 34.946 30.153 1.00 0.00 ? 14  GLU A HG2  1  
ATOM   202   H  HG3  . GLU A 1 14  ? -10.363 34.753 28.689 1.00 0.00 ? 14  GLU A HG3  1  
ATOM   203   N  N    . GLU A 1 15  ? -9.640  31.107 27.405 1.00 0.00 ? 15  GLU A N    1  
ATOM   204   C  CA   . GLU A 1 15  ? -8.240  30.807 27.044 1.00 0.00 ? 15  GLU A CA   1  
ATOM   205   C  C    . GLU A 1 15  ? -8.102  30.597 25.530 1.00 0.00 ? 15  GLU A C    1  
ATOM   206   O  O    . GLU A 1 15  ? -7.004  30.476 25.022 1.00 0.00 ? 15  GLU A O    1  
ATOM   207   C  CB   . GLU A 1 15  ? -7.825  29.518 27.778 1.00 0.00 ? 15  GLU A CB   1  
ATOM   208   C  CG   . GLU A 1 15  ? -7.720  29.810 29.275 1.00 0.00 ? 15  GLU A CG   1  
ATOM   209   C  CD   . GLU A 1 15  ? -6.302  30.285 29.598 1.00 0.00 ? 15  GLU A CD   1  
ATOM   210   O  OE1  . GLU A 1 15  ? -5.445  29.420 29.669 1.00 0.00 ? 15  GLU A OE1  1  
ATOM   211   O  OE2  . GLU A 1 15  ? -6.157  31.487 29.757 1.00 0.00 ? 15  GLU A OE2  1  
ATOM   212   H  H    . GLU A 1 15  ? -10.236 30.383 27.717 1.00 0.00 ? 15  GLU A H    1  
ATOM   213   H  HA   . GLU A 1 15  ? -7.610  31.644 27.344 1.00 0.00 ? 15  GLU A HA   1  
ATOM   214   H  HB2  . GLU A 1 15  ? -8.561  28.750 27.611 1.00 0.00 ? 15  GLU A HB2  1  
ATOM   215   H  HB3  . GLU A 1 15  ? -6.876  29.179 27.409 1.00 0.00 ? 15  GLU A HB3  1  
ATOM   216   H  HG2  . GLU A 1 15  ? -8.425  30.581 29.548 1.00 0.00 ? 15  GLU A HG2  1  
ATOM   217   H  HG3  . GLU A 1 15  ? -7.934  28.914 29.838 1.00 0.00 ? 15  GLU A HG3  1  
ATOM   218   N  N    . LEU A 1 16  ? -9.235  30.546 24.846 1.00 0.00 ? 16  LEU A N    1  
ATOM   219   C  CA   . LEU A 1 16  ? -9.221  30.345 23.358 1.00 0.00 ? 16  LEU A CA   1  
ATOM   220   C  C    . LEU A 1 16  ? -7.975  30.945 22.711 1.00 0.00 ? 16  LEU A C    1  
ATOM   221   O  O    . LEU A 1 16  ? -7.453  30.409 21.754 1.00 0.00 ? 16  LEU A O    1  
ATOM   222   C  CB   . LEU A 1 16  ? -10.478 31.027 22.742 1.00 0.00 ? 16  LEU A CB   1  
ATOM   223   C  CG   . LEU A 1 16  ? -10.301 32.564 22.690 1.00 0.00 ? 16  LEU A CG   1  
ATOM   224   C  CD1  . LEU A 1 16  ? -11.463 33.168 21.899 1.00 0.00 ? 16  LEU A CD1  1  
ATOM   225   C  CD2  . LEU A 1 16  ? -10.323 33.142 24.108 1.00 0.00 ? 16  LEU A CD2  1  
ATOM   226   H  H    . LEU A 1 16  ? -10.094 30.637 25.317 1.00 0.00 ? 16  LEU A H    1  
ATOM   227   H  HA   . LEU A 1 16  ? -9.240  29.272 23.156 1.00 0.00 ? 16  LEU A HA   1  
ATOM   228   H  HB2  . LEU A 1 16  ? -10.630 30.652 21.740 1.00 0.00 ? 16  LEU A HB2  1  
ATOM   229   H  HB3  . LEU A 1 16  ? -11.345 30.786 23.333 1.00 0.00 ? 16  LEU A HB3  1  
ATOM   230   H  HG   . LEU A 1 16  ? -9.372  32.817 22.206 1.00 0.00 ? 16  LEU A HG   1  
ATOM   231   H  HD11 . LEU A 1 16  ? -12.283 32.466 21.866 1.00 0.00 ? 16  LEU A HD11 1  
ATOM   232   H  HD12 . LEU A 1 16  ? -11.793 34.078 22.375 1.00 0.00 ? 16  LEU A HD12 1  
ATOM   233   H  HD13 . LEU A 1 16  ? -11.142 33.388 20.892 1.00 0.00 ? 16  LEU A HD13 1  
ATOM   234   H  HD21 . LEU A 1 16  ? -11.247 32.877 24.595 1.00 0.00 ? 16  LEU A HD21 1  
ATOM   235   H  HD22 . LEU A 1 16  ? -9.497  32.754 24.675 1.00 0.00 ? 16  LEU A HD22 1  
ATOM   236   H  HD23 . LEU A 1 16  ? -10.244 34.218 24.062 1.00 0.00 ? 16  LEU A HD23 1  
ATOM   237   N  N    . GLN A 1 17  ? -7.520  32.047 23.246 1.00 0.00 ? 17  GLN A N    1  
ATOM   238   C  CA   . GLN A 1 17  ? -6.313  32.687 22.668 1.00 0.00 ? 17  GLN A CA   1  
ATOM   239   C  C    . GLN A 1 17  ? -5.126  31.732 22.692 1.00 0.00 ? 17  GLN A C    1  
ATOM   240   O  O    . GLN A 1 17  ? -4.690  31.260 21.662 1.00 0.00 ? 17  GLN A O    1  
ATOM   241   C  CB   . GLN A 1 17  ? -5.962  33.925 23.502 1.00 0.00 ? 17  GLN A CB   1  
ATOM   242   C  CG   . GLN A 1 17  ? -6.665  35.150 22.916 1.00 0.00 ? 17  GLN A CG   1  
ATOM   243   C  CD   . GLN A 1 17  ? -6.208  36.401 23.672 1.00 0.00 ? 17  GLN A CD   1  
ATOM   244   O  OE1  . GLN A 1 17  ? -5.029  36.631 23.859 1.00 0.00 ? 17  GLN A OE1  1  
ATOM   245   N  NE2  . GLN A 1 17  ? -7.107  37.232 24.125 1.00 0.00 ? 17  GLN A NE2  1  
ATOM   246   H  H    . GLN A 1 17  ? -7.970  32.445 24.021 1.00 0.00 ? 17  GLN A H    1  
ATOM   247   H  HA   . GLN A 1 17  ? -6.522  32.964 21.635 1.00 0.00 ? 17  GLN A HA   1  
ATOM   248   H  HB2  . GLN A 1 17  ? -6.281  33.779 24.524 1.00 0.00 ? 17  GLN A HB2  1  
ATOM   249   H  HB3  . GLN A 1 17  ? -4.895  34.080 23.482 1.00 0.00 ? 17  GLN A HB3  1  
ATOM   250   H  HG2  . GLN A 1 17  ? -6.409  35.253 21.872 1.00 0.00 ? 17  GLN A HG2  1  
ATOM   251   H  HG3  . GLN A 1 17  ? -7.734  35.042 23.014 1.00 0.00 ? 17  GLN A HG3  1  
ATOM   252   H  HE21 . GLN A 1 17  ? -8.059  37.051 23.979 1.00 0.00 ? 17  GLN A HE21 1  
ATOM   253   H  HE22 . GLN A 1 17  ? -6.829  38.037 24.610 1.00 0.00 ? 17  GLN A HE22 1  
ATOM   254   N  N    . LEU A 1 18  ? -4.619  31.463 23.870 1.00 0.00 ? 18  LEU A N    1  
ATOM   255   C  CA   . LEU A 1 18  ? -3.459  30.538 23.964 1.00 0.00 ? 18  LEU A CA   1  
ATOM   256   C  C    . LEU A 1 18  ? -3.894  29.093 23.732 1.00 0.00 ? 18  LEU A C    1  
ATOM   257   O  O    . LEU A 1 18  ? -4.696  28.556 24.472 1.00 0.00 ? 18  LEU A O    1  
ATOM   258   C  CB   . LEU A 1 18  ? -2.830  30.644 25.375 1.00 0.00 ? 18  LEU A CB   1  
ATOM   259   C  CG   . LEU A 1 18  ? -3.447  31.819 26.141 1.00 0.00 ? 18  LEU A CG   1  
ATOM   260   C  CD1  . LEU A 1 18  ? -2.801  31.914 27.522 1.00 0.00 ? 18  LEU A CD1  1  
ATOM   261   C  CD2  . LEU A 1 18  ? -3.182  33.120 25.386 1.00 0.00 ? 18  LEU A CD2  1  
ATOM   262   H  H    . LEU A 1 18  ? -5.001  31.865 24.677 1.00 0.00 ? 18  LEU A H    1  
ATOM   263   H  HA   . LEU A 1 18  ? -2.732  30.812 23.197 1.00 0.00 ? 18  LEU A HA   1  
ATOM   264   H  HB2  . LEU A 1 18  ? -3.008  29.728 25.919 1.00 0.00 ? 18  LEU A HB2  1  
ATOM   265   H  HB3  . LEU A 1 18  ? -1.763  30.795 25.284 1.00 0.00 ? 18  LEU A HB3  1  
ATOM   266   H  HG   . LEU A 1 18  ? -4.511  31.666 26.249 1.00 0.00 ? 18  LEU A HG   1  
ATOM   267   H  HD11 . LEU A 1 18  ? -1.731  31.802 27.429 1.00 0.00 ? 18  LEU A HD11 1  
ATOM   268   H  HD12 . LEU A 1 18  ? -3.020  32.876 27.960 1.00 0.00 ? 18  LEU A HD12 1  
ATOM   269   H  HD13 . LEU A 1 18  ? -3.187  31.134 28.161 1.00 0.00 ? 18  LEU A HD13 1  
ATOM   270   H  HD21 . LEU A 1 18  ? -2.955  32.904 24.353 1.00 0.00 ? 18  LEU A HD21 1  
ATOM   271   H  HD22 . LEU A 1 18  ? -4.054  33.753 25.439 1.00 0.00 ? 18  LEU A HD22 1  
ATOM   272   H  HD23 . LEU A 1 18  ? -2.345  33.635 25.834 1.00 0.00 ? 18  LEU A HD23 1  
ATOM   273   N  N    . ASN A 1 19  ? -3.356  28.491 22.707 1.00 0.00 ? 19  ASN A N    1  
ATOM   274   C  CA   . ASN A 1 19  ? -3.721  27.082 22.408 1.00 0.00 ? 19  ASN A CA   1  
ATOM   275   C  C    . ASN A 1 19  ? -5.170  26.969 21.955 1.00 0.00 ? 19  ASN A C    1  
ATOM   276   O  O    . ASN A 1 19  ? -6.051  27.591 22.515 1.00 0.00 ? 19  ASN A O    1  
ATOM   277   C  CB   . ASN A 1 19  ? -3.541  26.251 23.686 1.00 0.00 ? 19  ASN A CB   1  
ATOM   278   C  CG   . ASN A 1 19  ? -3.022  24.862 23.312 1.00 0.00 ? 19  ASN A CG   1  
ATOM   279   O  OD1  . ASN A 1 19  ? -2.318  24.226 24.068 1.00 0.00 ? 19  ASN A OD1  1  
ATOM   280   N  ND2  . ASN A 1 19  ? -3.346  24.359 22.152 1.00 0.00 ? 19  ASN A ND2  1  
ATOM   281   H  H    . ASN A 1 19  ? -2.716  28.966 22.137 1.00 0.00 ? 19  ASN A H    1  
ATOM   282   H  HA   . ASN A 1 19  ? -3.075  26.712 21.614 1.00 0.00 ? 19  ASN A HA   1  
ATOM   283   H  HB2  . ASN A 1 19  ? -2.831  26.735 24.341 1.00 0.00 ? 19  ASN A HB2  1  
ATOM   284   H  HB3  . ASN A 1 19  ? -4.488  26.153 24.195 1.00 0.00 ? 19  ASN A HB3  1  
ATOM   285   H  HD21 . ASN A 1 19  ? -3.913  24.870 21.536 1.00 0.00 ? 19  ASN A HD21 1  
ATOM   286   H  HD22 . ASN A 1 19  ? -3.023  23.471 21.897 1.00 0.00 ? 19  ASN A HD22 1  
ATOM   287   N  N    . THR A 1 20  ? -5.389  26.167 20.943 1.00 0.00 ? 20  THR A N    1  
ATOM   288   C  CA   . THR A 1 20  ? -6.769  25.991 20.430 1.00 0.00 ? 20  THR A CA   1  
ATOM   289   C  C    . THR A 1 20  ? -7.414  24.754 21.040 1.00 0.00 ? 20  THR A C    1  
ATOM   290   O  O    . THR A 1 20  ? -7.114  23.642 20.657 1.00 0.00 ? 20  THR A O    1  
ATOM   291   C  CB   . THR A 1 20  ? -6.700  25.811 18.910 1.00 0.00 ? 20  THR A CB   1  
ATOM   292   O  OG1  . THR A 1 20  ? -6.188  27.030 18.413 1.00 0.00 ? 20  THR A OG1  1  
ATOM   293   C  CG2  . THR A 1 20  ? -8.110  25.710 18.308 1.00 0.00 ? 20  THR A CG2  1  
ATOM   294   H  H    . THR A 1 20  ? -4.643  25.688 20.525 1.00 0.00 ? 20  THR A H    1  
ATOM   295   H  HA   . THR A 1 20  ? -7.361  26.868 20.692 1.00 0.00 ? 20  THR A HA   1  
ATOM   296   H  HB   . THR A 1 20  ? -6.061  24.978 18.630 1.00 0.00 ? 20  THR A HB   1  
ATOM   297   H  HG1  . THR A 1 20  ? -5.593  27.394 19.074 1.00 0.00 ? 20  THR A HG1  1  
ATOM   298   H  HG21 . THR A 1 20  ? -8.717  26.533 18.656 1.00 0.00 ? 20  THR A HG21 1  
ATOM   299   H  HG22 . THR A 1 20  ? -8.051  25.742 17.231 1.00 0.00 ? 20  THR A HG22 1  
ATOM   300   H  HG23 . THR A 1 20  ? -8.568  24.779 18.612 1.00 0.00 ? 20  THR A HG23 1  
ATOM   301   N  N    . LYS A 1 21  ? -8.288  24.971 21.980 1.00 0.00 ? 21  LYS A N    1  
ATOM   302   C  CA   . LYS A 1 21  ? -8.965  23.820 22.629 1.00 0.00 ? 21  LYS A CA   1  
ATOM   303   C  C    . LYS A 1 21  ? -9.457  22.816 21.594 1.00 0.00 ? 21  LYS A C    1  
ATOM   304   O  O    . LYS A 1 21  ? -9.959  23.193 20.554 1.00 0.00 ? 21  LYS A O    1  
ATOM   305   C  CB   . LYS A 1 21  ? -10.177 24.357 23.408 1.00 0.00 ? 21  LYS A CB   1  
ATOM   306   C  CG   . LYS A 1 21  ? -9.736  24.730 24.823 1.00 0.00 ? 21  LYS A CG   1  
ATOM   307   C  CD   . LYS A 1 21  ? -8.534  25.674 24.744 1.00 0.00 ? 21  LYS A CD   1  
ATOM   308   C  CE   . LYS A 1 21  ? -8.233  26.217 26.139 1.00 0.00 ? 21  LYS A CE   1  
ATOM   309   N  NZ   . LYS A 1 21  ? -8.272  25.119 27.146 1.00 0.00 ? 21  LYS A NZ   1  
ATOM   310   H  H    . LYS A 1 21  ? -8.500  25.888 22.257 1.00 0.00 ? 21  LYS A H    1  
ATOM   311   H  HA   . LYS A 1 21  ? -8.264  23.325 23.299 1.00 0.00 ? 21  LYS A HA   1  
ATOM   312   H  HB2  . LYS A 1 21  ? -10.572 25.231 22.909 1.00 0.00 ? 21  LYS A HB2  1  
ATOM   313   H  HB3  . LYS A 1 21  ? -10.945 23.598 23.454 1.00 0.00 ? 21  LYS A HB3  1  
ATOM   314   H  HG2  . LYS A 1 21  ? -10.548 25.221 25.339 1.00 0.00 ? 21  LYS A HG2  1  
ATOM   315   H  HG3  . LYS A 1 21  ? -9.461  23.838 25.365 1.00 0.00 ? 21  LYS A HG3  1  
ATOM   316   H  HD2  . LYS A 1 21  ? -7.673  25.137 24.372 1.00 0.00 ? 21  LYS A HD2  1  
ATOM   317   H  HD3  . LYS A 1 21  ? -8.757  26.492 24.077 1.00 0.00 ? 21  LYS A HD3  1  
ATOM   318   H  HE2  . LYS A 1 21  ? -7.252  26.668 26.147 1.00 0.00 ? 21  LYS A HE2  1  
ATOM   319   H  HE3  . LYS A 1 21  ? -8.967  26.963 26.402 1.00 0.00 ? 21  LYS A HE3  1  
ATOM   320   H  HZ1  . LYS A 1 21  ? -9.054  24.472 26.924 1.00 0.00 ? 21  LYS A HZ1  1  
ATOM   321   H  HZ2  . LYS A 1 21  ? -7.373  24.596 27.124 1.00 0.00 ? 21  LYS A HZ2  1  
ATOM   322   H  HZ3  . LYS A 1 21  ? -8.416  25.523 28.094 1.00 0.00 ? 21  LYS A HZ3  1  
ATOM   323   N  N    . PHE A 1 22  ? -9.297  21.551 21.901 1.00 0.00 ? 22  PHE A N    1  
ATOM   324   C  CA   . PHE A 1 22  ? -9.748  20.499 20.953 1.00 0.00 ? 22  PHE A CA   1  
ATOM   325   C  C    . PHE A 1 22  ? -11.093 20.877 20.352 1.00 0.00 ? 22  PHE A C    1  
ATOM   326   O  O    . PHE A 1 22  ? -11.270 20.875 19.150 1.00 0.00 ? 22  PHE A O    1  
ATOM   327   C  CB   . PHE A 1 22  ? -9.919  19.190 21.742 1.00 0.00 ? 22  PHE A CB   1  
ATOM   328   C  CG   . PHE A 1 22  ? -8.699  18.293 21.520 1.00 0.00 ? 22  PHE A CG   1  
ATOM   329   C  CD1  . PHE A 1 22  ? -7.460  18.651 22.024 1.00 0.00 ? 22  PHE A CD1  1  
ATOM   330   C  CD2  . PHE A 1 22  ? -8.821  17.104 20.821 1.00 0.00 ? 22  PHE A CD2  1  
ATOM   331   C  CE1  . PHE A 1 22  ? -6.365  17.834 21.832 1.00 0.00 ? 22  PHE A CE1  1  
ATOM   332   C  CE2  . PHE A 1 22  ? -7.725  16.291 20.632 1.00 0.00 ? 22  PHE A CE2  1  
ATOM   333   C  CZ   . PHE A 1 22  ? -6.499  16.656 21.136 1.00 0.00 ? 22  PHE A CZ   1  
ATOM   334   H  H    . PHE A 1 22  ? -8.881  21.301 22.753 1.00 0.00 ? 22  PHE A H    1  
ATOM   335   H  HA   . PHE A 1 22  ? -9.015  20.388 20.159 1.00 0.00 ? 22  PHE A HA   1  
ATOM   336   H  HB2  . PHE A 1 22  ? -10.011 19.410 22.796 1.00 0.00 ? 22  PHE A HB2  1  
ATOM   337   H  HB3  . PHE A 1 22  ? -10.807 18.675 21.407 1.00 0.00 ? 22  PHE A HB3  1  
ATOM   338   H  HD1  . PHE A 1 22  ? -7.351  19.574 22.574 1.00 0.00 ? 22  PHE A HD1  1  
ATOM   339   H  HD2  . PHE A 1 22  ? -9.781  16.811 20.424 1.00 0.00 ? 22  PHE A HD2  1  
ATOM   340   H  HE1  . PHE A 1 22  ? -5.402  18.120 22.228 1.00 0.00 ? 22  PHE A HE1  1  
ATOM   341   H  HE2  . PHE A 1 22  ? -7.830  15.365 20.089 1.00 0.00 ? 22  PHE A HE2  1  
ATOM   342   H  HZ   . PHE A 1 22  ? -5.642  16.017 20.985 1.00 0.00 ? 22  PHE A HZ   1  
ATOM   343   N  N    . THR A 1 23  ? -12.009 21.191 21.211 1.00 0.00 ? 23  THR A N    1  
ATOM   344   C  CA   . THR A 1 23  ? -13.359 21.577 20.752 1.00 0.00 ? 23  THR A CA   1  
ATOM   345   C  C    . THR A 1 23  ? -14.156 22.134 21.916 1.00 0.00 ? 23  THR A C    1  
ATOM   346   O  O    . THR A 1 23  ? -14.356 21.464 22.905 1.00 0.00 ? 23  THR A O    1  
ATOM   347   C  CB   . THR A 1 23  ? -14.067 20.342 20.213 1.00 0.00 ? 23  THR A CB   1  
ATOM   348   O  OG1  . THR A 1 23  ? -13.076 19.338 20.140 1.00 0.00 ? 23  THR A OG1  1  
ATOM   349   C  CG2  . THR A 1 23  ? -14.510 20.558 18.759 1.00 0.00 ? 23  THR A CG2  1  
ATOM   350   H  H    . THR A 1 23  ? -11.806 21.171 22.168 1.00 0.00 ? 23  THR A H    1  
ATOM   351   H  HA   . THR A 1 23  ? -13.274 22.336 19.986 1.00 0.00 ? 23  THR A HA   1  
ATOM   352   H  HB   . THR A 1 23  ? -14.877 20.042 20.856 1.00 0.00 ? 23  THR A HB   1  
ATOM   353   H  HG1  . THR A 1 23  ? -13.309 18.746 19.422 1.00 0.00 ? 23  THR A HG1  1  
ATOM   354   H  HG21 . THR A 1 23  ? -15.025 21.504 18.669 1.00 0.00 ? 23  THR A HG21 1  
ATOM   355   H  HG22 . THR A 1 23  ? -13.647 20.561 18.110 1.00 0.00 ? 23  THR A HG22 1  
ATOM   356   H  HG23 . THR A 1 23  ? -15.176 19.761 18.458 1.00 0.00 ? 23  THR A HG23 1  
ATOM   357   N  N    . GLU A 1 24  ? -14.590 23.350 21.788 1.00 0.00 ? 24  GLU A N    1  
ATOM   358   C  CA   . GLU A 1 24  ? -15.374 23.953 22.887 1.00 0.00 ? 24  GLU A CA   1  
ATOM   359   C  C    . GLU A 1 24  ? -16.468 22.999 23.356 1.00 0.00 ? 24  GLU A C    1  
ATOM   360   O  O    . GLU A 1 24  ? -16.940 23.089 24.473 1.00 0.00 ? 24  GLU A O    1  
ATOM   361   C  CB   . GLU A 1 24  ? -16.020 25.241 22.370 1.00 0.00 ? 24  GLU A CB   1  
ATOM   362   C  CG   . GLU A 1 24  ? -16.895 24.910 21.157 1.00 0.00 ? 24  GLU A CG   1  
ATOM   363   C  CD   . GLU A 1 24  ? -16.558 25.868 20.013 1.00 0.00 ? 24  GLU A CD   1  
ATOM   364   O  OE1  . GLU A 1 24  ? -16.231 26.999 20.331 1.00 0.00 ? 24  GLU A OE1  1  
ATOM   365   O  OE2  . GLU A 1 24  ? -16.647 25.414 18.884 1.00 0.00 ? 24  GLU A OE2  1  
ATOM   366   H  H    . GLU A 1 24  ? -14.400 23.862 20.972 1.00 0.00 ? 24  GLU A H    1  
ATOM   367   H  HA   . GLU A 1 24  ? -14.707 24.164 23.724 1.00 0.00 ? 24  GLU A HA   1  
ATOM   368   H  HB2  . GLU A 1 24  ? -16.624 25.681 23.148 1.00 0.00 ? 24  GLU A HB2  1  
ATOM   369   H  HB3  . GLU A 1 24  ? -15.247 25.941 22.081 1.00 0.00 ? 24  GLU A HB3  1  
ATOM   370   H  HG2  . GLU A 1 24  ? -16.711 23.895 20.837 1.00 0.00 ? 24  GLU A HG2  1  
ATOM   371   H  HG3  . GLU A 1 24  ? -17.938 25.018 21.416 1.00 0.00 ? 24  GLU A HG3  1  
ATOM   372   N  N    . GLU A 1 25  ? -16.853 22.101 22.489 1.00 0.00 ? 25  GLU A N    1  
ATOM   373   C  CA   . GLU A 1 25  ? -17.911 21.133 22.863 1.00 0.00 ? 25  GLU A CA   1  
ATOM   374   C  C    . GLU A 1 25  ? -17.296 19.896 23.512 1.00 0.00 ? 25  GLU A C    1  
ATOM   375   O  O    . GLU A 1 25  ? -17.974 18.919 23.760 1.00 0.00 ? 25  GLU A O    1  
ATOM   376   C  CB   . GLU A 1 25  ? -18.652 20.708 21.581 1.00 0.00 ? 25  GLU A CB   1  
ATOM   377   C  CG   . GLU A 1 25  ? -20.140 21.030 21.731 1.00 0.00 ? 25  GLU A CG   1  
ATOM   378   C  CD   . GLU A 1 25  ? -20.367 22.518 21.449 1.00 0.00 ? 25  GLU A CD   1  
ATOM   379   O  OE1  . GLU A 1 25  ? -19.766 22.986 20.496 1.00 0.00 ? 25  GLU A OE1  1  
ATOM   380   O  OE2  . GLU A 1 25  ? -21.127 23.101 22.203 1.00 0.00 ? 25  GLU A OE2  1  
ATOM   381   H  H    . GLU A 1 25  ? -16.447 22.069 21.598 1.00 0.00 ? 25  GLU A H    1  
ATOM   382   H  HA   . GLU A 1 25  ? -18.595 21.606 23.568 1.00 0.00 ? 25  GLU A HA   1  
ATOM   383   H  HB2  . GLU A 1 25  ? -18.249 21.242 20.734 1.00 0.00 ? 25  GLU A HB2  1  
ATOM   384   H  HB3  . GLU A 1 25  ? -18.526 19.645 21.421 1.00 0.00 ? 25  GLU A HB3  1  
ATOM   385   H  HG2  . GLU A 1 25  ? -20.714 20.441 21.027 1.00 0.00 ? 25  GLU A HG2  1  
ATOM   386   H  HG3  . GLU A 1 25  ? -20.465 20.803 22.734 1.00 0.00 ? 25  GLU A HG3  1  
ATOM   387   N  N    . GLU A 1 26  ? -16.018 19.962 23.769 1.00 0.00 ? 26  GLU A N    1  
ATOM   388   C  CA   . GLU A 1 26  ? -15.337 18.805 24.400 1.00 0.00 ? 26  GLU A CA   1  
ATOM   389   C  C    . GLU A 1 26  ? -15.365 18.905 25.919 1.00 0.00 ? 26  GLU A C    1  
ATOM   390   O  O    . GLU A 1 26  ? -15.922 18.057 26.587 1.00 0.00 ? 26  GLU A O    1  
ATOM   391   C  CB   . GLU A 1 26  ? -13.873 18.790 23.930 1.00 0.00 ? 26  GLU A CB   1  
ATOM   392   C  CG   . GLU A 1 26  ? -13.306 17.378 24.099 1.00 0.00 ? 26  GLU A CG   1  
ATOM   393   C  CD   . GLU A 1 26  ? -13.016 17.123 25.579 1.00 0.00 ? 26  GLU A CD   1  
ATOM   394   O  OE1  . GLU A 1 26  ? -12.222 17.881 26.113 1.00 0.00 ? 26  GLU A OE1  1  
ATOM   395   O  OE2  . GLU A 1 26  ? -13.604 16.185 26.094 1.00 0.00 ? 26  GLU A OE2  1  
ATOM   396   H  H    . GLU A 1 26  ? -15.513 20.772 23.550 1.00 0.00 ? 26  GLU A H    1  
ATOM   397   H  HA   . GLU A 1 26  ? -15.845 17.893 24.098 1.00 0.00 ? 26  GLU A HA   1  
ATOM   398   H  HB2  . GLU A 1 26  ? -13.821 19.079 22.892 1.00 0.00 ? 26  GLU A HB2  1  
ATOM   399   H  HB3  . GLU A 1 26  ? -13.297 19.486 24.522 1.00 0.00 ? 26  GLU A HB3  1  
ATOM   400   H  HG2  . GLU A 1 26  ? -14.023 16.651 23.746 1.00 0.00 ? 26  GLU A HG2  1  
ATOM   401   H  HG3  . GLU A 1 26  ? -12.392 17.279 23.534 1.00 0.00 ? 26  GLU A HG3  1  
ATOM   402   N  N    . LEU A 1 27  ? -14.765 19.942 26.443 1.00 0.00 ? 27  LEU A N    1  
ATOM   403   C  CA   . LEU A 1 27  ? -14.756 20.097 27.920 1.00 0.00 ? 27  LEU A CA   1  
ATOM   404   C  C    . LEU A 1 27  ? -16.171 20.282 28.446 1.00 0.00 ? 27  LEU A C    1  
ATOM   405   O  O    . LEU A 1 27  ? -16.370 20.606 29.600 1.00 0.00 ? 27  LEU A O    1  
ATOM   406   C  CB   . LEU A 1 27  ? -13.903 21.326 28.318 1.00 0.00 ? 27  LEU A CB   1  
ATOM   407   C  CG   . LEU A 1 27  ? -13.704 22.256 27.113 1.00 0.00 ? 27  LEU A CG   1  
ATOM   408   C  CD1  . LEU A 1 27  ? -15.062 22.801 26.666 1.00 0.00 ? 27  LEU A CD1  1  
ATOM   409   C  CD2  . LEU A 1 27  ? -12.799 23.428 27.529 1.00 0.00 ? 27  LEU A CD2  1  
ATOM   410   H  H    . LEU A 1 27  ? -14.336 20.601 25.870 1.00 0.00 ? 27  LEU A H    1  
ATOM   411   H  HA   . LEU A 1 27  ? -14.344 19.188 28.359 1.00 0.00 ? 27  LEU A HA   1  
ATOM   412   H  HB2  . LEU A 1 27  ? -14.401 21.867 29.108 1.00 0.00 ? 27  LEU A HB2  1  
ATOM   413   H  HB3  . LEU A 1 27  ? -12.943 20.993 28.675 1.00 0.00 ? 27  LEU A HB3  1  
ATOM   414   H  HG   . LEU A 1 27  ? -13.241 21.713 26.304 1.00 0.00 ? 27  LEU A HG   1  
ATOM   415   H  HD11 . LEU A 1 27  ? -15.629 23.121 27.529 1.00 0.00 ? 27  LEU A HD11 1  
ATOM   416   H  HD12 . LEU A 1 27  ? -14.918 23.642 26.004 1.00 0.00 ? 27  LEU A HD12 1  
ATOM   417   H  HD13 . LEU A 1 27  ? -15.611 22.030 26.147 1.00 0.00 ? 27  LEU A HD13 1  
ATOM   418   H  HD21 . LEU A 1 27  ? -12.935 23.642 28.579 1.00 0.00 ? 27  LEU A HD21 1  
ATOM   419   H  HD22 . LEU A 1 27  ? -11.764 23.173 27.351 1.00 0.00 ? 27  LEU A HD22 1  
ATOM   420   H  HD23 . LEU A 1 27  ? -13.050 24.307 26.954 1.00 0.00 ? 27  LEU A HD23 1  
ATOM   421   N  N    . SER A 1 28  ? -17.131 20.073 27.588 1.00 0.00 ? 28  SER A N    1  
ATOM   422   C  CA   . SER A 1 28  ? -18.538 20.231 28.017 1.00 0.00 ? 28  SER A CA   1  
ATOM   423   C  C    . SER A 1 28  ? -19.053 18.934 28.628 1.00 0.00 ? 28  SER A C    1  
ATOM   424   O  O    . SER A 1 28  ? -19.426 18.894 29.783 1.00 0.00 ? 28  SER A O    1  
ATOM   425   C  CB   . SER A 1 28  ? -19.386 20.573 26.785 1.00 0.00 ? 28  SER A CB   1  
ATOM   426   O  OG   . SER A 1 28  ? -19.055 21.925 26.501 1.00 0.00 ? 28  SER A OG   1  
ATOM   427   H  H    . SER A 1 28  ? -16.922 19.818 26.667 1.00 0.00 ? 28  SER A H    1  
ATOM   428   H  HA   . SER A 1 28  ? -18.593 21.023 28.761 1.00 0.00 ? 28  SER A HA   1  
ATOM   429   H  HB2  . SER A 1 28  ? -19.122 19.940 25.949 1.00 0.00 ? 28  SER A HB2  1  
ATOM   430   H  HB3  . SER A 1 28  ? -20.438 20.485 27.007 1.00 0.00 ? 28  SER A HB3  1  
ATOM   431   H  HG   . SER A 1 28  ? -19.359 22.125 25.613 1.00 0.00 ? 28  SER A HG   1  
ATOM   432   N  N    . SER A 1 29  ? -19.067 17.893 27.839 1.00 0.00 ? 29  SER A N    1  
ATOM   433   C  CA   . SER A 1 29  ? -19.553 16.594 28.359 1.00 0.00 ? 29  SER A CA   1  
ATOM   434   C  C    . SER A 1 29  ? -18.493 15.951 29.239 1.00 0.00 ? 29  SER A C    1  
ATOM   435   O  O    . SER A 1 29  ? -18.767 15.031 29.985 1.00 0.00 ? 29  SER A O    1  
ATOM   436   C  CB   . SER A 1 29  ? -19.835 15.668 27.167 1.00 0.00 ? 29  SER A CB   1  
ATOM   437   O  OG   . SER A 1 29  ? -18.819 15.993 26.229 1.00 0.00 ? 29  SER A OG   1  
ATOM   438   H  H    . SER A 1 29  ? -18.758 17.970 26.911 1.00 0.00 ? 29  SER A H    1  
ATOM   439   H  HA   . SER A 1 29  ? -20.455 16.759 28.947 1.00 0.00 ? 29  SER A HA   1  
ATOM   440   H  HB2  . SER A 1 29  ? -19.755 14.631 27.461 1.00 0.00 ? 29  SER A HB2  1  
ATOM   441   H  HB3  . SER A 1 29  ? -20.810 15.868 26.749 1.00 0.00 ? 29  SER A HB3  1  
ATOM   442   H  HG   . SER A 1 29  ? -17.969 15.893 26.664 1.00 0.00 ? 29  SER A HG   1  
ATOM   443   N  N    . TRP A 1 30  ? -17.295 16.454 29.134 1.00 0.00 ? 30  TRP A N    1  
ATOM   444   C  CA   . TRP A 1 30  ? -16.188 15.901 29.948 1.00 0.00 ? 30  TRP A CA   1  
ATOM   445   C  C    . TRP A 1 30  ? -16.360 16.291 31.416 1.00 0.00 ? 30  TRP A C    1  
ATOM   446   O  O    . TRP A 1 30  ? -15.803 15.671 32.298 1.00 0.00 ? 30  TRP A O    1  
ATOM   447   C  CB   . TRP A 1 30  ? -14.875 16.504 29.416 1.00 0.00 ? 30  TRP A CB   1  
ATOM   448   C  CG   . TRP A 1 30  ? -13.656 15.709 29.920 1.00 0.00 ? 30  TRP A CG   1  
ATOM   449   C  CD1  . TRP A 1 30  ? -13.702 14.614 30.684 1.00 0.00 ? 30  TRP A CD1  1  
ATOM   450   C  CD2  . TRP A 1 30  ? -12.419 16.041 29.658 1.00 0.00 ? 30  TRP A CD2  1  
ATOM   451   N  NE1  . TRP A 1 30  ? -12.401 14.306 30.866 1.00 0.00 ? 30  TRP A NE1  1  
ATOM   452   C  CE2  . TRP A 1 30  ? -11.520 15.173 30.242 1.00 0.00 ? 30  TRP A CE2  1  
ATOM   453   C  CE3  . TRP A 1 30  ? -11.965 17.105 28.906 1.00 0.00 ? 30  TRP A CE3  1  
ATOM   454   C  CZ2  . TRP A 1 30  ? -10.164 15.375 30.073 1.00 0.00 ? 30  TRP A CZ2  1  
ATOM   455   C  CZ3  . TRP A 1 30  ? -10.613 17.303 28.738 1.00 0.00 ? 30  TRP A CZ3  1  
ATOM   456   C  CH2  . TRP A 1 30  ? -9.712  16.439 29.320 1.00 0.00 ? 30  TRP A CH2  1  
ATOM   457   H  H    . TRP A 1 30  ? -17.125 17.196 28.516 1.00 0.00 ? 30  TRP A H    1  
ATOM   458   H  HA   . TRP A 1 30  ? -16.189 14.818 29.858 1.00 0.00 ? 30  TRP A HA   1  
ATOM   459   H  HB2  . TRP A 1 30  ? -14.882 16.489 28.336 1.00 0.00 ? 30  TRP A HB2  1  
ATOM   460   H  HB3  . TRP A 1 30  ? -14.788 17.528 29.751 1.00 0.00 ? 30  TRP A HB3  1  
ATOM   461   H  HD1  . TRP A 1 30  ? -14.568 14.104 31.085 1.00 0.00 ? 30  TRP A HD1  1  
ATOM   462   H  HE1  . TRP A 1 30  ? -12.105 13.533 31.393 1.00 0.00 ? 30  TRP A HE1  1  
ATOM   463   H  HE3  . TRP A 1 30  ? -12.670 17.779 28.447 1.00 0.00 ? 30  TRP A HE3  1  
ATOM   464   H  HZ2  . TRP A 1 30  ? -9.458  14.703 30.529 1.00 0.00 ? 30  TRP A HZ2  1  
ATOM   465   H  HZ3  . TRP A 1 30  ? -10.260 18.135 28.147 1.00 0.00 ? 30  TRP A HZ3  1  
ATOM   466   H  HH2  . TRP A 1 30  ? -8.652  16.596 29.188 1.00 0.00 ? 30  TRP A HH2  1  
ATOM   467   N  N    . TYR A 1 31  ? -17.137 17.315 31.650 1.00 0.00 ? 31  TYR A N    1  
ATOM   468   C  CA   . TYR A 1 31  ? -17.355 17.756 33.050 1.00 0.00 ? 31  TYR A CA   1  
ATOM   469   C  C    . TYR A 1 31  ? -18.256 16.781 33.796 1.00 0.00 ? 31  TYR A C    1  
ATOM   470   O  O    . TYR A 1 31  ? -17.957 16.377 34.903 1.00 0.00 ? 31  TYR A O    1  
ATOM   471   C  CB   . TYR A 1 31  ? -18.040 19.131 33.031 1.00 0.00 ? 31  TYR A CB   1  
ATOM   472   C  CG   . TYR A 1 31  ? -18.272 19.589 34.473 1.00 0.00 ? 31  TYR A CG   1  
ATOM   473   C  CD1  . TYR A 1 31  ? -17.205 19.788 35.326 1.00 0.00 ? 31  TYR A CD1  1  
ATOM   474   C  CD2  . TYR A 1 31  ? -19.553 19.793 34.947 1.00 0.00 ? 31  TYR A CD2  1  
ATOM   475   C  CE1  . TYR A 1 31  ? -17.415 20.183 36.632 1.00 0.00 ? 31  TYR A CE1  1  
ATOM   476   C  CE2  . TYR A 1 31  ? -19.763 20.188 36.254 1.00 0.00 ? 31  TYR A CE2  1  
ATOM   477   C  CZ   . TYR A 1 31  ? -18.694 20.385 37.107 1.00 0.00 ? 31  TYR A CZ   1  
ATOM   478   O  OH   . TYR A 1 31  ? -18.903 20.771 38.415 1.00 0.00 ? 31  TYR A OH   1  
ATOM   479   H  H    . TYR A 1 31  ? -17.571 17.789 30.907 1.00 0.00 ? 31  TYR A H    1  
ATOM   480   H  HA   . TYR A 1 31  ? -16.393 17.811 33.558 1.00 0.00 ? 31  TYR A HA   1  
ATOM   481   H  HB2  . TYR A 1 31  ? -17.411 19.849 32.524 1.00 0.00 ? 31  TYR A HB2  1  
ATOM   482   H  HB3  . TYR A 1 31  ? -18.989 19.061 32.521 1.00 0.00 ? 31  TYR A HB3  1  
ATOM   483   H  HD1  . TYR A 1 31  ? -16.198 19.634 34.968 1.00 0.00 ? 31  TYR A HD1  1  
ATOM   484   H  HD2  . TYR A 1 31  ? -20.398 19.641 34.291 1.00 0.00 ? 31  TYR A HD2  1  
ATOM   485   H  HE1  . TYR A 1 31  ? -16.570 20.332 37.288 1.00 0.00 ? 31  TYR A HE1  1  
ATOM   486   H  HE2  . TYR A 1 31  ? -20.770 20.342 36.613 1.00 0.00 ? 31  TYR A HE2  1  
ATOM   487   H  HH   . TYR A 1 31  ? -19.204 21.682 38.413 1.00 0.00 ? 31  TYR A HH   1  
ATOM   488   N  N    . GLN A 1 32  ? -19.346 16.418 33.177 1.00 0.00 ? 32  GLN A N    1  
ATOM   489   C  CA   . GLN A 1 32  ? -20.276 15.471 33.836 1.00 0.00 ? 32  GLN A CA   1  
ATOM   490   C  C    . GLN A 1 32  ? -19.646 14.091 33.962 1.00 0.00 ? 32  GLN A C    1  
ATOM   491   O  O    . GLN A 1 32  ? -19.686 13.486 35.015 1.00 0.00 ? 32  GLN A O    1  
ATOM   492   C  CB   . GLN A 1 32  ? -21.550 15.368 32.981 1.00 0.00 ? 32  GLN A CB   1  
ATOM   493   C  CG   . GLN A 1 32  ? -22.384 16.637 33.184 1.00 0.00 ? 32  GLN A CG   1  
ATOM   494   C  CD   . GLN A 1 32  ? -23.808 16.399 32.676 1.00 0.00 ? 32  GLN A CD   1  
ATOM   495   O  OE1  . GLN A 1 32  ? -24.053 15.529 31.863 1.00 0.00 ? 32  GLN A OE1  1  
ATOM   496   N  NE2  . GLN A 1 32  ? -24.777 17.150 33.128 1.00 0.00 ? 32  GLN A NE2  1  
ATOM   497   H  H    . GLN A 1 32  ? -19.547 16.767 32.285 1.00 0.00 ? 32  GLN A H    1  
ATOM   498   H  HA   . GLN A 1 32  ? -20.509 15.842 34.833 1.00 0.00 ? 32  GLN A HA   1  
ATOM   499   H  HB2  . GLN A 1 32  ? -21.282 15.272 31.939 1.00 0.00 ? 32  GLN A HB2  1  
ATOM   500   H  HB3  . GLN A 1 32  ? -22.122 14.503 33.282 1.00 0.00 ? 32  GLN A HB3  1  
ATOM   501   H  HG2  . GLN A 1 32  ? -22.419 16.886 34.234 1.00 0.00 ? 32  GLN A HG2  1  
ATOM   502   H  HG3  . GLN A 1 32  ? -21.944 17.457 32.637 1.00 0.00 ? 32  GLN A HG3  1  
ATOM   503   H  HE21 . GLN A 1 32  ? -24.585 17.853 33.783 1.00 0.00 ? 32  GLN A HE21 1  
ATOM   504   H  HE22 . GLN A 1 32  ? -25.694 17.010 32.812 1.00 0.00 ? 32  GLN A HE22 1  
ATOM   505   N  N    . SER A 1 33  ? -19.076 13.614 32.891 1.00 0.00 ? 33  SER A N    1  
ATOM   506   C  CA   . SER A 1 33  ? -18.444 12.275 32.950 1.00 0.00 ? 33  SER A CA   1  
ATOM   507   C  C    . SER A 1 33  ? -17.590 12.158 34.196 1.00 0.00 ? 33  SER A C    1  
ATOM   508   O  O    . SER A 1 33  ? -17.450 11.090 34.758 1.00 0.00 ? 33  SER A O    1  
ATOM   509   C  CB   . SER A 1 33  ? -17.548 12.096 31.713 1.00 0.00 ? 33  SER A CB   1  
ATOM   510   O  OG   . SER A 1 33  ? -18.406 12.379 30.618 1.00 0.00 ? 33  SER A OG   1  
ATOM   511   H  H    . SER A 1 33  ? -19.066 14.132 32.058 1.00 0.00 ? 33  SER A H    1  
ATOM   512   H  HA   . SER A 1 33  ? -19.223 11.517 32.986 1.00 0.00 ? 33  SER A HA   1  
ATOM   513   H  HB2  . SER A 1 33  ? -16.724 12.795 31.731 1.00 0.00 ? 33  SER A HB2  1  
ATOM   514   H  HB3  . SER A 1 33  ? -17.182 11.082 31.648 1.00 0.00 ? 33  SER A HB3  1  
ATOM   515   H  HG   . SER A 1 33  ? -17.901 12.867 29.962 1.00 0.00 ? 33  SER A HG   1  
ATOM   516   N  N    . PHE A 1 34  ? -17.031 13.258 34.607 1.00 0.00 ? 34  PHE A N    1  
ATOM   517   C  CA   . PHE A 1 34  ? -16.186 13.228 35.814 1.00 0.00 ? 34  PHE A CA   1  
ATOM   518   C  C    . PHE A 1 34  ? -17.061 13.195 37.052 1.00 0.00 ? 34  PHE A C    1  
ATOM   519   O  O    . PHE A 1 34  ? -16.775 12.491 38.001 1.00 0.00 ? 34  PHE A O    1  
ATOM   520   C  CB   . PHE A 1 34  ? -15.320 14.501 35.833 1.00 0.00 ? 34  PHE A CB   1  
ATOM   521   C  CG   . PHE A 1 34  ? -14.994 14.883 37.280 1.00 0.00 ? 34  PHE A CG   1  
ATOM   522   C  CD1  . PHE A 1 34  ? -14.305 14.008 38.101 1.00 0.00 ? 34  PHE A CD1  1  
ATOM   523   C  CD2  . PHE A 1 34  ? -15.383 16.113 37.785 1.00 0.00 ? 34  PHE A CD2  1  
ATOM   524   C  CE1  . PHE A 1 34  ? -14.010 14.356 39.403 1.00 0.00 ? 34  PHE A CE1  1  
ATOM   525   C  CE2  . PHE A 1 34  ? -15.088 16.457 39.088 1.00 0.00 ? 34  PHE A CE2  1  
ATOM   526   C  CZ   . PHE A 1 34  ? -14.402 15.580 39.895 1.00 0.00 ? 34  PHE A CZ   1  
ATOM   527   H  H    . PHE A 1 34  ? -17.169 14.097 34.120 1.00 0.00 ? 34  PHE A H    1  
ATOM   528   H  HA   . PHE A 1 34  ? -15.570 12.329 35.791 1.00 0.00 ? 34  PHE A HA   1  
ATOM   529   H  HB2  . PHE A 1 34  ? -14.399 14.323 35.297 1.00 0.00 ? 34  PHE A HB2  1  
ATOM   530   H  HB3  . PHE A 1 34  ? -15.855 15.313 35.363 1.00 0.00 ? 34  PHE A HB3  1  
ATOM   531   H  HD1  . PHE A 1 34  ? -13.996 13.046 37.718 1.00 0.00 ? 34  PHE A HD1  1  
ATOM   532   H  HD2  . PHE A 1 34  ? -15.922 16.805 37.156 1.00 0.00 ? 34  PHE A HD2  1  
ATOM   533   H  HE1  . PHE A 1 34  ? -13.469 13.668 40.036 1.00 0.00 ? 34  PHE A HE1  1  
ATOM   534   H  HE2  . PHE A 1 34  ? -15.396 17.418 39.475 1.00 0.00 ? 34  PHE A HE2  1  
ATOM   535   H  HZ   . PHE A 1 34  ? -14.170 15.852 40.914 1.00 0.00 ? 34  PHE A HZ   1  
ATOM   536   N  N    . LEU A 1 35  ? -18.117 13.960 37.026 1.00 0.00 ? 35  LEU A N    1  
ATOM   537   C  CA   . LEU A 1 35  ? -19.014 13.976 38.194 1.00 0.00 ? 35  LEU A CA   1  
ATOM   538   C  C    . LEU A 1 35  ? -19.514 12.572 38.469 1.00 0.00 ? 35  LEU A C    1  
ATOM   539   O  O    . LEU A 1 35  ? -19.899 12.250 39.576 1.00 0.00 ? 35  LEU A O    1  
ATOM   540   C  CB   . LEU A 1 35  ? -20.213 14.880 37.880 1.00 0.00 ? 35  LEU A CB   1  
ATOM   541   C  CG   . LEU A 1 35  ? -19.901 16.304 38.342 1.00 0.00 ? 35  LEU A CG   1  
ATOM   542   C  CD1  . LEU A 1 35  ? -20.726 17.295 37.515 1.00 0.00 ? 35  LEU A CD1  1  
ATOM   543   C  CD2  . LEU A 1 35  ? -20.275 16.447 39.818 1.00 0.00 ? 35  LEU A CD2  1  
ATOM   544   H  H    . LEU A 1 35  ? -18.312 14.515 36.241 1.00 0.00 ? 35  LEU A H    1  
ATOM   545   H  HA   . LEU A 1 35  ? -18.464 14.339 39.063 1.00 0.00 ? 35  LEU A HA   1  
ATOM   546   H  HB2  . LEU A 1 35  ? -20.404 14.875 36.817 1.00 0.00 ? 35  LEU A HB2  1  
ATOM   547   H  HB3  . LEU A 1 35  ? -21.088 14.513 38.398 1.00 0.00 ? 35  LEU A HB3  1  
ATOM   548   H  HG   . LEU A 1 35  ? -18.849 16.508 38.211 1.00 0.00 ? 35  LEU A HG   1  
ATOM   549   H  HD11 . LEU A 1 35  ? -21.769 17.016 37.547 1.00 0.00 ? 35  LEU A HD11 1  
ATOM   550   H  HD12 . LEU A 1 35  ? -20.612 18.290 37.917 1.00 0.00 ? 35  LEU A HD12 1  
ATOM   551   H  HD13 . LEU A 1 35  ? -20.388 17.284 36.489 1.00 0.00 ? 35  LEU A HD13 1  
ATOM   552   H  HD21 . LEU A 1 35  ? -21.317 16.200 39.956 1.00 0.00 ? 35  LEU A HD21 1  
ATOM   553   H  HD22 . LEU A 1 35  ? -19.671 15.778 40.414 1.00 0.00 ? 35  LEU A HD22 1  
ATOM   554   H  HD23 . LEU A 1 35  ? -20.104 17.462 40.143 1.00 0.00 ? 35  LEU A HD23 1  
ATOM   555   N  N    . LYS A 1 36  ? -19.500 11.752 37.446 1.00 0.00 ? 36  LYS A N    1  
ATOM   556   C  CA   . LYS A 1 36  ? -19.971 10.367 37.629 1.00 0.00 ? 36  LYS A CA   1  
ATOM   557   C  C    . LYS A 1 36  ? -18.939 9.547  38.391 1.00 0.00 ? 36  LYS A C    1  
ATOM   558   O  O    . LYS A 1 36  ? -19.288 8.757  39.245 1.00 0.00 ? 36  LYS A O    1  
ATOM   559   C  CB   . LYS A 1 36  ? -20.189 9.739  36.244 1.00 0.00 ? 36  LYS A CB   1  
ATOM   560   C  CG   . LYS A 1 36  ? -21.499 10.267 35.657 1.00 0.00 ? 36  LYS A CG   1  
ATOM   561   C  CD   . LYS A 1 36  ? -22.660 9.411  36.164 1.00 0.00 ? 36  LYS A CD   1  
ATOM   562   C  CE   . LYS A 1 36  ? -23.964 9.907  35.528 1.00 0.00 ? 36  LYS A CE   1  
ATOM   563   N  NZ   . LYS A 1 36  ? -24.341 11.241 36.080 1.00 0.00 ? 36  LYS A NZ   1  
ATOM   564   H  H    . LYS A 1 36  ? -19.183 12.058 36.565 1.00 0.00 ? 36  LYS A H    1  
ATOM   565   H  HA   . LYS A 1 36  ? -20.897 10.384 38.197 1.00 0.00 ? 36  LYS A HA   1  
ATOM   566   H  HB2  . LYS A 1 36  ? -19.368 10.001 35.594 1.00 0.00 ? 36  LYS A HB2  1  
ATOM   567   H  HB3  . LYS A 1 36  ? -20.238 8.664  36.336 1.00 0.00 ? 36  LYS A HB3  1  
ATOM   568   H  HG2  . LYS A 1 36  ? -21.644 11.293 35.962 1.00 0.00 ? 36  LYS A HG2  1  
ATOM   569   H  HG3  . LYS A 1 36  ? -21.457 10.221 34.578 1.00 0.00 ? 36  LYS A HG3  1  
ATOM   570   H  HD2  . LYS A 1 36  ? -22.495 8.378  35.895 1.00 0.00 ? 36  LYS A HD2  1  
ATOM   571   H  HD3  . LYS A 1 36  ? -22.728 9.490  37.240 1.00 0.00 ? 36  LYS A HD3  1  
ATOM   572   H  HE2  . LYS A 1 36  ? -23.834 9.992  34.459 1.00 0.00 ? 36  LYS A HE2  1  
ATOM   573   H  HE3  . LYS A 1 36  ? -24.757 9.203  35.732 1.00 0.00 ? 36  LYS A HE3  1  
ATOM   574   H  HZ1  . LYS A 1 36  ? -23.547 11.903 35.961 1.00 0.00 ? 36  LYS A HZ1  1  
ATOM   575   H  HZ2  . LYS A 1 36  ? -25.174 11.603 35.573 1.00 0.00 ? 36  LYS A HZ2  1  
ATOM   576   H  HZ3  . LYS A 1 36  ? -24.565 11.147 37.093 1.00 0.00 ? 36  LYS A HZ3  1  
ATOM   577   N  N    . GLU A 1 37  ? -17.681 9.744  38.074 1.00 0.00 ? 37  GLU A N    1  
ATOM   578   C  CA   . GLU A 1 37  ? -16.636 8.968  38.790 1.00 0.00 ? 37  GLU A CA   1  
ATOM   579   C  C    . GLU A 1 37  ? -16.740 9.232  40.289 1.00 0.00 ? 37  GLU A C    1  
ATOM   580   O  O    . GLU A 1 37  ? -16.183 8.518  41.098 1.00 0.00 ? 37  GLU A O    1  
ATOM   581   C  CB   . GLU A 1 37  ? -15.244 9.413  38.271 1.00 0.00 ? 37  GLU A CB   1  
ATOM   582   C  CG   . GLU A 1 37  ? -14.643 10.482 39.201 1.00 0.00 ? 37  GLU A CG   1  
ATOM   583   C  CD   . GLU A 1 37  ? -13.959 9.803  40.395 1.00 0.00 ? 37  GLU A CD   1  
ATOM   584   O  OE1  . GLU A 1 37  ? -13.888 8.586  40.362 1.00 0.00 ? 37  GLU A OE1  1  
ATOM   585   O  OE2  . GLU A 1 37  ? -13.539 10.544 41.271 1.00 0.00 ? 37  GLU A OE2  1  
ATOM   586   H  H    . GLU A 1 37  ? -17.432 10.399 37.375 1.00 0.00 ? 37  GLU A H    1  
ATOM   587   H  HA   . GLU A 1 37  ? -16.799 7.905  38.607 1.00 0.00 ? 37  GLU A HA   1  
ATOM   588   H  HB2  . GLU A 1 37  ? -14.586 8.559  38.227 1.00 0.00 ? 37  GLU A HB2  1  
ATOM   589   H  HB3  . GLU A 1 37  ? -15.348 9.822  37.276 1.00 0.00 ? 37  GLU A HB3  1  
ATOM   590   H  HG2  . GLU A 1 37  ? -13.912 11.064 38.660 1.00 0.00 ? 37  GLU A HG2  1  
ATOM   591   H  HG3  . GLU A 1 37  ? -15.422 11.139 39.560 1.00 0.00 ? 37  GLU A HG3  1  
ATOM   592   N  N    . CYS A 1 38  ? -17.474 10.258 40.621 1.00 0.00 ? 38  CYS A N    1  
ATOM   593   C  CA   . CYS A 1 38  ? -17.650 10.614 42.044 1.00 0.00 ? 38  CYS A CA   1  
ATOM   594   C  C    . CYS A 1 38  ? -18.502 11.896 42.165 1.00 0.00 ? 38  CYS A C    1  
ATOM   595   O  O    . CYS A 1 38  ? -18.096 12.943 41.702 1.00 0.00 ? 38  CYS A O    1  
ATOM   596   C  CB   . CYS A 1 38  ? -16.264 10.898 42.642 1.00 0.00 ? 38  CYS A CB   1  
ATOM   597   S  SG   . CYS A 1 38  ? -15.433 9.539  43.501 1.00 0.00 ? 38  CYS A SG   1  
ATOM   598   H  H    . CYS A 1 38  ? -17.909 10.793 39.925 1.00 0.00 ? 38  CYS A H    1  
ATOM   599   H  HA   . CYS A 1 38  ? -18.129 9.791  42.555 1.00 0.00 ? 38  CYS A HA   1  
ATOM   600   H  HB2  . CYS A 1 38  ? -15.616 11.226 41.845 1.00 0.00 ? 38  CYS A HB2  1  
ATOM   601   H  HB3  . CYS A 1 38  ? -16.360 11.715 43.341 1.00 0.00 ? 38  CYS A HB3  1  
ATOM   602   H  HG   . CYS A 1 38  ? -15.120 9.870  44.346 1.00 0.00 ? 38  CYS A HG   1  
ATOM   603   N  N    . PRO A 1 39  ? -19.683 11.793 42.776 1.00 0.00 ? 39  PRO A N    1  
ATOM   604   C  CA   . PRO A 1 39  ? -20.561 12.957 42.936 1.00 0.00 ? 39  PRO A CA   1  
ATOM   605   C  C    . PRO A 1 39  ? -19.905 14.050 43.791 1.00 0.00 ? 39  PRO A C    1  
ATOM   606   O  O    . PRO A 1 39  ? -20.581 14.807 44.461 1.00 0.00 ? 39  PRO A O    1  
ATOM   607   C  CB   . PRO A 1 39  ? -21.816 12.413 43.655 1.00 0.00 ? 39  PRO A CB   1  
ATOM   608   C  CG   . PRO A 1 39  ? -21.608 10.884 43.866 1.00 0.00 ? 39  PRO A CG   1  
ATOM   609   C  CD   . PRO A 1 39  ? -20.215 10.531 43.318 1.00 0.00 ? 39  PRO A CD   1  
ATOM   610   H  HA   . PRO A 1 39  ? -20.815 13.358 41.959 1.00 0.00 ? 39  PRO A HA   1  
ATOM   611   H  HB2  . PRO A 1 39  ? -21.939 12.903 44.610 1.00 0.00 ? 39  PRO A HB2  1  
ATOM   612   H  HB3  . PRO A 1 39  ? -22.693 12.585 43.047 1.00 0.00 ? 39  PRO A HB3  1  
ATOM   613   H  HG2  . PRO A 1 39  ? -21.661 10.646 44.918 1.00 0.00 ? 39  PRO A HG2  1  
ATOM   614   H  HG3  . PRO A 1 39  ? -22.365 10.331 43.332 1.00 0.00 ? 39  PRO A HG3  1  
ATOM   615   H  HD2  . PRO A 1 39  ? -19.579 10.169 44.112 1.00 0.00 ? 39  PRO A HD2  1  
ATOM   616   H  HD3  . PRO A 1 39  ? -20.297 9.793  42.533 1.00 0.00 ? 39  PRO A HD3  1  
ATOM   617   N  N    . SER A 1 40  ? -18.600 14.116 43.745 1.00 0.00 ? 40  SER A N    1  
ATOM   618   C  CA   . SER A 1 40  ? -17.891 15.149 44.544 1.00 0.00 ? 40  SER A CA   1  
ATOM   619   C  C    . SER A 1 40  ? -17.705 16.427 43.733 1.00 0.00 ? 40  SER A C    1  
ATOM   620   O  O    . SER A 1 40  ? -18.619 16.889 43.081 1.00 0.00 ? 40  SER A O    1  
ATOM   621   C  CB   . SER A 1 40  ? -16.507 14.601 44.925 1.00 0.00 ? 40  SER A CB   1  
ATOM   622   O  OG   . SER A 1 40  ? -15.920 15.641 45.693 1.00 0.00 ? 40  SER A OG   1  
ATOM   623   H  H    . SER A 1 40  ? -18.094 13.491 43.186 1.00 0.00 ? 40  SER A H    1  
ATOM   624   H  HA   . SER A 1 40  ? -18.478 15.374 45.434 1.00 0.00 ? 40  SER A HA   1  
ATOM   625   H  HB2  . SER A 1 40  ? -16.600 13.705 45.519 1.00 0.00 ? 40  SER A HB2  1  
ATOM   626   H  HB3  . SER A 1 40  ? -15.915 14.409 44.042 1.00 0.00 ? 40  SER A HB3  1  
ATOM   627   H  HG   . SER A 1 40  ? -16.628 16.139 46.109 1.00 0.00 ? 40  SER A HG   1  
ATOM   628   N  N    . GLY A 1 41  ? -16.519 16.973 43.786 1.00 0.00 ? 41  GLY A N    1  
ATOM   629   C  CA   . GLY A 1 41  ? -16.257 18.226 43.020 1.00 0.00 ? 41  GLY A CA   1  
ATOM   630   C  C    . GLY A 1 41  ? -14.775 18.605 43.101 1.00 0.00 ? 41  GLY A C    1  
ATOM   631   O  O    . GLY A 1 41  ? -14.370 19.635 42.600 1.00 0.00 ? 41  GLY A O    1  
ATOM   632   H  H    . GLY A 1 41  ? -15.810 16.565 44.325 1.00 0.00 ? 41  GLY A H    1  
ATOM   633   H  HA2  . GLY A 1 41  ? -16.530 18.076 41.987 1.00 0.00 ? 41  GLY A HA2  1  
ATOM   634   H  HA3  . GLY A 1 41  ? -16.851 19.027 43.433 1.00 0.00 ? 41  GLY A HA3  1  
ATOM   635   N  N    . ARG A 1 42  ? -13.996 17.757 43.730 1.00 0.00 ? 42  ARG A N    1  
ATOM   636   C  CA   . ARG A 1 42  ? -12.539 18.042 43.858 1.00 0.00 ? 42  ARG A CA   1  
ATOM   637   C  C    . ARG A 1 42  ? -11.714 16.783 43.622 1.00 0.00 ? 42  ARG A C    1  
ATOM   638   O  O    . ARG A 1 42  ? -11.961 15.755 44.220 1.00 0.00 ? 42  ARG A O    1  
ATOM   639   C  CB   . ARG A 1 42  ? -12.272 18.543 45.286 1.00 0.00 ? 42  ARG A CB   1  
ATOM   640   C  CG   . ARG A 1 42  ? -12.806 19.973 45.427 1.00 0.00 ? 42  ARG A CG   1  
ATOM   641   C  CD   . ARG A 1 42  ? -11.707 20.866 46.008 1.00 0.00 ? 42  ARG A CD   1  
ATOM   642   N  NE   . ARG A 1 42  ? -12.332 22.075 46.616 1.00 0.00 ? 42  ARG A NE   1  
ATOM   643   C  CZ   . ARG A 1 42  ? -11.567 23.009 47.114 1.00 0.00 ? 42  ARG A CZ   1  
ATOM   644   N  NH1  . ARG A 1 42  ? -10.505 23.377 46.452 1.00 0.00 ? 42  ARG A NH1  1  
ATOM   645   N  NH2  . ARG A 1 42  ? -11.889 23.542 48.262 1.00 0.00 ? 42  ARG A NH2  1  
ATOM   646   H  H    . ARG A 1 42  ? -14.372 16.938 44.115 1.00 0.00 ? 42  ARG A H    1  
ATOM   647   H  HA   . ARG A 1 42  ? -12.253 18.795 43.125 1.00 0.00 ? 42  ARG A HA   1  
ATOM   648   H  HB2  . ARG A 1 42  ? -12.770 17.898 45.994 1.00 0.00 ? 42  ARG A HB2  1  
ATOM   649   H  HB3  . ARG A 1 42  ? -11.210 18.530 45.481 1.00 0.00 ? 42  ARG A HB3  1  
ATOM   650   H  HG2  . ARG A 1 42  ? -13.102 20.347 44.459 1.00 0.00 ? 42  ARG A HG2  1  
ATOM   651   H  HG3  . ARG A 1 42  ? -13.662 19.976 46.084 1.00 0.00 ? 42  ARG A HG3  1  
ATOM   652   H  HD2  . ARG A 1 42  ? -11.160 20.328 46.767 1.00 0.00 ? 42  ARG A HD2  1  
ATOM   653   H  HD3  . ARG A 1 42  ? -11.029 21.170 45.224 1.00 0.00 ? 42  ARG A HD3  1  
ATOM   654   H  HE   . ARG A 1 42  ? -13.307 22.168 46.641 1.00 0.00 ? 42  ARG A HE   1  
ATOM   655   H  HH11 . ARG A 1 42  ? -10.289 22.945 45.576 1.00 0.00 ? 42  ARG A HH11 1  
ATOM   656   H  HH12 . ARG A 1 42  ? -9.909  24.090 46.818 1.00 0.00 ? 42  ARG A HH12 1  
ATOM   657   H  HH21 . ARG A 1 42  ? -12.709 23.235 48.744 1.00 0.00 ? 42  ARG A HH21 1  
ATOM   658   H  HH22 . ARG A 1 42  ? -11.315 24.258 48.658 1.00 0.00 ? 42  ARG A HH22 1  
ATOM   659   N  N    . ILE A 1 43  ? -10.747 16.886 42.750 1.00 0.00 ? 43  ILE A N    1  
ATOM   660   C  CA   . ILE A 1 43  ? -9.898  15.703 42.463 1.00 0.00 ? 43  ILE A CA   1  
ATOM   661   C  C    . ILE A 1 43  ? -8.717  15.643 43.423 1.00 0.00 ? 43  ILE A C    1  
ATOM   662   O  O    . ILE A 1 43  ? -8.010  16.615 43.602 1.00 0.00 ? 43  ILE A O    1  
ATOM   663   C  CB   . ILE A 1 43  ? -9.362  15.827 41.036 1.00 0.00 ? 43  ILE A CB   1  
ATOM   664   C  CG1  . ILE A 1 43  ? -10.501 15.679 40.038 1.00 0.00 ? 43  ILE A CG1  1  
ATOM   665   C  CG2  . ILE A 1 43  ? -8.348  14.696 40.795 1.00 0.00 ? 43  ILE A CG2  1  
ATOM   666   C  CD1  . ILE A 1 43  ? -10.164 16.471 38.774 1.00 0.00 ? 43  ILE A CD1  1  
ATOM   667   H  H    . ILE A 1 43  ? -10.583 17.737 42.290 1.00 0.00 ? 43  ILE A H    1  
ATOM   668   H  HA   . ILE A 1 43  ? -10.496 14.799 42.576 1.00 0.00 ? 43  ILE A HA   1  
ATOM   669   H  HB   . ILE A 1 43  ? -8.894  16.806 40.908 1.00 0.00 ? 43  ILE A HB   1  
ATOM   670   H  HG12 . ILE A 1 43  ? -10.631 14.635 39.790 1.00 0.00 ? 43  ILE A HG12 1  
ATOM   671   H  HG13 . ILE A 1 43  ? -11.416 16.056 40.471 1.00 0.00 ? 43  ILE A HG13 1  
ATOM   672   H  HG21 . ILE A 1 43  ? -8.745  13.765 41.173 1.00 0.00 ? 43  ILE A HG21 1  
ATOM   673   H  HG22 . ILE A 1 43  ? -8.158  14.597 39.736 1.00 0.00 ? 43  ILE A HG22 1  
ATOM   674   H  HG23 . ILE A 1 43  ? -7.423  14.922 41.303 1.00 0.00 ? 43  ILE A HG23 1  
ATOM   675   H  HD11 . ILE A 1 43  ? -9.229  16.121 38.362 1.00 0.00 ? 43  ILE A HD11 1  
ATOM   676   H  HD12 . ILE A 1 43  ? -10.946 16.339 38.041 1.00 0.00 ? 43  ILE A HD12 1  
ATOM   677   H  HD13 . ILE A 1 43  ? -10.077 17.521 39.014 1.00 0.00 ? 43  ILE A HD13 1  
ATOM   678   N  N    . THR A 1 44  ? -8.522  14.502 44.024 1.00 0.00 ? 44  THR A N    1  
ATOM   679   C  CA   . THR A 1 44  ? -7.392  14.365 44.974 1.00 0.00 ? 44  THR A CA   1  
ATOM   680   C  C    . THR A 1 44  ? -6.080  14.159 44.226 1.00 0.00 ? 44  THR A C    1  
ATOM   681   O  O    . THR A 1 44  ? -6.068  13.999 43.020 1.00 0.00 ? 44  THR A O    1  
ATOM   682   C  CB   . THR A 1 44  ? -7.650  13.143 45.862 1.00 0.00 ? 44  THR A CB   1  
ATOM   683   O  OG1  . THR A 1 44  ? -8.400  12.253 45.063 1.00 0.00 ? 44  THR A OG1  1  
ATOM   684   C  CG2  . THR A 1 44  ? -8.590  13.501 47.023 1.00 0.00 ? 44  THR A CG2  1  
ATOM   685   H  H    . THR A 1 44  ? -9.117  13.742 43.851 1.00 0.00 ? 44  THR A H    1  
ATOM   686   H  HA   . THR A 1 44  ? -7.319  15.273 45.573 1.00 0.00 ? 44  THR A HA   1  
ATOM   687   H  HB   . THR A 1 44  ? -6.724  12.681 46.195 1.00 0.00 ? 44  THR A HB   1  
ATOM   688   H  HG1  . THR A 1 44  ? -9.290  12.604 44.984 1.00 0.00 ? 44  THR A HG1  1  
ATOM   689   H  HG21 . THR A 1 44  ? -9.524  13.876 46.633 1.00 0.00 ? 44  THR A HG21 1  
ATOM   690   H  HG22 . THR A 1 44  ? -8.780  12.622 47.621 1.00 0.00 ? 44  THR A HG22 1  
ATOM   691   H  HG23 . THR A 1 44  ? -8.132  14.259 47.641 1.00 0.00 ? 44  THR A HG23 1  
ATOM   692   N  N    . ARG A 1 45  ? -4.997  14.167 44.952 1.00 0.00 ? 45  ARG A N    1  
ATOM   693   C  CA   . ARG A 1 45  ? -3.681  13.973 44.297 1.00 0.00 ? 45  ARG A CA   1  
ATOM   694   C  C    . ARG A 1 45  ? -3.355  12.491 44.168 1.00 0.00 ? 45  ARG A C    1  
ATOM   695   O  O    . ARG A 1 45  ? -2.740  12.070 43.208 1.00 0.00 ? 45  ARG A O    1  
ATOM   696   C  CB   . ARG A 1 45  ? -2.603  14.640 45.167 1.00 0.00 ? 45  ARG A CB   1  
ATOM   697   C  CG   . ARG A 1 45  ? -1.298  14.730 44.369 1.00 0.00 ? 45  ARG A CG   1  
ATOM   698   C  CD   . ARG A 1 45  ? -0.313  13.686 44.898 1.00 0.00 ? 45  ARG A CD   1  
ATOM   699   N  NE   . ARG A 1 45  ? 0.043   14.023 46.307 1.00 0.00 ? 45  ARG A NE   1  
ATOM   700   C  CZ   . ARG A 1 45  ? 1.259   13.807 46.729 1.00 0.00 ? 45  ARG A CZ   1  
ATOM   701   N  NH1  . ARG A 1 45  ? 2.222   14.583 46.307 1.00 0.00 ? 45  ARG A NH1  1  
ATOM   702   N  NH2  . ARG A 1 45  ? 1.474   12.823 47.558 1.00 0.00 ? 45  ARG A NH2  1  
ATOM   703   H  H    . ARG A 1 45  ? -5.051  14.301 45.921 1.00 0.00 ? 45  ARG A H    1  
ATOM   704   H  HA   . ARG A 1 45  ? -3.708  14.419 43.304 1.00 0.00 ? 45  ARG A HA   1  
ATOM   705   H  HB2  . ARG A 1 45  ? -2.924  15.631 45.447 1.00 0.00 ? 45  ARG A HB2  1  
ATOM   706   H  HB3  . ARG A 1 45  ? -2.443  14.054 46.061 1.00 0.00 ? 45  ARG A HB3  1  
ATOM   707   H  HG2  . ARG A 1 45  ? -1.499  14.542 43.326 1.00 0.00 ? 45  ARG A HG2  1  
ATOM   708   H  HG3  . ARG A 1 45  ? -0.875  15.718 44.476 1.00 0.00 ? 45  ARG A HG3  1  
ATOM   709   H  HD2  . ARG A 1 45  ? -0.766  12.707 44.869 1.00 0.00 ? 45  ARG A HD2  1  
ATOM   710   H  HD3  . ARG A 1 45  ? 0.582   13.685 44.294 1.00 0.00 ? 45  ARG A HD3  1  
ATOM   711   H  HE   . ARG A 1 45  ? -0.631  14.402 46.910 1.00 0.00 ? 45  ARG A HE   1  
ATOM   712   H  HH11 . ARG A 1 45  ? 2.023   15.328 45.671 1.00 0.00 ? 45  ARG A HH11 1  
ATOM   713   H  HH12 . ARG A 1 45  ? 3.159   14.430 46.620 1.00 0.00 ? 45  ARG A HH12 1  
ATOM   714   H  HH21 . ARG A 1 45  ? 0.713   12.248 47.858 1.00 0.00 ? 45  ARG A HH21 1  
ATOM   715   H  HH22 . ARG A 1 45  ? 2.399   12.642 47.891 1.00 0.00 ? 45  ARG A HH22 1  
ATOM   716   N  N    . GLN A 1 46  ? -3.773  11.724 45.136 1.00 0.00 ? 46  GLN A N    1  
ATOM   717   C  CA   . GLN A 1 46  ? -3.494  10.268 45.081 1.00 0.00 ? 46  GLN A CA   1  
ATOM   718   C  C    . GLN A 1 46  ? -4.279  9.609  43.955 1.00 0.00 ? 46  GLN A C    1  
ATOM   719   O  O    . GLN A 1 46  ? -3.846  8.624  43.390 1.00 0.00 ? 46  GLN A O    1  
ATOM   720   C  CB   . GLN A 1 46  ? -3.921  9.640  46.417 1.00 0.00 ? 46  GLN A CB   1  
ATOM   721   C  CG   . GLN A 1 46  ? -3.259  8.266  46.560 1.00 0.00 ? 46  GLN A CG   1  
ATOM   722   C  CD   . GLN A 1 46  ? -4.138  7.207  45.892 1.00 0.00 ? 46  GLN A CD   1  
ATOM   723   O  OE1  . GLN A 1 46  ? -3.652  6.291  45.259 1.00 0.00 ? 46  GLN A OE1  1  
ATOM   724   N  NE2  . GLN A 1 46  ? -5.435  7.292  46.009 1.00 0.00 ? 46  GLN A NE2  1  
ATOM   725   H  H    . GLN A 1 46  ? -4.267  12.105 45.892 1.00 0.00 ? 46  GLN A H    1  
ATOM   726   H  HA   . GLN A 1 46  ? -2.429  10.121 44.906 1.00 0.00 ? 46  GLN A HA   1  
ATOM   727   H  HB2  . GLN A 1 46  ? -3.616  10.277 47.234 1.00 0.00 ? 46  GLN A HB2  1  
ATOM   728   H  HB3  . GLN A 1 46  ? -4.995  9.528  46.438 1.00 0.00 ? 46  GLN A HB3  1  
ATOM   729   H  HG2  . GLN A 1 46  ? -2.289  8.276  46.085 1.00 0.00 ? 46  GLN A HG2  1  
ATOM   730   H  HG3  . GLN A 1 46  ? -3.141  8.024  47.606 1.00 0.00 ? 46  GLN A HG3  1  
ATOM   731   H  HE21 . GLN A 1 46  ? -5.834  8.028  46.519 1.00 0.00 ? 46  GLN A HE21 1  
ATOM   732   H  HE22 . GLN A 1 46  ? -6.010  6.620  45.587 1.00 0.00 ? 46  GLN A HE22 1  
ATOM   733   N  N    . GLU A 1 47  ? -5.420  10.161 43.647 1.00 0.00 ? 47  GLU A N    1  
ATOM   734   C  CA   . GLU A 1 47  ? -6.243  9.575  42.560 1.00 0.00 ? 47  GLU A CA   1  
ATOM   735   C  C    . GLU A 1 47  ? -5.868  10.171 41.211 1.00 0.00 ? 47  GLU A C    1  
ATOM   736   O  O    . GLU A 1 47  ? -6.306  9.703  40.181 1.00 0.00 ? 47  GLU A O    1  
ATOM   737   C  CB   . GLU A 1 47  ? -7.719  9.890  42.843 1.00 0.00 ? 47  GLU A CB   1  
ATOM   738   C  CG   . GLU A 1 47  ? -8.586  9.218  41.774 1.00 0.00 ? 47  GLU A CG   1  
ATOM   739   C  CD   . GLU A 1 47  ? -10.023 9.102  42.286 1.00 0.00 ? 47  GLU A CD   1  
ATOM   740   O  OE1  . GLU A 1 47  ? -10.441 10.039 42.948 1.00 0.00 ? 47  GLU A OE1  1  
ATOM   741   O  OE2  . GLU A 1 47  ? -10.623 8.082  41.987 1.00 0.00 ? 47  GLU A OE2  1  
ATOM   742   H  H    . GLU A 1 47  ? -5.731  10.956 44.131 1.00 0.00 ? 47  GLU A H    1  
ATOM   743   H  HA   . GLU A 1 47  ? -6.076  8.499  42.529 1.00 0.00 ? 47  GLU A HA   1  
ATOM   744   H  HB2  . GLU A 1 47  ? -7.990  9.514  43.819 1.00 0.00 ? 47  GLU A HB2  1  
ATOM   745   H  HB3  . GLU A 1 47  ? -7.875  10.958 42.818 1.00 0.00 ? 47  GLU A HB3  1  
ATOM   746   H  HG2  . GLU A 1 47  ? -8.574  9.809  40.871 1.00 0.00 ? 47  GLU A HG2  1  
ATOM   747   H  HG3  . GLU A 1 47  ? -8.201  8.231  41.560 1.00 0.00 ? 47  GLU A HG3  1  
ATOM   748   N  N    . PHE A 1 48  ? -5.067  11.196 41.235 1.00 0.00 ? 48  PHE A N    1  
ATOM   749   C  CA   . PHE A 1 48  ? -4.661  11.823 39.957 1.00 0.00 ? 48  PHE A CA   1  
ATOM   750   C  C    . PHE A 1 48  ? -3.993  10.804 39.041 1.00 0.00 ? 48  PHE A C    1  
ATOM   751   O  O    . PHE A 1 48  ? -4.187  10.823 37.841 1.00 0.00 ? 48  PHE A O    1  
ATOM   752   C  CB   . PHE A 1 48  ? -3.660  12.944 40.262 1.00 0.00 ? 48  PHE A CB   1  
ATOM   753   C  CG   . PHE A 1 48  ? -3.302  13.663 38.961 1.00 0.00 ? 48  PHE A CG   1  
ATOM   754   C  CD1  . PHE A 1 48  ? -4.085  14.705 38.496 1.00 0.00 ? 48  PHE A CD1  1  
ATOM   755   C  CD2  . PHE A 1 48  ? -2.193  13.279 38.228 1.00 0.00 ? 48  PHE A CD2  1  
ATOM   756   C  CE1  . PHE A 1 48  ? -3.762  15.352 37.320 1.00 0.00 ? 48  PHE A CE1  1  
ATOM   757   C  CE2  . PHE A 1 48  ? -1.873  13.928 37.052 1.00 0.00 ? 48  PHE A CE2  1  
ATOM   758   C  CZ   . PHE A 1 48  ? -2.657  14.962 36.601 1.00 0.00 ? 48  PHE A CZ   1  
ATOM   759   H  H    . PHE A 1 48  ? -4.736  11.547 42.088 1.00 0.00 ? 48  PHE A H    1  
ATOM   760   H  HA   . PHE A 1 48  ? -5.546  12.219 39.462 1.00 0.00 ? 48  PHE A HA   1  
ATOM   761   H  HB2  . PHE A 1 48  ? -4.098  13.649 40.952 1.00 0.00 ? 48  PHE A HB2  1  
ATOM   762   H  HB3  . PHE A 1 48  ? -2.764  12.527 40.697 1.00 0.00 ? 48  PHE A HB3  1  
ATOM   763   H  HD1  . PHE A 1 48  ? -4.955  15.012 39.055 1.00 0.00 ? 48  PHE A HD1  1  
ATOM   764   H  HD2  . PHE A 1 48  ? -1.575  12.466 38.577 1.00 0.00 ? 48  PHE A HD2  1  
ATOM   765   H  HE1  . PHE A 1 48  ? -4.379  16.164 36.965 1.00 0.00 ? 48  PHE A HE1  1  
ATOM   766   H  HE2  . PHE A 1 48  ? -1.006  13.621 36.485 1.00 0.00 ? 48  PHE A HE2  1  
ATOM   767   H  HZ   . PHE A 1 48  ? -2.404  15.472 35.682 1.00 0.00 ? 48  PHE A HZ   1  
ATOM   768   N  N    . GLN A 1 49  ? -3.212  9.930  39.622 1.00 0.00 ? 49  GLN A N    1  
ATOM   769   C  CA   . GLN A 1 49  ? -2.525  8.905  38.798 1.00 0.00 ? 49  GLN A CA   1  
ATOM   770   C  C    . GLN A 1 49  ? -3.500  7.832  38.320 1.00 0.00 ? 49  GLN A C    1  
ATOM   771   O  O    . GLN A 1 49  ? -3.222  7.116  37.379 1.00 0.00 ? 49  GLN A O    1  
ATOM   772   C  CB   . GLN A 1 49  ? -1.444  8.236  39.662 1.00 0.00 ? 49  GLN A CB   1  
ATOM   773   C  CG   . GLN A 1 49  ? -2.120  7.379  40.735 1.00 0.00 ? 49  GLN A CG   1  
ATOM   774   C  CD   . GLN A 1 49  ? -1.050  6.773  41.646 1.00 0.00 ? 49  GLN A CD   1  
ATOM   775   O  OE1  . GLN A 1 49  ? -0.659  7.357  42.636 1.00 0.00 ? 49  GLN A OE1  1  
ATOM   776   N  NE2  . GLN A 1 49  ? -0.551  5.604  41.348 1.00 0.00 ? 49  GLN A NE2  1  
ATOM   777   H  H    . GLN A 1 49  ? -3.078  9.955  40.595 1.00 0.00 ? 49  GLN A H    1  
ATOM   778   H  HA   . GLN A 1 49  ? -2.079  9.390  37.930 1.00 0.00 ? 49  GLN A HA   1  
ATOM   779   H  HB2  . GLN A 1 49  ? -0.818  7.613  39.041 1.00 0.00 ? 49  GLN A HB2  1  
ATOM   780   H  HB3  . GLN A 1 49  ? -0.835  8.994  40.133 1.00 0.00 ? 49  GLN A HB3  1  
ATOM   781   H  HG2  . GLN A 1 49  ? -2.786  7.991  41.325 1.00 0.00 ? 49  GLN A HG2  1  
ATOM   782   H  HG3  . GLN A 1 49  ? -2.683  6.585  40.268 1.00 0.00 ? 49  GLN A HG3  1  
ATOM   783   H  HE21 . GLN A 1 49  ? -0.863  5.126  40.549 1.00 0.00 ? 49  GLN A HE21 1  
ATOM   784   H  HE22 . GLN A 1 49  ? 0.135   5.202  41.921 1.00 0.00 ? 49  GLN A HE22 1  
ATOM   785   N  N    . THR A 1 50  ? -4.627  7.737  38.974 1.00 0.00 ? 50  THR A N    1  
ATOM   786   C  CA   . THR A 1 50  ? -5.620  6.712  38.560 1.00 0.00 ? 50  THR A CA   1  
ATOM   787   C  C    . THR A 1 50  ? -6.162  7.014  37.168 1.00 0.00 ? 50  THR A C    1  
ATOM   788   O  O    . THR A 1 50  ? -6.813  6.188  36.561 1.00 0.00 ? 50  THR A O    1  
ATOM   789   C  CB   . THR A 1 50  ? -6.783  6.727  39.559 1.00 0.00 ? 50  THR A CB   1  
ATOM   790   O  OG1  . THR A 1 50  ? -6.194  6.489  40.823 1.00 0.00 ? 50  THR A OG1  1  
ATOM   791   C  CG2  . THR A 1 50  ? -7.710  5.524  39.334 1.00 0.00 ? 50  THR A CG2  1  
ATOM   792   H  H    . THR A 1 50  ? -4.816  8.334  39.729 1.00 0.00 ? 50  THR A H    1  
ATOM   793   H  HA   . THR A 1 50  ? -5.134  5.736  38.546 1.00 0.00 ? 50  THR A HA   1  
ATOM   794   H  HB   . THR A 1 50  ? -7.313  7.675  39.552 1.00 0.00 ? 50  THR A HB   1  
ATOM   795   H  HG1  . THR A 1 50  ? -6.896  6.280  41.443 1.00 0.00 ? 50  THR A HG1  1  
ATOM   796   H  HG21 . THR A 1 50  ? -7.121  4.626  39.226 1.00 0.00 ? 50  THR A HG21 1  
ATOM   797   H  HG22 . THR A 1 50  ? -8.377  5.413  40.177 1.00 0.00 ? 50  THR A HG22 1  
ATOM   798   H  HG23 . THR A 1 50  ? -8.293  5.677  38.438 1.00 0.00 ? 50  THR A HG23 1  
ATOM   799   N  N    . ILE A 1 51  ? -5.883  8.197  36.688 1.00 0.00 ? 51  ILE A N    1  
ATOM   800   C  CA   . ILE A 1 51  ? -6.373  8.568  35.337 1.00 0.00 ? 51  ILE A CA   1  
ATOM   801   C  C    . ILE A 1 51  ? -5.354  8.198  34.263 1.00 0.00 ? 51  ILE A C    1  
ATOM   802   O  O    . ILE A 1 51  ? -5.677  7.535  33.297 1.00 0.00 ? 51  ILE A O    1  
ATOM   803   C  CB   . ILE A 1 51  ? -6.583  10.083 35.303 1.00 0.00 ? 51  ILE A CB   1  
ATOM   804   C  CG1  . ILE A 1 51  ? -7.531  10.500 36.417 1.00 0.00 ? 51  ILE A CG1  1  
ATOM   805   C  CG2  . ILE A 1 51  ? -7.217  10.460 33.952 1.00 0.00 ? 51  ILE A CG2  1  
ATOM   806   C  CD1  . ILE A 1 51  ? -7.875  11.982 36.252 1.00 0.00 ? 51  ILE A CD1  1  
ATOM   807   H  H    . ILE A 1 51  ? -5.355  8.832  37.215 1.00 0.00 ? 51  ILE A H    1  
ATOM   808   H  HA   . ILE A 1 51  ? -7.307  8.044  35.140 1.00 0.00 ? 51  ILE A HA   1  
ATOM   809   H  HB   . ILE A 1 51  ? -5.622  10.584 35.437 1.00 0.00 ? 51  ILE A HB   1  
ATOM   810   H  HG12 . ILE A 1 51  ? -8.434  9.910  36.366 1.00 0.00 ? 51  ILE A HG12 1  
ATOM   811   H  HG13 . ILE A 1 51  ? -7.057  10.342 37.374 1.00 0.00 ? 51  ILE A HG13 1  
ATOM   812   H  HG21 . ILE A 1 51  ? -6.830  9.816  33.175 1.00 0.00 ? 51  ILE A HG21 1  
ATOM   813   H  HG22 . ILE A 1 51  ? -8.289  10.345 34.008 1.00 0.00 ? 51  ILE A HG22 1  
ATOM   814   H  HG23 . ILE A 1 51  ? -6.981  11.486 33.712 1.00 0.00 ? 51  ILE A HG23 1  
ATOM   815   H  HD11 . ILE A 1 51  ? -6.981  12.539 36.010 1.00 0.00 ? 51  ILE A HD11 1  
ATOM   816   H  HD12 . ILE A 1 51  ? -8.596  12.102 35.457 1.00 0.00 ? 51  ILE A HD12 1  
ATOM   817   H  HD13 . ILE A 1 51  ? -8.293  12.363 37.171 1.00 0.00 ? 51  ILE A HD13 1  
ATOM   818   N  N    . TYR A 1 52  ? -4.141  8.634  34.457 1.00 0.00 ? 52  TYR A N    1  
ATOM   819   C  CA   . TYR A 1 52  ? -3.079  8.325  33.467 1.00 0.00 ? 52  TYR A CA   1  
ATOM   820   C  C    . TYR A 1 52  ? -3.091  6.849  33.078 1.00 0.00 ? 52  TYR A C    1  
ATOM   821   O  O    . TYR A 1 52  ? -2.462  6.456  32.116 1.00 0.00 ? 52  TYR A O    1  
ATOM   822   C  CB   . TYR A 1 52  ? -1.722  8.653  34.104 1.00 0.00 ? 52  TYR A CB   1  
ATOM   823   C  CG   . TYR A 1 52  ? -1.231  10.003 33.581 1.00 0.00 ? 52  TYR A CG   1  
ATOM   824   C  CD1  . TYR A 1 52  ? -1.932  11.158 33.857 1.00 0.00 ? 52  TYR A CD1  1  
ATOM   825   C  CD2  . TYR A 1 52  ? -0.078  10.084 32.829 1.00 0.00 ? 52  TYR A CD2  1  
ATOM   826   C  CE1  . TYR A 1 52  ? -1.486  12.377 33.387 1.00 0.00 ? 52  TYR A CE1  1  
ATOM   827   C  CE2  . TYR A 1 52  ? 0.368   11.301 32.360 1.00 0.00 ? 52  TYR A CE2  1  
ATOM   828   C  CZ   . TYR A 1 52  ? -0.332  12.458 32.635 1.00 0.00 ? 52  TYR A CZ   1  
ATOM   829   O  OH   . TYR A 1 52  ? 0.117   13.677 32.168 1.00 0.00 ? 52  TYR A OH   1  
ATOM   830   H  H    . TYR A 1 52  ? -3.930  9.164  35.254 1.00 0.00 ? 52  TYR A H    1  
ATOM   831   H  HA   . TYR A 1 52  ? -3.242  8.928  32.574 1.00 0.00 ? 52  TYR A HA   1  
ATOM   832   H  HB2  . TYR A 1 52  ? -1.825  8.703  35.177 1.00 0.00 ? 52  TYR A HB2  1  
ATOM   833   H  HB3  . TYR A 1 52  ? -1.003  7.889  33.849 1.00 0.00 ? 52  TYR A HB3  1  
ATOM   834   H  HD1  . TYR A 1 52  ? -2.839  11.109 34.443 1.00 0.00 ? 52  TYR A HD1  1  
ATOM   835   H  HD2  . TYR A 1 52  ? 0.479   9.186  32.606 1.00 0.00 ? 52  TYR A HD2  1  
ATOM   836   H  HE1  . TYR A 1 52  ? -2.044  13.274 33.611 1.00 0.00 ? 52  TYR A HE1  1  
ATOM   837   H  HE2  . TYR A 1 52  ? 1.273   11.350 31.772 1.00 0.00 ? 52  TYR A HE2  1  
ATOM   838   H  HH   . TYR A 1 52  ? -0.400  14.365 32.593 1.00 0.00 ? 52  TYR A HH   1  
ATOM   839   N  N    . SER A 1 53  ? -3.805  6.059  33.830 1.00 0.00 ? 53  SER A N    1  
ATOM   840   C  CA   . SER A 1 53  ? -3.862  4.610  33.511 1.00 0.00 ? 53  SER A CA   1  
ATOM   841   C  C    . SER A 1 53  ? -4.752  4.349  32.302 1.00 0.00 ? 53  SER A C    1  
ATOM   842   O  O    . SER A 1 53  ? -4.839  3.237  31.820 1.00 0.00 ? 53  SER A O    1  
ATOM   843   C  CB   . SER A 1 53  ? -4.444  3.868  34.725 1.00 0.00 ? 53  SER A CB   1  
ATOM   844   O  OG   . SER A 1 53  ? -4.481  2.509  34.319 1.00 0.00 ? 53  SER A OG   1  
ATOM   845   H  H    . SER A 1 53  ? -4.298  6.416  34.598 1.00 0.00 ? 53  SER A H    1  
ATOM   846   H  HA   . SER A 1 53  ? -2.855  4.257  33.289 1.00 0.00 ? 53  SER A HA   1  
ATOM   847   H  HB2  . SER A 1 53  ? -3.803  3.984  35.587 1.00 0.00 ? 53  SER A HB2  1  
ATOM   848   H  HB3  . SER A 1 53  ? -5.442  4.220  34.946 1.00 0.00 ? 53  SER A HB3  1  
ATOM   849   H  HG   . SER A 1 53  ? -3.849  2.395  33.607 1.00 0.00 ? 53  SER A HG   1  
ATOM   850   N  N    . LYS A 1 54  ? -5.405  5.378  31.837 1.00 0.00 ? 54  LYS A N    1  
ATOM   851   C  CA   . LYS A 1 54  ? -6.292  5.203  30.664 1.00 0.00 ? 54  LYS A CA   1  
ATOM   852   C  C    . LYS A 1 54  ? -5.545  5.467  29.361 1.00 0.00 ? 54  LYS A C    1  
ATOM   853   O  O    . LYS A 1 54  ? -5.756  4.787  28.376 1.00 0.00 ? 54  LYS A O    1  
ATOM   854   C  CB   . LYS A 1 54  ? -7.447  6.209  30.773 1.00 0.00 ? 54  LYS A CB   1  
ATOM   855   C  CG   . LYS A 1 54  ? -8.435  5.726  31.833 1.00 0.00 ? 54  LYS A CG   1  
ATOM   856   C  CD   . LYS A 1 54  ? -9.318  6.900  32.265 1.00 0.00 ? 54  LYS A CD   1  
ATOM   857   C  CE   . LYS A 1 54  ? -10.400 7.130  31.208 1.00 0.00 ? 54  LYS A CE   1  
ATOM   858   N  NZ   . LYS A 1 54  ? -11.366 5.995  31.193 1.00 0.00 ? 54  LYS A NZ   1  
ATOM   859   H  H    . LYS A 1 54  ? -5.309  6.255  32.256 1.00 0.00 ? 54  LYS A H    1  
ATOM   860   H  HA   . LYS A 1 54  ? -6.668  4.185  30.656 1.00 0.00 ? 54  LYS A HA   1  
ATOM   861   H  HB2  . LYS A 1 54  ? -7.060  7.177  31.052 1.00 0.00 ? 54  LYS A HB2  1  
ATOM   862   H  HB3  . LYS A 1 54  ? -7.949  6.289  29.820 1.00 0.00 ? 54  LYS A HB3  1  
ATOM   863   H  HG2  . LYS A 1 54  ? -9.051  4.939  31.425 1.00 0.00 ? 54  LYS A HG2  1  
ATOM   864   H  HG3  . LYS A 1 54  ? -7.895  5.345  32.687 1.00 0.00 ? 54  LYS A HG3  1  
ATOM   865   H  HD2  . LYS A 1 54  ? -9.779  6.676  33.214 1.00 0.00 ? 54  LYS A HD2  1  
ATOM   866   H  HD3  . LYS A 1 54  ? -8.714  7.789  32.365 1.00 0.00 ? 54  LYS A HD3  1  
ATOM   867   H  HE2  . LYS A 1 54  ? -10.932 8.043  31.429 1.00 0.00 ? 54  LYS A HE2  1  
ATOM   868   H  HE3  . LYS A 1 54  ? -9.943  7.215  30.233 1.00 0.00 ? 54  LYS A HE3  1  
ATOM   869   H  HZ1  . LYS A 1 54  ? -11.434 5.585  32.146 1.00 0.00 ? 54  LYS A HZ1  1  
ATOM   870   H  HZ2  . LYS A 1 54  ? -12.302 6.339  30.896 1.00 0.00 ? 54  LYS A HZ2  1  
ATOM   871   H  HZ3  . LYS A 1 54  ? -11.036 5.268  30.526 1.00 0.00 ? 54  LYS A HZ3  1  
ATOM   872   N  N    . PHE A 1 55  ? -4.683  6.449  29.380 1.00 0.00 ? 55  PHE A N    1  
ATOM   873   C  CA   . PHE A 1 55  ? -3.917  6.772  28.151 1.00 0.00 ? 55  PHE A CA   1  
ATOM   874   C  C    . PHE A 1 55  ? -2.551  6.081  28.120 1.00 0.00 ? 55  PHE A C    1  
ATOM   875   O  O    . PHE A 1 55  ? -1.863  6.134  27.120 1.00 0.00 ? 55  PHE A O    1  
ATOM   876   C  CB   . PHE A 1 55  ? -3.695  8.296  28.112 1.00 0.00 ? 55  PHE A CB   1  
ATOM   877   C  CG   . PHE A 1 55  ? -4.976  9.013  28.559 1.00 0.00 ? 55  PHE A CG   1  
ATOM   878   C  CD1  . PHE A 1 55  ? -6.221  8.538  28.179 1.00 0.00 ? 55  PHE A CD1  1  
ATOM   879   C  CD2  . PHE A 1 55  ? -4.903  10.151 29.347 1.00 0.00 ? 55  PHE A CD2  1  
ATOM   880   C  CE1  . PHE A 1 55  ? -7.369  9.190  28.581 1.00 0.00 ? 55  PHE A CE1  1  
ATOM   881   C  CE2  . PHE A 1 55  ? -6.055  10.799 29.745 1.00 0.00 ? 55  PHE A CE2  1  
ATOM   882   C  CZ   . PHE A 1 55  ? -7.285  10.318 29.362 1.00 0.00 ? 55  PHE A CZ   1  
ATOM   883   H  H    . PHE A 1 55  ? -4.546  6.968  30.197 1.00 0.00 ? 55  PHE A H    1  
ATOM   884   H  HA   . PHE A 1 55  ? -4.491  6.450  27.287 1.00 0.00 ? 55  PHE A HA   1  
ATOM   885   H  HB2  . PHE A 1 55  ? -2.887  8.563  28.776 1.00 0.00 ? 55  PHE A HB2  1  
ATOM   886   H  HB3  . PHE A 1 55  ? -3.447  8.603  27.107 1.00 0.00 ? 55  PHE A HB3  1  
ATOM   887   H  HD1  . PHE A 1 55  ? -6.295  7.654  27.564 1.00 0.00 ? 55  PHE A HD1  1  
ATOM   888   H  HD2  . PHE A 1 55  ? -3.941  10.533 29.652 1.00 0.00 ? 55  PHE A HD2  1  
ATOM   889   H  HE1  . PHE A 1 55  ? -8.336  8.811  28.283 1.00 0.00 ? 55  PHE A HE1  1  
ATOM   890   H  HE2  . PHE A 1 55  ? -5.990  11.687 30.359 1.00 0.00 ? 55  PHE A HE2  1  
ATOM   891   H  HZ   . PHE A 1 55  ? -8.186  10.826 29.677 1.00 0.00 ? 55  PHE A HZ   1  
ATOM   892   N  N    . PHE A 1 56  ? -2.178  5.442  29.202 1.00 0.00 ? 56  PHE A N    1  
ATOM   893   C  CA   . PHE A 1 56  ? -0.851  4.757  29.209 1.00 0.00 ? 56  PHE A CA   1  
ATOM   894   C  C    . PHE A 1 56  ? -0.841  3.506  30.093 1.00 0.00 ? 56  PHE A C    1  
ATOM   895   O  O    . PHE A 1 56  ? -0.081  3.413  31.035 1.00 0.00 ? 56  PHE A O    1  
ATOM   896   C  CB   . PHE A 1 56  ? 0.183   5.750  29.755 1.00 0.00 ? 56  PHE A CB   1  
ATOM   897   C  CG   . PHE A 1 56  ? 0.075   7.057  28.972 1.00 0.00 ? 56  PHE A CG   1  
ATOM   898   C  CD1  . PHE A 1 56  ? 0.491   7.122  27.654 1.00 0.00 ? 56  PHE A CD1  1  
ATOM   899   C  CD2  . PHE A 1 56  ? -0.459  8.188  29.563 1.00 0.00 ? 56  PHE A CD2  1  
ATOM   900   C  CE1  . PHE A 1 56  ? 0.375   8.296  26.943 1.00 0.00 ? 56  PHE A CE1  1  
ATOM   901   C  CE2  . PHE A 1 56  ? -0.574  9.361  28.850 1.00 0.00 ? 56  PHE A CE2  1  
ATOM   902   C  CZ   . PHE A 1 56  ? -0.159  9.415  27.540 1.00 0.00 ? 56  PHE A CZ   1  
ATOM   903   H  H    . PHE A 1 56  ? -2.759  5.412  29.990 1.00 0.00 ? 56  PHE A H    1  
ATOM   904   H  HA   . PHE A 1 56  ? -0.596  4.467  28.191 1.00 0.00 ? 56  PHE A HA   1  
ATOM   905   H  HB2  . PHE A 1 56  ? -0.008  5.943  30.798 1.00 0.00 ? 56  PHE A HB2  1  
ATOM   906   H  HB3  . PHE A 1 56  ? 1.178   5.345  29.642 1.00 0.00 ? 56  PHE A HB3  1  
ATOM   907   H  HD1  . PHE A 1 56  ? 0.909   6.245  27.180 1.00 0.00 ? 56  PHE A HD1  1  
ATOM   908   H  HD2  . PHE A 1 56  ? -0.787  8.152  30.592 1.00 0.00 ? 56  PHE A HD2  1  
ATOM   909   H  HE1  . PHE A 1 56  ? 0.702   8.338  25.914 1.00 0.00 ? 56  PHE A HE1  1  
ATOM   910   H  HE2  . PHE A 1 56  ? -0.990  10.240 29.319 1.00 0.00 ? 56  PHE A HE2  1  
ATOM   911   H  HZ   . PHE A 1 56  ? -0.257  10.332 26.979 1.00 0.00 ? 56  PHE A HZ   1  
ATOM   912   N  N    . PRO A 1 57  ? -1.701  2.566  29.764 1.00 0.00 ? 57  PRO A N    1  
ATOM   913   C  CA   . PRO A 1 57  ? -1.798  1.317  30.518 1.00 0.00 ? 57  PRO A CA   1  
ATOM   914   C  C    . PRO A 1 57  ? -0.571  0.429  30.287 1.00 0.00 ? 57  PRO A C    1  
ATOM   915   O  O    . PRO A 1 57  ? -0.503  -0.677 30.787 1.00 0.00 ? 57  PRO A O    1  
ATOM   916   C  CB   . PRO A 1 57  ? -3.043  0.606  29.946 1.00 0.00 ? 57  PRO A CB   1  
ATOM   917   C  CG   . PRO A 1 57  ? -3.544  1.454  28.735 1.00 0.00 ? 57  PRO A CG   1  
ATOM   918   C  CD   . PRO A 1 57  ? -2.653  2.705  28.656 1.00 0.00 ? 57  PRO A CD   1  
ATOM   919   H  HA   . PRO A 1 57  ? -1.915  1.528  31.576 1.00 0.00 ? 57  PRO A HA   1  
ATOM   920   H  HB2  . PRO A 1 57  ? -2.781  -0.388 29.616 1.00 0.00 ? 57  PRO A HB2  1  
ATOM   921   H  HB3  . PRO A 1 57  ? -3.814  0.546  30.700 1.00 0.00 ? 57  PRO A HB3  1  
ATOM   922   H  HG2  . PRO A 1 57  ? -3.462  0.881  27.824 1.00 0.00 ? 57  PRO A HG2  1  
ATOM   923   H  HG3  . PRO A 1 57  ? -4.575  1.742  28.889 1.00 0.00 ? 57  PRO A HG3  1  
ATOM   924   H  HD2  . PRO A 1 57  ? -2.128  2.739  27.713 1.00 0.00 ? 57  PRO A HD2  1  
ATOM   925   H  HD3  . PRO A 1 57  ? -3.249  3.591  28.785 1.00 0.00 ? 57  PRO A HD3  1  
ATOM   926   N  N    . GLU A 1 58  ? 0.376   0.927  29.533 1.00 0.00 ? 58  GLU A N    1  
ATOM   927   C  CA   . GLU A 1 58  ? 1.594   0.117  29.265 1.00 0.00 ? 58  GLU A CA   1  
ATOM   928   C  C    . GLU A 1 58  ? 2.669   0.341  30.324 1.00 0.00 ? 58  GLU A C    1  
ATOM   929   O  O    . GLU A 1 58  ? 2.817   -0.448 31.236 1.00 0.00 ? 58  GLU A O    1  
ATOM   930   C  CB   . GLU A 1 58  ? 2.159   0.525  27.897 1.00 0.00 ? 58  GLU A CB   1  
ATOM   931   C  CG   . GLU A 1 58  ? 1.171   0.112  26.803 1.00 0.00 ? 58  GLU A CG   1  
ATOM   932   C  CD   . GLU A 1 58  ? 1.670   -1.168 26.129 1.00 0.00 ? 58  GLU A CD   1  
ATOM   933   O  OE1  . GLU A 1 58  ? 2.800   -1.133 25.669 1.00 0.00 ? 58  GLU A OE1  1  
ATOM   934   O  OE2  . GLU A 1 58  ? 0.895   -2.110 26.114 1.00 0.00 ? 58  GLU A OE2  1  
ATOM   935   H  H    . GLU A 1 58  ? 0.283   1.824  29.148 1.00 0.00 ? 58  GLU A H    1  
ATOM   936   H  HA   . GLU A 1 58  ? 1.319   -0.935 29.266 1.00 0.00 ? 58  GLU A HA   1  
ATOM   937   H  HB2  . GLU A 1 58  ? 2.306   1.594  27.868 1.00 0.00 ? 58  GLU A HB2  1  
ATOM   938   H  HB3  . GLU A 1 58  ? 3.106   0.032  27.734 1.00 0.00 ? 58  GLU A HB3  1  
ATOM   939   H  HG2  . GLU A 1 58  ? 0.199   -0.069 27.237 1.00 0.00 ? 58  GLU A HG2  1  
ATOM   940   H  HG3  . GLU A 1 58  ? 1.092   0.896  26.065 1.00 0.00 ? 58  GLU A HG3  1  
ATOM   941   N  N    . ALA A 1 59  ? 3.402   1.413  30.187 1.00 0.00 ? 59  ALA A N    1  
ATOM   942   C  CA   . ALA A 1 59  ? 4.464   1.696  31.172 1.00 0.00 ? 59  ALA A CA   1  
ATOM   943   C  C    . ALA A 1 59  ? 3.884   1.968  32.547 1.00 0.00 ? 59  ALA A C    1  
ATOM   944   O  O    . ALA A 1 59  ? 2.827   1.473  32.889 1.00 0.00 ? 59  ALA A O    1  
ATOM   945   C  CB   . ALA A 1 59  ? 5.223   2.939  30.703 1.00 0.00 ? 59  ALA A CB   1  
ATOM   946   H  H    . ALA A 1 59  ? 3.247   2.029  29.442 1.00 0.00 ? 59  ALA A H    1  
ATOM   947   H  HA   . ALA A 1 59  ? 5.131   0.838  31.231 1.00 0.00 ? 59  ALA A HA   1  
ATOM   948   H  HB1  . ALA A 1 59  ? 5.542   2.803  29.681 1.00 0.00 ? 59  ALA A HB1  1  
ATOM   949   H  HB2  . ALA A 1 59  ? 4.578   3.804  30.763 1.00 0.00 ? 59  ALA A HB2  1  
ATOM   950   H  HB3  . ALA A 1 59  ? 6.088   3.094  31.330 1.00 0.00 ? 59  ALA A HB3  1  
ATOM   951   N  N    . ASP A 1 60  ? 4.595   2.753  33.313 1.00 0.00 ? 60  ASP A N    1  
ATOM   952   C  CA   . ASP A 1 60  ? 4.119   3.082  34.675 1.00 0.00 ? 60  ASP A CA   1  
ATOM   953   C  C    . ASP A 1 60  ? 4.317   4.562  34.975 1.00 0.00 ? 60  ASP A C    1  
ATOM   954   O  O    . ASP A 1 60  ? 5.075   4.931  35.849 1.00 0.00 ? 60  ASP A O    1  
ATOM   955   C  CB   . ASP A 1 60  ? 4.938   2.262  35.683 1.00 0.00 ? 60  ASP A CB   1  
ATOM   956   C  CG   . ASP A 1 60  ? 4.476   0.804  35.638 1.00 0.00 ? 60  ASP A CG   1  
ATOM   957   O  OD1  . ASP A 1 60  ? 3.432   0.548  36.215 1.00 0.00 ? 60  ASP A OD1  1  
ATOM   958   O  OD2  . ASP A 1 60  ? 5.193   0.027  35.028 1.00 0.00 ? 60  ASP A OD2  1  
ATOM   959   H  H    . ASP A 1 60  ? 5.444   3.119  32.988 1.00 0.00 ? 60  ASP A H    1  
ATOM   960   H  HA   . ASP A 1 60  ? 3.062   2.843  34.755 1.00 0.00 ? 60  ASP A HA   1  
ATOM   961   H  HB2  . ASP A 1 60  ? 5.987   2.313  35.431 1.00 0.00 ? 60  ASP A HB2  1  
ATOM   962   H  HB3  . ASP A 1 60  ? 4.788   2.652  36.679 1.00 0.00 ? 60  ASP A HB3  1  
ATOM   963   N  N    . PRO A 1 61  ? 3.618   5.382  34.227 1.00 0.00 ? 61  PRO A N    1  
ATOM   964   C  CA   . PRO A 1 61  ? 3.696   6.832  34.390 1.00 0.00 ? 61  PRO A CA   1  
ATOM   965   C  C    . PRO A 1 61  ? 3.173   7.244  35.759 1.00 0.00 ? 61  PRO A C    1  
ATOM   966   O  O    . PRO A 1 61  ? 2.818   8.385  35.976 1.00 0.00 ? 61  PRO A O    1  
ATOM   967   C  CB   . PRO A 1 61  ? 2.771   7.403  33.294 1.00 0.00 ? 61  PRO A CB   1  
ATOM   968   C  CG   . PRO A 1 61  ? 2.122   6.189  32.557 1.00 0.00 ? 61  PRO A CG   1  
ATOM   969   C  CD   . PRO A 1 61  ? 2.715   4.911  33.175 1.00 0.00 ? 61  PRO A CD   1  
ATOM   970   H  HA   . PRO A 1 61  ? 4.720   7.167  34.260 1.00 0.00 ? 61  PRO A HA   1  
ATOM   971   H  HB2  . PRO A 1 61  ? 2.002   8.016  33.743 1.00 0.00 ? 61  PRO A HB2  1  
ATOM   972   H  HB3  . PRO A 1 61  ? 3.344   7.995  32.596 1.00 0.00 ? 61  PRO A HB3  1  
ATOM   973   H  HG2  . PRO A 1 61  ? 1.053   6.203  32.697 1.00 0.00 ? 61  PRO A HG2  1  
ATOM   974   H  HG3  . PRO A 1 61  ? 2.349   6.230  31.503 1.00 0.00 ? 61  PRO A HG3  1  
ATOM   975   H  HD2  . PRO A 1 61  ? 1.933   4.301  33.602 1.00 0.00 ? 61  PRO A HD2  1  
ATOM   976   H  HD3  . PRO A 1 61  ? 3.266   4.352  32.435 1.00 0.00 ? 61  PRO A HD3  1  
ATOM   977   N  N    . LYS A 1 62  ? 3.142   6.300  36.656 1.00 0.00 ? 62  LYS A N    1  
ATOM   978   C  CA   . LYS A 1 62  ? 2.649   6.602  38.024 1.00 0.00 ? 62  LYS A CA   1  
ATOM   979   C  C    . LYS A 1 62  ? 3.609   7.525  38.763 1.00 0.00 ? 62  LYS A C    1  
ATOM   980   O  O    . LYS A 1 62  ? 3.206   8.278  39.626 1.00 0.00 ? 62  LYS A O    1  
ATOM   981   C  CB   . LYS A 1 62  ? 2.533   5.278  38.799 1.00 0.00 ? 62  LYS A CB   1  
ATOM   982   C  CG   . LYS A 1 62  ? 2.032   4.181  37.851 1.00 0.00 ? 62  LYS A CG   1  
ATOM   983   C  CD   . LYS A 1 62  ? 1.115   3.223  38.620 1.00 0.00 ? 62  LYS A CD   1  
ATOM   984   C  CE   . LYS A 1 62  ? 1.966   2.339  39.533 1.00 0.00 ? 62  LYS A CE   1  
ATOM   985   N  NZ   . LYS A 1 62  ? 1.137   1.256  40.133 1.00 0.00 ? 62  LYS A NZ   1  
ATOM   986   H  H    . LYS A 1 62  ? 3.450   5.399  36.429 1.00 0.00 ? 62  LYS A H    1  
ATOM   987   H  HA   . LYS A 1 62  ? 1.676   7.091  37.948 1.00 0.00 ? 62  LYS A HA   1  
ATOM   988   H  HB2  . LYS A 1 62  ? 3.501   5.002  39.191 1.00 0.00 ? 62  LYS A HB2  1  
ATOM   989   H  HB3  . LYS A 1 62  ? 1.840   5.397  39.618 1.00 0.00 ? 62  LYS A HB3  1  
ATOM   990   H  HG2  . LYS A 1 62  ? 1.485   4.629  37.035 1.00 0.00 ? 62  LYS A HG2  1  
ATOM   991   H  HG3  . LYS A 1 62  ? 2.873   3.634  37.454 1.00 0.00 ? 62  LYS A HG3  1  
ATOM   992   H  HD2  . LYS A 1 62  ? 0.411   3.790  39.214 1.00 0.00 ? 62  LYS A HD2  1  
ATOM   993   H  HD3  . LYS A 1 62  ? 0.570   2.605  37.922 1.00 0.00 ? 62  LYS A HD3  1  
ATOM   994   H  HE2  . LYS A 1 62  ? 2.767   1.894  38.961 1.00 0.00 ? 62  LYS A HE2  1  
ATOM   995   H  HE3  . LYS A 1 62  ? 2.389   2.939  40.326 1.00 0.00 ? 62  LYS A HE3  1  
ATOM   996   H  HZ1  . LYS A 1 62  ? 0.156   1.586  40.236 1.00 0.00 ? 62  LYS A HZ1  1  
ATOM   997   H  HZ2  . LYS A 1 62  ? 1.159   0.421  39.513 1.00 0.00 ? 62  LYS A HZ2  1  
ATOM   998   H  HZ3  . LYS A 1 62  ? 1.520   1.004  41.067 1.00 0.00 ? 62  LYS A HZ3  1  
ATOM   999   N  N    . ALA A 1 63  ? 4.863   7.450  38.416 1.00 0.00 ? 63  ALA A N    1  
ATOM   1000  C  CA   . ALA A 1 63  ? 5.857   8.317  39.093 1.00 0.00 ? 63  ALA A CA   1  
ATOM   1001  C  C    . ALA A 1 63  ? 5.815   9.729  38.525 1.00 0.00 ? 63  ALA A C    1  
ATOM   1002  O  O    . ALA A 1 63  ? 6.062   10.693 39.224 1.00 0.00 ? 63  ALA A O    1  
ATOM   1003  C  CB   . ALA A 1 63  ? 7.256   7.727  38.855 1.00 0.00 ? 63  ALA A CB   1  
ATOM   1004  H  H    . ALA A 1 63  ? 5.146   6.826  37.714 1.00 0.00 ? 63  ALA A H    1  
ATOM   1005  H  HA   . ALA A 1 63  ? 5.627   8.356  40.157 1.00 0.00 ? 63  ALA A HA   1  
ATOM   1006  H  HB1  . ALA A 1 63  ? 7.268   6.689  39.152 1.00 0.00 ? 63  ALA A HB1  1  
ATOM   1007  H  HB2  . ALA A 1 63  ? 7.510   7.801  37.808 1.00 0.00 ? 63  ALA A HB2  1  
ATOM   1008  H  HB3  . ALA A 1 63  ? 7.985   8.272  39.437 1.00 0.00 ? 63  ALA A HB3  1  
ATOM   1009  N  N    . TYR A 1 64  ? 5.507   9.828  37.261 1.00 0.00 ? 64  TYR A N    1  
ATOM   1010  C  CA   . TYR A 1 64  ? 5.443   11.166 36.626 1.00 0.00 ? 64  TYR A CA   1  
ATOM   1011  C  C    . TYR A 1 64  ? 4.040   11.754 36.726 1.00 0.00 ? 64  TYR A C    1  
ATOM   1012  O  O    . TYR A 1 64  ? 3.839   12.929 36.495 1.00 0.00 ? 64  TYR A O    1  
ATOM   1013  C  CB   . TYR A 1 64  ? 5.813   11.011 35.145 1.00 0.00 ? 64  TYR A CB   1  
ATOM   1014  C  CG   . TYR A 1 64  ? 5.352   12.249 34.375 1.00 0.00 ? 64  TYR A CG   1  
ATOM   1015  C  CD1  . TYR A 1 64  ? 6.035   13.442 34.494 1.00 0.00 ? 64  TYR A CD1  1  
ATOM   1016  C  CD2  . TYR A 1 64  ? 4.249   12.189 33.550 1.00 0.00 ? 64  TYR A CD2  1  
ATOM   1017  C  CE1  . TYR A 1 64  ? 5.621   14.557 33.797 1.00 0.00 ? 64  TYR A CE1  1  
ATOM   1018  C  CE2  . TYR A 1 64  ? 3.834   13.305 32.854 1.00 0.00 ? 64  TYR A CE2  1  
ATOM   1019  C  CZ   . TYR A 1 64  ? 4.516   14.498 32.972 1.00 0.00 ? 64  TYR A CZ   1  
ATOM   1020  O  OH   . TYR A 1 64  ? 4.104   15.615 32.275 1.00 0.00 ? 64  TYR A OH   1  
ATOM   1021  H  H    . TYR A 1 64  ? 5.315   9.022  36.737 1.00 0.00 ? 64  TYR A H    1  
ATOM   1022  H  HA   . TYR A 1 64  ? 6.141   11.829 37.131 1.00 0.00 ? 64  TYR A HA   1  
ATOM   1023  H  HB2  . TYR A 1 64  ? 6.884   10.907 35.044 1.00 0.00 ? 64  TYR A HB2  1  
ATOM   1024  H  HB3  . TYR A 1 64  ? 5.329   10.135 34.736 1.00 0.00 ? 64  TYR A HB3  1  
ATOM   1025  H  HD1  . TYR A 1 64  ? 6.901   13.501 35.138 1.00 0.00 ? 64  TYR A HD1  1  
ATOM   1026  H  HD2  . TYR A 1 64  ? 3.704   11.262 33.448 1.00 0.00 ? 64  TYR A HD2  1  
ATOM   1027  H  HE1  . TYR A 1 64  ? 6.165   15.485 33.900 1.00 0.00 ? 64  TYR A HE1  1  
ATOM   1028  H  HE2  . TYR A 1 64  ? 2.969   13.245 32.210 1.00 0.00 ? 64  TYR A HE2  1  
ATOM   1029  H  HH   . TYR A 1 64  ? 4.777   16.291 32.373 1.00 0.00 ? 64  TYR A HH   1  
ATOM   1030  N  N    . ALA A 1 65  ? 3.093   10.926 37.067 1.00 0.00 ? 65  ALA A N    1  
ATOM   1031  C  CA   . ALA A 1 65  ? 1.699   11.421 37.184 1.00 0.00 ? 65  ALA A CA   1  
ATOM   1032  C  C    . ALA A 1 65  ? 1.513   12.254 38.446 1.00 0.00 ? 65  ALA A C    1  
ATOM   1033  O  O    . ALA A 1 65  ? 0.687   13.143 38.488 1.00 0.00 ? 65  ALA A O    1  
ATOM   1034  C  CB   . ALA A 1 65  ? 0.762   10.210 37.252 1.00 0.00 ? 65  ALA A CB   1  
ATOM   1035  H  H    . ALA A 1 65  ? 3.299   9.984  37.244 1.00 0.00 ? 65  ALA A H    1  
ATOM   1036  H  HA   . ALA A 1 65  ? 1.470   12.039 36.316 1.00 0.00 ? 65  ALA A HA   1  
ATOM   1037  H  HB1  . ALA A 1 65  ? 1.045   9.577  38.080 1.00 0.00 ? 65  ALA A HB1  1  
ATOM   1038  H  HB2  . ALA A 1 65  ? -0.256  10.544 37.390 1.00 0.00 ? 65  ALA A HB2  1  
ATOM   1039  H  HB3  . ALA A 1 65  ? 0.829   9.645  36.334 1.00 0.00 ? 65  ALA A HB3  1  
ATOM   1040  N  N    . GLN A 1 66  ? 2.285   11.955 39.454 1.00 0.00 ? 66  GLN A N    1  
ATOM   1041  C  CA   . GLN A 1 66  ? 2.156   12.726 40.714 1.00 0.00 ? 66  GLN A CA   1  
ATOM   1042  C  C    . GLN A 1 66  ? 2.915   14.043 40.620 1.00 0.00 ? 66  GLN A C    1  
ATOM   1043  O  O    . GLN A 1 66  ? 2.760   14.914 41.454 1.00 0.00 ? 66  GLN A O    1  
ATOM   1044  C  CB   . GLN A 1 66  ? 2.748   11.889 41.857 1.00 0.00 ? 66  GLN A CB   1  
ATOM   1045  C  CG   . GLN A 1 66  ? 1.736   10.815 42.266 1.00 0.00 ? 66  GLN A CG   1  
ATOM   1046  C  CD   . GLN A 1 66  ? 2.380   9.877  43.290 1.00 0.00 ? 66  GLN A CD   1  
ATOM   1047  O  OE1  . GLN A 1 66  ? 1.725   9.354  44.169 1.00 0.00 ? 66  GLN A OE1  1  
ATOM   1048  N  NE2  . GLN A 1 66  ? 3.662   9.635  43.212 1.00 0.00 ? 66  GLN A NE2  1  
ATOM   1049  H  H    . GLN A 1 66  ? 2.944   11.232 39.378 1.00 0.00 ? 66  GLN A H    1  
ATOM   1050  H  HA   . GLN A 1 66  ? 1.101   12.935 40.895 1.00 0.00 ? 66  GLN A HA   1  
ATOM   1051  H  HB2  . GLN A 1 66  ? 3.662   11.419 41.528 1.00 0.00 ? 66  GLN A HB2  1  
ATOM   1052  H  HB3  . GLN A 1 66  ? 2.962   12.528 42.701 1.00 0.00 ? 66  GLN A HB3  1  
ATOM   1053  H  HG2  . GLN A 1 66  ? 0.865   11.280 42.707 1.00 0.00 ? 66  GLN A HG2  1  
ATOM   1054  H  HG3  . GLN A 1 66  ? 1.436   10.245 41.399 1.00 0.00 ? 66  GLN A HG3  1  
ATOM   1055  H  HE21 . GLN A 1 66  ? 4.197   10.054 42.506 1.00 0.00 ? 66  GLN A HE21 1  
ATOM   1056  H  HE22 . GLN A 1 66  ? 4.088   9.035  43.860 1.00 0.00 ? 66  GLN A HE22 1  
ATOM   1057  N  N    . HIS A 1 67  ? 3.724   14.164 39.602 1.00 0.00 ? 67  HIS A N    1  
ATOM   1058  C  CA   . HIS A 1 67  ? 4.502   15.414 39.431 1.00 0.00 ? 67  HIS A CA   1  
ATOM   1059  C  C    . HIS A 1 67  ? 3.674   16.465 38.697 1.00 0.00 ? 67  HIS A C    1  
ATOM   1060  O  O    . HIS A 1 67  ? 3.835   17.651 38.912 1.00 0.00 ? 67  HIS A O    1  
ATOM   1061  C  CB   . HIS A 1 67  ? 5.755   15.093 38.597 1.00 0.00 ? 67  HIS A CB   1  
ATOM   1062  C  CG   . HIS A 1 67  ? 6.827   14.486 39.506 1.00 0.00 ? 67  HIS A CG   1  
ATOM   1063  N  ND1  . HIS A 1 67  ? 7.140   14.927 40.631 1.00 0.00 ? 67  HIS A ND1  1  
ATOM   1064  C  CD2  . HIS A 1 67  ? 7.640   13.383 39.304 1.00 0.00 ? 67  HIS A CD2  1  
ATOM   1065  C  CE1  . HIS A 1 67  ? 8.056   14.230 41.166 1.00 0.00 ? 67  HIS A CE1  1  
ATOM   1066  N  NE2  . HIS A 1 67  ? 8.442   13.216 40.391 1.00 0.00 ? 67  HIS A NE2  1  
ATOM   1067  H  H    . HIS A 1 67  ? 3.817   13.432 38.957 1.00 0.00 ? 67  HIS A H    1  
ATOM   1068  H  HA   . HIS A 1 67  ? 4.778   15.800 40.413 1.00 0.00 ? 67  HIS A HA   1  
ATOM   1069  H  HB2  . HIS A 1 67  ? 5.503   14.386 37.819 1.00 0.00 ? 67  HIS A HB2  1  
ATOM   1070  H  HB3  . HIS A 1 67  ? 6.136   15.997 38.147 1.00 0.00 ? 67  HIS A HB3  1  
ATOM   1071  H  HD1  . HIS A 1 67  ? 6.731   15.711 41.049 1.00 0.00 ? 67  HIS A HD1  1  
ATOM   1072  H  HD2  . HIS A 1 67  ? 7.638   12.756 38.425 1.00 0.00 ? 67  HIS A HD2  1  
ATOM   1073  H  HE1  . HIS A 1 67  ? 8.475   14.435 42.141 1.00 0.00 ? 67  HIS A HE1  1  
ATOM   1074  N  N    . VAL A 1 68  ? 2.799   16.006 37.844 1.00 0.00 ? 68  VAL A N    1  
ATOM   1075  C  CA   . VAL A 1 68  ? 1.947   16.955 37.083 1.00 0.00 ? 68  VAL A CA   1  
ATOM   1076  C  C    . VAL A 1 68  ? 0.933   17.629 38.003 1.00 0.00 ? 68  VAL A C    1  
ATOM   1077  O  O    . VAL A 1 68  ? 0.251   18.551 37.608 1.00 0.00 ? 68  VAL A O    1  
ATOM   1078  C  CB   . VAL A 1 68  ? 1.189   16.159 36.005 1.00 0.00 ? 68  VAL A CB   1  
ATOM   1079  C  CG1  . VAL A 1 68  ? 0.072   17.028 35.424 1.00 0.00 ? 68  VAL A CG1  1  
ATOM   1080  C  CG2  . VAL A 1 68  ? 2.158   15.774 34.887 1.00 0.00 ? 68  VAL A CG2  1  
ATOM   1081  H  H    . VAL A 1 68  ? 2.706   15.041 37.707 1.00 0.00 ? 68  VAL A H    1  
ATOM   1082  H  HA   . VAL A 1 68  ? 2.580   17.717 36.629 1.00 0.00 ? 68  VAL A HA   1  
ATOM   1083  H  HB   . VAL A 1 68  ? 0.766   15.266 36.444 1.00 0.00 ? 68  VAL A HB   1  
ATOM   1084  H  HG11 . VAL A 1 68  ? 0.421   18.044 35.306 1.00 0.00 ? 68  VAL A HG11 1  
ATOM   1085  H  HG12 . VAL A 1 68  ? -0.226  16.641 34.460 1.00 0.00 ? 68  VAL A HG12 1  
ATOM   1086  H  HG13 . VAL A 1 68  ? -0.781  17.020 36.088 1.00 0.00 ? 68  VAL A HG13 1  
ATOM   1087  H  HG21 . VAL A 1 68  ? 3.084   15.415 35.313 1.00 0.00 ? 68  VAL A HG21 1  
ATOM   1088  H  HG22 . VAL A 1 68  ? 1.722   14.994 34.280 1.00 0.00 ? 68  VAL A HG22 1  
ATOM   1089  H  HG23 . VAL A 1 68  ? 2.362   16.635 34.268 1.00 0.00 ? 68  VAL A HG23 1  
ATOM   1090  N  N    . PHE A 1 69  ? 0.846   17.146 39.211 1.00 0.00 ? 69  PHE A N    1  
ATOM   1091  C  CA   . PHE A 1 69  ? -0.116  17.744 40.173 1.00 0.00 ? 69  PHE A CA   1  
ATOM   1092  C  C    . PHE A 1 69  ? 0.429   19.030 40.758 1.00 0.00 ? 69  PHE A C    1  
ATOM   1093  O  O    . PHE A 1 69  ? 0.022   20.108 40.367 1.00 0.00 ? 69  PHE A O    1  
ATOM   1094  C  CB   . PHE A 1 69  ? -0.341  16.735 41.310 1.00 0.00 ? 69  PHE A CB   1  
ATOM   1095  C  CG   . PHE A 1 69  ? -1.571  17.138 42.123 1.00 0.00 ? 69  PHE A CG   1  
ATOM   1096  C  CD1  . PHE A 1 69  ? -2.842  16.790 41.695 1.00 0.00 ? 69  PHE A CD1  1  
ATOM   1097  C  CD2  . PHE A 1 69  ? -1.430  17.842 43.306 1.00 0.00 ? 69  PHE A CD2  1  
ATOM   1098  C  CE1  . PHE A 1 69  ? -3.948  17.139 42.441 1.00 0.00 ? 69  PHE A CE1  1  
ATOM   1099  C  CE2  . PHE A 1 69  ? -2.539  18.188 44.048 1.00 0.00 ? 69  PHE A CE2  1  
ATOM   1100  C  CZ   . PHE A 1 69  ? -3.796  17.838 43.615 1.00 0.00 ? 69  PHE A CZ   1  
ATOM   1101  H  H    . PHE A 1 69  ? 1.407   16.390 39.480 1.00 0.00 ? 69  PHE A H    1  
ATOM   1102  H  HA   . PHE A 1 69  ? -1.045  17.969 39.655 1.00 0.00 ? 69  PHE A HA   1  
ATOM   1103  H  HB2  . PHE A 1 69  ? -0.494  15.749 40.898 1.00 0.00 ? 69  PHE A HB2  1  
ATOM   1104  H  HB3  . PHE A 1 69  ? 0.522   16.718 41.958 1.00 0.00 ? 69  PHE A HB3  1  
ATOM   1105  H  HD1  . PHE A 1 69  ? -2.966  16.243 40.774 1.00 0.00 ? 69  PHE A HD1  1  
ATOM   1106  H  HD2  . PHE A 1 69  ? -0.445  18.123 43.650 1.00 0.00 ? 69  PHE A HD2  1  
ATOM   1107  H  HE1  . PHE A 1 69  ? -4.937  16.861 42.102 1.00 0.00 ? 69  PHE A HE1  1  
ATOM   1108  H  HE2  . PHE A 1 69  ? -2.419  18.737 44.972 1.00 0.00 ? 69  PHE A HE2  1  
ATOM   1109  H  HZ   . PHE A 1 69  ? -4.664  18.115 44.195 1.00 0.00 ? 69  PHE A HZ   1  
ATOM   1110  N  N    . ARG A 1 70  ? 1.326   18.908 41.698 1.00 0.00 ? 70  ARG A N    1  
ATOM   1111  C  CA   . ARG A 1 70  ? 1.890   20.129 42.301 1.00 0.00 ? 70  ARG A CA   1  
ATOM   1112  C  C    . ARG A 1 70  ? 2.293   21.098 41.201 1.00 0.00 ? 70  ARG A C    1  
ATOM   1113  O  O    . ARG A 1 70  ? 2.545   22.262 41.449 1.00 0.00 ? 70  ARG A O    1  
ATOM   1114  C  CB   . ARG A 1 70  ? 3.130   19.749 43.127 1.00 0.00 ? 70  ARG A CB   1  
ATOM   1115  C  CG   . ARG A 1 70  ? 3.301   20.758 44.267 1.00 0.00 ? 70  ARG A CG   1  
ATOM   1116  C  CD   . ARG A 1 70  ? 2.399   20.356 45.439 1.00 0.00 ? 70  ARG A CD   1  
ATOM   1117  N  NE   . ARG A 1 70  ? 2.799   19.003 45.919 1.00 0.00 ? 70  ARG A NE   1  
ATOM   1118  C  CZ   . ARG A 1 70  ? 2.501   18.644 47.139 1.00 0.00 ? 70  ARG A CZ   1  
ATOM   1119  N  NH1  . ARG A 1 70  ? 2.864   19.412 48.129 1.00 0.00 ? 70  ARG A NH1  1  
ATOM   1120  N  NH2  . ARG A 1 70  ? 1.849   17.529 47.326 1.00 0.00 ? 70  ARG A NH2  1  
ATOM   1121  H  H    . ARG A 1 70  ? 1.619   18.022 41.998 1.00 0.00 ? 70  ARG A H    1  
ATOM   1122  H  HA   . ARG A 1 70  ? 1.131   20.599 42.928 1.00 0.00 ? 70  ARG A HA   1  
ATOM   1123  H  HB2  . ARG A 1 70  ? 3.002   18.758 43.535 1.00 0.00 ? 70  ARG A HB2  1  
ATOM   1124  H  HB3  . ARG A 1 70  ? 4.004   19.761 42.495 1.00 0.00 ? 70  ARG A HB3  1  
ATOM   1125  H  HG2  . ARG A 1 70  ? 4.331   20.768 44.589 1.00 0.00 ? 70  ARG A HG2  1  
ATOM   1126  H  HG3  . ARG A 1 70  ? 3.028   21.744 43.921 1.00 0.00 ? 70  ARG A HG3  1  
ATOM   1127  H  HD2  . ARG A 1 70  ? 2.507   21.067 46.245 1.00 0.00 ? 70  ARG A HD2  1  
ATOM   1128  H  HD3  . ARG A 1 70  ? 1.368   20.332 45.118 1.00 0.00 ? 70  ARG A HD3  1  
ATOM   1129  H  HE   . ARG A 1 70  ? 3.279   18.389 45.325 1.00 0.00 ? 70  ARG A HE   1  
ATOM   1130  H  HH11 . ARG A 1 70  ? 3.361   20.261 47.948 1.00 0.00 ? 70  ARG A HH11 1  
ATOM   1131  H  HH12 . ARG A 1 70  ? 2.645   19.152 49.070 1.00 0.00 ? 70  ARG A HH12 1  
ATOM   1132  H  HH21 . ARG A 1 70  ? 1.584   16.967 46.542 1.00 0.00 ? 70  ARG A HH21 1  
ATOM   1133  H  HH22 . ARG A 1 70  ? 1.612   17.239 48.252 1.00 0.00 ? 70  ARG A HH22 1  
ATOM   1134  N  N    . SER A 1 71  ? 2.346   20.593 39.989 1.00 0.00 ? 71  SER A N    1  
ATOM   1135  C  CA   . SER A 1 71  ? 2.723   21.453 38.857 1.00 0.00 ? 71  SER A CA   1  
ATOM   1136  C  C    . SER A 1 71  ? 1.803   22.657 38.777 1.00 0.00 ? 71  SER A C    1  
ATOM   1137  O  O    . SER A 1 71  ? 2.246   23.756 38.506 1.00 0.00 ? 71  SER A O    1  
ATOM   1138  C  CB   . SER A 1 71  ? 2.573   20.641 37.564 1.00 0.00 ? 71  SER A CB   1  
ATOM   1139  O  OG   . SER A 1 71  ? 1.194   20.751 37.246 1.00 0.00 ? 71  SER A OG   1  
ATOM   1140  H  H    . SER A 1 71  ? 2.141   19.646 39.839 1.00 0.00 ? 71  SER A H    1  
ATOM   1141  H  HA   . SER A 1 71  ? 3.748   21.792 38.988 1.00 0.00 ? 71  SER A HA   1  
ATOM   1142  H  HB2  . SER A 1 71  ? 3.170   21.066 36.772 1.00 0.00 ? 71  SER A HB2  1  
ATOM   1143  H  HB3  . SER A 1 71  ? 2.839   19.608 37.726 1.00 0.00 ? 71  SER A HB3  1  
ATOM   1144  H  HG   . SER A 1 71  ? 0.846   19.864 37.123 1.00 0.00 ? 71  SER A HG   1  
ATOM   1145  N  N    . PHE A 1 72  ? 0.524   22.434 39.015 1.00 0.00 ? 72  PHE A N    1  
ATOM   1146  C  CA   . PHE A 1 72  ? -0.429  23.577 38.951 1.00 0.00 ? 72  PHE A CA   1  
ATOM   1147  C  C    . PHE A 1 72  ? -1.516  23.477 40.016 1.00 0.00 ? 72  PHE A C    1  
ATOM   1148  O  O    . PHE A 1 72  ? -2.393  24.316 40.076 1.00 0.00 ? 72  PHE A O    1  
ATOM   1149  C  CB   . PHE A 1 72  ? -1.094  23.579 37.567 1.00 0.00 ? 72  PHE A CB   1  
ATOM   1150  C  CG   . PHE A 1 72  ? -1.643  24.979 37.279 1.00 0.00 ? 72  PHE A CG   1  
ATOM   1151  C  CD1  . PHE A 1 72  ? -0.811  25.972 36.790 1.00 0.00 ? 72  PHE A CD1  1  
ATOM   1152  C  CD2  . PHE A 1 72  ? -2.977  25.271 37.508 1.00 0.00 ? 72  PHE A CD2  1  
ATOM   1153  C  CE1  . PHE A 1 72  ? -1.308  27.235 36.535 1.00 0.00 ? 72  PHE A CE1  1  
ATOM   1154  C  CE2  . PHE A 1 72  ? -3.469  26.535 37.253 1.00 0.00 ? 72  PHE A CE2  1  
ATOM   1155  C  CZ   . PHE A 1 72  ? -2.635  27.515 36.766 1.00 0.00 ? 72  PHE A CZ   1  
ATOM   1156  H  H    . PHE A 1 72  ? 0.200   21.515 39.229 1.00 0.00 ? 72  PHE A H    1  
ATOM   1157  H  HA   . PHE A 1 72  ? 0.121   24.503 39.108 1.00 0.00 ? 72  PHE A HA   1  
ATOM   1158  H  HB2  . PHE A 1 72  ? -0.369  23.317 36.812 1.00 0.00 ? 72  PHE A HB2  1  
ATOM   1159  H  HB3  . PHE A 1 72  ? -1.906  22.866 37.549 1.00 0.00 ? 72  PHE A HB3  1  
ATOM   1160  H  HD1  . PHE A 1 72  ? 0.231   25.759 36.608 1.00 0.00 ? 72  PHE A HD1  1  
ATOM   1161  H  HD2  . PHE A 1 72  ? -3.636  24.506 37.891 1.00 0.00 ? 72  PHE A HD2  1  
ATOM   1162  H  HE1  . PHE A 1 72  ? -0.653  28.005 36.155 1.00 0.00 ? 72  PHE A HE1  1  
ATOM   1163  H  HE2  . PHE A 1 72  ? -4.510  26.755 37.435 1.00 0.00 ? 72  PHE A HE2  1  
ATOM   1164  H  HZ   . PHE A 1 72  ? -3.021  28.503 36.566 1.00 0.00 ? 72  PHE A HZ   1  
ATOM   1165  N  N    . ASP A 1 73  ? -1.447  22.460 40.838 1.00 0.00 ? 73  ASP A N    1  
ATOM   1166  C  CA   . ASP A 1 73  ? -2.484  22.316 41.897 1.00 0.00 ? 73  ASP A CA   1  
ATOM   1167  C  C    . ASP A 1 73  ? -2.011  22.919 43.206 1.00 0.00 ? 73  ASP A C    1  
ATOM   1168  O  O    . ASP A 1 73  ? -2.483  22.554 44.265 1.00 0.00 ? 73  ASP A O    1  
ATOM   1169  C  CB   . ASP A 1 73  ? -2.767  20.829 42.128 1.00 0.00 ? 73  ASP A CB   1  
ATOM   1170  C  CG   . ASP A 1 73  ? -4.009  20.704 43.016 1.00 0.00 ? 73  ASP A CG   1  
ATOM   1171  O  OD1  . ASP A 1 73  ? -5.073  21.010 42.505 1.00 0.00 ? 73  ASP A OD1  1  
ATOM   1172  O  OD2  . ASP A 1 73  ? -3.822  20.322 44.156 1.00 0.00 ? 73  ASP A OD2  1  
ATOM   1173  H  H    . ASP A 1 73  ? -0.722  21.805 40.760 1.00 0.00 ? 73  ASP A H    1  
ATOM   1174  H  HA   . ASP A 1 73  ? -3.386  22.835 41.581 1.00 0.00 ? 73  ASP A HA   1  
ATOM   1175  H  HB2  . ASP A 1 73  ? -2.943  20.334 41.186 1.00 0.00 ? 73  ASP A HB2  1  
ATOM   1176  H  HB3  . ASP A 1 73  ? -1.926  20.368 42.624 1.00 0.00 ? 73  ASP A HB3  1  
ATOM   1177  N  N    . ALA A 1 74  ? -1.089  23.833 43.106 1.00 0.00 ? 74  ALA A N    1  
ATOM   1178  C  CA   . ALA A 1 74  ? -0.556  24.486 44.328 1.00 0.00 ? 74  ALA A CA   1  
ATOM   1179  C  C    . ALA A 1 74  ? -1.091  25.900 44.451 1.00 0.00 ? 74  ALA A C    1  
ATOM   1180  O  O    . ALA A 1 74  ? -0.653  26.669 45.284 1.00 0.00 ? 74  ALA A O    1  
ATOM   1181  C  CB   . ALA A 1 74  ? 0.978   24.538 44.217 1.00 0.00 ? 74  ALA A CB   1  
ATOM   1182  H  H    . ALA A 1 74  ? -0.754  24.093 42.229 1.00 0.00 ? 74  ALA A H    1  
ATOM   1183  H  HA   . ALA A 1 74  ? -0.864  23.918 45.200 1.00 0.00 ? 74  ALA A HA   1  
ATOM   1184  H  HB1  . ALA A 1 74  ? 1.368   23.535 44.108 1.00 0.00 ? 74  ALA A HB1  1  
ATOM   1185  H  HB2  . ALA A 1 74  ? 1.261   25.124 43.355 1.00 0.00 ? 74  ALA A HB2  1  
ATOM   1186  H  HB3  . ALA A 1 74  ? 1.394   24.987 45.105 1.00 0.00 ? 74  ALA A HB3  1  
ATOM   1187  N  N    . ASN A 1 75  ? -2.032  26.217 43.612 1.00 0.00 ? 75  ASN A N    1  
ATOM   1188  C  CA   . ASN A 1 75  ? -2.617  27.571 43.653 1.00 0.00 ? 75  ASN A CA   1  
ATOM   1189  C  C    . ASN A 1 75  ? -3.455  27.749 44.910 1.00 0.00 ? 75  ASN A C    1  
ATOM   1190  O  O    . ASN A 1 75  ? -4.625  28.059 44.833 1.00 0.00 ? 75  ASN A O    1  
ATOM   1191  C  CB   . ASN A 1 75  ? -3.527  27.733 42.426 1.00 0.00 ? 75  ASN A CB   1  
ATOM   1192  C  CG   . ASN A 1 75  ? -4.703  26.754 42.535 1.00 0.00 ? 75  ASN A CG   1  
ATOM   1193  O  OD1  . ASN A 1 75  ? -4.577  25.576 42.257 1.00 0.00 ? 75  ASN A OD1  1  
ATOM   1194  N  ND2  . ASN A 1 75  ? -5.861  27.200 42.936 1.00 0.00 ? 75  ASN A ND2  1  
ATOM   1195  H  H    . ASN A 1 75  ? -2.352  25.562 42.958 1.00 0.00 ? 75  ASN A H    1  
ATOM   1196  H  HA   . ASN A 1 75  ? -1.817  28.308 43.647 1.00 0.00 ? 75  ASN A HA   1  
ATOM   1197  H  HB2  . ASN A 1 75  ? -3.905  28.743 42.382 1.00 0.00 ? 75  ASN A HB2  1  
ATOM   1198  H  HB3  . ASN A 1 75  ? -2.970  27.520 41.526 1.00 0.00 ? 75  ASN A HB3  1  
ATOM   1199  H  HD21 . ASN A 1 75  ? -5.971  28.148 43.161 1.00 0.00 ? 75  ASN A HD21 1  
ATOM   1200  H  HD22 . ASN A 1 75  ? -6.622  26.587 43.013 1.00 0.00 ? 75  ASN A HD22 1  
ATOM   1201  N  N    . SER A 1 76  ? -2.845  27.551 46.050 1.00 0.00 ? 76  SER A N    1  
ATOM   1202  C  CA   . SER A 1 76  ? -3.610  27.707 47.310 1.00 0.00 ? 76  SER A CA   1  
ATOM   1203  C  C    . SER A 1 76  ? -4.951  27.002 47.189 1.00 0.00 ? 76  SER A C    1  
ATOM   1204  O  O    . SER A 1 76  ? -5.990  27.628 47.253 1.00 0.00 ? 76  SER A O    1  
ATOM   1205  C  CB   . SER A 1 76  ? -3.860  29.206 47.546 1.00 0.00 ? 76  SER A CB   1  
ATOM   1206  O  OG   . SER A 1 76  ? -2.560  29.778 47.565 1.00 0.00 ? 76  SER A OG   1  
ATOM   1207  H  H    . SER A 1 76  ? -1.895  27.303 46.070 1.00 0.00 ? 76  SER A H    1  
ATOM   1208  H  HA   . SER A 1 76  ? -3.044  27.268 48.132 1.00 0.00 ? 76  SER A HA   1  
ATOM   1209  H  HB2  . SER A 1 76  ? -4.442  29.629 46.741 1.00 0.00 ? 76  SER A HB2  1  
ATOM   1210  H  HB3  . SER A 1 76  ? -4.353  29.367 48.493 1.00 0.00 ? 76  SER A HB3  1  
ATOM   1211  H  HG   . SER A 1 76  ? -2.424  30.229 46.728 1.00 0.00 ? 76  SER A HG   1  
ATOM   1212  N  N    . ASP A 1 77  ? -4.901  25.706 47.014 1.00 0.00 ? 77  ASP A N    1  
ATOM   1213  C  CA   . ASP A 1 77  ? -6.164  24.937 46.883 1.00 0.00 ? 77  ASP A CA   1  
ATOM   1214  C  C    . ASP A 1 77  ? -6.075  23.590 47.586 1.00 0.00 ? 77  ASP A C    1  
ATOM   1215  O  O    . ASP A 1 77  ? -6.789  23.336 48.535 1.00 0.00 ? 77  ASP A O    1  
ATOM   1216  C  CB   . ASP A 1 77  ? -6.407  24.686 45.390 1.00 0.00 ? 77  ASP A CB   1  
ATOM   1217  C  CG   . ASP A 1 77  ? -5.170  24.028 44.781 1.00 0.00 ? 77  ASP A CG   1  
ATOM   1218  O  OD1  . ASP A 1 77  ? -4.192  24.742 44.638 1.00 0.00 ? 77  ASP A OD1  1  
ATOM   1219  O  OD2  . ASP A 1 77  ? -5.273  22.846 44.492 1.00 0.00 ? 77  ASP A OD2  1  
ATOM   1220  H  H    . ASP A 1 77  ? -4.037  25.245 46.970 1.00 0.00 ? 77  ASP A H    1  
ATOM   1221  H  HA   . ASP A 1 77  ? -6.980  25.509 47.316 1.00 0.00 ? 77  ASP A HA   1  
ATOM   1222  H  HB2  . ASP A 1 77  ? -7.256  24.034 45.262 1.00 0.00 ? 77  ASP A HB2  1  
ATOM   1223  H  HB3  . ASP A 1 77  ? -6.595  25.621 44.887 1.00 0.00 ? 77  ASP A HB3  1  
ATOM   1224  N  N    . GLY A 1 78  ? -5.199  22.750 47.102 1.00 0.00 ? 78  GLY A N    1  
ATOM   1225  C  CA   . GLY A 1 78  ? -5.040  21.404 47.725 1.00 0.00 ? 78  GLY A CA   1  
ATOM   1226  C  C    . GLY A 1 78  ? -5.744  20.350 46.865 1.00 0.00 ? 78  GLY A C    1  
ATOM   1227  O  O    . GLY A 1 78  ? -5.558  19.163 47.057 1.00 0.00 ? 78  GLY A O    1  
ATOM   1228  H  H    . GLY A 1 78  ? -4.645  23.004 46.335 1.00 0.00 ? 78  GLY A H    1  
ATOM   1229  H  HA2  . GLY A 1 78  ? -3.991  21.165 47.796 1.00 0.00 ? 78  GLY A HA2  1  
ATOM   1230  H  HA3  . GLY A 1 78  ? -5.475  21.409 48.711 1.00 0.00 ? 78  GLY A HA3  1  
ATOM   1231  N  N    . THR A 1 79  ? -6.539  20.812 45.931 1.00 0.00 ? 79  THR A N    1  
ATOM   1232  C  CA   . THR A 1 79  ? -7.266  19.865 45.045 1.00 0.00 ? 79  THR A CA   1  
ATOM   1233  C  C    . THR A 1 79  ? -7.303  20.387 43.612 1.00 0.00 ? 79  THR A C    1  
ATOM   1234  O  O    . THR A 1 79  ? -7.262  21.582 43.379 1.00 0.00 ? 79  THR A O    1  
ATOM   1235  C  CB   . THR A 1 79  ? -8.705  19.721 45.557 1.00 0.00 ? 79  THR A CB   1  
ATOM   1236  O  OG1  . THR A 1 79  ? -8.988  20.934 46.227 1.00 0.00 ? 79  THR A OG1  1  
ATOM   1237  C  CG2  . THR A 1 79  ? -8.788  18.645 46.653 1.00 0.00 ? 79  THR A CG2  1  
ATOM   1238  H  H    . THR A 1 79  ? -6.654  21.778 45.816 1.00 0.00 ? 79  THR A H    1  
ATOM   1239  H  HA   . THR A 1 79  ? -6.754  18.904 45.055 1.00 0.00 ? 79  THR A HA   1  
ATOM   1240  H  HB   . THR A 1 79  ? -9.411  19.552 44.744 1.00 0.00 ? 79  THR A HB   1  
ATOM   1241  H  HG1  . THR A 1 79  ? -8.704  20.843 47.139 1.00 0.00 ? 79  THR A HG1  1  
ATOM   1242  H  HG21 . THR A 1 79  ? -8.003  18.800 47.378 1.00 0.00 ? 79  THR A HG21 1  
ATOM   1243  H  HG22 . THR A 1 79  ? -9.746  18.701 47.149 1.00 0.00 ? 79  THR A HG22 1  
ATOM   1244  H  HG23 . THR A 1 79  ? -8.676  17.666 46.210 1.00 0.00 ? 79  THR A HG23 1  
ATOM   1245  N  N    . LEU A 1 80  ? -7.377  19.481 42.675 1.00 0.00 ? 80  LEU A N    1  
ATOM   1246  C  CA   . LEU A 1 80  ? -7.416  19.898 41.251 1.00 0.00 ? 80  LEU A CA   1  
ATOM   1247  C  C    . LEU A 1 80  ? -8.852  20.063 40.765 1.00 0.00 ? 80  LEU A C    1  
ATOM   1248  O  O    . LEU A 1 80  ? -9.636  19.135 40.811 1.00 0.00 ? 80  LEU A O    1  
ATOM   1249  C  CB   . LEU A 1 80  ? -6.742  18.800 40.410 1.00 0.00 ? 80  LEU A CB   1  
ATOM   1250  C  CG   . LEU A 1 80  ? -5.245  19.097 40.300 1.00 0.00 ? 80  LEU A CG   1  
ATOM   1251  C  CD1  . LEU A 1 80  ? -4.571  17.989 39.491 1.00 0.00 ? 80  LEU A CD1  1  
ATOM   1252  C  CD2  . LEU A 1 80  ? -5.050  20.433 39.579 1.00 0.00 ? 80  LEU A CD2  1  
ATOM   1253  H  H    . LEU A 1 80  ? -7.407  18.529 42.912 1.00 0.00 ? 80  LEU A H    1  
ATOM   1254  H  HA   . LEU A 1 80  ? -6.892  20.846 41.143 1.00 0.00 ? 80  LEU A HA   1  
ATOM   1255  H  HB2  . LEU A 1 80  ? -6.889  17.839 40.881 1.00 0.00 ? 80  LEU A HB2  1  
ATOM   1256  H  HB3  . LEU A 1 80  ? -7.179  18.780 39.423 1.00 0.00 ? 80  LEU A HB3  1  
ATOM   1257  H  HG   . LEU A 1 80  ? -4.807  19.144 41.286 1.00 0.00 ? 80  LEU A HG   1  
ATOM   1258  H  HD11 . LEU A 1 80  ? -4.836  17.028 39.903 1.00 0.00 ? 80  LEU A HD11 1  
ATOM   1259  H  HD12 . LEU A 1 80  ? -4.897  18.037 38.464 1.00 0.00 ? 80  LEU A HD12 1  
ATOM   1260  H  HD13 . LEU A 1 80  ? -3.499  18.109 39.531 1.00 0.00 ? 80  LEU A HD13 1  
ATOM   1261  H  HD21 . LEU A 1 80  ? -5.981  20.745 39.133 1.00 0.00 ? 80  LEU A HD21 1  
ATOM   1262  H  HD22 . LEU A 1 80  ? -4.726  21.184 40.281 1.00 0.00 ? 80  LEU A HD22 1  
ATOM   1263  H  HD23 . LEU A 1 80  ? -4.304  20.323 38.806 1.00 0.00 ? 80  LEU A HD23 1  
ATOM   1264  N  N    . ASP A 1 81  ? -9.172  21.243 40.303 1.00 0.00 ? 81  ASP A N    1  
ATOM   1265  C  CA   . ASP A 1 81  ? -10.549 21.481 39.811 1.00 0.00 ? 81  ASP A CA   1  
ATOM   1266  C  C    . ASP A 1 81  ? -10.636 21.151 38.323 1.00 0.00 ? 81  ASP A C    1  
ATOM   1267  O  O    . ASP A 1 81  ? -9.632  21.102 37.640 1.00 0.00 ? 81  ASP A O    1  
ATOM   1268  C  CB   . ASP A 1 81  ? -10.897 22.966 40.019 1.00 0.00 ? 81  ASP A CB   1  
ATOM   1269  C  CG   . ASP A 1 81  ? -11.057 23.242 41.517 1.00 0.00 ? 81  ASP A CG   1  
ATOM   1270  O  OD1  . ASP A 1 81  ? -11.885 22.569 42.107 1.00 0.00 ? 81  ASP A OD1  1  
ATOM   1271  O  OD2  . ASP A 1 81  ? -10.341 24.112 41.986 1.00 0.00 ? 81  ASP A OD2  1  
ATOM   1272  H  H    . ASP A 1 81  ? -8.507  21.964 40.285 1.00 0.00 ? 81  ASP A H    1  
ATOM   1273  H  HA   . ASP A 1 81  ? -11.239 20.837 40.359 1.00 0.00 ? 81  ASP A HA   1  
ATOM   1274  H  HB2  . ASP A 1 81  ? -10.108 23.587 39.623 1.00 0.00 ? 81  ASP A HB2  1  
ATOM   1275  H  HB3  . ASP A 1 81  ? -11.823 23.199 39.513 1.00 0.00 ? 81  ASP A HB3  1  
ATOM   1276  N  N    . PHE A 1 82  ? -11.826 20.929 37.846 1.00 0.00 ? 82  PHE A N    1  
ATOM   1277  C  CA   . PHE A 1 82  ? -11.983 20.600 36.406 1.00 0.00 ? 82  PHE A CA   1  
ATOM   1278  C  C    . PHE A 1 82  ? -11.468 21.724 35.511 1.00 0.00 ? 82  PHE A C    1  
ATOM   1279  O  O    . PHE A 1 82  ? -10.916 21.475 34.461 1.00 0.00 ? 82  PHE A O    1  
ATOM   1280  C  CB   . PHE A 1 82  ? -13.471 20.389 36.119 1.00 0.00 ? 82  PHE A CB   1  
ATOM   1281  C  CG   . PHE A 1 82  ? -13.617 19.499 34.887 1.00 0.00 ? 82  PHE A CG   1  
ATOM   1282  C  CD1  . PHE A 1 82  ? -13.611 20.049 33.615 1.00 0.00 ? 82  PHE A CD1  1  
ATOM   1283  C  CD2  . PHE A 1 82  ? -13.743 18.130 35.026 1.00 0.00 ? 82  PHE A CD2  1  
ATOM   1284  C  CE1  . PHE A 1 82  ? -13.729 19.239 32.506 1.00 0.00 ? 82  PHE A CE1  1  
ATOM   1285  C  CE2  . PHE A 1 82  ? -13.860 17.324 33.916 1.00 0.00 ? 82  PHE A CE2  1  
ATOM   1286  C  CZ   . PHE A 1 82  ? -13.854 17.878 32.658 1.00 0.00 ? 82  PHE A CZ   1  
ATOM   1287  H  H    . PHE A 1 82  ? -12.612 20.978 38.432 1.00 0.00 ? 82  PHE A H    1  
ATOM   1288  H  HA   . PHE A 1 82  ? -11.419 19.693 36.190 1.00 0.00 ? 82  PHE A HA   1  
ATOM   1289  H  HB2  . PHE A 1 82  ? -13.941 19.909 36.963 1.00 0.00 ? 82  PHE A HB2  1  
ATOM   1290  H  HB3  . PHE A 1 82  ? -13.948 21.338 35.936 1.00 0.00 ? 82  PHE A HB3  1  
ATOM   1291  H  HD1  . PHE A 1 82  ? -13.514 21.120 33.492 1.00 0.00 ? 82  PHE A HD1  1  
ATOM   1292  H  HD2  . PHE A 1 82  ? -13.750 17.690 36.012 1.00 0.00 ? 82  PHE A HD2  1  
ATOM   1293  H  HE1  . PHE A 1 82  ? -13.723 19.673 31.517 1.00 0.00 ? 82  PHE A HE1  1  
ATOM   1294  H  HE2  . PHE A 1 82  ? -13.953 16.257 34.036 1.00 0.00 ? 82  PHE A HE2  1  
ATOM   1295  H  HZ   . PHE A 1 82  ? -13.949 17.245 31.791 1.00 0.00 ? 82  PHE A HZ   1  
ATOM   1296  N  N    . LYS A 1 83  ? -11.660 22.938 35.936 1.00 0.00 ? 83  LYS A N    1  
ATOM   1297  C  CA   . LYS A 1 83  ? -11.183 24.079 35.114 1.00 0.00 ? 83  LYS A CA   1  
ATOM   1298  C  C    . LYS A 1 83  ? -9.685  23.973 34.865 1.00 0.00 ? 83  LYS A C    1  
ATOM   1299  O  O    . LYS A 1 83  ? -9.246  23.890 33.736 1.00 0.00 ? 83  LYS A O    1  
ATOM   1300  C  CB   . LYS A 1 83  ? -11.472 25.380 35.884 1.00 0.00 ? 83  LYS A CB   1  
ATOM   1301  C  CG   . LYS A 1 83  ? -10.744 26.548 35.208 1.00 0.00 ? 83  LYS A CG   1  
ATOM   1302  C  CD   . LYS A 1 83  ? -9.606  27.017 36.113 1.00 0.00 ? 83  LYS A CD   1  
ATOM   1303  C  CE   . LYS A 1 83  ? -8.955  28.252 35.497 1.00 0.00 ? 83  LYS A CE   1  
ATOM   1304  N  NZ   . LYS A 1 83  ? -8.087  28.932 36.496 1.00 0.00 ? 83  LYS A NZ   1  
ATOM   1305  H  H    . LYS A 1 83  ? -12.111 23.098 36.789 1.00 0.00 ? 83  LYS A H    1  
ATOM   1306  H  HA   . LYS A 1 83  ? -11.706 24.070 34.153 1.00 0.00 ? 83  LYS A HA   1  
ATOM   1307  H  HB2  . LYS A 1 83  ? -12.535 25.570 35.889 1.00 0.00 ? 83  LYS A HB2  1  
ATOM   1308  H  HB3  . LYS A 1 83  ? -11.128 25.279 36.904 1.00 0.00 ? 83  LYS A HB3  1  
ATOM   1309  H  HG2  . LYS A 1 83  ? -10.345 26.230 34.256 1.00 0.00 ? 83  LYS A HG2  1  
ATOM   1310  H  HG3  . LYS A 1 83  ? -11.436 27.361 35.046 1.00 0.00 ? 83  LYS A HG3  1  
ATOM   1311  H  HD2  . LYS A 1 83  ? -9.996  27.261 37.090 1.00 0.00 ? 83  LYS A HD2  1  
ATOM   1312  H  HD3  . LYS A 1 83  ? -8.872  26.231 36.210 1.00 0.00 ? 83  LYS A HD3  1  
ATOM   1313  H  HE2  . LYS A 1 83  ? -8.354  27.961 34.648 1.00 0.00 ? 83  LYS A HE2  1  
ATOM   1314  H  HE3  . LYS A 1 83  ? -9.721  28.940 35.168 1.00 0.00 ? 83  LYS A HE3  1  
ATOM   1315  H  HZ1  . LYS A 1 83  ? -8.500  28.820 37.445 1.00 0.00 ? 83  LYS A HZ1  1  
ATOM   1316  H  HZ2  . LYS A 1 83  ? -7.140  28.504 36.478 1.00 0.00 ? 83  LYS A HZ2  1  
ATOM   1317  H  HZ3  . LYS A 1 83  ? -8.017  29.942 36.264 1.00 0.00 ? 83  LYS A HZ3  1  
ATOM   1318  N  N    . GLU A 1 84  ? -8.926  23.974 35.924 1.00 0.00 ? 84  GLU A N    1  
ATOM   1319  C  CA   . GLU A 1 84  ? -7.454  23.875 35.765 1.00 0.00 ? 84  GLU A CA   1  
ATOM   1320  C  C    . GLU A 1 84  ? -7.046  22.510 35.215 1.00 0.00 ? 84  GLU A C    1  
ATOM   1321  O  O    . GLU A 1 84  ? -5.969  22.356 34.673 1.00 0.00 ? 84  GLU A O    1  
ATOM   1322  C  CB   . GLU A 1 84  ? -6.803  24.067 37.144 1.00 0.00 ? 84  GLU A CB   1  
ATOM   1323  C  CG   . GLU A 1 84  ? -7.428  23.082 38.138 1.00 0.00 ? 84  GLU A CG   1  
ATOM   1324  C  CD   . GLU A 1 84  ? -6.869  23.352 39.538 1.00 0.00 ? 84  GLU A CD   1  
ATOM   1325  O  OE1  . GLU A 1 84  ? -5.653  23.349 39.647 1.00 0.00 ? 84  GLU A OE1  1  
ATOM   1326  O  OE2  . GLU A 1 84  ? -7.690  23.543 40.421 1.00 0.00 ? 84  GLU A OE2  1  
ATOM   1327  H  H    . GLU A 1 84  ? -9.324  24.042 36.817 1.00 0.00 ? 84  GLU A H    1  
ATOM   1328  H  HA   . GLU A 1 84  ? -7.123  24.648 35.072 1.00 0.00 ? 84  GLU A HA   1  
ATOM   1329  H  HB2  . GLU A 1 84  ? -5.741  23.885 37.071 1.00 0.00 ? 84  GLU A HB2  1  
ATOM   1330  H  HB3  . GLU A 1 84  ? -6.966  25.080 37.484 1.00 0.00 ? 84  GLU A HB3  1  
ATOM   1331  H  HG2  . GLU A 1 84  ? -8.500  23.206 38.151 1.00 0.00 ? 84  GLU A HG2  1  
ATOM   1332  H  HG3  . GLU A 1 84  ? -7.190  22.070 37.848 1.00 0.00 ? 84  GLU A HG3  1  
ATOM   1333  N  N    . TYR A 1 85  ? -7.910  21.543 35.362 1.00 0.00 ? 85  TYR A N    1  
ATOM   1334  C  CA   . TYR A 1 85  ? -7.575  20.188 34.850 1.00 0.00 ? 85  TYR A CA   1  
ATOM   1335  C  C    . TYR A 1 85  ? -7.484  20.187 33.332 1.00 0.00 ? 85  TYR A C    1  
ATOM   1336  O  O    . TYR A 1 85  ? -6.513  19.722 32.769 1.00 0.00 ? 85  TYR A O    1  
ATOM   1337  C  CB   . TYR A 1 85  ? -8.683  19.214 35.288 1.00 0.00 ? 85  TYR A CB   1  
ATOM   1338  C  CG   . TYR A 1 85  ? -8.401  17.818 34.720 1.00 0.00 ? 85  TYR A CG   1  
ATOM   1339  C  CD1  . TYR A 1 85  ? -7.313  17.089 35.156 1.00 0.00 ? 85  TYR A CD1  1  
ATOM   1340  C  CD2  . TYR A 1 85  ? -9.242  17.263 33.774 1.00 0.00 ? 85  TYR A CD2  1  
ATOM   1341  C  CE1  . TYR A 1 85  ? -7.071  15.824 34.657 1.00 0.00 ? 85  TYR A CE1  1  
ATOM   1342  C  CE2  . TYR A 1 85  ? -8.999  15.998 33.277 1.00 0.00 ? 85  TYR A CE2  1  
ATOM   1343  C  CZ   . TYR A 1 85  ? -7.912  15.269 33.713 1.00 0.00 ? 85  TYR A CZ   1  
ATOM   1344  O  OH   . TYR A 1 85  ? -7.676  14.003 33.221 1.00 0.00 ? 85  TYR A OH   1  
ATOM   1345  H  H    . TYR A 1 85  ? -8.769  21.708 35.805 1.00 0.00 ? 85  TYR A H    1  
ATOM   1346  H  HA   . TYR A 1 85  ? -6.613  19.887 35.256 1.00 0.00 ? 85  TYR A HA   1  
ATOM   1347  H  HB2  . TYR A 1 85  ? -8.715  19.159 36.367 1.00 0.00 ? 85  TYR A HB2  1  
ATOM   1348  H  HB3  . TYR A 1 85  ? -9.637  19.558 34.923 1.00 0.00 ? 85  TYR A HB3  1  
ATOM   1349  H  HD1  . TYR A 1 85  ? -6.645  17.511 35.893 1.00 0.00 ? 85  TYR A HD1  1  
ATOM   1350  H  HD2  . TYR A 1 85  ? -10.093 17.823 33.419 1.00 0.00 ? 85  TYR A HD2  1  
ATOM   1351  H  HE1  . TYR A 1 85  ? -6.217  15.264 35.008 1.00 0.00 ? 85  TYR A HE1  1  
ATOM   1352  H  HE2  . TYR A 1 85  ? -9.665  15.575 32.538 1.00 0.00 ? 85  TYR A HE2  1  
ATOM   1353  H  HH   . TYR A 1 85  ? -7.600  14.065 32.265 1.00 0.00 ? 85  TYR A HH   1  
ATOM   1354  N  N    . VAL A 1 86  ? -8.493  20.704 32.693 1.00 0.00 ? 86  VAL A N    1  
ATOM   1355  C  CA   . VAL A 1 86  ? -8.468  20.734 31.213 1.00 0.00 ? 86  VAL A CA   1  
ATOM   1356  C  C    . VAL A 1 86  ? -7.217  21.449 30.720 1.00 0.00 ? 86  VAL A C    1  
ATOM   1357  O  O    . VAL A 1 86  ? -6.635  21.070 29.725 1.00 0.00 ? 86  VAL A O    1  
ATOM   1358  C  CB   . VAL A 1 86  ? -9.704  21.491 30.710 1.00 0.00 ? 86  VAL A CB   1  
ATOM   1359  C  CG1  . VAL A 1 86  ? -9.934  21.146 29.240 1.00 0.00 ? 86  VAL A CG1  1  
ATOM   1360  C  CG2  . VAL A 1 86  ? -10.927 21.057 31.521 1.00 0.00 ? 86  VAL A CG2  1  
ATOM   1361  H  H    . VAL A 1 86  ? -9.257  21.067 33.185 1.00 0.00 ? 86  VAL A H    1  
ATOM   1362  H  HA   . VAL A 1 86  ? -8.461  19.712 30.837 1.00 0.00 ? 86  VAL A HA   1  
ATOM   1363  H  HB   . VAL A 1 86  ? -9.552  22.555 30.817 1.00 0.00 ? 86  VAL A HB   1  
ATOM   1364  H  HG11 . VAL A 1 86  ? -9.997  20.075 29.125 1.00 0.00 ? 86  VAL A HG11 1  
ATOM   1365  H  HG12 . VAL A 1 86  ? -10.853 21.593 28.900 1.00 0.00 ? 86  VAL A HG12 1  
ATOM   1366  H  HG13 . VAL A 1 86  ? -9.115  21.520 28.644 1.00 0.00 ? 86  VAL A HG13 1  
ATOM   1367  H  HG21 . VAL A 1 86  ? -10.680 20.188 32.116 1.00 0.00 ? 86  VAL A HG21 1  
ATOM   1368  H  HG22 . VAL A 1 86  ? -11.234 21.859 32.172 1.00 0.00 ? 86  VAL A HG22 1  
ATOM   1369  H  HG23 . VAL A 1 86  ? -11.739 20.812 30.855 1.00 0.00 ? 86  VAL A HG23 1  
ATOM   1370  N  N    . ILE A 1 87  ? -6.823  22.468 31.430 1.00 0.00 ? 87  ILE A N    1  
ATOM   1371  C  CA   . ILE A 1 87  ? -5.613  23.215 31.015 1.00 0.00 ? 87  ILE A CA   1  
ATOM   1372  C  C    . ILE A 1 87  ? -4.407  22.290 30.945 1.00 0.00 ? 87  ILE A C    1  
ATOM   1373  O  O    . ILE A 1 87  ? -3.752  22.198 29.929 1.00 0.00 ? 87  ILE A O    1  
ATOM   1374  C  CB   . ILE A 1 87  ? -5.332  24.301 32.058 1.00 0.00 ? 87  ILE A CB   1  
ATOM   1375  C  CG1  . ILE A 1 87  ? -6.527  25.240 32.174 1.00 0.00 ? 87  ILE A CG1  1  
ATOM   1376  C  CG2  . ILE A 1 87  ? -4.111  25.118 31.598 1.00 0.00 ? 87  ILE A CG2  1  
ATOM   1377  C  CD1  . ILE A 1 87  ? -6.847  25.833 30.798 1.00 0.00 ? 87  ILE A CD1  1  
ATOM   1378  H  H    . ILE A 1 87  ? -7.320  22.736 32.229 1.00 0.00 ? 87  ILE A H    1  
ATOM   1379  H  HA   . ILE A 1 87  ? -5.782  23.655 30.032 1.00 0.00 ? 87  ILE A HA   1  
ATOM   1380  H  HB   . ILE A 1 87  ? -5.145  23.832 33.026 1.00 0.00 ? 87  ILE A HB   1  
ATOM   1381  H  HG12 . ILE A 1 87  ? -7.382  24.692 32.537 1.00 0.00 ? 87  ILE A HG12 1  
ATOM   1382  H  HG13 . ILE A 1 87  ? -6.296  26.035 32.867 1.00 0.00 ? 87  ILE A HG13 1  
ATOM   1383  H  HG21 . ILE A 1 87  ? -3.988  25.021 30.530 1.00 0.00 ? 87  ILE A HG21 1  
ATOM   1384  H  HG22 . ILE A 1 87  ? -4.254  26.159 31.847 1.00 0.00 ? 87  ILE A HG22 1  
ATOM   1385  H  HG23 . ILE A 1 87  ? -3.223  24.754 32.091 1.00 0.00 ? 87  ILE A HG23 1  
ATOM   1386  H  HD11 . ILE A 1 87  ? -5.932  26.008 30.253 1.00 0.00 ? 87  ILE A HD11 1  
ATOM   1387  H  HD12 . ILE A 1 87  ? -7.468  25.148 30.242 1.00 0.00 ? 87  ILE A HD12 1  
ATOM   1388  H  HD13 . ILE A 1 87  ? -7.370  26.771 30.920 1.00 0.00 ? 87  ILE A HD13 1  
ATOM   1389  N  N    . ALA A 1 88  ? -4.143  21.606 32.026 1.00 0.00 ? 88  ALA A N    1  
ATOM   1390  C  CA   . ALA A 1 88  ? -2.978  20.681 32.038 1.00 0.00 ? 88  ALA A CA   1  
ATOM   1391  C  C    . ALA A 1 88  ? -3.192  19.490 31.111 1.00 0.00 ? 88  ALA A C    1  
ATOM   1392  O  O    . ALA A 1 88  ? -2.314  19.131 30.346 1.00 0.00 ? 88  ALA A O    1  
ATOM   1393  C  CB   . ALA A 1 88  ? -2.793  20.156 33.468 1.00 0.00 ? 88  ALA A CB   1  
ATOM   1394  H  H    . ALA A 1 88  ? -4.715  21.695 32.824 1.00 0.00 ? 88  ALA A H    1  
ATOM   1395  H  HA   . ALA A 1 88  ? -2.093  21.227 31.713 1.00 0.00 ? 88  ALA A HA   1  
ATOM   1396  H  HB1  . ALA A 1 88  ? -3.755  19.918 33.897 1.00 0.00 ? 88  ALA A HB1  1  
ATOM   1397  H  HB2  . ALA A 1 88  ? -2.182  19.265 33.451 1.00 0.00 ? 88  ALA A HB2  1  
ATOM   1398  H  HB3  . ALA A 1 88  ? -2.310  20.908 34.074 1.00 0.00 ? 88  ALA A HB3  1  
ATOM   1399  N  N    . LEU A 1 89  ? -4.347  18.899 31.189 1.00 0.00 ? 89  LEU A N    1  
ATOM   1400  C  CA   . LEU A 1 89  ? -4.627  17.732 30.320 1.00 0.00 ? 89  LEU A CA   1  
ATOM   1401  C  C    . LEU A 1 89  ? -4.482  18.076 28.840 1.00 0.00 ? 89  LEU A C    1  
ATOM   1402  O  O    . LEU A 1 89  ? -3.996  17.276 28.064 1.00 0.00 ? 89  LEU A O    1  
ATOM   1403  C  CB   . LEU A 1 89  ? -6.058  17.267 30.583 1.00 0.00 ? 89  LEU A CB   1  
ATOM   1404  C  CG   . LEU A 1 89  ? -6.066  15.742 30.712 1.00 0.00 ? 89  LEU A CG   1  
ATOM   1405  C  CD1  . LEU A 1 89  ? -5.558  15.119 29.407 1.00 0.00 ? 89  LEU A CD1  1  
ATOM   1406  C  CD2  . LEU A 1 89  ? -5.154  15.320 31.869 1.00 0.00 ? 89  LEU A CD2  1  
ATOM   1407  H  H    . LEU A 1 89  ? -5.027  19.222 31.817 1.00 0.00 ? 89  LEU A H    1  
ATOM   1408  H  HA   . LEU A 1 89  ? -3.923  16.943 30.564 1.00 0.00 ? 89  LEU A HA   1  
ATOM   1409  H  HB2  . LEU A 1 89  ? -6.423  17.711 31.497 1.00 0.00 ? 89  LEU A HB2  1  
ATOM   1410  H  HB3  . LEU A 1 89  ? -6.693  17.567 29.763 1.00 0.00 ? 89  LEU A HB3  1  
ATOM   1411  H  HG   . LEU A 1 89  ? -7.062  15.408 30.904 1.00 0.00 ? 89  LEU A HG   1  
ATOM   1412  H  HD11 . LEU A 1 89  ? -6.038  15.596 28.567 1.00 0.00 ? 89  LEU A HD11 1  
ATOM   1413  H  HD12 . LEU A 1 89  ? -4.491  15.251 29.328 1.00 0.00 ? 89  LEU A HD12 1  
ATOM   1414  H  HD13 . LEU A 1 89  ? -5.786  14.065 29.395 1.00 0.00 ? 89  LEU A HD13 1  
ATOM   1415  H  HD21 . LEU A 1 89  ? -4.972  16.164 32.517 1.00 0.00 ? 89  LEU A HD21 1  
ATOM   1416  H  HD22 . LEU A 1 89  ? -5.625  14.533 32.436 1.00 0.00 ? 89  LEU A HD22 1  
ATOM   1417  H  HD23 . LEU A 1 89  ? -4.211  14.961 31.480 1.00 0.00 ? 89  LEU A HD23 1  
ATOM   1418  N  N    . HIS A 1 90  ? -4.904  19.253 28.466 1.00 0.00 ? 90  HIS A N    1  
ATOM   1419  C  CA   . HIS A 1 90  ? -4.786  19.636 27.036 1.00 0.00 ? 90  HIS A CA   1  
ATOM   1420  C  C    . HIS A 1 90  ? -3.405  20.220 26.738 1.00 0.00 ? 90  HIS A C    1  
ATOM   1421  O  O    . HIS A 1 90  ? -2.978  20.260 25.602 1.00 0.00 ? 90  HIS A O    1  
ATOM   1422  C  CB   . HIS A 1 90  ? -5.876  20.687 26.712 1.00 0.00 ? 90  HIS A CB   1  
ATOM   1423  C  CG   . HIS A 1 90  ? -5.286  22.099 26.788 1.00 0.00 ? 90  HIS A CG   1  
ATOM   1424  N  ND1  . HIS A 1 90  ? -4.996  22.697 27.845 1.00 0.00 ? 90  HIS A ND1  1  
ATOM   1425  C  CD2  . HIS A 1 90  ? -4.967  22.975 25.770 1.00 0.00 ? 90  HIS A CD2  1  
ATOM   1426  C  CE1  . HIS A 1 90  ? -4.529  23.853 27.611 1.00 0.00 ? 90  HIS A CE1  1  
ATOM   1427  N  NE2  . HIS A 1 90  ? -4.471  24.123 26.307 1.00 0.00 ? 90  HIS A NE2  1  
ATOM   1428  H  H    . HIS A 1 90  ? -5.292  19.873 29.118 1.00 0.00 ? 90  HIS A H    1  
ATOM   1429  H  HA   . HIS A 1 90  ? -4.922  18.744 26.427 1.00 0.00 ? 90  HIS A HA   1  
ATOM   1430  H  HB2  . HIS A 1 90  ? -6.258  20.518 25.717 1.00 0.00 ? 90  HIS A HB2  1  
ATOM   1431  H  HB3  . HIS A 1 90  ? -6.686  20.602 27.418 1.00 0.00 ? 90  HIS A HB3  1  
ATOM   1432  H  HD1  . HIS A 1 90  ? -5.115  22.322 28.742 1.00 0.00 ? 90  HIS A HD1  1  
ATOM   1433  H  HD2  . HIS A 1 90  ? -5.087  22.779 24.715 1.00 0.00 ? 90  HIS A HD2  1  
ATOM   1434  H  HE1  . HIS A 1 90  ? -4.211  24.538 28.381 1.00 0.00 ? 90  HIS A HE1  1  
ATOM   1435  N  N    . MET A 1 91  ? -2.730  20.662 27.766 1.00 0.00 ? 91  MET A N    1  
ATOM   1436  C  CA   . MET A 1 91  ? -1.381  21.244 27.551 1.00 0.00 ? 91  MET A CA   1  
ATOM   1437  C  C    . MET A 1 91  ? -0.409  20.180 27.063 1.00 0.00 ? 91  MET A C    1  
ATOM   1438  O  O    . MET A 1 91  ? 0.415   20.434 26.205 1.00 0.00 ? 91  MET A O    1  
ATOM   1439  C  CB   . MET A 1 91  ? -0.870  21.803 28.889 1.00 0.00 ? 91  MET A CB   1  
ATOM   1440  C  CG   . MET A 1 91  ? -1.409  23.222 29.079 1.00 0.00 ? 91  MET A CG   1  
ATOM   1441  S  SD   . MET A 1 91  ? -0.308  24.597 28.676 1.00 0.00 ? 91  MET A SD   1  
ATOM   1442  C  CE   . MET A 1 91  ? -1.562  25.903 28.739 1.00 0.00 ? 91  MET A CE   1  
ATOM   1443  H  H    . MET A 1 91  ? -3.110  20.612 28.669 1.00 0.00 ? 91  MET A H    1  
ATOM   1444  H  HA   . MET A 1 91  ? -1.449  22.032 26.802 1.00 0.00 ? 91  MET A HA   1  
ATOM   1445  H  HB2  . MET A 1 91  ? -1.210  21.174 29.698 1.00 0.00 ? 91  MET A HB2  1  
ATOM   1446  H  HB3  . MET A 1 91  ? 0.211   21.824 28.884 1.00 0.00 ? 91  MET A HB3  1  
ATOM   1447  H  HG2  . MET A 1 91  ? -2.295  23.326 28.472 1.00 0.00 ? 91  MET A HG2  1  
ATOM   1448  H  HG3  . MET A 1 91  ? -1.703  23.333 30.113 1.00 0.00 ? 91  MET A HG3  1  
ATOM   1449  H  HE1  . MET A 1 91  ? -2.085  25.854 29.682 1.00 0.00 ? 91  MET A HE1  1  
ATOM   1450  H  HE2  . MET A 1 91  ? -1.086  26.867 28.642 1.00 0.00 ? 91  MET A HE2  1  
ATOM   1451  H  HE3  . MET A 1 91  ? -2.265  25.764 27.930 1.00 0.00 ? 91  MET A HE3  1  
ATOM   1452  N  N    . THR A 1 92  ? -0.518  19.006 27.617 1.00 0.00 ? 92  THR A N    1  
ATOM   1453  C  CA   . THR A 1 92  ? 0.392   17.916 27.195 1.00 0.00 ? 92  THR A CA   1  
ATOM   1454  C  C    . THR A 1 92  ? 0.182   17.579 25.724 1.00 0.00 ? 92  THR A C    1  
ATOM   1455  O  O    . THR A 1 92  ? 0.699   16.595 25.232 1.00 0.00 ? 92  THR A O    1  
ATOM   1456  C  CB   . THR A 1 92  ? 0.080   16.674 28.032 1.00 0.00 ? 92  THR A CB   1  
ATOM   1457  O  OG1  . THR A 1 92  ? -0.553  17.159 29.199 1.00 0.00 ? 92  THR A OG1  1  
ATOM   1458  C  CG2  . THR A 1 92  ? 1.372   16.016 28.535 1.00 0.00 ? 92  THR A CG2  1  
ATOM   1459  H  H    . THR A 1 92  ? -1.196  18.846 28.310 1.00 0.00 ? 92  THR A H    1  
ATOM   1460  H  HA   . THR A 1 92  ? 1.423   18.236 27.343 1.00 0.00 ? 92  THR A HA   1  
ATOM   1461  H  HB   . THR A 1 92  ? -0.568  15.980 27.500 1.00 0.00 ? 92  THR A HB   1  
ATOM   1462  H  HG1  . THR A 1 92  ? -0.120  16.760 29.957 1.00 0.00 ? 92  THR A HG1  1  
ATOM   1463  H  HG21 . THR A 1 92  ? 2.020   16.766 28.964 1.00 0.00 ? 92  THR A HG21 1  
ATOM   1464  H  HG22 . THR A 1 92  ? 1.135   15.278 29.288 1.00 0.00 ? 92  THR A HG22 1  
ATOM   1465  H  HG23 . THR A 1 92  ? 1.881   15.534 27.713 1.00 0.00 ? 92  THR A HG23 1  
ATOM   1466  N  N    . SER A 1 93  ? -0.575  18.401 25.045 1.00 0.00 ? 93  SER A N    1  
ATOM   1467  C  CA   . SER A 1 93  ? -0.823  18.137 23.605 1.00 0.00 ? 93  SER A CA   1  
ATOM   1468  C  C    . SER A 1 93  ? -1.424  19.359 22.917 1.00 0.00 ? 93  SER A C    1  
ATOM   1469  O  O    . SER A 1 93  ? -0.798  20.398 22.833 1.00 0.00 ? 93  SER A O    1  
ATOM   1470  C  CB   . SER A 1 93  ? -1.817  16.970 23.496 1.00 0.00 ? 93  SER A CB   1  
ATOM   1471  O  OG   . SER A 1 93  ? -1.966  16.772 22.097 1.00 0.00 ? 93  SER A OG   1  
ATOM   1472  H  H    . SER A 1 93  ? -0.972  19.183 25.480 1.00 0.00 ? 93  SER A H    1  
ATOM   1473  H  HA   . SER A 1 93  ? 0.121   17.887 23.123 1.00 0.00 ? 93  SER A HA   1  
ATOM   1474  H  HB2  . SER A 1 93  ? -1.415  16.080 23.958 1.00 0.00 ? 93  SER A HB2  1  
ATOM   1475  H  HB3  . SER A 1 93  ? -2.766  17.232 23.940 1.00 0.00 ? 93  SER A HB3  1  
ATOM   1476  H  HG   . SER A 1 93  ? -2.803  16.326 21.950 1.00 0.00 ? 93  SER A HG   1  
ATOM   1477  N  N    . ALA A 1 94  ? -2.631  19.211 22.435 1.00 0.00 ? 94  ALA A N    1  
ATOM   1478  C  CA   . ALA A 1 94  ? -3.291  20.352 21.746 1.00 0.00 ? 94  ALA A CA   1  
ATOM   1479  C  C    . ALA A 1 94  ? -2.357  20.979 20.716 1.00 0.00 ? 94  ALA A C    1  
ATOM   1480  O  O    . ALA A 1 94  ? -2.596  22.073 20.242 1.00 0.00 ? 94  ALA A O    1  
ATOM   1481  C  CB   . ALA A 1 94  ? -3.661  21.413 22.798 1.00 0.00 ? 94  ALA A CB   1  
ATOM   1482  H  H    . ALA A 1 94  ? -3.098  18.355 22.528 1.00 0.00 ? 94  ALA A H    1  
ATOM   1483  H  HA   . ALA A 1 94  ? -4.183  19.986 21.238 1.00 0.00 ? 94  ALA A HA   1  
ATOM   1484  H  HB1  . ALA A 1 94  ? -4.120  20.935 23.651 1.00 0.00 ? 94  ALA A HB1  1  
ATOM   1485  H  HB2  . ALA A 1 94  ? -2.772  21.935 23.118 1.00 0.00 ? 94  ALA A HB2  1  
ATOM   1486  H  HB3  . ALA A 1 94  ? -4.357  22.121 22.372 1.00 0.00 ? 94  ALA A HB3  1  
ATOM   1487  N  N    . GLY A 1 95  ? -1.309  20.274 20.387 1.00 0.00 ? 95  GLY A N    1  
ATOM   1488  C  CA   . GLY A 1 95  ? -0.344  20.814 19.385 1.00 0.00 ? 95  GLY A CA   1  
ATOM   1489  C  C    . GLY A 1 95  ? 0.399   22.029 19.946 1.00 0.00 ? 95  GLY A C    1  
ATOM   1490  O  O    . GLY A 1 95  ? 0.253   22.366 21.105 1.00 0.00 ? 95  GLY A O    1  
ATOM   1491  H  H    . GLY A 1 95  ? -1.157  19.396 20.795 1.00 0.00 ? 95  GLY A H    1  
ATOM   1492  H  HA2  . GLY A 1 95  ? 0.372   20.046 19.131 1.00 0.00 ? 95  GLY A HA2  1  
ATOM   1493  H  HA3  . GLY A 1 95  ? -0.882  21.107 18.495 1.00 0.00 ? 95  GLY A HA3  1  
ATOM   1494  N  N    . LYS A 1 96  ? 1.185   22.658 19.099 1.00 0.00 ? 96  LYS A N    1  
ATOM   1495  C  CA   . LYS A 1 96  ? 1.958   23.857 19.542 1.00 0.00 ? 96  LYS A CA   1  
ATOM   1496  C  C    . LYS A 1 96  ? 1.535   25.090 18.754 1.00 0.00 ? 96  LYS A C    1  
ATOM   1497  O  O    . LYS A 1 96  ? 1.842   25.213 17.584 1.00 0.00 ? 96  LYS A O    1  
ATOM   1498  C  CB   . LYS A 1 96  ? 3.449   23.593 19.275 1.00 0.00 ? 96  LYS A CB   1  
ATOM   1499  C  CG   . LYS A 1 96  ? 4.261   24.812 19.721 1.00 0.00 ? 96  LYS A CG   1  
ATOM   1500  C  CD   . LYS A 1 96  ? 5.744   24.569 19.414 1.00 0.00 ? 96  LYS A CD   1  
ATOM   1501  C  CE   . LYS A 1 96  ? 6.025   24.930 17.952 1.00 0.00 ? 96  LYS A CE   1  
ATOM   1502  N  NZ   . LYS A 1 96  ? 5.565   23.840 17.048 1.00 0.00 ? 96  LYS A NZ   1  
ATOM   1503  H  H    . LYS A 1 96  ? 1.263   22.340 18.176 1.00 0.00 ? 96  LYS A H    1  
ATOM   1504  H  HA   . LYS A 1 96  ? 1.779   24.034 20.601 1.00 0.00 ? 96  LYS A HA   1  
ATOM   1505  H  HB2  . LYS A 1 96  ? 3.768   22.723 19.827 1.00 0.00 ? 96  LYS A HB2  1  
ATOM   1506  H  HB3  . LYS A 1 96  ? 3.603   23.421 18.220 1.00 0.00 ? 96  LYS A HB3  1  
ATOM   1507  H  HG2  . LYS A 1 96  ? 3.918   25.690 19.194 1.00 0.00 ? 96  LYS A HG2  1  
ATOM   1508  H  HG3  . LYS A 1 96  ? 4.131   24.963 20.783 1.00 0.00 ? 96  LYS A HG3  1  
ATOM   1509  H  HD2  . LYS A 1 96  ? 6.353   25.182 20.062 1.00 0.00 ? 96  LYS A HD2  1  
ATOM   1510  H  HD3  . LYS A 1 96  ? 5.984   23.529 19.583 1.00 0.00 ? 96  LYS A HD3  1  
ATOM   1511  H  HE2  . LYS A 1 96  ? 5.507   25.843 17.696 1.00 0.00 ? 96  LYS A HE2  1  
ATOM   1512  H  HE3  . LYS A 1 96  ? 7.086   25.077 17.814 1.00 0.00 ? 96  LYS A HE3  1  
ATOM   1513  H  HZ1  . LYS A 1 96  ? 5.593   22.933 17.555 1.00 0.00 ? 96  LYS A HZ1  1  
ATOM   1514  H  HZ2  . LYS A 1 96  ? 4.591   24.034 16.738 1.00 0.00 ? 96  LYS A HZ2  1  
ATOM   1515  H  HZ3  . LYS A 1 96  ? 6.189   23.791 16.217 1.00 0.00 ? 96  LYS A HZ3  1  
ATOM   1516  N  N    . THR A 1 97  ? 0.839   25.983 19.412 1.00 0.00 ? 97  THR A N    1  
ATOM   1517  C  CA   . THR A 1 97  ? 0.385   27.218 18.719 1.00 0.00 ? 97  THR A CA   1  
ATOM   1518  C  C    . THR A 1 97  ? 1.293   28.397 19.050 1.00 0.00 ? 97  THR A C    1  
ATOM   1519  O  O    . THR A 1 97  ? 2.492   28.333 18.859 1.00 0.00 ? 97  THR A O    1  
ATOM   1520  C  CB   . THR A 1 97  ? -1.033  27.544 19.195 1.00 0.00 ? 97  THR A CB   1  
ATOM   1521  O  OG1  . THR A 1 97  ? -0.890  27.960 20.537 1.00 0.00 ? 97  THR A OG1  1  
ATOM   1522  C  CG2  . THR A 1 97  ? -1.890  26.271 19.274 1.00 0.00 ? 97  THR A CG2  1  
ATOM   1523  H  H    . THR A 1 97  ? 0.621   25.838 20.356 1.00 0.00 ? 97  THR A H    1  
ATOM   1524  H  HA   . THR A 1 97  ? 0.401   27.051 17.643 1.00 0.00 ? 97  THR A HA   1  
ATOM   1525  H  HB   . THR A 1 97  ? -1.492  28.325 18.594 1.00 0.00 ? 97  THR A HB   1  
ATOM   1526  H  HG1  . THR A 1 97  ? -1.414  28.755 20.660 1.00 0.00 ? 97  THR A HG1  1  
ATOM   1527  H  HG21 . THR A 1 97  ? -1.783  25.702 18.361 1.00 0.00 ? 97  THR A HG21 1  
ATOM   1528  H  HG22 . THR A 1 97  ? -1.568  25.665 20.109 1.00 0.00 ? 97  THR A HG22 1  
ATOM   1529  H  HG23 . THR A 1 97  ? -2.928  26.538 19.407 1.00 0.00 ? 97  THR A HG23 1  
ATOM   1530  N  N    . ASN A 1 98  ? 0.697   29.456 19.546 1.00 0.00 ? 98  ASN A N    1  
ATOM   1531  C  CA   . ASN A 1 98  ? 1.496   30.660 19.902 1.00 0.00 ? 98  ASN A CA   1  
ATOM   1532  C  C    . ASN A 1 98  ? 1.646   30.793 21.413 1.00 0.00 ? 98  ASN A C    1  
ATOM   1533  O  O    . ASN A 1 98  ? 0.784   30.381 22.165 1.00 0.00 ? 98  ASN A O    1  
ATOM   1534  C  CB   . ASN A 1 98  ? 0.756   31.897 19.374 1.00 0.00 ? 98  ASN A CB   1  
ATOM   1535  C  CG   . ASN A 1 98  ? -0.015  31.518 18.110 1.00 0.00 ? 98  ASN A CG   1  
ATOM   1536  O  OD1  . ASN A 1 98  ? -1.222  31.375 18.123 1.00 0.00 ? 98  ASN A OD1  1  
ATOM   1537  N  ND2  . ASN A 1 98  ? 0.642   31.344 16.996 1.00 0.00 ? 98  ASN A ND2  1  
ATOM   1538  H  H    . ASN A 1 98  ? -0.274  29.452 19.685 1.00 0.00 ? 98  ASN A H    1  
ATOM   1539  H  HA   . ASN A 1 98  ? 2.485   30.582 19.453 1.00 0.00 ? 98  ASN A HA   1  
ATOM   1540  H  HB2  . ASN A 1 98  ? 0.062   32.255 20.120 1.00 0.00 ? 98  ASN A HB2  1  
ATOM   1541  H  HB3  . ASN A 1 98  ? 1.464   32.677 19.140 1.00 0.00 ? 98  ASN A HB3  1  
ATOM   1542  H  HD21 . ASN A 1 98  ? 1.616   31.456 16.979 1.00 0.00 ? 98  ASN A HD21 1  
ATOM   1543  H  HD22 . ASN A 1 98  ? 0.163   31.100 16.177 1.00 0.00 ? 98  ASN A HD22 1  
ATOM   1544  N  N    . GLN A 1 99  ? 2.740   31.371 21.830 1.00 0.00 ? 99  GLN A N    1  
ATOM   1545  C  CA   . GLN A 1 99  ? 2.969   31.542 23.286 1.00 0.00 ? 99  GLN A CA   1  
ATOM   1546  C  C    . GLN A 1 99  ? 2.892   30.201 24.009 1.00 0.00 ? 99  GLN A C    1  
ATOM   1547  O  O    . GLN A 1 99  ? 3.603   29.279 23.672 1.00 0.00 ? 99  GLN A O    1  
ATOM   1548  C  CB   . GLN A 1 99  ? 1.882   32.477 23.844 1.00 0.00 ? 99  GLN A CB   1  
ATOM   1549  C  CG   . GLN A 1 99  ? 2.344   33.034 25.195 1.00 0.00 ? 99  GLN A CG   1  
ATOM   1550  C  CD   . GLN A 1 99  ? 3.249   34.247 24.963 1.00 0.00 ? 99  GLN A CD   1  
ATOM   1551  O  OE1  . GLN A 1 99  ? 2.864   35.376 25.191 1.00 0.00 ? 99  GLN A OE1  1  
ATOM   1552  N  NE2  . GLN A 1 99  ? 4.459   34.057 24.511 1.00 0.00 ? 99  GLN A NE2  1  
ATOM   1553  H  H    . GLN A 1 99  ? 3.406   31.690 21.185 1.00 0.00 ? 99  GLN A H    1  
ATOM   1554  H  HA   . GLN A 1 99  ? 3.961   31.967 23.439 1.00 0.00 ? 99  GLN A HA   1  
ATOM   1555  H  HB2  . GLN A 1 99  ? 1.715   33.290 23.155 1.00 0.00 ? 99  GLN A HB2  1  
ATOM   1556  H  HB3  . GLN A 1 99  ? 0.961   31.927 23.974 1.00 0.00 ? 99  GLN A HB3  1  
ATOM   1557  H  HG2  . GLN A 1 99  ? 1.487   33.336 25.779 1.00 0.00 ? 99  GLN A HG2  1  
ATOM   1558  H  HG3  . GLN A 1 99  ? 2.895   32.277 25.734 1.00 0.00 ? 99  GLN A HG3  1  
ATOM   1559  H  HE21 . GLN A 1 99  ? 4.777   33.150 24.328 1.00 0.00 ? 99  GLN A HE21 1  
ATOM   1560  H  HE22 . GLN A 1 99  ? 5.051   34.824 24.358 1.00 0.00 ? 99  GLN A HE22 1  
ATOM   1561  N  N    . LYS A 1 100 ? 2.023   30.125 24.991 1.00 0.00 ? 100 LYS A N    1  
ATOM   1562  C  CA   . LYS A 1 100 ? 1.867   28.857 25.767 1.00 0.00 ? 100 LYS A CA   1  
ATOM   1563  C  C    . LYS A 1 100 ? 3.217   28.191 26.036 1.00 0.00 ? 100 LYS A C    1  
ATOM   1564  O  O    . LYS A 1 100 ? 4.247   28.836 26.028 1.00 0.00 ? 100 LYS A O    1  
ATOM   1565  C  CB   . LYS A 1 100 ? 0.961   27.885 24.965 1.00 0.00 ? 100 LYS A CB   1  
ATOM   1566  C  CG   . LYS A 1 100 ? 1.686   27.392 23.701 1.00 0.00 ? 100 LYS A CG   1  
ATOM   1567  C  CD   . LYS A 1 100 ? 0.969   26.148 23.170 1.00 0.00 ? 100 LYS A CD   1  
ATOM   1568  C  CE   . LYS A 1 100 ? 1.267   24.964 24.095 1.00 0.00 ? 100 LYS A CE   1  
ATOM   1569  N  NZ   . LYS A 1 100 ? 1.901   23.854 23.332 1.00 0.00 ? 100 LYS A NZ   1  
ATOM   1570  H  H    . LYS A 1 100 ? 1.474   30.904 25.217 1.00 0.00 ? 100 LYS A H    1  
ATOM   1571  H  HA   . LYS A 1 100 ? 1.406   29.097 26.726 1.00 0.00 ? 100 LYS A HA   1  
ATOM   1572  H  HB2  . LYS A 1 100 ? 0.707   27.037 25.584 1.00 0.00 ? 100 LYS A HB2  1  
ATOM   1573  H  HB3  . LYS A 1 100 ? 0.051   28.394 24.680 1.00 0.00 ? 100 LYS A HB3  1  
ATOM   1574  H  HG2  . LYS A 1 100 ? 1.671   28.166 22.948 1.00 0.00 ? 100 LYS A HG2  1  
ATOM   1575  H  HG3  . LYS A 1 100 ? 2.707   27.141 23.934 1.00 0.00 ? 100 LYS A HG3  1  
ATOM   1576  H  HD2  . LYS A 1 100 ? -0.095  26.328 23.142 1.00 0.00 ? 100 LYS A HD2  1  
ATOM   1577  H  HD3  . LYS A 1 100 ? 1.317   25.926 22.173 1.00 0.00 ? 100 LYS A HD3  1  
ATOM   1578  H  HE2  . LYS A 1 100 ? 1.936   25.277 24.884 1.00 0.00 ? 100 LYS A HE2  1  
ATOM   1579  H  HE3  . LYS A 1 100 ? 0.347   24.608 24.534 1.00 0.00 ? 100 LYS A HE3  1  
ATOM   1580  H  HZ1  . LYS A 1 100 ? 2.637   24.239 22.706 1.00 0.00 ? 100 LYS A HZ1  1  
ATOM   1581  H  HZ2  . LYS A 1 100 ? 2.330   23.177 23.996 1.00 0.00 ? 100 LYS A HZ2  1  
ATOM   1582  H  HZ3  . LYS A 1 100 ? 1.180   23.369 22.761 1.00 0.00 ? 100 LYS A HZ3  1  
ATOM   1583  N  N    . LEU A 1 101 ? 3.184   26.913 26.285 1.00 0.00 ? 101 LEU A N    1  
ATOM   1584  C  CA   . LEU A 1 101 ? 4.452   26.190 26.557 1.00 0.00 ? 101 LEU A CA   1  
ATOM   1585  C  C    . LEU A 1 101 ? 5.040   26.602 27.906 1.00 0.00 ? 101 LEU A C    1  
ATOM   1586  O  O    . LEU A 1 101 ? 5.955   25.975 28.402 1.00 0.00 ? 101 LEU A O    1  
ATOM   1587  C  CB   . LEU A 1 101 ? 5.458   26.542 25.448 1.00 0.00 ? 101 LEU A CB   1  
ATOM   1588  C  CG   . LEU A 1 101 ? 6.283   25.297 25.105 1.00 0.00 ? 101 LEU A CG   1  
ATOM   1589  C  CD1  . LEU A 1 101 ? 5.560   24.496 24.021 1.00 0.00 ? 101 LEU A CD1  1  
ATOM   1590  C  CD2  . LEU A 1 101 ? 7.654   25.728 24.581 1.00 0.00 ? 101 LEU A CD2  1  
ATOM   1591  H  H    . LEU A 1 101 ? 2.331   26.432 26.293 1.00 0.00 ? 101 LEU A H    1  
ATOM   1592  H  HA   . LEU A 1 101 ? 4.251   25.119 26.571 1.00 0.00 ? 101 LEU A HA   1  
ATOM   1593  H  HB2  . LEU A 1 101 ? 4.926   26.878 24.570 1.00 0.00 ? 101 LEU A HB2  1  
ATOM   1594  H  HB3  . LEU A 1 101 ? 6.114   27.330 25.788 1.00 0.00 ? 101 LEU A HB3  1  
ATOM   1595  H  HG   . LEU A 1 101 ? 6.405   24.688 25.988 1.00 0.00 ? 101 LEU A HG   1  
ATOM   1596  H  HD11 . LEU A 1 101 ? 4.515   24.396 24.276 1.00 0.00 ? 101 LEU A HD11 1  
ATOM   1597  H  HD12 . LEU A 1 101 ? 5.647   25.004 23.072 1.00 0.00 ? 101 LEU A HD12 1  
ATOM   1598  H  HD13 . LEU A 1 101 ? 6.002   23.513 23.939 1.00 0.00 ? 101 LEU A HD13 1  
ATOM   1599  H  HD21 . LEU A 1 101 ? 7.536   26.534 23.871 1.00 0.00 ? 101 LEU A HD21 1  
ATOM   1600  H  HD22 . LEU A 1 101 ? 8.268   26.066 25.402 1.00 0.00 ? 101 LEU A HD22 1  
ATOM   1601  H  HD23 . LEU A 1 101 ? 8.137   24.894 24.095 1.00 0.00 ? 101 LEU A HD23 1  
ATOM   1602  N  N    . GLU A 1 102 ? 4.505   27.650 28.477 1.00 0.00 ? 102 GLU A N    1  
ATOM   1603  C  CA   . GLU A 1 102 ? 5.026   28.110 29.792 1.00 0.00 ? 102 GLU A CA   1  
ATOM   1604  C  C    . GLU A 1 102 ? 4.643   27.137 30.903 1.00 0.00 ? 102 GLU A C    1  
ATOM   1605  O  O    . GLU A 1 102 ? 5.305   27.059 31.918 1.00 0.00 ? 102 GLU A O    1  
ATOM   1606  C  CB   . GLU A 1 102 ? 4.411   29.488 30.107 1.00 0.00 ? 102 GLU A CB   1  
ATOM   1607  C  CG   . GLU A 1 102 ? 4.699   30.446 28.949 1.00 0.00 ? 102 GLU A CG   1  
ATOM   1608  C  CD   . GLU A 1 102 ? 4.018   31.791 29.218 1.00 0.00 ? 102 GLU A CD   1  
ATOM   1609  O  OE1  . GLU A 1 102 ? 3.258   31.833 30.171 1.00 0.00 ? 102 GLU A OE1  1  
ATOM   1610  O  OE2  . GLU A 1 102 ? 4.297   32.701 28.454 1.00 0.00 ? 102 GLU A OE2  1  
ATOM   1611  H  H    . GLU A 1 102 ? 3.767   28.127 28.043 1.00 0.00 ? 102 GLU A H    1  
ATOM   1612  H  HA   . GLU A 1 102 ? 6.114   28.172 29.741 1.00 0.00 ? 102 GLU A HA   1  
ATOM   1613  H  HB2  . GLU A 1 102 ? 3.345   29.388 30.239 1.00 0.00 ? 102 GLU A HB2  1  
ATOM   1614  H  HB3  . GLU A 1 102 ? 4.846   29.880 31.016 1.00 0.00 ? 102 GLU A HB3  1  
ATOM   1615  H  HG2  . GLU A 1 102 ? 5.763   30.599 28.854 1.00 0.00 ? 102 GLU A HG2  1  
ATOM   1616  H  HG3  . GLU A 1 102 ? 4.315   30.035 28.032 1.00 0.00 ? 102 GLU A HG3  1  
ATOM   1617  N  N    . TRP A 1 103 ? 3.579   26.412 30.693 1.00 0.00 ? 103 TRP A N    1  
ATOM   1618  C  CA   . TRP A 1 103 ? 3.143   25.442 31.727 1.00 0.00 ? 103 TRP A CA   1  
ATOM   1619  C  C    . TRP A 1 103 ? 4.189   24.350 31.925 1.00 0.00 ? 103 TRP A C    1  
ATOM   1620  O  O    . TRP A 1 103 ? 4.156   23.623 32.899 1.00 0.00 ? 103 TRP A O    1  
ATOM   1621  C  CB   . TRP A 1 103 ? 1.829   24.798 31.258 1.00 0.00 ? 103 TRP A CB   1  
ATOM   1622  C  CG   . TRP A 1 103 ? 1.337   23.802 32.319 1.00 0.00 ? 103 TRP A CG   1  
ATOM   1623  C  CD1  . TRP A 1 103 ? 0.779   24.158 33.467 1.00 0.00 ? 103 TRP A CD1  1  
ATOM   1624  C  CD2  . TRP A 1 103 ? 1.396   22.489 32.207 1.00 0.00 ? 103 TRP A CD2  1  
ATOM   1625  N  NE1  . TRP A 1 103 ? 0.492   22.986 34.061 1.00 0.00 ? 103 TRP A NE1  1  
ATOM   1626  C  CE2  . TRP A 1 103 ? 0.853   21.874 33.326 1.00 0.00 ? 103 TRP A CE2  1  
ATOM   1627  C  CE3  . TRP A 1 103 ? 1.901   21.707 31.180 1.00 0.00 ? 103 TRP A CE3  1  
ATOM   1628  C  CZ2  . TRP A 1 103 ? 0.813   20.498 33.412 1.00 0.00 ? 103 TRP A CZ2  1  
ATOM   1629  C  CZ3  . TRP A 1 103 ? 1.857   20.330 31.271 1.00 0.00 ? 103 TRP A CZ3  1  
ATOM   1630  C  CH2  . TRP A 1 103 ? 1.314   19.727 32.386 1.00 0.00 ? 103 TRP A CH2  1  
ATOM   1631  H  H    . TRP A 1 103 ? 3.072   26.507 29.859 1.00 0.00 ? 103 TRP A H    1  
ATOM   1632  H  HA   . TRP A 1 103 ? 2.999   25.971 32.670 1.00 0.00 ? 103 TRP A HA   1  
ATOM   1633  H  HB2  . TRP A 1 103 ? 1.081   25.564 31.119 1.00 0.00 ? 103 TRP A HB2  1  
ATOM   1634  H  HB3  . TRP A 1 103 ? 1.986   24.285 30.326 1.00 0.00 ? 103 TRP A HB3  1  
ATOM   1635  H  HD1  . TRP A 1 103 ? 0.593   25.155 33.836 1.00 0.00 ? 103 TRP A HD1  1  
ATOM   1636  H  HE1  . TRP A 1 103 ? 0.062   22.926 34.941 1.00 0.00 ? 103 TRP A HE1  1  
ATOM   1637  H  HE3  . TRP A 1 103 ? 2.330   22.171 30.307 1.00 0.00 ? 103 TRP A HE3  1  
ATOM   1638  H  HZ2  . TRP A 1 103 ? 0.387   20.025 34.284 1.00 0.00 ? 103 TRP A HZ2  1  
ATOM   1639  H  HZ3  . TRP A 1 103 ? 2.250   19.724 30.468 1.00 0.00 ? 103 TRP A HZ3  1  
ATOM   1640  H  HH2  . TRP A 1 103 ? 1.282   18.650 32.455 1.00 0.00 ? 103 TRP A HH2  1  
ATOM   1641  N  N    . ALA A 1 104 ? 5.104   24.258 31.001 1.00 0.00 ? 104 ALA A N    1  
ATOM   1642  C  CA   . ALA A 1 104 ? 6.157   23.219 31.122 1.00 0.00 ? 104 ALA A CA   1  
ATOM   1643  C  C    . ALA A 1 104 ? 7.098   23.521 32.285 1.00 0.00 ? 104 ALA A C    1  
ATOM   1644  O  O    . ALA A 1 104 ? 7.375   22.662 33.098 1.00 0.00 ? 104 ALA A O    1  
ATOM   1645  C  CB   . ALA A 1 104 ? 6.969   23.199 29.819 1.00 0.00 ? 104 ALA A CB   1  
ATOM   1646  H  H    . ALA A 1 104 ? 5.097   24.868 30.235 1.00 0.00 ? 104 ALA A H    1  
ATOM   1647  H  HA   . ALA A 1 104 ? 5.682   22.254 31.295 1.00 0.00 ? 104 ALA A HA   1  
ATOM   1648  H  HB1  . ALA A 1 104 ? 6.298   23.203 28.972 1.00 0.00 ? 104 ALA A HB1  1  
ATOM   1649  H  HB2  . ALA A 1 104 ? 7.605   24.070 29.772 1.00 0.00 ? 104 ALA A HB2  1  
ATOM   1650  H  HB3  . ALA A 1 104 ? 7.580   22.310 29.784 1.00 0.00 ? 104 ALA A HB3  1  
ATOM   1651  N  N    . PHE A 1 105 ? 7.575   24.739 32.348 1.00 0.00 ? 105 PHE A N    1  
ATOM   1652  C  CA   . PHE A 1 105 ? 8.499   25.101 33.459 1.00 0.00 ? 105 PHE A CA   1  
ATOM   1653  C  C    . PHE A 1 105 ? 7.809   24.942 34.808 1.00 0.00 ? 105 PHE A C    1  
ATOM   1654  O  O    . PHE A 1 105 ? 8.422   25.104 35.845 1.00 0.00 ? 105 PHE A O    1  
ATOM   1655  C  CB   . PHE A 1 105 ? 8.918   26.572 33.284 1.00 0.00 ? 105 PHE A CB   1  
ATOM   1656  C  CG   . PHE A 1 105 ? 9.834   26.996 34.444 1.00 0.00 ? 105 PHE A CG   1  
ATOM   1657  C  CD1  . PHE A 1 105 ? 11.210  26.855 34.341 1.00 0.00 ? 105 PHE A CD1  1  
ATOM   1658  C  CD2  . PHE A 1 105 ? 9.301   27.552 35.597 1.00 0.00 ? 105 PHE A CD2  1  
ATOM   1659  C  CE1  . PHE A 1 105 ? 12.034  27.266 35.373 1.00 0.00 ? 105 PHE A CE1  1  
ATOM   1660  C  CE2  . PHE A 1 105 ? 10.130  27.962 36.625 1.00 0.00 ? 105 PHE A CE2  1  
ATOM   1661  C  CZ   . PHE A 1 105 ? 11.495  27.819 36.512 1.00 0.00 ? 105 PHE A CZ   1  
ATOM   1662  H  H    . PHE A 1 105 ? 7.324   25.408 31.671 1.00 0.00 ? 105 PHE A H    1  
ATOM   1663  H  HA   . PHE A 1 105 ? 9.369   24.442 33.427 1.00 0.00 ? 105 PHE A HA   1  
ATOM   1664  H  HB2  . PHE A 1 105 ? 9.449   26.691 32.351 1.00 0.00 ? 105 PHE A HB2  1  
ATOM   1665  H  HB3  . PHE A 1 105 ? 8.042   27.202 33.276 1.00 0.00 ? 105 PHE A HB3  1  
ATOM   1666  H  HD1  . PHE A 1 105 ? 11.641  26.418 33.453 1.00 0.00 ? 105 PHE A HD1  1  
ATOM   1667  H  HD2  . PHE A 1 105 ? 8.232   27.666 35.693 1.00 0.00 ? 105 PHE A HD2  1  
ATOM   1668  H  HE1  . PHE A 1 105 ? 13.105  27.155 35.284 1.00 0.00 ? 105 PHE A HE1  1  
ATOM   1669  H  HE2  . PHE A 1 105 ? 9.706   28.395 37.520 1.00 0.00 ? 105 PHE A HE2  1  
ATOM   1670  H  HZ   . PHE A 1 105 ? 12.143  28.147 37.316 1.00 0.00 ? 105 PHE A HZ   1  
ATOM   1671  N  N    . SER A 1 106 ? 6.541   24.625 34.772 1.00 0.00 ? 106 SER A N    1  
ATOM   1672  C  CA   . SER A 1 106 ? 5.800   24.453 36.042 1.00 0.00 ? 106 SER A CA   1  
ATOM   1673  C  C    . SER A 1 106 ? 5.886   23.012 36.529 1.00 0.00 ? 106 SER A C    1  
ATOM   1674  O  O    . SER A 1 106 ? 6.009   22.759 37.710 1.00 0.00 ? 106 SER A O    1  
ATOM   1675  C  CB   . SER A 1 106 ? 4.324   24.811 35.795 1.00 0.00 ? 106 SER A CB   1  
ATOM   1676  O  OG   . SER A 1 106 ? 3.748   23.605 35.321 1.00 0.00 ? 106 SER A OG   1  
ATOM   1677  H  H    . SER A 1 106 ? 6.084   24.502 33.914 1.00 0.00 ? 106 SER A H    1  
ATOM   1678  H  HA   . SER A 1 106 ? 6.235   25.106 36.794 1.00 0.00 ? 106 SER A HA   1  
ATOM   1679  H  HB2  . SER A 1 106 ? 3.845   25.118 36.714 1.00 0.00 ? 106 SER A HB2  1  
ATOM   1680  H  HB3  . SER A 1 106 ? 4.238   25.586 35.047 1.00 0.00 ? 106 SER A HB3  1  
ATOM   1681  H  HG   . SER A 1 106 ? 3.627   23.020 36.072 1.00 0.00 ? 106 SER A HG   1  
ATOM   1682  N  N    . LEU A 1 107 ? 5.822   22.090 35.607 1.00 0.00 ? 107 LEU A N    1  
ATOM   1683  C  CA   . LEU A 1 107 ? 5.899   20.661 36.004 1.00 0.00 ? 107 LEU A CA   1  
ATOM   1684  C  C    . LEU A 1 107 ? 7.335   20.284 36.329 1.00 0.00 ? 107 LEU A C    1  
ATOM   1685  O  O    . LEU A 1 107 ? 7.586   19.461 37.186 1.00 0.00 ? 107 LEU A O    1  
ATOM   1686  C  CB   . LEU A 1 107 ? 5.370   19.804 34.816 1.00 0.00 ? 107 LEU A CB   1  
ATOM   1687  C  CG   . LEU A 1 107 ? 6.019   18.390 34.783 1.00 0.00 ? 107 LEU A CG   1  
ATOM   1688  C  CD1  . LEU A 1 107 ? 7.499   18.511 34.353 1.00 0.00 ? 107 LEU A CD1  1  
ATOM   1689  C  CD2  . LEU A 1 107 ? 5.893   17.702 36.171 1.00 0.00 ? 107 LEU A CD2  1  
ATOM   1690  H  H    . LEU A 1 107 ? 5.726   22.339 34.665 1.00 0.00 ? 107 LEU A H    1  
ATOM   1691  H  HA   . LEU A 1 107 ? 5.286   20.516 36.891 1.00 0.00 ? 107 LEU A HA   1  
ATOM   1692  H  HB2  . LEU A 1 107 ? 4.298   19.699 34.908 1.00 0.00 ? 107 LEU A HB2  1  
ATOM   1693  H  HB3  . LEU A 1 107 ? 5.587   20.314 33.892 1.00 0.00 ? 107 LEU A HB3  1  
ATOM   1694  H  HG   . LEU A 1 107 ? 5.498   17.790 34.054 1.00 0.00 ? 107 LEU A HG   1  
ATOM   1695  H  HD11 . LEU A 1 107 ? 7.691   19.510 33.995 1.00 0.00 ? 107 LEU A HD11 1  
ATOM   1696  H  HD12 . LEU A 1 107 ? 8.153   18.303 35.183 1.00 0.00 ? 107 LEU A HD12 1  
ATOM   1697  H  HD13 . LEU A 1 107 ? 7.703   17.810 33.559 1.00 0.00 ? 107 LEU A HD13 1  
ATOM   1698  H  HD21 . LEU A 1 107 ? 5.511   18.398 36.894 1.00 0.00 ? 107 LEU A HD21 1  
ATOM   1699  H  HD22 . LEU A 1 107 ? 5.210   16.867 36.096 1.00 0.00 ? 107 LEU A HD22 1  
ATOM   1700  H  HD23 . LEU A 1 107 ? 6.851   17.336 36.500 1.00 0.00 ? 107 LEU A HD23 1  
ATOM   1701  N  N    . TYR A 1 108 ? 8.262   20.899 35.647 1.00 0.00 ? 108 TYR A N    1  
ATOM   1702  C  CA   . TYR A 1 108 ? 9.682   20.578 35.918 1.00 0.00 ? 108 TYR A CA   1  
ATOM   1703  C  C    . TYR A 1 108 ? 10.139  21.244 37.209 1.00 0.00 ? 108 TYR A C    1  
ATOM   1704  O  O    . TYR A 1 108 ? 11.049  20.775 37.862 1.00 0.00 ? 108 TYR A O    1  
ATOM   1705  C  CB   . TYR A 1 108 ? 10.539  21.093 34.750 1.00 0.00 ? 108 TYR A CB   1  
ATOM   1706  C  CG   . TYR A 1 108 ? 11.000  19.900 33.909 1.00 0.00 ? 108 TYR A CG   1  
ATOM   1707  C  CD1  . TYR A 1 108 ? 12.042  19.102 34.336 1.00 0.00 ? 108 TYR A CD1  1  
ATOM   1708  C  CD2  . TYR A 1 108 ? 10.371  19.597 32.719 1.00 0.00 ? 108 TYR A CD2  1  
ATOM   1709  C  CE1  . TYR A 1 108 ? 12.448  18.017 33.585 1.00 0.00 ? 108 TYR A CE1  1  
ATOM   1710  C  CE2  . TYR A 1 108 ? 10.776  18.512 31.968 1.00 0.00 ? 108 TYR A CE2  1  
ATOM   1711  C  CZ   . TYR A 1 108 ? 11.818  17.713 32.395 1.00 0.00 ? 108 TYR A CZ   1  
ATOM   1712  O  OH   . TYR A 1 108 ? 12.219  16.627 31.645 1.00 0.00 ? 108 TYR A OH   1  
ATOM   1713  H  H    . TYR A 1 108 ? 8.021   21.562 34.964 1.00 0.00 ? 108 TYR A H    1  
ATOM   1714  H  HA   . TYR A 1 108 ? 9.784   19.498 36.024 1.00 0.00 ? 108 TYR A HA   1  
ATOM   1715  H  HB2  . TYR A 1 108 ? 9.958   21.762 34.133 1.00 0.00 ? 108 TYR A HB2  1  
ATOM   1716  H  HB3  . TYR A 1 108 ? 11.402  21.616 35.132 1.00 0.00 ? 108 TYR A HB3  1  
ATOM   1717  H  HD1  . TYR A 1 108 ? 12.546  19.329 35.266 1.00 0.00 ? 108 TYR A HD1  1  
ATOM   1718  H  HD2  . TYR A 1 108 ? 9.554   20.212 32.374 1.00 0.00 ? 108 TYR A HD2  1  
ATOM   1719  H  HE1  . TYR A 1 108 ? 13.265  17.401 33.932 1.00 0.00 ? 108 TYR A HE1  1  
ATOM   1720  H  HE2  . TYR A 1 108 ? 10.276  18.288 31.038 1.00 0.00 ? 108 TYR A HE2  1  
ATOM   1721  H  HH   . TYR A 1 108 ? 13.147  16.466 31.827 1.00 0.00 ? 108 TYR A HH   1  
ATOM   1722  N  N    . ASP A 1 109 ? 9.496   22.331 37.556 1.00 0.00 ? 109 ASP A N    1  
ATOM   1723  C  CA   . ASP A 1 109 ? 9.881   23.038 38.804 1.00 0.00 ? 109 ASP A CA   1  
ATOM   1724  C  C    . ASP A 1 109 ? 9.055   22.525 39.971 1.00 0.00 ? 109 ASP A C    1  
ATOM   1725  O  O    . ASP A 1 109 ? 8.337   23.273 40.606 1.00 0.00 ? 109 ASP A O    1  
ATOM   1726  C  CB   . ASP A 1 109 ? 9.608   24.540 38.625 1.00 0.00 ? 109 ASP A CB   1  
ATOM   1727  C  CG   . ASP A 1 109 ? 10.369  25.324 39.700 1.00 0.00 ? 109 ASP A CG   1  
ATOM   1728  O  OD1  . ASP A 1 109 ? 10.767  24.681 40.658 1.00 0.00 ? 109 ASP A OD1  1  
ATOM   1729  O  OD2  . ASP A 1 109 ? 10.507  26.519 39.502 1.00 0.00 ? 109 ASP A OD2  1  
ATOM   1730  H  H    . ASP A 1 109 ? 8.765   22.675 36.998 1.00 0.00 ? 109 ASP A H    1  
ATOM   1731  H  HA   . ASP A 1 109 ? 10.937  22.855 39.006 1.00 0.00 ? 109 ASP A HA   1  
ATOM   1732  H  HB2  . ASP A 1 109 ? 9.940   24.859 37.647 1.00 0.00 ? 109 ASP A HB2  1  
ATOM   1733  H  HB3  . ASP A 1 109 ? 8.549   24.734 38.723 1.00 0.00 ? 109 ASP A HB3  1  
ATOM   1734  N  N    . VAL A 1 110 ? 9.173   21.249 40.228 1.00 0.00 ? 110 VAL A N    1  
ATOM   1735  C  CA   . VAL A 1 110 ? 8.409   20.637 41.346 1.00 0.00 ? 110 VAL A CA   1  
ATOM   1736  C  C    . VAL A 1 110 ? 8.325   21.568 42.556 1.00 0.00 ? 110 VAL A C    1  
ATOM   1737  O  O    . VAL A 1 110 ? 7.266   22.069 42.881 1.00 0.00 ? 110 VAL A O    1  
ATOM   1738  C  CB   . VAL A 1 110 ? 9.128   19.345 41.762 1.00 0.00 ? 110 VAL A CB   1  
ATOM   1739  C  CG1  . VAL A 1 110 ? 8.208   18.543 42.689 1.00 0.00 ? 110 VAL A CG1  1  
ATOM   1740  C  CG2  . VAL A 1 110 ? 9.446   18.517 40.503 1.00 0.00 ? 110 VAL A CG2  1  
ATOM   1741  H  H    . VAL A 1 110 ? 9.765   20.693 39.678 1.00 0.00 ? 110 VAL A H    1  
ATOM   1742  H  HA   . VAL A 1 110 ? 7.399   20.418 41.001 1.00 0.00 ? 110 VAL A HA   1  
ATOM   1743  H  HB   . VAL A 1 110 ? 10.044  19.590 42.279 1.00 0.00 ? 110 VAL A HB   1  
ATOM   1744  H  HG11 . VAL A 1 110 ? 7.176   18.762 42.456 1.00 0.00 ? 110 VAL A HG11 1  
ATOM   1745  H  HG12 . VAL A 1 110 ? 8.386   17.487 42.558 1.00 0.00 ? 110 VAL A HG12 1  
ATOM   1746  H  HG13 . VAL A 1 110 ? 8.404   18.812 43.716 1.00 0.00 ? 110 VAL A HG13 1  
ATOM   1747  H  HG21 . VAL A 1 110 ? 8.609   18.552 39.822 1.00 0.00 ? 110 VAL A HG21 1  
ATOM   1748  H  HG22 . VAL A 1 110 ? 10.321  18.921 40.011 1.00 0.00 ? 110 VAL A HG22 1  
ATOM   1749  H  HG23 . VAL A 1 110 ? 9.639   17.490 40.778 1.00 0.00 ? 110 VAL A HG23 1  
ATOM   1750  N  N    . ASP A 1 111 ? 9.435   21.781 43.207 1.00 0.00 ? 111 ASP A N    1  
ATOM   1751  C  CA   . ASP A 1 111 ? 9.419   22.677 44.392 1.00 0.00 ? 111 ASP A CA   1  
ATOM   1752  C  C    . ASP A 1 111 ? 8.834   24.040 44.037 1.00 0.00 ? 111 ASP A C    1  
ATOM   1753  O  O    . ASP A 1 111 ? 8.015   24.573 44.759 1.00 0.00 ? 111 ASP A O    1  
ATOM   1754  C  CB   . ASP A 1 111 ? 10.863  22.868 44.883 1.00 0.00 ? 111 ASP A CB   1  
ATOM   1755  C  CG   . ASP A 1 111 ? 11.823  22.743 43.699 1.00 0.00 ? 111 ASP A CG   1  
ATOM   1756  O  OD1  . ASP A 1 111 ? 11.479  23.290 42.664 1.00 0.00 ? 111 ASP A OD1  1  
ATOM   1757  O  OD2  . ASP A 1 111 ? 12.846  22.107 43.895 1.00 0.00 ? 111 ASP A OD2  1  
ATOM   1758  H  H    . ASP A 1 111 ? 10.269  21.354 42.919 1.00 0.00 ? 111 ASP A H    1  
ATOM   1759  H  HA   . ASP A 1 111 ? 8.804   22.222 45.168 1.00 0.00 ? 111 ASP A HA   1  
ATOM   1760  H  HB2  . ASP A 1 111 ? 10.972  23.845 45.329 1.00 0.00 ? 111 ASP A HB2  1  
ATOM   1761  H  HB3  . ASP A 1 111 ? 11.101  22.112 45.618 1.00 0.00 ? 111 ASP A HB3  1  
ATOM   1762  N  N    . GLY A 1 112 ? 9.263   24.579 42.928 1.00 0.00 ? 112 GLY A N    1  
ATOM   1763  C  CA   . GLY A 1 112 ? 8.738   25.911 42.512 1.00 0.00 ? 112 GLY A CA   1  
ATOM   1764  C  C    . GLY A 1 112 ? 9.577   27.033 43.126 1.00 0.00 ? 112 GLY A C    1  
ATOM   1765  O  O    . GLY A 1 112 ? 9.159   27.672 44.072 1.00 0.00 ? 112 GLY A O    1  
ATOM   1766  H  H    . GLY A 1 112 ? 9.924   24.113 42.375 1.00 0.00 ? 112 GLY A H    1  
ATOM   1767  H  HA2  . GLY A 1 112 ? 8.773   25.989 41.435 1.00 0.00 ? 112 GLY A HA2  1  
ATOM   1768  H  HA3  . GLY A 1 112 ? 7.714   26.011 42.843 1.00 0.00 ? 112 GLY A HA3  1  
ATOM   1769  N  N    . ASN A 1 113 ? 10.748  27.244 42.569 1.00 0.00 ? 113 ASN A N    1  
ATOM   1770  C  CA   . ASN A 1 113 ? 11.642  28.317 43.094 1.00 0.00 ? 113 ASN A CA   1  
ATOM   1771  C  C    . ASN A 1 113 ? 12.011  29.297 41.987 1.00 0.00 ? 113 ASN A C    1  
ATOM   1772  O  O    . ASN A 1 113 ? 13.095  29.846 41.973 1.00 0.00 ? 113 ASN A O    1  
ATOM   1773  C  CB   . ASN A 1 113 ? 12.926  27.658 43.628 1.00 0.00 ? 113 ASN A CB   1  
ATOM   1774  C  CG   . ASN A 1 113 ? 12.556  26.402 44.423 1.00 0.00 ? 113 ASN A CG   1  
ATOM   1775  O  OD1  . ASN A 1 113 ? 11.929  25.493 43.916 1.00 0.00 ? 113 ASN A OD1  1  
ATOM   1776  N  ND2  . ASN A 1 113 ? 12.922  26.313 45.674 1.00 0.00 ? 113 ASN A ND2  1  
ATOM   1777  H  H    . ASN A 1 113 ? 11.035  26.697 41.807 1.00 0.00 ? 113 ASN A H    1  
ATOM   1778  H  HA   . ASN A 1 113 ? 11.129  28.859 43.885 1.00 0.00 ? 113 ASN A HA   1  
ATOM   1779  H  HB2  . ASN A 1 113 ? 13.568  27.385 42.804 1.00 0.00 ? 113 ASN A HB2  1  
ATOM   1780  H  HB3  . ASN A 1 113 ? 13.448  28.349 44.274 1.00 0.00 ? 113 ASN A HB3  1  
ATOM   1781  H  HD21 . ASN A 1 113 ? 13.427  27.044 46.089 1.00 0.00 ? 113 ASN A HD21 1  
ATOM   1782  H  HD22 . ASN A 1 113 ? 12.689  25.519 46.199 1.00 0.00 ? 113 ASN A HD22 1  
ATOM   1783  N  N    . GLY A 1 114 ? 11.097  29.496 41.074 1.00 0.00 ? 114 GLY A N    1  
ATOM   1784  C  CA   . GLY A 1 114 ? 11.368  30.441 39.950 1.00 0.00 ? 114 GLY A CA   1  
ATOM   1785  C  C    . GLY A 1 114 ? 12.607  30.006 39.166 1.00 0.00 ? 114 GLY A C    1  
ATOM   1786  O  O    . GLY A 1 114 ? 12.945  30.594 38.159 1.00 0.00 ? 114 GLY A O    1  
ATOM   1787  H  H    . GLY A 1 114 ? 10.239  29.026 41.127 1.00 0.00 ? 114 GLY A H    1  
ATOM   1788  H  HA2  . GLY A 1 114 ? 10.516  30.458 39.287 1.00 0.00 ? 114 GLY A HA2  1  
ATOM   1789  H  HA3  . GLY A 1 114 ? 11.529  31.432 40.349 1.00 0.00 ? 114 GLY A HA3  1  
ATOM   1790  N  N    . THR A 1 115 ? 13.253  28.984 39.644 1.00 0.00 ? 115 THR A N    1  
ATOM   1791  C  CA   . THR A 1 115 ? 14.463  28.497 38.948 1.00 0.00 ? 115 THR A CA   1  
ATOM   1792  C  C    . THR A 1 115 ? 14.633  27.000 39.154 1.00 0.00 ? 115 THR A C    1  
ATOM   1793  O  O    . THR A 1 115 ? 14.409  26.492 40.233 1.00 0.00 ? 115 THR A O    1  
ATOM   1794  C  CB   . THR A 1 115 ? 15.670  29.223 39.525 1.00 0.00 ? 115 THR A CB   1  
ATOM   1795  O  OG1  . THR A 1 115 ? 15.617  28.997 40.919 1.00 0.00 ? 115 THR A OG1  1  
ATOM   1796  C  CG2  . THR A 1 115 ? 15.508  30.741 39.369 1.00 0.00 ? 115 THR A CG2  1  
ATOM   1797  H  H    . THR A 1 115 ? 12.942  28.539 40.455 1.00 0.00 ? 115 THR A H    1  
ATOM   1798  H  HA   . THR A 1 115 ? 14.366  28.699 37.885 1.00 0.00 ? 115 THR A HA   1  
ATOM   1799  H  HB   . THR A 1 115 ? 16.596  28.856 39.104 1.00 0.00 ? 115 THR A HB   1  
ATOM   1800  H  HG1  . THR A 1 115 ? 15.960  28.117 41.090 1.00 0.00 ? 115 THR A HG1  1  
ATOM   1801  H  HG21 . THR A 1 115 ? 15.295  30.980 38.336 1.00 0.00 ? 115 THR A HG21 1  
ATOM   1802  H  HG22 . THR A 1 115 ? 14.692  31.084 39.988 1.00 0.00 ? 115 THR A HG22 1  
ATOM   1803  H  HG23 . THR A 1 115 ? 16.417  31.239 39.669 1.00 0.00 ? 115 THR A HG23 1  
ATOM   1804  N  N    . ILE A 1 116 ? 15.026  26.317 38.113 1.00 0.00 ? 116 ILE A N    1  
ATOM   1805  C  CA   . ILE A 1 116 ? 15.214  24.851 38.233 1.00 0.00 ? 116 ILE A CA   1  
ATOM   1806  C  C    . ILE A 1 116 ? 16.651  24.504 38.604 1.00 0.00 ? 116 ILE A C    1  
ATOM   1807  O  O    . ILE A 1 116 ? 17.571  25.245 38.299 1.00 0.00 ? 116 ILE A O    1  
ATOM   1808  C  CB   . ILE A 1 116 ? 14.888  24.211 36.884 1.00 0.00 ? 116 ILE A CB   1  
ATOM   1809  C  CG1  . ILE A 1 116 ? 13.402  24.359 36.588 1.00 0.00 ? 116 ILE A CG1  1  
ATOM   1810  C  CG2  . ILE A 1 116 ? 15.227  22.713 36.956 1.00 0.00 ? 116 ILE A CG2  1  
ATOM   1811  C  CD1  . ILE A 1 116 ? 13.147  24.033 35.115 1.00 0.00 ? 116 ILE A CD1  1  
ATOM   1812  H  H    . ILE A 1 116 ? 15.195  26.770 37.260 1.00 0.00 ? 116 ILE A H    1  
ATOM   1813  H  HA   . ILE A 1 116 ? 14.549  24.472 39.009 1.00 0.00 ? 116 ILE A HA   1  
ATOM   1814  H  HB   . ILE A 1 116 ? 15.464  24.706 36.100 1.00 0.00 ? 116 ILE A HB   1  
ATOM   1815  H  HG12 . ILE A 1 116 ? 12.839  23.682 37.212 1.00 0.00 ? 116 ILE A HG12 1  
ATOM   1816  H  HG13 . ILE A 1 116 ? 13.090  25.373 36.793 1.00 0.00 ? 116 ILE A HG13 1  
ATOM   1817  H  HG21 . ILE A 1 116 ? 14.684  22.255 37.772 1.00 0.00 ? 116 ILE A HG21 1  
ATOM   1818  H  HG22 . ILE A 1 116 ? 14.950  22.231 36.030 1.00 0.00 ? 116 ILE A HG22 1  
ATOM   1819  H  HG23 . ILE A 1 116 ? 16.287  22.586 37.120 1.00 0.00 ? 116 ILE A HG23 1  
ATOM   1820  H  HD11 . ILE A 1 116 ? 13.920  24.477 34.504 1.00 0.00 ? 116 ILE A HD11 1  
ATOM   1821  H  HD12 . ILE A 1 116 ? 13.153  22.963 34.972 1.00 0.00 ? 116 ILE A HD12 1  
ATOM   1822  H  HD13 . ILE A 1 116 ? 12.187  24.427 34.815 1.00 0.00 ? 116 ILE A HD13 1  
ATOM   1823  N  N    . SER A 1 117 ? 16.812  23.376 39.257 1.00 0.00 ? 117 SER A N    1  
ATOM   1824  C  CA   . SER A 1 117 ? 18.170  22.938 39.668 1.00 0.00 ? 117 SER A CA   1  
ATOM   1825  C  C    . SER A 1 117 ? 18.383  21.465 39.330 1.00 0.00 ? 117 SER A C    1  
ATOM   1826  O  O    . SER A 1 117 ? 17.493  20.807 38.832 1.00 0.00 ? 117 SER A O    1  
ATOM   1827  C  CB   . SER A 1 117 ? 18.301  23.121 41.188 1.00 0.00 ? 117 SER A CB   1  
ATOM   1828  O  OG   . SER A 1 117 ? 19.681  22.905 41.446 1.00 0.00 ? 117 SER A OG   1  
ATOM   1829  H  H    . SER A 1 117 ? 16.038  22.822 39.469 1.00 0.00 ? 117 SER A H    1  
ATOM   1830  H  HA   . SER A 1 117 ? 18.911  23.530 39.141 1.00 0.00 ? 117 SER A HA   1  
ATOM   1831  H  HB2  . SER A 1 117 ? 18.019  24.122 41.481 1.00 0.00 ? 117 SER A HB2  1  
ATOM   1832  H  HB3  . SER A 1 117 ? 17.704  22.391 41.715 1.00 0.00 ? 117 SER A HB3  1  
ATOM   1833  H  HG   . SER A 1 117 ? 20.044  23.712 41.818 1.00 0.00 ? 117 SER A HG   1  
ATOM   1834  N  N    . LYS A 1 118 ? 19.556  20.975 39.616 1.00 0.00 ? 118 LYS A N    1  
ATOM   1835  C  CA   . LYS A 1 118 ? 19.847  19.549 39.317 1.00 0.00 ? 118 LYS A CA   1  
ATOM   1836  C  C    . LYS A 1 118 ? 18.914  18.612 40.083 1.00 0.00 ? 118 LYS A C    1  
ATOM   1837  O  O    . LYS A 1 118 ? 18.472  17.613 39.555 1.00 0.00 ? 118 LYS A O    1  
ATOM   1838  C  CB   . LYS A 1 118 ? 21.295  19.253 39.740 1.00 0.00 ? 118 LYS A CB   1  
ATOM   1839  C  CG   . LYS A 1 118 ? 22.227  20.312 39.143 1.00 0.00 ? 118 LYS A CG   1  
ATOM   1840  C  CD   . LYS A 1 118 ? 23.254  20.727 40.199 1.00 0.00 ? 118 LYS A CD   1  
ATOM   1841  C  CE   . LYS A 1 118 ? 24.113  19.516 40.567 1.00 0.00 ? 118 LYS A CE   1  
ATOM   1842  N  NZ   . LYS A 1 118 ? 24.567  18.805 39.339 1.00 0.00 ? 118 LYS A NZ   1  
ATOM   1843  H  H    . LYS A 1 118 ? 20.242  21.544 40.023 1.00 0.00 ? 118 LYS A H    1  
ATOM   1844  H  HA   . LYS A 1 118 ? 19.717  19.381 38.249 1.00 0.00 ? 118 LYS A HA   1  
ATOM   1845  H  HB2  . LYS A 1 118 ? 21.369  19.272 40.817 1.00 0.00 ? 118 LYS A HB2  1  
ATOM   1846  H  HB3  . LYS A 1 118 ? 21.583  18.276 39.383 1.00 0.00 ? 118 LYS A HB3  1  
ATOM   1847  H  HG2  . LYS A 1 118 ? 22.736  19.904 38.283 1.00 0.00 ? 118 LYS A HG2  1  
ATOM   1848  H  HG3  . LYS A 1 118 ? 21.653  21.173 38.838 1.00 0.00 ? 118 LYS A HG3  1  
ATOM   1849  H  HD2  . LYS A 1 118 ? 23.883  21.512 39.804 1.00 0.00 ? 118 LYS A HD2  1  
ATOM   1850  H  HD3  . LYS A 1 118 ? 22.744  21.091 41.078 1.00 0.00 ? 118 LYS A HD3  1  
ATOM   1851  H  HE2  . LYS A 1 118 ? 24.978  19.842 41.126 1.00 0.00 ? 118 LYS A HE2  1  
ATOM   1852  H  HE3  . LYS A 1 118 ? 23.537  18.836 41.177 1.00 0.00 ? 118 LYS A HE3  1  
ATOM   1853  H  HZ1  . LYS A 1 118 ? 24.900  19.498 38.639 1.00 0.00 ? 118 LYS A HZ1  1  
ATOM   1854  H  HZ2  . LYS A 1 118 ? 25.343  18.156 39.581 1.00 0.00 ? 118 LYS A HZ2  1  
ATOM   1855  H  HZ3  . LYS A 1 118 ? 23.775  18.262 38.939 1.00 0.00 ? 118 LYS A HZ3  1  
ATOM   1856  N  N    . ASN A 1 119 ? 18.633  18.947 41.314 1.00 0.00 ? 119 ASN A N    1  
ATOM   1857  C  CA   . ASN A 1 119 ? 17.731  18.076 42.115 1.00 0.00 ? 119 ASN A CA   1  
ATOM   1858  C  C    . ASN A 1 119 ? 16.401  17.853 41.402 1.00 0.00 ? 119 ASN A C    1  
ATOM   1859  O  O    . ASN A 1 119 ? 16.120  16.768 40.934 1.00 0.00 ? 119 ASN A O    1  
ATOM   1860  C  CB   . ASN A 1 119 ? 17.459  18.762 43.462 1.00 0.00 ? 119 ASN A CB   1  
ATOM   1861  C  CG   . ASN A 1 119 ? 16.710  17.791 44.378 1.00 0.00 ? 119 ASN A CG   1  
ATOM   1862  O  OD1  . ASN A 1 119 ? 17.287  16.883 44.945 1.00 0.00 ? 119 ASN A OD1  1  
ATOM   1863  N  ND2  . ASN A 1 119 ? 15.426  17.946 44.551 1.00 0.00 ? 119 ASN A ND2  1  
ATOM   1864  H  H    . ASN A 1 119 ? 19.011  19.763 41.705 1.00 0.00 ? 119 ASN A H    1  
ATOM   1865  H  HA   . ASN A 1 119 ? 18.216  17.112 42.265 1.00 0.00 ? 119 ASN A HA   1  
ATOM   1866  H  HB2  . ASN A 1 119 ? 18.394  19.041 43.926 1.00 0.00 ? 119 ASN A HB2  1  
ATOM   1867  H  HB3  . ASN A 1 119 ? 16.857  19.644 43.309 1.00 0.00 ? 119 ASN A HB3  1  
ATOM   1868  H  HD21 . ASN A 1 119 ? 14.955  18.675 44.096 1.00 0.00 ? 119 ASN A HD21 1  
ATOM   1869  H  HD22 . ASN A 1 119 ? 14.933  17.331 45.133 1.00 0.00 ? 119 ASN A HD22 1  
ATOM   1870  N  N    . GLU A 1 120 ? 15.604  18.883 41.332 1.00 0.00 ? 120 GLU A N    1  
ATOM   1871  C  CA   . GLU A 1 120 ? 14.292  18.743 40.654 1.00 0.00 ? 120 GLU A CA   1  
ATOM   1872  C  C    . GLU A 1 120 ? 14.445  18.027 39.322 1.00 0.00 ? 120 GLU A C    1  
ATOM   1873  O  O    . GLU A 1 120 ? 13.707  17.109 39.016 1.00 0.00 ? 120 GLU A O    1  
ATOM   1874  C  CB   . GLU A 1 120 ? 13.731  20.145 40.393 1.00 0.00 ? 120 GLU A CB   1  
ATOM   1875  C  CG   . GLU A 1 120 ? 13.541  20.865 41.728 1.00 0.00 ? 120 GLU A CG   1  
ATOM   1876  C  CD   . GLU A 1 120 ? 13.571  22.375 41.493 1.00 0.00 ? 120 GLU A CD   1  
ATOM   1877  O  OE1  . GLU A 1 120 ? 12.781  22.809 40.672 1.00 0.00 ? 120 GLU A OE1  1  
ATOM   1878  O  OE2  . GLU A 1 120 ? 14.384  23.008 42.146 1.00 0.00 ? 120 GLU A OE2  1  
ATOM   1879  H  H    . GLU A 1 120 ? 15.869  19.740 41.725 1.00 0.00 ? 120 GLU A H    1  
ATOM   1880  H  HA   . GLU A 1 120 ? 13.621  18.168 41.291 1.00 0.00 ? 120 GLU A HA   1  
ATOM   1881  H  HB2  . GLU A 1 120 ? 14.420  20.701 39.777 1.00 0.00 ? 120 GLU A HB2  1  
ATOM   1882  H  HB3  . GLU A 1 120 ? 12.783  20.068 39.883 1.00 0.00 ? 120 GLU A HB3  1  
ATOM   1883  H  HG2  . GLU A 1 120 ? 12.589  20.589 42.161 1.00 0.00 ? 120 GLU A HG2  1  
ATOM   1884  H  HG3  . GLU A 1 120 ? 14.335  20.593 42.407 1.00 0.00 ? 120 GLU A HG3  1  
ATOM   1885  N  N    . VAL A 1 121 ? 15.399  18.460 38.549 1.00 0.00 ? 121 VAL A N    1  
ATOM   1886  C  CA   . VAL A 1 121 ? 15.613  17.817 37.235 1.00 0.00 ? 121 VAL A CA   1  
ATOM   1887  C  C    . VAL A 1 121 ? 15.825  16.319 37.398 1.00 0.00 ? 121 VAL A C    1  
ATOM   1888  O  O    . VAL A 1 121 ? 15.454  15.544 36.546 1.00 0.00 ? 121 VAL A O    1  
ATOM   1889  C  CB   . VAL A 1 121 ? 16.870  18.429 36.596 1.00 0.00 ? 121 VAL A CB   1  
ATOM   1890  C  CG1  . VAL A 1 121 ? 17.173  17.700 35.285 1.00 0.00 ? 121 VAL A CG1  1  
ATOM   1891  C  CG2  . VAL A 1 121 ? 16.617  19.908 36.301 1.00 0.00 ? 121 VAL A CG2  1  
ATOM   1892  H  H    . VAL A 1 121 ? 15.971  19.201 38.836 1.00 0.00 ? 121 VAL A H    1  
ATOM   1893  H  HA   . VAL A 1 121 ? 14.739  17.987 36.609 1.00 0.00 ? 121 VAL A HA   1  
ATOM   1894  H  HB   . VAL A 1 121 ? 17.708  18.330 37.270 1.00 0.00 ? 121 VAL A HB   1  
ATOM   1895  H  HG11 . VAL A 1 121 ? 16.283  17.661 34.675 1.00 0.00 ? 121 VAL A HG11 1  
ATOM   1896  H  HG12 . VAL A 1 121 ? 17.950  18.226 34.748 1.00 0.00 ? 121 VAL A HG12 1  
ATOM   1897  H  HG13 . VAL A 1 121 ? 17.504  16.695 35.495 1.00 0.00 ? 121 VAL A HG13 1  
ATOM   1898  H  HG21 . VAL A 1 121 ? 15.993  20.333 37.072 1.00 0.00 ? 121 VAL A HG21 1  
ATOM   1899  H  HG22 . VAL A 1 121 ? 17.557  20.438 36.269 1.00 0.00 ? 121 VAL A HG22 1  
ATOM   1900  H  HG23 . VAL A 1 121 ? 16.120  20.008 35.346 1.00 0.00 ? 121 VAL A HG23 1  
ATOM   1901  N  N    . LEU A 1 122 ? 16.416  15.938 38.497 1.00 0.00 ? 122 LEU A N    1  
ATOM   1902  C  CA   . LEU A 1 122 ? 16.657  14.494 38.726 1.00 0.00 ? 122 LEU A CA   1  
ATOM   1903  C  C    . LEU A 1 122 ? 15.349  13.745 38.974 1.00 0.00 ? 122 LEU A C    1  
ATOM   1904  O  O    . LEU A 1 122 ? 15.116  12.699 38.404 1.00 0.00 ? 122 LEU A O    1  
ATOM   1905  C  CB   . LEU A 1 122 ? 17.562  14.342 39.959 1.00 0.00 ? 122 LEU A CB   1  
ATOM   1906  C  CG   . LEU A 1 122 ? 18.791  13.521 39.572 1.00 0.00 ? 122 LEU A CG   1  
ATOM   1907  C  CD1  . LEU A 1 122 ? 19.815  13.582 40.706 1.00 0.00 ? 122 LEU A CD1  1  
ATOM   1908  C  CD2  . LEU A 1 122 ? 18.374  12.068 39.345 1.00 0.00 ? 122 LEU A CD2  1  
ATOM   1909  H  H    . LEU A 1 122 ? 16.696  16.599 39.163 1.00 0.00 ? 122 LEU A H    1  
ATOM   1910  H  HA   . LEU A 1 122 ? 17.138  14.075 37.843 1.00 0.00 ? 122 LEU A HA   1  
ATOM   1911  H  HB2  . LEU A 1 122 ? 17.870  15.316 40.305 1.00 0.00 ? 122 LEU A HB2  1  
ATOM   1912  H  HB3  . LEU A 1 122 ? 17.023  13.839 40.748 1.00 0.00 ? 122 LEU A HB3  1  
ATOM   1913  H  HG   . LEU A 1 122 ? 19.226  13.921 38.668 1.00 0.00 ? 122 LEU A HG   1  
ATOM   1914  H  HD11 . LEU A 1 122 ? 20.026  14.611 40.953 1.00 0.00 ? 122 LEU A HD11 1  
ATOM   1915  H  HD12 . LEU A 1 122 ? 19.423  13.081 41.580 1.00 0.00 ? 122 LEU A HD12 1  
ATOM   1916  H  HD13 . LEU A 1 122 ? 20.729  13.095 40.399 1.00 0.00 ? 122 LEU A HD13 1  
ATOM   1917  H  HD21 . LEU A 1 122 ? 17.671  11.767 40.108 1.00 0.00 ? 122 LEU A HD21 1  
ATOM   1918  H  HD22 . LEU A 1 122 ? 17.909  11.970 38.375 1.00 0.00 ? 122 LEU A HD22 1  
ATOM   1919  H  HD23 . LEU A 1 122 ? 19.242  11.428 39.389 1.00 0.00 ? 122 LEU A HD23 1  
ATOM   1920  N  N    . GLU A 1 123 ? 14.518  14.290 39.818 1.00 0.00 ? 123 GLU A N    1  
ATOM   1921  C  CA   . GLU A 1 123 ? 13.230  13.607 40.101 1.00 0.00 ? 123 GLU A CA   1  
ATOM   1922  C  C    . GLU A 1 123 ? 12.439  13.395 38.821 1.00 0.00 ? 123 GLU A C    1  
ATOM   1923  O  O    . GLU A 1 123 ? 12.204  12.277 38.411 1.00 0.00 ? 123 GLU A O    1  
ATOM   1924  C  CB   . GLU A 1 123 ? 12.399  14.489 41.044 1.00 0.00 ? 123 GLU A CB   1  
ATOM   1925  C  CG   . GLU A 1 123 ? 12.956  14.372 42.464 1.00 0.00 ? 123 GLU A CG   1  
ATOM   1926  C  CD   . GLU A 1 123 ? 14.471  14.580 42.434 1.00 0.00 ? 123 GLU A CD   1  
ATOM   1927  O  OE1  . GLU A 1 123 ? 15.134  13.663 41.979 1.00 0.00 ? 123 GLU A OE1  1  
ATOM   1928  O  OE2  . GLU A 1 123 ? 14.878  15.646 42.866 1.00 0.00 ? 123 GLU A OE2  1  
ATOM   1929  H  H    . GLU A 1 123 ? 14.739  15.137 40.259 1.00 0.00 ? 123 GLU A H    1  
ATOM   1930  H  HA   . GLU A 1 123 ? 13.433  12.640 40.555 1.00 0.00 ? 123 GLU A HA   1  
ATOM   1931  H  HB2  . GLU A 1 123 ? 12.448  15.517 40.716 1.00 0.00 ? 123 GLU A HB2  1  
ATOM   1932  H  HB3  . GLU A 1 123 ? 11.368  14.162 41.029 1.00 0.00 ? 123 GLU A HB3  1  
ATOM   1933  H  HG2  . GLU A 1 123 ? 12.504  15.121 43.097 1.00 0.00 ? 123 GLU A HG2  1  
ATOM   1934  H  HG3  . GLU A 1 123 ? 12.739  13.391 42.861 1.00 0.00 ? 123 GLU A HG3  1  
ATOM   1935  N  N    . ILE A 1 124 ? 12.043  14.474 38.213 1.00 0.00 ? 124 ILE A N    1  
ATOM   1936  C  CA   . ILE A 1 124 ? 11.266  14.356 36.960 1.00 0.00 ? 124 ILE A CA   1  
ATOM   1937  C  C    . ILE A 1 124 ? 12.011  13.500 35.934 1.00 0.00 ? 124 ILE A C    1  
ATOM   1938  O  O    . ILE A 1 124 ? 11.400  12.863 35.098 1.00 0.00 ? 124 ILE A O    1  
ATOM   1939  C  CB   . ILE A 1 124 ? 11.048  15.768 36.402 1.00 0.00 ? 124 ILE A CB   1  
ATOM   1940  C  CG1  . ILE A 1 124 ? 9.750   16.342 36.955 1.00 0.00 ? 124 ILE A CG1  1  
ATOM   1941  C  CG2  . ILE A 1 124 ? 10.922  15.694 34.874 1.00 0.00 ? 124 ILE A CG2  1  
ATOM   1942  C  CD1  . ILE A 1 124 ? 9.797   16.328 38.484 1.00 0.00 ? 124 ILE A CD1  1  
ATOM   1943  H  H    . ILE A 1 124 ? 12.256  15.357 38.581 1.00 0.00 ? 124 ILE A H    1  
ATOM   1944  H  HA   . ILE A 1 124 ? 10.311  13.880 37.184 1.00 0.00 ? 124 ILE A HA   1  
ATOM   1945  H  HB   . ILE A 1 124 ? 11.882  16.410 36.697 1.00 0.00 ? 124 ILE A HB   1  
ATOM   1946  H  HG12 . ILE A 1 124 ? 9.624   17.356 36.606 1.00 0.00 ? 124 ILE A HG12 1  
ATOM   1947  H  HG13 . ILE A 1 124 ? 8.917   15.746 36.613 1.00 0.00 ? 124 ILE A HG13 1  
ATOM   1948  H  HG21 . ILE A 1 124 ? 10.277  14.874 34.602 1.00 0.00 ? 124 ILE A HG21 1  
ATOM   1949  H  HG22 . ILE A 1 124 ? 10.502  16.616 34.500 1.00 0.00 ? 124 ILE A HG22 1  
ATOM   1950  H  HG23 . ILE A 1 124 ? 11.895  15.542 34.435 1.00 0.00 ? 124 ILE A HG23 1  
ATOM   1951  H  HD11 . ILE A 1 124 ? 10.062  15.343 38.834 1.00 0.00 ? 124 ILE A HD11 1  
ATOM   1952  H  HD12 . ILE A 1 124 ? 10.531  17.039 38.831 1.00 0.00 ? 124 ILE A HD12 1  
ATOM   1953  H  HD13 . ILE A 1 124 ? 8.830   16.594 38.879 1.00 0.00 ? 124 ILE A HD13 1  
ATOM   1954  N  N    . VAL A 1 125 ? 13.316  13.492 36.014 1.00 0.00 ? 125 VAL A N    1  
ATOM   1955  C  CA   . VAL A 1 125 ? 14.090  12.677 35.045 1.00 0.00 ? 125 VAL A CA   1  
ATOM   1956  C  C    . VAL A 1 125 ? 13.893  11.192 35.330 1.00 0.00 ? 125 VAL A C    1  
ATOM   1957  O  O    . VAL A 1 125 ? 13.599  10.420 34.439 1.00 0.00 ? 125 VAL A O    1  
ATOM   1958  C  CB   . VAL A 1 125 ? 15.583  13.024 35.186 1.00 0.00 ? 125 VAL A CB   1  
ATOM   1959  C  CG1  . VAL A 1 125 ? 16.425  11.841 34.702 1.00 0.00 ? 125 VAL A CG1  1  
ATOM   1960  C  CG2  . VAL A 1 125 ? 15.897  14.252 34.324 1.00 0.00 ? 125 VAL A CG2  1  
ATOM   1961  H  H    . VAL A 1 125 ? 13.775  14.013 36.706 1.00 0.00 ? 125 VAL A H    1  
ATOM   1962  H  HA   . VAL A 1 125 ? 13.733  12.894 34.037 1.00 0.00 ? 125 VAL A HA   1  
ATOM   1963  H  HB   . VAL A 1 125 ? 15.813  13.236 36.217 1.00 0.00 ? 125 VAL A HB   1  
ATOM   1964  H  HG11 . VAL A 1 125 ? 16.083  11.523 33.728 1.00 0.00 ? 125 VAL A HG11 1  
ATOM   1965  H  HG12 . VAL A 1 125 ? 17.463  12.136 34.635 1.00 0.00 ? 125 VAL A HG12 1  
ATOM   1966  H  HG13 . VAL A 1 125 ? 16.333  11.020 35.397 1.00 0.00 ? 125 VAL A HG13 1  
ATOM   1967  H  HG21 . VAL A 1 125 ? 15.045  14.915 34.310 1.00 0.00 ? 125 VAL A HG21 1  
ATOM   1968  H  HG22 . VAL A 1 125 ? 16.750  14.776 34.729 1.00 0.00 ? 125 VAL A HG22 1  
ATOM   1969  H  HG23 . VAL A 1 125 ? 16.120  13.941 33.315 1.00 0.00 ? 125 VAL A HG23 1  
ATOM   1970  N  N    . THR A 1 126 ? 14.062  10.817 36.572 1.00 0.00 ? 126 THR A N    1  
ATOM   1971  C  CA   . THR A 1 126 ? 13.884  9.390  36.927 1.00 0.00 ? 126 THR A CA   1  
ATOM   1972  C  C    . THR A 1 126 ? 12.444  8.970  36.677 1.00 0.00 ? 126 THR A C    1  
ATOM   1973  O  O    . THR A 1 126 ? 12.181  7.909  36.141 1.00 0.00 ? 126 THR A O    1  
ATOM   1974  C  CB   . THR A 1 126 ? 14.206  9.218  38.415 1.00 0.00 ? 126 THR A CB   1  
ATOM   1975  O  OG1  . THR A 1 126 ? 15.592  9.474  38.528 1.00 0.00 ? 126 THR A OG1  1  
ATOM   1976  C  CG2  . THR A 1 126 ? 14.048  7.751  38.846 1.00 0.00 ? 126 THR A CG2  1  
ATOM   1977  H  H    . THR A 1 126 ? 14.302  11.472 37.260 1.00 0.00 ? 126 THR A H    1  
ATOM   1978  H  HA   . THR A 1 126 ? 14.547  8.782  36.310 1.00 0.00 ? 126 THR A HA   1  
ATOM   1979  H  HB   . THR A 1 126 ? 13.633  9.904  39.035 1.00 0.00 ? 126 THR A HB   1  
ATOM   1980  H  HG1  . THR A 1 126 ? 15.850  9.316  39.438 1.00 0.00 ? 126 THR A HG1  1  
ATOM   1981  H  HG21 . THR A 1 126 ? 14.553  7.108  38.141 1.00 0.00 ? 126 THR A HG21 1  
ATOM   1982  H  HG22 . THR A 1 126 ? 14.480  7.611  39.826 1.00 0.00 ? 126 THR A HG22 1  
ATOM   1983  H  HG23 . THR A 1 126 ? 13.001  7.492  38.878 1.00 0.00 ? 126 THR A HG23 1  
ATOM   1984  N  N    . ALA A 1 127 ? 11.531  9.815  37.073 1.00 0.00 ? 127 ALA A N    1  
ATOM   1985  C  CA   . ALA A 1 127 ? 10.104  9.491  36.868 1.00 0.00 ? 127 ALA A CA   1  
ATOM   1986  C  C    . ALA A 1 127 ? 9.844   9.236  35.388 1.00 0.00 ? 127 ALA A C    1  
ATOM   1987  O  O    . ALA A 1 127 ? 9.250   8.237  35.010 1.00 0.00 ? 127 ALA A O    1  
ATOM   1988  C  CB   . ALA A 1 127 ? 9.268   10.701 37.326 1.00 0.00 ? 127 ALA A CB   1  
ATOM   1989  H  H    . ALA A 1 127 ? 11.791  10.657 37.504 1.00 0.00 ? 127 ALA A H    1  
ATOM   1990  H  HA   . ALA A 1 127 ? 9.850   8.598  37.440 1.00 0.00 ? 127 ALA A HA   1  
ATOM   1991  H  HB1  . ALA A 1 127 ? 9.845   11.301 38.016 1.00 0.00 ? 127 ALA A HB1  1  
ATOM   1992  H  HB2  . ALA A 1 127 ? 9.000   11.303 36.471 1.00 0.00 ? 127 ALA A HB2  1  
ATOM   1993  H  HB3  . ALA A 1 127 ? 8.370   10.360 37.819 1.00 0.00 ? 127 ALA A HB3  1  
ATOM   1994  N  N    . ILE A 1 128 ? 10.298  10.148 34.573 1.00 0.00 ? 128 ILE A N    1  
ATOM   1995  C  CA   . ILE A 1 128 ? 10.096  9.987  33.120 1.00 0.00 ? 128 ILE A CA   1  
ATOM   1996  C  C    . ILE A 1 128 ? 10.657  8.650  32.659 1.00 0.00 ? 128 ILE A C    1  
ATOM   1997  O  O    . ILE A 1 128 ? 10.135  8.033  31.753 1.00 0.00 ? 128 ILE A O    1  
ATOM   1998  C  CB   . ILE A 1 128 ? 10.845  11.113 32.404 1.00 0.00 ? 128 ILE A CB   1  
ATOM   1999  C  CG1  . ILE A 1 128 ? 10.006  12.383 32.425 1.00 0.00 ? 128 ILE A CG1  1  
ATOM   2000  C  CG2  . ILE A 1 128 ? 11.074  10.699 30.942 1.00 0.00 ? 128 ILE A CG2  1  
ATOM   2001  C  CD1  . ILE A 1 128 ? 10.862  13.558 31.946 1.00 0.00 ? 128 ILE A CD1  1  
ATOM   2002  H  H    . ILE A 1 128 ? 10.766  10.935 34.924 1.00 0.00 ? 128 ILE A H    1  
ATOM   2003  H  HA   . ILE A 1 128 ? 9.030   10.025 32.900 1.00 0.00 ? 128 ILE A HA   1  
ATOM   2004  H  HB   . ILE A 1 128 ? 11.795  11.298 32.913 1.00 0.00 ? 128 ILE A HB   1  
ATOM   2005  H  HG12 . ILE A 1 128 ? 9.154   12.265 31.772 1.00 0.00 ? 128 ILE A HG12 1  
ATOM   2006  H  HG13 . ILE A 1 128 ? 9.659   12.572 33.430 1.00 0.00 ? 128 ILE A HG13 1  
ATOM   2007  H  HG21 . ILE A 1 128 ? 10.159  10.298 30.530 1.00 0.00 ? 128 ILE A HG21 1  
ATOM   2008  H  HG22 . ILE A 1 128 ? 11.377  11.559 30.362 1.00 0.00 ? 128 ILE A HG22 1  
ATOM   2009  H  HG23 . ILE A 1 128 ? 11.847  9.946  30.893 1.00 0.00 ? 128 ILE A HG23 1  
ATOM   2010  H  HD11 . ILE A 1 128 ? 11.900  13.373 32.184 1.00 0.00 ? 128 ILE A HD11 1  
ATOM   2011  H  HD12 . ILE A 1 128 ? 10.757  13.676 30.878 1.00 0.00 ? 128 ILE A HD12 1  
ATOM   2012  H  HD13 . ILE A 1 128 ? 10.542  14.465 32.438 1.00 0.00 ? 128 ILE A HD13 1  
ATOM   2013  N  N    . PHE A 1 129 ? 11.715  8.222  33.299 1.00 0.00 ? 129 PHE A N    1  
ATOM   2014  C  CA   . PHE A 1 129 ? 12.320  6.927  32.912 1.00 0.00 ? 129 PHE A CA   1  
ATOM   2015  C  C    . PHE A 1 129 ? 11.323  5.798  33.125 1.00 0.00 ? 129 PHE A C    1  
ATOM   2016  O  O    . PHE A 1 129 ? 11.222  4.897  32.319 1.00 0.00 ? 129 PHE A O    1  
ATOM   2017  C  CB   . PHE A 1 129 ? 13.556  6.680  33.791 1.00 0.00 ? 129 PHE A CB   1  
ATOM   2018  C  CG   . PHE A 1 129 ? 14.771  6.430  32.894 1.00 0.00 ? 129 PHE A CG   1  
ATOM   2019  C  CD1  . PHE A 1 129 ? 15.274  7.442  32.093 1.00 0.00 ? 129 PHE A CD1  1  
ATOM   2020  C  CD2  . PHE A 1 129 ? 15.382  5.188  32.870 1.00 0.00 ? 129 PHE A CD2  1  
ATOM   2021  C  CE1  . PHE A 1 129 ? 16.369  7.213  31.286 1.00 0.00 ? 129 PHE A CE1  1  
ATOM   2022  C  CE2  . PHE A 1 129 ? 16.477  4.964  32.061 1.00 0.00 ? 129 PHE A CE2  1  
ATOM   2023  C  CZ   . PHE A 1 129 ? 16.970  5.976  31.270 1.00 0.00 ? 129 PHE A CZ   1  
ATOM   2024  H  H    . PHE A 1 129 ? 12.100  8.749  34.029 1.00 0.00 ? 129 PHE A H    1  
ATOM   2025  H  HA   . PHE A 1 129 ? 12.594  6.966  31.856 1.00 0.00 ? 129 PHE A HA   1  
ATOM   2026  H  HB2  . PHE A 1 129 ? 13.743  7.545  34.410 1.00 0.00 ? 129 PHE A HB2  1  
ATOM   2027  H  HB3  . PHE A 1 129 ? 13.394  5.818  34.421 1.00 0.00 ? 129 PHE A HB3  1  
ATOM   2028  H  HD1  . PHE A 1 129 ? 14.809  8.416  32.102 1.00 0.00 ? 129 PHE A HD1  1  
ATOM   2029  H  HD2  . PHE A 1 129 ? 15.000  4.389  33.488 1.00 0.00 ? 129 PHE A HD2  1  
ATOM   2030  H  HE1  . PHE A 1 129 ? 16.756  8.008  30.662 1.00 0.00 ? 129 PHE A HE1  1  
ATOM   2031  H  HE2  . PHE A 1 129 ? 16.950  3.993  32.049 1.00 0.00 ? 129 PHE A HE2  1  
ATOM   2032  H  HZ   . PHE A 1 129 ? 17.825  5.798  30.635 1.00 0.00 ? 129 PHE A HZ   1  
ATOM   2033  N  N    . LYS A 1 130 ? 10.604  5.862  34.213 1.00 0.00 ? 130 LYS A N    1  
ATOM   2034  C  CA   . LYS A 1 130 ? 9.614   4.797  34.480 1.00 0.00 ? 130 LYS A CA   1  
ATOM   2035  C  C    . LYS A 1 130 ? 8.631   4.719  33.326 1.00 0.00 ? 130 LYS A C    1  
ATOM   2036  O  O    . LYS A 1 130 ? 8.309   3.649  32.848 1.00 0.00 ? 130 LYS A O    1  
ATOM   2037  C  CB   . LYS A 1 130 ? 8.848   5.144  35.767 1.00 0.00 ? 130 LYS A CB   1  
ATOM   2038  C  CG   . LYS A 1 130 ? 9.815   5.104  36.952 1.00 0.00 ? 130 LYS A CG   1  
ATOM   2039  C  CD   . LYS A 1 130 ? 9.870   3.678  37.503 1.00 0.00 ? 130 LYS A CD   1  
ATOM   2040  C  CE   . LYS A 1 130 ? 10.586  3.689  38.857 1.00 0.00 ? 130 LYS A CE   1  
ATOM   2041  N  NZ   . LYS A 1 130 ? 10.410  2.382  39.549 1.00 0.00 ? 130 LYS A NZ   1  
ATOM   2042  H  H    . LYS A 1 130 ? 10.723  6.606  34.845 1.00 0.00 ? 130 LYS A H    1  
ATOM   2043  H  HA   . LYS A 1 130 ? 10.130  3.842  34.576 1.00 0.00 ? 130 LYS A HA   1  
ATOM   2044  H  HB2  . LYS A 1 130 ? 8.421   6.131  35.680 1.00 0.00 ? 130 LYS A HB2  1  
ATOM   2045  H  HB3  . LYS A 1 130 ? 8.054   4.428  35.922 1.00 0.00 ? 130 LYS A HB3  1  
ATOM   2046  H  HG2  . LYS A 1 130 ? 10.800  5.407  36.627 1.00 0.00 ? 130 LYS A HG2  1  
ATOM   2047  H  HG3  . LYS A 1 130 ? 9.473   5.779  37.721 1.00 0.00 ? 130 LYS A HG3  1  
ATOM   2048  H  HD2  . LYS A 1 130 ? 8.867   3.297  37.626 1.00 0.00 ? 130 LYS A HD2  1  
ATOM   2049  H  HD3  . LYS A 1 130 ? 10.408  3.042  36.815 1.00 0.00 ? 130 LYS A HD3  1  
ATOM   2050  H  HE2  . LYS A 1 130 ? 11.640  3.871  38.708 1.00 0.00 ? 130 LYS A HE2  1  
ATOM   2051  H  HE3  . LYS A 1 130 ? 10.177  4.475  39.475 1.00 0.00 ? 130 LYS A HE3  1  
ATOM   2052  H  HZ1  . LYS A 1 130 ? 9.741   1.793  39.014 1.00 0.00 ? 130 LYS A HZ1  1  
ATOM   2053  H  HZ2  . LYS A 1 130 ? 11.328  1.897  39.611 1.00 0.00 ? 130 LYS A HZ2  1  
ATOM   2054  H  HZ3  . LYS A 1 130 ? 10.039  2.545  40.508 1.00 0.00 ? 130 LYS A HZ3  1  
ATOM   2055  N  N    . MET A 1 131 ? 8.169   5.864  32.896 1.00 0.00 ? 131 MET A N    1  
ATOM   2056  C  CA   . MET A 1 131 ? 7.205   5.879  31.768 1.00 0.00 ? 131 MET A CA   1  
ATOM   2057  C  C    . MET A 1 131 ? 7.818   5.179  30.552 1.00 0.00 ? 131 MET A C    1  
ATOM   2058  O  O    . MET A 1 131 ? 7.125   4.539  29.790 1.00 0.00 ? 131 MET A O    1  
ATOM   2059  C  CB   . MET A 1 131 ? 6.903   7.350  31.414 1.00 0.00 ? 131 MET A CB   1  
ATOM   2060  C  CG   . MET A 1 131 ? 6.092   7.422  30.113 1.00 0.00 ? 131 MET A CG   1  
ATOM   2061  S  SD   . MET A 1 131 ? 4.411   6.756  30.139 1.00 0.00 ? 131 MET A SD   1  
ATOM   2062  C  CE   . MET A 1 131 ? 3.548   8.347  30.168 1.00 0.00 ? 131 MET A CE   1  
ATOM   2063  H  H    . MET A 1 131 ? 8.457   6.707  33.316 1.00 0.00 ? 131 MET A H    1  
ATOM   2064  H  HA   . MET A 1 131 ? 6.284   5.345  32.070 1.00 0.00 ? 131 MET A HA   1  
ATOM   2065  H  HB2  . MET A 1 131 ? 6.338   7.804  32.215 1.00 0.00 ? 131 MET A HB2  1  
ATOM   2066  H  HB3  . MET A 1 131 ? 7.829   7.890  31.290 1.00 0.00 ? 131 MET A HB3  1  
ATOM   2067  H  HG2  . MET A 1 131 ? 6.023   8.459  29.821 1.00 0.00 ? 131 MET A HG2  1  
ATOM   2068  H  HG3  . MET A 1 131 ? 6.638   6.904  29.341 1.00 0.00 ? 131 MET A HG3  1  
ATOM   2069  H  HE1  . MET A 1 131 ? 4.090   9.038  30.798 1.00 0.00 ? 131 MET A HE1  1  
ATOM   2070  H  HE2  . MET A 1 131 ? 3.490   8.745  29.166 1.00 0.00 ? 131 MET A HE2  1  
ATOM   2071  H  HE3  . MET A 1 131 ? 2.551   8.208  30.560 1.00 0.00 ? 131 MET A HE3  1  
ATOM   2072  N  N    . ILE A 1 132 ? 9.115   5.324  30.385 1.00 0.00 ? 132 ILE A N    1  
ATOM   2073  C  CA   . ILE A 1 132 ? 9.773   4.665  29.220 1.00 0.00 ? 132 ILE A CA   1  
ATOM   2074  C  C    . ILE A 1 132 ? 9.801   3.159  29.425 1.00 0.00 ? 132 ILE A C    1  
ATOM   2075  O  O    . ILE A 1 132 ? 9.997   2.688  30.528 1.00 0.00 ? 132 ILE A O    1  
ATOM   2076  C  CB   . ILE A 1 132 ? 11.228  5.154  29.109 1.00 0.00 ? 132 ILE A CB   1  
ATOM   2077  C  CG1  . ILE A 1 132 ? 11.270  6.650  28.839 1.00 0.00 ? 132 ILE A CG1  1  
ATOM   2078  C  CG2  . ILE A 1 132 ? 11.895  4.432  27.923 1.00 0.00 ? 132 ILE A CG2  1  
ATOM   2079  C  CD1  . ILE A 1 132 ? 12.709  7.049  28.474 1.00 0.00 ? 132 ILE A CD1  1  
ATOM   2080  H  H    . ILE A 1 132 ? 9.643   5.861  31.017 1.00 0.00 ? 132 ILE A H    1  
ATOM   2081  H  HA   . ILE A 1 132 ? 9.211   4.893  28.314 1.00 0.00 ? 132 ILE A HA   1  
ATOM   2082  H  HB   . ILE A 1 132 ? 11.755  4.940  30.037 1.00 0.00 ? 132 ILE A HB   1  
ATOM   2083  H  HG12 . ILE A 1 132 ? 10.607  6.890  28.019 1.00 0.00 ? 132 ILE A HG12 1  
ATOM   2084  H  HG13 . ILE A 1 132 ? 10.957  7.187  29.717 1.00 0.00 ? 132 ILE A HG13 1  
ATOM   2085  H  HG21 . ILE A 1 132 ? 11.796  3.364  28.042 1.00 0.00 ? 132 ILE A HG21 1  
ATOM   2086  H  HG22 . ILE A 1 132 ? 11.421  4.732  27.000 1.00 0.00 ? 132 ILE A HG22 1  
ATOM   2087  H  HG23 . ILE A 1 132 ? 12.943  4.686  27.884 1.00 0.00 ? 132 ILE A HG23 1  
ATOM   2088  H  HD11 . ILE A 1 132 ? 13.409  6.484  29.076 1.00 0.00 ? 132 ILE A HD11 1  
ATOM   2089  H  HD12 . ILE A 1 132 ? 12.893  6.842  27.430 1.00 0.00 ? 132 ILE A HD12 1  
ATOM   2090  H  HD13 . ILE A 1 132 ? 12.854  8.103  28.658 1.00 0.00 ? 132 ILE A HD13 1  
ATOM   2091  N  N    . SER A 1 133 ? 9.611   2.429  28.364 1.00 0.00 ? 133 SER A N    1  
ATOM   2092  C  CA   . SER A 1 133 ? 9.627   0.954  28.489 1.00 0.00 ? 133 SER A CA   1  
ATOM   2093  C  C    . SER A 1 133 ? 11.031  0.407  28.204 1.00 0.00 ? 133 SER A C    1  
ATOM   2094  O  O    . SER A 1 133 ? 11.754  0.952  27.394 1.00 0.00 ? 133 SER A O    1  
ATOM   2095  C  CB   . SER A 1 133 ? 8.655   0.374  27.455 1.00 0.00 ? 133 SER A CB   1  
ATOM   2096  O  OG   . SER A 1 133 ? 8.996   1.043  26.249 1.00 0.00 ? 133 SER A OG   1  
ATOM   2097  H  H    . SER A 1 133 ? 9.458   2.848  27.494 1.00 0.00 ? 133 SER A H    1  
ATOM   2098  H  HA   . SER A 1 133 ? 9.326   0.689  29.493 1.00 0.00 ? 133 SER A HA   1  
ATOM   2099  H  HB2  . SER A 1 133 ? 8.802   -0.689 27.346 1.00 0.00 ? 133 SER A HB2  1  
ATOM   2100  H  HB3  . SER A 1 133 ? 7.634   0.590  27.726 1.00 0.00 ? 133 SER A HB3  1  
ATOM   2101  H  HG   . SER A 1 133 ? 8.485   1.855  26.205 1.00 0.00 ? 133 SER A HG   1  
ATOM   2102  N  N    . PRO A 1 134 ? 11.391  -0.676 28.876 1.00 0.00 ? 134 PRO A N    1  
ATOM   2103  C  CA   . PRO A 1 134 ? 12.702  -1.284 28.685 1.00 0.00 ? 134 PRO A CA   1  
ATOM   2104  C  C    . PRO A 1 134 ? 12.957  -1.580 27.221 1.00 0.00 ? 134 PRO A C    1  
ATOM   2105  O  O    . PRO A 1 134 ? 14.021  -1.307 26.702 1.00 0.00 ? 134 PRO A O    1  
ATOM   2106  C  CB   . PRO A 1 134 ? 12.642  -2.610 29.468 1.00 0.00 ? 134 PRO A CB   1  
ATOM   2107  C  CG   . PRO A 1 134 ? 11.278  -2.639 30.226 1.00 0.00 ? 134 PRO A CG   1  
ATOM   2108  C  CD   . PRO A 1 134 ? 10.515  -1.360 29.836 1.00 0.00 ? 134 PRO A CD   1  
ATOM   2109  H  HA   . PRO A 1 134 ? 13.475  -0.630 29.075 1.00 0.00 ? 134 PRO A HA   1  
ATOM   2110  H  HB2  . PRO A 1 134 ? 12.700  -3.445 28.782 1.00 0.00 ? 134 PRO A HB2  1  
ATOM   2111  H  HB3  . PRO A 1 134 ? 13.459  -2.662 30.170 1.00 0.00 ? 134 PRO A HB3  1  
ATOM   2112  H  HG2  . PRO A 1 134 ? 10.712  -3.511 29.936 1.00 0.00 ? 134 PRO A HG2  1  
ATOM   2113  H  HG3  . PRO A 1 134 ? 11.449  -2.656 31.292 1.00 0.00 ? 134 PRO A HG3  1  
ATOM   2114  H  HD2  . PRO A 1 134 ? 9.571   -1.604 29.371 1.00 0.00 ? 134 PRO A HD2  1  
ATOM   2115  H  HD3  . PRO A 1 134 ? 10.359  -0.740 30.706 1.00 0.00 ? 134 PRO A HD3  1  
ATOM   2116  N  N    . GLU A 1 135 ? 11.974  -2.136 26.581 1.00 0.00 ? 135 GLU A N    1  
ATOM   2117  C  CA   . GLU A 1 135 ? 12.133  -2.458 25.155 1.00 0.00 ? 135 GLU A CA   1  
ATOM   2118  C  C    . GLU A 1 135 ? 12.527  -1.215 24.364 1.00 0.00 ? 135 GLU A C    1  
ATOM   2119  O  O    . GLU A 1 135 ? 13.224  -1.301 23.372 1.00 0.00 ? 135 GLU A O    1  
ATOM   2120  C  CB   . GLU A 1 135 ? 10.788  -2.980 24.631 1.00 0.00 ? 135 GLU A CB   1  
ATOM   2121  C  CG   . GLU A 1 135 ? 10.985  -3.588 23.244 1.00 0.00 ? 135 GLU A CG   1  
ATOM   2122  C  CD   . GLU A 1 135 ? 9.621   -3.958 22.658 1.00 0.00 ? 135 GLU A CD   1  
ATOM   2123  O  OE1  . GLU A 1 135 ? 8.644   -3.564 23.271 1.00 0.00 ? 135 GLU A OE1  1  
ATOM   2124  O  OE2  . GLU A 1 135 ? 9.634   -4.615 21.629 1.00 0.00 ? 135 GLU A OE2  1  
ATOM   2125  H  H    . GLU A 1 135 ? 11.134  -2.336 27.043 1.00 0.00 ? 135 GLU A H    1  
ATOM   2126  H  HA   . GLU A 1 135 ? 12.911  -3.212 25.052 1.00 0.00 ? 135 GLU A HA   1  
ATOM   2127  H  HB2  . GLU A 1 135 ? 10.405  -3.733 25.304 1.00 0.00 ? 135 GLU A HB2  1  
ATOM   2128  H  HB3  . GLU A 1 135 ? 10.081  -2.165 24.572 1.00 0.00 ? 135 GLU A HB3  1  
ATOM   2129  H  HG2  . GLU A 1 135 ? 11.471  -2.872 22.596 1.00 0.00 ? 135 GLU A HG2  1  
ATOM   2130  H  HG3  . GLU A 1 135 ? 11.596  -4.476 23.317 1.00 0.00 ? 135 GLU A HG3  1  
ATOM   2131  N  N    . ASP A 1 136 ? 12.070  -0.079 24.823 1.00 0.00 ? 136 ASP A N    1  
ATOM   2132  C  CA   . ASP A 1 136 ? 12.400  1.186  24.121 1.00 0.00 ? 136 ASP A CA   1  
ATOM   2133  C  C    . ASP A 1 136 ? 13.591  1.878  24.779 1.00 0.00 ? 136 ASP A C    1  
ATOM   2134  O  O    . ASP A 1 136 ? 14.196  2.760  24.201 1.00 0.00 ? 136 ASP A O    1  
ATOM   2135  C  CB   . ASP A 1 136 ? 11.178  2.115  24.206 1.00 0.00 ? 136 ASP A CB   1  
ATOM   2136  C  CG   . ASP A 1 136 ? 10.019  1.500  23.417 1.00 0.00 ? 136 ASP A CG   1  
ATOM   2137  O  OD1  . ASP A 1 136 ? 10.227  0.410  22.909 1.00 0.00 ? 136 ASP A OD1  1  
ATOM   2138  O  OD2  . ASP A 1 136 ? 8.989   2.155  23.367 1.00 0.00 ? 136 ASP A OD2  1  
ATOM   2139  H  H    . ASP A 1 136 ? 11.512  -0.062 25.623 1.00 0.00 ? 136 ASP A H    1  
ATOM   2140  H  HA   . ASP A 1 136 ? 12.646  0.962  23.086 1.00 0.00 ? 136 ASP A HA   1  
ATOM   2141  H  HB2  . ASP A 1 136 ? 10.883  2.237  25.238 1.00 0.00 ? 136 ASP A HB2  1  
ATOM   2142  H  HB3  . ASP A 1 136 ? 11.422  3.081  23.788 1.00 0.00 ? 136 ASP A HB3  1  
ATOM   2143  N  N    . THR A 1 137 ? 13.907  1.465  25.978 1.00 0.00 ? 137 THR A N    1  
ATOM   2144  C  CA   . THR A 1 137 ? 15.053  2.088  26.686 1.00 0.00 ? 137 THR A CA   1  
ATOM   2145  C  C    . THR A 1 137 ? 16.370  1.728  26.012 1.00 0.00 ? 137 THR A C    1  
ATOM   2146  O  O    . THR A 1 137 ? 17.405  2.271  26.339 1.00 0.00 ? 137 THR A O    1  
ATOM   2147  C  CB   . THR A 1 137 ? 15.076  1.566  28.123 1.00 0.00 ? 137 THR A CB   1  
ATOM   2148  O  OG1  . THR A 1 137 ? 13.745  1.664  28.579 1.00 0.00 ? 137 THR A OG1  1  
ATOM   2149  C  CG2  . THR A 1 137 ? 15.864  2.511  29.037 1.00 0.00 ? 137 THR A CG2  1  
ATOM   2150  H  H    . THR A 1 137 ? 13.391  0.751  26.406 1.00 0.00 ? 137 THR A H    1  
ATOM   2151  H  HA   . THR A 1 137 ? 14.931  3.167  26.669 1.00 0.00 ? 137 THR A HA   1  
ATOM   2152  H  HB   . THR A 1 137 ? 15.428  0.546  28.173 1.00 0.00 ? 137 THR A HB   1  
ATOM   2153  H  HG1  . THR A 1 137 ? 13.405  2.522  28.319 1.00 0.00 ? 137 THR A HG1  1  
ATOM   2154  H  HG21 . THR A 1 137 ? 16.860  2.652  28.644 1.00 0.00 ? 137 THR A HG21 1  
ATOM   2155  H  HG22 . THR A 1 137 ? 15.363  3.465  29.092 1.00 0.00 ? 137 THR A HG22 1  
ATOM   2156  H  HG23 . THR A 1 137 ? 15.929  2.087  30.027 1.00 0.00 ? 137 THR A HG23 1  
ATOM   2157  N  N    . LYS A 1 138 ? 16.312  0.810  25.087 1.00 0.00 ? 138 LYS A N    1  
ATOM   2158  C  CA   . LYS A 1 138 ? 17.553  0.409  24.385 1.00 0.00 ? 138 LYS A CA   1  
ATOM   2159  C  C    . LYS A 1 138 ? 17.790  1.297  23.171 1.00 0.00 ? 138 LYS A C    1  
ATOM   2160  O  O    . LYS A 1 138 ? 18.843  1.261  22.564 1.00 0.00 ? 138 LYS A O    1  
ATOM   2161  C  CB   . LYS A 1 138 ? 17.396  -1.048 23.906 1.00 0.00 ? 138 LYS A CB   1  
ATOM   2162  C  CG   . LYS A 1 138 ? 17.669  -2.008 25.073 1.00 0.00 ? 138 LYS A CG   1  
ATOM   2163  C  CD   . LYS A 1 138 ? 18.646  -3.094 24.612 1.00 0.00 ? 138 LYS A CD   1  
ATOM   2164  C  CE   . LYS A 1 138 ? 20.076  -2.557 24.702 1.00 0.00 ? 138 LYS A CE   1  
ATOM   2165  N  NZ   . LYS A 1 138 ? 20.335  -1.989 26.054 1.00 0.00 ? 138 LYS A NZ   1  
ATOM   2166  H  H    . LYS A 1 138 ? 15.459  0.390  24.862 1.00 0.00 ? 138 LYS A H    1  
ATOM   2167  H  HA   . LYS A 1 138 ? 18.394  0.508  25.065 1.00 0.00 ? 138 LYS A HA   1  
ATOM   2168  H  HB2  . LYS A 1 138 ? 16.392  -1.201 23.540 1.00 0.00 ? 138 LYS A HB2  1  
ATOM   2169  H  HB3  . LYS A 1 138 ? 18.096  -1.243 23.107 1.00 0.00 ? 138 LYS A HB3  1  
ATOM   2170  H  HG2  . LYS A 1 138 ? 18.096  -1.466 25.903 1.00 0.00 ? 138 LYS A HG2  1  
ATOM   2171  H  HG3  . LYS A 1 138 ? 16.743  -2.466 25.389 1.00 0.00 ? 138 LYS A HG3  1  
ATOM   2172  H  HD2  . LYS A 1 138 ? 18.545  -3.964 25.244 1.00 0.00 ? 138 LYS A HD2  1  
ATOM   2173  H  HD3  . LYS A 1 138 ? 18.425  -3.370 23.591 1.00 0.00 ? 138 LYS A HD3  1  
ATOM   2174  H  HE2  . LYS A 1 138 ? 20.776  -3.357 24.516 1.00 0.00 ? 138 LYS A HE2  1  
ATOM   2175  H  HE3  . LYS A 1 138 ? 20.220  -1.784 23.961 1.00 0.00 ? 138 LYS A HE3  1  
ATOM   2176  H  HZ1  . LYS A 1 138 ? 19.820  -2.543 26.768 1.00 0.00 ? 138 LYS A HZ1  1  
ATOM   2177  H  HZ2  . LYS A 1 138 ? 21.355  -2.025 26.256 1.00 0.00 ? 138 LYS A HZ2  1  
ATOM   2178  H  HZ3  . LYS A 1 138 ? 20.012  -1.001 26.083 1.00 0.00 ? 138 LYS A HZ3  1  
ATOM   2179  N  N    . HIS A 1 139 ? 16.803  2.083  22.840 1.00 0.00 ? 139 HIS A N    1  
ATOM   2180  C  CA   . HIS A 1 139 ? 16.949  2.981  21.671 1.00 0.00 ? 139 HIS A CA   1  
ATOM   2181  C  C    . HIS A 1 139 ? 17.739  4.228  22.042 1.00 0.00 ? 139 HIS A C    1  
ATOM   2182  O  O    . HIS A 1 139 ? 18.618  4.645  21.316 1.00 0.00 ? 139 HIS A O    1  
ATOM   2183  C  CB   . HIS A 1 139 ? 15.547  3.394  21.207 1.00 0.00 ? 139 HIS A CB   1  
ATOM   2184  C  CG   . HIS A 1 139 ? 14.892  2.212  20.493 1.00 0.00 ? 139 HIS A CG   1  
ATOM   2185  N  ND1  . HIS A 1 139 ? 14.603  2.184  19.280 1.00 0.00 ? 139 HIS A ND1  1  
ATOM   2186  C  CD2  . HIS A 1 139 ? 14.511  0.982  20.993 1.00 0.00 ? 139 HIS A CD2  1  
ATOM   2187  C  CE1  . HIS A 1 139 ? 14.080  1.076  18.954 1.00 0.00 ? 139 HIS A CE1  1  
ATOM   2188  N  NE2  . HIS A 1 139 ? 13.978  0.238  19.985 1.00 0.00 ? 139 HIS A NE2  1  
ATOM   2189  H  H    . HIS A 1 139 ? 15.973  2.079  23.360 1.00 0.00 ? 139 HIS A H    1  
ATOM   2190  H  HA   . HIS A 1 139 ? 17.476  2.451  20.884 1.00 0.00 ? 139 HIS A HA   1  
ATOM   2191  H  HB2  . HIS A 1 139 ? 14.945  3.676  22.059 1.00 0.00 ? 139 HIS A HB2  1  
ATOM   2192  H  HB3  . HIS A 1 139 ? 15.618  4.229  20.525 1.00 0.00 ? 139 HIS A HB3  1  
ATOM   2193  H  HD1  . HIS A 1 139 ? 14.760  2.923  18.659 1.00 0.00 ? 139 HIS A HD1  1  
ATOM   2194  H  HD2  . HIS A 1 139 ? 14.620  0.660  22.019 1.00 0.00 ? 139 HIS A HD2  1  
ATOM   2195  H  HE1  . HIS A 1 139 ? 13.758  0.836  17.951 1.00 0.00 ? 139 HIS A HE1  1  
ATOM   2196  N  N    . LEU A 1 140 ? 17.413  4.803  23.164 1.00 0.00 ? 140 LEU A N    1  
ATOM   2197  C  CA   . LEU A 1 140 ? 18.140  6.021  23.591 1.00 0.00 ? 140 LEU A CA   1  
ATOM   2198  C  C    . LEU A 1 140 ? 19.640  5.714  23.750 1.00 0.00 ? 140 LEU A C    1  
ATOM   2199  O  O    . LEU A 1 140 ? 20.016  4.602  24.061 1.00 0.00 ? 140 LEU A O    1  
ATOM   2200  C  CB   . LEU A 1 140 ? 17.554  6.481  24.937 1.00 0.00 ? 140 LEU A CB   1  
ATOM   2201  C  CG   . LEU A 1 140 ? 17.643  5.337  25.934 1.00 0.00 ? 140 LEU A CG   1  
ATOM   2202  C  CD1  . LEU A 1 140 ? 18.852  5.558  26.817 1.00 0.00 ? 140 LEU A CD1  1  
ATOM   2203  C  CD2  . LEU A 1 140 ? 16.390  5.314  26.807 1.00 0.00 ? 140 LEU A CD2  1  
ATOM   2204  H  H    . LEU A 1 140 ? 16.696  4.433  23.720 1.00 0.00 ? 140 LEU A H    1  
ATOM   2205  H  HA   . LEU A 1 140 ? 18.010  6.778  22.842 1.00 0.00 ? 140 LEU A HA   1  
ATOM   2206  H  HB2  . LEU A 1 140 ? 18.110  7.329  25.307 1.00 0.00 ? 140 LEU A HB2  1  
ATOM   2207  H  HB3  . LEU A 1 140 ? 16.522  6.766  24.803 1.00 0.00 ? 140 LEU A HB3  1  
ATOM   2208  H  HG   . LEU A 1 140 ? 17.739  4.401  25.408 1.00 0.00 ? 140 LEU A HG   1  
ATOM   2209  H  HD11 . LEU A 1 140 ? 18.810  6.550  27.242 1.00 0.00 ? 140 LEU A HD11 1  
ATOM   2210  H  HD12 . LEU A 1 140 ? 18.858  4.830  27.608 1.00 0.00 ? 140 LEU A HD12 1  
ATOM   2211  H  HD13 . LEU A 1 140 ? 19.749  5.461  26.232 1.00 0.00 ? 140 LEU A HD13 1  
ATOM   2212  H  HD21 . LEU A 1 140 ? 15.513  5.202  26.189 1.00 0.00 ? 140 LEU A HD21 1  
ATOM   2213  H  HD22 . LEU A 1 140 ? 16.448  4.488  27.497 1.00 0.00 ? 140 LEU A HD22 1  
ATOM   2214  H  HD23 . LEU A 1 140 ? 16.317  6.235  27.365 1.00 0.00 ? 140 LEU A HD23 1  
ATOM   2215  N  N    . PRO A 1 141 ? 20.474  6.717  23.520 1.00 0.00 ? 141 PRO A N    1  
ATOM   2216  C  CA   . PRO A 1 141 ? 21.923  6.552  23.637 1.00 0.00 ? 141 PRO A CA   1  
ATOM   2217  C  C    . PRO A 1 141 ? 22.327  5.995  24.998 1.00 0.00 ? 141 PRO A C    1  
ATOM   2218  O  O    . PRO A 1 141 ? 21.879  6.464  26.024 1.00 0.00 ? 141 PRO A O    1  
ATOM   2219  C  CB   . PRO A 1 141 ? 22.500  7.973  23.464 1.00 0.00 ? 141 PRO A CB   1  
ATOM   2220  C  CG   . PRO A 1 141 ? 21.304  8.925  23.152 1.00 0.00 ? 141 PRO A CG   1  
ATOM   2221  C  CD   . PRO A 1 141 ? 20.026  8.068  23.149 1.00 0.00 ? 141 PRO A CD   1  
ATOM   2222  H  HA   . PRO A 1 141 ? 22.278  5.892  22.850 1.00 0.00 ? 141 PRO A HA   1  
ATOM   2223  H  HB2  . PRO A 1 141 ? 22.994  8.285  24.374 1.00 0.00 ? 141 PRO A HB2  1  
ATOM   2224  H  HB3  . PRO A 1 141 ? 23.207  7.987  22.645 1.00 0.00 ? 141 PRO A HB3  1  
ATOM   2225  H  HG2  . PRO A 1 141 ? 21.234  9.690  23.912 1.00 0.00 ? 141 PRO A HG2  1  
ATOM   2226  H  HG3  . PRO A 1 141 ? 21.442  9.388  22.186 1.00 0.00 ? 141 PRO A HG3  1  
ATOM   2227  H  HD2  . PRO A 1 141 ? 19.318  8.439  23.871 1.00 0.00 ? 141 PRO A HD2  1  
ATOM   2228  H  HD3  . PRO A 1 141 ? 19.588  8.057  22.162 1.00 0.00 ? 141 PRO A HD3  1  
ATOM   2229  N  N    . GLU A 1 142 ? 23.174  4.998  24.975 1.00 0.00 ? 142 GLU A N    1  
ATOM   2230  C  CA   . GLU A 1 142 ? 23.626  4.392  26.249 1.00 0.00 ? 142 GLU A CA   1  
ATOM   2231  C  C    . GLU A 1 142 ? 24.317  5.427  27.126 1.00 0.00 ? 142 GLU A C    1  
ATOM   2232  O  O    . GLU A 1 142 ? 24.414  5.263  28.326 1.00 0.00 ? 142 GLU A O    1  
ATOM   2233  C  CB   . GLU A 1 142 ? 24.630  3.274  25.924 1.00 0.00 ? 142 GLU A CB   1  
ATOM   2234  C  CG   . GLU A 1 142 ? 23.908  2.139  25.191 1.00 0.00 ? 142 GLU A CG   1  
ATOM   2235  C  CD   . GLU A 1 142 ? 23.649  2.554  23.742 1.00 0.00 ? 142 GLU A CD   1  
ATOM   2236  O  OE1  . GLU A 1 142 ? 24.633  2.681  23.030 1.00 0.00 ? 142 GLU A OE1  1  
ATOM   2237  O  OE2  . GLU A 1 142 ? 22.482  2.719  23.426 1.00 0.00 ? 142 GLU A OE2  1  
ATOM   2238  H  H    . GLU A 1 142 ? 23.507  4.654  24.120 1.00 0.00 ? 142 GLU A H    1  
ATOM   2239  H  HA   . GLU A 1 142 ? 22.761  3.993  26.780 1.00 0.00 ? 142 GLU A HA   1  
ATOM   2240  H  HB2  . GLU A 1 142 ? 25.417  3.667  25.299 1.00 0.00 ? 142 GLU A HB2  1  
ATOM   2241  H  HB3  . GLU A 1 142 ? 25.061  2.898  26.840 1.00 0.00 ? 142 GLU A HB3  1  
ATOM   2242  H  HG2  . GLU A 1 142 ? 24.521  1.249  25.203 1.00 0.00 ? 142 GLU A HG2  1  
ATOM   2243  H  HG3  . GLU A 1 142 ? 22.967  1.929  25.678 1.00 0.00 ? 142 GLU A HG3  1  
ATOM   2244  N  N    . ASP A 1 143 ? 24.787  6.480  26.511 1.00 0.00 ? 143 ASP A N    1  
ATOM   2245  C  CA   . ASP A 1 143 ? 25.474  7.535  27.297 1.00 0.00 ? 143 ASP A CA   1  
ATOM   2246  C  C    . ASP A 1 143 ? 24.546  8.106  28.361 1.00 0.00 ? 143 ASP A C    1  
ATOM   2247  O  O    . ASP A 1 143 ? 24.883  9.056  29.041 1.00 0.00 ? 143 ASP A O    1  
ATOM   2248  C  CB   . ASP A 1 143 ? 25.889  8.664  26.343 1.00 0.00 ? 143 ASP A CB   1  
ATOM   2249  C  CG   . ASP A 1 143 ? 27.255  9.209  26.766 1.00 0.00 ? 143 ASP A CG   1  
ATOM   2250  O  OD1  . ASP A 1 143 ? 28.208  8.463  26.608 1.00 0.00 ? 143 ASP A OD1  1  
ATOM   2251  O  OD2  . ASP A 1 143 ? 27.269  10.338 27.224 1.00 0.00 ? 143 ASP A OD2  1  
ATOM   2252  H  H    . ASP A 1 143 ? 24.687  6.572  25.540 1.00 0.00 ? 143 ASP A H    1  
ATOM   2253  H  HA   . ASP A 1 143 ? 26.347  7.101  27.785 1.00 0.00 ? 143 ASP A HA   1  
ATOM   2254  H  HB2  . ASP A 1 143 ? 25.952  8.286  25.333 1.00 0.00 ? 143 ASP A HB2  1  
ATOM   2255  H  HB3  . ASP A 1 143 ? 25.160  9.460  26.381 1.00 0.00 ? 143 ASP A HB3  1  
ATOM   2256  N  N    . GLU A 1 144 ? 23.389  7.517  28.482 1.00 0.00 ? 144 GLU A N    1  
ATOM   2257  C  CA   . GLU A 1 144 ? 22.420  8.001  29.489 1.00 0.00 ? 144 GLU A CA   1  
ATOM   2258  C  C    . GLU A 1 144 ? 21.376  6.930  29.773 1.00 0.00 ? 144 GLU A C    1  
ATOM   2259  O  O    . GLU A 1 144 ? 20.188  7.177  29.697 1.00 0.00 ? 144 GLU A O    1  
ATOM   2260  C  CB   . GLU A 1 144 ? 21.717  9.248  28.933 1.00 0.00 ? 144 GLU A CB   1  
ATOM   2261  C  CG   . GLU A 1 144 ? 21.374  9.015  27.461 1.00 0.00 ? 144 GLU A CG   1  
ATOM   2262  C  CD   . GLU A 1 144 ? 20.629  10.233 26.917 1.00 0.00 ? 144 GLU A CD   1  
ATOM   2263  O  OE1  . GLU A 1 144 ? 19.544  10.474 27.420 1.00 0.00 ? 144 GLU A OE1  1  
ATOM   2264  O  OE2  . GLU A 1 144 ? 21.186  10.855 26.028 1.00 0.00 ? 144 GLU A OE2  1  
ATOM   2265  H  H    . GLU A 1 144 ? 23.162  6.759  27.908 1.00 0.00 ? 144 GLU A H    1  
ATOM   2266  H  HA   . GLU A 1 144 ? 22.950  8.234  30.409 1.00 0.00 ? 144 GLU A HA   1  
ATOM   2267  H  HB2  . GLU A 1 144 ? 20.813  9.437  29.491 1.00 0.00 ? 144 GLU A HB2  1  
ATOM   2268  H  HB3  . GLU A 1 144 ? 22.372  10.102 29.022 1.00 0.00 ? 144 GLU A HB3  1  
ATOM   2269  H  HG2  . GLU A 1 144 ? 22.282  8.868  26.893 1.00 0.00 ? 144 GLU A HG2  1  
ATOM   2270  H  HG3  . GLU A 1 144 ? 20.748  8.141  27.366 1.00 0.00 ? 144 GLU A HG3  1  
ATOM   2271  N  N    . ASN A 1 145 ? 21.840  5.753  30.093 1.00 0.00 ? 145 ASN A N    1  
ATOM   2272  C  CA   . ASN A 1 145 ? 20.895  4.653  30.383 1.00 0.00 ? 145 ASN A CA   1  
ATOM   2273  C  C    . ASN A 1 145 ? 20.350  4.752  31.801 1.00 0.00 ? 145 ASN A C    1  
ATOM   2274  O  O    . ASN A 1 145 ? 19.552  3.932  32.212 1.00 0.00 ? 145 ASN A O    1  
ATOM   2275  C  CB   . ASN A 1 145 ? 21.643  3.320  30.237 1.00 0.00 ? 145 ASN A CB   1  
ATOM   2276  C  CG   . ASN A 1 145 ? 20.632  2.194  30.010 1.00 0.00 ? 145 ASN A CG   1  
ATOM   2277  O  OD1  . ASN A 1 145 ? 19.450  2.428  29.856 1.00 0.00 ? 145 ASN A OD1  1  
ATOM   2278  N  ND2  . ASN A 1 145 ? 21.055  0.959  29.983 1.00 0.00 ? 145 ASN A ND2  1  
ATOM   2279  H  H    . ASN A 1 145 ? 22.808  5.601  30.139 1.00 0.00 ? 145 ASN A H    1  
ATOM   2280  H  HA   . ASN A 1 145 ? 20.063  4.706  29.680 1.00 0.00 ? 145 ASN A HA   1  
ATOM   2281  H  HB2  . ASN A 1 145 ? 22.318  3.370  29.395 1.00 0.00 ? 145 ASN A HB2  1  
ATOM   2282  H  HB3  . ASN A 1 145 ? 22.208  3.116  31.135 1.00 0.00 ? 145 ASN A HB3  1  
ATOM   2283  H  HD21 . ASN A 1 145 ? 22.007  0.764  30.107 1.00 0.00 ? 145 ASN A HD21 1  
ATOM   2284  H  HD22 . ASN A 1 145 ? 20.420  0.227  29.838 1.00 0.00 ? 145 ASN A HD22 1  
ATOM   2285  N  N    . THR A 1 146 ? 20.794  5.750  32.531 1.00 0.00 ? 146 THR A N    1  
ATOM   2286  C  CA   . THR A 1 146 ? 20.303  5.908  33.926 1.00 0.00 ? 146 THR A CA   1  
ATOM   2287  C  C    . THR A 1 146 ? 20.046  7.385  34.247 1.00 0.00 ? 146 THR A C    1  
ATOM   2288  O  O    . THR A 1 146 ? 20.643  8.266  33.662 1.00 0.00 ? 146 THR A O    1  
ATOM   2289  C  CB   . THR A 1 146 ? 21.379  5.372  34.877 1.00 0.00 ? 146 THR A CB   1  
ATOM   2290  O  OG1  . THR A 1 146 ? 22.611  5.670  34.253 1.00 0.00 ? 146 THR A OG1  1  
ATOM   2291  C  CG2  . THR A 1 146 ? 21.339  3.837  34.937 1.00 0.00 ? 146 THR A CG2  1  
ATOM   2292  H  H    . THR A 1 146 ? 21.451  6.386  32.161 1.00 0.00 ? 146 THR A H    1  
ATOM   2293  H  HA   . THR A 1 146 ? 19.381  5.352  34.034 1.00 0.00 ? 146 THR A HA   1  
ATOM   2294  H  HB   . THR A 1 146 ? 21.321  5.835  35.860 1.00 0.00 ? 146 THR A HB   1  
ATOM   2295  H  HG1  . THR A 1 146 ? 23.064  6.325  34.790 1.00 0.00 ? 146 THR A HG1  1  
ATOM   2296  H  HG21 . THR A 1 146 ? 20.340  3.507  35.177 1.00 0.00 ? 146 THR A HG21 1  
ATOM   2297  H  HG22 . THR A 1 146 ? 21.629  3.428  33.979 1.00 0.00 ? 146 THR A HG22 1  
ATOM   2298  H  HG23 . THR A 1 146 ? 22.022  3.484  35.694 1.00 0.00 ? 146 THR A HG23 1  
ATOM   2299  N  N    . PRO A 1 147 ? 19.148  7.623  35.188 1.00 0.00 ? 147 PRO A N    1  
ATOM   2300  C  CA   . PRO A 1 147 ? 18.804  8.983  35.596 1.00 0.00 ? 147 PRO A CA   1  
ATOM   2301  C  C    . PRO A 1 147 ? 20.041  9.768  36.014 1.00 0.00 ? 147 PRO A C    1  
ATOM   2302  O  O    . PRO A 1 147 ? 20.126  10.961 35.795 1.00 0.00 ? 147 PRO A O    1  
ATOM   2303  C  CB   . PRO A 1 147 ? 17.867  8.807  36.811 1.00 0.00 ? 147 PRO A CB   1  
ATOM   2304  C  CG   . PRO A 1 147 ? 17.649  7.275  37.012 1.00 0.00 ? 147 PRO A CG   1  
ATOM   2305  C  CD   . PRO A 1 147 ? 18.441  6.555  35.907 1.00 0.00 ? 147 PRO A CD   1  
ATOM   2306  H  HA   . PRO A 1 147 ? 18.299  9.494  34.782 1.00 0.00 ? 147 PRO A HA   1  
ATOM   2307  H  HB2  . PRO A 1 147 ? 18.322  9.233  37.693 1.00 0.00 ? 147 PRO A HB2  1  
ATOM   2308  H  HB3  . PRO A 1 147 ? 16.921  9.293  36.622 1.00 0.00 ? 147 PRO A HB3  1  
ATOM   2309  H  HG2  . PRO A 1 147 ? 18.012  6.974  37.983 1.00 0.00 ? 147 PRO A HG2  1  
ATOM   2310  H  HG3  . PRO A 1 147 ? 16.599  7.036  36.928 1.00 0.00 ? 147 PRO A HG3  1  
ATOM   2311  H  HD2  . PRO A 1 147 ? 19.149  5.860  36.336 1.00 0.00 ? 147 PRO A HD2  1  
ATOM   2312  H  HD3  . PRO A 1 147 ? 17.765  6.039  35.241 1.00 0.00 ? 147 PRO A HD3  1  
ATOM   2313  N  N    . GLU A 1 148 ? 20.975  9.086  36.609 1.00 0.00 ? 148 GLU A N    1  
ATOM   2314  C  CA   . GLU A 1 148 ? 22.211  9.774  37.049 1.00 0.00 ? 148 GLU A CA   1  
ATOM   2315  C  C    . GLU A 1 148 ? 23.159  9.988  35.879 1.00 0.00 ? 148 GLU A C    1  
ATOM   2316  O  O    . GLU A 1 148 ? 23.984  10.881 35.901 1.00 0.00 ? 148 GLU A O    1  
ATOM   2317  C  CB   . GLU A 1 148 ? 22.910  8.887  38.090 1.00 0.00 ? 148 GLU A CB   1  
ATOM   2318  C  CG   . GLU A 1 148 ? 22.026  8.781  39.333 1.00 0.00 ? 148 GLU A CG   1  
ATOM   2319  C  CD   . GLU A 1 148 ? 22.494  9.798  40.374 1.00 0.00 ? 148 GLU A CD   1  
ATOM   2320  O  OE1  . GLU A 1 148 ? 23.071  10.785 39.946 1.00 0.00 ? 148 GLU A OE1  1  
ATOM   2321  O  OE2  . GLU A 1 148 ? 22.250  9.531  41.539 1.00 0.00 ? 148 GLU A OE2  1  
ATOM   2322  H  H    . GLU A 1 148 ? 20.863  8.125  36.764 1.00 0.00 ? 148 GLU A H    1  
ATOM   2323  H  HA   . GLU A 1 148 ? 21.946  10.740 37.477 1.00 0.00 ? 148 GLU A HA   1  
ATOM   2324  H  HB2  . GLU A 1 148 ? 23.075  7.903  37.676 1.00 0.00 ? 148 GLU A HB2  1  
ATOM   2325  H  HB3  . GLU A 1 148 ? 23.861  9.323  38.357 1.00 0.00 ? 148 GLU A HB3  1  
ATOM   2326  H  HG2  . GLU A 1 148 ? 20.999  8.985  39.070 1.00 0.00 ? 148 GLU A HG2  1  
ATOM   2327  H  HG3  . GLU A 1 148 ? 22.097  7.787  39.748 1.00 0.00 ? 148 GLU A HG3  1  
ATOM   2328  N  N    . LYS A 1 149 ? 23.027  9.167  34.876 1.00 0.00 ? 149 LYS A N    1  
ATOM   2329  C  CA   . LYS A 1 149 ? 23.916  9.312  33.700 1.00 0.00 ? 149 LYS A CA   1  
ATOM   2330  C  C    . LYS A 1 149 ? 23.318  10.267 32.667 1.00 0.00 ? 149 LYS A C    1  
ATOM   2331  O  O    . LYS A 1 149 ? 24.015  10.762 31.803 1.00 0.00 ? 149 LYS A O    1  
ATOM   2332  C  CB   . LYS A 1 149 ? 24.096  7.925  33.060 1.00 0.00 ? 149 LYS A CB   1  
ATOM   2333  C  CG   . LYS A 1 149 ? 25.321  7.948  32.137 1.00 0.00 ? 149 LYS A CG   1  
ATOM   2334  C  CD   . LYS A 1 149 ? 26.213  6.741  32.449 1.00 0.00 ? 149 LYS A CD   1  
ATOM   2335  C  CE   . LYS A 1 149 ? 25.561  5.474  31.887 1.00 0.00 ? 149 LYS A CE   1  
ATOM   2336  N  NZ   . LYS A 1 149 ? 24.076  5.562  31.979 1.00 0.00 ? 149 LYS A NZ   1  
ATOM   2337  H  H    . LYS A 1 149 ? 22.348  8.462  34.899 1.00 0.00 ? 149 LYS A H    1  
ATOM   2338  H  HA   . LYS A 1 149 ? 24.870  9.706  34.032 1.00 0.00 ? 149 LYS A HA   1  
ATOM   2339  H  HB2  . LYS A 1 149 ? 24.239  7.187  33.834 1.00 0.00 ? 149 LYS A HB2  1  
ATOM   2340  H  HB3  . LYS A 1 149 ? 23.216  7.672  32.492 1.00 0.00 ? 149 LYS A HB3  1  
ATOM   2341  H  HG2  . LYS A 1 149 ? 25.001  7.903  31.107 1.00 0.00 ? 149 LYS A HG2  1  
ATOM   2342  H  HG3  . LYS A 1 149 ? 25.880  8.859  32.293 1.00 0.00 ? 149 LYS A HG3  1  
ATOM   2343  H  HD2  . LYS A 1 149 ? 27.182  6.881  31.994 1.00 0.00 ? 149 LYS A HD2  1  
ATOM   2344  H  HD3  . LYS A 1 149 ? 26.334  6.644  33.517 1.00 0.00 ? 149 LYS A HD3  1  
ATOM   2345  H  HE2  . LYS A 1 149 ? 25.843  5.353  30.853 1.00 0.00 ? 149 LYS A HE2  1  
ATOM   2346  H  HE3  . LYS A 1 149 ? 25.898  4.614  32.447 1.00 0.00 ? 149 LYS A HE3  1  
ATOM   2347  H  HZ1  . LYS A 1 149 ? 23.799  5.720  32.970 1.00 0.00 ? 149 LYS A HZ1  1  
ATOM   2348  H  HZ2  . LYS A 1 149 ? 23.739  6.353  31.396 1.00 0.00 ? 149 LYS A HZ2  1  
ATOM   2349  H  HZ3  . LYS A 1 149 ? 23.655  4.675  31.638 1.00 0.00 ? 149 LYS A HZ3  1  
ATOM   2350  N  N    . ARG A 1 150 ? 22.040  10.509 32.771 1.00 0.00 ? 150 ARG A N    1  
ATOM   2351  C  CA   . ARG A 1 150 ? 21.394  11.428 31.801 1.00 0.00 ? 150 ARG A CA   1  
ATOM   2352  C  C    . ARG A 1 150 ? 21.416  12.860 32.296 1.00 0.00 ? 150 ARG A C    1  
ATOM   2353  O  O    . ARG A 1 150 ? 21.485  13.781 31.514 1.00 0.00 ? 150 ARG A O    1  
ATOM   2354  C  CB   . ARG A 1 150 ? 19.943  11.009 31.629 1.00 0.00 ? 150 ARG A CB   1  
ATOM   2355  C  CG   . ARG A 1 150 ? 19.381  11.639 30.355 1.00 0.00 ? 150 ARG A CG   1  
ATOM   2356  C  CD   . ARG A 1 150 ? 18.058  10.956 30.005 1.00 0.00 ? 150 ARG A CD   1  
ATOM   2357  N  NE   . ARG A 1 150 ? 17.100  11.979 29.498 1.00 0.00 ? 150 ARG A NE   1  
ATOM   2358  C  CZ   . ARG A 1 150 ? 16.463  11.762 28.380 1.00 0.00 ? 150 ARG A CZ   1  
ATOM   2359  N  NH1  . ARG A 1 150 ? 15.324  11.126 28.416 1.00 0.00 ? 150 ARG A NH1  1  
ATOM   2360  N  NH2  . ARG A 1 150 ? 16.987  12.183 27.261 1.00 0.00 ? 150 ARG A NH2  1  
ATOM   2361  H  H    . ARG A 1 150 ? 21.514  10.092 33.481 1.00 0.00 ? 150 ARG A H    1  
ATOM   2362  H  HA   . ARG A 1 150 ? 21.926  11.372 30.855 1.00 0.00 ? 150 ARG A HA   1  
ATOM   2363  H  HB2  . ARG A 1 150 ? 19.886  9.940  31.560 1.00 0.00 ? 150 ARG A HB2  1  
ATOM   2364  H  HB3  . ARG A 1 150 ? 19.374  11.344 32.479 1.00 0.00 ? 150 ARG A HB3  1  
ATOM   2365  H  HG2  . ARG A 1 150 ? 19.213  12.694 30.514 1.00 0.00 ? 150 ARG A HG2  1  
ATOM   2366  H  HG3  . ARG A 1 150 ? 20.082  11.510 29.544 1.00 0.00 ? 150 ARG A HG3  1  
ATOM   2367  H  HD2  . ARG A 1 150 ? 18.220  10.210 29.241 1.00 0.00 ? 150 ARG A HD2  1  
ATOM   2368  H  HD3  . ARG A 1 150 ? 17.645  10.484 30.884 1.00 0.00 ? 150 ARG A HD3  1  
ATOM   2369  H  HE   . ARG A 1 150 ? 16.948  12.806 30.003 1.00 0.00 ? 150 ARG A HE   1  
ATOM   2370  H  HH11 . ARG A 1 150 ? 14.952  10.814 29.291 1.00 0.00 ? 150 ARG A HH11 1  
ATOM   2371  H  HH12 . ARG A 1 150 ? 14.823  10.952 27.568 1.00 0.00 ? 150 ARG A HH12 1  
ATOM   2372  H  HH21 . ARG A 1 150 ? 17.864  12.663 27.271 1.00 0.00 ? 150 ARG A HH21 1  
ATOM   2373  H  HH22 . ARG A 1 150 ? 16.512  12.025 26.396 1.00 0.00 ? 150 ARG A HH22 1  
ATOM   2374  N  N    . ALA A 1 151 ? 21.331  13.031 33.586 1.00 0.00 ? 151 ALA A N    1  
ATOM   2375  C  CA   . ALA A 1 151 ? 21.349  14.408 34.125 1.00 0.00 ? 151 ALA A CA   1  
ATOM   2376  C  C    . ALA A 1 151 ? 22.458  15.198 33.466 1.00 0.00 ? 151 ALA A C    1  
ATOM   2377  O  O    . ALA A 1 151 ? 22.411  16.411 33.396 1.00 0.00 ? 151 ALA A O    1  
ATOM   2378  C  CB   . ALA A 1 151 ? 21.611  14.341 35.635 1.00 0.00 ? 151 ALA A CB   1  
ATOM   2379  H  H    . ALA A 1 151 ? 21.257  12.260 34.188 1.00 0.00 ? 151 ALA A H    1  
ATOM   2380  H  HA   . ALA A 1 151 ? 20.392  14.888 33.914 1.00 0.00 ? 151 ALA A HA   1  
ATOM   2381  H  HB1  . ALA A 1 151 ? 22.456  13.700 35.830 1.00 0.00 ? 151 ALA A HB1  1  
ATOM   2382  H  HB2  . ALA A 1 151 ? 21.822  15.332 36.013 1.00 0.00 ? 151 ALA A HB2  1  
ATOM   2383  H  HB3  . ALA A 1 151 ? 20.742  13.948 36.138 1.00 0.00 ? 151 ALA A HB3  1  
ATOM   2384  N  N    . GLU A 1 152 ? 23.442  14.489 32.988 1.00 0.00 ? 152 GLU A N    1  
ATOM   2385  C  CA   . GLU A 1 152 ? 24.569  15.166 32.327 1.00 0.00 ? 152 GLU A CA   1  
ATOM   2386  C  C    . GLU A 1 152 ? 24.205  15.510 30.891 1.00 0.00 ? 152 GLU A C    1  
ATOM   2387  O  O    . GLU A 1 152 ? 24.719  16.458 30.329 1.00 0.00 ? 152 GLU A O    1  
ATOM   2388  C  CB   . GLU A 1 152 ? 25.776  14.215 32.324 1.00 0.00 ? 152 GLU A CB   1  
ATOM   2389  C  CG   . GLU A 1 152 ? 26.380  14.171 33.731 1.00 0.00 ? 152 GLU A CG   1  
ATOM   2390  C  CD   . GLU A 1 152 ? 25.426  13.429 34.668 1.00 0.00 ? 152 GLU A CD   1  
ATOM   2391  O  OE1  . GLU A 1 152 ? 24.743  12.553 34.163 1.00 0.00 ? 152 GLU A OE1  1  
ATOM   2392  O  OE2  . GLU A 1 152 ? 25.432  13.780 35.837 1.00 0.00 ? 152 GLU A OE2  1  
ATOM   2393  H  H    . GLU A 1 152 ? 23.432  13.514 33.069 1.00 0.00 ? 152 GLU A H    1  
ATOM   2394  H  HA   . GLU A 1 152 ? 24.797  16.084 32.866 1.00 0.00 ? 152 GLU A HA   1  
ATOM   2395  H  HB2  . GLU A 1 152 ? 25.458  13.225 32.035 1.00 0.00 ? 152 GLU A HB2  1  
ATOM   2396  H  HB3  . GLU A 1 152 ? 26.516  14.569 31.623 1.00 0.00 ? 152 GLU A HB3  1  
ATOM   2397  H  HG2  . GLU A 1 152 ? 27.328  13.655 33.706 1.00 0.00 ? 152 GLU A HG2  1  
ATOM   2398  H  HG3  . GLU A 1 152 ? 26.530  15.175 34.097 1.00 0.00 ? 152 GLU A HG3  1  
ATOM   2399  N  N    . LYS A 1 153 ? 23.315  14.734 30.314 1.00 0.00 ? 153 LYS A N    1  
ATOM   2400  C  CA   . LYS A 1 153 ? 22.916  15.017 28.917 1.00 0.00 ? 153 LYS A CA   1  
ATOM   2401  C  C    . LYS A 1 153 ? 22.006  16.236 28.870 1.00 0.00 ? 153 LYS A C    1  
ATOM   2402  O  O    . LYS A 1 153 ? 22.231  17.154 28.106 1.00 0.00 ? 153 LYS A O    1  
ATOM   2403  C  CB   . LYS A 1 153 ? 22.149  13.799 28.369 1.00 0.00 ? 153 LYS A CB   1  
ATOM   2404  C  CG   . LYS A 1 153 ? 23.143  12.679 27.985 1.00 0.00 ? 153 LYS A CG   1  
ATOM   2405  C  CD   . LYS A 1 153 ? 24.079  13.136 26.840 1.00 0.00 ? 153 LYS A CD   1  
ATOM   2406  C  CE   . LYS A 1 153 ? 23.292  13.951 25.807 1.00 0.00 ? 153 LYS A CE   1  
ATOM   2407  N  NZ   . LYS A 1 153 ? 24.077  14.088 24.546 1.00 0.00 ? 153 LYS A NZ   1  
ATOM   2408  H  H    . LYS A 1 153 ? 22.906  13.972 30.810 1.00 0.00 ? 153 LYS A H    1  
ATOM   2409  H  HA   . LYS A 1 153 ? 23.803  15.220 28.329 1.00 0.00 ? 153 LYS A HA   1  
ATOM   2410  H  HB2  . LYS A 1 153 ? 21.477  13.431 29.132 1.00 0.00 ? 153 LYS A HB2  1  
ATOM   2411  H  HB3  . LYS A 1 153 ? 21.569  14.089 27.510 1.00 0.00 ? 153 LYS A HB3  1  
ATOM   2412  H  HG2  . LYS A 1 153 ? 23.736  12.415 28.848 1.00 0.00 ? 153 LYS A HG2  1  
ATOM   2413  H  HG3  . LYS A 1 153 ? 22.591  11.808 27.666 1.00 0.00 ? 153 LYS A HG3  1  
ATOM   2414  H  HD2  . LYS A 1 153 ? 24.881  13.734 27.242 1.00 0.00 ? 153 LYS A HD2  1  
ATOM   2415  H  HD3  . LYS A 1 153 ? 24.502  12.267 26.360 1.00 0.00 ? 153 LYS A HD3  1  
ATOM   2416  H  HE2  . LYS A 1 153 ? 22.359  13.453 25.586 1.00 0.00 ? 153 LYS A HE2  1  
ATOM   2417  H  HE3  . LYS A 1 153 ? 23.086  14.935 26.200 1.00 0.00 ? 153 LYS A HE3  1  
ATOM   2418  H  HZ1  . LYS A 1 153 ? 24.512  13.173 24.307 1.00 0.00 ? 153 LYS A HZ1  1  
ATOM   2419  H  HZ2  . LYS A 1 153 ? 23.445  14.382 23.774 1.00 0.00 ? 153 LYS A HZ2  1  
ATOM   2420  H  HZ3  . LYS A 1 153 ? 24.822  14.802 24.676 1.00 0.00 ? 153 LYS A HZ3  1  
ATOM   2421  N  N    . ILE A 1 154 ? 20.996  16.226 29.695 1.00 0.00 ? 154 ILE A N    1  
ATOM   2422  C  CA   . ILE A 1 154 ? 20.062  17.375 29.714 1.00 0.00 ? 154 ILE A CA   1  
ATOM   2423  C  C    . ILE A 1 154 ? 20.766  18.620 30.226 1.00 0.00 ? 154 ILE A C    1  
ATOM   2424  O  O    . ILE A 1 154 ? 20.866  19.611 29.533 1.00 0.00 ? 154 ILE A O    1  
ATOM   2425  C  CB   . ILE A 1 154 ? 18.915  17.049 30.661 1.00 0.00 ? 154 ILE A CB   1  
ATOM   2426  C  CG1  . ILE A 1 154 ? 18.401  15.643 30.393 1.00 0.00 ? 154 ILE A CG1  1  
ATOM   2427  C  CG2  . ILE A 1 154 ? 17.774  18.047 30.403 1.00 0.00 ? 154 ILE A CG2  1  
ATOM   2428  C  CD1  . ILE A 1 154 ? 17.435  15.243 31.511 1.00 0.00 ? 154 ILE A CD1  1  
ATOM   2429  H  H    . ILE A 1 154 ? 20.855  15.465 30.294 1.00 0.00 ? 154 ILE A H    1  
ATOM   2430  H  HA   . ILE A 1 154 ? 19.695  17.559 28.703 1.00 0.00 ? 154 ILE A HA   1  
ATOM   2431  H  HB   . ILE A 1 154 ? 19.270  17.118 31.690 1.00 0.00 ? 154 ILE A HB   1  
ATOM   2432  H  HG12 . ILE A 1 154 ? 17.888  15.618 29.444 1.00 0.00 ? 154 ILE A HG12 1  
ATOM   2433  H  HG13 . ILE A 1 154 ? 19.231  14.951 30.366 1.00 0.00 ? 154 ILE A HG13 1  
ATOM   2434  H  HG21 . ILE A 1 154 ? 18.173  19.047 30.335 1.00 0.00 ? 154 ILE A HG21 1  
ATOM   2435  H  HG22 . ILE A 1 154 ? 17.276  17.799 29.477 1.00 0.00 ? 154 ILE A HG22 1  
ATOM   2436  H  HG23 . ILE A 1 154 ? 17.060  18.003 31.213 1.00 0.00 ? 154 ILE A HG23 1  
ATOM   2437  H  HD11 . ILE A 1 154 ? 17.913  15.374 32.471 1.00 0.00 ? 154 ILE A HD11 1  
ATOM   2438  H  HD12 . ILE A 1 154 ? 16.550  15.861 31.467 1.00 0.00 ? 154 ILE A HD12 1  
ATOM   2439  H  HD13 . ILE A 1 154 ? 17.151  14.207 31.394 1.00 0.00 ? 154 ILE A HD13 1  
ATOM   2440  N  N    . TRP A 1 155 ? 21.238  18.552 31.440 1.00 0.00 ? 155 TRP A N    1  
ATOM   2441  C  CA   . TRP A 1 155 ? 21.936  19.724 32.008 1.00 0.00 ? 155 TRP A CA   1  
ATOM   2442  C  C    . TRP A 1 155 ? 23.079  20.144 31.097 1.00 0.00 ? 155 TRP A C    1  
ATOM   2443  O  O    . TRP A 1 155 ? 23.452  21.300 31.053 1.00 0.00 ? 155 TRP A O    1  
ATOM   2444  C  CB   . TRP A 1 155 ? 22.510  19.333 33.378 1.00 0.00 ? 155 TRP A CB   1  
ATOM   2445  C  CG   . TRP A 1 155 ? 22.883  20.601 34.144 1.00 0.00 ? 155 TRP A CG   1  
ATOM   2446  C  CD1  . TRP A 1 155 ? 24.123  21.034 34.317 1.00 0.00 ? 155 TRP A CD1  1  
ATOM   2447  C  CD2  . TRP A 1 155 ? 22.021  21.403 34.707 1.00 0.00 ? 155 TRP A CD2  1  
ATOM   2448  N  NE1  . TRP A 1 155 ? 23.966  22.166 35.030 1.00 0.00 ? 155 TRP A NE1  1  
ATOM   2449  C  CE2  . TRP A 1 155 ? 22.647  22.471 35.321 1.00 0.00 ? 155 TRP A CE2  1  
ATOM   2450  C  CE3  . TRP A 1 155 ? 20.646  21.296 34.745 1.00 0.00 ? 155 TRP A CE3  1  
ATOM   2451  C  CZ2  . TRP A 1 155 ? 21.896  23.430 35.971 1.00 0.00 ? 155 TRP A CZ2  1  
ATOM   2452  C  CZ3  . TRP A 1 155 ? 19.897  22.253 35.396 1.00 0.00 ? 155 TRP A CZ3  1  
ATOM   2453  C  CH2  . TRP A 1 155 ? 20.521  23.320 36.008 1.00 0.00 ? 155 TRP A CH2  1  
ATOM   2454  H  H    . TRP A 1 155 ? 21.134  17.731 31.968 1.00 0.00 ? 155 TRP A H    1  
ATOM   2455  H  HA   . TRP A 1 155 ? 21.230  20.549 32.101 1.00 0.00 ? 155 TRP A HA   1  
ATOM   2456  H  HB2  . TRP A 1 155 ? 21.770  18.781 33.940 1.00 0.00 ? 155 TRP A HB2  1  
ATOM   2457  H  HB3  . TRP A 1 155 ? 23.390  18.722 33.247 1.00 0.00 ? 155 TRP A HB3  1  
ATOM   2458  H  HD1  . TRP A 1 155 ? 25.041  20.586 33.968 1.00 0.00 ? 155 TRP A HD1  1  
ATOM   2459  H  HE1  . TRP A 1 155 ? 24.719  22.723 35.318 1.00 0.00 ? 155 TRP A HE1  1  
ATOM   2460  H  HE3  . TRP A 1 155 ? 20.157  20.461 34.264 1.00 0.00 ? 155 TRP A HE3  1  
ATOM   2461  H  HZ2  . TRP A 1 155 ? 22.385  24.263 36.451 1.00 0.00 ? 155 TRP A HZ2  1  
ATOM   2462  H  HZ3  . TRP A 1 155 ? 18.819  22.168 35.424 1.00 0.00 ? 155 TRP A HZ3  1  
ATOM   2463  H  HH2  . TRP A 1 155 ? 19.933  24.069 36.517 1.00 0.00 ? 155 TRP A HH2  1  
ATOM   2464  N  N    . GLY A 1 156 ? 23.612  19.190 30.383 1.00 0.00 ? 156 GLY A N    1  
ATOM   2465  C  CA   . GLY A 1 156 ? 24.735  19.503 29.463 1.00 0.00 ? 156 GLY A CA   1  
ATOM   2466  C  C    . GLY A 1 156 ? 24.218  20.226 28.218 1.00 0.00 ? 156 GLY A C    1  
ATOM   2467  O  O    . GLY A 1 156 ? 24.913  21.041 27.642 1.00 0.00 ? 156 GLY A O    1  
ATOM   2468  H  H    . GLY A 1 156 ? 23.275  18.272 30.455 1.00 0.00 ? 156 GLY A H    1  
ATOM   2469  H  HA2  . GLY A 1 156 ? 25.447  20.135 29.973 1.00 0.00 ? 156 GLY A HA2  1  
ATOM   2470  H  HA3  . GLY A 1 156 ? 25.221  18.586 29.167 1.00 0.00 ? 156 GLY A HA3  1  
ATOM   2471  N  N    . PHE A 1 157 ? 23.007  19.919 27.826 1.00 0.00 ? 157 PHE A N    1  
ATOM   2472  C  CA   . PHE A 1 157 ? 22.451  20.589 26.623 1.00 0.00 ? 157 PHE A CA   1  
ATOM   2473  C  C    . PHE A 1 157 ? 22.289  22.082 26.873 1.00 0.00 ? 157 PHE A C    1  
ATOM   2474  O  O    . PHE A 1 157 ? 22.668  22.898 26.056 1.00 0.00 ? 157 PHE A O    1  
ATOM   2475  C  CB   . PHE A 1 157 ? 21.072  19.983 26.306 1.00 0.00 ? 157 PHE A CB   1  
ATOM   2476  C  CG   . PHE A 1 157 ? 21.231  18.866 25.269 1.00 0.00 ? 157 PHE A CG   1  
ATOM   2477  C  CD1  . PHE A 1 157 ? 21.743  19.140 24.011 1.00 0.00 ? 157 PHE A CD1  1  
ATOM   2478  C  CD2  . PHE A 1 157 ? 20.864  17.567 25.576 1.00 0.00 ? 157 PHE A CD2  1  
ATOM   2479  C  CE1  . PHE A 1 157 ? 21.882  18.130 23.079 1.00 0.00 ? 157 PHE A CE1  1  
ATOM   2480  C  CE2  . PHE A 1 157 ? 21.007  16.561 24.641 1.00 0.00 ? 157 PHE A CE2  1  
ATOM   2481  C  CZ   . PHE A 1 157 ? 21.514  16.843 23.396 1.00 0.00 ? 157 PHE A CZ   1  
ATOM   2482  H  H    . PHE A 1 157 ? 22.472  19.257 28.324 1.00 0.00 ? 157 PHE A H    1  
ATOM   2483  H  HA   . PHE A 1 157 ? 23.139  20.444 25.789 1.00 0.00 ? 157 PHE A HA   1  
ATOM   2484  H  HB2  . PHE A 1 157 ? 20.636  19.575 27.202 1.00 0.00 ? 157 PHE A HB2  1  
ATOM   2485  H  HB3  . PHE A 1 157 ? 20.420  20.747 25.908 1.00 0.00 ? 157 PHE A HB3  1  
ATOM   2486  H  HD1  . PHE A 1 157 ? 22.033  20.148 23.758 1.00 0.00 ? 157 PHE A HD1  1  
ATOM   2487  H  HD2  . PHE A 1 157 ? 20.461  17.338 26.552 1.00 0.00 ? 157 PHE A HD2  1  
ATOM   2488  H  HE1  . PHE A 1 157 ? 22.284  18.351 22.102 1.00 0.00 ? 157 PHE A HE1  1  
ATOM   2489  H  HE2  . PHE A 1 157 ? 20.724  15.550 24.890 1.00 0.00 ? 157 PHE A HE2  1  
ATOM   2490  H  HZ   . PHE A 1 157 ? 21.623  16.055 22.665 1.00 0.00 ? 157 PHE A HZ   1  
ATOM   2491  N  N    . PHE A 1 158 ? 21.726  22.418 28.004 1.00 0.00 ? 158 PHE A N    1  
ATOM   2492  C  CA   . PHE A 1 158 ? 21.534  23.851 28.321 1.00 0.00 ? 158 PHE A CA   1  
ATOM   2493  C  C    . PHE A 1 158 ? 22.882  24.546 28.490 1.00 0.00 ? 158 PHE A C    1  
ATOM   2494  O  O    . PHE A 1 158 ? 23.221  25.440 27.741 1.00 0.00 ? 158 PHE A O    1  
ATOM   2495  C  CB   . PHE A 1 158 ? 20.749  23.956 29.639 1.00 0.00 ? 158 PHE A CB   1  
ATOM   2496  C  CG   . PHE A 1 158 ? 19.328  23.422 29.427 1.00 0.00 ? 158 PHE A CG   1  
ATOM   2497  C  CD1  . PHE A 1 158 ? 18.498  23.994 28.476 1.00 0.00 ? 158 PHE A CD1  1  
ATOM   2498  C  CD2  . PHE A 1 158 ? 18.854  22.362 30.183 1.00 0.00 ? 158 PHE A CD2  1  
ATOM   2499  C  CE1  . PHE A 1 158 ? 17.218  23.511 28.287 1.00 0.00 ? 158 PHE A CE1  1  
ATOM   2500  C  CE2  . PHE A 1 158 ? 17.572  21.884 29.989 1.00 0.00 ? 158 PHE A CE2  1  
ATOM   2501  C  CZ   . PHE A 1 158 ? 16.757  22.459 29.042 1.00 0.00 ? 158 PHE A CZ   1  
ATOM   2502  H  H    . PHE A 1 158 ? 21.431  21.727 28.634 1.00 0.00 ? 158 PHE A H    1  
ATOM   2503  H  HA   . PHE A 1 158 ? 20.989  24.326 27.505 1.00 0.00 ? 158 PHE A HA   1  
ATOM   2504  H  HB2  . PHE A 1 158 ? 21.238  23.373 30.404 1.00 0.00 ? 158 PHE A HB2  1  
ATOM   2505  H  HB3  . PHE A 1 158 ? 20.698  24.988 29.955 1.00 0.00 ? 158 PHE A HB3  1  
ATOM   2506  H  HD1  . PHE A 1 158 ? 18.853  24.819 27.879 1.00 0.00 ? 158 PHE A HD1  1  
ATOM   2507  H  HD2  . PHE A 1 158 ? 19.489  21.907 30.928 1.00 0.00 ? 158 PHE A HD2  1  
ATOM   2508  H  HE1  . PHE A 1 158 ? 16.577  23.962 27.543 1.00 0.00 ? 158 PHE A HE1  1  
ATOM   2509  H  HE2  . PHE A 1 158 ? 17.211  21.056 30.581 1.00 0.00 ? 158 PHE A HE2  1  
ATOM   2510  H  HZ   . PHE A 1 158 ? 15.756  22.081 28.890 1.00 0.00 ? 158 PHE A HZ   1  
ATOM   2511  N  N    . GLY A 1 159 ? 23.630  24.116 29.474 1.00 0.00 ? 159 GLY A N    1  
ATOM   2512  C  CA   . GLY A 1 159 ? 24.964  24.741 29.708 1.00 0.00 ? 159 GLY A CA   1  
ATOM   2513  C  C    . GLY A 1 159 ? 24.870  25.844 30.767 1.00 0.00 ? 159 GLY A C    1  
ATOM   2514  O  O    . GLY A 1 159 ? 24.869  27.016 30.443 1.00 0.00 ? 159 GLY A O    1  
ATOM   2515  H  H    . GLY A 1 159 ? 23.316  23.389 30.053 1.00 0.00 ? 159 GLY A H    1  
ATOM   2516  H  HA2  . GLY A 1 159 ? 25.656  23.984 30.046 1.00 0.00 ? 159 GLY A HA2  1  
ATOM   2517  H  HA3  . GLY A 1 159 ? 25.327  25.165 28.784 1.00 0.00 ? 159 GLY A HA3  1  
ATOM   2518  N  N    . LYS A 1 160 ? 24.797  25.439 32.012 1.00 0.00 ? 160 LYS A N    1  
ATOM   2519  C  CA   . LYS A 1 160 ? 24.702  26.436 33.112 1.00 0.00 ? 160 LYS A CA   1  
ATOM   2520  C  C    . LYS A 1 160 ? 26.031  26.551 33.862 1.00 0.00 ? 160 LYS A C    1  
ATOM   2521  O  O    . LYS A 1 160 ? 26.719  25.569 34.063 1.00 0.00 ? 160 LYS A O    1  
ATOM   2522  C  CB   . LYS A 1 160 ? 23.620  25.962 34.093 1.00 0.00 ? 160 LYS A CB   1  
ATOM   2523  C  CG   . LYS A 1 160 ? 22.686  27.138 34.433 1.00 0.00 ? 160 LYS A CG   1  
ATOM   2524  C  CD   . LYS A 1 160 ? 21.932  27.644 33.175 1.00 0.00 ? 160 LYS A CD   1  
ATOM   2525  C  CE   . LYS A 1 160 ? 21.662  26.492 32.205 1.00 0.00 ? 160 LYS A CE   1  
ATOM   2526  N  NZ   . LYS A 1 160 ? 20.789  26.950 31.088 1.00 0.00 ? 160 LYS A NZ   1  
ATOM   2527  H  H    . LYS A 1 160 ? 24.797  24.484 32.219 1.00 0.00 ? 160 LYS A H    1  
ATOM   2528  H  HA   . LYS A 1 160 ? 24.449  27.405 32.699 1.00 0.00 ? 160 LYS A HA   1  
ATOM   2529  H  HB2  . LYS A 1 160 ? 23.057  25.153 33.659 1.00 0.00 ? 160 LYS A HB2  1  
ATOM   2530  H  HB3  . LYS A 1 160 ? 24.088  25.608 34.998 1.00 0.00 ? 160 LYS A HB3  1  
ATOM   2531  H  HG2  . LYS A 1 160 ? 21.970  26.823 35.177 1.00 0.00 ? 160 LYS A HG2  1  
ATOM   2532  H  HG3  . LYS A 1 160 ? 23.276  27.941 34.834 1.00 0.00 ? 160 LYS A HG3  1  
ATOM   2533  H  HD2  . LYS A 1 160 ? 20.991  28.081 33.478 1.00 0.00 ? 160 LYS A HD2  1  
ATOM   2534  H  HD3  . LYS A 1 160 ? 22.521  28.399 32.681 1.00 0.00 ? 160 LYS A HD3  1  
ATOM   2535  H  HE2  . LYS A 1 160 ? 22.592  26.133 31.794 1.00 0.00 ? 160 LYS A HE2  1  
ATOM   2536  H  HE3  . LYS A 1 160 ? 21.166  25.685 32.726 1.00 0.00 ? 160 LYS A HE3  1  
ATOM   2537  H  HZ1  . LYS A 1 160 ? 20.481  27.928 31.266 1.00 0.00 ? 160 LYS A HZ1  1  
ATOM   2538  H  HZ2  . LYS A 1 160 ? 21.319  26.911 30.194 1.00 0.00 ? 160 LYS A HZ2  1  
ATOM   2539  H  HZ3  . LYS A 1 160 ? 19.955  26.331 31.023 1.00 0.00 ? 160 LYS A HZ3  1  
ATOM   2540  N  N    . LYS A 1 161 ? 26.363  27.758 34.262 1.00 0.00 ? 161 LYS A N    1  
ATOM   2541  C  CA   . LYS A 1 161 ? 27.641  27.968 35.001 1.00 0.00 ? 161 LYS A CA   1  
ATOM   2542  C  C    . LYS A 1 161 ? 27.443  28.972 36.136 1.00 0.00 ? 161 LYS A C    1  
ATOM   2543  O  O    . LYS A 1 161 ? 27.135  28.597 37.250 1.00 0.00 ? 161 LYS A O    1  
ATOM   2544  C  CB   . LYS A 1 161 ? 28.690  28.517 34.004 1.00 0.00 ? 161 LYS A CB   1  
ATOM   2545  C  CG   . LYS A 1 161 ? 29.981  28.921 34.749 1.00 0.00 ? 161 LYS A CG   1  
ATOM   2546  C  CD   . LYS A 1 161 ? 30.773  27.663 35.126 1.00 0.00 ? 161 LYS A CD   1  
ATOM   2547  C  CE   . LYS A 1 161 ? 31.352  27.023 33.858 1.00 0.00 ? 161 LYS A CE   1  
ATOM   2548  N  NZ   . LYS A 1 161 ? 31.724  28.069 32.863 1.00 0.00 ? 161 LYS A NZ   1  
ATOM   2549  H  H    . LYS A 1 161 ? 25.773  28.517 34.074 1.00 0.00 ? 161 LYS A H    1  
ATOM   2550  H  HA   . LYS A 1 161 ? 27.964  27.019 35.423 1.00 0.00 ? 161 LYS A HA   1  
ATOM   2551  H  HB2  . LYS A 1 161 ? 28.921  27.757 33.271 1.00 0.00 ? 161 LYS A HB2  1  
ATOM   2552  H  HB3  . LYS A 1 161 ? 28.285  29.380 33.495 1.00 0.00 ? 161 LYS A HB3  1  
ATOM   2553  H  HG2  . LYS A 1 161 ? 30.583  29.547 34.108 1.00 0.00 ? 161 LYS A HG2  1  
ATOM   2554  H  HG3  . LYS A 1 161 ? 29.735  29.472 35.641 1.00 0.00 ? 161 LYS A HG3  1  
ATOM   2555  H  HD2  . LYS A 1 161 ? 31.579  27.931 35.794 1.00 0.00 ? 161 LYS A HD2  1  
ATOM   2556  H  HD3  . LYS A 1 161 ? 30.125  26.958 35.623 1.00 0.00 ? 161 LYS A HD3  1  
ATOM   2557  H  HE2  . LYS A 1 161 ? 32.232  26.450 34.112 1.00 0.00 ? 161 LYS A HE2  1  
ATOM   2558  H  HE3  . LYS A 1 161 ? 30.617  26.364 33.419 1.00 0.00 ? 161 LYS A HE3  1  
ATOM   2559  H  HZ1  . LYS A 1 161 ? 32.184  28.865 33.352 1.00 0.00 ? 161 LYS A HZ1  1  
ATOM   2560  H  HZ2  . LYS A 1 161 ? 32.380  27.665 32.164 1.00 0.00 ? 161 LYS A HZ2  1  
ATOM   2561  H  HZ3  . LYS A 1 161 ? 30.868  28.409 32.380 1.00 0.00 ? 161 LYS A HZ3  1  
ATOM   2562  N  N    . ASP A 1 162 ? 27.625  30.232 35.836 1.00 0.00 ? 162 ASP A N    1  
ATOM   2563  C  CA   . ASP A 1 162 ? 27.449  31.260 36.893 1.00 0.00 ? 162 ASP A CA   1  
ATOM   2564  C  C    . ASP A 1 162 ? 26.097  31.094 37.580 1.00 0.00 ? 162 ASP A C    1  
ATOM   2565  O  O    . ASP A 1 162 ? 26.029  30.850 38.769 1.00 0.00 ? 162 ASP A O    1  
ATOM   2566  C  CB   . ASP A 1 162 ? 27.514  32.649 36.237 1.00 0.00 ? 162 ASP A CB   1  
ATOM   2567  C  CG   . ASP A 1 162 ? 28.912  32.864 35.652 1.00 0.00 ? 162 ASP A CG   1  
ATOM   2568  O  OD1  . ASP A 1 162 ? 29.774  32.076 36.007 1.00 0.00 ? 162 ASP A OD1  1  
ATOM   2569  O  OD2  . ASP A 1 162 ? 29.040  33.805 34.886 1.00 0.00 ? 162 ASP A OD2  1  
ATOM   2570  H  H    . ASP A 1 162 ? 27.875  30.494 34.925 1.00 0.00 ? 162 ASP A H    1  
ATOM   2571  H  HA   . ASP A 1 162 ? 28.241  31.144 37.634 1.00 0.00 ? 162 ASP A HA   1  
ATOM   2572  H  HB2  . ASP A 1 162 ? 26.782  32.716 35.446 1.00 0.00 ? 162 ASP A HB2  1  
ATOM   2573  H  HB3  . ASP A 1 162 ? 27.314  33.412 36.974 1.00 0.00 ? 162 ASP A HB3  1  
ATOM   2574  N  N    . ASP A 1 163 ? 25.045  31.226 36.815 1.00 0.00 ? 163 ASP A N    1  
ATOM   2575  C  CA   . ASP A 1 163 ? 23.690  31.077 37.397 1.00 0.00 ? 163 ASP A CA   1  
ATOM   2576  C  C    . ASP A 1 163 ? 23.203  29.659 37.172 1.00 0.00 ? 163 ASP A C    1  
ATOM   2577  O  O    . ASP A 1 163 ? 22.340  29.421 36.356 1.00 0.00 ? 163 ASP A O    1  
ATOM   2578  C  CB   . ASP A 1 163 ? 22.738  32.052 36.683 1.00 0.00 ? 163 ASP A CB   1  
ATOM   2579  C  CG   . ASP A 1 163 ? 23.155  33.489 36.998 1.00 0.00 ? 163 ASP A CG   1  
ATOM   2580  O  OD1  . ASP A 1 163 ? 24.272  33.638 37.465 1.00 0.00 ? 163 ASP A OD1  1  
ATOM   2581  O  OD2  . ASP A 1 163 ? 22.334  34.356 36.754 1.00 0.00 ? 163 ASP A OD2  1  
ATOM   2582  H  H    . ASP A 1 163 ? 25.151  31.409 35.866 1.00 0.00 ? 163 ASP A H    1  
ATOM   2583  H  HA   . ASP A 1 163 ? 23.734  31.282 38.467 1.00 0.00 ? 163 ASP A HA   1  
ATOM   2584  H  HB2  . ASP A 1 163 ? 22.783  31.893 35.616 1.00 0.00 ? 163 ASP A HB2  1  
ATOM   2585  H  HB3  . ASP A 1 163 ? 21.727  31.892 37.026 1.00 0.00 ? 163 ASP A HB3  1  
ATOM   2586  N  N    . ASP A 1 164 ? 23.786  28.746 37.904 1.00 0.00 ? 164 ASP A N    1  
ATOM   2587  C  CA   . ASP A 1 164 ? 23.405  27.305 37.780 1.00 0.00 ? 164 ASP A CA   1  
ATOM   2588  C  C    . ASP A 1 164 ? 21.919  27.036 38.066 1.00 0.00 ? 164 ASP A C    1  
ATOM   2589  O  O    . ASP A 1 164 ? 21.574  25.998 38.597 1.00 0.00 ? 164 ASP A O    1  
ATOM   2590  C  CB   . ASP A 1 164 ? 24.247  26.506 38.777 1.00 0.00 ? 164 ASP A CB   1  
ATOM   2591  C  CG   . ASP A 1 164 ? 24.046  27.075 40.184 1.00 0.00 ? 164 ASP A CG   1  
ATOM   2592  O  OD1  . ASP A 1 164 ? 23.104  26.631 40.818 1.00 0.00 ? 164 ASP A OD1  1  
ATOM   2593  O  OD2  . ASP A 1 164 ? 24.847  27.923 40.545 1.00 0.00 ? 164 ASP A OD2  1  
ATOM   2594  H  H    . ASP A 1 164 ? 24.490  29.011 38.531 1.00 0.00 ? 164 ASP A H    1  
ATOM   2595  H  HA   . ASP A 1 164 ? 23.621  26.979 36.766 1.00 0.00 ? 164 ASP A HA   1  
ATOM   2596  H  HB2  . ASP A 1 164 ? 23.943  25.470 38.763 1.00 0.00 ? 164 ASP A HB2  1  
ATOM   2597  H  HB3  . ASP A 1 164 ? 25.292  26.575 38.509 1.00 0.00 ? 164 ASP A HB3  1  
ATOM   2598  N  N    . LYS A 1 165 ? 21.077  27.969 37.717 1.00 0.00 ? 165 LYS A N    1  
ATOM   2599  C  CA   . LYS A 1 165 ? 19.616  27.785 37.954 1.00 0.00 ? 165 LYS A CA   1  
ATOM   2600  C  C    . LYS A 1 165 ? 18.850  28.243 36.724 1.00 0.00 ? 165 LYS A C    1  
ATOM   2601  O  O    . LYS A 1 165 ? 18.813  29.419 36.419 1.00 0.00 ? 165 LYS A O    1  
ATOM   2602  C  CB   . LYS A 1 165 ? 19.170  28.636 39.159 1.00 0.00 ? 165 LYS A CB   1  
ATOM   2603  C  CG   . LYS A 1 165 ? 20.386  29.040 39.991 1.00 0.00 ? 165 LYS A CG   1  
ATOM   2604  C  CD   . LYS A 1 165 ? 21.025  30.280 39.372 1.00 0.00 ? 165 LYS A CD   1  
ATOM   2605  C  CE   . LYS A 1 165 ? 20.633  31.510 40.195 1.00 0.00 ? 165 LYS A CE   1  
ATOM   2606  N  NZ   . LYS A 1 165 ? 21.359  32.718 39.709 1.00 0.00 ? 165 LYS A NZ   1  
ATOM   2607  H  H    . LYS A 1 165 ? 21.405  28.792 37.297 1.00 0.00 ? 165 LYS A H    1  
ATOM   2608  H  HA   . LYS A 1 165 ? 19.410  26.727 38.122 1.00 0.00 ? 165 LYS A HA   1  
ATOM   2609  H  HB2  . LYS A 1 165 ? 18.659  29.521 38.807 1.00 0.00 ? 165 LYS A HB2  1  
ATOM   2610  H  HB3  . LYS A 1 165 ? 18.492  28.058 39.773 1.00 0.00 ? 165 LYS A HB3  1  
ATOM   2611  H  HG2  . LYS A 1 165 ? 20.077  29.258 41.002 1.00 0.00 ? 165 LYS A HG2  1  
ATOM   2612  H  HG3  . LYS A 1 165 ? 21.100  28.234 40.009 1.00 0.00 ? 165 LYS A HG3  1  
ATOM   2613  H  HD2  . LYS A 1 165 ? 22.097  30.170 39.373 1.00 0.00 ? 165 LYS A HD2  1  
ATOM   2614  H  HD3  . LYS A 1 165 ? 20.680  30.397 38.356 1.00 0.00 ? 165 LYS A HD3  1  
ATOM   2615  H  HE2  . LYS A 1 165 ? 19.571  31.679 40.107 1.00 0.00 ? 165 LYS A HE2  1  
ATOM   2616  H  HE3  . LYS A 1 165 ? 20.878  31.344 41.233 1.00 0.00 ? 165 LYS A HE3  1  
ATOM   2617  H  HZ1  . LYS A 1 165 ? 22.136  32.425 39.083 1.00 0.00 ? 165 LYS A HZ1  1  
ATOM   2618  H  HZ2  . LYS A 1 165 ? 20.702  33.329 39.184 1.00 0.00 ? 165 LYS A HZ2  1  
ATOM   2619  H  HZ3  . LYS A 1 165 ? 21.746  33.240 40.521 1.00 0.00 ? 165 LYS A HZ3  1  
ATOM   2620  N  N    . LEU A 1 166 ? 18.251  27.313 36.034 1.00 0.00 ? 166 LEU A N    1  
ATOM   2621  C  CA   . LEU A 1 166 ? 17.489  27.693 34.820 1.00 0.00 ? 166 LEU A CA   1  
ATOM   2622  C  C    . LEU A 1 166 ? 16.188  28.387 35.177 1.00 0.00 ? 166 LEU A C    1  
ATOM   2623  O  O    . LEU A 1 166 ? 15.393  27.880 35.941 1.00 0.00 ? 166 LEU A O    1  
ATOM   2624  C  CB   . LEU A 1 166 ? 17.180  26.420 34.024 1.00 0.00 ? 166 LEU A CB   1  
ATOM   2625  C  CG   . LEU A 1 166 ? 17.010  26.765 32.539 1.00 0.00 ? 166 LEU A CG   1  
ATOM   2626  C  CD1  . LEU A 1 166 ? 18.280  27.442 32.020 1.00 0.00 ? 166 LEU A CD1  1  
ATOM   2627  C  CD2  . LEU A 1 166 ? 16.783  25.476 31.749 1.00 0.00 ? 166 LEU A CD2  1  
ATOM   2628  H  H    . LEU A 1 166 ? 18.295  26.373 36.323 1.00 0.00 ? 166 LEU A H    1  
ATOM   2629  H  HA   . LEU A 1 166 ? 18.095  28.377 34.234 1.00 0.00 ? 166 LEU A HA   1  
ATOM   2630  H  HB2  . LEU A 1 166 ? 17.990  25.720 34.140 1.00 0.00 ? 166 LEU A HB2  1  
ATOM   2631  H  HB3  . LEU A 1 166 ? 16.271  25.976 34.396 1.00 0.00 ? 166 LEU A HB3  1  
ATOM   2632  H  HG   . LEU A 1 166 ? 16.164  27.425 32.411 1.00 0.00 ? 166 LEU A HG   1  
ATOM   2633  H  HD11 . LEU A 1 166 ? 19.121  27.160 32.636 1.00 0.00 ? 166 LEU A HD11 1  
ATOM   2634  H  HD12 . LEU A 1 166 ? 18.465  27.136 31.001 1.00 0.00 ? 166 LEU A HD12 1  
ATOM   2635  H  HD13 . LEU A 1 166 ? 18.160  28.515 32.052 1.00 0.00 ? 166 LEU A HD13 1  
ATOM   2636  H  HD21 . LEU A 1 166 ? 16.170  24.799 32.323 1.00 0.00 ? 166 LEU A HD21 1  
ATOM   2637  H  HD22 . LEU A 1 166 ? 16.288  25.702 30.817 1.00 0.00 ? 166 LEU A HD22 1  
ATOM   2638  H  HD23 . LEU A 1 166 ? 17.734  25.005 31.541 1.00 0.00 ? 166 LEU A HD23 1  
ATOM   2639  N  N    . THR A 1 167 ? 15.997  29.536 34.600 1.00 0.00 ? 167 THR A N    1  
ATOM   2640  C  CA   . THR A 1 167 ? 14.760  30.312 34.870 1.00 0.00 ? 167 THR A CA   1  
ATOM   2641  C  C    . THR A 1 167 ? 13.671  29.970 33.858 1.00 0.00 ? 167 THR A C    1  
ATOM   2642  O  O    . THR A 1 167 ? 13.948  29.441 32.800 1.00 0.00 ? 167 THR A O    1  
ATOM   2643  C  CB   . THR A 1 167 ? 15.098  31.802 34.754 1.00 0.00 ? 167 THR A CB   1  
ATOM   2644  O  OG1  . THR A 1 167 ? 15.673  31.956 33.471 1.00 0.00 ? 167 THR A OG1  1  
ATOM   2645  C  CG2  . THR A 1 167 ? 16.223  32.181 35.730 1.00 0.00 ? 167 THR A CG2  1  
ATOM   2646  H  H    . THR A 1 167 ? 16.669  29.882 33.980 1.00 0.00 ? 167 THR A H    1  
ATOM   2647  H  HA   . THR A 1 167 ? 14.402  30.071 35.874 1.00 0.00 ? 167 THR A HA   1  
ATOM   2648  H  HB   . THR A 1 167 ? 14.216  32.428 34.862 1.00 0.00 ? 167 THR A HB   1  
ATOM   2649  H  HG1  . THR A 1 167 ? 15.010  31.715 32.818 1.00 0.00 ? 167 THR A HG1  1  
ATOM   2650  H  HG21 . THR A 1 167 ? 16.703  31.286 36.099 1.00 0.00 ? 167 THR A HG21 1  
ATOM   2651  H  HG22 . THR A 1 167 ? 16.955  32.792 35.224 1.00 0.00 ? 167 THR A HG22 1  
ATOM   2652  H  HG23 . THR A 1 167 ? 15.814  32.735 36.563 1.00 0.00 ? 167 THR A HG23 1  
ATOM   2653  N  N    . GLU A 1 168 ? 12.448  30.279 34.202 1.00 0.00 ? 168 GLU A N    1  
ATOM   2654  C  CA   . GLU A 1 168 ? 11.328  29.978 33.270 1.00 0.00 ? 168 GLU A CA   1  
ATOM   2655  C  C    . GLU A 1 168 ? 11.433  30.799 31.983 1.00 0.00 ? 168 GLU A C    1  
ATOM   2656  O  O    . GLU A 1 168 ? 10.836  30.461 30.981 1.00 0.00 ? 168 GLU A O    1  
ATOM   2657  C  CB   . GLU A 1 168 ? 9.997   30.323 33.971 1.00 0.00 ? 168 GLU A CB   1  
ATOM   2658  C  CG   . GLU A 1 168 ? 10.283  30.840 35.385 1.00 0.00 ? 168 GLU A CG   1  
ATOM   2659  C  CD   . GLU A 1 168 ? 10.951  32.213 35.296 1.00 0.00 ? 168 GLU A CD   1  
ATOM   2660  O  OE1  . GLU A 1 168 ? 10.296  33.101 34.775 1.00 0.00 ? 168 GLU A OE1  1  
ATOM   2661  O  OE2  . GLU A 1 168 ? 12.077  32.299 35.757 1.00 0.00 ? 168 GLU A OE2  1  
ATOM   2662  H  H    . GLU A 1 168 ? 12.272  30.711 35.064 1.00 0.00 ? 168 GLU A H    1  
ATOM   2663  H  HA   . GLU A 1 168 ? 11.362  28.919 33.013 1.00 0.00 ? 168 GLU A HA   1  
ATOM   2664  H  HB2  . GLU A 1 168 ? 9.475   31.082 33.408 1.00 0.00 ? 168 GLU A HB2  1  
ATOM   2665  H  HB3  . GLU A 1 168 ? 9.379   29.439 34.028 1.00 0.00 ? 168 GLU A HB3  1  
ATOM   2666  H  HG2  . GLU A 1 168 ? 9.358   30.931 35.933 1.00 0.00 ? 168 GLU A HG2  1  
ATOM   2667  H  HG3  . GLU A 1 168 ? 10.939  30.156 35.903 1.00 0.00 ? 168 GLU A HG3  1  
ATOM   2668  N  N    . LYS A 1 169 ? 12.188  31.862 32.033 1.00 0.00 ? 169 LYS A N    1  
ATOM   2669  C  CA   . LYS A 1 169 ? 12.335  32.706 30.819 1.00 0.00 ? 169 LYS A CA   1  
ATOM   2670  C  C    . LYS A 1 169 ? 13.079  31.959 29.718 1.00 0.00 ? 169 LYS A C    1  
ATOM   2671  O  O    . LYS A 1 169 ? 12.631  31.908 28.590 1.00 0.00 ? 169 LYS A O    1  
ATOM   2672  C  CB   . LYS A 1 169 ? 13.135  33.961 31.199 1.00 0.00 ? 169 LYS A CB   1  
ATOM   2673  C  CG   . LYS A 1 169 ? 12.362  34.736 32.266 1.00 0.00 ? 169 LYS A CG   1  
ATOM   2674  C  CD   . LYS A 1 169 ? 13.044  36.083 32.508 1.00 0.00 ? 169 LYS A CD   1  
ATOM   2675  C  CE   . LYS A 1 169 ? 12.519  36.677 33.814 1.00 0.00 ? 169 LYS A CE   1  
ATOM   2676  N  NZ   . LYS A 1 169 ? 13.445  36.362 34.937 1.00 0.00 ? 169 LYS A NZ   1  
ATOM   2677  H  H    . LYS A 1 169 ? 12.653  32.102 32.862 1.00 0.00 ? 169 LYS A H    1  
ATOM   2678  H  HA   . LYS A 1 169 ? 11.344  32.976 30.454 1.00 0.00 ? 169 LYS A HA   1  
ATOM   2679  H  HB2  . LYS A 1 169 ? 14.101  33.673 31.586 1.00 0.00 ? 169 LYS A HB2  1  
ATOM   2680  H  HB3  . LYS A 1 169 ? 13.273  34.583 30.326 1.00 0.00 ? 169 LYS A HB3  1  
ATOM   2681  H  HG2  . LYS A 1 169 ? 11.348  34.898 31.933 1.00 0.00 ? 169 LYS A HG2  1  
ATOM   2682  H  HG3  . LYS A 1 169 ? 12.346  34.169 33.185 1.00 0.00 ? 169 LYS A HG3  1  
ATOM   2683  H  HD2  . LYS A 1 169 ? 14.113  35.943 32.576 1.00 0.00 ? 169 LYS A HD2  1  
ATOM   2684  H  HD3  . LYS A 1 169 ? 12.825  36.753 31.689 1.00 0.00 ? 169 LYS A HD3  1  
ATOM   2685  H  HE2  . LYS A 1 169 ? 12.434  37.749 33.716 1.00 0.00 ? 169 LYS A HE2  1  
ATOM   2686  H  HE3  . LYS A 1 169 ? 11.545  36.265 34.033 1.00 0.00 ? 169 LYS A HE3  1  
ATOM   2687  H  HZ1  . LYS A 1 169 ? 13.950  35.477 34.731 1.00 0.00 ? 169 LYS A HZ1  1  
ATOM   2688  H  HZ2  . LYS A 1 169 ? 14.130  37.136 35.048 1.00 0.00 ? 169 LYS A HZ2  1  
ATOM   2689  H  HZ3  . LYS A 1 169 ? 12.899  36.253 35.815 1.00 0.00 ? 169 LYS A HZ3  1  
ATOM   2690  N  N    . GLU A 1 170 ? 14.203  31.391 30.063 1.00 0.00 ? 170 GLU A N    1  
ATOM   2691  C  CA   . GLU A 1 170 ? 14.983  30.646 29.044 1.00 0.00 ? 170 GLU A CA   1  
ATOM   2692  C  C    . GLU A 1 170 ? 14.440  29.235 28.867 1.00 0.00 ? 170 GLU A C    1  
ATOM   2693  O  O    . GLU A 1 170 ? 14.512  28.672 27.793 1.00 0.00 ? 170 GLU A O    1  
ATOM   2694  C  CB   . GLU A 1 170 ? 16.440  30.551 29.513 1.00 0.00 ? 170 GLU A CB   1  
ATOM   2695  C  CG   . GLU A 1 170 ? 16.947  31.947 29.878 1.00 0.00 ? 170 GLU A CG   1  
ATOM   2696  C  CD   . GLU A 1 170 ? 17.453  32.647 28.615 1.00 0.00 ? 170 GLU A CD   1  
ATOM   2697  O  OE1  . GLU A 1 170 ? 18.343  32.081 28.002 1.00 0.00 ? 170 GLU A OE1  1  
ATOM   2698  O  OE2  . GLU A 1 170 ? 16.921  33.709 28.333 1.00 0.00 ? 170 GLU A OE2  1  
ATOM   2699  H  H    . GLU A 1 170 ? 14.529  31.458 30.983 1.00 0.00 ? 170 GLU A H    1  
ATOM   2700  H  HA   . GLU A 1 170 ? 14.918  31.172 28.093 1.00 0.00 ? 170 GLU A HA   1  
ATOM   2701  H  HB2  . GLU A 1 170 ? 16.500  29.906 30.376 1.00 0.00 ? 170 GLU A HB2  1  
ATOM   2702  H  HB3  . GLU A 1 170 ? 17.049  30.139 28.721 1.00 0.00 ? 170 GLU A HB3  1  
ATOM   2703  H  HG2  . GLU A 1 170 ? 16.146  32.527 30.311 1.00 0.00 ? 170 GLU A HG2  1  
ATOM   2704  H  HG3  . GLU A 1 170 ? 17.756  31.867 30.589 1.00 0.00 ? 170 GLU A HG3  1  
ATOM   2705  N  N    . PHE A 1 171 ? 13.910  28.684 29.926 1.00 0.00 ? 171 PHE A N    1  
ATOM   2706  C  CA   . PHE A 1 171 ? 13.361  27.311 29.828 1.00 0.00 ? 171 PHE A CA   1  
ATOM   2707  C  C    . PHE A 1 171 ? 12.522  27.179 28.572 1.00 0.00 ? 171 PHE A C    1  
ATOM   2708  O  O    . PHE A 1 171 ? 12.291  26.094 28.080 1.00 0.00 ? 171 PHE A O    1  
ATOM   2709  C  CB   . PHE A 1 171 ? 12.468  27.056 31.051 1.00 0.00 ? 171 PHE A CB   1  
ATOM   2710  C  CG   . PHE A 1 171 ? 12.171  25.560 31.159 1.00 0.00 ? 171 PHE A CG   1  
ATOM   2711  C  CD1  . PHE A 1 171 ? 11.070  25.014 30.521 1.00 0.00 ? 171 PHE A CD1  1  
ATOM   2712  C  CD2  . PHE A 1 171 ? 12.993  24.732 31.905 1.00 0.00 ? 171 PHE A CD2  1  
ATOM   2713  C  CE1  . PHE A 1 171 ? 10.799  23.665 30.629 1.00 0.00 ? 171 PHE A CE1  1  
ATOM   2714  C  CE2  . PHE A 1 171 ? 12.719  23.385 32.009 1.00 0.00 ? 171 PHE A CE2  1  
ATOM   2715  C  CZ   . PHE A 1 171 ? 11.623  22.853 31.371 1.00 0.00 ? 171 PHE A CZ   1  
ATOM   2716  H  H    . PHE A 1 171 ? 13.867  29.177 30.771 1.00 0.00 ? 171 PHE A H    1  
ATOM   2717  H  HA   . PHE A 1 171 ? 14.184  26.598 29.788 1.00 0.00 ? 171 PHE A HA   1  
ATOM   2718  H  HB2  . PHE A 1 171 ? 12.972  27.385 31.947 1.00 0.00 ? 171 PHE A HB2  1  
ATOM   2719  H  HB3  . PHE A 1 171 ? 11.540  27.596 30.944 1.00 0.00 ? 171 PHE A HB3  1  
ATOM   2720  H  HD1  . PHE A 1 171 ? 10.421  25.647 29.936 1.00 0.00 ? 171 PHE A HD1  1  
ATOM   2721  H  HD2  . PHE A 1 171 ? 13.856  25.143 32.407 1.00 0.00 ? 171 PHE A HD2  1  
ATOM   2722  H  HE1  . PHE A 1 171 ? 9.937   23.247 30.129 1.00 0.00 ? 171 PHE A HE1  1  
ATOM   2723  H  HE2  . PHE A 1 171 ? 13.365  22.747 32.594 1.00 0.00 ? 171 PHE A HE2  1  
ATOM   2724  H  HZ   . PHE A 1 171 ? 11.409  21.798 31.455 1.00 0.00 ? 171 PHE A HZ   1  
ATOM   2725  N  N    . ILE A 1 172 ? 12.081  28.298 28.082 1.00 0.00 ? 172 ILE A N    1  
ATOM   2726  C  CA   . ILE A 1 172 ? 11.256  28.289 26.859 1.00 0.00 ? 172 ILE A CA   1  
ATOM   2727  C  C    . ILE A 1 172 ? 12.136  28.411 25.619 1.00 0.00 ? 172 ILE A C    1  
ATOM   2728  O  O    . ILE A 1 172 ? 11.886  27.779 24.606 1.00 0.00 ? 172 ILE A O    1  
ATOM   2729  C  CB   . ILE A 1 172 ? 10.313  29.488 26.930 1.00 0.00 ? 172 ILE A CB   1  
ATOM   2730  C  CG1  . ILE A 1 172 ? 9.549   29.456 28.247 1.00 0.00 ? 172 ILE A CG1  1  
ATOM   2731  C  CG2  . ILE A 1 172 ? 9.301   29.395 25.775 1.00 0.00 ? 172 ILE A CG2  1  
ATOM   2732  C  CD1  . ILE A 1 172 ? 9.014   30.856 28.556 1.00 0.00 ? 172 ILE A CD1  1  
ATOM   2733  H  H    . ILE A 1 172 ? 12.294  29.146 28.523 1.00 0.00 ? 172 ILE A H    1  
ATOM   2734  H  HA   . ILE A 1 172 ? 10.696  27.355 26.813 1.00 0.00 ? 172 ILE A HA   1  
ATOM   2735  H  HB   . ILE A 1 172 ? 10.896  30.410 26.870 1.00 0.00 ? 172 ILE A HB   1  
ATOM   2736  H  HG12 . ILE A 1 172 ? 8.727   28.761 28.172 1.00 0.00 ? 172 ILE A HG12 1  
ATOM   2737  H  HG13 . ILE A 1 172 ? 10.211  29.139 29.039 1.00 0.00 ? 172 ILE A HG13 1  
ATOM   2738  H  HG21 . ILE A 1 172 ? 8.753   28.467 25.844 1.00 0.00 ? 172 ILE A HG21 1  
ATOM   2739  H  HG22 . ILE A 1 172 ? 8.609   30.222 25.831 1.00 0.00 ? 172 ILE A HG22 1  
ATOM   2740  H  HG23 . ILE A 1 172 ? 9.822   29.430 24.830 1.00 0.00 ? 172 ILE A HG23 1  
ATOM   2741  H  HD11 . ILE A 1 172 ? 9.774   31.593 28.343 1.00 0.00 ? 172 ILE A HD11 1  
ATOM   2742  H  HD12 . ILE A 1 172 ? 8.143   31.055 27.949 1.00 0.00 ? 172 ILE A HD12 1  
ATOM   2743  H  HD13 . ILE A 1 172 ? 8.742   30.918 29.600 1.00 0.00 ? 172 ILE A HD13 1  
ATOM   2744  N  N    . GLU A 1 173 ? 13.162  29.213 25.719 1.00 0.00 ? 173 GLU A N    1  
ATOM   2745  C  CA   . GLU A 1 173 ? 14.062  29.382 24.556 1.00 0.00 ? 173 GLU A CA   1  
ATOM   2746  C  C    . GLU A 1 173 ? 15.055  28.237 24.474 1.00 0.00 ? 173 GLU A C    1  
ATOM   2747  O  O    . GLU A 1 173 ? 15.227  27.635 23.433 1.00 0.00 ? 173 GLU A O    1  
ATOM   2748  C  CB   . GLU A 1 173 ? 14.836  30.688 24.719 1.00 0.00 ? 173 GLU A CB   1  
ATOM   2749  C  CG   . GLU A 1 173 ? 13.875  31.793 25.172 1.00 0.00 ? 173 GLU A CG   1  
ATOM   2750  C  CD   . GLU A 1 173 ? 12.959  32.174 24.006 1.00 0.00 ? 173 GLU A CD   1  
ATOM   2751  O  OE1  . GLU A 1 173 ? 13.477  32.218 22.902 1.00 0.00 ? 173 GLU A OE1  1  
ATOM   2752  O  OE2  . GLU A 1 173 ? 11.793  32.401 24.286 1.00 0.00 ? 173 GLU A OE2  1  
ATOM   2753  H  H    . GLU A 1 173 ? 13.339  29.693 26.556 1.00 0.00 ? 173 GLU A H    1  
ATOM   2754  H  HA   . GLU A 1 173 ? 13.467  29.399 23.652 1.00 0.00 ? 173 GLU A HA   1  
ATOM   2755  H  HB2  . GLU A 1 173 ? 15.612  30.557 25.452 1.00 0.00 ? 173 GLU A HB2  1  
ATOM   2756  H  HB3  . GLU A 1 173 ? 15.282  30.959 23.773 1.00 0.00 ? 173 GLU A HB3  1  
ATOM   2757  H  HG2  . GLU A 1 173 ? 13.274  31.442 25.997 1.00 0.00 ? 173 GLU A HG2  1  
ATOM   2758  H  HG3  . GLU A 1 173 ? 14.436  32.661 25.483 1.00 0.00 ? 173 GLU A HG3  1  
ATOM   2759  N  N    . GLY A 1 174 ? 15.700  27.957 25.577 1.00 0.00 ? 174 GLY A N    1  
ATOM   2760  C  CA   . GLY A 1 174 ? 16.690  26.847 25.577 1.00 0.00 ? 174 GLY A CA   1  
ATOM   2761  C  C    . GLY A 1 174 ? 16.107  25.640 24.851 1.00 0.00 ? 174 GLY A C    1  
ATOM   2762  O  O    . GLY A 1 174 ? 16.827  24.766 24.409 1.00 0.00 ? 174 GLY A O    1  
ATOM   2763  H  H    . GLY A 1 174 ? 15.535  28.473 26.393 1.00 0.00 ? 174 GLY A H    1  
ATOM   2764  H  HA2  . GLY A 1 174 ? 17.591  27.168 25.075 1.00 0.00 ? 174 GLY A HA2  1  
ATOM   2765  H  HA3  . GLY A 1 174 ? 16.925  26.576 26.596 1.00 0.00 ? 174 GLY A HA3  1  
ATOM   2766  N  N    . THR A 1 175 ? 14.804  25.619 24.746 1.00 0.00 ? 175 THR A N    1  
ATOM   2767  C  CA   . THR A 1 175 ? 14.143  24.509 24.069 1.00 0.00 ? 175 THR A CA   1  
ATOM   2768  C  C    . THR A 1 175 ? 13.829  24.882 22.622 1.00 0.00 ? 175 THR A C    1  
ATOM   2769  O  O    . THR A 1 175 ? 13.847  24.042 21.744 1.00 0.00 ? 175 THR A O    1  
ATOM   2770  C  CB   . THR A 1 175 ? 12.840  24.250 24.802 1.00 0.00 ? 175 THR A CB   1  
ATOM   2771  O  OG1  . THR A 1 175 ? 12.670  25.359 25.659 1.00 0.00 ? 175 THR A OG1  1  
ATOM   2772  C  CG2  . THR A 1 175 ? 12.955  23.049 25.750 1.00 0.00 ? 175 THR A CG2  1  
ATOM   2773  H  H    . THR A 1 175 ? 14.264  26.339 25.121 1.00 0.00 ? 175 THR A H    1  
ATOM   2774  H  HA   . THR A 1 175 ? 14.788  23.633 24.089 1.00 0.00 ? 175 THR A HA   1  
ATOM   2775  H  HB   . THR A 1 175 ? 12.023  24.169 24.124 1.00 0.00 ? 175 THR A HB   1  
ATOM   2776  H  HG1  . THR A 1 175 ? 13.485  25.484 26.149 1.00 0.00 ? 175 THR A HG1  1  
ATOM   2777  H  HG21 . THR A 1 175 ? 13.547  22.282 25.291 1.00 0.00 ? 175 THR A HG21 1  
ATOM   2778  H  HG22 . THR A 1 175 ? 13.423  23.358 26.673 1.00 0.00 ? 175 THR A HG22 1  
ATOM   2779  H  HG23 . THR A 1 175 ? 11.971  22.658 25.964 1.00 0.00 ? 175 THR A HG23 1  
ATOM   2780  N  N    . LEU A 1 176 ? 13.540  26.145 22.401 1.00 0.00 ? 176 LEU A N    1  
ATOM   2781  C  CA   . LEU A 1 176 ? 13.222  26.590 21.016 1.00 0.00 ? 176 LEU A CA   1  
ATOM   2782  C  C    . LEU A 1 176 ? 14.446  26.445 20.113 1.00 0.00 ? 176 LEU A C    1  
ATOM   2783  O  O    . LEU A 1 176 ? 14.333  26.420 18.905 1.00 0.00 ? 176 LEU A O    1  
ATOM   2784  C  CB   . LEU A 1 176 ? 12.814  28.077 21.076 1.00 0.00 ? 176 LEU A CB   1  
ATOM   2785  C  CG   . LEU A 1 176 ? 11.664  28.349 20.099 1.00 0.00 ? 176 LEU A CG   1  
ATOM   2786  C  CD1  . LEU A 1 176 ? 12.130  28.062 18.669 1.00 0.00 ? 176 LEU A CD1  1  
ATOM   2787  C  CD2  . LEU A 1 176 ? 10.470  27.450 20.449 1.00 0.00 ? 176 LEU A CD2  1  
ATOM   2788  H  H    . LEU A 1 176 ? 13.536  26.797 23.148 1.00 0.00 ? 176 LEU A H    1  
ATOM   2789  H  HA   . LEU A 1 176 ? 12.413  25.978 20.623 1.00 0.00 ? 176 LEU A HA   1  
ATOM   2790  H  HB2  . LEU A 1 176 ? 12.493  28.316 22.073 1.00 0.00 ? 176 LEU A HB2  1  
ATOM   2791  H  HB3  . LEU A 1 176 ? 13.661  28.695 20.821 1.00 0.00 ? 176 LEU A HB3  1  
ATOM   2792  H  HG   . LEU A 1 176 ? 11.367  29.385 20.177 1.00 0.00 ? 176 LEU A HG   1  
ATOM   2793  H  HD11 . LEU A 1 176 ? 13.139  28.427 18.536 1.00 0.00 ? 176 LEU A HD11 1  
ATOM   2794  H  HD12 . LEU A 1 176 ? 12.108  27.002 18.481 1.00 0.00 ? 176 LEU A HD12 1  
ATOM   2795  H  HD13 . LEU A 1 176 ? 11.479  28.561 17.968 1.00 0.00 ? 176 LEU A HD13 1  
ATOM   2796  H  HD21 . LEU A 1 176 ? 10.630  26.990 21.413 1.00 0.00 ? 176 LEU A HD21 1  
ATOM   2797  H  HD22 . LEU A 1 176 ? 9.567   28.042 20.485 1.00 0.00 ? 176 LEU A HD22 1  
ATOM   2798  H  HD23 . LEU A 1 176 ? 10.356  26.680 19.703 1.00 0.00 ? 176 LEU A HD23 1  
ATOM   2799  N  N    . ALA A 1 177 ? 15.595  26.341 20.720 1.00 0.00 ? 177 ALA A N    1  
ATOM   2800  C  CA   . ALA A 1 177 ? 16.835  26.196 19.916 1.00 0.00 ? 177 ALA A CA   1  
ATOM   2801  C  C    . ALA A 1 177 ? 16.763  24.964 19.022 1.00 0.00 ? 177 ALA A C    1  
ATOM   2802  O  O    . ALA A 1 177 ? 16.228  25.013 17.932 1.00 0.00 ? 177 ALA A O    1  
ATOM   2803  C  CB   . ALA A 1 177 ? 18.020  26.036 20.880 1.00 0.00 ? 177 ALA A CB   1  
ATOM   2804  H  H    . ALA A 1 177 ? 15.641  26.358 21.700 1.00 0.00 ? 177 ALA A H    1  
ATOM   2805  H  HA   . ALA A 1 177 ? 16.959  27.081 19.293 1.00 0.00 ? 177 ALA A HA   1  
ATOM   2806  H  HB1  . ALA A 1 177 ? 17.848  25.192 21.531 1.00 0.00 ? 177 ALA A HB1  1  
ATOM   2807  H  HB2  . ALA A 1 177 ? 18.927  25.872 20.318 1.00 0.00 ? 177 ALA A HB2  1  
ATOM   2808  H  HB3  . ALA A 1 177 ? 18.127  26.929 21.477 1.00 0.00 ? 177 ALA A HB3  1  
ATOM   2809  N  N    . ASN A 1 178 ? 17.307  23.879 19.499 1.00 0.00 ? 178 ASN A N    1  
ATOM   2810  C  CA   . ASN A 1 178 ? 17.283  22.633 18.694 1.00 0.00 ? 178 ASN A CA   1  
ATOM   2811  C  C    . ASN A 1 178 ? 15.985  21.867 18.917 1.00 0.00 ? 178 ASN A C    1  
ATOM   2812  O  O    . ASN A 1 178 ? 15.806  21.231 19.937 1.00 0.00 ? 178 ASN A O    1  
ATOM   2813  C  CB   . ASN A 1 178 ? 18.460  21.751 19.137 1.00 0.00 ? 178 ASN A CB   1  
ATOM   2814  C  CG   . ASN A 1 178 ? 19.705  22.132 18.335 1.00 0.00 ? 178 ASN A CG   1  
ATOM   2815  O  OD1  . ASN A 1 178 ? 20.735  22.464 18.886 1.00 0.00 ? 178 ASN A OD1  1  
ATOM   2816  N  ND2  . ASN A 1 178 ? 19.653  22.096 17.031 1.00 0.00 ? 178 ASN A ND2  1  
ATOM   2817  H  H    . ASN A 1 178 ? 17.730  23.886 20.384 1.00 0.00 ? 178 ASN A H    1  
ATOM   2818  H  HA   . ASN A 1 178 ? 17.367  22.891 17.638 1.00 0.00 ? 178 ASN A HA   1  
ATOM   2819  H  HB2  . ASN A 1 178 ? 18.653  21.901 20.189 1.00 0.00 ? 178 ASN A HB2  1  
ATOM   2820  H  HB3  . ASN A 1 178 ? 18.225  20.712 18.961 1.00 0.00 ? 178 ASN A HB3  1  
ATOM   2821  H  HD21 . ASN A 1 178 ? 18.823  21.830 16.581 1.00 0.00 ? 178 ASN A HD21 1  
ATOM   2822  H  HD22 . ASN A 1 178 ? 20.442  22.337 16.502 1.00 0.00 ? 178 ASN A HD22 1  
ATOM   2823  N  N    . LYS A 1 179 ? 15.102  21.936 17.959 1.00 0.00 ? 179 LYS A N    1  
ATOM   2824  C  CA   . LYS A 1 179 ? 13.815  21.214 18.107 1.00 0.00 ? 179 LYS A CA   1  
ATOM   2825  C  C    . LYS A 1 179 ? 14.052  19.780 18.557 1.00 0.00 ? 179 LYS A C    1  
ATOM   2826  O  O    . LYS A 1 179 ? 13.135  19.095 18.963 1.00 0.00 ? 179 LYS A O    1  
ATOM   2827  C  CB   . LYS A 1 179 ? 13.104  21.195 16.745 1.00 0.00 ? 179 LYS A CB   1  
ATOM   2828  C  CG   . LYS A 1 179 ? 13.996  20.488 15.722 1.00 0.00 ? 179 LYS A CG   1  
ATOM   2829  C  CD   . LYS A 1 179 ? 13.194  20.258 14.437 1.00 0.00 ? 179 LYS A CD   1  
ATOM   2830  C  CE   . LYS A 1 179 ? 14.078  19.541 13.413 1.00 0.00 ? 179 LYS A CE   1  
ATOM   2831  N  NZ   . LYS A 1 179 ? 15.120  20.468 12.885 1.00 0.00 ? 179 LYS A NZ   1  
ATOM   2832  H  H    . LYS A 1 179 ? 15.287  22.457 17.150 1.00 0.00 ? 179 LYS A H    1  
ATOM   2833  H  HA   . LYS A 1 179 ? 13.207  21.723 18.854 1.00 0.00 ? 179 LYS A HA   1  
ATOM   2834  H  HB2  . LYS A 1 179 ? 12.166  20.668 16.834 1.00 0.00 ? 179 LYS A HB2  1  
ATOM   2835  H  HB3  . LYS A 1 179 ? 12.912  22.208 16.424 1.00 0.00 ? 179 LYS A HB3  1  
ATOM   2836  H  HG2  . LYS A 1 179 ? 14.858  21.102 15.507 1.00 0.00 ? 179 LYS A HG2  1  
ATOM   2837  H  HG3  . LYS A 1 179 ? 14.326  19.540 16.120 1.00 0.00 ? 179 LYS A HG3  1  
ATOM   2838  H  HD2  . LYS A 1 179 ? 12.327  19.652 14.655 1.00 0.00 ? 179 LYS A HD2  1  
ATOM   2839  H  HD3  . LYS A 1 179 ? 12.871  21.206 14.036 1.00 0.00 ? 179 LYS A HD3  1  
ATOM   2840  H  HE2  . LYS A 1 179 ? 14.562  18.695 13.879 1.00 0.00 ? 179 LYS A HE2  1  
ATOM   2841  H  HE3  . LYS A 1 179 ? 13.470  19.191 12.593 1.00 0.00 ? 179 LYS A HE3  1  
ATOM   2842  H  HZ1  . LYS A 1 179 ? 14.718  21.422 12.791 1.00 0.00 ? 179 LYS A HZ1  1  
ATOM   2843  H  HZ2  . LYS A 1 179 ? 15.926  20.493 13.540 1.00 0.00 ? 179 LYS A HZ2  1  
ATOM   2844  H  HZ3  . LYS A 1 179 ? 15.441  20.133 11.953 1.00 0.00 ? 179 LYS A HZ3  1  
ATOM   2845  N  N    . GLU A 1 180 ? 15.280  19.349 18.477 1.00 0.00 ? 180 GLU A N    1  
ATOM   2846  C  CA   . GLU A 1 180 ? 15.591  17.963 18.896 1.00 0.00 ? 180 GLU A CA   1  
ATOM   2847  C  C    . GLU A 1 180 ? 15.794  17.890 20.404 1.00 0.00 ? 180 GLU A C    1  
ATOM   2848  O  O    . GLU A 1 180 ? 16.092  16.843 20.944 1.00 0.00 ? 180 GLU A O    1  
ATOM   2849  C  CB   . GLU A 1 180 ? 16.887  17.523 18.201 1.00 0.00 ? 180 GLU A CB   1  
ATOM   2850  C  CG   . GLU A 1 180 ? 16.805  16.026 17.897 1.00 0.00 ? 180 GLU A CG   1  
ATOM   2851  C  CD   . GLU A 1 180 ? 17.938  15.641 16.945 1.00 0.00 ? 180 GLU A CD   1  
ATOM   2852  O  OE1  . GLU A 1 180 ? 18.648  16.552 16.551 1.00 0.00 ? 180 GLU A OE1  1  
ATOM   2853  O  OE2  . GLU A 1 180 ? 18.028  14.458 16.662 1.00 0.00 ? 180 GLU A OE2  1  
ATOM   2854  H  H    . GLU A 1 180 ? 15.990  19.937 18.140 1.00 0.00 ? 180 GLU A H    1  
ATOM   2855  H  HA   . GLU A 1 180 ? 14.761  17.314 18.617 1.00 0.00 ? 180 GLU A HA   1  
ATOM   2856  H  HB2  . GLU A 1 180 ? 17.012  18.074 17.280 1.00 0.00 ? 180 GLU A HB2  1  
ATOM   2857  H  HB3  . GLU A 1 180 ? 17.730  17.718 18.848 1.00 0.00 ? 180 GLU A HB3  1  
ATOM   2858  H  HG2  . GLU A 1 180 ? 16.902  15.462 18.813 1.00 0.00 ? 180 GLU A HG2  1  
ATOM   2859  H  HG3  . GLU A 1 180 ? 15.857  15.798 17.436 1.00 0.00 ? 180 GLU A HG3  1  
ATOM   2860  N  N    . ILE A 1 181 ? 15.628  19.007 21.057 1.00 0.00 ? 181 ILE A N    1  
ATOM   2861  C  CA   . ILE A 1 181 ? 15.806  19.024 22.528 1.00 0.00 ? 181 ILE A CA   1  
ATOM   2862  C  C    . ILE A 1 181 ? 14.542  18.544 23.228 1.00 0.00 ? 181 ILE A C    1  
ATOM   2863  O  O    . ILE A 1 181 ? 14.548  17.539 23.911 1.00 0.00 ? 181 ILE A O    1  
ATOM   2864  C  CB   . ILE A 1 181 ? 16.102  20.469 22.957 1.00 0.00 ? 181 ILE A CB   1  
ATOM   2865  C  CG1  . ILE A 1 181 ? 17.596  20.731 22.861 1.00 0.00 ? 181 ILE A CG1  1  
ATOM   2866  C  CG2  . ILE A 1 181 ? 15.666  20.665 24.425 1.00 0.00 ? 181 ILE A CG2  1  
ATOM   2867  C  CD1  . ILE A 1 181 ? 17.863  22.209 23.147 1.00 0.00 ? 181 ILE A CD1  1  
ATOM   2868  H  H    . ILE A 1 181 ? 15.389  19.827 20.579 1.00 0.00 ? 181 ILE A H    1  
ATOM   2869  H  HA   . ILE A 1 181 ? 16.630  18.363 22.793 1.00 0.00 ? 181 ILE A HA   1  
ATOM   2870  H  HB   . ILE A 1 181 ? 15.571  21.157 22.296 1.00 0.00 ? 181 ILE A HB   1  
ATOM   2871  H  HG12 . ILE A 1 181 ? 18.118  20.121 23.583 1.00 0.00 ? 181 ILE A HG12 1  
ATOM   2872  H  HG13 . ILE A 1 181 ? 17.944  20.484 21.869 1.00 0.00 ? 181 ILE A HG13 1  
ATOM   2873  H  HG21 . ILE A 1 181 ? 16.119  19.908 25.046 1.00 0.00 ? 181 ILE A HG21 1  
ATOM   2874  H  HG22 . ILE A 1 181 ? 15.979  21.641 24.771 1.00 0.00 ? 181 ILE A HG22 1  
ATOM   2875  H  HG23 . ILE A 1 181 ? 14.594  20.591 24.501 1.00 0.00 ? 181 ILE A HG23 1  
ATOM   2876  H  HD11 . ILE A 1 181 ? 16.980  22.790 22.925 1.00 0.00 ? 181 ILE A HD11 1  
ATOM   2877  H  HD12 . ILE A 1 181 ? 18.121  22.339 24.188 1.00 0.00 ? 181 ILE A HD12 1  
ATOM   2878  H  HD13 . ILE A 1 181 ? 18.680  22.557 22.533 1.00 0.00 ? 181 ILE A HD13 1  
ATOM   2879  N  N    . LEU A 1 182 ? 13.476  19.275 23.046 1.00 0.00 ? 182 LEU A N    1  
ATOM   2880  C  CA   . LEU A 1 182 ? 12.207  18.878 23.693 1.00 0.00 ? 182 LEU A CA   1  
ATOM   2881  C  C    . LEU A 1 182 ? 11.964  17.386 23.537 1.00 0.00 ? 182 LEU A C    1  
ATOM   2882  O  O    . LEU A 1 182 ? 11.179  16.811 24.255 1.00 0.00 ? 182 LEU A O    1  
ATOM   2883  C  CB   . LEU A 1 182 ? 11.053  19.649 23.030 1.00 0.00 ? 182 LEU A CB   1  
ATOM   2884  C  CG   . LEU A 1 182 ? 11.206  19.602 21.502 1.00 0.00 ? 182 LEU A CG   1  
ATOM   2885  C  CD1  . LEU A 1 182 ? 10.757  18.231 20.978 1.00 0.00 ? 182 LEU A CD1  1  
ATOM   2886  C  CD2  . LEU A 1 182 ? 10.325  20.690 20.878 1.00 0.00 ? 182 LEU A CD2  1  
ATOM   2887  H  H    . LEU A 1 182 ? 13.515  20.078 22.486 1.00 0.00 ? 182 LEU A H    1  
ATOM   2888  H  HA   . LEU A 1 182 ? 12.268  19.114 24.755 1.00 0.00 ? 182 LEU A HA   1  
ATOM   2889  H  HB2  . LEU A 1 182 ? 10.111  19.206 23.315 1.00 0.00 ? 182 LEU A HB2  1  
ATOM   2890  H  HB3  . LEU A 1 182 ? 11.071  20.676 23.360 1.00 0.00 ? 182 LEU A HB3  1  
ATOM   2891  H  HG   . LEU A 1 182 ? 12.237  19.773 21.233 1.00 0.00 ? 182 LEU A HG   1  
ATOM   2892  H  HD11 . LEU A 1 182 ? 10.138  17.741 21.713 1.00 0.00 ? 182 LEU A HD11 1  
ATOM   2893  H  HD12 . LEU A 1 182 ? 10.192  18.358 20.066 1.00 0.00 ? 182 LEU A HD12 1  
ATOM   2894  H  HD13 . LEU A 1 182 ? 11.622  17.619 20.775 1.00 0.00 ? 182 LEU A HD13 1  
ATOM   2895  H  HD21 . LEU A 1 182 ? 10.559  21.647 21.320 1.00 0.00 ? 182 LEU A HD21 1  
ATOM   2896  H  HD22 . LEU A 1 182 ? 10.505  20.739 19.814 1.00 0.00 ? 182 LEU A HD22 1  
ATOM   2897  H  HD23 . LEU A 1 182 ? 9.284   20.462 21.052 1.00 0.00 ? 182 LEU A HD23 1  
ATOM   2898  N  N    . ARG A 1 183 ? 12.649  16.785 22.599 1.00 0.00 ? 183 ARG A N    1  
ATOM   2899  C  CA   . ARG A 1 183 ? 12.470  15.321 22.380 1.00 0.00 ? 183 ARG A CA   1  
ATOM   2900  C  C    . ARG A 1 183 ? 13.032  14.522 23.551 1.00 0.00 ? 183 ARG A C    1  
ATOM   2901  O  O    . ARG A 1 183 ? 12.531  13.465 23.880 1.00 0.00 ? 183 ARG A O    1  
ATOM   2902  C  CB   . ARG A 1 183 ? 13.229  14.917 21.107 1.00 0.00 ? 183 ARG A CB   1  
ATOM   2903  C  CG   . ARG A 1 183 ? 12.907  13.455 20.777 1.00 0.00 ? 183 ARG A CG   1  
ATOM   2904  C  CD   . ARG A 1 183 ? 12.779  13.296 19.261 1.00 0.00 ? 183 ARG A CD   1  
ATOM   2905  N  NE   . ARG A 1 183 ? 13.952  13.940 18.607 1.00 0.00 ? 183 ARG A NE   1  
ATOM   2906  C  CZ   . ARG A 1 183 ? 14.088  13.858 17.313 1.00 0.00 ? 183 ARG A CZ   1  
ATOM   2907  N  NH1  . ARG A 1 183 ? 13.461  14.718 16.557 1.00 0.00 ? 183 ARG A NH1  1  
ATOM   2908  N  NH2  . ARG A 1 183 ? 14.845  12.918 16.816 1.00 0.00 ? 183 ARG A NH2  1  
ATOM   2909  H  H    . ARG A 1 183 ? 13.269  17.297 22.039 1.00 0.00 ? 183 ARG A H    1  
ATOM   2910  H  HA   . ARG A 1 183 ? 11.406  15.106 22.281 1.00 0.00 ? 183 ARG A HA   1  
ATOM   2911  H  HB2  . ARG A 1 183 ? 12.926  15.550 20.285 1.00 0.00 ? 183 ARG A HB2  1  
ATOM   2912  H  HB3  . ARG A 1 183 ? 14.292  15.028 21.265 1.00 0.00 ? 183 ARG A HB3  1  
ATOM   2913  H  HG2  . ARG A 1 183 ? 13.698  12.817 21.144 1.00 0.00 ? 183 ARG A HG2  1  
ATOM   2914  H  HG3  . ARG A 1 183 ? 11.978  13.173 21.250 1.00 0.00 ? 183 ARG A HG3  1  
ATOM   2915  H  HD2  . ARG A 1 183 ? 12.757  12.246 19.003 1.00 0.00 ? 183 ARG A HD2  1  
ATOM   2916  H  HD3  . ARG A 1 183 ? 11.872  13.769 18.917 1.00 0.00 ? 183 ARG A HD3  1  
ATOM   2917  H  HE   . ARG A 1 183 ? 14.616  14.421 19.145 1.00 0.00 ? 183 ARG A HE   1  
ATOM   2918  H  HH11 . ARG A 1 183 ? 12.889  15.424 16.973 1.00 0.00 ? 183 ARG A HH11 1  
ATOM   2919  H  HH12 . ARG A 1 183 ? 13.553  14.670 15.563 1.00 0.00 ? 183 ARG A HH12 1  
ATOM   2920  H  HH21 . ARG A 1 183 ? 15.309  12.276 17.426 1.00 0.00 ? 183 ARG A HH21 1  
ATOM   2921  H  HH22 . ARG A 1 183 ? 14.960  12.840 15.825 1.00 0.00 ? 183 ARG A HH22 1  
ATOM   2922  N  N    . LEU A 1 184 ? 14.072  15.031 24.151 1.00 0.00 ? 184 LEU A N    1  
ATOM   2923  C  CA   . LEU A 1 184 ? 14.671  14.307 25.299 1.00 0.00 ? 184 LEU A CA   1  
ATOM   2924  C  C    . LEU A 1 184 ? 13.822  14.504 26.544 1.00 0.00 ? 184 LEU A C    1  
ATOM   2925  O  O    . LEU A 1 184 ? 13.191  13.583 27.025 1.00 0.00 ? 184 LEU A O    1  
ATOM   2926  C  CB   . LEU A 1 184 ? 16.071  14.880 25.558 1.00 0.00 ? 184 LEU A CB   1  
ATOM   2927  C  CG   . LEU A 1 184 ? 16.855  14.895 24.246 1.00 0.00 ? 184 LEU A CG   1  
ATOM   2928  C  CD1  . LEU A 1 184 ? 18.241  15.487 24.501 1.00 0.00 ? 184 LEU A CD1  1  
ATOM   2929  C  CD2  . LEU A 1 184 ? 17.006  13.461 23.735 1.00 0.00 ? 184 LEU A CD2  1  
ATOM   2930  H  H    . LEU A 1 184 ? 14.457  15.879 23.844 1.00 0.00 ? 184 LEU A H    1  
ATOM   2931  H  HA   . LEU A 1 184 ? 14.720  13.244 25.065 1.00 0.00 ? 184 LEU A HA   1  
ATOM   2932  H  HB2  . LEU A 1 184 ? 15.987  15.885 25.944 1.00 0.00 ? 184 LEU A HB2  1  
ATOM   2933  H  HB3  . LEU A 1 184 ? 16.585  14.264 26.282 1.00 0.00 ? 184 LEU A HB3  1  
ATOM   2934  H  HG   . LEU A 1 184 ? 16.332  15.491 23.513 1.00 0.00 ? 184 LEU A HG   1  
ATOM   2935  H  HD11 . LEU A 1 184 ? 18.657  15.062 25.402 1.00 0.00 ? 184 LEU A HD11 1  
ATOM   2936  H  HD12 . LEU A 1 184 ? 18.893  15.261 23.669 1.00 0.00 ? 184 LEU A HD12 1  
ATOM   2937  H  HD13 . LEU A 1 184 ? 18.165  16.557 24.614 1.00 0.00 ? 184 LEU A HD13 1  
ATOM   2938  H  HD21 . LEU A 1 184 ? 17.297  12.813 24.549 1.00 0.00 ? 184 LEU A HD21 1  
ATOM   2939  H  HD22 . LEU A 1 184 ? 16.066  13.119 23.326 1.00 0.00 ? 184 LEU A HD22 1  
ATOM   2940  H  HD23 . LEU A 1 184 ? 17.763  13.426 22.966 1.00 0.00 ? 184 LEU A HD23 1  
ATOM   2941  N  N    . ILE A 1 185 ? 13.824  15.703 27.048 1.00 0.00 ? 185 ILE A N    1  
ATOM   2942  C  CA   . ILE A 1 185 ? 13.025  15.984 28.258 1.00 0.00 ? 185 ILE A CA   1  
ATOM   2943  C  C    . ILE A 1 185 ? 11.544  15.901 27.933 1.00 0.00 ? 185 ILE A C    1  
ATOM   2944  O  O    . ILE A 1 185 ? 10.701  16.264 28.731 1.00 0.00 ? 185 ILE A O    1  
ATOM   2945  C  CB   . ILE A 1 185 ? 13.359  17.395 28.721 1.00 0.00 ? 185 ILE A CB   1  
ATOM   2946  C  CG1  . ILE A 1 185 ? 12.811  18.415 27.721 1.00 0.00 ? 185 ILE A CG1  1  
ATOM   2947  C  CG2  . ILE A 1 185 ? 14.884  17.529 28.769 1.00 0.00 ? 185 ILE A CG2  1  
ATOM   2948  C  CD1  . ILE A 1 185 ? 11.711  19.233 28.395 1.00 0.00 ? 185 ILE A CD1  1  
ATOM   2949  H  H    . ILE A 1 185 ? 14.350  16.414 26.629 1.00 0.00 ? 185 ILE A H    1  
ATOM   2950  H  HA   . ILE A 1 185 ? 13.267  15.250 29.028 1.00 0.00 ? 185 ILE A HA   1  
ATOM   2951  H  HB   . ILE A 1 185 ? 12.917  17.570 29.704 1.00 0.00 ? 185 ILE A HB   1  
ATOM   2952  H  HG12 . ILE A 1 185 ? 13.605  19.074 27.399 1.00 0.00 ? 185 ILE A HG12 1  
ATOM   2953  H  HG13 . ILE A 1 185 ? 12.407  17.904 26.860 1.00 0.00 ? 185 ILE A HG13 1  
ATOM   2954  H  HG21 . ILE A 1 185 ? 15.304  17.237 27.818 1.00 0.00 ? 185 ILE A HG21 1  
ATOM   2955  H  HG22 . ILE A 1 185 ? 15.153  18.552 28.976 1.00 0.00 ? 185 ILE A HG22 1  
ATOM   2956  H  HG23 . ILE A 1 185 ? 15.280  16.891 29.545 1.00 0.00 ? 185 ILE A HG23 1  
ATOM   2957  H  HD11 . ILE A 1 185 ? 12.060  19.592 29.352 1.00 0.00 ? 185 ILE A HD11 1  
ATOM   2958  H  HD12 . ILE A 1 185 ? 11.451  20.077 27.773 1.00 0.00 ? 185 ILE A HD12 1  
ATOM   2959  H  HD13 . ILE A 1 185 ? 10.838  18.618 28.544 1.00 0.00 ? 185 ILE A HD13 1  
ATOM   2960  N  N    . GLN A 1 186 ? 11.262  15.426 26.751 1.00 0.00 ? 186 GLN A N    1  
ATOM   2961  C  CA   . GLN A 1 186 ? 9.855   15.297 26.316 1.00 0.00 ? 186 GLN A CA   1  
ATOM   2962  C  C    . GLN A 1 186 ? 8.976   14.760 27.430 1.00 0.00 ? 186 GLN A C    1  
ATOM   2963  O  O    . GLN A 1 186 ? 9.448   14.112 28.345 1.00 0.00 ? 186 GLN A O    1  
ATOM   2964  C  CB   . GLN A 1 186 ? 9.806   14.310 25.144 1.00 0.00 ? 186 GLN A CB   1  
ATOM   2965  C  CG   . GLN A 1 186 ? 10.104  12.900 25.660 1.00 0.00 ? 186 GLN A CG   1  
ATOM   2966  C  CD   . GLN A 1 186 ? 8.810   12.260 26.166 1.00 0.00 ? 186 GLN A CD   1  
ATOM   2967  O  OE1  . GLN A 1 186 ? 7.816   12.209 25.470 1.00 0.00 ? 186 GLN A OE1  1  
ATOM   2968  N  NE2  . GLN A 1 186 ? 8.782   11.754 27.370 1.00 0.00 ? 186 GLN A NE2  1  
ATOM   2969  H  H    . GLN A 1 186 ? 11.987  15.158 26.148 1.00 0.00 ? 186 GLN A H    1  
ATOM   2970  H  HA   . GLN A 1 186 ? 9.484   16.275 26.011 1.00 0.00 ? 186 GLN A HA   1  
ATOM   2971  H  HB2  . GLN A 1 186 ? 8.831   14.333 24.691 1.00 0.00 ? 186 GLN A HB2  1  
ATOM   2972  H  HB3  . GLN A 1 186 ? 10.540  14.585 24.410 1.00 0.00 ? 186 GLN A HB3  1  
ATOM   2973  H  HG2  . GLN A 1 186 ? 10.512  12.297 24.862 1.00 0.00 ? 186 GLN A HG2  1  
ATOM   2974  H  HG3  . GLN A 1 186 ? 10.817  12.950 26.470 1.00 0.00 ? 186 GLN A HG3  1  
ATOM   2975  H  HE21 . GLN A 1 186 ? 9.582   11.790 27.934 1.00 0.00 ? 186 GLN A HE21 1  
ATOM   2976  H  HE22 . GLN A 1 186 ? 7.960   11.342 27.709 1.00 0.00 ? 186 GLN A HE22 1  
ATOM   2977  N  N    . PHE A 1 187 ? 7.706   15.038 27.323 1.00 0.00 ? 187 PHE A N    1  
ATOM   2978  C  CA   . PHE A 1 187 ? 6.754   14.562 28.352 1.00 0.00 ? 187 PHE A CA   1  
ATOM   2979  C  C    . PHE A 1 187 ? 5.491   14.035 27.692 1.00 0.00 ? 187 PHE A C    1  
ATOM   2980  O  O    . PHE A 1 187 ? 4.569   14.781 27.429 1.00 0.00 ? 187 PHE A O    1  
ATOM   2981  C  CB   . PHE A 1 187 ? 6.384   15.750 29.251 1.00 0.00 ? 187 PHE A CB   1  
ATOM   2982  C  CG   . PHE A 1 187 ? 6.441   17.038 28.428 1.00 0.00 ? 187 PHE A CG   1  
ATOM   2983  C  CD1  . PHE A 1 187 ? 7.648   17.681 28.208 1.00 0.00 ? 187 PHE A CD1  1  
ATOM   2984  C  CD2  . PHE A 1 187 ? 5.286   17.577 27.888 1.00 0.00 ? 187 PHE A CD2  1  
ATOM   2985  C  CE1  . PHE A 1 187 ? 7.696   18.841 27.462 1.00 0.00 ? 187 PHE A CE1  1  
ATOM   2986  C  CE2  . PHE A 1 187 ? 5.338   18.737 27.142 1.00 0.00 ? 187 PHE A CE2  1  
ATOM   2987  C  CZ   . PHE A 1 187 ? 6.541   19.367 26.930 1.00 0.00 ? 187 PHE A CZ   1  
ATOM   2988  H  H    . PHE A 1 187 ? 7.380   15.563 26.560 1.00 0.00 ? 187 PHE A H    1  
ATOM   2989  H  HA   . PHE A 1 187 ? 7.216   13.763 28.930 1.00 0.00 ? 187 PHE A HA   1  
ATOM   2990  H  HB2  . PHE A 1 187 ? 5.385   15.618 29.641 1.00 0.00 ? 187 PHE A HB2  1  
ATOM   2991  H  HB3  . PHE A 1 187 ? 7.082   15.819 30.072 1.00 0.00 ? 187 PHE A HB3  1  
ATOM   2992  H  HD1  . PHE A 1 187 ? 8.558   17.272 28.622 1.00 0.00 ? 187 PHE A HD1  1  
ATOM   2993  H  HD2  . PHE A 1 187 ? 4.337   17.088 28.051 1.00 0.00 ? 187 PHE A HD2  1  
ATOM   2994  H  HE1  . PHE A 1 187 ? 8.642   19.335 27.291 1.00 0.00 ? 187 PHE A HE1  1  
ATOM   2995  H  HE2  . PHE A 1 187 ? 4.432   19.149 26.723 1.00 0.00 ? 187 PHE A HE2  1  
ATOM   2996  H  HZ   . PHE A 1 187 ? 6.580   20.275 26.346 1.00 0.00 ? 187 PHE A HZ   1  
ATOM   2997  N  N    . GLU A 1 188 ? 5.474   12.756 27.429 1.00 0.00 ? 188 GLU A N    1  
ATOM   2998  C  CA   . GLU A 1 188 ? 4.280   12.153 26.784 1.00 0.00 ? 188 GLU A CA   1  
ATOM   2999  C  C    . GLU A 1 188 ? 4.212   12.536 25.310 1.00 0.00 ? 188 GLU A C    1  
ATOM   3000  O  O    . GLU A 1 188 ? 4.404   11.637 24.508 1.00 0.00 ? 188 GLU A O    1  
ATOM   3001  C  CB   . GLU A 1 188 ? 3.020   12.679 27.487 1.00 0.00 ? 188 GLU A CB   1  
ATOM   3002  C  CG   . GLU A 1 188 ? 1.966   11.575 27.499 1.00 0.00 ? 188 GLU A CG   1  
ATOM   3003  C  CD   . GLU A 1 188 ? 1.965   10.867 26.141 1.00 0.00 ? 188 GLU A CD   1  
ATOM   3004  O  OE1  . GLU A 1 188 ? 1.381   11.436 25.234 1.00 0.00 ? 188 GLU A OE1  1  
ATOM   3005  O  OE2  . GLU A 1 188 ? 2.551   9.797  26.088 1.00 0.00 ? 188 GLU A OE2  1  
ATOM   3006  H  H    . GLU A 1 188 ? 6.246   12.195 27.657 1.00 0.00 ? 188 GLU A H    1  
ATOM   3007  H  HA   . GLU A 1 188 ? 4.344   11.068 26.864 1.00 0.00 ? 188 GLU A HA   1  
ATOM   3008  H  HB2  . GLU A 1 188 ? 3.261   12.966 28.500 1.00 0.00 ? 188 GLU A HB2  1  
ATOM   3009  H  HB3  . GLU A 1 188 ? 2.637   13.537 26.955 1.00 0.00 ? 188 GLU A HB3  1  
ATOM   3010  H  HG2  . GLU A 1 188 ? 2.193   10.859 28.275 1.00 0.00 ? 188 GLU A HG2  1  
ATOM   3011  H  HG3  . GLU A 1 188 ? 0.990   12.002 27.680 1.00 0.00 ? 188 GLU A HG3  1  
HETATM 3012  CA CA   . CA  B 2 .   ? -5.894  23.373 42.162 1.00 0.00 ? 500 CA  A CA   1  
HETATM 3013  CA CA   . CA  C 2 .   ? 13.006  25.047 41.723 1.00 0.00 ? 501 CA  A CA   1  
HETATM 3014  C  C1   . MYR D 3 .   ? -35.687 22.221 31.772 1.00 0.00 ? 502 MYR A C1   1  
HETATM 3015  O  O1   . MYR D 3 .   ? -36.706 22.202 31.111 1.00 0.00 ? 502 MYR A O1   1  
HETATM 3016  C  C2   . MYR D 3 .   ? -35.029 20.922 32.241 1.00 0.00 ? 502 MYR A C2   1  
HETATM 3017  C  C3   . MYR D 3 .   ? -33.612 20.839 31.671 1.00 0.00 ? 502 MYR A C3   1  
HETATM 3018  C  C4   . MYR D 3 .   ? -33.686 20.412 30.203 1.00 0.00 ? 502 MYR A C4   1  
HETATM 3019  C  C5   . MYR D 3 .   ? -32.277 20.096 29.699 1.00 0.00 ? 502 MYR A C5   1  
HETATM 3020  C  C6   . MYR D 3 .   ? -32.319 19.896 28.180 1.00 0.00 ? 502 MYR A C6   1  
HETATM 3021  C  C7   . MYR D 3 .   ? -31.603 18.590 27.825 1.00 0.00 ? 502 MYR A C7   1  
HETATM 3022  C  C8   . MYR D 3 .   ? -32.533 17.411 28.120 1.00 0.00 ? 502 MYR A C8   1  
HETATM 3023  C  C9   . MYR D 3 .   ? -31.997 16.161 27.418 1.00 0.00 ? 502 MYR A C9   1  
HETATM 3024  C  C10  . MYR D 3 .   ? -30.858 15.568 28.249 1.00 0.00 ? 502 MYR A C10  1  
HETATM 3025  C  C11  . MYR D 3 .   ? -30.492 14.191 27.689 1.00 0.00 ? 502 MYR A C11  1  
HETATM 3026  C  C12  . MYR D 3 .   ? -30.040 14.344 26.235 1.00 0.00 ? 502 MYR A C12  1  
HETATM 3027  C  C13  . MYR D 3 .   ? -29.253 13.099 25.819 1.00 0.00 ? 502 MYR A C13  1  
HETATM 3028  C  C14  . MYR D 3 .   ? -28.754 13.275 24.384 1.00 0.00 ? 502 MYR A C14  1  
HETATM 3029  H  H21  . MYR D 3 .   ? -34.990 20.911 33.320 1.00 0.00 ? 502 MYR A H21  1  
HETATM 3030  H  H22  . MYR D 3 .   ? -35.613 20.082 31.895 1.00 0.00 ? 502 MYR A H22  1  
HETATM 3031  H  H31  . MYR D 3 .   ? -33.133 21.805 31.744 1.00 0.00 ? 502 MYR A H31  1  
HETATM 3032  H  H32  . MYR D 3 .   ? -33.037 20.116 32.230 1.00 0.00 ? 502 MYR A H32  1  
HETATM 3033  H  H41  . MYR D 3 .   ? -34.310 19.535 30.112 1.00 0.00 ? 502 MYR A H41  1  
HETATM 3034  H  H42  . MYR D 3 .   ? -34.112 21.211 29.614 1.00 0.00 ? 502 MYR A H42  1  
HETATM 3035  H  H51  . MYR D 3 .   ? -31.614 20.915 29.938 1.00 0.00 ? 502 MYR A H51  1  
HETATM 3036  H  H52  . MYR D 3 .   ? -31.915 19.196 30.174 1.00 0.00 ? 502 MYR A H52  1  
HETATM 3037  H  H61  . MYR D 3 .   ? -33.345 19.849 27.848 1.00 0.00 ? 502 MYR A H61  1  
HETATM 3038  H  H62  . MYR D 3 .   ? -31.826 20.724 27.692 1.00 0.00 ? 502 MYR A H62  1  
HETATM 3039  H  H71  . MYR D 3 .   ? -31.343 18.593 26.777 1.00 0.00 ? 502 MYR A H71  1  
HETATM 3040  H  H72  . MYR D 3 .   ? -30.702 18.498 28.413 1.00 0.00 ? 502 MYR A H72  1  
HETATM 3041  H  H81  . MYR D 3 .   ? -32.573 17.238 29.186 1.00 0.00 ? 502 MYR A H81  1  
HETATM 3042  H  H82  . MYR D 3 .   ? -33.526 17.633 27.760 1.00 0.00 ? 502 MYR A H82  1  
HETATM 3043  H  H91  . MYR D 3 .   ? -32.790 15.433 27.316 1.00 0.00 ? 502 MYR A H91  1  
HETATM 3044  H  H92  . MYR D 3 .   ? -31.631 16.424 26.437 1.00 0.00 ? 502 MYR A H92  1  
HETATM 3045  H  H101 . MYR D 3 .   ? -29.997 16.219 28.202 1.00 0.00 ? 502 MYR A H101 1  
HETATM 3046  H  H102 . MYR D 3 .   ? -31.172 15.469 29.278 1.00 0.00 ? 502 MYR A H102 1  
HETATM 3047  H  H111 . MYR D 3 .   ? -29.691 13.763 28.274 1.00 0.00 ? 502 MYR A H111 1  
HETATM 3048  H  H112 . MYR D 3 .   ? -31.352 13.540 27.735 1.00 0.00 ? 502 MYR A H112 1  
HETATM 3049  H  H121 . MYR D 3 .   ? -30.903 14.458 25.596 1.00 0.00 ? 502 MYR A H121 1  
HETATM 3050  H  H122 . MYR D 3 .   ? -29.412 15.219 26.140 1.00 0.00 ? 502 MYR A H122 1  
HETATM 3051  H  H131 . MYR D 3 .   ? -28.411 12.964 26.482 1.00 0.00 ? 502 MYR A H131 1  
HETATM 3052  H  H132 . MYR D 3 .   ? -29.893 12.231 25.878 1.00 0.00 ? 502 MYR A H132 1  
HETATM 3053  H  H141 . MYR D 3 .   ? -29.533 12.995 23.690 1.00 0.00 ? 502 MYR A H141 1  
HETATM 3054  H  H142 . MYR D 3 .   ? -27.890 12.650 24.219 1.00 0.00 ? 502 MYR A H142 1  
HETATM 3055  H  H143 . MYR D 3 .   ? -28.483 14.307 24.217 1.00 0.00 ? 502 MYR A H143 1  
ATOM   3056  N  N    . GLY A 1 1   ? -21.551 26.504 49.899 1.00 0.00 ? 1   GLY A N    2  
ATOM   3057  C  CA   . GLY A 1 1   ? -20.566 27.596 50.139 1.00 0.00 ? 1   GLY A CA   2  
ATOM   3058  C  C    . GLY A 1 1   ? -20.866 28.791 49.233 1.00 0.00 ? 1   GLY A C    2  
ATOM   3059  O  O    . GLY A 1 1   ? -21.816 29.516 49.453 1.00 0.00 ? 1   GLY A O    2  
ATOM   3060  H  H    . GLY A 1 1   ? -21.371 25.814 49.226 1.00 0.00 ? 1   GLY A H    2  
ATOM   3061  H  HA2  . GLY A 1 1   ? -20.623 27.907 51.171 1.00 0.00 ? 1   GLY A HA2  2  
ATOM   3062  H  HA3  . GLY A 1 1   ? -19.571 27.231 49.930 1.00 0.00 ? 1   GLY A HA3  2  
ATOM   3063  N  N    . ASN A 1 2   ? -20.048 28.974 48.235 1.00 0.00 ? 2   ASN A N    2  
ATOM   3064  C  CA   . ASN A 1 2   ? -20.271 30.110 47.312 1.00 0.00 ? 2   ASN A CA   2  
ATOM   3065  C  C    . ASN A 1 2   ? -21.355 29.776 46.297 1.00 0.00 ? 2   ASN A C    2  
ATOM   3066  O  O    . ASN A 1 2   ? -21.836 28.661 46.243 1.00 0.00 ? 2   ASN A O    2  
ATOM   3067  C  CB   . ASN A 1 2   ? -18.960 30.392 46.563 1.00 0.00 ? 2   ASN A CB   2  
ATOM   3068  C  CG   . ASN A 1 2   ? -18.328 29.066 46.131 1.00 0.00 ? 2   ASN A CG   2  
ATOM   3069  O  OD1  . ASN A 1 2   ? -18.441 28.654 44.993 1.00 0.00 ? 2   ASN A OD1  2  
ATOM   3070  N  ND2  . ASN A 1 2   ? -17.656 28.371 47.006 1.00 0.00 ? 2   ASN A ND2  2  
ATOM   3071  H  H    . ASN A 1 2   ? -19.294 28.363 48.095 1.00 0.00 ? 2   ASN A H    2  
ATOM   3072  H  HA   . ASN A 1 2   ? -20.581 30.980 47.889 1.00 0.00 ? 2   ASN A HA   2  
ATOM   3073  H  HB2  . ASN A 1 2   ? -19.160 30.993 45.688 1.00 0.00 ? 2   ASN A HB2  2  
ATOM   3074  H  HB3  . ASN A 1 2   ? -18.275 30.919 47.210 1.00 0.00 ? 2   ASN A HB3  2  
ATOM   3075  H  HD21 . ASN A 1 2   ? -17.562 28.698 47.925 1.00 0.00 ? 2   ASN A HD21 2  
ATOM   3076  H  HD22 . ASN A 1 2   ? -17.245 27.520 46.745 1.00 0.00 ? 2   ASN A HD22 2  
ATOM   3077  N  N    . SER A 1 3   ? -21.722 30.748 45.508 1.00 0.00 ? 3   SER A N    2  
ATOM   3078  C  CA   . SER A 1 3   ? -22.772 30.503 44.492 1.00 0.00 ? 3   SER A CA   2  
ATOM   3079  C  C    . SER A 1 3   ? -22.378 29.352 43.574 1.00 0.00 ? 3   SER A C    2  
ATOM   3080  O  O    . SER A 1 3   ? -21.341 28.741 43.745 1.00 0.00 ? 3   SER A O    2  
ATOM   3081  C  CB   . SER A 1 3   ? -22.939 31.777 43.647 1.00 0.00 ? 3   SER A CB   2  
ATOM   3082  O  OG   . SER A 1 3   ? -21.757 31.834 42.863 1.00 0.00 ? 3   SER A OG   2  
ATOM   3083  H  H    . SER A 1 3   ? -21.306 31.632 45.587 1.00 0.00 ? 3   SER A H    2  
ATOM   3084  H  HA   . SER A 1 3   ? -23.702 30.250 44.999 1.00 0.00 ? 3   SER A HA   2  
ATOM   3085  H  HB2  . SER A 1 3   ? -23.807 31.702 43.010 1.00 0.00 ? 3   SER A HB2  2  
ATOM   3086  H  HB3  . SER A 1 3   ? -23.010 32.649 44.281 1.00 0.00 ? 3   SER A HB3  2  
ATOM   3087  H  HG   . SER A 1 3   ? -21.832 32.581 42.267 1.00 0.00 ? 3   SER A HG   2  
ATOM   3088  N  N    . LYS A 1 4   ? -23.215 29.077 42.613 1.00 0.00 ? 4   LYS A N    2  
ATOM   3089  C  CA   . LYS A 1 4   ? -22.911 27.970 41.673 1.00 0.00 ? 4   LYS A CA   2  
ATOM   3090  C  C    . LYS A 1 4   ? -21.764 28.344 40.740 1.00 0.00 ? 4   LYS A C    2  
ATOM   3091  O  O    . LYS A 1 4   ? -21.544 29.504 40.455 1.00 0.00 ? 4   LYS A O    2  
ATOM   3092  C  CB   . LYS A 1 4   ? -24.162 27.700 40.829 1.00 0.00 ? 4   LYS A CB   2  
ATOM   3093  C  CG   . LYS A 1 4   ? -24.668 29.023 40.255 1.00 0.00 ? 4   LYS A CG   2  
ATOM   3094  C  CD   . LYS A 1 4   ? -25.038 28.821 38.787 1.00 0.00 ? 4   LYS A CD   2  
ATOM   3095  C  CE   . LYS A 1 4   ? -26.203 27.834 38.697 1.00 0.00 ? 4   LYS A CE   2  
ATOM   3096  N  NZ   . LYS A 1 4   ? -25.696 26.437 38.592 1.00 0.00 ? 4   LYS A NZ   2  
ATOM   3097  H  H    . LYS A 1 4   ? -24.040 29.597 42.512 1.00 0.00 ? 4   LYS A H    2  
ATOM   3098  H  HA   . LYS A 1 4   ? -22.630 27.086 42.244 1.00 0.00 ? 4   LYS A HA   2  
ATOM   3099  H  HB2  . LYS A 1 4   ? -23.918 27.024 40.023 1.00 0.00 ? 4   LYS A HB2  2  
ATOM   3100  H  HB3  . LYS A 1 4   ? -24.928 27.255 41.447 1.00 0.00 ? 4   LYS A HB3  2  
ATOM   3101  H  HG2  . LYS A 1 4   ? -25.538 29.350 40.807 1.00 0.00 ? 4   LYS A HG2  2  
ATOM   3102  H  HG3  . LYS A 1 4   ? -23.896 29.773 40.335 1.00 0.00 ? 4   LYS A HG3  2  
ATOM   3103  H  HD2  . LYS A 1 4   ? -25.328 29.766 38.353 1.00 0.00 ? 4   LYS A HD2  2  
ATOM   3104  H  HD3  . LYS A 1 4   ? -24.188 28.430 38.249 1.00 0.00 ? 4   LYS A HD3  2  
ATOM   3105  H  HE2  . LYS A 1 4   ? -26.819 27.921 39.579 1.00 0.00 ? 4   LYS A HE2  2  
ATOM   3106  H  HE3  . LYS A 1 4   ? -26.801 28.058 37.825 1.00 0.00 ? 4   LYS A HE3  2  
ATOM   3107  H  HZ1  . LYS A 1 4   ? -24.764 26.441 38.130 1.00 0.00 ? 4   LYS A HZ1  2  
ATOM   3108  H  HZ2  . LYS A 1 4   ? -25.611 26.028 39.544 1.00 0.00 ? 4   LYS A HZ2  2  
ATOM   3109  H  HZ3  . LYS A 1 4   ? -26.359 25.869 38.029 1.00 0.00 ? 4   LYS A HZ3  2  
ATOM   3110  N  N    . SER A 1 5   ? -21.055 27.350 40.278 1.00 0.00 ? 5   SER A N    2  
ATOM   3111  C  CA   . SER A 1 5   ? -19.920 27.624 39.363 1.00 0.00 ? 5   SER A CA   2  
ATOM   3112  C  C    . SER A 1 5   ? -19.717 26.468 38.392 1.00 0.00 ? 5   SER A C    2  
ATOM   3113  O  O    . SER A 1 5   ? -18.883 26.532 37.511 1.00 0.00 ? 5   SER A O    2  
ATOM   3114  C  CB   . SER A 1 5   ? -18.646 27.790 40.205 1.00 0.00 ? 5   SER A CB   2  
ATOM   3115  O  OG   . SER A 1 5   ? -18.520 29.194 40.372 1.00 0.00 ? 5   SER A OG   2  
ATOM   3116  H  H    . SER A 1 5   ? -21.272 26.428 40.533 1.00 0.00 ? 5   SER A H    2  
ATOM   3117  H  HA   . SER A 1 5   ? -20.132 28.530 38.796 1.00 0.00 ? 5   SER A HA   2  
ATOM   3118  H  HB2  . SER A 1 5   ? -18.756 27.308 41.165 1.00 0.00 ? 5   SER A HB2  2  
ATOM   3119  H  HB3  . SER A 1 5   ? -17.787 27.397 39.680 1.00 0.00 ? 5   SER A HB3  2  
ATOM   3120  H  HG   . SER A 1 5   ? -18.930 29.432 41.205 1.00 0.00 ? 5   SER A HG   2  
ATOM   3121  N  N    . GLY A 1 6   ? -20.487 25.427 38.570 1.00 0.00 ? 6   GLY A N    2  
ATOM   3122  C  CA   . GLY A 1 6   ? -20.351 24.252 37.662 1.00 0.00 ? 6   GLY A CA   2  
ATOM   3123  C  C    . GLY A 1 6   ? -20.650 24.659 36.222 1.00 0.00 ? 6   GLY A C    2  
ATOM   3124  O  O    . GLY A 1 6   ? -20.462 23.887 35.303 1.00 0.00 ? 6   GLY A O    2  
ATOM   3125  H  H    . GLY A 1 6   ? -21.148 25.419 39.294 1.00 0.00 ? 6   GLY A H    2  
ATOM   3126  H  HA2  . GLY A 1 6   ? -19.344 23.868 37.723 1.00 0.00 ? 6   GLY A HA2  2  
ATOM   3127  H  HA3  . GLY A 1 6   ? -21.045 23.483 37.967 1.00 0.00 ? 6   GLY A HA3  2  
ATOM   3128  N  N    . ALA A 1 7   ? -21.112 25.866 36.054 1.00 0.00 ? 7   ALA A N    2  
ATOM   3129  C  CA   . ALA A 1 7   ? -21.426 26.336 34.687 1.00 0.00 ? 7   ALA A CA   2  
ATOM   3130  C  C    . ALA A 1 7   ? -20.152 26.721 33.944 1.00 0.00 ? 7   ALA A C    2  
ATOM   3131  O  O    . ALA A 1 7   ? -20.070 27.782 33.359 1.00 0.00 ? 7   ALA A O    2  
ATOM   3132  C  CB   . ALA A 1 7   ? -22.329 27.577 34.798 1.00 0.00 ? 7   ALA A CB   2  
ATOM   3133  H  H    . ALA A 1 7   ? -21.250 26.455 36.826 1.00 0.00 ? 7   ALA A H    2  
ATOM   3134  H  HA   . ALA A 1 7   ? -21.927 25.538 34.142 1.00 0.00 ? 7   ALA A HA   2  
ATOM   3135  H  HB1  . ALA A 1 7   ? -23.036 27.443 35.604 1.00 0.00 ? 7   ALA A HB1  2  
ATOM   3136  H  HB2  . ALA A 1 7   ? -21.727 28.451 34.994 1.00 0.00 ? 7   ALA A HB2  2  
ATOM   3137  H  HB3  . ALA A 1 7   ? -22.869 27.716 33.873 1.00 0.00 ? 7   ALA A HB3  2  
ATOM   3138  N  N    . LEU A 1 8   ? -19.175 25.849 33.978 1.00 0.00 ? 8   LEU A N    2  
ATOM   3139  C  CA   . LEU A 1 8   ? -17.907 26.159 33.275 1.00 0.00 ? 8   LEU A CA   2  
ATOM   3140  C  C    . LEU A 1 8   ? -18.063 25.962 31.774 1.00 0.00 ? 8   LEU A C    2  
ATOM   3141  O  O    . LEU A 1 8   ? -18.636 24.990 31.317 1.00 0.00 ? 8   LEU A O    2  
ATOM   3142  C  CB   . LEU A 1 8   ? -16.797 25.229 33.803 1.00 0.00 ? 8   LEU A CB   2  
ATOM   3143  C  CG   . LEU A 1 8   ? -17.230 23.769 33.666 1.00 0.00 ? 8   LEU A CG   2  
ATOM   3144  C  CD1  . LEU A 1 8   ? -16.798 23.230 32.296 1.00 0.00 ? 8   LEU A CD1  2  
ATOM   3145  C  CD2  . LEU A 1 8   ? -16.546 22.950 34.762 1.00 0.00 ? 8   LEU A CD2  2  
ATOM   3146  H  H    . LEU A 1 8   ? -19.281 25.003 34.461 1.00 0.00 ? 8   LEU A H    2  
ATOM   3147  H  HA   . LEU A 1 8   ? -17.648 27.207 33.462 1.00 0.00 ? 8   LEU A HA   2  
ATOM   3148  H  HB2  . LEU A 1 8   ? -15.889 25.394 33.241 1.00 0.00 ? 8   LEU A HB2  2  
ATOM   3149  H  HB3  . LEU A 1 8   ? -16.608 25.451 34.843 1.00 0.00 ? 8   LEU A HB3  2  
ATOM   3150  H  HG   . LEU A 1 8   ? -18.303 23.693 33.768 1.00 0.00 ? 8   LEU A HG   2  
ATOM   3151  H  HD11 . LEU A 1 8   ? -16.508 24.046 31.656 1.00 0.00 ? 8   LEU A HD11 2  
ATOM   3152  H  HD12 . LEU A 1 8   ? -15.960 22.558 32.417 1.00 0.00 ? 8   LEU A HD12 2  
ATOM   3153  H  HD13 . LEU A 1 8   ? -17.618 22.696 31.840 1.00 0.00 ? 8   LEU A HD13 2  
ATOM   3154  H  HD21 . LEU A 1 8   ? -15.534 23.304 34.900 1.00 0.00 ? 8   LEU A HD21 2  
ATOM   3155  H  HD22 . LEU A 1 8   ? -17.089 23.057 35.688 1.00 0.00 ? 8   LEU A HD22 2  
ATOM   3156  H  HD23 . LEU A 1 8   ? -16.523 21.909 34.479 1.00 0.00 ? 8   LEU A HD23 2  
ATOM   3157  N  N    . SER A 1 9   ? -17.555 26.900 31.044 1.00 0.00 ? 9   SER A N    2  
ATOM   3158  C  CA   . SER A 1 9   ? -17.635 26.837 29.568 1.00 0.00 ? 9   SER A CA   2  
ATOM   3159  C  C    . SER A 1 9   ? -17.195 28.175 29.011 1.00 0.00 ? 9   SER A C    2  
ATOM   3160  O  O    . SER A 1 9   ? -16.172 28.277 28.362 1.00 0.00 ? 9   SER A O    2  
ATOM   3161  C  CB   . SER A 1 9   ? -19.101 26.553 29.161 1.00 0.00 ? 9   SER A CB   2  
ATOM   3162  O  OG   . SER A 1 9   ? -19.367 27.456 28.096 1.00 0.00 ? 9   SER A OG   2  
ATOM   3163  H  H    . SER A 1 9   ? -17.111 27.662 31.472 1.00 0.00 ? 9   SER A H    2  
ATOM   3164  H  HA   . SER A 1 9   ? -16.964 26.057 29.205 1.00 0.00 ? 9   SER A HA   2  
ATOM   3165  H  HB2  . SER A 1 9   ? -19.209 25.534 28.820 1.00 0.00 ? 9   SER A HB2  2  
ATOM   3166  H  HB3  . SER A 1 9   ? -19.768 26.744 29.986 1.00 0.00 ? 9   SER A HB3  2  
ATOM   3167  H  HG   . SER A 1 9   ? -19.172 27.007 27.270 1.00 0.00 ? 9   SER A HG   2  
ATOM   3168  N  N    . LYS A 1 10  ? -17.978 29.186 29.277 1.00 0.00 ? 10  LYS A N    2  
ATOM   3169  C  CA   . LYS A 1 10  ? -17.617 30.519 28.777 1.00 0.00 ? 10  LYS A CA   2  
ATOM   3170  C  C    . LYS A 1 10  ? -16.418 31.013 29.563 1.00 0.00 ? 10  LYS A C    2  
ATOM   3171  O  O    . LYS A 1 10  ? -15.653 31.831 29.097 1.00 0.00 ? 10  LYS A O    2  
ATOM   3172  C  CB   . LYS A 1 10  ? -18.802 31.474 29.001 1.00 0.00 ? 10  LYS A CB   2  
ATOM   3173  C  CG   . LYS A 1 10  ? -20.002 30.674 29.510 1.00 0.00 ? 10  LYS A CG   2  
ATOM   3174  C  CD   . LYS A 1 10  ? -21.226 31.594 29.597 1.00 0.00 ? 10  LYS A CD   2  
ATOM   3175  C  CE   . LYS A 1 10  ? -21.669 31.706 31.058 1.00 0.00 ? 10  LYS A CE   2  
ATOM   3176  N  NZ   . LYS A 1 10  ? -22.975 32.416 31.156 1.00 0.00 ? 10  LYS A NZ   2  
ATOM   3177  H  H    . LYS A 1 10  ? -18.795 29.055 29.801 1.00 0.00 ? 10  LYS A H    2  
ATOM   3178  H  HA   . LYS A 1 10  ? -17.353 30.450 27.720 1.00 0.00 ? 10  LYS A HA   2  
ATOM   3179  H  HB2  . LYS A 1 10  ? -18.531 32.226 29.729 1.00 0.00 ? 10  LYS A HB2  2  
ATOM   3180  H  HB3  . LYS A 1 10  ? -19.057 31.959 28.070 1.00 0.00 ? 10  LYS A HB3  2  
ATOM   3181  H  HG2  . LYS A 1 10  ? -20.209 29.859 28.832 1.00 0.00 ? 10  LYS A HG2  2  
ATOM   3182  H  HG3  . LYS A 1 10  ? -19.780 30.271 30.489 1.00 0.00 ? 10  LYS A HG3  2  
ATOM   3183  H  HD2  . LYS A 1 10  ? -20.973 32.573 29.217 1.00 0.00 ? 10  LYS A HD2  2  
ATOM   3184  H  HD3  . LYS A 1 10  ? -22.031 31.183 29.004 1.00 0.00 ? 10  LYS A HD3  2  
ATOM   3185  H  HE2  . LYS A 1 10  ? -21.772 30.718 31.483 1.00 0.00 ? 10  LYS A HE2  2  
ATOM   3186  H  HE3  . LYS A 1 10  ? -20.927 32.255 31.619 1.00 0.00 ? 10  LYS A HE3  2  
ATOM   3187  H  HZ1  . LYS A 1 10  ? -23.464 32.368 30.241 1.00 0.00 ? 10  LYS A HZ1  2  
ATOM   3188  H  HZ2  . LYS A 1 10  ? -23.561 31.964 31.887 1.00 0.00 ? 10  LYS A HZ2  2  
ATOM   3189  H  HZ3  . LYS A 1 10  ? -22.810 33.411 31.409 1.00 0.00 ? 10  LYS A HZ3  2  
ATOM   3190  N  N    . GLU A 1 11  ? -16.282 30.492 30.763 1.00 0.00 ? 11  GLU A N    2  
ATOM   3191  C  CA   . GLU A 1 11  ? -15.145 30.901 31.613 1.00 0.00 ? 11  GLU A CA   2  
ATOM   3192  C  C    . GLU A 1 11  ? -13.906 30.143 31.179 1.00 0.00 ? 11  GLU A C    2  
ATOM   3193  O  O    . GLU A 1 11  ? -12.808 30.662 31.205 1.00 0.00 ? 11  GLU A O    2  
ATOM   3194  C  CB   . GLU A 1 11  ? -15.472 30.542 33.072 1.00 0.00 ? 11  GLU A CB   2  
ATOM   3195  C  CG   . GLU A 1 11  ? -14.754 31.522 34.004 1.00 0.00 ? 11  GLU A CG   2  
ATOM   3196  C  CD   . GLU A 1 11  ? -15.146 31.222 35.452 1.00 0.00 ? 11  GLU A CD   2  
ATOM   3197  O  OE1  . GLU A 1 11  ? -16.115 30.496 35.612 1.00 0.00 ? 11  GLU A OE1  2  
ATOM   3198  O  OE2  . GLU A 1 11  ? -14.457 31.736 36.317 1.00 0.00 ? 11  GLU A OE2  2  
ATOM   3199  H  H    . GLU A 1 11  ? -16.933 29.829 31.092 1.00 0.00 ? 11  GLU A H    2  
ATOM   3200  H  HA   . GLU A 1 11  ? -14.974 31.971 31.497 1.00 0.00 ? 11  GLU A HA   2  
ATOM   3201  H  HB2  . GLU A 1 11  ? -16.537 30.605 33.231 1.00 0.00 ? 11  GLU A HB2  2  
ATOM   3202  H  HB3  . GLU A 1 11  ? -15.141 29.535 33.280 1.00 0.00 ? 11  GLU A HB3  2  
ATOM   3203  H  HG2  . GLU A 1 11  ? -13.685 31.416 33.894 1.00 0.00 ? 11  GLU A HG2  2  
ATOM   3204  H  HG3  . GLU A 1 11  ? -15.039 32.534 33.759 1.00 0.00 ? 11  GLU A HG3  2  
ATOM   3205  N  N    . ILE A 1 12  ? -14.111 28.912 30.789 1.00 0.00 ? 12  ILE A N    2  
ATOM   3206  C  CA   . ILE A 1 12  ? -12.971 28.084 30.340 1.00 0.00 ? 12  ILE A CA   2  
ATOM   3207  C  C    . ILE A 1 12  ? -12.535 28.549 28.989 1.00 0.00 ? 12  ILE A C    2  
ATOM   3208  O  O    . ILE A 1 12  ? -11.423 28.980 28.816 1.00 0.00 ? 12  ILE A O    2  
ATOM   3209  C  CB   . ILE A 1 12  ? -13.435 26.631 30.221 1.00 0.00 ? 12  ILE A CB   2  
ATOM   3210  C  CG1  . ILE A 1 12  ? -14.133 26.188 31.508 1.00 0.00 ? 12  ILE A CG1  2  
ATOM   3211  C  CG2  . ILE A 1 12  ? -12.203 25.734 29.971 1.00 0.00 ? 12  ILE A CG2  2  
ATOM   3212  C  CD1  . ILE A 1 12  ? -13.103 25.663 32.519 1.00 0.00 ? 12  ILE A CD1  2  
ATOM   3213  H  H    . ILE A 1 12  ? -15.018 28.538 30.796 1.00 0.00 ? 12  ILE A H    2  
ATOM   3214  H  HA   . ILE A 1 12  ? -12.137 28.188 31.032 1.00 0.00 ? 12  ILE A HA   2  
ATOM   3215  H  HB   . ILE A 1 12  ? -14.140 26.557 29.390 1.00 0.00 ? 12  ILE A HB   2  
ATOM   3216  H  HG12 . ILE A 1 12  ? -14.664 27.025 31.937 1.00 0.00 ? 12  ILE A HG12 2  
ATOM   3217  H  HG13 . ILE A 1 12  ? -14.840 25.408 31.280 1.00 0.00 ? 12  ILE A HG13 2  
ATOM   3218  H  HG21 . ILE A 1 12  ? -11.461 25.909 30.731 1.00 0.00 ? 12  ILE A HG21 2  
ATOM   3219  H  HG22 . ILE A 1 12  ? -12.500 24.695 29.992 1.00 0.00 ? 12  ILE A HG22 2  
ATOM   3220  H  HG23 . ILE A 1 12  ? -11.780 25.962 29.005 1.00 0.00 ? 12  ILE A HG23 2  
ATOM   3221  H  HD11 . ILE A 1 12  ? -12.324 26.397 32.664 1.00 0.00 ? 12  ILE A HD11 2  
ATOM   3222  H  HD12 . ILE A 1 12  ? -13.588 25.471 33.463 1.00 0.00 ? 12  ILE A HD12 2  
ATOM   3223  H  HD13 . ILE A 1 12  ? -12.664 24.744 32.156 1.00 0.00 ? 12  ILE A HD13 2  
ATOM   3224  N  N    . LEU A 1 13  ? -13.419 28.468 28.042 1.00 0.00 ? 13  LEU A N    2  
ATOM   3225  C  CA   . LEU A 1 13  ? -13.036 28.912 26.707 1.00 0.00 ? 13  LEU A CA   2  
ATOM   3226  C  C    . LEU A 1 13  ? -12.415 30.283 26.797 1.00 0.00 ? 13  LEU A C    2  
ATOM   3227  O  O    . LEU A 1 13  ? -11.598 30.641 25.997 1.00 0.00 ? 13  LEU A O    2  
ATOM   3228  C  CB   . LEU A 1 13  ? -14.278 28.986 25.815 1.00 0.00 ? 13  LEU A CB   2  
ATOM   3229  C  CG   . LEU A 1 13  ? -14.468 27.658 25.070 1.00 0.00 ? 13  LEU A CG   2  
ATOM   3230  C  CD1  . LEU A 1 13  ? -15.618 27.818 24.080 1.00 0.00 ? 13  LEU A CD1  2  
ATOM   3231  C  CD2  . LEU A 1 13  ? -13.184 27.300 24.301 1.00 0.00 ? 13  LEU A CD2  2  
ATOM   3232  H  H    . LEU A 1 13  ? -14.320 28.122 28.220 1.00 0.00 ? 13  LEU A H    2  
ATOM   3233  H  HA   . LEU A 1 13  ? -12.301 28.218 26.308 1.00 0.00 ? 13  LEU A HA   2  
ATOM   3234  H  HB2  . LEU A 1 13  ? -15.146 29.185 26.426 1.00 0.00 ? 13  LEU A HB2  2  
ATOM   3235  H  HB3  . LEU A 1 13  ? -14.159 29.786 25.102 1.00 0.00 ? 13  LEU A HB3  2  
ATOM   3236  H  HG   . LEU A 1 13  ? -14.703 26.874 25.776 1.00 0.00 ? 13  LEU A HG   2  
ATOM   3237  H  HD11 . LEU A 1 13  ? -16.281 28.603 24.416 1.00 0.00 ? 13  LEU A HD11 2  
ATOM   3238  H  HD12 . LEU A 1 13  ? -15.229 28.078 23.106 1.00 0.00 ? 13  LEU A HD12 2  
ATOM   3239  H  HD13 . LEU A 1 13  ? -16.167 26.896 24.009 1.00 0.00 ? 13  LEU A HD13 2  
ATOM   3240  H  HD21 . LEU A 1 13  ? -12.596 28.192 24.135 1.00 0.00 ? 13  LEU A HD21 2  
ATOM   3241  H  HD22 . LEU A 1 13  ? -12.601 26.593 24.875 1.00 0.00 ? 13  LEU A HD22 2  
ATOM   3242  H  HD23 . LEU A 1 13  ? -13.436 26.858 23.350 1.00 0.00 ? 13  LEU A HD23 2  
ATOM   3243  N  N    . GLU A 1 14  ? -12.825 31.045 27.771 1.00 0.00 ? 14  GLU A N    2  
ATOM   3244  C  CA   . GLU A 1 14  ? -12.238 32.387 27.895 1.00 0.00 ? 14  GLU A CA   2  
ATOM   3245  C  C    . GLU A 1 14  ? -10.727 32.250 27.854 1.00 0.00 ? 14  GLU A C    2  
ATOM   3246  O  O    . GLU A 1 14  ? -10.009 33.207 27.634 1.00 0.00 ? 14  GLU A O    2  
ATOM   3247  C  CB   . GLU A 1 14  ? -12.662 32.992 29.245 1.00 0.00 ? 14  GLU A CB   2  
ATOM   3248  C  CG   . GLU A 1 14  ? -13.220 34.401 29.014 1.00 0.00 ? 14  GLU A CG   2  
ATOM   3249  C  CD   . GLU A 1 14  ? -13.801 34.938 30.325 1.00 0.00 ? 14  GLU A CD   2  
ATOM   3250  O  OE1  . GLU A 1 14  ? -14.811 34.389 30.734 1.00 0.00 ? 14  GLU A OE1  2  
ATOM   3251  O  OE2  . GLU A 1 14  ? -13.202 35.868 30.842 1.00 0.00 ? 14  GLU A OE2  2  
ATOM   3252  H  H    . GLU A 1 14  ? -13.506 30.732 28.403 1.00 0.00 ? 14  GLU A H    2  
ATOM   3253  H  HA   . GLU A 1 14  ? -12.571 33.004 27.059 1.00 0.00 ? 14  GLU A HA   2  
ATOM   3254  H  HB2  . GLU A 1 14  ? -13.420 32.372 29.698 1.00 0.00 ? 14  GLU A HB2  2  
ATOM   3255  H  HB3  . GLU A 1 14  ? -11.808 33.045 29.904 1.00 0.00 ? 14  GLU A HB3  2  
ATOM   3256  H  HG2  . GLU A 1 14  ? -12.432 35.057 28.678 1.00 0.00 ? 14  GLU A HG2  2  
ATOM   3257  H  HG3  . GLU A 1 14  ? -13.999 34.367 28.266 1.00 0.00 ? 14  GLU A HG3  2  
ATOM   3258  N  N    . GLU A 1 15  ? -10.275 31.035 28.074 1.00 0.00 ? 15  GLU A N    2  
ATOM   3259  C  CA   . GLU A 1 15  ? -8.817  30.767 28.059 1.00 0.00 ? 15  GLU A CA   2  
ATOM   3260  C  C    . GLU A 1 15  ? -8.335  30.432 26.640 1.00 0.00 ? 15  GLU A C    2  
ATOM   3261  O  O    . GLU A 1 15  ? -7.149  30.306 26.402 1.00 0.00 ? 15  GLU A O    2  
ATOM   3262  C  CB   . GLU A 1 15  ? -8.539  29.562 28.983 1.00 0.00 ? 15  GLU A CB   2  
ATOM   3263  C  CG   . GLU A 1 15  ? -8.893  29.942 30.422 1.00 0.00 ? 15  GLU A CG   2  
ATOM   3264  C  CD   . GLU A 1 15  ? -8.063  31.158 30.838 1.00 0.00 ? 15  GLU A CD   2  
ATOM   3265  O  OE1  . GLU A 1 15  ? -6.983  31.290 30.287 1.00 0.00 ? 15  GLU A OE1  2  
ATOM   3266  O  OE2  . GLU A 1 15  ? -8.555  31.886 31.684 1.00 0.00 ? 15  GLU A OE2  2  
ATOM   3267  H  H    . GLU A 1 15  ? -10.911 30.295 28.265 1.00 0.00 ? 15  GLU A H    2  
ATOM   3268  H  HA   . GLU A 1 15  ? -8.290  31.654 28.413 1.00 0.00 ? 15  GLU A HA   2  
ATOM   3269  H  HB2  . GLU A 1 15  ? -9.136  28.718 28.673 1.00 0.00 ? 15  GLU A HB2  2  
ATOM   3270  H  HB3  . GLU A 1 15  ? -7.499  29.295 28.928 1.00 0.00 ? 15  GLU A HB3  2  
ATOM   3271  H  HG2  . GLU A 1 15  ? -9.944  30.186 30.489 1.00 0.00 ? 15  GLU A HG2  2  
ATOM   3272  H  HG3  . GLU A 1 15  ? -8.674  29.117 31.084 1.00 0.00 ? 15  GLU A HG3  2  
ATOM   3273  N  N    . LEU A 1 16  ? -9.272  30.278 25.726 1.00 0.00 ? 16  LEU A N    2  
ATOM   3274  C  CA   . LEU A 1 16  ? -8.893  29.949 24.318 1.00 0.00 ? 16  LEU A CA   2  
ATOM   3275  C  C    . LEU A 1 16  ? -7.677  30.753 23.857 1.00 0.00 ? 16  LEU A C    2  
ATOM   3276  O  O    . LEU A 1 16  ? -7.046  30.409 22.877 1.00 0.00 ? 16  LEU A O    2  
ATOM   3277  C  CB   . LEU A 1 16  ? -10.088 30.257 23.373 1.00 0.00 ? 16  LEU A CB   2  
ATOM   3278  C  CG   . LEU A 1 16  ? -10.099 31.747 22.964 1.00 0.00 ? 16  LEU A CG   2  
ATOM   3279  C  CD1  . LEU A 1 16  ? -11.252 31.975 21.985 1.00 0.00 ? 16  LEU A CD1  2  
ATOM   3280  C  CD2  . LEU A 1 16  ? -10.313 32.624 24.199 1.00 0.00 ? 16  LEU A CD2  2  
ATOM   3281  H  H    . LEU A 1 16  ? -10.218 30.377 25.969 1.00 0.00 ? 16  LEU A H    2  
ATOM   3282  H  HA   . LEU A 1 16  ? -8.652  28.892 24.274 1.00 0.00 ? 16  LEU A HA   2  
ATOM   3283  H  HB2  . LEU A 1 16  ? -10.002 29.650 22.484 1.00 0.00 ? 16  LEU A HB2  2  
ATOM   3284  H  HB3  . LEU A 1 16  ? -11.010 30.014 23.863 1.00 0.00 ? 16  LEU A HB3  2  
ATOM   3285  H  HG   . LEU A 1 16  ? -9.168  32.007 22.486 1.00 0.00 ? 16  LEU A HG   2  
ATOM   3286  H  HD11 . LEU A 1 16  ? -12.175 31.616 22.417 1.00 0.00 ? 16  LEU A HD11 2  
ATOM   3287  H  HD12 . LEU A 1 16  ? -11.346 33.029 21.772 1.00 0.00 ? 16  LEU A HD12 2  
ATOM   3288  H  HD13 . LEU A 1 16  ? -11.059 31.442 21.067 1.00 0.00 ? 16  LEU A HD13 2  
ATOM   3289  H  HD21 . LEU A 1 16  ? -9.608  32.354 24.968 1.00 0.00 ? 16  LEU A HD21 2  
ATOM   3290  H  HD22 . LEU A 1 16  ? -10.168 33.661 23.937 1.00 0.00 ? 16  LEU A HD22 2  
ATOM   3291  H  HD23 . LEU A 1 16  ? -11.317 32.491 24.573 1.00 0.00 ? 16  LEU A HD23 2  
ATOM   3292  N  N    . GLN A 1 17  ? -7.383  31.818 24.565 1.00 0.00 ? 17  GLN A N    2  
ATOM   3293  C  CA   . GLN A 1 17  ? -6.213  32.660 24.185 1.00 0.00 ? 17  GLN A CA   2  
ATOM   3294  C  C    . GLN A 1 17  ? -5.045  31.803 23.713 1.00 0.00 ? 17  GLN A C    2  
ATOM   3295  O  O    . GLN A 1 17  ? -4.538  31.987 22.623 1.00 0.00 ? 17  GLN A O    2  
ATOM   3296  C  CB   . GLN A 1 17  ? -5.767  33.453 25.423 1.00 0.00 ? 17  GLN A CB   2  
ATOM   3297  C  CG   . GLN A 1 17  ? -6.854  34.466 25.788 1.00 0.00 ? 17  GLN A CG   2  
ATOM   3298  C  CD   . GLN A 1 17  ? -6.783  35.654 24.826 1.00 0.00 ? 17  GLN A CD   2  
ATOM   3299  O  OE1  . GLN A 1 17  ? -6.221  36.687 25.135 1.00 0.00 ? 17  GLN A OE1  2  
ATOM   3300  N  NE2  . GLN A 1 17  ? -7.341  35.550 23.650 1.00 0.00 ? 17  GLN A NE2  2  
ATOM   3301  H  H    . GLN A 1 17  ? -7.929  32.058 25.343 1.00 0.00 ? 17  GLN A H    2  
ATOM   3302  H  HA   . GLN A 1 17  ? -6.506  33.332 23.382 1.00 0.00 ? 17  GLN A HA   2  
ATOM   3303  H  HB2  . GLN A 1 17  ? -5.608  32.778 26.251 1.00 0.00 ? 17  GLN A HB2  2  
ATOM   3304  H  HB3  . GLN A 1 17  ? -4.846  33.973 25.209 1.00 0.00 ? 17  GLN A HB3  2  
ATOM   3305  H  HG2  . GLN A 1 17  ? -7.825  34.003 25.711 1.00 0.00 ? 17  GLN A HG2  2  
ATOM   3306  H  HG3  . GLN A 1 17  ? -6.705  34.816 26.800 1.00 0.00 ? 17  GLN A HG3  2  
ATOM   3307  H  HE21 . GLN A 1 17  ? -7.796  34.720 23.396 1.00 0.00 ? 17  GLN A HE21 2  
ATOM   3308  H  HE22 . GLN A 1 17  ? -7.301  36.300 23.021 1.00 0.00 ? 17  GLN A HE22 2  
ATOM   3309  N  N    . LEU A 1 18  ? -4.641  30.879 24.543 1.00 0.00 ? 18  LEU A N    2  
ATOM   3310  C  CA   . LEU A 1 18  ? -3.508  29.997 24.167 1.00 0.00 ? 18  LEU A CA   2  
ATOM   3311  C  C    . LEU A 1 18  ? -4.008  28.670 23.609 1.00 0.00 ? 18  LEU A C    2  
ATOM   3312  O  O    . LEU A 1 18  ? -4.019  28.459 22.412 1.00 0.00 ? 18  LEU A O    2  
ATOM   3313  C  CB   . LEU A 1 18  ? -2.681  29.722 25.431 1.00 0.00 ? 18  LEU A CB   2  
ATOM   3314  C  CG   . LEU A 1 18  ? -1.360  30.484 25.342 1.00 0.00 ? 18  LEU A CG   2  
ATOM   3315  C  CD1  . LEU A 1 18  ? -1.637  31.986 25.451 1.00 0.00 ? 18  LEU A CD1  2  
ATOM   3316  C  CD2  . LEU A 1 18  ? -0.454  30.055 26.498 1.00 0.00 ? 18  LEU A CD2  2  
ATOM   3317  H  H    . LEU A 1 18  ? -5.084  30.769 25.411 1.00 0.00 ? 18  LEU A H    2  
ATOM   3318  H  HA   . LEU A 1 18  ? -2.903  30.495 23.411 1.00 0.00 ? 18  LEU A HA   2  
ATOM   3319  H  HB2  . LEU A 1 18  ? -3.231  30.047 26.301 1.00 0.00 ? 18  LEU A HB2  2  
ATOM   3320  H  HB3  . LEU A 1 18  ? -2.485  28.663 25.513 1.00 0.00 ? 18  LEU A HB3  2  
ATOM   3321  H  HG   . LEU A 1 18  ? -0.876  30.268 24.401 1.00 0.00 ? 18  LEU A HG   2  
ATOM   3322  H  HD11 . LEU A 1 18  ? -2.329  32.287 24.681 1.00 0.00 ? 18  LEU A HD11 2  
ATOM   3323  H  HD12 . LEU A 1 18  ? -2.061  32.210 26.419 1.00 0.00 ? 18  LEU A HD12 2  
ATOM   3324  H  HD13 . LEU A 1 18  ? -0.720  32.531 25.331 1.00 0.00 ? 18  LEU A HD13 2  
ATOM   3325  H  HD21 . LEU A 1 18  ? -1.049  29.878 27.382 1.00 0.00 ? 18  LEU A HD21 2  
ATOM   3326  H  HD22 . LEU A 1 18  ? 0.069   29.147 26.234 1.00 0.00 ? 18  LEU A HD22 2  
ATOM   3327  H  HD23 . LEU A 1 18  ? 0.265   30.834 26.705 1.00 0.00 ? 18  LEU A HD23 2  
ATOM   3328  N  N    . ASN A 1 19  ? -4.408  27.797 24.491 1.00 0.00 ? 19  ASN A N    2  
ATOM   3329  C  CA   . ASN A 1 19  ? -4.912  26.478 24.040 1.00 0.00 ? 19  ASN A CA   2  
ATOM   3330  C  C    . ASN A 1 19  ? -6.174  26.631 23.203 1.00 0.00 ? 19  ASN A C    2  
ATOM   3331  O  O    . ASN A 1 19  ? -7.034  27.417 23.523 1.00 0.00 ? 19  ASN A O    2  
ATOM   3332  C  CB   . ASN A 1 19  ? -5.244  25.645 25.285 1.00 0.00 ? 19  ASN A CB   2  
ATOM   3333  C  CG   . ASN A 1 19  ? -4.952  24.172 25.004 1.00 0.00 ? 19  ASN A CG   2  
ATOM   3334  O  OD1  . ASN A 1 19  ? -5.748  23.472 24.409 1.00 0.00 ? 19  ASN A OD1  2  
ATOM   3335  N  ND2  . ASN A 1 19  ? -3.824  23.662 25.415 1.00 0.00 ? 19  ASN A ND2  2  
ATOM   3336  H  H    . ASN A 1 19  ? -4.378  28.014 25.447 1.00 0.00 ? 19  ASN A H    2  
ATOM   3337  H  HA   . ASN A 1 19  ? -4.145  25.990 23.442 1.00 0.00 ? 19  ASN A HA   2  
ATOM   3338  H  HB2  . ASN A 1 19  ? -4.641  25.977 26.119 1.00 0.00 ? 19  ASN A HB2  2  
ATOM   3339  H  HB3  . ASN A 1 19  ? -6.291  25.760 25.533 1.00 0.00 ? 19  ASN A HB3  2  
ATOM   3340  H  HD21 . ASN A 1 19  ? -3.180  24.224 25.895 1.00 0.00 ? 19  ASN A HD21 2  
ATOM   3341  H  HD22 . ASN A 1 19  ? -3.621  22.719 25.245 1.00 0.00 ? 19  ASN A HD22 2  
ATOM   3342  N  N    . THR A 1 20  ? -6.262  25.875 22.143 1.00 0.00 ? 20  THR A N    2  
ATOM   3343  C  CA   . THR A 1 20  ? -7.468  25.971 21.282 1.00 0.00 ? 20  THR A CA   2  
ATOM   3344  C  C    . THR A 1 20  ? -8.572  25.069 21.812 1.00 0.00 ? 20  THR A C    2  
ATOM   3345  O  O    . THR A 1 20  ? -9.718  25.192 21.423 1.00 0.00 ? 20  THR A O    2  
ATOM   3346  C  CB   . THR A 1 20  ? -7.095  25.506 19.873 1.00 0.00 ? 20  THR A CB   2  
ATOM   3347  O  OG1  . THR A 1 20  ? -8.284  25.616 19.116 1.00 0.00 ? 20  THR A OG1  2  
ATOM   3348  C  CG2  . THR A 1 20  ? -6.770  24.005 19.863 1.00 0.00 ? 20  THR A CG2  2  
ATOM   3349  H  H    . THR A 1 20  ? -5.542  25.251 21.919 1.00 0.00 ? 20  THR A H    2  
ATOM   3350  H  HA   . THR A 1 20  ? -7.822  27.002 21.272 1.00 0.00 ? 20  THR A HA   2  
ATOM   3351  H  HB   . THR A 1 20  ? -6.303  26.113 19.442 1.00 0.00 ? 20  THR A HB   2  
ATOM   3352  H  HG1  . THR A 1 20  ? -8.433  26.546 18.929 1.00 0.00 ? 20  THR A HG1  2  
ATOM   3353  H  HG21 . THR A 1 20  ? -6.158  23.759 20.718 1.00 0.00 ? 20  THR A HG21 2  
ATOM   3354  H  HG22 . THR A 1 20  ? -7.686  23.435 19.906 1.00 0.00 ? 20  THR A HG22 2  
ATOM   3355  H  HG23 . THR A 1 20  ? -6.237  23.753 18.958 1.00 0.00 ? 20  THR A HG23 2  
ATOM   3356  N  N    . LYS A 1 21  ? -8.195  24.179 22.700 1.00 0.00 ? 21  LYS A N    2  
ATOM   3357  C  CA   . LYS A 1 21  ? -9.188  23.241 23.289 1.00 0.00 ? 21  LYS A CA   2  
ATOM   3358  C  C    . LYS A 1 21  ? -9.864  22.406 22.209 1.00 0.00 ? 21  LYS A C    2  
ATOM   3359  O  O    . LYS A 1 21  ? -9.815  22.731 21.040 1.00 0.00 ? 21  LYS A O    2  
ATOM   3360  C  CB   . LYS A 1 21  ? -10.266 24.051 24.043 1.00 0.00 ? 21  LYS A CB   2  
ATOM   3361  C  CG   . LYS A 1 21  ? -9.926  24.062 25.536 1.00 0.00 ? 21  LYS A CG   2  
ATOM   3362  C  CD   . LYS A 1 21  ? -8.594  24.788 25.740 1.00 0.00 ? 21  LYS A CD   2  
ATOM   3363  C  CE   . LYS A 1 21  ? -8.517  25.306 27.177 1.00 0.00 ? 21  LYS A CE   2  
ATOM   3364  N  NZ   . LYS A 1 21  ? -9.701  26.153 27.490 1.00 0.00 ? 21  LYS A NZ   2  
ATOM   3365  H  H    . LYS A 1 21  ? -7.256  24.134 22.977 1.00 0.00 ? 21  LYS A H    2  
ATOM   3366  H  HA   . LYS A 1 21  ? -8.667  22.568 23.973 1.00 0.00 ? 21  LYS A HA   2  
ATOM   3367  H  HB2  . LYS A 1 21  ? -10.294 25.062 23.672 1.00 0.00 ? 21  LYS A HB2  2  
ATOM   3368  H  HB3  . LYS A 1 21  ? -11.236 23.593 23.895 1.00 0.00 ? 21  LYS A HB3  2  
ATOM   3369  H  HG2  . LYS A 1 21  ? -10.706 24.572 26.082 1.00 0.00 ? 21  LYS A HG2  2  
ATOM   3370  H  HG3  . LYS A 1 21  ? -9.846  23.047 25.898 1.00 0.00 ? 21  LYS A HG3  2  
ATOM   3371  H  HD2  . LYS A 1 21  ? -7.777  24.106 25.556 1.00 0.00 ? 21  LYS A HD2  2  
ATOM   3372  H  HD3  . LYS A 1 21  ? -8.524  25.618 25.052 1.00 0.00 ? 21  LYS A HD3  2  
ATOM   3373  H  HE2  . LYS A 1 21  ? -8.490  24.472 27.863 1.00 0.00 ? 21  LYS A HE2  2  
ATOM   3374  H  HE3  . LYS A 1 21  ? -7.620  25.896 27.303 1.00 0.00 ? 21  LYS A HE3  2  
ATOM   3375  H  HZ1  . LYS A 1 21  ? -10.291 26.251 26.640 1.00 0.00 ? 21  LYS A HZ1  2  
ATOM   3376  H  HZ2  . LYS A 1 21  ? -10.257 25.706 28.247 1.00 0.00 ? 21  LYS A HZ2  2  
ATOM   3377  H  HZ3  . LYS A 1 21  ? -9.383  27.093 27.801 1.00 0.00 ? 21  LYS A HZ3  2  
ATOM   3378  N  N    . PHE A 1 22  ? -10.470 21.332 22.620 1.00 0.00 ? 22  PHE A N    2  
ATOM   3379  C  CA   . PHE A 1 22  ? -11.152 20.468 21.637 1.00 0.00 ? 22  PHE A CA   2  
ATOM   3380  C  C    . PHE A 1 22  ? -12.545 20.997 21.380 1.00 0.00 ? 22  PHE A C    2  
ATOM   3381  O  O    . PHE A 1 22  ? -12.900 22.049 21.874 1.00 0.00 ? 22  PHE A O    2  
ATOM   3382  C  CB   . PHE A 1 22  ? -11.247 19.051 22.225 1.00 0.00 ? 22  PHE A CB   2  
ATOM   3383  C  CG   . PHE A 1 22  ? -9.831  18.532 22.492 1.00 0.00 ? 22  PHE A CG   2  
ATOM   3384  C  CD1  . PHE A 1 22  ? -8.987  18.221 21.439 1.00 0.00 ? 22  PHE A CD1  2  
ATOM   3385  C  CD2  . PHE A 1 22  ? -9.368  18.385 23.789 1.00 0.00 ? 22  PHE A CD2  2  
ATOM   3386  C  CE1  . PHE A 1 22  ? -7.705  17.772 21.680 1.00 0.00 ? 22  PHE A CE1  2  
ATOM   3387  C  CE2  . PHE A 1 22  ? -8.085  17.934 24.025 1.00 0.00 ? 22  PHE A CE2  2  
ATOM   3388  C  CZ   . PHE A 1 22  ? -7.256  17.629 22.971 1.00 0.00 ? 22  PHE A CZ   2  
ATOM   3389  H  H    . PHE A 1 22  ? -10.475 21.100 23.571 1.00 0.00 ? 22  PHE A H    2  
ATOM   3390  H  HA   . PHE A 1 22  ? -10.593 20.469 20.706 1.00 0.00 ? 22  PHE A HA   2  
ATOM   3391  H  HB2  . PHE A 1 22  ? -11.800 19.074 23.152 1.00 0.00 ? 22  PHE A HB2  2  
ATOM   3392  H  HB3  . PHE A 1 22  ? -11.744 18.395 21.526 1.00 0.00 ? 22  PHE A HB3  2  
ATOM   3393  H  HD1  . PHE A 1 22  ? -9.335  18.332 20.422 1.00 0.00 ? 22  PHE A HD1  2  
ATOM   3394  H  HD2  . PHE A 1 22  ? -10.015 18.623 24.620 1.00 0.00 ? 22  PHE A HD2  2  
ATOM   3395  H  HE1  . PHE A 1 22  ? -7.053  17.531 20.852 1.00 0.00 ? 22  PHE A HE1  2  
ATOM   3396  H  HE2  . PHE A 1 22  ? -7.732  17.821 25.039 1.00 0.00 ? 22  PHE A HE2  2  
ATOM   3397  H  HZ   . PHE A 1 22  ? -6.252  17.279 23.158 1.00 0.00 ? 22  PHE A HZ   2  
ATOM   3398  N  N    . THR A 1 23  ? -13.315 20.283 20.605 1.00 0.00 ? 23  THR A N    2  
ATOM   3399  C  CA   . THR A 1 23  ? -14.683 20.767 20.332 1.00 0.00 ? 23  THR A CA   2  
ATOM   3400  C  C    . THR A 1 23  ? -15.325 21.221 21.629 1.00 0.00 ? 23  THR A C    2  
ATOM   3401  O  O    . THR A 1 23  ? -15.726 20.412 22.434 1.00 0.00 ? 23  THR A O    2  
ATOM   3402  C  CB   . THR A 1 23  ? -15.500 19.622 19.746 1.00 0.00 ? 23  THR A CB   2  
ATOM   3403  O  OG1  . THR A 1 23  ? -14.555 18.699 19.247 1.00 0.00 ? 23  THR A OG1  2  
ATOM   3404  C  CG2  . THR A 1 23  ? -16.281 20.086 18.510 1.00 0.00 ? 23  THR A CG2  2  
ATOM   3405  H  H    . THR A 1 23  ? -12.993 19.445 20.214 1.00 0.00 ? 23  THR A H    2  
ATOM   3406  H  HA   . THR A 1 23  ? -14.640 21.599 19.649 1.00 0.00 ? 23  THR A HA   2  
ATOM   3407  H  HB   . THR A 1 23  ? -16.129 19.165 20.488 1.00 0.00 ? 23  THR A HB   2  
ATOM   3408  H  HG1  . THR A 1 23  ? -14.946 17.824 19.281 1.00 0.00 ? 23  THR A HG1  2  
ATOM   3409  H  HG21 . THR A 1 23  ? -16.586 21.114 18.638 1.00 0.00 ? 23  THR A HG21 2  
ATOM   3410  H  HG22 . THR A 1 23  ? -15.658 20.005 17.633 1.00 0.00 ? 23  THR A HG22 2  
ATOM   3411  H  HG23 . THR A 1 23  ? -17.158 19.468 18.381 1.00 0.00 ? 23  THR A HG23 2  
ATOM   3412  N  N    . GLU A 1 24  ? -15.389 22.512 21.826 1.00 0.00 ? 24  GLU A N    2  
ATOM   3413  C  CA   . GLU A 1 24  ? -16.002 23.020 23.075 1.00 0.00 ? 24  GLU A CA   2  
ATOM   3414  C  C    . GLU A 1 24  ? -17.263 22.240 23.404 1.00 0.00 ? 24  GLU A C    2  
ATOM   3415  O  O    . GLU A 1 24  ? -17.606 22.072 24.557 1.00 0.00 ? 24  GLU A O    2  
ATOM   3416  C  CB   . GLU A 1 24  ? -16.352 24.497 22.895 1.00 0.00 ? 24  GLU A CB   2  
ATOM   3417  C  CG   . GLU A 1 24  ? -17.233 24.661 21.655 1.00 0.00 ? 24  GLU A CG   2  
ATOM   3418  C  CD   . GLU A 1 24  ? -17.895 26.038 21.686 1.00 0.00 ? 24  GLU A CD   2  
ATOM   3419  O  OE1  . GLU A 1 24  ? -18.771 26.200 22.520 1.00 0.00 ? 24  GLU A OE1  2  
ATOM   3420  O  OE2  . GLU A 1 24  ? -17.488 26.854 20.874 1.00 0.00 ? 24  GLU A OE2  2  
ATOM   3421  H  H    . GLU A 1 24  ? -15.037 23.135 21.156 1.00 0.00 ? 24  GLU A H    2  
ATOM   3422  H  HA   . GLU A 1 24  ? -15.291 22.889 23.890 1.00 0.00 ? 24  GLU A HA   2  
ATOM   3423  H  HB2  . GLU A 1 24  ? -16.881 24.850 23.768 1.00 0.00 ? 24  GLU A HB2  2  
ATOM   3424  H  HB3  . GLU A 1 24  ? -15.442 25.072 22.775 1.00 0.00 ? 24  GLU A HB3  2  
ATOM   3425  H  HG2  . GLU A 1 24  ? -16.630 24.573 20.765 1.00 0.00 ? 24  GLU A HG2  2  
ATOM   3426  H  HG3  . GLU A 1 24  ? -17.997 23.899 21.647 1.00 0.00 ? 24  GLU A HG3  2  
ATOM   3427  N  N    . GLU A 1 25  ? -17.936 21.773 22.388 1.00 0.00 ? 25  GLU A N    2  
ATOM   3428  C  CA   . GLU A 1 25  ? -19.167 21.003 22.646 1.00 0.00 ? 25  GLU A CA   2  
ATOM   3429  C  C    . GLU A 1 25  ? -18.850 19.878 23.610 1.00 0.00 ? 25  GLU A C    2  
ATOM   3430  O  O    . GLU A 1 25  ? -19.716 19.368 24.292 1.00 0.00 ? 25  GLU A O    2  
ATOM   3431  C  CB   . GLU A 1 25  ? -19.663 20.403 21.321 1.00 0.00 ? 25  GLU A CB   2  
ATOM   3432  C  CG   . GLU A 1 25  ? -20.524 21.436 20.592 1.00 0.00 ? 25  GLU A CG   2  
ATOM   3433  C  CD   . GLU A 1 25  ? -21.312 20.740 19.480 1.00 0.00 ? 25  GLU A CD   2  
ATOM   3434  O  OE1  . GLU A 1 25  ? -22.150 19.929 19.837 1.00 0.00 ? 25  GLU A OE1  2  
ATOM   3435  O  OE2  . GLU A 1 25  ? -21.029 21.058 18.337 1.00 0.00 ? 25  GLU A OE2  2  
ATOM   3436  H  H    . GLU A 1 25  ? -17.627 21.927 21.470 1.00 0.00 ? 25  GLU A H    2  
ATOM   3437  H  HA   . GLU A 1 25  ? -19.917 21.660 23.089 1.00 0.00 ? 25  GLU A HA   2  
ATOM   3438  H  HB2  . GLU A 1 25  ? -18.817 20.136 20.704 1.00 0.00 ? 25  GLU A HB2  2  
ATOM   3439  H  HB3  . GLU A 1 25  ? -20.248 19.518 21.520 1.00 0.00 ? 25  GLU A HB3  2  
ATOM   3440  H  HG2  . GLU A 1 25  ? -21.214 21.891 21.286 1.00 0.00 ? 25  GLU A HG2  2  
ATOM   3441  H  HG3  . GLU A 1 25  ? -19.893 22.199 20.161 1.00 0.00 ? 25  GLU A HG3  2  
ATOM   3442  N  N    . GLU A 1 26  ? -17.595 19.516 23.644 1.00 0.00 ? 26  GLU A N    2  
ATOM   3443  C  CA   . GLU A 1 26  ? -17.166 18.431 24.546 1.00 0.00 ? 26  GLU A CA   2  
ATOM   3444  C  C    . GLU A 1 26  ? -17.018 18.959 25.963 1.00 0.00 ? 26  GLU A C    2  
ATOM   3445  O  O    . GLU A 1 26  ? -17.475 18.350 26.905 1.00 0.00 ? 26  GLU A O    2  
ATOM   3446  C  CB   . GLU A 1 26  ? -15.802 17.904 24.058 1.00 0.00 ? 26  GLU A CB   2  
ATOM   3447  C  CG   . GLU A 1 26  ? -15.754 16.388 24.245 1.00 0.00 ? 26  GLU A CG   2  
ATOM   3448  C  CD   . GLU A 1 26  ? -14.470 15.841 23.620 1.00 0.00 ? 26  GLU A CD   2  
ATOM   3449  O  OE1  . GLU A 1 26  ? -13.475 15.858 24.326 1.00 0.00 ? 26  GLU A OE1  2  
ATOM   3450  O  OE2  . GLU A 1 26  ? -14.555 15.436 22.472 1.00 0.00 ? 26  GLU A OE2  2  
ATOM   3451  H  H    . GLU A 1 26  ? -16.940 19.965 23.071 1.00 0.00 ? 26  GLU A H    2  
ATOM   3452  H  HA   . GLU A 1 26  ? -17.915 17.643 24.537 1.00 0.00 ? 26  GLU A HA   2  
ATOM   3453  H  HB2  . GLU A 1 26  ? -15.673 18.141 23.011 1.00 0.00 ? 26  GLU A HB2  2  
ATOM   3454  H  HB3  . GLU A 1 26  ? -15.007 18.367 24.625 1.00 0.00 ? 26  GLU A HB3  2  
ATOM   3455  H  HG2  . GLU A 1 26  ? -15.770 16.150 25.297 1.00 0.00 ? 26  GLU A HG2  2  
ATOM   3456  H  HG3  . GLU A 1 26  ? -16.608 15.933 23.762 1.00 0.00 ? 26  GLU A HG3  2  
ATOM   3457  N  N    . LEU A 1 27  ? -16.379 20.092 26.091 1.00 0.00 ? 27  LEU A N    2  
ATOM   3458  C  CA   . LEU A 1 27  ? -16.196 20.668 27.445 1.00 0.00 ? 27  LEU A CA   2  
ATOM   3459  C  C    . LEU A 1 27  ? -17.530 20.726 28.168 1.00 0.00 ? 27  LEU A C    2  
ATOM   3460  O  O    . LEU A 1 27  ? -17.582 20.825 29.377 1.00 0.00 ? 27  LEU A O    2  
ATOM   3461  C  CB   . LEU A 1 27  ? -15.630 22.094 27.308 1.00 0.00 ? 27  LEU A CB   2  
ATOM   3462  C  CG   . LEU A 1 27  ? -14.096 22.025 27.212 1.00 0.00 ? 27  LEU A CG   2  
ATOM   3463  C  CD1  . LEU A 1 27  ? -13.693 21.755 25.762 1.00 0.00 ? 27  LEU A CD1  2  
ATOM   3464  C  CD2  . LEU A 1 27  ? -13.498 23.365 27.660 1.00 0.00 ? 27  LEU A CD2  2  
ATOM   3465  H  H    . LEU A 1 27  ? -16.027 20.553 25.303 1.00 0.00 ? 27  LEU A H    2  
ATOM   3466  H  HA   . LEU A 1 27  ? -15.522 20.032 28.011 1.00 0.00 ? 27  LEU A HA   2  
ATOM   3467  H  HB2  . LEU A 1 27  ? -16.028 22.557 26.419 1.00 0.00 ? 27  LEU A HB2  2  
ATOM   3468  H  HB3  . LEU A 1 27  ? -15.913 22.680 28.170 1.00 0.00 ? 27  LEU A HB3  2  
ATOM   3469  H  HG   . LEU A 1 27  ? -13.723 21.234 27.846 1.00 0.00 ? 27  LEU A HG   2  
ATOM   3470  H  HD11 . LEU A 1 27  ? -14.458 21.174 25.272 1.00 0.00 ? 27  LEU A HD11 2  
ATOM   3471  H  HD12 . LEU A 1 27  ? -13.568 22.692 25.238 1.00 0.00 ? 27  LEU A HD12 2  
ATOM   3472  H  HD13 . LEU A 1 27  ? -12.762 21.209 25.738 1.00 0.00 ? 27  LEU A HD13 2  
ATOM   3473  H  HD21 . LEU A 1 27  ? -13.866 23.619 28.643 1.00 0.00 ? 27  LEU A HD21 2  
ATOM   3474  H  HD22 . LEU A 1 27  ? -12.420 23.290 27.692 1.00 0.00 ? 27  LEU A HD22 2  
ATOM   3475  H  HD23 . LEU A 1 27  ? -13.779 24.141 26.963 1.00 0.00 ? 27  LEU A HD23 2  
ATOM   3476  N  N    . SER A 1 28  ? -18.590 20.666 27.409 1.00 0.00 ? 28  SER A N    2  
ATOM   3477  C  CA   . SER A 1 28  ? -19.930 20.714 28.026 1.00 0.00 ? 28  SER A CA   2  
ATOM   3478  C  C    . SER A 1 28  ? -20.331 19.320 28.489 1.00 0.00 ? 28  SER A C    2  
ATOM   3479  O  O    . SER A 1 28  ? -20.688 19.120 29.632 1.00 0.00 ? 28  SER A O    2  
ATOM   3480  C  CB   . SER A 1 28  ? -20.936 21.205 26.973 1.00 0.00 ? 28  SER A CB   2  
ATOM   3481  O  OG   . SER A 1 28  ? -20.457 22.493 26.612 1.00 0.00 ? 28  SER A OG   2  
ATOM   3482  H  H    . SER A 1 28  ? -18.496 20.590 26.438 1.00 0.00 ? 28  SER A H    2  
ATOM   3483  H  HA   . SER A 1 28  ? -19.904 21.382 28.885 1.00 0.00 ? 28  SER A HA   2  
ATOM   3484  H  HB2  . SER A 1 28  ? -20.937 20.552 26.112 1.00 0.00 ? 28  SER A HB2  2  
ATOM   3485  H  HB3  . SER A 1 28  ? -21.928 21.278 27.394 1.00 0.00 ? 28  SER A HB3  2  
ATOM   3486  H  HG   . SER A 1 28  ? -21.217 23.063 26.469 1.00 0.00 ? 28  SER A HG   2  
ATOM   3487  N  N    . SER A 1 29  ? -20.260 18.376 27.584 1.00 0.00 ? 29  SER A N    2  
ATOM   3488  C  CA   . SER A 1 29  ? -20.630 16.987 27.950 1.00 0.00 ? 29  SER A CA   2  
ATOM   3489  C  C    . SER A 1 29  ? -19.512 16.355 28.763 1.00 0.00 ? 29  SER A C    2  
ATOM   3490  O  O    . SER A 1 29  ? -19.722 15.404 29.488 1.00 0.00 ? 29  SER A O    2  
ATOM   3491  C  CB   . SER A 1 29  ? -20.825 16.175 26.661 1.00 0.00 ? 29  SER A CB   2  
ATOM   3492  O  OG   . SER A 1 29  ? -21.307 17.124 25.722 1.00 0.00 ? 29  SER A OG   2  
ATOM   3493  H  H    . SER A 1 29  ? -19.968 18.585 26.673 1.00 0.00 ? 29  SER A H    2  
ATOM   3494  H  HA   . SER A 1 29  ? -21.540 17.004 28.546 1.00 0.00 ? 29  SER A HA   2  
ATOM   3495  H  HB2  . SER A 1 29  ? -19.886 15.759 26.324 1.00 0.00 ? 29  SER A HB2  2  
ATOM   3496  H  HB3  . SER A 1 29  ? -21.553 15.391 26.809 1.00 0.00 ? 29  SER A HB3  2  
ATOM   3497  H  HG   . SER A 1 29  ? -21.806 17.789 26.202 1.00 0.00 ? 29  SER A HG   2  
ATOM   3498  N  N    . TRP A 1 30  ? -18.337 16.899 28.618 1.00 0.00 ? 30  TRP A N    2  
ATOM   3499  C  CA   . TRP A 1 30  ? -17.182 16.359 29.365 1.00 0.00 ? 30  TRP A CA   2  
ATOM   3500  C  C    . TRP A 1 30  ? -17.300 16.741 30.831 1.00 0.00 ? 30  TRP A C    2  
ATOM   3501  O  O    . TRP A 1 30  ? -16.625 16.195 31.679 1.00 0.00 ? 30  TRP A O    2  
ATOM   3502  C  CB   . TRP A 1 30  ? -15.903 16.988 28.780 1.00 0.00 ? 30  TRP A CB   2  
ATOM   3503  C  CG   . TRP A 1 30  ? -14.652 16.373 29.430 1.00 0.00 ? 30  TRP A CG   2  
ATOM   3504  C  CD1  . TRP A 1 30  ? -14.623 15.226 30.101 1.00 0.00 ? 30  TRP A CD1  2  
ATOM   3505  C  CD2  . TRP A 1 30  ? -13.464 16.915 29.382 1.00 0.00 ? 30  TRP A CD2  2  
ATOM   3506  N  NE1  . TRP A 1 30  ? -13.329 15.101 30.458 1.00 0.00 ? 30  TRP A NE1  2  
ATOM   3507  C  CE2  . TRP A 1 30  ? -12.524 16.144 30.036 1.00 0.00 ? 30  TRP A CE2  2  
ATOM   3508  C  CE3  . TRP A 1 30  ? -13.090 18.099 28.781 1.00 0.00 ? 30  TRP A CE3  2  
ATOM   3509  C  CZ2  . TRP A 1 30  ? -11.209 16.562 30.086 1.00 0.00 ? 30  TRP A CZ2  2  
ATOM   3510  C  CZ3  . TRP A 1 30  ? -11.779 18.514 28.831 1.00 0.00 ? 30  TRP A CZ3  2  
ATOM   3511  C  CH2  . TRP A 1 30  ? -10.837 17.746 29.483 1.00 0.00 ? 30  TRP A CH2  2  
ATOM   3512  H  H    . TRP A 1 30  ? -18.219 17.666 28.017 1.00 0.00 ? 30  TRP A H    2  
ATOM   3513  H  HA   . TRP A 1 30  ? -17.171 15.277 29.270 1.00 0.00 ? 30  TRP A HA   2  
ATOM   3514  H  HB2  . TRP A 1 30  ? -15.867 16.814 27.715 1.00 0.00 ? 30  TRP A HB2  2  
ATOM   3515  H  HB3  . TRP A 1 30  ? -15.908 18.052 28.964 1.00 0.00 ? 30  TRP A HB3  2  
ATOM   3516  H  HD1  . TRP A 1 30  ? -15.435 14.545 30.300 1.00 0.00 ? 30  TRP A HD1  2  
ATOM   3517  H  HE1  . TRP A 1 30  ? -12.988 14.338 30.971 1.00 0.00 ? 30  TRP A HE1  2  
ATOM   3518  H  HE3  . TRP A 1 30  ? -13.823 18.699 28.273 1.00 0.00 ? 30  TRP A HE3  2  
ATOM   3519  H  HZ2  . TRP A 1 30  ? -10.472 15.963 30.600 1.00 0.00 ? 30  TRP A HZ2  2  
ATOM   3520  H  HZ3  . TRP A 1 30  ? -11.488 19.442 28.361 1.00 0.00 ? 30  TRP A HZ3  2  
ATOM   3521  H  HH2  . TRP A 1 30  ? -9.809  18.071 29.521 1.00 0.00 ? 30  TRP A HH2  2  
ATOM   3522  N  N    . TYR A 1 31  ? -18.168 17.681 31.097 1.00 0.00 ? 31  TYR A N    2  
ATOM   3523  C  CA   . TYR A 1 31  ? -18.363 18.128 32.493 1.00 0.00 ? 31  TYR A CA   2  
ATOM   3524  C  C    . TYR A 1 31  ? -19.286 17.175 33.236 1.00 0.00 ? 31  TYR A C    2  
ATOM   3525  O  O    . TYR A 1 31  ? -19.012 16.788 34.353 1.00 0.00 ? 31  TYR A O    2  
ATOM   3526  C  CB   . TYR A 1 31  ? -19.006 19.523 32.465 1.00 0.00 ? 31  TYR A CB   2  
ATOM   3527  C  CG   . TYR A 1 31  ? -19.455 19.907 33.876 1.00 0.00 ? 31  TYR A CG   2  
ATOM   3528  C  CD1  . TYR A 1 31  ? -18.534 20.035 34.894 1.00 0.00 ? 31  TYR A CD1  2  
ATOM   3529  C  CD2  . TYR A 1 31  ? -20.788 20.140 34.147 1.00 0.00 ? 31  TYR A CD2  2  
ATOM   3530  C  CE1  . TYR A 1 31  ? -18.938 20.389 36.165 1.00 0.00 ? 31  TYR A CE1  2  
ATOM   3531  C  CE2  . TYR A 1 31  ? -21.193 20.495 35.418 1.00 0.00 ? 31  TYR A CE2  2  
ATOM   3532  C  CZ   . TYR A 1 31  ? -20.271 20.623 36.436 1.00 0.00 ? 31  TYR A CZ   2  
ATOM   3533  O  OH   . TYR A 1 31  ? -20.674 20.983 37.706 1.00 0.00 ? 31  TYR A OH   2  
ATOM   3534  H  H    . TYR A 1 31  ? -18.690 18.088 30.373 1.00 0.00 ? 31  TYR A H    2  
ATOM   3535  H  HA   . TYR A 1 31  ? -17.397 18.155 32.996 1.00 0.00 ? 31  TYR A HA   2  
ATOM   3536  H  HB2  . TYR A 1 31  ? -18.289 20.248 32.110 1.00 0.00 ? 31  TYR A HB2  2  
ATOM   3537  H  HB3  . TYR A 1 31  ? -19.862 19.518 31.806 1.00 0.00 ? 31  TYR A HB3  2  
ATOM   3538  H  HD1  . TYR A 1 31  ? -17.488 19.856 34.695 1.00 0.00 ? 31  TYR A HD1  2  
ATOM   3539  H  HD2  . TYR A 1 31  ? -21.520 20.043 33.358 1.00 0.00 ? 31  TYR A HD2  2  
ATOM   3540  H  HE1  . TYR A 1 31  ? -18.206 20.482 36.954 1.00 0.00 ? 31  TYR A HE1  2  
ATOM   3541  H  HE2  . TYR A 1 31  ? -22.239 20.676 35.615 1.00 0.00 ? 31  TYR A HE2  2  
ATOM   3542  H  HH   . TYR A 1 31  ? -19.941 21.436 38.131 1.00 0.00 ? 31  TYR A HH   2  
ATOM   3543  N  N    . GLN A 1 32  ? -20.367 16.810 32.600 1.00 0.00 ? 32  GLN A N    2  
ATOM   3544  C  CA   . GLN A 1 32  ? -21.316 15.883 33.258 1.00 0.00 ? 32  GLN A CA   2  
ATOM   3545  C  C    . GLN A 1 32  ? -20.810 14.449 33.177 1.00 0.00 ? 32  GLN A C    2  
ATOM   3546  O  O    . GLN A 1 32  ? -20.970 13.679 34.101 1.00 0.00 ? 32  GLN A O    2  
ATOM   3547  C  CB   . GLN A 1 32  ? -22.676 15.978 32.544 1.00 0.00 ? 32  GLN A CB   2  
ATOM   3548  C  CG   . GLN A 1 32  ? -22.493 15.645 31.063 1.00 0.00 ? 32  GLN A CG   2  
ATOM   3549  C  CD   . GLN A 1 32  ? -23.720 16.118 30.281 1.00 0.00 ? 32  GLN A CD   2  
ATOM   3550  O  OE1  . GLN A 1 32  ? -24.704 16.553 30.848 1.00 0.00 ? 32  GLN A OE1  2  
ATOM   3551  N  NE2  . GLN A 1 32  ? -23.705 16.051 28.978 1.00 0.00 ? 32  GLN A NE2  2  
ATOM   3552  H  H    . GLN A 1 32  ? -20.549 17.148 31.696 1.00 0.00 ? 32  GLN A H    2  
ATOM   3553  H  HA   . GLN A 1 32  ? -21.410 16.163 34.309 1.00 0.00 ? 32  GLN A HA   2  
ATOM   3554  H  HB2  . GLN A 1 32  ? -23.368 15.280 32.989 1.00 0.00 ? 32  GLN A HB2  2  
ATOM   3555  H  HB3  . GLN A 1 32  ? -23.068 16.980 32.644 1.00 0.00 ? 32  GLN A HB3  2  
ATOM   3556  H  HG2  . GLN A 1 32  ? -21.615 16.143 30.683 1.00 0.00 ? 32  GLN A HG2  2  
ATOM   3557  H  HG3  . GLN A 1 32  ? -22.381 14.579 30.940 1.00 0.00 ? 32  GLN A HG3  2  
ATOM   3558  H  HE21 . GLN A 1 32  ? -22.916 15.701 28.515 1.00 0.00 ? 32  GLN A HE21 2  
ATOM   3559  H  HE22 . GLN A 1 32  ? -24.482 16.350 28.462 1.00 0.00 ? 32  GLN A HE22 2  
ATOM   3560  N  N    . SER A 1 33  ? -20.207 14.106 32.071 1.00 0.00 ? 33  SER A N    2  
ATOM   3561  C  CA   . SER A 1 33  ? -19.694 12.722 31.939 1.00 0.00 ? 33  SER A CA   2  
ATOM   3562  C  C    . SER A 1 33  ? -18.729 12.416 33.069 1.00 0.00 ? 33  SER A C    2  
ATOM   3563  O  O    . SER A 1 33  ? -18.530 11.273 33.428 1.00 0.00 ? 33  SER A O    2  
ATOM   3564  C  CB   . SER A 1 33  ? -18.950 12.595 30.598 1.00 0.00 ? 33  SER A CB   2  
ATOM   3565  O  OG   . SER A 1 33  ? -18.417 11.278 30.622 1.00 0.00 ? 33  SER A OG   2  
ATOM   3566  H  H    . SER A 1 33  ? -20.098 14.751 31.341 1.00 0.00 ? 33  SER A H    2  
ATOM   3567  H  HA   . SER A 1 33  ? -20.530 12.026 31.992 1.00 0.00 ? 33  SER A HA   2  
ATOM   3568  H  HB2  . SER A 1 33  ? -19.632 12.707 29.769 1.00 0.00 ? 33  SER A HB2  2  
ATOM   3569  H  HB3  . SER A 1 33  ? -18.152 13.320 30.532 1.00 0.00 ? 33  SER A HB3  2  
ATOM   3570  H  HG   . SER A 1 33  ? -18.021 11.134 31.485 1.00 0.00 ? 33  SER A HG   2  
ATOM   3571  N  N    . PHE A 1 34  ? -18.143 13.446 33.611 1.00 0.00 ? 34  PHE A N    2  
ATOM   3572  C  CA   . PHE A 1 34  ? -17.190 13.234 34.719 1.00 0.00 ? 34  PHE A CA   2  
ATOM   3573  C  C    . PHE A 1 34  ? -17.941 13.095 36.030 1.00 0.00 ? 34  PHE A C    2  
ATOM   3574  O  O    . PHE A 1 34  ? -17.495 12.416 36.934 1.00 0.00 ? 34  PHE A O    2  
ATOM   3575  C  CB   . PHE A 1 34  ? -16.251 14.450 34.800 1.00 0.00 ? 34  PHE A CB   2  
ATOM   3576  C  CG   . PHE A 1 34  ? -15.679 14.559 36.216 1.00 0.00 ? 34  PHE A CG   2  
ATOM   3577  C  CD1  . PHE A 1 34  ? -14.526 13.875 36.564 1.00 0.00 ? 34  PHE A CD1  2  
ATOM   3578  C  CD2  . PHE A 1 34  ? -16.304 15.349 37.167 1.00 0.00 ? 34  PHE A CD2  2  
ATOM   3579  C  CE1  . PHE A 1 34  ? -14.011 13.979 37.841 1.00 0.00 ? 34  PHE A CE1  2  
ATOM   3580  C  CE2  . PHE A 1 34  ? -15.785 15.450 38.441 1.00 0.00 ? 34  PHE A CE2  2  
ATOM   3581  C  CZ   . PHE A 1 34  ? -14.639 14.767 38.777 1.00 0.00 ? 34  PHE A CZ   2  
ATOM   3582  H  H    . PHE A 1 34  ? -18.331 14.352 33.286 1.00 0.00 ? 34  PHE A H    2  
ATOM   3583  H  HA   . PHE A 1 34  ? -16.631 12.315 34.534 1.00 0.00 ? 34  PHE A HA   2  
ATOM   3584  H  HB2  . PHE A 1 34  ? -15.440 14.335 34.096 1.00 0.00 ? 34  PHE A HB2  2  
ATOM   3585  H  HB3  . PHE A 1 34  ? -16.800 15.351 34.567 1.00 0.00 ? 34  PHE A HB3  2  
ATOM   3586  H  HD1  . PHE A 1 34  ? -14.029 13.254 35.835 1.00 0.00 ? 34  PHE A HD1  2  
ATOM   3587  H  HD2  . PHE A 1 34  ? -17.204 15.886 36.910 1.00 0.00 ? 34  PHE A HD2  2  
ATOM   3588  H  HE1  . PHE A 1 34  ? -13.110 13.445 38.104 1.00 0.00 ? 34  PHE A HE1  2  
ATOM   3589  H  HE2  . PHE A 1 34  ? -16.277 16.070 39.177 1.00 0.00 ? 34  PHE A HE2  2  
ATOM   3590  H  HZ   . PHE A 1 34  ? -14.236 14.845 39.775 1.00 0.00 ? 34  PHE A HZ   2  
ATOM   3591  N  N    . LEU A 1 35  ? -19.074 13.742 36.116 1.00 0.00 ? 35  LEU A N    2  
ATOM   3592  C  CA   . LEU A 1 35  ? -19.858 13.648 37.364 1.00 0.00 ? 35  LEU A CA   2  
ATOM   3593  C  C    . LEU A 1 35  ? -20.314 12.219 37.571 1.00 0.00 ? 35  LEU A C    2  
ATOM   3594  O  O    . LEU A 1 35  ? -20.455 11.763 38.689 1.00 0.00 ? 35  LEU A O    2  
ATOM   3595  C  CB   . LEU A 1 35  ? -21.099 14.548 37.242 1.00 0.00 ? 35  LEU A CB   2  
ATOM   3596  C  CG   . LEU A 1 35  ? -20.713 15.988 37.580 1.00 0.00 ? 35  LEU A CG   2  
ATOM   3597  C  CD1  . LEU A 1 35  ? -21.895 16.911 37.275 1.00 0.00 ? 35  LEU A CD1  2  
ATOM   3598  C  CD2  . LEU A 1 35  ? -20.371 16.081 39.068 1.00 0.00 ? 35  LEU A CD2  2  
ATOM   3599  H  H    . LEU A 1 35  ? -19.399 14.282 35.363 1.00 0.00 ? 35  LEU A H    2  
ATOM   3600  H  HA   . LEU A 1 35  ? -19.233 13.952 38.204 1.00 0.00 ? 35  LEU A HA   2  
ATOM   3601  H  HB2  . LEU A 1 35  ? -21.483 14.502 36.236 1.00 0.00 ? 35  LEU A HB2  2  
ATOM   3602  H  HB3  . LEU A 1 35  ? -21.861 14.206 37.927 1.00 0.00 ? 35  LEU A HB3  2  
ATOM   3603  H  HG   . LEU A 1 35  ? -19.857 16.285 36.991 1.00 0.00 ? 35  LEU A HG   2  
ATOM   3604  H  HD11 . LEU A 1 35  ? -22.468 16.509 36.452 1.00 0.00 ? 35  LEU A HD11 2  
ATOM   3605  H  HD12 . LEU A 1 35  ? -22.530 16.989 38.146 1.00 0.00 ? 35  LEU A HD12 2  
ATOM   3606  H  HD13 . LEU A 1 35  ? -21.533 17.893 37.009 1.00 0.00 ? 35  LEU A HD13 2  
ATOM   3607  H  HD21 . LEU A 1 35  ? -20.836 15.264 39.600 1.00 0.00 ? 35  LEU A HD21 2  
ATOM   3608  H  HD22 . LEU A 1 35  ? -19.300 16.030 39.201 1.00 0.00 ? 35  LEU A HD22 2  
ATOM   3609  H  HD23 . LEU A 1 35  ? -20.734 17.016 39.467 1.00 0.00 ? 35  LEU A HD23 2  
ATOM   3610  N  N    . LYS A 1 36  ? -20.536 11.531 36.482 1.00 0.00 ? 36  LYS A N    2  
ATOM   3611  C  CA   . LYS A 1 36  ? -20.983 10.130 36.593 1.00 0.00 ? 36  LYS A CA   2  
ATOM   3612  C  C    . LYS A 1 36  ? -19.791 9.193  36.694 1.00 0.00 ? 36  LYS A C    2  
ATOM   3613  O  O    . LYS A 1 36  ? -19.830 8.212  37.410 1.00 0.00 ? 36  LYS A O    2  
ATOM   3614  C  CB   . LYS A 1 36  ? -21.785 9.775  35.336 1.00 0.00 ? 36  LYS A CB   2  
ATOM   3615  C  CG   . LYS A 1 36  ? -23.126 10.505 35.373 1.00 0.00 ? 36  LYS A CG   2  
ATOM   3616  C  CD   . LYS A 1 36  ? -23.930 10.131 34.128 1.00 0.00 ? 36  LYS A CD   2  
ATOM   3617  C  CE   . LYS A 1 36  ? -24.972 9.078  34.504 1.00 0.00 ? 36  LYS A CE   2  
ATOM   3618  N  NZ   . LYS A 1 36  ? -26.110 9.710  35.229 1.00 0.00 ? 36  LYS A NZ   2  
ATOM   3619  H  H    . LYS A 1 36  ? -20.409 11.941 35.597 1.00 0.00 ? 36  LYS A H    2  
ATOM   3620  H  HA   . LYS A 1 36  ? -21.594 10.027 37.485 1.00 0.00 ? 36  LYS A HA   2  
ATOM   3621  H  HB2  . LYS A 1 36  ? -21.233 10.075 34.457 1.00 0.00 ? 36  LYS A HB2  2  
ATOM   3622  H  HB3  . LYS A 1 36  ? -21.952 8.709  35.302 1.00 0.00 ? 36  LYS A HB3  2  
ATOM   3623  H  HG2  . LYS A 1 36  ? -23.673 10.216 36.258 1.00 0.00 ? 36  LYS A HG2  2  
ATOM   3624  H  HG3  . LYS A 1 36  ? -22.960 11.572 35.391 1.00 0.00 ? 36  LYS A HG3  2  
ATOM   3625  H  HD2  . LYS A 1 36  ? -24.424 11.008 33.738 1.00 0.00 ? 36  LYS A HD2  2  
ATOM   3626  H  HD3  . LYS A 1 36  ? -23.267 9.731  33.374 1.00 0.00 ? 36  LYS A HD3  2  
ATOM   3627  H  HE2  . LYS A 1 36  ? -25.345 8.600  33.611 1.00 0.00 ? 36  LYS A HE2  2  
ATOM   3628  H  HE3  . LYS A 1 36  ? -24.520 8.332  35.141 1.00 0.00 ? 36  LYS A HE3  2  
ATOM   3629  H  HZ1  . LYS A 1 36  ? -26.222 10.692 34.908 1.00 0.00 ? 36  LYS A HZ1  2  
ATOM   3630  H  HZ2  . LYS A 1 36  ? -26.982 9.180  35.033 1.00 0.00 ? 36  LYS A HZ2  2  
ATOM   3631  H  HZ3  . LYS A 1 36  ? -25.919 9.698  36.251 1.00 0.00 ? 36  LYS A HZ3  2  
ATOM   3632  N  N    . GLU A 1 37  ? -18.747 9.508  35.973 1.00 0.00 ? 37  GLU A N    2  
ATOM   3633  C  CA   . GLU A 1 37  ? -17.551 8.640  36.022 1.00 0.00 ? 37  GLU A CA   2  
ATOM   3634  C  C    . GLU A 1 37  ? -16.739 8.945  37.266 1.00 0.00 ? 37  GLU A C    2  
ATOM   3635  O  O    . GLU A 1 37  ? -15.743 8.306  37.541 1.00 0.00 ? 37  GLU A O    2  
ATOM   3636  C  CB   . GLU A 1 37  ? -16.690 8.931  34.783 1.00 0.00 ? 37  GLU A CB   2  
ATOM   3637  C  CG   . GLU A 1 37  ? -17.409 8.408  33.537 1.00 0.00 ? 37  GLU A CG   2  
ATOM   3638  C  CD   . GLU A 1 37  ? -16.747 8.993  32.287 1.00 0.00 ? 37  GLU A CD   2  
ATOM   3639  O  OE1  . GLU A 1 37  ? -16.105 10.019 32.444 1.00 0.00 ? 37  GLU A OE1  2  
ATOM   3640  O  OE2  . GLU A 1 37  ? -16.921 8.383  31.245 1.00 0.00 ? 37  GLU A OE2  2  
ATOM   3641  H  H    . GLU A 1 37  ? -18.753 10.315 35.411 1.00 0.00 ? 37  GLU A H    2  
ATOM   3642  H  HA   . GLU A 1 37  ? -17.865 7.598  36.044 1.00 0.00 ? 37  GLU A HA   2  
ATOM   3643  H  HB2  . GLU A 1 37  ? -16.534 9.996  34.691 1.00 0.00 ? 37  GLU A HB2  2  
ATOM   3644  H  HB3  . GLU A 1 37  ? -15.733 8.441  34.882 1.00 0.00 ? 37  GLU A HB3  2  
ATOM   3645  H  HG2  . GLU A 1 37  ? -17.345 7.330  33.502 1.00 0.00 ? 37  GLU A HG2  2  
ATOM   3646  H  HG3  . GLU A 1 37  ? -18.447 8.702  33.562 1.00 0.00 ? 37  GLU A HG3  2  
ATOM   3647  N  N    . CYS A 1 38  ? -17.189 9.922  38.001 1.00 0.00 ? 38  CYS A N    2  
ATOM   3648  C  CA   . CYS A 1 38  ? -16.475 10.303 39.235 1.00 0.00 ? 38  CYS A CA   2  
ATOM   3649  C  C    . CYS A 1 38  ? -17.315 11.305 40.046 1.00 0.00 ? 38  CYS A C    2  
ATOM   3650  O  O    . CYS A 1 38  ? -17.365 12.473 39.716 1.00 0.00 ? 38  CYS A O    2  
ATOM   3651  C  CB   . CYS A 1 38  ? -15.162 10.986 38.825 1.00 0.00 ? 38  CYS A CB   2  
ATOM   3652  S  SG   . CYS A 1 38  ? -13.951 11.314 40.129 1.00 0.00 ? 38  CYS A SG   2  
ATOM   3653  H  H    . CYS A 1 38  ? -18.000 10.403 37.734 1.00 0.00 ? 38  CYS A H    2  
ATOM   3654  H  HA   . CYS A 1 38  ? -16.280 9.415  39.821 1.00 0.00 ? 38  CYS A HA   2  
ATOM   3655  H  HB2  . CYS A 1 38  ? -14.680 10.370 38.080 1.00 0.00 ? 38  CYS A HB2  2  
ATOM   3656  H  HB3  . CYS A 1 38  ? -15.406 11.929 38.359 1.00 0.00 ? 38  CYS A HB3  2  
ATOM   3657  H  HG   . CYS A 1 38  ? -13.244 11.842 39.750 1.00 0.00 ? 38  CYS A HG   2  
ATOM   3658  N  N    . PRO A 1 39  ? -17.980 10.821 41.091 1.00 0.00 ? 39  PRO A N    2  
ATOM   3659  C  CA   . PRO A 1 39  ? -18.811 11.683 41.934 1.00 0.00 ? 39  PRO A CA   2  
ATOM   3660  C  C    . PRO A 1 39  ? -17.985 12.772 42.622 1.00 0.00 ? 39  PRO A C    2  
ATOM   3661  O  O    . PRO A 1 39  ? -17.043 13.287 42.058 1.00 0.00 ? 39  PRO A O    2  
ATOM   3662  C  CB   . PRO A 1 39  ? -19.425 10.732 42.989 1.00 0.00 ? 39  PRO A CB   2  
ATOM   3663  C  CG   . PRO A 1 39  ? -18.987 9.285  42.613 1.00 0.00 ? 39  PRO A CG   2  
ATOM   3664  C  CD   . PRO A 1 39  ? -17.962 9.402  41.476 1.00 0.00 ? 39  PRO A CD   2  
ATOM   3665  H  HA   . PRO A 1 39  ? -19.588 12.141 41.328 1.00 0.00 ? 39  PRO A HA   2  
ATOM   3666  H  HB2  . PRO A 1 39  ? -19.059 10.983 43.972 1.00 0.00 ? 39  PRO A HB2  2  
ATOM   3667  H  HB3  . PRO A 1 39  ? -20.501 10.810 42.974 1.00 0.00 ? 39  PRO A HB3  2  
ATOM   3668  H  HG2  . PRO A 1 39  ? -18.539 8.800  43.467 1.00 0.00 ? 39  PRO A HG2  2  
ATOM   3669  H  HG3  . PRO A 1 39  ? -19.843 8.715  42.281 1.00 0.00 ? 39  PRO A HG3  2  
ATOM   3670  H  HD2  . PRO A 1 39  ? -16.979 9.125  41.829 1.00 0.00 ? 39  PRO A HD2  2  
ATOM   3671  H  HD3  . PRO A 1 39  ? -18.247 8.784  40.637 1.00 0.00 ? 39  PRO A HD3  2  
ATOM   3672  N  N    . SER A 1 40  ? -18.356 13.105 43.830 1.00 0.00 ? 40  SER A N    2  
ATOM   3673  C  CA   . SER A 1 40  ? -17.602 14.156 44.559 1.00 0.00 ? 40  SER A CA   2  
ATOM   3674  C  C    . SER A 1 40  ? -17.565 15.444 43.739 1.00 0.00 ? 40  SER A C    2  
ATOM   3675  O  O    . SER A 1 40  ? -18.582 16.071 43.527 1.00 0.00 ? 40  SER A O    2  
ATOM   3676  C  CB   . SER A 1 40  ? -16.163 13.659 44.791 1.00 0.00 ? 40  SER A CB   2  
ATOM   3677  O  OG   . SER A 1 40  ? -15.611 14.608 45.693 1.00 0.00 ? 40  SER A OG   2  
ATOM   3678  H  H    . SER A 1 40  ? -19.124 12.665 44.251 1.00 0.00 ? 40  SER A H    2  
ATOM   3679  H  HA   . SER A 1 40  ? -18.102 14.355 45.506 1.00 0.00 ? 40  SER A HA   2  
ATOM   3680  H  HB2  . SER A 1 40  ? -16.164 12.676 45.239 1.00 0.00 ? 40  SER A HB2  2  
ATOM   3681  H  HB3  . SER A 1 40  ? -15.602 13.652 43.870 1.00 0.00 ? 40  SER A HB3  2  
ATOM   3682  H  HG   . SER A 1 40  ? -14.656 14.502 45.687 1.00 0.00 ? 40  SER A HG   2  
ATOM   3683  N  N    . GLY A 1 41  ? -16.395 15.819 43.294 1.00 0.00 ? 41  GLY A N    2  
ATOM   3684  C  CA   . GLY A 1 41  ? -16.293 17.069 42.486 1.00 0.00 ? 41  GLY A CA   2  
ATOM   3685  C  C    . GLY A 1 41  ? -14.888 17.667 42.584 1.00 0.00 ? 41  GLY A C    2  
ATOM   3686  O  O    . GLY A 1 41  ? -14.652 18.773 42.140 1.00 0.00 ? 41  GLY A O    2  
ATOM   3687  H  H    . GLY A 1 41  ? -15.596 15.289 43.488 1.00 0.00 ? 41  GLY A H    2  
ATOM   3688  H  HA2  . GLY A 1 41  ? -16.513 16.844 41.452 1.00 0.00 ? 41  GLY A HA2  2  
ATOM   3689  H  HA3  . GLY A 1 41  ? -17.011 17.789 42.851 1.00 0.00 ? 41  GLY A HA3  2  
ATOM   3690  N  N    . ARG A 1 42  ? -13.983 16.922 43.161 1.00 0.00 ? 42  ARG A N    2  
ATOM   3691  C  CA   . ARG A 1 42  ? -12.595 17.431 43.295 1.00 0.00 ? 42  ARG A CA   2  
ATOM   3692  C  C    . ARG A 1 42  ? -11.583 16.305 43.137 1.00 0.00 ? 42  ARG A C    2  
ATOM   3693  O  O    . ARG A 1 42  ? -11.529 15.394 43.939 1.00 0.00 ? 42  ARG A O    2  
ATOM   3694  C  CB   . ARG A 1 42  ? -12.446 18.043 44.694 1.00 0.00 ? 42  ARG A CB   2  
ATOM   3695  C  CG   . ARG A 1 42  ? -12.690 19.553 44.609 1.00 0.00 ? 42  ARG A CG   2  
ATOM   3696  C  CD   . ARG A 1 42  ? -12.893 20.107 46.019 1.00 0.00 ? 42  ARG A CD   2  
ATOM   3697  N  NE   . ARG A 1 42  ? -12.105 19.286 46.978 1.00 0.00 ? 42  ARG A NE   2  
ATOM   3698  C  CZ   . ARG A 1 42  ? -11.734 19.807 48.115 1.00 0.00 ? 42  ARG A CZ   2  
ATOM   3699  N  NH1  . ARG A 1 42  ? -12.558 20.602 48.740 1.00 0.00 ? 42  ARG A NH1  2  
ATOM   3700  N  NH2  . ARG A 1 42  ? -10.553 19.517 48.588 1.00 0.00 ? 42  ARG A NH2  2  
ATOM   3701  H  H    . ARG A 1 42  ? -14.219 16.035 43.504 1.00 0.00 ? 42  ARG A H    2  
ATOM   3702  H  HA   . ARG A 1 42  ? -12.412 18.180 42.526 1.00 0.00 ? 42  ARG A HA   2  
ATOM   3703  H  HB2  . ARG A 1 42  ? -13.166 17.596 45.362 1.00 0.00 ? 42  ARG A HB2  2  
ATOM   3704  H  HB3  . ARG A 1 42  ? -11.455 17.855 45.067 1.00 0.00 ? 42  ARG A HB3  2  
ATOM   3705  H  HG2  . ARG A 1 42  ? -11.838 20.033 44.149 1.00 0.00 ? 42  ARG A HG2  2  
ATOM   3706  H  HG3  . ARG A 1 42  ? -13.570 19.746 44.012 1.00 0.00 ? 42  ARG A HG3  2  
ATOM   3707  H  HD2  . ARG A 1 42  ? -12.556 21.131 46.063 1.00 0.00 ? 42  ARG A HD2  2  
ATOM   3708  H  HD3  . ARG A 1 42  ? -13.939 20.061 46.285 1.00 0.00 ? 42  ARG A HD3  2  
ATOM   3709  H  HE   . ARG A 1 42  ? -11.865 18.362 46.757 1.00 0.00 ? 42  ARG A HE   2  
ATOM   3710  H  HH11 . ARG A 1 42  ? -13.455 20.803 48.346 1.00 0.00 ? 42  ARG A HH11 2  
ATOM   3711  H  HH12 . ARG A 1 42  ? -12.293 21.011 49.612 1.00 0.00 ? 42  ARG A HH12 2  
ATOM   3712  H  HH21 . ARG A 1 42  ? -9.948  18.905 48.080 1.00 0.00 ? 42  ARG A HH21 2  
ATOM   3713  H  HH22 . ARG A 1 42  ? -10.254 19.908 49.459 1.00 0.00 ? 42  ARG A HH22 2  
ATOM   3714  N  N    . ILE A 1 43  ? -10.795 16.391 42.100 1.00 0.00 ? 43  ILE A N    2  
ATOM   3715  C  CA   . ILE A 1 43  ? -9.777  15.338 41.865 1.00 0.00 ? 43  ILE A CA   2  
ATOM   3716  C  C    . ILE A 1 43  ? -8.663  15.415 42.902 1.00 0.00 ? 43  ILE A C    2  
ATOM   3717  O  O    . ILE A 1 43  ? -8.282  16.489 43.331 1.00 0.00 ? 43  ILE A O    2  
ATOM   3718  C  CB   . ILE A 1 43  ? -9.175  15.559 40.481 1.00 0.00 ? 43  ILE A CB   2  
ATOM   3719  C  CG1  . ILE A 1 43  ? -10.283 15.622 39.442 1.00 0.00 ? 43  ILE A CG1  2  
ATOM   3720  C  CG2  . ILE A 1 43  ? -8.261  14.369 40.149 1.00 0.00 ? 43  ILE A CG2  2  
ATOM   3721  C  CD1  . ILE A 1 43  ? -9.660  15.634 38.045 1.00 0.00 ? 43  ILE A CD1  2  
ATOM   3722  H  H    . ILE A 1 43  ? -10.874 17.145 41.482 1.00 0.00 ? 43  ILE A H    2  
ATOM   3723  H  HA   . ILE A 1 43  ? -10.255 14.362 41.929 1.00 0.00 ? 43  ILE A HA   2  
ATOM   3724  H  HB   . ILE A 1 43  ? -8.616  16.496 40.474 1.00 0.00 ? 43  ILE A HB   2  
ATOM   3725  H  HG12 . ILE A 1 43  ? -10.927 14.761 39.544 1.00 0.00 ? 43  ILE A HG12 2  
ATOM   3726  H  HG13 . ILE A 1 43  ? -10.866 16.520 39.586 1.00 0.00 ? 43  ILE A HG13 2  
ATOM   3727  H  HG21 . ILE A 1 43  ? -7.629  14.148 40.996 1.00 0.00 ? 43  ILE A HG21 2  
ATOM   3728  H  HG22 . ILE A 1 43  ? -8.862  13.502 39.917 1.00 0.00 ? 43  ILE A HG22 2  
ATOM   3729  H  HG23 . ILE A 1 43  ? -7.643  14.611 39.297 1.00 0.00 ? 43  ILE A HG23 2  
ATOM   3730  H  HD11 . ILE A 1 43  ? -8.703  16.133 38.078 1.00 0.00 ? 43  ILE A HD11 2  
ATOM   3731  H  HD12 . ILE A 1 43  ? -9.520  14.620 37.701 1.00 0.00 ? 43  ILE A HD12 2  
ATOM   3732  H  HD13 . ILE A 1 43  ? -10.310 16.155 37.359 1.00 0.00 ? 43  ILE A HD13 2  
ATOM   3733  N  N    . THR A 1 44  ? -8.158  14.269 43.281 1.00 0.00 ? 44  THR A N    2  
ATOM   3734  C  CA   . THR A 1 44  ? -7.068  14.240 44.288 1.00 0.00 ? 44  THR A CA   2  
ATOM   3735  C  C    . THR A 1 44  ? -5.705  14.097 43.619 1.00 0.00 ? 44  THR A C    2  
ATOM   3736  O  O    . THR A 1 44  ? -5.605  14.032 42.409 1.00 0.00 ? 44  THR A O    2  
ATOM   3737  C  CB   . THR A 1 44  ? -7.293  13.034 45.204 1.00 0.00 ? 44  THR A CB   2  
ATOM   3738  O  OG1  . THR A 1 44  ? -8.288  12.260 44.565 1.00 0.00 ? 44  THR A OG1  2  
ATOM   3739  C  CG2  . THR A 1 44  ? -7.934  13.467 46.530 1.00 0.00 ? 44  THR A CG2  2  
ATOM   3740  H  H    . THR A 1 44  ? -8.498  13.432 42.900 1.00 0.00 ? 44  THR A H    2  
ATOM   3741  H  HA   . THR A 1 44  ? -7.086  15.166 44.860 1.00 0.00 ? 44  THR A HA   2  
ATOM   3742  H  HB   . THR A 1 44  ? -6.382  12.456 45.344 1.00 0.00 ? 44  THR A HB   2  
ATOM   3743  H  HG1  . THR A 1 44  ? -7.887  11.435 44.283 1.00 0.00 ? 44  THR A HG1  2  
ATOM   3744  H  HG21 . THR A 1 44  ? -8.686  14.220 46.342 1.00 0.00 ? 44  THR A HG21 2  
ATOM   3745  H  HG22 . THR A 1 44  ? -8.396  12.616 47.008 1.00 0.00 ? 44  THR A HG22 2  
ATOM   3746  H  HG23 . THR A 1 44  ? -7.178  13.876 47.185 1.00 0.00 ? 44  THR A HG23 2  
ATOM   3747  N  N    . ARG A 1 45  ? -4.682  14.052 44.423 1.00 0.00 ? 45  ARG A N    2  
ATOM   3748  C  CA   . ARG A 1 45  ? -3.312  13.917 43.870 1.00 0.00 ? 45  ARG A CA   2  
ATOM   3749  C  C    . ARG A 1 45  ? -3.127  12.584 43.148 1.00 0.00 ? 45  ARG A C    2  
ATOM   3750  O  O    . ARG A 1 45  ? -3.028  12.534 41.939 1.00 0.00 ? 45  ARG A O    2  
ATOM   3751  C  CB   . ARG A 1 45  ? -2.323  13.966 45.046 1.00 0.00 ? 45  ARG A CB   2  
ATOM   3752  C  CG   . ARG A 1 45  ? -0.885  13.896 44.509 1.00 0.00 ? 45  ARG A CG   2  
ATOM   3753  C  CD   . ARG A 1 45  ? -0.438  15.285 44.044 1.00 0.00 ? 45  ARG A CD   2  
ATOM   3754  N  NE   . ARG A 1 45  ? 0.942   15.537 44.541 1.00 0.00 ? 45  ARG A NE   2  
ATOM   3755  C  CZ   . ARG A 1 45  ? 1.184   15.468 45.822 1.00 0.00 ? 45  ARG A CZ   2  
ATOM   3756  N  NH1  . ARG A 1 45  ? 0.347   16.028 46.654 1.00 0.00 ? 45  ARG A NH1  2  
ATOM   3757  N  NH2  . ARG A 1 45  ? 2.249   14.834 46.230 1.00 0.00 ? 45  ARG A NH2  2  
ATOM   3758  H  H    . ARG A 1 45  ? -4.816  14.108 45.393 1.00 0.00 ? 45  ARG A H    2  
ATOM   3759  H  HA   . ARG A 1 45  ? -3.126  14.731 43.172 1.00 0.00 ? 45  ARG A HA   2  
ATOM   3760  H  HB2  . ARG A 1 45  ? -2.465  14.879 45.604 1.00 0.00 ? 45  ARG A HB2  2  
ATOM   3761  H  HB3  . ARG A 1 45  ? -2.502  13.125 45.700 1.00 0.00 ? 45  ARG A HB3  2  
ATOM   3762  H  HG2  . ARG A 1 45  ? -0.227  13.545 45.289 1.00 0.00 ? 45  ARG A HG2  2  
ATOM   3763  H  HG3  . ARG A 1 45  ? -0.841  13.207 43.679 1.00 0.00 ? 45  ARG A HG3  2  
ATOM   3764  H  HD2  . ARG A 1 45  ? -0.443  15.329 42.965 1.00 0.00 ? 45  ARG A HD2  2  
ATOM   3765  H  HD3  . ARG A 1 45  ? -1.098  16.039 44.435 1.00 0.00 ? 45  ARG A HD3  2  
ATOM   3766  H  HE   . ARG A 1 45  ? 1.662   15.752 43.913 1.00 0.00 ? 45  ARG A HE   2  
ATOM   3767  H  HH11 . ARG A 1 45  ? -0.462  16.500 46.307 1.00 0.00 ? 45  ARG A HH11 2  
ATOM   3768  H  HH12 . ARG A 1 45  ? 0.518   15.986 47.639 1.00 0.00 ? 45  ARG A HH12 2  
ATOM   3769  H  HH21 . ARG A 1 45  ? 2.864   14.410 45.565 1.00 0.00 ? 45  ARG A HH21 2  
ATOM   3770  H  HH22 . ARG A 1 45  ? 2.450   14.772 47.207 1.00 0.00 ? 45  ARG A HH22 2  
ATOM   3771  N  N    . GLN A 1 46  ? -3.087  11.531 43.913 1.00 0.00 ? 46  GLN A N    2  
ATOM   3772  C  CA   . GLN A 1 46  ? -2.908  10.188 43.309 1.00 0.00 ? 46  GLN A CA   2  
ATOM   3773  C  C    . GLN A 1 46  ? -3.962  9.892  42.250 1.00 0.00 ? 46  GLN A C    2  
ATOM   3774  O  O    . GLN A 1 46  ? -3.672  9.281  41.243 1.00 0.00 ? 46  GLN A O    2  
ATOM   3775  C  CB   . GLN A 1 46  ? -3.031  9.143  44.427 1.00 0.00 ? 46  GLN A CB   2  
ATOM   3776  C  CG   . GLN A 1 46  ? -2.266  7.884  44.018 1.00 0.00 ? 46  GLN A CG   2  
ATOM   3777  C  CD   . GLN A 1 46  ? -2.972  7.227  42.829 1.00 0.00 ? 46  GLN A CD   2  
ATOM   3778  O  OE1  . GLN A 1 46  ? -4.123  6.848  42.910 1.00 0.00 ? 46  GLN A OE1  2  
ATOM   3779  N  NE2  . GLN A 1 46  ? -2.318  7.075  41.710 1.00 0.00 ? 46  GLN A NE2  2  
ATOM   3780  H  H    . GLN A 1 46  ? -3.174  11.625 44.883 1.00 0.00 ? 46  GLN A H    2  
ATOM   3781  H  HA   . GLN A 1 46  ? -1.923  10.140 42.848 1.00 0.00 ? 46  GLN A HA   2  
ATOM   3782  H  HB2  . GLN A 1 46  ? -2.616  9.540  45.342 1.00 0.00 ? 46  GLN A HB2  2  
ATOM   3783  H  HB3  . GLN A 1 46  ? -4.072  8.901  44.584 1.00 0.00 ? 46  GLN A HB3  2  
ATOM   3784  H  HG2  . GLN A 1 46  ? -1.257  8.145  43.734 1.00 0.00 ? 46  GLN A HG2  2  
ATOM   3785  H  HG3  . GLN A 1 46  ? -2.236  7.189  44.844 1.00 0.00 ? 46  GLN A HG3  2  
ATOM   3786  H  HE21 . GLN A 1 46  ? -1.389  7.380  41.640 1.00 0.00 ? 46  GLN A HE21 2  
ATOM   3787  H  HE22 . GLN A 1 46  ? -2.757  6.657  40.940 1.00 0.00 ? 46  GLN A HE22 2  
ATOM   3788  N  N    . GLU A 1 47  ? -5.165  10.325 42.488 1.00 0.00 ? 47  GLU A N    2  
ATOM   3789  C  CA   . GLU A 1 47  ? -6.233  10.062 41.492 1.00 0.00 ? 47  GLU A CA   2  
ATOM   3790  C  C    . GLU A 1 47  ? -5.882  10.637 40.125 1.00 0.00 ? 47  GLU A C    2  
ATOM   3791  O  O    . GLU A 1 47  ? -6.135  10.017 39.111 1.00 0.00 ? 47  GLU A O    2  
ATOM   3792  C  CB   . GLU A 1 47  ? -7.531  10.714 41.974 1.00 0.00 ? 47  GLU A CB   2  
ATOM   3793  C  CG   . GLU A 1 47  ? -8.626  10.422 40.949 1.00 0.00 ? 47  GLU A CG   2  
ATOM   3794  C  CD   . GLU A 1 47  ? -9.992  10.756 41.552 1.00 0.00 ? 47  GLU A CD   2  
ATOM   3795  O  OE1  . GLU A 1 47  ? -10.001 11.072 42.730 1.00 0.00 ? 47  GLU A OE1  2  
ATOM   3796  O  OE2  . GLU A 1 47  ? -10.950 10.675 40.800 1.00 0.00 ? 47  GLU A OE2  2  
ATOM   3797  H  H    . GLU A 1 47  ? -5.363  10.817 43.313 1.00 0.00 ? 47  GLU A H    2  
ATOM   3798  H  HA   . GLU A 1 47  ? -6.361  8.986  41.395 1.00 0.00 ? 47  GLU A HA   2  
ATOM   3799  H  HB2  . GLU A 1 47  ? -7.811  10.305 42.934 1.00 0.00 ? 47  GLU A HB2  2  
ATOM   3800  H  HB3  . GLU A 1 47  ? -7.392  11.780 42.066 1.00 0.00 ? 47  GLU A HB3  2  
ATOM   3801  H  HG2  . GLU A 1 47  ? -8.468  11.022 40.064 1.00 0.00 ? 47  GLU A HG2  2  
ATOM   3802  H  HG3  . GLU A 1 47  ? -8.601  9.375  40.677 1.00 0.00 ? 47  GLU A HG3  2  
ATOM   3803  N  N    . PHE A 1 48  ? -5.310  11.806 40.116 1.00 0.00 ? 48  PHE A N    2  
ATOM   3804  C  CA   . PHE A 1 48  ? -4.944  12.422 38.815 1.00 0.00 ? 48  PHE A CA   2  
ATOM   3805  C  C    . PHE A 1 48  ? -4.296  11.401 37.890 1.00 0.00 ? 48  PHE A C    2  
ATOM   3806  O  O    . PHE A 1 48  ? -4.384  11.509 36.683 1.00 0.00 ? 48  PHE A O    2  
ATOM   3807  C  CB   . PHE A 1 48  ? -3.944  13.557 39.076 1.00 0.00 ? 48  PHE A CB   2  
ATOM   3808  C  CG   . PHE A 1 48  ? -3.794  14.392 37.803 1.00 0.00 ? 48  PHE A CG   2  
ATOM   3809  C  CD1  . PHE A 1 48  ? -4.755  15.328 37.461 1.00 0.00 ? 48  PHE A CD1  2  
ATOM   3810  C  CD2  . PHE A 1 48  ? -2.698  14.220 36.974 1.00 0.00 ? 48  PHE A CD2  2  
ATOM   3811  C  CE1  . PHE A 1 48  ? -4.622  16.075 36.309 1.00 0.00 ? 48  PHE A CE1  2  
ATOM   3812  C  CE2  . PHE A 1 48  ? -2.570  14.969 35.822 1.00 0.00 ? 48  PHE A CE2  2  
ATOM   3813  C  CZ   . PHE A 1 48  ? -3.531  15.896 35.491 1.00 0.00 ? 48  PHE A CZ   2  
ATOM   3814  H  H    . PHE A 1 48  ? -5.122  12.270 40.957 1.00 0.00 ? 48  PHE A H    2  
ATOM   3815  H  HA   . PHE A 1 48  ? -5.846  12.805 38.338 1.00 0.00 ? 48  PHE A HA   2  
ATOM   3816  H  HB2  . PHE A 1 48  ? -4.304  14.186 39.877 1.00 0.00 ? 48  PHE A HB2  2  
ATOM   3817  H  HB3  . PHE A 1 48  ? -2.984  13.145 39.348 1.00 0.00 ? 48  PHE A HB3  2  
ATOM   3818  H  HD1  . PHE A 1 48  ? -5.614  15.473 38.098 1.00 0.00 ? 48  PHE A HD1  2  
ATOM   3819  H  HD2  . PHE A 1 48  ? -1.940  13.494 37.230 1.00 0.00 ? 48  PHE A HD2  2  
ATOM   3820  H  HE1  . PHE A 1 48  ? -5.377  16.803 36.048 1.00 0.00 ? 48  PHE A HE1  2  
ATOM   3821  H  HE2  . PHE A 1 48  ? -1.714  14.826 35.178 1.00 0.00 ? 48  PHE A HE2  2  
ATOM   3822  H  HZ   . PHE A 1 48  ? -3.429  16.481 34.590 1.00 0.00 ? 48  PHE A HZ   2  
ATOM   3823  N  N    . GLN A 1 49  ? -3.654  10.429 38.473 1.00 0.00 ? 49  GLN A N    2  
ATOM   3824  C  CA   . GLN A 1 49  ? -2.995  9.393  37.644 1.00 0.00 ? 49  GLN A CA   2  
ATOM   3825  C  C    . GLN A 1 49  ? -3.996  8.325  37.195 1.00 0.00 ? 49  GLN A C    2  
ATOM   3826  O  O    . GLN A 1 49  ? -3.800  7.673  36.189 1.00 0.00 ? 49  GLN A O    2  
ATOM   3827  C  CB   . GLN A 1 49  ? -1.898  8.730  38.496 1.00 0.00 ? 49  GLN A CB   2  
ATOM   3828  C  CG   . GLN A 1 49  ? -1.498  7.400  37.860 1.00 0.00 ? 49  GLN A CG   2  
ATOM   3829  C  CD   . GLN A 1 49  ? -2.465  6.304  38.313 1.00 0.00 ? 49  GLN A CD   2  
ATOM   3830  O  OE1  . GLN A 1 49  ? -3.420  6.555  39.022 1.00 0.00 ? 49  GLN A OE1  2  
ATOM   3831  N  NE2  . GLN A 1 49  ? -2.254  5.076  37.928 1.00 0.00 ? 49  GLN A NE2  2  
ATOM   3832  H  H    . GLN A 1 49  ? -3.600  10.387 39.452 1.00 0.00 ? 49  GLN A H    2  
ATOM   3833  H  HA   . GLN A 1 49  ? -2.565  9.867  36.762 1.00 0.00 ? 49  GLN A HA   2  
ATOM   3834  H  HB2  . GLN A 1 49  ? -1.036  9.381  38.546 1.00 0.00 ? 49  GLN A HB2  2  
ATOM   3835  H  HB3  . GLN A 1 49  ? -2.267  8.557  39.494 1.00 0.00 ? 49  GLN A HB3  2  
ATOM   3836  H  HG2  . GLN A 1 49  ? -1.531  7.484  36.785 1.00 0.00 ? 49  GLN A HG2  2  
ATOM   3837  H  HG3  . GLN A 1 49  ? -0.497  7.138  38.164 1.00 0.00 ? 49  GLN A HG3  2  
ATOM   3838  H  HE21 . GLN A 1 49  ? -1.486  4.867  37.358 1.00 0.00 ? 49  GLN A HE21 2  
ATOM   3839  H  HE22 . GLN A 1 49  ? -2.864  4.363  38.211 1.00 0.00 ? 49  GLN A HE22 2  
ATOM   3840  N  N    . THR A 1 50  ? -5.057  8.169  37.947 1.00 0.00 ? 50  THR A N    2  
ATOM   3841  C  CA   . THR A 1 50  ? -6.074  7.147  37.570 1.00 0.00 ? 50  THR A CA   2  
ATOM   3842  C  C    . THR A 1 50  ? -6.584  7.377  36.151 1.00 0.00 ? 50  THR A C    2  
ATOM   3843  O  O    . THR A 1 50  ? -7.084  6.471  35.515 1.00 0.00 ? 50  THR A O    2  
ATOM   3844  C  CB   . THR A 1 50  ? -7.255  7.258  38.541 1.00 0.00 ? 50  THR A CB   2  
ATOM   3845  O  OG1  . THR A 1 50  ? -6.748  6.848  39.795 1.00 0.00 ? 50  THR A OG1  2  
ATOM   3846  C  CG2  . THR A 1 50  ? -8.342  6.223  38.206 1.00 0.00 ? 50  THR A CG2  2  
ATOM   3847  H  H    . THR A 1 50  ? -5.183  8.722  38.748 1.00 0.00 ? 50  THR A H    2  
ATOM   3848  H  HA   . THR A 1 50  ? -5.618  6.158  37.627 1.00 0.00 ? 50  THR A HA   2  
ATOM   3849  H  HB   . THR A 1 50  ? -7.641  8.273  38.594 1.00 0.00 ? 50  THR A HB   2  
ATOM   3850  H  HG1  . THR A 1 50  ? -6.122  7.511  40.093 1.00 0.00 ? 50  THR A HG1  2  
ATOM   3851  H  HG21 . THR A 1 50  ? -7.888  5.339  37.784 1.00 0.00 ? 50  THR A HG21 2  
ATOM   3852  H  HG22 . THR A 1 50  ? -8.877  5.952  39.105 1.00 0.00 ? 50  THR A HG22 2  
ATOM   3853  H  HG23 . THR A 1 50  ? -9.036  6.641  37.492 1.00 0.00 ? 50  THR A HG23 2  
ATOM   3854  N  N    . ILE A 1 51  ? -6.447  8.585  35.681 1.00 0.00 ? 51  ILE A N    2  
ATOM   3855  C  CA   . ILE A 1 51  ? -6.919  8.894  34.307 1.00 0.00 ? 51  ILE A CA   2  
ATOM   3856  C  C    . ILE A 1 51  ? -5.826  8.626  33.279 1.00 0.00 ? 51  ILE A C    2  
ATOM   3857  O  O    . ILE A 1 51  ? -6.104  8.327  32.135 1.00 0.00 ? 51  ILE A O    2  
ATOM   3858  C  CB   . ILE A 1 51  ? -7.279  10.377 34.248 1.00 0.00 ? 51  ILE A CB   2  
ATOM   3859  C  CG1  . ILE A 1 51  ? -8.293  10.707 35.331 1.00 0.00 ? 51  ILE A CG1  2  
ATOM   3860  C  CG2  . ILE A 1 51  ? -7.910  10.676 32.880 1.00 0.00 ? 51  ILE A CG2  2  
ATOM   3861  C  CD1  . ILE A 1 51  ? -8.503  12.221 35.369 1.00 0.00 ? 51  ILE A CD1  2  
ATOM   3862  H  H    . ILE A 1 51  ? -6.038  9.285  36.232 1.00 0.00 ? 51  ILE A H    2  
ATOM   3863  H  HA   . ILE A 1 51  ? -7.784  8.274  34.078 1.00 0.00 ? 51  ILE A HA   2  
ATOM   3864  H  HB   . ILE A 1 51  ? -6.379  10.975 34.403 1.00 0.00 ? 51  ILE A HB   2  
ATOM   3865  H  HG12 . ILE A 1 51  ? -9.230  10.215 35.114 1.00 0.00 ? 51  ILE A HG12 2  
ATOM   3866  H  HG13 . ILE A 1 51  ? -7.928  10.367 36.287 1.00 0.00 ? 51  ILE A HG13 2  
ATOM   3867  H  HG21 . ILE A 1 51  ? -8.784  10.059 32.741 1.00 0.00 ? 51  ILE A HG21 2  
ATOM   3868  H  HG22 . ILE A 1 51  ? -8.196  11.715 32.831 1.00 0.00 ? 51  ILE A HG22 2  
ATOM   3869  H  HG23 . ILE A 1 51  ? -7.196  10.466 32.096 1.00 0.00 ? 51  ILE A HG23 2  
ATOM   3870  H  HD11 . ILE A 1 51  ? -7.594  12.723 35.073 1.00 0.00 ? 51  ILE A HD11 2  
ATOM   3871  H  HD12 . ILE A 1 51  ? -9.298  12.496 34.692 1.00 0.00 ? 51  ILE A HD12 2  
ATOM   3872  H  HD13 . ILE A 1 51  ? -8.768  12.526 36.370 1.00 0.00 ? 51  ILE A HD13 2  
ATOM   3873  N  N    . TYR A 1 52  ? -4.601  8.739  33.707 1.00 0.00 ? 52  TYR A N    2  
ATOM   3874  C  CA   . TYR A 1 52  ? -3.473  8.497  32.773 1.00 0.00 ? 52  TYR A CA   2  
ATOM   3875  C  C    . TYR A 1 52  ? -3.362  7.016  32.403 1.00 0.00 ? 52  TYR A C    2  
ATOM   3876  O  O    . TYR A 1 52  ? -3.298  6.669  31.241 1.00 0.00 ? 52  TYR A O    2  
ATOM   3877  C  CB   . TYR A 1 52  ? -2.170  8.931  33.474 1.00 0.00 ? 52  TYR A CB   2  
ATOM   3878  C  CG   . TYR A 1 52  ? -1.984  10.448 33.323 1.00 0.00 ? 52  TYR A CG   2  
ATOM   3879  C  CD1  . TYR A 1 52  ? -3.063  11.304 33.423 1.00 0.00 ? 52  TYR A CD1  2  
ATOM   3880  C  CD2  . TYR A 1 52  ? -0.734  10.978 33.074 1.00 0.00 ? 52  TYR A CD2  2  
ATOM   3881  C  CE1  . TYR A 1 52  ? -2.893  12.666 33.277 1.00 0.00 ? 52  TYR A CE1  2  
ATOM   3882  C  CE2  . TYR A 1 52  ? -0.566  12.339 32.927 1.00 0.00 ? 52  TYR A CE2  2  
ATOM   3883  C  CZ   . TYR A 1 52  ? -1.643  13.193 33.027 1.00 0.00 ? 52  TYR A CZ   2  
ATOM   3884  O  OH   . TYR A 1 52  ? -1.476  14.555 32.872 1.00 0.00 ? 52  TYR A OH   2  
ATOM   3885  H  H    . TYR A 1 52  ? -4.426  8.980  34.641 1.00 0.00 ? 52  TYR A H    2  
ATOM   3886  H  HA   . TYR A 1 52  ? -3.634  9.077  31.866 1.00 0.00 ? 52  TYR A HA   2  
ATOM   3887  H  HB2  . TYR A 1 52  ? -2.217  8.679  34.523 1.00 0.00 ? 52  TYR A HB2  2  
ATOM   3888  H  HB3  . TYR A 1 52  ? -1.328  8.423  33.025 1.00 0.00 ? 52  TYR A HB3  2  
ATOM   3889  H  HD1  . TYR A 1 52  ? -4.046  10.908 33.623 1.00 0.00 ? 52  TYR A HD1  2  
ATOM   3890  H  HD2  . TYR A 1 52  ? 0.120   10.321 32.994 1.00 0.00 ? 52  TYR A HD2  2  
ATOM   3891  H  HE1  . TYR A 1 52  ? -3.746  13.324 33.358 1.00 0.00 ? 52  TYR A HE1  2  
ATOM   3892  H  HE2  . TYR A 1 52  ? 0.419   12.738 32.729 1.00 0.00 ? 52  TYR A HE2  2  
ATOM   3893  H  HH   . TYR A 1 52  ? -1.760  14.789 31.985 1.00 0.00 ? 52  TYR A HH   2  
ATOM   3894  N  N    . SER A 1 53  ? -3.347  6.177  33.403 1.00 0.00 ? 53  SER A N    2  
ATOM   3895  C  CA   . SER A 1 53  ? -3.240  4.712  33.147 1.00 0.00 ? 53  SER A CA   2  
ATOM   3896  C  C    . SER A 1 53  ? -4.043  4.277  31.918 1.00 0.00 ? 53  SER A C    2  
ATOM   3897  O  O    . SER A 1 53  ? -3.639  3.383  31.201 1.00 0.00 ? 53  SER A O    2  
ATOM   3898  C  CB   . SER A 1 53  ? -3.791  3.973  34.375 1.00 0.00 ? 53  SER A CB   2  
ATOM   3899  O  OG   . SER A 1 53  ? -2.836  4.232  35.393 1.00 0.00 ? 53  SER A OG   2  
ATOM   3900  H  H    . SER A 1 53  ? -3.406  6.510  34.323 1.00 0.00 ? 53  SER A H    2  
ATOM   3901  H  HA   . SER A 1 53  ? -2.192  4.459  32.989 1.00 0.00 ? 53  SER A HA   2  
ATOM   3902  H  HB2  . SER A 1 53  ? -4.756  4.367  34.658 1.00 0.00 ? 53  SER A HB2  2  
ATOM   3903  H  HB3  . SER A 1 53  ? -3.857  2.912  34.186 1.00 0.00 ? 53  SER A HB3  2  
ATOM   3904  H  HG   . SER A 1 53  ? -1.962  4.148  35.007 1.00 0.00 ? 53  SER A HG   2  
ATOM   3905  N  N    . LYS A 1 54  ? -5.160  4.912  31.695 1.00 0.00 ? 54  LYS A N    2  
ATOM   3906  C  CA   . LYS A 1 54  ? -5.986  4.533  30.516 1.00 0.00 ? 54  LYS A CA   2  
ATOM   3907  C  C    . LYS A 1 54  ? -5.344  4.999  29.208 1.00 0.00 ? 54  LYS A C    2  
ATOM   3908  O  O    . LYS A 1 54  ? -5.555  4.405  28.169 1.00 0.00 ? 54  LYS A O    2  
ATOM   3909  C  CB   . LYS A 1 54  ? -7.363  5.194  30.659 1.00 0.00 ? 54  LYS A CB   2  
ATOM   3910  C  CG   . LYS A 1 54  ? -8.294  4.243  31.415 1.00 0.00 ? 54  LYS A CG   2  
ATOM   3911  C  CD   . LYS A 1 54  ? -9.734  4.744  31.293 1.00 0.00 ? 54  LYS A CD   2  
ATOM   3912  C  CE   . LYS A 1 54  ? -9.895  6.018  32.126 1.00 0.00 ? 54  LYS A CE   2  
ATOM   3913  N  NZ   . LYS A 1 54  ? -11.227 6.042  32.794 1.00 0.00 ? 54  LYS A NZ   2  
ATOM   3914  H  H    . LYS A 1 54  ? -5.451  5.630  32.296 1.00 0.00 ? 54  LYS A H    2  
ATOM   3915  H  HA   . LYS A 1 54  ? -6.083  3.448  30.490 1.00 0.00 ? 54  LYS A HA   2  
ATOM   3916  H  HB2  . LYS A 1 54  ? -7.269  6.121  31.206 1.00 0.00 ? 54  LYS A HB2  2  
ATOM   3917  H  HB3  . LYS A 1 54  ? -7.772  5.400  29.680 1.00 0.00 ? 54  LYS A HB3  2  
ATOM   3918  H  HG2  . LYS A 1 54  ? -8.218  3.251  30.993 1.00 0.00 ? 54  LYS A HG2  2  
ATOM   3919  H  HG3  . LYS A 1 54  ? -8.009  4.207  32.456 1.00 0.00 ? 54  LYS A HG3  2  
ATOM   3920  H  HD2  . LYS A 1 54  ? -9.957  4.956  30.258 1.00 0.00 ? 54  LYS A HD2  2  
ATOM   3921  H  HD3  . LYS A 1 54  ? -10.413 3.985  31.654 1.00 0.00 ? 54  LYS A HD3  2  
ATOM   3922  H  HE2  . LYS A 1 54  ? -9.121  6.057  32.879 1.00 0.00 ? 54  LYS A HE2  2  
ATOM   3923  H  HE3  . LYS A 1 54  ? -9.806  6.883  31.485 1.00 0.00 ? 54  LYS A HE3  2  
ATOM   3924  H  HZ1  . LYS A 1 54  ? -11.712 5.136  32.633 1.00 0.00 ? 54  LYS A HZ1  2  
ATOM   3925  H  HZ2  . LYS A 1 54  ? -11.100 6.190  33.815 1.00 0.00 ? 54  LYS A HZ2  2  
ATOM   3926  H  HZ3  . LYS A 1 54  ? -11.799 6.816  32.399 1.00 0.00 ? 54  LYS A HZ3  2  
ATOM   3927  N  N    . PHE A 1 55  ? -4.576  6.049  29.282 1.00 0.00 ? 55  PHE A N    2  
ATOM   3928  C  CA   . PHE A 1 55  ? -3.919  6.558  28.051 1.00 0.00 ? 55  PHE A CA   2  
ATOM   3929  C  C    . PHE A 1 55  ? -2.617  5.811  27.782 1.00 0.00 ? 55  PHE A C    2  
ATOM   3930  O  O    . PHE A 1 55  ? -2.263  5.560  26.646 1.00 0.00 ? 55  PHE A O    2  
ATOM   3931  C  CB   . PHE A 1 55  ? -3.600  8.046  28.258 1.00 0.00 ? 55  PHE A CB   2  
ATOM   3932  C  CG   . PHE A 1 55  ? -4.783  8.887  27.777 1.00 0.00 ? 55  PHE A CG   2  
ATOM   3933  C  CD1  . PHE A 1 55  ? -4.944  9.169  26.431 1.00 0.00 ? 55  PHE A CD1  2  
ATOM   3934  C  CD2  . PHE A 1 55  ? -5.709  9.379  28.681 1.00 0.00 ? 55  PHE A CD2  2  
ATOM   3935  C  CE1  . PHE A 1 55  ? -6.012  9.930  26.000 1.00 0.00 ? 55  PHE A CE1  2  
ATOM   3936  C  CE2  . PHE A 1 55  ? -6.776  10.140 28.247 1.00 0.00 ? 55  PHE A CE2  2  
ATOM   3937  C  CZ   . PHE A 1 55  ? -6.925  10.414 26.908 1.00 0.00 ? 55  PHE A CZ   2  
ATOM   3938  H  H    . PHE A 1 55  ? -4.437  6.501  30.137 1.00 0.00 ? 55  PHE A H    2  
ATOM   3939  H  HA   . PHE A 1 55  ? -4.592  6.420  27.206 1.00 0.00 ? 55  PHE A HA   2  
ATOM   3940  H  HB2  . PHE A 1 55  ? -3.427  8.242  29.305 1.00 0.00 ? 55  PHE A HB2  2  
ATOM   3941  H  HB3  . PHE A 1 55  ? -2.718  8.314  27.695 1.00 0.00 ? 55  PHE A HB3  2  
ATOM   3942  H  HD1  . PHE A 1 55  ? -4.230  8.794  25.716 1.00 0.00 ? 55  PHE A HD1  2  
ATOM   3943  H  HD2  . PHE A 1 55  ? -5.596  9.166  29.735 1.00 0.00 ? 55  PHE A HD2  2  
ATOM   3944  H  HE1  . PHE A 1 55  ? -6.131  10.145 24.948 1.00 0.00 ? 55  PHE A HE1  2  
ATOM   3945  H  HE2  . PHE A 1 55  ? -7.494  10.518 28.958 1.00 0.00 ? 55  PHE A HE2  2  
ATOM   3946  H  HZ   . PHE A 1 55  ? -7.762  11.009 26.567 1.00 0.00 ? 55  PHE A HZ   2  
ATOM   3947  N  N    . PHE A 1 56  ? -1.930  5.471  28.836 1.00 0.00 ? 56  PHE A N    2  
ATOM   3948  C  CA   . PHE A 1 56  ? -0.648  4.739  28.677 1.00 0.00 ? 56  PHE A CA   2  
ATOM   3949  C  C    . PHE A 1 56  ? -0.877  3.228  28.796 1.00 0.00 ? 56  PHE A C    2  
ATOM   3950  O  O    . PHE A 1 56  ? -1.778  2.788  29.481 1.00 0.00 ? 56  PHE A O    2  
ATOM   3951  C  CB   . PHE A 1 56  ? 0.291   5.209  29.799 1.00 0.00 ? 56  PHE A CB   2  
ATOM   3952  C  CG   . PHE A 1 56  ? 0.391   6.734  29.731 1.00 0.00 ? 56  PHE A CG   2  
ATOM   3953  C  CD1  . PHE A 1 56  ? 1.200   7.345  28.788 1.00 0.00 ? 56  PHE A CD1  2  
ATOM   3954  C  CD2  . PHE A 1 56  ? -0.354  7.522  30.587 1.00 0.00 ? 56  PHE A CD2  2  
ATOM   3955  C  CE1  . PHE A 1 56  ? 1.257   8.722  28.704 1.00 0.00 ? 56  PHE A CE1  2  
ATOM   3956  C  CE2  . PHE A 1 56  ? -0.296  8.897  30.500 1.00 0.00 ? 56  PHE A CE2  2  
ATOM   3957  C  CZ   . PHE A 1 56  ? 0.509   9.496  29.560 1.00 0.00 ? 56  PHE A CZ   2  
ATOM   3958  H  H    . PHE A 1 56  ? -2.261  5.695  29.731 1.00 0.00 ? 56  PHE A H    2  
ATOM   3959  H  HA   . PHE A 1 56  ? -0.231  4.969  27.703 1.00 0.00 ? 56  PHE A HA   2  
ATOM   3960  H  HB2  . PHE A 1 56  ? -0.109  4.918  30.759 1.00 0.00 ? 56  PHE A HB2  2  
ATOM   3961  H  HB3  . PHE A 1 56  ? 1.269   4.779  29.673 1.00 0.00 ? 56  PHE A HB3  2  
ATOM   3962  H  HD1  . PHE A 1 56  ? 1.791   6.741  28.112 1.00 0.00 ? 56  PHE A HD1  2  
ATOM   3963  H  HD2  . PHE A 1 56  ? -0.982  7.059  31.331 1.00 0.00 ? 56  PHE A HD2  2  
ATOM   3964  H  HE1  . PHE A 1 56  ? 1.885   9.193  27.963 1.00 0.00 ? 56  PHE A HE1  2  
ATOM   3965  H  HE2  . PHE A 1 56  ? -0.893  9.503  31.160 1.00 0.00 ? 56  PHE A HE2  2  
ATOM   3966  H  HZ   . PHE A 1 56  ? 0.554   10.573 29.495 1.00 0.00 ? 56  PHE A HZ   2  
ATOM   3967  N  N    . PRO A 1 57  ? -0.046  2.454  28.116 1.00 0.00 ? 57  PRO A N    2  
ATOM   3968  C  CA   . PRO A 1 57  ? -0.161  0.998  28.148 1.00 0.00 ? 57  PRO A CA   2  
ATOM   3969  C  C    . PRO A 1 57  ? -0.232  0.465  29.575 1.00 0.00 ? 57  PRO A C    2  
ATOM   3970  O  O    . PRO A 1 57  ? -1.278  0.043  30.028 1.00 0.00 ? 57  PRO A O    2  
ATOM   3971  C  CB   . PRO A 1 57  ? 1.118   0.486  27.452 1.00 0.00 ? 57  PRO A CB   2  
ATOM   3972  C  CG   . PRO A 1 57  ? 1.867   1.734  26.885 1.00 0.00 ? 57  PRO A CG   2  
ATOM   3973  C  CD   . PRO A 1 57  ? 1.062   2.976  27.304 1.00 0.00 ? 57  PRO A CD   2  
ATOM   3974  H  HA   . PRO A 1 57  ? -1.048  0.694  27.600 1.00 0.00 ? 57  PRO A HA   2  
ATOM   3975  H  HB2  . PRO A 1 57  ? 1.744   -0.029 28.165 1.00 0.00 ? 57  PRO A HB2  2  
ATOM   3976  H  HB3  . PRO A 1 57  ? 0.856   -0.186 26.647 1.00 0.00 ? 57  PRO A HB3  2  
ATOM   3977  H  HG2  . PRO A 1 57  ? 2.864   1.783  27.295 1.00 0.00 ? 57  PRO A HG2  2  
ATOM   3978  H  HG3  . PRO A 1 57  ? 1.920   1.675  25.808 1.00 0.00 ? 57  PRO A HG3  2  
ATOM   3979  H  HD2  . PRO A 1 57  ? 1.672   3.641  27.887 1.00 0.00 ? 57  PRO A HD2  2  
ATOM   3980  H  HD3  . PRO A 1 57  ? 0.678   3.485  26.432 1.00 0.00 ? 57  PRO A HD3  2  
ATOM   3981  N  N    . GLU A 1 58  ? 0.877   0.487  30.262 1.00 0.00 ? 58  GLU A N    2  
ATOM   3982  C  CA   . GLU A 1 58  ? 0.868   -0.018 31.658 1.00 0.00 ? 58  GLU A CA   2  
ATOM   3983  C  C    . GLU A 1 58  ? 2.157   0.342  32.386 1.00 0.00 ? 58  GLU A C    2  
ATOM   3984  O  O    . GLU A 1 58  ? 2.624   -0.402 33.225 1.00 0.00 ? 58  GLU A O    2  
ATOM   3985  C  CB   . GLU A 1 58  ? 0.739   -1.553 31.616 1.00 0.00 ? 58  GLU A CB   2  
ATOM   3986  C  CG   . GLU A 1 58  ? -0.042  -2.030 32.846 1.00 0.00 ? 58  GLU A CG   2  
ATOM   3987  C  CD   . GLU A 1 58  ? -0.572  -3.442 32.593 1.00 0.00 ? 58  GLU A CD   2  
ATOM   3988  O  OE1  . GLU A 1 58  ? -0.171  -3.999 31.584 1.00 0.00 ? 58  GLU A OE1  2  
ATOM   3989  O  OE2  . GLU A 1 58  ? -1.349  -3.886 33.423 1.00 0.00 ? 58  GLU A OE2  2  
ATOM   3990  H  H    . GLU A 1 58  ? 1.702   0.835  29.864 1.00 0.00 ? 58  GLU A H    2  
ATOM   3991  H  HA   . GLU A 1 58  ? 0.028   0.426  32.188 1.00 0.00 ? 58  GLU A HA   2  
ATOM   3992  H  HB2  . GLU A 1 58  ? 0.218   -1.848 30.719 1.00 0.00 ? 58  GLU A HB2  2  
ATOM   3993  H  HB3  . GLU A 1 58  ? 1.724   -1.998 31.617 1.00 0.00 ? 58  GLU A HB3  2  
ATOM   3994  H  HG2  . GLU A 1 58  ? 0.606   -2.040 33.710 1.00 0.00 ? 58  GLU A HG2  2  
ATOM   3995  H  HG3  . GLU A 1 58  ? -0.875  -1.369 33.033 1.00 0.00 ? 58  GLU A HG3  2  
ATOM   3996  N  N    . ALA A 1 59  ? 2.713   1.476  32.056 1.00 0.00 ? 59  ALA A N    2  
ATOM   3997  C  CA   . ALA A 1 59  ? 3.963   1.885  32.724 1.00 0.00 ? 59  ALA A CA   2  
ATOM   3998  C  C    . ALA A 1 59  ? 3.669   2.422  34.117 1.00 0.00 ? 59  ALA A C    2  
ATOM   3999  O  O    . ALA A 1 59  ? 2.838   1.886  34.824 1.00 0.00 ? 59  ALA A O    2  
ATOM   4000  C  CB   . ALA A 1 59  ? 4.611   2.995  31.889 1.00 0.00 ? 59  ALA A CB   2  
ATOM   4001  H  H    . ALA A 1 59  ? 2.306   2.052  31.376 1.00 0.00 ? 59  ALA A H    2  
ATOM   4002  H  HA   . ALA A 1 59  ? 4.623   1.023  32.804 1.00 0.00 ? 59  ALA A HA   2  
ATOM   4003  H  HB1  . ALA A 1 59  ? 3.919   3.819  31.773 1.00 0.00 ? 59  ALA A HB1  2  
ATOM   4004  H  HB2  . ALA A 1 59  ? 5.501   3.345  32.385 1.00 0.00 ? 59  ALA A HB2  2  
ATOM   4005  H  HB3  . ALA A 1 59  ? 4.873   2.612  30.913 1.00 0.00 ? 59  ALA A HB3  2  
ATOM   4006  N  N    . ASP A 1 60  ? 4.358   3.471  34.490 1.00 0.00 ? 60  ASP A N    2  
ATOM   4007  C  CA   . ASP A 1 60  ? 4.130   4.058  35.835 1.00 0.00 ? 60  ASP A CA   2  
ATOM   4008  C  C    . ASP A 1 60  ? 4.155   5.584  35.777 1.00 0.00 ? 60  ASP A C    2  
ATOM   4009  O  O    . ASP A 1 60  ? 4.942   6.226  36.444 1.00 0.00 ? 60  ASP A O    2  
ATOM   4010  C  CB   . ASP A 1 60  ? 5.253   3.580  36.769 1.00 0.00 ? 60  ASP A CB   2  
ATOM   4011  C  CG   . ASP A 1 60  ? 5.048   2.098  37.090 1.00 0.00 ? 60  ASP A CG   2  
ATOM   4012  O  OD1  . ASP A 1 60  ? 4.356   1.845  38.063 1.00 0.00 ? 60  ASP A OD1  2  
ATOM   4013  O  OD2  . ASP A 1 60  ? 5.595   1.304  36.344 1.00 0.00 ? 60  ASP A OD2  2  
ATOM   4014  H  H    . ASP A 1 60  ? 5.020   3.868  33.888 1.00 0.00 ? 60  ASP A H    2  
ATOM   4015  H  HA   . ASP A 1 60  ? 3.158   3.737  36.205 1.00 0.00 ? 60  ASP A HA   2  
ATOM   4016  H  HB2  . ASP A 1 60  ? 6.211   3.712  36.288 1.00 0.00 ? 60  ASP A HB2  2  
ATOM   4017  H  HB3  . ASP A 1 60  ? 5.233   4.149  37.686 1.00 0.00 ? 60  ASP A HB3  2  
ATOM   4018  N  N    . PRO A 1 61  ? 3.275   6.132  34.968 1.00 0.00 ? 61  PRO A N    2  
ATOM   4019  C  CA   . PRO A 1 61  ? 3.177   7.579  34.808 1.00 0.00 ? 61  PRO A CA   2  
ATOM   4020  C  C    . PRO A 1 61  ? 2.765   8.236  36.111 1.00 0.00 ? 61  PRO A C    2  
ATOM   4021  O  O    . PRO A 1 61  ? 2.487   9.416  36.159 1.00 0.00 ? 61  PRO A O    2  
ATOM   4022  C  CB   . PRO A 1 61  ? 2.061   7.786  33.764 1.00 0.00 ? 61  PRO A CB   2  
ATOM   4023  C  CG   . PRO A 1 61  ? 1.488   6.379  33.412 1.00 0.00 ? 61  PRO A CG   2  
ATOM   4024  C  CD   . PRO A 1 61  ? 2.328   5.342  34.173 1.00 0.00 ? 61  PRO A CD   2  
ATOM   4025  H  HA   . PRO A 1 61  ? 4.124   7.982  34.463 1.00 0.00 ? 61  PRO A HA   2  
ATOM   4026  H  HB2  . PRO A 1 61  ? 1.281   8.410  34.175 1.00 0.00 ? 61  PRO A HB2  2  
ATOM   4027  H  HB3  . PRO A 1 61  ? 2.466   8.250  32.883 1.00 0.00 ? 61  PRO A HB3  2  
ATOM   4028  H  HG2  . PRO A 1 61  ? 0.455   6.314  33.719 1.00 0.00 ? 61  PRO A HG2  2  
ATOM   4029  H  HG3  . PRO A 1 61  ? 1.560   6.204  32.349 1.00 0.00 ? 61  PRO A HG3  2  
ATOM   4030  H  HD2  . PRO A 1 61  ? 1.703   4.746  34.823 1.00 0.00 ? 61  PRO A HD2  2  
ATOM   4031  H  HD3  . PRO A 1 61  ? 2.856   4.712  33.480 1.00 0.00 ? 61  PRO A HD3  2  
ATOM   4032  N  N    . LYS A 1 62  ? 2.740   7.457  37.145 1.00 0.00 ? 62  LYS A N    2  
ATOM   4033  C  CA   . LYS A 1 62  ? 2.347   8.011  38.462 1.00 0.00 ? 62  LYS A CA   2  
ATOM   4034  C  C    . LYS A 1 62  ? 3.354   9.044  38.942 1.00 0.00 ? 62  LYS A C    2  
ATOM   4035  O  O    . LYS A 1 62  ? 3.010   9.958  39.664 1.00 0.00 ? 62  LYS A O    2  
ATOM   4036  C  CB   . LYS A 1 62  ? 2.292   6.859  39.478 1.00 0.00 ? 62  LYS A CB   2  
ATOM   4037  C  CG   . LYS A 1 62  ? 1.915   5.565  38.749 1.00 0.00 ? 62  LYS A CG   2  
ATOM   4038  C  CD   . LYS A 1 62  ? 1.211   4.619  39.727 1.00 0.00 ? 62  LYS A CD   2  
ATOM   4039  C  CE   . LYS A 1 62  ? 2.255   3.987  40.649 1.00 0.00 ? 62  LYS A CE   2  
ATOM   4040  N  NZ   . LYS A 1 62  ? 2.832   5.010  41.564 1.00 0.00 ? 62  LYS A NZ   2  
ATOM   4041  H  H    . LYS A 1 62  ? 2.989   6.510  37.055 1.00 0.00 ? 62  LYS A H    2  
ATOM   4042  H  HA   . LYS A 1 62  ? 1.373   8.489  38.366 1.00 0.00 ? 62  LYS A HA   2  
ATOM   4043  H  HB2  . LYS A 1 62  ? 3.257   6.743  39.948 1.00 0.00 ? 62  LYS A HB2  2  
ATOM   4044  H  HB3  . LYS A 1 62  ? 1.554   7.080  40.234 1.00 0.00 ? 62  LYS A HB3  2  
ATOM   4045  H  HG2  . LYS A 1 62  ? 1.254   5.793  37.926 1.00 0.00 ? 62  LYS A HG2  2  
ATOM   4046  H  HG3  . LYS A 1 62  ? 2.807   5.092  38.366 1.00 0.00 ? 62  LYS A HG3  2  
ATOM   4047  H  HD2  . LYS A 1 62  ? 0.493   5.170  40.315 1.00 0.00 ? 62  LYS A HD2  2  
ATOM   4048  H  HD3  . LYS A 1 62  ? 0.697   3.845  39.176 1.00 0.00 ? 62  LYS A HD3  2  
ATOM   4049  H  HE2  . LYS A 1 62  ? 1.794   3.208  41.237 1.00 0.00 ? 62  LYS A HE2  2  
ATOM   4050  H  HE3  . LYS A 1 62  ? 3.048   3.557  40.056 1.00 0.00 ? 62  LYS A HE3  2  
ATOM   4051  H  HZ1  . LYS A 1 62  ? 2.230   5.859  41.562 1.00 0.00 ? 62  LYS A HZ1  2  
ATOM   4052  H  HZ2  . LYS A 1 62  ? 2.882   4.624  42.528 1.00 0.00 ? 62  LYS A HZ2  2  
ATOM   4053  H  HZ3  . LYS A 1 62  ? 3.789   5.264  41.243 1.00 0.00 ? 62  LYS A HZ3  2  
ATOM   4054  N  N    . ALA A 1 63  ? 4.578   8.884  38.535 1.00 0.00 ? 63  ALA A N    2  
ATOM   4055  C  CA   . ALA A 1 63  ? 5.610   9.854  38.963 1.00 0.00 ? 63  ALA A CA   2  
ATOM   4056  C  C    . ALA A 1 63  ? 5.438   11.178 38.232 1.00 0.00 ? 63  ALA A C    2  
ATOM   4057  O  O    . ALA A 1 63  ? 5.395   12.226 38.845 1.00 0.00 ? 63  ALA A O    2  
ATOM   4058  C  CB   . ALA A 1 63  ? 6.993   9.274  38.626 1.00 0.00 ? 63  ALA A CB   2  
ATOM   4059  H  H    . ALA A 1 63  ? 4.814   8.134  37.952 1.00 0.00 ? 63  ALA A H    2  
ATOM   4060  H  HA   . ALA A 1 63  ? 5.512   10.025 40.035 1.00 0.00 ? 63  ALA A HA   2  
ATOM   4061  H  HB1  . ALA A 1 63  ? 7.096   8.295  39.073 1.00 0.00 ? 63  ALA A HB1  2  
ATOM   4062  H  HB2  . ALA A 1 63  ? 7.101   9.189  37.556 1.00 0.00 ? 63  ALA A HB2  2  
ATOM   4063  H  HB3  . ALA A 1 63  ? 7.765   9.924  39.011 1.00 0.00 ? 63  ALA A HB3  2  
ATOM   4064  N  N    . TYR A 1 64  ? 5.338   11.109 36.932 1.00 0.00 ? 64  TYR A N    2  
ATOM   4065  C  CA   . TYR A 1 64  ? 5.168   12.357 36.144 1.00 0.00 ? 64  TYR A CA   2  
ATOM   4066  C  C    . TYR A 1 64  ? 3.741   12.888 36.250 1.00 0.00 ? 64  TYR A C    2  
ATOM   4067  O  O    . TYR A 1 64  ? 3.513   14.077 36.150 1.00 0.00 ? 64  TYR A O    2  
ATOM   4068  C  CB   . TYR A 1 64  ? 5.464   12.042 34.671 1.00 0.00 ? 64  TYR A CB   2  
ATOM   4069  C  CG   . TYR A 1 64  ? 5.066   13.242 33.808 1.00 0.00 ? 64  TYR A CG   2  
ATOM   4070  C  CD1  . TYR A 1 64  ? 3.745   13.454 33.469 1.00 0.00 ? 64  TYR A CD1  2  
ATOM   4071  C  CD2  . TYR A 1 64  ? 6.023   14.128 33.355 1.00 0.00 ? 64  TYR A CD2  2  
ATOM   4072  C  CE1  . TYR A 1 64  ? 3.387   14.535 32.688 1.00 0.00 ? 64  TYR A CE1  2  
ATOM   4073  C  CE2  . TYR A 1 64  ? 5.664   15.208 32.575 1.00 0.00 ? 64  TYR A CE2  2  
ATOM   4074  C  CZ   . TYR A 1 64  ? 4.344   15.419 32.235 1.00 0.00 ? 64  TYR A CZ   2  
ATOM   4075  O  OH   . TYR A 1 64  ? 3.985   16.497 31.452 1.00 0.00 ? 64  TYR A OH   2  
ATOM   4076  H  H    . TYR A 1 64  ? 5.376   10.240 36.479 1.00 0.00 ? 64  TYR A H    2  
ATOM   4077  H  HA   . TYR A 1 64  ? 5.856   13.111 36.523 1.00 0.00 ? 64  TYR A HA   2  
ATOM   4078  H  HB2  . TYR A 1 64  ? 6.518   11.845 34.543 1.00 0.00 ? 64  TYR A HB2  2  
ATOM   4079  H  HB3  . TYR A 1 64  ? 4.898   11.176 34.360 1.00 0.00 ? 64  TYR A HB3  2  
ATOM   4080  H  HD1  . TYR A 1 64  ? 2.986   12.769 33.816 1.00 0.00 ? 64  TYR A HD1  2  
ATOM   4081  H  HD2  . TYR A 1 64  ? 7.061   13.976 33.614 1.00 0.00 ? 64  TYR A HD2  2  
ATOM   4082  H  HE1  . TYR A 1 64  ? 2.350   14.687 32.428 1.00 0.00 ? 64  TYR A HE1  2  
ATOM   4083  H  HE2  . TYR A 1 64  ? 6.423   15.893 32.225 1.00 0.00 ? 64  TYR A HE2  2  
ATOM   4084  H  HH   . TYR A 1 64  ? 4.608   17.208 31.621 1.00 0.00 ? 64  TYR A HH   2  
ATOM   4085  N  N    . ALA A 1 65  ? 2.804   12.000 36.454 1.00 0.00 ? 65  ALA A N    2  
ATOM   4086  C  CA   . ALA A 1 65  ? 1.393   12.448 36.566 1.00 0.00 ? 65  ALA A CA   2  
ATOM   4087  C  C    . ALA A 1 65  ? 1.142   13.133 37.901 1.00 0.00 ? 65  ALA A C    2  
ATOM   4088  O  O    . ALA A 1 65  ? 0.261   13.962 38.020 1.00 0.00 ? 65  ALA A O    2  
ATOM   4089  C  CB   . ALA A 1 65  ? 0.480   11.216 36.465 1.00 0.00 ? 65  ALA A CB   2  
ATOM   4090  H  H    . ALA A 1 65  ? 3.030   11.048 36.535 1.00 0.00 ? 65  ALA A H    2  
ATOM   4091  H  HA   . ALA A 1 65  ? 1.180   13.155 35.763 1.00 0.00 ? 65  ALA A HA   2  
ATOM   4092  H  HB1  . ALA A 1 65  ? 0.709   10.527 37.263 1.00 0.00 ? 65  ALA A HB1  2  
ATOM   4093  H  HB2  . ALA A 1 65  ? -0.552  11.521 36.543 1.00 0.00 ? 65  ALA A HB2  2  
ATOM   4094  H  HB3  . ALA A 1 65  ? 0.634   10.726 35.515 1.00 0.00 ? 65  ALA A HB3  2  
ATOM   4095  N  N    . GLN A 1 66  ? 1.920   12.780 38.884 1.00 0.00 ? 66  GLN A N    2  
ATOM   4096  C  CA   . GLN A 1 66  ? 1.733   13.405 40.213 1.00 0.00 ? 66  GLN A CA   2  
ATOM   4097  C  C    . GLN A 1 66  ? 2.584   14.661 40.330 1.00 0.00 ? 66  GLN A C    2  
ATOM   4098  O  O    . GLN A 1 66  ? 2.362   15.489 41.191 1.00 0.00 ? 66  GLN A O    2  
ATOM   4099  C  CB   . GLN A 1 66  ? 2.168   12.402 41.290 1.00 0.00 ? 66  GLN A CB   2  
ATOM   4100  C  CG   . GLN A 1 66  ? 1.068   11.351 41.470 1.00 0.00 ? 66  GLN A CG   2  
ATOM   4101  C  CD   . GLN A 1 66  ? 1.474   10.378 42.580 1.00 0.00 ? 66  GLN A CD   2  
ATOM   4102  O  OE1  . GLN A 1 66  ? 1.137   9.211  42.551 1.00 0.00 ? 66  GLN A OE1  2  
ATOM   4103  N  NE2  . GLN A 1 66  ? 2.197   10.817 43.575 1.00 0.00 ? 66  GLN A NE2  2  
ATOM   4104  H  H    . GLN A 1 66  ? 2.626   12.111 38.744 1.00 0.00 ? 66  GLN A H    2  
ATOM   4105  H  HA   . GLN A 1 66  ? 0.683   13.675 40.334 1.00 0.00 ? 66  GLN A HA   2  
ATOM   4106  H  HB2  . GLN A 1 66  ? 3.086   11.919 40.987 1.00 0.00 ? 66  GLN A HB2  2  
ATOM   4107  H  HB3  . GLN A 1 66  ? 2.332   12.920 42.224 1.00 0.00 ? 66  GLN A HB3  2  
ATOM   4108  H  HG2  . GLN A 1 66  ? 0.139   11.834 41.741 1.00 0.00 ? 66  GLN A HG2  2  
ATOM   4109  H  HG3  . GLN A 1 66  ? 0.928   10.805 40.547 1.00 0.00 ? 66  GLN A HG3  2  
ATOM   4110  H  HE21 . GLN A 1 66  ? 2.472   11.757 43.605 1.00 0.00 ? 66  GLN A HE21 2  
ATOM   4111  H  HE22 . GLN A 1 66  ? 2.464   10.205 44.294 1.00 0.00 ? 66  GLN A HE22 2  
ATOM   4112  N  N    . HIS A 1 67  ? 3.548   14.778 39.458 1.00 0.00 ? 67  HIS A N    2  
ATOM   4113  C  CA   . HIS A 1 67  ? 4.430   15.969 39.495 1.00 0.00 ? 67  HIS A CA   2  
ATOM   4114  C  C    . HIS A 1 67  ? 3.702   17.182 38.934 1.00 0.00 ? 67  HIS A C    2  
ATOM   4115  O  O    . HIS A 1 67  ? 3.892   18.293 39.386 1.00 0.00 ? 67  HIS A O    2  
ATOM   4116  C  CB   . HIS A 1 67  ? 5.660   15.688 38.613 1.00 0.00 ? 67  HIS A CB   2  
ATOM   4117  C  CG   . HIS A 1 67  ? 6.680   14.861 39.399 1.00 0.00 ? 67  HIS A CG   2  
ATOM   4118  N  ND1  . HIS A 1 67  ? 6.967   15.038 40.602 1.00 0.00 ? 67  HIS A ND1  2  
ATOM   4119  C  CD2  . HIS A 1 67  ? 7.466   13.800 38.985 1.00 0.00 ? 67  HIS A CD2  2  
ATOM   4120  C  CE1  . HIS A 1 67  ? 7.845   14.213 40.996 1.00 0.00 ? 67  HIS A CE1  2  
ATOM   4121  N  NE2  . HIS A 1 67  ? 8.228   13.376 40.031 1.00 0.00 ? 67  HIS A NE2  2  
ATOM   4122  H  H    . HIS A 1 67  ? 3.688   14.083 38.782 1.00 0.00 ? 67  HIS A H    2  
ATOM   4123  H  HA   . HIS A 1 67  ? 4.724   16.169 40.525 1.00 0.00 ? 67  HIS A HA   2  
ATOM   4124  H  HB2  . HIS A 1 67  ? 5.359   15.138 37.733 1.00 0.00 ? 67  HIS A HB2  2  
ATOM   4125  H  HB3  . HIS A 1 67  ? 6.115   16.621 38.311 1.00 0.00 ? 67  HIS A HB3  2  
ATOM   4126  H  HD1  . HIS A 1 67  ? 6.566   15.730 41.168 1.00 0.00 ? 67  HIS A HD1  2  
ATOM   4127  H  HD2  . HIS A 1 67  ? 7.471   13.370 37.990 1.00 0.00 ? 67  HIS A HD2  2  
ATOM   4128  H  HE1  . HIS A 1 67  ? 8.236   14.187 42.003 1.00 0.00 ? 67  HIS A HE1  2  
ATOM   4129  N  N    . VAL A 1 68  ? 2.872   16.937 37.956 1.00 0.00 ? 68  VAL A N    2  
ATOM   4130  C  CA   . VAL A 1 68  ? 2.110   18.046 37.332 1.00 0.00 ? 68  VAL A CA   2  
ATOM   4131  C  C    . VAL A 1 68  ? 1.105   18.649 38.313 1.00 0.00 ? 68  VAL A C    2  
ATOM   4132  O  O    . VAL A 1 68  ? 0.538   19.692 38.062 1.00 0.00 ? 68  VAL A O    2  
ATOM   4133  C  CB   . VAL A 1 68  ? 1.348   17.467 36.123 1.00 0.00 ? 68  VAL A CB   2  
ATOM   4134  C  CG1  . VAL A 1 68  ? 0.140   18.351 35.804 1.00 0.00 ? 68  VAL A CG1  2  
ATOM   4135  C  CG2  . VAL A 1 68  ? 2.281   17.436 34.911 1.00 0.00 ? 68  VAL A CG2  2  
ATOM   4136  H  H    . VAL A 1 68  ? 2.753   16.019 37.634 1.00 0.00 ? 68  VAL A H    2  
ATOM   4137  H  HA   . VAL A 1 68  ? 2.807   18.820 37.015 1.00 0.00 ? 68  VAL A HA   2  
ATOM   4138  H  HB   . VAL A 1 68  ? 1.015   16.461 36.349 1.00 0.00 ? 68  VAL A HB   2  
ATOM   4139  H  HG11 . VAL A 1 68  ? 0.450   19.382 35.733 1.00 0.00 ? 68  VAL A HG11 2  
ATOM   4140  H  HG12 . VAL A 1 68  ? -0.295  18.046 34.865 1.00 0.00 ? 68  VAL A HG12 2  
ATOM   4141  H  HG13 . VAL A 1 68  ? -0.600  18.253 36.586 1.00 0.00 ? 68  VAL A HG13 2  
ATOM   4142  H  HG21 . VAL A 1 68  ? 2.620   18.436 34.686 1.00 0.00 ? 68  VAL A HG21 2  
ATOM   4143  H  HG22 . VAL A 1 68  ? 3.135   16.811 35.124 1.00 0.00 ? 68  VAL A HG22 2  
ATOM   4144  H  HG23 . VAL A 1 68  ? 1.755   17.040 34.055 1.00 0.00 ? 68  VAL A HG23 2  
ATOM   4145  N  N    . PHE A 1 69  ? 0.911   17.986 39.416 1.00 0.00 ? 69  PHE A N    2  
ATOM   4146  C  CA   . PHE A 1 69  ? -0.052  18.512 40.415 1.00 0.00 ? 69  PHE A CA   2  
ATOM   4147  C  C    . PHE A 1 69  ? 0.447   19.815 41.032 1.00 0.00 ? 69  PHE A C    2  
ATOM   4148  O  O    . PHE A 1 69  ? 0.020   20.885 40.647 1.00 0.00 ? 69  PHE A O    2  
ATOM   4149  C  CB   . PHE A 1 69  ? -0.217  17.459 41.525 1.00 0.00 ? 69  PHE A CB   2  
ATOM   4150  C  CG   . PHE A 1 69  ? -1.661  17.468 42.031 1.00 0.00 ? 69  PHE A CG   2  
ATOM   4151  C  CD1  . PHE A 1 69  ? -2.681  16.939 41.258 1.00 0.00 ? 69  PHE A CD1  2  
ATOM   4152  C  CD2  . PHE A 1 69  ? -1.964  17.992 43.275 1.00 0.00 ? 69  PHE A CD2  2  
ATOM   4153  C  CE1  . PHE A 1 69  ? -3.980  16.935 41.725 1.00 0.00 ? 69  PHE A CE1  2  
ATOM   4154  C  CE2  . PHE A 1 69  ? -3.263  17.985 43.738 1.00 0.00 ? 69  PHE A CE2  2  
ATOM   4155  C  CZ   . PHE A 1 69  ? -4.269  17.458 42.964 1.00 0.00 ? 69  PHE A CZ   2  
ATOM   4156  H  H    . PHE A 1 69  ? 1.393   17.150 39.585 1.00 0.00 ? 69  PHE A H    2  
ATOM   4157  H  HA   . PHE A 1 69  ? -1.003  18.704 39.920 1.00 0.00 ? 69  PHE A HA   2  
ATOM   4158  H  HB2  . PHE A 1 69  ? 0.016   16.479 41.135 1.00 0.00 ? 69  PHE A HB2  2  
ATOM   4159  H  HB3  . PHE A 1 69  ? 0.447   17.681 42.345 1.00 0.00 ? 69  PHE A HB3  2  
ATOM   4160  H  HD1  . PHE A 1 69  ? -2.460  16.528 40.284 1.00 0.00 ? 69  PHE A HD1  2  
ATOM   4161  H  HD2  . PHE A 1 69  ? -1.178  18.407 43.887 1.00 0.00 ? 69  PHE A HD2  2  
ATOM   4162  H  HE1  . PHE A 1 69  ? -4.772  16.522 41.118 1.00 0.00 ? 69  PHE A HE1  2  
ATOM   4163  H  HE2  . PHE A 1 69  ? -3.489  18.394 44.712 1.00 0.00 ? 69  PHE A HE2  2  
ATOM   4164  H  HZ   . PHE A 1 69  ? -5.286  17.455 43.328 1.00 0.00 ? 69  PHE A HZ   2  
ATOM   4165  N  N    . ARG A 1 70  ? 1.344   19.709 41.973 1.00 0.00 ? 70  ARG A N    2  
ATOM   4166  C  CA   . ARG A 1 70  ? 1.866   20.940 42.608 1.00 0.00 ? 70  ARG A CA   2  
ATOM   4167  C  C    . ARG A 1 70  ? 2.256   21.962 41.552 1.00 0.00 ? 70  ARG A C    2  
ATOM   4168  O  O    . ARG A 1 70  ? 2.387   23.135 41.839 1.00 0.00 ? 70  ARG A O    2  
ATOM   4169  C  CB   . ARG A 1 70  ? 3.107   20.578 43.441 1.00 0.00 ? 70  ARG A CB   2  
ATOM   4170  C  CG   . ARG A 1 70  ? 3.396   21.709 44.435 1.00 0.00 ? 70  ARG A CG   2  
ATOM   4171  C  CD   . ARG A 1 70  ? 4.048   21.124 45.690 1.00 0.00 ? 70  ARG A CD   2  
ATOM   4172  N  NE   . ARG A 1 70  ? 3.003   20.931 46.735 1.00 0.00 ? 70  ARG A NE   2  
ATOM   4173  C  CZ   . ARG A 1 70  ? 3.284   20.231 47.801 1.00 0.00 ? 70  ARG A CZ   2  
ATOM   4174  N  NH1  . ARG A 1 70  ? 4.535   20.008 48.095 1.00 0.00 ? 70  ARG A NH1  2  
ATOM   4175  N  NH2  . ARG A 1 70  ? 2.304   19.782 48.538 1.00 0.00 ? 70  ARG A NH2  2  
ATOM   4176  H  H    . ARG A 1 70  ? 1.670   18.828 42.253 1.00 0.00 ? 70  ARG A H    2  
ATOM   4177  H  HA   . ARG A 1 70  ? 1.088   21.366 43.239 1.00 0.00 ? 70  ARG A HA   2  
ATOM   4178  H  HB2  . ARG A 1 70  ? 2.926   19.660 43.979 1.00 0.00 ? 70  ARG A HB2  2  
ATOM   4179  H  HB3  . ARG A 1 70  ? 3.956   20.444 42.787 1.00 0.00 ? 70  ARG A HB3  2  
ATOM   4180  H  HG2  . ARG A 1 70  ? 4.063   22.428 43.981 1.00 0.00 ? 70  ARG A HG2  2  
ATOM   4181  H  HG3  . ARG A 1 70  ? 2.474   22.203 44.703 1.00 0.00 ? 70  ARG A HG3  2  
ATOM   4182  H  HD2  . ARG A 1 70  ? 4.504   20.173 45.458 1.00 0.00 ? 70  ARG A HD2  2  
ATOM   4183  H  HD3  . ARG A 1 70  ? 4.803   21.801 46.060 1.00 0.00 ? 70  ARG A HD3  2  
ATOM   4184  H  HE   . ARG A 1 70  ? 2.112   21.325 46.624 1.00 0.00 ? 70  ARG A HE   2  
ATOM   4185  H  HH11 . ARG A 1 70  ? 5.259   20.370 47.509 1.00 0.00 ? 70  ARG A HH11 2  
ATOM   4186  H  HH12 . ARG A 1 70  ? 4.769   19.473 48.907 1.00 0.00 ? 70  ARG A HH12 2  
ATOM   4187  H  HH21 . ARG A 1 70  ? 1.357   19.975 48.282 1.00 0.00 ? 70  ARG A HH21 2  
ATOM   4188  H  HH22 . ARG A 1 70  ? 2.502   19.243 49.357 1.00 0.00 ? 70  ARG A HH22 2  
ATOM   4189  N  N    . SER A 1 71  ? 2.437   21.500 40.345 1.00 0.00 ? 71  SER A N    2  
ATOM   4190  C  CA   . SER A 1 71  ? 2.817   22.434 39.267 1.00 0.00 ? 71  SER A CA   2  
ATOM   4191  C  C    . SER A 1 71  ? 1.667   23.381 38.957 1.00 0.00 ? 71  SER A C    2  
ATOM   4192  O  O    . SER A 1 71  ? 1.879   24.493 38.513 1.00 0.00 ? 71  SER A O    2  
ATOM   4193  C  CB   . SER A 1 71  ? 3.142   21.617 38.008 1.00 0.00 ? 71  SER A CB   2  
ATOM   4194  O  OG   . SER A 1 71  ? 3.936   20.544 38.487 1.00 0.00 ? 71  SER A OG   2  
ATOM   4195  H  H    . SER A 1 71  ? 2.327   20.545 40.157 1.00 0.00 ? 71  SER A H    2  
ATOM   4196  H  HA   . SER A 1 71  ? 3.681   23.015 39.587 1.00 0.00 ? 71  SER A HA   2  
ATOM   4197  H  HB2  . SER A 1 71  ? 2.239   21.240 37.553 1.00 0.00 ? 71  SER A HB2  2  
ATOM   4198  H  HB3  . SER A 1 71  ? 3.702   22.211 37.300 1.00 0.00 ? 71  SER A HB3  2  
ATOM   4199  H  HG   . SER A 1 71  ? 4.546   20.896 39.139 1.00 0.00 ? 71  SER A HG   2  
ATOM   4200  N  N    . PHE A 1 72  ? 0.461   22.926 39.197 1.00 0.00 ? 72  PHE A N    2  
ATOM   4201  C  CA   . PHE A 1 72  ? -0.707  23.795 38.918 1.00 0.00 ? 72  PHE A CA   2  
ATOM   4202  C  C    . PHE A 1 72  ? -1.861  23.505 39.874 1.00 0.00 ? 72  PHE A C    2  
ATOM   4203  O  O    . PHE A 1 72  ? -3.008  23.493 39.475 1.00 0.00 ? 72  PHE A O    2  
ATOM   4204  C  CB   . PHE A 1 72  ? -1.181  23.532 37.482 1.00 0.00 ? 72  PHE A CB   2  
ATOM   4205  C  CG   . PHE A 1 72  ? -1.964  24.749 36.986 1.00 0.00 ? 72  PHE A CG   2  
ATOM   4206  C  CD1  . PHE A 1 72  ? -1.346  25.984 36.877 1.00 0.00 ? 72  PHE A CD1  2  
ATOM   4207  C  CD2  . PHE A 1 72  ? -3.304  24.637 36.653 1.00 0.00 ? 72  PHE A CD2  2  
ATOM   4208  C  CE1  . PHE A 1 72  ? -2.057  27.084 36.443 1.00 0.00 ? 72  PHE A CE1  2  
ATOM   4209  C  CE2  . PHE A 1 72  ? -4.010  25.739 36.220 1.00 0.00 ? 72  PHE A CE2  2  
ATOM   4210  C  CZ   . PHE A 1 72  ? -3.387  26.961 36.116 1.00 0.00 ? 72  PHE A CZ   2  
ATOM   4211  H  H    . PHE A 1 72  ? 0.332   22.016 39.552 1.00 0.00 ? 72  PHE A H    2  
ATOM   4212  H  HA   . PHE A 1 72  ? -0.406  24.835 39.037 1.00 0.00 ? 72  PHE A HA   2  
ATOM   4213  H  HB2  . PHE A 1 72  ? -0.329  23.367 36.839 1.00 0.00 ? 72  PHE A HB2  2  
ATOM   4214  H  HB3  . PHE A 1 72  ? -1.820  22.661 37.459 1.00 0.00 ? 72  PHE A HB3  2  
ATOM   4215  H  HD1  . PHE A 1 72  ? -0.302  26.086 37.131 1.00 0.00 ? 72  PHE A HD1  2  
ATOM   4216  H  HD2  . PHE A 1 72  ? -3.797  23.680 36.733 1.00 0.00 ? 72  PHE A HD2  2  
ATOM   4217  H  HE1  . PHE A 1 72  ? -1.569  28.044 36.361 1.00 0.00 ? 72  PHE A HE1  2  
ATOM   4218  H  HE2  . PHE A 1 72  ? -5.055  25.644 35.964 1.00 0.00 ? 72  PHE A HE2  2  
ATOM   4219  H  HZ   . PHE A 1 72  ? -3.942  27.824 35.779 1.00 0.00 ? 72  PHE A HZ   2  
ATOM   4220  N  N    . ASP A 1 73  ? -1.542  23.275 41.121 1.00 0.00 ? 73  ASP A N    2  
ATOM   4221  C  CA   . ASP A 1 73  ? -2.616  22.988 42.104 1.00 0.00 ? 73  ASP A CA   2  
ATOM   4222  C  C    . ASP A 1 73  ? -2.213  23.449 43.492 1.00 0.00 ? 73  ASP A C    2  
ATOM   4223  O  O    . ASP A 1 73  ? -2.739  22.983 44.485 1.00 0.00 ? 73  ASP A O    2  
ATOM   4224  C  CB   . ASP A 1 73  ? -2.876  21.474 42.137 1.00 0.00 ? 73  ASP A CB   2  
ATOM   4225  C  CG   . ASP A 1 73  ? -4.270  21.215 42.726 1.00 0.00 ? 73  ASP A CG   2  
ATOM   4226  O  OD1  . ASP A 1 73  ? -5.052  22.152 42.709 1.00 0.00 ? 73  ASP A OD1  2  
ATOM   4227  O  OD2  . ASP A 1 73  ? -4.472  20.094 43.159 1.00 0.00 ? 73  ASP A OD2  2  
ATOM   4228  H  H    . ASP A 1 73  ? -0.603  23.295 41.404 1.00 0.00 ? 73  ASP A H    2  
ATOM   4229  H  HA   . ASP A 1 73  ? -3.511  23.527 41.806 1.00 0.00 ? 73  ASP A HA   2  
ATOM   4230  H  HB2  . ASP A 1 73  ? -2.827  21.070 41.136 1.00 0.00 ? 73  ASP A HB2  2  
ATOM   4231  H  HB3  . ASP A 1 73  ? -2.134  20.990 42.754 1.00 0.00 ? 73  ASP A HB3  2  
ATOM   4232  N  N    . ALA A 1 74  ? -1.284  24.358 43.534 1.00 0.00 ? 74  ALA A N    2  
ATOM   4233  C  CA   . ALA A 1 74  ? -0.818  24.876 44.838 1.00 0.00 ? 74  ALA A CA   2  
ATOM   4234  C  C    . ALA A 1 74  ? -1.537  26.179 45.163 1.00 0.00 ? 74  ALA A C    2  
ATOM   4235  O  O    . ALA A 1 74  ? -1.090  26.957 45.982 1.00 0.00 ? 74  ALA A O    2  
ATOM   4236  C  CB   . ALA A 1 74  ? 0.697   25.144 44.741 1.00 0.00 ? 74  ALA A CB   2  
ATOM   4237  H  H    . ALA A 1 74  ? -0.901  24.700 42.706 1.00 0.00 ? 74  ALA A H    2  
ATOM   4238  H  HA   . ALA A 1 74  ? -1.037  24.145 45.613 1.00 0.00 ? 74  ALA A HA   2  
ATOM   4239  H  HB1  . ALA A 1 74  ? 0.934   25.551 43.769 1.00 0.00 ? 74  ALA A HB1  2  
ATOM   4240  H  HB2  . ALA A 1 74  ? 0.994   25.848 45.504 1.00 0.00 ? 74  ALA A HB2  2  
ATOM   4241  H  HB3  . ALA A 1 74  ? 1.240   24.220 44.881 1.00 0.00 ? 74  ALA A HB3  2  
ATOM   4242  N  N    . ASN A 1 75  ? -2.650  26.389 44.505 1.00 0.00 ? 75  ASN A N    2  
ATOM   4243  C  CA   . ASN A 1 75  ? -3.428  27.628 44.746 1.00 0.00 ? 75  ASN A CA   2  
ATOM   4244  C  C    . ASN A 1 75  ? -4.338  27.483 45.957 1.00 0.00 ? 75  ASN A C    2  
ATOM   4245  O  O    . ASN A 1 75  ? -5.508  27.802 45.896 1.00 0.00 ? 75  ASN A O    2  
ATOM   4246  C  CB   . ASN A 1 75  ? -4.299  27.901 43.504 1.00 0.00 ? 75  ASN A CB   2  
ATOM   4247  C  CG   . ASN A 1 75  ? -5.427  26.861 43.424 1.00 0.00 ? 75  ASN A CG   2  
ATOM   4248  O  OD1  . ASN A 1 75  ? -5.233  25.742 42.983 1.00 0.00 ? 75  ASN A OD1  2  
ATOM   4249  N  ND2  . ASN A 1 75  ? -6.620  27.193 43.832 1.00 0.00 ? 75  ASN A ND2  2  
ATOM   4250  H  H    . ASN A 1 75  ? -2.967  25.729 43.852 1.00 0.00 ? 75  ASN A H    2  
ATOM   4251  H  HA   . ASN A 1 75  ? -2.737  28.450 44.919 1.00 0.00 ? 75  ASN A HA   2  
ATOM   4252  H  HB2  . ASN A 1 75  ? -4.730  28.888 43.574 1.00 0.00 ? 75  ASN A HB2  2  
ATOM   4253  H  HB3  . ASN A 1 75  ? -3.693  27.839 42.613 1.00 0.00 ? 75  ASN A HB3  2  
ATOM   4254  H  HD21 . ASN A 1 75  ? -6.786  28.092 44.182 1.00 0.00 ? 75  ASN A HD21 2  
ATOM   4255  H  HD22 . ASN A 1 75  ? -7.350  26.542 43.787 1.00 0.00 ? 75  ASN A HD22 2  
ATOM   4256  N  N    . SER A 1 76  ? -3.790  27.007 47.039 1.00 0.00 ? 76  SER A N    2  
ATOM   4257  C  CA   . SER A 1 76  ? -4.620  26.843 48.252 1.00 0.00 ? 76  SER A CA   2  
ATOM   4258  C  C    . SER A 1 76  ? -5.948  26.187 47.902 1.00 0.00 ? 76  SER A C    2  
ATOM   4259  O  O    . SER A 1 76  ? -6.997  26.784 48.047 1.00 0.00 ? 76  SER A O    2  
ATOM   4260  C  CB   . SER A 1 76  ? -4.892  28.233 48.841 1.00 0.00 ? 76  SER A CB   2  
ATOM   4261  O  OG   . SER A 1 76  ? -3.658  28.602 49.439 1.00 0.00 ? 76  SER A OG   2  
ATOM   4262  H  H    . SER A 1 76  ? -2.842  26.762 47.049 1.00 0.00 ? 76  SER A H    2  
ATOM   4263  H  HA   . SER A 1 76  ? -4.089  26.214 48.967 1.00 0.00 ? 76  SER A HA   2  
ATOM   4264  H  HB2  . SER A 1 76  ? -5.153  28.934 48.061 1.00 0.00 ? 76  SER A HB2  2  
ATOM   4265  H  HB3  . SER A 1 76  ? -5.670  28.189 49.586 1.00 0.00 ? 76  SER A HB3  2  
ATOM   4266  H  HG   . SER A 1 76  ? -3.840  28.903 50.332 1.00 0.00 ? 76  SER A HG   2  
ATOM   4267  N  N    . ASP A 1 77  ? -5.871  24.967 47.442 1.00 0.00 ? 77  ASP A N    2  
ATOM   4268  C  CA   . ASP A 1 77  ? -7.108  24.239 47.071 1.00 0.00 ? 77  ASP A CA   2  
ATOM   4269  C  C    . ASP A 1 77  ? -7.012  22.779 47.491 1.00 0.00 ? 77  ASP A C    2  
ATOM   4270  O  O    . ASP A 1 77  ? -7.983  22.188 47.922 1.00 0.00 ? 77  ASP A O    2  
ATOM   4271  C  CB   . ASP A 1 77  ? -7.256  24.306 45.545 1.00 0.00 ? 77  ASP A CB   2  
ATOM   4272  C  CG   . ASP A 1 77  ? -8.628  23.772 45.144 1.00 0.00 ? 77  ASP A CG   2  
ATOM   4273  O  OD1  . ASP A 1 77  ? -9.365  23.435 46.055 1.00 0.00 ? 77  ASP A OD1  2  
ATOM   4274  O  OD2  . ASP A 1 77  ? -8.863  23.730 43.947 1.00 0.00 ? 77  ASP A OD2  2  
ATOM   4275  H  H    . ASP A 1 77  ? -4.999  24.533 47.344 1.00 0.00 ? 77  ASP A H    2  
ATOM   4276  H  HA   . ASP A 1 77  ? -7.961  24.699 47.567 1.00 0.00 ? 77  ASP A HA   2  
ATOM   4277  H  HB2  . ASP A 1 77  ? -7.161  25.330 45.214 1.00 0.00 ? 77  ASP A HB2  2  
ATOM   4278  H  HB3  . ASP A 1 77  ? -6.489  23.707 45.077 1.00 0.00 ? 77  ASP A HB3  2  
ATOM   4279  N  N    . GLY A 1 78  ? -5.839  22.224 47.358 1.00 0.00 ? 78  GLY A N    2  
ATOM   4280  C  CA   . GLY A 1 78  ? -5.653  20.799 47.746 1.00 0.00 ? 78  GLY A CA   2  
ATOM   4281  C  C    . GLY A 1 78  ? -6.252  19.870 46.687 1.00 0.00 ? 78  GLY A C    2  
ATOM   4282  O  O    . GLY A 1 78  ? -5.968  18.690 46.665 1.00 0.00 ? 78  GLY A O    2  
ATOM   4283  H  H    . GLY A 1 78  ? -5.085  22.742 47.007 1.00 0.00 ? 78  GLY A H    2  
ATOM   4284  H  HA2  . GLY A 1 78  ? -4.598  20.592 47.844 1.00 0.00 ? 78  GLY A HA2  2  
ATOM   4285  H  HA3  . GLY A 1 78  ? -6.141  20.621 48.693 1.00 0.00 ? 78  GLY A HA3  2  
ATOM   4286  N  N    . THR A 1 79  ? -7.071  20.424 45.832 1.00 0.00 ? 79  THR A N    2  
ATOM   4287  C  CA   . THR A 1 79  ? -7.695  19.592 44.773 1.00 0.00 ? 79  THR A CA   2  
ATOM   4288  C  C    . THR A 1 79  ? -7.801  20.363 43.466 1.00 0.00 ? 79  THR A C    2  
ATOM   4289  O  O    . THR A 1 79  ? -7.746  21.584 43.449 1.00 0.00 ? 79  THR A O    2  
ATOM   4290  C  CB   . THR A 1 79  ? -9.107  19.208 45.228 1.00 0.00 ? 79  THR A CB   2  
ATOM   4291  O  OG1  . THR A 1 79  ? -9.531  20.264 46.064 1.00 0.00 ? 79  THR A OG1  2  
ATOM   4292  C  CG2  . THR A 1 79  ? -9.073  17.976 46.148 1.00 0.00 ? 79  THR A CG2  2  
ATOM   4293  H  H    . THR A 1 79  ? -7.273  21.381 45.890 1.00 0.00 ? 79  THR A H    2  
ATOM   4294  H  HA   . THR A 1 79  ? -7.085  18.704 44.609 1.00 0.00 ? 79  THR A HA   2  
ATOM   4295  H  HB   . THR A 1 79  ? -9.784  19.087 44.382 1.00 0.00 ? 79  THR A HB   2  
ATOM   4296  H  HG1  . THR A 1 79  ? -9.414  19.987 46.976 1.00 0.00 ? 79  THR A HG1  2  
ATOM   4297  H  HG21 . THR A 1 79  ? -8.249  18.059 46.840 1.00 0.00 ? 79  THR A HG21 2  
ATOM   4298  H  HG22 . THR A 1 79  ? -9.997  17.910 46.703 1.00 0.00 ? 79  THR A HG22 2  
ATOM   4299  H  HG23 . THR A 1 79  ? -8.950  17.081 45.555 1.00 0.00 ? 79  THR A HG23 2  
ATOM   4300  N  N    . LEU A 1 80  ? -7.949  19.635 42.390 1.00 0.00 ? 80  LEU A N    2  
ATOM   4301  C  CA   . LEU A 1 80  ? -8.064  20.295 41.069 1.00 0.00 ? 80  LEU A CA   2  
ATOM   4302  C  C    . LEU A 1 80  ? -9.519  20.372 40.642 1.00 0.00 ? 80  LEU A C    2  
ATOM   4303  O  O    . LEU A 1 80  ? -10.235 19.392 40.693 1.00 0.00 ? 80  LEU A O    2  
ATOM   4304  C  CB   . LEU A 1 80  ? -7.295  19.456 40.037 1.00 0.00 ? 80  LEU A CB   2  
ATOM   4305  C  CG   . LEU A 1 80  ? -5.797  19.698 40.210 1.00 0.00 ? 80  LEU A CG   2  
ATOM   4306  C  CD1  . LEU A 1 80  ? -5.020  18.655 39.405 1.00 0.00 ? 80  LEU A CD1  2  
ATOM   4307  C  CD2  . LEU A 1 80  ? -5.446  21.097 39.695 1.00 0.00 ? 80  LEU A CD2  2  
ATOM   4308  H  H    . LEU A 1 80  ? -7.983  18.654 42.459 1.00 0.00 ? 80  LEU A H    2  
ATOM   4309  H  HA   . LEU A 1 80  ? -7.656  21.303 41.132 1.00 0.00 ? 80  LEU A HA   2  
ATOM   4310  H  HB2  . LEU A 1 80  ? -7.512  18.410 40.186 1.00 0.00 ? 80  LEU A HB2  2  
ATOM   4311  H  HB3  . LEU A 1 80  ? -7.595  19.741 39.040 1.00 0.00 ? 80  LEU A HB3  2  
ATOM   4312  H  HG   . LEU A 1 80  ? -5.538  19.618 41.247 1.00 0.00 ? 80  LEU A HG   2  
ATOM   4313  H  HD11 . LEU A 1 80  ? -5.549  17.712 39.425 1.00 0.00 ? 80  LEU A HD11 2  
ATOM   4314  H  HD12 . LEU A 1 80  ? -4.920  18.984 38.381 1.00 0.00 ? 80  LEU A HD12 2  
ATOM   4315  H  HD13 . LEU A 1 80  ? -4.038  18.521 39.834 1.00 0.00 ? 80  LEU A HD13 2  
ATOM   4316  H  HD21 . LEU A 1 80  ? -6.074  21.343 38.853 1.00 0.00 ? 80  LEU A HD21 2  
ATOM   4317  H  HD22 . LEU A 1 80  ? -5.603  21.823 40.480 1.00 0.00 ? 80  LEU A HD22 2  
ATOM   4318  H  HD23 . LEU A 1 80  ? -4.411  21.122 39.387 1.00 0.00 ? 80  LEU A HD23 2  
ATOM   4319  N  N    . ASP A 1 81  ? -9.935  21.533 40.230 1.00 0.00 ? 81  ASP A N    2  
ATOM   4320  C  CA   . ASP A 1 81  ? -11.341 21.683 39.796 1.00 0.00 ? 81  ASP A CA   2  
ATOM   4321  C  C    . ASP A 1 81  ? -11.470 21.385 38.311 1.00 0.00 ? 81  ASP A C    2  
ATOM   4322  O  O    . ASP A 1 81  ? -10.530 21.564 37.561 1.00 0.00 ? 81  ASP A O    2  
ATOM   4323  C  CB   . ASP A 1 81  ? -11.778 23.132 40.055 1.00 0.00 ? 81  ASP A CB   2  
ATOM   4324  C  CG   . ASP A 1 81  ? -13.306 23.208 40.046 1.00 0.00 ? 81  ASP A CG   2  
ATOM   4325  O  OD1  . ASP A 1 81  ? -13.872 22.820 41.055 1.00 0.00 ? 81  ASP A OD1  2  
ATOM   4326  O  OD2  . ASP A 1 81  ? -13.820 23.646 39.030 1.00 0.00 ? 81  ASP A OD2  2  
ATOM   4327  H  H    . ASP A 1 81  ? -9.324  22.300 40.210 1.00 0.00 ? 81  ASP A H    2  
ATOM   4328  H  HA   . ASP A 1 81  ? -11.964 20.983 40.357 1.00 0.00 ? 81  ASP A HA   2  
ATOM   4329  H  HB2  . ASP A 1 81  ? -11.410 23.459 41.016 1.00 0.00 ? 81  ASP A HB2  2  
ATOM   4330  H  HB3  . ASP A 1 81  ? -11.384 23.776 39.283 1.00 0.00 ? 81  ASP A HB3  2  
ATOM   4331  N  N    . PHE A 1 82  ? -12.629 20.933 37.908 1.00 0.00 ? 82  PHE A N    2  
ATOM   4332  C  CA   . PHE A 1 82  ? -12.828 20.619 36.470 1.00 0.00 ? 82  PHE A CA   2  
ATOM   4333  C  C    . PHE A 1 82  ? -12.220 21.699 35.588 1.00 0.00 ? 82  PHE A C    2  
ATOM   4334  O  O    . PHE A 1 82  ? -11.648 21.410 34.554 1.00 0.00 ? 82  PHE A O    2  
ATOM   4335  C  CB   . PHE A 1 82  ? -14.336 20.538 36.188 1.00 0.00 ? 82  PHE A CB   2  
ATOM   4336  C  CG   . PHE A 1 82  ? -14.552 19.918 34.808 1.00 0.00 ? 82  PHE A CG   2  
ATOM   4337  C  CD1  . PHE A 1 82  ? -14.529 20.708 33.671 1.00 0.00 ? 82  PHE A CD1  2  
ATOM   4338  C  CD2  . PHE A 1 82  ? -14.770 18.559 34.678 1.00 0.00 ? 82  PHE A CD2  2  
ATOM   4339  C  CE1  . PHE A 1 82  ? -14.719 20.144 32.428 1.00 0.00 ? 82  PHE A CE1  2  
ATOM   4340  C  CE2  . PHE A 1 82  ? -14.960 17.999 33.434 1.00 0.00 ? 82  PHE A CE2  2  
ATOM   4341  C  CZ   . PHE A 1 82  ? -14.934 18.792 32.309 1.00 0.00 ? 82  PHE A CZ   2  
ATOM   4342  H  H    . PHE A 1 82  ? -13.360 20.805 38.548 1.00 0.00 ? 82  PHE A H    2  
ATOM   4343  H  HA   . PHE A 1 82  ? -12.343 19.667 36.247 1.00 0.00 ? 82  PHE A HA   2  
ATOM   4344  H  HB2  . PHE A 1 82  ? -14.816 19.924 36.934 1.00 0.00 ? 82  PHE A HB2  2  
ATOM   4345  H  HB3  . PHE A 1 82  ? -14.767 21.528 36.206 1.00 0.00 ? 82  PHE A HB3  2  
ATOM   4346  H  HD1  . PHE A 1 82  ? -14.356 21.769 33.758 1.00 0.00 ? 82  PHE A HD1  2  
ATOM   4347  H  HD2  . PHE A 1 82  ? -14.794 17.933 35.557 1.00 0.00 ? 82  PHE A HD2  2  
ATOM   4348  H  HE1  . PHE A 1 82  ? -14.699 20.767 31.545 1.00 0.00 ? 82  PHE A HE1  2  
ATOM   4349  H  HE2  . PHE A 1 82  ? -15.126 16.937 33.342 1.00 0.00 ? 82  PHE A HE2  2  
ATOM   4350  H  HZ   . PHE A 1 82  ? -15.082 18.352 31.334 1.00 0.00 ? 82  PHE A HZ   2  
ATOM   4351  N  N    . LYS A 1 83  ? -12.352 22.926 36.009 1.00 0.00 ? 83  LYS A N    2  
ATOM   4352  C  CA   . LYS A 1 83  ? -11.786 24.032 35.205 1.00 0.00 ? 83  LYS A CA   2  
ATOM   4353  C  C    . LYS A 1 83  ? -10.263 23.914 35.144 1.00 0.00 ? 83  LYS A C    2  
ATOM   4354  O  O    . LYS A 1 83  ? -9.707  23.624 34.108 1.00 0.00 ? 83  LYS A O    2  
ATOM   4355  C  CB   . LYS A 1 83  ? -12.176 25.365 35.874 1.00 0.00 ? 83  LYS A CB   2  
ATOM   4356  C  CG   . LYS A 1 83  ? -11.453 26.522 35.174 1.00 0.00 ? 83  LYS A CG   2  
ATOM   4357  C  CD   . LYS A 1 83  ? -10.569 27.247 36.191 1.00 0.00 ? 83  LYS A CD   2  
ATOM   4358  C  CE   . LYS A 1 83  ? -9.938  28.472 35.528 1.00 0.00 ? 83  LYS A CE   2  
ATOM   4359  N  NZ   . LYS A 1 83  ? -10.981 29.492 35.218 1.00 0.00 ? 83  LYS A NZ   2  
ATOM   4360  H  H    . LYS A 1 83  ? -12.818 23.113 36.850 1.00 0.00 ? 83  LYS A H    2  
ATOM   4361  H  HA   . LYS A 1 83  ? -12.185 23.971 34.192 1.00 0.00 ? 83  LYS A HA   2  
ATOM   4362  H  HB2  . LYS A 1 83  ? -13.246 25.509 35.796 1.00 0.00 ? 83  LYS A HB2  2  
ATOM   4363  H  HB3  . LYS A 1 83  ? -11.899 25.341 36.916 1.00 0.00 ? 83  LYS A HB3  2  
ATOM   4364  H  HG2  . LYS A 1 83  ? -10.844 26.141 34.369 1.00 0.00 ? 83  LYS A HG2  2  
ATOM   4365  H  HG3  . LYS A 1 83  ? -12.179 27.213 34.769 1.00 0.00 ? 83  LYS A HG3  2  
ATOM   4366  H  HD2  . LYS A 1 83  ? -11.169 27.559 37.034 1.00 0.00 ? 83  LYS A HD2  2  
ATOM   4367  H  HD3  . LYS A 1 83  ? -9.793  26.581 36.537 1.00 0.00 ? 83  LYS A HD3  2  
ATOM   4368  H  HE2  . LYS A 1 83  ? -9.207  28.907 36.193 1.00 0.00 ? 83  LYS A HE2  2  
ATOM   4369  H  HE3  . LYS A 1 83  ? -9.451  28.176 34.611 1.00 0.00 ? 83  LYS A HE3  2  
ATOM   4370  H  HZ1  . LYS A 1 83  ? -11.748 29.048 34.674 1.00 0.00 ? 83  LYS A HZ1  2  
ATOM   4371  H  HZ2  . LYS A 1 83  ? -11.363 29.876 36.106 1.00 0.00 ? 83  LYS A HZ2  2  
ATOM   4372  H  HZ3  . LYS A 1 83  ? -10.558 30.260 34.660 1.00 0.00 ? 83  LYS A HZ3  2  
ATOM   4373  N  N    . GLU A 1 84  ? -9.618  24.141 36.253 1.00 0.00 ? 84  GLU A N    2  
ATOM   4374  C  CA   . GLU A 1 84  ? -8.130  24.039 36.260 1.00 0.00 ? 84  GLU A CA   2  
ATOM   4375  C  C    . GLU A 1 84  ? -7.693  22.714 35.644 1.00 0.00 ? 84  GLU A C    2  
ATOM   4376  O  O    . GLU A 1 84  ? -6.711  22.637 34.919 1.00 0.00 ? 84  GLU A O    2  
ATOM   4377  C  CB   . GLU A 1 84  ? -7.628  24.069 37.725 1.00 0.00 ? 84  GLU A CB   2  
ATOM   4378  C  CG   . GLU A 1 84  ? -8.487  25.024 38.564 1.00 0.00 ? 84  GLU A CG   2  
ATOM   4379  C  CD   . GLU A 1 84  ? -8.044  24.936 40.028 1.00 0.00 ? 84  GLU A CD   2  
ATOM   4380  O  OE1  . GLU A 1 84  ? -6.920  25.335 40.280 1.00 0.00 ? 84  GLU A OE1  2  
ATOM   4381  O  OE2  . GLU A 1 84  ? -8.854  24.470 40.814 1.00 0.00 ? 84  GLU A OE2  2  
ATOM   4382  H  H    . GLU A 1 84  ? -10.105 24.373 37.065 1.00 0.00 ? 84  GLU A H    2  
ATOM   4383  H  HA   . GLU A 1 84  ? -7.708  24.862 35.682 1.00 0.00 ? 84  GLU A HA   2  
ATOM   4384  H  HB2  . GLU A 1 84  ? -7.685  23.073 38.142 1.00 0.00 ? 84  GLU A HB2  2  
ATOM   4385  H  HB3  . GLU A 1 84  ? -6.599  24.397 37.746 1.00 0.00 ? 84  GLU A HB3  2  
ATOM   4386  H  HG2  . GLU A 1 84  ? -8.362  26.036 38.212 1.00 0.00 ? 84  GLU A HG2  2  
ATOM   4387  H  HG3  . GLU A 1 84  ? -9.524  24.746 38.495 1.00 0.00 ? 84  GLU A HG3  2  
ATOM   4388  N  N    . TYR A 1 85  ? -8.441  21.696 35.951 1.00 0.00 ? 85  TYR A N    2  
ATOM   4389  C  CA   . TYR A 1 85  ? -8.128  20.353 35.421 1.00 0.00 ? 85  TYR A CA   2  
ATOM   4390  C  C    . TYR A 1 85  ? -8.115  20.350 33.895 1.00 0.00 ? 85  TYR A C    2  
ATOM   4391  O  O    . TYR A 1 85  ? -7.316  19.670 33.287 1.00 0.00 ? 85  TYR A O    2  
ATOM   4392  C  CB   . TYR A 1 85  ? -9.215  19.395 35.946 1.00 0.00 ? 85  TYR A CB   2  
ATOM   4393  C  CG   . TYR A 1 85  ? -9.294  18.137 35.082 1.00 0.00 ? 85  TYR A CG   2  
ATOM   4394  C  CD1  . TYR A 1 85  ? -8.491  17.050 35.356 1.00 0.00 ? 85  TYR A CD1  2  
ATOM   4395  C  CD2  . TYR A 1 85  ? -10.203 18.054 34.050 1.00 0.00 ? 85  TYR A CD2  2  
ATOM   4396  C  CE1  . TYR A 1 85  ? -8.598  15.895 34.608 1.00 0.00 ? 85  TYR A CE1  2  
ATOM   4397  C  CE2  . TYR A 1 85  ? -10.311 16.902 33.302 1.00 0.00 ? 85  TYR A CE2  2  
ATOM   4398  C  CZ   . TYR A 1 85  ? -9.509  15.811 33.576 1.00 0.00 ? 85  TYR A CZ   2  
ATOM   4399  O  OH   . TYR A 1 85  ? -9.619  14.654 32.831 1.00 0.00 ? 85  TYR A OH   2  
ATOM   4400  H  H    . TYR A 1 85  ? -9.217  21.819 36.536 1.00 0.00 ? 85  TYR A H    2  
ATOM   4401  H  HA   . TYR A 1 85  ? -7.144  20.055 35.779 1.00 0.00 ? 85  TYR A HA   2  
ATOM   4402  H  HB2  . TYR A 1 85  ? -8.984  19.110 36.962 1.00 0.00 ? 85  TYR A HB2  2  
ATOM   4403  H  HB3  . TYR A 1 85  ? -10.173 19.893 35.930 1.00 0.00 ? 85  TYR A HB3  2  
ATOM   4404  H  HD1  . TYR A 1 85  ? -7.770  17.104 36.158 1.00 0.00 ? 85  TYR A HD1  2  
ATOM   4405  H  HD2  . TYR A 1 85  ? -10.838 18.900 33.825 1.00 0.00 ? 85  TYR A HD2  2  
ATOM   4406  H  HE1  . TYR A 1 85  ? -7.969  15.047 34.837 1.00 0.00 ? 85  TYR A HE1  2  
ATOM   4407  H  HE2  . TYR A 1 85  ? -11.031 16.850 32.503 1.00 0.00 ? 85  TYR A HE2  2  
ATOM   4408  H  HH   . TYR A 1 85  ? -9.003  14.011 33.190 1.00 0.00 ? 85  TYR A HH   2  
ATOM   4409  N  N    . VAL A 1 86  ? -8.994  21.113 33.298 1.00 0.00 ? 86  VAL A N    2  
ATOM   4410  C  CA   . VAL A 1 86  ? -9.024  21.147 31.811 1.00 0.00 ? 86  VAL A CA   2  
ATOM   4411  C  C    . VAL A 1 86  ? -7.684  21.637 31.261 1.00 0.00 ? 86  VAL A C    2  
ATOM   4412  O  O    . VAL A 1 86  ? -7.140  21.065 30.338 1.00 0.00 ? 86  VAL A O    2  
ATOM   4413  C  CB   . VAL A 1 86  ? -10.128 22.114 31.360 1.00 0.00 ? 86  VAL A CB   2  
ATOM   4414  C  CG1  . VAL A 1 86  ? -10.020 22.315 29.849 1.00 0.00 ? 86  VAL A CG1  2  
ATOM   4415  C  CG2  . VAL A 1 86  ? -11.497 21.508 31.694 1.00 0.00 ? 86  VAL A CG2  2  
ATOM   4416  H  H    . VAL A 1 86  ? -9.621  21.652 33.822 1.00 0.00 ? 86  VAL A H    2  
ATOM   4417  H  HA   . VAL A 1 86  ? -9.217  20.147 31.439 1.00 0.00 ? 86  VAL A HA   2  
ATOM   4418  H  HB   . VAL A 1 86  ? -10.014 23.060 31.861 1.00 0.00 ? 86  VAL A HB   2  
ATOM   4419  H  HG11 . VAL A 1 86  ? -9.998  21.355 29.354 1.00 0.00 ? 86  VAL A HG11 2  
ATOM   4420  H  HG12 . VAL A 1 86  ? -10.869 22.879 29.495 1.00 0.00 ? 86  VAL A HG12 2  
ATOM   4421  H  HG13 . VAL A 1 86  ? -9.112  22.854 29.617 1.00 0.00 ? 86  VAL A HG13 2  
ATOM   4422  H  HG21 . VAL A 1 86  ? -11.364 20.591 32.252 1.00 0.00 ? 86  VAL A HG21 2  
ATOM   4423  H  HG22 . VAL A 1 86  ? -12.068 22.205 32.288 1.00 0.00 ? 86  VAL A HG22 2  
ATOM   4424  H  HG23 . VAL A 1 86  ? -12.034 21.294 30.782 1.00 0.00 ? 86  VAL A HG23 2  
ATOM   4425  N  N    . ILE A 1 87  ? -7.182  22.693 31.848 1.00 0.00 ? 87  ILE A N    2  
ATOM   4426  C  CA   . ILE A 1 87  ? -5.877  23.256 31.391 1.00 0.00 ? 87  ILE A CA   2  
ATOM   4427  C  C    . ILE A 1 87  ? -4.780  22.202 31.407 1.00 0.00 ? 87  ILE A C    2  
ATOM   4428  O  O    . ILE A 1 87  ? -4.123  21.979 30.414 1.00 0.00 ? 87  ILE A O    2  
ATOM   4429  C  CB   . ILE A 1 87  ? -5.481  24.380 32.353 1.00 0.00 ? 87  ILE A CB   2  
ATOM   4430  C  CG1  . ILE A 1 87  ? -6.682  25.273 32.626 1.00 0.00 ? 87  ILE A CG1  2  
ATOM   4431  C  CG2  . ILE A 1 87  ? -4.375  25.232 31.696 1.00 0.00 ? 87  ILE A CG2  2  
ATOM   4432  C  CD1  . ILE A 1 87  ? -7.213  25.821 31.301 1.00 0.00 ? 87  ILE A CD1  2  
ATOM   4433  H  H    . ILE A 1 87  ? -7.664  23.116 32.588 1.00 0.00 ? 87  ILE A H    2  
ATOM   4434  H  HA   . ILE A 1 87  ? -5.982  23.640 30.376 1.00 0.00 ? 87  ILE A HA   2  
ATOM   4435  H  HB   . ILE A 1 87  ? -5.133  23.945 33.293 1.00 0.00 ? 87  ILE A HB   2  
ATOM   4436  H  HG12 . ILE A 1 87  ? -7.455  24.702 33.117 1.00 0.00 ? 87  ILE A HG12 2  
ATOM   4437  H  HG13 . ILE A 1 87  ? -6.388  26.092 33.265 1.00 0.00 ? 87  ILE A HG13 2  
ATOM   4438  H  HG21 . ILE A 1 87  ? -4.471  25.194 30.621 1.00 0.00 ? 87  ILE A HG21 2  
ATOM   4439  H  HG22 . ILE A 1 87  ? -4.462  26.257 32.023 1.00 0.00 ? 87  ILE A HG22 2  
ATOM   4440  H  HG23 . ILE A 1 87  ? -3.404  24.851 31.980 1.00 0.00 ? 87  ILE A HG23 2  
ATOM   4441  H  HD11 . ILE A 1 87  ? -6.400  26.247 30.731 1.00 0.00 ? 87  ILE A HD11 2  
ATOM   4442  H  HD12 . ILE A 1 87  ? -7.666  25.022 30.731 1.00 0.00 ? 87  ILE A HD12 2  
ATOM   4443  H  HD13 . ILE A 1 87  ? -7.952  26.584 31.492 1.00 0.00 ? 87  ILE A HD13 2  
ATOM   4444  N  N    . ALA A 1 88  ? -4.613  21.560 32.534 1.00 0.00 ? 88  ALA A N    2  
ATOM   4445  C  CA   . ALA A 1 88  ? -3.552  20.514 32.634 1.00 0.00 ? 88  ALA A CA   2  
ATOM   4446  C  C    . ALA A 1 88  ? -3.841  19.281 31.765 1.00 0.00 ? 88  ALA A C    2  
ATOM   4447  O  O    . ALA A 1 88  ? -3.082  18.962 30.865 1.00 0.00 ? 88  ALA A O    2  
ATOM   4448  C  CB   . ALA A 1 88  ? -3.469  20.063 34.100 1.00 0.00 ? 88  ALA A CB   2  
ATOM   4449  H  H    . ALA A 1 88  ? -5.186  21.762 33.312 1.00 0.00 ? 88  ALA A H    2  
ATOM   4450  H  HA   . ALA A 1 88  ? -2.604  20.947 32.318 1.00 0.00 ? 88  ALA A HA   2  
ATOM   4451  H  HB1  . ALA A 1 88  ? -3.518  20.924 34.750 1.00 0.00 ? 88  ALA A HB1  2  
ATOM   4452  H  HB2  . ALA A 1 88  ? -4.292  19.402 34.326 1.00 0.00 ? 88  ALA A HB2  2  
ATOM   4453  H  HB3  . ALA A 1 88  ? -2.538  19.542 34.271 1.00 0.00 ? 88  ALA A HB3  2  
ATOM   4454  N  N    . LEU A 1 89  ? -4.921  18.610 32.048 1.00 0.00 ? 89  LEU A N    2  
ATOM   4455  C  CA   . LEU A 1 89  ? -5.265  17.398 31.250 1.00 0.00 ? 89  LEU A CA   2  
ATOM   4456  C  C    . LEU A 1 89  ? -4.969  17.558 29.756 1.00 0.00 ? 89  LEU A C    2  
ATOM   4457  O  O    . LEU A 1 89  ? -4.199  16.800 29.200 1.00 0.00 ? 89  LEU A O    2  
ATOM   4458  C  CB   . LEU A 1 89  ? -6.750  17.099 31.416 1.00 0.00 ? 89  LEU A CB   2  
ATOM   4459  C  CG   . LEU A 1 89  ? -6.942  15.579 31.459 1.00 0.00 ? 89  LEU A CG   2  
ATOM   4460  C  CD1  . LEU A 1 89  ? -6.260  14.938 30.239 1.00 0.00 ? 89  LEU A CD1  2  
ATOM   4461  C  CD2  . LEU A 1 89  ? -6.324  15.021 32.752 1.00 0.00 ? 89  LEU A CD2  2  
ATOM   4462  H  H    . LEU A 1 89  ? -5.502  18.899 32.783 1.00 0.00 ? 89  LEU A H    2  
ATOM   4463  H  HA   . LEU A 1 89  ? -4.680  16.568 31.628 1.00 0.00 ? 89  LEU A HA   2  
ATOM   4464  H  HB2  . LEU A 1 89  ? -7.111  17.535 32.331 1.00 0.00 ? 89  LEU A HB2  2  
ATOM   4465  H  HB3  . LEU A 1 89  ? -7.301  17.511 30.584 1.00 0.00 ? 89  LEU A HB3  2  
ATOM   4466  H  HG   . LEU A 1 89  ? -7.983  15.355 31.440 1.00 0.00 ? 89  LEU A HG   2  
ATOM   4467  H  HD11 . LEU A 1 89  ? -6.428  15.550 29.366 1.00 0.00 ? 89  LEU A HD11 2  
ATOM   4468  H  HD12 . LEU A 1 89  ? -5.197  14.850 30.410 1.00 0.00 ? 89  LEU A HD12 2  
ATOM   4469  H  HD13 . LEU A 1 89  ? -6.672  13.956 30.067 1.00 0.00 ? 89  LEU A HD13 2  
ATOM   4470  H  HD21 . LEU A 1 89  ? -6.327  15.785 33.516 1.00 0.00 ? 89  LEU A HD21 2  
ATOM   4471  H  HD22 . LEU A 1 89  ? -6.902  14.174 33.095 1.00 0.00 ? 89  LEU A HD22 2  
ATOM   4472  H  HD23 . LEU A 1 89  ? -5.308  14.705 32.572 1.00 0.00 ? 89  LEU A HD23 2  
ATOM   4473  N  N    . HIS A 1 90  ? -5.571  18.534 29.125 1.00 0.00 ? 90  HIS A N    2  
ATOM   4474  C  CA   . HIS A 1 90  ? -5.305  18.708 27.673 1.00 0.00 ? 90  HIS A CA   2  
ATOM   4475  C  C    . HIS A 1 90  ? -3.912  19.268 27.394 1.00 0.00 ? 90  HIS A C    2  
ATOM   4476  O  O    . HIS A 1 90  ? -3.422  19.154 26.293 1.00 0.00 ? 90  HIS A O    2  
ATOM   4477  C  CB   . HIS A 1 90  ? -6.371  19.635 27.063 1.00 0.00 ? 90  HIS A CB   2  
ATOM   4478  C  CG   . HIS A 1 90  ? -6.200  21.067 27.567 1.00 0.00 ? 90  HIS A CG   2  
ATOM   4479  N  ND1  . HIS A 1 90  ? -5.108  21.650 27.734 1.00 0.00 ? 90  HIS A ND1  2  
ATOM   4480  C  CD2  . HIS A 1 90  ? -7.166  21.992 27.900 1.00 0.00 ? 90  HIS A CD2  2  
ATOM   4481  C  CE1  . HIS A 1 90  ? -5.279  22.844 28.133 1.00 0.00 ? 90  HIS A CE1  2  
ATOM   4482  N  NE2  . HIS A 1 90  ? -6.566  23.154 28.270 1.00 0.00 ? 90  HIS A NE2  2  
ATOM   4483  H  H    . HIS A 1 90  ? -6.185  19.134 29.599 1.00 0.00 ? 90  HIS A H    2  
ATOM   4484  H  HA   . HIS A 1 90  ? -5.365  17.724 27.208 1.00 0.00 ? 90  HIS A HA   2  
ATOM   4485  H  HB2  . HIS A 1 90  ? -6.283  19.627 25.986 1.00 0.00 ? 90  HIS A HB2  2  
ATOM   4486  H  HB3  . HIS A 1 90  ? -7.354  19.280 27.337 1.00 0.00 ? 90  HIS A HB3  2  
ATOM   4487  H  HD1  . HIS A 1 90  ? -4.232  21.240 27.572 1.00 0.00 ? 90  HIS A HD1  2  
ATOM   4488  H  HD2  . HIS A 1 90  ? -8.231  21.817 27.879 1.00 0.00 ? 90  HIS A HD2  2  
ATOM   4489  H  HE1  . HIS A 1 90  ? -4.474  23.531 28.338 1.00 0.00 ? 90  HIS A HE1  2  
ATOM   4490  N  N    . MET A 1 91  ? -3.288  19.863 28.375 1.00 0.00 ? 91  MET A N    2  
ATOM   4491  C  CA   . MET A 1 91  ? -1.931  20.408 28.109 1.00 0.00 ? 91  MET A CA   2  
ATOM   4492  C  C    . MET A 1 91  ? -0.968  19.273 27.803 1.00 0.00 ? 91  MET A C    2  
ATOM   4493  O  O    . MET A 1 91  ? 0.003   19.448 27.096 1.00 0.00 ? 91  MET A O    2  
ATOM   4494  C  CB   . MET A 1 91  ? -1.425  21.164 29.349 1.00 0.00 ? 91  MET A CB   2  
ATOM   4495  C  CG   . MET A 1 91  ? -1.434  22.661 29.046 1.00 0.00 ? 91  MET A CG   2  
ATOM   4496  S  SD   . MET A 1 91  ? -0.918  23.788 30.362 1.00 0.00 ? 91  MET A SD   2  
ATOM   4497  C  CE   . MET A 1 91  ? -1.371  25.325 29.519 1.00 0.00 ? 91  MET A CE   2  
ATOM   4498  H  H    . MET A 1 91  ? -3.704  19.955 29.260 1.00 0.00 ? 91  MET A H    2  
ATOM   4499  H  HA   . MET A 1 91  ? -1.979  21.070 27.244 1.00 0.00 ? 91  MET A HA   2  
ATOM   4500  H  HB2  . MET A 1 91  ? -2.059  20.957 30.189 1.00 0.00 ? 91  MET A HB2  2  
ATOM   4501  H  HB3  . MET A 1 91  ? -0.418  20.849 29.582 1.00 0.00 ? 91  MET A HB3  2  
ATOM   4502  H  HG2  . MET A 1 91  ? -0.789  22.835 28.198 1.00 0.00 ? 91  MET A HG2  2  
ATOM   4503  H  HG3  . MET A 1 91  ? -2.433  22.936 28.757 1.00 0.00 ? 91  MET A HG3  2  
ATOM   4504  H  HE1  . MET A 1 91  ? -2.366  25.229 29.108 1.00 0.00 ? 91  MET A HE1  2  
ATOM   4505  H  HE2  . MET A 1 91  ? -1.348  26.143 30.223 1.00 0.00 ? 91  MET A HE2  2  
ATOM   4506  H  HE3  . MET A 1 91  ? -0.670  25.516 28.720 1.00 0.00 ? 91  MET A HE3  2  
ATOM   4507  N  N    . THR A 1 92  ? -1.259  18.123 28.346 1.00 0.00 ? 92  THR A N    2  
ATOM   4508  C  CA   . THR A 1 92  ? -0.375  16.957 28.102 1.00 0.00 ? 92  THR A CA   2  
ATOM   4509  C  C    . THR A 1 92  ? -0.625  16.362 26.719 1.00 0.00 ? 92  THR A C    2  
ATOM   4510  O  O    . THR A 1 92  ? -0.146  15.291 26.407 1.00 0.00 ? 92  THR A O    2  
ATOM   4511  C  CB   . THR A 1 92  ? -0.685  15.893 29.159 1.00 0.00 ? 92  THR A CB   2  
ATOM   4512  O  OG1  . THR A 1 92  ? -1.036  16.613 30.324 1.00 0.00 ? 92  THR A OG1  2  
ATOM   4513  C  CG2  . THR A 1 92  ? 0.584   15.124 29.548 1.00 0.00 ? 92  THR A CG2  2  
ATOM   4514  H  H    . THR A 1 92  ? -2.054  18.032 28.917 1.00 0.00 ? 92  THR A H    2  
ATOM   4515  H  HA   . THR A 1 92  ? 0.664   17.278 28.170 1.00 0.00 ? 92  THR A HA   2  
ATOM   4516  H  HB   . THR A 1 92  ? -1.498  15.239 28.847 1.00 0.00 ? 92  THR A HB   2  
ATOM   4517  H  HG1  . THR A 1 92  ? -1.941  16.918 30.222 1.00 0.00 ? 92  THR A HG1  2  
ATOM   4518  H  HG21 . THR A 1 92  ? 1.107   14.810 28.657 1.00 0.00 ? 92  THR A HG21 2  
ATOM   4519  H  HG22 . THR A 1 92  ? 1.230   15.760 30.134 1.00 0.00 ? 92  THR A HG22 2  
ATOM   4520  H  HG23 . THR A 1 92  ? 0.319   14.254 30.129 1.00 0.00 ? 92  THR A HG23 2  
ATOM   4521  N  N    . SER A 1 93  ? -1.370  17.070 25.914 1.00 0.00 ? 93  SER A N    2  
ATOM   4522  C  CA   . SER A 1 93  ? -1.660  16.560 24.549 1.00 0.00 ? 93  SER A CA   2  
ATOM   4523  C  C    . SER A 1 93  ? -1.958  17.711 23.596 1.00 0.00 ? 93  SER A C    2  
ATOM   4524  O  O    . SER A 1 93  ? -1.448  17.754 22.493 1.00 0.00 ? 93  SER A O    2  
ATOM   4525  C  CB   . SER A 1 93  ? -2.894  15.648 24.624 1.00 0.00 ? 93  SER A CB   2  
ATOM   4526  O  OG   . SER A 1 93  ? -3.917  16.491 25.132 1.00 0.00 ? 93  SER A OG   2  
ATOM   4527  H  H    . SER A 1 93  ? -1.734  17.931 26.207 1.00 0.00 ? 93  SER A H    2  
ATOM   4528  H  HA   . SER A 1 93  ? -0.792  16.011 24.184 1.00 0.00 ? 93  SER A HA   2  
ATOM   4529  H  HB2  . SER A 1 93  ? -3.162  15.285 23.643 1.00 0.00 ? 93  SER A HB2  2  
ATOM   4530  H  HB3  . SER A 1 93  ? -2.720  14.824 25.298 1.00 0.00 ? 93  SER A HB3  2  
ATOM   4531  H  HG   . SER A 1 93  ? -3.557  16.979 25.874 1.00 0.00 ? 93  SER A HG   2  
ATOM   4532  N  N    . ALA A 1 94  ? -2.782  18.623 24.035 1.00 0.00 ? 94  ALA A N    2  
ATOM   4533  C  CA   . ALA A 1 94  ? -3.122  19.774 23.168 1.00 0.00 ? 94  ALA A CA   2  
ATOM   4534  C  C    . ALA A 1 94  ? -1.861  20.367 22.556 1.00 0.00 ? 94  ALA A C    2  
ATOM   4535  O  O    . ALA A 1 94  ? -1.057  20.965 23.241 1.00 0.00 ? 94  ALA A O    2  
ATOM   4536  C  CB   . ALA A 1 94  ? -3.812  20.846 24.029 1.00 0.00 ? 94  ALA A CB   2  
ATOM   4537  H  H    . ALA A 1 94  ? -3.172  18.548 24.931 1.00 0.00 ? 94  ALA A H    2  
ATOM   4538  H  HA   . ALA A 1 94  ? -3.780  19.434 22.369 1.00 0.00 ? 94  ALA A HA   2  
ATOM   4539  H  HB1  . ALA A 1 94  ? -3.172  21.121 24.854 1.00 0.00 ? 94  ALA A HB1  2  
ATOM   4540  H  HB2  . ALA A 1 94  ? -4.014  21.722 23.429 1.00 0.00 ? 94  ALA A HB2  2  
ATOM   4541  H  HB3  . ALA A 1 94  ? -4.743  20.459 24.415 1.00 0.00 ? 94  ALA A HB3  2  
ATOM   4542  N  N    . GLY A 1 95  ? -1.713  20.190 21.275 1.00 0.00 ? 95  GLY A N    2  
ATOM   4543  C  CA   . GLY A 1 95  ? -0.506  20.737 20.598 1.00 0.00 ? 95  GLY A CA   2  
ATOM   4544  C  C    . GLY A 1 95  ? -0.794  22.125 20.025 1.00 0.00 ? 95  GLY A C    2  
ATOM   4545  O  O    . GLY A 1 95  ? -1.934  22.502 19.841 1.00 0.00 ? 95  GLY A O    2  
ATOM   4546  H  H    . GLY A 1 95  ? -2.390  19.701 20.762 1.00 0.00 ? 95  GLY A H    2  
ATOM   4547  H  HA2  . GLY A 1 95  ? 0.302   20.806 21.311 1.00 0.00 ? 95  GLY A HA2  2  
ATOM   4548  H  HA3  . GLY A 1 95  ? -0.216  20.073 19.797 1.00 0.00 ? 95  GLY A HA3  2  
ATOM   4549  N  N    . LYS A 1 96  ? 0.251   22.857 19.755 1.00 0.00 ? 96  LYS A N    2  
ATOM   4550  C  CA   . LYS A 1 96  ? 0.067   24.217 19.195 1.00 0.00 ? 96  LYS A CA   2  
ATOM   4551  C  C    . LYS A 1 96  ? 1.414   24.834 18.836 1.00 0.00 ? 96  LYS A C    2  
ATOM   4552  O  O    . LYS A 1 96  ? 1.481   25.825 18.136 1.00 0.00 ? 96  LYS A O    2  
ATOM   4553  C  CB   . LYS A 1 96  ? -0.615  25.089 20.259 1.00 0.00 ? 96  LYS A CB   2  
ATOM   4554  C  CG   . LYS A 1 96  ? 0.033   24.821 21.616 1.00 0.00 ? 96  LYS A CG   2  
ATOM   4555  C  CD   . LYS A 1 96  ? -0.483  25.844 22.629 1.00 0.00 ? 96  LYS A CD   2  
ATOM   4556  C  CE   . LYS A 1 96  ? -0.007  25.446 24.024 1.00 0.00 ? 96  LYS A CE   2  
ATOM   4557  N  NZ   . LYS A 1 96  ? -0.248  26.551 24.994 1.00 0.00 ? 96  LYS A NZ   2  
ATOM   4558  H  H    . LYS A 1 96  ? 1.152   22.510 19.922 1.00 0.00 ? 96  LYS A H    2  
ATOM   4559  H  HA   . LYS A 1 96  ? -0.545  24.150 18.297 1.00 0.00 ? 96  LYS A HA   2  
ATOM   4560  H  HB2  . LYS A 1 96  ? -0.501  26.131 20.001 1.00 0.00 ? 96  LYS A HB2  2  
ATOM   4561  H  HB3  . LYS A 1 96  ? -1.666  24.849 20.305 1.00 0.00 ? 96  LYS A HB3  2  
ATOM   4562  H  HG2  . LYS A 1 96  ? -0.217  23.824 21.948 1.00 0.00 ? 96  LYS A HG2  2  
ATOM   4563  H  HG3  . LYS A 1 96  ? 1.107   24.906 21.528 1.00 0.00 ? 96  LYS A HG3  2  
ATOM   4564  H  HD2  . LYS A 1 96  ? -0.103  26.823 22.381 1.00 0.00 ? 96  LYS A HD2  2  
ATOM   4565  H  HD3  . LYS A 1 96  ? -1.562  25.865 22.605 1.00 0.00 ? 96  LYS A HD3  2  
ATOM   4566  H  HE2  . LYS A 1 96  ? -0.540  24.567 24.352 1.00 0.00 ? 96  LYS A HE2  2  
ATOM   4567  H  HE3  . LYS A 1 96  ? 1.047   25.227 23.994 1.00 0.00 ? 96  LYS A HE3  2  
ATOM   4568  H  HZ1  . LYS A 1 96  ? -1.254  26.814 24.978 1.00 0.00 ? 96  LYS A HZ1  2  
ATOM   4569  H  HZ2  . LYS A 1 96  ? 0.012   26.235 25.951 1.00 0.00 ? 96  LYS A HZ2  2  
ATOM   4570  H  HZ3  . LYS A 1 96  ? 0.330   27.375 24.732 1.00 0.00 ? 96  LYS A HZ3  2  
ATOM   4571  N  N    . THR A 1 97  ? 2.464   24.235 19.329 1.00 0.00 ? 97  THR A N    2  
ATOM   4572  C  CA   . THR A 1 97  ? 3.817   24.763 19.031 1.00 0.00 ? 97  THR A CA   2  
ATOM   4573  C  C    . THR A 1 97  ? 3.877   26.285 19.200 1.00 0.00 ? 97  THR A C    2  
ATOM   4574  O  O    . THR A 1 97  ? 4.384   26.989 18.348 1.00 0.00 ? 97  THR A O    2  
ATOM   4575  C  CB   . THR A 1 97  ? 4.158   24.402 17.591 1.00 0.00 ? 97  THR A CB   2  
ATOM   4576  O  OG1  . THR A 1 97  ? 3.360   23.275 17.291 1.00 0.00 ? 97  THR A OG1  2  
ATOM   4577  C  CG2  . THR A 1 97  ? 5.601   23.893 17.483 1.00 0.00 ? 97  THR A CG2  2  
ATOM   4578  H  H    . THR A 1 97  ? 2.360   23.440 19.892 1.00 0.00 ? 97  THR A H    2  
ATOM   4579  H  HA   . THR A 1 97  ? 4.525   24.312 19.707 1.00 0.00 ? 97  THR A HA   2  
ATOM   4580  H  HB   . THR A 1 97  ? 3.947   25.210 16.918 1.00 0.00 ? 97  THR A HB   2  
ATOM   4581  H  HG1  . THR A 1 97  ? 3.937   22.511 17.233 1.00 0.00 ? 97  THR A HG1  2  
ATOM   4582  H  HG21 . THR A 1 97  ? 5.746   23.063 18.159 1.00 0.00 ? 97  THR A HG21 2  
ATOM   4583  H  HG22 . THR A 1 97  ? 5.798   23.566 16.472 1.00 0.00 ? 97  THR A HG22 2  
ATOM   4584  H  HG23 . THR A 1 97  ? 6.288   24.685 17.741 1.00 0.00 ? 97  THR A HG23 2  
ATOM   4585  N  N    . ASN A 1 98  ? 3.365   26.766 20.303 1.00 0.00 ? 98  ASN A N    2  
ATOM   4586  C  CA   . ASN A 1 98  ? 3.390   28.235 20.532 1.00 0.00 ? 98  ASN A CA   2  
ATOM   4587  C  C    . ASN A 1 98  ? 3.014   28.578 21.970 1.00 0.00 ? 98  ASN A C    2  
ATOM   4588  O  O    . ASN A 1 98  ? 1.890   28.386 22.385 1.00 0.00 ? 98  ASN A O    2  
ATOM   4589  C  CB   . ASN A 1 98  ? 2.370   28.890 19.587 1.00 0.00 ? 98  ASN A CB   2  
ATOM   4590  C  CG   . ASN A 1 98  ? 2.487   30.414 19.695 1.00 0.00 ? 98  ASN A CG   2  
ATOM   4591  O  OD1  . ASN A 1 98  ? 3.164   31.053 18.914 1.00 0.00 ? 98  ASN A OD1  2  
ATOM   4592  N  ND2  . ASN A 1 98  ? 1.843   31.032 20.648 1.00 0.00 ? 98  ASN A ND2  2  
ATOM   4593  H  H    . ASN A 1 98  ? 2.970   26.166 20.969 1.00 0.00 ? 98  ASN A H    2  
ATOM   4594  H  HA   . ASN A 1 98  ? 4.393   28.606 20.332 1.00 0.00 ? 98  ASN A HA   2  
ATOM   4595  H  HB2  . ASN A 1 98  ? 2.569   28.589 18.569 1.00 0.00 ? 98  ASN A HB2  2  
ATOM   4596  H  HB3  . ASN A 1 98  ? 1.370   28.589 19.861 1.00 0.00 ? 98  ASN A HB3  2  
ATOM   4597  H  HD21 . ASN A 1 98  ? 1.295   30.522 21.280 1.00 0.00 ? 98  ASN A HD21 2  
ATOM   4598  H  HD22 . ASN A 1 98  ? 1.907   32.006 20.730 1.00 0.00 ? 98  ASN A HD22 2  
ATOM   4599  N  N    . GLN A 1 99  ? 3.970   29.085 22.702 1.00 0.00 ? 99  GLN A N    2  
ATOM   4600  C  CA   . GLN A 1 99  ? 3.703   29.453 24.118 1.00 0.00 ? 99  GLN A CA   2  
ATOM   4601  C  C    . GLN A 1 99  ? 3.249   28.240 24.929 1.00 0.00 ? 99  GLN A C    2  
ATOM   4602  O  O    . GLN A 1 99  ? 2.120   27.800 24.828 1.00 0.00 ? 99  GLN A O    2  
ATOM   4603  C  CB   . GLN A 1 99  ? 2.596   30.529 24.143 1.00 0.00 ? 99  GLN A CB   2  
ATOM   4604  C  CG   . GLN A 1 99  ? 2.873   31.538 25.272 1.00 0.00 ? 99  GLN A CG   2  
ATOM   4605  C  CD   . GLN A 1 99  ? 2.287   32.901 24.891 1.00 0.00 ? 99  GLN A CD   2  
ATOM   4606  O  OE1  . GLN A 1 99  ? 1.424   33.424 25.561 1.00 0.00 ? 99  GLN A OE1  2  
ATOM   4607  N  NE2  . GLN A 1 99  ? 2.736   33.511 23.829 1.00 0.00 ? 99  GLN A NE2  2  
ATOM   4608  H  H    . GLN A 1 99  ? 4.862   29.220 22.319 1.00 0.00 ? 99  GLN A H    2  
ATOM   4609  H  HA   . GLN A 1 99  ? 4.624   29.834 24.553 1.00 0.00 ? 99  GLN A HA   2  
ATOM   4610  H  HB2  . GLN A 1 99  ? 2.574   31.045 23.195 1.00 0.00 ? 99  GLN A HB2  2  
ATOM   4611  H  HB3  . GLN A 1 99  ? 1.638   30.056 24.309 1.00 0.00 ? 99  GLN A HB3  2  
ATOM   4612  H  HG2  . GLN A 1 99  ? 2.414   31.196 26.188 1.00 0.00 ? 99  GLN A HG2  2  
ATOM   4613  H  HG3  . GLN A 1 99  ? 3.934   31.645 25.423 1.00 0.00 ? 99  GLN A HG3  2  
ATOM   4614  H  HE21 . GLN A 1 99  ? 3.440   33.098 23.287 1.00 0.00 ? 99  GLN A HE21 2  
ATOM   4615  H  HE22 . GLN A 1 99  ? 2.370   34.384 23.574 1.00 0.00 ? 99  GLN A HE22 2  
ATOM   4616  N  N    . LYS A 1 100 ? 4.148   27.732 25.724 1.00 0.00 ? 100 LYS A N    2  
ATOM   4617  C  CA   . LYS A 1 100 ? 3.823   26.550 26.563 1.00 0.00 ? 100 LYS A CA   2  
ATOM   4618  C  C    . LYS A 1 100 ? 4.952   26.306 27.561 1.00 0.00 ? 100 LYS A C    2  
ATOM   4619  O  O    . LYS A 1 100 ? 4.735   25.813 28.646 1.00 0.00 ? 100 LYS A O    2  
ATOM   4620  C  CB   . LYS A 1 100 ? 3.709   25.324 25.641 1.00 0.00 ? 100 LYS A CB   2  
ATOM   4621  C  CG   . LYS A 1 100 ? 3.182   24.128 26.448 1.00 0.00 ? 100 LYS A CG   2  
ATOM   4622  C  CD   . LYS A 1 100 ? 3.561   22.821 25.737 1.00 0.00 ? 100 LYS A CD   2  
ATOM   4623  C  CE   . LYS A 1 100 ? 2.480   22.479 24.713 1.00 0.00 ? 100 LYS A CE   2  
ATOM   4624  N  NZ   . LYS A 1 100 ? 1.243   22.017 25.400 1.00 0.00 ? 100 LYS A NZ   2  
ATOM   4625  H  H    . LYS A 1 100 ? 5.040   28.132 25.768 1.00 0.00 ? 100 LYS A H    2  
ATOM   4626  H  HA   . LYS A 1 100 ? 2.882   26.728 27.107 1.00 0.00 ? 100 LYS A HA   2  
ATOM   4627  H  HB2  . LYS A 1 100 ? 3.033   25.542 24.832 1.00 0.00 ? 100 LYS A HB2  2  
ATOM   4628  H  HB3  . LYS A 1 100 ? 4.681   25.091 25.234 1.00 0.00 ? 100 LYS A HB3  2  
ATOM   4629  H  HG2  . LYS A 1 100 ? 3.614   24.138 27.436 1.00 0.00 ? 100 LYS A HG2  2  
ATOM   4630  H  HG3  . LYS A 1 100 ? 2.107   24.194 26.533 1.00 0.00 ? 100 LYS A HG3  2  
ATOM   4631  H  HD2  . LYS A 1 100 ? 4.510   22.936 25.238 1.00 0.00 ? 100 LYS A HD2  2  
ATOM   4632  H  HD3  . LYS A 1 100 ? 3.637   22.025 26.461 1.00 0.00 ? 100 LYS A HD3  2  
ATOM   4633  H  HE2  . LYS A 1 100 ? 2.251   23.354 24.121 1.00 0.00 ? 100 LYS A HE2  2  
ATOM   4634  H  HE3  . LYS A 1 100 ? 2.835   21.695 24.060 1.00 0.00 ? 100 LYS A HE3  2  
ATOM   4635  H  HZ1  . LYS A 1 100 ? 1.357   22.127 26.429 1.00 0.00 ? 100 LYS A HZ1  2  
ATOM   4636  H  HZ2  . LYS A 1 100 ? 0.435   22.587 25.079 1.00 0.00 ? 100 LYS A HZ2  2  
ATOM   4637  H  HZ3  . LYS A 1 100 ? 1.074   21.016 25.177 1.00 0.00 ? 100 LYS A HZ3  2  
ATOM   4638  N  N    . LEU A 1 101 ? 6.144   26.668 27.163 1.00 0.00 ? 101 LEU A N    2  
ATOM   4639  C  CA   . LEU A 1 101 ? 7.309   26.470 28.063 1.00 0.00 ? 101 LEU A CA   2  
ATOM   4640  C  C    . LEU A 1 101 ? 7.093   27.166 29.400 1.00 0.00 ? 101 LEU A C    2  
ATOM   4641  O  O    . LEU A 1 101 ? 7.171   26.547 30.443 1.00 0.00 ? 101 LEU A O    2  
ATOM   4642  C  CB   . LEU A 1 101 ? 8.554   27.079 27.395 1.00 0.00 ? 101 LEU A CB   2  
ATOM   4643  C  CG   . LEU A 1 101 ? 8.507   26.808 25.891 1.00 0.00 ? 101 LEU A CG   2  
ATOM   4644  C  CD1  . LEU A 1 101 ? 9.842   27.215 25.264 1.00 0.00 ? 101 LEU A CD1  2  
ATOM   4645  C  CD2  . LEU A 1 101 ? 8.275   25.316 25.653 1.00 0.00 ? 101 LEU A CD2  2  
ATOM   4646  H  H    . LEU A 1 101 ? 6.269   27.066 26.277 1.00 0.00 ? 101 LEU A H    2  
ATOM   4647  H  HA   . LEU A 1 101 ? 7.447   25.407 28.237 1.00 0.00 ? 101 LEU A HA   2  
ATOM   4648  H  HB2  . LEU A 1 101 ? 8.574   28.145 27.572 1.00 0.00 ? 101 LEU A HB2  2  
ATOM   4649  H  HB3  . LEU A 1 101 ? 9.443   26.635 27.816 1.00 0.00 ? 101 LEU A HB3  2  
ATOM   4650  H  HG   . LEU A 1 101 ? 7.706   27.378 25.443 1.00 0.00 ? 101 LEU A HG   2  
ATOM   4651  H  HD11 . LEU A 1 101 ? 10.652  26.709 25.770 1.00 0.00 ? 101 LEU A HD11 2  
ATOM   4652  H  HD12 . LEU A 1 101 ? 9.852   26.944 24.219 1.00 0.00 ? 101 LEU A HD12 2  
ATOM   4653  H  HD13 . LEU A 1 101 ? 9.978   28.283 25.356 1.00 0.00 ? 101 LEU A HD13 2  
ATOM   4654  H  HD21 . LEU A 1 101 ? 9.042   24.744 26.153 1.00 0.00 ? 101 LEU A HD21 2  
ATOM   4655  H  HD22 . LEU A 1 101 ? 7.309   25.031 26.042 1.00 0.00 ? 101 LEU A HD22 2  
ATOM   4656  H  HD23 . LEU A 1 101 ? 8.307   25.107 24.594 1.00 0.00 ? 101 LEU A HD23 2  
ATOM   4657  N  N    . GLU A 1 102 ? 6.829   28.446 29.344 1.00 0.00 ? 102 GLU A N    2  
ATOM   4658  C  CA   . GLU A 1 102 ? 6.605   29.201 30.604 1.00 0.00 ? 102 GLU A CA   2  
ATOM   4659  C  C    . GLU A 1 102 ? 5.740   28.402 31.569 1.00 0.00 ? 102 GLU A C    2  
ATOM   4660  O  O    . GLU A 1 102 ? 5.882   28.513 32.770 1.00 0.00 ? 102 GLU A O    2  
ATOM   4661  C  CB   . GLU A 1 102 ? 5.889   30.518 30.263 1.00 0.00 ? 102 GLU A CB   2  
ATOM   4662  C  CG   . GLU A 1 102 ? 4.674   30.219 29.383 1.00 0.00 ? 102 GLU A CG   2  
ATOM   4663  C  CD   . GLU A 1 102 ? 3.858   31.501 29.197 1.00 0.00 ? 102 GLU A CD   2  
ATOM   4664  O  OE1  . GLU A 1 102 ? 3.476   32.051 30.217 1.00 0.00 ? 102 GLU A OE1  2  
ATOM   4665  O  OE2  . GLU A 1 102 ? 3.665   31.857 28.047 1.00 0.00 ? 102 GLU A OE2  2  
ATOM   4666  H  H    . GLU A 1 102 ? 6.780   28.903 28.479 1.00 0.00 ? 102 GLU A H    2  
ATOM   4667  H  HA   . GLU A 1 102 ? 7.569   29.394 31.074 1.00 0.00 ? 102 GLU A HA   2  
ATOM   4668  H  HB2  . GLU A 1 102 ? 5.567   31.002 31.172 1.00 0.00 ? 102 GLU A HB2  2  
ATOM   4669  H  HB3  . GLU A 1 102 ? 6.567   31.173 29.734 1.00 0.00 ? 102 GLU A HB3  2  
ATOM   4670  H  HG2  . GLU A 1 102 ? 4.999   29.861 28.417 1.00 0.00 ? 102 GLU A HG2  2  
ATOM   4671  H  HG3  . GLU A 1 102 ? 4.057   29.469 29.854 1.00 0.00 ? 102 GLU A HG3  2  
ATOM   4672  N  N    . TRP A 1 103 ? 4.856   27.611 31.028 1.00 0.00 ? 103 TRP A N    2  
ATOM   4673  C  CA   . TRP A 1 103 ? 3.981   26.800 31.904 1.00 0.00 ? 103 TRP A CA   2  
ATOM   4674  C  C    . TRP A 1 103 ? 4.744   25.602 32.451 1.00 0.00 ? 103 TRP A C    2  
ATOM   4675  O  O    . TRP A 1 103 ? 4.579   25.222 33.594 1.00 0.00 ? 103 TRP A O    2  
ATOM   4676  C  CB   . TRP A 1 103 ? 2.790   26.296 31.075 1.00 0.00 ? 103 TRP A CB   2  
ATOM   4677  C  CG   . TRP A 1 103 ? 1.786   25.614 32.004 1.00 0.00 ? 103 TRP A CG   2  
ATOM   4678  C  CD1  . TRP A 1 103 ? 0.828   26.250 32.661 1.00 0.00 ? 103 TRP A CD1  2  
ATOM   4679  C  CD2  . TRP A 1 103 ? 1.761   24.327 32.258 1.00 0.00 ? 103 TRP A CD2  2  
ATOM   4680  N  NE1  . TRP A 1 103 ? 0.205   25.272 33.342 1.00 0.00 ? 103 TRP A NE1  2  
ATOM   4681  C  CE2  . TRP A 1 103 ? 0.740   24.012 33.139 1.00 0.00 ? 103 TRP A CE2  2  
ATOM   4682  C  CE3  . TRP A 1 103 ? 2.584   23.324 31.777 1.00 0.00 ? 103 TRP A CE3  2  
ATOM   4683  C  CZ2  . TRP A 1 103 ? 0.546   22.705 33.534 1.00 0.00 ? 103 TRP A CZ2  2  
ATOM   4684  C  CZ3  . TRP A 1 103 ? 2.386   22.017 32.173 1.00 0.00 ? 103 TRP A CZ3  2  
ATOM   4685  C  CH2  . TRP A 1 103 ? 1.369   21.709 33.051 1.00 0.00 ? 103 TRP A CH2  2  
ATOM   4686  H  H    . TRP A 1 103 ? 4.772   27.555 30.052 1.00 0.00 ? 103 TRP A H    2  
ATOM   4687  H  HA   . TRP A 1 103 ? 3.642   27.417 32.736 1.00 0.00 ? 103 TRP A HA   2  
ATOM   4688  H  HB2  . TRP A 1 103 ? 2.311   27.128 30.578 1.00 0.00 ? 103 TRP A HB2  2  
ATOM   4689  H  HB3  . TRP A 1 103 ? 3.130   25.590 30.337 1.00 0.00 ? 103 TRP A HB3  2  
ATOM   4690  H  HD1  . TRP A 1 103 ? 0.592   27.306 32.641 1.00 0.00 ? 103 TRP A HD1  2  
ATOM   4691  H  HE1  . TRP A 1 103 ? -0.558  25.438 33.933 1.00 0.00 ? 103 TRP A HE1  2  
ATOM   4692  H  HE3  . TRP A 1 103 ? 3.383   23.563 31.090 1.00 0.00 ? 103 TRP A HE3  2  
ATOM   4693  H  HZ2  . TRP A 1 103 ? -0.250  22.462 34.221 1.00 0.00 ? 103 TRP A HZ2  2  
ATOM   4694  H  HZ3  . TRP A 1 103 ? 3.030   21.236 31.798 1.00 0.00 ? 103 TRP A HZ3  2  
ATOM   4695  H  HH2  . TRP A 1 103 ? 1.215   20.686 33.362 1.00 0.00 ? 103 TRP A HH2  2  
ATOM   4696  N  N    . ALA A 1 104 ? 5.574   25.029 31.621 1.00 0.00 ? 104 ALA A N    2  
ATOM   4697  C  CA   . ALA A 1 104 ? 6.360   23.855 32.070 1.00 0.00 ? 104 ALA A CA   2  
ATOM   4698  C  C    . ALA A 1 104 ? 7.353   24.261 33.144 1.00 0.00 ? 104 ALA A C    2  
ATOM   4699  O  O    . ALA A 1 104 ? 7.686   23.480 34.016 1.00 0.00 ? 104 ALA A O    2  
ATOM   4700  C  CB   . ALA A 1 104 ? 7.137   23.302 30.865 1.00 0.00 ? 104 ALA A CB   2  
ATOM   4701  H  H    . ALA A 1 104 ? 5.678   25.374 30.711 1.00 0.00 ? 104 ALA A H    2  
ATOM   4702  H  HA   . ALA A 1 104 ? 5.685   23.104 32.474 1.00 0.00 ? 104 ALA A HA   2  
ATOM   4703  H  HB1  . ALA A 1 104 ? 7.660   24.106 30.368 1.00 0.00 ? 104 ALA A HB1  2  
ATOM   4704  H  HB2  . ALA A 1 104 ? 7.855   22.566 31.199 1.00 0.00 ? 104 ALA A HB2  2  
ATOM   4705  H  HB3  . ALA A 1 104 ? 6.453   22.841 30.169 1.00 0.00 ? 104 ALA A HB3  2  
ATOM   4706  N  N    . PHE A 1 105 ? 7.807   25.483 33.067 1.00 0.00 ? 105 PHE A N    2  
ATOM   4707  C  CA   . PHE A 1 105 ? 8.779   25.961 34.074 1.00 0.00 ? 105 PHE A CA   2  
ATOM   4708  C  C    . PHE A 1 105 ? 8.343   25.552 35.474 1.00 0.00 ? 105 PHE A C    2  
ATOM   4709  O  O    . PHE A 1 105 ? 9.161   25.335 36.344 1.00 0.00 ? 105 PHE A O    2  
ATOM   4710  C  CB   . PHE A 1 105 ? 8.836   27.496 33.992 1.00 0.00 ? 105 PHE A CB   2  
ATOM   4711  C  CG   . PHE A 1 105 ? 10.043  28.006 34.783 1.00 0.00 ? 105 PHE A CG   2  
ATOM   4712  C  CD1  . PHE A 1 105 ? 11.327  27.648 34.414 1.00 0.00 ? 105 PHE A CD1  2  
ATOM   4713  C  CD2  . PHE A 1 105 ? 9.866   28.838 35.875 1.00 0.00 ? 105 PHE A CD2  2  
ATOM   4714  C  CE1  . PHE A 1 105 ? 12.415  28.114 35.125 1.00 0.00 ? 105 PHE A CE1  2  
ATOM   4715  C  CE2  . PHE A 1 105 ? 10.955  29.302 36.584 1.00 0.00 ? 105 PHE A CE2  2  
ATOM   4716  C  CZ   . PHE A 1 105 ? 12.227  28.940 36.209 1.00 0.00 ? 105 PHE A CZ   2  
ATOM   4717  H  H    . PHE A 1 105 ? 7.500   26.081 32.352 1.00 0.00 ? 105 PHE A H    2  
ATOM   4718  H  HA   . PHE A 1 105 ? 9.755   25.523 33.862 1.00 0.00 ? 105 PHE A HA   2  
ATOM   4719  H  HB2  . PHE A 1 105 ? 8.933   27.803 32.962 1.00 0.00 ? 105 PHE A HB2  2  
ATOM   4720  H  HB3  . PHE A 1 105 ? 7.933   27.919 34.406 1.00 0.00 ? 105 PHE A HB3  2  
ATOM   4721  H  HD1  . PHE A 1 105 ? 11.480  26.995 33.568 1.00 0.00 ? 105 PHE A HD1  2  
ATOM   4722  H  HD2  . PHE A 1 105 ? 8.869   29.127 36.173 1.00 0.00 ? 105 PHE A HD2  2  
ATOM   4723  H  HE1  . PHE A 1 105 ? 13.414  27.836 34.825 1.00 0.00 ? 105 PHE A HE1  2  
ATOM   4724  H  HE2  . PHE A 1 105 ? 10.808  29.954 37.430 1.00 0.00 ? 105 PHE A HE2  2  
ATOM   4725  H  HZ   . PHE A 1 105 ? 13.079  29.303 36.769 1.00 0.00 ? 105 PHE A HZ   2  
ATOM   4726  N  N    . SER A 1 106 ? 7.056   25.451 35.665 1.00 0.00 ? 106 SER A N    2  
ATOM   4727  C  CA   . SER A 1 106 ? 6.550   25.057 37.000 1.00 0.00 ? 106 SER A CA   2  
ATOM   4728  C  C    . SER A 1 106 ? 6.634   23.548 37.192 1.00 0.00 ? 106 SER A C    2  
ATOM   4729  O  O    . SER A 1 106 ? 7.098   23.075 38.210 1.00 0.00 ? 106 SER A O    2  
ATOM   4730  C  CB   . SER A 1 106 ? 5.077   25.492 37.107 1.00 0.00 ? 106 SER A CB   2  
ATOM   4731  O  OG   . SER A 1 106 ? 4.682   25.068 38.404 1.00 0.00 ? 106 SER A OG   2  
ATOM   4732  H  H    . SER A 1 106 ? 6.429   25.638 34.935 1.00 0.00 ? 106 SER A H    2  
ATOM   4733  H  HA   . SER A 1 106 ? 7.153   25.542 37.761 1.00 0.00 ? 106 SER A HA   2  
ATOM   4734  H  HB2  . SER A 1 106 ? 4.986   26.565 37.022 1.00 0.00 ? 106 SER A HB2  2  
ATOM   4735  H  HB3  . SER A 1 106 ? 4.479   25.000 36.355 1.00 0.00 ? 106 SER A HB3  2  
ATOM   4736  H  HG   . SER A 1 106 ? 4.539   24.119 38.374 1.00 0.00 ? 106 SER A HG   2  
ATOM   4737  N  N    . LEU A 1 107 ? 6.193   22.816 36.207 1.00 0.00 ? 107 LEU A N    2  
ATOM   4738  C  CA   . LEU A 1 107 ? 6.242   21.334 36.320 1.00 0.00 ? 107 LEU A CA   2  
ATOM   4739  C  C    . LEU A 1 107 ? 7.685   20.845 36.327 1.00 0.00 ? 107 LEU A C    2  
ATOM   4740  O  O    . LEU A 1 107 ? 8.028   19.927 37.042 1.00 0.00 ? 107 LEU A O    2  
ATOM   4741  C  CB   . LEU A 1 107 ? 5.476   20.731 35.106 1.00 0.00 ? 107 LEU A CB   2  
ATOM   4742  C  CG   . LEU A 1 107 ? 5.943   19.280 34.786 1.00 0.00 ? 107 LEU A CG   2  
ATOM   4743  C  CD1  . LEU A 1 107 ? 7.353   19.311 34.151 1.00 0.00 ? 107 LEU A CD1  2  
ATOM   4744  C  CD2  . LEU A 1 107 ? 5.931   18.407 36.069 1.00 0.00 ? 107 LEU A CD2  2  
ATOM   4745  H  H    . LEU A 1 107 ? 5.839   23.239 35.398 1.00 0.00 ? 107 LEU A H    2  
ATOM   4746  H  HA   . LEU A 1 107 ? 5.769   21.051 37.257 1.00 0.00 ? 107 LEU A HA   2  
ATOM   4747  H  HB2  . LEU A 1 107 ? 4.419   20.722 35.323 1.00 0.00 ? 107 LEU A HB2  2  
ATOM   4748  H  HB3  . LEU A 1 107 ? 5.644   21.354 34.239 1.00 0.00 ? 107 LEU A HB3  2  
ATOM   4749  H  HG   . LEU A 1 107 ? 5.256   18.849 34.073 1.00 0.00 ? 107 LEU A HG   2  
ATOM   4750  H  HD11 . LEU A 1 107 ? 7.585   20.317 33.835 1.00 0.00 ? 107 LEU A HD11 2  
ATOM   4751  H  HD12 . LEU A 1 107 ? 8.095   18.982 34.856 1.00 0.00 ? 107 LEU A HD12 2  
ATOM   4752  H  HD13 . LEU A 1 107 ? 7.374   18.659 33.290 1.00 0.00 ? 107 LEU A HD13 2  
ATOM   4753  H  HD21 . LEU A 1 107 ? 5.615   18.992 36.910 1.00 0.00 ? 107 LEU A HD21 2  
ATOM   4754  H  HD22 . LEU A 1 107 ? 5.240   17.587 35.938 1.00 0.00 ? 107 LEU A HD22 2  
ATOM   4755  H  HD23 . LEU A 1 107 ? 6.911   18.008 36.265 1.00 0.00 ? 107 LEU A HD23 2  
ATOM   4756  N  N    . TYR A 1 108 ? 8.508   21.474 35.529 1.00 0.00 ? 108 TYR A N    2  
ATOM   4757  C  CA   . TYR A 1 108 ? 9.934   21.060 35.474 1.00 0.00 ? 108 TYR A CA   2  
ATOM   4758  C  C    . TYR A 1 108 ? 10.643  21.404 36.777 1.00 0.00 ? 108 TYR A C    2  
ATOM   4759  O  O    . TYR A 1 108 ? 11.697  20.873 37.069 1.00 0.00 ? 108 TYR A O    2  
ATOM   4760  C  CB   . TYR A 1 108 ? 10.616  21.820 34.320 1.00 0.00 ? 108 TYR A CB   2  
ATOM   4761  C  CG   . TYR A 1 108 ? 11.245  20.816 33.350 1.00 0.00 ? 108 TYR A CG   2  
ATOM   4762  C  CD1  . TYR A 1 108 ? 12.542  20.380 33.534 1.00 0.00 ? 108 TYR A CD1  2  
ATOM   4763  C  CD2  . TYR A 1 108 ? 10.525  20.335 32.275 1.00 0.00 ? 108 TYR A CD2  2  
ATOM   4764  C  CE1  . TYR A 1 108 ? 13.109  19.477 32.657 1.00 0.00 ? 108 TYR A CE1  2  
ATOM   4765  C  CE2  . TYR A 1 108 ? 11.092  19.431 31.400 1.00 0.00 ? 108 TYR A CE2  2  
ATOM   4766  C  CZ   . TYR A 1 108 ? 12.388  18.996 31.584 1.00 0.00 ? 108 TYR A CZ   2  
ATOM   4767  O  OH   . TYR A 1 108 ? 12.954  18.091 30.710 1.00 0.00 ? 108 TYR A OH   2  
ATOM   4768  H  H    . TYR A 1 108 ? 8.188   22.213 34.972 1.00 0.00 ? 108 TYR A H    2  
ATOM   4769  H  HA   . TYR A 1 108 ? 9.988   19.984 35.315 1.00 0.00 ? 108 TYR A HA   2  
ATOM   4770  H  HB2  . TYR A 1 108 ? 9.886   22.415 33.792 1.00 0.00 ? 108 TYR A HB2  2  
ATOM   4771  H  HB3  . TYR A 1 108 ? 11.387  22.469 34.712 1.00 0.00 ? 108 TYR A HB3  2  
ATOM   4772  H  HD1  . TYR A 1 108 ? 13.117  20.748 34.370 1.00 0.00 ? 108 TYR A HD1  2  
ATOM   4773  H  HD2  . TYR A 1 108 ? 9.510   20.669 32.119 1.00 0.00 ? 108 TYR A HD2  2  
ATOM   4774  H  HE1  . TYR A 1 108 ? 14.125  19.144 32.813 1.00 0.00 ? 108 TYR A HE1  2  
ATOM   4775  H  HE2  . TYR A 1 108 ? 10.517  19.064 30.562 1.00 0.00 ? 108 TYR A HE2  2  
ATOM   4776  H  HH   . TYR A 1 108 ? 13.226  17.322 31.216 1.00 0.00 ? 108 TYR A HH   2  
ATOM   4777  N  N    . ASP A 1 109 ? 10.044  22.286 37.539 1.00 0.00 ? 109 ASP A N    2  
ATOM   4778  C  CA   . ASP A 1 109 ? 10.658  22.688 38.831 1.00 0.00 ? 109 ASP A CA   2  
ATOM   4779  C  C    . ASP A 1 109 ? 9.912   22.051 39.994 1.00 0.00 ? 109 ASP A C    2  
ATOM   4780  O  O    . ASP A 1 109 ? 9.207   22.720 40.724 1.00 0.00 ? 109 ASP A O    2  
ATOM   4781  C  CB   . ASP A 1 109 ? 10.568  24.219 38.951 1.00 0.00 ? 109 ASP A CB   2  
ATOM   4782  C  CG   . ASP A 1 109 ? 11.556  24.702 40.013 1.00 0.00 ? 109 ASP A CG   2  
ATOM   4783  O  OD1  . ASP A 1 109 ? 12.018  23.846 40.751 1.00 0.00 ? 109 ASP A OD1  2  
ATOM   4784  O  OD2  . ASP A 1 109 ? 11.793  25.899 40.026 1.00 0.00 ? 109 ASP A OD2  2  
ATOM   4785  H  H    . ASP A 1 109 ? 9.188   22.672 37.264 1.00 0.00 ? 109 ASP A H    2  
ATOM   4786  H  HA   . ASP A 1 109 ? 11.696  22.359 38.854 1.00 0.00 ? 109 ASP A HA   2  
ATOM   4787  H  HB2  . ASP A 1 109 ? 10.813  24.675 38.003 1.00 0.00 ? 109 ASP A HB2  2  
ATOM   4788  H  HB3  . ASP A 1 109 ? 9.567   24.507 39.235 1.00 0.00 ? 109 ASP A HB3  2  
ATOM   4789  N  N    . VAL A 1 110 ? 10.078  20.759 40.133 1.00 0.00 ? 110 VAL A N    2  
ATOM   4790  C  CA   . VAL A 1 110 ? 9.393   20.031 41.240 1.00 0.00 ? 110 VAL A CA   2  
ATOM   4791  C  C    . VAL A 1 110 ? 9.347   20.872 42.509 1.00 0.00 ? 110 VAL A C    2  
ATOM   4792  O  O    . VAL A 1 110 ? 8.284   21.213 42.991 1.00 0.00 ? 110 VAL A O    2  
ATOM   4793  C  CB   . VAL A 1 110 ? 10.176  18.737 41.530 1.00 0.00 ? 110 VAL A CB   2  
ATOM   4794  C  CG1  . VAL A 1 110 ? 9.361   17.858 42.481 1.00 0.00 ? 110 VAL A CG1  2  
ATOM   4795  C  CG2  . VAL A 1 110 ? 10.405  17.979 40.219 1.00 0.00 ? 110 VAL A CG2  2  
ATOM   4796  H  H    . VAL A 1 110 ? 10.648  20.272 39.505 1.00 0.00 ? 110 VAL A H    2  
ATOM   4797  H  HA   . VAL A 1 110 ? 8.373   19.803 40.933 1.00 0.00 ? 110 VAL A HA   2  
ATOM   4798  H  HB   . VAL A 1 110 ? 11.127  18.979 41.981 1.00 0.00 ? 110 VAL A HB   2  
ATOM   4799  H  HG11 . VAL A 1 110 ? 9.180   18.389 43.403 1.00 0.00 ? 110 VAL A HG11 2  
ATOM   4800  H  HG12 . VAL A 1 110 ? 8.416   17.606 42.023 1.00 0.00 ? 110 VAL A HG12 2  
ATOM   4801  H  HG13 . VAL A 1 110 ? 9.906   16.949 42.694 1.00 0.00 ? 110 VAL A HG13 2  
ATOM   4802  H  HG21 . VAL A 1 110 ? 9.454   17.742 39.764 1.00 0.00 ? 110 VAL A HG21 2  
ATOM   4803  H  HG22 . VAL A 1 110 ? 10.980  18.590 39.538 1.00 0.00 ? 110 VAL A HG22 2  
ATOM   4804  H  HG23 . VAL A 1 110 ? 10.943  17.064 40.416 1.00 0.00 ? 110 VAL A HG23 2  
ATOM   4805  N  N    . ASP A 1 111 ? 10.497  21.198 43.029 1.00 0.00 ? 111 ASP A N    2  
ATOM   4806  C  CA   . ASP A 1 111 ? 10.521  22.015 44.262 1.00 0.00 ? 111 ASP A CA   2  
ATOM   4807  C  C    . ASP A 1 111 ? 9.763   23.315 44.047 1.00 0.00 ? 111 ASP A C    2  
ATOM   4808  O  O    . ASP A 1 111 ? 8.807   23.604 44.741 1.00 0.00 ? 111 ASP A O    2  
ATOM   4809  C  CB   . ASP A 1 111 ? 11.985  22.337 44.605 1.00 0.00 ? 111 ASP A CB   2  
ATOM   4810  C  CG   . ASP A 1 111 ? 12.612  23.150 43.468 1.00 0.00 ? 111 ASP A CG   2  
ATOM   4811  O  OD1  . ASP A 1 111 ? 13.013  22.516 42.506 1.00 0.00 ? 111 ASP A OD1  2  
ATOM   4812  O  OD2  . ASP A 1 111 ? 12.656  24.358 43.628 1.00 0.00 ? 111 ASP A OD2  2  
ATOM   4813  H  H    . ASP A 1 111 ? 11.332  20.908 42.609 1.00 0.00 ? 111 ASP A H    2  
ATOM   4814  H  HA   . ASP A 1 111 ? 10.047  21.457 45.067 1.00 0.00 ? 111 ASP A HA   2  
ATOM   4815  H  HB2  . ASP A 1 111 ? 12.029  22.912 45.518 1.00 0.00 ? 111 ASP A HB2  2  
ATOM   4816  H  HB3  . ASP A 1 111 ? 12.540  21.421 44.735 1.00 0.00 ? 111 ASP A HB3  2  
ATOM   4817  N  N    . GLY A 1 112 ? 10.201  24.076 43.085 1.00 0.00 ? 112 GLY A N    2  
ATOM   4818  C  CA   . GLY A 1 112 ? 9.519   25.365 42.804 1.00 0.00 ? 112 GLY A CA   2  
ATOM   4819  C  C    . GLY A 1 112 ? 10.217  26.506 43.530 1.00 0.00 ? 112 GLY A C    2  
ATOM   4820  O  O    . GLY A 1 112 ? 9.808   26.903 44.604 1.00 0.00 ? 112 GLY A O    2  
ATOM   4821  H  H    . GLY A 1 112 ? 10.977  23.803 42.554 1.00 0.00 ? 112 GLY A H    2  
ATOM   4822  H  HA2  . GLY A 1 112 ? 9.541   25.555 41.742 1.00 0.00 ? 112 GLY A HA2  2  
ATOM   4823  H  HA3  . GLY A 1 112 ? 8.493   25.308 43.134 1.00 0.00 ? 112 GLY A HA3  2  
ATOM   4824  N  N    . ASN A 1 113 ? 11.265  27.002 42.928 1.00 0.00 ? 113 ASN A N    2  
ATOM   4825  C  CA   . ASN A 1 113 ? 12.015  28.118 43.552 1.00 0.00 ? 113 ASN A CA   2  
ATOM   4826  C  C    . ASN A 1 113 ? 12.395  29.154 42.505 1.00 0.00 ? 113 ASN A C    2  
ATOM   4827  O  O    . ASN A 1 113 ? 13.301  29.943 42.698 1.00 0.00 ? 113 ASN A O    2  
ATOM   4828  C  CB   . ASN A 1 113 ? 13.285  27.545 44.196 1.00 0.00 ? 113 ASN A CB   2  
ATOM   4829  C  CG   . ASN A 1 113 ? 14.132  26.874 43.121 1.00 0.00 ? 113 ASN A CG   2  
ATOM   4830  O  OD1  . ASN A 1 113 ? 14.013  27.168 41.951 1.00 0.00 ? 113 ASN A OD1  2  
ATOM   4831  N  ND2  . ASN A 1 113 ? 15.001  25.968 43.477 1.00 0.00 ? 113 ASN A ND2  2  
ATOM   4832  H  H    . ASN A 1 113 ? 11.557  26.633 42.069 1.00 0.00 ? 113 ASN A H    2  
ATOM   4833  H  HA   . ASN A 1 113 ? 11.383  28.595 44.295 1.00 0.00 ? 113 ASN A HA   2  
ATOM   4834  H  HB2  . ASN A 1 113 ? 13.852  28.336 44.659 1.00 0.00 ? 113 ASN A HB2  2  
ATOM   4835  H  HB3  . ASN A 1 113 ? 13.016  26.815 44.944 1.00 0.00 ? 113 ASN A HB3  2  
ATOM   4836  H  HD21 . ASN A 1 113 ? 15.105  25.733 44.423 1.00 0.00 ? 113 ASN A HD21 2  
ATOM   4837  H  HD22 . ASN A 1 113 ? 15.541  25.513 42.798 1.00 0.00 ? 113 ASN A HD22 2  
ATOM   4838  N  N    . GLY A 1 114 ? 11.683  29.130 41.413 1.00 0.00 ? 114 GLY A N    2  
ATOM   4839  C  CA   . GLY A 1 114 ? 11.963  30.102 40.311 1.00 0.00 ? 114 GLY A CA   2  
ATOM   4840  C  C    . GLY A 1 114 ? 13.294  29.801 39.605 1.00 0.00 ? 114 GLY A C    2  
ATOM   4841  O  O    . GLY A 1 114 ? 13.775  30.605 38.825 1.00 0.00 ? 114 GLY A O    2  
ATOM   4842  H  H    . GLY A 1 114 ? 10.959  28.475 41.320 1.00 0.00 ? 114 GLY A H    2  
ATOM   4843  H  HA2  . GLY A 1 114 ? 11.162  30.053 39.590 1.00 0.00 ? 114 GLY A HA2  2  
ATOM   4844  H  HA3  . GLY A 1 114 ? 12.001  31.100 40.723 1.00 0.00 ? 114 GLY A HA3  2  
ATOM   4845  N  N    . THR A 1 115 ? 13.866  28.661 39.883 1.00 0.00 ? 115 THR A N    2  
ATOM   4846  C  CA   . THR A 1 115 ? 15.157  28.322 39.227 1.00 0.00 ? 115 THR A CA   2  
ATOM   4847  C  C    . THR A 1 115 ? 15.330  26.805 39.068 1.00 0.00 ? 115 THR A C    2  
ATOM   4848  O  O    . THR A 1 115 ? 15.012  26.047 39.958 1.00 0.00 ? 115 THR A O    2  
ATOM   4849  C  CB   . THR A 1 115 ? 16.288  28.862 40.109 1.00 0.00 ? 115 THR A CB   2  
ATOM   4850  O  OG1  . THR A 1 115 ? 15.838  28.694 41.438 1.00 0.00 ? 115 THR A OG1  2  
ATOM   4851  C  CG2  . THR A 1 115 ? 16.437  30.386 39.936 1.00 0.00 ? 115 THR A CG2  2  
ATOM   4852  H  H    . THR A 1 115 ? 13.451  28.040 40.506 1.00 0.00 ? 115 THR A H    2  
ATOM   4853  H  HA   . THR A 1 115 ? 15.182  28.787 38.245 1.00 0.00 ? 115 THR A HA   2  
ATOM   4854  H  HB   . THR A 1 115 ? 17.218  28.324 39.945 1.00 0.00 ? 115 THR A HB   2  
ATOM   4855  H  HG1  . THR A 1 115 ? 15.540  27.786 41.536 1.00 0.00 ? 115 THR A HG1  2  
ATOM   4856  H  HG21 . THR A 1 115 ? 16.307  30.650 38.895 1.00 0.00 ? 115 THR A HG21 2  
ATOM   4857  H  HG22 . THR A 1 115 ? 15.689  30.896 40.528 1.00 0.00 ? 115 THR A HG22 2  
ATOM   4858  H  HG23 . THR A 1 115 ? 17.419  30.696 40.260 1.00 0.00 ? 115 THR A HG23 2  
ATOM   4859  N  N    . ILE A 1 116 ? 15.833  26.391 37.926 1.00 0.00 ? 116 ILE A N    2  
ATOM   4860  C  CA   . ILE A 1 116 ? 16.032  24.927 37.702 1.00 0.00 ? 116 ILE A CA   2  
ATOM   4861  C  C    . ILE A 1 116 ? 17.462  24.538 38.012 1.00 0.00 ? 116 ILE A C    2  
ATOM   4862  O  O    . ILE A 1 116 ? 18.386  25.253 37.673 1.00 0.00 ? 116 ILE A O    2  
ATOM   4863  C  CB   . ILE A 1 116 ? 15.747  24.605 36.236 1.00 0.00 ? 116 ILE A CB   2  
ATOM   4864  C  CG1  . ILE A 1 116 ? 14.310  24.970 35.903 1.00 0.00 ? 116 ILE A CG1  2  
ATOM   4865  C  CG2  . ILE A 1 116 ? 15.926  23.089 36.018 1.00 0.00 ? 116 ILE A CG2  2  
ATOM   4866  C  CD1  . ILE A 1 116 ? 13.880  24.226 34.638 1.00 0.00 ? 116 ILE A CD1  2  
ATOM   4867  H  H    . ILE A 1 116 ? 16.080  27.038 37.231 1.00 0.00 ? 116 ILE A H    2  
ATOM   4868  H  HA   . ILE A 1 116 ? 15.364  24.370 38.358 1.00 0.00 ? 116 ILE A HA   2  
ATOM   4869  H  HB   . ILE A 1 116 ? 16.424  25.173 35.602 1.00 0.00 ? 116 ILE A HB   2  
ATOM   4870  H  HG12 . ILE A 1 116 ? 13.665  24.693 36.724 1.00 0.00 ? 116 ILE A HG12 2  
ATOM   4871  H  HG13 . ILE A 1 116 ? 14.238  26.031 35.741 1.00 0.00 ? 116 ILE A HG13 2  
ATOM   4872  H  HG21 . ILE A 1 116 ? 16.854  22.761 36.458 1.00 0.00 ? 116 ILE A HG21 2  
ATOM   4873  H  HG22 . ILE A 1 116 ? 15.107  22.554 36.478 1.00 0.00 ? 116 ILE A HG22 2  
ATOM   4874  H  HG23 . ILE A 1 116 ? 15.940  22.874 34.960 1.00 0.00 ? 116 ILE A HG23 2  
ATOM   4875  H  HD11 . ILE A 1 116 ? 14.639  24.329 33.877 1.00 0.00 ? 116 ILE A HD11 2  
ATOM   4876  H  HD12 . ILE A 1 116 ? 13.739  23.178 34.860 1.00 0.00 ? 116 ILE A HD12 2  
ATOM   4877  H  HD13 . ILE A 1 116 ? 12.952  24.638 34.271 1.00 0.00 ? 116 ILE A HD13 2  
ATOM   4878  N  N    . SER A 1 117 ? 17.619  23.404 38.649 1.00 0.00 ? 117 SER A N    2  
ATOM   4879  C  CA   . SER A 1 117 ? 18.979  22.934 38.998 1.00 0.00 ? 117 SER A CA   2  
ATOM   4880  C  C    . SER A 1 117 ? 19.189  21.497 38.545 1.00 0.00 ? 117 SER A C    2  
ATOM   4881  O  O    . SER A 1 117 ? 18.290  20.868 38.020 1.00 0.00 ? 117 SER A O    2  
ATOM   4882  C  CB   . SER A 1 117 ? 19.133  23.004 40.527 1.00 0.00 ? 117 SER A CB   2  
ATOM   4883  O  OG   . SER A 1 117 ? 20.513  22.765 40.748 1.00 0.00 ? 117 SER A OG   2  
ATOM   4884  H  H    . SER A 1 117 ? 16.841  22.867 38.888 1.00 0.00 ? 117 SER A H    2  
ATOM   4885  H  HA   . SER A 1 117 ? 19.712  23.565 38.511 1.00 0.00 ? 117 SER A HA   2  
ATOM   4886  H  HB2  . SER A 1 117 ? 18.859  23.983 40.895 1.00 0.00 ? 117 SER A HB2  2  
ATOM   4887  H  HB3  . SER A 1 117 ? 18.539  22.241 41.007 1.00 0.00 ? 117 SER A HB3  2  
ATOM   4888  H  HG   . SER A 1 117 ? 20.672  21.825 40.638 1.00 0.00 ? 117 SER A HG   2  
ATOM   4889  N  N    . LYS A 1 118 ? 20.378  21.003 38.752 1.00 0.00 ? 118 LYS A N    2  
ATOM   4890  C  CA   . LYS A 1 118 ? 20.673  19.609 38.341 1.00 0.00 ? 118 LYS A CA   2  
ATOM   4891  C  C    . LYS A 1 118 ? 19.763  18.622 39.063 1.00 0.00 ? 118 LYS A C    2  
ATOM   4892  O  O    . LYS A 1 118 ? 19.007  17.901 38.442 1.00 0.00 ? 118 LYS A O    2  
ATOM   4893  C  CB   . LYS A 1 118 ? 22.133  19.299 38.714 1.00 0.00 ? 118 LYS A CB   2  
ATOM   4894  C  CG   . LYS A 1 118 ? 22.534  17.943 38.122 1.00 0.00 ? 118 LYS A CG   2  
ATOM   4895  C  CD   . LYS A 1 118 ? 23.987  17.637 38.507 1.00 0.00 ? 118 LYS A CD   2  
ATOM   4896  C  CE   . LYS A 1 118 ? 24.390  16.273 37.935 1.00 0.00 ? 118 LYS A CE   2  
ATOM   4897  N  NZ   . LYS A 1 118 ? 24.244  15.206 38.968 1.00 0.00 ? 118 LYS A NZ   2  
ATOM   4898  H  H    . LYS A 1 118 ? 21.070  21.549 39.179 1.00 0.00 ? 118 LYS A H    2  
ATOM   4899  H  HA   . LYS A 1 118 ? 20.518  19.516 37.267 1.00 0.00 ? 118 LYS A HA   2  
ATOM   4900  H  HB2  . LYS A 1 118 ? 22.779  20.070 38.320 1.00 0.00 ? 118 LYS A HB2  2  
ATOM   4901  H  HB3  . LYS A 1 118 ? 22.234  19.268 39.789 1.00 0.00 ? 118 LYS A HB3  2  
ATOM   4902  H  HG2  . LYS A 1 118 ? 21.886  17.171 38.510 1.00 0.00 ? 118 LYS A HG2  2  
ATOM   4903  H  HG3  . LYS A 1 118 ? 22.443  17.973 37.046 1.00 0.00 ? 118 LYS A HG3  2  
ATOM   4904  H  HD2  . LYS A 1 118 ? 24.636  18.403 38.106 1.00 0.00 ? 118 LYS A HD2  2  
ATOM   4905  H  HD3  . LYS A 1 118 ? 24.081  17.621 39.582 1.00 0.00 ? 118 LYS A HD3  2  
ATOM   4906  H  HE2  . LYS A 1 118 ? 23.761  16.035 37.090 1.00 0.00 ? 118 LYS A HE2  2  
ATOM   4907  H  HE3  . LYS A 1 118 ? 25.419  16.308 37.609 1.00 0.00 ? 118 LYS A HE3  2  
ATOM   4908  H  HZ1  . LYS A 1 118 ? 24.480  15.595 39.904 1.00 0.00 ? 118 LYS A HZ1  2  
ATOM   4909  H  HZ2  . LYS A 1 118 ? 23.264  14.860 38.974 1.00 0.00 ? 118 LYS A HZ2  2  
ATOM   4910  H  HZ3  . LYS A 1 118 ? 24.889  14.420 38.747 1.00 0.00 ? 118 LYS A HZ3  2  
ATOM   4911  N  N    . ASN A 1 119 ? 19.850  18.610 40.362 1.00 0.00 ? 119 ASN A N    2  
ATOM   4912  C  CA   . ASN A 1 119 ? 19.003  17.678 41.146 1.00 0.00 ? 119 ASN A CA   2  
ATOM   4913  C  C    . ASN A 1 119 ? 17.570  17.645 40.625 1.00 0.00 ? 119 ASN A C    2  
ATOM   4914  O  O    . ASN A 1 119 ? 17.027  16.589 40.373 1.00 0.00 ? 119 ASN A O    2  
ATOM   4915  C  CB   . ASN A 1 119 ? 18.985  18.149 42.604 1.00 0.00 ? 119 ASN A CB   2  
ATOM   4916  C  CG   . ASN A 1 119 ? 18.864  16.931 43.520 1.00 0.00 ? 119 ASN A CG   2  
ATOM   4917  O  OD1  . ASN A 1 119 ? 19.035  17.024 44.719 1.00 0.00 ? 119 ASN A OD1  2  
ATOM   4918  N  ND2  . ASN A 1 119 ? 18.572  15.771 42.997 1.00 0.00 ? 119 ASN A ND2  2  
ATOM   4919  H  H    . ASN A 1 119 ? 20.472  19.214 40.820 1.00 0.00 ? 119 ASN A H    2  
ATOM   4920  H  HA   . ASN A 1 119 ? 19.425  16.678 41.073 1.00 0.00 ? 119 ASN A HA   2  
ATOM   4921  H  HB2  . ASN A 1 119 ? 19.898  18.678 42.831 1.00 0.00 ? 119 ASN A HB2  2  
ATOM   4922  H  HB3  . ASN A 1 119 ? 18.142  18.804 42.767 1.00 0.00 ? 119 ASN A HB3  2  
ATOM   4923  H  HD21 . ASN A 1 119 ? 18.434  15.690 42.030 1.00 0.00 ? 119 ASN A HD21 2  
ATOM   4924  H  HD22 . ASN A 1 119 ? 18.492  14.981 43.571 1.00 0.00 ? 119 ASN A HD22 2  
ATOM   4925  N  N    . GLU A 1 120 ? 16.978  18.794 40.477 1.00 0.00 ? 120 GLU A N    2  
ATOM   4926  C  CA   . GLU A 1 120 ? 15.584  18.826 39.975 1.00 0.00 ? 120 GLU A CA   2  
ATOM   4927  C  C    . GLU A 1 120 ? 15.467  18.087 38.645 1.00 0.00 ? 120 GLU A C    2  
ATOM   4928  O  O    . GLU A 1 120 ? 14.667  17.180 38.507 1.00 0.00 ? 120 GLU A O    2  
ATOM   4929  C  CB   . GLU A 1 120 ? 15.174  20.291 39.770 1.00 0.00 ? 120 GLU A CB   2  
ATOM   4930  C  CG   . GLU A 1 120 ? 15.084  20.980 41.132 1.00 0.00 ? 120 GLU A CG   2  
ATOM   4931  C  CD   . GLU A 1 120 ? 15.210  22.495 40.943 1.00 0.00 ? 120 GLU A CD   2  
ATOM   4932  O  OE1  . GLU A 1 120 ? 14.532  22.987 40.058 1.00 0.00 ? 120 GLU A OE1  2  
ATOM   4933  O  OE2  . GLU A 1 120 ? 15.977  23.071 41.693 1.00 0.00 ? 120 GLU A OE2  2  
ATOM   4934  H  H    . GLU A 1 120 ? 17.448  19.627 40.693 1.00 0.00 ? 120 GLU A H    2  
ATOM   4935  H  HA   . GLU A 1 120 ? 14.936  18.340 40.706 1.00 0.00 ? 120 GLU A HA   2  
ATOM   4936  H  HB2  . GLU A 1 120 ? 15.910  20.792 39.159 1.00 0.00 ? 120 GLU A HB2  2  
ATOM   4937  H  HB3  . GLU A 1 120 ? 14.215  20.335 39.278 1.00 0.00 ? 120 GLU A HB3  2  
ATOM   4938  H  HG2  . GLU A 1 120 ? 14.134  20.755 41.594 1.00 0.00 ? 120 GLU A HG2  2  
ATOM   4939  H  HG3  . GLU A 1 120 ? 15.882  20.632 41.772 1.00 0.00 ? 120 GLU A HG3  2  
ATOM   4940  N  N    . VAL A 1 121 ? 16.264  18.483 37.690 1.00 0.00 ? 121 VAL A N    2  
ATOM   4941  C  CA   . VAL A 1 121 ? 16.203  17.808 36.369 1.00 0.00 ? 121 VAL A CA   2  
ATOM   4942  C  C    . VAL A 1 121 ? 16.413  16.306 36.519 1.00 0.00 ? 121 VAL A C    2  
ATOM   4943  O  O    . VAL A 1 121 ? 16.010  15.534 35.672 1.00 0.00 ? 121 VAL A O    2  
ATOM   4944  C  CB   . VAL A 1 121 ? 17.317  18.371 35.476 1.00 0.00 ? 121 VAL A CB   2  
ATOM   4945  C  CG1  . VAL A 1 121 ? 17.263  17.677 34.111 1.00 0.00 ? 121 VAL A CG1  2  
ATOM   4946  C  CG2  . VAL A 1 121 ? 17.100  19.874 35.284 1.00 0.00 ? 121 VAL A CG2  2  
ATOM   4947  H  H    . VAL A 1 121 ? 16.895  19.216 37.843 1.00 0.00 ? 121 VAL A H    2  
ATOM   4948  H  HA   . VAL A 1 121 ? 15.223  17.986 35.926 1.00 0.00 ? 121 VAL A HA   2  
ATOM   4949  H  HB   . VAL A 1 121 ? 18.278  18.198 35.936 1.00 0.00 ? 121 VAL A HB   2  
ATOM   4950  H  HG11 . VAL A 1 121 ? 16.234  17.525 33.820 1.00 0.00 ? 121 VAL A HG11 2  
ATOM   4951  H  HG12 . VAL A 1 121 ? 17.755  18.291 33.370 1.00 0.00 ? 121 VAL A HG12 2  
ATOM   4952  H  HG13 . VAL A 1 121 ? 17.762  16.721 34.168 1.00 0.00 ? 121 VAL A HG13 2  
ATOM   4953  H  HG21 . VAL A 1 121 ? 16.716  20.305 36.198 1.00 0.00 ? 121 VAL A HG21 2  
ATOM   4954  H  HG22 . VAL A 1 121 ? 18.036  20.349 35.034 1.00 0.00 ? 121 VAL A HG22 2  
ATOM   4955  H  HG23 . VAL A 1 121 ? 16.391  20.042 34.487 1.00 0.00 ? 121 VAL A HG23 2  
ATOM   4956  N  N    . LEU A 1 122 ? 17.043  15.915 37.596 1.00 0.00 ? 122 LEU A N    2  
ATOM   4957  C  CA   . LEU A 1 122 ? 17.283  14.466 37.810 1.00 0.00 ? 122 LEU A CA   2  
ATOM   4958  C  C    . LEU A 1 122 ? 15.964  13.725 37.984 1.00 0.00 ? 122 LEU A C    2  
ATOM   4959  O  O    . LEU A 1 122 ? 15.767  12.665 37.424 1.00 0.00 ? 122 LEU A O    2  
ATOM   4960  C  CB   . LEU A 1 122 ? 18.126  14.291 39.085 1.00 0.00 ? 122 LEU A CB   2  
ATOM   4961  C  CG   . LEU A 1 122 ? 19.173  13.194 38.853 1.00 0.00 ? 122 LEU A CG   2  
ATOM   4962  C  CD1  . LEU A 1 122 ? 20.097  13.117 40.070 1.00 0.00 ? 122 LEU A CD1  2  
ATOM   4963  C  CD2  . LEU A 1 122 ? 18.468  11.848 38.673 1.00 0.00 ? 122 LEU A CD2  2  
ATOM   4964  H  H    . LEU A 1 122 ? 17.353  16.572 38.255 1.00 0.00 ? 122 LEU A H    2  
ATOM   4965  H  HA   . LEU A 1 122 ? 17.805  14.062 36.942 1.00 0.00 ? 122 LEU A HA   2  
ATOM   4966  H  HB2  . LEU A 1 122 ? 18.623  15.221 39.318 1.00 0.00 ? 122 LEU A HB2  2  
ATOM   4967  H  HB3  . LEU A 1 122 ? 17.486  14.016 39.910 1.00 0.00 ? 122 LEU A HB3  2  
ATOM   4968  H  HG   . LEU A 1 122 ? 19.753  13.423 37.971 1.00 0.00 ? 122 LEU A HG   2  
ATOM   4969  H  HD11 . LEU A 1 122 ? 20.592  14.066 40.212 1.00 0.00 ? 122 LEU A HD11 2  
ATOM   4970  H  HD12 . LEU A 1 122 ? 19.519  12.881 40.952 1.00 0.00 ? 122 LEU A HD12 2  
ATOM   4971  H  HD13 . LEU A 1 122 ? 20.839  12.348 39.916 1.00 0.00 ? 122 LEU A HD13 2  
ATOM   4972  H  HD21 . LEU A 1 122 ? 17.686  11.743 39.411 1.00 0.00 ? 122 LEU A HD21 2  
ATOM   4973  H  HD22 . LEU A 1 122 ? 18.035  11.793 37.685 1.00 0.00 ? 122 LEU A HD22 2  
ATOM   4974  H  HD23 . LEU A 1 122 ? 19.181  11.045 38.794 1.00 0.00 ? 122 LEU A HD23 2  
ATOM   4975  N  N    . GLU A 1 123 ? 15.078  14.297 38.757 1.00 0.00 ? 123 GLU A N    2  
ATOM   4976  C  CA   . GLU A 1 123 ? 13.769  13.632 38.970 1.00 0.00 ? 123 GLU A CA   2  
ATOM   4977  C  C    . GLU A 1 123 ? 12.955  13.659 37.692 1.00 0.00 ? 123 GLU A C    2  
ATOM   4978  O  O    . GLU A 1 123 ? 12.473  12.642 37.235 1.00 0.00 ? 123 GLU A O    2  
ATOM   4979  C  CB   . GLU A 1 123 ? 12.998  14.396 40.057 1.00 0.00 ? 123 GLU A CB   2  
ATOM   4980  C  CG   . GLU A 1 123 ? 11.913  13.489 40.647 1.00 0.00 ? 123 GLU A CG   2  
ATOM   4981  C  CD   . GLU A 1 123 ? 11.714  13.837 42.123 1.00 0.00 ? 123 GLU A CD   2  
ATOM   4982  O  OE1  . GLU A 1 123 ? 12.722  13.884 42.808 1.00 0.00 ? 123 GLU A OE1  2  
ATOM   4983  O  OE2  . GLU A 1 123 ? 10.566  14.037 42.482 1.00 0.00 ? 123 GLU A OE2  2  
ATOM   4984  H  H    . GLU A 1 123 ? 15.276  15.156 39.191 1.00 0.00 ? 123 GLU A H    2  
ATOM   4985  H  HA   . GLU A 1 123 ? 13.941  12.598 39.264 1.00 0.00 ? 123 GLU A HA   2  
ATOM   4986  H  HB2  . GLU A 1 123 ? 13.677  14.702 40.835 1.00 0.00 ? 123 GLU A HB2  2  
ATOM   4987  H  HB3  . GLU A 1 123 ? 12.539  15.272 39.624 1.00 0.00 ? 123 GLU A HB3  2  
ATOM   4988  H  HG2  . GLU A 1 123 ? 10.984  13.639 40.117 1.00 0.00 ? 123 GLU A HG2  2  
ATOM   4989  H  HG3  . GLU A 1 123 ? 12.209  12.456 40.563 1.00 0.00 ? 123 GLU A HG3  2  
ATOM   4990  N  N    . ILE A 1 124 ? 12.810  14.829 37.135 1.00 0.00 ? 124 ILE A N    2  
ATOM   4991  C  CA   . ILE A 1 124 ? 12.031  14.942 35.885 1.00 0.00 ? 124 ILE A CA   2  
ATOM   4992  C  C    . ILE A 1 124 ? 12.446  13.850 34.917 1.00 0.00 ? 124 ILE A C    2  
ATOM   4993  O  O    . ILE A 1 124 ? 11.625  13.277 34.227 1.00 0.00 ? 124 ILE A O    2  
ATOM   4994  C  CB   . ILE A 1 124 ? 12.327  16.302 35.259 1.00 0.00 ? 124 ILE A CB   2  
ATOM   4995  C  CG1  . ILE A 1 124 ? 12.049  17.405 36.271 1.00 0.00 ? 124 ILE A CG1  2  
ATOM   4996  C  CG2  . ILE A 1 124 ? 11.396  16.498 34.053 1.00 0.00 ? 124 ILE A CG2  2  
ATOM   4997  C  CD1  . ILE A 1 124 ? 10.634  17.230 36.828 1.00 0.00 ? 124 ILE A CD1  2  
ATOM   4998  H  H    . ILE A 1 124 ? 13.214  15.626 37.541 1.00 0.00 ? 124 ILE A H    2  
ATOM   4999  H  HA   . ILE A 1 124 ? 10.970  14.837 36.113 1.00 0.00 ? 124 ILE A HA   2  
ATOM   5000  H  HB   . ILE A 1 124 ? 13.375  16.343 34.957 1.00 0.00 ? 124 ILE A HB   2  
ATOM   5001  H  HG12 . ILE A 1 124 ? 12.766  17.345 37.077 1.00 0.00 ? 124 ILE A HG12 2  
ATOM   5002  H  HG13 . ILE A 1 124 ? 12.134  18.367 35.791 1.00 0.00 ? 124 ILE A HG13 2  
ATOM   5003  H  HG21 . ILE A 1 124 ? 10.559  15.820 34.125 1.00 0.00 ? 124 ILE A HG21 2  
ATOM   5004  H  HG22 . ILE A 1 124 ? 11.032  17.513 34.036 1.00 0.00 ? 124 ILE A HG22 2  
ATOM   5005  H  HG23 . ILE A 1 124 ? 11.937  16.298 33.141 1.00 0.00 ? 124 ILE A HG23 2  
ATOM   5006  H  HD11 . ILE A 1 124 ? 9.979   16.864 36.052 1.00 0.00 ? 124 ILE A HD11 2  
ATOM   5007  H  HD12 . ILE A 1 124 ? 10.648  16.521 37.644 1.00 0.00 ? 124 ILE A HD12 2  
ATOM   5008  H  HD13 . ILE A 1 124 ? 10.265  18.179 37.188 1.00 0.00 ? 124 ILE A HD13 2  
ATOM   5009  N  N    . VAL A 1 125 ? 13.720  13.580 34.884 1.00 0.00 ? 125 VAL A N    2  
ATOM   5010  C  CA   . VAL A 1 125 ? 14.220  12.531 33.974 1.00 0.00 ? 125 VAL A CA   2  
ATOM   5011  C  C    . VAL A 1 125 ? 13.919  11.155 34.556 1.00 0.00 ? 125 VAL A C    2  
ATOM   5012  O  O    . VAL A 1 125 ? 13.433  10.278 33.869 1.00 0.00 ? 125 VAL A O    2  
ATOM   5013  C  CB   . VAL A 1 125 ? 15.744  12.703 33.833 1.00 0.00 ? 125 VAL A CB   2  
ATOM   5014  C  CG1  . VAL A 1 125 ? 16.358  11.421 33.270 1.00 0.00 ? 125 VAL A CG1  2  
ATOM   5015  C  CG2  . VAL A 1 125 ? 16.029  13.861 32.871 1.00 0.00 ? 125 VAL A CG2  2  
ATOM   5016  H  H    . VAL A 1 125 ? 14.344  14.070 35.460 1.00 0.00 ? 125 VAL A H    2  
ATOM   5017  H  HA   . VAL A 1 125 ? 13.724  12.628 33.009 1.00 0.00 ? 125 VAL A HA   2  
ATOM   5018  H  HB   . VAL A 1 125 ? 16.175  12.920 34.800 1.00 0.00 ? 125 VAL A HB   2  
ATOM   5019  H  HG11 . VAL A 1 125 ? 15.897  11.181 32.323 1.00 0.00 ? 125 VAL A HG11 2  
ATOM   5020  H  HG12 . VAL A 1 125 ? 17.418  11.559 33.123 1.00 0.00 ? 125 VAL A HG12 2  
ATOM   5021  H  HG13 . VAL A 1 125 ? 16.201  10.606 33.959 1.00 0.00 ? 125 VAL A HG13 2  
ATOM   5022  H  HG21 . VAL A 1 125 ? 15.535  14.757 33.221 1.00 0.00 ? 125 VAL A HG21 2  
ATOM   5023  H  HG22 . VAL A 1 125 ? 17.092  14.040 32.819 1.00 0.00 ? 125 VAL A HG22 2  
ATOM   5024  H  HG23 . VAL A 1 125 ? 15.662  13.615 31.886 1.00 0.00 ? 125 VAL A HG23 2  
ATOM   5025  N  N    . THR A 1 126 ? 14.215  10.991 35.821 1.00 0.00 ? 126 THR A N    2  
ATOM   5026  C  CA   . THR A 1 126 ? 13.952  9.684  36.467 1.00 0.00 ? 126 THR A CA   2  
ATOM   5027  C  C    . THR A 1 126 ? 12.472  9.348  36.385 1.00 0.00 ? 126 THR A C    2  
ATOM   5028  O  O    . THR A 1 126 ? 12.097  8.275  35.960 1.00 0.00 ? 126 THR A O    2  
ATOM   5029  C  CB   . THR A 1 126 ? 14.356  9.780  37.942 1.00 0.00 ? 126 THR A CB   2  
ATOM   5030  O  OG1  . THR A 1 126 ? 15.693  10.240 37.936 1.00 0.00 ? 126 THR A OG1  2  
ATOM   5031  C  CG2  . THR A 1 126 ? 14.428  8.385  38.581 1.00 0.00 ? 126 THR A CG2  2  
ATOM   5032  H  H    . THR A 1 126 ? 14.608  11.727 36.336 1.00 0.00 ? 126 THR A H    2  
ATOM   5033  H  HA   . THR A 1 126 ? 14.523  8.910  35.956 1.00 0.00 ? 126 THR A HA   2  
ATOM   5034  H  HB   . THR A 1 126 ? 13.714  10.464 38.492 1.00 0.00 ? 126 THR A HB   2  
ATOM   5035  H  HG1  . THR A 1 126 ? 16.242  9.554  37.549 1.00 0.00 ? 126 THR A HG1  2  
ATOM   5036  H  HG21 . THR A 1 126 ? 13.935  7.666  37.943 1.00 0.00 ? 126 THR A HG21 2  
ATOM   5037  H  HG22 . THR A 1 126 ? 15.460  8.095  38.710 1.00 0.00 ? 126 THR A HG22 2  
ATOM   5038  H  HG23 . THR A 1 126 ? 13.941  8.400  39.544 1.00 0.00 ? 126 THR A HG23 2  
ATOM   5039  N  N    . ALA A 1 127 ? 11.656  10.277 36.800 1.00 0.00 ? 127 ALA A N    2  
ATOM   5040  C  CA   . ALA A 1 127 ? 10.199  10.034 36.752 1.00 0.00 ? 127 ALA A CA   2  
ATOM   5041  C  C    . ALA A 1 127 ? 9.792   9.605  35.348 1.00 0.00 ? 127 ALA A C    2  
ATOM   5042  O  O    . ALA A 1 127 ? 9.179   8.566  35.152 1.00 0.00 ? 127 ALA A O    2  
ATOM   5043  C  CB   . ALA A 1 127 ? 9.486   11.351 37.104 1.00 0.00 ? 127 ALA A CB   2  
ATOM   5044  H  H    . ALA A 1 127 ? 12.005  11.126 37.140 1.00 0.00 ? 127 ALA A H    2  
ATOM   5045  H  HA   . ALA A 1 127 ? 9.941   9.246  37.460 1.00 0.00 ? 127 ALA A HA   2  
ATOM   5046  H  HB1  . ALA A 1 127 ? 9.941   12.167 36.563 1.00 0.00 ? 127 ALA A HB1  2  
ATOM   5047  H  HB2  . ALA A 1 127 ? 8.444   11.285 36.838 1.00 0.00 ? 127 ALA A HB2  2  
ATOM   5048  H  HB3  . ALA A 1 127 ? 9.571   11.539 38.166 1.00 0.00 ? 127 ALA A HB3  2  
ATOM   5049  N  N    . ILE A 1 128 ? 10.138  10.415 34.391 1.00 0.00 ? 128 ILE A N    2  
ATOM   5050  C  CA   . ILE A 1 128 ? 9.785   10.074 32.998 1.00 0.00 ? 128 ILE A CA   2  
ATOM   5051  C  C    . ILE A 1 128 ? 10.263  8.666  32.662 1.00 0.00 ? 128 ILE A C    2  
ATOM   5052  O  O    . ILE A 1 128 ? 9.535   7.880  32.090 1.00 0.00 ? 128 ILE A O    2  
ATOM   5053  C  CB   . ILE A 1 128 ? 10.478  11.068 32.064 1.00 0.00 ? 128 ILE A CB   2  
ATOM   5054  C  CG1  . ILE A 1 128 ? 9.702   12.379 32.041 1.00 0.00 ? 128 ILE A CG1  2  
ATOM   5055  C  CG2  . ILE A 1 128 ? 10.486  10.480 30.642 1.00 0.00 ? 128 ILE A CG2  2  
ATOM   5056  C  CD1  . ILE A 1 128 ? 10.571  13.469 31.408 1.00 0.00 ? 128 ILE A CD1  2  
ATOM   5057  H  H    . ILE A 1 128 ? 10.615  11.247 34.595 1.00 0.00 ? 128 ILE A H    2  
ATOM   5058  H  HA   . ILE A 1 128 ? 8.702   10.120 32.883 1.00 0.00 ? 128 ILE A HA   2  
ATOM   5059  H  HB   . ILE A 1 128 ? 11.494  11.252 32.418 1.00 0.00 ? 128 ILE A HB   2  
ATOM   5060  H  HG12 . ILE A 1 128 ? 8.798   12.255 31.463 1.00 0.00 ? 128 ILE A HG12 2  
ATOM   5061  H  HG13 . ILE A 1 128 ? 9.442   12.663 33.049 1.00 0.00 ? 128 ILE A HG13 2  
ATOM   5062  H  HG21 . ILE A 1 128 ? 9.514   10.067 30.412 1.00 0.00 ? 128 ILE A HG21 2  
ATOM   5063  H  HG22 . ILE A 1 128 ? 10.721  11.256 29.929 1.00 0.00 ? 128 ILE A HG22 2  
ATOM   5064  H  HG23 . ILE A 1 128 ? 11.229  9.698  30.574 1.00 0.00 ? 128 ILE A HG23 2  
ATOM   5065  H  HD11 . ILE A 1 128 ? 11.604  13.320 31.686 1.00 0.00 ? 128 ILE A HD11 2  
ATOM   5066  H  HD12 . ILE A 1 128 ? 10.482  13.428 30.332 1.00 0.00 ? 128 ILE A HD12 2  
ATOM   5067  H  HD13 . ILE A 1 128 ? 10.247  14.440 31.754 1.00 0.00 ? 128 ILE A HD13 2  
ATOM   5068  N  N    . PHE A 1 129 ? 11.482  8.362  33.030 1.00 0.00 ? 129 PHE A N    2  
ATOM   5069  C  CA   . PHE A 1 129 ? 11.999  7.009  32.731 1.00 0.00 ? 129 PHE A CA   2  
ATOM   5070  C  C    . PHE A 1 129 ? 11.003  5.958  33.187 1.00 0.00 ? 129 PHE A C    2  
ATOM   5071  O  O    . PHE A 1 129 ? 10.807  4.959  32.524 1.00 0.00 ? 129 PHE A O    2  
ATOM   5072  C  CB   . PHE A 1 129 ? 13.334  6.804  33.467 1.00 0.00 ? 129 PHE A CB   2  
ATOM   5073  C  CG   . PHE A 1 129 ? 14.470  6.836  32.443 1.00 0.00 ? 129 PHE A CG   2  
ATOM   5074  C  CD1  . PHE A 1 129 ? 14.514  7.829  31.481 1.00 0.00 ? 129 PHE A CD1  2  
ATOM   5075  C  CD2  . PHE A 1 129 ? 15.460  5.870  32.458 1.00 0.00 ? 129 PHE A CD2  2  
ATOM   5076  C  CE1  . PHE A 1 129 ? 15.532  7.855  30.550 1.00 0.00 ? 129 PHE A CE1  2  
ATOM   5077  C  CE2  . PHE A 1 129 ? 16.476  5.898  31.525 1.00 0.00 ? 129 PHE A CE2  2  
ATOM   5078  C  CZ   . PHE A 1 129 ? 16.510  6.890  30.573 1.00 0.00 ? 129 PHE A CZ   2  
ATOM   5079  H  H    . PHE A 1 129 ? 12.040  9.018  33.497 1.00 0.00 ? 129 PHE A H    2  
ATOM   5080  H  HA   . PHE A 1 129 ? 12.134  6.917  31.651 1.00 0.00 ? 129 PHE A HA   2  
ATOM   5081  H  HB2  . PHE A 1 129 ? 13.484  7.592  34.188 1.00 0.00 ? 129 PHE A HB2  2  
ATOM   5082  H  HB3  . PHE A 1 129 ? 13.335  5.849  33.972 1.00 0.00 ? 129 PHE A HB3  2  
ATOM   5083  H  HD1  . PHE A 1 129 ? 13.746  8.589  31.458 1.00 0.00 ? 129 PHE A HD1  2  
ATOM   5084  H  HD2  . PHE A 1 129 ? 15.439  5.090  33.205 1.00 0.00 ? 129 PHE A HD2  2  
ATOM   5085  H  HE1  . PHE A 1 129 ? 15.557  8.632  29.802 1.00 0.00 ? 129 PHE A HE1  2  
ATOM   5086  H  HE2  . PHE A 1 129 ? 17.241  5.137  31.537 1.00 0.00 ? 129 PHE A HE2  2  
ATOM   5087  H  HZ   . PHE A 1 129 ? 17.307  6.912  29.845 1.00 0.00 ? 129 PHE A HZ   2  
ATOM   5088  N  N    . LYS A 1 130 ? 10.381  6.197  34.315 1.00 0.00 ? 130 LYS A N    2  
ATOM   5089  C  CA   . LYS A 1 130 ? 9.396   5.209  34.808 1.00 0.00 ? 130 LYS A CA   2  
ATOM   5090  C  C    . LYS A 1 130 ? 8.307   5.027  33.770 1.00 0.00 ? 130 LYS A C    2  
ATOM   5091  O  O    . LYS A 1 130 ? 8.001   3.918  33.377 1.00 0.00 ? 130 LYS A O    2  
ATOM   5092  C  CB   . LYS A 1 130 ? 8.770   5.728  36.112 1.00 0.00 ? 130 LYS A CB   2  
ATOM   5093  C  CG   . LYS A 1 130 ? 9.883   6.098  37.091 1.00 0.00 ? 130 LYS A CG   2  
ATOM   5094  C  CD   . LYS A 1 130 ? 10.215  4.879  37.951 1.00 0.00 ? 130 LYS A CD   2  
ATOM   5095  C  CE   . LYS A 1 130 ? 11.206  5.287  39.041 1.00 0.00 ? 130 LYS A CE   2  
ATOM   5096  N  NZ   . LYS A 1 130 ? 11.834  4.081  39.649 1.00 0.00 ? 130 LYS A NZ   2  
ATOM   5097  H  H    . LYS A 1 130 ? 10.565  7.014  34.824 1.00 0.00 ? 130 LYS A H    2  
ATOM   5098  H  HA   . LYS A 1 130 ? 9.899   4.254  34.967 1.00 0.00 ? 130 LYS A HA   2  
ATOM   5099  H  HB2  . LYS A 1 130 ? 8.162   6.594  35.904 1.00 0.00 ? 130 LYS A HB2  2  
ATOM   5100  H  HB3  . LYS A 1 130 ? 8.149   4.958  36.545 1.00 0.00 ? 130 LYS A HB3  2  
ATOM   5101  H  HG2  . LYS A 1 130 ? 10.761  6.407  36.543 1.00 0.00 ? 130 LYS A HG2  2  
ATOM   5102  H  HG3  . LYS A 1 130 ? 9.557   6.911  37.723 1.00 0.00 ? 130 LYS A HG3  2  
ATOM   5103  H  HD2  . LYS A 1 130 ? 9.312   4.498  38.406 1.00 0.00 ? 130 LYS A HD2  2  
ATOM   5104  H  HD3  . LYS A 1 130 ? 10.651  4.107  37.333 1.00 0.00 ? 130 LYS A HD3  2  
ATOM   5105  H  HE2  . LYS A 1 130 ? 11.977  5.909  38.613 1.00 0.00 ? 130 LYS A HE2  2  
ATOM   5106  H  HE3  . LYS A 1 130 ? 10.690  5.841  39.809 1.00 0.00 ? 130 LYS A HE3  2  
ATOM   5107  H  HZ1  . LYS A 1 130 ? 12.122  3.423  38.897 1.00 0.00 ? 130 LYS A HZ1  2  
ATOM   5108  H  HZ2  . LYS A 1 130 ? 12.670  4.366  40.198 1.00 0.00 ? 130 LYS A HZ2  2  
ATOM   5109  H  HZ3  . LYS A 1 130 ? 11.151  3.612  40.277 1.00 0.00 ? 130 LYS A HZ3  2  
ATOM   5110  N  N    . MET A 1 131 ? 7.734   6.124  33.335 1.00 0.00 ? 131 MET A N    2  
ATOM   5111  C  CA   . MET A 1 131 ? 6.661   6.012  32.313 1.00 0.00 ? 131 MET A CA   2  
ATOM   5112  C  C    . MET A 1 131 ? 7.133   5.083  31.198 1.00 0.00 ? 131 MET A C    2  
ATOM   5113  O  O    . MET A 1 131 ? 6.344   4.447  30.529 1.00 0.00 ? 131 MET A O    2  
ATOM   5114  C  CB   . MET A 1 131 ? 6.392   7.412  31.725 1.00 0.00 ? 131 MET A CB   2  
ATOM   5115  C  CG   . MET A 1 131 ? 5.395   7.300  30.568 1.00 0.00 ? 131 MET A CG   2  
ATOM   5116  S  SD   . MET A 1 131 ? 4.943   8.830  29.708 1.00 0.00 ? 131 MET A SD   2  
ATOM   5117  C  CE   . MET A 1 131 ? 3.448   9.201  30.657 1.00 0.00 ? 131 MET A CE   2  
ATOM   5118  H  H    . MET A 1 131 ? 8.009   7.006  33.684 1.00 0.00 ? 131 MET A H    2  
ATOM   5119  H  HA   . MET A 1 131 ? 5.753   5.593  32.780 1.00 0.00 ? 131 MET A HA   2  
ATOM   5120  H  HB2  . MET A 1 131 ? 5.987   8.055  32.491 1.00 0.00 ? 131 MET A HB2  2  
ATOM   5121  H  HB3  . MET A 1 131 ? 7.313   7.836  31.363 1.00 0.00 ? 131 MET A HB3  2  
ATOM   5122  H  HG2  . MET A 1 131 ? 5.806   6.625  29.833 1.00 0.00 ? 131 MET A HG2  2  
ATOM   5123  H  HG3  . MET A 1 131 ? 4.487   6.855  30.948 1.00 0.00 ? 131 MET A HG3  2  
ATOM   5124  H  HE1  . MET A 1 131 ? 2.850   8.307  30.745 1.00 0.00 ? 131 MET A HE1  2  
ATOM   5125  H  HE2  . MET A 1 131 ? 3.725   9.552  31.642 1.00 0.00 ? 131 MET A HE2  2  
ATOM   5126  H  HE3  . MET A 1 131 ? 2.880   9.966  30.149 1.00 0.00 ? 131 MET A HE3  2  
ATOM   5127  N  N    . ILE A 1 132 ? 8.430   5.040  31.011 1.00 0.00 ? 132 ILE A N    2  
ATOM   5128  C  CA   . ILE A 1 132 ? 8.986   4.163  29.953 1.00 0.00 ? 132 ILE A CA   2  
ATOM   5129  C  C    . ILE A 1 132 ? 9.327   2.800  30.542 1.00 0.00 ? 132 ILE A C    2  
ATOM   5130  O  O    . ILE A 1 132 ? 9.915   2.713  31.600 1.00 0.00 ? 132 ILE A O    2  
ATOM   5131  C  CB   . ILE A 1 132 ? 10.269  4.797  29.406 1.00 0.00 ? 132 ILE A CB   2  
ATOM   5132  C  CG1  . ILE A 1 132 ? 10.052  6.282  29.159 1.00 0.00 ? 132 ILE A CG1  2  
ATOM   5133  C  CG2  . ILE A 1 132 ? 10.616  4.127  28.067 1.00 0.00 ? 132 ILE A CG2  2  
ATOM   5134  C  CD1  . ILE A 1 132 ? 11.400  6.943  28.848 1.00 0.00 ? 132 ILE A CD1  2  
ATOM   5135  H  H    . ILE A 1 132 ? 9.028   5.592  31.561 1.00 0.00 ? 132 ILE A H    2  
ATOM   5136  H  HA   . ILE A 1 132 ? 8.244   4.039  29.167 1.00 0.00 ? 132 ILE A HA   2  
ATOM   5137  H  HB   . ILE A 1 132 ? 11.077  4.665  30.130 1.00 0.00 ? 132 ILE A HB   2  
ATOM   5138  H  HG12 . ILE A 1 132 ? 9.382   6.417  28.323 1.00 0.00 ? 132 ILE A HG12 2  
ATOM   5139  H  HG13 . ILE A 1 132 ? 9.620   6.737  30.036 1.00 0.00 ? 132 ILE A HG13 2  
ATOM   5140  H  HG21 . ILE A 1 132 ? 10.694  3.058  28.202 1.00 0.00 ? 132 ILE A HG21 2  
ATOM   5141  H  HG22 . ILE A 1 132 ? 9.844   4.338  27.342 1.00 0.00 ? 132 ILE A HG22 2  
ATOM   5142  H  HG23 . ILE A 1 132 ? 11.558  4.507  27.702 1.00 0.00 ? 132 ILE A HG23 2  
ATOM   5143  H  HD11 . ILE A 1 132 ? 12.198  6.230  28.991 1.00 0.00 ? 132 ILE A HD11 2  
ATOM   5144  H  HD12 . ILE A 1 132 ? 11.409  7.286  27.825 1.00 0.00 ? 132 ILE A HD12 2  
ATOM   5145  H  HD13 . ILE A 1 132 ? 11.553  7.785  29.507 1.00 0.00 ? 132 ILE A HD13 2  
ATOM   5146  N  N    . SER A 1 133 ? 8.954   1.759  29.852 1.00 0.00 ? 133 SER A N    2  
ATOM   5147  C  CA   . SER A 1 133 ? 9.254   0.402  30.373 1.00 0.00 ? 133 SER A CA   2  
ATOM   5148  C  C    . SER A 1 133 ? 10.770  0.119  30.343 1.00 0.00 ? 133 SER A C    2  
ATOM   5149  O  O    . SER A 1 133 ? 11.439  0.438  29.381 1.00 0.00 ? 133 SER A O    2  
ATOM   5150  C  CB   . SER A 1 133 ? 8.550   -0.621 29.471 1.00 0.00 ? 133 SER A CB   2  
ATOM   5151  O  OG   . SER A 1 133 ? 7.321   0.005  29.133 1.00 0.00 ? 133 SER A OG   2  
ATOM   5152  H  H    . SER A 1 133 ? 8.484   1.871  29.000 1.00 0.00 ? 133 SER A H    2  
ATOM   5153  H  HA   . SER A 1 133 ? 8.884   0.337  31.387 1.00 0.00 ? 133 SER A HA   2  
ATOM   5154  H  HB2  . SER A 1 133 ? 9.130   -0.811 28.581 1.00 0.00 ? 133 SER A HB2  2  
ATOM   5155  H  HB3  . SER A 1 133 ? 8.365   -1.541 30.006 1.00 0.00 ? 133 SER A HB3  2  
ATOM   5156  H  HG   . SER A 1 133 ? 6.809   -0.613 28.609 1.00 0.00 ? 133 SER A HG   2  
ATOM   5157  N  N    . PRO A 1 134 ? 11.287  -0.489 31.410 1.00 0.00 ? 134 PRO A N    2  
ATOM   5158  C  CA   . PRO A 1 134 ? 12.710  -0.808 31.491 1.00 0.00 ? 134 PRO A CA   2  
ATOM   5159  C  C    . PRO A 1 134 ? 13.146  -1.684 30.330 1.00 0.00 ? 134 PRO A C    2  
ATOM   5160  O  O    . PRO A 1 134 ? 14.032  -1.327 29.580 1.00 0.00 ? 134 PRO A O    2  
ATOM   5161  C  CB   . PRO A 1 134 ? 12.869  -1.598 32.805 1.00 0.00 ? 134 PRO A CB   2  
ATOM   5162  C  CG   . PRO A 1 134 ? 11.464  -1.671 33.475 1.00 0.00 ? 134 PRO A CG   2  
ATOM   5163  C  CD   . PRO A 1 134 ? 10.493  -0.889 32.577 1.00 0.00 ? 134 PRO A CD   2  
ATOM   5164  H  HA   . PRO A 1 134 ? 13.294  0.105  31.509 1.00 0.00 ? 134 PRO A HA   2  
ATOM   5165  H  HB2  . PRO A 1 134 ? 13.229  -2.597 32.594 1.00 0.00 ? 134 PRO A HB2  2  
ATOM   5166  H  HB3  . PRO A 1 134 ? 13.564  -1.096 33.457 1.00 0.00 ? 134 PRO A HB3  2  
ATOM   5167  H  HG2  . PRO A 1 134 ? 11.145  -2.701 33.556 1.00 0.00 ? 134 PRO A HG2  2  
ATOM   5168  H  HG3  . PRO A 1 134 ? 11.500  -1.225 34.458 1.00 0.00 ? 134 PRO A HG3  2  
ATOM   5169  H  HD2  . PRO A 1 134 ? 9.670   -1.514 32.271 1.00 0.00 ? 134 PRO A HD2  2  
ATOM   5170  H  HD3  . PRO A 1 134 ? 10.130  -0.014 33.096 1.00 0.00 ? 134 PRO A HD3  2  
ATOM   5171  N  N    . GLU A 1 135 ? 12.515  -2.822 30.208 1.00 0.00 ? 135 GLU A N    2  
ATOM   5172  C  CA   . GLU A 1 135 ? 12.875  -3.738 29.106 1.00 0.00 ? 135 GLU A CA   2  
ATOM   5173  C  C    . GLU A 1 135 ? 13.074  -2.961 27.815 1.00 0.00 ? 135 GLU A C    2  
ATOM   5174  O  O    . GLU A 1 135 ? 13.893  -3.317 26.991 1.00 0.00 ? 135 GLU A O    2  
ATOM   5175  C  CB   . GLU A 1 135 ? 11.729  -4.744 28.915 1.00 0.00 ? 135 GLU A CB   2  
ATOM   5176  C  CG   . GLU A 1 135 ? 11.747  -5.748 30.071 1.00 0.00 ? 135 GLU A CG   2  
ATOM   5177  C  CD   . GLU A 1 135 ? 10.560  -6.705 29.930 1.00 0.00 ? 135 GLU A CD   2  
ATOM   5178  O  OE1  . GLU A 1 135 ? 10.684  -7.604 29.115 1.00 0.00 ? 135 GLU A OE1  2  
ATOM   5179  O  OE2  . GLU A 1 135 ? 9.598   -6.484 30.647 1.00 0.00 ? 135 GLU A OE2  2  
ATOM   5180  H  H    . GLU A 1 135 ? 11.809  -3.066 30.842 1.00 0.00 ? 135 GLU A H    2  
ATOM   5181  H  HA   . GLU A 1 135 ? 13.802  -4.247 29.363 1.00 0.00 ? 135 GLU A HA   2  
ATOM   5182  H  HB2  . GLU A 1 135 ? 10.784  -4.223 28.902 1.00 0.00 ? 135 GLU A HB2  2  
ATOM   5183  H  HB3  . GLU A 1 135 ? 11.859  -5.267 27.979 1.00 0.00 ? 135 GLU A HB3  2  
ATOM   5184  H  HG2  . GLU A 1 135 ? 12.667  -6.313 30.051 1.00 0.00 ? 135 GLU A HG2  2  
ATOM   5185  H  HG3  . GLU A 1 135 ? 11.671  -5.222 31.012 1.00 0.00 ? 135 GLU A HG3  2  
ATOM   5186  N  N    . ASP A 1 136 ? 12.317  -1.908 27.662 1.00 0.00 ? 136 ASP A N    2  
ATOM   5187  C  CA   . ASP A 1 136 ? 12.445  -1.092 26.436 1.00 0.00 ? 136 ASP A CA   2  
ATOM   5188  C  C    . ASP A 1 136 ? 13.562  -0.070 26.601 1.00 0.00 ? 136 ASP A C    2  
ATOM   5189  O  O    . ASP A 1 136 ? 14.344  0.151  25.699 1.00 0.00 ? 136 ASP A O    2  
ATOM   5190  C  CB   . ASP A 1 136 ? 11.122  -0.343 26.205 1.00 0.00 ? 136 ASP A CB   2  
ATOM   5191  C  CG   . ASP A 1 136 ? 10.025  -1.348 25.847 1.00 0.00 ? 136 ASP A CG   2  
ATOM   5192  O  OD1  . ASP A 1 136 ? 9.940   -2.335 26.560 1.00 0.00 ? 136 ASP A OD1  2  
ATOM   5193  O  OD2  . ASP A 1 136 ? 9.331   -1.072 24.881 1.00 0.00 ? 136 ASP A OD2  2  
ATOM   5194  H  H    . ASP A 1 136 ? 11.671  -1.662 28.353 1.00 0.00 ? 136 ASP A H    2  
ATOM   5195  H  HA   . ASP A 1 136 ? 12.677  -1.743 25.596 1.00 0.00 ? 136 ASP A HA   2  
ATOM   5196  H  HB2  . ASP A 1 136 ? 10.841  0.188  27.101 1.00 0.00 ? 136 ASP A HB2  2  
ATOM   5197  H  HB3  . ASP A 1 136 ? 11.238  0.360  25.395 1.00 0.00 ? 136 ASP A HB3  2  
ATOM   5198  N  N    . THR A 1 137 ? 13.612  0.536  27.759 1.00 0.00 ? 137 THR A N    2  
ATOM   5199  C  CA   . THR A 1 137 ? 14.666  1.545  28.008 1.00 0.00 ? 137 THR A CA   2  
ATOM   5200  C  C    . THR A 1 137 ? 16.048  0.931  27.826 1.00 0.00 ? 137 THR A C    2  
ATOM   5201  O  O    . THR A 1 137 ? 17.050  1.618  27.855 1.00 0.00 ? 137 THR A O    2  
ATOM   5202  C  CB   . THR A 1 137 ? 14.536  2.043  29.439 1.00 0.00 ? 137 THR A CB   2  
ATOM   5203  O  OG1  . THR A 1 137 ? 13.147  2.137  29.680 1.00 0.00 ? 137 THR A OG1  2  
ATOM   5204  C  CG2  . THR A 1 137 ? 15.049  3.481  29.564 1.00 0.00 ? 137 THR A CG2  2  
ATOM   5205  H  H    . THR A 1 137 ? 12.956  0.324  28.457 1.00 0.00 ? 137 THR A H    2  
ATOM   5206  H  HA   . THR A 1 137 ? 14.545  2.362  27.300 1.00 0.00 ? 137 THR A HA   2  
ATOM   5207  H  HB   . THR A 1 137 ? 15.004  1.370  30.136 1.00 0.00 ? 137 THR A HB   2  
ATOM   5208  H  HG1  . THR A 1 137 ? 12.996  1.961  30.612 1.00 0.00 ? 137 THR A HG1  2  
ATOM   5209  H  HG21 . THR A 1 137 ? 14.624  4.089  28.779 1.00 0.00 ? 137 THR A HG21 2  
ATOM   5210  H  HG22 . THR A 1 137 ? 14.764  3.887  30.523 1.00 0.00 ? 137 THR A HG22 2  
ATOM   5211  H  HG23 . THR A 1 137 ? 16.126  3.491  29.478 1.00 0.00 ? 137 THR A HG23 2  
ATOM   5212  N  N    . LYS A 1 138 ? 16.078  -0.362 27.678 1.00 0.00 ? 138 LYS A N    2  
ATOM   5213  C  CA   . LYS A 1 138 ? 17.380  -1.041 27.493 1.00 0.00 ? 138 LYS A CA   2  
ATOM   5214  C  C    . LYS A 1 138 ? 17.889  -0.806 26.078 1.00 0.00 ? 138 LYS A C    2  
ATOM   5215  O  O    . LYS A 1 138 ? 19.009  -1.143 25.749 1.00 0.00 ? 138 LYS A O    2  
ATOM   5216  C  CB   . LYS A 1 138 ? 17.177  -2.554 27.706 1.00 0.00 ? 138 LYS A CB   2  
ATOM   5217  C  CG   . LYS A 1 138 ? 17.263  -2.870 29.202 1.00 0.00 ? 138 LYS A CG   2  
ATOM   5218  C  CD   . LYS A 1 138 ? 18.736  -2.929 29.623 1.00 0.00 ? 138 LYS A CD   2  
ATOM   5219  C  CE   . LYS A 1 138 ? 19.094  -4.369 30.004 1.00 0.00 ? 138 LYS A CE   2  
ATOM   5220  N  NZ   . LYS A 1 138 ? 18.724  -5.305 28.904 1.00 0.00 ? 138 LYS A NZ   2  
ATOM   5221  H  H    . LYS A 1 138 ? 15.248  -0.879 27.694 1.00 0.00 ? 138 LYS A H    2  
ATOM   5222  H  HA   . LYS A 1 138 ? 18.099  -0.638 28.204 1.00 0.00 ? 138 LYS A HA   2  
ATOM   5223  H  HB2  . LYS A 1 138 ? 16.208  -2.847 27.329 1.00 0.00 ? 138 LYS A HB2  2  
ATOM   5224  H  HB3  . LYS A 1 138 ? 17.941  -3.101 27.175 1.00 0.00 ? 138 LYS A HB3  2  
ATOM   5225  H  HG2  . LYS A 1 138 ? 16.756  -2.100 29.764 1.00 0.00 ? 138 LYS A HG2  2  
ATOM   5226  H  HG3  . LYS A 1 138 ? 16.790  -3.822 29.398 1.00 0.00 ? 138 LYS A HG3  2  
ATOM   5227  H  HD2  . LYS A 1 138 ? 19.361  -2.605 28.805 1.00 0.00 ? 138 LYS A HD2  2  
ATOM   5228  H  HD3  . LYS A 1 138 ? 18.898  -2.280 30.471 1.00 0.00 ? 138 LYS A HD3  2  
ATOM   5229  H  HE2  . LYS A 1 138 ? 20.155  -4.442 30.188 1.00 0.00 ? 138 LYS A HE2  2  
ATOM   5230  H  HE3  . LYS A 1 138 ? 18.561  -4.649 30.900 1.00 0.00 ? 138 LYS A HE3  2  
ATOM   5231  H  HZ1  . LYS A 1 138 ? 18.272  -4.773 28.133 1.00 0.00 ? 138 LYS A HZ1  2  
ATOM   5232  H  HZ2  . LYS A 1 138 ? 19.579  -5.775 28.546 1.00 0.00 ? 138 LYS A HZ2  2  
ATOM   5233  H  HZ3  . LYS A 1 138 ? 18.061  -6.020 29.266 1.00 0.00 ? 138 LYS A HZ3  2  
ATOM   5234  N  N    . HIS A 1 139 ? 17.044  -0.226 25.262 1.00 0.00 ? 139 HIS A N    2  
ATOM   5235  C  CA   . HIS A 1 139 ? 17.444  0.046  23.861 1.00 0.00 ? 139 HIS A CA   2  
ATOM   5236  C  C    . HIS A 1 139 ? 18.161  1.386  23.748 1.00 0.00 ? 139 HIS A C    2  
ATOM   5237  O  O    . HIS A 1 139 ? 18.760  1.687  22.735 1.00 0.00 ? 139 HIS A O    2  
ATOM   5238  C  CB   . HIS A 1 139 ? 16.174  0.095  22.999 1.00 0.00 ? 139 HIS A CB   2  
ATOM   5239  C  CG   . HIS A 1 139 ? 15.296  -1.116 23.322 1.00 0.00 ? 139 HIS A CG   2  
ATOM   5240  N  ND1  . HIS A 1 139 ? 15.725  -2.234 23.667 1.00 0.00 ? 139 HIS A ND1  2  
ATOM   5241  C  CD2  . HIS A 1 139 ? 13.919  -1.239 23.303 1.00 0.00 ? 139 HIS A CD2  2  
ATOM   5242  C  CE1  . HIS A 1 139 ? 14.779  -3.055 23.867 1.00 0.00 ? 139 HIS A CE1  2  
ATOM   5243  N  NE2  . HIS A 1 139 ? 13.581  -2.509 23.659 1.00 0.00 ? 139 HIS A NE2  2  
ATOM   5244  H  H    . HIS A 1 139 ? 16.152  0.026  25.577 1.00 0.00 ? 139 HIS A H    2  
ATOM   5245  H  HA   . HIS A 1 139 ? 18.113  -0.745 23.522 1.00 0.00 ? 139 HIS A HA   2  
ATOM   5246  H  HB2  . HIS A 1 139 ? 15.623  1.000  23.207 1.00 0.00 ? 139 HIS A HB2  2  
ATOM   5247  H  HB3  . HIS A 1 139 ? 16.441  0.074  21.953 1.00 0.00 ? 139 HIS A HB3  2  
ATOM   5248  H  HD1  . HIS A 1 139 ? 16.675  -2.451 23.771 1.00 0.00 ? 139 HIS A HD1  2  
ATOM   5249  H  HD2  . HIS A 1 139 ? 13.224  -0.454 23.046 1.00 0.00 ? 139 HIS A HD2  2  
ATOM   5250  H  HE1  . HIS A 1 139 ? 14.929  -4.080 24.170 1.00 0.00 ? 139 HIS A HE1  2  
ATOM   5251  N  N    . LEU A 1 140 ? 18.089  2.171  24.791 1.00 0.00 ? 140 LEU A N    2  
ATOM   5252  C  CA   . LEU A 1 140 ? 18.760  3.485  24.751 1.00 0.00 ? 140 LEU A CA   2  
ATOM   5253  C  C    . LEU A 1 140 ? 20.217  3.311  24.304 1.00 0.00 ? 140 LEU A C    2  
ATOM   5254  O  O    . LEU A 1 140 ? 20.814  2.276  24.526 1.00 0.00 ? 140 LEU A O    2  
ATOM   5255  C  CB   . LEU A 1 140 ? 18.767  4.059  26.180 1.00 0.00 ? 140 LEU A CB   2  
ATOM   5256  C  CG   . LEU A 1 140 ? 17.337  4.446  26.668 1.00 0.00 ? 140 LEU A CG   2  
ATOM   5257  C  CD1  . LEU A 1 140 ? 17.167  5.963  26.555 1.00 0.00 ? 140 LEU A CD1  2  
ATOM   5258  C  CD2  . LEU A 1 140 ? 16.225  3.762  25.851 1.00 0.00 ? 140 LEU A CD2  2  
ATOM   5259  H  H    . LEU A 1 140 ? 17.608  1.888  25.599 1.00 0.00 ? 140 LEU A H    2  
ATOM   5260  H  HA   . LEU A 1 140 ? 18.245  4.136  24.062 1.00 0.00 ? 140 LEU A HA   2  
ATOM   5261  H  HB2  . LEU A 1 140 ? 19.179  3.320  26.851 1.00 0.00 ? 140 LEU A HB2  2  
ATOM   5262  H  HB3  . LEU A 1 140 ? 19.397  4.934  26.206 1.00 0.00 ? 140 LEU A HB3  2  
ATOM   5263  H  HG   . LEU A 1 140 ? 17.235  4.153  27.697 1.00 0.00 ? 140 LEU A HG   2  
ATOM   5264  H  HD11 . LEU A 1 140 ? 17.986  6.460  27.054 1.00 0.00 ? 140 LEU A HD11 2  
ATOM   5265  H  HD12 . LEU A 1 140 ? 17.157  6.253  25.514 1.00 0.00 ? 140 LEU A HD12 2  
ATOM   5266  H  HD13 . LEU A 1 140 ? 16.237  6.261  27.015 1.00 0.00 ? 140 LEU A HD13 2  
ATOM   5267  H  HD21 . LEU A 1 140 ? 16.314  4.011  24.818 1.00 0.00 ? 140 LEU A HD21 2  
ATOM   5268  H  HD22 . LEU A 1 140 ? 16.279  2.699  25.969 1.00 0.00 ? 140 LEU A HD22 2  
ATOM   5269  H  HD23 . LEU A 1 140 ? 15.265  4.102  26.210 1.00 0.00 ? 140 LEU A HD23 2  
ATOM   5270  N  N    . PRO A 1 141 ? 20.766  4.334  23.676 1.00 0.00 ? 141 PRO A N    2  
ATOM   5271  C  CA   . PRO A 1 141 ? 22.146  4.282  23.207 1.00 0.00 ? 141 PRO A CA   2  
ATOM   5272  C  C    . PRO A 1 141 ? 23.100  3.967  24.356 1.00 0.00 ? 141 PRO A C    2  
ATOM   5273  O  O    . PRO A 1 141 ? 22.975  4.510  25.435 1.00 0.00 ? 141 PRO A O    2  
ATOM   5274  C  CB   . PRO A 1 141 ? 22.434  5.694  22.653 1.00 0.00 ? 141 PRO A CB   2  
ATOM   5275  C  CG   . PRO A 1 141 ? 21.123  6.526  22.804 1.00 0.00 ? 141 PRO A CG   2  
ATOM   5276  C  CD   . PRO A 1 141 ? 20.058  5.594  23.406 1.00 0.00 ? 141 PRO A CD   2  
ATOM   5277  H  HA   . PRO A 1 141 ? 22.241  3.528  22.430 1.00 0.00 ? 141 PRO A HA   2  
ATOM   5278  H  HB2  . PRO A 1 141 ? 23.232  6.156  23.214 1.00 0.00 ? 141 PRO A HB2  2  
ATOM   5279  H  HB3  . PRO A 1 141 ? 22.713  5.632  21.611 1.00 0.00 ? 141 PRO A HB3  2  
ATOM   5280  H  HG2  . PRO A 1 141 ? 21.292  7.366  23.462 1.00 0.00 ? 141 PRO A HG2  2  
ATOM   5281  H  HG3  . PRO A 1 141 ? 20.798  6.883  21.838 1.00 0.00 ? 141 PRO A HG3  2  
ATOM   5282  H  HD2  . PRO A 1 141 ? 19.665  6.005  24.322 1.00 0.00 ? 141 PRO A HD2  2  
ATOM   5283  H  HD3  . PRO A 1 141 ? 19.263  5.428  22.695 1.00 0.00 ? 141 PRO A HD3  2  
ATOM   5284  N  N    . GLU A 1 142 ? 24.035  3.096  24.102 1.00 0.00 ? 142 GLU A N    2  
ATOM   5285  C  CA   . GLU A 1 142 ? 25.004  2.734  25.164 1.00 0.00 ? 142 GLU A CA   2  
ATOM   5286  C  C    . GLU A 1 142 ? 25.706  3.968  25.716 1.00 0.00 ? 142 GLU A C    2  
ATOM   5287  O  O    . GLU A 1 142 ? 26.541  3.866  26.594 1.00 0.00 ? 142 GLU A O    2  
ATOM   5288  C  CB   . GLU A 1 142 ? 26.056  1.794  24.555 1.00 0.00 ? 142 GLU A CB   2  
ATOM   5289  C  CG   . GLU A 1 142 ? 26.143  0.526  25.405 1.00 0.00 ? 142 GLU A CG   2  
ATOM   5290  C  CD   . GLU A 1 142 ? 26.637  0.891  26.806 1.00 0.00 ? 142 GLU A CD   2  
ATOM   5291  O  OE1  . GLU A 1 142 ? 25.782  1.207  27.617 1.00 0.00 ? 142 GLU A OE1  2  
ATOM   5292  O  OE2  . GLU A 1 142 ? 27.842  0.834  26.986 1.00 0.00 ? 142 GLU A OE2  2  
ATOM   5293  H  H    . GLU A 1 142 ? 24.100  2.686  23.213 1.00 0.00 ? 142 GLU A H    2  
ATOM   5294  H  HA   . GLU A 1 142 ? 24.469  2.239  25.974 1.00 0.00 ? 142 GLU A HA   2  
ATOM   5295  H  HB2  . GLU A 1 142 ? 25.770  1.535  23.546 1.00 0.00 ? 142 GLU A HB2  2  
ATOM   5296  H  HB3  . GLU A 1 142 ? 27.017  2.286  24.535 1.00 0.00 ? 142 GLU A HB3  2  
ATOM   5297  H  HG2  . GLU A 1 142 ? 25.168  0.067  25.479 1.00 0.00 ? 142 GLU A HG2  2  
ATOM   5298  H  HG3  . GLU A 1 142 ? 26.833  -0.171 24.954 1.00 0.00 ? 142 GLU A HG3  2  
ATOM   5299  N  N    . ASP A 1 143 ? 25.353  5.115  25.193 1.00 0.00 ? 143 ASP A N    2  
ATOM   5300  C  CA   . ASP A 1 143 ? 25.990  6.367  25.672 1.00 0.00 ? 143 ASP A CA   2  
ATOM   5301  C  C    . ASP A 1 143 ? 25.089  7.103  26.656 1.00 0.00 ? 143 ASP A C    2  
ATOM   5302  O  O    . ASP A 1 143 ? 25.452  8.142  27.169 1.00 0.00 ? 143 ASP A O    2  
ATOM   5303  C  CB   . ASP A 1 143 ? 26.234  7.277  24.459 1.00 0.00 ? 143 ASP A CB   2  
ATOM   5304  C  CG   . ASP A 1 143 ? 27.535  6.860  23.771 1.00 0.00 ? 143 ASP A CG   2  
ATOM   5305  O  OD1  . ASP A 1 143 ? 28.465  6.566  24.504 1.00 0.00 ? 143 ASP A OD1  2  
ATOM   5306  O  OD2  . ASP A 1 143 ? 27.527  6.859  22.551 1.00 0.00 ? 143 ASP A OD2  2  
ATOM   5307  H  H    . ASP A 1 143 ? 24.677  5.146  24.491 1.00 0.00 ? 143 ASP A H    2  
ATOM   5308  H  HA   . ASP A 1 143 ? 26.925  6.125  26.164 1.00 0.00 ? 143 ASP A HA   2  
ATOM   5309  H  HB2  . ASP A 1 143 ? 25.416  7.185  23.761 1.00 0.00 ? 143 ASP A HB2  2  
ATOM   5310  H  HB3  . ASP A 1 143 ? 26.315  8.304  24.783 1.00 0.00 ? 143 ASP A HB3  2  
ATOM   5311  N  N    . GLU A 1 144 ? 23.932  6.550  26.911 1.00 0.00 ? 144 GLU A N    2  
ATOM   5312  C  CA   . GLU A 1 144 ? 23.002  7.211  27.861 1.00 0.00 ? 144 GLU A CA   2  
ATOM   5313  C  C    . GLU A 1 144 ? 21.731  6.395  28.025 1.00 0.00 ? 144 GLU A C    2  
ATOM   5314  O  O    . GLU A 1 144 ? 20.705  6.727  27.463 1.00 0.00 ? 144 GLU A O    2  
ATOM   5315  C  CB   . GLU A 1 144 ? 22.630  8.603  27.311 1.00 0.00 ? 144 GLU A CB   2  
ATOM   5316  C  CG   . GLU A 1 144 ? 22.359  8.509  25.805 1.00 0.00 ? 144 GLU A CG   2  
ATOM   5317  C  CD   . GLU A 1 144 ? 22.414  9.912  25.196 1.00 0.00 ? 144 GLU A CD   2  
ATOM   5318  O  OE1  . GLU A 1 144 ? 23.524  10.403 25.069 1.00 0.00 ? 144 GLU A OE1  2  
ATOM   5319  O  OE2  . GLU A 1 144 ? 21.344  10.413 24.892 1.00 0.00 ? 144 GLU A OE2  2  
ATOM   5320  H  H    . GLU A 1 144 ? 23.684  5.702  26.488 1.00 0.00 ? 144 GLU A H    2  
ATOM   5321  H  HA   . GLU A 1 144 ? 23.490  7.296  28.825 1.00 0.00 ? 144 GLU A HA   2  
ATOM   5322  H  HB2  . GLU A 1 144 ? 21.744  8.963  27.815 1.00 0.00 ? 144 GLU A HB2  2  
ATOM   5323  H  HB3  . GLU A 1 144 ? 23.439  9.294  27.491 1.00 0.00 ? 144 GLU A HB3  2  
ATOM   5324  H  HG2  . GLU A 1 144 ? 23.104  7.888  25.332 1.00 0.00 ? 144 GLU A HG2  2  
ATOM   5325  H  HG3  . GLU A 1 144 ? 21.380  8.085  25.634 1.00 0.00 ? 144 GLU A HG3  2  
ATOM   5326  N  N    . ASN A 1 145 ? 21.825  5.342  28.799 1.00 0.00 ? 145 ASN A N    2  
ATOM   5327  C  CA   . ASN A 1 145 ? 20.635  4.475  29.026 1.00 0.00 ? 145 ASN A CA   2  
ATOM   5328  C  C    . ASN A 1 145 ? 20.125  4.587  30.461 1.00 0.00 ? 145 ASN A C    2  
ATOM   5329  O  O    . ASN A 1 145 ? 19.430  3.708  30.934 1.00 0.00 ? 145 ASN A O    2  
ATOM   5330  C  CB   . ASN A 1 145 ? 21.050  3.017  28.764 1.00 0.00 ? 145 ASN A CB   2  
ATOM   5331  C  CG   . ASN A 1 145 ? 22.128  2.608  29.769 1.00 0.00 ? 145 ASN A CG   2  
ATOM   5332  O  OD1  . ASN A 1 145 ? 22.439  1.444  29.925 1.00 0.00 ? 145 ASN A OD1  2  
ATOM   5333  N  ND2  . ASN A 1 145 ? 22.723  3.534  30.469 1.00 0.00 ? 145 ASN A ND2  2  
ATOM   5334  H  H    . ASN A 1 145 ? 22.682  5.121  29.221 1.00 0.00 ? 145 ASN A H    2  
ATOM   5335  H  HA   . ASN A 1 145 ? 19.839  4.772  28.347 1.00 0.00 ? 145 ASN A HA   2  
ATOM   5336  H  HB2  . ASN A 1 145 ? 20.193  2.368  28.875 1.00 0.00 ? 145 ASN A HB2  2  
ATOM   5337  H  HB3  . ASN A 1 145 ? 21.441  2.922  27.763 1.00 0.00 ? 145 ASN A HB3  2  
ATOM   5338  H  HD21 . ASN A 1 145 ? 22.476  4.474  30.348 1.00 0.00 ? 145 ASN A HD21 2  
ATOM   5339  H  HD22 . ASN A 1 145 ? 23.416  3.289  31.116 1.00 0.00 ? 145 ASN A HD22 2  
ATOM   5340  N  N    . THR A 1 146 ? 20.478  5.660  31.135 1.00 0.00 ? 146 THR A N    2  
ATOM   5341  C  CA   . THR A 1 146 ? 20.008  5.823  32.539 1.00 0.00 ? 146 THR A CA   2  
ATOM   5342  C  C    . THR A 1 146 ? 19.689  7.287  32.840 1.00 0.00 ? 146 THR A C    2  
ATOM   5343  O  O    . THR A 1 146 ? 20.161  8.184  32.169 1.00 0.00 ? 146 THR A O    2  
ATOM   5344  C  CB   . THR A 1 146 ? 21.118  5.350  33.483 1.00 0.00 ? 146 THR A CB   2  
ATOM   5345  O  OG1  . THR A 1 146 ? 22.270  5.241  32.677 1.00 0.00 ? 146 THR A OG1  2  
ATOM   5346  C  CG2  . THR A 1 146 ? 20.849  3.918  33.967 1.00 0.00 ? 146 THR A CG2  2  
ATOM   5347  H  H    . THR A 1 146 ? 21.055  6.346  30.722 1.00 0.00 ? 146 THR A H    2  
ATOM   5348  H  HA   . THR A 1 146 ? 19.108  5.230  32.674 1.00 0.00 ? 146 THR A HA   2  
ATOM   5349  H  HB   . THR A 1 146 ? 21.280  6.049  34.300 1.00 0.00 ? 146 THR A HB   2  
ATOM   5350  H  HG1  . THR A 1 146 ? 22.434  6.100  32.278 1.00 0.00 ? 146 THR A HG1  2  
ATOM   5351  H  HG21 . THR A 1 146 ? 19.813  3.820  34.259 1.00 0.00 ? 146 THR A HG21 2  
ATOM   5352  H  HG22 . THR A 1 146 ? 21.062  3.219  33.172 1.00 0.00 ? 146 THR A HG22 2  
ATOM   5353  H  HG23 . THR A 1 146 ? 21.480  3.694  34.815 1.00 0.00 ? 146 THR A HG23 2  
ATOM   5354  N  N    . PRO A 1 147 ? 18.883  7.493  33.860 1.00 0.00 ? 147 PRO A N    2  
ATOM   5355  C  CA   . PRO A 1 147 ? 18.487  8.838  34.272 1.00 0.00 ? 147 PRO A CA   2  
ATOM   5356  C  C    . PRO A 1 147 ? 19.699  9.696  34.608 1.00 0.00 ? 147 PRO A C    2  
ATOM   5357  O  O    . PRO A 1 147 ? 19.768  10.853 34.243 1.00 0.00 ? 147 PRO A O    2  
ATOM   5358  C  CB   . PRO A 1 147 ? 17.639  8.626  35.545 1.00 0.00 ? 147 PRO A CB   2  
ATOM   5359  C  CG   . PRO A 1 147 ? 17.603  7.093  35.830 1.00 0.00 ? 147 PRO A CG   2  
ATOM   5360  C  CD   . PRO A 1 147 ? 18.334  6.400  34.672 1.00 0.00 ? 147 PRO A CD   2  
ATOM   5361  H  HA   . PRO A 1 147 ? 17.905  9.307  33.486 1.00 0.00 ? 147 PRO A HA   2  
ATOM   5362  H  HB2  . PRO A 1 147 ? 18.090  9.146  36.379 1.00 0.00 ? 147 PRO A HB2  2  
ATOM   5363  H  HB3  . PRO A 1 147 ? 16.638  8.996  35.388 1.00 0.00 ? 147 PRO A HB3  2  
ATOM   5364  H  HG2  . PRO A 1 147 ? 18.102  6.878  36.764 1.00 0.00 ? 147 PRO A HG2  2  
ATOM   5365  H  HG3  . PRO A 1 147 ? 16.579  6.749  35.880 1.00 0.00 ? 147 PRO A HG3  2  
ATOM   5366  H  HD2  . PRO A 1 147 ? 19.131  5.772  35.042 1.00 0.00 ? 147 PRO A HD2  2  
ATOM   5367  H  HD3  . PRO A 1 147 ? 17.637  5.816  34.089 1.00 0.00 ? 147 PRO A HD3  2  
ATOM   5368  N  N    . GLU A 1 148 ? 20.631  9.112  35.301 1.00 0.00 ? 148 GLU A N    2  
ATOM   5369  C  CA   . GLU A 1 148 ? 21.844  9.870  35.674 1.00 0.00 ? 148 GLU A CA   2  
ATOM   5370  C  C    . GLU A 1 148 ? 22.731  10.122 34.459 1.00 0.00 ? 148 GLU A C    2  
ATOM   5371  O  O    . GLU A 1 148 ? 23.593  10.978 34.487 1.00 0.00 ? 148 GLU A O    2  
ATOM   5372  C  CB   . GLU A 1 148 ? 22.629  9.035  36.695 1.00 0.00 ? 148 GLU A CB   2  
ATOM   5373  C  CG   . GLU A 1 148 ? 23.706  9.904  37.342 1.00 0.00 ? 148 GLU A CG   2  
ATOM   5374  C  CD   . GLU A 1 148 ? 24.451  9.080  38.393 1.00 0.00 ? 148 GLU A CD   2  
ATOM   5375  O  OE1  . GLU A 1 148 ? 24.803  7.962  38.053 1.00 0.00 ? 148 GLU A OE1  2  
ATOM   5376  O  OE2  . GLU A 1 148 ? 24.625  9.613  39.476 1.00 0.00 ? 148 GLU A OE2  2  
ATOM   5377  H  H    . GLU A 1 148 ? 20.531  8.176  35.572 1.00 0.00 ? 148 GLU A H    2  
ATOM   5378  H  HA   . GLU A 1 148 ? 21.547  10.826 36.102 1.00 0.00 ? 148 GLU A HA   2  
ATOM   5379  H  HB2  . GLU A 1 148 ? 21.956  8.667  37.456 1.00 0.00 ? 148 GLU A HB2  2  
ATOM   5380  H  HB3  . GLU A 1 148 ? 23.093  8.195  36.198 1.00 0.00 ? 148 GLU A HB3  2  
ATOM   5381  H  HG2  . GLU A 1 148 ? 24.404  10.242 36.590 1.00 0.00 ? 148 GLU A HG2  2  
ATOM   5382  H  HG3  . GLU A 1 148 ? 23.249  10.761 37.817 1.00 0.00 ? 148 GLU A HG3  2  
ATOM   5383  N  N    . LYS A 1 149 ? 22.510  9.371  33.411 1.00 0.00 ? 149 LYS A N    2  
ATOM   5384  C  CA   . LYS A 1 149 ? 23.339  9.565  32.195 1.00 0.00 ? 149 LYS A CA   2  
ATOM   5385  C  C    . LYS A 1 149 ? 22.715  10.582 31.241 1.00 0.00 ? 149 LYS A C    2  
ATOM   5386  O  O    . LYS A 1 149 ? 23.417  11.316 30.573 1.00 0.00 ? 149 LYS A O    2  
ATOM   5387  C  CB   . LYS A 1 149 ? 23.468  8.222  31.470 1.00 0.00 ? 149 LYS A CB   2  
ATOM   5388  C  CG   . LYS A 1 149 ? 24.068  7.189  32.424 1.00 0.00 ? 149 LYS A CG   2  
ATOM   5389  C  CD   . LYS A 1 149 ? 25.461  7.653  32.857 1.00 0.00 ? 149 LYS A CD   2  
ATOM   5390  C  CE   . LYS A 1 149 ? 26.268  6.441  33.331 1.00 0.00 ? 149 LYS A CE   2  
ATOM   5391  N  NZ   . LYS A 1 149 ? 27.602  6.868  33.838 1.00 0.00 ? 149 LYS A NZ   2  
ATOM   5392  H  H    . LYS A 1 149 ? 21.805  8.690  33.429 1.00 0.00 ? 149 LYS A H    2  
ATOM   5393  H  HA   . LYS A 1 149 ? 24.314  9.925  32.497 1.00 0.00 ? 149 LYS A HA   2  
ATOM   5394  H  HB2  . LYS A 1 149 ? 22.494  7.892  31.138 1.00 0.00 ? 149 LYS A HB2  2  
ATOM   5395  H  HB3  . LYS A 1 149 ? 24.113  8.340  30.615 1.00 0.00 ? 149 LYS A HB3  2  
ATOM   5396  H  HG2  . LYS A 1 149 ? 23.435  7.085  33.293 1.00 0.00 ? 149 LYS A HG2  2  
ATOM   5397  H  HG3  . LYS A 1 149 ? 24.145  6.235  31.924 1.00 0.00 ? 149 LYS A HG3  2  
ATOM   5398  H  HD2  . LYS A 1 149 ? 25.963  8.120  32.022 1.00 0.00 ? 149 LYS A HD2  2  
ATOM   5399  H  HD3  . LYS A 1 149 ? 25.372  8.368  33.661 1.00 0.00 ? 149 LYS A HD3  2  
ATOM   5400  H  HE2  . LYS A 1 149 ? 25.733  5.938  34.123 1.00 0.00 ? 149 LYS A HE2  2  
ATOM   5401  H  HE3  . LYS A 1 149 ? 26.407  5.755  32.508 1.00 0.00 ? 149 LYS A HE3  2  
ATOM   5402  H  HZ1  . LYS A 1 149 ? 28.001  7.589  33.202 1.00 0.00 ? 149 LYS A HZ1  2  
ATOM   5403  H  HZ2  . LYS A 1 149 ? 27.498  7.268  34.792 1.00 0.00 ? 149 LYS A HZ2  2  
ATOM   5404  H  HZ3  . LYS A 1 149 ? 28.239  6.047  33.873 1.00 0.00 ? 149 LYS A HZ3  2  
ATOM   5405  N  N    . ARG A 1 150 ? 21.408  10.612 31.189 1.00 0.00 ? 150 ARG A N    2  
ATOM   5406  C  CA   . ARG A 1 150 ? 20.742  11.581 30.278 1.00 0.00 ? 150 ARG A CA   2  
ATOM   5407  C  C    . ARG A 1 150 ? 20.672  12.959 30.896 1.00 0.00 ? 150 ARG A C    2  
ATOM   5408  O  O    . ARG A 1 150 ? 20.791  13.949 30.207 1.00 0.00 ? 150 ARG A O    2  
ATOM   5409  C  CB   . ARG A 1 150 ? 19.326  11.104 30.008 1.00 0.00 ? 150 ARG A CB   2  
ATOM   5410  C  CG   . ARG A 1 150 ? 18.583  12.170 29.199 1.00 0.00 ? 150 ARG A CG   2  
ATOM   5411  C  CD   . ARG A 1 150 ? 17.425  11.514 28.442 1.00 0.00 ? 150 ARG A CD   2  
ATOM   5412  N  NE   . ARG A 1 150 ? 17.931  10.978 27.147 1.00 0.00 ? 150 ARG A NE   2  
ATOM   5413  C  CZ   . ARG A 1 150 ? 17.083  10.702 26.193 1.00 0.00 ? 150 ARG A CZ   2  
ATOM   5414  N  NH1  . ARG A 1 150 ? 16.024  9.996  26.475 1.00 0.00 ? 150 ARG A NH1  2  
ATOM   5415  N  NH2  . ARG A 1 150 ? 17.323  11.145 24.989 1.00 0.00 ? 150 ARG A NH2  2  
ATOM   5416  H  H    . ARG A 1 150 ? 20.877  10.005 31.742 1.00 0.00 ? 150 ARG A H    2  
ATOM   5417  H  HA   . ARG A 1 150 ? 21.311  11.639 29.351 1.00 0.00 ? 150 ARG A HA   2  
ATOM   5418  H  HB2  . ARG A 1 150 ? 19.359  10.185 29.453 1.00 0.00 ? 150 ARG A HB2  2  
ATOM   5419  H  HB3  . ARG A 1 150 ? 18.821  10.941 30.943 1.00 0.00 ? 150 ARG A HB3  2  
ATOM   5420  H  HG2  . ARG A 1 150 ? 18.199  12.927 29.865 1.00 0.00 ? 150 ARG A HG2  2  
ATOM   5421  H  HG3  . ARG A 1 150 ? 19.263  12.629 28.495 1.00 0.00 ? 150 ARG A HG3  2  
ATOM   5422  H  HD2  . ARG A 1 150 ? 17.014  10.706 29.029 1.00 0.00 ? 150 ARG A HD2  2  
ATOM   5423  H  HD3  . ARG A 1 150 ? 16.654  12.245 28.249 1.00 0.00 ? 150 ARG A HD3  2  
ATOM   5424  H  HE   . ARG A 1 150 ? 18.890  10.833 27.013 1.00 0.00 ? 150 ARG A HE   2  
ATOM   5425  H  HH11 . ARG A 1 150 ? 15.872  9.673  27.409 1.00 0.00 ? 150 ARG A HH11 2  
ATOM   5426  H  HH12 . ARG A 1 150 ? 15.364  9.775  25.756 1.00 0.00 ? 150 ARG A HH12 2  
ATOM   5427  H  HH21 . ARG A 1 150 ? 18.146  11.685 24.810 1.00 0.00 ? 150 ARG A HH21 2  
ATOM   5428  H  HH22 . ARG A 1 150 ? 16.685  10.944 24.246 1.00 0.00 ? 150 ARG A HH22 2  
ATOM   5429  N  N    . ALA A 1 151 ? 20.442  13.014 32.182 1.00 0.00 ? 151 ALA A N    2  
ATOM   5430  C  CA   . ALA A 1 151 ? 20.368  14.339 32.828 1.00 0.00 ? 151 ALA A CA   2  
ATOM   5431  C  C    . ALA A 1 151 ? 21.549  15.159 32.369 1.00 0.00 ? 151 ALA A C    2  
ATOM   5432  O  O    . ALA A 1 151 ? 21.475  16.369 32.253 1.00 0.00 ? 151 ALA A O    2  
ATOM   5433  C  CB   . ALA A 1 151 ? 20.444  14.153 34.351 1.00 0.00 ? 151 ALA A CB   2  
ATOM   5434  H  H    . ALA A 1 151 ? 20.318  12.195 32.705 1.00 0.00 ? 151 ALA A H    2  
ATOM   5435  H  HA   . ALA A 1 151 ? 19.442  14.836 32.532 1.00 0.00 ? 151 ALA A HA   2  
ATOM   5436  H  HB1  . ALA A 1 151 ? 21.245  13.472 34.595 1.00 0.00 ? 151 ALA A HB1  2  
ATOM   5437  H  HB2  . ALA A 1 151 ? 20.630  15.105 34.824 1.00 0.00 ? 151 ALA A HB2  2  
ATOM   5438  H  HB3  . ALA A 1 151 ? 19.511  13.750 34.715 1.00 0.00 ? 151 ALA A HB3  2  
ATOM   5439  N  N    . GLU A 1 152 ? 22.628  14.467 32.102 1.00 0.00 ? 152 GLU A N    2  
ATOM   5440  C  CA   . GLU A 1 152 ? 23.840  15.157 31.643 1.00 0.00 ? 152 GLU A CA   2  
ATOM   5441  C  C    . GLU A 1 152 ? 23.629  15.653 30.228 1.00 0.00 ? 152 GLU A C    2  
ATOM   5442  O  O    . GLU A 1 152 ? 24.167  16.668 29.837 1.00 0.00 ? 152 GLU A O    2  
ATOM   5443  C  CB   . GLU A 1 152 ? 25.007  14.158 31.655 1.00 0.00 ? 152 GLU A CB   2  
ATOM   5444  C  CG   . GLU A 1 152 ? 25.966  14.528 32.787 1.00 0.00 ? 152 GLU A CG   2  
ATOM   5445  C  CD   . GLU A 1 152 ? 25.295  14.243 34.132 1.00 0.00 ? 152 GLU A CD   2  
ATOM   5446  O  OE1  . GLU A 1 152 ? 25.203  13.069 34.453 1.00 0.00 ? 152 GLU A OE1  2  
ATOM   5447  O  OE2  . GLU A 1 152 ? 24.913  15.214 34.764 1.00 0.00 ? 152 GLU A OE2  2  
ATOM   5448  H  H    . GLU A 1 152 ? 22.627  13.493 32.209 1.00 0.00 ? 152 GLU A H    2  
ATOM   5449  H  HA   . GLU A 1 152 ? 24.042  16.006 32.295 1.00 0.00 ? 152 GLU A HA   2  
ATOM   5450  H  HB2  . GLU A 1 152 ? 24.628  13.160 31.813 1.00 0.00 ? 152 GLU A HB2  2  
ATOM   5451  H  HB3  . GLU A 1 152 ? 25.529  14.194 30.710 1.00 0.00 ? 152 GLU A HB3  2  
ATOM   5452  H  HG2  . GLU A 1 152 ? 26.870  13.942 32.707 1.00 0.00 ? 152 GLU A HG2  2  
ATOM   5453  H  HG3  . GLU A 1 152 ? 26.215  15.577 32.727 1.00 0.00 ? 152 GLU A HG3  2  
ATOM   5454  N  N    . LYS A 1 153 ? 22.841  14.919 29.472 1.00 0.00 ? 153 LYS A N    2  
ATOM   5455  C  CA   . LYS A 1 153 ? 22.590  15.349 28.084 1.00 0.00 ? 153 LYS A CA   2  
ATOM   5456  C  C    . LYS A 1 153 ? 21.836  16.663 28.103 1.00 0.00 ? 153 LYS A C    2  
ATOM   5457  O  O    . LYS A 1 153 ? 22.362  17.701 27.723 1.00 0.00 ? 153 LYS A O    2  
ATOM   5458  C  CB   . LYS A 1 153 ? 21.729  14.287 27.384 1.00 0.00 ? 153 LYS A CB   2  
ATOM   5459  C  CG   . LYS A 1 153 ? 21.565  14.672 25.913 1.00 0.00 ? 153 LYS A CG   2  
ATOM   5460  C  CD   . LYS A 1 153 ? 22.950  14.803 25.274 1.00 0.00 ? 153 LYS A CD   2  
ATOM   5461  C  CE   . LYS A 1 153 ? 22.860  14.426 23.794 1.00 0.00 ? 153 LYS A CE   2  
ATOM   5462  N  NZ   . LYS A 1 153 ? 23.798  15.257 22.988 1.00 0.00 ? 153 LYS A NZ   2  
ATOM   5463  H  H    . LYS A 1 153 ? 22.412  14.091 29.832 1.00 0.00 ? 153 LYS A H    2  
ATOM   5464  H  HA   . LYS A 1 153 ? 23.542  15.487 27.571 1.00 0.00 ? 153 LYS A HA   2  
ATOM   5465  H  HB2  . LYS A 1 153 ? 22.210  13.323 27.457 1.00 0.00 ? 153 LYS A HB2  2  
ATOM   5466  H  HB3  . LYS A 1 153 ? 20.759  14.236 27.857 1.00 0.00 ? 153 LYS A HB3  2  
ATOM   5467  H  HG2  . LYS A 1 153 ? 20.999  13.911 25.398 1.00 0.00 ? 153 LYS A HG2  2  
ATOM   5468  H  HG3  . LYS A 1 153 ? 21.042  15.613 25.840 1.00 0.00 ? 153 LYS A HG3  2  
ATOM   5469  H  HD2  . LYS A 1 153 ? 23.297  15.822 25.369 1.00 0.00 ? 153 LYS A HD2  2  
ATOM   5470  H  HD3  . LYS A 1 153 ? 23.644  14.146 25.775 1.00 0.00 ? 153 LYS A HD3  2  
ATOM   5471  H  HE2  . LYS A 1 153 ? 23.117  13.384 23.670 1.00 0.00 ? 153 LYS A HE2  2  
ATOM   5472  H  HE3  . LYS A 1 153 ? 21.853  14.586 23.440 1.00 0.00 ? 153 LYS A HE3  2  
ATOM   5473  H  HZ1  . LYS A 1 153 ? 24.768  15.122 23.336 1.00 0.00 ? 153 LYS A HZ1  2  
ATOM   5474  H  HZ2  . LYS A 1 153 ? 23.745  14.970 21.989 1.00 0.00 ? 153 LYS A HZ2  2  
ATOM   5475  H  HZ3  . LYS A 1 153 ? 23.535  16.260 23.075 1.00 0.00 ? 153 LYS A HZ3  2  
ATOM   5476  N  N    . ILE A 1 154 ? 20.612  16.610 28.555 1.00 0.00 ? 154 ILE A N    2  
ATOM   5477  C  CA   . ILE A 1 154 ? 19.827  17.850 28.603 1.00 0.00 ? 154 ILE A CA   2  
ATOM   5478  C  C    . ILE A 1 154 ? 20.638  18.925 29.265 1.00 0.00 ? 154 ILE A C    2  
ATOM   5479  O  O    . ILE A 1 154 ? 21.141  19.798 28.612 1.00 0.00 ? 154 ILE A O    2  
ATOM   5480  C  CB   . ILE A 1 154 ? 18.581  17.627 29.439 1.00 0.00 ? 154 ILE A CB   2  
ATOM   5481  C  CG1  . ILE A 1 154 ? 17.750  16.494 28.851 1.00 0.00 ? 154 ILE A CG1  2  
ATOM   5482  C  CG2  . ILE A 1 154 ? 17.750  18.926 29.415 1.00 0.00 ? 154 ILE A CG2  2  
ATOM   5483  C  CD1  . ILE A 1 154 ? 16.724  16.029 29.889 1.00 0.00 ? 154 ILE A CD1  2  
ATOM   5484  H  H    . ILE A 1 154 ? 20.226  15.760 28.859 1.00 0.00 ? 154 ILE A H    2  
ATOM   5485  H  HA   . ILE A 1 154 ? 19.573  18.160 27.590 1.00 0.00 ? 154 ILE A HA   2  
ATOM   5486  H  HB   . ILE A 1 154 ? 18.878  17.374 30.456 1.00 0.00 ? 154 ILE A HB   2  
ATOM   5487  H  HG12 . ILE A 1 154 ? 17.238  16.842 27.965 1.00 0.00 ? 154 ILE A HG12 2  
ATOM   5488  H  HG13 . ILE A 1 154 ? 18.397  15.671 28.586 1.00 0.00 ? 154 ILE A HG13 2  
ATOM   5489  H  HG21 . ILE A 1 154 ? 18.336  19.744 29.813 1.00 0.00 ? 154 ILE A HG21 2  
ATOM   5490  H  HG22 . ILE A 1 154 ? 17.466  19.158 28.398 1.00 0.00 ? 154 ILE A HG22 2  
ATOM   5491  H  HG23 . ILE A 1 154 ? 16.861  18.803 30.013 1.00 0.00 ? 154 ILE A HG23 2  
ATOM   5492  H  HD11 . ILE A 1 154 ? 16.861  16.575 30.812 1.00 0.00 ? 154 ILE A HD11 2  
ATOM   5493  H  HD12 . ILE A 1 154 ? 15.725  16.205 29.518 1.00 0.00 ? 154 ILE A HD12 2  
ATOM   5494  H  HD13 . ILE A 1 154 ? 16.852  14.974 30.078 1.00 0.00 ? 154 ILE A HD13 2  
ATOM   5495  N  N    . TRP A 1 155 ? 20.768  18.825 30.570 1.00 0.00 ? 155 TRP A N    2  
ATOM   5496  C  CA   . TRP A 1 155 ? 21.553  19.844 31.304 1.00 0.00 ? 155 TRP A CA   2  
ATOM   5497  C  C    . TRP A 1 155 ? 22.819  20.184 30.536 1.00 0.00 ? 155 TRP A C    2  
ATOM   5498  O  O    . TRP A 1 155 ? 23.358  21.271 30.655 1.00 0.00 ? 155 TRP A O    2  
ATOM   5499  C  CB   . TRP A 1 155 ? 21.946  19.270 32.671 1.00 0.00 ? 155 TRP A CB   2  
ATOM   5500  C  CG   . TRP A 1 155 ? 22.668  20.352 33.475 1.00 0.00 ? 155 TRP A CG   2  
ATOM   5501  C  CD1  . TRP A 1 155 ? 23.984  20.462 33.570 1.00 0.00 ? 155 TRP A CD1  2  
ATOM   5502  C  CD2  . TRP A 1 155 ? 22.066  21.302 34.146 1.00 0.00 ? 155 TRP A CD2  2  
ATOM   5503  N  NE1  . TRP A 1 155 ? 24.157  21.549 34.346 1.00 0.00 ? 155 TRP A NE1  2  
ATOM   5504  C  CE2  . TRP A 1 155 ? 22.978  22.142 34.756 1.00 0.00 ? 155 TRP A CE2  2  
ATOM   5505  C  CE3  . TRP A 1 155 ? 20.712  21.533 34.291 1.00 0.00 ? 155 TRP A CE3  2  
ATOM   5506  C  CZ2  . TRP A 1 155 ? 22.537  23.212 35.507 1.00 0.00 ? 155 TRP A CZ2  2  
ATOM   5507  C  CZ3  . TRP A 1 155 ? 20.272  22.605 35.042 1.00 0.00 ? 155 TRP A CZ3  2  
ATOM   5508  C  CH2  . TRP A 1 155 ? 21.184  23.443 35.651 1.00 0.00 ? 155 TRP A CH2  2  
ATOM   5509  H  H    . TRP A 1 155 ? 20.353  18.077 31.053 1.00 0.00 ? 155 TRP A H    2  
ATOM   5510  H  HA   . TRP A 1 155 ? 20.949  20.736 31.421 1.00 0.00 ? 155 TRP A HA   2  
ATOM   5511  H  HB2  . TRP A 1 155 ? 21.063  18.956 33.204 1.00 0.00 ? 155 TRP A HB2  2  
ATOM   5512  H  HB3  . TRP A 1 155 ? 22.605  18.424 32.538 1.00 0.00 ? 155 TRP A HB3  2  
ATOM   5513  H  HD1  . TRP A 1 155 ? 24.740  19.837 33.118 1.00 0.00 ? 155 TRP A HD1  2  
ATOM   5514  H  HE1  . TRP A 1 155 ? 25.041  21.889 34.596 1.00 0.00 ? 155 TRP A HE1  2  
ATOM   5515  H  HE3  . TRP A 1 155 ? 19.999  20.878 33.815 1.00 0.00 ? 155 TRP A HE3  2  
ATOM   5516  H  HZ2  . TRP A 1 155 ? 23.250  23.866 35.985 1.00 0.00 ? 155 TRP A HZ2  2  
ATOM   5517  H  HZ3  . TRP A 1 155 ? 19.214  22.786 35.154 1.00 0.00 ? 155 TRP A HZ3  2  
ATOM   5518  H  HH2  . TRP A 1 155 ? 20.839  24.282 36.238 1.00 0.00 ? 155 TRP A HH2  2  
ATOM   5519  N  N    . GLY A 1 156 ? 23.265  19.242 29.753 1.00 0.00 ? 156 GLY A N    2  
ATOM   5520  C  CA   . GLY A 1 156 ? 24.497  19.464 28.956 1.00 0.00 ? 156 GLY A CA   2  
ATOM   5521  C  C    . GLY A 1 156 ? 24.280  20.560 27.909 1.00 0.00 ? 156 GLY A C    2  
ATOM   5522  O  O    . GLY A 1 156 ? 25.221  21.205 27.496 1.00 0.00 ? 156 GLY A O    2  
ATOM   5523  H  H    . GLY A 1 156 ? 22.787  18.388 29.692 1.00 0.00 ? 156 GLY A H    2  
ATOM   5524  H  HA2  . GLY A 1 156 ? 25.298  19.758 29.617 1.00 0.00 ? 156 GLY A HA2  2  
ATOM   5525  H  HA3  . GLY A 1 156 ? 24.767  18.545 28.457 1.00 0.00 ? 156 GLY A HA3  2  
ATOM   5526  N  N    . PHE A 1 157 ? 23.050  20.747 27.490 1.00 0.00 ? 157 PHE A N    2  
ATOM   5527  C  CA   . PHE A 1 157 ? 22.794  21.805 26.469 1.00 0.00 ? 157 PHE A CA   2  
ATOM   5528  C  C    . PHE A 1 157 ? 23.369  23.160 26.927 1.00 0.00 ? 157 PHE A C    2  
ATOM   5529  O  O    . PHE A 1 157 ? 24.520  23.462 26.675 1.00 0.00 ? 157 PHE A O    2  
ATOM   5530  C  CB   . PHE A 1 157 ? 21.264  21.925 26.246 1.00 0.00 ? 157 PHE A CB   2  
ATOM   5531  C  CG   . PHE A 1 157 ? 20.484  22.100 27.581 1.00 0.00 ? 157 PHE A CG   2  
ATOM   5532  C  CD1  . PHE A 1 157 ? 21.129  22.339 28.802 1.00 0.00 ? 157 PHE A CD1  2  
ATOM   5533  C  CD2  . PHE A 1 157 ? 19.098  22.084 27.560 1.00 0.00 ? 157 PHE A CD2  2  
ATOM   5534  C  CE1  . PHE A 1 157 ? 20.393  22.568 29.943 1.00 0.00 ? 157 PHE A CE1  2  
ATOM   5535  C  CE2  . PHE A 1 157 ? 18.375  22.307 28.712 1.00 0.00 ? 157 PHE A CE2  2  
ATOM   5536  C  CZ   . PHE A 1 157 ? 19.021  22.549 29.899 1.00 0.00 ? 157 PHE A CZ   2  
ATOM   5537  H  H    . PHE A 1 157 ? 22.308  20.186 27.836 1.00 0.00 ? 157 PHE A H    2  
ATOM   5538  H  HA   . PHE A 1 157 ? 23.292  21.515 25.541 1.00 0.00 ? 157 PHE A HA   2  
ATOM   5539  H  HB2  . PHE A 1 157 ? 21.061  22.775 25.613 1.00 0.00 ? 157 PHE A HB2  2  
ATOM   5540  H  HB3  . PHE A 1 157 ? 20.905  21.033 25.752 1.00 0.00 ? 157 PHE A HB3  2  
ATOM   5541  H  HD1  . PHE A 1 157 ? 22.200  22.292 28.866 1.00 0.00 ? 157 PHE A HD1  2  
ATOM   5542  H  HD2  . PHE A 1 157 ? 18.580  21.893 26.632 1.00 0.00 ? 157 PHE A HD2  2  
ATOM   5543  H  HE1  . PHE A 1 157 ? 20.898  22.795 30.870 1.00 0.00 ? 157 PHE A HE1  2  
ATOM   5544  H  HE2  . PHE A 1 157 ? 17.296  22.291 28.681 1.00 0.00 ? 157 PHE A HE2  2  
ATOM   5545  H  HZ   . PHE A 1 157 ? 18.449  22.723 30.797 1.00 0.00 ? 157 PHE A HZ   2  
ATOM   5546  N  N    . PHE A 1 158 ? 22.562  23.953 27.569 1.00 0.00 ? 158 PHE A N    2  
ATOM   5547  C  CA   . PHE A 1 158 ? 23.053  25.262 28.040 1.00 0.00 ? 158 PHE A CA   2  
ATOM   5548  C  C    . PHE A 1 158 ? 24.334  25.068 28.851 1.00 0.00 ? 158 PHE A C    2  
ATOM   5549  O  O    . PHE A 1 158 ? 25.261  25.845 28.753 1.00 0.00 ? 158 PHE A O    2  
ATOM   5550  C  CB   . PHE A 1 158 ? 21.978  25.870 28.947 1.00 0.00 ? 158 PHE A CB   2  
ATOM   5551  C  CG   . PHE A 1 158 ? 20.596  25.503 28.399 1.00 0.00 ? 158 PHE A CG   2  
ATOM   5552  C  CD1  . PHE A 1 158 ? 20.390  25.382 27.036 1.00 0.00 ? 158 PHE A CD1  2  
ATOM   5553  C  CD2  . PHE A 1 158 ? 19.530  25.300 29.256 1.00 0.00 ? 158 PHE A CD2  2  
ATOM   5554  C  CE1  . PHE A 1 158 ? 19.142  25.068 26.541 1.00 0.00 ? 158 PHE A CE1  2  
ATOM   5555  C  CE2  . PHE A 1 158 ? 18.281  24.987 28.755 1.00 0.00 ? 158 PHE A CE2  2  
ATOM   5556  C  CZ   . PHE A 1 158 ? 18.090  24.871 27.402 1.00 0.00 ? 158 PHE A CZ   2  
ATOM   5557  H  H    . PHE A 1 158 ? 21.636  23.697 27.715 1.00 0.00 ? 158 PHE A H    2  
ATOM   5558  H  HA   . PHE A 1 158 ? 23.256  25.902 27.186 1.00 0.00 ? 158 PHE A HA   2  
ATOM   5559  H  HB2  . PHE A 1 158 ? 22.080  25.482 29.949 1.00 0.00 ? 158 PHE A HB2  2  
ATOM   5560  H  HB3  . PHE A 1 158 ? 22.081  26.945 28.967 1.00 0.00 ? 158 PHE A HB3  2  
ATOM   5561  H  HD1  . PHE A 1 158 ? 21.213  25.522 26.355 1.00 0.00 ? 158 PHE A HD1  2  
ATOM   5562  H  HD2  . PHE A 1 158 ? 19.680  25.366 30.322 1.00 0.00 ? 158 PHE A HD2  2  
ATOM   5563  H  HE1  . PHE A 1 158 ? 18.993  24.973 25.478 1.00 0.00 ? 158 PHE A HE1  2  
ATOM   5564  H  HE2  . PHE A 1 158 ? 17.455  24.827 29.426 1.00 0.00 ? 158 PHE A HE2  2  
ATOM   5565  H  HZ   . PHE A 1 158 ? 17.111  24.629 27.013 1.00 0.00 ? 158 PHE A HZ   2  
ATOM   5566  N  N    . GLY A 1 159 ? 24.352  24.022 29.643 1.00 0.00 ? 159 GLY A N    2  
ATOM   5567  C  CA   . GLY A 1 159 ? 25.552  23.741 30.476 1.00 0.00 ? 159 GLY A CA   2  
ATOM   5568  C  C    . GLY A 1 159 ? 25.659  24.756 31.606 1.00 0.00 ? 159 GLY A C    2  
ATOM   5569  O  O    . GLY A 1 159 ? 25.544  24.413 32.764 1.00 0.00 ? 159 GLY A O    2  
ATOM   5570  H  H    . GLY A 1 159 ? 23.578  23.433 29.691 1.00 0.00 ? 159 GLY A H    2  
ATOM   5571  H  HA2  . GLY A 1 159 ? 25.470  22.748 30.894 1.00 0.00 ? 159 GLY A HA2  2  
ATOM   5572  H  HA3  . GLY A 1 159 ? 26.435  23.798 29.859 1.00 0.00 ? 159 GLY A HA3  2  
ATOM   5573  N  N    . LYS A 1 160 ? 25.869  25.985 31.231 1.00 0.00 ? 160 LYS A N    2  
ATOM   5574  C  CA   . LYS A 1 160 ? 25.994  27.072 32.246 1.00 0.00 ? 160 LYS A CA   2  
ATOM   5575  C  C    . LYS A 1 160 ? 27.105  26.788 33.259 1.00 0.00 ? 160 LYS A C    2  
ATOM   5576  O  O    . LYS A 1 160 ? 27.611  25.686 33.345 1.00 0.00 ? 160 LYS A O    2  
ATOM   5577  C  CB   . LYS A 1 160 ? 24.660  27.199 32.981 1.00 0.00 ? 160 LYS A CB   2  
ATOM   5578  C  CG   . LYS A 1 160 ? 23.553  27.354 31.944 1.00 0.00 ? 160 LYS A CG   2  
ATOM   5579  C  CD   . LYS A 1 160 ? 22.219  27.495 32.660 1.00 0.00 ? 160 LYS A CD   2  
ATOM   5580  C  CE   . LYS A 1 160 ? 21.877  26.177 33.369 1.00 0.00 ? 160 LYS A CE   2  
ATOM   5581  N  NZ   . LYS A 1 160 ? 22.625  25.040 32.763 1.00 0.00 ? 160 LYS A NZ   2  
ATOM   5582  H  H    . LYS A 1 160 ? 25.931  26.196 30.276 1.00 0.00 ? 160 LYS A H    2  
ATOM   5583  H  HA   . LYS A 1 160 ? 26.224  28.000 31.731 1.00 0.00 ? 160 LYS A HA   2  
ATOM   5584  H  HB2  . LYS A 1 160 ? 24.482  26.322 33.579 1.00 0.00 ? 160 LYS A HB2  2  
ATOM   5585  H  HB3  . LYS A 1 160 ? 24.680  28.069 33.621 1.00 0.00 ? 160 LYS A HB3  2  
ATOM   5586  H  HG2  . LYS A 1 160 ? 23.737  28.235 31.347 1.00 0.00 ? 160 LYS A HG2  2  
ATOM   5587  H  HG3  . LYS A 1 160 ? 23.531  26.489 31.300 1.00 0.00 ? 160 LYS A HG3  2  
ATOM   5588  H  HD2  . LYS A 1 160 ? 22.284  28.292 33.385 1.00 0.00 ? 160 LYS A HD2  2  
ATOM   5589  H  HD3  . LYS A 1 160 ? 21.454  27.732 31.942 1.00 0.00 ? 160 LYS A HD3  2  
ATOM   5590  H  HE2  . LYS A 1 160 ? 22.138  26.252 34.414 1.00 0.00 ? 160 LYS A HE2  2  
ATOM   5591  H  HE3  . LYS A 1 160 ? 20.819  25.985 33.285 1.00 0.00 ? 160 LYS A HE3  2  
ATOM   5592  H  HZ1  . LYS A 1 160 ? 23.590  25.344 32.528 1.00 0.00 ? 160 LYS A HZ1  2  
ATOM   5593  H  HZ2  . LYS A 1 160 ? 22.666  24.252 33.440 1.00 0.00 ? 160 LYS A HZ2  2  
ATOM   5594  H  HZ3  . LYS A 1 160 ? 22.139  24.728 31.898 1.00 0.00 ? 160 LYS A HZ3  2  
ATOM   5595  N  N    . LYS A 1 161 ? 27.471  27.800 34.001 1.00 0.00 ? 161 LYS A N    2  
ATOM   5596  C  CA   . LYS A 1 161 ? 28.543  27.624 35.016 1.00 0.00 ? 161 LYS A CA   2  
ATOM   5597  C  C    . LYS A 1 161 ? 28.374  28.634 36.144 1.00 0.00 ? 161 LYS A C    2  
ATOM   5598  O  O    . LYS A 1 161 ? 28.027  28.277 37.253 1.00 0.00 ? 161 LYS A O    2  
ATOM   5599  C  CB   . LYS A 1 161 ? 29.905  27.861 34.339 1.00 0.00 ? 161 LYS A CB   2  
ATOM   5600  C  CG   . LYS A 1 161 ? 30.647  26.525 34.221 1.00 0.00 ? 161 LYS A CG   2  
ATOM   5601  C  CD   . LYS A 1 161 ? 31.238  26.153 35.584 1.00 0.00 ? 161 LYS A CD   2  
ATOM   5602  C  CE   . LYS A 1 161 ? 31.942  24.797 35.473 1.00 0.00 ? 161 LYS A CE   2  
ATOM   5603  N  NZ   . LYS A 1 161 ? 33.395  24.984 35.200 1.00 0.00 ? 161 LYS A NZ   2  
ATOM   5604  H  H    . LYS A 1 161 ? 27.042  28.674 33.887 1.00 0.00 ? 161 LYS A H    2  
ATOM   5605  H  HA   . LYS A 1 161 ? 28.482  26.616 35.427 1.00 0.00 ? 161 LYS A HA   2  
ATOM   5606  H  HB2  . LYS A 1 161 ? 29.751  28.278 33.354 1.00 0.00 ? 161 LYS A HB2  2  
ATOM   5607  H  HB3  . LYS A 1 161 ? 30.490  28.551 34.928 1.00 0.00 ? 161 LYS A HB3  2  
ATOM   5608  H  HG2  . LYS A 1 161 ? 29.961  25.755 33.901 1.00 0.00 ? 161 LYS A HG2  2  
ATOM   5609  H  HG3  . LYS A 1 161 ? 31.442  26.615 33.494 1.00 0.00 ? 161 LYS A HG3  2  
ATOM   5610  H  HD2  . LYS A 1 161 ? 31.948  26.906 35.891 1.00 0.00 ? 161 LYS A HD2  2  
ATOM   5611  H  HD3  . LYS A 1 161 ? 30.447  26.091 36.318 1.00 0.00 ? 161 LYS A HD3  2  
ATOM   5612  H  HE2  . LYS A 1 161 ? 31.823  24.251 36.397 1.00 0.00 ? 161 LYS A HE2  2  
ATOM   5613  H  HE3  . LYS A 1 161 ? 31.503  24.227 34.667 1.00 0.00 ? 161 LYS A HE3  2  
ATOM   5614  H  HZ1  . LYS A 1 161 ? 33.518  25.670 34.427 1.00 0.00 ? 161 LYS A HZ1  2  
ATOM   5615  H  HZ2  . LYS A 1 161 ? 33.866  25.339 36.058 1.00 0.00 ? 161 LYS A HZ2  2  
ATOM   5616  H  HZ3  . LYS A 1 161 ? 33.817  24.074 34.925 1.00 0.00 ? 161 LYS A HZ3  2  
ATOM   5617  N  N    . ASP A 1 162 ? 28.624  29.883 35.842 1.00 0.00 ? 162 ASP A N    2  
ATOM   5618  C  CA   . ASP A 1 162 ? 28.480  30.924 36.890 1.00 0.00 ? 162 ASP A CA   2  
ATOM   5619  C  C    . ASP A 1 162 ? 27.095  30.846 37.511 1.00 0.00 ? 162 ASP A C    2  
ATOM   5620  O  O    . ASP A 1 162 ? 26.955  30.547 38.682 1.00 0.00 ? 162 ASP A O    2  
ATOM   5621  C  CB   . ASP A 1 162 ? 28.659  32.304 36.237 1.00 0.00 ? 162 ASP A CB   2  
ATOM   5622  C  CG   . ASP A 1 162 ? 28.549  33.388 37.311 1.00 0.00 ? 162 ASP A CG   2  
ATOM   5623  O  OD1  . ASP A 1 162 ? 27.953  33.080 38.330 1.00 0.00 ? 162 ASP A OD1  2  
ATOM   5624  O  OD2  . ASP A 1 162 ? 29.067  34.462 37.053 1.00 0.00 ? 162 ASP A OD2  2  
ATOM   5625  H  H    . ASP A 1 162 ? 28.904  30.128 34.936 1.00 0.00 ? 162 ASP A H    2  
ATOM   5626  H  HA   . ASP A 1 162 ? 29.229  30.757 37.664 1.00 0.00 ? 162 ASP A HA   2  
ATOM   5627  H  HB2  . ASP A 1 162 ? 29.630  32.365 35.768 1.00 0.00 ? 162 ASP A HB2  2  
ATOM   5628  H  HB3  . ASP A 1 162 ? 27.892  32.460 35.492 1.00 0.00 ? 162 ASP A HB3  2  
ATOM   5629  N  N    . ASP A 1 163 ? 26.091  31.117 36.711 1.00 0.00 ? 163 ASP A N    2  
ATOM   5630  C  CA   . ASP A 1 163 ? 24.702  31.063 37.229 1.00 0.00 ? 163 ASP A CA   2  
ATOM   5631  C  C    . ASP A 1 163 ? 24.044  29.764 36.771 1.00 0.00 ? 163 ASP A C    2  
ATOM   5632  O  O    . ASP A 1 163 ? 23.121  29.771 35.982 1.00 0.00 ? 163 ASP A O    2  
ATOM   5633  C  CB   . ASP A 1 163 ? 23.912  32.253 36.655 1.00 0.00 ? 163 ASP A CB   2  
ATOM   5634  C  CG   . ASP A 1 163 ? 24.176  33.492 37.511 1.00 0.00 ? 163 ASP A CG   2  
ATOM   5635  O  OD1  . ASP A 1 163 ? 24.166  33.327 38.720 1.00 0.00 ? 163 ASP A OD1  2  
ATOM   5636  O  OD2  . ASP A 1 163 ? 24.374  34.534 36.908 1.00 0.00 ? 163 ASP A OD2  2  
ATOM   5637  H  H    . ASP A 1 163 ? 26.257  31.348 35.775 1.00 0.00 ? 163 ASP A H    2  
ATOM   5638  H  HA   . ASP A 1 163 ? 24.729  31.098 38.314 1.00 0.00 ? 163 ASP A HA   2  
ATOM   5639  H  HB2  . ASP A 1 163 ? 24.223  32.445 35.640 1.00 0.00 ? 163 ASP A HB2  2  
ATOM   5640  H  HB3  . ASP A 1 163 ? 22.855  32.029 36.669 1.00 0.00 ? 163 ASP A HB3  2  
ATOM   5641  N  N    . ASP A 1 164 ? 24.539  28.671 37.283 1.00 0.00 ? 164 ASP A N    2  
ATOM   5642  C  CA   . ASP A 1 164 ? 23.978  27.346 36.901 1.00 0.00 ? 164 ASP A CA   2  
ATOM   5643  C  C    . ASP A 1 164 ? 22.512  27.154 37.316 1.00 0.00 ? 164 ASP A C    2  
ATOM   5644  O  O    . ASP A 1 164 ? 22.142  26.087 37.767 1.00 0.00 ? 164 ASP A O    2  
ATOM   5645  C  CB   . ASP A 1 164 ? 24.823  26.263 37.579 1.00 0.00 ? 164 ASP A CB   2  
ATOM   5646  C  CG   . ASP A 1 164 ? 24.797  26.474 39.093 1.00 0.00 ? 164 ASP A CG   2  
ATOM   5647  O  OD1  . ASP A 1 164 ? 23.746  26.217 39.658 1.00 0.00 ? 164 ASP A OD1  2  
ATOM   5648  O  OD2  . ASP A 1 164 ? 25.829  26.881 39.601 1.00 0.00 ? 164 ASP A OD2  2  
ATOM   5649  H  H    . ASP A 1 164 ? 25.283  28.725 37.917 1.00 0.00 ? 164 ASP A H    2  
ATOM   5650  H  HA   . ASP A 1 164 ? 24.043  27.247 35.820 1.00 0.00 ? 164 ASP A HA   2  
ATOM   5651  H  HB2  . ASP A 1 164 ? 24.422  25.288 37.346 1.00 0.00 ? 164 ASP A HB2  2  
ATOM   5652  H  HB3  . ASP A 1 164 ? 25.842  26.323 37.226 1.00 0.00 ? 164 ASP A HB3  2  
ATOM   5653  N  N    . LYS A 1 165 ? 21.705  28.184 37.163 1.00 0.00 ? 165 LYS A N    2  
ATOM   5654  C  CA   . LYS A 1 165 ? 20.259  28.051 37.546 1.00 0.00 ? 165 LYS A CA   2  
ATOM   5655  C  C    . LYS A 1 165 ? 19.377  28.635 36.454 1.00 0.00 ? 165 LYS A C    2  
ATOM   5656  O  O    . LYS A 1 165 ? 19.351  29.831 36.247 1.00 0.00 ? 165 LYS A O    2  
ATOM   5657  C  CB   . LYS A 1 165 ? 19.979  28.808 38.859 1.00 0.00 ? 165 LYS A CB   2  
ATOM   5658  C  CG   . LYS A 1 165 ? 21.282  29.080 39.592 1.00 0.00 ? 165 LYS A CG   2  
ATOM   5659  C  CD   . LYS A 1 165 ? 21.868  30.393 39.097 1.00 0.00 ? 165 LYS A CD   2  
ATOM   5660  C  CE   . LYS A 1 165 ? 21.624  31.481 40.144 1.00 0.00 ? 165 LYS A CE   2  
ATOM   5661  N  NZ   . LYS A 1 165 ? 20.308  31.278 40.815 1.00 0.00 ? 165 LYS A NZ   2  
ATOM   5662  H  H    . LYS A 1 165 ? 22.047  29.032 36.809 1.00 0.00 ? 165 LYS A H    2  
ATOM   5663  H  HA   . LYS A 1 165 ? 20.016  26.993 37.652 1.00 0.00 ? 165 LYS A HA   2  
ATOM   5664  H  HB2  . LYS A 1 165 ? 19.483  29.742 38.640 1.00 0.00 ? 165 LYS A HB2  2  
ATOM   5665  H  HB3  . LYS A 1 165 ? 19.340  28.209 39.486 1.00 0.00 ? 165 LYS A HB3  2  
ATOM   5666  H  HG2  . LYS A 1 165 ? 21.092  29.147 40.653 1.00 0.00 ? 165 LYS A HG2  2  
ATOM   5667  H  HG3  . LYS A 1 165 ? 21.979  28.279 39.408 1.00 0.00 ? 165 LYS A HG3  2  
ATOM   5668  H  HD2  . LYS A 1 165 ? 22.916  30.273 38.942 1.00 0.00 ? 165 LYS A HD2  2  
ATOM   5669  H  HD3  . LYS A 1 165 ? 21.402  30.675 38.163 1.00 0.00 ? 165 LYS A HD3  2  
ATOM   5670  H  HE2  . LYS A 1 165 ? 22.407  31.449 40.886 1.00 0.00 ? 165 LYS A HE2  2  
ATOM   5671  H  HE3  . LYS A 1 165 ? 21.630  32.450 39.668 1.00 0.00 ? 165 LYS A HE3  2  
ATOM   5672  H  HZ1  . LYS A 1 165 ? 19.591  31.029 40.104 1.00 0.00 ? 165 LYS A HZ1  2  
ATOM   5673  H  HZ2  . LYS A 1 165 ? 20.389  30.508 41.510 1.00 0.00 ? 165 LYS A HZ2  2  
ATOM   5674  H  HZ3  . LYS A 1 165 ? 20.027  32.154 41.299 1.00 0.00 ? 165 LYS A HZ3  2  
ATOM   5675  N  N    . LEU A 1 166 ? 18.666  27.778 35.773 1.00 0.00 ? 166 LEU A N    2  
ATOM   5676  C  CA   . LEU A 1 166 ? 17.779  28.263 34.687 1.00 0.00 ? 166 LEU A CA   2  
ATOM   5677  C  C    . LEU A 1 166 ? 16.558  28.963 35.247 1.00 0.00 ? 166 LEU A C    2  
ATOM   5678  O  O    . LEU A 1 166 ? 15.814  28.400 36.023 1.00 0.00 ? 166 LEU A O    2  
ATOM   5679  C  CB   . LEU A 1 166 ? 17.312  27.055 33.866 1.00 0.00 ? 166 LEU A CB   2  
ATOM   5680  C  CG   . LEU A 1 166 ? 17.341  27.398 32.373 1.00 0.00 ? 166 LEU A CG   2  
ATOM   5681  C  CD1  . LEU A 1 166 ? 18.753  27.830 31.972 1.00 0.00 ? 166 LEU A CD1  2  
ATOM   5682  C  CD2  . LEU A 1 166 ? 16.953  26.154 31.576 1.00 0.00 ? 166 LEU A CD2  2  
ATOM   5683  H  H    . LEU A 1 166 ? 18.717  26.820 35.980 1.00 0.00 ? 166 LEU A H    2  
ATOM   5684  H  HA   . LEU A 1 166 ? 18.331  28.964 34.067 1.00 0.00 ? 166 LEU A HA   2  
ATOM   5685  H  HB2  . LEU A 1 166 ? 17.959  26.217 34.057 1.00 0.00 ? 166 LEU A HB2  2  
ATOM   5686  H  HB3  . LEU A 1 166 ? 16.303  26.797 34.152 1.00 0.00 ? 166 LEU A HB3  2  
ATOM   5687  H  HG   . LEU A 1 166 ? 16.643  28.194 32.167 1.00 0.00 ? 166 LEU A HG   2  
ATOM   5688  H  HD11 . LEU A 1 166 ? 19.442  27.596 32.766 1.00 0.00 ? 166 LEU A HD11 2  
ATOM   5689  H  HD12 . LEU A 1 166 ? 19.053  27.311 31.075 1.00 0.00 ? 166 LEU A HD12 2  
ATOM   5690  H  HD13 . LEU A 1 166 ? 18.770  28.894 31.788 1.00 0.00 ? 166 LEU A HD13 2  
ATOM   5691  H  HD21 . LEU A 1 166 ? 16.189  25.606 32.107 1.00 0.00 ? 166 LEU A HD21 2  
ATOM   5692  H  HD22 . LEU A 1 166 ? 16.575  26.445 30.608 1.00 0.00 ? 166 LEU A HD22 2  
ATOM   5693  H  HD23 . LEU A 1 166 ? 17.817  25.522 31.450 1.00 0.00 ? 166 LEU A HD23 2  
ATOM   5694  N  N    . THR A 1 167 ? 16.373  30.176 34.825 1.00 0.00 ? 167 THR A N    2  
ATOM   5695  C  CA   . THR A 1 167 ? 15.209  30.962 35.303 1.00 0.00 ? 167 THR A CA   2  
ATOM   5696  C  C    . THR A 1 167 ? 14.106  30.968 34.249 1.00 0.00 ? 167 THR A C    2  
ATOM   5697  O  O    . THR A 1 167 ? 14.353  30.698 33.091 1.00 0.00 ? 167 THR A O    2  
ATOM   5698  C  CB   . THR A 1 167 ? 15.669  32.404 35.544 1.00 0.00 ? 167 THR A CB   2  
ATOM   5699  O  OG1  . THR A 1 167 ? 16.255  32.817 34.326 1.00 0.00 ? 167 THR A OG1  2  
ATOM   5700  C  CG2  . THR A 1 167 ? 16.818  32.448 36.562 1.00 0.00 ? 167 THR A CG2  2  
ATOM   5701  H  H    . THR A 1 167 ? 16.999  30.564 34.185 1.00 0.00 ? 167 THR A H    2  
ATOM   5702  H  HA   . THR A 1 167 ? 14.824  30.514 36.227 1.00 0.00 ? 167 THR A HA   2  
ATOM   5703  H  HB   . THR A 1 167 ? 14.840  33.052 35.816 1.00 0.00 ? 167 THR A HB   2  
ATOM   5704  H  HG1  . THR A 1 167 ? 16.916  32.168 34.078 1.00 0.00 ? 167 THR A HG1  2  
ATOM   5705  H  HG21 . THR A 1 167 ? 17.252  31.464 36.666 1.00 0.00 ? 167 THR A HG21 2  
ATOM   5706  H  HG22 . THR A 1 167 ? 17.578  33.137 36.224 1.00 0.00 ? 167 THR A HG22 2  
ATOM   5707  H  HG23 . THR A 1 167 ? 16.443  32.775 37.520 1.00 0.00 ? 167 THR A HG23 2  
ATOM   5708  N  N    . GLU A 1 168 ? 12.909  31.275 34.664 1.00 0.00 ? 168 GLU A N    2  
ATOM   5709  C  CA   . GLU A 1 168 ? 11.784  31.300 33.693 1.00 0.00 ? 168 GLU A CA   2  
ATOM   5710  C  C    . GLU A 1 168 ? 12.096  32.191 32.489 1.00 0.00 ? 168 GLU A C    2  
ATOM   5711  O  O    . GLU A 1 168 ? 11.764  31.859 31.372 1.00 0.00 ? 168 GLU A O    2  
ATOM   5712  C  CB   . GLU A 1 168 ? 10.541  31.860 34.405 1.00 0.00 ? 168 GLU A CB   2  
ATOM   5713  C  CG   . GLU A 1 168 ? 9.358   31.857 33.428 1.00 0.00 ? 168 GLU A CG   2  
ATOM   5714  C  CD   . GLU A 1 168 ? 8.244   30.962 33.980 1.00 0.00 ? 168 GLU A CD   2  
ATOM   5715  O  OE1  . GLU A 1 168 ? 7.999   31.075 35.170 1.00 0.00 ? 168 GLU A OE1  2  
ATOM   5716  O  OE2  . GLU A 1 168 ? 7.702   30.217 33.182 1.00 0.00 ? 168 GLU A OE2  2  
ATOM   5717  H  H    . GLU A 1 168 ? 12.754  31.489 35.608 1.00 0.00 ? 168 GLU A H    2  
ATOM   5718  H  HA   . GLU A 1 168 ? 11.601  30.287 33.342 1.00 0.00 ? 168 GLU A HA   2  
ATOM   5719  H  HB2  . GLU A 1 168 ? 10.306  31.249 35.261 1.00 0.00 ? 168 GLU A HB2  2  
ATOM   5720  H  HB3  . GLU A 1 168 ? 10.735  32.870 34.734 1.00 0.00 ? 168 GLU A HB3  2  
ATOM   5721  H  HG2  . GLU A 1 168 ? 8.981   32.863 33.307 1.00 0.00 ? 168 GLU A HG2  2  
ATOM   5722  H  HG3  . GLU A 1 168 ? 9.677   31.478 32.467 1.00 0.00 ? 168 GLU A HG3  2  
ATOM   5723  N  N    . LYS A 1 169 ? 12.730  33.302 32.736 1.00 0.00 ? 169 LYS A N    2  
ATOM   5724  C  CA   . LYS A 1 169 ? 13.062  34.216 31.611 1.00 0.00 ? 169 LYS A CA   2  
ATOM   5725  C  C    . LYS A 1 169 ? 13.853  33.505 30.512 1.00 0.00 ? 169 LYS A C    2  
ATOM   5726  O  O    . LYS A 1 169 ? 13.562  33.658 29.342 1.00 0.00 ? 169 LYS A O    2  
ATOM   5727  C  CB   . LYS A 1 169 ? 13.914  35.373 32.160 1.00 0.00 ? 169 LYS A CB   2  
ATOM   5728  C  CG   . LYS A 1 169 ? 13.092  36.158 33.187 1.00 0.00 ? 169 LYS A CG   2  
ATOM   5729  C  CD   . LYS A 1 169 ? 12.201  37.175 32.459 1.00 0.00 ? 169 LYS A CD   2  
ATOM   5730  C  CE   . LYS A 1 169 ? 13.063  38.322 31.918 1.00 0.00 ? 169 LYS A CE   2  
ATOM   5731  N  NZ   . LYS A 1 169 ? 14.195  38.612 32.841 1.00 0.00 ? 169 LYS A NZ   2  
ATOM   5732  H  H    . LYS A 1 169 ? 12.984  33.535 33.655 1.00 0.00 ? 169 LYS A H    2  
ATOM   5733  H  HA   . LYS A 1 169 ? 12.135  34.593 31.183 1.00 0.00 ? 169 LYS A HA   2  
ATOM   5734  H  HB2  . LYS A 1 169 ? 14.803  34.979 32.631 1.00 0.00 ? 169 LYS A HB2  2  
ATOM   5735  H  HB3  . LYS A 1 169 ? 14.203  36.026 31.350 1.00 0.00 ? 169 LYS A HB3  2  
ATOM   5736  H  HG2  . LYS A 1 169 ? 12.474  35.475 33.750 1.00 0.00 ? 169 LYS A HG2  2  
ATOM   5737  H  HG3  . LYS A 1 169 ? 13.755  36.673 33.866 1.00 0.00 ? 169 LYS A HG3  2  
ATOM   5738  H  HD2  . LYS A 1 169 ? 11.690  36.691 31.642 1.00 0.00 ? 169 LYS A HD2  2  
ATOM   5739  H  HD3  . LYS A 1 169 ? 11.468  37.570 33.146 1.00 0.00 ? 169 LYS A HD3  2  
ATOM   5740  H  HE2  . LYS A 1 169 ? 13.459  38.052 30.949 1.00 0.00 ? 169 LYS A HE2  2  
ATOM   5741  H  HE3  . LYS A 1 169 ? 12.458  39.210 31.814 1.00 0.00 ? 169 LYS A HE3  2  
ATOM   5742  H  HZ1  . LYS A 1 169 ? 13.824  38.807 33.793 1.00 0.00 ? 169 LYS A HZ1  2  
ATOM   5743  H  HZ2  . LYS A 1 169 ? 14.831  37.791 32.878 1.00 0.00 ? 169 LYS A HZ2  2  
ATOM   5744  H  HZ3  . LYS A 1 169 ? 14.718  39.442 32.497 1.00 0.00 ? 169 LYS A HZ3  2  
ATOM   5745  N  N    . GLU A 1 170 ? 14.837  32.741 30.900 1.00 0.00 ? 170 GLU A N    2  
ATOM   5746  C  CA   . GLU A 1 170 ? 15.644  32.024 29.878 1.00 0.00 ? 170 GLU A CA   2  
ATOM   5747  C  C    . GLU A 1 170 ? 15.054  30.656 29.550 1.00 0.00 ? 170 GLU A C    2  
ATOM   5748  O  O    . GLU A 1 170 ? 15.078  30.230 28.412 1.00 0.00 ? 170 GLU A O    2  
ATOM   5749  C  CB   . GLU A 1 170 ? 17.058  31.818 30.432 1.00 0.00 ? 170 GLU A CB   2  
ATOM   5750  C  CG   . GLU A 1 170 ? 17.768  33.171 30.542 1.00 0.00 ? 170 GLU A CG   2  
ATOM   5751  C  CD   . GLU A 1 170 ? 16.862  34.167 31.268 1.00 0.00 ? 170 GLU A CD   2  
ATOM   5752  O  OE1  . GLU A 1 170 ? 16.949  34.190 32.485 1.00 0.00 ? 170 GLU A OE1  2  
ATOM   5753  O  OE2  . GLU A 1 170 ? 16.135  34.849 30.565 1.00 0.00 ? 170 GLU A OE2  2  
ATOM   5754  H  H    . GLU A 1 170 ? 15.044  32.643 31.850 1.00 0.00 ? 170 GLU A H    2  
ATOM   5755  H  HA   . GLU A 1 170 ? 15.671  32.623 28.971 1.00 0.00 ? 170 GLU A HA   2  
ATOM   5756  H  HB2  . GLU A 1 170 ? 16.999  31.358 31.405 1.00 0.00 ? 170 GLU A HB2  2  
ATOM   5757  H  HB3  . GLU A 1 170 ? 17.612  31.171 29.768 1.00 0.00 ? 170 GLU A HB3  2  
ATOM   5758  H  HG2  . GLU A 1 170 ? 18.689  33.057 31.096 1.00 0.00 ? 170 GLU A HG2  2  
ATOM   5759  H  HG3  . GLU A 1 170 ? 17.992  33.548 29.554 1.00 0.00 ? 170 GLU A HG3  2  
ATOM   5760  N  N    . PHE A 1 171 ? 14.539  29.989 30.550 1.00 0.00 ? 171 PHE A N    2  
ATOM   5761  C  CA   . PHE A 1 171 ? 13.948  28.647 30.303 1.00 0.00 ? 171 PHE A CA   2  
ATOM   5762  C  C    . PHE A 1 171 ? 13.107  28.654 29.041 1.00 0.00 ? 171 PHE A C    2  
ATOM   5763  O  O    . PHE A 1 171 ? 12.870  27.626 28.440 1.00 0.00 ? 171 PHE A O    2  
ATOM   5764  C  CB   . PHE A 1 171 ? 13.045  28.278 31.489 1.00 0.00 ? 171 PHE A CB   2  
ATOM   5765  C  CG   . PHE A 1 171 ? 12.411  26.909 31.227 1.00 0.00 ? 171 PHE A CG   2  
ATOM   5766  C  CD1  . PHE A 1 171 ? 13.206  25.793 31.032 1.00 0.00 ? 171 PHE A CD1  2  
ATOM   5767  C  CD2  . PHE A 1 171 ? 11.035  26.769 31.179 1.00 0.00 ? 171 PHE A CD2  2  
ATOM   5768  C  CE1  . PHE A 1 171 ? 12.634  24.560 30.793 1.00 0.00 ? 171 PHE A CE1  2  
ATOM   5769  C  CE2  . PHE A 1 171 ? 10.466  25.534 30.941 1.00 0.00 ? 171 PHE A CE2  2  
ATOM   5770  C  CZ   . PHE A 1 171 ? 11.266  24.432 30.749 1.00 0.00 ? 171 PHE A CZ   2  
ATOM   5771  H  H    . PHE A 1 171 ? 14.535  30.373 31.448 1.00 0.00 ? 171 PHE A H    2  
ATOM   5772  H  HA   . PHE A 1 171 ? 14.753  27.920 30.189 1.00 0.00 ? 171 PHE A HA   2  
ATOM   5773  H  HB2  . PHE A 1 171 ? 13.628  28.235 32.396 1.00 0.00 ? 171 PHE A HB2  2  
ATOM   5774  H  HB3  . PHE A 1 171 ? 12.265  29.017 31.599 1.00 0.00 ? 171 PHE A HB3  2  
ATOM   5775  H  HD1  . PHE A 1 171 ? 14.280  25.888 31.065 1.00 0.00 ? 171 PHE A HD1  2  
ATOM   5776  H  HD2  . PHE A 1 171 ? 10.402  27.631 31.327 1.00 0.00 ? 171 PHE A HD2  2  
ATOM   5777  H  HE1  . PHE A 1 171 ? 13.261  23.695 30.640 1.00 0.00 ? 171 PHE A HE1  2  
ATOM   5778  H  HE2  . PHE A 1 171 ? 9.391   25.432 30.910 1.00 0.00 ? 171 PHE A HE2  2  
ATOM   5779  H  HZ   . PHE A 1 171 ? 10.820  23.466 30.560 1.00 0.00 ? 171 PHE A HZ   2  
ATOM   5780  N  N    . ILE A 1 172 ? 12.671  29.817 28.666 1.00 0.00 ? 172 ILE A N    2  
ATOM   5781  C  CA   . ILE A 1 172 ? 11.846  29.928 27.450 1.00 0.00 ? 172 ILE A CA   2  
ATOM   5782  C  C    . ILE A 1 172 ? 12.720  30.160 26.221 1.00 0.00 ? 172 ILE A C    2  
ATOM   5783  O  O    . ILE A 1 172 ? 12.407  29.705 25.136 1.00 0.00 ? 172 ILE A O    2  
ATOM   5784  C  CB   . ILE A 1 172 ? 10.913  31.121 27.631 1.00 0.00 ? 172 ILE A CB   2  
ATOM   5785  C  CG1  . ILE A 1 172 ? 10.095  30.938 28.902 1.00 0.00 ? 172 ILE A CG1  2  
ATOM   5786  C  CG2  . ILE A 1 172 ? 9.948   31.179 26.438 1.00 0.00 ? 172 ILE A CG2  2  
ATOM   5787  C  CD1  . ILE A 1 172 ? 9.482   32.283 29.312 1.00 0.00 ? 172 ILE A CD1  2  
ATOM   5788  H  H    . ILE A 1 172 ? 12.889  30.617 29.187 1.00 0.00 ? 172 ILE A H    2  
ATOM   5789  H  HA   . ILE A 1 172 ? 11.279  29.007 27.317 1.00 0.00 ? 172 ILE A HA   2  
ATOM   5790  H  HB   . ILE A 1 172 ? 11.507  32.033 27.706 1.00 0.00 ? 172 ILE A HB   2  
ATOM   5791  H  HG12 . ILE A 1 172 ? 9.308   30.220 28.727 1.00 0.00 ? 172 ILE A HG12 2  
ATOM   5792  H  HG13 . ILE A 1 172 ? 10.733  30.575 29.694 1.00 0.00 ? 172 ILE A HG13 2  
ATOM   5793  H  HG21 . ILE A 1 172 ? 10.500  31.078 25.516 1.00 0.00 ? 172 ILE A HG21 2  
ATOM   5794  H  HG22 . ILE A 1 172 ? 9.229   30.376 26.511 1.00 0.00 ? 172 ILE A HG22 2  
ATOM   5795  H  HG23 . ILE A 1 172 ? 9.426   32.124 26.438 1.00 0.00 ? 172 ILE A HG23 2  
ATOM   5796  H  HD11 . ILE A 1 172 ? 10.137  33.090 29.019 1.00 0.00 ? 172 ILE A HD11 2  
ATOM   5797  H  HD12 . ILE A 1 172 ? 8.525   32.408 28.827 1.00 0.00 ? 172 ILE A HD12 2  
ATOM   5798  H  HD13 . ILE A 1 172 ? 9.343   32.308 30.382 1.00 0.00 ? 172 ILE A HD13 2  
ATOM   5799  N  N    . GLU A 1 173 ? 13.812  30.854 26.411 1.00 0.00 ? 173 GLU A N    2  
ATOM   5800  C  CA   . GLU A 1 173 ? 14.705  31.115 25.261 1.00 0.00 ? 173 GLU A CA   2  
ATOM   5801  C  C    . GLU A 1 173 ? 15.686  29.976 25.075 1.00 0.00 ? 173 GLU A C    2  
ATOM   5802  O  O    . GLU A 1 173 ? 15.837  29.458 23.986 1.00 0.00 ? 173 GLU A O    2  
ATOM   5803  C  CB   . GLU A 1 173 ? 15.493  32.396 25.534 1.00 0.00 ? 173 GLU A CB   2  
ATOM   5804  C  CG   . GLU A 1 173 ? 14.514  33.546 25.778 1.00 0.00 ? 173 GLU A CG   2  
ATOM   5805  C  CD   . GLU A 1 173 ? 15.154  34.861 25.326 1.00 0.00 ? 173 GLU A CD   2  
ATOM   5806  O  OE1  . GLU A 1 173 ? 16.355  34.838 25.119 1.00 0.00 ? 173 GLU A OE1  2  
ATOM   5807  O  OE2  . GLU A 1 173 ? 14.402  35.817 25.214 1.00 0.00 ? 173 GLU A OE2  2  
ATOM   5808  H  H    . GLU A 1 173 ? 14.041  31.190 27.306 1.00 0.00 ? 173 GLU A H    2  
ATOM   5809  H  HA   . GLU A 1 173 ? 14.102  31.216 24.361 1.00 0.00 ? 173 GLU A HA   2  
ATOM   5810  H  HB2  . GLU A 1 173 ? 16.117  32.256 26.403 1.00 0.00 ? 173 GLU A HB2  2  
ATOM   5811  H  HB3  . GLU A 1 173 ? 16.117  32.623 24.683 1.00 0.00 ? 173 GLU A HB3  2  
ATOM   5812  H  HG2  . GLU A 1 173 ? 13.607  33.379 25.217 1.00 0.00 ? 173 GLU A HG2  2  
ATOM   5813  H  HG3  . GLU A 1 173 ? 14.278  33.608 26.830 1.00 0.00 ? 173 GLU A HG3  2  
ATOM   5814  N  N    . GLY A 1 174 ? 16.346  29.610 26.146 1.00 0.00 ? 174 GLY A N    2  
ATOM   5815  C  CA   . GLY A 1 174 ? 17.329  28.497 26.054 1.00 0.00 ? 174 GLY A CA   2  
ATOM   5816  C  C    . GLY A 1 174 ? 16.755  27.373 25.203 1.00 0.00 ? 174 GLY A C    2  
ATOM   5817  O  O    . GLY A 1 174 ? 17.482  26.576 24.645 1.00 0.00 ? 174 GLY A O    2  
ATOM   5818  H  H    . GLY A 1 174 ? 16.195  30.066 27.000 1.00 0.00 ? 174 GLY A H    2  
ATOM   5819  H  HA2  . GLY A 1 174 ? 18.240  28.860 25.603 1.00 0.00 ? 174 GLY A HA2  2  
ATOM   5820  H  HA3  . GLY A 1 174 ? 17.542  28.124 27.044 1.00 0.00 ? 174 GLY A HA3  2  
ATOM   5821  N  N    . THR A 1 175 ? 15.450  27.341 25.117 1.00 0.00 ? 175 THR A N    2  
ATOM   5822  C  CA   . THR A 1 175 ? 14.794  26.300 24.322 1.00 0.00 ? 175 THR A CA   2  
ATOM   5823  C  C    . THR A 1 175 ? 14.378  26.855 22.962 1.00 0.00 ? 175 THR A C    2  
ATOM   5824  O  O    . THR A 1 175 ? 14.353  26.139 21.981 1.00 0.00 ? 175 THR A O    2  
ATOM   5825  C  CB   . THR A 1 175 ? 13.544  25.868 25.076 1.00 0.00 ? 175 THR A CB   2  
ATOM   5826  O  OG1  . THR A 1 175 ? 13.576  26.587 26.293 1.00 0.00 ? 175 THR A OG1  2  
ATOM   5827  C  CG2  . THR A 1 175 ? 13.625  24.396 25.498 1.00 0.00 ? 175 THR A CG2  2  
ATOM   5828  H  H    . THR A 1 175 ? 14.908  28.006 25.586 1.00 0.00 ? 175 THR A H    2  
ATOM   5829  H  HA   . THR A 1 175 ? 15.474  25.463 24.180 1.00 0.00 ? 175 THR A HA   2  
ATOM   5830  H  HB   . THR A 1 175 ? 12.654  26.097 24.523 1.00 0.00 ? 175 THR A HB   2  
ATOM   5831  H  HG1  . THR A 1 175 ? 12.748  26.430 26.752 1.00 0.00 ? 175 THR A HG1  2  
ATOM   5832  H  HG21 . THR A 1 175 ? 14.647  24.138 25.723 1.00 0.00 ? 175 THR A HG21 2  
ATOM   5833  H  HG22 . THR A 1 175 ? 13.017  24.235 26.377 1.00 0.00 ? 175 THR A HG22 2  
ATOM   5834  H  HG23 . THR A 1 175 ? 13.264  23.768 24.696 1.00 0.00 ? 175 THR A HG23 2  
ATOM   5835  N  N    . LEU A 1 176 ? 14.055  28.129 22.929 1.00 0.00 ? 176 LEU A N    2  
ATOM   5836  C  CA   . LEU A 1 176 ? 13.642  28.739 21.642 1.00 0.00 ? 176 LEU A CA   2  
ATOM   5837  C  C    . LEU A 1 176 ? 14.789  28.730 20.638 1.00 0.00 ? 176 LEU A C    2  
ATOM   5838  O  O    . LEU A 1 176 ? 14.575  28.821 19.445 1.00 0.00 ? 176 LEU A O    2  
ATOM   5839  C  CB   . LEU A 1 176 ? 13.233  30.193 21.913 1.00 0.00 ? 176 LEU A CB   2  
ATOM   5840  C  CG   . LEU A 1 176 ? 12.308  30.670 20.798 1.00 0.00 ? 176 LEU A CG   2  
ATOM   5841  C  CD1  . LEU A 1 176 ? 10.865  30.316 21.159 1.00 0.00 ? 176 LEU A CD1  2  
ATOM   5842  C  CD2  . LEU A 1 176 ? 12.437  32.187 20.656 1.00 0.00 ? 176 LEU A CD2  2  
ATOM   5843  H  H    . LEU A 1 176 ? 14.084  28.677 23.752 1.00 0.00 ? 176 LEU A H    2  
ATOM   5844  H  HA   . LEU A 1 176 ? 12.806  28.172 21.232 1.00 0.00 ? 176 LEU A HA   2  
ATOM   5845  H  HB2  . LEU A 1 176 ? 12.720  30.254 22.860 1.00 0.00 ? 176 LEU A HB2  2  
ATOM   5846  H  HB3  . LEU A 1 176 ? 14.113  30.817 21.947 1.00 0.00 ? 176 LEU A HB3  2  
ATOM   5847  H  HG   . LEU A 1 176 ? 12.580  30.192 19.868 1.00 0.00 ? 176 LEU A HG   2  
ATOM   5848  H  HD11 . LEU A 1 176 ? 10.651  30.645 22.166 1.00 0.00 ? 176 LEU A HD11 2  
ATOM   5849  H  HD12 . LEU A 1 176 ? 10.189  30.802 20.473 1.00 0.00 ? 176 LEU A HD12 2  
ATOM   5850  H  HD13 . LEU A 1 176 ? 10.726  29.247 21.098 1.00 0.00 ? 176 LEU A HD13 2  
ATOM   5851  H  HD21 . LEU A 1 176 ? 13.479  32.458 20.576 1.00 0.00 ? 176 LEU A HD21 2  
ATOM   5852  H  HD22 . LEU A 1 176 ? 11.914  32.515 19.770 1.00 0.00 ? 176 LEU A HD22 2  
ATOM   5853  H  HD23 . LEU A 1 176 ? 12.010  32.671 21.522 1.00 0.00 ? 176 LEU A HD23 2  
ATOM   5854  N  N    . ALA A 1 177 ? 15.989  28.617 21.138 1.00 0.00 ? 177 ALA A N    2  
ATOM   5855  C  CA   . ALA A 1 177 ? 17.161  28.600 20.227 1.00 0.00 ? 177 ALA A CA   2  
ATOM   5856  C  C    . ALA A 1 177 ? 17.030  27.489 19.191 1.00 0.00 ? 177 ALA A C    2  
ATOM   5857  O  O    . ALA A 1 177 ? 16.526  27.704 18.106 1.00 0.00 ? 177 ALA A O    2  
ATOM   5858  C  CB   . ALA A 1 177 ? 18.423  28.347 21.067 1.00 0.00 ? 177 ALA A CB   2  
ATOM   5859  H  H    . ALA A 1 177 ? 16.116  28.542 22.107 1.00 0.00 ? 177 ALA A H    2  
ATOM   5860  H  HA   . ALA A 1 177 ? 17.224  29.559 19.713 1.00 0.00 ? 177 ALA A HA   2  
ATOM   5861  H  HB1  . ALA A 1 177 ? 18.535  29.132 21.800 1.00 0.00 ? 177 ALA A HB1  2  
ATOM   5862  H  HB2  . ALA A 1 177 ? 18.339  27.397 21.574 1.00 0.00 ? 177 ALA A HB2  2  
ATOM   5863  H  HB3  . ALA A 1 177 ? 19.292  28.332 20.425 1.00 0.00 ? 177 ALA A HB3  2  
ATOM   5864  N  N    . ASN A 1 178 ? 17.491  26.320 19.544 1.00 0.00 ? 178 ASN A N    2  
ATOM   5865  C  CA   . ASN A 1 178 ? 17.403  25.184 18.594 1.00 0.00 ? 178 ASN A CA   2  
ATOM   5866  C  C    . ASN A 1 178 ? 16.075  24.454 18.741 1.00 0.00 ? 178 ASN A C    2  
ATOM   5867  O  O    . ASN A 1 178 ? 15.742  23.977 19.808 1.00 0.00 ? 178 ASN A O    2  
ATOM   5868  C  CB   . ASN A 1 178 ? 18.539  24.200 18.910 1.00 0.00 ? 178 ASN A CB   2  
ATOM   5869  C  CG   . ASN A 1 178 ? 19.827  24.980 19.177 1.00 0.00 ? 178 ASN A CG   2  
ATOM   5870  O  OD1  . ASN A 1 178 ? 20.007  25.562 20.229 1.00 0.00 ? 178 ASN A OD1  2  
ATOM   5871  N  ND2  . ASN A 1 178 ? 20.748  25.018 18.254 1.00 0.00 ? 178 ASN A ND2  2  
ATOM   5872  H  H    . ASN A 1 178 ? 17.892  26.194 20.428 1.00 0.00 ? 178 ASN A H    2  
ATOM   5873  H  HA   . ASN A 1 178 ? 17.490  25.562 17.577 1.00 0.00 ? 178 ASN A HA   2  
ATOM   5874  H  HB2  . ASN A 1 178 ? 18.286  23.618 19.784 1.00 0.00 ? 178 ASN A HB2  2  
ATOM   5875  H  HB3  . ASN A 1 178 ? 18.692  23.536 18.071 1.00 0.00 ? 178 ASN A HB3  2  
ATOM   5876  H  HD21 . ASN A 1 178 ? 20.610  24.550 17.404 1.00 0.00 ? 178 ASN A HD21 2  
ATOM   5877  H  HD22 . ASN A 1 178 ? 21.578  25.513 18.411 1.00 0.00 ? 178 ASN A HD22 2  
ATOM   5878  N  N    . LYS A 1 179 ? 15.340  24.379 17.667 1.00 0.00 ? 179 LYS A N    2  
ATOM   5879  C  CA   . LYS A 1 179 ? 14.035  23.683 17.731 1.00 0.00 ? 179 LYS A CA   2  
ATOM   5880  C  C    . LYS A 1 179 ? 14.232  22.223 18.106 1.00 0.00 ? 179 LYS A C    2  
ATOM   5881  O  O    . LYS A 1 179 ? 13.302  21.547 18.501 1.00 0.00 ? 179 LYS A O    2  
ATOM   5882  C  CB   . LYS A 1 179 ? 13.382  23.749 16.342 1.00 0.00 ? 179 LYS A CB   2  
ATOM   5883  C  CG   . LYS A 1 179 ? 12.410  24.929 16.299 1.00 0.00 ? 179 LYS A CG   2  
ATOM   5884  C  CD   . LYS A 1 179 ? 13.198  26.234 16.435 1.00 0.00 ? 179 LYS A CD   2  
ATOM   5885  C  CE   . LYS A 1 179 ? 14.123  26.389 15.226 1.00 0.00 ? 179 LYS A CE   2  
ATOM   5886  N  NZ   . LYS A 1 179 ? 14.401  27.828 14.963 1.00 0.00 ? 179 LYS A NZ   2  
ATOM   5887  H  H    . LYS A 1 179 ? 15.649  24.778 16.827 1.00 0.00 ? 179 LYS A H    2  
ATOM   5888  H  HA   . LYS A 1 179 ? 13.408  24.164 18.481 1.00 0.00 ? 179 LYS A HA   2  
ATOM   5889  H  HB2  . LYS A 1 179 ? 14.144  23.878 15.588 1.00 0.00 ? 179 LYS A HB2  2  
ATOM   5890  H  HB3  . LYS A 1 179 ? 12.846  22.831 16.150 1.00 0.00 ? 179 LYS A HB3  2  
ATOM   5891  H  HG2  . LYS A 1 179 ? 11.876  24.924 15.361 1.00 0.00 ? 179 LYS A HG2  2  
ATOM   5892  H  HG3  . LYS A 1 179 ? 11.702  24.847 17.111 1.00 0.00 ? 179 LYS A HG3  2  
ATOM   5893  H  HD2  . LYS A 1 179 ? 12.514  27.068 16.476 1.00 0.00 ? 179 LYS A HD2  2  
ATOM   5894  H  HD3  . LYS A 1 179 ? 13.785  26.212 17.340 1.00 0.00 ? 179 LYS A HD3  2  
ATOM   5895  H  HE2  . LYS A 1 179 ? 15.056  25.879 15.418 1.00 0.00 ? 179 LYS A HE2  2  
ATOM   5896  H  HE3  . LYS A 1 179 ? 13.656  25.954 14.355 1.00 0.00 ? 179 LYS A HE3  2  
ATOM   5897  H  HZ1  . LYS A 1 179 ? 14.755  28.278 15.833 1.00 0.00 ? 179 LYS A HZ1  2  
ATOM   5898  H  HZ2  . LYS A 1 179 ? 15.115  27.913 14.213 1.00 0.00 ? 179 LYS A HZ2  2  
ATOM   5899  H  HZ3  . LYS A 1 179 ? 13.524  28.301 14.662 1.00 0.00 ? 179 LYS A HZ3  2  
ATOM   5900  N  N    . GLU A 1 180 ? 15.446  21.764 17.975 1.00 0.00 ? 180 GLU A N    2  
ATOM   5901  C  CA   . GLU A 1 180 ? 15.736  20.352 18.316 1.00 0.00 ? 180 GLU A CA   2  
ATOM   5902  C  C    . GLU A 1 180 ? 15.780  20.154 19.825 1.00 0.00 ? 180 GLU A C    2  
ATOM   5903  O  O    . GLU A 1 180 ? 15.861  19.042 20.305 1.00 0.00 ? 180 GLU A O    2  
ATOM   5904  C  CB   . GLU A 1 180 ? 17.109  19.993 17.731 1.00 0.00 ? 180 GLU A CB   2  
ATOM   5905  C  CG   . GLU A 1 180 ? 17.128  20.349 16.243 1.00 0.00 ? 180 GLU A CG   2  
ATOM   5906  C  CD   . GLU A 1 180 ? 18.559  20.231 15.711 1.00 0.00 ? 180 GLU A CD   2  
ATOM   5907  O  OE1  . GLU A 1 180 ? 18.952  19.102 15.466 1.00 0.00 ? 180 GLU A OE1  2  
ATOM   5908  O  OE2  . GLU A 1 180 ? 19.177  21.275 15.582 1.00 0.00 ? 180 GLU A OE2  2  
ATOM   5909  H  H    . GLU A 1 180 ? 16.161  22.351 17.652 1.00 0.00 ? 180 GLU A H    2  
ATOM   5910  H  HA   . GLU A 1 180 ? 14.958  19.716 17.896 1.00 0.00 ? 180 GLU A HA   2  
ATOM   5911  H  HB2  . GLU A 1 180 ? 17.879  20.548 18.247 1.00 0.00 ? 180 GLU A HB2  2  
ATOM   5912  H  HB3  . GLU A 1 180 ? 17.292  18.936 17.854 1.00 0.00 ? 180 GLU A HB3  2  
ATOM   5913  H  HG2  . GLU A 1 180 ? 16.487  19.674 15.697 1.00 0.00 ? 180 GLU A HG2  2  
ATOM   5914  H  HG3  . GLU A 1 180 ? 16.779  21.363 16.105 1.00 0.00 ? 180 GLU A HG3  2  
ATOM   5915  N  N    . ILE A 1 181 ? 15.732  21.237 20.548 1.00 0.00 ? 181 ILE A N    2  
ATOM   5916  C  CA   . ILE A 1 181 ? 15.769  21.126 22.027 1.00 0.00 ? 181 ILE A CA   2  
ATOM   5917  C  C    . ILE A 1 181 ? 14.355  21.010 22.585 1.00 0.00 ? 181 ILE A C    2  
ATOM   5918  O  O    . ILE A 1 181 ? 14.150  20.489 23.663 1.00 0.00 ? 181 ILE A O    2  
ATOM   5919  C  CB   . ILE A 1 181 ? 16.435  22.393 22.588 1.00 0.00 ? 181 ILE A CB   2  
ATOM   5920  C  CG1  . ILE A 1 181 ? 17.946  22.288 22.424 1.00 0.00 ? 181 ILE A CG1  2  
ATOM   5921  C  CG2  . ILE A 1 181 ? 16.119  22.506 24.091 1.00 0.00 ? 181 ILE A CG2  2  
ATOM   5922  C  CD1  . ILE A 1 181 ? 18.597  23.590 22.893 1.00 0.00 ? 181 ILE A CD1  2  
ATOM   5923  H  H    . ILE A 1 181 ? 15.668  22.115 20.118 1.00 0.00 ? 181 ILE A H    2  
ATOM   5924  H  HA   . ILE A 1 181 ? 16.334  20.236 22.302 1.00 0.00 ? 181 ILE A HA   2  
ATOM   5925  H  HB   . ILE A 1 181 ? 16.068  23.269 22.044 1.00 0.00 ? 181 ILE A HB   2  
ATOM   5926  H  HG12 . ILE A 1 181 ? 18.320  21.463 23.016 1.00 0.00 ? 181 ILE A HG12 2  
ATOM   5927  H  HG13 . ILE A 1 181 ? 18.189  22.116 21.386 1.00 0.00 ? 181 ILE A HG13 2  
ATOM   5928  H  HG21 . ILE A 1 181 ? 16.457  21.619 24.604 1.00 0.00 ? 181 ILE A HG21 2  
ATOM   5929  H  HG22 . ILE A 1 181 ? 16.621  23.370 24.504 1.00 0.00 ? 181 ILE A HG22 2  
ATOM   5930  H  HG23 . ILE A 1 181 ? 15.058  22.615 24.234 1.00 0.00 ? 181 ILE A HG23 2  
ATOM   5931  H  HD11 . ILE A 1 181 ? 17.852  24.369 22.957 1.00 0.00 ? 181 ILE A HD11 2  
ATOM   5932  H  HD12 . ILE A 1 181 ? 19.042  23.443 23.866 1.00 0.00 ? 181 ILE A HD12 2  
ATOM   5933  H  HD13 . ILE A 1 181 ? 19.365  23.888 22.194 1.00 0.00 ? 181 ILE A HD13 2  
ATOM   5934  N  N    . LEU A 1 182 ? 13.405  21.496 21.835 1.00 0.00 ? 182 LEU A N    2  
ATOM   5935  C  CA   . LEU A 1 182 ? 11.999  21.425 22.299 1.00 0.00 ? 182 LEU A CA   2  
ATOM   5936  C  C    . LEU A 1 182 ? 11.444  20.011 22.156 1.00 0.00 ? 182 LEU A C    2  
ATOM   5937  O  O    . LEU A 1 182 ? 10.984  19.422 23.113 1.00 0.00 ? 182 LEU A O    2  
ATOM   5938  C  CB   . LEU A 1 182 ? 11.159  22.377 21.431 1.00 0.00 ? 182 LEU A CB   2  
ATOM   5939  C  CG   . LEU A 1 182 ? 9.695   22.296 21.867 1.00 0.00 ? 182 LEU A CG   2  
ATOM   5940  C  CD1  . LEU A 1 182 ? 9.568   22.805 23.304 1.00 0.00 ? 182 LEU A CD1  2  
ATOM   5941  C  CD2  . LEU A 1 182 ? 8.846   23.175 20.945 1.00 0.00 ? 182 LEU A CD2  2  
ATOM   5942  H  H    . LEU A 1 182 ? 13.620  21.906 20.971 1.00 0.00 ? 182 LEU A H    2  
ATOM   5943  H  HA   . LEU A 1 182 ? 11.957  21.719 23.347 1.00 0.00 ? 182 LEU A HA   2  
ATOM   5944  H  HB2  . LEU A 1 182 ? 11.518  23.390 21.551 1.00 0.00 ? 182 LEU A HB2  2  
ATOM   5945  H  HB3  . LEU A 1 182 ? 11.245  22.092 20.393 1.00 0.00 ? 182 LEU A HB3  2  
ATOM   5946  H  HG   . LEU A 1 182 ? 9.354   21.273 21.811 1.00 0.00 ? 182 LEU A HG   2  
ATOM   5947  H  HD11 . LEU A 1 182 ? 10.299  23.579 23.482 1.00 0.00 ? 182 LEU A HD11 2  
ATOM   5948  H  HD12 . LEU A 1 182 ? 8.579   23.207 23.462 1.00 0.00 ? 182 LEU A HD12 2  
ATOM   5949  H  HD13 . LEU A 1 182 ? 9.736   21.992 23.995 1.00 0.00 ? 182 LEU A HD13 2  
ATOM   5950  H  HD21 . LEU A 1 182 ? 9.317   23.246 19.976 1.00 0.00 ? 182 LEU A HD21 2  
ATOM   5951  H  HD22 . LEU A 1 182 ? 7.863   22.743 20.832 1.00 0.00 ? 182 LEU A HD22 2  
ATOM   5952  H  HD23 . LEU A 1 182 ? 8.753   24.164 21.368 1.00 0.00 ? 182 LEU A HD23 2  
ATOM   5953  N  N    . ARG A 1 183 ? 11.498  19.494 20.959 1.00 0.00 ? 183 ARG A N    2  
ATOM   5954  C  CA   . ARG A 1 183 ? 10.978  18.122 20.730 1.00 0.00 ? 183 ARG A CA   2  
ATOM   5955  C  C    . ARG A 1 183 ? 11.775  17.085 21.518 1.00 0.00 ? 183 ARG A C    2  
ATOM   5956  O  O    . ARG A 1 183 ? 11.408  15.927 21.566 1.00 0.00 ? 183 ARG A O    2  
ATOM   5957  C  CB   . ARG A 1 183 ? 11.106  17.808 19.232 1.00 0.00 ? 183 ARG A CB   2  
ATOM   5958  C  CG   . ARG A 1 183 ? 9.885   17.008 18.777 1.00 0.00 ? 183 ARG A CG   2  
ATOM   5959  C  CD   . ARG A 1 183 ? 8.752   17.976 18.425 1.00 0.00 ? 183 ARG A CD   2  
ATOM   5960  N  NE   . ARG A 1 183 ? 8.184   18.539 19.681 1.00 0.00 ? 183 ARG A NE   2  
ATOM   5961  C  CZ   . ARG A 1 183 ? 8.076   19.832 19.813 1.00 0.00 ? 183 ARG A CZ   2  
ATOM   5962  N  NH1  . ARG A 1 183 ? 9.030   20.597 19.354 1.00 0.00 ? 183 ARG A NH1  2  
ATOM   5963  N  NH2  . ARG A 1 183 ? 7.015   20.319 20.397 1.00 0.00 ? 183 ARG A NH2  2  
ATOM   5964  H  H    . ARG A 1 183 ? 11.880  20.007 20.217 1.00 0.00 ? 183 ARG A H    2  
ATOM   5965  H  HA   . ARG A 1 183 ? 9.937   18.082 21.044 1.00 0.00 ? 183 ARG A HA   2  
ATOM   5966  H  HB2  . ARG A 1 183 ? 11.166  18.731 18.673 1.00 0.00 ? 183 ARG A HB2  2  
ATOM   5967  H  HB3  . ARG A 1 183 ? 12.003  17.231 19.059 1.00 0.00 ? 183 ARG A HB3  2  
ATOM   5968  H  HG2  . ARG A 1 183 ? 10.140  16.418 17.910 1.00 0.00 ? 183 ARG A HG2  2  
ATOM   5969  H  HG3  . ARG A 1 183 ? 9.566   16.350 19.573 1.00 0.00 ? 183 ARG A HG3  2  
ATOM   5970  H  HD2  . ARG A 1 183 ? 9.132   18.779 17.811 1.00 0.00 ? 183 ARG A HD2  2  
ATOM   5971  H  HD3  . ARG A 1 183 ? 7.976   17.453 17.886 1.00 0.00 ? 183 ARG A HD3  2  
ATOM   5972  H  HE   . ARG A 1 183 ? 7.895   17.942 20.401 1.00 0.00 ? 183 ARG A HE   2  
ATOM   5973  H  HH11 . ARG A 1 183 ? 9.828   20.189 18.911 1.00 0.00 ? 183 ARG A HH11 2  
ATOM   5974  H  HH12 . ARG A 1 183 ? 8.964   21.592 19.447 1.00 0.00 ? 183 ARG A HH12 2  
ATOM   5975  H  HH21 . ARG A 1 183 ? 6.303   19.703 20.736 1.00 0.00 ? 183 ARG A HH21 2  
ATOM   5976  H  HH22 . ARG A 1 183 ? 6.915   21.308 20.509 1.00 0.00 ? 183 ARG A HH22 2  
ATOM   5977  N  N    . LEU A 1 184 ? 12.851  17.514 22.121 1.00 0.00 ? 184 LEU A N    2  
ATOM   5978  C  CA   . LEU A 1 184 ? 13.672  16.569 22.904 1.00 0.00 ? 184 LEU A CA   2  
ATOM   5979  C  C    . LEU A 1 184 ? 13.267  16.560 24.375 1.00 0.00 ? 184 LEU A C    2  
ATOM   5980  O  O    . LEU A 1 184 ? 12.660  15.619 24.849 1.00 0.00 ? 184 LEU A O    2  
ATOM   5981  C  CB   . LEU A 1 184 ? 15.128  17.024 22.798 1.00 0.00 ? 184 LEU A CB   2  
ATOM   5982  C  CG   . LEU A 1 184 ? 16.041  15.902 23.263 1.00 0.00 ? 184 LEU A CG   2  
ATOM   5983  C  CD1  . LEU A 1 184 ? 15.812  14.674 22.383 1.00 0.00 ? 184 LEU A CD1  2  
ATOM   5984  C  CD2  . LEU A 1 184 ? 17.490  16.361 23.129 1.00 0.00 ? 184 LEU A CD2  2  
ATOM   5985  H  H    . LEU A 1 184 ? 13.121  18.448 22.046 1.00 0.00 ? 184 LEU A H    2  
ATOM   5986  H  HA   . LEU A 1 184 ? 13.548  15.569 22.495 1.00 0.00 ? 184 LEU A HA   2  
ATOM   5987  H  HB2  . LEU A 1 184 ? 15.355  17.272 21.773 1.00 0.00 ? 184 LEU A HB2  2  
ATOM   5988  H  HB3  . LEU A 1 184 ? 15.281  17.897 23.415 1.00 0.00 ? 184 LEU A HB3  2  
ATOM   5989  H  HG   . LEU A 1 184 ? 15.828  15.660 24.294 1.00 0.00 ? 184 LEU A HG   2  
ATOM   5990  H  HD11 . LEU A 1 184 ? 15.399  14.979 21.433 1.00 0.00 ? 184 LEU A HD11 2  
ATOM   5991  H  HD12 . LEU A 1 184 ? 16.747  14.163 22.217 1.00 0.00 ? 184 LEU A HD12 2  
ATOM   5992  H  HD13 . LEU A 1 184 ? 15.120  14.001 22.870 1.00 0.00 ? 184 LEU A HD13 2  
ATOM   5993  H  HD21 . LEU A 1 184 ? 17.642  17.261 23.708 1.00 0.00 ? 184 LEU A HD21 2  
ATOM   5994  H  HD22 . LEU A 1 184 ? 18.152  15.590 23.490 1.00 0.00 ? 184 LEU A HD22 2  
ATOM   5995  H  HD23 . LEU A 1 184 ? 17.712  16.566 22.091 1.00 0.00 ? 184 LEU A HD23 2  
ATOM   5996  N  N    . ILE A 1 185 ? 13.610  17.611 25.072 1.00 0.00 ? 185 ILE A N    2  
ATOM   5997  C  CA   . ILE A 1 185 ? 13.256  17.682 26.512 1.00 0.00 ? 185 ILE A CA   2  
ATOM   5998  C  C    . ILE A 1 185 ? 11.753  17.527 26.724 1.00 0.00 ? 185 ILE A C    2  
ATOM   5999  O  O    . ILE A 1 185 ? 11.268  17.633 27.833 1.00 0.00 ? 185 ILE A O    2  
ATOM   6000  C  CB   . ILE A 1 185 ? 13.689  19.049 27.049 1.00 0.00 ? 185 ILE A CB   2  
ATOM   6001  C  CG1  . ILE A 1 185 ? 12.994  20.154 26.265 1.00 0.00 ? 185 ILE A CG1  2  
ATOM   6002  C  CG2  . ILE A 1 185 ? 15.210  19.193 26.854 1.00 0.00 ? 185 ILE A CG2  2  
ATOM   6003  C  CD1  . ILE A 1 185 ? 11.876  20.752 27.122 1.00 0.00 ? 185 ILE A CD1  2  
ATOM   6004  H  H    . ILE A 1 185 ? 14.098  18.346 24.648 1.00 0.00 ? 185 ILE A H    2  
ATOM   6005  H  HA   . ILE A 1 185 ? 13.771  16.881 27.043 1.00 0.00 ? 185 ILE A HA   2  
ATOM   6006  H  HB   . ILE A 1 185 ? 13.420  19.127 28.104 1.00 0.00 ? 185 ILE A HB   2  
ATOM   6007  H  HG12 . ILE A 1 185 ? 13.707  20.925 26.012 1.00 0.00 ? 185 ILE A HG12 2  
ATOM   6008  H  HG13 . ILE A 1 185 ? 12.576  19.747 25.357 1.00 0.00 ? 185 ILE A HG13 2  
ATOM   6009  H  HG21 . ILE A 1 185 ? 15.712  18.325 27.255 1.00 0.00 ? 185 ILE A HG21 2  
ATOM   6010  H  HG22 . ILE A 1 185 ? 15.437  19.282 25.803 1.00 0.00 ? 185 ILE A HG22 2  
ATOM   6011  H  HG23 . ILE A 1 185 ? 15.561  20.075 27.370 1.00 0.00 ? 185 ILE A HG23 2  
ATOM   6012  H  HD11 . ILE A 1 185 ? 12.265  21.017 28.095 1.00 0.00 ? 185 ILE A HD11 2  
ATOM   6013  H  HD12 . ILE A 1 185 ? 11.482  21.636 26.644 1.00 0.00 ? 185 ILE A HD12 2  
ATOM   6014  H  HD13 . ILE A 1 185 ? 11.082  20.028 27.242 1.00 0.00 ? 185 ILE A HD13 2  
ATOM   6015  N  N    . GLN A 1 186 ? 11.042  17.277 25.659 1.00 0.00 ? 186 GLN A N    2  
ATOM   6016  C  CA   . GLN A 1 186 ? 9.574   17.112 25.791 1.00 0.00 ? 186 GLN A CA   2  
ATOM   6017  C  C    . GLN A 1 186 ? 9.245   15.825 26.536 1.00 0.00 ? 186 GLN A C    2  
ATOM   6018  O  O    . GLN A 1 186 ? 9.741   14.769 26.201 1.00 0.00 ? 186 GLN A O    2  
ATOM   6019  C  CB   . GLN A 1 186 ? 8.967   17.038 24.381 1.00 0.00 ? 186 GLN A CB   2  
ATOM   6020  C  CG   . GLN A 1 186 ? 7.441   17.043 24.491 1.00 0.00 ? 186 GLN A CG   2  
ATOM   6021  C  CD   . GLN A 1 186 ? 6.840   17.421 23.135 1.00 0.00 ? 186 GLN A CD   2  
ATOM   6022  O  OE1  . GLN A 1 186 ? 5.909   16.800 22.662 1.00 0.00 ? 186 GLN A OE1  2  
ATOM   6023  N  NE2  . GLN A 1 186 ? 7.344   18.429 22.476 1.00 0.00 ? 186 GLN A NE2  2  
ATOM   6024  H  H    . GLN A 1 186 ? 11.473  17.195 24.784 1.00 0.00 ? 186 GLN A H    2  
ATOM   6025  H  HA   . GLN A 1 186 ? 9.169   17.959 26.344 1.00 0.00 ? 186 GLN A HA   2  
ATOM   6026  H  HB2  . GLN A 1 186 ? 9.292   17.887 23.801 1.00 0.00 ? 186 GLN A HB2  2  
ATOM   6027  H  HB3  . GLN A 1 186 ? 9.292   16.130 23.894 1.00 0.00 ? 186 GLN A HB3  2  
ATOM   6028  H  HG2  . GLN A 1 186 ? 7.090   16.062 24.777 1.00 0.00 ? 186 GLN A HG2  2  
ATOM   6029  H  HG3  . GLN A 1 186 ? 7.129   17.765 25.232 1.00 0.00 ? 186 GLN A HG3  2  
ATOM   6030  H  HE21 . GLN A 1 186 ? 8.096   18.933 22.853 1.00 0.00 ? 186 GLN A HE21 2  
ATOM   6031  H  HE22 . GLN A 1 186 ? 6.970   18.682 21.607 1.00 0.00 ? 186 GLN A HE22 2  
ATOM   6032  N  N    . PHE A 1 187 ? 8.413   15.933 27.538 1.00 0.00 ? 187 PHE A N    2  
ATOM   6033  C  CA   . PHE A 1 187 ? 8.048   14.719 28.311 1.00 0.00 ? 187 PHE A CA   2  
ATOM   6034  C  C    . PHE A 1 187 ? 7.400   13.677 27.407 1.00 0.00 ? 187 PHE A C    2  
ATOM   6035  O  O    . PHE A 1 187 ? 6.248   13.799 27.039 1.00 0.00 ? 187 PHE A O    2  
ATOM   6036  C  CB   . PHE A 1 187 ? 7.048   15.119 29.411 1.00 0.00 ? 187 PHE A CB   2  
ATOM   6037  C  CG   . PHE A 1 187 ? 6.719   16.606 29.281 1.00 0.00 ? 187 PHE A CG   2  
ATOM   6038  C  CD1  . PHE A 1 187 ? 7.659   17.565 29.617 1.00 0.00 ? 187 PHE A CD1  2  
ATOM   6039  C  CD2  . PHE A 1 187 ? 5.476   17.012 28.828 1.00 0.00 ? 187 PHE A CD2  2  
ATOM   6040  C  CE1  . PHE A 1 187 ? 7.358   18.907 29.500 1.00 0.00 ? 187 PHE A CE1  2  
ATOM   6041  C  CE2  . PHE A 1 187 ? 5.180   18.353 28.713 1.00 0.00 ? 187 PHE A CE2  2  
ATOM   6042  C  CZ   . PHE A 1 187 ? 6.120   19.300 29.048 1.00 0.00 ? 187 PHE A CZ   2  
ATOM   6043  H  H    . PHE A 1 187 ? 8.035   16.804 27.777 1.00 0.00 ? 187 PHE A H    2  
ATOM   6044  H  HA   . PHE A 1 187 ? 8.952   14.294 28.746 1.00 0.00 ? 187 PHE A HA   2  
ATOM   6045  H  HB2  . PHE A 1 187 ? 6.139   14.543 29.309 1.00 0.00 ? 187 PHE A HB2  2  
ATOM   6046  H  HB3  . PHE A 1 187 ? 7.480   14.933 30.385 1.00 0.00 ? 187 PHE A HB3  2  
ATOM   6047  H  HD1  . PHE A 1 187 ? 8.633   17.262 29.971 1.00 0.00 ? 187 PHE A HD1  2  
ATOM   6048  H  HD2  . PHE A 1 187 ? 4.734   16.273 28.565 1.00 0.00 ? 187 PHE A HD2  2  
ATOM   6049  H  HE1  . PHE A 1 187 ? 8.096   19.650 29.765 1.00 0.00 ? 187 PHE A HE1  2  
ATOM   6050  H  HE2  . PHE A 1 187 ? 4.207   18.662 28.360 1.00 0.00 ? 187 PHE A HE2  2  
ATOM   6051  H  HZ   . PHE A 1 187 ? 5.887   20.350 28.957 1.00 0.00 ? 187 PHE A HZ   2  
ATOM   6052  N  N    . GLU A 1 188 ? 8.155   12.667 27.064 1.00 0.00 ? 188 GLU A N    2  
ATOM   6053  C  CA   . GLU A 1 188 ? 7.603   11.606 26.188 1.00 0.00 ? 188 GLU A CA   2  
ATOM   6054  C  C    . GLU A 1 188 ? 6.638   10.715 26.959 1.00 0.00 ? 188 GLU A C    2  
ATOM   6055  O  O    . GLU A 1 188 ? 6.975   9.553  27.107 1.00 0.00 ? 188 GLU A O    2  
ATOM   6056  C  CB   . GLU A 1 188 ? 8.769   10.744 25.674 1.00 0.00 ? 188 GLU A CB   2  
ATOM   6057  C  CG   . GLU A 1 188 ? 9.724   11.625 24.865 1.00 0.00 ? 188 GLU A CG   2  
ATOM   6058  C  CD   . GLU A 1 188 ? 11.052  10.889 24.664 1.00 0.00 ? 188 GLU A CD   2  
ATOM   6059  O  OE1  . GLU A 1 188 ? 11.622  10.513 25.675 1.00 0.00 ? 188 GLU A OE1  2  
ATOM   6060  O  OE2  . GLU A 1 188 ? 11.421  10.745 23.509 1.00 0.00 ? 188 GLU A OE2  2  
ATOM   6061  H  H    . GLU A 1 188 ? 9.078   12.611 27.386 1.00 0.00 ? 188 GLU A H    2  
ATOM   6062  H  HA   . GLU A 1 188 ? 7.071   12.072 25.358 1.00 0.00 ? 188 GLU A HA   2  
ATOM   6063  H  HB2  . GLU A 1 188 ? 9.296   10.311 26.512 1.00 0.00 ? 188 GLU A HB2  2  
ATOM   6064  H  HB3  . GLU A 1 188 ? 8.387   9.952  25.049 1.00 0.00 ? 188 GLU A HB3  2  
ATOM   6065  H  HG2  . GLU A 1 188 ? 9.289   11.845 23.901 1.00 0.00 ? 188 GLU A HG2  2  
ATOM   6066  H  HG3  . GLU A 1 188 ? 9.905   12.549 25.393 1.00 0.00 ? 188 GLU A HG3  2  
HETATM 6067  CA CA   . CA  B 2 .   ? -6.914  23.838 42.360 1.00 0.00 ? 500 CA  A CA   2  
HETATM 6068  CA CA   . CA  C 2 .   ? 14.098  24.693 41.828 1.00 0.00 ? 501 CA  A CA   2  
HETATM 6069  C  C1   . MYR D 3 .   ? -22.655 26.476 50.594 1.00 0.00 ? 502 MYR A C1   2  
HETATM 6070  O  O1   . MYR D 3 .   ? -22.926 27.304 51.440 1.00 0.00 ? 502 MYR A O1   2  
HETATM 6071  C  C2   . MYR D 3 .   ? -23.615 25.323 50.290 1.00 0.00 ? 502 MYR A C2   2  
HETATM 6072  C  C3   . MYR D 3 .   ? -23.000 24.421 49.218 1.00 0.00 ? 502 MYR A C3   2  
HETATM 6073  C  C4   . MYR D 3 .   ? -21.851 23.622 49.836 1.00 0.00 ? 502 MYR A C4   2  
HETATM 6074  C  C5   . MYR D 3 .   ? -20.939 23.111 48.722 1.00 0.00 ? 502 MYR A C5   2  
HETATM 6075  C  C6   . MYR D 3 .   ? -19.840 22.242 49.334 1.00 0.00 ? 502 MYR A C6   2  
HETATM 6076  C  C7   . MYR D 3 .   ? -20.450 20.922 49.808 1.00 0.00 ? 502 MYR A C7   2  
HETATM 6077  C  C8   . MYR D 3 .   ? -19.397 19.819 49.708 1.00 0.00 ? 502 MYR A C8   2  
HETATM 6078  C  C9   . MYR D 3 .   ? -19.762 18.687 50.672 1.00 0.00 ? 502 MYR A C9   2  
HETATM 6079  C  C10  . MYR D 3 .   ? -21.020 17.979 50.163 1.00 0.00 ? 502 MYR A C10  2  
HETATM 6080  C  C11  . MYR D 3 .   ? -20.782 16.466 50.164 1.00 0.00 ? 502 MYR A C11  2  
HETATM 6081  C  C12  . MYR D 3 .   ? -19.853 16.103 49.002 1.00 0.00 ? 502 MYR A C12  2  
HETATM 6082  C  C13  . MYR D 3 .   ? -20.114 14.656 48.583 1.00 0.00 ? 502 MYR A C13  2  
HETATM 6083  C  C14  . MYR D 3 .   ? -19.540 13.714 49.641 1.00 0.00 ? 502 MYR A C14  2  
HETATM 6084  H  H21  . MYR D 3 .   ? -23.788 24.755 51.192 1.00 0.00 ? 502 MYR A H21  2  
HETATM 6085  H  H22  . MYR D 3 .   ? -24.553 25.725 49.936 1.00 0.00 ? 502 MYR A H22  2  
HETATM 6086  H  H31  . MYR D 3 .   ? -23.751 23.743 48.840 1.00 0.00 ? 502 MYR A H31  2  
HETATM 6087  H  H32  . MYR D 3 .   ? -22.626 25.025 48.405 1.00 0.00 ? 502 MYR A H32  2  
HETATM 6088  H  H41  . MYR D 3 .   ? -21.288 24.255 50.505 1.00 0.00 ? 502 MYR A H41  2  
HETATM 6089  H  H42  . MYR D 3 .   ? -22.249 22.785 50.392 1.00 0.00 ? 502 MYR A H42  2  
HETATM 6090  H  H51  . MYR D 3 .   ? -21.515 22.527 48.019 1.00 0.00 ? 502 MYR A H51  2  
HETATM 6091  H  H52  . MYR D 3 .   ? -20.493 23.949 48.205 1.00 0.00 ? 502 MYR A H52  2  
HETATM 6092  H  H61  . MYR D 3 .   ? -19.077 22.046 48.595 1.00 0.00 ? 502 MYR A H61  2  
HETATM 6093  H  H62  . MYR D 3 .   ? -19.395 22.757 50.173 1.00 0.00 ? 502 MYR A H62  2  
HETATM 6094  H  H71  . MYR D 3 .   ? -20.777 21.020 50.833 1.00 0.00 ? 502 MYR A H71  2  
HETATM 6095  H  H72  . MYR D 3 .   ? -21.299 20.670 49.189 1.00 0.00 ? 502 MYR A H72  2  
HETATM 6096  H  H81  . MYR D 3 .   ? -19.364 19.438 48.698 1.00 0.00 ? 502 MYR A H81  2  
HETATM 6097  H  H82  . MYR D 3 .   ? -18.427 20.218 49.968 1.00 0.00 ? 502 MYR A H82  2  
HETATM 6098  H  H91  . MYR D 3 .   ? -18.946 17.983 50.729 1.00 0.00 ? 502 MYR A H91  2  
HETATM 6099  H  H92  . MYR D 3 .   ? -19.947 19.095 51.655 1.00 0.00 ? 502 MYR A H92  2  
HETATM 6100  H  H101 . MYR D 3 .   ? -21.854 18.214 50.808 1.00 0.00 ? 502 MYR A H101 2  
HETATM 6101  H  H102 . MYR D 3 .   ? -21.243 18.311 49.160 1.00 0.00 ? 502 MYR A H102 2  
HETATM 6102  H  H111 . MYR D 3 .   ? -20.328 16.170 51.097 1.00 0.00 ? 502 MYR A H111 2  
HETATM 6103  H  H112 . MYR D 3 .   ? -21.723 15.950 50.048 1.00 0.00 ? 502 MYR A H112 2  
HETATM 6104  H  H121 . MYR D 3 .   ? -20.040 16.762 48.167 1.00 0.00 ? 502 MYR A H121 2  
HETATM 6105  H  H122 . MYR D 3 .   ? -18.824 16.211 49.314 1.00 0.00 ? 502 MYR A H122 2  
HETATM 6106  H  H131 . MYR D 3 .   ? -21.178 14.491 48.489 1.00 0.00 ? 502 MYR A H131 2  
HETATM 6107  H  H132 . MYR D 3 .   ? -19.642 14.462 47.630 1.00 0.00 ? 502 MYR A H132 2  
HETATM 6108  H  H141 . MYR D 3 .   ? -19.897 14.002 50.620 1.00 0.00 ? 502 MYR A H141 2  
HETATM 6109  H  H142 . MYR D 3 .   ? -18.462 13.764 49.628 1.00 0.00 ? 502 MYR A H142 2  
HETATM 6110  H  H143 . MYR D 3 .   ? -19.851 12.701 49.435 1.00 0.00 ? 502 MYR A H143 2  
ATOM   6111  N  N    . GLY A 1 1   ? -19.242 37.757 38.778 1.00 0.00 ? 1   GLY A N    3  
ATOM   6112  C  CA   . GLY A 1 1   ? -19.532 37.018 40.039 1.00 0.00 ? 1   GLY A CA   3  
ATOM   6113  C  C    . GLY A 1 1   ? -18.263 36.343 40.565 1.00 0.00 ? 1   GLY A C    3  
ATOM   6114  O  O    . GLY A 1 1   ? -17.197 36.493 40.001 1.00 0.00 ? 1   GLY A O    3  
ATOM   6115  H  H    . GLY A 1 1   ? -19.489 37.373 37.911 1.00 0.00 ? 1   GLY A H    3  
ATOM   6116  H  HA2  . GLY A 1 1   ? -19.902 37.711 40.781 1.00 0.00 ? 1   GLY A HA2  3  
ATOM   6117  H  HA3  . GLY A 1 1   ? -20.284 36.267 39.848 1.00 0.00 ? 1   GLY A HA3  3  
ATOM   6118  N  N    . ASN A 1 2   ? -18.404 35.612 41.637 1.00 0.00 ? 2   ASN A N    3  
ATOM   6119  C  CA   . ASN A 1 2   ? -17.223 34.923 42.209 1.00 0.00 ? 2   ASN A CA   3  
ATOM   6120  C  C    . ASN A 1 2   ? -16.776 33.780 41.305 1.00 0.00 ? 2   ASN A C    3  
ATOM   6121  O  O    . ASN A 1 2   ? -16.992 33.810 40.111 1.00 0.00 ? 2   ASN A O    3  
ATOM   6122  C  CB   . ASN A 1 2   ? -17.620 34.347 43.577 1.00 0.00 ? 2   ASN A CB   3  
ATOM   6123  C  CG   . ASN A 1 2   ? -18.325 33.004 43.373 1.00 0.00 ? 2   ASN A CG   3  
ATOM   6124  O  OD1  . ASN A 1 2   ? -19.230 32.881 42.572 1.00 0.00 ? 2   ASN A OD1  3  
ATOM   6125  N  ND2  . ASN A 1 2   ? -17.943 31.974 44.079 1.00 0.00 ? 2   ASN A ND2  3  
ATOM   6126  H  H    . ASN A 1 2   ? -19.282 35.519 42.060 1.00 0.00 ? 2   ASN A H    3  
ATOM   6127  H  HA   . ASN A 1 2   ? -16.406 35.637 42.310 1.00 0.00 ? 2   ASN A HA   3  
ATOM   6128  H  HB2  . ASN A 1 2   ? -16.737 34.199 44.182 1.00 0.00 ? 2   ASN A HB2  3  
ATOM   6129  H  HB3  . ASN A 1 2   ? -18.289 35.029 44.080 1.00 0.00 ? 2   ASN A HB3  3  
ATOM   6130  H  HD21 . ASN A 1 2   ? -17.213 32.067 44.727 1.00 0.00 ? 2   ASN A HD21 3  
ATOM   6131  H  HD22 . ASN A 1 2   ? -18.385 31.108 43.960 1.00 0.00 ? 2   ASN A HD22 3  
ATOM   6132  N  N    . SER A 1 3   ? -16.160 32.789 41.892 1.00 0.00 ? 3   SER A N    3  
ATOM   6133  C  CA   . SER A 1 3   ? -15.694 31.640 41.077 1.00 0.00 ? 3   SER A CA   3  
ATOM   6134  C  C    . SER A 1 3   ? -16.868 30.749 40.686 1.00 0.00 ? 3   SER A C    3  
ATOM   6135  O  O    . SER A 1 3   ? -17.892 30.746 41.340 1.00 0.00 ? 3   SER A O    3  
ATOM   6136  C  CB   . SER A 1 3   ? -14.701 30.818 41.916 1.00 0.00 ? 3   SER A CB   3  
ATOM   6137  O  OG   . SER A 1 3   ? -15.490 30.288 42.970 1.00 0.00 ? 3   SER A OG   3  
ATOM   6138  H  H    . SER A 1 3   ? -16.005 32.805 42.858 1.00 0.00 ? 3   SER A H    3  
ATOM   6139  H  HA   . SER A 1 3   ? -15.219 32.017 40.172 1.00 0.00 ? 3   SER A HA   3  
ATOM   6140  H  HB2  . SER A 1 3   ? -14.274 30.017 41.328 1.00 0.00 ? 3   SER A HB2  3  
ATOM   6141  H  HB3  . SER A 1 3   ? -13.920 31.451 42.315 1.00 0.00 ? 3   SER A HB3  3  
ATOM   6142  H  HG   . SER A 1 3   ? -15.512 29.333 42.873 1.00 0.00 ? 3   SER A HG   3  
ATOM   6143  N  N    . LYS A 1 4   ? -16.698 30.008 39.628 1.00 0.00 ? 4   LYS A N    3  
ATOM   6144  C  CA   . LYS A 1 4   ? -17.794 29.113 39.183 1.00 0.00 ? 4   LYS A CA   3  
ATOM   6145  C  C    . LYS A 1 4   ? -17.247 27.966 38.342 1.00 0.00 ? 4   LYS A C    3  
ATOM   6146  O  O    . LYS A 1 4   ? -16.523 28.186 37.391 1.00 0.00 ? 4   LYS A O    3  
ATOM   6147  C  CB   . LYS A 1 4   ? -18.766 29.939 38.325 1.00 0.00 ? 4   LYS A CB   3  
ATOM   6148  C  CG   . LYS A 1 4   ? -19.839 29.017 37.752 1.00 0.00 ? 4   LYS A CG   3  
ATOM   6149  C  CD   . LYS A 1 4   ? -20.941 29.868 37.112 1.00 0.00 ? 4   LYS A CD   3  
ATOM   6150  C  CE   . LYS A 1 4   ? -21.840 30.438 38.213 1.00 0.00 ? 4   LYS A CE   3  
ATOM   6151  N  NZ   . LYS A 1 4   ? -23.175 30.801 37.661 1.00 0.00 ? 4   LYS A NZ   3  
ATOM   6152  H  H    . LYS A 1 4   ? -15.852 30.040 39.131 1.00 0.00 ? 4   LYS A H    3  
ATOM   6153  H  HA   . LYS A 1 4   ? -18.298 28.706 40.057 1.00 0.00 ? 4   LYS A HA   3  
ATOM   6154  H  HB2  . LYS A 1 4   ? -19.231 30.701 38.935 1.00 0.00 ? 4   LYS A HB2  3  
ATOM   6155  H  HB3  . LYS A 1 4   ? -18.226 30.414 37.518 1.00 0.00 ? 4   LYS A HB3  3  
ATOM   6156  H  HG2  . LYS A 1 4   ? -19.400 28.370 37.004 1.00 0.00 ? 4   LYS A HG2  3  
ATOM   6157  H  HG3  . LYS A 1 4   ? -20.259 28.412 38.541 1.00 0.00 ? 4   LYS A HG3  3  
ATOM   6158  H  HD2  . LYS A 1 4   ? -20.493 30.678 36.555 1.00 0.00 ? 4   LYS A HD2  3  
ATOM   6159  H  HD3  . LYS A 1 4   ? -21.527 29.259 36.442 1.00 0.00 ? 4   LYS A HD3  3  
ATOM   6160  H  HE2  . LYS A 1 4   ? -21.971 29.703 38.992 1.00 0.00 ? 4   LYS A HE2  3  
ATOM   6161  H  HE3  . LYS A 1 4   ? -21.381 31.319 38.635 1.00 0.00 ? 4   LYS A HE3  3  
ATOM   6162  H  HZ1  . LYS A 1 4   ? -23.072 31.089 36.666 1.00 0.00 ? 4   LYS A HZ1  3  
ATOM   6163  H  HZ2  . LYS A 1 4   ? -23.809 29.980 37.720 1.00 0.00 ? 4   LYS A HZ2  3  
ATOM   6164  H  HZ3  . LYS A 1 4   ? -23.574 31.588 38.210 1.00 0.00 ? 4   LYS A HZ3  3  
ATOM   6165  N  N    . SER A 1 5   ? -17.604 26.757 38.713 1.00 0.00 ? 5   SER A N    3  
ATOM   6166  C  CA   . SER A 1 5   ? -17.116 25.575 37.948 1.00 0.00 ? 5   SER A CA   3  
ATOM   6167  C  C    . SER A 1 5   ? -18.244 24.589 37.684 1.00 0.00 ? 5   SER A C    3  
ATOM   6168  O  O    . SER A 1 5   ? -18.009 23.414 37.491 1.00 0.00 ? 5   SER A O    3  
ATOM   6169  C  CB   . SER A 1 5   ? -16.039 24.870 38.786 1.00 0.00 ? 5   SER A CB   3  
ATOM   6170  O  OG   . SER A 1 5   ? -16.613 24.778 40.082 1.00 0.00 ? 5   SER A OG   3  
ATOM   6171  H  H    . SER A 1 5   ? -18.190 26.633 39.489 1.00 0.00 ? 5   SER A H    3  
ATOM   6172  H  HA   . SER A 1 5   ? -16.708 25.906 36.996 1.00 0.00 ? 5   SER A HA   3  
ATOM   6173  H  HB2  . SER A 1 5   ? -15.837 23.884 38.396 1.00 0.00 ? 5   SER A HB2  3  
ATOM   6174  H  HB3  . SER A 1 5   ? -15.133 25.456 38.818 1.00 0.00 ? 5   SER A HB3  3  
ATOM   6175  H  HG   . SER A 1 5   ? -15.906 24.599 40.707 1.00 0.00 ? 5   SER A HG   3  
ATOM   6176  N  N    . GLY A 1 6   ? -19.449 25.080 37.681 1.00 0.00 ? 6   GLY A N    3  
ATOM   6177  C  CA   . GLY A 1 6   ? -20.603 24.175 37.428 1.00 0.00 ? 6   GLY A CA   3  
ATOM   6178  C  C    . GLY A 1 6   ? -20.798 23.980 35.927 1.00 0.00 ? 6   GLY A C    3  
ATOM   6179  O  O    . GLY A 1 6   ? -20.825 22.866 35.442 1.00 0.00 ? 6   GLY A O    3  
ATOM   6180  H  H    . GLY A 1 6   ? -19.595 26.037 37.843 1.00 0.00 ? 6   GLY A H    3  
ATOM   6181  H  HA2  . GLY A 1 6   ? -20.415 23.220 37.892 1.00 0.00 ? 6   GLY A HA2  3  
ATOM   6182  H  HA3  . GLY A 1 6   ? -21.496 24.608 37.850 1.00 0.00 ? 6   GLY A HA3  3  
ATOM   6183  N  N    . ALA A 1 7   ? -20.928 25.077 35.225 1.00 0.00 ? 7   ALA A N    3  
ATOM   6184  C  CA   . ALA A 1 7   ? -21.122 24.999 33.755 1.00 0.00 ? 7   ALA A CA   3  
ATOM   6185  C  C    . ALA A 1 7   ? -19.855 25.427 33.030 1.00 0.00 ? 7   ALA A C    3  
ATOM   6186  O  O    . ALA A 1 7   ? -19.771 25.317 31.824 1.00 0.00 ? 7   ALA A O    3  
ATOM   6187  C  CB   . ALA A 1 7   ? -22.259 25.956 33.370 1.00 0.00 ? 7   ALA A CB   3  
ATOM   6188  H  H    . ALA A 1 7   ? -20.894 25.949 35.670 1.00 0.00 ? 7   ALA A H    3  
ATOM   6189  H  HA   . ALA A 1 7   ? -21.364 23.976 33.474 1.00 0.00 ? 7   ALA A HA   3  
ATOM   6190  H  HB1  . ALA A 1 7   ? -23.046 25.900 34.107 1.00 0.00 ? 7   ALA A HB1  3  
ATOM   6191  H  HB2  . ALA A 1 7   ? -21.886 26.968 33.325 1.00 0.00 ? 7   ALA A HB2  3  
ATOM   6192  H  HB3  . ALA A 1 7   ? -22.657 25.681 32.405 1.00 0.00 ? 7   ALA A HB3  3  
ATOM   6193  N  N    . LEU A 1 8   ? -18.885 25.896 33.810 1.00 0.00 ? 8   LEU A N    3  
ATOM   6194  C  CA   . LEU A 1 8   ? -17.572 26.359 33.235 1.00 0.00 ? 8   LEU A CA   3  
ATOM   6195  C  C    . LEU A 1 8   ? -17.660 26.645 31.728 1.00 0.00 ? 8   LEU A C    3  
ATOM   6196  O  O    . LEU A 1 8   ? -18.449 27.462 31.308 1.00 0.00 ? 8   LEU A O    3  
ATOM   6197  C  CB   . LEU A 1 8   ? -16.473 25.285 33.515 1.00 0.00 ? 8   LEU A CB   3  
ATOM   6198  C  CG   . LEU A 1 8   ? -17.044 23.856 33.414 1.00 0.00 ? 8   LEU A CG   3  
ATOM   6199  C  CD1  . LEU A 1 8   ? -16.717 23.270 32.039 1.00 0.00 ? 8   LEU A CD1  3  
ATOM   6200  C  CD2  . LEU A 1 8   ? -16.390 22.984 34.487 1.00 0.00 ? 8   LEU A CD2  3  
ATOM   6201  H  H    . LEU A 1 8   ? -19.028 25.941 34.778 1.00 0.00 ? 8   LEU A H    3  
ATOM   6202  H  HA   . LEU A 1 8   ? -17.305 27.295 33.735 1.00 0.00 ? 8   LEU A HA   3  
ATOM   6203  H  HB2  . LEU A 1 8   ? -15.672 25.399 32.809 1.00 0.00 ? 8   LEU A HB2  3  
ATOM   6204  H  HB3  . LEU A 1 8   ? -16.077 25.436 34.509 1.00 0.00 ? 8   LEU A HB3  3  
ATOM   6205  H  HG   . LEU A 1 8   ? -18.104 23.864 33.559 1.00 0.00 ? 8   LEU A HG   3  
ATOM   6206  H  HD11 . LEU A 1 8   ? -15.665 23.385 31.836 1.00 0.00 ? 8   LEU A HD11 3  
ATOM   6207  H  HD12 . LEU A 1 8   ? -16.967 22.221 32.024 1.00 0.00 ? 8   LEU A HD12 3  
ATOM   6208  H  HD13 . LEU A 1 8   ? -17.286 23.780 31.278 1.00 0.00 ? 8   LEU A HD13 3  
ATOM   6209  H  HD21 . LEU A 1 8   ? -15.340 23.226 34.562 1.00 0.00 ? 8   LEU A HD21 3  
ATOM   6210  H  HD22 . LEU A 1 8   ? -16.864 23.163 35.440 1.00 0.00 ? 8   LEU A HD22 3  
ATOM   6211  H  HD23 . LEU A 1 8   ? -16.497 21.943 34.225 1.00 0.00 ? 8   LEU A HD23 3  
ATOM   6212  N  N    . SER A 1 9   ? -16.862 25.956 30.947 1.00 0.00 ? 9   SER A N    3  
ATOM   6213  C  CA   . SER A 1 9   ? -16.889 26.180 29.470 1.00 0.00 ? 9   SER A CA   3  
ATOM   6214  C  C    . SER A 1 9   ? -16.519 27.629 29.131 1.00 0.00 ? 9   SER A C    3  
ATOM   6215  O  O    . SER A 1 9   ? -15.483 27.879 28.547 1.00 0.00 ? 9   SER A O    3  
ATOM   6216  C  CB   . SER A 1 9   ? -18.304 25.855 28.933 1.00 0.00 ? 9   SER A CB   3  
ATOM   6217  O  OG   . SER A 1 9   ? -19.008 27.084 28.987 1.00 0.00 ? 9   SER A OG   3  
ATOM   6218  H  H    . SER A 1 9   ? -16.260 25.290 31.326 1.00 0.00 ? 9   SER A H    3  
ATOM   6219  H  HA   . SER A 1 9   ? -16.148 25.522 29.013 1.00 0.00 ? 9   SER A HA   3  
ATOM   6220  H  HB2  . SER A 1 9   ? -18.249 25.505 27.910 1.00 0.00 ? 9   SER A HB2  3  
ATOM   6221  H  HB3  . SER A 1 9   ? -18.789 25.120 29.555 1.00 0.00 ? 9   SER A HB3  3  
ATOM   6222  H  HG   . SER A 1 9   ? -18.903 27.524 28.141 1.00 0.00 ? 9   SER A HG   3  
ATOM   6223  N  N    . LYS A 1 10  ? -17.363 28.559 29.497 1.00 0.00 ? 10  LYS A N    3  
ATOM   6224  C  CA   . LYS A 1 10  ? -17.050 29.973 29.195 1.00 0.00 ? 10  LYS A CA   3  
ATOM   6225  C  C    . LYS A 1 10  ? -15.731 30.347 29.836 1.00 0.00 ? 10  LYS A C    3  
ATOM   6226  O  O    . LYS A 1 10  ? -14.835 30.842 29.181 1.00 0.00 ? 10  LYS A O    3  
ATOM   6227  C  CB   . LYS A 1 10  ? -18.162 30.863 29.776 1.00 0.00 ? 10  LYS A CB   3  
ATOM   6228  C  CG   . LYS A 1 10  ? -17.900 32.315 29.374 1.00 0.00 ? 10  LYS A CG   3  
ATOM   6229  C  CD   . LYS A 1 10  ? -18.669 32.626 28.088 1.00 0.00 ? 10  LYS A CD   3  
ATOM   6230  C  CE   . LYS A 1 10  ? -20.086 33.086 28.444 1.00 0.00 ? 10  LYS A CE   3  
ATOM   6231  N  NZ   . LYS A 1 10  ? -20.041 34.323 29.274 1.00 0.00 ? 10  LYS A NZ   3  
ATOM   6232  H  H    . LYS A 1 10  ? -18.192 28.322 29.964 1.00 0.00 ? 10  LYS A H    3  
ATOM   6233  H  HA   . LYS A 1 10  ? -16.971 30.099 28.117 1.00 0.00 ? 10  LYS A HA   3  
ATOM   6234  H  HB2  . LYS A 1 10  ? -19.119 30.546 29.389 1.00 0.00 ? 10  LYS A HB2  3  
ATOM   6235  H  HB3  . LYS A 1 10  ? -18.168 30.779 30.852 1.00 0.00 ? 10  LYS A HB3  3  
ATOM   6236  H  HG2  . LYS A 1 10  ? -18.229 32.975 30.163 1.00 0.00 ? 10  LYS A HG2  3  
ATOM   6237  H  HG3  . LYS A 1 10  ? -16.843 32.459 29.209 1.00 0.00 ? 10  LYS A HG3  3  
ATOM   6238  H  HD2  . LYS A 1 10  ? -18.161 33.407 27.542 1.00 0.00 ? 10  LYS A HD2  3  
ATOM   6239  H  HD3  . LYS A 1 10  ? -18.720 31.739 27.472 1.00 0.00 ? 10  LYS A HD3  3  
ATOM   6240  H  HE2  . LYS A 1 10  ? -20.639 33.289 27.539 1.00 0.00 ? 10  LYS A HE2  3  
ATOM   6241  H  HE3  . LYS A 1 10  ? -20.590 32.307 28.998 1.00 0.00 ? 10  LYS A HE3  3  
ATOM   6242  H  HZ1  . LYS A 1 10  ? -19.111 34.400 29.733 1.00 0.00 ? 10  LYS A HZ1  3  
ATOM   6243  H  HZ2  . LYS A 1 10  ? -20.198 35.154 28.668 1.00 0.00 ? 10  LYS A HZ2  3  
ATOM   6244  H  HZ3  . LYS A 1 10  ? -20.783 34.280 30.001 1.00 0.00 ? 10  LYS A HZ3  3  
ATOM   6245  N  N    . GLU A 1 11  ? -15.631 30.103 31.113 1.00 0.00 ? 11  GLU A N    3  
ATOM   6246  C  CA   . GLU A 1 11  ? -14.376 30.436 31.813 1.00 0.00 ? 11  GLU A CA   3  
ATOM   6247  C  C    . GLU A 1 11  ? -13.233 29.648 31.202 1.00 0.00 ? 11  GLU A C    3  
ATOM   6248  O  O    . GLU A 1 11  ? -12.100 30.084 31.200 1.00 0.00 ? 11  GLU A O    3  
ATOM   6249  C  CB   . GLU A 1 11  ? -14.521 30.034 33.290 1.00 0.00 ? 11  GLU A CB   3  
ATOM   6250  C  CG   . GLU A 1 11  ? -15.096 31.210 34.080 1.00 0.00 ? 11  GLU A CG   3  
ATOM   6251  C  CD   . GLU A 1 11  ? -16.535 31.464 33.631 1.00 0.00 ? 11  GLU A CD   3  
ATOM   6252  O  OE1  . GLU A 1 11  ? -17.103 30.536 33.081 1.00 0.00 ? 11  GLU A OE1  3  
ATOM   6253  O  OE2  . GLU A 1 11  ? -16.985 32.575 33.863 1.00 0.00 ? 11  GLU A OE2  3  
ATOM   6254  H  H    . GLU A 1 11  ? -16.381 29.704 31.600 1.00 0.00 ? 11  GLU A H    3  
ATOM   6255  H  HA   . GLU A 1 11  ? -14.177 31.502 31.711 1.00 0.00 ? 11  GLU A HA   3  
ATOM   6256  H  HB2  . GLU A 1 11  ? -15.182 29.184 33.371 1.00 0.00 ? 11  GLU A HB2  3  
ATOM   6257  H  HB3  . GLU A 1 11  ? -13.553 29.768 33.689 1.00 0.00 ? 11  GLU A HB3  3  
ATOM   6258  H  HG2  . GLU A 1 11  ? -15.086 30.981 35.136 1.00 0.00 ? 11  GLU A HG2  3  
ATOM   6259  H  HG3  . GLU A 1 11  ? -14.503 32.096 33.901 1.00 0.00 ? 11  GLU A HG3  3  
ATOM   6260  N  N    . ILE A 1 12  ? -13.559 28.491 30.691 1.00 0.00 ? 12  ILE A N    3  
ATOM   6261  C  CA   . ILE A 1 12  ? -12.515 27.646 30.070 1.00 0.00 ? 12  ILE A CA   3  
ATOM   6262  C  C    . ILE A 1 12  ? -12.204 28.138 28.677 1.00 0.00 ? 12  ILE A C    3  
ATOM   6263  O  O    . ILE A 1 12  ? -11.132 28.633 28.424 1.00 0.00 ? 12  ILE A O    3  
ATOM   6264  C  CB   . ILE A 1 12  ? -13.037 26.214 29.970 1.00 0.00 ? 12  ILE A CB   3  
ATOM   6265  C  CG1  . ILE A 1 12  ? -13.687 25.800 31.284 1.00 0.00 ? 12  ILE A CG1  3  
ATOM   6266  C  CG2  . ILE A 1 12  ? -11.851 25.273 29.689 1.00 0.00 ? 12  ILE A CG2  3  
ATOM   6267  C  CD1  . ILE A 1 12  ? -12.603 25.419 32.291 1.00 0.00 ? 12  ILE A CD1  3  
ATOM   6268  H  H    . ILE A 1 12  ? -14.490 28.184 30.718 1.00 0.00 ? 12  ILE A H    3  
ATOM   6269  H  HA   . ILE A 1 12  ? -11.609 27.694 30.672 1.00 0.00 ? 12  ILE A HA   3  
ATOM   6270  H  HB   . ILE A 1 12  ? -13.776 26.161 29.168 1.00 0.00 ? 12  ILE A HB   3  
ATOM   6271  H  HG12 . ILE A 1 12  ? -14.270 26.619 31.673 1.00 0.00 ? 12  ILE A HG12 3  
ATOM   6272  H  HG13 . ILE A 1 12  ? -14.335 24.956 31.114 1.00 0.00 ? 12  ILE A HG13 3  
ATOM   6273  H  HG21 . ILE A 1 12  ? -11.030 25.513 30.347 1.00 0.00 ? 12  ILE A HG21 3  
ATOM   6274  H  HG22 . ILE A 1 12  ? -12.151 24.248 29.853 1.00 0.00 ? 12  ILE A HG22 3  
ATOM   6275  H  HG23 . ILE A 1 12  ? -11.530 25.388 28.663 1.00 0.00 ? 12  ILE A HG23 3  
ATOM   6276  H  HD11 . ILE A 1 12  ? -11.817 26.159 32.279 1.00 0.00 ? 12  ILE A HD11 3  
ATOM   6277  H  HD12 . ILE A 1 12  ? -13.032 25.369 33.281 1.00 0.00 ? 12  ILE A HD12 3  
ATOM   6278  H  HD13 . ILE A 1 12  ? -12.188 24.454 32.036 1.00 0.00 ? 12  ILE A HD13 3  
ATOM   6279  N  N    . LEU A 1 13  ? -13.151 27.999 27.788 1.00 0.00 ? 13  LEU A N    3  
ATOM   6280  C  CA   . LEU A 1 13  ? -12.903 28.462 26.407 1.00 0.00 ? 13  LEU A CA   3  
ATOM   6281  C  C    . LEU A 1 13  ? -12.255 29.826 26.429 1.00 0.00 ? 13  LEU A C    3  
ATOM   6282  O  O    . LEU A 1 13  ? -11.535 30.186 25.529 1.00 0.00 ? 13  LEU A O    3  
ATOM   6283  C  CB   . LEU A 1 13  ? -14.233 28.558 25.667 1.00 0.00 ? 13  LEU A CB   3  
ATOM   6284  C  CG   . LEU A 1 13  ? -14.493 27.246 24.914 1.00 0.00 ? 13  LEU A CG   3  
ATOM   6285  C  CD1  . LEU A 1 13  ? -15.912 27.275 24.351 1.00 0.00 ? 13  LEU A CD1  3  
ATOM   6286  C  CD2  . LEU A 1 13  ? -13.499 27.109 23.752 1.00 0.00 ? 13  LEU A CD2  3  
ATOM   6287  H  H    . LEU A 1 13  ? -14.010 27.594 28.033 1.00 0.00 ? 13  LEU A H    3  
ATOM   6288  H  HA   . LEU A 1 13  ? -12.233 27.762 25.916 1.00 0.00 ? 13  LEU A HA   3  
ATOM   6289  H  HB2  . LEU A 1 13  ? -15.025 28.735 26.376 1.00 0.00 ? 13  LEU A HB2  3  
ATOM   6290  H  HB3  . LEU A 1 13  ? -14.195 29.380 24.967 1.00 0.00 ? 13  LEU A HB3  3  
ATOM   6291  H  HG   . LEU A 1 13  ? -14.385 26.410 25.588 1.00 0.00 ? 13  LEU A HG   3  
ATOM   6292  H  HD11 . LEU A 1 13  ? -16.468 28.078 24.811 1.00 0.00 ? 13  LEU A HD11 3  
ATOM   6293  H  HD12 . LEU A 1 13  ? -15.877 27.433 23.284 1.00 0.00 ? 13  LEU A HD12 3  
ATOM   6294  H  HD13 . LEU A 1 13  ? -16.402 26.337 24.558 1.00 0.00 ? 13  LEU A HD13 3  
ATOM   6295  H  HD21 . LEU A 1 13  ? -13.272 28.084 23.352 1.00 0.00 ? 13  LEU A HD21 3  
ATOM   6296  H  HD22 . LEU A 1 13  ? -12.589 26.645 24.101 1.00 0.00 ? 13  LEU A HD22 3  
ATOM   6297  H  HD23 . LEU A 1 13  ? -13.930 26.497 22.974 1.00 0.00 ? 13  LEU A HD23 3  
ATOM   6298  N  N    . GLU A 1 14  ? -12.527 30.578 27.452 1.00 0.00 ? 14  GLU A N    3  
ATOM   6299  C  CA   . GLU A 1 14  ? -11.915 31.907 27.516 1.00 0.00 ? 14  GLU A CA   3  
ATOM   6300  C  C    . GLU A 1 14  ? -10.431 31.748 27.267 1.00 0.00 ? 14  GLU A C    3  
ATOM   6301  O  O    . GLU A 1 14  ? -9.771  32.640 26.770 1.00 0.00 ? 14  GLU A O    3  
ATOM   6302  C  CB   . GLU A 1 14  ? -12.138 32.485 28.920 1.00 0.00 ? 14  GLU A CB   3  
ATOM   6303  C  CG   . GLU A 1 14  ? -11.468 33.856 29.011 1.00 0.00 ? 14  GLU A CG   3  
ATOM   6304  C  CD   . GLU A 1 14  ? -11.967 34.740 27.864 1.00 0.00 ? 14  GLU A CD   3  
ATOM   6305  O  OE1  . GLU A 1 14  ? -11.333 34.685 26.823 1.00 0.00 ? 14  GLU A OE1  3  
ATOM   6306  O  OE2  . GLU A 1 14  ? -12.954 35.421 28.095 1.00 0.00 ? 14  GLU A OE2  3  
ATOM   6307  H  H    . GLU A 1 14  ? -13.124 30.264 28.162 1.00 0.00 ? 14  GLU A H    3  
ATOM   6308  H  HA   . GLU A 1 14  ? -12.349 32.545 26.746 1.00 0.00 ? 14  GLU A HA   3  
ATOM   6309  H  HB2  . GLU A 1 14  ? -13.197 32.584 29.107 1.00 0.00 ? 14  GLU A HB2  3  
ATOM   6310  H  HB3  . GLU A 1 14  ? -11.710 31.823 29.655 1.00 0.00 ? 14  GLU A HB3  3  
ATOM   6311  H  HG2  . GLU A 1 14  ? -11.716 34.323 29.953 1.00 0.00 ? 14  GLU A HG2  3  
ATOM   6312  H  HG3  . GLU A 1 14  ? -10.398 33.747 28.936 1.00 0.00 ? 14  GLU A HG3  3  
ATOM   6313  N  N    . GLU A 1 15  ? -9.936  30.589 27.630 1.00 0.00 ? 15  GLU A N    3  
ATOM   6314  C  CA   . GLU A 1 15  ? -8.498  30.306 27.438 1.00 0.00 ? 15  GLU A CA   3  
ATOM   6315  C  C    . GLU A 1 15  ? -8.233  29.648 26.074 1.00 0.00 ? 15  GLU A C    3  
ATOM   6316  O  O    . GLU A 1 15  ? -7.093  29.473 25.694 1.00 0.00 ? 15  GLU A O    3  
ATOM   6317  C  CB   . GLU A 1 15  ? -8.037  29.337 28.541 1.00 0.00 ? 15  GLU A CB   3  
ATOM   6318  C  CG   . GLU A 1 15  ? -7.560  30.137 29.755 1.00 0.00 ? 15  GLU A CG   3  
ATOM   6319  C  CD   . GLU A 1 15  ? -8.600  31.203 30.094 1.00 0.00 ? 15  GLU A CD   3  
ATOM   6320  O  OE1  . GLU A 1 15  ? -8.502  32.264 29.499 1.00 0.00 ? 15  GLU A OE1  3  
ATOM   6321  O  OE2  . GLU A 1 15  ? -9.435  30.897 30.927 1.00 0.00 ? 15  GLU A OE2  3  
ATOM   6322  H  H    . GLU A 1 15  ? -10.525 29.903 28.035 1.00 0.00 ? 15  GLU A H    3  
ATOM   6323  H  HA   . GLU A 1 15  ? -7.944  31.242 27.492 1.00 0.00 ? 15  GLU A HA   3  
ATOM   6324  H  HB2  . GLU A 1 15  ? -8.854  28.699 28.828 1.00 0.00 ? 15  GLU A HB2  3  
ATOM   6325  H  HB3  . GLU A 1 15  ? -7.231  28.727 28.168 1.00 0.00 ? 15  GLU A HB3  3  
ATOM   6326  H  HG2  . GLU A 1 15  ? -7.436  29.478 30.601 1.00 0.00 ? 15  GLU A HG2  3  
ATOM   6327  H  HG3  . GLU A 1 15  ? -6.617  30.615 29.532 1.00 0.00 ? 15  GLU A HG3  3  
ATOM   6328  N  N    . LEU A 1 16  ? -9.293  29.273 25.371 1.00 0.00 ? 16  LEU A N    3  
ATOM   6329  C  CA   . LEU A 1 16  ? -9.094  28.624 24.030 1.00 0.00 ? 16  LEU A CA   3  
ATOM   6330  C  C    . LEU A 1 16  ? -7.959  29.286 23.257 1.00 0.00 ? 16  LEU A C    3  
ATOM   6331  O  O    . LEU A 1 16  ? -7.378  28.689 22.370 1.00 0.00 ? 16  LEU A O    3  
ATOM   6332  C  CB   . LEU A 1 16  ? -10.404 28.717 23.198 1.00 0.00 ? 16  LEU A CB   3  
ATOM   6333  C  CG   . LEU A 1 16  ? -10.439 30.013 22.355 1.00 0.00 ? 16  LEU A CG   3  
ATOM   6334  C  CD1  . LEU A 1 16  ? -11.736 30.033 21.544 1.00 0.00 ? 16  LEU A CD1  3  
ATOM   6335  C  CD2  . LEU A 1 16  ? -10.410 31.243 23.267 1.00 0.00 ? 16  LEU A CD2  3  
ATOM   6336  H  H    . LEU A 1 16  ? -10.196 29.420 25.721 1.00 0.00 ? 16  LEU A H    3  
ATOM   6337  H  HA   . LEU A 1 16  ? -8.836  27.578 24.197 1.00 0.00 ? 16  LEU A HA   3  
ATOM   6338  H  HB2  . LEU A 1 16  ? -10.459 27.866 22.536 1.00 0.00 ? 16  LEU A HB2  3  
ATOM   6339  H  HB3  . LEU A 1 16  ? -11.247 28.690 23.853 1.00 0.00 ? 16  LEU A HB3  3  
ATOM   6340  H  HG   . LEU A 1 16  ? -9.597  30.038 21.680 1.00 0.00 ? 16  LEU A HG   3  
ATOM   6341  H  HD11 . LEU A 1 16  ? -11.866 29.086 21.039 1.00 0.00 ? 16  LEU A HD11 3  
ATOM   6342  H  HD12 . LEU A 1 16  ? -12.574 30.201 22.205 1.00 0.00 ? 16  LEU A HD12 3  
ATOM   6343  H  HD13 . LEU A 1 16  ? -11.697 30.824 20.812 1.00 0.00 ? 16  LEU A HD13 3  
ATOM   6344  H  HD21 . LEU A 1 16  ? -9.816  31.041 24.138 1.00 0.00 ? 16  LEU A HD21 3  
ATOM   6345  H  HD22 . LEU A 1 16  ? -9.984  32.081 22.733 1.00 0.00 ? 16  LEU A HD22 3  
ATOM   6346  H  HD23 . LEU A 1 16  ? -11.415 31.493 23.572 1.00 0.00 ? 16  LEU A HD23 3  
ATOM   6347  N  N    . GLN A 1 17  ? -7.663  30.509 23.603 1.00 0.00 ? 17  GLN A N    3  
ATOM   6348  C  CA   . GLN A 1 17  ? -6.570  31.220 22.897 1.00 0.00 ? 17  GLN A CA   3  
ATOM   6349  C  C    . GLN A 1 17  ? -5.212  30.778 23.431 1.00 0.00 ? 17  GLN A C    3  
ATOM   6350  O  O    . GLN A 1 17  ? -4.256  30.661 22.691 1.00 0.00 ? 17  GLN A O    3  
ATOM   6351  C  CB   . GLN A 1 17  ? -6.736  32.728 23.145 1.00 0.00 ? 17  GLN A CB   3  
ATOM   6352  C  CG   . GLN A 1 17  ? -6.079  33.502 22.002 1.00 0.00 ? 17  GLN A CG   3  
ATOM   6353  C  CD   . GLN A 1 17  ? -6.092  34.995 22.332 1.00 0.00 ? 17  GLN A CD   3  
ATOM   6354  O  OE1  . GLN A 1 17  ? -5.578  35.810 21.592 1.00 0.00 ? 17  GLN A OE1  3  
ATOM   6355  N  NE2  . GLN A 1 17  ? -6.670  35.395 23.431 1.00 0.00 ? 17  GLN A NE2  3  
ATOM   6356  H  H    . GLN A 1 17  ? -8.153  30.951 24.326 1.00 0.00 ? 17  GLN A H    3  
ATOM   6357  H  HA   . GLN A 1 17  ? -6.626  30.992 21.833 1.00 0.00 ? 17  GLN A HA   3  
ATOM   6358  H  HB2  . GLN A 1 17  ? -7.787  32.974 23.193 1.00 0.00 ? 17  GLN A HB2  3  
ATOM   6359  H  HB3  . GLN A 1 17  ? -6.267  32.996 24.081 1.00 0.00 ? 17  GLN A HB3  3  
ATOM   6360  H  HG2  . GLN A 1 17  ? -5.057  33.173 21.877 1.00 0.00 ? 17  GLN A HG2  3  
ATOM   6361  H  HG3  . GLN A 1 17  ? -6.623  33.334 21.084 1.00 0.00 ? 17  GLN A HG3  3  
ATOM   6362  H  HE21 . GLN A 1 17  ? -7.086  34.743 24.031 1.00 0.00 ? 17  GLN A HE21 3  
ATOM   6363  H  HE22 . GLN A 1 17  ? -6.687  36.349 23.656 1.00 0.00 ? 17  GLN A HE22 3  
ATOM   6364  N  N    . LEU A 1 18  ? -5.156  30.538 24.714 1.00 0.00 ? 18  LEU A N    3  
ATOM   6365  C  CA   . LEU A 1 18  ? -3.876  30.101 25.324 1.00 0.00 ? 18  LEU A CA   3  
ATOM   6366  C  C    . LEU A 1 18  ? -3.533  28.679 24.894 1.00 0.00 ? 18  LEU A C    3  
ATOM   6367  O  O    . LEU A 1 18  ? -2.380  28.301 24.854 1.00 0.00 ? 18  LEU A O    3  
ATOM   6368  C  CB   . LEU A 1 18  ? -4.042  30.128 26.852 1.00 0.00 ? 18  LEU A CB   3  
ATOM   6369  C  CG   . LEU A 1 18  ? -2.672  29.968 27.512 1.00 0.00 ? 18  LEU A CG   3  
ATOM   6370  C  CD1  . LEU A 1 18  ? -1.894  31.279 27.386 1.00 0.00 ? 18  LEU A CD1  3  
ATOM   6371  C  CD2  . LEU A 1 18  ? -2.865  29.638 28.994 1.00 0.00 ? 18  LEU A CD2  3  
ATOM   6372  H  H    . LEU A 1 18  ? -5.955  30.647 25.271 1.00 0.00 ? 18  LEU A H    3  
ATOM   6373  H  HA   . LEU A 1 18  ? -3.081  30.773 25.006 1.00 0.00 ? 18  LEU A HA   3  
ATOM   6374  H  HB2  . LEU A 1 18  ? -4.481  31.068 27.153 1.00 0.00 ? 18  LEU A HB2  3  
ATOM   6375  H  HB3  . LEU A 1 18  ? -4.689  29.320 27.161 1.00 0.00 ? 18  LEU A HB3  3  
ATOM   6376  H  HG   . LEU A 1 18  ? -2.126  29.172 27.031 1.00 0.00 ? 18  LEU A HG   3  
ATOM   6377  H  HD11 . LEU A 1 18  ? -2.572  32.115 27.472 1.00 0.00 ? 18  LEU A HD11 3  
ATOM   6378  H  HD12 . LEU A 1 18  ? -1.154  31.340 28.169 1.00 0.00 ? 18  LEU A HD12 3  
ATOM   6379  H  HD13 . LEU A 1 18  ? -1.402  31.319 26.425 1.00 0.00 ? 18  LEU A HD13 3  
ATOM   6380  H  HD21 . LEU A 1 18  ? -3.537  28.799 29.096 1.00 0.00 ? 18  LEU A HD21 3  
ATOM   6381  H  HD22 . LEU A 1 18  ? -1.913  29.386 29.439 1.00 0.00 ? 18  LEU A HD22 3  
ATOM   6382  H  HD23 . LEU A 1 18  ? -3.282  30.492 29.506 1.00 0.00 ? 18  LEU A HD23 3  
ATOM   6383  N  N    . ASN A 1 19  ? -4.545  27.918 24.580 1.00 0.00 ? 19  ASN A N    3  
ATOM   6384  C  CA   . ASN A 1 19  ? -4.303  26.519 24.152 1.00 0.00 ? 19  ASN A CA   3  
ATOM   6385  C  C    . ASN A 1 19  ? -5.405  26.041 23.215 1.00 0.00 ? 19  ASN A C    3  
ATOM   6386  O  O    . ASN A 1 19  ? -6.576  26.190 23.504 1.00 0.00 ? 19  ASN A O    3  
ATOM   6387  C  CB   . ASN A 1 19  ? -4.298  25.630 25.405 1.00 0.00 ? 19  ASN A CB   3  
ATOM   6388  C  CG   . ASN A 1 19  ? -5.273  26.204 26.435 1.00 0.00 ? 19  ASN A CG   3  
ATOM   6389  O  OD1  . ASN A 1 19  ? -6.449  25.897 26.432 1.00 0.00 ? 19  ASN A OD1  3  
ATOM   6390  N  ND2  . ASN A 1 19  ? -4.828  27.041 27.331 1.00 0.00 ? 19  ASN A ND2  3  
ATOM   6391  H  H    . ASN A 1 19  ? -5.459  28.270 24.625 1.00 0.00 ? 19  ASN A H    3  
ATOM   6392  H  HA   . ASN A 1 19  ? -3.346  26.465 23.634 1.00 0.00 ? 19  ASN A HA   3  
ATOM   6393  H  HB2  . ASN A 1 19  ? -4.604  24.628 25.144 1.00 0.00 ? 19  ASN A HB2  3  
ATOM   6394  H  HB3  . ASN A 1 19  ? -3.306  25.601 25.831 1.00 0.00 ? 19  ASN A HB3  3  
ATOM   6395  H  HD21 . ASN A 1 19  ? -3.881  27.292 27.340 1.00 0.00 ? 19  ASN A HD21 3  
ATOM   6396  H  HD22 . ASN A 1 19  ? -5.441  27.419 27.996 1.00 0.00 ? 19  ASN A HD22 3  
ATOM   6397  N  N    . THR A 1 20  ? -5.013  25.474 22.105 1.00 0.00 ? 20  THR A N    3  
ATOM   6398  C  CA   . THR A 1 20  ? -6.028  24.981 21.141 1.00 0.00 ? 20  THR A CA   3  
ATOM   6399  C  C    . THR A 1 20  ? -6.912  23.922 21.788 1.00 0.00 ? 20  THR A C    3  
ATOM   6400  O  O    . THR A 1 20  ? -6.535  22.771 21.893 1.00 0.00 ? 20  THR A O    3  
ATOM   6401  C  CB   . THR A 1 20  ? -5.299  24.358 19.942 1.00 0.00 ? 20  THR A CB   3  
ATOM   6402  O  OG1  . THR A 1 20  ? -6.149  23.329 19.475 1.00 0.00 ? 20  THR A OG1  3  
ATOM   6403  C  CG2  . THR A 1 20  ? -4.024  23.630 20.395 1.00 0.00 ? 20  THR A CG2  3  
ATOM   6404  H  H    . THR A 1 20  ? -4.057  25.374 21.911 1.00 0.00 ? 20  THR A H    3  
ATOM   6405  H  HA   . THR A 1 20  ? -6.652  25.817 20.823 1.00 0.00 ? 20  THR A HA   3  
ATOM   6406  H  HB   . THR A 1 20  ? -5.111  25.090 19.159 1.00 0.00 ? 20  THR A HB   3  
ATOM   6407  H  HG1  . THR A 1 20  ? -6.381  22.773 20.223 1.00 0.00 ? 20  THR A HG1  3  
ATOM   6408  H  HG21 . THR A 1 20  ? -4.251  22.983 21.229 1.00 0.00 ? 20  THR A HG21 3  
ATOM   6409  H  HG22 . THR A 1 20  ? -3.636  23.035 19.580 1.00 0.00 ? 20  THR A HG22 3  
ATOM   6410  H  HG23 . THR A 1 20  ? -3.278  24.351 20.695 1.00 0.00 ? 20  THR A HG23 3  
ATOM   6411  N  N    . LYS A 1 21  ? -8.078  24.331 22.210 1.00 0.00 ? 21  LYS A N    3  
ATOM   6412  C  CA   . LYS A 1 21  ? -8.999  23.364 22.853 1.00 0.00 ? 21  LYS A CA   3  
ATOM   6413  C  C    . LYS A 1 21  ? -9.308  22.209 21.918 1.00 0.00 ? 21  LYS A C    3  
ATOM   6414  O  O    . LYS A 1 21  ? -9.715  22.414 20.792 1.00 0.00 ? 21  LYS A O    3  
ATOM   6415  C  CB   . LYS A 1 21  ? -10.318 24.094 23.192 1.00 0.00 ? 21  LYS A CB   3  
ATOM   6416  C  CG   . LYS A 1 21  ? -11.390 23.064 23.573 1.00 0.00 ? 21  LYS A CG   3  
ATOM   6417  C  CD   . LYS A 1 21  ? -10.893 22.215 24.748 1.00 0.00 ? 21  LYS A CD   3  
ATOM   6418  C  CE   . LYS A 1 21  ? -10.424 23.137 25.876 1.00 0.00 ? 21  LYS A CE   3  
ATOM   6419  N  NZ   . LYS A 1 21  ? -10.447 22.419 27.178 1.00 0.00 ? 21  LYS A NZ   3  
ATOM   6420  H  H    . LYS A 1 21  ? -8.343  25.267 22.101 1.00 0.00 ? 21  LYS A H    3  
ATOM   6421  H  HA   . LYS A 1 21  ? -8.530  22.976 23.751 1.00 0.00 ? 21  LYS A HA   3  
ATOM   6422  H  HB2  . LYS A 1 21  ? -10.159 24.771 24.017 1.00 0.00 ? 21  LYS A HB2  3  
ATOM   6423  H  HB3  . LYS A 1 21  ? -10.651 24.659 22.331 1.00 0.00 ? 21  LYS A HB3  3  
ATOM   6424  H  HG2  . LYS A 1 21  ? -12.298 23.578 23.856 1.00 0.00 ? 21  LYS A HG2  3  
ATOM   6425  H  HG3  . LYS A 1 21  ? -11.598 22.427 22.728 1.00 0.00 ? 21  LYS A HG3  3  
ATOM   6426  H  HD2  . LYS A 1 21  ? -11.695 21.587 25.106 1.00 0.00 ? 21  LYS A HD2  3  
ATOM   6427  H  HD3  . LYS A 1 21  ? -10.076 21.591 24.425 1.00 0.00 ? 21  LYS A HD3  3  
ATOM   6428  H  HE2  . LYS A 1 21  ? -9.418  23.472 25.678 1.00 0.00 ? 21  LYS A HE2  3  
ATOM   6429  H  HE3  . LYS A 1 21  ? -11.076 23.997 25.935 1.00 0.00 ? 21  LYS A HE3  3  
ATOM   6430  H  HZ1  . LYS A 1 21  ? -11.297 21.821 27.229 1.00 0.00 ? 21  LYS A HZ1  3  
ATOM   6431  H  HZ2  . LYS A 1 21  ? -9.599  21.824 27.262 1.00 0.00 ? 21  LYS A HZ2  3  
ATOM   6432  H  HZ3  . LYS A 1 21  ? -10.463 23.111 27.952 1.00 0.00 ? 21  LYS A HZ3  3  
ATOM   6433  N  N    . PHE A 1 22  ? -9.101  21.009 22.398 1.00 0.00 ? 22  PHE A N    3  
ATOM   6434  C  CA   . PHE A 1 22  ? -9.380  19.829 21.547 1.00 0.00 ? 22  PHE A CA   3  
ATOM   6435  C  C    . PHE A 1 22  ? -10.694 20.023 20.817 1.00 0.00 ? 22  PHE A C    3  
ATOM   6436  O  O    . PHE A 1 22  ? -10.765 19.927 19.609 1.00 0.00 ? 22  PHE A O    3  
ATOM   6437  C  CB   . PHE A 1 22  ? -9.494  18.595 22.460 1.00 0.00 ? 22  PHE A CB   3  
ATOM   6438  C  CG   . PHE A 1 22  ? -8.656  17.451 21.874 1.00 0.00 ? 22  PHE A CG   3  
ATOM   6439  C  CD1  . PHE A 1 22  ? -9.087  16.768 20.746 1.00 0.00 ? 22  PHE A CD1  3  
ATOM   6440  C  CD2  . PHE A 1 22  ? -7.454  17.086 22.458 1.00 0.00 ? 22  PHE A CD2  3  
ATOM   6441  C  CE1  . PHE A 1 22  ? -8.330  15.742 20.217 1.00 0.00 ? 22  PHE A CE1  3  
ATOM   6442  C  CE2  . PHE A 1 22  ? -6.700  16.059 21.925 1.00 0.00 ? 22  PHE A CE2  3  
ATOM   6443  C  CZ   . PHE A 1 22  ? -7.139  15.389 20.807 1.00 0.00 ? 22  PHE A CZ   3  
ATOM   6444  H  H    . PHE A 1 22  ? -8.764  20.891 23.309 1.00 0.00 ? 22  PHE A H    3  
ATOM   6445  H  HA   . PHE A 1 22  ? -8.581  19.709 20.824 1.00 0.00 ? 22  PHE A HA   3  
ATOM   6446  H  HB2  . PHE A 1 22  ? -9.129  18.837 23.449 1.00 0.00 ? 22  PHE A HB2  3  
ATOM   6447  H  HB3  . PHE A 1 22  ? -10.527 18.285 22.530 1.00 0.00 ? 22  PHE A HB3  3  
ATOM   6448  H  HD1  . PHE A 1 22  ? -10.023 17.040 20.279 1.00 0.00 ? 22  PHE A HD1  3  
ATOM   6449  H  HD2  . PHE A 1 22  ? -7.105  17.608 23.336 1.00 0.00 ? 22  PHE A HD2  3  
ATOM   6450  H  HE1  . PHE A 1 22  ? -8.673  15.215 19.338 1.00 0.00 ? 22  PHE A HE1  3  
ATOM   6451  H  HE2  . PHE A 1 22  ? -5.764  15.783 22.386 1.00 0.00 ? 22  PHE A HE2  3  
ATOM   6452  H  HZ   . PHE A 1 22  ? -6.547  14.586 20.391 1.00 0.00 ? 22  PHE A HZ   3  
ATOM   6453  N  N    . THR A 1 23  ? -11.704 20.308 21.574 1.00 0.00 ? 23  THR A N    3  
ATOM   6454  C  CA   . THR A 1 23  ? -13.040 20.524 20.986 1.00 0.00 ? 23  THR A CA   3  
ATOM   6455  C  C    . THR A 1 23  ? -13.948 21.151 22.022 1.00 0.00 ? 23  THR A C    3  
ATOM   6456  O  O    . THR A 1 23  ? -14.241 20.548 23.028 1.00 0.00 ? 23  THR A O    3  
ATOM   6457  C  CB   . THR A 1 23  ? -13.624 19.168 20.575 1.00 0.00 ? 23  THR A CB   3  
ATOM   6458  O  OG1  . THR A 1 23  ? -13.054 18.233 21.463 1.00 0.00 ? 23  THR A OG1  3  
ATOM   6459  C  CG2  . THR A 1 23  ? -13.120 18.741 19.188 1.00 0.00 ? 23  THR A CG2  3  
ATOM   6460  H  H    . THR A 1 23  ? -11.581 20.380 22.543 1.00 0.00 ? 23  THR A H    3  
ATOM   6461  H  HA   . THR A 1 23  ? -12.953 21.192 20.129 1.00 0.00 ? 23  THR A HA   3  
ATOM   6462  H  HB   . THR A 1 23  ? -14.708 19.161 20.651 1.00 0.00 ? 23  THR A HB   3  
ATOM   6463  H  HG1  . THR A 1 23  ? -12.272 17.866 21.044 1.00 0.00 ? 23  THR A HG1  3  
ATOM   6464  H  HG21 . THR A 1 23  ? -12.876 19.615 18.601 1.00 0.00 ? 23  THR A HG21 3  
ATOM   6465  H  HG22 . THR A 1 23  ? -12.238 18.125 19.293 1.00 0.00 ? 23  THR A HG22 3  
ATOM   6466  H  HG23 . THR A 1 23  ? -13.887 18.176 18.680 1.00 0.00 ? 23  THR A HG23 3  
ATOM   6467  N  N    . GLU A 1 24  ? -14.366 22.356 21.778 1.00 0.00 ? 24  GLU A N    3  
ATOM   6468  C  CA   . GLU A 1 24  ? -15.255 23.013 22.759 1.00 0.00 ? 24  GLU A CA   3  
ATOM   6469  C  C    . GLU A 1 24  ? -16.368 22.062 23.194 1.00 0.00 ? 24  GLU A C    3  
ATOM   6470  O  O    . GLU A 1 24  ? -17.022 22.283 24.194 1.00 0.00 ? 24  GLU A O    3  
ATOM   6471  C  CB   . GLU A 1 24  ? -15.873 24.250 22.101 1.00 0.00 ? 24  GLU A CB   3  
ATOM   6472  C  CG   . GLU A 1 24  ? -16.840 23.805 20.999 1.00 0.00 ? 24  GLU A CG   3  
ATOM   6473  C  CD   . GLU A 1 24  ? -16.073 22.997 19.947 1.00 0.00 ? 24  GLU A CD   3  
ATOM   6474  O  OE1  . GLU A 1 24  ? -15.545 23.638 19.053 1.00 0.00 ? 24  GLU A OE1  3  
ATOM   6475  O  OE2  . GLU A 1 24  ? -16.061 21.787 20.097 1.00 0.00 ? 24  GLU A OE2  3  
ATOM   6476  H  H    . GLU A 1 24  ? -14.097 22.821 20.959 1.00 0.00 ? 24  GLU A H    3  
ATOM   6477  H  HA   . GLU A 1 24  ? -14.667 23.292 23.634 1.00 0.00 ? 24  GLU A HA   3  
ATOM   6478  H  HB2  . GLU A 1 24  ? -16.406 24.826 22.843 1.00 0.00 ? 24  GLU A HB2  3  
ATOM   6479  H  HB3  . GLU A 1 24  ? -15.090 24.860 21.675 1.00 0.00 ? 24  GLU A HB3  3  
ATOM   6480  H  HG2  . GLU A 1 24  ? -17.620 23.189 21.422 1.00 0.00 ? 24  GLU A HG2  3  
ATOM   6481  H  HG3  . GLU A 1 24  ? -17.283 24.670 20.530 1.00 0.00 ? 24  GLU A HG3  3  
ATOM   6482  N  N    . GLU A 1 25  ? -16.562 21.020 22.430 1.00 0.00 ? 25  GLU A N    3  
ATOM   6483  C  CA   . GLU A 1 25  ? -17.624 20.041 22.780 1.00 0.00 ? 25  GLU A CA   3  
ATOM   6484  C  C    . GLU A 1 25  ? -17.060 18.944 23.676 1.00 0.00 ? 25  GLU A C    3  
ATOM   6485  O  O    . GLU A 1 25  ? -17.727 17.973 23.972 1.00 0.00 ? 25  GLU A O    3  
ATOM   6486  C  CB   . GLU A 1 25  ? -18.137 19.395 21.482 1.00 0.00 ? 25  GLU A CB   3  
ATOM   6487  C  CG   . GLU A 1 25  ? -18.899 20.436 20.660 1.00 0.00 ? 25  GLU A CG   3  
ATOM   6488  C  CD   . GLU A 1 25  ? -19.282 19.827 19.309 1.00 0.00 ? 25  GLU A CD   3  
ATOM   6489  O  OE1  . GLU A 1 25  ? -20.084 18.907 19.338 1.00 0.00 ? 25  GLU A OE1  3  
ATOM   6490  O  OE2  . GLU A 1 25  ? -18.752 20.315 18.324 1.00 0.00 ? 25  GLU A OE2  3  
ATOM   6491  H  H    . GLU A 1 25  ? -16.012 20.886 21.629 1.00 0.00 ? 25  GLU A H    3  
ATOM   6492  H  HA   . GLU A 1 25  ? -18.427 20.557 23.306 1.00 0.00 ? 25  GLU A HA   3  
ATOM   6493  H  HB2  . GLU A 1 25  ? -17.302 19.022 20.908 1.00 0.00 ? 25  GLU A HB2  3  
ATOM   6494  H  HB3  . GLU A 1 25  ? -18.795 18.573 21.724 1.00 0.00 ? 25  GLU A HB3  3  
ATOM   6495  H  HG2  . GLU A 1 25  ? -19.794 20.733 21.185 1.00 0.00 ? 25  GLU A HG2  3  
ATOM   6496  H  HG3  . GLU A 1 25  ? -18.276 21.302 20.498 1.00 0.00 ? 25  GLU A HG3  3  
ATOM   6497  N  N    . GLU A 1 26  ? -15.833 19.121 24.091 1.00 0.00 ? 26  GLU A N    3  
ATOM   6498  C  CA   . GLU A 1 26  ? -15.199 18.107 24.966 1.00 0.00 ? 26  GLU A CA   3  
ATOM   6499  C  C    . GLU A 1 26  ? -15.465 18.401 26.435 1.00 0.00 ? 26  GLU A C    3  
ATOM   6500  O  O    . GLU A 1 26  ? -15.964 17.559 27.157 1.00 0.00 ? 26  GLU A O    3  
ATOM   6501  C  CB   . GLU A 1 26  ? -13.680 18.141 24.724 1.00 0.00 ? 26  GLU A CB   3  
ATOM   6502  C  CG   . GLU A 1 26  ? -13.022 17.006 25.510 1.00 0.00 ? 26  GLU A CG   3  
ATOM   6503  C  CD   . GLU A 1 26  ? -13.218 15.690 24.755 1.00 0.00 ? 26  GLU A CD   3  
ATOM   6504  O  OE1  . GLU A 1 26  ? -12.354 15.398 23.945 1.00 0.00 ? 26  GLU A OE1  3  
ATOM   6505  O  OE2  . GLU A 1 26  ? -14.222 15.053 25.029 1.00 0.00 ? 26  GLU A OE2  3  
ATOM   6506  H  H    . GLU A 1 26  ? -15.335 19.921 23.824 1.00 0.00 ? 26  GLU A H    3  
ATOM   6507  H  HA   . GLU A 1 26  ? -15.604 17.130 24.723 1.00 0.00 ? 26  GLU A HA   3  
ATOM   6508  H  HB2  . GLU A 1 26  ? -13.476 18.017 23.672 1.00 0.00 ? 26  GLU A HB2  3  
ATOM   6509  H  HB3  . GLU A 1 26  ? -13.280 19.089 25.052 1.00 0.00 ? 26  GLU A HB3  3  
ATOM   6510  H  HG2  . GLU A 1 26  ? -11.967 17.200 25.621 1.00 0.00 ? 26  GLU A HG2  3  
ATOM   6511  H  HG3  . GLU A 1 26  ? -13.476 16.927 26.487 1.00 0.00 ? 26  GLU A HG3  3  
ATOM   6512  N  N    . LEU A 1 27  ? -15.130 19.587 26.856 1.00 0.00 ? 27  LEU A N    3  
ATOM   6513  C  CA   . LEU A 1 27  ? -15.363 19.936 28.279 1.00 0.00 ? 27  LEU A CA   3  
ATOM   6514  C  C    . LEU A 1 27  ? -16.849 20.129 28.545 1.00 0.00 ? 27  LEU A C    3  
ATOM   6515  O  O    . LEU A 1 27  ? -17.240 20.602 29.592 1.00 0.00 ? 27  LEU A O    3  
ATOM   6516  C  CB   . LEU A 1 27  ? -14.616 21.244 28.626 1.00 0.00 ? 27  LEU A CB   3  
ATOM   6517  C  CG   . LEU A 1 27  ? -14.202 21.975 27.349 1.00 0.00 ? 27  LEU A CG   3  
ATOM   6518  C  CD1  . LEU A 1 27  ? -15.455 22.482 26.628 1.00 0.00 ? 27  LEU A CD1  3  
ATOM   6519  C  CD2  . LEU A 1 27  ? -13.324 23.165 27.729 1.00 0.00 ? 27  LEU A CD2  3  
ATOM   6520  H  H    . LEU A 1 27  ? -14.741 20.235 26.240 1.00 0.00 ? 27  LEU A H    3  
ATOM   6521  H  HA   . LEU A 1 27  ? -15.004 19.115 28.899 1.00 0.00 ? 27  LEU A HA   3  
ATOM   6522  H  HB2  . LEU A 1 27  ? -15.261 21.882 29.211 1.00 0.00 ? 27  LEU A HB2  3  
ATOM   6523  H  HB3  . LEU A 1 27  ? -13.735 21.011 29.206 1.00 0.00 ? 27  LEU A HB3  3  
ATOM   6524  H  HG   . LEU A 1 27  ? -13.650 21.311 26.705 1.00 0.00 ? 27  LEU A HG   3  
ATOM   6525  H  HD11 . LEU A 1 27  ? -16.010 23.139 27.282 1.00 0.00 ? 27  LEU A HD11 3  
ATOM   6526  H  HD12 . LEU A 1 27  ? -15.170 23.025 25.741 1.00 0.00 ? 27  LEU A HD12 3  
ATOM   6527  H  HD13 . LEU A 1 27  ? -16.079 21.646 26.350 1.00 0.00 ? 27  LEU A HD13 3  
ATOM   6528  H  HD21 . LEU A 1 27  ? -13.855 23.806 28.416 1.00 0.00 ? 27  LEU A HD21 3  
ATOM   6529  H  HD22 . LEU A 1 27  ? -12.419 22.810 28.203 1.00 0.00 ? 27  LEU A HD22 3  
ATOM   6530  H  HD23 . LEU A 1 27  ? -13.065 23.725 26.845 1.00 0.00 ? 27  LEU A HD23 3  
ATOM   6531  N  N    . SER A 1 28  ? -17.650 19.760 27.582 1.00 0.00 ? 28  SER A N    3  
ATOM   6532  C  CA   . SER A 1 28  ? -19.112 19.910 27.750 1.00 0.00 ? 28  SER A CA   3  
ATOM   6533  C  C    . SER A 1 28  ? -19.675 18.755 28.568 1.00 0.00 ? 28  SER A C    3  
ATOM   6534  O  O    . SER A 1 28  ? -20.294 18.959 29.594 1.00 0.00 ? 28  SER A O    3  
ATOM   6535  C  CB   . SER A 1 28  ? -19.761 19.894 26.360 1.00 0.00 ? 28  SER A CB   3  
ATOM   6536  O  OG   . SER A 1 28  ? -19.442 21.167 25.814 1.00 0.00 ? 28  SER A OG   3  
ATOM   6537  H  H    . SER A 1 28  ? -17.287 19.387 26.753 1.00 0.00 ? 28  SER A H    3  
ATOM   6538  H  HA   . SER A 1 28  ? -19.317 20.847 28.266 1.00 0.00 ? 28  SER A HA   3  
ATOM   6539  H  HB2  . SER A 1 28  ? -19.341 19.109 25.749 1.00 0.00 ? 28  SER A HB2  3  
ATOM   6540  H  HB3  . SER A 1 28  ? -20.832 19.778 26.438 1.00 0.00 ? 28  SER A HB3  3  
ATOM   6541  H  HG   . SER A 1 28  ? -19.108 21.719 26.524 1.00 0.00 ? 28  SER A HG   3  
ATOM   6542  N  N    . SER A 1 29  ? -19.448 17.558 28.098 1.00 0.00 ? 29  SER A N    3  
ATOM   6543  C  CA   . SER A 1 29  ? -19.960 16.377 28.832 1.00 0.00 ? 29  SER A CA   3  
ATOM   6544  C  C    . SER A 1 29  ? -18.934 15.885 29.846 1.00 0.00 ? 29  SER A C    3  
ATOM   6545  O  O    . SER A 1 29  ? -19.283 15.323 30.864 1.00 0.00 ? 29  SER A O    3  
ATOM   6546  C  CB   . SER A 1 29  ? -20.231 15.256 27.817 1.00 0.00 ? 29  SER A CB   3  
ATOM   6547  O  OG   . SER A 1 29  ? -21.314 15.746 27.041 1.00 0.00 ? 29  SER A OG   3  
ATOM   6548  H  H    . SER A 1 29  ? -18.944 17.441 27.268 1.00 0.00 ? 29  SER A H    3  
ATOM   6549  H  HA   . SER A 1 29  ? -20.870 16.655 29.356 1.00 0.00 ? 29  SER A HA   3  
ATOM   6550  H  HB2  . SER A 1 29  ? -19.367 15.088 27.190 1.00 0.00 ? 29  SER A HB2  3  
ATOM   6551  H  HB3  . SER A 1 29  ? -20.514 14.343 28.321 1.00 0.00 ? 29  SER A HB3  3  
ATOM   6552  H  HG   . SER A 1 29  ? -20.997 15.883 26.145 1.00 0.00 ? 29  SER A HG   3  
ATOM   6553  N  N    . TRP A 1 30  ? -17.684 16.108 29.546 1.00 0.00 ? 30  TRP A N    3  
ATOM   6554  C  CA   . TRP A 1 30  ? -16.618 15.663 30.474 1.00 0.00 ? 30  TRP A CA   3  
ATOM   6555  C  C    . TRP A 1 30  ? -16.958 16.074 31.908 1.00 0.00 ? 30  TRP A C    3  
ATOM   6556  O  O    . TRP A 1 30  ? -16.354 15.606 32.854 1.00 0.00 ? 30  TRP A O    3  
ATOM   6557  C  CB   . TRP A 1 30  ? -15.304 16.342 30.039 1.00 0.00 ? 30  TRP A CB   3  
ATOM   6558  C  CG   . TRP A 1 30  ? -14.113 15.800 30.851 1.00 0.00 ? 30  TRP A CG   3  
ATOM   6559  C  CD1  . TRP A 1 30  ? -14.137 14.715 31.618 1.00 0.00 ? 30  TRP A CD1  3  
ATOM   6560  C  CD2  . TRP A 1 30  ? -12.923 16.350 30.856 1.00 0.00 ? 30  TRP A CD2  3  
ATOM   6561  N  NE1  . TRP A 1 30  ? -12.877 14.638 32.096 1.00 0.00 ? 30  TRP A NE1  3  
ATOM   6562  C  CE2  . TRP A 1 30  ? -12.039 15.648 31.653 1.00 0.00 ? 30  TRP A CE2  3  
ATOM   6563  C  CE3  . TRP A 1 30  ? -12.501 17.481 30.186 1.00 0.00 ? 30  TRP A CE3  3  
ATOM   6564  C  CZ2  . TRP A 1 30  ? -10.729 16.080 31.775 1.00 0.00 ? 30  TRP A CZ2  3  
ATOM   6565  C  CZ3  . TRP A 1 30  ? -11.194 17.909 30.310 1.00 0.00 ? 30  TRP A CZ3  3  
ATOM   6566  C  CH2  . TRP A 1 30  ? -10.310 17.210 31.104 1.00 0.00 ? 30  TRP A CH2  3  
ATOM   6567  H  H    . TRP A 1 30  ? -17.452 16.570 28.712 1.00 0.00 ? 30  TRP A H    3  
ATOM   6568  H  HA   . TRP A 1 30  ? -16.536 14.578 30.420 1.00 0.00 ? 30  TRP A HA   3  
ATOM   6569  H  HB2  . TRP A 1 30  ? -15.131 16.149 28.988 1.00 0.00 ? 30  TRP A HB2  3  
ATOM   6570  H  HB3  . TRP A 1 30  ? -15.380 17.405 30.191 1.00 0.00 ? 30  TRP A HB3  3  
ATOM   6571  H  HD1  . TRP A 1 30  ? -14.958 14.038 31.794 1.00 0.00 ? 30  TRP A HD1  3  
ATOM   6572  H  HE1  . TRP A 1 30  ? -12.582 13.933 32.707 1.00 0.00 ? 30  TRP A HE1  3  
ATOM   6573  H  HE3  . TRP A 1 30  ? -13.192 18.032 29.567 1.00 0.00 ? 30  TRP A HE3  3  
ATOM   6574  H  HZ2  . TRP A 1 30  ? -10.032 15.527 32.387 1.00 0.00 ? 30  TRP A HZ2  3  
ATOM   6575  H  HZ3  . TRP A 1 30  ? -10.864 18.791 29.784 1.00 0.00 ? 30  TRP A HZ3  3  
ATOM   6576  H  HH2  . TRP A 1 30  ? -9.289  17.549 31.204 1.00 0.00 ? 30  TRP A HH2  3  
ATOM   6577  N  N    . TYR A 1 31  ? -17.925 16.946 32.038 1.00 0.00 ? 31  TYR A N    3  
ATOM   6578  C  CA   . TYR A 1 31  ? -18.324 17.403 33.396 1.00 0.00 ? 31  TYR A CA   3  
ATOM   6579  C  C    . TYR A 1 31  ? -19.193 16.355 34.086 1.00 0.00 ? 31  TYR A C    3  
ATOM   6580  O  O    . TYR A 1 31  ? -18.780 15.740 35.047 1.00 0.00 ? 31  TYR A O    3  
ATOM   6581  C  CB   . TYR A 1 31  ? -19.133 18.699 33.252 1.00 0.00 ? 31  TYR A CB   3  
ATOM   6582  C  CG   . TYR A 1 31  ? -19.632 19.144 34.632 1.00 0.00 ? 31  TYR A CG   3  
ATOM   6583  C  CD1  . TYR A 1 31  ? -18.743 19.358 35.667 1.00 0.00 ? 31  TYR A CD1  3  
ATOM   6584  C  CD2  . TYR A 1 31  ? -20.979 19.347 34.856 1.00 0.00 ? 31  TYR A CD2  3  
ATOM   6585  C  CE1  . TYR A 1 31  ? -19.195 19.769 36.906 1.00 0.00 ? 31  TYR A CE1  3  
ATOM   6586  C  CE2  . TYR A 1 31  ? -21.429 19.757 36.094 1.00 0.00 ? 31  TYR A CE2  3  
ATOM   6587  C  CZ   . TYR A 1 31  ? -20.542 19.972 37.128 1.00 0.00 ? 31  TYR A CZ   3  
ATOM   6588  O  OH   . TYR A 1 31  ? -20.994 20.385 38.365 1.00 0.00 ? 31  TYR A OH   3  
ATOM   6589  H  H    . TYR A 1 31  ? -18.384 17.297 31.245 1.00 0.00 ? 31  TYR A H    3  
ATOM   6590  H  HA   . TYR A 1 31  ? -17.427 17.568 33.991 1.00 0.00 ? 31  TYR A HA   3  
ATOM   6591  H  HB2  . TYR A 1 31  ? -18.511 19.475 32.831 1.00 0.00 ? 31  TYR A HB2  3  
ATOM   6592  H  HB3  . TYR A 1 31  ? -19.980 18.531 32.604 1.00 0.00 ? 31  TYR A HB3  3  
ATOM   6593  H  HD1  . TYR A 1 31  ? -17.685 19.204 35.506 1.00 0.00 ? 31  TYR A HD1  3  
ATOM   6594  H  HD2  . TYR A 1 31  ? -21.686 19.180 34.058 1.00 0.00 ? 31  TYR A HD2  3  
ATOM   6595  H  HE1  . TYR A 1 31  ? -18.489 19.934 37.707 1.00 0.00 ? 31  TYR A HE1  3  
ATOM   6596  H  HE2  . TYR A 1 31  ? -22.486 19.912 36.256 1.00 0.00 ? 31  TYR A HE2  3  
ATOM   6597  H  HH   . TYR A 1 31  ? -21.955 20.392 38.342 1.00 0.00 ? 31  TYR A HH   3  
ATOM   6598  N  N    . GLN A 1 32  ? -20.388 16.169 33.588 1.00 0.00 ? 32  GLN A N    3  
ATOM   6599  C  CA   . GLN A 1 32  ? -21.283 15.164 34.214 1.00 0.00 ? 32  GLN A CA   3  
ATOM   6600  C  C    . GLN A 1 32  ? -20.639 13.785 34.189 1.00 0.00 ? 32  GLN A C    3  
ATOM   6601  O  O    . GLN A 1 32  ? -20.628 13.086 35.181 1.00 0.00 ? 32  GLN A O    3  
ATOM   6602  C  CB   . GLN A 1 32  ? -22.605 15.112 33.426 1.00 0.00 ? 32  GLN A CB   3  
ATOM   6603  C  CG   . GLN A 1 32  ? -22.372 14.404 32.090 1.00 0.00 ? 32  GLN A CG   3  
ATOM   6604  C  CD   . GLN A 1 32  ? -23.616 14.553 31.214 1.00 0.00 ? 32  GLN A CD   3  
ATOM   6605  O  OE1  . GLN A 1 32  ? -24.069 15.646 30.941 1.00 0.00 ? 32  GLN A OE1  3  
ATOM   6606  N  NE2  . GLN A 1 32  ? -24.196 13.479 30.754 1.00 0.00 ? 32  GLN A NE2  3  
ATOM   6607  H  H    . GLN A 1 32  ? -20.690 16.690 32.813 1.00 0.00 ? 32  GLN A H    3  
ATOM   6608  H  HA   . GLN A 1 32  ? -21.459 15.449 35.251 1.00 0.00 ? 32  GLN A HA   3  
ATOM   6609  H  HB2  . GLN A 1 32  ? -23.345 14.572 33.996 1.00 0.00 ? 32  GLN A HB2  3  
ATOM   6610  H  HB3  . GLN A 1 32  ? -22.961 16.116 33.246 1.00 0.00 ? 32  GLN A HB3  3  
ATOM   6611  H  HG2  . GLN A 1 32  ? -21.525 14.841 31.585 1.00 0.00 ? 32  GLN A HG2  3  
ATOM   6612  H  HG3  . GLN A 1 32  ? -22.186 13.355 32.259 1.00 0.00 ? 32  GLN A HG3  3  
ATOM   6613  H  HE21 . GLN A 1 32  ? -23.833 12.594 30.972 1.00 0.00 ? 32  GLN A HE21 3  
ATOM   6614  H  HE22 . GLN A 1 32  ? -24.994 13.555 30.192 1.00 0.00 ? 32  GLN A HE22 3  
ATOM   6615  N  N    . SER A 1 33  ? -20.114 13.412 33.058 1.00 0.00 ? 33  SER A N    3  
ATOM   6616  C  CA   . SER A 1 33  ? -19.474 12.084 32.973 1.00 0.00 ? 33  SER A CA   3  
ATOM   6617  C  C    . SER A 1 33  ? -18.472 11.928 34.096 1.00 0.00 ? 33  SER A C    3  
ATOM   6618  O  O    . SER A 1 33  ? -18.327 10.862 34.661 1.00 0.00 ? 33  SER A O    3  
ATOM   6619  C  CB   . SER A 1 33  ? -18.741 11.975 31.626 1.00 0.00 ? 33  SER A CB   3  
ATOM   6620  O  OG   . SER A 1 33  ? -17.877 10.860 31.787 1.00 0.00 ? 33  SER A OG   3  
ATOM   6621  H  H    . SER A 1 33  ? -20.144 14.002 32.276 1.00 0.00 ? 33  SER A H    3  
ATOM   6622  H  HA   . SER A 1 33  ? -20.238 11.312 33.069 1.00 0.00 ? 33  SER A HA   3  
ATOM   6623  H  HB2  . SER A 1 33  ? -19.439 11.794 30.823 1.00 0.00 ? 33  SER A HB2  3  
ATOM   6624  H  HB3  . SER A 1 33  ? -18.165 12.868 31.430 1.00 0.00 ? 33  SER A HB3  3  
ATOM   6625  H  HG   . SER A 1 33  ? -17.400 10.732 30.964 1.00 0.00 ? 33  SER A HG   3  
ATOM   6626  N  N    . PHE A 1 34  ? -17.799 13.001 34.407 1.00 0.00 ? 34  PHE A N    3  
ATOM   6627  C  CA   . PHE A 1 34  ? -16.802 12.939 35.491 1.00 0.00 ? 34  PHE A CA   3  
ATOM   6628  C  C    . PHE A 1 34  ? -17.497 12.880 36.839 1.00 0.00 ? 34  PHE A C    3  
ATOM   6629  O  O    . PHE A 1 34  ? -17.026 12.233 37.752 1.00 0.00 ? 34  PHE A O    3  
ATOM   6630  C  CB   . PHE A 1 34  ? -15.928 14.203 35.433 1.00 0.00 ? 34  PHE A CB   3  
ATOM   6631  C  CG   . PHE A 1 34  ? -15.228 14.393 36.777 1.00 0.00 ? 34  PHE A CG   3  
ATOM   6632  C  CD1  . PHE A 1 34  ? -15.873 15.036 37.822 1.00 0.00 ? 34  PHE A CD1  3  
ATOM   6633  C  CD2  . PHE A 1 34  ? -13.943 13.924 36.971 1.00 0.00 ? 34  PHE A CD2  3  
ATOM   6634  C  CE1  . PHE A 1 34  ? -15.239 15.204 39.035 1.00 0.00 ? 34  PHE A CE1  3  
ATOM   6635  C  CE2  . PHE A 1 34  ? -13.312 14.093 38.185 1.00 0.00 ? 34  PHE A CE2  3  
ATOM   6636  C  CZ   . PHE A 1 34  ? -13.960 14.733 39.215 1.00 0.00 ? 34  PHE A CZ   3  
ATOM   6637  H  H    . PHE A 1 34  ? -17.953 13.840 33.923 1.00 0.00 ? 34  PHE A H    3  
ATOM   6638  H  HA   . PHE A 1 34  ? -16.199 12.040 35.367 1.00 0.00 ? 34  PHE A HA   3  
ATOM   6639  H  HB2  . PHE A 1 34  ? -15.185 14.099 34.657 1.00 0.00 ? 34  PHE A HB2  3  
ATOM   6640  H  HB3  . PHE A 1 34  ? -16.541 15.065 35.225 1.00 0.00 ? 34  PHE A HB3  3  
ATOM   6641  H  HD1  . PHE A 1 34  ? -16.877 15.407 37.684 1.00 0.00 ? 34  PHE A HD1  3  
ATOM   6642  H  HD2  . PHE A 1 34  ? -13.429 13.420 36.165 1.00 0.00 ? 34  PHE A HD2  3  
ATOM   6643  H  HE1  . PHE A 1 34  ? -15.749 15.705 39.845 1.00 0.00 ? 34  PHE A HE1  3  
ATOM   6644  H  HE2  . PHE A 1 34  ? -12.308 13.724 38.328 1.00 0.00 ? 34  PHE A HE2  3  
ATOM   6645  H  HZ   . PHE A 1 34  ? -13.466 14.864 40.165 1.00 0.00 ? 34  PHE A HZ   3  
ATOM   6646  N  N    . LEU A 1 35  ? -18.611 13.557 36.948 1.00 0.00 ? 35  LEU A N    3  
ATOM   6647  C  CA   . LEU A 1 35  ? -19.331 13.533 38.237 1.00 0.00 ? 35  LEU A CA   3  
ATOM   6648  C  C    . LEU A 1 35  ? -19.758 12.116 38.560 1.00 0.00 ? 35  LEU A C    3  
ATOM   6649  O  O    . LEU A 1 35  ? -19.809 11.723 39.706 1.00 0.00 ? 35  LEU A O    3  
ATOM   6650  C  CB   . LEU A 1 35  ? -20.589 14.405 38.122 1.00 0.00 ? 35  LEU A CB   3  
ATOM   6651  C  CG   . LEU A 1 35  ? -20.245 15.839 38.525 1.00 0.00 ? 35  LEU A CG   3  
ATOM   6652  C  CD1  . LEU A 1 35  ? -21.439 16.747 38.217 1.00 0.00 ? 35  LEU A CD1  3  
ATOM   6653  C  CD2  . LEU A 1 35  ? -19.952 15.883 40.026 1.00 0.00 ? 35  LEU A CD2  3  
ATOM   6654  H  H    . LEU A 1 35  ? -18.965 14.072 36.187 1.00 0.00 ? 35  LEU A H    3  
ATOM   6655  H  HA   . LEU A 1 35  ? -18.672 13.897 39.024 1.00 0.00 ? 35  LEU A HA   3  
ATOM   6656  H  HB2  . LEU A 1 35  ? -20.949 14.390 37.106 1.00 0.00 ? 35  LEU A HB2  3  
ATOM   6657  H  HB3  . LEU A 1 35  ? -21.357 14.017 38.775 1.00 0.00 ? 35  LEU A HB3  3  
ATOM   6658  H  HG   . LEU A 1 35  ? -19.380 16.176 37.974 1.00 0.00 ? 35  LEU A HG   3  
ATOM   6659  H  HD11 . LEU A 1 35  ? -22.313 16.393 38.745 1.00 0.00 ? 35  LEU A HD11 3  
ATOM   6660  H  HD12 . LEU A 1 35  ? -21.220 17.757 38.530 1.00 0.00 ? 35  LEU A HD12 3  
ATOM   6661  H  HD13 . LEU A 1 35  ? -21.638 16.741 37.156 1.00 0.00 ? 35  LEU A HD13 3  
ATOM   6662  H  HD21 . LEU A 1 35  ? -20.461 15.069 40.521 1.00 0.00 ? 35  LEU A HD21 3  
ATOM   6663  H  HD22 . LEU A 1 35  ? -18.889 15.793 40.193 1.00 0.00 ? 35  LEU A HD22 3  
ATOM   6664  H  HD23 . LEU A 1 35  ? -20.298 16.820 40.436 1.00 0.00 ? 35  LEU A HD23 3  
ATOM   6665  N  N    . LYS A 1 36  ? -20.060 11.366 37.531 1.00 0.00 ? 36  LYS A N    3  
ATOM   6666  C  CA   . LYS A 1 36  ? -20.486 9.971  37.753 1.00 0.00 ? 36  LYS A CA   3  
ATOM   6667  C  C    . LYS A 1 36  ? -19.296 9.024  37.741 1.00 0.00 ? 36  LYS A C    3  
ATOM   6668  O  O    . LYS A 1 36  ? -19.315 7.995  38.387 1.00 0.00 ? 36  LYS A O    3  
ATOM   6669  C  CB   . LYS A 1 36  ? -21.441 9.570  36.623 1.00 0.00 ? 36  LYS A CB   3  
ATOM   6670  C  CG   . LYS A 1 36  ? -22.653 10.498 36.639 1.00 0.00 ? 36  LYS A CG   3  
ATOM   6671  C  CD   . LYS A 1 36  ? -23.758 9.862  37.483 1.00 0.00 ? 36  LYS A CD   3  
ATOM   6672  C  CE   . LYS A 1 36  ? -24.758 10.941 37.895 1.00 0.00 ? 36  LYS A CE   3  
ATOM   6673  N  NZ   . LYS A 1 36  ? -24.108 11.937 38.791 1.00 0.00 ? 36  LYS A NZ   3  
ATOM   6674  H  H    . LYS A 1 36  ? -20.004 11.728 36.620 1.00 0.00 ? 36  LYS A H    3  
ATOM   6675  H  HA   . LYS A 1 36  ? -20.982 9.908  38.718 1.00 0.00 ? 36  LYS A HA   3  
ATOM   6676  H  HB2  . LYS A 1 36  ? -20.932 9.649  35.673 1.00 0.00 ? 36  LYS A HB2  3  
ATOM   6677  H  HB3  . LYS A 1 36  ? -21.763 8.548  36.768 1.00 0.00 ? 36  LYS A HB3  3  
ATOM   6678  H  HG2  . LYS A 1 36  ? -22.374 11.451 37.064 1.00 0.00 ? 36  LYS A HG2  3  
ATOM   6679  H  HG3  . LYS A 1 36  ? -23.007 10.649 35.630 1.00 0.00 ? 36  LYS A HG3  3  
ATOM   6680  H  HD2  . LYS A 1 36  ? -24.263 9.101  36.907 1.00 0.00 ? 36  LYS A HD2  3  
ATOM   6681  H  HD3  . LYS A 1 36  ? -23.327 9.410  38.365 1.00 0.00 ? 36  LYS A HD3  3  
ATOM   6682  H  HE2  . LYS A 1 36  ? -25.128 11.447 37.015 1.00 0.00 ? 36  LYS A HE2  3  
ATOM   6683  H  HE3  . LYS A 1 36  ? -25.588 10.486 38.416 1.00 0.00 ? 36  LYS A HE3  3  
ATOM   6684  H  HZ1  . LYS A 1 36  ? -23.417 11.456 39.401 1.00 0.00 ? 36  LYS A HZ1  3  
ATOM   6685  H  HZ2  . LYS A 1 36  ? -23.621 12.655 38.216 1.00 0.00 ? 36  LYS A HZ2  3  
ATOM   6686  H  HZ3  . LYS A 1 36  ? -24.830 12.396 39.381 1.00 0.00 ? 36  LYS A HZ3  3  
ATOM   6687  N  N    . GLU A 1 37  ? -18.276 9.381  37.007 1.00 0.00 ? 37  GLU A N    3  
ATOM   6688  C  CA   . GLU A 1 37  ? -17.099 8.517  36.948 1.00 0.00 ? 37  GLU A CA   3  
ATOM   6689  C  C    . GLU A 1 37  ? -16.125 8.863  38.068 1.00 0.00 ? 37  GLU A C    3  
ATOM   6690  O  O    . GLU A 1 37  ? -15.254 8.085  38.406 1.00 0.00 ? 37  GLU A O    3  
ATOM   6691  C  CB   . GLU A 1 37  ? -16.418 8.760  35.600 1.00 0.00 ? 37  GLU A CB   3  
ATOM   6692  C  CG   . GLU A 1 37  ? -15.030 8.168  35.641 1.00 0.00 ? 37  GLU A CG   3  
ATOM   6693  C  CD   . GLU A 1 37  ? -14.489 8.056  34.214 1.00 0.00 ? 37  GLU A CD   3  
ATOM   6694  O  OE1  . GLU A 1 37  ? -15.079 8.698  33.361 1.00 0.00 ? 37  GLU A OE1  3  
ATOM   6695  O  OE2  . GLU A 1 37  ? -13.517 7.335  34.058 1.00 0.00 ? 37  GLU A OE2  3  
ATOM   6696  H  H    . GLU A 1 37  ? -18.288 10.217 36.505 1.00 0.00 ? 37  GLU A H    3  
ATOM   6697  H  HA   . GLU A 1 37  ? -17.411 7.482  37.047 1.00 0.00 ? 37  GLU A HA   3  
ATOM   6698  H  HB2  . GLU A 1 37  ? -16.992 8.295  34.813 1.00 0.00 ? 37  GLU A HB2  3  
ATOM   6699  H  HB3  . GLU A 1 37  ? -16.353 9.821  35.414 1.00 0.00 ? 37  GLU A HB3  3  
ATOM   6700  H  HG2  . GLU A 1 37  ? -14.384 8.803  36.224 1.00 0.00 ? 37  GLU A HG2  3  
ATOM   6701  H  HG3  . GLU A 1 37  ? -15.071 7.189  36.087 1.00 0.00 ? 37  GLU A HG3  3  
ATOM   6702  N  N    . CYS A 1 38  ? -16.300 10.029 38.627 1.00 0.00 ? 38  CYS A N    3  
ATOM   6703  C  CA   . CYS A 1 38  ? -15.407 10.461 39.726 1.00 0.00 ? 38  CYS A CA   3  
ATOM   6704  C  C    . CYS A 1 38  ? -16.170 11.347 40.717 1.00 0.00 ? 38  CYS A C    3  
ATOM   6705  O  O    . CYS A 1 38  ? -16.148 12.558 40.615 1.00 0.00 ? 38  CYS A O    3  
ATOM   6706  C  CB   . CYS A 1 38  ? -14.264 11.287 39.115 1.00 0.00 ? 38  CYS A CB   3  
ATOM   6707  S  SG   . CYS A 1 38  ? -13.054 12.005 40.255 1.00 0.00 ? 38  CYS A SG   3  
ATOM   6708  H  H    . CYS A 1 38  ? -17.021 10.617 38.321 1.00 0.00 ? 38  CYS A H    3  
ATOM   6709  H  HA   . CYS A 1 38  ? -15.019 9.587  40.237 1.00 0.00 ? 38  CYS A HA   3  
ATOM   6710  H  HB2  . CYS A 1 38  ? -13.727 10.657 38.423 1.00 0.00 ? 38  CYS A HB2  3  
ATOM   6711  H  HB3  . CYS A 1 38  ? -14.700 12.097 38.550 1.00 0.00 ? 38  CYS A HB3  3  
ATOM   6712  H  HG   . CYS A 1 38  ? -12.250 11.485 40.200 1.00 0.00 ? 38  CYS A HG   3  
ATOM   6713  N  N    . PRO A 1 39  ? -16.837 10.716 41.665 1.00 0.00 ? 39  PRO A N    3  
ATOM   6714  C  CA   . PRO A 1 39  ? -17.606 11.447 42.670 1.00 0.00 ? 39  PRO A CA   3  
ATOM   6715  C  C    . PRO A 1 39  ? -16.704 12.336 43.517 1.00 0.00 ? 39  PRO A C    3  
ATOM   6716  O  O    . PRO A 1 39  ? -17.143 12.929 44.483 1.00 0.00 ? 39  PRO A O    3  
ATOM   6717  C  CB   . PRO A 1 39  ? -18.247 10.353 43.552 1.00 0.00 ? 39  PRO A CB   3  
ATOM   6718  C  CG   . PRO A 1 39  ? -17.836 8.973  42.950 1.00 0.00 ? 39  PRO A CG   3  
ATOM   6719  C  CD   . PRO A 1 39  ? -16.862 9.254  41.794 1.00 0.00 ? 39  PRO A CD   3  
ATOM   6720  H  HA   . PRO A 1 39  ? -18.365 12.050 42.182 1.00 0.00 ? 39  PRO A HA   3  
ATOM   6721  H  HB2  . PRO A 1 39  ? -17.885 10.437 44.565 1.00 0.00 ? 39  PRO A HB2  3  
ATOM   6722  H  HB3  . PRO A 1 39  ? -19.322 10.453 43.542 1.00 0.00 ? 39  PRO A HB3  3  
ATOM   6723  H  HG2  . PRO A 1 39  ? -17.350 8.371  43.704 1.00 0.00 ? 39  PRO A HG2  3  
ATOM   6724  H  HG3  . PRO A 1 39  ? -18.709 8.456  42.581 1.00 0.00 ? 39  PRO A HG3  3  
ATOM   6725  H  HD2  . PRO A 1 39  ? -15.878 8.884  42.042 1.00 0.00 ? 39  PRO A HD2  3  
ATOM   6726  H  HD3  . PRO A 1 39  ? -17.213 8.804  40.878 1.00 0.00 ? 39  PRO A HD3  3  
ATOM   6727  N  N    . SER A 1 40  ? -15.457 12.413 43.134 1.00 0.00 ? 40  SER A N    3  
ATOM   6728  C  CA   . SER A 1 40  ? -14.504 13.256 43.898 1.00 0.00 ? 40  SER A CA   3  
ATOM   6729  C  C    . SER A 1 40  ? -14.331 14.619 43.236 1.00 0.00 ? 40  SER A C    3  
ATOM   6730  O  O    . SER A 1 40  ? -13.372 14.846 42.526 1.00 0.00 ? 40  SER A O    3  
ATOM   6731  C  CB   . SER A 1 40  ? -13.143 12.547 43.920 1.00 0.00 ? 40  SER A CB   3  
ATOM   6732  O  OG   . SER A 1 40  ? -12.315 13.410 44.685 1.00 0.00 ? 40  SER A OG   3  
ATOM   6733  H  H    . SER A 1 40  ? -15.151 11.915 42.346 1.00 0.00 ? 40  SER A H    3  
ATOM   6734  H  HA   . SER A 1 40  ? -14.881 13.398 44.910 1.00 0.00 ? 40  SER A HA   3  
ATOM   6735  H  HB2  . SER A 1 40  ? -13.220 11.581 44.398 1.00 0.00 ? 40  SER A HB2  3  
ATOM   6736  H  HB3  . SER A 1 40  ? -12.749 12.442 42.920 1.00 0.00 ? 40  SER A HB3  3  
ATOM   6737  H  HG   . SER A 1 40  ? -11.684 12.869 45.165 1.00 0.00 ? 40  SER A HG   3  
ATOM   6738  N  N    . GLY A 1 41  ? -15.265 15.501 43.479 1.00 0.00 ? 41  GLY A N    3  
ATOM   6739  C  CA   . GLY A 1 41  ? -15.171 16.860 42.869 1.00 0.00 ? 41  GLY A CA   3  
ATOM   6740  C  C    . GLY A 1 41  ? -13.732 17.382 42.949 1.00 0.00 ? 41  GLY A C    3  
ATOM   6741  O  O    . GLY A 1 41  ? -13.192 17.870 41.977 1.00 0.00 ? 41  GLY A O    3  
ATOM   6742  H  H    . GLY A 1 41  ? -16.022 15.271 44.057 1.00 0.00 ? 41  GLY A H    3  
ATOM   6743  H  HA2  . GLY A 1 41  ? -15.475 16.808 41.834 1.00 0.00 ? 41  GLY A HA2  3  
ATOM   6744  H  HA3  . GLY A 1 41  ? -15.826 17.534 43.399 1.00 0.00 ? 41  GLY A HA3  3  
ATOM   6745  N  N    . ARG A 1 42  ? -13.145 17.267 44.111 1.00 0.00 ? 42  ARG A N    3  
ATOM   6746  C  CA   . ARG A 1 42  ? -11.749 17.747 44.278 1.00 0.00 ? 42  ARG A CA   3  
ATOM   6747  C  C    . ARG A 1 42  ? -10.763 16.604 44.091 1.00 0.00 ? 42  ARG A C    3  
ATOM   6748  O  O    . ARG A 1 42  ? -10.594 15.777 44.965 1.00 0.00 ? 42  ARG A O    3  
ATOM   6749  C  CB   . ARG A 1 42  ? -11.595 18.304 45.700 1.00 0.00 ? 42  ARG A CB   3  
ATOM   6750  C  CG   . ARG A 1 42  ? -12.427 19.582 45.831 1.00 0.00 ? 42  ARG A CG   3  
ATOM   6751  C  CD   . ARG A 1 42  ? -11.630 20.631 46.611 1.00 0.00 ? 42  ARG A CD   3  
ATOM   6752  N  NE   . ARG A 1 42  ? -12.578 21.481 47.381 1.00 0.00 ? 42  ARG A NE   3  
ATOM   6753  C  CZ   . ARG A 1 42  ? -13.017 21.062 48.537 1.00 0.00 ? 42  ARG A CZ   3  
ATOM   6754  N  NH1  . ARG A 1 42  ? -12.182 20.984 49.536 1.00 0.00 ? 42  ARG A NH1  3  
ATOM   6755  N  NH2  . ARG A 1 42  ? -14.274 20.731 48.653 1.00 0.00 ? 42  ARG A NH2  3  
ATOM   6756  H  H    . ARG A 1 42  ? -13.623 16.866 44.866 1.00 0.00 ? 42  ARG A H    3  
ATOM   6757  H  HA   . ARG A 1 42  ? -11.543 18.518 43.536 1.00 0.00 ? 42  ARG A HA   3  
ATOM   6758  H  HB2  . ARG A 1 42  ? -11.938 17.572 46.416 1.00 0.00 ? 42  ARG A HB2  3  
ATOM   6759  H  HB3  . ARG A 1 42  ? -10.555 18.526 45.889 1.00 0.00 ? 42  ARG A HB3  3  
ATOM   6760  H  HG2  . ARG A 1 42  ? -12.662 19.963 44.847 1.00 0.00 ? 42  ARG A HG2  3  
ATOM   6761  H  HG3  . ARG A 1 42  ? -13.347 19.363 46.352 1.00 0.00 ? 42  ARG A HG3  3  
ATOM   6762  H  HD2  . ARG A 1 42  ? -10.951 20.144 47.295 1.00 0.00 ? 42  ARG A HD2  3  
ATOM   6763  H  HD3  . ARG A 1 42  ? -11.068 21.250 45.926 1.00 0.00 ? 42  ARG A HD3  3  
ATOM   6764  H  HE   . ARG A 1 42  ? -12.869 22.345 47.024 1.00 0.00 ? 42  ARG A HE   3  
ATOM   6765  H  HH11 . ARG A 1 42  ? -11.224 21.243 49.408 1.00 0.00 ? 42  ARG A HH11 3  
ATOM   6766  H  HH12 . ARG A 1 42  ? -12.500 20.668 50.430 1.00 0.00 ? 42  ARG A HH12 3  
ATOM   6767  H  HH21 . ARG A 1 42  ? -14.885 20.798 47.863 1.00 0.00 ? 42  ARG A HH21 3  
ATOM   6768  H  HH22 . ARG A 1 42  ? -14.628 20.410 49.532 1.00 0.00 ? 42  ARG A HH22 3  
ATOM   6769  N  N    . ILE A 1 43  ? -10.129 16.576 42.955 1.00 0.00 ? 43  ILE A N    3  
ATOM   6770  C  CA   . ILE A 1 43  ? -9.153  15.495 42.697 1.00 0.00 ? 43  ILE A CA   3  
ATOM   6771  C  C    . ILE A 1 43  ? -7.913  15.671 43.566 1.00 0.00 ? 43  ILE A C    3  
ATOM   6772  O  O    . ILE A 1 43  ? -7.263  16.696 43.524 1.00 0.00 ? 43  ILE A O    3  
ATOM   6773  C  CB   . ILE A 1 43  ? -8.741  15.561 41.227 1.00 0.00 ? 43  ILE A CB   3  
ATOM   6774  C  CG1  . ILE A 1 43  ? -9.976  15.430 40.343 1.00 0.00 ? 43  ILE A CG1  3  
ATOM   6775  C  CG2  . ILE A 1 43  ? -7.794  14.386 40.927 1.00 0.00 ? 43  ILE A CG2  3  
ATOM   6776  C  CD1  . ILE A 1 43  ? -9.588  15.723 38.894 1.00 0.00 ? 43  ILE A CD1  3  
ATOM   6777  H  H    . ILE A 1 43  ? -10.295 17.265 42.278 1.00 0.00 ? 43  ILE A H    3  
ATOM   6778  H  HA   . ILE A 1 43  ? -9.615  14.535 42.928 1.00 0.00 ? 43  ILE A HA   3  
ATOM   6779  H  HB   . ILE A 1 43  ? -8.255  16.519 41.030 1.00 0.00 ? 43  ILE A HB   3  
ATOM   6780  H  HG12 . ILE A 1 43  ? -10.371 14.427 40.419 1.00 0.00 ? 43  ILE A HG12 3  
ATOM   6781  H  HG13 . ILE A 1 43  ? -10.730 16.132 40.667 1.00 0.00 ? 43  ILE A HG13 3  
ATOM   6782  H  HG21 . ILE A 1 43  ? -6.992  14.373 41.650 1.00 0.00 ? 43  ILE A HG21 3  
ATOM   6783  H  HG22 . ILE A 1 43  ? -8.338  13.455 40.983 1.00 0.00 ? 43  ILE A HG22 3  
ATOM   6784  H  HG23 . ILE A 1 43  ? -7.379  14.497 39.936 1.00 0.00 ? 43  ILE A HG23 3  
ATOM   6785  H  HD11 . ILE A 1 43  ? -8.861  16.520 38.865 1.00 0.00 ? 43  ILE A HD11 3  
ATOM   6786  H  HD12 . ILE A 1 43  ? -9.164  14.837 38.445 1.00 0.00 ? 43  ILE A HD12 3  
ATOM   6787  H  HD13 . ILE A 1 43  ? -10.463 16.020 38.335 1.00 0.00 ? 43  ILE A HD13 3  
ATOM   6788  N  N    . THR A 1 44  ? -7.608  14.666 44.339 1.00 0.00 ? 44  THR A N    3  
ATOM   6789  C  CA   . THR A 1 44  ? -6.416  14.758 45.218 1.00 0.00 ? 44  THR A CA   3  
ATOM   6790  C  C    . THR A 1 44  ? -5.143  14.400 44.458 1.00 0.00 ? 44  THR A C    3  
ATOM   6791  O  O    . THR A 1 44  ? -5.180  14.096 43.283 1.00 0.00 ? 44  THR A O    3  
ATOM   6792  C  CB   . THR A 1 44  ? -6.596  13.773 46.378 1.00 0.00 ? 44  THR A CB   3  
ATOM   6793  O  OG1  . THR A 1 44  ? -7.971  13.823 46.699 1.00 0.00 ? 44  THR A OG1  3  
ATOM   6794  C  CG2  . THR A 1 44  ? -5.886  14.278 47.644 1.00 0.00 ? 44  THR A CG2  3  
ATOM   6795  H  H    . THR A 1 44  ? -8.161  13.857 44.340 1.00 0.00 ? 44  THR A H    3  
ATOM   6796  H  HA   . THR A 1 44  ? -6.331  15.779 45.588 1.00 0.00 ? 44  THR A HA   3  
ATOM   6797  H  HB   . THR A 1 44  ? -6.300  12.764 46.101 1.00 0.00 ? 44  THR A HB   3  
ATOM   6798  H  HG1  . THR A 1 44  ? -8.066  14.311 47.520 1.00 0.00 ? 44  THR A HG1  3  
ATOM   6799  H  HG21 . THR A 1 44  ? -5.967  15.353 47.705 1.00 0.00 ? 44  THR A HG21 3  
ATOM   6800  H  HG22 . THR A 1 44  ? -6.342  13.838 48.519 1.00 0.00 ? 44  THR A HG22 3  
ATOM   6801  H  HG23 . THR A 1 44  ? -4.842  14.004 47.612 1.00 0.00 ? 44  THR A HG23 3  
ATOM   6802  N  N    . ARG A 1 45  ? -4.036  14.446 45.149 1.00 0.00 ? 45  ARG A N    3  
ATOM   6803  C  CA   . ARG A 1 45  ? -2.746  14.114 44.493 1.00 0.00 ? 45  ARG A CA   3  
ATOM   6804  C  C    . ARG A 1 45  ? -2.590  12.608 44.316 1.00 0.00 ? 45  ARG A C    3  
ATOM   6805  O  O    . ARG A 1 45  ? -1.864  12.154 43.453 1.00 0.00 ? 45  ARG A O    3  
ATOM   6806  C  CB   . ARG A 1 45  ? -1.606  14.620 45.393 1.00 0.00 ? 45  ARG A CB   3  
ATOM   6807  C  CG   . ARG A 1 45  ? -0.451  15.105 44.516 1.00 0.00 ? 45  ARG A CG   3  
ATOM   6808  C  CD   . ARG A 1 45  ? 0.848   15.069 45.327 1.00 0.00 ? 45  ARG A CD   3  
ATOM   6809  N  NE   . ARG A 1 45  ? 0.567   15.519 46.719 1.00 0.00 ? 45  ARG A NE   3  
ATOM   6810  C  CZ   . ARG A 1 45  ? 1.238   14.997 47.711 1.00 0.00 ? 45  ARG A CZ   3  
ATOM   6811  N  NH1  . ARG A 1 45  ? 2.522   15.218 47.789 1.00 0.00 ? 45  ARG A NH1  3  
ATOM   6812  N  NH2  . ARG A 1 45  ? 0.602   14.272 48.590 1.00 0.00 ? 45  ARG A NH2  3  
ATOM   6813  H  H    . ARG A 1 45  ? -4.057  14.699 46.095 1.00 0.00 ? 45  ARG A H    3  
ATOM   6814  H  HA   . ARG A 1 45  ? -2.709  14.593 43.515 1.00 0.00 ? 45  ARG A HA   3  
ATOM   6815  H  HB2  . ARG A 1 45  ? -1.963  15.434 46.007 1.00 0.00 ? 45  ARG A HB2  3  
ATOM   6816  H  HB3  . ARG A 1 45  ? -1.265  13.818 46.031 1.00 0.00 ? 45  ARG A HB3  3  
ATOM   6817  H  HG2  . ARG A 1 45  ? -0.357  14.464 43.652 1.00 0.00 ? 45  ARG A HG2  3  
ATOM   6818  H  HG3  . ARG A 1 45  ? -0.645  16.115 44.187 1.00 0.00 ? 45  ARG A HG3  3  
ATOM   6819  H  HD2  . ARG A 1 45  ? 1.239   14.061 45.349 1.00 0.00 ? 45  ARG A HD2  3  
ATOM   6820  H  HD3  . ARG A 1 45  ? 1.580   15.726 44.879 1.00 0.00 ? 45  ARG A HD3  3  
ATOM   6821  H  HE   . ARG A 1 45  ? -0.116  16.202 46.889 1.00 0.00 ? 45  ARG A HE   3  
ATOM   6822  H  HH11 . ARG A 1 45  ? 2.977   15.779 47.097 1.00 0.00 ? 45  ARG A HH11 3  
ATOM   6823  H  HH12 . ARG A 1 45  ? 3.051   14.825 48.542 1.00 0.00 ? 45  ARG A HH12 3  
ATOM   6824  H  HH21 . ARG A 1 45  ? -0.382  14.124 48.498 1.00 0.00 ? 45  ARG A HH21 3  
ATOM   6825  H  HH22 . ARG A 1 45  ? 1.100   13.864 49.355 1.00 0.00 ? 45  ARG A HH22 3  
ATOM   6826  N  N    . GLN A 1 46  ? -3.271  11.860 45.137 1.00 0.00 ? 46  GLN A N    3  
ATOM   6827  C  CA   . GLN A 1 46  ? -3.171  10.385 45.027 1.00 0.00 ? 46  GLN A CA   3  
ATOM   6828  C  C    . GLN A 1 46  ? -4.127  9.847  43.969 1.00 0.00 ? 46  GLN A C    3  
ATOM   6829  O  O    . GLN A 1 46  ? -3.938  8.763  43.453 1.00 0.00 ? 46  GLN A O    3  
ATOM   6830  C  CB   . GLN A 1 46  ? -3.545  9.775  46.387 1.00 0.00 ? 46  GLN A CB   3  
ATOM   6831  C  CG   . GLN A 1 46  ? -2.754  8.484  46.592 1.00 0.00 ? 46  GLN A CG   3  
ATOM   6832  C  CD   . GLN A 1 46  ? -3.516  7.575  47.557 1.00 0.00 ? 46  GLN A CD   3  
ATOM   6833  O  OE1  . GLN A 1 46  ? -4.271  8.032  48.392 1.00 0.00 ? 46  GLN A OE1  3  
ATOM   6834  N  NE2  . GLN A 1 46  ? -3.346  6.283  47.478 1.00 0.00 ? 46  GLN A NE2  3  
ATOM   6835  H  H    . GLN A 1 46  ? -3.842  12.268 45.821 1.00 0.00 ? 46  GLN A H    3  
ATOM   6836  H  HA   . GLN A 1 46  ? -2.151  10.118 44.753 1.00 0.00 ? 46  GLN A HA   3  
ATOM   6837  H  HB2  . GLN A 1 46  ? -3.309  10.476 47.175 1.00 0.00 ? 46  GLN A HB2  3  
ATOM   6838  H  HB3  . GLN A 1 46  ? -4.603  9.561  46.409 1.00 0.00 ? 46  GLN A HB3  3  
ATOM   6839  H  HG2  . GLN A 1 46  ? -2.629  7.977  45.647 1.00 0.00 ? 46  GLN A HG2  3  
ATOM   6840  H  HG3  . GLN A 1 46  ? -1.783  8.711  47.007 1.00 0.00 ? 46  GLN A HG3  3  
ATOM   6841  H  HE21 . GLN A 1 46  ? -2.737  5.910  46.808 1.00 0.00 ? 46  GLN A HE21 3  
ATOM   6842  H  HE22 . GLN A 1 46  ? -3.828  5.688  48.088 1.00 0.00 ? 46  GLN A HE22 3  
ATOM   6843  N  N    . GLU A 1 47  ? -5.135  10.613 43.661 1.00 0.00 ? 47  GLU A N    3  
ATOM   6844  C  CA   . GLU A 1 47  ? -6.110  10.158 42.639 1.00 0.00 ? 47  GLU A CA   3  
ATOM   6845  C  C    . GLU A 1 47  ? -5.658  10.552 41.237 1.00 0.00 ? 47  GLU A C    3  
ATOM   6846  O  O    . GLU A 1 47  ? -5.981  9.894  40.271 1.00 0.00 ? 47  GLU A O    3  
ATOM   6847  C  CB   . GLU A 1 47  ? -7.461  10.828 42.928 1.00 0.00 ? 47  GLU A CB   3  
ATOM   6848  C  CG   . GLU A 1 47  ? -8.430  10.520 41.785 1.00 0.00 ? 47  GLU A CG   3  
ATOM   6849  C  CD   . GLU A 1 47  ? -9.833  10.991 42.169 1.00 0.00 ? 47  GLU A CD   3  
ATOM   6850  O  OE1  . GLU A 1 47  ? -10.383 10.378 43.069 1.00 0.00 ? 47  GLU A OE1  3  
ATOM   6851  O  OE2  . GLU A 1 47  ? -10.277 11.940 41.542 1.00 0.00 ? 47  GLU A OE2  3  
ATOM   6852  H  H    . GLU A 1 47  ? -5.250  11.482 44.103 1.00 0.00 ? 47  GLU A H    3  
ATOM   6853  H  HA   . GLU A 1 47  ? -6.198  9.073  42.691 1.00 0.00 ? 47  GLU A HA   3  
ATOM   6854  H  HB2  . GLU A 1 47  ? -7.863  10.450 43.856 1.00 0.00 ? 47  GLU A HB2  3  
ATOM   6855  H  HB3  . GLU A 1 47  ? -7.325  11.898 43.011 1.00 0.00 ? 47  GLU A HB3  3  
ATOM   6856  H  HG2  . GLU A 1 47  ? -8.113  11.034 40.889 1.00 0.00 ? 47  GLU A HG2  3  
ATOM   6857  H  HG3  . GLU A 1 47  ? -8.449  9.457  41.598 1.00 0.00 ? 47  GLU A HG3  3  
ATOM   6858  N  N    . PHE A 1 48  ? -4.918  11.618 41.151 1.00 0.00 ? 48  PHE A N    3  
ATOM   6859  C  CA   . PHE A 1 48  ? -4.439  12.066 39.820 1.00 0.00 ? 48  PHE A CA   3  
ATOM   6860  C  C    . PHE A 1 48  ? -3.830  10.907 39.034 1.00 0.00 ? 48  PHE A C    3  
ATOM   6861  O  O    . PHE A 1 48  ? -3.923  10.861 37.824 1.00 0.00 ? 48  PHE A O    3  
ATOM   6862  C  CB   . PHE A 1 48  ? -3.365  13.142 40.031 1.00 0.00 ? 48  PHE A CB   3  
ATOM   6863  C  CG   . PHE A 1 48  ? -3.206  13.957 38.747 1.00 0.00 ? 48  PHE A CG   3  
ATOM   6864  C  CD1  . PHE A 1 48  ? -2.465  13.462 37.688 1.00 0.00 ? 48  PHE A CD1  3  
ATOM   6865  C  CD2  . PHE A 1 48  ? -3.802  15.201 38.627 1.00 0.00 ? 48  PHE A CD2  3  
ATOM   6866  C  CE1  . PHE A 1 48  ? -2.321  14.201 36.532 1.00 0.00 ? 48  PHE A CE1  3  
ATOM   6867  C  CE2  . PHE A 1 48  ? -3.657  15.935 37.469 1.00 0.00 ? 48  PHE A CE2  3  
ATOM   6868  C  CZ   . PHE A 1 48  ? -2.918  15.435 36.423 1.00 0.00 ? 48  PHE A CZ   3  
ATOM   6869  H  H    . PHE A 1 48  ? -4.678  12.121 41.956 1.00 0.00 ? 48  PHE A H    3  
ATOM   6870  H  HA   . PHE A 1 48  ? -5.283  12.467 39.259 1.00 0.00 ? 48  PHE A HA   3  
ATOM   6871  H  HB2  . PHE A 1 48  ? -3.658  13.798 40.836 1.00 0.00 ? 48  PHE A HB2  3  
ATOM   6872  H  HB3  . PHE A 1 48  ? -2.423  12.675 40.276 1.00 0.00 ? 48  PHE A HB3  3  
ATOM   6873  H  HD1  . PHE A 1 48  ? -1.995  12.494 37.767 1.00 0.00 ? 48  PHE A HD1  3  
ATOM   6874  H  HD2  . PHE A 1 48  ? -4.387  15.597 39.444 1.00 0.00 ? 48  PHE A HD2  3  
ATOM   6875  H  HE1  . PHE A 1 48  ? -1.741  13.809 35.709 1.00 0.00 ? 48  PHE A HE1  3  
ATOM   6876  H  HE2  . PHE A 1 48  ? -4.123  16.905 37.384 1.00 0.00 ? 48  PHE A HE2  3  
ATOM   6877  H  HZ   . PHE A 1 48  ? -2.803  16.012 35.517 1.00 0.00 ? 48  PHE A HZ   3  
ATOM   6878  N  N    . GLN A 1 49  ? -3.214  9.993  39.734 1.00 0.00 ? 49  GLN A N    3  
ATOM   6879  C  CA   . GLN A 1 49  ? -2.596  8.836  39.038 1.00 0.00 ? 49  GLN A CA   3  
ATOM   6880  C  C    . GLN A 1 49  ? -3.640  7.785  38.669 1.00 0.00 ? 49  GLN A C    3  
ATOM   6881  O  O    . GLN A 1 49  ? -3.356  6.862  37.932 1.00 0.00 ? 49  GLN A O    3  
ATOM   6882  C  CB   . GLN A 1 49  ? -1.573  8.195  39.989 1.00 0.00 ? 49  GLN A CB   3  
ATOM   6883  C  CG   . GLN A 1 49  ? -2.318  7.508  41.138 1.00 0.00 ? 49  GLN A CG   3  
ATOM   6884  C  CD   . GLN A 1 49  ? -2.338  5.996  40.899 1.00 0.00 ? 49  GLN A CD   3  
ATOM   6885  O  OE1  . GLN A 1 49  ? -3.039  5.501  40.039 1.00 0.00 ? 49  GLN A OE1  3  
ATOM   6886  N  NE2  . GLN A 1 49  ? -1.584  5.228  41.638 1.00 0.00 ? 49  GLN A NE2  3  
ATOM   6887  H  H    . GLN A 1 49  ? -3.156  10.073 40.709 1.00 0.00 ? 49  GLN A H    3  
ATOM   6888  H  HA   . GLN A 1 49  ? -2.110  9.189  38.129 1.00 0.00 ? 49  GLN A HA   3  
ATOM   6889  H  HB2  . GLN A 1 49  ? -0.983  7.466  39.452 1.00 0.00 ? 49  GLN A HB2  3  
ATOM   6890  H  HB3  . GLN A 1 49  ? -0.918  8.957  40.386 1.00 0.00 ? 49  GLN A HB3  3  
ATOM   6891  H  HG2  . GLN A 1 49  ? -1.818  7.715  42.074 1.00 0.00 ? 49  GLN A HG2  3  
ATOM   6892  H  HG3  . GLN A 1 49  ? -3.332  7.874  41.185 1.00 0.00 ? 49  GLN A HG3  3  
ATOM   6893  H  HE21 . GLN A 1 49  ? -1.017  5.621  42.334 1.00 0.00 ? 49  GLN A HE21 3  
ATOM   6894  H  HE22 . GLN A 1 49  ? -1.585  4.258  41.497 1.00 0.00 ? 49  GLN A HE22 3  
ATOM   6895  N  N    . THR A 1 50  ? -4.831  7.943  39.180 1.00 0.00 ? 50  THR A N    3  
ATOM   6896  C  CA   . THR A 1 50  ? -5.894  6.955  38.861 1.00 0.00 ? 50  THR A CA   3  
ATOM   6897  C  C    . THR A 1 50  ? -6.415  7.145  37.443 1.00 0.00 ? 50  THR A C    3  
ATOM   6898  O  O    . THR A 1 50  ? -6.683  6.187  36.744 1.00 0.00 ? 50  THR A O    3  
ATOM   6899  C  CB   . THR A 1 50  ? -7.053  7.152  39.843 1.00 0.00 ? 50  THR A CB   3  
ATOM   6900  O  OG1  . THR A 1 50  ? -6.504  6.922  41.125 1.00 0.00 ? 50  THR A OG1  3  
ATOM   6901  C  CG2  . THR A 1 50  ? -8.107  6.049  39.668 1.00 0.00 ? 50  THR A CG2  3  
ATOM   6902  H  H    . THR A 1 50  ? -5.022  8.706  39.765 1.00 0.00 ? 50  THR A H    3  
ATOM   6903  H  HA   . THR A 1 50  ? -5.480  5.953  38.952 1.00 0.00 ? 50  THR A HA   3  
ATOM   6904  H  HB   . THR A 1 50  ? -7.476  8.152  39.775 1.00 0.00 ? 50  THR A HB   3  
ATOM   6905  H  HG1  . THR A 1 50  ? -5.836  6.236  41.043 1.00 0.00 ? 50  THR A HG1  3  
ATOM   6906  H  HG21 . THR A 1 50  ? -7.617  5.095  39.543 1.00 0.00 ? 50  THR A HG21 3  
ATOM   6907  H  HG22 . THR A 1 50  ? -8.743  6.010  40.540 1.00 0.00 ? 50  THR A HG22 3  
ATOM   6908  H  HG23 . THR A 1 50  ? -8.711  6.256  38.798 1.00 0.00 ? 50  THR A HG23 3  
ATOM   6909  N  N    . ILE A 1 51  ? -6.550  8.376  37.040 1.00 0.00 ? 51  ILE A N    3  
ATOM   6910  C  CA   . ILE A 1 51  ? -7.053  8.644  35.669 1.00 0.00 ? 51  ILE A CA   3  
ATOM   6911  C  C    . ILE A 1 51  ? -5.942  8.484  34.639 1.00 0.00 ? 51  ILE A C    3  
ATOM   6912  O  O    . ILE A 1 51  ? -6.121  7.845  33.621 1.00 0.00 ? 51  ILE A O    3  
ATOM   6913  C  CB   . ILE A 1 51  ? -7.563  10.084 35.621 1.00 0.00 ? 51  ILE A CB   3  
ATOM   6914  C  CG1  . ILE A 1 51  ? -8.708  10.260 36.608 1.00 0.00 ? 51  ILE A CG1  3  
ATOM   6915  C  CG2  . ILE A 1 51  ? -8.089  10.372 34.204 1.00 0.00 ? 51  ILE A CG2  3  
ATOM   6916  C  CD1  . ILE A 1 51  ? -9.319  11.652 36.429 1.00 0.00 ? 51  ILE A CD1  3  
ATOM   6917  H  H    . ILE A 1 51  ? -6.319  9.117  37.637 1.00 0.00 ? 51  ILE A H    3  
ATOM   6918  H  HA   . ILE A 1 51  ? -7.854  7.940  35.441 1.00 0.00 ? 51  ILE A HA   3  
ATOM   6919  H  HB   . ILE A 1 51  ? -6.750  10.764 35.883 1.00 0.00 ? 51  ILE A HB   3  
ATOM   6920  H  HG12 . ILE A 1 51  ? -9.461  9.507  36.429 1.00 0.00 ? 51  ILE A HG12 3  
ATOM   6921  H  HG13 . ILE A 1 51  ? -8.336  10.154 37.617 1.00 0.00 ? 51  ILE A HG13 3  
ATOM   6922  H  HG21 . ILE A 1 51  ? -7.310  10.179 33.480 1.00 0.00 ? 51  ILE A HG21 3  
ATOM   6923  H  HG22 . ILE A 1 51  ? -8.935  9.737  33.992 1.00 0.00 ? 51  ILE A HG22 3  
ATOM   6924  H  HG23 . ILE A 1 51  ? -8.393  11.406 34.131 1.00 0.00 ? 51  ILE A HG23 3  
ATOM   6925  H  HD11 . ILE A 1 51  ? -8.542  12.364 36.191 1.00 0.00 ? 51  ILE A HD11 3  
ATOM   6926  H  HD12 . ILE A 1 51  ? -10.041 11.633 35.625 1.00 0.00 ? 51  ILE A HD12 3  
ATOM   6927  H  HD13 . ILE A 1 51  ? -9.811  11.954 37.342 1.00 0.00 ? 51  ILE A HD13 3  
ATOM   6928  N  N    . TYR A 1 52  ? -4.812  9.068  34.924 1.00 0.00 ? 52  TYR A N    3  
ATOM   6929  C  CA   . TYR A 1 52  ? -3.674  8.966  33.978 1.00 0.00 ? 52  TYR A CA   3  
ATOM   6930  C  C    . TYR A 1 52  ? -3.338  7.509  33.675 1.00 0.00 ? 52  TYR A C    3  
ATOM   6931  O  O    . TYR A 1 52  ? -2.838  7.193  32.613 1.00 0.00 ? 52  TYR A O    3  
ATOM   6932  C  CB   . TYR A 1 52  ? -2.451  9.629  34.629 1.00 0.00 ? 52  TYR A CB   3  
ATOM   6933  C  CG   . TYR A 1 52  ? -1.667  10.405 33.570 1.00 0.00 ? 52  TYR A CG   3  
ATOM   6934  C  CD1  . TYR A 1 52  ? -0.726  9.767  32.789 1.00 0.00 ? 52  TYR A CD1  3  
ATOM   6935  C  CD2  . TYR A 1 52  ? -1.879  11.757 33.390 1.00 0.00 ? 52  TYR A CD2  3  
ATOM   6936  C  CE1  . TYR A 1 52  ? -0.011  10.466 31.840 1.00 0.00 ? 52  TYR A CE1  3  
ATOM   6937  C  CE2  . TYR A 1 52  ? -1.164  12.458 32.440 1.00 0.00 ? 52  TYR A CE2  3  
ATOM   6938  C  CZ   . TYR A 1 52  ? -0.223  11.818 31.659 1.00 0.00 ? 52  TYR A CZ   3  
ATOM   6939  O  OH   . TYR A 1 52  ? 0.496   12.519 30.713 1.00 0.00 ? 52  TYR A OH   3  
ATOM   6940  H  H    . TYR A 1 52  ? -4.716  9.573  35.758 1.00 0.00 ? 52  TYR A H    3  
ATOM   6941  H  HA   . TYR A 1 52  ? -3.938  9.470  33.048 1.00 0.00 ? 52  TYR A HA   3  
ATOM   6942  H  HB2  . TYR A 1 52  ? -2.775  10.309 35.403 1.00 0.00 ? 52  TYR A HB2  3  
ATOM   6943  H  HB3  . TYR A 1 52  ? -1.814  8.872  35.063 1.00 0.00 ? 52  TYR A HB3  3  
ATOM   6944  H  HD1  . TYR A 1 52  ? -0.551  8.709  32.920 1.00 0.00 ? 52  TYR A HD1  3  
ATOM   6945  H  HD2  . TYR A 1 52  ? -2.612  12.271 33.996 1.00 0.00 ? 52  TYR A HD2  3  
ATOM   6946  H  HE1  . TYR A 1 52  ? 0.722   9.954  31.235 1.00 0.00 ? 52  TYR A HE1  3  
ATOM   6947  H  HE2  . TYR A 1 52  ? -1.340  13.517 32.308 1.00 0.00 ? 52  TYR A HE2  3  
ATOM   6948  H  HH   . TYR A 1 52  ? 1.390   12.631 31.046 1.00 0.00 ? 52  TYR A HH   3  
ATOM   6949  N  N    . SER A 1 53  ? -3.617  6.645  34.612 1.00 0.00 ? 53  SER A N    3  
ATOM   6950  C  CA   . SER A 1 53  ? -3.317  5.209  34.390 1.00 0.00 ? 53  SER A CA   3  
ATOM   6951  C  C    . SER A 1 53  ? -4.215  4.624  33.306 1.00 0.00 ? 53  SER A C    3  
ATOM   6952  O  O    . SER A 1 53  ? -3.779  3.824  32.501 1.00 0.00 ? 53  SER A O    3  
ATOM   6953  C  CB   . SER A 1 53  ? -3.571  4.451  35.702 1.00 0.00 ? 53  SER A CB   3  
ATOM   6954  O  OG   . SER A 1 53  ? -4.978  4.526  35.881 1.00 0.00 ? 53  SER A OG   3  
ATOM   6955  H  H    . SER A 1 53  ? -4.021  6.942  35.454 1.00 0.00 ? 53  SER A H    3  
ATOM   6956  H  HA   . SER A 1 53  ? -2.278  5.108  34.080 1.00 0.00 ? 53  SER A HA   3  
ATOM   6957  H  HB2  . SER A 1 53  ? -3.260  3.420  35.616 1.00 0.00 ? 53  SER A HB2  3  
ATOM   6958  H  HB3  . SER A 1 53  ? -3.063  4.931  36.525 1.00 0.00 ? 53  SER A HB3  3  
ATOM   6959  H  HG   . SER A 1 53  ? -5.207  5.443  36.047 1.00 0.00 ? 53  SER A HG   3  
ATOM   6960  N  N    . LYS A 1 54  ? -5.454  5.031  33.303 1.00 0.00 ? 54  LYS A N    3  
ATOM   6961  C  CA   . LYS A 1 54  ? -6.391  4.507  32.280 1.00 0.00 ? 54  LYS A CA   3  
ATOM   6962  C  C    . LYS A 1 54  ? -5.826  4.688  30.874 1.00 0.00 ? 54  LYS A C    3  
ATOM   6963  O  O    . LYS A 1 54  ? -6.214  3.989  29.958 1.00 0.00 ? 54  LYS A O    3  
ATOM   6964  C  CB   . LYS A 1 54  ? -7.710  5.288  32.389 1.00 0.00 ? 54  LYS A CB   3  
ATOM   6965  C  CG   . LYS A 1 54  ? -8.809  4.524  31.646 1.00 0.00 ? 54  LYS A CG   3  
ATOM   6966  C  CD   . LYS A 1 54  ? -10.164 5.161  31.963 1.00 0.00 ? 54  LYS A CD   3  
ATOM   6967  C  CE   . LYS A 1 54  ? -10.144 6.628  31.527 1.00 0.00 ? 54  LYS A CE   3  
ATOM   6968  N  NZ   . LYS A 1 54  ? -11.531 7.163  31.433 1.00 0.00 ? 54  LYS A NZ   3  
ATOM   6969  H  H    . LYS A 1 54  ? -5.763  5.679  33.972 1.00 0.00 ? 54  LYS A H    3  
ATOM   6970  H  HA   . LYS A 1 54  ? -6.556  3.445  32.462 1.00 0.00 ? 54  LYS A HA   3  
ATOM   6971  H  HB2  . LYS A 1 54  ? -7.983  5.396  33.428 1.00 0.00 ? 54  LYS A HB2  3  
ATOM   6972  H  HB3  . LYS A 1 54  ? -7.589  6.268  31.951 1.00 0.00 ? 54  LYS A HB3  3  
ATOM   6973  H  HG2  . LYS A 1 54  ? -8.627  4.569  30.582 1.00 0.00 ? 54  LYS A HG2  3  
ATOM   6974  H  HG3  . LYS A 1 54  ? -8.810  3.491  31.962 1.00 0.00 ? 54  LYS A HG3  3  
ATOM   6975  H  HD2  . LYS A 1 54  ? -10.946 4.635  31.434 1.00 0.00 ? 54  LYS A HD2  3  
ATOM   6976  H  HD3  . LYS A 1 54  ? -10.354 5.100  33.025 1.00 0.00 ? 54  LYS A HD3  3  
ATOM   6977  H  HE2  . LYS A 1 54  ? -9.589  7.211  32.247 1.00 0.00 ? 54  LYS A HE2  3  
ATOM   6978  H  HE3  . LYS A 1 54  ? -9.667  6.711  30.562 1.00 0.00 ? 54  LYS A HE3  3  
ATOM   6979  H  HZ1  . LYS A 1 54  ? -12.199 6.463  31.813 1.00 0.00 ? 54  LYS A HZ1  3  
ATOM   6980  H  HZ2  . LYS A 1 54  ? -11.602 8.044  31.982 1.00 0.00 ? 54  LYS A HZ2  3  
ATOM   6981  H  HZ3  . LYS A 1 54  ? -11.761 7.356  30.438 1.00 0.00 ? 54  LYS A HZ3  3  
ATOM   6982  N  N    . PHE A 1 55  ? -4.916  5.624  30.734 1.00 0.00 ? 55  PHE A N    3  
ATOM   6983  C  CA   . PHE A 1 55  ? -4.308  5.873  29.401 1.00 0.00 ? 55  PHE A CA   3  
ATOM   6984  C  C    . PHE A 1 55  ? -2.886  5.332  29.343 1.00 0.00 ? 55  PHE A C    3  
ATOM   6985  O  O    . PHE A 1 55  ? -2.405  4.744  30.291 1.00 0.00 ? 55  PHE A O    3  
ATOM   6986  C  CB   . PHE A 1 55  ? -4.276  7.389  29.160 1.00 0.00 ? 55  PHE A CB   3  
ATOM   6987  C  CG   . PHE A 1 55  ? -5.712  7.903  29.029 1.00 0.00 ? 55  PHE A CG   3  
ATOM   6988  C  CD1  . PHE A 1 55  ? -6.403  7.764  27.836 1.00 0.00 ? 55  PHE A CD1  3  
ATOM   6989  C  CD2  . PHE A 1 55  ? -6.345  8.500  30.106 1.00 0.00 ? 55  PHE A CD2  3  
ATOM   6990  C  CE1  . PHE A 1 55  ? -7.702  8.214  27.724 1.00 0.00 ? 55  PHE A CE1  3  
ATOM   6991  C  CE2  . PHE A 1 55  ? -7.644  8.950  29.989 1.00 0.00 ? 55  PHE A CE2  3  
ATOM   6992  C  CZ   . PHE A 1 55  ? -8.321  8.807  28.801 1.00 0.00 ? 55  PHE A CZ   3  
ATOM   6993  H  H    . PHE A 1 55  ? -4.640  6.156  31.504 1.00 0.00 ? 55  PHE A H    3  
ATOM   6994  H  HA   . PHE A 1 55  ? -4.904  5.377  28.640 1.00 0.00 ? 55  PHE A HA   3  
ATOM   6995  H  HB2  . PHE A 1 55  ? -3.794  7.883  29.992 1.00 0.00 ? 55  PHE A HB2  3  
ATOM   6996  H  HB3  . PHE A 1 55  ? -3.734  7.606  28.251 1.00 0.00 ? 55  PHE A HB3  3  
ATOM   6997  H  HD1  . PHE A 1 55  ? -5.920  7.301  26.987 1.00 0.00 ? 55  PHE A HD1  3  
ATOM   6998  H  HD2  . PHE A 1 55  ? -5.818  8.616  31.041 1.00 0.00 ? 55  PHE A HD2  3  
ATOM   6999  H  HE1  . PHE A 1 55  ? -8.234  8.102  26.791 1.00 0.00 ? 55  PHE A HE1  3  
ATOM   7000  H  HE2  . PHE A 1 55  ? -8.132  9.414  30.834 1.00 0.00 ? 55  PHE A HE2  3  
ATOM   7001  H  HZ   . PHE A 1 55  ? -9.339  9.158  28.712 1.00 0.00 ? 55  PHE A HZ   3  
ATOM   7002  N  N    . PHE A 1 56  ? -2.236  5.541  28.230 1.00 0.00 ? 56  PHE A N    3  
ATOM   7003  C  CA   . PHE A 1 56  ? -0.845  5.044  28.095 1.00 0.00 ? 56  PHE A CA   3  
ATOM   7004  C  C    . PHE A 1 56  ? -0.739  3.589  28.548 1.00 0.00 ? 56  PHE A C    3  
ATOM   7005  O  O    . PHE A 1 56  ? 0.012   3.261  29.443 1.00 0.00 ? 56  PHE A O    3  
ATOM   7006  C  CB   . PHE A 1 56  ? 0.060   5.909  28.982 1.00 0.00 ? 56  PHE A CB   3  
ATOM   7007  C  CG   . PHE A 1 56  ? 0.012   7.354  28.482 1.00 0.00 ? 56  PHE A CG   3  
ATOM   7008  C  CD1  . PHE A 1 56  ? 0.390   7.660  27.185 1.00 0.00 ? 56  PHE A CD1  3  
ATOM   7009  C  CD2  . PHE A 1 56  ? -0.414  8.375  29.315 1.00 0.00 ? 56  PHE A CD2  3  
ATOM   7010  C  CE1  . PHE A 1 56  ? 0.341   8.962  26.732 1.00 0.00 ? 56  PHE A CE1  3  
ATOM   7011  C  CE2  . PHE A 1 56  ? -0.460  9.675  28.858 1.00 0.00 ? 56  PHE A CE2  3  
ATOM   7012  C  CZ   . PHE A 1 56  ? -0.084  9.968  27.568 1.00 0.00 ? 56  PHE A CZ   3  
ATOM   7013  H  H    . PHE A 1 56  ? -2.664  6.020  27.490 1.00 0.00 ? 56  PHE A H    3  
ATOM   7014  H  HA   . PHE A 1 56  ? -0.541  5.111  27.052 1.00 0.00 ? 56  PHE A HA   3  
ATOM   7015  H  HB2  . PHE A 1 56  ? -0.284  5.873  30.006 1.00 0.00 ? 56  PHE A HB2  3  
ATOM   7016  H  HB3  . PHE A 1 56  ? 1.077   5.548  28.932 1.00 0.00 ? 56  PHE A HB3  3  
ATOM   7017  H  HD1  . PHE A 1 56  ? 0.725   6.875  26.524 1.00 0.00 ? 56  PHE A HD1  3  
ATOM   7018  H  HD2  . PHE A 1 56  ? -0.714  8.150  30.327 1.00 0.00 ? 56  PHE A HD2  3  
ATOM   7019  H  HE1  . PHE A 1 56  ? 0.637   9.192  25.720 1.00 0.00 ? 56  PHE A HE1  3  
ATOM   7020  H  HE2  . PHE A 1 56  ? -0.793  10.465 29.514 1.00 0.00 ? 56  PHE A HE2  3  
ATOM   7021  H  HZ   . PHE A 1 56  ? -0.120  10.986 27.212 1.00 0.00 ? 56  PHE A HZ   3  
ATOM   7022  N  N    . PRO A 1 57  ? -1.512  2.744  27.901 1.00 0.00 ? 57  PRO A N    3  
ATOM   7023  C  CA   . PRO A 1 57  ? -1.527  1.317  28.214 1.00 0.00 ? 57  PRO A CA   3  
ATOM   7024  C  C    . PRO A 1 57  ? -0.182  0.671  27.910 1.00 0.00 ? 57  PRO A C    3  
ATOM   7025  O  O    . PRO A 1 57  ? 0.016   -0.502 28.154 1.00 0.00 ? 57  PRO A O    3  
ATOM   7026  C  CB   . PRO A 1 57  ? -2.597  0.721  27.274 1.00 0.00 ? 57  PRO A CB   3  
ATOM   7027  C  CG   . PRO A 1 57  ? -3.080  1.867  26.333 1.00 0.00 ? 57  PRO A CG   3  
ATOM   7028  C  CD   . PRO A 1 57  ? -2.413  3.163  26.820 1.00 0.00 ? 57  PRO A CD   3  
ATOM   7029  H  HA   . PRO A 1 57  ? -1.790  1.167  29.256 1.00 0.00 ? 57  PRO A HA   3  
ATOM   7030  H  HB2  . PRO A 1 57  ? -2.170  -0.081 26.689 1.00 0.00 ? 57  PRO A HB2  3  
ATOM   7031  H  HB3  . PRO A 1 57  ? -3.428  0.344  27.852 1.00 0.00 ? 57  PRO A HB3  3  
ATOM   7032  H  HG2  . PRO A 1 57  ? -2.783  1.659  25.316 1.00 0.00 ? 57  PRO A HG2  3  
ATOM   7033  H  HG3  . PRO A 1 57  ? -4.154  1.961  26.385 1.00 0.00 ? 57  PRO A HG3  3  
ATOM   7034  H  HD2  . PRO A 1 57  ? -1.850  3.626  26.023 1.00 0.00 ? 57  PRO A HD2  3  
ATOM   7035  H  HD3  . PRO A 1 57  ? -3.157  3.843  27.195 1.00 0.00 ? 57  PRO A HD3  3  
ATOM   7036  N  N    . GLU A 1 58  ? 0.719   1.450  27.383 1.00 0.00 ? 58  GLU A N    3  
ATOM   7037  C  CA   . GLU A 1 58  ? 2.054   0.898  27.056 1.00 0.00 ? 58  GLU A CA   3  
ATOM   7038  C  C    . GLU A 1 58  ? 2.970   0.891  28.270 1.00 0.00 ? 58  GLU A C    3  
ATOM   7039  O  O    . GLU A 1 58  ? 3.657   -0.081 28.520 1.00 0.00 ? 58  GLU A O    3  
ATOM   7040  C  CB   . GLU A 1 58  ? 2.689   1.777  25.972 1.00 0.00 ? 58  GLU A CB   3  
ATOM   7041  C  CG   . GLU A 1 58  ? 3.987   1.121  25.503 1.00 0.00 ? 58  GLU A CG   3  
ATOM   7042  C  CD   . GLU A 1 58  ? 4.892   2.176  24.865 1.00 0.00 ? 58  GLU A CD   3  
ATOM   7043  O  OE1  . GLU A 1 58  ? 4.739   2.370  23.670 1.00 0.00 ? 58  GLU A OE1  3  
ATOM   7044  O  OE2  . GLU A 1 58  ? 5.687   2.729  25.608 1.00 0.00 ? 58  GLU A OE2  3  
ATOM   7045  H  H    . GLU A 1 58  ? 0.517   2.394  27.206 1.00 0.00 ? 58  GLU A H    3  
ATOM   7046  H  HA   . GLU A 1 58  ? 1.933   -0.121 26.700 1.00 0.00 ? 58  GLU A HA   3  
ATOM   7047  H  HB2  . GLU A 1 58  ? 2.010   1.877  25.138 1.00 0.00 ? 58  GLU A HB2  3  
ATOM   7048  H  HB3  . GLU A 1 58  ? 2.903   2.756  26.376 1.00 0.00 ? 58  GLU A HB3  3  
ATOM   7049  H  HG2  . GLU A 1 58  ? 4.497   0.677  26.347 1.00 0.00 ? 58  GLU A HG2  3  
ATOM   7050  H  HG3  . GLU A 1 58  ? 3.766   0.353  24.776 1.00 0.00 ? 58  GLU A HG3  3  
ATOM   7051  N  N    . ALA A 1 59  ? 2.964   1.978  29.004 1.00 0.00 ? 59  ALA A N    3  
ATOM   7052  C  CA   . ALA A 1 59  ? 3.826   2.066  30.207 1.00 0.00 ? 59  ALA A CA   3  
ATOM   7053  C  C    . ALA A 1 59  ? 3.025   2.478  31.435 1.00 0.00 ? 59  ALA A C    3  
ATOM   7054  O  O    . ALA A 1 59  ? 1.833   2.254  31.506 1.00 0.00 ? 59  ALA A O    3  
ATOM   7055  C  CB   . ALA A 1 59  ? 4.896   3.129  29.936 1.00 0.00 ? 59  ALA A CB   3  
ATOM   7056  H  H    . ALA A 1 59  ? 2.396   2.731  28.758 1.00 0.00 ? 59  ALA A H    3  
ATOM   7057  H  HA   . ALA A 1 59  ? 4.282   1.101  30.394 1.00 0.00 ? 59  ALA A HA   3  
ATOM   7058  H  HB1  . ALA A 1 59  ? 5.298   2.991  28.943 1.00 0.00 ? 59  ALA A HB1  3  
ATOM   7059  H  HB2  . ALA A 1 59  ? 4.458   4.114  30.009 1.00 0.00 ? 59  ALA A HB2  3  
ATOM   7060  H  HB3  . ALA A 1 59  ? 5.693   3.039  30.659 1.00 0.00 ? 59  ALA A HB3  3  
ATOM   7061  N  N    . ASP A 1 60  ? 3.704   3.076  32.382 1.00 0.00 ? 60  ASP A N    3  
ATOM   7062  C  CA   . ASP A 1 60  ? 3.015   3.520  33.625 1.00 0.00 ? 60  ASP A CA   3  
ATOM   7063  C  C    . ASP A 1 60  ? 3.486   4.912  34.038 1.00 0.00 ? 60  ASP A C    3  
ATOM   7064  O  O    . ASP A 1 60  ? 4.197   5.073  35.010 1.00 0.00 ? 60  ASP A O    3  
ATOM   7065  C  CB   . ASP A 1 60  ? 3.371   2.530  34.747 1.00 0.00 ? 60  ASP A CB   3  
ATOM   7066  C  CG   . ASP A 1 60  ? 4.867   2.215  34.689 1.00 0.00 ? 60  ASP A CG   3  
ATOM   7067  O  OD1  . ASP A 1 60  ? 5.509   2.793  33.829 1.00 0.00 ? 60  ASP A OD1  3  
ATOM   7068  O  OD2  . ASP A 1 60  ? 5.284   1.413  35.510 1.00 0.00 ? 60  ASP A OD2  3  
ATOM   7069  H  H    . ASP A 1 60  ? 4.666   3.230  32.273 1.00 0.00 ? 60  ASP A H    3  
ATOM   7070  H  HA   . ASP A 1 60  ? 1.943   3.542  33.454 1.00 0.00 ? 60  ASP A HA   3  
ATOM   7071  H  HB2  . ASP A 1 60  ? 3.135   2.967  35.706 1.00 0.00 ? 60  ASP A HB2  3  
ATOM   7072  H  HB3  . ASP A 1 60  ? 2.807   1.617  34.623 1.00 0.00 ? 60  ASP A HB3  3  
ATOM   7073  N  N    . PRO A 1 61  ? 3.071   5.896  33.277 1.00 0.00 ? 61  PRO A N    3  
ATOM   7074  C  CA   . PRO A 1 61  ? 3.439   7.284  33.544 1.00 0.00 ? 61  PRO A CA   3  
ATOM   7075  C  C    . PRO A 1 61  ? 2.838   7.770  34.861 1.00 0.00 ? 61  PRO A C    3  
ATOM   7076  O  O    . PRO A 1 61  ? 2.592   8.946  35.042 1.00 0.00 ? 61  PRO A O    3  
ATOM   7077  C  CB   . PRO A 1 61  ? 2.839   8.084  32.366 1.00 0.00 ? 61  PRO A CB   3  
ATOM   7078  C  CG   . PRO A 1 61  ? 2.074   7.072  31.458 1.00 0.00 ? 61  PRO A CG   3  
ATOM   7079  C  CD   . PRO A 1 61  ? 2.219   5.683  32.103 1.00 0.00 ? 61  PRO A CD   3  
ATOM   7080  H  HA   . PRO A 1 61  ? 4.520   7.377  33.572 1.00 0.00 ? 61  PRO A HA   3  
ATOM   7081  H  HB2  . PRO A 1 61  ? 2.158   8.835  32.736 1.00 0.00 ? 61  PRO A HB2  3  
ATOM   7082  H  HB3  . PRO A 1 61  ? 3.630   8.559  31.805 1.00 0.00 ? 61  PRO A HB3  3  
ATOM   7083  H  HG2  . PRO A 1 61  ? 1.032   7.345  31.399 1.00 0.00 ? 61  PRO A HG2  3  
ATOM   7084  H  HG3  . PRO A 1 61  ? 2.502   7.067  30.469 1.00 0.00 ? 61  PRO A HG3  3  
ATOM   7085  H  HD2  . PRO A 1 61  ? 1.253   5.307  32.408 1.00 0.00 ? 61  PRO A HD2  3  
ATOM   7086  H  HD3  . PRO A 1 61  ? 2.691   4.992  31.420 1.00 0.00 ? 61  PRO A HD3  3  
ATOM   7087  N  N    . LYS A 1 62  ? 2.615   6.856  35.756 1.00 0.00 ? 62  LYS A N    3  
ATOM   7088  C  CA   . LYS A 1 62  ? 2.034   7.246  37.063 1.00 0.00 ? 62  LYS A CA   3  
ATOM   7089  C  C    . LYS A 1 62  ? 2.861   8.348  37.717 1.00 0.00 ? 62  LYS A C    3  
ATOM   7090  O  O    . LYS A 1 62  ? 2.359   9.414  38.011 1.00 0.00 ? 62  LYS A O    3  
ATOM   7091  C  CB   . LYS A 1 62  ? 2.040   6.015  37.987 1.00 0.00 ? 62  LYS A CB   3  
ATOM   7092  C  CG   . LYS A 1 62  ? 1.123   4.937  37.403 1.00 0.00 ? 62  LYS A CG   3  
ATOM   7093  C  CD   . LYS A 1 62  ? 0.529   4.108  38.546 1.00 0.00 ? 62  LYS A CD   3  
ATOM   7094  C  CE   . LYS A 1 62  ? 1.660   3.423  39.314 1.00 0.00 ? 62  LYS A CE   3  
ATOM   7095  N  NZ   . LYS A 1 62  ? 2.328   2.405  38.457 1.00 0.00 ? 62  LYS A NZ   3  
ATOM   7096  H  H    . LYS A 1 62  ? 2.827   5.917  35.567 1.00 0.00 ? 62  LYS A H    3  
ATOM   7097  H  HA   . LYS A 1 62  ? 1.019   7.610  36.905 1.00 0.00 ? 62  LYS A HA   3  
ATOM   7098  H  HB2  . LYS A 1 62  ? 3.046   5.630  38.068 1.00 0.00 ? 62  LYS A HB2  3  
ATOM   7099  H  HB3  . LYS A 1 62  ? 1.689   6.297  38.968 1.00 0.00 ? 62  LYS A HB3  3  
ATOM   7100  H  HG2  . LYS A 1 62  ? 0.328   5.401  36.840 1.00 0.00 ? 62  LYS A HG2  3  
ATOM   7101  H  HG3  . LYS A 1 62  ? 1.692   4.295  36.747 1.00 0.00 ? 62  LYS A HG3  3  
ATOM   7102  H  HD2  . LYS A 1 62  ? -0.024  4.752  39.212 1.00 0.00 ? 62  LYS A HD2  3  
ATOM   7103  H  HD3  . LYS A 1 62  ? -0.139  3.360  38.142 1.00 0.00 ? 62  LYS A HD3  3  
ATOM   7104  H  HE2  . LYS A 1 62  ? 2.388   4.161  39.619 1.00 0.00 ? 62  LYS A HE2  3  
ATOM   7105  H  HE3  . LYS A 1 62  ? 1.261   2.937  40.192 1.00 0.00 ? 62  LYS A HE3  3  
ATOM   7106  H  HZ1  . LYS A 1 62  ? 1.821   2.329  37.551 1.00 0.00 ? 62  LYS A HZ1  3  
ATOM   7107  H  HZ2  . LYS A 1 62  ? 3.312   2.692  38.280 1.00 0.00 ? 62  LYS A HZ2  3  
ATOM   7108  H  HZ3  . LYS A 1 62  ? 2.317   1.484  38.939 1.00 0.00 ? 62  LYS A HZ3  3  
ATOM   7109  N  N    . ALA A 1 63  ? 4.117   8.067  37.932 1.00 0.00 ? 63  ALA A N    3  
ATOM   7110  C  CA   . ALA A 1 63  ? 4.998   9.080  38.565 1.00 0.00 ? 63  ALA A CA   3  
ATOM   7111  C  C    . ALA A 1 63  ? 4.966   10.395 37.796 1.00 0.00 ? 63  ALA A C    3  
ATOM   7112  O  O    . ALA A 1 63  ? 5.136   11.454 38.367 1.00 0.00 ? 63  ALA A O    3  
ATOM   7113  C  CB   . ALA A 1 63  ? 6.437   8.539  38.555 1.00 0.00 ? 63  ALA A CB   3  
ATOM   7114  H  H    . ALA A 1 63  ? 4.476   7.191  37.674 1.00 0.00 ? 63  ALA A H    3  
ATOM   7115  H  HA   . ALA A 1 63  ? 4.660   9.257  39.586 1.00 0.00 ? 63  ALA A HA   3  
ATOM   7116  H  HB1  . ALA A 1 63  ? 6.706   8.239  37.553 1.00 0.00 ? 63  ALA A HB1  3  
ATOM   7117  H  HB2  . ALA A 1 63  ? 7.118   9.307  38.891 1.00 0.00 ? 63  ALA A HB2  3  
ATOM   7118  H  HB3  . ALA A 1 63  ? 6.511   7.686  39.213 1.00 0.00 ? 63  ALA A HB3  3  
ATOM   7119  N  N    . TYR A 1 64  ? 4.754   10.308 36.513 1.00 0.00 ? 64  TYR A N    3  
ATOM   7120  C  CA   . TYR A 1 64  ? 4.709   11.547 35.697 1.00 0.00 ? 64  TYR A CA   3  
ATOM   7121  C  C    . TYR A 1 64  ? 3.396   12.293 35.903 1.00 0.00 ? 64  TYR A C    3  
ATOM   7122  O  O    . TYR A 1 64  ? 3.391   13.481 36.157 1.00 0.00 ? 64  TYR A O    3  
ATOM   7123  C  CB   . TYR A 1 64  ? 4.833   11.159 34.216 1.00 0.00 ? 64  TYR A CB   3  
ATOM   7124  C  CG   . TYR A 1 64  ? 4.578   12.392 33.349 1.00 0.00 ? 64  TYR A CG   3  
ATOM   7125  C  CD1  . TYR A 1 64  ? 3.297   12.715 32.950 1.00 0.00 ? 64  TYR A CD1  3  
ATOM   7126  C  CD2  . TYR A 1 64  ? 5.625   13.202 32.955 1.00 0.00 ? 64  TYR A CD2  3  
ATOM   7127  C  CE1  . TYR A 1 64  ? 3.066   13.828 32.168 1.00 0.00 ? 64  TYR A CE1  3  
ATOM   7128  C  CE2  . TYR A 1 64  ? 5.394   14.315 32.173 1.00 0.00 ? 64  TYR A CE2  3  
ATOM   7129  C  CZ   . TYR A 1 64  ? 4.111   14.637 31.774 1.00 0.00 ? 64  TYR A CZ   3  
ATOM   7130  O  OH   . TYR A 1 64  ? 3.880   15.748 30.990 1.00 0.00 ? 64  TYR A OH   3  
ATOM   7131  H  H    . TYR A 1 64  ? 4.626   9.432  36.091 1.00 0.00 ? 64  TYR A H    3  
ATOM   7132  H  HA   . TYR A 1 64  ? 5.531   12.196 35.997 1.00 0.00 ? 64  TYR A HA   3  
ATOM   7133  H  HB2  . TYR A 1 64  ? 5.824   10.781 34.018 1.00 0.00 ? 64  TYR A HB2  3  
ATOM   7134  H  HB3  . TYR A 1 64  ? 4.107   10.399 33.975 1.00 0.00 ? 64  TYR A HB3  3  
ATOM   7135  H  HD1  . TYR A 1 64  ? 2.470   12.091 33.251 1.00 0.00 ? 64  TYR A HD1  3  
ATOM   7136  H  HD2  . TYR A 1 64  ? 6.633   12.960 33.259 1.00 0.00 ? 64  TYR A HD2  3  
ATOM   7137  H  HE1  . TYR A 1 64  ? 2.058   14.069 31.865 1.00 0.00 ? 64  TYR A HE1  3  
ATOM   7138  H  HE2  . TYR A 1 64  ? 6.221   14.941 31.874 1.00 0.00 ? 64  TYR A HE2  3  
ATOM   7139  H  HH   . TYR A 1 64  ? 3.641   15.446 30.110 1.00 0.00 ? 64  TYR A HH   3  
ATOM   7140  N  N    . ALA A 1 65  ? 2.302   11.587 35.794 1.00 0.00 ? 65  ALA A N    3  
ATOM   7141  C  CA   . ALA A 1 65  ? 0.989   12.254 35.981 1.00 0.00 ? 65  ALA A CA   3  
ATOM   7142  C  C    . ALA A 1 65  ? 0.968   13.049 37.279 1.00 0.00 ? 65  ALA A C    3  
ATOM   7143  O  O    . ALA A 1 65  ? 0.146   13.925 37.460 1.00 0.00 ? 65  ALA A O    3  
ATOM   7144  C  CB   . ALA A 1 65  ? -0.103  11.175 36.042 1.00 0.00 ? 65  ALA A CB   3  
ATOM   7145  H  H    . ALA A 1 65  ? 2.348   10.627 35.594 1.00 0.00 ? 65  ALA A H    3  
ATOM   7146  H  HA   . ALA A 1 65  ? 0.816   12.936 35.148 1.00 0.00 ? 65  ALA A HA   3  
ATOM   7147  H  HB1  . ALA A 1 65  ? 0.095   10.414 35.303 1.00 0.00 ? 65  ALA A HB1  3  
ATOM   7148  H  HB2  . ALA A 1 65  ? -0.117  10.725 37.023 1.00 0.00 ? 65  ALA A HB2  3  
ATOM   7149  H  HB3  . ALA A 1 65  ? -1.066  11.621 35.841 1.00 0.00 ? 65  ALA A HB3  3  
ATOM   7150  N  N    . GLN A 1 66  ? 1.872   12.730 38.162 1.00 0.00 ? 66  GLN A N    3  
ATOM   7151  C  CA   . GLN A 1 66  ? 1.915   13.459 39.451 1.00 0.00 ? 66  GLN A CA   3  
ATOM   7152  C  C    . GLN A 1 66  ? 2.614   14.803 39.283 1.00 0.00 ? 66  GLN A C    3  
ATOM   7153  O  O    . GLN A 1 66  ? 2.346   15.739 40.010 1.00 0.00 ? 66  GLN A O    3  
ATOM   7154  C  CB   . GLN A 1 66  ? 2.698   12.608 40.461 1.00 0.00 ? 66  GLN A CB   3  
ATOM   7155  C  CG   . GLN A 1 66  ? 1.759   11.561 41.067 1.00 0.00 ? 66  GLN A CG   3  
ATOM   7156  C  CD   . GLN A 1 66  ? 2.589   10.498 41.787 1.00 0.00 ? 66  GLN A CD   3  
ATOM   7157  O  OE1  . GLN A 1 66  ? 2.070   9.507  42.262 1.00 0.00 ? 66  GLN A OE1  3  
ATOM   7158  N  NE2  . GLN A 1 66  ? 3.879   10.663 41.889 1.00 0.00 ? 66  GLN A NE2  3  
ATOM   7159  H  H    . GLN A 1 66  ? 2.515   12.014 37.976 1.00 0.00 ? 66  GLN A H    3  
ATOM   7160  H  HA   . GLN A 1 66  ? 0.896   13.629 39.794 1.00 0.00 ? 66  GLN A HA   3  
ATOM   7161  H  HB2  . GLN A 1 66  ? 3.519   12.113 39.961 1.00 0.00 ? 66  GLN A HB2  3  
ATOM   7162  H  HB3  . GLN A 1 66  ? 3.091   13.242 41.243 1.00 0.00 ? 66  GLN A HB3  3  
ATOM   7163  H  HG2  . GLN A 1 66  ? 1.091   12.033 41.774 1.00 0.00 ? 66  GLN A HG2  3  
ATOM   7164  H  HG3  . GLN A 1 66  ? 1.178   11.095 40.285 1.00 0.00 ? 66  GLN A HG3  3  
ATOM   7165  H  HE21 . GLN A 1 66  ? 4.302   11.459 41.507 1.00 0.00 ? 66  GLN A HE21 3  
ATOM   7166  H  HE22 . GLN A 1 66  ? 4.424   9.990  42.348 1.00 0.00 ? 66  GLN A HE22 3  
ATOM   7167  N  N    . HIS A 1 67  ? 3.502   14.874 38.328 1.00 0.00 ? 67  HIS A N    3  
ATOM   7168  C  CA   . HIS A 1 67  ? 4.226   16.149 38.100 1.00 0.00 ? 67  HIS A CA   3  
ATOM   7169  C  C    . HIS A 1 67  ? 3.297   17.180 37.470 1.00 0.00 ? 67  HIS A C    3  
ATOM   7170  O  O    . HIS A 1 67  ? 3.489   18.371 37.622 1.00 0.00 ? 67  HIS A O    3  
ATOM   7171  C  CB   . HIS A 1 67  ? 5.391   15.881 37.133 1.00 0.00 ? 67  HIS A CB   3  
ATOM   7172  C  CG   . HIS A 1 67  ? 6.615   15.405 37.918 1.00 0.00 ? 67  HIS A CG   3  
ATOM   7173  N  ND1  . HIS A 1 67  ? 7.158   16.041 38.847 1.00 0.00 ? 67  HIS A ND1  3  
ATOM   7174  C  CD2  . HIS A 1 67  ? 7.355   14.244 37.783 1.00 0.00 ? 67  HIS A CD2  3  
ATOM   7175  C  CE1  . HIS A 1 67  ? 8.157   15.416 39.315 1.00 0.00 ? 67  HIS A CE1  3  
ATOM   7176  N  NE2  . HIS A 1 67  ? 8.365   14.251 38.697 1.00 0.00 ? 67  HIS A NE2  3  
ATOM   7177  H  H    . HIS A 1 67  ? 3.689   14.092 37.768 1.00 0.00 ? 67  HIS A H    3  
ATOM   7178  H  HA   . HIS A 1 67  ? 4.589   16.530 39.055 1.00 0.00 ? 67  HIS A HA   3  
ATOM   7179  H  HB2  . HIS A 1 67  ? 5.107   15.120 36.422 1.00 0.00 ? 67  HIS A HB2  3  
ATOM   7180  H  HB3  . HIS A 1 67  ? 5.641   16.787 36.603 1.00 0.00 ? 67  HIS A HB3  3  
ATOM   7181  H  HD1  . HIS A 1 67  ? 6.853   16.915 39.169 1.00 0.00 ? 67  HIS A HD1  3  
ATOM   7182  H  HD2  . HIS A 1 67  ? 7.167   13.461 37.062 1.00 0.00 ? 67  HIS A HD2  3  
ATOM   7183  H  HE1  . HIS A 1 67  ? 8.774   15.787 40.122 1.00 0.00 ? 67  HIS A HE1  3  
ATOM   7184  N  N    . VAL A 1 68  ? 2.305   16.699 36.771 1.00 0.00 ? 68  VAL A N    3  
ATOM   7185  C  CA   . VAL A 1 68  ? 1.349   17.627 36.121 1.00 0.00 ? 68  VAL A CA   3  
ATOM   7186  C  C    . VAL A 1 68  ? 0.566   18.421 37.168 1.00 0.00 ? 68  VAL A C    3  
ATOM   7187  O  O    . VAL A 1 68  ? -0.140  19.355 36.843 1.00 0.00 ? 68  VAL A O    3  
ATOM   7188  C  CB   . VAL A 1 68  ? 0.366   16.792 35.280 1.00 0.00 ? 68  VAL A CB   3  
ATOM   7189  C  CG1  . VAL A 1 68  ? -0.697  17.714 34.678 1.00 0.00 ? 68  VAL A CG1  3  
ATOM   7190  C  CG2  . VAL A 1 68  ? 1.134   16.106 34.148 1.00 0.00 ? 68  VAL A CG2  3  
ATOM   7191  H  H    . VAL A 1 68  ? 2.193   15.731 36.673 1.00 0.00 ? 68  VAL A H    3  
ATOM   7192  H  HA   . VAL A 1 68  ? 1.904   18.321 35.491 1.00 0.00 ? 68  VAL A HA   3  
ATOM   7193  H  HB   . VAL A 1 68  ? -0.107  16.046 35.902 1.00 0.00 ? 68  VAL A HB   3  
ATOM   7194  H  HG11 . VAL A 1 68  ? -0.235  18.628 34.336 1.00 0.00 ? 68  VAL A HG11 3  
ATOM   7195  H  HG12 . VAL A 1 68  ? -1.175  17.223 33.843 1.00 0.00 ? 68  VAL A HG12 3  
ATOM   7196  H  HG13 . VAL A 1 68  ? -1.440  17.948 35.425 1.00 0.00 ? 68  VAL A HG13 3  
ATOM   7197  H  HG21 . VAL A 1 68  ? 1.653   16.847 33.558 1.00 0.00 ? 68  VAL A HG21 3  
ATOM   7198  H  HG22 . VAL A 1 68  ? 1.853   15.415 34.563 1.00 0.00 ? 68  VAL A HG22 3  
ATOM   7199  H  HG23 . VAL A 1 68  ? 0.446   15.565 33.515 1.00 0.00 ? 68  VAL A HG23 3  
ATOM   7200  N  N    . PHE A 1 69  ? 0.710   18.030 38.408 1.00 0.00 ? 69  PHE A N    3  
ATOM   7201  C  CA   . PHE A 1 69  ? -0.014  18.742 39.496 1.00 0.00 ? 69  PHE A CA   3  
ATOM   7202  C  C    . PHE A 1 69  ? 0.596   20.113 39.754 1.00 0.00 ? 69  PHE A C    3  
ATOM   7203  O  O    . PHE A 1 69  ? -0.008  21.125 39.458 1.00 0.00 ? 69  PHE A O    3  
ATOM   7204  C  CB   . PHE A 1 69  ? 0.098   17.899 40.781 1.00 0.00 ? 69  PHE A CB   3  
ATOM   7205  C  CG   . PHE A 1 69  ? -1.231  17.931 41.544 1.00 0.00 ? 69  PHE A CG   3  
ATOM   7206  C  CD1  . PHE A 1 69  ? -2.379  17.402 40.981 1.00 0.00 ? 69  PHE A CD1  3  
ATOM   7207  C  CD2  . PHE A 1 69  ? -1.299  18.480 42.815 1.00 0.00 ? 69  PHE A CD2  3  
ATOM   7208  C  CE1  . PHE A 1 69  ? -3.572  17.423 41.674 1.00 0.00 ? 69  PHE A CE1  3  
ATOM   7209  C  CE2  . PHE A 1 69  ? -2.495  18.500 43.504 1.00 0.00 ? 69  PHE A CE2  3  
ATOM   7210  C  CZ   . PHE A 1 69  ? -3.629  17.973 42.933 1.00 0.00 ? 69  PHE A CZ   3  
ATOM   7211  H  H    . PHE A 1 69  ? 1.290   17.269 38.620 1.00 0.00 ? 69  PHE A H    3  
ATOM   7212  H  HA   . PHE A 1 69  ? -1.054  18.875 39.205 1.00 0.00 ? 69  PHE A HA   3  
ATOM   7213  H  HB2  . PHE A 1 69  ? 0.336   16.877 40.525 1.00 0.00 ? 69  PHE A HB2  3  
ATOM   7214  H  HB3  . PHE A 1 69  ? 0.880   18.298 41.410 1.00 0.00 ? 69  PHE A HB3  3  
ATOM   7215  H  HD1  . PHE A 1 69  ? -2.342  16.971 39.990 1.00 0.00 ? 69  PHE A HD1  3  
ATOM   7216  H  HD2  . PHE A 1 69  ? -0.412  18.894 43.268 1.00 0.00 ? 69  PHE A HD2  3  
ATOM   7217  H  HE1  . PHE A 1 69  ? -4.462  17.004 41.230 1.00 0.00 ? 69  PHE A HE1  3  
ATOM   7218  H  HE2  . PHE A 1 69  ? -2.538  18.924 44.497 1.00 0.00 ? 69  PHE A HE2  3  
ATOM   7219  H  HZ   . PHE A 1 69  ? -4.564  17.994 43.472 1.00 0.00 ? 69  PHE A HZ   3  
ATOM   7220  N  N    . ARG A 1 70  ? 1.782   20.129 40.306 1.00 0.00 ? 70  ARG A N    3  
ATOM   7221  C  CA   . ARG A 1 70  ? 2.432   21.433 40.581 1.00 0.00 ? 70  ARG A CA   3  
ATOM   7222  C  C    . ARG A 1 70  ? 2.285   22.355 39.380 1.00 0.00 ? 70  ARG A C    3  
ATOM   7223  O  O    . ARG A 1 70  ? 2.285   23.563 39.512 1.00 0.00 ? 70  ARG A O    3  
ATOM   7224  C  CB   . ARG A 1 70  ? 3.929   21.191 40.851 1.00 0.00 ? 70  ARG A CB   3  
ATOM   7225  C  CG   . ARG A 1 70  ? 4.444   22.226 41.868 1.00 0.00 ? 70  ARG A CG   3  
ATOM   7226  C  CD   . ARG A 1 70  ? 3.776   22.004 43.237 1.00 0.00 ? 70  ARG A CD   3  
ATOM   7227  N  NE   . ARG A 1 70  ? 3.484   20.553 43.428 1.00 0.00 ? 70  ARG A NE   3  
ATOM   7228  C  CZ   . ARG A 1 70  ? 3.493   20.055 44.635 1.00 0.00 ? 70  ARG A CZ   3  
ATOM   7229  N  NH1  . ARG A 1 70  ? 2.409   20.138 45.357 1.00 0.00 ? 70  ARG A NH1  3  
ATOM   7230  N  NH2  . ARG A 1 70  ? 4.583   19.493 45.079 1.00 0.00 ? 70  ARG A NH2  3  
ATOM   7231  H  H    . ARG A 1 70  ? 2.237   19.290 40.530 1.00 0.00 ? 70  ARG A H    3  
ATOM   7232  H  HA   . ARG A 1 70  ? 1.949   21.892 41.441 1.00 0.00 ? 70  ARG A HA   3  
ATOM   7233  H  HB2  . ARG A 1 70  ? 4.072   20.197 41.240 1.00 0.00 ? 70  ARG A HB2  3  
ATOM   7234  H  HB3  . ARG A 1 70  ? 4.481   21.289 39.928 1.00 0.00 ? 70  ARG A HB3  3  
ATOM   7235  H  HG2  . ARG A 1 70  ? 5.514   22.126 41.970 1.00 0.00 ? 70  ARG A HG2  3  
ATOM   7236  H  HG3  . ARG A 1 70  ? 4.216   23.220 41.514 1.00 0.00 ? 70  ARG A HG3  3  
ATOM   7237  H  HD2  . ARG A 1 70  ? 4.439   22.336 44.023 1.00 0.00 ? 70  ARG A HD2  3  
ATOM   7238  H  HD3  . ARG A 1 70  ? 2.854   22.563 43.293 1.00 0.00 ? 70  ARG A HD3  3  
ATOM   7239  H  HE   . ARG A 1 70  ? 3.283   19.982 42.660 1.00 0.00 ? 70  ARG A HE   3  
ATOM   7240  H  HH11 . ARG A 1 70  ? 1.591   20.576 44.984 1.00 0.00 ? 70  ARG A HH11 3  
ATOM   7241  H  HH12 . ARG A 1 70  ? 2.396   19.764 46.284 1.00 0.00 ? 70  ARG A HH12 3  
ATOM   7242  H  HH21 . ARG A 1 70  ? 5.395   19.448 44.499 1.00 0.00 ? 70  ARG A HH21 3  
ATOM   7243  H  HH22 . ARG A 1 70  ? 4.606   19.109 46.003 1.00 0.00 ? 70  ARG A HH22 3  
ATOM   7244  N  N    . SER A 1 71  ? 2.163   21.763 38.222 1.00 0.00 ? 71  SER A N    3  
ATOM   7245  C  CA   . SER A 1 71  ? 2.013   22.576 37.000 1.00 0.00 ? 71  SER A CA   3  
ATOM   7246  C  C    . SER A 1 71  ? 0.866   23.572 37.140 1.00 0.00 ? 71  SER A C    3  
ATOM   7247  O  O    . SER A 1 71  ? 0.895   24.631 36.543 1.00 0.00 ? 71  SER A O    3  
ATOM   7248  C  CB   . SER A 1 71  ? 1.704   21.628 35.832 1.00 0.00 ? 71  SER A CB   3  
ATOM   7249  O  OG   . SER A 1 71  ? 2.504   20.485 36.092 1.00 0.00 ? 71  SER A OG   3  
ATOM   7250  H  H    . SER A 1 71  ? 2.187   20.785 38.161 1.00 0.00 ? 71  SER A H    3  
ATOM   7251  H  HA   . SER A 1 71  ? 2.938   23.121 36.820 1.00 0.00 ? 71  SER A HA   3  
ATOM   7252  H  HB2  . SER A 1 71  ? 0.659   21.358 35.823 1.00 0.00 ? 71  SER A HB2  3  
ATOM   7253  H  HB3  . SER A 1 71  ? 1.987   22.076 34.890 1.00 0.00 ? 71  SER A HB3  3  
ATOM   7254  H  HG   . SER A 1 71  ? 3.181   20.735 36.727 1.00 0.00 ? 71  SER A HG   3  
ATOM   7255  N  N    . PHE A 1 72  ? -0.136  23.216 37.923 1.00 0.00 ? 72  PHE A N    3  
ATOM   7256  C  CA   . PHE A 1 72  ? -1.287  24.153 38.098 1.00 0.00 ? 72  PHE A CA   3  
ATOM   7257  C  C    . PHE A 1 72  ? -1.793  24.172 39.539 1.00 0.00 ? 72  PHE A C    3  
ATOM   7258  O  O    . PHE A 1 72  ? -2.270  25.183 40.011 1.00 0.00 ? 72  PHE A O    3  
ATOM   7259  C  CB   . PHE A 1 72  ? -2.433  23.697 37.181 1.00 0.00 ? 72  PHE A CB   3  
ATOM   7260  C  CG   . PHE A 1 72  ? -2.941  24.899 36.376 1.00 0.00 ? 72  PHE A CG   3  
ATOM   7261  C  CD1  . PHE A 1 72  ? -3.892  25.752 36.912 1.00 0.00 ? 72  PHE A CD1  3  
ATOM   7262  C  CD2  . PHE A 1 72  ? -2.453  25.150 35.104 1.00 0.00 ? 72  PHE A CD2  3  
ATOM   7263  C  CE1  . PHE A 1 72  ? -4.345  26.836 36.187 1.00 0.00 ? 72  PHE A CE1  3  
ATOM   7264  C  CE2  . PHE A 1 72  ? -2.910  26.237 34.384 1.00 0.00 ? 72  PHE A CE2  3  
ATOM   7265  C  CZ   . PHE A 1 72  ? -3.854  27.076 34.926 1.00 0.00 ? 72  PHE A CZ   3  
ATOM   7266  H  H    . PHE A 1 72  ? -0.130  22.338 38.381 1.00 0.00 ? 72  PHE A H    3  
ATOM   7267  H  HA   . PHE A 1 72  ? -0.966  25.159 37.834 1.00 0.00 ? 72  PHE A HA   3  
ATOM   7268  H  HB2  . PHE A 1 72  ? -2.077  22.936 36.500 1.00 0.00 ? 72  PHE A HB2  3  
ATOM   7269  H  HB3  . PHE A 1 72  ? -3.243  23.297 37.774 1.00 0.00 ? 72  PHE A HB3  3  
ATOM   7270  H  HD1  . PHE A 1 72  ? -4.280  25.568 37.903 1.00 0.00 ? 72  PHE A HD1  3  
ATOM   7271  H  HD2  . PHE A 1 72  ? -1.711  24.495 34.674 1.00 0.00 ? 72  PHE A HD2  3  
ATOM   7272  H  HE1  . PHE A 1 72  ? -5.086  27.496 36.613 1.00 0.00 ? 72  PHE A HE1  3  
ATOM   7273  H  HE2  . PHE A 1 72  ? -2.524  26.426 33.393 1.00 0.00 ? 72  PHE A HE2  3  
ATOM   7274  H  HZ   . PHE A 1 72  ? -4.209  27.925 34.361 1.00 0.00 ? 72  PHE A HZ   3  
ATOM   7275  N  N    . ASP A 1 73  ? -1.684  23.063 40.215 1.00 0.00 ? 73  ASP A N    3  
ATOM   7276  C  CA   . ASP A 1 73  ? -2.162  23.032 41.620 1.00 0.00 ? 73  ASP A CA   3  
ATOM   7277  C  C    . ASP A 1 73  ? -1.161  23.702 42.557 1.00 0.00 ? 73  ASP A C    3  
ATOM   7278  O  O    . ASP A 1 73  ? -0.968  23.266 43.675 1.00 0.00 ? 73  ASP A O    3  
ATOM   7279  C  CB   . ASP A 1 73  ? -2.342  21.569 42.045 1.00 0.00 ? 73  ASP A CB   3  
ATOM   7280  C  CG   . ASP A 1 73  ? -3.576  21.462 42.940 1.00 0.00 ? 73  ASP A CG   3  
ATOM   7281  O  OD1  . ASP A 1 73  ? -4.622  21.886 42.472 1.00 0.00 ? 73  ASP A OD1  3  
ATOM   7282  O  OD2  . ASP A 1 73  ? -3.404  20.966 44.042 1.00 0.00 ? 73  ASP A OD2  3  
ATOM   7283  H  H    . ASP A 1 73  ? -1.293  22.265 39.803 1.00 0.00 ? 73  ASP A H    3  
ATOM   7284  H  HA   . ASP A 1 73  ? -3.110  23.568 41.678 1.00 0.00 ? 73  ASP A HA   3  
ATOM   7285  H  HB2  . ASP A 1 73  ? -2.477  20.949 41.172 1.00 0.00 ? 73  ASP A HB2  3  
ATOM   7286  H  HB3  . ASP A 1 73  ? -1.474  21.234 42.590 1.00 0.00 ? 73  ASP A HB3  3  
ATOM   7287  N  N    . ALA A 1 74  ? -0.548  24.756 42.077 1.00 0.00 ? 74  ALA A N    3  
ATOM   7288  C  CA   . ALA A 1 74  ? 0.445   25.481 42.910 1.00 0.00 ? 74  ALA A CA   3  
ATOM   7289  C  C    . ALA A 1 74  ? -0.136  26.795 43.415 1.00 0.00 ? 74  ALA A C    3  
ATOM   7290  O  O    . ALA A 1 74  ? 0.587   27.678 43.831 1.00 0.00 ? 74  ALA A O    3  
ATOM   7291  C  CB   . ALA A 1 74  ? 1.672   25.790 42.038 1.00 0.00 ? 74  ALA A CB   3  
ATOM   7292  H  H    . ALA A 1 74  ? -0.743  25.066 41.172 1.00 0.00 ? 74  ALA A H    3  
ATOM   7293  H  HA   . ALA A 1 74  ? 0.719   24.864 43.759 1.00 0.00 ? 74  ALA A HA   3  
ATOM   7294  H  HB1  . ALA A 1 74  ? 2.062   24.874 41.620 1.00 0.00 ? 74  ALA A HB1  3  
ATOM   7295  H  HB2  . ALA A 1 74  ? 1.389   26.454 41.235 1.00 0.00 ? 74  ALA A HB2  3  
ATOM   7296  H  HB3  . ALA A 1 74  ? 2.436   26.262 42.637 1.00 0.00 ? 74  ALA A HB3  3  
ATOM   7297  N  N    . ASN A 1 75  ? -1.440  26.898 43.368 1.00 0.00 ? 75  ASN A N    3  
ATOM   7298  C  CA   . ASN A 1 75  ? -2.094  28.145 43.838 1.00 0.00 ? 75  ASN A CA   3  
ATOM   7299  C  C    . ASN A 1 75  ? -2.569  28.005 45.280 1.00 0.00 ? 75  ASN A C    3  
ATOM   7300  O  O    . ASN A 1 75  ? -3.677  28.381 45.608 1.00 0.00 ? 75  ASN A O    3  
ATOM   7301  C  CB   . ASN A 1 75  ? -3.311  28.421 42.934 1.00 0.00 ? 75  ASN A CB   3  
ATOM   7302  C  CG   . ASN A 1 75  ? -4.404  27.379 43.206 1.00 0.00 ? 75  ASN A CG   3  
ATOM   7303  O  OD1  . ASN A 1 75  ? -4.384  26.280 42.672 1.00 0.00 ? 75  ASN A OD1  3  
ATOM   7304  N  ND2  . ASN A 1 75  ? -5.377  27.683 44.023 1.00 0.00 ? 75  ASN A ND2  3  
ATOM   7305  H  H    . ASN A 1 75  ? -1.981  26.158 43.025 1.00 0.00 ? 75  ASN A H    3  
ATOM   7306  H  HA   . ASN A 1 75  ? -1.378  28.964 43.779 1.00 0.00 ? 75  ASN A HA   3  
ATOM   7307  H  HB2  . ASN A 1 75  ? -3.701  29.406 43.138 1.00 0.00 ? 75  ASN A HB2  3  
ATOM   7308  H  HB3  . ASN A 1 75  ? -3.016  28.363 41.897 1.00 0.00 ? 75  ASN A HB3  3  
ATOM   7309  H  HD21 . ASN A 1 75  ? -5.400  28.566 44.451 1.00 0.00 ? 75  ASN A HD21 3  
ATOM   7310  H  HD22 . ASN A 1 75  ? -6.084  27.030 44.206 1.00 0.00 ? 75  ASN A HD22 3  
ATOM   7311  N  N    . SER A 1 76  ? -1.723  27.466 46.118 1.00 0.00 ? 76  SER A N    3  
ATOM   7312  C  CA   . SER A 1 76  ? -2.118  27.299 47.541 1.00 0.00 ? 76  SER A CA   3  
ATOM   7313  C  C    . SER A 1 76  ? -3.530  26.743 47.641 1.00 0.00 ? 76  SER A C    3  
ATOM   7314  O  O    . SER A 1 76  ? -4.335  27.224 48.414 1.00 0.00 ? 76  SER A O    3  
ATOM   7315  C  CB   . SER A 1 76  ? -2.080  28.677 48.226 1.00 0.00 ? 76  SER A CB   3  
ATOM   7316  O  OG   . SER A 1 76  ? -0.760  29.146 47.995 1.00 0.00 ? 76  SER A OG   3  
ATOM   7317  H  H    . SER A 1 76  ? -0.841  27.170 45.809 1.00 0.00 ? 76  SER A H    3  
ATOM   7318  H  HA   . SER A 1 76  ? -1.427  26.607 48.022 1.00 0.00 ? 76  SER A HA   3  
ATOM   7319  H  HB2  . SER A 1 76  ? -2.799  29.347 47.777 1.00 0.00 ? 76  SER A HB2  3  
ATOM   7320  H  HB3  . SER A 1 76  ? -2.263  28.583 49.286 1.00 0.00 ? 76  SER A HB3  3  
ATOM   7321  H  HG   . SER A 1 76  ? -0.476  29.628 48.775 1.00 0.00 ? 76  SER A HG   3  
ATOM   7322  N  N    . ASP A 1 77  ? -3.802  25.733 46.854 1.00 0.00 ? 77  ASP A N    3  
ATOM   7323  C  CA   . ASP A 1 77  ? -5.155  25.120 46.877 1.00 0.00 ? 77  ASP A CA   3  
ATOM   7324  C  C    . ASP A 1 77  ? -5.147  23.810 47.648 1.00 0.00 ? 77  ASP A C    3  
ATOM   7325  O  O    . ASP A 1 77  ? -5.779  23.689 48.680 1.00 0.00 ? 77  ASP A O    3  
ATOM   7326  C  CB   . ASP A 1 77  ? -5.568  24.820 45.425 1.00 0.00 ? 77  ASP A CB   3  
ATOM   7327  C  CG   . ASP A 1 77  ? -7.100  24.787 45.315 1.00 0.00 ? 77  ASP A CG   3  
ATOM   7328  O  OD1  . ASP A 1 77  ? -7.720  25.405 46.164 1.00 0.00 ? 77  ASP A OD1  3  
ATOM   7329  O  OD2  . ASP A 1 77  ? -7.561  24.147 44.383 1.00 0.00 ? 77  ASP A OD2  3  
ATOM   7330  H  H    . ASP A 1 77  ? -3.113  25.382 46.251 1.00 0.00 ? 77  ASP A H    3  
ATOM   7331  H  HA   . ASP A 1 77  ? -5.854  25.807 47.346 1.00 0.00 ? 77  ASP A HA   3  
ATOM   7332  H  HB2  . ASP A 1 77  ? -5.181  25.583 44.774 1.00 0.00 ? 77  ASP A HB2  3  
ATOM   7333  H  HB3  . ASP A 1 77  ? -5.171  23.862 45.125 1.00 0.00 ? 77  ASP A HB3  3  
ATOM   7334  N  N    . GLY A 1 78  ? -4.425  22.853 47.126 1.00 0.00 ? 78  GLY A N    3  
ATOM   7335  C  CA   . GLY A 1 78  ? -4.346  21.525 47.800 1.00 0.00 ? 78  GLY A CA   3  
ATOM   7336  C  C    . GLY A 1 78  ? -5.119  20.496 46.979 1.00 0.00 ? 78  GLY A C    3  
ATOM   7337  O  O    . GLY A 1 78  ? -5.057  19.312 47.237 1.00 0.00 ? 78  GLY A O    3  
ATOM   7338  H  H    . GLY A 1 78  ? -3.936  23.009 46.292 1.00 0.00 ? 78  GLY A H    3  
ATOM   7339  H  HA2  . GLY A 1 78  ? -3.313  21.219 47.874 1.00 0.00 ? 78  GLY A HA2  3  
ATOM   7340  H  HA3  . GLY A 1 78  ? -4.773  21.589 48.789 1.00 0.00 ? 78  GLY A HA3  3  
ATOM   7341  N  N    . THR A 1 79  ? -5.842  20.980 46.008 1.00 0.00 ? 79  THR A N    3  
ATOM   7342  C  CA   . THR A 1 79  ? -6.628  20.065 45.152 1.00 0.00 ? 79  THR A CA   3  
ATOM   7343  C  C    . THR A 1 79  ? -6.804  20.655 43.757 1.00 0.00 ? 79  THR A C    3  
ATOM   7344  O  O    . THR A 1 79  ? -6.773  21.863 43.583 1.00 0.00 ? 79  THR A O    3  
ATOM   7345  C  CB   . THR A 1 79  ? -8.006  19.871 45.789 1.00 0.00 ? 79  THR A CB   3  
ATOM   7346  O  OG1  . THR A 1 79  ? -8.417  21.161 46.192 1.00 0.00 ? 79  THR A OG1  3  
ATOM   7347  C  CG2  . THR A 1 79  ? -7.888  19.074 47.096 1.00 0.00 ? 79  THR A CG2  3  
ATOM   7348  H  H    . THR A 1 79  ? -5.859  21.945 45.841 1.00 0.00 ? 79  THR A H    3  
ATOM   7349  H  HA   . THR A 1 79  ? -6.099  19.115 45.072 1.00 0.00 ? 79  THR A HA   3  
ATOM   7350  H  HB   . THR A 1 79  ? -8.720  19.436 45.090 1.00 0.00 ? 79  THR A HB   3  
ATOM   7351  H  HG1  . THR A 1 79  ? -7.889  21.805 45.712 1.00 0.00 ? 79  THR A HG1  3  
ATOM   7352  H  HG21 . THR A 1 79  ? -7.265  18.206 46.938 1.00 0.00 ? 79  THR A HG21 3  
ATOM   7353  H  HG22 . THR A 1 79  ? -7.444  19.694 47.861 1.00 0.00 ? 79  THR A HG22 3  
ATOM   7354  H  HG23 . THR A 1 79  ? -8.867  18.758 47.421 1.00 0.00 ? 79  THR A HG23 3  
ATOM   7355  N  N    . LEU A 1 80  ? -6.985  19.794 42.787 1.00 0.00 ? 80  LEU A N    3  
ATOM   7356  C  CA   . LEU A 1 80  ? -7.164  20.285 41.397 1.00 0.00 ? 80  LEU A CA   3  
ATOM   7357  C  C    . LEU A 1 80  ? -8.639  20.315 41.026 1.00 0.00 ? 80  LEU A C    3  
ATOM   7358  O  O    . LEU A 1 80  ? -9.315  19.306 41.075 1.00 0.00 ? 80  LEU A O    3  
ATOM   7359  C  CB   . LEU A 1 80  ? -6.433  19.325 40.438 1.00 0.00 ? 80  LEU A CB   3  
ATOM   7360  C  CG   . LEU A 1 80  ? -5.048  19.896 40.107 1.00 0.00 ? 80  LEU A CG   3  
ATOM   7361  C  CD1  . LEU A 1 80  ? -4.333  18.953 39.137 1.00 0.00 ? 80  LEU A CD1  3  
ATOM   7362  C  CD2  . LEU A 1 80  ? -5.207  21.268 39.446 1.00 0.00 ? 80  LEU A CD2  3  
ATOM   7363  H  H    . LEU A 1 80  ? -7.001  18.832 42.977 1.00 0.00 ? 80  LEU A H    3  
ATOM   7364  H  HA   . LEU A 1 80  ? -6.761  21.291 41.321 1.00 0.00 ? 80  LEU A HA   3  
ATOM   7365  H  HB2  . LEU A 1 80  ? -6.324  18.358 40.907 1.00 0.00 ? 80  LEU A HB2  3  
ATOM   7366  H  HB3  . LEU A 1 80  ? -7.006  19.214 39.529 1.00 0.00 ? 80  LEU A HB3  3  
ATOM   7367  H  HG   . LEU A 1 80  ? -4.469  19.994 41.013 1.00 0.00 ? 80  LEU A HG   3  
ATOM   7368  H  HD11 . LEU A 1 80  ? -4.705  17.948 39.266 1.00 0.00 ? 80  LEU A HD11 3  
ATOM   7369  H  HD12 . LEU A 1 80  ? -4.511  19.269 38.122 1.00 0.00 ? 80  LEU A HD12 3  
ATOM   7370  H  HD13 . LEU A 1 80  ? -3.272  18.968 39.332 1.00 0.00 ? 80  LEU A HD13 3  
ATOM   7371  H  HD21 . LEU A 1 80  ? -6.202  21.362 39.039 1.00 0.00 ? 80  LEU A HD21 3  
ATOM   7372  H  HD22 . LEU A 1 80  ? -5.047  22.046 40.177 1.00 0.00 ? 80  LEU A HD22 3  
ATOM   7373  H  HD23 . LEU A 1 80  ? -4.485  21.377 38.649 1.00 0.00 ? 80  LEU A HD23 3  
ATOM   7374  N  N    . ASP A 1 81  ? -9.117  21.473 40.660 1.00 0.00 ? 81  ASP A N    3  
ATOM   7375  C  CA   . ASP A 1 81  ? -10.545 21.582 40.283 1.00 0.00 ? 81  ASP A CA   3  
ATOM   7376  C  C    . ASP A 1 81  ? -10.723 21.319 38.793 1.00 0.00 ? 81  ASP A C    3  
ATOM   7377  O  O    . ASP A 1 81  ? -9.780  21.399 38.030 1.00 0.00 ? 81  ASP A O    3  
ATOM   7378  C  CB   . ASP A 1 81  ? -11.028 23.008 40.599 1.00 0.00 ? 81  ASP A CB   3  
ATOM   7379  C  CG   . ASP A 1 81  ? -11.331 23.119 42.096 1.00 0.00 ? 81  ASP A CG   3  
ATOM   7380  O  OD1  . ASP A 1 81  ? -11.877 22.156 42.611 1.00 0.00 ? 81  ASP A OD1  3  
ATOM   7381  O  OD2  . ASP A 1 81  ? -11.001 24.159 42.641 1.00 0.00 ? 81  ASP A OD2  3  
ATOM   7382  H  H    . ASP A 1 81  ? -8.535  22.265 40.637 1.00 0.00 ? 81  ASP A H    3  
ATOM   7383  H  HA   . ASP A 1 81  ? -11.117 20.844 40.845 1.00 0.00 ? 81  ASP A HA   3  
ATOM   7384  H  HB2  . ASP A 1 81  ? -10.262 23.722 40.336 1.00 0.00 ? 81  ASP A HB2  3  
ATOM   7385  H  HB3  . ASP A 1 81  ? -11.925 23.222 40.037 1.00 0.00 ? 81  ASP A HB3  3  
ATOM   7386  N  N    . PHE A 1 82  ? -11.926 21.000 38.404 1.00 0.00 ? 82  PHE A N    3  
ATOM   7387  C  CA   . PHE A 1 82  ? -12.179 20.727 36.967 1.00 0.00 ? 82  PHE A CA   3  
ATOM   7388  C  C    . PHE A 1 82  ? -11.485 21.755 36.088 1.00 0.00 ? 82  PHE A C    3  
ATOM   7389  O  O    . PHE A 1 82  ? -10.534 21.442 35.398 1.00 0.00 ? 82  PHE A O    3  
ATOM   7390  C  CB   . PHE A 1 82  ? -13.689 20.812 36.713 1.00 0.00 ? 82  PHE A CB   3  
ATOM   7391  C  CG   . PHE A 1 82  ? -14.026 20.075 35.414 1.00 0.00 ? 82  PHE A CG   3  
ATOM   7392  C  CD1  . PHE A 1 82  ? -13.989 20.739 34.197 1.00 0.00 ? 82  PHE A CD1  3  
ATOM   7393  C  CD2  . PHE A 1 82  ? -14.372 18.734 35.436 1.00 0.00 ? 82  PHE A CD2  3  
ATOM   7394  C  CE1  . PHE A 1 82  ? -14.295 20.072 33.029 1.00 0.00 ? 82  PHE A CE1  3  
ATOM   7395  C  CE2  . PHE A 1 82  ? -14.676 18.072 34.263 1.00 0.00 ? 82  PHE A CE2  3  
ATOM   7396  C  CZ   . PHE A 1 82  ? -14.638 18.741 33.063 1.00 0.00 ? 82  PHE A CZ   3  
ATOM   7397  H  H    . PHE A 1 82  ? -12.658 20.945 39.053 1.00 0.00 ? 82  PHE A H    3  
ATOM   7398  H  HA   . PHE A 1 82  ? -11.800 19.735 36.722 1.00 0.00 ? 82  PHE A HA   3  
ATOM   7399  H  HB2  . PHE A 1 82  ? -14.225 20.356 37.531 1.00 0.00 ? 82  PHE A HB2  3  
ATOM   7400  H  HB3  . PHE A 1 82  ? -13.987 21.847 36.624 1.00 0.00 ? 82  PHE A HB3  3  
ATOM   7401  H  HD1  . PHE A 1 82  ? -13.720 21.784 34.163 1.00 0.00 ? 82  PHE A HD1  3  
ATOM   7402  H  HD2  . PHE A 1 82  ? -14.404 18.204 36.375 1.00 0.00 ? 82  PHE A HD2  3  
ATOM   7403  H  HE1  . PHE A 1 82  ? -14.265 20.596 32.084 1.00 0.00 ? 82  PHE A HE1  3  
ATOM   7404  H  HE2  . PHE A 1 82  ? -14.946 17.026 34.290 1.00 0.00 ? 82  PHE A HE2  3  
ATOM   7405  H  HZ   . PHE A 1 82  ? -14.875 18.221 32.149 1.00 0.00 ? 82  PHE A HZ   3  
ATOM   7406  N  N    . LYS A 1 83  ? -11.977 22.967 36.130 1.00 0.00 ? 83  LYS A N    3  
ATOM   7407  C  CA   . LYS A 1 83  ? -11.368 24.044 35.306 1.00 0.00 ? 83  LYS A CA   3  
ATOM   7408  C  C    . LYS A 1 83  ? -9.843  23.939 35.317 1.00 0.00 ? 83  LYS A C    3  
ATOM   7409  O  O    . LYS A 1 83  ? -9.209  24.009 34.282 1.00 0.00 ? 83  LYS A O    3  
ATOM   7410  C  CB   . LYS A 1 83  ? -11.801 25.400 35.909 1.00 0.00 ? 83  LYS A CB   3  
ATOM   7411  C  CG   . LYS A 1 83  ? -11.179 26.556 35.115 1.00 0.00 ? 83  LYS A CG   3  
ATOM   7412  C  CD   . LYS A 1 83  ? -10.920 27.725 36.067 1.00 0.00 ? 83  LYS A CD   3  
ATOM   7413  C  CE   . LYS A 1 83  ? -10.875 29.035 35.269 1.00 0.00 ? 83  LYS A CE   3  
ATOM   7414  N  NZ   . LYS A 1 83  ? -11.087 30.202 36.172 1.00 0.00 ? 83  LYS A NZ   3  
ATOM   7415  H  H    . LYS A 1 83  ? -12.744 23.164 36.706 1.00 0.00 ? 83  LYS A H    3  
ATOM   7416  H  HA   . LYS A 1 83  ? -11.722 23.944 34.274 1.00 0.00 ? 83  LYS A HA   3  
ATOM   7417  H  HB2  . LYS A 1 83  ? -12.878 25.479 35.874 1.00 0.00 ? 83  LYS A HB2  3  
ATOM   7418  H  HB3  . LYS A 1 83  ? -11.480 25.455 36.938 1.00 0.00 ? 83  LYS A HB3  3  
ATOM   7419  H  HG2  . LYS A 1 83  ? -10.251 26.240 34.666 1.00 0.00 ? 83  LYS A HG2  3  
ATOM   7420  H  HG3  . LYS A 1 83  ? -11.858 26.868 34.340 1.00 0.00 ? 83  LYS A HG3  3  
ATOM   7421  H  HD2  . LYS A 1 83  ? -11.712 27.776 36.801 1.00 0.00 ? 83  LYS A HD2  3  
ATOM   7422  H  HD3  . LYS A 1 83  ? -9.979  27.577 36.574 1.00 0.00 ? 83  LYS A HD3  3  
ATOM   7423  H  HE2  . LYS A 1 83  ? -9.913  29.132 34.786 1.00 0.00 ? 83  LYS A HE2  3  
ATOM   7424  H  HE3  . LYS A 1 83  ? -11.649 29.029 34.515 1.00 0.00 ? 83  LYS A HE3  3  
ATOM   7425  H  HZ1  . LYS A 1 83  ? -10.464 30.117 36.999 1.00 0.00 ? 83  LYS A HZ1  3  
ATOM   7426  H  HZ2  . LYS A 1 83  ? -10.867 31.080 35.660 1.00 0.00 ? 83  LYS A HZ2  3  
ATOM   7427  H  HZ3  . LYS A 1 83  ? -12.079 30.222 36.485 1.00 0.00 ? 83  LYS A HZ3  3  
ATOM   7428  N  N    . GLU A 1 84  ? -9.278  23.769 36.486 1.00 0.00 ? 84  GLU A N    3  
ATOM   7429  C  CA   . GLU A 1 84  ? -7.798  23.658 36.564 1.00 0.00 ? 84  GLU A CA   3  
ATOM   7430  C  C    . GLU A 1 84  ? -7.332  22.386 35.858 1.00 0.00 ? 84  GLU A C    3  
ATOM   7431  O  O    . GLU A 1 84  ? -6.289  22.361 35.232 1.00 0.00 ? 84  GLU A O    3  
ATOM   7432  C  CB   . GLU A 1 84  ? -7.386  23.571 38.049 1.00 0.00 ? 84  GLU A CB   3  
ATOM   7433  C  CG   . GLU A 1 84  ? -7.722  24.890 38.757 1.00 0.00 ? 84  GLU A CG   3  
ATOM   7434  C  CD   . GLU A 1 84  ? -7.282  24.802 40.223 1.00 0.00 ? 84  GLU A CD   3  
ATOM   7435  O  OE1  . GLU A 1 84  ? -7.800  23.923 40.894 1.00 0.00 ? 84  GLU A OE1  3  
ATOM   7436  O  OE2  . GLU A 1 84  ? -6.453  25.620 40.591 1.00 0.00 ? 84  GLU A OE2  3  
ATOM   7437  H  H    . GLU A 1 84  ? -9.822  23.716 37.298 1.00 0.00 ? 84  GLU A H    3  
ATOM   7438  H  HA   . GLU A 1 84  ? -7.347  24.523 36.080 1.00 0.00 ? 84  GLU A HA   3  
ATOM   7439  H  HB2  . GLU A 1 84  ? -7.916  22.761 38.525 1.00 0.00 ? 84  GLU A HB2  3  
ATOM   7440  H  HB3  . GLU A 1 84  ? -6.323  23.385 38.118 1.00 0.00 ? 84  GLU A HB3  3  
ATOM   7441  H  HG2  . GLU A 1 84  ? -7.201  25.707 38.278 1.00 0.00 ? 84  GLU A HG2  3  
ATOM   7442  H  HG3  . GLU A 1 84  ? -8.786  25.069 38.713 1.00 0.00 ? 84  GLU A HG3  3  
ATOM   7443  N  N    . TYR A 1 85  ? -8.128  21.355 35.970 1.00 0.00 ? 85  TYR A N    3  
ATOM   7444  C  CA   . TYR A 1 85  ? -7.769  20.068 35.322 1.00 0.00 ? 85  TYR A CA   3  
ATOM   7445  C  C    . TYR A 1 85  ? -7.737  20.196 33.806 1.00 0.00 ? 85  TYR A C    3  
ATOM   7446  O  O    . TYR A 1 85  ? -6.746  19.884 33.178 1.00 0.00 ? 85  TYR A O    3  
ATOM   7447  C  CB   . TYR A 1 85  ? -8.832  19.026 35.711 1.00 0.00 ? 85  TYR A CB   3  
ATOM   7448  C  CG   . TYR A 1 85  ? -8.210  17.626 35.696 1.00 0.00 ? 85  TYR A CG   3  
ATOM   7449  C  CD1  . TYR A 1 85  ? -7.331  17.236 36.689 1.00 0.00 ? 85  TYR A CD1  3  
ATOM   7450  C  CD2  . TYR A 1 85  ? -8.525  16.731 34.694 1.00 0.00 ? 85  TYR A CD2  3  
ATOM   7451  C  CE1  . TYR A 1 85  ? -6.780  15.970 36.681 1.00 0.00 ? 85  TYR A CE1  3  
ATOM   7452  C  CE2  . TYR A 1 85  ? -7.973  15.465 34.686 1.00 0.00 ? 85  TYR A CE2  3  
ATOM   7453  C  CZ   . TYR A 1 85  ? -7.097  15.075 35.679 1.00 0.00 ? 85  TYR A CZ   3  
ATOM   7454  O  OH   . TYR A 1 85  ? -6.548  13.810 35.672 1.00 0.00 ? 85  TYR A OH   3  
ATOM   7455  H  H    . TYR A 1 85  ? -8.961  21.431 36.480 1.00 0.00 ? 85  TYR A H    3  
ATOM   7456  H  HA   . TYR A 1 85  ? -6.787  19.764 35.667 1.00 0.00 ? 85  TYR A HA   3  
ATOM   7457  H  HB2  . TYR A 1 85  ? -9.206  19.238 36.703 1.00 0.00 ? 85  TYR A HB2  3  
ATOM   7458  H  HB3  . TYR A 1 85  ? -9.651  19.060 35.007 1.00 0.00 ? 85  TYR A HB3  3  
ATOM   7459  H  HD1  . TYR A 1 85  ? -7.075  17.926 37.480 1.00 0.00 ? 85  TYR A HD1  3  
ATOM   7460  H  HD2  . TYR A 1 85  ? -9.207  17.023 33.909 1.00 0.00 ? 85  TYR A HD2  3  
ATOM   7461  H  HE1  . TYR A 1 85  ? -6.095  15.677 37.464 1.00 0.00 ? 85  TYR A HE1  3  
ATOM   7462  H  HE2  . TYR A 1 85  ? -8.231  14.775 33.897 1.00 0.00 ? 85  TYR A HE2  3  
ATOM   7463  H  HH   . TYR A 1 85  ? -6.572  13.470 36.569 1.00 0.00 ? 85  TYR A HH   3  
ATOM   7464  N  N    . VAL A 1 86  ? -8.824  20.649 33.244 1.00 0.00 ? 86  VAL A N    3  
ATOM   7465  C  CA   . VAL A 1 86  ? -8.874  20.804 31.766 1.00 0.00 ? 86  VAL A CA   3  
ATOM   7466  C  C    . VAL A 1 86  ? -7.569  21.383 31.231 1.00 0.00 ? 86  VAL A C    3  
ATOM   7467  O  O    . VAL A 1 86  ? -6.818  20.708 30.562 1.00 0.00 ? 86  VAL A O    3  
ATOM   7468  C  CB   . VAL A 1 86  ? -10.020 21.759 31.413 1.00 0.00 ? 86  VAL A CB   3  
ATOM   7469  C  CG1  . VAL A 1 86  ? -10.440 21.512 29.965 1.00 0.00 ? 86  VAL A CG1  3  
ATOM   7470  C  CG2  . VAL A 1 86  ? -11.206 21.485 32.336 1.00 0.00 ? 86  VAL A CG2  3  
ATOM   7471  H  H    . VAL A 1 86  ? -9.601  20.883 33.793 1.00 0.00 ? 86  VAL A H    3  
ATOM   7472  H  HA   . VAL A 1 86  ? -9.036  19.824 31.316 1.00 0.00 ? 86  VAL A HA   3  
ATOM   7473  H  HB   . VAL A 1 86  ? -9.693  22.780 31.530 1.00 0.00 ? 86  VAL A HB   3  
ATOM   7474  H  HG11 . VAL A 1 86  ? -9.658  20.976 29.444 1.00 0.00 ? 86  VAL A HG11 3  
ATOM   7475  H  HG12 . VAL A 1 86  ? -11.347 20.926 29.942 1.00 0.00 ? 86  VAL A HG12 3  
ATOM   7476  H  HG13 . VAL A 1 86  ? -10.613 22.453 29.472 1.00 0.00 ? 86  VAL A HG13 3  
ATOM   7477  H  HG21 . VAL A 1 86  ? -11.209 20.444 32.626 1.00 0.00 ? 86  VAL A HG21 3  
ATOM   7478  H  HG22 . VAL A 1 86  ? -11.129 22.101 33.217 1.00 0.00 ? 86  VAL A HG22 3  
ATOM   7479  H  HG23 . VAL A 1 86  ? -12.130 21.714 31.822 1.00 0.00 ? 86  VAL A HG23 3  
ATOM   7480  N  N    . ILE A 1 87  ? -7.323  22.627 31.534 1.00 0.00 ? 87  ILE A N    3  
ATOM   7481  C  CA   . ILE A 1 87  ? -6.071  23.262 31.050 1.00 0.00 ? 87  ILE A CA   3  
ATOM   7482  C  C    . ILE A 1 87  ? -4.882  22.332 31.250 1.00 0.00 ? 87  ILE A C    3  
ATOM   7483  O  O    . ILE A 1 87  ? -4.053  22.189 30.372 1.00 0.00 ? 87  ILE A O    3  
ATOM   7484  C  CB   . ILE A 1 87  ? -5.855  24.543 31.844 1.00 0.00 ? 87  ILE A CB   3  
ATOM   7485  C  CG1  . ILE A 1 87  ? -7.156  25.340 31.854 1.00 0.00 ? 87  ILE A CG1  3  
ATOM   7486  C  CG2  . ILE A 1 87  ? -4.759  25.375 31.149 1.00 0.00 ? 87  ILE A CG2  3  
ATOM   7487  C  CD1  . ILE A 1 87  ? -6.856  26.821 32.069 1.00 0.00 ? 87  ILE A CD1  3  
ATOM   7488  H  H    . ILE A 1 87  ? -7.959  23.138 32.074 1.00 0.00 ? 87  ILE A H    3  
ATOM   7489  H  HA   . ILE A 1 87  ? -6.171  23.481 29.983 1.00 0.00 ? 87  ILE A HA   3  
ATOM   7490  H  HB   . ILE A 1 87  ? -5.573  24.292 32.870 1.00 0.00 ? 87  ILE A HB   3  
ATOM   7491  H  HG12 . ILE A 1 87  ? -7.665  25.209 30.910 1.00 0.00 ? 87  ILE A HG12 3  
ATOM   7492  H  HG13 . ILE A 1 87  ? -7.792  24.982 32.650 1.00 0.00 ? 87  ILE A HG13 3  
ATOM   7493  H  HG21 . ILE A 1 87  ? -3.886  24.759 30.985 1.00 0.00 ? 87  ILE A HG21 3  
ATOM   7494  H  HG22 . ILE A 1 87  ? -5.122  25.735 30.198 1.00 0.00 ? 87  ILE A HG22 3  
ATOM   7495  H  HG23 . ILE A 1 87  ? -4.489  26.217 31.770 1.00 0.00 ? 87  ILE A HG23 3  
ATOM   7496  H  HD11 . ILE A 1 87  ? -6.207  26.943 32.921 1.00 0.00 ? 87  ILE A HD11 3  
ATOM   7497  H  HD12 . ILE A 1 87  ? -6.374  27.227 31.192 1.00 0.00 ? 87  ILE A HD12 3  
ATOM   7498  H  HD13 . ILE A 1 87  ? -7.779  27.356 32.245 1.00 0.00 ? 87  ILE A HD13 3  
ATOM   7499  N  N    . ALA A 1 88  ? -4.813  21.710 32.398 1.00 0.00 ? 88  ALA A N    3  
ATOM   7500  C  CA   . ALA A 1 88  ? -3.679  20.789 32.647 1.00 0.00 ? 88  ALA A CA   3  
ATOM   7501  C  C    . ALA A 1 88  ? -3.804  19.557 31.760 1.00 0.00 ? 88  ALA A C    3  
ATOM   7502  O  O    . ALA A 1 88  ? -2.937  19.272 30.954 1.00 0.00 ? 88  ALA A O    3  
ATOM   7503  C  CB   . ALA A 1 88  ? -3.717  20.352 34.122 1.00 0.00 ? 88  ALA A CB   3  
ATOM   7504  H  H    . ALA A 1 88  ? -5.505  21.848 33.085 1.00 0.00 ? 88  ALA A H    3  
ATOM   7505  H  HA   . ALA A 1 88  ? -2.745  21.303 32.416 1.00 0.00 ? 88  ALA A HA   3  
ATOM   7506  H  HB1  . ALA A 1 88  ? -4.312  21.050 34.693 1.00 0.00 ? 88  ALA A HB1  3  
ATOM   7507  H  HB2  . ALA A 1 88  ? -4.154  19.366 34.199 1.00 0.00 ? 88  ALA A HB2  3  
ATOM   7508  H  HB3  . ALA A 1 88  ? -2.715  20.329 34.523 1.00 0.00 ? 88  ALA A HB3  3  
ATOM   7509  N  N    . LEU A 1 89  ? -4.887  18.851 31.922 1.00 0.00 ? 89  LEU A N    3  
ATOM   7510  C  CA   . LEU A 1 89  ? -5.098  17.637 31.104 1.00 0.00 ? 89  LEU A CA   3  
ATOM   7511  C  C    . LEU A 1 89  ? -5.068  17.981 29.618 1.00 0.00 ? 89  LEU A C    3  
ATOM   7512  O  O    . LEU A 1 89  ? -4.728  17.157 28.792 1.00 0.00 ? 89  LEU A O    3  
ATOM   7513  C  CB   . LEU A 1 89  ? -6.476  17.070 31.452 1.00 0.00 ? 89  LEU A CB   3  
ATOM   7514  C  CG   . LEU A 1 89  ? -6.365  15.560 31.640 1.00 0.00 ? 89  LEU A CG   3  
ATOM   7515  C  CD1  . LEU A 1 89  ? -5.922  14.925 30.326 1.00 0.00 ? 89  LEU A CD1  3  
ATOM   7516  C  CD2  . LEU A 1 89  ? -5.334  15.248 32.732 1.00 0.00 ? 89  LEU A CD2  3  
ATOM   7517  H  H    . LEU A 1 89  ? -5.556  19.121 32.584 1.00 0.00 ? 89  LEU A H    3  
ATOM   7518  H  HA   . LEU A 1 89  ? -4.318  16.916 31.320 1.00 0.00 ? 89  LEU A HA   3  
ATOM   7519  H  HB2  . LEU A 1 89  ? -6.834  17.523 32.364 1.00 0.00 ? 89  LEU A HB2  3  
ATOM   7520  H  HB3  . LEU A 1 89  ? -7.171  17.286 30.654 1.00 0.00 ? 89  LEU A HB3  3  
ATOM   7521  H  HG   . LEU A 1 89  ? -7.315  15.168 31.925 1.00 0.00 ? 89  LEU A HG   3  
ATOM   7522  H  HD11 . LEU A 1 89  ? -6.516  15.318 29.513 1.00 0.00 ? 89  LEU A HD11 3  
ATOM   7523  H  HD12 . LEU A 1 89  ? -4.882  15.147 30.145 1.00 0.00 ? 89  LEU A HD12 3  
ATOM   7524  H  HD13 . LEU A 1 89  ? -6.053  13.854 30.376 1.00 0.00 ? 89  LEU A HD13 3  
ATOM   7525  H  HD21 . LEU A 1 89  ? -5.080  16.152 33.264 1.00 0.00 ? 89  LEU A HD21 3  
ATOM   7526  H  HD22 . LEU A 1 89  ? -5.746  14.530 33.426 1.00 0.00 ? 89  LEU A HD22 3  
ATOM   7527  H  HD23 . LEU A 1 89  ? -4.441  14.837 32.282 1.00 0.00 ? 89  LEU A HD23 3  
ATOM   7528  N  N    . HIS A 1 90  ? -5.428  19.196 29.309 1.00 0.00 ? 90  HIS A N    3  
ATOM   7529  C  CA   . HIS A 1 90  ? -5.431  19.625 27.890 1.00 0.00 ? 90  HIS A CA   3  
ATOM   7530  C  C    . HIS A 1 90  ? -4.008  19.809 27.374 1.00 0.00 ? 90  HIS A C    3  
ATOM   7531  O  O    . HIS A 1 90  ? -3.637  19.255 26.358 1.00 0.00 ? 90  HIS A O    3  
ATOM   7532  C  CB   . HIS A 1 90  ? -6.166  20.973 27.802 1.00 0.00 ? 90  HIS A CB   3  
ATOM   7533  C  CG   . HIS A 1 90  ? -6.267  21.404 26.339 1.00 0.00 ? 90  HIS A CG   3  
ATOM   7534  N  ND1  . HIS A 1 90  ? -6.173  22.581 25.936 1.00 0.00 ? 90  HIS A ND1  3  
ATOM   7535  C  CD2  . HIS A 1 90  ? -6.473  20.641 25.205 1.00 0.00 ? 90  HIS A CD2  3  
ATOM   7536  C  CE1  . HIS A 1 90  ? -6.295  22.654 24.677 1.00 0.00 ? 90  HIS A CE1  3  
ATOM   7537  N  NE2  . HIS A 1 90  ? -6.489  21.460 24.115 1.00 0.00 ? 90  HIS A NE2  3  
ATOM   7538  H  H    . HIS A 1 90  ? -5.697  19.822 30.013 1.00 0.00 ? 90  HIS A H    3  
ATOM   7539  H  HA   . HIS A 1 90  ? -5.934  18.868 27.289 1.00 0.00 ? 90  HIS A HA   3  
ATOM   7540  H  HB2  . HIS A 1 90  ? -7.159  20.874 28.215 1.00 0.00 ? 90  HIS A HB2  3  
ATOM   7541  H  HB3  . HIS A 1 90  ? -5.623  21.724 28.357 1.00 0.00 ? 90  HIS A HB3  3  
ATOM   7542  H  HD1  . HIS A 1 90  ? -6.029  23.354 26.521 1.00 0.00 ? 90  HIS A HD1  3  
ATOM   7543  H  HD2  . HIS A 1 90  ? -6.598  19.569 25.185 1.00 0.00 ? 90  HIS A HD2  3  
ATOM   7544  H  HE1  . HIS A 1 90  ? -6.248  23.580 24.122 1.00 0.00 ? 90  HIS A HE1  3  
ATOM   7545  N  N    . MET A 1 91  ? -3.236  20.585 28.085 1.00 0.00 ? 91  MET A N    3  
ATOM   7546  C  CA   . MET A 1 91  ? -1.837  20.815 27.649 1.00 0.00 ? 91  MET A CA   3  
ATOM   7547  C  C    . MET A 1 91  ? -1.064  19.506 27.601 1.00 0.00 ? 91  MET A C    3  
ATOM   7548  O  O    . MET A 1 91  ? -0.015  19.427 26.994 1.00 0.00 ? 91  MET A O    3  
ATOM   7549  C  CB   . MET A 1 91  ? -1.161  21.751 28.658 1.00 0.00 ? 91  MET A CB   3  
ATOM   7550  C  CG   . MET A 1 91  ? -1.176  23.173 28.100 1.00 0.00 ? 91  MET A CG   3  
ATOM   7551  S  SD   . MET A 1 91  ? -0.713  24.511 29.224 1.00 0.00 ? 91  MET A SD   3  
ATOM   7552  C  CE   . MET A 1 91  ? -1.939  25.711 28.654 1.00 0.00 ? 91  MET A CE   3  
ATOM   7553  H  H    . MET A 1 91  ? -3.578  21.013 28.897 1.00 0.00 ? 91  MET A H    3  
ATOM   7554  H  HA   . MET A 1 91  ? -1.845  21.258 26.654 1.00 0.00 ? 91  MET A HA   3  
ATOM   7555  H  HB2  . MET A 1 91  ? -1.694  21.720 29.597 1.00 0.00 ? 91  MET A HB2  3  
ATOM   7556  H  HB3  . MET A 1 91  ? -0.140  21.434 28.819 1.00 0.00 ? 91  MET A HB3  3  
ATOM   7557  H  HG2  . MET A 1 91  ? -0.506  23.210 27.254 1.00 0.00 ? 91  MET A HG2  3  
ATOM   7558  H  HG3  . MET A 1 91  ? -2.172  23.381 27.738 1.00 0.00 ? 91  MET A HG3  3  
ATOM   7559  H  HE1  . MET A 1 91  ? -1.793  25.902 27.601 1.00 0.00 ? 91  MET A HE1  3  
ATOM   7560  H  HE2  . MET A 1 91  ? -2.931  25.314 28.814 1.00 0.00 ? 91  MET A HE2  3  
ATOM   7561  H  HE3  . MET A 1 91  ? -1.825  26.631 29.207 1.00 0.00 ? 91  MET A HE3  3  
ATOM   7562  N  N    . THR A 1 92  ? -1.595  18.501 28.252 1.00 0.00 ? 92  THR A N    3  
ATOM   7563  C  CA   . THR A 1 92  ? -0.907  17.182 28.258 1.00 0.00 ? 92  THR A CA   3  
ATOM   7564  C  C    . THR A 1 92  ? -0.331  16.861 26.882 1.00 0.00 ? 92  THR A C    3  
ATOM   7565  O  O    . THR A 1 92  ? 0.616   16.107 26.762 1.00 0.00 ? 92  THR A O    3  
ATOM   7566  C  CB   . THR A 1 92  ? -1.934  16.106 28.623 1.00 0.00 ? 92  THR A CB   3  
ATOM   7567  O  OG1  . THR A 1 92  ? -2.578  16.583 29.788 1.00 0.00 ? 92  THR A OG1  3  
ATOM   7568  C  CG2  . THR A 1 92  ? -1.239  14.813 29.070 1.00 0.00 ? 92  THR A CG2  3  
ATOM   7569  H  H    . THR A 1 92  ? -2.441  18.619 28.739 1.00 0.00 ? 92  THR A H    3  
ATOM   7570  H  HA   . THR A 1 92  ? -0.096  17.207 28.986 1.00 0.00 ? 92  THR A HA   3  
ATOM   7571  H  HB   . THR A 1 92  ? -2.652  15.945 27.823 1.00 0.00 ? 92  THR A HB   3  
ATOM   7572  H  HG1  . THR A 1 92  ? -2.779  15.828 30.346 1.00 0.00 ? 92  THR A HG1  3  
ATOM   7573  H  HG21 . THR A 1 92  ? -0.383  15.052 29.684 1.00 0.00 ? 92  THR A HG21 3  
ATOM   7574  H  HG22 . THR A 1 92  ? -1.926  14.207 29.640 1.00 0.00 ? 92  THR A HG22 3  
ATOM   7575  H  HG23 . THR A 1 92  ? -0.910  14.258 28.204 1.00 0.00 ? 92  THR A HG23 3  
ATOM   7576  N  N    . SER A 1 93  ? -0.913  17.442 25.866 1.00 0.00 ? 93  SER A N    3  
ATOM   7577  C  CA   . SER A 1 93  ? -0.414  17.185 24.492 1.00 0.00 ? 93  SER A CA   3  
ATOM   7578  C  C    . SER A 1 93  ? -1.100  18.100 23.482 1.00 0.00 ? 93  SER A C    3  
ATOM   7579  O  O    . SER A 1 93  ? -0.772  18.092 22.312 1.00 0.00 ? 93  SER A O    3  
ATOM   7580  C  CB   . SER A 1 93  ? -0.730  15.724 24.129 1.00 0.00 ? 93  SER A CB   3  
ATOM   7581  O  OG   . SER A 1 93  ? -2.137  15.619 24.298 1.00 0.00 ? 93  SER A OG   3  
ATOM   7582  H  H    . SER A 1 93  ? -1.673  18.043 26.010 1.00 0.00 ? 93  SER A H    3  
ATOM   7583  H  HA   . SER A 1 93  ? 0.660   17.368 24.465 1.00 0.00 ? 93  SER A HA   3  
ATOM   7584  H  HB2  . SER A 1 93  ? -0.459  15.517 23.105 1.00 0.00 ? 93  SER A HB2  3  
ATOM   7585  H  HB3  . SER A 1 93  ? -0.223  15.045 24.799 1.00 0.00 ? 93  SER A HB3  3  
ATOM   7586  H  HG   . SER A 1 93  ? -2.555  15.861 23.467 1.00 0.00 ? 93  SER A HG   3  
ATOM   7587  N  N    . ALA A 1 94  ? -2.039  18.876 23.952 1.00 0.00 ? 94  ALA A N    3  
ATOM   7588  C  CA   . ALA A 1 94  ? -2.755  19.796 23.029 1.00 0.00 ? 94  ALA A CA   3  
ATOM   7589  C  C    . ALA A 1 94  ? -2.019  21.127 22.892 1.00 0.00 ? 94  ALA A C    3  
ATOM   7590  O  O    . ALA A 1 94  ? -1.827  21.838 23.858 1.00 0.00 ? 94  ALA A O    3  
ATOM   7591  C  CB   . ALA A 1 94  ? -4.153  20.064 23.608 1.00 0.00 ? 94  ALA A CB   3  
ATOM   7592  H  H    . ALA A 1 94  ? -2.272  18.851 24.903 1.00 0.00 ? 94  ALA A H    3  
ATOM   7593  H  HA   . ALA A 1 94  ? -2.827  19.327 22.049 1.00 0.00 ? 94  ALA A HA   3  
ATOM   7594  H  HB1  . ALA A 1 94  ? -4.622  19.129 23.879 1.00 0.00 ? 94  ALA A HB1  3  
ATOM   7595  H  HB2  . ALA A 1 94  ? -4.071  20.688 24.486 1.00 0.00 ? 94  ALA A HB2  3  
ATOM   7596  H  HB3  . ALA A 1 94  ? -4.763  20.566 22.870 1.00 0.00 ? 94  ALA A HB3  3  
ATOM   7597  N  N    . GLY A 1 95  ? -1.619  21.441 21.685 1.00 0.00 ? 95  GLY A N    3  
ATOM   7598  C  CA   . GLY A 1 95  ? -0.893  22.726 21.460 1.00 0.00 ? 95  GLY A CA   3  
ATOM   7599  C  C    . GLY A 1 95  ? 0.623   22.511 21.489 1.00 0.00 ? 95  GLY A C    3  
ATOM   7600  O  O    . GLY A 1 95  ? 1.280   22.849 22.454 1.00 0.00 ? 95  GLY A O    3  
ATOM   7601  H  H    . GLY A 1 95  ? -1.795  20.835 20.934 1.00 0.00 ? 95  GLY A H    3  
ATOM   7602  H  HA2  . GLY A 1 95  ? -1.175  23.130 20.498 1.00 0.00 ? 95  GLY A HA2  3  
ATOM   7603  H  HA3  . GLY A 1 95  ? -1.168  23.428 22.233 1.00 0.00 ? 95  GLY A HA3  3  
ATOM   7604  N  N    . LYS A 1 96  ? 1.151   21.958 20.428 1.00 0.00 ? 96  LYS A N    3  
ATOM   7605  C  CA   . LYS A 1 96  ? 2.618   21.722 20.388 1.00 0.00 ? 96  LYS A CA   3  
ATOM   7606  C  C    . LYS A 1 96  ? 3.363   23.014 20.698 1.00 0.00 ? 96  LYS A C    3  
ATOM   7607  O  O    . LYS A 1 96  ? 4.492   22.990 21.152 1.00 0.00 ? 96  LYS A O    3  
ATOM   7608  C  CB   . LYS A 1 96  ? 3.015   21.248 18.973 1.00 0.00 ? 96  LYS A CB   3  
ATOM   7609  C  CG   . LYS A 1 96  ? 1.981   20.237 18.449 1.00 0.00 ? 96  LYS A CG   3  
ATOM   7610  C  CD   . LYS A 1 96  ? 1.999   18.983 19.330 1.00 0.00 ? 96  LYS A CD   3  
ATOM   7611  C  CE   . LYS A 1 96  ? 3.375   18.321 19.235 1.00 0.00 ? 96  LYS A CE   3  
ATOM   7612  N  NZ   . LYS A 1 96  ? 3.237   16.839 19.139 1.00 0.00 ? 96  LYS A NZ   3  
ATOM   7613  H  H    . LYS A 1 96  ? 0.587   21.709 19.670 1.00 0.00 ? 96  LYS A H    3  
ATOM   7614  H  HA   . LYS A 1 96  ? 2.879   20.976 21.137 1.00 0.00 ? 96  LYS A HA   3  
ATOM   7615  H  HB2  . LYS A 1 96  ? 3.058   22.097 18.306 1.00 0.00 ? 96  LYS A HB2  3  
ATOM   7616  H  HB3  . LYS A 1 96  ? 3.989   20.782 19.009 1.00 0.00 ? 96  LYS A HB3  3  
ATOM   7617  H  HG2  . LYS A 1 96  ? 0.999   20.678 18.467 1.00 0.00 ? 96  LYS A HG2  3  
ATOM   7618  H  HG3  . LYS A 1 96  ? 2.225   19.965 17.432 1.00 0.00 ? 96  LYS A HG3  3  
ATOM   7619  H  HD2  . LYS A 1 96  ? 1.794   19.254 20.353 1.00 0.00 ? 96  LYS A HD2  3  
ATOM   7620  H  HD3  . LYS A 1 96  ? 1.241   18.292 18.990 1.00 0.00 ? 96  LYS A HD3  3  
ATOM   7621  H  HE2  . LYS A 1 96  ? 3.893   18.683 18.359 1.00 0.00 ? 96  LYS A HE2  3  
ATOM   7622  H  HE3  . LYS A 1 96  ? 3.954   18.564 20.114 1.00 0.00 ? 96  LYS A HE3  3  
ATOM   7623  H  HZ1  . LYS A 1 96  ? 2.257   16.567 19.355 1.00 0.00 ? 96  LYS A HZ1  3  
ATOM   7624  H  HZ2  . LYS A 1 96  ? 3.477   16.531 18.175 1.00 0.00 ? 96  LYS A HZ2  3  
ATOM   7625  H  HZ3  . LYS A 1 96  ? 3.880   16.385 19.818 1.00 0.00 ? 96  LYS A HZ3  3  
ATOM   7626  N  N    . THR A 1 97  ? 2.709   24.121 20.443 1.00 0.00 ? 97  THR A N    3  
ATOM   7627  C  CA   . THR A 1 97  ? 3.340   25.439 20.708 1.00 0.00 ? 97  THR A CA   3  
ATOM   7628  C  C    . THR A 1 97  ? 2.360   26.356 21.436 1.00 0.00 ? 97  THR A C    3  
ATOM   7629  O  O    . THR A 1 97  ? 2.336   26.394 22.645 1.00 0.00 ? 97  THR A O    3  
ATOM   7630  C  CB   . THR A 1 97  ? 3.709   26.076 19.362 1.00 0.00 ? 97  THR A CB   3  
ATOM   7631  O  OG1  . THR A 1 97  ? 2.551   25.957 18.563 1.00 0.00 ? 97  THR A OG1  3  
ATOM   7632  C  CG2  . THR A 1 97  ? 4.772   25.239 18.628 1.00 0.00 ? 97  THR A CG2  3  
ATOM   7633  H  H    . THR A 1 97  ? 1.800   24.079 20.078 1.00 0.00 ? 97  THR A H    3  
ATOM   7634  H  HA   . THR A 1 97  ? 4.223   25.300 21.329 1.00 0.00 ? 97  THR A HA   3  
ATOM   7635  H  HB   . THR A 1 97  ? 3.997   27.119 19.474 1.00 0.00 ? 97  THR A HB   3  
ATOM   7636  H  HG1  . THR A 1 97  ? 2.793   25.489 17.761 1.00 0.00 ? 97  THR A HG1  3  
ATOM   7637  H  HG21 . THR A 1 97  ? 4.762   24.226 19.003 1.00 0.00 ? 97  THR A HG21 3  
ATOM   7638  H  HG22 . THR A 1 97  ? 4.560   25.228 17.568 1.00 0.00 ? 97  THR A HG22 3  
ATOM   7639  H  HG23 . THR A 1 97  ? 5.750   25.668 18.790 1.00 0.00 ? 97  THR A HG23 3  
ATOM   7640  N  N    . ASN A 1 98  ? 1.567   27.074 20.670 1.00 0.00 ? 98  ASN A N    3  
ATOM   7641  C  CA   . ASN A 1 98  ? 0.565   28.008 21.279 1.00 0.00 ? 98  ASN A CA   3  
ATOM   7642  C  C    . ASN A 1 98  ? 1.063   28.615 22.590 1.00 0.00 ? 98  ASN A C    3  
ATOM   7643  O  O    . ASN A 1 98  ? 0.470   28.421 23.634 1.00 0.00 ? 98  ASN A O    3  
ATOM   7644  C  CB   . ASN A 1 98  ? -0.722  27.220 21.559 1.00 0.00 ? 98  ASN A CB   3  
ATOM   7645  C  CG   . ASN A 1 98  ? -1.492  27.028 20.252 1.00 0.00 ? 98  ASN A CG   3  
ATOM   7646  O  OD1  . ASN A 1 98  ? -2.117  27.939 19.746 1.00 0.00 ? 98  ASN A OD1  3  
ATOM   7647  N  ND2  . ASN A 1 98  ? -1.472  25.859 19.671 1.00 0.00 ? 98  ASN A ND2  3  
ATOM   7648  H  H    . ASN A 1 98  ? 1.633   26.997 19.694 1.00 0.00 ? 98  ASN A H    3  
ATOM   7649  H  HA   . ASN A 1 98  ? 0.370   28.816 20.574 1.00 0.00 ? 98  ASN A HA   3  
ATOM   7650  H  HB2  . ASN A 1 98  ? -0.478  26.253 21.974 1.00 0.00 ? 98  ASN A HB2  3  
ATOM   7651  H  HB3  . ASN A 1 98  ? -1.340  27.763 22.260 1.00 0.00 ? 98  ASN A HB3  3  
ATOM   7652  H  HD21 . ASN A 1 98  ? -0.970  25.121 20.075 1.00 0.00 ? 98  ASN A HD21 3  
ATOM   7653  H  HD22 . ASN A 1 98  ? -1.959  25.721 18.833 1.00 0.00 ? 98  ASN A HD22 3  
ATOM   7654  N  N    . GLN A 1 99  ? 2.144   29.339 22.510 1.00 0.00 ? 99  GLN A N    3  
ATOM   7655  C  CA   . GLN A 1 99  ? 2.700   29.970 23.734 1.00 0.00 ? 99  GLN A CA   3  
ATOM   7656  C  C    . GLN A 1 99  ? 2.737   28.991 24.911 1.00 0.00 ? 99  GLN A C    3  
ATOM   7657  O  O    . GLN A 1 99  ? 2.685   29.395 26.056 1.00 0.00 ? 99  GLN A O    3  
ATOM   7658  C  CB   . GLN A 1 99  ? 1.803   31.162 24.105 1.00 0.00 ? 99  GLN A CB   3  
ATOM   7659  C  CG   . GLN A 1 99  ? 1.592   32.036 22.864 1.00 0.00 ? 99  GLN A CG   3  
ATOM   7660  C  CD   . GLN A 1 99  ? 0.574   31.364 21.936 1.00 0.00 ? 99  GLN A CD   3  
ATOM   7661  O  OE1  . GLN A 1 99  ? -0.410  30.805 22.378 1.00 0.00 ? 99  GLN A OE1  3  
ATOM   7662  N  NE2  . GLN A 1 99  ? 0.773   31.397 20.646 1.00 0.00 ? 99  GLN A NE2  3  
ATOM   7663  H  H    . GLN A 1 99  ? 2.587   29.467 21.646 1.00 0.00 ? 99  GLN A H    3  
ATOM   7664  H  HA   . GLN A 1 99  ? 3.715   30.307 23.524 1.00 0.00 ? 99  GLN A HA   3  
ATOM   7665  H  HB2  . GLN A 1 99  ? 0.849   30.801 24.462 1.00 0.00 ? 99  GLN A HB2  3  
ATOM   7666  H  HB3  . GLN A 1 99  ? 2.275   31.743 24.882 1.00 0.00 ? 99  GLN A HB3  3  
ATOM   7667  H  HG2  . GLN A 1 99  ? 1.220   33.006 23.158 1.00 0.00 ? 99  GLN A HG2  3  
ATOM   7668  H  HG3  . GLN A 1 99  ? 2.528   32.157 22.339 1.00 0.00 ? 99  GLN A HG3  3  
ATOM   7669  H  HE21 . GLN A 1 99  ? 1.566   31.845 20.283 1.00 0.00 ? 99  GLN A HE21 3  
ATOM   7670  H  HE22 . GLN A 1 99  ? 0.129   30.974 20.039 1.00 0.00 ? 99  GLN A HE22 3  
ATOM   7671  N  N    . LYS A 1 100 ? 2.826   27.720 24.609 1.00 0.00 ? 100 LYS A N    3  
ATOM   7672  C  CA   . LYS A 1 100 ? 2.868   26.707 25.704 1.00 0.00 ? 100 LYS A CA   3  
ATOM   7673  C  C    . LYS A 1 100 ? 4.253   26.689 26.353 1.00 0.00 ? 100 LYS A C    3  
ATOM   7674  O  O    . LYS A 1 100 ? 4.483   25.995 27.324 1.00 0.00 ? 100 LYS A O    3  
ATOM   7675  C  CB   . LYS A 1 100 ? 2.580   25.319 25.089 1.00 0.00 ? 100 LYS A CB   3  
ATOM   7676  C  CG   . LYS A 1 100 ? 2.588   24.253 26.198 1.00 0.00 ? 100 LYS A CG   3  
ATOM   7677  C  CD   . LYS A 1 100 ? 1.878   22.989 25.697 1.00 0.00 ? 100 LYS A CD   3  
ATOM   7678  C  CE   . LYS A 1 100 ? 2.895   22.097 24.983 1.00 0.00 ? 100 LYS A CE   3  
ATOM   7679  N  NZ   . LYS A 1 100 ? 3.727   21.363 25.975 1.00 0.00 ? 100 LYS A NZ   3  
ATOM   7680  H  H    . LYS A 1 100 ? 2.865   27.437 23.672 1.00 0.00 ? 100 LYS A H    3  
ATOM   7681  H  HA   . LYS A 1 100 ? 2.119   26.963 26.460 1.00 0.00 ? 100 LYS A HA   3  
ATOM   7682  H  HB2  . LYS A 1 100 ? 1.613   25.333 24.611 1.00 0.00 ? 100 LYS A HB2  3  
ATOM   7683  H  HB3  . LYS A 1 100 ? 3.336   25.084 24.354 1.00 0.00 ? 100 LYS A HB3  3  
ATOM   7684  H  HG2  . LYS A 1 100 ? 3.607   24.010 26.459 1.00 0.00 ? 100 LYS A HG2  3  
ATOM   7685  H  HG3  . LYS A 1 100 ? 2.080   24.633 27.070 1.00 0.00 ? 100 LYS A HG3  3  
ATOM   7686  H  HD2  . LYS A 1 100 ? 1.454   22.455 26.535 1.00 0.00 ? 100 LYS A HD2  3  
ATOM   7687  H  HD3  . LYS A 1 100 ? 1.088   23.259 25.013 1.00 0.00 ? 100 LYS A HD3  3  
ATOM   7688  H  HE2  . LYS A 1 100 ? 2.378   21.384 24.358 1.00 0.00 ? 100 LYS A HE2  3  
ATOM   7689  H  HE3  . LYS A 1 100 ? 3.539   22.706 24.366 1.00 0.00 ? 100 LYS A HE3  3  
ATOM   7690  H  HZ1  . LYS A 1 100 ? 3.486   21.685 26.935 1.00 0.00 ? 100 LYS A HZ1  3  
ATOM   7691  H  HZ2  . LYS A 1 100 ? 3.542   20.342 25.896 1.00 0.00 ? 100 LYS A HZ2  3  
ATOM   7692  H  HZ3  . LYS A 1 100 ? 4.733   21.548 25.791 1.00 0.00 ? 100 LYS A HZ3  3  
ATOM   7693  N  N    . LEU A 1 101 ? 5.150   27.469 25.802 1.00 0.00 ? 101 LEU A N    3  
ATOM   7694  C  CA   . LEU A 1 101 ? 6.525   27.519 26.362 1.00 0.00 ? 101 LEU A CA   3  
ATOM   7695  C  C    . LEU A 1 101 ? 6.515   27.979 27.815 1.00 0.00 ? 101 LEU A C    3  
ATOM   7696  O  O    . LEU A 1 101 ? 6.704   27.191 28.716 1.00 0.00 ? 101 LEU A O    3  
ATOM   7697  C  CB   . LEU A 1 101 ? 7.347   28.524 25.534 1.00 0.00 ? 101 LEU A CB   3  
ATOM   7698  C  CG   . LEU A 1 101 ? 8.760   27.968 25.293 1.00 0.00 ? 101 LEU A CG   3  
ATOM   7699  C  CD1  . LEU A 1 101 ? 9.408   27.599 26.637 1.00 0.00 ? 101 LEU A CD1  3  
ATOM   7700  C  CD2  . LEU A 1 101 ? 8.667   26.720 24.403 1.00 0.00 ? 101 LEU A CD2  3  
ATOM   7701  H  H    . LEU A 1 101 ? 4.915   28.016 25.025 1.00 0.00 ? 101 LEU A H    3  
ATOM   7702  H  HA   . LEU A 1 101 ? 6.960   26.525 26.309 1.00 0.00 ? 101 LEU A HA   3  
ATOM   7703  H  HB2  . LEU A 1 101 ? 6.860   28.694 24.586 1.00 0.00 ? 101 LEU A HB2  3  
ATOM   7704  H  HB3  . LEU A 1 101 ? 7.415   29.462 26.066 1.00 0.00 ? 101 LEU A HB3  3  
ATOM   7705  H  HG   . LEU A 1 101 ? 9.362   28.717 24.800 1.00 0.00 ? 101 LEU A HG   3  
ATOM   7706  H  HD11 . LEU A 1 101 ? 9.192   28.366 27.368 1.00 0.00 ? 101 LEU A HD11 3  
ATOM   7707  H  HD12 . LEU A 1 101 ? 9.022   26.654 26.988 1.00 0.00 ? 101 LEU A HD12 3  
ATOM   7708  H  HD13 . LEU A 1 101 ? 10.480  27.519 26.514 1.00 0.00 ? 101 LEU A HD13 3  
ATOM   7709  H  HD21 . LEU A 1 101 ? 7.804   26.798 23.757 1.00 0.00 ? 101 LEU A HD21 3  
ATOM   7710  H  HD22 . LEU A 1 101 ? 9.558   26.638 23.797 1.00 0.00 ? 101 LEU A HD22 3  
ATOM   7711  H  HD23 . LEU A 1 101 ? 8.575   25.836 25.014 1.00 0.00 ? 101 LEU A HD23 3  
ATOM   7712  N  N    . GLU A 1 102 ? 6.299   29.251 28.014 1.00 0.00 ? 102 GLU A N    3  
ATOM   7713  C  CA   . GLU A 1 102 ? 6.274   29.781 29.404 1.00 0.00 ? 102 GLU A CA   3  
ATOM   7714  C  C    . GLU A 1 102 ? 5.516   28.844 30.338 1.00 0.00 ? 102 GLU A C    3  
ATOM   7715  O  O    . GLU A 1 102 ? 5.865   28.700 31.492 1.00 0.00 ? 102 GLU A O    3  
ATOM   7716  C  CB   . GLU A 1 102 ? 5.566   31.147 29.396 1.00 0.00 ? 102 GLU A CB   3  
ATOM   7717  C  CG   . GLU A 1 102 ? 4.220   31.017 28.681 1.00 0.00 ? 102 GLU A CG   3  
ATOM   7718  C  CD   . GLU A 1 102 ? 3.110   30.864 29.721 1.00 0.00 ? 102 GLU A CD   3  
ATOM   7719  O  OE1  . GLU A 1 102 ? 3.043   31.736 30.572 1.00 0.00 ? 102 GLU A OE1  3  
ATOM   7720  O  OE2  . GLU A 1 102 ? 2.392   29.885 29.607 1.00 0.00 ? 102 GLU A OE2  3  
ATOM   7721  H  H    . GLU A 1 102 ? 6.158   29.853 27.254 1.00 0.00 ? 102 GLU A H    3  
ATOM   7722  H  HA   . GLU A 1 102 ? 7.298   29.881 29.761 1.00 0.00 ? 102 GLU A HA   3  
ATOM   7723  H  HB2  . GLU A 1 102 ? 5.405   31.477 30.411 1.00 0.00 ? 102 GLU A HB2  3  
ATOM   7724  H  HB3  . GLU A 1 102 ? 6.181   31.872 28.882 1.00 0.00 ? 102 GLU A HB3  3  
ATOM   7725  H  HG2  . GLU A 1 102 ? 4.034   31.900 28.086 1.00 0.00 ? 102 GLU A HG2  3  
ATOM   7726  H  HG3  . GLU A 1 102 ? 4.228   30.149 28.038 1.00 0.00 ? 102 GLU A HG3  3  
ATOM   7727  N  N    . TRP A 1 103 ? 4.493   28.224 29.822 1.00 0.00 ? 103 TRP A N    3  
ATOM   7728  C  CA   . TRP A 1 103 ? 3.703   27.294 30.666 1.00 0.00 ? 103 TRP A CA   3  
ATOM   7729  C  C    . TRP A 1 103 ? 4.550   26.108 31.118 1.00 0.00 ? 103 TRP A C    3  
ATOM   7730  O  O    . TRP A 1 103 ? 4.253   25.470 32.109 1.00 0.00 ? 103 TRP A O    3  
ATOM   7731  C  CB   . TRP A 1 103 ? 2.536   26.764 29.827 1.00 0.00 ? 103 TRP A CB   3  
ATOM   7732  C  CG   . TRP A 1 103 ? 1.551   26.040 30.743 1.00 0.00 ? 103 TRP A CG   3  
ATOM   7733  C  CD1  . TRP A 1 103 ? 0.481   26.601 31.285 1.00 0.00 ? 103 TRP A CD1  3  
ATOM   7734  C  CD2  . TRP A 1 103 ? 1.658   24.787 31.098 1.00 0.00 ? 103 TRP A CD2  3  
ATOM   7735  N  NE1  . TRP A 1 103 ? -0.069  25.604 32.004 1.00 0.00 ? 103 TRP A NE1  3  
ATOM   7736  C  CE2  . TRP A 1 103 ? 0.626   24.409 31.936 1.00 0.00 ? 103 TRP A CE2  3  
ATOM   7737  C  CE3  . TRP A 1 103 ? 2.631   23.875 30.746 1.00 0.00 ? 103 TRP A CE3  3  
ATOM   7738  C  CZ2  . TRP A 1 103 ? 0.570   23.119 32.421 1.00 0.00 ? 103 TRP A CZ2  3  
ATOM   7739  C  CZ3  . TRP A 1 103 ? 2.574   22.585 31.231 1.00 0.00 ? 103 TRP A CZ3  3  
ATOM   7740  C  CH2  . TRP A 1 103 ? 1.544   22.207 32.068 1.00 0.00 ? 103 TRP A CH2  3  
ATOM   7741  H  H    . TRP A 1 103 ? 4.246   28.371 28.885 1.00 0.00 ? 103 TRP A H    3  
ATOM   7742  H  HA   . TRP A 1 103 ? 3.338   27.828 31.542 1.00 0.00 ? 103 TRP A HA   3  
ATOM   7743  H  HB2  . TRP A 1 103 ? 2.033   27.583 29.336 1.00 0.00 ? 103 TRP A HB2  3  
ATOM   7744  H  HB3  . TRP A 1 103 ? 2.905   26.073 29.085 1.00 0.00 ? 103 TRP A HB3  3  
ATOM   7745  H  HD1  . TRP A 1 103 ? 0.132   27.618 31.176 1.00 0.00 ? 103 TRP A HD1  3  
ATOM   7746  H  HE1  . TRP A 1 103 ? -0.890  25.715 32.528 1.00 0.00 ? 103 TRP A HE1  3  
ATOM   7747  H  HE3  . TRP A 1 103 ? 3.436   24.170 30.090 1.00 0.00 ? 103 TRP A HE3  3  
ATOM   7748  H  HZ2  . TRP A 1 103 ? -0.237  22.822 33.073 1.00 0.00 ? 103 TRP A HZ2  3  
ATOM   7749  H  HZ3  . TRP A 1 103 ? 3.337   21.871 30.957 1.00 0.00 ? 103 TRP A HZ3  3  
ATOM   7750  H  HH2  . TRP A 1 103 ? 1.501   21.197 32.448 1.00 0.00 ? 103 TRP A HH2  3  
ATOM   7751  N  N    . ALA A 1 104 ? 5.593   25.837 30.383 1.00 0.00 ? 104 ALA A N    3  
ATOM   7752  C  CA   . ALA A 1 104 ? 6.473   24.699 30.751 1.00 0.00 ? 104 ALA A CA   3  
ATOM   7753  C  C    . ALA A 1 104 ? 7.217   24.972 32.051 1.00 0.00 ? 104 ALA A C    3  
ATOM   7754  O  O    . ALA A 1 104 ? 7.314   24.112 32.903 1.00 0.00 ? 104 ALA A O    3  
ATOM   7755  C  CB   . ALA A 1 104 ? 7.501   24.501 29.629 1.00 0.00 ? 104 ALA A CB   3  
ATOM   7756  H  H    . ALA A 1 104 ? 5.798   26.383 29.596 1.00 0.00 ? 104 ALA A H    3  
ATOM   7757  H  HA   . ALA A 1 104 ? 5.861   23.806 30.874 1.00 0.00 ? 104 ALA A HA   3  
ATOM   7758  H  HB1  . ALA A 1 104 ? 7.009   24.544 28.670 1.00 0.00 ? 104 ALA A HB1  3  
ATOM   7759  H  HB2  . ALA A 1 104 ? 8.246   25.278 29.681 1.00 0.00 ? 104 ALA A HB2  3  
ATOM   7760  H  HB3  . ALA A 1 104 ? 7.981   23.540 29.740 1.00 0.00 ? 104 ALA A HB3  3  
ATOM   7761  N  N    . PHE A 1 105 ? 7.734   26.164 32.183 1.00 0.00 ? 105 PHE A N    3  
ATOM   7762  C  CA   . PHE A 1 105 ? 8.471   26.495 33.426 1.00 0.00 ? 105 PHE A CA   3  
ATOM   7763  C  C    . PHE A 1 105 ? 7.679   26.059 34.652 1.00 0.00 ? 105 PHE A C    3  
ATOM   7764  O  O    . PHE A 1 105 ? 8.212   25.971 35.739 1.00 0.00 ? 105 PHE A O    3  
ATOM   7765  C  CB   . PHE A 1 105 ? 8.686   28.017 33.482 1.00 0.00 ? 105 PHE A CB   3  
ATOM   7766  C  CG   . PHE A 1 105 ? 9.824   28.335 34.466 1.00 0.00 ? 105 PHE A CG   3  
ATOM   7767  C  CD1  . PHE A 1 105 ? 11.096  27.813 34.270 1.00 0.00 ? 105 PHE A CD1  3  
ATOM   7768  C  CD2  . PHE A 1 105 ? 9.597   29.150 35.564 1.00 0.00 ? 105 PHE A CD2  3  
ATOM   7769  C  CE1  . PHE A 1 105 ? 12.119  28.104 35.158 1.00 0.00 ? 105 PHE A CE1  3  
ATOM   7770  C  CE2  . PHE A 1 105 ? 10.621  29.437 36.447 1.00 0.00 ? 105 PHE A CE2  3  
ATOM   7771  C  CZ   . PHE A 1 105 ? 11.880  28.916 36.245 1.00 0.00 ? 105 PHE A CZ   3  
ATOM   7772  H  H    . PHE A 1 105 ? 7.631   26.832 31.473 1.00 0.00 ? 105 PHE A H    3  
ATOM   7773  H  HA   . PHE A 1 105 ? 9.426   25.969 33.417 1.00 0.00 ? 105 PHE A HA   3  
ATOM   7774  H  HB2  . PHE A 1 105 ? 8.948   28.387 32.501 1.00 0.00 ? 105 PHE A HB2  3  
ATOM   7775  H  HB3  . PHE A 1 105 ? 7.781   28.501 33.815 1.00 0.00 ? 105 PHE A HB3  3  
ATOM   7776  H  HD1  . PHE A 1 105 ? 11.289  27.176 33.420 1.00 0.00 ? 105 PHE A HD1  3  
ATOM   7777  H  HD2  . PHE A 1 105 ? 8.612   29.557 35.737 1.00 0.00 ? 105 PHE A HD2  3  
ATOM   7778  H  HE1  . PHE A 1 105 ? 13.105  27.694 34.998 1.00 0.00 ? 105 PHE A HE1  3  
ATOM   7779  H  HE2  . PHE A 1 105 ? 10.434  30.076 37.292 1.00 0.00 ? 105 PHE A HE2  3  
ATOM   7780  H  HZ   . PHE A 1 105 ? 12.684  29.144 36.947 1.00 0.00 ? 105 PHE A HZ   3  
ATOM   7781  N  N    . SER A 1 106 ? 6.414   25.791 34.455 1.00 0.00 ? 106 SER A N    3  
ATOM   7782  C  CA   . SER A 1 106 ? 5.575   25.359 35.599 1.00 0.00 ? 106 SER A CA   3  
ATOM   7783  C  C    . SER A 1 106 ? 5.774   23.872 35.878 1.00 0.00 ? 106 SER A C    3  
ATOM   7784  O  O    . SER A 1 106 ? 5.992   23.468 37.005 1.00 0.00 ? 106 SER A O    3  
ATOM   7785  C  CB   . SER A 1 106 ? 4.099   25.604 35.235 1.00 0.00 ? 106 SER A CB   3  
ATOM   7786  O  OG   . SER A 1 106 ? 3.716   24.430 34.533 1.00 0.00 ? 106 SER A OG   3  
ATOM   7787  H  H    . SER A 1 106 ? 6.023   25.875 33.559 1.00 0.00 ? 106 SER A H    3  
ATOM   7788  H  HA   . SER A 1 106 ? 5.858   25.928 36.480 1.00 0.00 ? 106 SER A HA   3  
ATOM   7789  H  HB2  . SER A 1 106 ? 3.497   25.720 36.125 1.00 0.00 ? 106 SER A HB2  3  
ATOM   7790  H  HB3  . SER A 1 106 ? 3.999   26.470 34.596 1.00 0.00 ? 106 SER A HB3  3  
ATOM   7791  H  HG   . SER A 1 106 ? 3.614   23.722 35.173 1.00 0.00 ? 106 SER A HG   3  
ATOM   7792  N  N    . LEU A 1 107 ? 5.700   23.089 34.837 1.00 0.00 ? 107 LEU A N    3  
ATOM   7793  C  CA   . LEU A 1 107 ? 5.880   21.621 34.990 1.00 0.00 ? 107 LEU A CA   3  
ATOM   7794  C  C    . LEU A 1 107 ? 7.270   21.310 35.540 1.00 0.00 ? 107 LEU A C    3  
ATOM   7795  O  O    . LEU A 1 107 ? 7.411   20.601 36.518 1.00 0.00 ? 107 LEU A O    3  
ATOM   7796  C  CB   . LEU A 1 107 ? 5.726   20.991 33.586 1.00 0.00 ? 107 LEU A CB   3  
ATOM   7797  C  CG   . LEU A 1 107 ? 6.040   19.485 33.617 1.00 0.00 ? 107 LEU A CG   3  
ATOM   7798  C  CD1  . LEU A 1 107 ? 7.553   19.276 33.758 1.00 0.00 ? 107 LEU A CD1  3  
ATOM   7799  C  CD2  . LEU A 1 107 ? 5.310   18.830 34.793 1.00 0.00 ? 107 LEU A CD2  3  
ATOM   7800  H  H    . LEU A 1 107 ? 5.526   23.471 33.953 1.00 0.00 ? 107 LEU A H    3  
ATOM   7801  H  HA   . LEU A 1 107 ? 5.126   21.236 35.677 1.00 0.00 ? 107 LEU A HA   3  
ATOM   7802  H  HB2  . LEU A 1 107 ? 4.712   21.137 33.243 1.00 0.00 ? 107 LEU A HB2  3  
ATOM   7803  H  HB3  . LEU A 1 107 ? 6.398   21.481 32.903 1.00 0.00 ? 107 LEU A HB3  3  
ATOM   7804  H  HG   . LEU A 1 107 ? 5.704   19.033 32.695 1.00 0.00 ? 107 LEU A HG   3  
ATOM   7805  H  HD11 . LEU A 1 107 ? 8.076   20.167 33.445 1.00 0.00 ? 107 LEU A HD11 3  
ATOM   7806  H  HD12 . LEU A 1 107 ? 7.801   19.059 34.784 1.00 0.00 ? 107 LEU A HD12 3  
ATOM   7807  H  HD13 . LEU A 1 107 ? 7.863   18.449 33.136 1.00 0.00 ? 107 LEU A HD13 3  
ATOM   7808  H  HD21 . LEU A 1 107 ? 4.293   19.190 34.833 1.00 0.00 ? 107 LEU A HD21 3  
ATOM   7809  H  HD22 . LEU A 1 107 ? 5.303   17.757 34.662 1.00 0.00 ? 107 LEU A HD22 3  
ATOM   7810  H  HD23 . LEU A 1 107 ? 5.811   19.072 35.716 1.00 0.00 ? 107 LEU A HD23 3  
ATOM   7811  N  N    . TYR A 1 108 ? 8.271   21.857 34.906 1.00 0.00 ? 108 TYR A N    3  
ATOM   7812  C  CA   . TYR A 1 108 ? 9.657   21.608 35.373 1.00 0.00 ? 108 TYR A CA   3  
ATOM   7813  C  C    . TYR A 1 108 ? 9.867   22.162 36.781 1.00 0.00 ? 108 TYR A C    3  
ATOM   7814  O  O    . TYR A 1 108 ? 10.797  21.782 37.465 1.00 0.00 ? 108 TYR A O    3  
ATOM   7815  C  CB   . TYR A 1 108 ? 10.626  22.319 34.414 1.00 0.00 ? 108 TYR A CB   3  
ATOM   7816  C  CG   . TYR A 1 108 ? 10.684  21.561 33.082 1.00 0.00 ? 108 TYR A CG   3  
ATOM   7817  C  CD1  . TYR A 1 108 ? 11.531  20.481 32.924 1.00 0.00 ? 108 TYR A CD1  3  
ATOM   7818  C  CD2  . TYR A 1 108 ? 9.896   21.954 32.018 1.00 0.00 ? 108 TYR A CD2  3  
ATOM   7819  C  CE1  . TYR A 1 108 ? 11.590  19.807 31.719 1.00 0.00 ? 108 TYR A CE1  3  
ATOM   7820  C  CE2  . TYR A 1 108 ? 9.956   21.280 30.815 1.00 0.00 ? 108 TYR A CE2  3  
ATOM   7821  C  CZ   . TYR A 1 108 ? 10.803  20.201 30.655 1.00 0.00 ? 108 TYR A CZ   3  
ATOM   7822  O  OH   . TYR A 1 108 ? 10.859  19.525 29.451 1.00 0.00 ? 108 TYR A OH   3  
ATOM   7823  H  H    . TYR A 1 108 ? 8.109   22.425 34.125 1.00 0.00 ? 108 TYR A H    3  
ATOM   7824  H  HA   . TYR A 1 108 ? 9.841   20.533 35.382 1.00 0.00 ? 108 TYR A HA   3  
ATOM   7825  H  HB2  . TYR A 1 108 ? 10.284  23.329 34.233 1.00 0.00 ? 108 TYR A HB2  3  
ATOM   7826  H  HB3  . TYR A 1 108 ? 11.614  22.352 34.848 1.00 0.00 ? 108 TYR A HB3  3  
ATOM   7827  H  HD1  . TYR A 1 108 ? 12.151  20.160 33.749 1.00 0.00 ? 108 TYR A HD1  3  
ATOM   7828  H  HD2  . TYR A 1 108 ? 9.230   22.796 32.129 1.00 0.00 ? 108 TYR A HD2  3  
ATOM   7829  H  HE1  . TYR A 1 108 ? 12.259  18.966 31.608 1.00 0.00 ? 108 TYR A HE1  3  
ATOM   7830  H  HE2  . TYR A 1 108 ? 9.336   21.601 29.991 1.00 0.00 ? 108 TYR A HE2  3  
ATOM   7831  H  HH   . TYR A 1 108 ? 10.756  20.167 28.746 1.00 0.00 ? 108 TYR A HH   3  
ATOM   7832  N  N    . ASP A 1 109 ? 8.997   23.051 37.191 1.00 0.00 ? 109 ASP A N    3  
ATOM   7833  C  CA   . ASP A 1 109 ? 9.139   23.633 38.550 1.00 0.00 ? 109 ASP A CA   3  
ATOM   7834  C  C    . ASP A 1 109 ? 8.449   22.750 39.577 1.00 0.00 ? 109 ASP A C    3  
ATOM   7835  O  O    . ASP A 1 109 ? 7.499   23.156 40.216 1.00 0.00 ? 109 ASP A O    3  
ATOM   7836  C  CB   . ASP A 1 109 ? 8.484   25.025 38.561 1.00 0.00 ? 109 ASP A CB   3  
ATOM   7837  C  CG   . ASP A 1 109 ? 8.469   25.569 39.994 1.00 0.00 ? 109 ASP A CG   3  
ATOM   7838  O  OD1  . ASP A 1 109 ? 9.555   25.703 40.536 1.00 0.00 ? 109 ASP A OD1  3  
ATOM   7839  O  OD2  . ASP A 1 109 ? 7.372   25.822 40.467 1.00 0.00 ? 109 ASP A OD2  3  
ATOM   7840  H  H    . ASP A 1 109 ? 8.256   23.323 36.613 1.00 0.00 ? 109 ASP A H    3  
ATOM   7841  H  HA   . ASP A 1 109 ? 10.200  23.700 38.795 1.00 0.00 ? 109 ASP A HA   3  
ATOM   7842  H  HB2  . ASP A 1 109 ? 9.046   25.699 37.931 1.00 0.00 ? 109 ASP A HB2  3  
ATOM   7843  H  HB3  . ASP A 1 109 ? 7.471   24.955 38.196 1.00 0.00 ? 109 ASP A HB3  3  
ATOM   7844  N  N    . VAL A 1 110 ? 8.941   21.554 39.708 1.00 0.00 ? 110 VAL A N    3  
ATOM   7845  C  CA   . VAL A 1 110 ? 8.339   20.612 40.684 1.00 0.00 ? 110 VAL A CA   3  
ATOM   7846  C  C    . VAL A 1 110 ? 8.306   21.205 42.090 1.00 0.00 ? 110 VAL A C    3  
ATOM   7847  O  O    . VAL A 1 110 ? 7.444   20.876 42.879 1.00 0.00 ? 110 VAL A O    3  
ATOM   7848  C  CB   . VAL A 1 110 ? 9.197   19.342 40.710 1.00 0.00 ? 110 VAL A CB   3  
ATOM   7849  C  CG1  . VAL A 1 110 ? 8.557   18.325 41.654 1.00 0.00 ? 110 VAL A CG1  3  
ATOM   7850  C  CG2  . VAL A 1 110 ? 9.263   18.751 39.302 1.00 0.00 ? 110 VAL A CG2  3  
ATOM   7851  H  H    . VAL A 1 110 ? 9.702   21.274 39.159 1.00 0.00 ? 110 VAL A H    3  
ATOM   7852  H  HA   . VAL A 1 110 ? 7.321   20.383 40.373 1.00 0.00 ? 110 VAL A HA   3  
ATOM   7853  H  HB   . VAL A 1 110 ? 10.193  19.581 41.052 1.00 0.00 ? 110 VAL A HB   3  
ATOM   7854  H  HG11 . VAL A 1 110 ? 7.528   18.161 41.371 1.00 0.00 ? 110 VAL A HG11 3  
ATOM   7855  H  HG12 . VAL A 1 110 ? 9.093   17.390 41.599 1.00 0.00 ? 110 VAL A HG12 3  
ATOM   7856  H  HG13 . VAL A 1 110 ? 8.591   18.696 42.667 1.00 0.00 ? 110 VAL A HG13 3  
ATOM   7857  H  HG21 . VAL A 1 110 ? 9.547   19.519 38.598 1.00 0.00 ? 110 VAL A HG21 3  
ATOM   7858  H  HG22 . VAL A 1 110 ? 9.991   17.955 39.274 1.00 0.00 ? 110 VAL A HG22 3  
ATOM   7859  H  HG23 . VAL A 1 110 ? 8.295   18.358 39.025 1.00 0.00 ? 110 VAL A HG23 3  
ATOM   7860  N  N    . ASP A 1 111 ? 9.244   22.070 42.381 1.00 0.00 ? 111 ASP A N    3  
ATOM   7861  C  CA   . ASP A 1 111 ? 9.273   22.685 43.731 1.00 0.00 ? 111 ASP A CA   3  
ATOM   7862  C  C    . ASP A 1 111 ? 8.574   24.034 43.725 1.00 0.00 ? 111 ASP A C    3  
ATOM   7863  O  O    . ASP A 1 111 ? 7.405   24.131 44.048 1.00 0.00 ? 111 ASP A O    3  
ATOM   7864  C  CB   . ASP A 1 111 ? 10.740  22.893 44.137 1.00 0.00 ? 111 ASP A CB   3  
ATOM   7865  C  CG   . ASP A 1 111 ? 11.557  23.289 42.907 1.00 0.00 ? 111 ASP A CG   3  
ATOM   7866  O  OD1  . ASP A 1 111 ? 10.926  23.697 41.946 1.00 0.00 ? 111 ASP A OD1  3  
ATOM   7867  O  OD2  . ASP A 1 111 ? 12.767  23.164 42.998 1.00 0.00 ? 111 ASP A OD2  3  
ATOM   7868  H  H    . ASP A 1 111 ? 9.916   22.317 41.712 1.00 0.00 ? 111 ASP A H    3  
ATOM   7869  H  HA   . ASP A 1 111 ? 8.766   22.026 44.436 1.00 0.00 ? 111 ASP A HA   3  
ATOM   7870  H  HB2  . ASP A 1 111 ? 10.807  23.676 44.877 1.00 0.00 ? 111 ASP A HB2  3  
ATOM   7871  H  HB3  . ASP A 1 111 ? 11.137  21.977 44.549 1.00 0.00 ? 111 ASP A HB3  3  
ATOM   7872  N  N    . GLY A 1 112 ? 9.303   25.051 43.355 1.00 0.00 ? 112 GLY A N    3  
ATOM   7873  C  CA   . GLY A 1 112 ? 8.701   26.415 43.320 1.00 0.00 ? 112 GLY A CA   3  
ATOM   7874  C  C    . GLY A 1 112 ? 9.690   27.458 43.848 1.00 0.00 ? 112 GLY A C    3  
ATOM   7875  O  O    . GLY A 1 112 ? 9.561   27.930 44.960 1.00 0.00 ? 112 GLY A O    3  
ATOM   7876  H  H    . GLY A 1 112 ? 10.241  24.918 43.098 1.00 0.00 ? 112 GLY A H    3  
ATOM   7877  H  HA2  . GLY A 1 112 ? 8.434   26.660 42.302 1.00 0.00 ? 112 GLY A HA2  3  
ATOM   7878  H  HA3  . GLY A 1 112 ? 7.812   26.430 43.932 1.00 0.00 ? 112 GLY A HA3  3  
ATOM   7879  N  N    . ASN A 1 113 ? 10.661  27.796 43.040 1.00 0.00 ? 113 ASN A N    3  
ATOM   7880  C  CA   . ASN A 1 113 ? 11.661  28.804 43.481 1.00 0.00 ? 113 ASN A CA   3  
ATOM   7881  C  C    . ASN A 1 113 ? 12.130  29.643 42.302 1.00 0.00 ? 113 ASN A C    3  
ATOM   7882  O  O    . ASN A 1 113 ? 13.230  30.160 42.299 1.00 0.00 ? 113 ASN A O    3  
ATOM   7883  C  CB   . ASN A 1 113 ? 12.869  28.069 44.080 1.00 0.00 ? 113 ASN A CB   3  
ATOM   7884  C  CG   . ASN A 1 113 ? 13.326  26.977 43.114 1.00 0.00 ? 113 ASN A CG   3  
ATOM   7885  O  OD1  . ASN A 1 113 ? 12.645  26.650 42.163 1.00 0.00 ? 113 ASN A OD1  3  
ATOM   7886  N  ND2  . ASN A 1 113 ? 14.471  26.391 43.320 1.00 0.00 ? 113 ASN A ND2  3  
ATOM   7887  H  H    . ASN A 1 113 ? 10.730  27.386 42.151 1.00 0.00 ? 113 ASN A H    3  
ATOM   7888  H  HA   . ASN A 1 113 ? 11.201  29.459 44.217 1.00 0.00 ? 113 ASN A HA   3  
ATOM   7889  H  HB2  . ASN A 1 113 ? 13.679  28.766 44.240 1.00 0.00 ? 113 ASN A HB2  3  
ATOM   7890  H  HB3  . ASN A 1 113 ? 12.594  27.620 45.022 1.00 0.00 ? 113 ASN A HB3  3  
ATOM   7891  H  HD21 . ASN A 1 113 ? 15.025  26.650 44.085 1.00 0.00 ? 113 ASN A HD21 3  
ATOM   7892  H  HD22 . ASN A 1 113 ? 14.779  25.692 42.708 1.00 0.00 ? 113 ASN A HD22 3  
ATOM   7893  N  N    . GLY A 1 114 ? 11.282  29.762 41.323 1.00 0.00 ? 114 GLY A N    3  
ATOM   7894  C  CA   . GLY A 1 114 ? 11.646  30.566 40.121 1.00 0.00 ? 114 GLY A CA   3  
ATOM   7895  C  C    . GLY A 1 114 ? 12.993  30.110 39.545 1.00 0.00 ? 114 GLY A C    3  
ATOM   7896  O  O    . GLY A 1 114 ? 13.623  30.832 38.797 1.00 0.00 ? 114 GLY A O    3  
ATOM   7897  H  H    . GLY A 1 114 ? 10.406  29.328 41.376 1.00 0.00 ? 114 GLY A H    3  
ATOM   7898  H  HA2  . GLY A 1 114 ? 10.882  30.448 39.375 1.00 0.00 ? 114 GLY A HA2  3  
ATOM   7899  H  HA3  . GLY A 1 114 ? 11.713  31.609 40.397 1.00 0.00 ? 114 GLY A HA3  3  
ATOM   7900  N  N    . THR A 1 115 ? 13.405  28.924 39.902 1.00 0.00 ? 115 THR A N    3  
ATOM   7901  C  CA   . THR A 1 115 ? 14.701  28.422 39.381 1.00 0.00 ? 115 THR A CA   3  
ATOM   7902  C  C    . THR A 1 115 ? 14.714  26.899 39.279 1.00 0.00 ? 115 THR A C    3  
ATOM   7903  O  O    . THR A 1 115 ? 14.325  26.210 40.203 1.00 0.00 ? 115 THR A O    3  
ATOM   7904  C  CB   . THR A 1 115 ? 15.793  28.857 40.348 1.00 0.00 ? 115 THR A CB   3  
ATOM   7905  O  OG1  . THR A 1 115 ? 15.215  28.758 41.635 1.00 0.00 ? 115 THR A OG1  3  
ATOM   7906  C  CG2  . THR A 1 115 ? 16.096  30.347 40.170 1.00 0.00 ? 115 THR A CG2  3  
ATOM   7907  H  H    . THR A 1 115 ? 12.867  28.374 40.500 1.00 0.00 ? 115 THR A H    3  
ATOM   7908  H  HA   . THR A 1 115 ? 14.876  28.845 38.393 1.00 0.00 ? 115 THR A HA   3  
ATOM   7909  H  HB   . THR A 1 115 ? 16.678  28.231 40.270 1.00 0.00 ? 115 THR A HB   3  
ATOM   7910  H  HG1  . THR A 1 115 ? 14.500  28.119 41.590 1.00 0.00 ? 115 THR A HG1  3  
ATOM   7911  H  HG21 . THR A 1 115 ? 16.194  30.576 39.119 1.00 0.00 ? 115 THR A HG21 3  
ATOM   7912  H  HG22 . THR A 1 115 ? 15.292  30.935 40.588 1.00 0.00 ? 115 THR A HG22 3  
ATOM   7913  H  HG23 . THR A 1 115 ? 17.015  30.596 40.674 1.00 0.00 ? 115 THR A HG23 3  
ATOM   7914  N  N    . ILE A 1 116 ? 15.162  26.405 38.149 1.00 0.00 ? 116 ILE A N    3  
ATOM   7915  C  CA   . ILE A 1 116 ? 15.216  24.930 37.956 1.00 0.00 ? 116 ILE A CA   3  
ATOM   7916  C  C    . ILE A 1 116 ? 16.649  24.438 38.112 1.00 0.00 ? 116 ILE A C    3  
ATOM   7917  O  O    . ILE A 1 116 ? 17.541  24.911 37.439 1.00 0.00 ? 116 ILE A O    3  
ATOM   7918  C  CB   . ILE A 1 116 ? 14.736  24.608 36.539 1.00 0.00 ? 116 ILE A CB   3  
ATOM   7919  C  CG1  . ILE A 1 116 ? 13.303  25.082 36.361 1.00 0.00 ? 116 ILE A CG1  3  
ATOM   7920  C  CG2  . ILE A 1 116 ? 14.775  23.081 36.335 1.00 0.00 ? 116 ILE A CG2  3  
ATOM   7921  C  CD1  . ILE A 1 116 ? 12.856  24.803 34.925 1.00 0.00 ? 116 ILE A CD1  3  
ATOM   7922  H  H    . ILE A 1 116 ? 15.458  27.006 37.433 1.00 0.00 ? 116 ILE A H    3  
ATOM   7923  H  HA   . ILE A 1 116 ? 14.588  24.443 38.701 1.00 0.00 ? 116 ILE A HA   3  
ATOM   7924  H  HB   . ILE A 1 116 ? 15.375  25.112 35.819 1.00 0.00 ? 116 ILE A HB   3  
ATOM   7925  H  HG12 . ILE A 1 116 ? 12.660  24.557 37.051 1.00 0.00 ? 116 ILE A HG12 3  
ATOM   7926  H  HG13 . ILE A 1 116 ? 13.245  26.143 36.559 1.00 0.00 ? 116 ILE A HG13 3  
ATOM   7927  H  HG21 . ILE A 1 116 ? 15.388  22.625 37.095 1.00 0.00 ? 116 ILE A HG21 3  
ATOM   7928  H  HG22 . ILE A 1 116 ? 13.774  22.680 36.399 1.00 0.00 ? 116 ILE A HG22 3  
ATOM   7929  H  HG23 . ILE A 1 116 ? 15.186  22.855 35.363 1.00 0.00 ? 116 ILE A HG23 3  
ATOM   7930  H  HD11 . ILE A 1 116 ? 13.222  23.839 34.609 1.00 0.00 ? 116 ILE A HD11 3  
ATOM   7931  H  HD12 . ILE A 1 116 ? 11.779  24.810 34.872 1.00 0.00 ? 116 ILE A HD12 3  
ATOM   7932  H  HD13 . ILE A 1 116 ? 13.248  25.563 34.270 1.00 0.00 ? 116 ILE A HD13 3  
ATOM   7933  N  N    . SER A 1 117 ? 16.840  23.497 39.002 1.00 0.00 ? 117 SER A N    3  
ATOM   7934  C  CA   . SER A 1 117 ? 18.207  22.955 39.224 1.00 0.00 ? 117 SER A CA   3  
ATOM   7935  C  C    . SER A 1 117 ? 18.349  21.566 38.620 1.00 0.00 ? 117 SER A C    3  
ATOM   7936  O  O    . SER A 1 117 ? 17.379  20.963 38.209 1.00 0.00 ? 117 SER A O    3  
ATOM   7937  C  CB   . SER A 1 117 ? 18.444  22.855 40.739 1.00 0.00 ? 117 SER A CB   3  
ATOM   7938  O  OG   . SER A 1 117 ? 18.978  24.123 41.089 1.00 0.00 ? 117 SER A OG   3  
ATOM   7939  H  H    . SER A 1 117 ? 16.089  23.149 39.517 1.00 0.00 ? 117 SER A H    3  
ATOM   7940  H  HA   . SER A 1 117 ? 18.934  23.616 38.765 1.00 0.00 ? 117 SER A HA   3  
ATOM   7941  H  HB2  . SER A 1 117 ? 17.516  22.683 41.261 1.00 0.00 ? 117 SER A HB2  3  
ATOM   7942  H  HB3  . SER A 1 117 ? 19.155  22.075 40.965 1.00 0.00 ? 117 SER A HB3  3  
ATOM   7943  H  HG   . SER A 1 117 ? 19.291  24.545 40.287 1.00 0.00 ? 117 SER A HG   3  
ATOM   7944  N  N    . LYS A 1 118 ? 19.561  21.084 38.578 1.00 0.00 ? 118 LYS A N    3  
ATOM   7945  C  CA   . LYS A 1 118 ? 19.790  19.737 38.005 1.00 0.00 ? 118 LYS A CA   3  
ATOM   7946  C  C    . LYS A 1 118 ? 18.880  18.712 38.670 1.00 0.00 ? 118 LYS A C    3  
ATOM   7947  O  O    . LYS A 1 118 ? 18.392  17.802 38.029 1.00 0.00 ? 118 LYS A O    3  
ATOM   7948  C  CB   . LYS A 1 118 ? 21.253  19.343 38.268 1.00 0.00 ? 118 LYS A CB   3  
ATOM   7949  C  CG   . LYS A 1 118 ? 22.176  20.273 37.476 1.00 0.00 ? 118 LYS A CG   3  
ATOM   7950  C  CD   . LYS A 1 118 ? 23.612  20.106 37.981 1.00 0.00 ? 118 LYS A CD   3  
ATOM   7951  C  CE   . LYS A 1 118 ? 24.583  20.572 36.892 1.00 0.00 ? 118 LYS A CE   3  
ATOM   7952  N  NZ   . LYS A 1 118 ? 25.987  20.533 37.392 1.00 0.00 ? 118 LYS A NZ   3  
ATOM   7953  H  H    . LYS A 1 118 ? 20.313  21.608 38.922 1.00 0.00 ? 118 LYS A H    3  
ATOM   7954  H  HA   . LYS A 1 118 ? 19.578  19.763 36.937 1.00 0.00 ? 118 LYS A HA   3  
ATOM   7955  H  HB2  . LYS A 1 118 ? 21.468  19.430 39.322 1.00 0.00 ? 118 LYS A HB2  3  
ATOM   7956  H  HB3  . LYS A 1 118 ? 21.414  18.321 37.958 1.00 0.00 ? 118 LYS A HB3  3  
ATOM   7957  H  HG2  . LYS A 1 118 ? 22.129  20.023 36.426 1.00 0.00 ? 118 LYS A HG2  3  
ATOM   7958  H  HG3  . LYS A 1 118 ? 21.861  21.298 37.609 1.00 0.00 ? 118 LYS A HG3  3  
ATOM   7959  H  HD2  . LYS A 1 118 ? 23.755  20.700 38.873 1.00 0.00 ? 118 LYS A HD2  3  
ATOM   7960  H  HD3  . LYS A 1 118 ? 23.797  19.068 38.214 1.00 0.00 ? 118 LYS A HD3  3  
ATOM   7961  H  HE2  . LYS A 1 118 ? 24.497  19.924 36.032 1.00 0.00 ? 118 LYS A HE2  3  
ATOM   7962  H  HE3  . LYS A 1 118 ? 24.340  21.582 36.600 1.00 0.00 ? 118 LYS A HE3  3  
ATOM   7963  H  HZ1  . LYS A 1 118 ? 25.988  20.594 38.430 1.00 0.00 ? 118 LYS A HZ1  3  
ATOM   7964  H  HZ2  . LYS A 1 118 ? 26.436  19.643 37.096 1.00 0.00 ? 118 LYS A HZ2  3  
ATOM   7965  H  HZ3  . LYS A 1 118 ? 26.517  21.337 36.997 1.00 0.00 ? 118 LYS A HZ3  3  
ATOM   7966  N  N    . ASN A 1 119 ? 18.668  18.879 39.947 1.00 0.00 ? 119 ASN A N    3  
ATOM   7967  C  CA   . ASN A 1 119 ? 17.795  17.925 40.671 1.00 0.00 ? 119 ASN A CA   3  
ATOM   7968  C  C    . ASN A 1 119 ? 16.383  17.940 40.094 1.00 0.00 ? 119 ASN A C    3  
ATOM   7969  O  O    . ASN A 1 119 ? 15.873  16.923 39.672 1.00 0.00 ? 119 ASN A O    3  
ATOM   7970  C  CB   . ASN A 1 119 ? 17.736  18.347 42.147 1.00 0.00 ? 119 ASN A CB   3  
ATOM   7971  C  CG   . ASN A 1 119 ? 17.290  17.155 42.994 1.00 0.00 ? 119 ASN A CG   3  
ATOM   7972  O  OD1  . ASN A 1 119 ? 16.232  17.166 43.591 1.00 0.00 ? 119 ASN A OD1  3  
ATOM   7973  N  ND2  . ASN A 1 119 ? 18.066  16.109 43.073 1.00 0.00 ? 119 ASN A ND2  3  
ATOM   7974  H  H    . ASN A 1 119 ? 19.083  19.628 40.424 1.00 0.00 ? 119 ASN A H    3  
ATOM   7975  H  HA   . ASN A 1 119 ? 18.206  16.922 40.572 1.00 0.00 ? 119 ASN A HA   3  
ATOM   7976  H  HB2  . ASN A 1 119 ? 18.714  18.671 42.473 1.00 0.00 ? 119 ASN A HB2  3  
ATOM   7977  H  HB3  . ASN A 1 119 ? 17.033  19.155 42.269 1.00 0.00 ? 119 ASN A HB3  3  
ATOM   7978  H  HD21 . ASN A 1 119 ? 18.920  16.094 42.592 1.00 0.00 ? 119 ASN A HD21 3  
ATOM   7979  H  HD22 . ASN A 1 119 ? 17.793  15.336 43.611 1.00 0.00 ? 119 ASN A HD22 3  
ATOM   7980  N  N    . GLU A 1 120 ? 15.773  19.096 40.089 1.00 0.00 ? 120 GLU A N    3  
ATOM   7981  C  CA   . GLU A 1 120 ? 14.397  19.186 39.542 1.00 0.00 ? 120 GLU A CA   3  
ATOM   7982  C  C    . GLU A 1 120 ? 14.307  18.438 38.220 1.00 0.00 ? 120 GLU A C    3  
ATOM   7983  O  O    . GLU A 1 120 ? 13.541  17.500 38.079 1.00 0.00 ? 120 GLU A O    3  
ATOM   7984  C  CB   . GLU A 1 120 ? 14.066  20.668 39.290 1.00 0.00 ? 120 GLU A CB   3  
ATOM   7985  C  CG   . GLU A 1 120 ? 13.977  21.403 40.630 1.00 0.00 ? 120 GLU A CG   3  
ATOM   7986  C  CD   . GLU A 1 120 ? 13.313  22.767 40.414 1.00 0.00 ? 120 GLU A CD   3  
ATOM   7987  O  OE1  . GLU A 1 120 ? 12.231  22.759 39.850 1.00 0.00 ? 120 GLU A OE1  3  
ATOM   7988  O  OE2  . GLU A 1 120 ? 13.925  23.739 40.824 1.00 0.00 ? 120 GLU A OE2  3  
ATOM   7989  H  H    . GLU A 1 120 ? 16.218  19.895 40.442 1.00 0.00 ? 120 GLU A H    3  
ATOM   7990  H  HA   . GLU A 1 120 ? 13.698  18.743 40.251 1.00 0.00 ? 120 GLU A HA   3  
ATOM   7991  H  HB2  . GLU A 1 120 ? 14.839  21.113 38.683 1.00 0.00 ? 120 GLU A HB2  3  
ATOM   7992  H  HB3  . GLU A 1 120 ? 13.122  20.745 38.772 1.00 0.00 ? 120 GLU A HB3  3  
ATOM   7993  H  HG2  . GLU A 1 120 ? 13.390  20.826 41.327 1.00 0.00 ? 120 GLU A HG2  3  
ATOM   7994  H  HG3  . GLU A 1 120 ? 14.968  21.550 41.033 1.00 0.00 ? 120 GLU A HG3  3  
ATOM   7995  N  N    . VAL A 1 121 ? 15.093  18.867 37.271 1.00 0.00 ? 121 VAL A N    3  
ATOM   7996  C  CA   . VAL A 1 121 ? 15.070  18.198 35.953 1.00 0.00 ? 121 VAL A CA   3  
ATOM   7997  C  C    . VAL A 1 121 ? 15.233  16.695 36.123 1.00 0.00 ? 121 VAL A C    3  
ATOM   7998  O  O    . VAL A 1 121 ? 14.738  15.919 35.331 1.00 0.00 ? 121 VAL A O    3  
ATOM   7999  C  CB   . VAL A 1 121 ? 16.242  18.734 35.114 1.00 0.00 ? 121 VAL A CB   3  
ATOM   8000  C  CG1  . VAL A 1 121 ? 16.280  18.001 33.773 1.00 0.00 ? 121 VAL A CG1  3  
ATOM   8001  C  CG2  . VAL A 1 121 ? 16.037  20.229 34.862 1.00 0.00 ? 121 VAL A CG2  3  
ATOM   8002  H  H    . VAL A 1 121 ? 15.695  19.624 37.430 1.00 0.00 ? 121 VAL A H    3  
ATOM   8003  H  HA   . VAL A 1 121 ? 14.117  18.402 35.466 1.00 0.00 ? 121 VAL A HA   3  
ATOM   8004  H  HB   . VAL A 1 121 ? 17.170  18.577 35.642 1.00 0.00 ? 121 VAL A HB   3  
ATOM   8005  H  HG11 . VAL A 1 121 ? 15.286  17.954 33.356 1.00 0.00 ? 121 VAL A HG11 3  
ATOM   8006  H  HG12 . VAL A 1 121 ? 16.929  18.529 33.089 1.00 0.00 ? 121 VAL A HG12 3  
ATOM   8007  H  HG13 . VAL A 1 121 ? 16.655  16.999 33.916 1.00 0.00 ? 121 VAL A HG13 3  
ATOM   8008  H  HG21 . VAL A 1 121 ? 15.947  20.748 35.805 1.00 0.00 ? 121 VAL A HG21 3  
ATOM   8009  H  HG22 . VAL A 1 121 ? 16.880  20.624 34.318 1.00 0.00 ? 121 VAL A HG22 3  
ATOM   8010  H  HG23 . VAL A 1 121 ? 15.137  20.380 34.285 1.00 0.00 ? 121 VAL A HG23 3  
ATOM   8011  N  N    . LEU A 1 122 ? 15.931  16.309 37.160 1.00 0.00 ? 122 LEU A N    3  
ATOM   8012  C  CA   . LEU A 1 122 ? 16.136  14.864 37.398 1.00 0.00 ? 122 LEU A CA   3  
ATOM   8013  C  C    . LEU A 1 122 ? 14.803  14.174 37.644 1.00 0.00 ? 122 LEU A C    3  
ATOM   8014  O  O    . LEU A 1 122 ? 14.474  13.203 36.992 1.00 0.00 ? 122 LEU A O    3  
ATOM   8015  C  CB   . LEU A 1 122 ? 17.022  14.694 38.643 1.00 0.00 ? 122 LEU A CB   3  
ATOM   8016  C  CG   . LEU A 1 122 ? 17.945  13.490 38.441 1.00 0.00 ? 122 LEU A CG   3  
ATOM   8017  C  CD1  . LEU A 1 122 ? 19.011  13.482 39.538 1.00 0.00 ? 122 LEU A CD1  3  
ATOM   8018  C  CD2  . LEU A 1 122 ? 17.121  12.203 38.530 1.00 0.00 ? 122 LEU A CD2  3  
ATOM   8019  H  H    . LEU A 1 122 ? 16.313  16.971 37.773 1.00 0.00 ? 122 LEU A H    3  
ATOM   8020  H  HA   . LEU A 1 122 ? 16.608  14.422 36.521 1.00 0.00 ? 122 LEU A HA   3  
ATOM   8021  H  HB2  . LEU A 1 122 ? 17.616  15.584 38.791 1.00 0.00 ? 122 LEU A HB2  3  
ATOM   8022  H  HB3  . LEU A 1 122 ? 16.402  14.533 39.512 1.00 0.00 ? 122 LEU A HB3  3  
ATOM   8023  H  HG   . LEU A 1 122 ? 18.419  13.554 37.472 1.00 0.00 ? 122 LEU A HG   3  
ATOM   8024  H  HD11 . LEU A 1 122 ? 19.562  14.410 39.519 1.00 0.00 ? 122 LEU A HD11 3  
ATOM   8025  H  HD12 . LEU A 1 122 ? 18.541  13.368 40.503 1.00 0.00 ? 122 LEU A HD12 3  
ATOM   8026  H  HD13 . LEU A 1 122 ? 19.694  12.660 39.376 1.00 0.00 ? 122 LEU A HD13 3  
ATOM   8027  H  HD21 . LEU A 1 122 ? 16.333  12.323 39.258 1.00 0.00 ? 122 LEU A HD21 3  
ATOM   8028  H  HD22 . LEU A 1 122 ? 16.685  11.983 37.567 1.00 0.00 ? 122 LEU A HD22 3  
ATOM   8029  H  HD23 . LEU A 1 122 ? 17.759  11.381 38.826 1.00 0.00 ? 122 LEU A HD23 3  
ATOM   8030  N  N    . GLU A 1 123 ? 14.053  14.689 38.582 1.00 0.00 ? 123 GLU A N    3  
ATOM   8031  C  CA   . GLU A 1 123 ? 12.740  14.069 38.875 1.00 0.00 ? 123 GLU A CA   3  
ATOM   8032  C  C    . GLU A 1 123 ? 11.951  13.885 37.592 1.00 0.00 ? 123 GLU A C    3  
ATOM   8033  O  O    . GLU A 1 123 ? 11.383  12.838 37.352 1.00 0.00 ? 123 GLU A O    3  
ATOM   8034  C  CB   . GLU A 1 123 ? 11.953  15.000 39.809 1.00 0.00 ? 123 GLU A CB   3  
ATOM   8035  C  CG   . GLU A 1 123 ? 12.915  15.631 40.817 1.00 0.00 ? 123 GLU A CG   3  
ATOM   8036  C  CD   . GLU A 1 123 ? 13.756  14.533 41.473 1.00 0.00 ? 123 GLU A CD   3  
ATOM   8037  O  OE1  . GLU A 1 123 ? 14.531  13.937 40.744 1.00 0.00 ? 123 GLU A OE1  3  
ATOM   8038  O  OE2  . GLU A 1 123 ? 13.574  14.352 42.666 1.00 0.00 ? 123 GLU A OE2  3  
ATOM   8039  H  H    . GLU A 1 123 ? 14.355  15.476 39.084 1.00 0.00 ? 123 GLU A H    3  
ATOM   8040  H  HA   . GLU A 1 123 ? 12.901  13.096 39.338 1.00 0.00 ? 123 GLU A HA   3  
ATOM   8041  H  HB2  . GLU A 1 123 ? 11.475  15.774 39.229 1.00 0.00 ? 123 GLU A HB2  3  
ATOM   8042  H  HB3  . GLU A 1 123 ? 11.198  14.431 40.334 1.00 0.00 ? 123 GLU A HB3  3  
ATOM   8043  H  HG2  . GLU A 1 123 ? 13.568  16.328 40.315 1.00 0.00 ? 123 GLU A HG2  3  
ATOM   8044  H  HG3  . GLU A 1 123 ? 12.355  16.154 41.578 1.00 0.00 ? 123 GLU A HG3  3  
ATOM   8045  N  N    . ILE A 1 124 ? 11.927  14.912 36.784 1.00 0.00 ? 124 ILE A N    3  
ATOM   8046  C  CA   . ILE A 1 124 ? 11.180  14.811 35.511 1.00 0.00 ? 124 ILE A CA   3  
ATOM   8047  C  C    . ILE A 1 124 ? 11.692  13.633 34.695 1.00 0.00 ? 124 ILE A C    3  
ATOM   8048  O  O    . ILE A 1 124 ? 10.927  12.788 34.271 1.00 0.00 ? 124 ILE A O    3  
ATOM   8049  C  CB   . ILE A 1 124 ? 11.397  16.100 34.717 1.00 0.00 ? 124 ILE A CB   3  
ATOM   8050  C  CG1  . ILE A 1 124 ? 11.106  17.305 35.603 1.00 0.00 ? 124 ILE A CG1  3  
ATOM   8051  C  CG2  . ILE A 1 124 ? 10.420  16.115 33.530 1.00 0.00 ? 124 ILE A CG2  3  
ATOM   8052  C  CD1  . ILE A 1 124 ? 9.755   17.106 36.298 1.00 0.00 ? 124 ILE A CD1  3  
ATOM   8053  H  H    . ILE A 1 124 ? 12.399  15.741 37.019 1.00 0.00 ? 124 ILE A H    3  
ATOM   8054  H  HA   . ILE A 1 124 ? 10.122  14.661 35.730 1.00 0.00 ? 124 ILE A HA   3  
ATOM   8055  H  HB   . ILE A 1 124 ? 12.433  16.144 34.373 1.00 0.00 ? 124 ILE A HB   3  
ATOM   8056  H  HG12 . ILE A 1 124 ? 11.883  17.406 36.345 1.00 0.00 ? 124 ILE A HG12 3  
ATOM   8057  H  HG13 . ILE A 1 124 ? 11.074  18.199 34.999 1.00 0.00 ? 124 ILE A HG13 3  
ATOM   8058  H  HG21 . ILE A 1 124 ? 9.597   15.442 33.726 1.00 0.00 ? 124 ILE A HG21 3  
ATOM   8059  H  HG22 . ILE A 1 124 ? 10.035  17.114 33.387 1.00 0.00 ? 124 ILE A HG22 3  
ATOM   8060  H  HG23 . ILE A 1 124 ? 10.931  15.799 32.632 1.00 0.00 ? 124 ILE A HG23 3  
ATOM   8061  H  HD11 . ILE A 1 124 ? 9.051   16.661 35.610 1.00 0.00 ? 124 ILE A HD11 3  
ATOM   8062  H  HD12 . ILE A 1 124 ? 9.876   16.455 37.151 1.00 0.00 ? 124 ILE A HD12 3  
ATOM   8063  H  HD13 . ILE A 1 124 ? 9.372   18.061 36.631 1.00 0.00 ? 124 ILE A HD13 3  
ATOM   8064  N  N    . VAL A 1 125 ? 12.980  13.593 34.489 1.00 0.00 ? 125 VAL A N    3  
ATOM   8065  C  CA   . VAL A 1 125 ? 13.555  12.477 33.706 1.00 0.00 ? 125 VAL A CA   3  
ATOM   8066  C  C    . VAL A 1 125 ? 13.173  11.148 34.335 1.00 0.00 ? 125 VAL A C    3  
ATOM   8067  O  O    . VAL A 1 125 ? 12.740  10.237 33.658 1.00 0.00 ? 125 VAL A O    3  
ATOM   8068  C  CB   . VAL A 1 125 ? 15.086  12.615 33.717 1.00 0.00 ? 125 VAL A CB   3  
ATOM   8069  C  CG1  . VAL A 1 125 ? 15.713  11.403 33.018 1.00 0.00 ? 125 VAL A CG1  3  
ATOM   8070  C  CG2  . VAL A 1 125 ? 15.477  13.887 32.964 1.00 0.00 ? 125 VAL A CG2  3  
ATOM   8071  H  H    . VAL A 1 125 ? 13.561  14.296 34.850 1.00 0.00 ? 125 VAL A H    3  
ATOM   8072  H  HA   . VAL A 1 125 ? 13.166  12.517 32.688 1.00 0.00 ? 125 VAL A HA   3  
ATOM   8073  H  HB   . VAL A 1 125 ? 15.439  12.672 34.734 1.00 0.00 ? 125 VAL A HB   3  
ATOM   8074  H  HG11 . VAL A 1 125 ? 15.358  10.492 33.476 1.00 0.00 ? 125 VAL A HG11 3  
ATOM   8075  H  HG12 . VAL A 1 125 ? 15.443  11.405 31.972 1.00 0.00 ? 125 VAL A HG12 3  
ATOM   8076  H  HG13 . VAL A 1 125 ? 16.789  11.449 33.107 1.00 0.00 ? 125 VAL A HG13 3  
ATOM   8077  H  HG21 . VAL A 1 125 ? 14.795  14.684 33.218 1.00 0.00 ? 125 VAL A HG21 3  
ATOM   8078  H  HG22 . VAL A 1 125 ? 16.480  14.177 33.235 1.00 0.00 ? 125 VAL A HG22 3  
ATOM   8079  H  HG23 . VAL A 1 125 ? 15.434  13.707 31.899 1.00 0.00 ? 125 VAL A HG23 3  
ATOM   8080  N  N    . THR A 1 126 ? 13.341  11.056 35.628 1.00 0.00 ? 126 THR A N    3  
ATOM   8081  C  CA   . THR A 1 126 ? 12.991  9.795  36.316 1.00 0.00 ? 126 THR A CA   3  
ATOM   8082  C  C    . THR A 1 126 ? 11.557  9.407  35.995 1.00 0.00 ? 126 THR A C    3  
ATOM   8083  O  O    . THR A 1 126 ? 11.285  8.302  35.560 1.00 0.00 ? 126 THR A O    3  
ATOM   8084  C  CB   . THR A 1 126 ? 13.116  10.014 37.826 1.00 0.00 ? 126 THR A CB   3  
ATOM   8085  O  OG1  . THR A 1 126 ? 14.397  10.578 38.019 1.00 0.00 ? 126 THR A OG1  3  
ATOM   8086  C  CG2  . THR A 1 126 ? 13.169  8.671  38.569 1.00 0.00 ? 126 THR A CG2  3  
ATOM   8087  H  H    . THR A 1 126 ? 13.697  11.816 36.135 1.00 0.00 ? 126 THR A H    3  
ATOM   8088  H  HA   . THR A 1 126 ? 13.661  9.004  35.977 1.00 0.00 ? 126 THR A HA   3  
ATOM   8089  H  HB   . THR A 1 126 ? 12.341  10.675 38.204 1.00 0.00 ? 126 THR A HB   3  
ATOM   8090  H  HG1  . THR A 1 126 ? 14.333  11.221 38.730 1.00 0.00 ? 126 THR A HG1  3  
ATOM   8091  H  HG21 . THR A 1 126 ? 12.276  8.102  38.357 1.00 0.00 ? 126 THR A HG21 3  
ATOM   8092  H  HG22 . THR A 1 126 ? 14.033  8.111  38.246 1.00 0.00 ? 126 THR A HG22 3  
ATOM   8093  H  HG23 . THR A 1 126 ? 13.234  8.846  39.633 1.00 0.00 ? 126 THR A HG23 3  
ATOM   8094  N  N    . ALA A 1 127 ? 10.658  10.330 36.214 1.00 0.00 ? 127 ALA A N    3  
ATOM   8095  C  CA   . ALA A 1 127 ? 9.240   10.040 35.928 1.00 0.00 ? 127 ALA A CA   3  
ATOM   8096  C  C    . ALA A 1 127 ? 9.077   9.620  34.477 1.00 0.00 ? 127 ALA A C    3  
ATOM   8097  O  O    . ALA A 1 127 ? 8.392   8.662  34.175 1.00 0.00 ? 127 ALA A O    3  
ATOM   8098  C  CB   . ALA A 1 127 ? 8.426   11.317 36.173 1.00 0.00 ? 127 ALA A CB   3  
ATOM   8099  H  H    . ALA A 1 127 ? 10.923  11.206 36.564 1.00 0.00 ? 127 ALA A H    3  
ATOM   8100  H  HA   . ALA A 1 127 ? 8.903   9.230  36.575 1.00 0.00 ? 127 ALA A HA   3  
ATOM   8101  H  HB1  . ALA A 1 127 ? 8.953   12.170 35.771 1.00 0.00 ? 127 ALA A HB1  3  
ATOM   8102  H  HB2  . ALA A 1 127 ? 7.467   11.234 35.690 1.00 0.00 ? 127 ALA A HB2  3  
ATOM   8103  H  HB3  . ALA A 1 127 ? 8.278   11.459 37.235 1.00 0.00 ? 127 ALA A HB3  3  
ATOM   8104  N  N    . ILE A 1 128 ? 9.708   10.345 33.598 1.00 0.00 ? 128 ILE A N    3  
ATOM   8105  C  CA   . ILE A 1 128 ? 9.596   9.993  32.170 1.00 0.00 ? 128 ILE A CA   3  
ATOM   8106  C  C    . ILE A 1 128 ? 10.072  8.569  31.955 1.00 0.00 ? 128 ILE A C    3  
ATOM   8107  O  O    . ILE A 1 128 ? 9.491   7.826  31.195 1.00 0.00 ? 128 ILE A O    3  
ATOM   8108  C  CB   . ILE A 1 128 ? 10.482  10.943 31.362 1.00 0.00 ? 128 ILE A CB   3  
ATOM   8109  C  CG1  . ILE A 1 128 ? 9.837   12.319 31.304 1.00 0.00 ? 128 ILE A CG1  3  
ATOM   8110  C  CG2  . ILE A 1 128 ? 10.605  10.397 29.930 1.00 0.00 ? 128 ILE A CG2  3  
ATOM   8111  C  CD1  . ILE A 1 128 ? 10.801  13.297 30.630 1.00 0.00 ? 128 ILE A CD1  3  
ATOM   8112  H  H    . ILE A 1 128 ? 10.248  11.113 33.882 1.00 0.00 ? 128 ILE A H    3  
ATOM   8113  H  HA   . ILE A 1 128 ? 8.551   10.072 31.862 1.00 0.00 ? 128 ILE A HA   3  
ATOM   8114  H  HB   . ILE A 1 128 ? 11.461  11.021 31.838 1.00 0.00 ? 128 ILE A HB   3  
ATOM   8115  H  HG12 . ILE A 1 128 ? 8.920   12.265 30.736 1.00 0.00 ? 128 ILE A HG12 3  
ATOM   8116  H  HG13 . ILE A 1 128 ? 9.616   12.660 32.304 1.00 0.00 ? 128 ILE A HG13 3  
ATOM   8117  H  HG21 . ILE A 1 128 ? 9.623   10.169 29.541 1.00 0.00 ? 128 ILE A HG21 3  
ATOM   8118  H  HG22 . ILE A 1 128 ? 11.075  11.136 29.298 1.00 0.00 ? 128 ILE A HG22 3  
ATOM   8119  H  HG23 . ILE A 1 128 ? 11.204  9.499  29.933 1.00 0.00 ? 128 ILE A HG23 3  
ATOM   8120  H  HD11 . ILE A 1 128 ? 11.819  12.977 30.795 1.00 0.00 ? 128 ILE A HD11 3  
ATOM   8121  H  HD12 . ILE A 1 128 ? 10.607  13.327 29.567 1.00 0.00 ? 128 ILE A HD12 3  
ATOM   8122  H  HD13 . ILE A 1 128 ? 10.666  14.286 31.043 1.00 0.00 ? 128 ILE A HD13 3  
ATOM   8123  N  N    . PHE A 1 129 ? 11.127  8.205  32.637 1.00 0.00 ? 129 PHE A N    3  
ATOM   8124  C  CA   . PHE A 1 129 ? 11.645  6.830  32.478 1.00 0.00 ? 129 PHE A CA   3  
ATOM   8125  C  C    . PHE A 1 129 ? 10.528  5.825  32.697 1.00 0.00 ? 129 PHE A C    3  
ATOM   8126  O  O    . PHE A 1 129 ? 10.381  4.882  31.947 1.00 0.00 ? 129 PHE A O    3  
ATOM   8127  C  CB   . PHE A 1 129 ? 12.740  6.593  33.527 1.00 0.00 ? 129 PHE A CB   3  
ATOM   8128  C  CG   . PHE A 1 129 ? 13.887  5.814  32.881 1.00 0.00 ? 129 PHE A CG   3  
ATOM   8129  C  CD1  . PHE A 1 129 ? 13.810  4.439  32.745 1.00 0.00 ? 129 PHE A CD1  3  
ATOM   8130  C  CD2  . PHE A 1 129 ? 15.013  6.474  32.416 1.00 0.00 ? 129 PHE A CD2  3  
ATOM   8131  C  CE1  . PHE A 1 129 ? 14.839  3.738  32.153 1.00 0.00 ? 129 PHE A CE1  3  
ATOM   8132  C  CE2  . PHE A 1 129 ? 16.040  5.768  31.825 1.00 0.00 ? 129 PHE A CE2  3  
ATOM   8133  C  CZ   . PHE A 1 129 ? 15.953  4.403  31.694 1.00 0.00 ? 129 PHE A CZ   3  
ATOM   8134  H  H    . PHE A 1 129 ? 11.566  8.835  33.245 1.00 0.00 ? 129 PHE A H    3  
ATOM   8135  H  HA   . PHE A 1 129 ? 12.038  6.712  31.468 1.00 0.00 ? 129 PHE A HA   3  
ATOM   8136  H  HB2  . PHE A 1 129 ? 13.110  7.540  33.891 1.00 0.00 ? 129 PHE A HB2  3  
ATOM   8137  H  HB3  . PHE A 1 129 ? 12.340  6.023  34.351 1.00 0.00 ? 129 PHE A HB3  3  
ATOM   8138  H  HD1  . PHE A 1 129 ? 12.940  3.912  33.104 1.00 0.00 ? 129 PHE A HD1  3  
ATOM   8139  H  HD2  . PHE A 1 129 ? 15.086  7.547  32.516 1.00 0.00 ? 129 PHE A HD2  3  
ATOM   8140  H  HE1  . PHE A 1 129 ? 14.773  2.665  32.051 1.00 0.00 ? 129 PHE A HE1  3  
ATOM   8141  H  HE2  . PHE A 1 129 ? 16.915  6.290  31.465 1.00 0.00 ? 129 PHE A HE2  3  
ATOM   8142  H  HZ   . PHE A 1 129 ? 16.756  3.852  31.228 1.00 0.00 ? 129 PHE A HZ   3  
ATOM   8143  N  N    . LYS A 1 130 ? 9.757   6.042  33.729 1.00 0.00 ? 130 LYS A N    3  
ATOM   8144  C  CA   . LYS A 1 130 ? 8.643   5.105  34.005 1.00 0.00 ? 130 LYS A CA   3  
ATOM   8145  C  C    . LYS A 1 130 ? 7.715   5.037  32.802 1.00 0.00 ? 130 LYS A C    3  
ATOM   8146  O  O    . LYS A 1 130 ? 7.271   3.976  32.414 1.00 0.00 ? 130 LYS A O    3  
ATOM   8147  C  CB   . LYS A 1 130 ? 7.851   5.628  35.215 1.00 0.00 ? 130 LYS A CB   3  
ATOM   8148  C  CG   . LYS A 1 130 ? 8.240   4.823  36.455 1.00 0.00 ? 130 LYS A CG   3  
ATOM   8149  C  CD   . LYS A 1 130 ? 9.675   5.175  36.855 1.00 0.00 ? 130 LYS A CD   3  
ATOM   8150  C  CE   . LYS A 1 130 ? 9.990   4.528  38.205 1.00 0.00 ? 130 LYS A CE   3  
ATOM   8151  N  NZ   . LYS A 1 130 ? 8.843   4.692  39.142 1.00 0.00 ? 130 LYS A NZ   3  
ATOM   8152  H  H    . LYS A 1 130 ? 9.916   6.815  34.317 1.00 0.00 ? 130 LYS A H    3  
ATOM   8153  H  HA   . LYS A 1 130 ? 9.050   4.114  34.201 1.00 0.00 ? 130 LYS A HA   3  
ATOM   8154  H  HB2  . LYS A 1 130 ? 8.077   6.670  35.375 1.00 0.00 ? 130 LYS A HB2  3  
ATOM   8155  H  HB3  . LYS A 1 130 ? 6.793   5.519  35.029 1.00 0.00 ? 130 LYS A HB3  3  
ATOM   8156  H  HG2  . LYS A 1 130 ? 7.569   5.062  37.267 1.00 0.00 ? 130 LYS A HG2  3  
ATOM   8157  H  HG3  . LYS A 1 130 ? 8.171   3.768  36.239 1.00 0.00 ? 130 LYS A HG3  3  
ATOM   8158  H  HD2  . LYS A 1 130 ? 10.361  4.807  36.106 1.00 0.00 ? 130 LYS A HD2  3  
ATOM   8159  H  HD3  . LYS A 1 130 ? 9.778   6.247  36.933 1.00 0.00 ? 130 LYS A HD3  3  
ATOM   8160  H  HE2  . LYS A 1 130 ? 10.183  3.474  38.065 1.00 0.00 ? 130 LYS A HE2  3  
ATOM   8161  H  HE3  . LYS A 1 130 ? 10.866  4.992  38.633 1.00 0.00 ? 130 LYS A HE3  3  
ATOM   8162  H  HZ1  . LYS A 1 130 ? 8.561   5.694  39.173 1.00 0.00 ? 130 LYS A HZ1  3  
ATOM   8163  H  HZ2  . LYS A 1 130 ? 8.041   4.117  38.812 1.00 0.00 ? 130 LYS A HZ2  3  
ATOM   8164  H  HZ3  . LYS A 1 130 ? 9.125   4.383  40.093 1.00 0.00 ? 130 LYS A HZ3  3  
ATOM   8165  N  N    . MET A 1 131 ? 7.443   6.179  32.233 1.00 0.00 ? 131 MET A N    3  
ATOM   8166  C  CA   . MET A 1 131 ? 6.547   6.213  31.052 1.00 0.00 ? 131 MET A CA   3  
ATOM   8167  C  C    . MET A 1 131 ? 7.170   5.441  29.886 1.00 0.00 ? 131 MET A C    3  
ATOM   8168  O  O    . MET A 1 131 ? 6.478   5.018  28.982 1.00 0.00 ? 131 MET A O    3  
ATOM   8169  C  CB   . MET A 1 131 ? 6.354   7.683  30.641 1.00 0.00 ? 131 MET A CB   3  
ATOM   8170  C  CG   . MET A 1 131 ? 5.428   7.752  29.430 1.00 0.00 ? 131 MET A CG   3  
ATOM   8171  S  SD   . MET A 1 131 ? 4.916   9.401  28.878 1.00 0.00 ? 131 MET A SD   3  
ATOM   8172  C  CE   . MET A 1 131 ? 3.125   9.124  28.908 1.00 0.00 ? 131 MET A CE   3  
ATOM   8173  H  H    . MET A 1 131 ? 7.825   7.013  32.590 1.00 0.00 ? 131 MET A H    3  
ATOM   8174  H  HA   . MET A 1 131 ? 5.590   5.751  31.316 1.00 0.00 ? 131 MET A HA   3  
ATOM   8175  H  HB2  . MET A 1 131 ? 5.918   8.233  31.461 1.00 0.00 ? 131 MET A HB2  3  
ATOM   8176  H  HB3  . MET A 1 131 ? 7.307   8.120  30.390 1.00 0.00 ? 131 MET A HB3  3  
ATOM   8177  H  HG2  . MET A 1 131 ? 5.923   7.271  28.601 1.00 0.00 ? 131 MET A HG2  3  
ATOM   8178  H  HG3  . MET A 1 131 ? 4.538   7.185  29.654 1.00 0.00 ? 131 MET A HG3  3  
ATOM   8179  H  HE1  . MET A 1 131 ? 2.907   8.126  28.563 1.00 0.00 ? 131 MET A HE1  3  
ATOM   8180  H  HE2  . MET A 1 131 ? 2.759   9.244  29.917 1.00 0.00 ? 131 MET A HE2  3  
ATOM   8181  H  HE3  . MET A 1 131 ? 2.642   9.841  28.264 1.00 0.00 ? 131 MET A HE3  3  
ATOM   8182  N  N    . ILE A 1 132 ? 8.471   5.276  29.925 1.00 0.00 ? 132 ILE A N    3  
ATOM   8183  C  CA   . ILE A 1 132 ? 9.146   4.534  28.825 1.00 0.00 ? 132 ILE A CA   3  
ATOM   8184  C  C    . ILE A 1 132 ? 9.127   3.036  29.103 1.00 0.00 ? 132 ILE A C    3  
ATOM   8185  O  O    . ILE A 1 132 ? 9.832   2.557  29.968 1.00 0.00 ? 132 ILE A O    3  
ATOM   8186  C  CB   . ILE A 1 132 ? 10.610  4.984  28.738 1.00 0.00 ? 132 ILE A CB   3  
ATOM   8187  C  CG1  . ILE A 1 132 ? 10.689  6.448  28.341 1.00 0.00 ? 132 ILE A CG1  3  
ATOM   8188  C  CG2  . ILE A 1 132 ? 11.313  4.154  27.652 1.00 0.00 ? 132 ILE A CG2  3  
ATOM   8189  C  CD1  . ILE A 1 132 ? 12.162  6.834  28.169 1.00 0.00 ? 132 ILE A CD1  3  
ATOM   8190  H  H    . ILE A 1 132 ? 8.994   5.638  30.669 1.00 0.00 ? 132 ILE A H    3  
ATOM   8191  H  HA   . ILE A 1 132 ? 8.622   4.730  27.891 1.00 0.00 ? 132 ILE A HA   3  
ATOM   8192  H  HB   . ILE A 1 132 ? 11.092  4.846  29.707 1.00 0.00 ? 132 ILE A HB   3  
ATOM   8193  H  HG12 . ILE A 1 132 ? 10.161  6.601  27.410 1.00 0.00 ? 132 ILE A HG12 3  
ATOM   8194  H  HG13 . ILE A 1 132 ? 10.240  7.057  29.107 1.00 0.00 ? 132 ILE A HG13 3  
ATOM   8195  H  HG21 . ILE A 1 132 ? 10.826  4.309  26.701 1.00 0.00 ? 132 ILE A HG21 3  
ATOM   8196  H  HG22 . ILE A 1 132 ? 12.347  4.456  27.574 1.00 0.00 ? 132 ILE A HG22 3  
ATOM   8197  H  HG23 . ILE A 1 132 ? 11.267  3.105  27.908 1.00 0.00 ? 132 ILE A HG23 3  
ATOM   8198  H  HD11 . ILE A 1 132 ? 12.774  6.235  28.828 1.00 0.00 ? 132 ILE A HD11 3  
ATOM   8199  H  HD12 . ILE A 1 132 ? 12.467  6.663  27.147 1.00 0.00 ? 132 ILE A HD12 3  
ATOM   8200  H  HD13 . ILE A 1 132 ? 12.295  7.877  28.410 1.00 0.00 ? 132 ILE A HD13 3  
ATOM   8201  N  N    . SER A 1 133 ? 8.322   2.323  28.368 1.00 0.00 ? 133 SER A N    3  
ATOM   8202  C  CA   . SER A 1 133 ? 8.252   0.856  28.585 1.00 0.00 ? 133 SER A CA   3  
ATOM   8203  C  C    . SER A 1 133 ? 9.579   0.194  28.203 1.00 0.00 ? 133 SER A C    3  
ATOM   8204  O  O    . SER A 1 133 ? 10.322  0.709  27.391 1.00 0.00 ? 133 SER A O    3  
ATOM   8205  C  CB   . SER A 1 133 ? 7.140   0.292  27.685 1.00 0.00 ? 133 SER A CB   3  
ATOM   8206  O  OG   . SER A 1 133 ? 7.276   1.017  26.472 1.00 0.00 ? 133 SER A OG   3  
ATOM   8207  H  H    . SER A 1 133 ? 7.769   2.748  27.680 1.00 0.00 ? 133 SER A H    3  
ATOM   8208  H  HA   . SER A 1 133 ? 8.039   0.666  29.633 1.00 0.00 ? 133 SER A HA   3  
ATOM   8209  H  HB2  . SER A 1 133 ? 7.288   -0.763 27.505 1.00 0.00 ? 133 SER A HB2  3  
ATOM   8210  H  HB3  . SER A 1 133 ? 6.167   0.470  28.120 1.00 0.00 ? 133 SER A HB3  3  
ATOM   8211  H  HG   . SER A 1 133 ? 7.841   0.510  25.885 1.00 0.00 ? 133 SER A HG   3  
ATOM   8212  N  N    . PRO A 1 134 ? 9.852   -0.948 28.803 1.00 0.00 ? 134 PRO A N    3  
ATOM   8213  C  CA   . PRO A 1 134 ? 11.083  -1.680 28.527 1.00 0.00 ? 134 PRO A CA   3  
ATOM   8214  C  C    . PRO A 1 134 ? 11.294  -1.866 27.038 1.00 0.00 ? 134 PRO A C    3  
ATOM   8215  O  O    . PRO A 1 134 ? 12.411  -1.972 26.572 1.00 0.00 ? 134 PRO A O    3  
ATOM   8216  C  CB   . PRO A 1 134 ? 10.877  -3.057 29.184 1.00 0.00 ? 134 PRO A CB   3  
ATOM   8217  C  CG   . PRO A 1 134 ? 9.576   -2.967 30.043 1.00 0.00 ? 134 PRO A CG   3  
ATOM   8218  C  CD   . PRO A 1 134 ? 8.949   -1.586 29.774 1.00 0.00 ? 134 PRO A CD   3  
ATOM   8219  H  HA   . PRO A 1 134 ? 11.930  -1.161 28.963 1.00 0.00 ? 134 PRO A HA   3  
ATOM   8220  H  HB2  . PRO A 1 134 ? 10.763  -3.814 28.419 1.00 0.00 ? 134 PRO A HB2  3  
ATOM   8221  H  HB3  . PRO A 1 134 ? 11.720  -3.296 29.808 1.00 0.00 ? 134 PRO A HB3  3  
ATOM   8222  H  HG2  . PRO A 1 134 ? 8.889   -3.748 29.756 1.00 0.00 ? 134 PRO A HG2  3  
ATOM   8223  H  HG3  . PRO A 1 134 ? 9.817   -3.065 31.092 1.00 0.00 ? 134 PRO A HG3  3  
ATOM   8224  H  HD2  . PRO A 1 134 ? 7.962   -1.693 29.355 1.00 0.00 ? 134 PRO A HD2  3  
ATOM   8225  H  HD3  . PRO A 1 134 ? 8.910   -1.008 30.685 1.00 0.00 ? 134 PRO A HD3  3  
ATOM   8226  N  N    . GLU A 1 135 ? 10.217  -1.903 26.317 1.00 0.00 ? 135 GLU A N    3  
ATOM   8227  C  CA   . GLU A 1 135 ? 10.334  -2.083 24.860 1.00 0.00 ? 135 GLU A CA   3  
ATOM   8228  C  C    . GLU A 1 135 ? 11.285  -1.053 24.254 1.00 0.00 ? 135 GLU A C    3  
ATOM   8229  O  O    . GLU A 1 135 ? 12.070  -1.369 23.383 1.00 0.00 ? 135 GLU A O    3  
ATOM   8230  C  CB   . GLU A 1 135 ? 8.943   -1.900 24.233 1.00 0.00 ? 135 GLU A CB   3  
ATOM   8231  C  CG   . GLU A 1 135 ? 7.982   -2.935 24.821 1.00 0.00 ? 135 GLU A CG   3  
ATOM   8232  C  CD   . GLU A 1 135 ? 6.563   -2.362 24.833 1.00 0.00 ? 135 GLU A CD   3  
ATOM   8233  O  OE1  . GLU A 1 135 ? 6.352   -1.423 24.083 1.00 0.00 ? 135 GLU A OE1  3  
ATOM   8234  O  OE2  . GLU A 1 135 ? 5.772   -2.894 25.594 1.00 0.00 ? 135 GLU A OE2  3  
ATOM   8235  H  H    . GLU A 1 135 ? 9.337   -1.816 26.736 1.00 0.00 ? 135 GLU A H    3  
ATOM   8236  H  HA   . GLU A 1 135 ? 10.720  -3.080 24.667 1.00 0.00 ? 135 GLU A HA   3  
ATOM   8237  H  HB2  . GLU A 1 135 ? 8.577   -0.906 24.445 1.00 0.00 ? 135 GLU A HB2  3  
ATOM   8238  H  HB3  . GLU A 1 135 ? 9.007   -2.032 23.164 1.00 0.00 ? 135 GLU A HB3  3  
ATOM   8239  H  HG2  . GLU A 1 135 ? 7.999   -3.832 24.219 1.00 0.00 ? 135 GLU A HG2  3  
ATOM   8240  H  HG3  . GLU A 1 135 ? 8.278   -3.179 25.831 1.00 0.00 ? 135 GLU A HG3  3  
ATOM   8241  N  N    . ASP A 1 136 ? 11.197  0.161  24.729 1.00 0.00 ? 136 ASP A N    3  
ATOM   8242  C  CA   . ASP A 1 136 ? 12.086  1.222  24.192 1.00 0.00 ? 136 ASP A CA   3  
ATOM   8243  C  C    . ASP A 1 136 ? 13.351  1.355  25.031 1.00 0.00 ? 136 ASP A C    3  
ATOM   8244  O  O    . ASP A 1 136 ? 14.403  1.685  24.519 1.00 0.00 ? 136 ASP A O    3  
ATOM   8245  C  CB   . ASP A 1 136 ? 11.328  2.557  24.231 1.00 0.00 ? 136 ASP A CB   3  
ATOM   8246  C  CG   . ASP A 1 136 ? 10.238  2.551  23.159 1.00 0.00 ? 136 ASP A CG   3  
ATOM   8247  O  OD1  . ASP A 1 136 ? 9.611   1.512  23.032 1.00 0.00 ? 136 ASP A OD1  3  
ATOM   8248  O  OD2  . ASP A 1 136 ? 10.094  3.586  22.528 1.00 0.00 ? 136 ASP A OD2  3  
ATOM   8249  H  H    . ASP A 1 136 ? 10.550  0.370  25.431 1.00 0.00 ? 136 ASP A H    3  
ATOM   8250  H  HA   . ASP A 1 136 ? 12.362  0.966  23.173 1.00 0.00 ? 136 ASP A HA   3  
ATOM   8251  H  HB2  . ASP A 1 136 ? 10.874  2.694  25.201 1.00 0.00 ? 136 ASP A HB2  3  
ATOM   8252  H  HB3  . ASP A 1 136 ? 12.012  3.371  24.040 1.00 0.00 ? 136 ASP A HB3  3  
ATOM   8253  N  N    . THR A 1 137 ? 13.227  1.103  26.307 1.00 0.00 ? 137 THR A N    3  
ATOM   8254  C  CA   . THR A 1 137 ? 14.414  1.210  27.191 1.00 0.00 ? 137 THR A CA   3  
ATOM   8255  C  C    . THR A 1 137 ? 15.600  0.457  26.593 1.00 0.00 ? 137 THR A C    3  
ATOM   8256  O  O    . THR A 1 137 ? 16.706  0.524  27.088 1.00 0.00 ? 137 THR A O    3  
ATOM   8257  C  CB   . THR A 1 137 ? 14.066  0.592  28.538 1.00 0.00 ? 137 THR A CB   3  
ATOM   8258  O  OG1  . THR A 1 137 ? 12.719  0.948  28.775 1.00 0.00 ? 137 THR A OG1  3  
ATOM   8259  C  CG2  . THR A 1 137 ? 14.850  1.270  29.665 1.00 0.00 ? 137 THR A CG2  3  
ATOM   8260  H  H    . THR A 1 137 ? 12.358  0.846  26.677 1.00 0.00 ? 137 THR A H    3  
ATOM   8261  H  HA   . THR A 1 137 ? 14.679  2.267  27.303 1.00 0.00 ? 137 THR A HA   3  
ATOM   8262  H  HB   . THR A 1 137 ? 14.188  -0.482 28.527 1.00 0.00 ? 137 THR A HB   3  
ATOM   8263  H  HG1  . THR A 1 137 ? 12.308  1.137  27.929 1.00 0.00 ? 137 THR A HG1  3  
ATOM   8264  H  HG21 . THR A 1 137 ? 15.868  1.442  29.348 1.00 0.00 ? 137 THR A HG21 3  
ATOM   8265  H  HG22 . THR A 1 137 ? 14.390  2.213  29.912 1.00 0.00 ? 137 THR A HG22 3  
ATOM   8266  H  HG23 . THR A 1 137 ? 14.851  0.635  30.538 1.00 0.00 ? 137 THR A HG23 3  
ATOM   8267  N  N    . LYS A 1 138 ? 15.338  -0.278 25.558 1.00 0.00 ? 138 LYS A N    3  
ATOM   8268  C  CA   . LYS A 1 138 ? 16.428  -1.042 24.912 1.00 0.00 ? 138 LYS A CA   3  
ATOM   8269  C  C    . LYS A 1 138 ? 17.080  -0.203 23.823 1.00 0.00 ? 138 LYS A C    3  
ATOM   8270  O  O    . LYS A 1 138 ? 17.860  -0.703 23.035 1.00 0.00 ? 138 LYS A O    3  
ATOM   8271  C  CB   . LYS A 1 138 ? 15.833  -2.303 24.270 1.00 0.00 ? 138 LYS A CB   3  
ATOM   8272  C  CG   . LYS A 1 138 ? 15.694  -3.393 25.334 1.00 0.00 ? 138 LYS A CG   3  
ATOM   8273  C  CD   . LYS A 1 138 ? 15.276  -4.699 24.657 1.00 0.00 ? 138 LYS A CD   3  
ATOM   8274  C  CE   . LYS A 1 138 ? 15.780  -5.880 25.490 1.00 0.00 ? 138 LYS A CE   3  
ATOM   8275  N  NZ   . LYS A 1 138 ? 15.372  -5.726 26.914 1.00 0.00 ? 138 LYS A NZ   3  
ATOM   8276  H  H    . LYS A 1 138 ? 14.428  -0.332 25.212 1.00 0.00 ? 138 LYS A H    3  
ATOM   8277  H  HA   . LYS A 1 138 ? 17.175  -1.298 25.660 1.00 0.00 ? 138 LYS A HA   3  
ATOM   8278  H  HB2  . LYS A 1 138 ? 14.862  -2.076 23.855 1.00 0.00 ? 138 LYS A HB2  3  
ATOM   8279  H  HB3  . LYS A 1 138 ? 16.483  -2.648 23.481 1.00 0.00 ? 138 LYS A HB3  3  
ATOM   8280  H  HG2  . LYS A 1 138 ? 16.640  -3.530 25.836 1.00 0.00 ? 138 LYS A HG2  3  
ATOM   8281  H  HG3  . LYS A 1 138 ? 14.947  -3.102 26.056 1.00 0.00 ? 138 LYS A HG3  3  
ATOM   8282  H  HD2  . LYS A 1 138 ? 14.199  -4.741 24.584 1.00 0.00 ? 138 LYS A HD2  3  
ATOM   8283  H  HD3  . LYS A 1 138 ? 15.700  -4.748 23.665 1.00 0.00 ? 138 LYS A HD3  3  
ATOM   8284  H  HE2  . LYS A 1 138 ? 15.367  -6.799 25.101 1.00 0.00 ? 138 LYS A HE2  3  
ATOM   8285  H  HE3  . LYS A 1 138 ? 16.858  -5.927 25.435 1.00 0.00 ? 138 LYS A HE3  3  
ATOM   8286  H  HZ1  . LYS A 1 138 ? 14.502  -5.158 26.966 1.00 0.00 ? 138 LYS A HZ1  3  
ATOM   8287  H  HZ2  . LYS A 1 138 ? 15.197  -6.664 27.328 1.00 0.00 ? 138 LYS A HZ2  3  
ATOM   8288  H  HZ3  . LYS A 1 138 ? 16.129  -5.250 27.443 1.00 0.00 ? 138 LYS A HZ3  3  
ATOM   8289  N  N    . HIS A 1 139 ? 16.738  1.066  23.797 1.00 0.00 ? 139 HIS A N    3  
ATOM   8290  C  CA   . HIS A 1 139 ? 17.320  1.969  22.766 1.00 0.00 ? 139 HIS A CA   3  
ATOM   8291  C  C    . HIS A 1 139 ? 18.417  2.863  23.338 1.00 0.00 ? 139 HIS A C    3  
ATOM   8292  O  O    . HIS A 1 139 ? 19.534  2.851  22.860 1.00 0.00 ? 139 HIS A O    3  
ATOM   8293  C  CB   . HIS A 1 139 ? 16.194  2.864  22.228 1.00 0.00 ? 139 HIS A CB   3  
ATOM   8294  C  CG   . HIS A 1 139 ? 15.337  2.061  21.256 1.00 0.00 ? 139 HIS A CG   3  
ATOM   8295  N  ND1  . HIS A 1 139 ? 15.724  1.053  20.633 1.00 0.00 ? 139 HIS A ND1  3  
ATOM   8296  C  CD2  . HIS A 1 139 ? 14.024  2.253  20.871 1.00 0.00 ? 139 HIS A CD2  3  
ATOM   8297  C  CE1  . HIS A 1 139 ? 14.806  0.582  19.898 1.00 0.00 ? 139 HIS A CE1  3  
ATOM   8298  N  NE2  . HIS A 1 139 ? 13.677  1.284  19.983 1.00 0.00 ? 139 HIS A NE2  3  
ATOM   8299  H  H    . HIS A 1 139 ? 16.103  1.416  24.454 1.00 0.00 ? 139 HIS A H    3  
ATOM   8300  H  HA   . HIS A 1 139 ? 17.741  1.368  21.968 1.00 0.00 ? 139 HIS A HA   3  
ATOM   8301  H  HB2  . HIS A 1 139 ? 15.578  3.208  23.046 1.00 0.00 ? 139 HIS A HB2  3  
ATOM   8302  H  HB3  . HIS A 1 139 ? 16.615  3.713  21.716 1.00 0.00 ? 139 HIS A HB3  3  
ATOM   8303  H  HD1  . HIS A 1 139 ? 16.623  0.673  20.705 1.00 0.00 ? 139 HIS A HD1  3  
ATOM   8304  H  HD2  . HIS A 1 139 ? 13.377  3.043  21.222 1.00 0.00 ? 139 HIS A HD2  3  
ATOM   8305  H  HE1  . HIS A 1 139 ? 14.926  -0.292 19.275 1.00 0.00 ? 139 HIS A HE1  3  
ATOM   8306  N  N    . LEU A 1 140 ? 18.085  3.624  24.353 1.00 0.00 ? 140 LEU A N    3  
ATOM   8307  C  CA   . LEU A 1 140 ? 19.108  4.518  24.952 1.00 0.00 ? 140 LEU A CA   3  
ATOM   8308  C  C    . LEU A 1 140 ? 20.442  3.772  25.112 1.00 0.00 ? 140 LEU A C    3  
ATOM   8309  O  O    . LEU A 1 140 ? 20.464  2.569  25.287 1.00 0.00 ? 140 LEU A O    3  
ATOM   8310  C  CB   . LEU A 1 140 ? 18.612  4.983  26.339 1.00 0.00 ? 140 LEU A CB   3  
ATOM   8311  C  CG   . LEU A 1 140 ? 17.136  4.583  26.514 1.00 0.00 ? 140 LEU A CG   3  
ATOM   8312  C  CD1  . LEU A 1 140 ? 16.299  5.153  25.337 1.00 0.00 ? 140 LEU A CD1  3  
ATOM   8313  C  CD2  . LEU A 1 140 ? 17.044  3.057  26.585 1.00 0.00 ? 140 LEU A CD2  3  
ATOM   8314  H  H    . LEU A 1 140 ? 17.180  3.592  24.719 1.00 0.00 ? 140 LEU A H    3  
ATOM   8315  H  HA   . LEU A 1 140 ? 19.249  5.365  24.289 1.00 0.00 ? 140 LEU A HA   3  
ATOM   8316  H  HB2  . LEU A 1 140 ? 19.207  4.517  27.110 1.00 0.00 ? 140 LEU A HB2  3  
ATOM   8317  H  HB3  . LEU A 1 140 ? 18.709  6.056  26.417 1.00 0.00 ? 140 LEU A HB3  3  
ATOM   8318  H  HG   . LEU A 1 140 ? 16.763  4.986  27.430 1.00 0.00 ? 140 LEU A HG   3  
ATOM   8319  H  HD11 . LEU A 1 140 ? 16.956  5.576  24.593 1.00 0.00 ? 140 LEU A HD11 3  
ATOM   8320  H  HD12 . LEU A 1 140 ? 15.706  4.381  24.883 1.00 0.00 ? 140 LEU A HD12 3  
ATOM   8321  H  HD13 . LEU A 1 140 ? 15.641  5.926  25.705 1.00 0.00 ? 140 LEU A HD13 3  
ATOM   8322  H  HD21 . LEU A 1 140 ? 18.004  2.622  26.352 1.00 0.00 ? 140 LEU A HD21 3  
ATOM   8323  H  HD22 . LEU A 1 140 ? 16.766  2.774  27.587 1.00 0.00 ? 140 LEU A HD22 3  
ATOM   8324  H  HD23 . LEU A 1 140 ? 16.310  2.686  25.895 1.00 0.00 ? 140 LEU A HD23 3  
ATOM   8325  N  N    . PRO A 1 141 ? 21.534  4.511  25.049 1.00 0.00 ? 141 PRO A N    3  
ATOM   8326  C  CA   . PRO A 1 141 ? 22.865  3.924  25.184 1.00 0.00 ? 141 PRO A CA   3  
ATOM   8327  C  C    . PRO A 1 141 ? 23.022  3.167  26.499 1.00 0.00 ? 141 PRO A C    3  
ATOM   8328  O  O    . PRO A 1 141 ? 22.174  3.238  27.368 1.00 0.00 ? 141 PRO A O    3  
ATOM   8329  C  CB   . PRO A 1 141 ? 23.832  5.129  25.165 1.00 0.00 ? 141 PRO A CB   3  
ATOM   8330  C  CG   . PRO A 1 141 ? 22.965  6.419  25.040 1.00 0.00 ? 141 PRO A CG   3  
ATOM   8331  C  CD   . PRO A 1 141 ? 21.506  5.969  24.866 1.00 0.00 ? 141 PRO A CD   3  
ATOM   8332  H  HA   . PRO A 1 141 ? 23.057  3.258  24.349 1.00 0.00 ? 141 PRO A HA   3  
ATOM   8333  H  HB2  . PRO A 1 141 ? 24.406  5.156  26.079 1.00 0.00 ? 141 PRO A HB2  3  
ATOM   8334  H  HB3  . PRO A 1 141 ? 24.500  5.050  24.321 1.00 0.00 ? 141 PRO A HB3  3  
ATOM   8335  H  HG2  . PRO A 1 141 ? 23.064  7.016  25.933 1.00 0.00 ? 141 PRO A HG2  3  
ATOM   8336  H  HG3  . PRO A 1 141 ? 23.280  6.994  24.181 1.00 0.00 ? 141 PRO A HG3  3  
ATOM   8337  H  HD2  . PRO A 1 141 ? 20.874  6.426  25.612 1.00 0.00 ? 141 PRO A HD2  3  
ATOM   8338  H  HD3  . PRO A 1 141 ? 21.158  6.215  23.874 1.00 0.00 ? 141 PRO A HD3  3  
ATOM   8339  N  N    . GLU A 1 142 ? 24.110  2.452  26.616 1.00 0.00 ? 142 GLU A N    3  
ATOM   8340  C  CA   . GLU A 1 142 ? 24.349  1.683  27.859 1.00 0.00 ? 142 GLU A CA   3  
ATOM   8341  C  C    . GLU A 1 142 ? 25.105  2.529  28.875 1.00 0.00 ? 142 GLU A C    3  
ATOM   8342  O  O    . GLU A 1 142 ? 25.624  3.576  28.548 1.00 0.00 ? 142 GLU A O    3  
ATOM   8343  C  CB   . GLU A 1 142 ? 25.200  0.451  27.511 1.00 0.00 ? 142 GLU A CB   3  
ATOM   8344  C  CG   . GLU A 1 142 ? 24.556  -0.286 26.336 1.00 0.00 ? 142 GLU A CG   3  
ATOM   8345  C  CD   . GLU A 1 142 ? 25.135  0.245  25.023 1.00 0.00 ? 142 GLU A CD   3  
ATOM   8346  O  OE1  . GLU A 1 142 ? 24.599  1.238  24.558 1.00 0.00 ? 142 GLU A OE1  3  
ATOM   8347  O  OE2  . GLU A 1 142 ? 26.081  -0.371 24.559 1.00 0.00 ? 142 GLU A OE2  3  
ATOM   8348  H  H    . GLU A 1 142 ? 24.763  2.427  25.887 1.00 0.00 ? 142 GLU A H    3  
ATOM   8349  H  HA   . GLU A 1 142 ? 23.391  1.385  28.285 1.00 0.00 ? 142 GLU A HA   3  
ATOM   8350  H  HB2  . GLU A 1 142 ? 26.198  0.765  27.239 1.00 0.00 ? 142 GLU A HB2  3  
ATOM   8351  H  HB3  . GLU A 1 142 ? 25.256  -0.206 28.366 1.00 0.00 ? 142 GLU A HB3  3  
ATOM   8352  H  HG2  . GLU A 1 142 ? 24.758  -1.344 26.413 1.00 0.00 ? 142 GLU A HG2  3  
ATOM   8353  H  HG3  . GLU A 1 142 ? 23.487  -0.126 26.345 1.00 0.00 ? 142 GLU A HG3  3  
ATOM   8354  N  N    . ASP A 1 143 ? 25.154  2.062  30.091 1.00 0.00 ? 143 ASP A N    3  
ATOM   8355  C  CA   . ASP A 1 143 ? 25.872  2.832  31.135 1.00 0.00 ? 143 ASP A CA   3  
ATOM   8356  C  C    . ASP A 1 143 ? 25.330  4.253  31.215 1.00 0.00 ? 143 ASP A C    3  
ATOM   8357  O  O    . ASP A 1 143 ? 25.802  5.057  31.995 1.00 0.00 ? 143 ASP A O    3  
ATOM   8358  C  CB   . ASP A 1 143 ? 27.362  2.887  30.760 1.00 0.00 ? 143 ASP A CB   3  
ATOM   8359  C  CG   . ASP A 1 143 ? 28.202  2.982  32.036 1.00 0.00 ? 143 ASP A CG   3  
ATOM   8360  O  OD1  . ASP A 1 143 ? 27.926  2.192  32.925 1.00 0.00 ? 143 ASP A OD1  3  
ATOM   8361  O  OD2  . ASP A 1 143 ? 29.070  3.838  32.050 1.00 0.00 ? 143 ASP A OD2  3  
ATOM   8362  H  H    . ASP A 1 143 ? 24.720  1.212  30.313 1.00 0.00 ? 143 ASP A H    3  
ATOM   8363  H  HA   . ASP A 1 143 ? 25.732  2.342  32.099 1.00 0.00 ? 143 ASP A HA   3  
ATOM   8364  H  HB2  . ASP A 1 143 ? 27.636  1.994  30.219 1.00 0.00 ? 143 ASP A HB2  3  
ATOM   8365  H  HB3  . ASP A 1 143 ? 27.553  3.752  30.142 1.00 0.00 ? 143 ASP A HB3  3  
ATOM   8366  N  N    . GLU A 1 144 ? 24.343  4.533  30.398 1.00 0.00 ? 144 GLU A N    3  
ATOM   8367  C  CA   . GLU A 1 144 ? 23.741  5.893  30.397 1.00 0.00 ? 144 GLU A CA   3  
ATOM   8368  C  C    . GLU A 1 144 ? 22.222  5.803  30.352 1.00 0.00 ? 144 GLU A C    3  
ATOM   8369  O  O    . GLU A 1 144 ? 21.540  6.798  30.211 1.00 0.00 ? 144 GLU A O    3  
ATOM   8370  C  CB   . GLU A 1 144 ? 24.225  6.639  29.145 1.00 0.00 ? 144 GLU A CB   3  
ATOM   8371  C  CG   . GLU A 1 144 ? 25.644  7.150  29.382 1.00 0.00 ? 144 GLU A CG   3  
ATOM   8372  C  CD   . GLU A 1 144 ? 26.218  7.665  28.063 1.00 0.00 ? 144 GLU A CD   3  
ATOM   8373  O  OE1  . GLU A 1 144 ? 26.172  6.897  27.117 1.00 0.00 ? 144 GLU A OE1  3  
ATOM   8374  O  OE2  . GLU A 1 144 ? 26.670  8.798  28.074 1.00 0.00 ? 144 GLU A OE2  3  
ATOM   8375  H  H    . GLU A 1 144 ? 24.002  3.846  29.787 1.00 0.00 ? 144 GLU A H    3  
ATOM   8376  H  HA   . GLU A 1 144 ? 24.038  6.419  31.301 1.00 0.00 ? 144 GLU A HA   3  
ATOM   8377  H  HB2  . GLU A 1 144 ? 24.216  5.970  28.298 1.00 0.00 ? 144 GLU A HB2  3  
ATOM   8378  H  HB3  . GLU A 1 144 ? 23.569  7.474  28.945 1.00 0.00 ? 144 GLU A HB3  3  
ATOM   8379  H  HG2  . GLU A 1 144 ? 25.631  7.953  30.103 1.00 0.00 ? 144 GLU A HG2  3  
ATOM   8380  H  HG3  . GLU A 1 144 ? 26.266  6.348  29.753 1.00 0.00 ? 144 GLU A HG3  3  
ATOM   8381  N  N    . ASN A 1 145 ? 21.719  4.604  30.473 1.00 0.00 ? 145 ASN A N    3  
ATOM   8382  C  CA   . ASN A 1 145 ? 20.248  4.418  30.439 1.00 0.00 ? 145 ASN A CA   3  
ATOM   8383  C  C    . ASN A 1 145 ? 19.632  4.651  31.817 1.00 0.00 ? 145 ASN A C    3  
ATOM   8384  O  O    . ASN A 1 145 ? 18.865  3.839  32.298 1.00 0.00 ? 145 ASN A O    3  
ATOM   8385  C  CB   . ASN A 1 145 ? 19.965  2.972  30.009 1.00 0.00 ? 145 ASN A CB   3  
ATOM   8386  C  CG   . ASN A 1 145 ? 20.722  2.013  30.934 1.00 0.00 ? 145 ASN A CG   3  
ATOM   8387  O  OD1  . ASN A 1 145 ? 21.735  1.450  30.569 1.00 0.00 ? 145 ASN A OD1  3  
ATOM   8388  N  ND2  . ASN A 1 145 ? 20.266  1.801  32.139 1.00 0.00 ? 145 ASN A ND2  3  
ATOM   8389  H  H    . ASN A 1 145 ? 22.312  3.830  30.583 1.00 0.00 ? 145 ASN A H    3  
ATOM   8390  H  HA   . ASN A 1 145 ? 19.815  5.122  29.731 1.00 0.00 ? 145 ASN A HA   3  
ATOM   8391  H  HB2  . ASN A 1 145 ? 18.906  2.771  30.074 1.00 0.00 ? 145 ASN A HB2  3  
ATOM   8392  H  HB3  . ASN A 1 145 ? 20.296  2.822  28.993 1.00 0.00 ? 145 ASN A HB3  3  
ATOM   8393  H  HD21 . ASN A 1 145 ? 19.451  2.254  32.441 1.00 0.00 ? 145 ASN A HD21 3  
ATOM   8394  H  HD22 . ASN A 1 145 ? 20.739  1.190  32.741 1.00 0.00 ? 145 ASN A HD22 3  
ATOM   8395  N  N    . THR A 1 146 ? 19.979  5.760  32.430 1.00 0.00 ? 146 THR A N    3  
ATOM   8396  C  CA   . THR A 1 146 ? 19.420  6.063  33.780 1.00 0.00 ? 146 THR A CA   3  
ATOM   8397  C  C    . THR A 1 146 ? 19.068  7.549  33.903 1.00 0.00 ? 146 THR A C    3  
ATOM   8398  O  O    . THR A 1 146 ? 19.486  8.362  33.103 1.00 0.00 ? 146 THR A O    3  
ATOM   8399  C  CB   . THR A 1 146 ? 20.489  5.719  34.823 1.00 0.00 ? 146 THR A CB   3  
ATOM   8400  O  OG1  . THR A 1 146 ? 21.668  5.498  34.083 1.00 0.00 ? 146 THR A OG1  3  
ATOM   8401  C  CG2  . THR A 1 146 ? 20.192  4.368  35.485 1.00 0.00 ? 146 THR A CG2  3  
ATOM   8402  H  H    . THR A 1 146 ? 20.607  6.385  32.004 1.00 0.00 ? 146 THR A H    3  
ATOM   8403  H  HA   . THR A 1 146 ? 18.523  5.470  33.933 1.00 0.00 ? 146 THR A HA   3  
ATOM   8404  H  HB   . THR A 1 146 ? 20.629  6.524  35.542 1.00 0.00 ? 146 THR A HB   3  
ATOM   8405  H  HG1  . THR A 1 146 ? 22.134  6.329  34.019 1.00 0.00 ? 146 THR A HG1  3  
ATOM   8406  H  HG21 . THR A 1 146 ? 19.133  4.280  35.678 1.00 0.00 ? 146 THR A HG21 3  
ATOM   8407  H  HG22 . THR A 1 146 ? 20.501  3.567  34.830 1.00 0.00 ? 146 THR A HG22 3  
ATOM   8408  H  HG23 . THR A 1 146 ? 20.732  4.293  36.417 1.00 0.00 ? 146 THR A HG23 3  
ATOM   8409  N  N    . PRO A 1 147 ? 18.289  7.870  34.917 1.00 0.00 ? 147 PRO A N    3  
ATOM   8410  C  CA   . PRO A 1 147 ? 17.872  9.249  35.156 1.00 0.00 ? 147 PRO A CA   3  
ATOM   8411  C  C    . PRO A 1 147 ? 19.075  10.168 35.344 1.00 0.00 ? 147 PRO A C    3  
ATOM   8412  O  O    . PRO A 1 147 ? 19.317  11.047 34.541 1.00 0.00 ? 147 PRO A O    3  
ATOM   8413  C  CB   . PRO A 1 147 ? 17.050  9.195  36.462 1.00 0.00 ? 147 PRO A CB   3  
ATOM   8414  C  CG   . PRO A 1 147 ? 17.022  7.708  36.931 1.00 0.00 ? 147 PRO A CG   3  
ATOM   8415  C  CD   . PRO A 1 147 ? 17.785  6.883  35.879 1.00 0.00 ? 147 PRO A CD   3  
ATOM   8416  H  HA   . PRO A 1 147 ? 17.265  9.597  34.326 1.00 0.00 ? 147 PRO A HA   3  
ATOM   8417  H  HB2  . PRO A 1 147 ? 17.512  9.814  37.217 1.00 0.00 ? 147 PRO A HB2  3  
ATOM   8418  H  HB3  . PRO A 1 147 ? 16.043  9.543  36.278 1.00 0.00 ? 147 PRO A HB3  3  
ATOM   8419  H  HG2  . PRO A 1 147 ? 17.503  7.616  37.893 1.00 0.00 ? 147 PRO A HG2  3  
ATOM   8420  H  HG3  . PRO A 1 147 ? 16.001  7.362  37.002 1.00 0.00 ? 147 PRO A HG3  3  
ATOM   8421  H  HD2  . PRO A 1 147 ? 18.604  6.352  36.333 1.00 0.00 ? 147 PRO A HD2  3  
ATOM   8422  H  HD3  . PRO A 1 147 ? 17.116  6.193  35.388 1.00 0.00 ? 147 PRO A HD3  3  
ATOM   8423  N  N    . GLU A 1 148 ? 19.808  9.949  36.401 1.00 0.00 ? 148 GLU A N    3  
ATOM   8424  C  CA   . GLU A 1 148 ? 20.995  10.802 36.649 1.00 0.00 ? 148 GLU A CA   3  
ATOM   8425  C  C    . GLU A 1 148 ? 21.936  10.779 35.452 1.00 0.00 ? 148 GLU A C    3  
ATOM   8426  O  O    . GLU A 1 148 ? 22.714  11.692 35.251 1.00 0.00 ? 148 GLU A O    3  
ATOM   8427  C  CB   . GLU A 1 148 ? 21.746  10.257 37.874 1.00 0.00 ? 148 GLU A CB   3  
ATOM   8428  C  CG   . GLU A 1 148 ? 20.738  9.790  38.926 1.00 0.00 ? 148 GLU A CG   3  
ATOM   8429  C  CD   . GLU A 1 148 ? 21.173  10.301 40.302 1.00 0.00 ? 148 GLU A CD   3  
ATOM   8430  O  OE1  . GLU A 1 148 ? 22.367  10.241 40.548 1.00 0.00 ? 148 GLU A OE1  3  
ATOM   8431  O  OE2  . GLU A 1 148 ? 20.288  10.725 41.027 1.00 0.00 ? 148 GLU A OE2  3  
ATOM   8432  H  H    . GLU A 1 148 ? 19.576  9.229  37.024 1.00 0.00 ? 148 GLU A H    3  
ATOM   8433  H  HA   . GLU A 1 148 ? 20.665  11.827 36.822 1.00 0.00 ? 148 GLU A HA   3  
ATOM   8434  H  HB2  . GLU A 1 148 ? 22.369  9.426  37.576 1.00 0.00 ? 148 GLU A HB2  3  
ATOM   8435  H  HB3  . GLU A 1 148 ? 22.371  11.034 38.291 1.00 0.00 ? 148 GLU A HB3  3  
ATOM   8436  H  HG2  . GLU A 1 148 ? 19.757  10.179 38.694 1.00 0.00 ? 148 GLU A HG2  3  
ATOM   8437  H  HG3  . GLU A 1 148 ? 20.699  8.710  38.944 1.00 0.00 ? 148 GLU A HG3  3  
ATOM   8438  N  N    . LYS A 1 149 ? 21.852  9.731  34.675 1.00 0.00 ? 149 LYS A N    3  
ATOM   8439  C  CA   . LYS A 1 149 ? 22.736  9.633  33.488 1.00 0.00 ? 149 LYS A CA   3  
ATOM   8440  C  C    . LYS A 1 149 ? 22.253  10.548 32.372 1.00 0.00 ? 149 LYS A C    3  
ATOM   8441  O  O    . LYS A 1 149 ? 23.001  11.361 31.869 1.00 0.00 ? 149 LYS A O    3  
ATOM   8442  C  CB   . LYS A 1 149 ? 22.714  8.183  32.984 1.00 0.00 ? 149 LYS A CB   3  
ATOM   8443  C  CG   . LYS A 1 149 ? 23.817  7.388  33.694 1.00 0.00 ? 149 LYS A CG   3  
ATOM   8444  C  CD   . LYS A 1 149 ? 23.696  7.602  35.208 1.00 0.00 ? 149 LYS A CD   3  
ATOM   8445  C  CE   . LYS A 1 149 ? 24.489  6.515  35.939 1.00 0.00 ? 149 LYS A CE   3  
ATOM   8446  N  NZ   . LYS A 1 149 ? 23.954  6.319  37.316 1.00 0.00 ? 149 LYS A NZ   3  
ATOM   8447  H  H    . LYS A 1 149 ? 21.211  9.016  34.874 1.00 0.00 ? 149 LYS A H    3  
ATOM   8448  H  HA   . LYS A 1 149 ? 23.743  9.925  33.772 1.00 0.00 ? 149 LYS A HA   3  
ATOM   8449  H  HB2  . LYS A 1 149 ? 21.755  7.741  33.194 1.00 0.00 ? 149 LYS A HB2  3  
ATOM   8450  H  HB3  . LYS A 1 149 ? 22.886  8.170  31.920 1.00 0.00 ? 149 LYS A HB3  3  
ATOM   8451  H  HG2  . LYS A 1 149 ? 23.711  6.338  33.466 1.00 0.00 ? 149 LYS A HG2  3  
ATOM   8452  H  HG3  . LYS A 1 149 ? 24.784  7.728  33.357 1.00 0.00 ? 149 LYS A HG3  3  
ATOM   8453  H  HD2  . LYS A 1 149 ? 24.090  8.574  35.469 1.00 0.00 ? 149 LYS A HD2  3  
ATOM   8454  H  HD3  . LYS A 1 149 ? 22.658  7.553  35.501 1.00 0.00 ? 149 LYS A HD3  3  
ATOM   8455  H  HE2  . LYS A 1 149 ? 24.412  5.584  35.397 1.00 0.00 ? 149 LYS A HE2  3  
ATOM   8456  H  HE3  . LYS A 1 149 ? 25.528  6.802  36.000 1.00 0.00 ? 149 LYS A HE3  3  
ATOM   8457  H  HZ1  . LYS A 1 149 ? 22.927  6.483  37.317 1.00 0.00 ? 149 LYS A HZ1  3  
ATOM   8458  H  HZ2  . LYS A 1 149 ? 24.149  5.346  37.628 1.00 0.00 ? 149 LYS A HZ2  3  
ATOM   8459  H  HZ3  . LYS A 1 149 ? 24.413  6.988  37.966 1.00 0.00 ? 149 LYS A HZ3  3  
ATOM   8460  N  N    . ARG A 1 150 ? 21.011  10.401 32.001 1.00 0.00 ? 150 ARG A N    3  
ATOM   8461  C  CA   . ARG A 1 150 ? 20.472  11.261 30.917 1.00 0.00 ? 150 ARG A CA   3  
ATOM   8462  C  C    . ARG A 1 150 ? 20.321  12.696 31.389 1.00 0.00 ? 150 ARG A C    3  
ATOM   8463  O  O    . ARG A 1 150 ? 20.517  13.627 30.625 1.00 0.00 ? 150 ARG A O    3  
ATOM   8464  C  CB   . ARG A 1 150 ? 19.090  10.738 30.511 1.00 0.00 ? 150 ARG A CB   3  
ATOM   8465  C  CG   . ARG A 1 150 ? 19.212  9.281  30.059 1.00 0.00 ? 150 ARG A CG   3  
ATOM   8466  C  CD   . ARG A 1 150 ? 17.813  8.665  29.967 1.00 0.00 ? 150 ARG A CD   3  
ATOM   8467  N  NE   . ARG A 1 150 ? 16.988  9.472  29.025 1.00 0.00 ? 150 ARG A NE   3  
ATOM   8468  C  CZ   . ARG A 1 150 ? 15.716  9.207  28.900 1.00 0.00 ? 150 ARG A CZ   3  
ATOM   8469  N  NH1  . ARG A 1 150 ? 15.348  7.979  28.658 1.00 0.00 ? 150 ARG A NH1  3  
ATOM   8470  N  NH2  . ARG A 1 150 ? 14.855  10.181 29.016 1.00 0.00 ? 150 ARG A NH2  3  
ATOM   8471  H  H    . ARG A 1 150 ? 20.441  9.728  32.431 1.00 0.00 ? 150 ARG A H    3  
ATOM   8472  H  HA   . ARG A 1 150 ? 21.158  11.240 30.072 1.00 0.00 ? 150 ARG A HA   3  
ATOM   8473  H  HB2  . ARG A 1 150 ? 18.419  10.803 31.354 1.00 0.00 ? 150 ARG A HB2  3  
ATOM   8474  H  HB3  . ARG A 1 150 ? 18.702  11.339 29.702 1.00 0.00 ? 150 ARG A HB3  3  
ATOM   8475  H  HG2  . ARG A 1 150 ? 19.692  9.240  29.092 1.00 0.00 ? 150 ARG A HG2  3  
ATOM   8476  H  HG3  . ARG A 1 150 ? 19.807  8.727  30.772 1.00 0.00 ? 150 ARG A HG3  3  
ATOM   8477  H  HD2  . ARG A 1 150 ? 17.882  7.650  29.603 1.00 0.00 ? 150 ARG A HD2  3  
ATOM   8478  H  HD3  . ARG A 1 150 ? 17.347  8.666  30.940 1.00 0.00 ? 150 ARG A HD3  3  
ATOM   8479  H  HE   . ARG A 1 150 ? 17.396  10.196 28.506 1.00 0.00 ? 150 ARG A HE   3  
ATOM   8480  H  HH11 . ARG A 1 150 ? 16.036  7.258  28.574 1.00 0.00 ? 150 ARG A HH11 3  
ATOM   8481  H  HH12 . ARG A 1 150 ? 14.377  7.758  28.560 1.00 0.00 ? 150 ARG A HH12 3  
ATOM   8482  H  HH21 . ARG A 1 150 ? 15.174  11.111 29.200 1.00 0.00 ? 150 ARG A HH21 3  
ATOM   8483  H  HH22 . ARG A 1 150 ? 13.876  9.997  28.924 1.00 0.00 ? 150 ARG A HH22 3  
ATOM   8484  N  N    . ALA A 1 151 ? 19.963  12.861 32.635 1.00 0.00 ? 151 ALA A N    3  
ATOM   8485  C  CA   . ALA A 1 151 ? 19.800  14.233 33.157 1.00 0.00 ? 151 ALA A CA   3  
ATOM   8486  C  C    . ALA A 1 151 ? 20.977  15.086 32.730 1.00 0.00 ? 151 ALA A C    3  
ATOM   8487  O  O    . ALA A 1 151 ? 20.826  16.246 32.404 1.00 0.00 ? 151 ALA A O    3  
ATOM   8488  C  CB   . ALA A 1 151 ? 19.758  14.172 34.691 1.00 0.00 ? 151 ALA A CB   3  
ATOM   8489  H  H    . ALA A 1 151 ? 19.803  12.085 33.212 1.00 0.00 ? 151 ALA A H    3  
ATOM   8490  H  HA   . ALA A 1 151 ? 18.883  14.662 32.756 1.00 0.00 ? 151 ALA A HA   3  
ATOM   8491  H  HB1  . ALA A 1 151 ? 19.079  13.397 35.008 1.00 0.00 ? 151 ALA A HB1  3  
ATOM   8492  H  HB2  . ALA A 1 151 ? 20.746  13.960 35.075 1.00 0.00 ? 151 ALA A HB2  3  
ATOM   8493  H  HB3  . ALA A 1 151 ? 19.422  15.120 35.083 1.00 0.00 ? 151 ALA A HB3  3  
ATOM   8494  N  N    . GLU A 1 152 ? 22.138  14.489 32.735 1.00 0.00 ? 152 GLU A N    3  
ATOM   8495  C  CA   . GLU A 1 152 ? 23.337  15.244 32.333 1.00 0.00 ? 152 GLU A CA   3  
ATOM   8496  C  C    . GLU A 1 152 ? 23.235  15.652 30.872 1.00 0.00 ? 152 GLU A C    3  
ATOM   8497  O  O    . GLU A 1 152 ? 23.776  16.664 30.471 1.00 0.00 ? 152 GLU A O    3  
ATOM   8498  C  CB   . GLU A 1 152 ? 24.566  14.343 32.514 1.00 0.00 ? 152 GLU A CB   3  
ATOM   8499  C  CG   . GLU A 1 152 ? 25.774  15.216 32.855 1.00 0.00 ? 152 GLU A CG   3  
ATOM   8500  C  CD   . GLU A 1 152 ? 26.958  14.320 33.217 1.00 0.00 ? 152 GLU A CD   3  
ATOM   8501  O  OE1  . GLU A 1 152 ? 26.691  13.275 33.787 1.00 0.00 ? 152 GLU A OE1  3  
ATOM   8502  O  OE2  . GLU A 1 152 ? 28.062  14.729 32.902 1.00 0.00 ? 152 GLU A OE2  3  
ATOM   8503  H  H    . GLU A 1 152 ? 22.212  13.549 33.005 1.00 0.00 ? 152 GLU A H    3  
ATOM   8504  H  HA   . GLU A 1 152 ? 23.417  16.139 32.949 1.00 0.00 ? 152 GLU A HA   3  
ATOM   8505  H  HB2  . GLU A 1 152 ? 24.388  13.641 33.315 1.00 0.00 ? 152 GLU A HB2  3  
ATOM   8506  H  HB3  . GLU A 1 152 ? 24.757  13.800 31.601 1.00 0.00 ? 152 GLU A HB3  3  
ATOM   8507  H  HG2  . GLU A 1 152 ? 26.036  15.827 32.004 1.00 0.00 ? 152 GLU A HG2  3  
ATOM   8508  H  HG3  . GLU A 1 152 ? 25.541  15.855 33.695 1.00 0.00 ? 152 GLU A HG3  3  
ATOM   8509  N  N    . LYS A 1 153 ? 22.538  14.858 30.093 1.00 0.00 ? 153 LYS A N    3  
ATOM   8510  C  CA   . LYS A 1 153 ? 22.403  15.205 28.661 1.00 0.00 ? 153 LYS A CA   3  
ATOM   8511  C  C    . LYS A 1 153 ? 21.571  16.467 28.512 1.00 0.00 ? 153 LYS A C    3  
ATOM   8512  O  O    . LYS A 1 153 ? 22.050  17.485 28.044 1.00 0.00 ? 153 LYS A O    3  
ATOM   8513  C  CB   . LYS A 1 153 ? 21.692  14.053 27.932 1.00 0.00 ? 153 LYS A CB   3  
ATOM   8514  C  CG   . LYS A 1 153 ? 22.383  12.731 28.272 1.00 0.00 ? 153 LYS A CG   3  
ATOM   8515  C  CD   . LYS A 1 153 ? 23.649  12.587 27.421 1.00 0.00 ? 153 LYS A CD   3  
ATOM   8516  C  CE   . LYS A 1 153 ? 24.578  11.566 28.079 1.00 0.00 ? 153 LYS A CE   3  
ATOM   8517  N  NZ   . LYS A 1 153 ? 23.918  10.234 28.153 1.00 0.00 ? 153 LYS A NZ   3  
ATOM   8518  H  H    . LYS A 1 153 ? 22.107  14.041 30.454 1.00 0.00 ? 153 LYS A H    3  
ATOM   8519  H  HA   . LYS A 1 153 ? 23.392  15.383 28.243 1.00 0.00 ? 153 LYS A HA   3  
ATOM   8520  H  HB2  . LYS A 1 153 ? 20.658  14.012 28.241 1.00 0.00 ? 153 LYS A HB2  3  
ATOM   8521  H  HB3  . LYS A 1 153 ? 21.734  14.219 26.865 1.00 0.00 ? 153 LYS A HB3  3  
ATOM   8522  H  HG2  . LYS A 1 153 ? 22.644  12.715 29.319 1.00 0.00 ? 153 LYS A HG2  3  
ATOM   8523  H  HG3  . LYS A 1 153 ? 21.713  11.909 28.062 1.00 0.00 ? 153 LYS A HG3  3  
ATOM   8524  H  HD2  . LYS A 1 153 ? 23.386  12.251 26.430 1.00 0.00 ? 153 LYS A HD2  3  
ATOM   8525  H  HD3  . LYS A 1 153 ? 24.151  13.539 27.351 1.00 0.00 ? 153 LYS A HD3  3  
ATOM   8526  H  HE2  . LYS A 1 153 ? 25.486  11.479 27.500 1.00 0.00 ? 153 LYS A HE2  3  
ATOM   8527  H  HE3  . LYS A 1 153 ? 24.827  11.894 29.078 1.00 0.00 ? 153 LYS A HE3  3  
ATOM   8528  H  HZ1  . LYS A 1 153 ? 22.908  10.358 28.369 1.00 0.00 ? 153 LYS A HZ1  3  
ATOM   8529  H  HZ2  . LYS A 1 153 ? 24.018  9.746  27.240 1.00 0.00 ? 153 LYS A HZ2  3  
ATOM   8530  H  HZ3  . LYS A 1 153 ? 24.366  9.665  28.901 1.00 0.00 ? 153 LYS A HZ3  3  
ATOM   8531  N  N    . ILE A 1 154 ? 20.336  16.386 28.920 1.00 0.00 ? 154 ILE A N    3  
ATOM   8532  C  CA   . ILE A 1 154 ? 19.469  17.576 28.807 1.00 0.00 ? 154 ILE A CA   3  
ATOM   8533  C  C    . ILE A 1 154 ? 20.139  18.769 29.459 1.00 0.00 ? 154 ILE A C    3  
ATOM   8534  O  O    . ILE A 1 154 ? 20.596  19.666 28.786 1.00 0.00 ? 154 ILE A O    3  
ATOM   8535  C  CB   . ILE A 1 154 ? 18.164  17.300 29.531 1.00 0.00 ? 154 ILE A CB   3  
ATOM   8536  C  CG1  . ILE A 1 154 ? 17.425  16.160 28.846 1.00 0.00 ? 154 ILE A CG1  3  
ATOM   8537  C  CG2  . ILE A 1 154 ? 17.289  18.563 29.462 1.00 0.00 ? 154 ILE A CG2  3  
ATOM   8538  C  CD1  . ILE A 1 154 ? 16.646  15.363 29.892 1.00 0.00 ? 154 ILE A CD1  3  
ATOM   8539  H  H    . ILE A 1 154 ? 19.991  15.547 29.303 1.00 0.00 ? 154 ILE A H    3  
ATOM   8540  H  HA   . ILE A 1 154 ? 19.295  17.794 27.755 1.00 0.00 ? 154 ILE A HA   3  
ATOM   8541  H  HB   . ILE A 1 154 ? 18.380  17.030 30.561 1.00 0.00 ? 154 ILE A HB   3  
ATOM   8542  H  HG12 . ILE A 1 154 ? 16.741  16.560 28.112 1.00 0.00 ? 154 ILE A HG12 3  
ATOM   8543  H  HG13 . ILE A 1 154 ? 18.136  15.512 28.350 1.00 0.00 ? 154 ILE A HG13 3  
ATOM   8544  H  HG21 . ILE A 1 154 ? 17.221  18.903 28.438 1.00 0.00 ? 154 ILE A HG21 3  
ATOM   8545  H  HG22 . ILE A 1 154 ? 16.298  18.342 29.830 1.00 0.00 ? 154 ILE A HG22 3  
ATOM   8546  H  HG23 . ILE A 1 154 ? 17.727  19.343 30.066 1.00 0.00 ? 154 ILE A HG23 3  
ATOM   8547  H  HD11 . ILE A 1 154 ? 17.320  15.010 30.658 1.00 0.00 ? 154 ILE A HD11 3  
ATOM   8548  H  HD12 . ILE A 1 154 ? 15.893  15.993 30.344 1.00 0.00 ? 154 ILE A HD12 3  
ATOM   8549  H  HD13 . ILE A 1 154 ? 16.165  14.516 29.423 1.00 0.00 ? 154 ILE A HD13 3  
ATOM   8550  N  N    . TRP A 1 155 ? 20.189  18.758 30.767 1.00 0.00 ? 155 TRP A N    3  
ATOM   8551  C  CA   . TRP A 1 155 ? 20.831  19.891 31.467 1.00 0.00 ? 155 TRP A CA   3  
ATOM   8552  C  C    . TRP A 1 155 ? 22.146  20.224 30.799 1.00 0.00 ? 155 TRP A C    3  
ATOM   8553  O  O    . TRP A 1 155 ? 22.647  21.327 30.908 1.00 0.00 ? 155 TRP A O    3  
ATOM   8554  C  CB   . TRP A 1 155 ? 21.110  19.480 32.917 1.00 0.00 ? 155 TRP A CB   3  
ATOM   8555  C  CG   . TRP A 1 155 ? 21.671  20.684 33.669 1.00 0.00 ? 155 TRP A CG   3  
ATOM   8556  C  CD1  . TRP A 1 155 ? 22.962  20.922 33.848 1.00 0.00 ? 155 TRP A CD1  3  
ATOM   8557  C  CD2  . TRP A 1 155 ? 20.942  21.627 34.195 1.00 0.00 ? 155 TRP A CD2  3  
ATOM   8558  N  NE1  . TRP A 1 155 ? 22.977  22.087 34.522 1.00 0.00 ? 155 TRP A NE1  3  
ATOM   8559  C  CE2  . TRP A 1 155 ? 21.720  22.604 34.783 1.00 0.00 ? 155 TRP A CE2  3  
ATOM   8560  C  CE3  . TRP A 1 155 ? 19.569  21.734 34.210 1.00 0.00 ? 155 TRP A CE3  3  
ATOM   8561  C  CZ2  . TRP A 1 155 ? 21.120  23.689 35.387 1.00 0.00 ? 155 TRP A CZ2  3  
ATOM   8562  C  CZ3  . TRP A 1 155 ? 18.969  22.819 34.814 1.00 0.00 ? 155 TRP A CZ3  3  
ATOM   8563  C  CH2  . TRP A 1 155 ? 19.745  23.796 35.402 1.00 0.00 ? 155 TRP A CH2  3  
ATOM   8564  H  H    . TRP A 1 155 ? 19.811  18.008 31.273 1.00 0.00 ? 155 TRP A H    3  
ATOM   8565  H  HA   . TRP A 1 155 ? 20.173  20.761 31.423 1.00 0.00 ? 155 TRP A HA   3  
ATOM   8566  H  HB2  . TRP A 1 155 ? 20.195  19.156 33.390 1.00 0.00 ? 155 TRP A HB2  3  
ATOM   8567  H  HB3  . TRP A 1 155 ? 21.830  18.675 32.940 1.00 0.00 ? 155 TRP A HB3  3  
ATOM   8568  H  HD1  . TRP A 1 155 ? 23.802  20.324 33.528 1.00 0.00 ? 155 TRP A HD1  3  
ATOM   8569  H  HE1  . TRP A 1 155 ? 23.805  22.532 34.801 1.00 0.00 ? 155 TRP A HE1  3  
ATOM   8570  H  HE3  . TRP A 1 155 ? 18.965  20.969 33.749 1.00 0.00 ? 155 TRP A HE3  3  
ATOM   8571  H  HZ2  . TRP A 1 155 ? 21.724  24.455 35.844 1.00 0.00 ? 155 TRP A HZ2  3  
ATOM   8572  H  HZ3  . TRP A 1 155 ? 17.893  22.902 34.830 1.00 0.00 ? 155 TRP A HZ3  3  
ATOM   8573  H  HH2  . TRP A 1 155 ? 19.277  24.646 35.870 1.00 0.00 ? 155 TRP A HH2  3  
ATOM   8574  N  N    . GLY A 1 156 ? 22.687  19.255 30.116 1.00 0.00 ? 156 GLY A N    3  
ATOM   8575  C  CA   . GLY A 1 156 ? 23.974  19.481 29.424 1.00 0.00 ? 156 GLY A CA   3  
ATOM   8576  C  C    . GLY A 1 156 ? 23.789  20.477 28.284 1.00 0.00 ? 156 GLY A C    3  
ATOM   8577  O  O    . GLY A 1 156 ? 24.696  21.213 27.952 1.00 0.00 ? 156 GLY A O    3  
ATOM   8578  H  H    . GLY A 1 156 ? 22.245  18.381 30.061 1.00 0.00 ? 156 GLY A H    3  
ATOM   8579  H  HA2  . GLY A 1 156 ? 24.694  19.873 30.127 1.00 0.00 ? 156 GLY A HA2  3  
ATOM   8580  H  HA3  . GLY A 1 156 ? 24.337  18.545 29.026 1.00 0.00 ? 156 GLY A HA3  3  
ATOM   8581  N  N    . PHE A 1 157 ? 22.614  20.487 27.701 1.00 0.00 ? 157 PHE A N    3  
ATOM   8582  C  CA   . PHE A 1 157 ? 22.387  21.442 26.585 1.00 0.00 ? 157 PHE A CA   3  
ATOM   8583  C  C    . PHE A 1 157 ? 22.640  22.872 27.049 1.00 0.00 ? 157 PHE A C    3  
ATOM   8584  O  O    . PHE A 1 157 ? 23.543  23.527 26.572 1.00 0.00 ? 157 PHE A O    3  
ATOM   8585  C  CB   . PHE A 1 157 ? 20.930  21.322 26.098 1.00 0.00 ? 157 PHE A CB   3  
ATOM   8586  C  CG   . PHE A 1 157 ? 20.847  20.253 25.002 1.00 0.00 ? 157 PHE A CG   3  
ATOM   8587  C  CD1  . PHE A 1 157 ? 21.644  20.337 23.869 1.00 0.00 ? 157 PHE A CD1  3  
ATOM   8588  C  CD2  . PHE A 1 157 ? 19.978  19.183 25.131 1.00 0.00 ? 157 PHE A CD2  3  
ATOM   8589  C  CE1  . PHE A 1 157 ? 21.570  19.368 22.889 1.00 0.00 ? 157 PHE A CE1  3  
ATOM   8590  C  CE2  . PHE A 1 157 ? 19.909  18.217 24.149 1.00 0.00 ? 157 PHE A CE2  3  
ATOM   8591  C  CZ   . PHE A 1 157 ? 20.703  18.311 23.030 1.00 0.00 ? 157 PHE A CZ   3  
ATOM   8592  H  H    . PHE A 1 157 ? 21.895  19.867 27.999 1.00 0.00 ? 157 PHE A H    3  
ATOM   8593  H  HA   . PHE A 1 157 ? 23.084  21.209 25.783 1.00 0.00 ? 157 PHE A HA   3  
ATOM   8594  H  HB2  . PHE A 1 157 ? 20.290  21.043 26.918 1.00 0.00 ? 157 PHE A HB2  3  
ATOM   8595  H  HB3  . PHE A 1 157 ? 20.600  22.269 25.696 1.00 0.00 ? 157 PHE A HB3  3  
ATOM   8596  H  HD1  . PHE A 1 157 ? 22.320  21.170 23.748 1.00 0.00 ? 157 PHE A HD1  3  
ATOM   8597  H  HD2  . PHE A 1 157 ? 19.349  19.106 26.004 1.00 0.00 ? 157 PHE A HD2  3  
ATOM   8598  H  HE1  . PHE A 1 157 ? 22.196  19.439 22.012 1.00 0.00 ? 157 PHE A HE1  3  
ATOM   8599  H  HE2  . PHE A 1 157 ? 19.228  17.386 24.256 1.00 0.00 ? 157 PHE A HE2  3  
ATOM   8600  H  HZ   . PHE A 1 157 ? 20.648  17.553 22.262 1.00 0.00 ? 157 PHE A HZ   3  
ATOM   8601  N  N    . PHE A 1 158 ? 21.837  23.335 27.972 1.00 0.00 ? 158 PHE A N    3  
ATOM   8602  C  CA   . PHE A 1 158 ? 22.031  24.718 28.466 1.00 0.00 ? 158 PHE A CA   3  
ATOM   8603  C  C    . PHE A 1 158 ? 23.486  24.939 28.872 1.00 0.00 ? 158 PHE A C    3  
ATOM   8604  O  O    . PHE A 1 158 ? 24.103  25.905 28.472 1.00 0.00 ? 158 PHE A O    3  
ATOM   8605  C  CB   . PHE A 1 158 ? 21.131  24.929 29.691 1.00 0.00 ? 158 PHE A CB   3  
ATOM   8606  C  CG   . PHE A 1 158 ? 19.742  24.355 29.399 1.00 0.00 ? 158 PHE A CG   3  
ATOM   8607  C  CD1  . PHE A 1 158 ? 19.513  22.994 29.491 1.00 0.00 ? 158 PHE A CD1  3  
ATOM   8608  C  CD2  . PHE A 1 158 ? 18.699  25.188 29.030 1.00 0.00 ? 158 PHE A CD2  3  
ATOM   8609  C  CE1  . PHE A 1 158 ? 18.265  22.476 29.218 1.00 0.00 ? 158 PHE A CE1  3  
ATOM   8610  C  CE2  . PHE A 1 158 ? 17.450  24.666 28.759 1.00 0.00 ? 158 PHE A CE2  3  
ATOM   8611  C  CZ   . PHE A 1 158 ? 17.235  23.312 28.853 1.00 0.00 ? 158 PHE A CZ   3  
ATOM   8612  H  H    . PHE A 1 158 ? 21.114  22.777 28.330 1.00 0.00 ? 158 PHE A H    3  
ATOM   8613  H  HA   . PHE A 1 158 ? 21.775  25.418 27.671 1.00 0.00 ? 158 PHE A HA   3  
ATOM   8614  H  HB2  . PHE A 1 158 ? 21.554  24.425 30.548 1.00 0.00 ? 158 PHE A HB2  3  
ATOM   8615  H  HB3  . PHE A 1 158 ? 21.043  25.986 29.904 1.00 0.00 ? 158 PHE A HB3  3  
ATOM   8616  H  HD1  . PHE A 1 158 ? 20.317  22.332 29.779 1.00 0.00 ? 158 PHE A HD1  3  
ATOM   8617  H  HD2  . PHE A 1 158 ? 18.862  26.253 28.955 1.00 0.00 ? 158 PHE A HD2  3  
ATOM   8618  H  HE1  . PHE A 1 158 ? 18.094  21.413 29.290 1.00 0.00 ? 158 PHE A HE1  3  
ATOM   8619  H  HE2  . PHE A 1 158 ? 16.642  25.322 28.471 1.00 0.00 ? 158 PHE A HE2  3  
ATOM   8620  H  HZ   . PHE A 1 158 ? 16.259  22.903 28.640 1.00 0.00 ? 158 PHE A HZ   3  
ATOM   8621  N  N    . GLY A 1 159 ? 24.009  24.033 29.663 1.00 0.00 ? 159 GLY A N    3  
ATOM   8622  C  CA   . GLY A 1 159 ? 25.429  24.174 30.108 1.00 0.00 ? 159 GLY A CA   3  
ATOM   8623  C  C    . GLY A 1 159 ? 25.628  25.493 30.852 1.00 0.00 ? 159 GLY A C    3  
ATOM   8624  O  O    . GLY A 1 159 ? 25.780  26.533 30.240 1.00 0.00 ? 159 GLY A O    3  
ATOM   8625  H  H    . GLY A 1 159 ? 23.472  23.270 29.962 1.00 0.00 ? 159 GLY A H    3  
ATOM   8626  H  HA2  . GLY A 1 159 ? 25.678  23.353 30.766 1.00 0.00 ? 159 GLY A HA2  3  
ATOM   8627  H  HA3  . GLY A 1 159 ? 26.078  24.148 29.246 1.00 0.00 ? 159 GLY A HA3  3  
ATOM   8628  N  N    . LYS A 1 160 ? 25.627  25.416 32.160 1.00 0.00 ? 160 LYS A N    3  
ATOM   8629  C  CA   . LYS A 1 160 ? 25.813  26.649 32.977 1.00 0.00 ? 160 LYS A CA   3  
ATOM   8630  C  C    . LYS A 1 160 ? 27.057  26.563 33.860 1.00 0.00 ? 160 LYS A C    3  
ATOM   8631  O  O    . LYS A 1 160 ? 27.838  25.636 33.759 1.00 0.00 ? 160 LYS A O    3  
ATOM   8632  C  CB   . LYS A 1 160 ? 24.593  26.797 33.881 1.00 0.00 ? 160 LYS A CB   3  
ATOM   8633  C  CG   . LYS A 1 160 ? 23.405  27.257 33.042 1.00 0.00 ? 160 LYS A CG   3  
ATOM   8634  C  CD   . LYS A 1 160 ? 22.164  27.298 33.928 1.00 0.00 ? 160 LYS A CD   3  
ATOM   8635  C  CE   . LYS A 1 160 ? 20.937  27.542 33.059 1.00 0.00 ? 160 LYS A CE   3  
ATOM   8636  N  NZ   . LYS A 1 160 ? 20.681  26.370 32.177 1.00 0.00 ? 160 LYS A NZ   3  
ATOM   8637  H  H    . LYS A 1 160 ? 25.495  24.551 32.600 1.00 0.00 ? 160 LYS A H    3  
ATOM   8638  H  HA   . LYS A 1 160 ? 25.906  27.509 32.321 1.00 0.00 ? 160 LYS A HA   3  
ATOM   8639  H  HB2  . LYS A 1 160 ? 24.366  25.847 34.340 1.00 0.00 ? 160 LYS A HB2  3  
ATOM   8640  H  HB3  . LYS A 1 160 ? 24.796  27.523 34.652 1.00 0.00 ? 160 LYS A HB3  3  
ATOM   8641  H  HG2  . LYS A 1 160 ? 23.600  28.241 32.642 1.00 0.00 ? 160 LYS A HG2  3  
ATOM   8642  H  HG3  . LYS A 1 160 ? 23.247  26.567 32.226 1.00 0.00 ? 160 LYS A HG3  3  
ATOM   8643  H  HD2  . LYS A 1 160 ? 22.059  26.356 34.447 1.00 0.00 ? 160 LYS A HD2  3  
ATOM   8644  H  HD3  . LYS A 1 160 ? 22.261  28.093 34.651 1.00 0.00 ? 160 LYS A HD3  3  
ATOM   8645  H  HE2  . LYS A 1 160 ? 20.077  27.705 33.689 1.00 0.00 ? 160 LYS A HE2  3  
ATOM   8646  H  HE3  . LYS A 1 160 ? 21.097  28.416 32.445 1.00 0.00 ? 160 LYS A HE3  3  
ATOM   8647  H  HZ1  . LYS A 1 160 ? 21.520  26.186 31.593 1.00 0.00 ? 160 LYS A HZ1  3  
ATOM   8648  H  HZ2  . LYS A 1 160 ? 20.474  25.534 32.760 1.00 0.00 ? 160 LYS A HZ2  3  
ATOM   8649  H  HZ3  . LYS A 1 160 ? 19.868  26.571 31.560 1.00 0.00 ? 160 LYS A HZ3  3  
ATOM   8650  N  N    . LYS A 1 161 ? 27.212  27.547 34.711 1.00 0.00 ? 161 LYS A N    3  
ATOM   8651  C  CA   . LYS A 1 161 ? 28.387  27.569 35.622 1.00 0.00 ? 161 LYS A CA   3  
ATOM   8652  C  C    . LYS A 1 161 ? 28.229  28.681 36.657 1.00 0.00 ? 161 LYS A C    3  
ATOM   8653  O  O    . LYS A 1 161 ? 27.876  29.793 36.323 1.00 0.00 ? 161 LYS A O    3  
ATOM   8654  C  CB   . LYS A 1 161 ? 29.651  27.843 34.787 1.00 0.00 ? 161 LYS A CB   3  
ATOM   8655  C  CG   . LYS A 1 161 ? 30.880  27.325 35.549 1.00 0.00 ? 161 LYS A CG   3  
ATOM   8656  C  CD   . LYS A 1 161 ? 31.128  25.860 35.178 1.00 0.00 ? 161 LYS A CD   3  
ATOM   8657  C  CE   . LYS A 1 161 ? 32.307  25.782 34.204 1.00 0.00 ? 161 LYS A CE   3  
ATOM   8658  N  NZ   . LYS A 1 161 ? 33.599  25.913 34.938 1.00 0.00 ? 161 LYS A NZ   3  
ATOM   8659  H  H    . LYS A 1 161 ? 26.552  28.269 34.747 1.00 0.00 ? 161 LYS A H    3  
ATOM   8660  H  HA   . LYS A 1 161 ? 28.458  26.612 36.137 1.00 0.00 ? 161 LYS A HA   3  
ATOM   8661  H  HB2  . LYS A 1 161 ? 29.574  27.339 33.836 1.00 0.00 ? 161 LYS A HB2  3  
ATOM   8662  H  HB3  . LYS A 1 161 ? 29.752  28.905 34.619 1.00 0.00 ? 161 LYS A HB3  3  
ATOM   8663  H  HG2  . LYS A 1 161 ? 31.744  27.918 35.285 1.00 0.00 ? 161 LYS A HG2  3  
ATOM   8664  H  HG3  . LYS A 1 161 ? 30.709  27.406 36.611 1.00 0.00 ? 161 LYS A HG3  3  
ATOM   8665  H  HD2  . LYS A 1 161 ? 31.356  25.295 36.068 1.00 0.00 ? 161 LYS A HD2  3  
ATOM   8666  H  HD3  . LYS A 1 161 ? 30.246  25.448 34.713 1.00 0.00 ? 161 LYS A HD3  3  
ATOM   8667  H  HE2  . LYS A 1 161 ? 32.289  24.835 33.688 1.00 0.00 ? 161 LYS A HE2  3  
ATOM   8668  H  HE3  . LYS A 1 161 ? 32.232  26.580 33.479 1.00 0.00 ? 161 LYS A HE3  3  
ATOM   8669  H  HZ1  . LYS A 1 161 ? 33.411  25.987 35.959 1.00 0.00 ? 161 LYS A HZ1  3  
ATOM   8670  H  HZ2  . LYS A 1 161 ? 34.189  25.077 34.754 1.00 0.00 ? 161 LYS A HZ2  3  
ATOM   8671  H  HZ3  . LYS A 1 161 ? 34.097  26.767 34.615 1.00 0.00 ? 161 LYS A HZ3  3  
ATOM   8672  N  N    . ASP A 1 162 ? 28.490  28.363 37.896 1.00 0.00 ? 162 ASP A N    3  
ATOM   8673  C  CA   . ASP A 1 162 ? 28.357  29.395 38.957 1.00 0.00 ? 162 ASP A CA   3  
ATOM   8674  C  C    . ASP A 1 162 ? 26.883  29.709 39.210 1.00 0.00 ? 162 ASP A C    3  
ATOM   8675  O  O    . ASP A 1 162 ? 26.489  30.010 40.321 1.00 0.00 ? 162 ASP A O    3  
ATOM   8676  C  CB   . ASP A 1 162 ? 29.095  30.678 38.486 1.00 0.00 ? 162 ASP A CB   3  
ATOM   8677  C  CG   . ASP A 1 162 ? 28.087  31.759 38.057 1.00 0.00 ? 162 ASP A CG   3  
ATOM   8678  O  OD1  . ASP A 1 162 ? 27.315  32.150 38.916 1.00 0.00 ? 162 ASP A OD1  3  
ATOM   8679  O  OD2  . ASP A 1 162 ? 28.155  32.134 36.898 1.00 0.00 ? 162 ASP A OD2  3  
ATOM   8680  H  H    . ASP A 1 162 ? 28.774  27.453 38.124 1.00 0.00 ? 162 ASP A H    3  
ATOM   8681  H  HA   . ASP A 1 162 ? 28.798  29.011 39.878 1.00 0.00 ? 162 ASP A HA   3  
ATOM   8682  H  HB2  . ASP A 1 162 ? 29.702  31.062 39.293 1.00 0.00 ? 162 ASP A HB2  3  
ATOM   8683  H  HB3  . ASP A 1 162 ? 29.734  30.439 37.648 1.00 0.00 ? 162 ASP A HB3  3  
ATOM   8684  N  N    . ASP A 1 163 ? 26.101  29.632 38.165 1.00 0.00 ? 163 ASP A N    3  
ATOM   8685  C  CA   . ASP A 1 163 ? 24.647  29.916 38.296 1.00 0.00 ? 163 ASP A CA   3  
ATOM   8686  C  C    . ASP A 1 163 ? 23.840  28.866 37.545 1.00 0.00 ? 163 ASP A C    3  
ATOM   8687  O  O    . ASP A 1 163 ? 23.043  29.184 36.684 1.00 0.00 ? 163 ASP A O    3  
ATOM   8688  C  CB   . ASP A 1 163 ? 24.367  31.295 37.678 1.00 0.00 ? 163 ASP A CB   3  
ATOM   8689  C  CG   . ASP A 1 163 ? 23.054  31.849 38.238 1.00 0.00 ? 163 ASP A CG   3  
ATOM   8690  O  OD1  . ASP A 1 163 ? 23.128  32.444 39.301 1.00 0.00 ? 163 ASP A OD1  3  
ATOM   8691  O  OD2  . ASP A 1 163 ? 22.052  31.646 37.571 1.00 0.00 ? 163 ASP A OD2  3  
ATOM   8692  H  H    . ASP A 1 163 ? 26.474  29.388 37.292 1.00 0.00 ? 163 ASP A H    3  
ATOM   8693  H  HA   . ASP A 1 163 ? 24.368  29.895 39.349 1.00 0.00 ? 163 ASP A HA   3  
ATOM   8694  H  HB2  . ASP A 1 163 ? 25.172  31.973 37.920 1.00 0.00 ? 163 ASP A HB2  3  
ATOM   8695  H  HB3  . ASP A 1 163 ? 24.288  31.205 36.605 1.00 0.00 ? 163 ASP A HB3  3  
ATOM   8696  N  N    . ASP A 1 164 ? 24.063  27.628 37.890 1.00 0.00 ? 164 ASP A N    3  
ATOM   8697  C  CA   . ASP A 1 164 ? 23.329  26.532 37.215 1.00 0.00 ? 164 ASP A CA   3  
ATOM   8698  C  C    . ASP A 1 164 ? 21.847  26.543 37.584 1.00 0.00 ? 164 ASP A C    3  
ATOM   8699  O  O    . ASP A 1 164 ? 21.316  25.554 38.051 1.00 0.00 ? 164 ASP A O    3  
ATOM   8700  C  CB   . ASP A 1 164 ? 23.946  25.196 37.666 1.00 0.00 ? 164 ASP A CB   3  
ATOM   8701  C  CG   . ASP A 1 164 ? 24.032  25.167 39.192 1.00 0.00 ? 164 ASP A CG   3  
ATOM   8702  O  OD1  . ASP A 1 164 ? 24.827  25.940 39.705 1.00 0.00 ? 164 ASP A OD1  3  
ATOM   8703  O  OD2  . ASP A 1 164 ? 23.302  24.373 39.761 1.00 0.00 ? 164 ASP A OD2  3  
ATOM   8704  H  H    . ASP A 1 164 ? 24.710  27.424 38.592 1.00 0.00 ? 164 ASP A H    3  
ATOM   8705  H  HA   . ASP A 1 164 ? 23.425  26.655 36.140 1.00 0.00 ? 164 ASP A HA   3  
ATOM   8706  H  HB2  . ASP A 1 164 ? 23.333  24.374 37.329 1.00 0.00 ? 164 ASP A HB2  3  
ATOM   8707  H  HB3  . ASP A 1 164 ? 24.938  25.093 37.251 1.00 0.00 ? 164 ASP A HB3  3  
ATOM   8708  N  N    . LYS A 1 165 ? 21.209  27.672 37.365 1.00 0.00 ? 165 LYS A N    3  
ATOM   8709  C  CA   . LYS A 1 165 ? 19.754  27.778 37.692 1.00 0.00 ? 165 LYS A CA   3  
ATOM   8710  C  C    . LYS A 1 165 ? 18.984  28.430 36.551 1.00 0.00 ? 165 LYS A C    3  
ATOM   8711  O  O    . LYS A 1 165 ? 19.122  29.611 36.299 1.00 0.00 ? 165 LYS A O    3  
ATOM   8712  C  CB   . LYS A 1 165 ? 19.589  28.655 38.939 1.00 0.00 ? 165 LYS A CB   3  
ATOM   8713  C  CG   . LYS A 1 165 ? 20.403  28.061 40.087 1.00 0.00 ? 165 LYS A CG   3  
ATOM   8714  C  CD   . LYS A 1 165 ? 21.716  28.834 40.225 1.00 0.00 ? 165 LYS A CD   3  
ATOM   8715  C  CE   . LYS A 1 165 ? 21.459  30.133 40.990 1.00 0.00 ? 165 LYS A CE   3  
ATOM   8716  N  NZ   . LYS A 1 165 ? 20.658  29.866 42.218 1.00 0.00 ? 165 LYS A NZ   3  
ATOM   8717  H  H    . LYS A 1 165 ? 21.689  28.442 36.995 1.00 0.00 ? 165 LYS A H    3  
ATOM   8718  H  HA   . LYS A 1 165 ? 19.350  26.782 37.864 1.00 0.00 ? 165 LYS A HA   3  
ATOM   8719  H  HB2  . LYS A 1 165 ? 19.933  29.655 38.727 1.00 0.00 ? 165 LYS A HB2  3  
ATOM   8720  H  HB3  . LYS A 1 165 ? 18.544  28.694 39.218 1.00 0.00 ? 165 LYS A HB3  3  
ATOM   8721  H  HG2  . LYS A 1 165 ? 19.841  28.134 41.007 1.00 0.00 ? 165 LYS A HG2  3  
ATOM   8722  H  HG3  . LYS A 1 165 ? 20.614  27.022 39.882 1.00 0.00 ? 165 LYS A HG3  3  
ATOM   8723  H  HD2  . LYS A 1 165 ? 22.437  28.234 40.760 1.00 0.00 ? 165 LYS A HD2  3  
ATOM   8724  H  HD3  . LYS A 1 165 ? 22.103  29.063 39.246 1.00 0.00 ? 165 LYS A HD3  3  
ATOM   8725  H  HE2  . LYS A 1 165 ? 22.401  30.579 41.273 1.00 0.00 ? 165 LYS A HE2  3  
ATOM   8726  H  HE3  . LYS A 1 165 ? 20.918  30.824 40.360 1.00 0.00 ? 165 LYS A HE3  3  
ATOM   8727  H  HZ1  . LYS A 1 165 ? 20.720  28.857 42.460 1.00 0.00 ? 165 LYS A HZ1  3  
ATOM   8728  H  HZ2  . LYS A 1 165 ? 21.033  30.435 43.005 1.00 0.00 ? 165 LYS A HZ2  3  
ATOM   8729  H  HZ3  . LYS A 1 165 ? 19.665  30.124 42.048 1.00 0.00 ? 165 LYS A HZ3  3  
ATOM   8730  N  N    . LEU A 1 166 ? 18.183  27.651 35.883 1.00 0.00 ? 166 LEU A N    3  
ATOM   8731  C  CA   . LEU A 1 166 ? 17.395  28.207 34.756 1.00 0.00 ? 166 LEU A CA   3  
ATOM   8732  C  C    . LEU A 1 166 ? 16.194  28.972 35.298 1.00 0.00 ? 166 LEU A C    3  
ATOM   8733  O  O    . LEU A 1 166 ? 15.468  28.478 36.138 1.00 0.00 ? 166 LEU A O    3  
ATOM   8734  C  CB   . LEU A 1 166 ? 16.908  27.029 33.892 1.00 0.00 ? 166 LEU A CB   3  
ATOM   8735  C  CG   . LEU A 1 166 ? 16.473  27.503 32.492 1.00 0.00 ? 166 LEU A CG   3  
ATOM   8736  C  CD1  . LEU A 1 166 ? 17.544  28.405 31.880 1.00 0.00 ? 166 LEU A CD1  3  
ATOM   8737  C  CD2  . LEU A 1 166 ? 16.301  26.272 31.595 1.00 0.00 ? 166 LEU A CD2  3  
ATOM   8738  H  H    . LEU A 1 166 ? 18.103  26.705 36.121 1.00 0.00 ? 166 LEU A H    3  
ATOM   8739  H  HA   . LEU A 1 166 ? 18.025  28.884 34.188 1.00 0.00 ? 166 LEU A HA   3  
ATOM   8740  H  HB2  . LEU A 1 166 ? 17.704  26.310 33.793 1.00 0.00 ? 166 LEU A HB2  3  
ATOM   8741  H  HB3  . LEU A 1 166 ? 16.075  26.559 34.376 1.00 0.00 ? 166 LEU A HB3  3  
ATOM   8742  H  HG   . LEU A 1 166 ? 15.537  28.040 32.561 1.00 0.00 ? 166 LEU A HG   3  
ATOM   8743  H  HD11 . LEU A 1 166 ? 18.520  28.084 32.207 1.00 0.00 ? 166 LEU A HD11 3  
ATOM   8744  H  HD12 . LEU A 1 166 ? 17.494  28.347 30.802 1.00 0.00 ? 166 LEU A HD12 3  
ATOM   8745  H  HD13 . LEU A 1 166 ? 17.381  29.426 32.187 1.00 0.00 ? 166 LEU A HD13 3  
ATOM   8746  H  HD21 . LEU A 1 166 ? 15.965  25.433 32.187 1.00 0.00 ? 166 LEU A HD21 3  
ATOM   8747  H  HD22 . LEU A 1 166 ? 15.575  26.477 30.825 1.00 0.00 ? 166 LEU A HD22 3  
ATOM   8748  H  HD23 . LEU A 1 166 ? 17.247  26.023 31.132 1.00 0.00 ? 166 LEU A HD23 3  
ATOM   8749  N  N    . THR A 1 167 ? 16.009  30.160 34.803 1.00 0.00 ? 167 THR A N    3  
ATOM   8750  C  CA   . THR A 1 167 ? 14.862  30.993 35.271 1.00 0.00 ? 167 THR A CA   3  
ATOM   8751  C  C    . THR A 1 167 ? 13.716  30.971 34.269 1.00 0.00 ? 167 THR A C    3  
ATOM   8752  O  O    . THR A 1 167 ? 13.897  30.632 33.126 1.00 0.00 ? 167 THR A O    3  
ATOM   8753  C  CB   . THR A 1 167 ? 15.352  32.436 35.425 1.00 0.00 ? 167 THR A CB   3  
ATOM   8754  O  OG1  . THR A 1 167 ? 15.900  32.783 34.169 1.00 0.00 ? 167 THR A OG1  3  
ATOM   8755  C  CG2  . THR A 1 167 ? 16.538  32.506 36.397 1.00 0.00 ? 167 THR A CG2  3  
ATOM   8756  H  H    . THR A 1 167 ? 16.615  30.499 34.115 1.00 0.00 ? 167 THR A H    3  
ATOM   8757  H  HA   . THR A 1 167 ? 14.503  30.604 36.228 1.00 0.00 ? 167 THR A HA   3  
ATOM   8758  H  HB   . THR A 1 167 ? 14.543  33.112 35.696 1.00 0.00 ? 167 THR A HB   3  
ATOM   8759  H  HG1  . THR A 1 167 ? 16.244  33.677 34.233 1.00 0.00 ? 167 THR A HG1  3  
ATOM   8760  H  HG21 . THR A 1 167 ? 16.237  32.133 37.366 1.00 0.00 ? 167 THR A HG21 3  
ATOM   8761  H  HG22 . THR A 1 167 ? 17.352  31.904 36.023 1.00 0.00 ? 167 THR A HG22 3  
ATOM   8762  H  HG23 . THR A 1 167 ? 16.869  33.529 36.497 1.00 0.00 ? 167 THR A HG23 3  
ATOM   8763  N  N    . GLU A 1 168 ? 12.552  31.332 34.730 1.00 0.00 ? 168 GLU A N    3  
ATOM   8764  C  CA   . GLU A 1 168 ? 11.370  31.343 33.829 1.00 0.00 ? 168 GLU A CA   3  
ATOM   8765  C  C    . GLU A 1 168 ? 11.650  32.111 32.538 1.00 0.00 ? 168 GLU A C    3  
ATOM   8766  O  O    . GLU A 1 168 ? 11.709  31.537 31.470 1.00 0.00 ? 168 GLU A O    3  
ATOM   8767  C  CB   . GLU A 1 168 ? 10.217  32.043 34.567 1.00 0.00 ? 168 GLU A CB   3  
ATOM   8768  C  CG   . GLU A 1 168 ? 8.906   31.769 33.827 1.00 0.00 ? 168 GLU A CG   3  
ATOM   8769  C  CD   . GLU A 1 168 ? 7.779   32.576 34.476 1.00 0.00 ? 168 GLU A CD   3  
ATOM   8770  O  OE1  . GLU A 1 168 ? 7.194   32.042 35.405 1.00 0.00 ? 168 GLU A OE1  3  
ATOM   8771  O  OE2  . GLU A 1 168 ? 7.565   33.681 34.006 1.00 0.00 ? 168 GLU A OE2  3  
ATOM   8772  H  H    . GLU A 1 168 ? 12.456  31.595 35.669 1.00 0.00 ? 168 GLU A H    3  
ATOM   8773  H  HA   . GLU A 1 168 ? 11.102  30.318 33.582 1.00 0.00 ? 168 GLU A HA   3  
ATOM   8774  H  HB2  . GLU A 1 168 ? 10.151  31.669 35.576 1.00 0.00 ? 168 GLU A HB2  3  
ATOM   8775  H  HB3  . GLU A 1 168 ? 10.401  33.108 34.597 1.00 0.00 ? 168 GLU A HB3  3  
ATOM   8776  H  HG2  . GLU A 1 168 ? 9.002   32.060 32.792 1.00 0.00 ? 168 GLU A HG2  3  
ATOM   8777  H  HG3  . GLU A 1 168 ? 8.668   30.718 33.880 1.00 0.00 ? 168 GLU A HG3  3  
ATOM   8778  N  N    . LYS A 1 169 ? 11.817  33.394 32.664 1.00 0.00 ? 169 LYS A N    3  
ATOM   8779  C  CA   . LYS A 1 169 ? 12.090  34.220 31.460 1.00 0.00 ? 169 LYS A CA   3  
ATOM   8780  C  C    . LYS A 1 169 ? 13.152  33.583 30.573 1.00 0.00 ? 169 LYS A C    3  
ATOM   8781  O  O    . LYS A 1 169 ? 12.992  33.504 29.371 1.00 0.00 ? 169 LYS A O    3  
ATOM   8782  C  CB   . LYS A 1 169 ? 12.591  35.592 31.929 1.00 0.00 ? 169 LYS A CB   3  
ATOM   8783  C  CG   . LYS A 1 169 ? 11.445  36.332 32.627 1.00 0.00 ? 169 LYS A CG   3  
ATOM   8784  C  CD   . LYS A 1 169 ? 10.983  37.491 31.743 1.00 0.00 ? 169 LYS A CD   3  
ATOM   8785  C  CE   . LYS A 1 169 ? 9.783   38.174 32.399 1.00 0.00 ? 169 LYS A CE   3  
ATOM   8786  N  NZ   . LYS A 1 169 ? 8.525   37.441 32.080 1.00 0.00 ? 169 LYS A NZ   3  
ATOM   8787  H  H    . LYS A 1 169 ? 11.772  33.812 33.546 1.00 0.00 ? 169 LYS A H    3  
ATOM   8788  H  HA   . LYS A 1 169 ? 11.168  34.323 30.889 1.00 0.00 ? 169 LYS A HA   3  
ATOM   8789  H  HB2  . LYS A 1 169 ? 13.413  35.462 32.617 1.00 0.00 ? 169 LYS A HB2  3  
ATOM   8790  H  HB3  . LYS A 1 169 ? 12.929  36.164 31.077 1.00 0.00 ? 169 LYS A HB3  3  
ATOM   8791  H  HG2  . LYS A 1 169 ? 10.622  35.652 32.793 1.00 0.00 ? 169 LYS A HG2  3  
ATOM   8792  H  HG3  . LYS A 1 169 ? 11.786  36.714 33.577 1.00 0.00 ? 169 LYS A HG3  3  
ATOM   8793  H  HD2  . LYS A 1 169 ? 11.788  38.202 31.628 1.00 0.00 ? 169 LYS A HD2  3  
ATOM   8794  H  HD3  . LYS A 1 169 ? 10.701  37.116 30.771 1.00 0.00 ? 169 LYS A HD3  3  
ATOM   8795  H  HE2  . LYS A 1 169 ? 9.918   38.192 33.470 1.00 0.00 ? 169 LYS A HE2  3  
ATOM   8796  H  HE3  . LYS A 1 169 ? 9.702   39.188 32.037 1.00 0.00 ? 169 LYS A HE3  3  
ATOM   8797  H  HZ1  . LYS A 1 169 ? 8.746   36.617 31.484 1.00 0.00 ? 169 LYS A HZ1  3  
ATOM   8798  H  HZ2  . LYS A 1 169 ? 8.077   37.121 32.962 1.00 0.00 ? 169 LYS A HZ2  3  
ATOM   8799  H  HZ3  . LYS A 1 169 ? 7.875   38.073 31.570 1.00 0.00 ? 169 LYS A HZ3  3  
ATOM   8800  N  N    . GLU A 1 170 ? 14.216  33.138 31.176 1.00 0.00 ? 170 GLU A N    3  
ATOM   8801  C  CA   . GLU A 1 170 ? 15.293  32.506 30.374 1.00 0.00 ? 170 GLU A CA   3  
ATOM   8802  C  C    . GLU A 1 170 ? 14.911  31.100 29.951 1.00 0.00 ? 170 GLU A C    3  
ATOM   8803  O  O    . GLU A 1 170 ? 15.315  30.639 28.903 1.00 0.00 ? 170 GLU A O    3  
ATOM   8804  C  CB   . GLU A 1 170 ? 16.555  32.428 31.228 1.00 0.00 ? 170 GLU A CB   3  
ATOM   8805  C  CG   . GLU A 1 170 ? 17.781  32.670 30.343 1.00 0.00 ? 170 GLU A CG   3  
ATOM   8806  C  CD   . GLU A 1 170 ? 17.914  34.166 30.057 1.00 0.00 ? 170 GLU A CD   3  
ATOM   8807  O  OE1  . GLU A 1 170 ? 17.641  34.919 30.977 1.00 0.00 ? 170 GLU A OE1  3  
ATOM   8808  O  OE2  . GLU A 1 170 ? 18.280  34.473 28.934 1.00 0.00 ? 170 GLU A OE2  3  
ATOM   8809  H  H    . GLU A 1 170 ? 14.303  33.218 32.150 1.00 0.00 ? 170 GLU A H    3  
ATOM   8810  H  HA   . GLU A 1 170 ? 15.468  33.108 29.483 1.00 0.00 ? 170 GLU A HA   3  
ATOM   8811  H  HB2  . GLU A 1 170 ? 16.513  33.175 32.000 1.00 0.00 ? 170 GLU A HB2  3  
ATOM   8812  H  HB3  . GLU A 1 170 ? 16.622  31.451 31.679 1.00 0.00 ? 170 GLU A HB3  3  
ATOM   8813  H  HG2  . GLU A 1 170 ? 18.671  32.323 30.848 1.00 0.00 ? 170 GLU A HG2  3  
ATOM   8814  H  HG3  . GLU A 1 170 ? 17.670  32.137 29.411 1.00 0.00 ? 170 GLU A HG3  3  
ATOM   8815  N  N    . PHE A 1 171 ? 14.147  30.430 30.769 1.00 0.00 ? 171 PHE A N    3  
ATOM   8816  C  CA   . PHE A 1 171 ? 13.750  29.058 30.396 1.00 0.00 ? 171 PHE A CA   3  
ATOM   8817  C  C    . PHE A 1 171 ? 13.236  29.057 28.981 1.00 0.00 ? 171 PHE A C    3  
ATOM   8818  O  O    . PHE A 1 171 ? 13.141  28.028 28.345 1.00 0.00 ? 171 PHE A O    3  
ATOM   8819  C  CB   . PHE A 1 171 ? 12.632  28.574 31.328 1.00 0.00 ? 171 PHE A CB   3  
ATOM   8820  C  CG   . PHE A 1 171 ? 12.275  27.140 30.944 1.00 0.00 ? 171 PHE A CG   3  
ATOM   8821  C  CD1  . PHE A 1 171 ? 12.940  26.074 31.521 1.00 0.00 ? 171 PHE A CD1  3  
ATOM   8822  C  CD2  . PHE A 1 171 ? 11.304  26.890 29.993 1.00 0.00 ? 171 PHE A CD2  3  
ATOM   8823  C  CE1  . PHE A 1 171 ? 12.639  24.780 31.150 1.00 0.00 ? 171 PHE A CE1  3  
ATOM   8824  C  CE2  . PHE A 1 171 ? 11.006  25.595 29.624 1.00 0.00 ? 171 PHE A CE2  3  
ATOM   8825  C  CZ   . PHE A 1 171 ? 11.673  24.542 30.202 1.00 0.00 ? 171 PHE A CZ   3  
ATOM   8826  H  H    . PHE A 1 171 ? 13.844  30.828 31.611 1.00 0.00 ? 171 PHE A H    3  
ATOM   8827  H  HA   . PHE A 1 171 ? 14.620  28.409 30.458 1.00 0.00 ? 171 PHE A HA   3  
ATOM   8828  H  HB2  . PHE A 1 171 ? 12.967  28.600 32.355 1.00 0.00 ? 171 PHE A HB2  3  
ATOM   8829  H  HB3  . PHE A 1 171 ? 11.762  29.201 31.216 1.00 0.00 ? 171 PHE A HB3  3  
ATOM   8830  H  HD1  . PHE A 1 171 ? 13.705  26.256 32.257 1.00 0.00 ? 171 PHE A HD1  3  
ATOM   8831  H  HD2  . PHE A 1 171 ? 10.773  27.713 29.538 1.00 0.00 ? 171 PHE A HD2  3  
ATOM   8832  H  HE1  . PHE A 1 171 ? 13.163  23.954 31.605 1.00 0.00 ? 171 PHE A HE1  3  
ATOM   8833  H  HE2  . PHE A 1 171 ? 10.257  25.409 28.871 1.00 0.00 ? 171 PHE A HE2  3  
ATOM   8834  H  HZ   . PHE A 1 171 ? 11.439  23.530 29.912 1.00 0.00 ? 171 PHE A HZ   3  
ATOM   8835  N  N    . ILE A 1 172 ? 12.903  30.223 28.513 1.00 0.00 ? 172 ILE A N    3  
ATOM   8836  C  CA   . ILE A 1 172 ? 12.392  30.337 27.142 1.00 0.00 ? 172 ILE A CA   3  
ATOM   8837  C  C    . ILE A 1 172 ? 13.546  30.534 26.182 1.00 0.00 ? 172 ILE A C    3  
ATOM   8838  O  O    . ILE A 1 172 ? 13.486  30.119 25.043 1.00 0.00 ? 172 ILE A O    3  
ATOM   8839  C  CB   . ILE A 1 172 ? 11.478  31.559 27.064 1.00 0.00 ? 172 ILE A CB   3  
ATOM   8840  C  CG1  . ILE A 1 172 ? 10.408  31.481 28.147 1.00 0.00 ? 172 ILE A CG1  3  
ATOM   8841  C  CG2  . ILE A 1 172 ? 10.788  31.566 25.691 1.00 0.00 ? 172 ILE A CG2  3  
ATOM   8842  C  CD1  . ILE A 1 172 ? 9.733   32.851 28.291 1.00 0.00 ? 172 ILE A CD1  3  
ATOM   8843  H  H    . ILE A 1 172 ? 12.995  31.022 29.073 1.00 0.00 ? 172 ILE A H    3  
ATOM   8844  H  HA   . ILE A 1 172 ? 11.855  29.425 26.881 1.00 0.00 ? 172 ILE A HA   3  
ATOM   8845  H  HB   . ILE A 1 172 ? 12.073  32.463 27.208 1.00 0.00 ? 172 ILE A HB   3  
ATOM   8846  H  HG12 . ILE A 1 172 ? 9.670   30.741 27.873 1.00 0.00 ? 172 ILE A HG12 3  
ATOM   8847  H  HG13 . ILE A 1 172 ? 10.860  31.199 29.086 1.00 0.00 ? 172 ILE A HG13 3  
ATOM   8848  H  HG21 . ILE A 1 172 ? 11.533  31.586 24.909 1.00 0.00 ? 172 ILE A HG21 3  
ATOM   8849  H  HG22 . ILE A 1 172 ? 10.183  30.678 25.582 1.00 0.00 ? 172 ILE A HG22 3  
ATOM   8850  H  HG23 . ILE A 1 172 ? 10.157  32.438 25.603 1.00 0.00 ? 172 ILE A HG23 3  
ATOM   8851  H  HD11 . ILE A 1 172 ? 10.438  33.634 28.054 1.00 0.00 ? 172 ILE A HD11 3  
ATOM   8852  H  HD12 . ILE A 1 172 ? 8.891   32.915 27.617 1.00 0.00 ? 172 ILE A HD12 3  
ATOM   8853  H  HD13 . ILE A 1 172 ? 9.387   32.981 29.305 1.00 0.00 ? 172 ILE A HD13 3  
ATOM   8854  N  N    . GLU A 1 173 ? 14.593  31.162 26.665 1.00 0.00 ? 173 GLU A N    3  
ATOM   8855  C  CA   . GLU A 1 173 ? 15.761  31.396 25.788 1.00 0.00 ? 173 GLU A CA   3  
ATOM   8856  C  C    . GLU A 1 173 ? 16.640  30.158 25.703 1.00 0.00 ? 173 GLU A C    3  
ATOM   8857  O  O    . GLU A 1 173 ? 16.891  29.647 24.631 1.00 0.00 ? 173 GLU A O    3  
ATOM   8858  C  CB   . GLU A 1 173 ? 16.590  32.530 26.376 1.00 0.00 ? 173 GLU A CB   3  
ATOM   8859  C  CG   . GLU A 1 173 ? 15.697  33.752 26.592 1.00 0.00 ? 173 GLU A CG   3  
ATOM   8860  C  CD   . GLU A 1 173 ? 16.565  34.948 26.986 1.00 0.00 ? 173 GLU A CD   3  
ATOM   8861  O  OE1  . GLU A 1 173 ? 17.574  35.125 26.321 1.00 0.00 ? 173 GLU A OE1  3  
ATOM   8862  O  OE2  . GLU A 1 173 ? 16.174  35.615 27.928 1.00 0.00 ? 173 GLU A OE2  3  
ATOM   8863  H  H    . GLU A 1 173 ? 14.606  31.470 27.607 1.00 0.00 ? 173 GLU A H    3  
ATOM   8864  H  HA   . GLU A 1 173 ? 15.410  31.652 24.796 1.00 0.00 ? 173 GLU A HA   3  
ATOM   8865  H  HB2  . GLU A 1 173 ? 17.011  32.215 27.316 1.00 0.00 ? 173 GLU A HB2  3  
ATOM   8866  H  HB3  . GLU A 1 173 ? 17.389  32.779 25.695 1.00 0.00 ? 173 GLU A HB3  3  
ATOM   8867  H  HG2  . GLU A 1 173 ? 15.163  33.981 25.682 1.00 0.00 ? 173 GLU A HG2  3  
ATOM   8868  H  HG3  . GLU A 1 173 ? 14.987  33.552 27.381 1.00 0.00 ? 173 GLU A HG3  3  
ATOM   8869  N  N    . GLY A 1 174 ? 17.103  29.707 26.843 1.00 0.00 ? 174 GLY A N    3  
ATOM   8870  C  CA   . GLY A 1 174 ? 17.975  28.497 26.857 1.00 0.00 ? 174 GLY A CA   3  
ATOM   8871  C  C    . GLY A 1 174 ? 17.441  27.442 25.889 1.00 0.00 ? 174 GLY A C    3  
ATOM   8872  O  O    . GLY A 1 174 ? 18.170  26.570 25.458 1.00 0.00 ? 174 GLY A O    3  
ATOM   8873  H  H    . GLY A 1 174 ? 16.883  30.165 27.681 1.00 0.00 ? 174 GLY A H    3  
ATOM   8874  H  HA2  . GLY A 1 174 ? 18.976  28.775 26.563 1.00 0.00 ? 174 GLY A HA2  3  
ATOM   8875  H  HA3  . GLY A 1 174 ? 17.998  28.086 27.855 1.00 0.00 ? 174 GLY A HA3  3  
ATOM   8876  N  N    . THR A 1 175 ? 16.176  27.545 25.569 1.00 0.00 ? 175 THR A N    3  
ATOM   8877  C  CA   . THR A 1 175 ? 15.575  26.575 24.644 1.00 0.00 ? 175 THR A CA   3  
ATOM   8878  C  C    . THR A 1 175 ? 15.458  27.170 23.242 1.00 0.00 ? 175 THR A C    3  
ATOM   8879  O  O    . THR A 1 175 ? 15.512  26.457 22.259 1.00 0.00 ? 175 THR A O    3  
ATOM   8880  C  CB   . THR A 1 175 ? 14.174  26.260 25.151 1.00 0.00 ? 175 THR A CB   3  
ATOM   8881  O  OG1  . THR A 1 175 ? 14.025  27.016 26.332 1.00 0.00 ? 175 THR A OG1  3  
ATOM   8882  C  CG2  . THR A 1 175 ? 14.061  24.802 25.607 1.00 0.00 ? 175 THR A CG2  3  
ATOM   8883  H  H    . THR A 1 175 ? 15.625  28.260 25.944 1.00 0.00 ? 175 THR A H    3  
ATOM   8884  H  HA   . THR A 1 175 ? 16.187  25.676 24.606 1.00 0.00 ? 175 THR A HA   3  
ATOM   8885  H  HB   . THR A 1 175 ? 13.429  26.530 24.430 1.00 0.00 ? 175 THR A HB   3  
ATOM   8886  H  HG1  . THR A 1 175 ? 13.346  27.676 26.177 1.00 0.00 ? 175 THR A HG1  3  
ATOM   8887  H  HG21 . THR A 1 175 ? 14.605  24.170 24.933 1.00 0.00 ? 175 THR A HG21 3  
ATOM   8888  H  HG22 . THR A 1 175 ? 14.467  24.698 26.602 1.00 0.00 ? 175 THR A HG22 3  
ATOM   8889  H  HG23 . THR A 1 175 ? 13.022  24.505 25.614 1.00 0.00 ? 175 THR A HG23 3  
ATOM   8890  N  N    . LEU A 1 176 ? 15.302  28.475 23.170 1.00 0.00 ? 176 LEU A N    3  
ATOM   8891  C  CA   . LEU A 1 176 ? 15.181  29.112 21.832 1.00 0.00 ? 176 LEU A CA   3  
ATOM   8892  C  C    . LEU A 1 176 ? 16.544  29.254 21.181 1.00 0.00 ? 176 LEU A C    3  
ATOM   8893  O  O    . LEU A 1 176 ? 16.664  29.223 19.972 1.00 0.00 ? 176 LEU A O    3  
ATOM   8894  C  CB   . LEU A 1 176 ? 14.563  30.513 22.001 1.00 0.00 ? 176 LEU A CB   3  
ATOM   8895  C  CG   . LEU A 1 176 ? 13.150  30.511 21.417 1.00 0.00 ? 176 LEU A CG   3  
ATOM   8896  C  CD1  . LEU A 1 176 ? 12.268  29.573 22.241 1.00 0.00 ? 176 LEU A CD1  3  
ATOM   8897  C  CD2  . LEU A 1 176 ? 12.576  31.930 21.480 1.00 0.00 ? 176 LEU A CD2  3  
ATOM   8898  H  H    . LEU A 1 176 ? 15.273  29.026 23.991 1.00 0.00 ? 176 LEU A H    3  
ATOM   8899  H  HA   . LEU A 1 176 ? 14.552  28.487 21.201 1.00 0.00 ? 176 LEU A HA   3  
ATOM   8900  H  HB2  . LEU A 1 176 ? 14.521  30.765 23.041 1.00 0.00 ? 176 LEU A HB2  3  
ATOM   8901  H  HB3  . LEU A 1 176 ? 15.168  31.244 21.483 1.00 0.00 ? 176 LEU A HB3  3  
ATOM   8902  H  HG   . LEU A 1 176 ? 13.179  30.176 20.391 1.00 0.00 ? 176 LEU A HG   3  
ATOM   8903  H  HD11 . LEU A 1 176 ? 12.856  28.740 22.598 1.00 0.00 ? 176 LEU A HD11 3  
ATOM   8904  H  HD12 . LEU A 1 176 ? 11.860  30.108 23.088 1.00 0.00 ? 176 LEU A HD12 3  
ATOM   8905  H  HD13 . LEU A 1 176 ? 11.458  29.203 21.632 1.00 0.00 ? 176 LEU A HD13 3  
ATOM   8906  H  HD21 . LEU A 1 176 ? 12.587  32.282 22.502 1.00 0.00 ? 176 LEU A HD21 3  
ATOM   8907  H  HD22 . LEU A 1 176 ? 13.172  32.592 20.869 1.00 0.00 ? 176 LEU A HD22 3  
ATOM   8908  H  HD23 . LEU A 1 176 ? 11.559  31.929 21.116 1.00 0.00 ? 176 LEU A HD23 3  
ATOM   8909  N  N    . ALA A 1 177 ? 17.553  29.409 21.990 1.00 0.00 ? 177 ALA A N    3  
ATOM   8910  C  CA   . ALA A 1 177 ? 18.913  29.554 21.430 1.00 0.00 ? 177 ALA A CA   3  
ATOM   8911  C  C    . ALA A 1 177 ? 19.185  28.471 20.398 1.00 0.00 ? 177 ALA A C    3  
ATOM   8912  O  O    . ALA A 1 177 ? 19.534  28.761 19.271 1.00 0.00 ? 177 ALA A O    3  
ATOM   8913  C  CB   . ALA A 1 177 ? 19.926  29.411 22.574 1.00 0.00 ? 177 ALA A CB   3  
ATOM   8914  H  H    . ALA A 1 177 ? 17.411  29.431 22.961 1.00 0.00 ? 177 ALA A H    3  
ATOM   8915  H  HA   . ALA A 1 177 ? 19.000  30.527 20.954 1.00 0.00 ? 177 ALA A HA   3  
ATOM   8916  H  HB1  . ALA A 1 177 ? 19.811  28.446 23.044 1.00 0.00 ? 177 ALA A HB1  3  
ATOM   8917  H  HB2  . ALA A 1 177 ? 20.929  29.499 22.184 1.00 0.00 ? 177 ALA A HB2  3  
ATOM   8918  H  HB3  . ALA A 1 177 ? 19.760  30.186 23.307 1.00 0.00 ? 177 ALA A HB3  3  
ATOM   8919  N  N    . ASN A 1 178 ? 19.012  27.241 20.806 1.00 0.00 ? 178 ASN A N    3  
ATOM   8920  C  CA   . ASN A 1 178 ? 19.251  26.107 19.873 1.00 0.00 ? 178 ASN A CA   3  
ATOM   8921  C  C    . ASN A 1 178 ? 17.935  25.494 19.411 1.00 0.00 ? 178 ASN A C    3  
ATOM   8922  O  O    . ASN A 1 178 ? 17.055  25.232 20.206 1.00 0.00 ? 178 ASN A O    3  
ATOM   8923  C  CB   . ASN A 1 178 ? 20.057  25.035 20.620 1.00 0.00 ? 178 ASN A CB   3  
ATOM   8924  C  CG   . ASN A 1 178 ? 21.507  25.499 20.753 1.00 0.00 ? 178 ASN A CG   3  
ATOM   8925  O  OD1  . ASN A 1 178 ? 22.239  25.571 19.786 1.00 0.00 ? 178 ASN A OD1  3  
ATOM   8926  N  ND2  . ASN A 1 178 ? 21.961  25.824 21.932 1.00 0.00 ? 178 ASN A ND2  3  
ATOM   8927  H  H    . ASN A 1 178 ? 18.724  27.067 21.726 1.00 0.00 ? 178 ASN A H    3  
ATOM   8928  H  HA   . ASN A 1 178 ? 19.800  26.466 19.004 1.00 0.00 ? 178 ASN A HA   3  
ATOM   8929  H  HB2  . ASN A 1 178 ? 19.639  24.882 21.604 1.00 0.00 ? 178 ASN A HB2  3  
ATOM   8930  H  HB3  . ASN A 1 178 ? 20.029  24.105 20.071 1.00 0.00 ? 178 ASN A HB3  3  
ATOM   8931  H  HD21 . ASN A 1 178 ? 21.376  25.769 22.716 1.00 0.00 ? 178 ASN A HD21 3  
ATOM   8932  H  HD22 . ASN A 1 178 ? 22.889  26.125 22.034 1.00 0.00 ? 178 ASN A HD22 3  
ATOM   8933  N  N    . LYS A 1 179 ? 17.824  25.278 18.129 1.00 0.00 ? 179 LYS A N    3  
ATOM   8934  C  CA   . LYS A 1 179 ? 16.574  24.683 17.596 1.00 0.00 ? 179 LYS A CA   3  
ATOM   8935  C  C    . LYS A 1 179 ? 16.603  23.164 17.720 1.00 0.00 ? 179 LYS A C    3  
ATOM   8936  O  O    . LYS A 1 179 ? 15.607  22.501 17.510 1.00 0.00 ? 179 LYS A O    3  
ATOM   8937  C  CB   . LYS A 1 179 ? 16.457  25.056 16.108 1.00 0.00 ? 179 LYS A CB   3  
ATOM   8938  C  CG   . LYS A 1 179 ? 17.647  24.467 15.349 1.00 0.00 ? 179 LYS A CG   3  
ATOM   8939  C  CD   . LYS A 1 179 ? 17.739  25.125 13.972 1.00 0.00 ? 179 LYS A CD   3  
ATOM   8940  C  CE   . LYS A 1 179 ? 18.677  24.302 13.088 1.00 0.00 ? 179 LYS A CE   3  
ATOM   8941  N  NZ   . LYS A 1 179 ? 20.092  24.510 13.500 1.00 0.00 ? 179 LYS A NZ   3  
ATOM   8942  H  H    . LYS A 1 179 ? 18.559  25.506 17.524 1.00 0.00 ? 179 LYS A H    3  
ATOM   8943  H  HA   . LYS A 1 179 ? 15.727  25.071 18.160 1.00 0.00 ? 179 LYS A HA   3  
ATOM   8944  H  HB2  . LYS A 1 179 ? 15.537  24.659 15.706 1.00 0.00 ? 179 LYS A HB2  3  
ATOM   8945  H  HB3  . LYS A 1 179 ? 16.454  26.131 16.002 1.00 0.00 ? 179 LYS A HB3  3  
ATOM   8946  H  HG2  . LYS A 1 179 ? 18.557  24.651 15.901 1.00 0.00 ? 179 LYS A HG2  3  
ATOM   8947  H  HG3  . LYS A 1 179 ? 17.513  23.401 15.234 1.00 0.00 ? 179 LYS A HG3  3  
ATOM   8948  H  HD2  . LYS A 1 179 ? 16.758  25.166 13.521 1.00 0.00 ? 179 LYS A HD2  3  
ATOM   8949  H  HD3  . LYS A 1 179 ? 18.124  26.128 14.074 1.00 0.00 ? 179 LYS A HD3  3  
ATOM   8950  H  HE2  . LYS A 1 179 ? 18.433  23.253 13.179 1.00 0.00 ? 179 LYS A HE2  3  
ATOM   8951  H  HE3  . LYS A 1 179 ? 18.561  24.603 12.058 1.00 0.00 ? 179 LYS A HE3  3  
ATOM   8952  H  HZ1  . LYS A 1 179 ? 20.122  25.130 14.335 1.00 0.00 ? 179 LYS A HZ1  3  
ATOM   8953  H  HZ2  . LYS A 1 179 ? 20.524  23.593 13.732 1.00 0.00 ? 179 LYS A HZ2  3  
ATOM   8954  H  HZ3  . LYS A 1 179 ? 20.618  24.954 12.721 1.00 0.00 ? 179 LYS A HZ3  3  
ATOM   8955  N  N    . GLU A 1 180 ? 17.749  22.641 18.065 1.00 0.00 ? 180 GLU A N    3  
ATOM   8956  C  CA   . GLU A 1 180 ? 17.868  21.167 18.210 1.00 0.00 ? 180 GLU A CA   3  
ATOM   8957  C  C    . GLU A 1 180 ? 17.375  20.710 19.582 1.00 0.00 ? 180 GLU A C    3  
ATOM   8958  O  O    . GLU A 1 180 ? 17.289  19.528 19.852 1.00 0.00 ? 180 GLU A O    3  
ATOM   8959  C  CB   . GLU A 1 180 ? 19.352  20.791 18.059 1.00 0.00 ? 180 GLU A CB   3  
ATOM   8960  C  CG   . GLU A 1 180 ? 19.460  19.357 17.535 1.00 0.00 ? 180 GLU A CG   3  
ATOM   8961  C  CD   . GLU A 1 180 ? 20.853  19.136 16.944 1.00 0.00 ? 180 GLU A CD   3  
ATOM   8962  O  OE1  . GLU A 1 180 ? 21.715  19.933 17.275 1.00 0.00 ? 180 GLU A OE1  3  
ATOM   8963  O  OE2  . GLU A 1 180 ? 20.977  18.183 16.193 1.00 0.00 ? 180 GLU A OE2  3  
ATOM   8964  H  H    . GLU A 1 180 ? 18.526  23.216 18.226 1.00 0.00 ? 180 GLU A H    3  
ATOM   8965  H  HA   . GLU A 1 180 ? 17.266  20.687 17.439 1.00 0.00 ? 180 GLU A HA   3  
ATOM   8966  H  HB2  . GLU A 1 180 ? 19.829  21.469 17.364 1.00 0.00 ? 180 GLU A HB2  3  
ATOM   8967  H  HB3  . GLU A 1 180 ? 19.844  20.864 19.018 1.00 0.00 ? 180 GLU A HB3  3  
ATOM   8968  H  HG2  . GLU A 1 180 ? 19.300  18.660 18.342 1.00 0.00 ? 180 GLU A HG2  3  
ATOM   8969  H  HG3  . GLU A 1 180 ? 18.717  19.191 16.767 1.00 0.00 ? 180 GLU A HG3  3  
ATOM   8970  N  N    . ILE A 1 181 ? 17.059  21.658 20.424 1.00 0.00 ? 181 ILE A N    3  
ATOM   8971  C  CA   . ILE A 1 181 ? 16.570  21.301 21.782 1.00 0.00 ? 181 ILE A CA   3  
ATOM   8972  C  C    . ILE A 1 181 ? 15.051  21.138 21.785 1.00 0.00 ? 181 ILE A C    3  
ATOM   8973  O  O    . ILE A 1 181 ? 14.530  20.129 22.216 1.00 0.00 ? 181 ILE A O    3  
ATOM   8974  C  CB   . ILE A 1 181 ? 16.955  22.441 22.738 1.00 0.00 ? 181 ILE A CB   3  
ATOM   8975  C  CG1  . ILE A 1 181 ? 18.444  22.367 23.045 1.00 0.00 ? 181 ILE A CG1  3  
ATOM   8976  C  CG2  . ILE A 1 181 ? 16.180  22.279 24.060 1.00 0.00 ? 181 ILE A CG2  3  
ATOM   8977  C  CD1  . ILE A 1 181 ? 18.816  23.485 24.021 1.00 0.00 ? 181 ILE A CD1  3  
ATOM   8978  H  H    . ILE A 1 181 ? 17.146  22.598 20.164 1.00 0.00 ? 181 ILE A H    3  
ATOM   8979  H  HA   . ILE A 1 181 ? 17.029  20.362 22.090 1.00 0.00 ? 181 ILE A HA   3  
ATOM   8980  H  HB   . ILE A 1 181 ? 16.729  23.402 22.267 1.00 0.00 ? 181 ILE A HB   3  
ATOM   8981  H  HG12 . ILE A 1 181 ? 18.677  21.409 23.486 1.00 0.00 ? 181 ILE A HG12 3  
ATOM   8982  H  HG13 . ILE A 1 181 ? 19.008  22.482 22.132 1.00 0.00 ? 181 ILE A HG13 3  
ATOM   8983  H  HG21 . ILE A 1 181 ? 16.405  21.322 24.500 1.00 0.00 ? 181 ILE A HG21 3  
ATOM   8984  H  HG22 . ILE A 1 181 ? 16.467  23.062 24.748 1.00 0.00 ? 181 ILE A HG22 3  
ATOM   8985  H  HG23 . ILE A 1 181 ? 15.117  22.345 23.874 1.00 0.00 ? 181 ILE A HG23 3  
ATOM   8986  H  HD11 . ILE A 1 181 ? 18.186  24.345 23.848 1.00 0.00 ? 181 ILE A HD11 3  
ATOM   8987  H  HD12 . ILE A 1 181 ? 18.681  23.144 25.036 1.00 0.00 ? 181 ILE A HD12 3  
ATOM   8988  H  HD13 . ILE A 1 181 ? 19.849  23.766 23.874 1.00 0.00 ? 181 ILE A HD13 3  
ATOM   8989  N  N    . LEU A 1 182 ? 14.373  22.145 21.302 1.00 0.00 ? 182 LEU A N    3  
ATOM   8990  C  CA   . LEU A 1 182 ? 12.885  22.092 21.259 1.00 0.00 ? 182 LEU A CA   3  
ATOM   8991  C  C    . LEU A 1 182 ? 12.370  20.702 20.878 1.00 0.00 ? 182 LEU A C    3  
ATOM   8992  O  O    . LEU A 1 182 ? 11.275  20.327 21.247 1.00 0.00 ? 182 LEU A O    3  
ATOM   8993  C  CB   . LEU A 1 182 ? 12.408  23.099 20.196 1.00 0.00 ? 182 LEU A CB   3  
ATOM   8994  C  CG   . LEU A 1 182 ? 10.881  23.022 20.074 1.00 0.00 ? 182 LEU A CG   3  
ATOM   8995  C  CD1  . LEU A 1 182 ? 10.247  23.345 21.428 1.00 0.00 ? 182 LEU A CD1  3  
ATOM   8996  C  CD2  . LEU A 1 182 ? 10.404  24.044 19.040 1.00 0.00 ? 182 LEU A CD2  3  
ATOM   8997  H  H    . LEU A 1 182 ? 14.845  22.938 20.972 1.00 0.00 ? 182 LEU A H    3  
ATOM   8998  H  HA   . LEU A 1 182 ? 12.494  22.358 22.240 1.00 0.00 ? 182 LEU A HA   3  
ATOM   8999  H  HB2  . LEU A 1 182 ? 12.699  24.097 20.486 1.00 0.00 ? 182 LEU A HB2  3  
ATOM   9000  H  HB3  . LEU A 1 182 ? 12.858  22.860 19.245 1.00 0.00 ? 182 LEU A HB3  3  
ATOM   9001  H  HG   . LEU A 1 182 ? 10.591  22.030 19.765 1.00 0.00 ? 182 LEU A HG   3  
ATOM   9002  H  HD11 . LEU A 1 182 ? 10.885  24.020 21.979 1.00 0.00 ? 182 LEU A HD11 3  
ATOM   9003  H  HD12 . LEU A 1 182 ? 9.283   23.809 21.278 1.00 0.00 ? 182 LEU A HD12 3  
ATOM   9004  H  HD13 . LEU A 1 182 ? 10.117  22.436 21.996 1.00 0.00 ? 182 LEU A HD13 3  
ATOM   9005  H  HD21 . LEU A 1 182 ? 10.759  25.027 19.309 1.00 0.00 ? 182 LEU A HD21 3  
ATOM   9006  H  HD22 . LEU A 1 182 ? 10.786  23.781 18.064 1.00 0.00 ? 182 LEU A HD22 3  
ATOM   9007  H  HD23 . LEU A 1 182 ? 9.325   24.052 19.007 1.00 0.00 ? 182 LEU A HD23 3  
ATOM   9008  N  N    . ARG A 1 183 ? 13.163  19.961 20.153 1.00 0.00 ? 183 ARG A N    3  
ATOM   9009  C  CA   . ARG A 1 183 ? 12.714  18.601 19.752 1.00 0.00 ? 183 ARG A CA   3  
ATOM   9010  C  C    . ARG A 1 183 ? 13.121  17.555 20.781 1.00 0.00 ? 183 ARG A C    3  
ATOM   9011  O  O    . ARG A 1 183 ? 12.367  16.650 21.080 1.00 0.00 ? 183 ARG A O    3  
ATOM   9012  C  CB   . ARG A 1 183 ? 13.375  18.251 18.408 1.00 0.00 ? 183 ARG A CB   3  
ATOM   9013  C  CG   . ARG A 1 183 ? 12.442  17.339 17.606 1.00 0.00 ? 183 ARG A CG   3  
ATOM   9014  C  CD   . ARG A 1 183 ? 12.873  17.353 16.140 1.00 0.00 ? 183 ARG A CD   3  
ATOM   9015  N  NE   . ARG A 1 183 ? 12.305  18.563 15.479 1.00 0.00 ? 183 ARG A NE   3  
ATOM   9016  C  CZ   . ARG A 1 183 ? 12.958  19.125 14.498 1.00 0.00 ? 183 ARG A CZ   3  
ATOM   9017  N  NH1  . ARG A 1 183 ? 13.961  19.913 14.776 1.00 0.00 ? 183 ARG A NH1  3  
ATOM   9018  N  NH2  . ARG A 1 183 ? 12.585  18.882 13.272 1.00 0.00 ? 183 ARG A NH2  3  
ATOM   9019  H  H    . ARG A 1 183 ? 14.041  20.292 19.880 1.00 0.00 ? 183 ARG A H    3  
ATOM   9020  H  HA   . ARG A 1 183 ? 11.633  18.604 19.660 1.00 0.00 ? 183 ARG A HA   3  
ATOM   9021  H  HB2  . ARG A 1 183 ? 13.566  19.156 17.851 1.00 0.00 ? 183 ARG A HB2  3  
ATOM   9022  H  HB3  . ARG A 1 183 ? 14.312  17.743 18.588 1.00 0.00 ? 183 ARG A HB3  3  
ATOM   9023  H  HG2  . ARG A 1 183 ? 12.500  16.331 17.992 1.00 0.00 ? 183 ARG A HG2  3  
ATOM   9024  H  HG3  . ARG A 1 183 ? 11.426  17.693 17.688 1.00 0.00 ? 183 ARG A HG3  3  
ATOM   9025  H  HD2  . ARG A 1 183 ? 13.951  17.381 16.074 1.00 0.00 ? 183 ARG A HD2  3  
ATOM   9026  H  HD3  . ARG A 1 183 ? 12.507  16.467 15.640 1.00 0.00 ? 183 ARG A HD3  3  
ATOM   9027  H  HE   . ARG A 1 183 ? 11.447  18.932 15.779 1.00 0.00 ? 183 ARG A HE   3  
ATOM   9028  H  HH11 . ARG A 1 183 ? 14.219  20.079 15.728 1.00 0.00 ? 183 ARG A HH11 3  
ATOM   9029  H  HH12 . ARG A 1 183 ? 14.471  20.353 14.036 1.00 0.00 ? 183 ARG A HH12 3  
ATOM   9030  H  HH21 . ARG A 1 183 ? 11.811  18.274 13.096 1.00 0.00 ? 183 ARG A HH21 3  
ATOM   9031  H  HH22 . ARG A 1 183 ? 13.073  19.305 12.509 1.00 0.00 ? 183 ARG A HH22 3  
ATOM   9032  N  N    . LEU A 1 184 ? 14.305  17.691 21.301 1.00 0.00 ? 184 LEU A N    3  
ATOM   9033  C  CA   . LEU A 1 184 ? 14.774  16.713 22.310 1.00 0.00 ? 184 LEU A CA   3  
ATOM   9034  C  C    . LEU A 1 184 ? 14.104  16.962 23.661 1.00 0.00 ? 184 LEU A C    3  
ATOM   9035  O  O    . LEU A 1 184 ? 13.486  16.081 24.224 1.00 0.00 ? 184 LEU A O    3  
ATOM   9036  C  CB   . LEU A 1 184 ? 16.300  16.887 22.462 1.00 0.00 ? 184 LEU A CB   3  
ATOM   9037  C  CG   . LEU A 1 184 ? 16.890  15.728 23.278 1.00 0.00 ? 184 LEU A CG   3  
ATOM   9038  C  CD1  . LEU A 1 184 ? 16.439  15.856 24.741 1.00 0.00 ? 184 LEU A CD1  3  
ATOM   9039  C  CD2  . LEU A 1 184 ? 16.416  14.384 22.692 1.00 0.00 ? 184 LEU A CD2  3  
ATOM   9040  H  H    . LEU A 1 184 ? 14.883  18.429 21.026 1.00 0.00 ? 184 LEU A H    3  
ATOM   9041  H  HA   . LEU A 1 184 ? 14.526  15.714 21.968 1.00 0.00 ? 184 LEU A HA   3  
ATOM   9042  H  HB2  . LEU A 1 184 ? 16.758  16.910 21.485 1.00 0.00 ? 184 LEU A HB2  3  
ATOM   9043  H  HB3  . LEU A 1 184 ? 16.506  17.822 22.965 1.00 0.00 ? 184 LEU A HB3  3  
ATOM   9044  H  HG   . LEU A 1 184 ? 17.968  15.773 23.233 1.00 0.00 ? 184 LEU A HG   3  
ATOM   9045  H  HD11 . LEU A 1 184 ? 16.184  16.885 24.951 1.00 0.00 ? 184 LEU A HD11 3  
ATOM   9046  H  HD12 . LEU A 1 184 ? 15.578  15.234 24.920 1.00 0.00 ? 184 LEU A HD12 3  
ATOM   9047  H  HD13 . LEU A 1 184 ? 17.241  15.548 25.395 1.00 0.00 ? 184 LEU A HD13 3  
ATOM   9048  H  HD21 . LEU A 1 184 ? 16.329  14.467 21.619 1.00 0.00 ? 184 LEU A HD21 3  
ATOM   9049  H  HD22 . LEU A 1 184 ? 17.132  13.612 22.930 1.00 0.00 ? 184 LEU A HD22 3  
ATOM   9050  H  HD23 . LEU A 1 184 ? 15.456  14.114 23.104 1.00 0.00 ? 184 LEU A HD23 3  
ATOM   9051  N  N    . ILE A 1 185 ? 14.237  18.163 24.149 1.00 0.00 ? 185 ILE A N    3  
ATOM   9052  C  CA   . ILE A 1 185 ? 13.621  18.502 25.458 1.00 0.00 ? 185 ILE A CA   3  
ATOM   9053  C  C    . ILE A 1 185 ? 12.182  17.980 25.552 1.00 0.00 ? 185 ILE A C    3  
ATOM   9054  O  O    . ILE A 1 185 ? 11.645  17.830 26.631 1.00 0.00 ? 185 ILE A O    3  
ATOM   9055  C  CB   . ILE A 1 185 ? 13.600  20.027 25.576 1.00 0.00 ? 185 ILE A CB   3  
ATOM   9056  C  CG1  . ILE A 1 185 ? 13.335  20.440 27.020 1.00 0.00 ? 185 ILE A CG1  3  
ATOM   9057  C  CG2  . ILE A 1 185 ? 12.466  20.567 24.683 1.00 0.00 ? 185 ILE A CG2  3  
ATOM   9058  C  CD1  . ILE A 1 185 ? 12.752  21.856 27.042 1.00 0.00 ? 185 ILE A CD1  3  
ATOM   9059  H  H    . ILE A 1 185 ? 14.743  18.839 23.655 1.00 0.00 ? 185 ILE A H    3  
ATOM   9060  H  HA   . ILE A 1 185 ? 14.214  18.060 26.256 1.00 0.00 ? 185 ILE A HA   3  
ATOM   9061  H  HB   . ILE A 1 185 ? 14.566  20.424 25.260 1.00 0.00 ? 185 ILE A HB   3  
ATOM   9062  H  HG12 . ILE A 1 185 ? 12.640  19.758 27.473 1.00 0.00 ? 185 ILE A HG12 3  
ATOM   9063  H  HG13 . ILE A 1 185 ? 14.260  20.421 27.577 1.00 0.00 ? 185 ILE A HG13 3  
ATOM   9064  H  HG21 . ILE A 1 185 ? 12.541  20.131 23.697 1.00 0.00 ? 185 ILE A HG21 3  
ATOM   9065  H  HG22 . ILE A 1 185 ? 11.509  20.310 25.112 1.00 0.00 ? 185 ILE A HG22 3  
ATOM   9066  H  HG23 . ILE A 1 185 ? 12.545  21.640 24.604 1.00 0.00 ? 185 ILE A HG23 3  
ATOM   9067  H  HD11 . ILE A 1 185 ? 13.362  22.511 26.441 1.00 0.00 ? 185 ILE A HD11 3  
ATOM   9068  H  HD12 . ILE A 1 185 ? 11.747  21.844 26.648 1.00 0.00 ? 185 ILE A HD12 3  
ATOM   9069  H  HD13 . ILE A 1 185 ? 12.728  22.223 28.056 1.00 0.00 ? 185 ILE A HD13 3  
ATOM   9070  N  N    . GLN A 1 186 ? 11.592  17.705 24.419 1.00 0.00 ? 186 GLN A N    3  
ATOM   9071  C  CA   . GLN A 1 186 ? 10.190  17.192 24.423 1.00 0.00 ? 186 GLN A CA   3  
ATOM   9072  C  C    . GLN A 1 186 ? 9.955   16.194 25.554 1.00 0.00 ? 186 GLN A C    3  
ATOM   9073  O  O    . GLN A 1 186 ? 10.795  15.365 25.839 1.00 0.00 ? 186 GLN A O    3  
ATOM   9074  C  CB   . GLN A 1 186 ? 9.931   16.495 23.083 1.00 0.00 ? 186 GLN A CB   3  
ATOM   9075  C  CG   . GLN A 1 186 ? 9.913   17.547 21.975 1.00 0.00 ? 186 GLN A CG   3  
ATOM   9076  C  CD   . GLN A 1 186 ? 8.698   18.460 22.161 1.00 0.00 ? 186 GLN A CD   3  
ATOM   9077  O  OE1  . GLN A 1 186 ? 8.674   19.580 21.691 1.00 0.00 ? 186 GLN A OE1  3  
ATOM   9078  N  NE2  . GLN A 1 186 ? 7.670   18.023 22.837 1.00 0.00 ? 186 GLN A NE2  3  
ATOM   9079  H  H    . GLN A 1 186 ? 12.067  17.832 23.571 1.00 0.00 ? 186 GLN A H    3  
ATOM   9080  H  HA   . GLN A 1 186 ? 9.511   18.035 24.553 1.00 0.00 ? 186 GLN A HA   3  
ATOM   9081  H  HB2  . GLN A 1 186 ? 10.713  15.776 22.889 1.00 0.00 ? 186 GLN A HB2  3  
ATOM   9082  H  HB3  . GLN A 1 186 ? 8.979   15.984 23.116 1.00 0.00 ? 186 GLN A HB3  3  
ATOM   9083  H  HG2  . GLN A 1 186 ? 10.812  18.143 22.022 1.00 0.00 ? 186 GLN A HG2  3  
ATOM   9084  H  HG3  . GLN A 1 186 ? 9.852   17.065 21.013 1.00 0.00 ? 186 GLN A HG3  3  
ATOM   9085  H  HE21 . GLN A 1 186 ? 7.683   17.121 23.219 1.00 0.00 ? 186 GLN A HE21 3  
ATOM   9086  H  HE22 . GLN A 1 186 ? 6.886   18.598 22.963 1.00 0.00 ? 186 GLN A HE22 3  
ATOM   9087  N  N    . PHE A 1 187 ? 8.802   16.302 26.174 1.00 0.00 ? 187 PHE A N    3  
ATOM   9088  C  CA   . PHE A 1 187 ? 8.467   15.379 27.293 1.00 0.00 ? 187 PHE A CA   3  
ATOM   9089  C  C    . PHE A 1 187 ? 7.026   14.898 27.181 1.00 0.00 ? 187 PHE A C    3  
ATOM   9090  O  O    . PHE A 1 187 ? 6.128   15.485 27.753 1.00 0.00 ? 187 PHE A O    3  
ATOM   9091  C  CB   . PHE A 1 187 ? 8.623   16.150 28.617 1.00 0.00 ? 187 PHE A CB   3  
ATOM   9092  C  CG   . PHE A 1 187 ? 7.851   17.468 28.525 1.00 0.00 ? 187 PHE A CG   3  
ATOM   9093  C  CD1  . PHE A 1 187 ? 8.293   18.486 27.696 1.00 0.00 ? 187 PHE A CD1  3  
ATOM   9094  C  CD2  . PHE A 1 187 ? 6.694   17.657 29.262 1.00 0.00 ? 187 PHE A CD2  3  
ATOM   9095  C  CE1  . PHE A 1 187 ? 7.589   19.671 27.608 1.00 0.00 ? 187 PHE A CE1  3  
ATOM   9096  C  CE2  . PHE A 1 187 ? 5.995   18.842 29.171 1.00 0.00 ? 187 PHE A CE2  3  
ATOM   9097  C  CZ   . PHE A 1 187 ? 6.441   19.847 28.345 1.00 0.00 ? 187 PHE A CZ   3  
ATOM   9098  H  H    . PHE A 1 187 ? 8.160   16.989 25.898 1.00 0.00 ? 187 PHE A H    3  
ATOM   9099  H  HA   . PHE A 1 187 ? 9.133   14.518 27.262 1.00 0.00 ? 187 PHE A HA   3  
ATOM   9100  H  HB2  . PHE A 1 187 ? 8.227   15.563 29.433 1.00 0.00 ? 187 PHE A HB2  3  
ATOM   9101  H  HB3  . PHE A 1 187 ? 9.666   16.359 28.800 1.00 0.00 ? 187 PHE A HB3  3  
ATOM   9102  H  HD1  . PHE A 1 187 ? 9.194   18.355 27.117 1.00 0.00 ? 187 PHE A HD1  3  
ATOM   9103  H  HD2  . PHE A 1 187 ? 6.340   16.873 29.914 1.00 0.00 ? 187 PHE A HD2  3  
ATOM   9104  H  HE1  . PHE A 1 187 ? 7.939   20.460 26.959 1.00 0.00 ? 187 PHE A HE1  3  
ATOM   9105  H  HE2  . PHE A 1 187 ? 5.093   18.981 29.749 1.00 0.00 ? 187 PHE A HE2  3  
ATOM   9106  H  HZ   . PHE A 1 187 ? 5.890   20.773 28.274 1.00 0.00 ? 187 PHE A HZ   3  
ATOM   9107  N  N    . GLU A 1 188 ? 6.826   13.838 26.446 1.00 0.00 ? 188 GLU A N    3  
ATOM   9108  C  CA   . GLU A 1 188 ? 5.448   13.313 26.290 1.00 0.00 ? 188 GLU A CA   3  
ATOM   9109  C  C    . GLU A 1 188 ? 4.885   12.866 27.633 1.00 0.00 ? 188 GLU A C    3  
ATOM   9110  O  O    . GLU A 1 188 ? 5.701   12.606 28.504 1.00 0.00 ? 188 GLU A O    3  
ATOM   9111  C  CB   . GLU A 1 188 ? 5.489   12.101 25.348 1.00 0.00 ? 188 GLU A CB   3  
ATOM   9112  C  CG   . GLU A 1 188 ? 6.035   12.535 23.986 1.00 0.00 ? 188 GLU A CG   3  
ATOM   9113  C  CD   . GLU A 1 188 ? 5.863   11.388 22.989 1.00 0.00 ? 188 GLU A CD   3  
ATOM   9114  O  OE1  . GLU A 1 188 ? 6.545   10.394 23.184 1.00 0.00 ? 188 GLU A OE1  3  
ATOM   9115  O  OE2  . GLU A 1 188 ? 5.060   11.569 22.088 1.00 0.00 ? 188 GLU A OE2  3  
ATOM   9116  H  H    . GLU A 1 188 ? 7.578   13.393 26.003 1.00 0.00 ? 188 GLU A H    3  
ATOM   9117  H  HA   . GLU A 1 188 ? 4.813   14.100 25.884 1.00 0.00 ? 188 GLU A HA   3  
ATOM   9118  H  HB2  . GLU A 1 188 ? 6.126   11.337 25.767 1.00 0.00 ? 188 GLU A HB2  3  
ATOM   9119  H  HB3  . GLU A 1 188 ? 4.491   11.702 25.228 1.00 0.00 ? 188 GLU A HB3  3  
ATOM   9120  H  HG2  . GLU A 1 188 ? 5.493   13.400 23.632 1.00 0.00 ? 188 GLU A HG2  3  
ATOM   9121  H  HG3  . GLU A 1 188 ? 7.082   12.780 24.073 1.00 0.00 ? 188 GLU A HG3  3  
HETATM 9122  CA CA   . CA  B 2 .   ? -5.874  24.095 42.538 1.00 0.00 ? 500 CA  A CA   3  
HETATM 9123  CA CA   . CA  C 2 .   ? 11.994  25.223 40.254 1.00 0.00 ? 501 CA  A CA   3  
HETATM 9124  C  C1   . MYR D 3 .   ? -18.656 38.922 38.840 1.00 0.00 ? 502 MYR A C1   3  
HETATM 9125  O  O1   . MYR D 3 .   ? -18.331 39.444 39.887 1.00 0.00 ? 502 MYR A O1   3  
HETATM 9126  C  C2   . MYR D 3 .   ? -18.392 39.616 37.503 1.00 0.00 ? 502 MYR A C2   3  
HETATM 9127  C  C3   . MYR D 3 .   ? -19.194 40.918 37.445 1.00 0.00 ? 502 MYR A C3   3  
HETATM 9128  C  C4   . MYR D 3 .   ? -18.510 41.969 38.321 1.00 0.00 ? 502 MYR A C4   3  
HETATM 9129  C  C5   . MYR D 3 .   ? -19.059 43.352 37.966 1.00 0.00 ? 502 MYR A C5   3  
HETATM 9130  C  C6   . MYR D 3 .   ? -18.465 43.802 36.626 1.00 0.00 ? 502 MYR A C6   3  
HETATM 9131  C  C7   . MYR D 3 .   ? -17.648 45.079 36.840 1.00 0.00 ? 502 MYR A C7   3  
HETATM 9132  C  C8   . MYR D 3 .   ? -17.241 45.651 35.481 1.00 0.00 ? 502 MYR A C8   3  
HETATM 9133  C  C9   . MYR D 3 .   ? -15.784 45.283 35.198 1.00 0.00 ? 502 MYR A C9   3  
HETATM 9134  C  C10  . MYR D 3 .   ? -15.359 45.898 33.862 1.00 0.00 ? 502 MYR A C10  3  
HETATM 9135  C  C11  . MYR D 3 .   ? -14.006 45.313 33.449 1.00 0.00 ? 502 MYR A C11  3  
HETATM 9136  C  C12  . MYR D 3 .   ? -13.485 46.069 32.226 1.00 0.00 ? 502 MYR A C12  3  
HETATM 9137  C  C13  . MYR D 3 .   ? -14.332 45.697 31.007 1.00 0.00 ? 502 MYR A C13  3  
HETATM 9138  C  C14  . MYR D 3 .   ? -13.498 45.889 29.738 1.00 0.00 ? 502 MYR A C14  3  
HETATM 9139  H  H21  . MYR D 3 .   ? -17.338 39.832 37.414 1.00 0.00 ? 502 MYR A H21  3  
HETATM 9140  H  H22  . MYR D 3 .   ? -18.694 38.965 36.696 1.00 0.00 ? 502 MYR A H22  3  
HETATM 9141  H  H31  . MYR D 3 .   ? -19.241 41.270 36.425 1.00 0.00 ? 502 MYR A H31  3  
HETATM 9142  H  H32  . MYR D 3 .   ? -20.197 40.742 37.805 1.00 0.00 ? 502 MYR A H32  3  
HETATM 9143  H  H41  . MYR D 3 .   ? -18.704 41.757 39.363 1.00 0.00 ? 502 MYR A H41  3  
HETATM 9144  H  H42  . MYR D 3 .   ? -17.443 41.947 38.149 1.00 0.00 ? 502 MYR A H42  3  
HETATM 9145  H  H51  . MYR D 3 .   ? -20.135 43.306 37.889 1.00 0.00 ? 502 MYR A H51  3  
HETATM 9146  H  H52  . MYR D 3 .   ? -18.791 44.059 38.739 1.00 0.00 ? 502 MYR A H52  3  
HETATM 9147  H  H61  . MYR D 3 .   ? -17.827 43.025 36.230 1.00 0.00 ? 502 MYR A H61  3  
HETATM 9148  H  H62  . MYR D 3 .   ? -19.263 43.996 35.924 1.00 0.00 ? 502 MYR A H62  3  
HETATM 9149  H  H71  . MYR D 3 .   ? -18.243 45.804 37.375 1.00 0.00 ? 502 MYR A H71  3  
HETATM 9150  H  H72  . MYR D 3 .   ? -16.763 44.852 37.417 1.00 0.00 ? 502 MYR A H72  3  
HETATM 9151  H  H81  . MYR D 3 .   ? -17.876 45.238 34.709 1.00 0.00 ? 502 MYR A H81  3  
HETATM 9152  H  H82  . MYR D 3 .   ? -17.349 46.725 35.491 1.00 0.00 ? 502 MYR A H82  3  
HETATM 9153  H  H91  . MYR D 3 .   ? -15.154 45.663 35.989 1.00 0.00 ? 502 MYR A H91  3  
HETATM 9154  H  H92  . MYR D 3 .   ? -15.684 44.208 35.149 1.00 0.00 ? 502 MYR A H92  3  
HETATM 9155  H  H101 . MYR D 3 .   ? -16.098 45.671 33.107 1.00 0.00 ? 502 MYR A H101 3  
HETATM 9156  H  H102 . MYR D 3 .   ? -15.275 46.970 33.966 1.00 0.00 ? 502 MYR A H102 3  
HETATM 9157  H  H111 . MYR D 3 .   ? -13.304 45.414 34.263 1.00 0.00 ? 502 MYR A H111 3  
HETATM 9158  H  H112 . MYR D 3 .   ? -14.121 44.267 33.207 1.00 0.00 ? 502 MYR A H112 3  
HETATM 9159  H  H121 . MYR D 3 .   ? -13.550 47.132 32.400 1.00 0.00 ? 502 MYR A H121 3  
HETATM 9160  H  H122 . MYR D 3 .   ? -12.453 45.803 32.046 1.00 0.00 ? 502 MYR A H122 3  
HETATM 9161  H  H131 . MYR D 3 .   ? -14.644 44.665 31.084 1.00 0.00 ? 502 MYR A H131 3  
HETATM 9162  H  H132 . MYR D 3 .   ? -15.206 46.329 30.966 1.00 0.00 ? 502 MYR A H132 3  
HETATM 9163  H  H141 . MYR D 3 .   ? -12.954 46.821 29.795 1.00 0.00 ? 502 MYR A H141 3  
HETATM 9164  H  H142 . MYR D 3 .   ? -14.149 45.911 28.875 1.00 0.00 ? 502 MYR A H142 3  
HETATM 9165  H  H143 . MYR D 3 .   ? -12.797 45.074 29.634 1.00 0.00 ? 502 MYR A H143 3  
ATOM   9166  N  N    . GLY A 1 1   ? -34.255 27.034 40.535 1.00 0.00 ? 1   GLY A N    4  
ATOM   9167  C  CA   . GLY A 1 1   ? -32.772 27.106 40.402 1.00 0.00 ? 1   GLY A CA   4  
ATOM   9168  C  C    . GLY A 1 1   ? -32.188 25.714 40.153 1.00 0.00 ? 1   GLY A C    4  
ATOM   9169  O  O    . GLY A 1 1   ? -31.399 25.220 40.934 1.00 0.00 ? 1   GLY A O    4  
ATOM   9170  H  H    . GLY A 1 1   ? -34.831 27.235 39.769 1.00 0.00 ? 1   GLY A H    4  
ATOM   9171  H  HA2  . GLY A 1 1   ? -32.520 27.752 39.573 1.00 0.00 ? 1   GLY A HA2  4  
ATOM   9172  H  HA3  . GLY A 1 1   ? -32.352 27.512 41.311 1.00 0.00 ? 1   GLY A HA3  4  
ATOM   9173  N  N    . ASN A 1 2   ? -32.588 25.109 39.067 1.00 0.00 ? 2   ASN A N    4  
ATOM   9174  C  CA   . ASN A 1 2   ? -32.067 23.755 38.756 1.00 0.00 ? 2   ASN A CA   4  
ATOM   9175  C  C    . ASN A 1 2   ? -30.547 23.724 38.860 1.00 0.00 ? 2   ASN A C    4  
ATOM   9176  O  O    . ASN A 1 2   ? -29.989 22.934 39.595 1.00 0.00 ? 2   ASN A O    4  
ATOM   9177  C  CB   . ASN A 1 2   ? -32.473 23.397 37.317 1.00 0.00 ? 2   ASN A CB   4  
ATOM   9178  C  CG   . ASN A 1 2   ? -31.924 24.454 36.356 1.00 0.00 ? 2   ASN A CG   4  
ATOM   9179  O  OD1  . ASN A 1 2   ? -30.849 24.310 35.806 1.00 0.00 ? 2   ASN A OD1  4  
ATOM   9180  N  ND2  . ASN A 1 2   ? -32.627 25.528 36.126 1.00 0.00 ? 2   ASN A ND2  4  
ATOM   9181  H  H    . ASN A 1 2   ? -33.224 25.544 38.464 1.00 0.00 ? 2   ASN A H    4  
ATOM   9182  H  HA   . ASN A 1 2   ? -32.486 23.042 39.465 1.00 0.00 ? 2   ASN A HA   4  
ATOM   9183  H  HB2  . ASN A 1 2   ? -32.070 22.431 37.053 1.00 0.00 ? 2   ASN A HB2  4  
ATOM   9184  H  HB3  . ASN A 1 2   ? -33.550 23.369 37.238 1.00 0.00 ? 2   ASN A HB3  4  
ATOM   9185  H  HD21 . ASN A 1 2   ? -33.495 25.650 36.566 1.00 0.00 ? 2   ASN A HD21 4  
ATOM   9186  H  HD22 . ASN A 1 2   ? -32.290 26.214 35.511 1.00 0.00 ? 2   ASN A HD22 4  
ATOM   9187  N  N    . SER A 1 3   ? -29.902 24.587 38.121 1.00 0.00 ? 3   SER A N    4  
ATOM   9188  C  CA   . SER A 1 3   ? -28.418 24.622 38.165 1.00 0.00 ? 3   SER A CA   4  
ATOM   9189  C  C    . SER A 1 3   ? -27.820 23.388 37.500 1.00 0.00 ? 3   SER A C    4  
ATOM   9190  O  O    . SER A 1 3   ? -28.289 22.284 37.700 1.00 0.00 ? 3   SER A O    4  
ATOM   9191  C  CB   . SER A 1 3   ? -27.981 24.649 39.638 1.00 0.00 ? 3   SER A CB   4  
ATOM   9192  O  OG   . SER A 1 3   ? -26.803 25.442 39.636 1.00 0.00 ? 3   SER A OG   4  
ATOM   9193  H  H    . SER A 1 3   ? -30.394 25.207 37.542 1.00 0.00 ? 3   SER A H    4  
ATOM   9194  H  HA   . SER A 1 3   ? -28.069 25.511 37.643 1.00 0.00 ? 3   SER A HA   4  
ATOM   9195  H  HB2  . SER A 1 3   ? -28.739 25.107 40.256 1.00 0.00 ? 3   SER A HB2  4  
ATOM   9196  H  HB3  . SER A 1 3   ? -27.759 23.652 39.990 1.00 0.00 ? 3   SER A HB3  4  
ATOM   9197  H  HG   . SER A 1 3   ? -26.314 25.245 38.835 1.00 0.00 ? 3   SER A HG   4  
ATOM   9198  N  N    . LYS A 1 4   ? -26.791 23.603 36.718 1.00 0.00 ? 4   LYS A N    4  
ATOM   9199  C  CA   . LYS A 1 4   ? -26.139 22.461 36.024 1.00 0.00 ? 4   LYS A CA   4  
ATOM   9200  C  C    . LYS A 1 4   ? -24.862 22.053 36.747 1.00 0.00 ? 4   LYS A C    4  
ATOM   9201  O  O    . LYS A 1 4   ? -24.861 21.131 37.538 1.00 0.00 ? 4   LYS A O    4  
ATOM   9202  C  CB   . LYS A 1 4   ? -25.777 22.905 34.597 1.00 0.00 ? 4   LYS A CB   4  
ATOM   9203  C  CG   . LYS A 1 4   ? -27.040 22.896 33.734 1.00 0.00 ? 4   LYS A CG   4  
ATOM   9204  C  CD   . LYS A 1 4   ? -26.656 23.164 32.275 1.00 0.00 ? 4   LYS A CD   4  
ATOM   9205  C  CE   . LYS A 1 4   ? -27.529 24.293 31.724 1.00 0.00 ? 4   LYS A CE   4  
ATOM   9206  N  NZ   . LYS A 1 4   ? -27.181 24.574 30.303 1.00 0.00 ? 4   LYS A NZ   4  
ATOM   9207  H  H    . LYS A 1 4   ? -26.451 24.514 36.592 1.00 0.00 ? 4   LYS A H    4  
ATOM   9208  H  HA   . LYS A 1 4   ? -26.823 21.614 36.003 1.00 0.00 ? 4   LYS A HA   4  
ATOM   9209  H  HB2  . LYS A 1 4   ? -25.360 23.901 34.622 1.00 0.00 ? 4   LYS A HB2  4  
ATOM   9210  H  HB3  . LYS A 1 4   ? -25.048 22.226 34.180 1.00 0.00 ? 4   LYS A HB3  4  
ATOM   9211  H  HG2  . LYS A 1 4   ? -27.526 21.936 33.811 1.00 0.00 ? 4   LYS A HG2  4  
ATOM   9212  H  HG3  . LYS A 1 4   ? -27.718 23.664 34.078 1.00 0.00 ? 4   LYS A HG3  4  
ATOM   9213  H  HD2  . LYS A 1 4   ? -25.616 23.448 32.218 1.00 0.00 ? 4   LYS A HD2  4  
ATOM   9214  H  HD3  . LYS A 1 4   ? -26.810 22.268 31.690 1.00 0.00 ? 4   LYS A HD3  4  
ATOM   9215  H  HE2  . LYS A 1 4   ? -28.569 24.009 31.782 1.00 0.00 ? 4   LYS A HE2  4  
ATOM   9216  H  HE3  . LYS A 1 4   ? -27.374 25.188 32.308 1.00 0.00 ? 4   LYS A HE3  4  
ATOM   9217  H  HZ1  . LYS A 1 4   ? -27.206 23.689 29.758 1.00 0.00 ? 4   LYS A HZ1  4  
ATOM   9218  H  HZ2  . LYS A 1 4   ? -27.866 25.248 29.904 1.00 0.00 ? 4   LYS A HZ2  4  
ATOM   9219  H  HZ3  . LYS A 1 4   ? -26.225 24.983 30.255 1.00 0.00 ? 4   LYS A HZ3  4  
ATOM   9220  N  N    . SER A 1 5   ? -23.797 22.749 36.462 1.00 0.00 ? 5   SER A N    4  
ATOM   9221  C  CA   . SER A 1 5   ? -22.511 22.418 37.121 1.00 0.00 ? 5   SER A CA   4  
ATOM   9222  C  C    . SER A 1 5   ? -21.619 23.649 37.204 1.00 0.00 ? 5   SER A C    4  
ATOM   9223  O  O    . SER A 1 5   ? -22.005 24.664 37.749 1.00 0.00 ? 5   SER A O    4  
ATOM   9224  C  CB   . SER A 1 5   ? -21.797 21.345 36.284 1.00 0.00 ? 5   SER A CB   4  
ATOM   9225  O  OG   . SER A 1 5   ? -22.617 20.193 36.420 1.00 0.00 ? 5   SER A OG   4  
ATOM   9226  H  H    . SER A 1 5   ? -23.846 23.485 35.816 1.00 0.00 ? 5   SER A H    4  
ATOM   9227  H  HA   . SER A 1 5   ? -22.711 22.054 38.129 1.00 0.00 ? 5   SER A HA   4  
ATOM   9228  H  HB2  . SER A 1 5   ? -21.741 21.643 35.246 1.00 0.00 ? 5   SER A HB2  4  
ATOM   9229  H  HB3  . SER A 1 5   ? -20.809 21.148 36.673 1.00 0.00 ? 5   SER A HB3  4  
ATOM   9230  H  HG   . SER A 1 5   ? -22.747 19.816 35.546 1.00 0.00 ? 5   SER A HG   4  
ATOM   9231  N  N    . GLY A 1 6   ? -20.438 23.538 36.662 1.00 0.00 ? 6   GLY A N    4  
ATOM   9232  C  CA   . GLY A 1 6   ? -19.507 24.698 36.701 1.00 0.00 ? 6   GLY A CA   4  
ATOM   9233  C  C    . GLY A 1 6   ? -19.659 25.537 35.431 1.00 0.00 ? 6   GLY A C    4  
ATOM   9234  O  O    . GLY A 1 6   ? -18.839 26.384 35.140 1.00 0.00 ? 6   GLY A O    4  
ATOM   9235  H  H    . GLY A 1 6   ? -20.167 22.699 36.234 1.00 0.00 ? 6   GLY A H    4  
ATOM   9236  H  HA2  . GLY A 1 6   ? -19.733 25.309 37.562 1.00 0.00 ? 6   GLY A HA2  4  
ATOM   9237  H  HA3  . GLY A 1 6   ? -18.491 24.339 36.773 1.00 0.00 ? 6   GLY A HA3  4  
ATOM   9238  N  N    . ALA A 1 7   ? -20.710 25.279 34.701 1.00 0.00 ? 7   ALA A N    4  
ATOM   9239  C  CA   . ALA A 1 7   ? -20.936 26.045 33.453 1.00 0.00 ? 7   ALA A CA   4  
ATOM   9240  C  C    . ALA A 1 7   ? -19.651 26.155 32.650 1.00 0.00 ? 7   ALA A C    4  
ATOM   9241  O  O    . ALA A 1 7   ? -19.198 27.241 32.350 1.00 0.00 ? 7   ALA A O    4  
ATOM   9242  C  CB   . ALA A 1 7   ? -21.404 27.460 33.825 1.00 0.00 ? 7   ALA A CB   4  
ATOM   9243  H  H    . ALA A 1 7   ? -21.343 24.583 34.974 1.00 0.00 ? 7   ALA A H    4  
ATOM   9244  H  HA   . ALA A 1 7   ? -21.687 25.533 32.853 1.00 0.00 ? 7   ALA A HA   4  
ATOM   9245  H  HB1  . ALA A 1 7   ? -22.253 27.401 34.489 1.00 0.00 ? 7   ALA A HB1  4  
ATOM   9246  H  HB2  . ALA A 1 7   ? -20.602 27.991 34.318 1.00 0.00 ? 7   ALA A HB2  4  
ATOM   9247  H  HB3  . ALA A 1 7   ? -21.688 27.997 32.932 1.00 0.00 ? 7   ALA A HB3  4  
ATOM   9248  N  N    . LEU A 1 8   ? -19.078 25.026 32.320 1.00 0.00 ? 8   LEU A N    4  
ATOM   9249  C  CA   . LEU A 1 8   ? -17.822 25.056 31.536 1.00 0.00 ? 8   LEU A CA   4  
ATOM   9250  C  C    . LEU A 1 8   ? -18.052 25.758 30.206 1.00 0.00 ? 8   LEU A C    4  
ATOM   9251  O  O    . LEU A 1 8   ? -19.073 26.378 29.992 1.00 0.00 ? 8   LEU A O    4  
ATOM   9252  C  CB   . LEU A 1 8   ? -17.374 23.612 31.199 1.00 0.00 ? 8   LEU A CB   4  
ATOM   9253  C  CG   . LEU A 1 8   ? -17.458 22.648 32.414 1.00 0.00 ? 8   LEU A CG   4  
ATOM   9254  C  CD1  . LEU A 1 8   ? -16.210 21.750 32.391 1.00 0.00 ? 8   LEU A CD1  4  
ATOM   9255  C  CD2  . LEU A 1 8   ? -17.511 23.401 33.756 1.00 0.00 ? 8   LEU A CD2  4  
ATOM   9256  H  H    . LEU A 1 8   ? -19.472 24.172 32.593 1.00 0.00 ? 8   LEU A H    4  
ATOM   9257  H  HA   . LEU A 1 8   ? -17.050 25.596 32.093 1.00 0.00 ? 8   LEU A HA   4  
ATOM   9258  H  HB2  . LEU A 1 8   ? -18.003 23.228 30.410 1.00 0.00 ? 8   LEU A HB2  4  
ATOM   9259  H  HB3  . LEU A 1 8   ? -16.360 23.635 30.841 1.00 0.00 ? 8   LEU A HB3  4  
ATOM   9260  H  HG   . LEU A 1 8   ? -18.339 22.032 32.316 1.00 0.00 ? 8   LEU A HG   4  
ATOM   9261  H  HD11 . LEU A 1 8   ? -16.158 21.229 31.455 1.00 0.00 ? 8   LEU A HD11 4  
ATOM   9262  H  HD12 . LEU A 1 8   ? -15.326 22.346 32.500 1.00 0.00 ? 8   LEU A HD12 4  
ATOM   9263  H  HD13 . LEU A 1 8   ? -16.258 21.036 33.195 1.00 0.00 ? 8   LEU A HD13 4  
ATOM   9264  H  HD21 . LEU A 1 8   ? -16.880 24.264 33.727 1.00 0.00 ? 8   LEU A HD21 4  
ATOM   9265  H  HD22 . LEU A 1 8   ? -18.521 23.703 33.968 1.00 0.00 ? 8   LEU A HD22 4  
ATOM   9266  H  HD23 . LEU A 1 8   ? -17.172 22.746 34.543 1.00 0.00 ? 8   LEU A HD23 4  
ATOM   9267  N  N    . SER A 1 9   ? -17.092 25.632 29.335 1.00 0.00 ? 9   SER A N    4  
ATOM   9268  C  CA   . SER A 1 9   ? -17.208 26.272 28.006 1.00 0.00 ? 9   SER A CA   4  
ATOM   9269  C  C    . SER A 1 9   ? -17.315 27.787 28.114 1.00 0.00 ? 9   SER A C    4  
ATOM   9270  O  O    . SER A 1 9   ? -17.040 28.485 27.169 1.00 0.00 ? 9   SER A O    4  
ATOM   9271  C  CB   . SER A 1 9   ? -18.472 25.736 27.316 1.00 0.00 ? 9   SER A CB   4  
ATOM   9272  O  OG   . SER A 1 9   ? -18.257 26.008 25.941 1.00 0.00 ? 9   SER A OG   4  
ATOM   9273  H  H    . SER A 1 9   ? -16.292 25.113 29.560 1.00 0.00 ? 9   SER A H    4  
ATOM   9274  H  HA   . SER A 1 9   ? -16.320 26.026 27.423 1.00 0.00 ? 9   SER A HA   4  
ATOM   9275  H  HB2  . SER A 1 9   ? -18.574 24.674 27.476 1.00 0.00 ? 9   SER A HB2  4  
ATOM   9276  H  HB3  . SER A 1 9   ? -19.351 26.258 27.664 1.00 0.00 ? 9   SER A HB3  4  
ATOM   9277  H  HG   . SER A 1 9   ? -17.858 26.879 25.872 1.00 0.00 ? 9   SER A HG   4  
ATOM   9278  N  N    . LYS A 1 10  ? -17.753 28.263 29.247 1.00 0.00 ? 10  LYS A N    4  
ATOM   9279  C  CA   . LYS A 1 10  ? -17.881 29.733 29.417 1.00 0.00 ? 10  LYS A CA   4  
ATOM   9280  C  C    . LYS A 1 10  ? -16.632 30.332 30.042 1.00 0.00 ? 10  LYS A C    4  
ATOM   9281  O  O    . LYS A 1 10  ? -15.998 31.193 29.467 1.00 0.00 ? 10  LYS A O    4  
ATOM   9282  C  CB   . LYS A 1 10  ? -19.075 30.016 30.340 1.00 0.00 ? 10  LYS A CB   4  
ATOM   9283  C  CG   . LYS A 1 10  ? -20.352 30.093 29.502 1.00 0.00 ? 10  LYS A CG   4  
ATOM   9284  C  CD   . LYS A 1 10  ? -21.510 30.539 30.400 1.00 0.00 ? 10  LYS A CD   4  
ATOM   9285  C  CE   . LYS A 1 10  ? -21.410 32.049 30.642 1.00 0.00 ? 10  LYS A CE   4  
ATOM   9286  N  NZ   . LYS A 1 10  ? -21.105 32.763 29.371 1.00 0.00 ? 10  LYS A NZ   4  
ATOM   9287  H  H    . LYS A 1 10  ? -17.996 27.661 29.976 1.00 0.00 ? 10  LYS A H    4  
ATOM   9288  H  HA   . LYS A 1 10  ? -18.027 30.186 28.447 1.00 0.00 ? 10  LYS A HA   4  
ATOM   9289  H  HB2  . LYS A 1 10  ? -19.165 29.226 31.068 1.00 0.00 ? 10  LYS A HB2  4  
ATOM   9290  H  HB3  . LYS A 1 10  ? -18.920 30.955 30.852 1.00 0.00 ? 10  LYS A HB3  4  
ATOM   9291  H  HG2  . LYS A 1 10  ? -20.219 30.802 28.701 1.00 0.00 ? 10  LYS A HG2  4  
ATOM   9292  H  HG3  . LYS A 1 10  ? -20.571 29.121 29.084 1.00 0.00 ? 10  LYS A HG3  4  
ATOM   9293  H  HD2  . LYS A 1 10  ? -22.450 30.310 29.921 1.00 0.00 ? 10  LYS A HD2  4  
ATOM   9294  H  HD3  . LYS A 1 10  ? -21.458 30.018 31.344 1.00 0.00 ? 10  LYS A HD3  4  
ATOM   9295  H  HE2  . LYS A 1 10  ? -22.348 32.415 31.034 1.00 0.00 ? 10  LYS A HE2  4  
ATOM   9296  H  HE3  . LYS A 1 10  ? -20.627 32.250 31.357 1.00 0.00 ? 10  LYS A HE3  4  
ATOM   9297  H  HZ1  . LYS A 1 10  ? -21.810 32.506 28.650 1.00 0.00 ? 10  LYS A HZ1  4  
ATOM   9298  H  HZ2  . LYS A 1 10  ? -21.134 33.790 29.534 1.00 0.00 ? 10  LYS A HZ2  4  
ATOM   9299  H  HZ3  . LYS A 1 10  ? -20.156 32.492 29.040 1.00 0.00 ? 10  LYS A HZ3  4  
ATOM   9300  N  N    . GLU A 1 11  ? -16.302 29.864 31.211 1.00 0.00 ? 11  GLU A N    4  
ATOM   9301  C  CA   . GLU A 1 11  ? -15.101 30.395 31.896 1.00 0.00 ? 11  GLU A CA   4  
ATOM   9302  C  C    . GLU A 1 11  ? -13.842 29.678 31.440 1.00 0.00 ? 11  GLU A C    4  
ATOM   9303  O  O    . GLU A 1 11  ? -12.744 30.165 31.620 1.00 0.00 ? 11  GLU A O    4  
ATOM   9304  C  CB   . GLU A 1 11  ? -15.276 30.157 33.396 1.00 0.00 ? 11  GLU A CB   4  
ATOM   9305  C  CG   . GLU A 1 11  ? -16.573 30.819 33.863 1.00 0.00 ? 11  GLU A CG   4  
ATOM   9306  C  CD   . GLU A 1 11  ? -16.696 30.667 35.381 1.00 0.00 ? 11  GLU A CD   4  
ATOM   9307  O  OE1  . GLU A 1 11  ? -15.666 30.417 35.986 1.00 0.00 ? 11  GLU A OE1  4  
ATOM   9308  O  OE2  . GLU A 1 11  ? -17.813 30.811 35.849 1.00 0.00 ? 11  GLU A OE2  4  
ATOM   9309  H  H    . GLU A 1 11  ? -16.840 29.154 31.631 1.00 0.00 ? 11  GLU A H    4  
ATOM   9310  H  HA   . GLU A 1 11  ? -15.004 31.458 31.681 1.00 0.00 ? 11  GLU A HA   4  
ATOM   9311  H  HB2  . GLU A 1 11  ? -15.322 29.096 33.587 1.00 0.00 ? 11  GLU A HB2  4  
ATOM   9312  H  HB3  . GLU A 1 11  ? -14.441 30.578 33.927 1.00 0.00 ? 11  GLU A HB3  4  
ATOM   9313  H  HG2  . GLU A 1 11  ? -16.562 31.868 33.608 1.00 0.00 ? 11  GLU A HG2  4  
ATOM   9314  H  HG3  . GLU A 1 11  ? -17.417 30.343 33.388 1.00 0.00 ? 11  GLU A HG3  4  
ATOM   9315  N  N    . ILE A 1 12  ? -14.021 28.536 30.858 1.00 0.00 ? 12  ILE A N    4  
ATOM   9316  C  CA   . ILE A 1 12  ? -12.850 27.772 30.382 1.00 0.00 ? 12  ILE A CA   4  
ATOM   9317  C  C    . ILE A 1 12  ? -12.479 28.177 28.987 1.00 0.00 ? 12  ILE A C    4  
ATOM   9318  O  O    . ILE A 1 12  ? -11.421 27.834 28.504 1.00 0.00 ? 12  ILE A O    4  
ATOM   9319  C  CB   . ILE A 1 12  ? -13.222 26.311 30.382 1.00 0.00 ? 12  ILE A CB   4  
ATOM   9320  C  CG1  . ILE A 1 12  ? -14.305 26.077 31.426 1.00 0.00 ? 12  ILE A CG1  4  
ATOM   9321  C  CG2  . ILE A 1 12  ? -11.975 25.487 30.741 1.00 0.00 ? 12  ILE A CG2  4  
ATOM   9322  C  CD1  . ILE A 1 12  ? -14.235 24.647 31.944 1.00 0.00 ? 12  ILE A CD1  4  
ATOM   9323  H  H    . ILE A 1 12  ? -14.926 28.180 30.735 1.00 0.00 ? 12  ILE A H    4  
ATOM   9324  H  HA   . ILE A 1 12  ? -12.004 27.962 31.040 1.00 0.00 ? 12  ILE A HA   4  
ATOM   9325  H  HB   . ILE A 1 12  ? -13.599 26.044 29.398 1.00 0.00 ? 12  ILE A HB   4  
ATOM   9326  H  HG12 . ILE A 1 12  ? -14.169 26.764 32.248 1.00 0.00 ? 12  ILE A HG12 4  
ATOM   9327  H  HG13 . ILE A 1 12  ? -15.273 26.251 30.984 1.00 0.00 ? 12  ILE A HG13 4  
ATOM   9328  H  HG21 . ILE A 1 12  ? -11.161 25.761 30.091 1.00 0.00 ? 12  ILE A HG21 4  
ATOM   9329  H  HG22 . ILE A 1 12  ? -11.692 25.678 31.765 1.00 0.00 ? 12  ILE A HG22 4  
ATOM   9330  H  HG23 . ILE A 1 12  ? -12.186 24.437 30.618 1.00 0.00 ? 12  ILE A HG23 4  
ATOM   9331  H  HD11 . ILE A 1 12  ? -14.235 23.955 31.123 1.00 0.00 ? 12  ILE A HD11 4  
ATOM   9332  H  HD12 . ILE A 1 12  ? -13.340 24.510 32.520 1.00 0.00 ? 12  ILE A HD12 4  
ATOM   9333  H  HD13 . ILE A 1 12  ? -15.082 24.456 32.564 1.00 0.00 ? 12  ILE A HD13 4  
ATOM   9334  N  N    . LEU A 1 13  ? -13.349 28.894 28.346 1.00 0.00 ? 13  LEU A N    4  
ATOM   9335  C  CA   . LEU A 1 13  ? -13.054 29.311 27.021 1.00 0.00 ? 13  LEU A CA   4  
ATOM   9336  C  C    . LEU A 1 13  ? -12.263 30.582 27.154 1.00 0.00 ? 13  LEU A C    4  
ATOM   9337  O  O    . LEU A 1 13  ? -11.460 30.922 26.324 1.00 0.00 ? 13  LEU A O    4  
ATOM   9338  C  CB   . LEU A 1 13  ? -14.389 29.554 26.333 1.00 0.00 ? 13  LEU A CB   4  
ATOM   9339  C  CG   . LEU A 1 13  ? -14.324 30.752 25.441 1.00 0.00 ? 13  LEU A CG   4  
ATOM   9340  C  CD1  . LEU A 1 13  ? -13.331 30.494 24.302 1.00 0.00 ? 13  LEU A CD1  4  
ATOM   9341  C  CD2  . LEU A 1 13  ? -15.704 30.996 24.835 1.00 0.00 ? 13  LEU A CD2  4  
ATOM   9342  H  H    . LEU A 1 13  ? -14.178 29.184 28.763 1.00 0.00 ? 13  LEU A H    4  
ATOM   9343  H  HA   . LEU A 1 13  ? -12.467 28.538 26.516 1.00 0.00 ? 13  LEU A HA   4  
ATOM   9344  H  HB2  . LEU A 1 13  ? -14.652 28.693 25.759 1.00 0.00 ? 13  LEU A HB2  4  
ATOM   9345  H  HB3  . LEU A 1 13  ? -15.130 29.723 27.082 1.00 0.00 ? 13  LEU A HB3  4  
ATOM   9346  H  HG   . LEU A 1 13  ? -14.029 31.600 26.027 1.00 0.00 ? 13  LEU A HG   4  
ATOM   9347  H  HD11 . LEU A 1 13  ? -12.560 29.811 24.629 1.00 0.00 ? 13  LEU A HD11 4  
ATOM   9348  H  HD12 . LEU A 1 13  ? -13.850 30.057 23.461 1.00 0.00 ? 13  LEU A HD12 4  
ATOM   9349  H  HD13 . LEU A 1 13  ? -12.884 31.422 23.995 1.00 0.00 ? 13  LEU A HD13 4  
ATOM   9350  H  HD21 . LEU A 1 13  ? -16.425 31.146 25.622 1.00 0.00 ? 13  LEU A HD21 4  
ATOM   9351  H  HD22 . LEU A 1 13  ? -15.673 31.870 24.204 1.00 0.00 ? 13  LEU A HD22 4  
ATOM   9352  H  HD23 . LEU A 1 13  ? -15.996 30.140 24.243 1.00 0.00 ? 13  LEU A HD23 4  
ATOM   9353  N  N    . GLU A 1 14  ? -12.534 31.280 28.230 1.00 0.00 ? 14  GLU A N    4  
ATOM   9354  C  CA   . GLU A 1 14  ? -11.820 32.529 28.464 1.00 0.00 ? 14  GLU A CA   4  
ATOM   9355  C  C    . GLU A 1 14  ? -10.355 32.216 28.420 1.00 0.00 ? 14  GLU A C    4  
ATOM   9356  O  O    . GLU A 1 14  ? -9.516  33.095 28.399 1.00 0.00 ? 14  GLU A O    4  
ATOM   9357  C  CB   . GLU A 1 14  ? -12.185 33.053 29.862 1.00 0.00 ? 14  GLU A CB   4  
ATOM   9358  C  CG   . GLU A 1 14  ? -13.498 33.830 29.777 1.00 0.00 ? 14  GLU A CG   4  
ATOM   9359  C  CD   . GLU A 1 14  ? -13.299 35.056 28.885 1.00 0.00 ? 14  GLU A CD   4  
ATOM   9360  O  OE1  . GLU A 1 14  ? -12.568 35.930 29.322 1.00 0.00 ? 14  GLU A OE1  4  
ATOM   9361  O  OE2  . GLU A 1 14  ? -13.888 35.049 27.816 1.00 0.00 ? 14  GLU A OE2  4  
ATOM   9362  H  H    . GLU A 1 14  ? -13.209 30.968 28.868 1.00 0.00 ? 14  GLU A H    4  
ATOM   9363  H  HA   . GLU A 1 14  ? -12.069 33.248 27.685 1.00 0.00 ? 14  GLU A HA   4  
ATOM   9364  H  HB2  . GLU A 1 14  ? -12.298 32.222 30.542 1.00 0.00 ? 14  GLU A HB2  4  
ATOM   9365  H  HB3  . GLU A 1 14  ? -11.402 33.703 30.222 1.00 0.00 ? 14  GLU A HB3  4  
ATOM   9366  H  HG2  . GLU A 1 14  ? -14.269 33.201 29.355 1.00 0.00 ? 14  GLU A HG2  4  
ATOM   9367  H  HG3  . GLU A 1 14  ? -13.800 34.150 30.764 1.00 0.00 ? 14  GLU A HG3  4  
ATOM   9368  N  N    . GLU A 1 15  ? -10.074 30.935 28.436 1.00 0.00 ? 15  GLU A N    4  
ATOM   9369  C  CA   . GLU A 1 15  ? -8.679  30.493 28.393 1.00 0.00 ? 15  GLU A CA   4  
ATOM   9370  C  C    . GLU A 1 15  ? -8.196  30.455 26.946 1.00 0.00 ? 15  GLU A C    4  
ATOM   9371  O  O    . GLU A 1 15  ? -7.024  30.263 26.695 1.00 0.00 ? 15  GLU A O    4  
ATOM   9372  C  CB   . GLU A 1 15  ? -8.600  29.081 28.996 1.00 0.00 ? 15  GLU A CB   4  
ATOM   9373  C  CG   . GLU A 1 15  ? -9.212  29.102 30.401 1.00 0.00 ? 15  GLU A CG   4  
ATOM   9374  C  CD   . GLU A 1 15  ? -9.100  27.710 31.026 1.00 0.00 ? 15  GLU A CD   4  
ATOM   9375  O  OE1  . GLU A 1 15  ? -8.830  26.794 30.265 1.00 0.00 ? 15  GLU A OE1  4  
ATOM   9376  O  OE2  . GLU A 1 15  ? -9.292  27.638 32.229 1.00 0.00 ? 15  GLU A OE2  4  
ATOM   9377  H  H    . GLU A 1 15  ? -10.805 30.264 28.496 1.00 0.00 ? 15  GLU A H    4  
ATOM   9378  H  HA   . GLU A 1 15  ? -8.064  31.195 28.958 1.00 0.00 ? 15  GLU A HA   4  
ATOM   9379  H  HB2  . GLU A 1 15  ? -9.145  28.390 28.373 1.00 0.00 ? 15  GLU A HB2  4  
ATOM   9380  H  HB3  . GLU A 1 15  ? -7.569  28.767 29.055 1.00 0.00 ? 15  GLU A HB3  4  
ATOM   9381  H  HG2  . GLU A 1 15  ? -8.684  29.814 31.019 1.00 0.00 ? 15  GLU A HG2  4  
ATOM   9382  H  HG3  . GLU A 1 15  ? -10.254 29.385 30.342 1.00 0.00 ? 15  GLU A HG3  4  
ATOM   9383  N  N    . LEU A 1 16  ? -9.141  30.618 26.010 1.00 0.00 ? 16  LEU A N    4  
ATOM   9384  C  CA   . LEU A 1 16  ? -8.773  30.600 24.549 1.00 0.00 ? 16  LEU A CA   4  
ATOM   9385  C  C    . LEU A 1 16  ? -7.339  31.076 24.310 1.00 0.00 ? 16  LEU A C    4  
ATOM   9386  O  O    . LEU A 1 16  ? -6.651  30.564 23.448 1.00 0.00 ? 16  LEU A O    4  
ATOM   9387  C  CB   . LEU A 1 16  ? -9.751  31.523 23.775 1.00 0.00 ? 16  LEU A CB   4  
ATOM   9388  C  CG   . LEU A 1 16  ? -9.417  33.009 24.021 1.00 0.00 ? 16  LEU A CG   4  
ATOM   9389  C  CD1  . LEU A 1 16  ? -10.272 33.872 23.091 1.00 0.00 ? 16  LEU A CD1  4  
ATOM   9390  C  CD2  . LEU A 1 16  ? -9.743  33.372 25.469 1.00 0.00 ? 16  LEU A CD2  4  
ATOM   9391  H  H    . LEU A 1 16  ? -10.107 30.715 26.280 1.00 0.00 ? 16  LEU A H    4  
ATOM   9392  H  HA   . LEU A 1 16  ? -8.863  29.579 24.188 1.00 0.00 ? 16  LEU A HA   4  
ATOM   9393  H  HB2  . LEU A 1 16  ? -9.683  31.312 22.718 1.00 0.00 ? 16  LEU A HB2  4  
ATOM   9394  H  HB3  . LEU A 1 16  ? -10.752 31.327 24.103 1.00 0.00 ? 16  LEU A HB3  4  
ATOM   9395  H  HG   . LEU A 1 16  ? -8.376  33.194 23.823 1.00 0.00 ? 16  LEU A HG   4  
ATOM   9396  H  HD11 . LEU A 1 16  ? -11.275 33.472 23.044 1.00 0.00 ? 16  LEU A HD11 4  
ATOM   9397  H  HD12 . LEU A 1 16  ? -10.310 34.884 23.465 1.00 0.00 ? 16  LEU A HD12 4  
ATOM   9398  H  HD13 . LEU A 1 16  ? -9.843  33.875 22.100 1.00 0.00 ? 16  LEU A HD13 4  
ATOM   9399  H  HD21 . LEU A 1 16  ? -10.757 33.084 25.699 1.00 0.00 ? 16  LEU A HD21 4  
ATOM   9400  H  HD22 . LEU A 1 16  ? -9.070  32.859 26.130 1.00 0.00 ? 16  LEU A HD22 4  
ATOM   9401  H  HD23 . LEU A 1 16  ? -9.636  34.438 25.610 1.00 0.00 ? 16  LEU A HD23 4  
ATOM   9402  N  N    . GLN A 1 17  ? -6.913  32.047 25.077 1.00 0.00 ? 17  GLN A N    4  
ATOM   9403  C  CA   . GLN A 1 17  ? -5.535  32.557 24.901 1.00 0.00 ? 17  GLN A CA   4  
ATOM   9404  C  C    . GLN A 1 17  ? -4.531  31.454 25.181 1.00 0.00 ? 17  GLN A C    4  
ATOM   9405  O  O    . GLN A 1 17  ? -3.664  31.174 24.376 1.00 0.00 ? 17  GLN A O    4  
ATOM   9406  C  CB   . GLN A 1 17  ? -5.308  33.703 25.900 1.00 0.00 ? 17  GLN A CB   4  
ATOM   9407  C  CG   . GLN A 1 17  ? -4.028  34.449 25.523 1.00 0.00 ? 17  GLN A CG   4  
ATOM   9408  C  CD   . GLN A 1 17  ? -4.169  35.011 24.107 1.00 0.00 ? 17  GLN A CD   4  
ATOM   9409  O  OE1  . GLN A 1 17  ? -4.683  36.094 23.906 1.00 0.00 ? 17  GLN A OE1  4  
ATOM   9410  N  NE2  . GLN A 1 17  ? -3.727  34.307 23.102 1.00 0.00 ? 17  GLN A NE2  4  
ATOM   9411  H  H    . GLN A 1 17  ? -7.498  32.430 25.760 1.00 0.00 ? 17  GLN A H    4  
ATOM   9412  H  HA   . GLN A 1 17  ? -5.409  32.903 23.875 1.00 0.00 ? 17  GLN A HA   4  
ATOM   9413  H  HB2  . GLN A 1 17  ? -6.146  34.382 25.869 1.00 0.00 ? 17  GLN A HB2  4  
ATOM   9414  H  HB3  . GLN A 1 17  ? -5.213  33.301 26.897 1.00 0.00 ? 17  GLN A HB3  4  
ATOM   9415  H  HG2  . GLN A 1 17  ? -3.862  35.263 26.216 1.00 0.00 ? 17  GLN A HG2  4  
ATOM   9416  H  HG3  . GLN A 1 17  ? -3.185  33.774 25.559 1.00 0.00 ? 17  GLN A HG3  4  
ATOM   9417  H  HE21 . GLN A 1 17  ? -3.312  33.434 23.261 1.00 0.00 ? 17  GLN A HE21 4  
ATOM   9418  H  HE22 . GLN A 1 17  ? -3.811  34.651 22.188 1.00 0.00 ? 17  GLN A HE22 4  
ATOM   9419  N  N    . LEU A 1 18  ? -4.666  30.844 26.327 1.00 0.00 ? 18  LEU A N    4  
ATOM   9420  C  CA   . LEU A 1 18  ? -3.733  29.753 26.681 1.00 0.00 ? 18  LEU A CA   4  
ATOM   9421  C  C    . LEU A 1 18  ? -3.959  28.567 25.760 1.00 0.00 ? 18  LEU A C    4  
ATOM   9422  O  O    . LEU A 1 18  ? -4.899  27.816 25.937 1.00 0.00 ? 18  LEU A O    4  
ATOM   9423  C  CB   . LEU A 1 18  ? -4.018  29.329 28.130 1.00 0.00 ? 18  LEU A CB   4  
ATOM   9424  C  CG   . LEU A 1 18  ? -2.972  28.309 28.579 1.00 0.00 ? 18  LEU A CG   4  
ATOM   9425  C  CD1  . LEU A 1 18  ? -1.589  28.960 28.564 1.00 0.00 ? 18  LEU A CD1  4  
ATOM   9426  C  CD2  . LEU A 1 18  ? -3.297  27.850 30.002 1.00 0.00 ? 18  LEU A CD2  4  
ATOM   9427  H  H    . LEU A 1 18  ? -5.380  31.105 26.945 1.00 0.00 ? 18  LEU A H    4  
ATOM   9428  H  HA   . LEU A 1 18  ? -2.706  30.107 26.568 1.00 0.00 ? 18  LEU A HA   4  
ATOM   9429  H  HB2  . LEU A 1 18  ? -3.980  30.195 28.775 1.00 0.00 ? 18  LEU A HB2  4  
ATOM   9430  H  HB3  . LEU A 1 18  ? -5.002  28.888 28.189 1.00 0.00 ? 18  LEU A HB3  4  
ATOM   9431  H  HG   . LEU A 1 18  ? -2.980  27.459 27.912 1.00 0.00 ? 18  LEU A HG   4  
ATOM   9432  H  HD11 . LEU A 1 18  ? -1.680  30.010 28.795 1.00 0.00 ? 18  LEU A HD11 4  
ATOM   9433  H  HD12 . LEU A 1 18  ? -0.956  28.486 29.301 1.00 0.00 ? 18  LEU A HD12 4  
ATOM   9434  H  HD13 . LEU A 1 18  ? -1.144  28.846 27.587 1.00 0.00 ? 18  LEU A HD13 4  
ATOM   9435  H  HD21 . LEU A 1 18  ? -4.365  27.888 30.162 1.00 0.00 ? 18  LEU A HD21 4  
ATOM   9436  H  HD22 . LEU A 1 18  ? -2.952  26.838 30.148 1.00 0.00 ? 18  LEU A HD22 4  
ATOM   9437  H  HD23 . LEU A 1 18  ? -2.807  28.498 30.715 1.00 0.00 ? 18  LEU A HD23 4  
ATOM   9438  N  N    . ASN A 1 19  ? -3.102  28.426 24.785 1.00 0.00 ? 19  ASN A N    4  
ATOM   9439  C  CA   . ASN A 1 19  ? -3.247  27.295 23.834 1.00 0.00 ? 19  ASN A CA   4  
ATOM   9440  C  C    . ASN A 1 19  ? -4.363  27.581 22.841 1.00 0.00 ? 19  ASN A C    4  
ATOM   9441  O  O    . ASN A 1 19  ? -4.911  28.666 22.817 1.00 0.00 ? 19  ASN A O    4  
ATOM   9442  C  CB   . ASN A 1 19  ? -3.588  26.018 24.620 1.00 0.00 ? 19  ASN A CB   4  
ATOM   9443  C  CG   . ASN A 1 19  ? -2.888  24.824 23.964 1.00 0.00 ? 19  ASN A CG   4  
ATOM   9444  O  OD1  . ASN A 1 19  ? -1.683  24.804 23.810 1.00 0.00 ? 19  ASN A OD1  4  
ATOM   9445  N  ND2  . ASN A 1 19  ? -3.606  23.811 23.560 1.00 0.00 ? 19  ASN A ND2  4  
ATOM   9446  H  H    . ASN A 1 19  ? -2.365  29.066 24.681 1.00 0.00 ? 19  ASN A H    4  
ATOM   9447  H  HA   . ASN A 1 19  ? -2.316  27.173 23.285 1.00 0.00 ? 19  ASN A HA   4  
ATOM   9448  H  HB2  . ASN A 1 19  ? -3.251  26.114 25.642 1.00 0.00 ? 19  ASN A HB2  4  
ATOM   9449  H  HB3  . ASN A 1 19  ? -4.656  25.855 24.609 1.00 0.00 ? 19  ASN A HB3  4  
ATOM   9450  H  HD21 . ASN A 1 19  ? -4.578  23.822 23.679 1.00 0.00 ? 19  ASN A HD21 4  
ATOM   9451  H  HD22 . ASN A 1 19  ? -3.173  23.042 23.139 1.00 0.00 ? 19  ASN A HD22 4  
ATOM   9452  N  N    . THR A 1 20  ? -4.680  26.601 22.041 1.00 0.00 ? 20  THR A N    4  
ATOM   9453  C  CA   . THR A 1 20  ? -5.758  26.794 21.036 1.00 0.00 ? 20  THR A CA   4  
ATOM   9454  C  C    . THR A 1 20  ? -7.089  26.199 21.511 1.00 0.00 ? 20  THR A C    4  
ATOM   9455  O  O    . THR A 1 20  ? -8.140  26.599 21.055 1.00 0.00 ? 20  THR A O    4  
ATOM   9456  C  CB   . THR A 1 20  ? -5.324  26.081 19.751 1.00 0.00 ? 20  THR A CB   4  
ATOM   9457  O  OG1  . THR A 1 20  ? -4.753  27.090 18.940 1.00 0.00 ? 20  THR A OG1  4  
ATOM   9458  C  CG2  . THR A 1 20  ? -6.540  25.589 18.959 1.00 0.00 ? 20  THR A CG2  4  
ATOM   9459  H  H    . THR A 1 20  ? -4.209  25.744 22.098 1.00 0.00 ? 20  THR A H    4  
ATOM   9460  H  HA   . THR A 1 20  ? -5.893  27.858 20.856 1.00 0.00 ? 20  THR A HA   4  
ATOM   9461  H  HB   . THR A 1 20  ? -4.604  25.292 19.952 1.00 0.00 ? 20  THR A HB   4  
ATOM   9462  H  HG1  . THR A 1 20  ? -4.336  27.735 19.518 1.00 0.00 ? 20  THR A HG1  4  
ATOM   9463  H  HG21 . THR A 1 20  ? -7.256  26.390 18.860 1.00 0.00 ? 20  THR A HG21 4  
ATOM   9464  H  HG22 . THR A 1 20  ? -6.229  25.263 17.979 1.00 0.00 ? 20  THR A HG22 4  
ATOM   9465  H  HG23 . THR A 1 20  ? -7.001  24.761 19.481 1.00 0.00 ? 20  THR A HG23 4  
ATOM   9466  N  N    . LYS A 1 21  ? -7.011  25.258 22.420 1.00 0.00 ? 21  LYS A N    4  
ATOM   9467  C  CA   . LYS A 1 21  ? -8.259  24.613 22.948 1.00 0.00 ? 21  LYS A CA   4  
ATOM   9468  C  C    . LYS A 1 21  ? -8.991  23.846 21.849 1.00 0.00 ? 21  LYS A C    4  
ATOM   9469  O  O    . LYS A 1 21  ? -9.346  24.407 20.834 1.00 0.00 ? 21  LYS A O    4  
ATOM   9470  C  CB   . LYS A 1 21  ? -9.218  25.701 23.500 1.00 0.00 ? 21  LYS A CB   4  
ATOM   9471  C  CG   . LYS A 1 21  ? -8.424  26.763 24.277 1.00 0.00 ? 21  LYS A CG   4  
ATOM   9472  C  CD   . LYS A 1 21  ? -7.646  26.095 25.411 1.00 0.00 ? 21  LYS A CD   4  
ATOM   9473  C  CE   . LYS A 1 21  ? -8.635  25.439 26.378 1.00 0.00 ? 21  LYS A CE   4  
ATOM   9474  N  NZ   . LYS A 1 21  ? -8.691  23.968 26.150 1.00 0.00 ? 21  LYS A NZ   4  
ATOM   9475  H  H    . LYS A 1 21  ? -6.138  24.973 22.751 1.00 0.00 ? 21  LYS A H    4  
ATOM   9476  H  HA   . LYS A 1 21  ? -7.983  23.909 23.733 1.00 0.00 ? 21  LYS A HA   4  
ATOM   9477  H  HB2  . LYS A 1 21  ? -9.745  26.172 22.683 1.00 0.00 ? 21  LYS A HB2  4  
ATOM   9478  H  HB3  . LYS A 1 21  ? -9.942  25.239 24.158 1.00 0.00 ? 21  LYS A HB3  4  
ATOM   9479  H  HG2  . LYS A 1 21  ? -7.740  27.265 23.611 1.00 0.00 ? 21  LYS A HG2  4  
ATOM   9480  H  HG3  . LYS A 1 21  ? -9.107  27.486 24.694 1.00 0.00 ? 21  LYS A HG3  4  
ATOM   9481  H  HD2  . LYS A 1 21  ? -6.979  25.348 25.008 1.00 0.00 ? 21  LYS A HD2  4  
ATOM   9482  H  HD3  . LYS A 1 21  ? -7.064  26.840 25.937 1.00 0.00 ? 21  LYS A HD3  4  
ATOM   9483  H  HE2  . LYS A 1 21  ? -8.325  25.628 27.394 1.00 0.00 ? 21  LYS A HE2  4  
ATOM   9484  H  HE3  . LYS A 1 21  ? -9.619  25.857 26.228 1.00 0.00 ? 21  LYS A HE3  4  
ATOM   9485  H  HZ1  . LYS A 1 21  ? -7.862  23.672 25.597 1.00 0.00 ? 21  LYS A HZ1  4  
ATOM   9486  H  HZ2  . LYS A 1 21  ? -8.691  23.477 27.065 1.00 0.00 ? 21  LYS A HZ2  4  
ATOM   9487  H  HZ3  . LYS A 1 21  ? -9.560  23.731 25.629 1.00 0.00 ? 21  LYS A HZ3  4  
ATOM   9488  N  N    . PHE A 1 22  ? -9.199  22.566 22.075 1.00 0.00 ? 22  PHE A N    4  
ATOM   9489  C  CA   . PHE A 1 22  ? -9.910  21.743 21.052 1.00 0.00 ? 22  PHE A CA   4  
ATOM   9490  C  C    . PHE A 1 22  ? -11.071 22.532 20.470 1.00 0.00 ? 22  PHE A C    4  
ATOM   9491  O  O    . PHE A 1 22  ? -11.048 22.931 19.325 1.00 0.00 ? 22  PHE A O    4  
ATOM   9492  C  CB   . PHE A 1 22  ? -10.469 20.484 21.747 1.00 0.00 ? 22  PHE A CB   4  
ATOM   9493  C  CG   . PHE A 1 22  ? -10.513 19.314 20.753 1.00 0.00 ? 22  PHE A CG   4  
ATOM   9494  C  CD1  . PHE A 1 22  ? -10.951 19.511 19.452 1.00 0.00 ? 22  PHE A CD1  4  
ATOM   9495  C  CD2  . PHE A 1 22  ? -10.127 18.040 21.145 1.00 0.00 ? 22  PHE A CD2  4  
ATOM   9496  C  CE1  . PHE A 1 22  ? -11.004 18.453 18.566 1.00 0.00 ? 22  PHE A CE1  4  
ATOM   9497  C  CE2  . PHE A 1 22  ? -10.183 16.987 20.253 1.00 0.00 ? 22  PHE A CE2  4  
ATOM   9498  C  CZ   . PHE A 1 22  ? -10.621 17.195 18.968 1.00 0.00 ? 22  PHE A CZ   4  
ATOM   9499  H  H    . PHE A 1 22  ? -8.882  22.154 22.906 1.00 0.00 ? 22  PHE A H    4  
ATOM   9500  H  HA   . PHE A 1 22  ? -9.219  21.478 20.256 1.00 0.00 ? 22  PHE A HA   4  
ATOM   9501  H  HB2  . PHE A 1 22  ? -9.841  20.218 22.582 1.00 0.00 ? 22  PHE A HB2  4  
ATOM   9502  H  HB3  . PHE A 1 22  ? -11.470 20.681 22.108 1.00 0.00 ? 22  PHE A HB3  4  
ATOM   9503  H  HD1  . PHE A 1 22  ? -11.251 20.493 19.132 1.00 0.00 ? 22  PHE A HD1  4  
ATOM   9504  H  HD2  . PHE A 1 22  ? -9.780  17.870 22.153 1.00 0.00 ? 22  PHE A HD2  4  
ATOM   9505  H  HE1  . PHE A 1 22  ? -11.344 18.613 17.556 1.00 0.00 ? 22  PHE A HE1  4  
ATOM   9506  H  HE2  . PHE A 1 22  ? -9.884  15.998 20.566 1.00 0.00 ? 22  PHE A HE2  4  
ATOM   9507  H  HZ   . PHE A 1 22  ? -10.665 16.369 18.273 1.00 0.00 ? 22  PHE A HZ   4  
ATOM   9508  N  N    . THR A 1 23  ? -12.059 22.744 21.283 1.00 0.00 ? 23  THR A N    4  
ATOM   9509  C  CA   . THR A 1 23  ? -13.244 23.503 20.826 1.00 0.00 ? 23  THR A CA   4  
ATOM   9510  C  C    . THR A 1 23  ? -14.185 23.733 21.987 1.00 0.00 ? 23  THR A C    4  
ATOM   9511  O  O    . THR A 1 23  ? -14.770 22.804 22.512 1.00 0.00 ? 23  THR A O    4  
ATOM   9512  C  CB   . THR A 1 23  ? -13.974 22.687 19.750 1.00 0.00 ? 23  THR A CB   4  
ATOM   9513  O  OG1  . THR A 1 23  ? -13.458 21.376 19.863 1.00 0.00 ? 23  THR A OG1  4  
ATOM   9514  C  CG2  . THR A 1 23  ? -13.580 23.131 18.324 1.00 0.00 ? 23  THR A CG2  4  
ATOM   9515  H  H    . THR A 1 23  ? -12.022 22.398 22.197 1.00 0.00 ? 23  THR A H    4  
ATOM   9516  H  HA   . THR A 1 23  ? -12.927 24.472 20.443 1.00 0.00 ? 23  THR A HA   4  
ATOM   9517  H  HB   . THR A 1 23  ? -15.044 22.693 19.908 1.00 0.00 ? 23  THR A HB   4  
ATOM   9518  H  HG1  . THR A 1 23  ? -14.093 20.772 19.469 1.00 0.00 ? 23  THR A HG1  4  
ATOM   9519  H  HG21 . THR A 1 23  ? -13.151 24.122 18.346 1.00 0.00 ? 23  THR A HG21 4  
ATOM   9520  H  HG22 . THR A 1 23  ? -12.858 22.442 17.913 1.00 0.00 ? 23  THR A HG22 4  
ATOM   9521  H  HG23 . THR A 1 23  ? -14.456 23.141 17.694 1.00 0.00 ? 23  THR A HG23 4  
ATOM   9522  N  N    . GLU A 1 24  ? -14.308 24.967 22.375 1.00 0.00 ? 24  GLU A N    4  
ATOM   9523  C  CA   . GLU A 1 24  ? -15.202 25.291 23.503 1.00 0.00 ? 24  GLU A CA   4  
ATOM   9524  C  C    . GLU A 1 24  ? -16.540 24.565 23.367 1.00 0.00 ? 24  GLU A C    4  
ATOM   9525  O  O    . GLU A 1 24  ? -17.301 24.481 24.310 1.00 0.00 ? 24  GLU A O    4  
ATOM   9526  C  CB   . GLU A 1 24  ? -15.437 26.813 23.497 1.00 0.00 ? 24  GLU A CB   4  
ATOM   9527  C  CG   . GLU A 1 24  ? -16.711 27.140 22.704 1.00 0.00 ? 24  GLU A CG   4  
ATOM   9528  C  CD   . GLU A 1 24  ? -16.637 28.578 22.195 1.00 0.00 ? 24  GLU A CD   4  
ATOM   9529  O  OE1  . GLU A 1 24  ? -15.755 28.821 21.387 1.00 0.00 ? 24  GLU A OE1  4  
ATOM   9530  O  OE2  . GLU A 1 24  ? -17.465 29.353 22.642 1.00 0.00 ? 24  GLU A OE2  4  
ATOM   9531  H  H    . GLU A 1 24  ? -13.809 25.678 21.921 1.00 0.00 ? 24  GLU A H    4  
ATOM   9532  H  HA   . GLU A 1 24  ? -14.725 24.981 24.431 1.00 0.00 ? 24  GLU A HA   4  
ATOM   9533  H  HB2  . GLU A 1 24  ? -15.542 27.159 24.509 1.00 0.00 ? 24  GLU A HB2  4  
ATOM   9534  H  HB3  . GLU A 1 24  ? -14.588 27.306 23.041 1.00 0.00 ? 24  GLU A HB3  4  
ATOM   9535  H  HG2  . GLU A 1 24  ? -16.801 26.468 21.862 1.00 0.00 ? 24  GLU A HG2  4  
ATOM   9536  H  HG3  . GLU A 1 24  ? -17.576 27.031 23.342 1.00 0.00 ? 24  GLU A HG3  4  
ATOM   9537  N  N    . GLU A 1 25  ? -16.801 24.057 22.192 1.00 0.00 ? 25  GLU A N    4  
ATOM   9538  C  CA   . GLU A 1 25  ? -18.078 23.337 21.973 1.00 0.00 ? 25  GLU A CA   4  
ATOM   9539  C  C    . GLU A 1 25  ? -17.927 21.852 22.293 1.00 0.00 ? 25  GLU A C    4  
ATOM   9540  O  O    . GLU A 1 25  ? -18.875 21.203 22.692 1.00 0.00 ? 25  GLU A O    4  
ATOM   9541  C  CB   . GLU A 1 25  ? -18.465 23.487 20.492 1.00 0.00 ? 25  GLU A CB   4  
ATOM   9542  C  CG   . GLU A 1 25  ? -19.132 24.848 20.285 1.00 0.00 ? 25  GLU A CG   4  
ATOM   9543  C  CD   . GLU A 1 25  ? -19.260 25.128 18.786 1.00 0.00 ? 25  GLU A CD   4  
ATOM   9544  O  OE1  . GLU A 1 25  ? -19.919 24.330 18.141 1.00 0.00 ? 25  GLU A OE1  4  
ATOM   9545  O  OE2  . GLU A 1 25  ? -18.695 26.127 18.373 1.00 0.00 ? 25  GLU A OE2  4  
ATOM   9546  H  H    . GLU A 1 25  ? -16.156 24.150 21.460 1.00 0.00 ? 25  GLU A H    4  
ATOM   9547  H  HA   . GLU A 1 25  ? -18.843 23.764 22.620 1.00 0.00 ? 25  GLU A HA   4  
ATOM   9548  H  HB2  . GLU A 1 25  ? -17.578 23.419 19.878 1.00 0.00 ? 25  GLU A HB2  4  
ATOM   9549  H  HB3  . GLU A 1 25  ? -19.151 22.700 20.214 1.00 0.00 ? 25  GLU A HB3  4  
ATOM   9550  H  HG2  . GLU A 1 25  ? -20.111 24.848 20.734 1.00 0.00 ? 25  GLU A HG2  4  
ATOM   9551  H  HG3  . GLU A 1 25  ? -18.532 25.621 20.741 1.00 0.00 ? 25  GLU A HG3  4  
ATOM   9552  N  N    . GLU A 1 26  ? -16.739 21.341 22.113 1.00 0.00 ? 26  GLU A N    4  
ATOM   9553  C  CA   . GLU A 1 26  ? -16.510 19.902 22.403 1.00 0.00 ? 26  GLU A CA   4  
ATOM   9554  C  C    . GLU A 1 26  ? -16.106 19.683 23.863 1.00 0.00 ? 26  GLU A C    4  
ATOM   9555  O  O    . GLU A 1 26  ? -16.045 18.561 24.326 1.00 0.00 ? 26  GLU A O    4  
ATOM   9556  C  CB   . GLU A 1 26  ? -15.381 19.395 21.490 1.00 0.00 ? 26  GLU A CB   4  
ATOM   9557  C  CG   . GLU A 1 26  ? -15.824 18.087 20.819 1.00 0.00 ? 26  GLU A CG   4  
ATOM   9558  C  CD   . GLU A 1 26  ? -16.092 17.031 21.894 1.00 0.00 ? 26  GLU A CD   4  
ATOM   9559  O  OE1  . GLU A 1 26  ? -15.204 16.853 22.710 1.00 0.00 ? 26  GLU A OE1  4  
ATOM   9560  O  OE2  . GLU A 1 26  ? -17.170 16.461 21.837 1.00 0.00 ? 26  GLU A OE2  4  
ATOM   9561  H  H    . GLU A 1 26  ? -16.005 21.902 21.787 1.00 0.00 ? 26  GLU A H    4  
ATOM   9562  H  HA   . GLU A 1 26  ? -17.433 19.355 22.209 1.00 0.00 ? 26  GLU A HA   4  
ATOM   9563  H  HB2  . GLU A 1 26  ? -15.166 20.133 20.734 1.00 0.00 ? 26  GLU A HB2  4  
ATOM   9564  H  HB3  . GLU A 1 26  ? -14.490 19.219 22.076 1.00 0.00 ? 26  GLU A HB3  4  
ATOM   9565  H  HG2  . GLU A 1 26  ? -16.727 18.255 20.249 1.00 0.00 ? 26  GLU A HG2  4  
ATOM   9566  H  HG3  . GLU A 1 26  ? -15.046 17.733 20.159 1.00 0.00 ? 26  GLU A HG3  4  
ATOM   9567  N  N    . LEU A 1 27  ? -15.834 20.756 24.565 1.00 0.00 ? 27  LEU A N    4  
ATOM   9568  C  CA   . LEU A 1 27  ? -15.442 20.618 25.970 1.00 0.00 ? 27  LEU A CA   4  
ATOM   9569  C  C    . LEU A 1 27  ? -16.706 20.491 26.841 1.00 0.00 ? 27  LEU A C    4  
ATOM   9570  O  O    . LEU A 1 27  ? -16.635 20.251 28.024 1.00 0.00 ? 27  LEU A O    4  
ATOM   9571  C  CB   . LEU A 1 27  ? -14.602 21.891 26.341 1.00 0.00 ? 27  LEU A CB   4  
ATOM   9572  C  CG   . LEU A 1 27  ? -14.889 22.352 27.771 1.00 0.00 ? 27  LEU A CG   4  
ATOM   9573  C  CD1  . LEU A 1 27  ? -14.408 21.289 28.754 1.00 0.00 ? 27  LEU A CD1  4  
ATOM   9574  C  CD2  . LEU A 1 27  ? -14.120 23.661 28.057 1.00 0.00 ? 27  LEU A CD2  4  
ATOM   9575  H  H    . LEU A 1 27  ? -15.904 21.643 24.171 1.00 0.00 ? 27  LEU A H    4  
ATOM   9576  H  HA   . LEU A 1 27  ? -14.843 19.712 26.079 1.00 0.00 ? 27  LEU A HA   4  
ATOM   9577  H  HB2  . LEU A 1 27  ? -13.550 21.662 26.246 1.00 0.00 ? 27  LEU A HB2  4  
ATOM   9578  H  HB3  . LEU A 1 27  ? -14.846 22.690 25.654 1.00 0.00 ? 27  LEU A HB3  4  
ATOM   9579  H  HG   . LEU A 1 27  ? -15.946 22.516 27.886 1.00 0.00 ? 27  LEU A HG   4  
ATOM   9580  H  HD11 . LEU A 1 27  ? -14.313 20.351 28.250 1.00 0.00 ? 27  LEU A HD11 4  
ATOM   9581  H  HD12 . LEU A 1 27  ? -13.451 21.572 29.162 1.00 0.00 ? 27  LEU A HD12 4  
ATOM   9582  H  HD13 . LEU A 1 27  ? -15.119 21.191 29.554 1.00 0.00 ? 27  LEU A HD13 4  
ATOM   9583  H  HD21 . LEU A 1 27  ? -14.279 24.363 27.256 1.00 0.00 ? 27  LEU A HD21 4  
ATOM   9584  H  HD22 . LEU A 1 27  ? -14.470 24.092 28.982 1.00 0.00 ? 27  LEU A HD22 4  
ATOM   9585  H  HD23 . LEU A 1 27  ? -13.059 23.456 28.143 1.00 0.00 ? 27  LEU A HD23 4  
ATOM   9586  N  N    . SER A 1 28  ? -17.851 20.626 26.213 1.00 0.00 ? 28  SER A N    4  
ATOM   9587  C  CA   . SER A 1 28  ? -19.122 20.517 26.982 1.00 0.00 ? 28  SER A CA   4  
ATOM   9588  C  C    . SER A 1 28  ? -19.474 19.053 27.261 1.00 0.00 ? 28  SER A C    4  
ATOM   9589  O  O    . SER A 1 28  ? -19.893 18.714 28.349 1.00 0.00 ? 28  SER A O    4  
ATOM   9590  C  CB   . SER A 1 28  ? -20.254 21.145 26.149 1.00 0.00 ? 28  SER A CB   4  
ATOM   9591  O  OG   . SER A 1 28  ? -19.722 22.390 25.725 1.00 0.00 ? 28  SER A OG   4  
ATOM   9592  H  H    . SER A 1 28  ? -17.869 20.800 25.250 1.00 0.00 ? 28  SER A H    4  
ATOM   9593  H  HA   . SER A 1 28  ? -19.006 21.040 27.929 1.00 0.00 ? 28  SER A HA   4  
ATOM   9594  H  HB2  . SER A 1 28  ? -20.489 20.529 25.294 1.00 0.00 ? 28  SER A HB2  4  
ATOM   9595  H  HB3  . SER A 1 28  ? -21.134 21.302 26.756 1.00 0.00 ? 28  SER A HB3  4  
ATOM   9596  H  HG   . SER A 1 28  ? -19.044 22.216 25.068 1.00 0.00 ? 28  SER A HG   4  
ATOM   9597  N  N    . SER A 1 29  ? -19.301 18.213 26.273 1.00 0.00 ? 29  SER A N    4  
ATOM   9598  C  CA   . SER A 1 29  ? -19.624 16.774 26.478 1.00 0.00 ? 29  SER A CA   4  
ATOM   9599  C  C    . SER A 1 29  ? -18.558 16.104 27.338 1.00 0.00 ? 29  SER A C    4  
ATOM   9600  O  O    . SER A 1 29  ? -18.612 14.918 27.593 1.00 0.00 ? 29  SER A O    4  
ATOM   9601  C  CB   . SER A 1 29  ? -19.656 16.083 25.105 1.00 0.00 ? 29  SER A CB   4  
ATOM   9602  O  OG   . SER A 1 29  ? -20.851 16.557 24.503 1.00 0.00 ? 29  SER A OG   4  
ATOM   9603  H  H    . SER A 1 29  ? -18.963 18.526 25.409 1.00 0.00 ? 29  SER A H    4  
ATOM   9604  H  HA   . SER A 1 29  ? -20.589 16.692 26.977 1.00 0.00 ? 29  SER A HA   4  
ATOM   9605  H  HB2  . SER A 1 29  ? -18.800 16.370 24.512 1.00 0.00 ? 29  SER A HB2  4  
ATOM   9606  H  HB3  . SER A 1 29  ? -19.694 15.009 25.217 1.00 0.00 ? 29  SER A HB3  4  
ATOM   9607  H  HG   . SER A 1 29  ? -21.558 16.483 25.147 1.00 0.00 ? 29  SER A HG   4  
ATOM   9608  N  N    . TRP A 1 30  ? -17.609 16.884 27.768 1.00 0.00 ? 30  TRP A N    4  
ATOM   9609  C  CA   . TRP A 1 30  ? -16.518 16.333 28.614 1.00 0.00 ? 30  TRP A CA   4  
ATOM   9610  C  C    . TRP A 1 30  ? -16.934 16.319 30.093 1.00 0.00 ? 30  TRP A C    4  
ATOM   9611  O  O    . TRP A 1 30  ? -17.138 15.266 30.671 1.00 0.00 ? 30  TRP A O    4  
ATOM   9612  C  CB   . TRP A 1 30  ? -15.288 17.252 28.422 1.00 0.00 ? 30  TRP A CB   4  
ATOM   9613  C  CG   . TRP A 1 30  ? -14.053 16.710 29.170 1.00 0.00 ? 30  TRP A CG   4  
ATOM   9614  C  CD1  . TRP A 1 30  ? -14.065 15.721 30.055 1.00 0.00 ? 30  TRP A CD1  4  
ATOM   9615  C  CD2  . TRP A 1 30  ? -12.858 17.243 29.080 1.00 0.00 ? 30  TRP A CD2  4  
ATOM   9616  N  NE1  . TRP A 1 30  ? -12.795 15.694 30.513 1.00 0.00 ? 30  TRP A NE1  4  
ATOM   9617  C  CE2  . TRP A 1 30  ? -11.964 16.639 29.940 1.00 0.00 ? 30  TRP A CE2  4  
ATOM   9618  C  CE3  . TRP A 1 30  ? -12.440 18.277 28.265 1.00 0.00 ? 30  TRP A CE3  4  
ATOM   9619  C  CZ2  . TRP A 1 30  ? -10.655 17.081 29.992 1.00 0.00 ? 30  TRP A CZ2  4  
ATOM   9620  C  CZ3  . TRP A 1 30  ? -11.136 18.713 28.317 1.00 0.00 ? 30  TRP A CZ3  4  
ATOM   9621  C  CH2  . TRP A 1 30  ? -10.244 18.117 29.177 1.00 0.00 ? 30  TRP A CH2  4  
ATOM   9622  H  H    . TRP A 1 30  ? -17.612 17.835 27.530 1.00 0.00 ? 30  TRP A H    4  
ATOM   9623  H  HA   . TRP A 1 30  ? -16.299 15.315 28.293 1.00 0.00 ? 30  TRP A HA   4  
ATOM   9624  H  HB2  . TRP A 1 30  ? -15.056 17.326 27.370 1.00 0.00 ? 30  TRP A HB2  4  
ATOM   9625  H  HB3  . TRP A 1 30  ? -15.517 18.238 28.799 1.00 0.00 ? 30  TRP A HB3  4  
ATOM   9626  H  HD1  . TRP A 1 30  ? -14.865 15.047 30.290 1.00 0.00 ? 30  TRP A HD1  4  
ATOM   9627  H  HE1  . TRP A 1 30  ? -12.486 15.054 31.190 1.00 0.00 ? 30  TRP A HE1  4  
ATOM   9628  H  HE3  . TRP A 1 30  ? -13.126 18.724 27.570 1.00 0.00 ? 30  TRP A HE3  4  
ATOM   9629  H  HZ2  . TRP A 1 30  ? -9.961  16.635 30.683 1.00 0.00 ? 30  TRP A HZ2  4  
ATOM   9630  H  HZ3  . TRP A 1 30  ? -10.813 19.526 27.683 1.00 0.00 ? 30  TRP A HZ3  4  
ATOM   9631  H  HH2  . TRP A 1 30  ? -9.222  18.462 29.221 1.00 0.00 ? 30  TRP A HH2  4  
ATOM   9632  N  N    . TYR A 1 31  ? -17.073 17.490 30.671 1.00 0.00 ? 31  TYR A N    4  
ATOM   9633  C  CA   . TYR A 1 31  ? -17.474 17.568 32.112 1.00 0.00 ? 31  TYR A CA   4  
ATOM   9634  C  C    . TYR A 1 31  ? -18.512 16.510 32.475 1.00 0.00 ? 31  TYR A C    4  
ATOM   9635  O  O    . TYR A 1 31  ? -18.615 16.109 33.617 1.00 0.00 ? 31  TYR A O    4  
ATOM   9636  C  CB   . TYR A 1 31  ? -18.073 18.963 32.379 1.00 0.00 ? 31  TYR A CB   4  
ATOM   9637  C  CG   . TYR A 1 31  ? -19.583 18.955 32.110 1.00 0.00 ? 31  TYR A CG   4  
ATOM   9638  C  CD1  . TYR A 1 31  ? -20.458 18.373 33.008 1.00 0.00 ? 31  TYR A CD1  4  
ATOM   9639  C  CD2  . TYR A 1 31  ? -20.090 19.547 30.972 1.00 0.00 ? 31  TYR A CD2  4  
ATOM   9640  C  CE1  . TYR A 1 31  ? -21.819 18.388 32.769 1.00 0.00 ? 31  TYR A CE1  4  
ATOM   9641  C  CE2  . TYR A 1 31  ? -21.451 19.561 30.735 1.00 0.00 ? 31  TYR A CE2  4  
ATOM   9642  C  CZ   . TYR A 1 31  ? -22.324 18.980 31.632 1.00 0.00 ? 31  TYR A CZ   4  
ATOM   9643  O  OH   . TYR A 1 31  ? -23.683 18.996 31.396 1.00 0.00 ? 31  TYR A OH   4  
ATOM   9644  H  H    . TYR A 1 31  ? -16.912 18.311 30.161 1.00 0.00 ? 31  TYR A H    4  
ATOM   9645  H  HA   . TYR A 1 31  ? -16.589 17.411 32.728 1.00 0.00 ? 31  TYR A HA   4  
ATOM   9646  H  HB2  . TYR A 1 31  ? -17.896 19.244 33.407 1.00 0.00 ? 31  TYR A HB2  4  
ATOM   9647  H  HB3  . TYR A 1 31  ? -17.608 19.683 31.732 1.00 0.00 ? 31  TYR A HB3  4  
ATOM   9648  H  HD1  . TYR A 1 31  ? -20.079 17.914 33.905 1.00 0.00 ? 31  TYR A HD1  4  
ATOM   9649  H  HD2  . TYR A 1 31  ? -19.418 20.008 30.263 1.00 0.00 ? 31  TYR A HD2  4  
ATOM   9650  H  HE1  . TYR A 1 31  ? -22.493 17.930 33.480 1.00 0.00 ? 31  TYR A HE1  4  
ATOM   9651  H  HE2  . TYR A 1 31  ? -21.834 20.030 29.842 1.00 0.00 ? 31  TYR A HE2  4  
ATOM   9652  H  HH   . TYR A 1 31  ? -23.964 19.911 31.337 1.00 0.00 ? 31  TYR A HH   4  
ATOM   9653  N  N    . GLN A 1 32  ? -19.262 16.073 31.509 1.00 0.00 ? 32  GLN A N    4  
ATOM   9654  C  CA   . GLN A 1 32  ? -20.286 15.043 31.808 1.00 0.00 ? 32  GLN A CA   4  
ATOM   9655  C  C    . GLN A 1 32  ? -19.636 13.692 32.049 1.00 0.00 ? 32  GLN A C    4  
ATOM   9656  O  O    . GLN A 1 32  ? -19.660 13.181 33.149 1.00 0.00 ? 32  GLN A O    4  
ATOM   9657  C  CB   . GLN A 1 32  ? -21.240 14.940 30.611 1.00 0.00 ? 32  GLN A CB   4  
ATOM   9658  C  CG   . GLN A 1 32  ? -22.205 16.127 30.643 1.00 0.00 ? 32  GLN A CG   4  
ATOM   9659  C  CD   . GLN A 1 32  ? -23.391 15.845 29.720 1.00 0.00 ? 32  GLN A CD   4  
ATOM   9660  O  OE1  . GLN A 1 32  ? -24.343 15.189 30.096 1.00 0.00 ? 32  GLN A OE1  4  
ATOM   9661  N  NE2  . GLN A 1 32  ? -23.376 16.323 28.506 1.00 0.00 ? 32  GLN A NE2  4  
ATOM   9662  H  H    . GLN A 1 32  ? -19.153 16.417 30.598 1.00 0.00 ? 32  GLN A H    4  
ATOM   9663  H  HA   . GLN A 1 32  ? -20.823 15.334 32.711 1.00 0.00 ? 32  GLN A HA   4  
ATOM   9664  H  HB2  . GLN A 1 32  ? -20.673 14.957 29.692 1.00 0.00 ? 32  GLN A HB2  4  
ATOM   9665  H  HB3  . GLN A 1 32  ? -21.797 14.016 30.668 1.00 0.00 ? 32  GLN A HB3  4  
ATOM   9666  H  HG2  . GLN A 1 32  ? -22.564 16.281 31.650 1.00 0.00 ? 32  GLN A HG2  4  
ATOM   9667  H  HG3  . GLN A 1 32  ? -21.697 17.019 30.306 1.00 0.00 ? 32  GLN A HG3  4  
ATOM   9668  H  HE21 . GLN A 1 32  ? -22.611 16.853 28.198 1.00 0.00 ? 32  GLN A HE21 4  
ATOM   9669  H  HE22 . GLN A 1 32  ? -24.129 16.154 27.904 1.00 0.00 ? 32  GLN A HE22 4  
ATOM   9670  N  N    . SER A 1 33  ? -19.068 13.129 31.021 1.00 0.00 ? 33  SER A N    4  
ATOM   9671  C  CA   . SER A 1 33  ? -18.419 11.813 31.201 1.00 0.00 ? 33  SER A CA   4  
ATOM   9672  C  C    . SER A 1 33  ? -17.546 11.835 32.441 1.00 0.00 ? 33  SER A C    4  
ATOM   9673  O  O    . SER A 1 33  ? -17.202 10.802 32.984 1.00 0.00 ? 33  SER A O    4  
ATOM   9674  C  CB   . SER A 1 33  ? -17.543 11.524 29.972 1.00 0.00 ? 33  SER A CB   4  
ATOM   9675  O  OG   . SER A 1 33  ? -18.449 11.589 28.882 1.00 0.00 ? 33  SER A OG   4  
ATOM   9676  H  H    . SER A 1 33  ? -19.072 13.567 30.145 1.00 0.00 ? 33  SER A H    4  
ATOM   9677  H  HA   . SER A 1 33  ? -19.188 11.050 31.325 1.00 0.00 ? 33  SER A HA   4  
ATOM   9678  H  HB2  . SER A 1 33  ? -16.774 12.274 29.864 1.00 0.00 ? 33  SER A HB2  4  
ATOM   9679  H  HB3  . SER A 1 33  ? -17.104 10.540 30.037 1.00 0.00 ? 33  SER A HB3  4  
ATOM   9680  H  HG   . SER A 1 33  ? -19.315 11.327 29.200 1.00 0.00 ? 33  SER A HG   4  
ATOM   9681  N  N    . PHE A 1 34  ? -17.199 13.018 32.873 1.00 0.00 ? 34  PHE A N    4  
ATOM   9682  C  CA   . PHE A 1 34  ? -16.352 13.127 34.076 1.00 0.00 ? 34  PHE A CA   4  
ATOM   9683  C  C    . PHE A 1 34  ? -17.200 12.954 35.321 1.00 0.00 ? 34  PHE A C    4  
ATOM   9684  O  O    . PHE A 1 34  ? -16.765 12.365 36.291 1.00 0.00 ? 34  PHE A O    4  
ATOM   9685  C  CB   . PHE A 1 34  ? -15.700 14.521 34.103 1.00 0.00 ? 34  PHE A CB   4  
ATOM   9686  C  CG   . PHE A 1 34  ? -14.969 14.713 35.434 1.00 0.00 ? 34  PHE A CG   4  
ATOM   9687  C  CD1  . PHE A 1 34  ? -13.743 14.110 35.653 1.00 0.00 ? 34  PHE A CD1  4  
ATOM   9688  C  CD2  . PHE A 1 34  ? -15.524 15.493 36.437 1.00 0.00 ? 34  PHE A CD2  4  
ATOM   9689  C  CE1  . PHE A 1 34  ? -13.083 14.284 36.854 1.00 0.00 ? 34  PHE A CE1  4  
ATOM   9690  C  CE2  . PHE A 1 34  ? -14.861 15.664 37.635 1.00 0.00 ? 34  PHE A CE2  4  
ATOM   9691  C  CZ   . PHE A 1 34  ? -13.641 15.060 37.841 1.00 0.00 ? 34  PHE A CZ   4  
ATOM   9692  H  H    . PHE A 1 34  ? -17.501 13.825 32.403 1.00 0.00 ? 34  PHE A H    4  
ATOM   9693  H  HA   . PHE A 1 34  ? -15.596 12.341 34.051 1.00 0.00 ? 34  PHE A HA   4  
ATOM   9694  H  HB2  . PHE A 1 34  ? -14.993 14.610 33.291 1.00 0.00 ? 34  PHE A HB2  4  
ATOM   9695  H  HB3  . PHE A 1 34  ? -16.457 15.279 34.000 1.00 0.00 ? 34  PHE A HB3  4  
ATOM   9696  H  HD1  . PHE A 1 34  ? -13.299 13.500 34.881 1.00 0.00 ? 34  PHE A HD1  4  
ATOM   9697  H  HD2  . PHE A 1 34  ? -16.480 15.969 36.280 1.00 0.00 ? 34  PHE A HD2  4  
ATOM   9698  H  HE1  . PHE A 1 34  ? -12.126 13.810 37.016 1.00 0.00 ? 34  PHE A HE1  4  
ATOM   9699  H  HE2  . PHE A 1 34  ? -15.298 16.274 38.412 1.00 0.00 ? 34  PHE A HE2  4  
ATOM   9700  H  HZ   . PHE A 1 34  ? -13.124 15.196 38.779 1.00 0.00 ? 34  PHE A HZ   4  
ATOM   9701  N  N    . LEU A 1 35  ? -18.404 13.470 35.280 1.00 0.00 ? 35  LEU A N    4  
ATOM   9702  C  CA   . LEU A 1 35  ? -19.274 13.329 36.465 1.00 0.00 ? 35  LEU A CA   4  
ATOM   9703  C  C    . LEU A 1 35  ? -19.426 11.861 36.818 1.00 0.00 ? 35  LEU A C    4  
ATOM   9704  O  O    . LEU A 1 35  ? -19.670 11.513 37.956 1.00 0.00 ? 35  LEU A O    4  
ATOM   9705  C  CB   . LEU A 1 35  ? -20.660 13.902 36.135 1.00 0.00 ? 35  LEU A CB   4  
ATOM   9706  C  CG   . LEU A 1 35  ? -20.684 15.388 36.493 1.00 0.00 ? 35  LEU A CG   4  
ATOM   9707  C  CD1  . LEU A 1 35  ? -22.051 15.972 36.125 1.00 0.00 ? 35  LEU A CD1  4  
ATOM   9708  C  CD2  . LEU A 1 35  ? -20.456 15.547 37.998 1.00 0.00 ? 35  LEU A CD2  4  
ATOM   9709  H  H    . LEU A 1 35  ? -18.726 13.944 34.474 1.00 0.00 ? 35  LEU A H    4  
ATOM   9710  H  HA   . LEU A 1 35  ? -18.821 13.854 37.306 1.00 0.00 ? 35  LEU A HA   4  
ATOM   9711  H  HB2  . LEU A 1 35  ? -20.865 13.777 35.083 1.00 0.00 ? 35  LEU A HB2  4  
ATOM   9712  H  HB3  . LEU A 1 35  ? -21.412 13.379 36.707 1.00 0.00 ? 35  LEU A HB3  4  
ATOM   9713  H  HG   . LEU A 1 35  ? -19.908 15.907 35.949 1.00 0.00 ? 35  LEU A HG   4  
ATOM   9714  H  HD11 . LEU A 1 35  ? -22.290 15.722 35.103 1.00 0.00 ? 35  LEU A HD11 4  
ATOM   9715  H  HD12 . LEU A 1 35  ? -22.809 15.565 36.778 1.00 0.00 ? 35  LEU A HD12 4  
ATOM   9716  H  HD13 . LEU A 1 35  ? -22.028 17.047 36.232 1.00 0.00 ? 35  LEU A HD13 4  
ATOM   9717  H  HD21 . LEU A 1 35  ? -20.704 14.625 38.503 1.00 0.00 ? 35  LEU A HD21 4  
ATOM   9718  H  HD22 . LEU A 1 35  ? -19.420 15.787 38.187 1.00 0.00 ? 35  LEU A HD22 4  
ATOM   9719  H  HD23 . LEU A 1 35  ? -21.081 16.340 38.381 1.00 0.00 ? 35  LEU A HD23 4  
ATOM   9720  N  N    . LYS A 1 36  ? -19.277 11.020 35.826 1.00 0.00 ? 36  LYS A N    4  
ATOM   9721  C  CA   . LYS A 1 36  ? -19.407 9.570  36.080 1.00 0.00 ? 36  LYS A CA   4  
ATOM   9722  C  C    . LYS A 1 36  ? -18.139 9.014  36.717 1.00 0.00 ? 36  LYS A C    4  
ATOM   9723  O  O    . LYS A 1 36  ? -18.189 8.084  37.496 1.00 0.00 ? 36  LYS A O    4  
ATOM   9724  C  CB   . LYS A 1 36  ? -19.635 8.860  34.738 1.00 0.00 ? 36  LYS A CB   4  
ATOM   9725  C  CG   . LYS A 1 36  ? -21.067 9.122  34.270 1.00 0.00 ? 36  LYS A CG   4  
ATOM   9726  C  CD   . LYS A 1 36  ? -21.936 7.914  34.618 1.00 0.00 ? 36  LYS A CD   4  
ATOM   9727  C  CE   . LYS A 1 36  ? -21.776 6.850  33.530 1.00 0.00 ? 36  LYS A CE   4  
ATOM   9728  N  NZ   . LYS A 1 36  ? -22.476 7.269  32.284 1.00 0.00 ? 36  LYS A NZ   4  
ATOM   9729  H  H    . LYS A 1 36  ? -19.085 11.348 34.919 1.00 0.00 ? 36  LYS A H    4  
ATOM   9730  H  HA   . LYS A 1 36  ? -20.246 9.404  36.753 1.00 0.00 ? 36  LYS A HA   4  
ATOM   9731  H  HB2  . LYS A 1 36  ? -18.937 9.239  34.005 1.00 0.00 ? 36  LYS A HB2  4  
ATOM   9732  H  HB3  . LYS A 1 36  ? -19.481 7.798  34.858 1.00 0.00 ? 36  LYS A HB3  4  
ATOM   9733  H  HG2  . LYS A 1 36  ? -21.455 10.003 34.761 1.00 0.00 ? 36  LYS A HG2  4  
ATOM   9734  H  HG3  . LYS A 1 36  ? -21.076 9.280  33.201 1.00 0.00 ? 36  LYS A HG3  4  
ATOM   9735  H  HD2  . LYS A 1 36  ? -21.628 7.508  35.570 1.00 0.00 ? 36  LYS A HD2  4  
ATOM   9736  H  HD3  . LYS A 1 36  ? -22.971 8.217  34.680 1.00 0.00 ? 36  LYS A HD3  4  
ATOM   9737  H  HE2  . LYS A 1 36  ? -20.728 6.707  33.316 1.00 0.00 ? 36  LYS A HE2  4  
ATOM   9738  H  HE3  . LYS A 1 36  ? -22.196 5.917  33.874 1.00 0.00 ? 36  LYS A HE3  4  
ATOM   9739  H  HZ1  . LYS A 1 36  ? -22.188 8.237  32.033 1.00 0.00 ? 36  LYS A HZ1  4  
ATOM   9740  H  HZ2  . LYS A 1 36  ? -22.225 6.621  31.511 1.00 0.00 ? 36  LYS A HZ2  4  
ATOM   9741  H  HZ3  . LYS A 1 36  ? -23.504 7.243  32.439 1.00 0.00 ? 36  LYS A HZ3  4  
ATOM   9742  N  N    . GLU A 1 37  ? -17.019 9.596  36.372 1.00 0.00 ? 37  GLU A N    4  
ATOM   9743  C  CA   . GLU A 1 37  ? -15.741 9.113  36.948 1.00 0.00 ? 37  GLU A CA   4  
ATOM   9744  C  C    . GLU A 1 37  ? -15.557 9.621  38.373 1.00 0.00 ? 37  GLU A C    4  
ATOM   9745  O  O    . GLU A 1 37  ? -14.609 9.263  39.044 1.00 0.00 ? 37  GLU A O    4  
ATOM   9746  C  CB   . GLU A 1 37  ? -14.589 9.648  36.086 1.00 0.00 ? 37  GLU A CB   4  
ATOM   9747  C  CG   . GLU A 1 37  ? -14.565 8.900  34.754 1.00 0.00 ? 37  GLU A CG   4  
ATOM   9748  C  CD   . GLU A 1 37  ? -13.367 9.373  33.929 1.00 0.00 ? 37  GLU A CD   4  
ATOM   9749  O  OE1  . GLU A 1 37  ? -12.327 9.554  34.541 1.00 0.00 ? 37  GLU A OE1  4  
ATOM   9750  O  OE2  . GLU A 1 37  ? -13.558 9.527  32.735 1.00 0.00 ? 37  GLU A OE2  4  
ATOM   9751  H  H    . GLU A 1 37  ? -17.024 10.345 35.735 1.00 0.00 ? 37  GLU A H    4  
ATOM   9752  H  HA   . GLU A 1 37  ? -15.745 8.025  36.956 1.00 0.00 ? 37  GLU A HA   4  
ATOM   9753  H  HB2  . GLU A 1 37  ? -14.731 10.704 35.906 1.00 0.00 ? 37  GLU A HB2  4  
ATOM   9754  H  HB3  . GLU A 1 37  ? -13.651 9.501  36.601 1.00 0.00 ? 37  GLU A HB3  4  
ATOM   9755  H  HG2  . GLU A 1 37  ? -14.479 7.838  34.931 1.00 0.00 ? 37  GLU A HG2  4  
ATOM   9756  H  HG3  . GLU A 1 37  ? -15.475 9.096  34.206 1.00 0.00 ? 37  GLU A HG3  4  
ATOM   9757  N  N    . CYS A 1 38  ? -16.465 10.448 38.810 1.00 0.00 ? 38  CYS A N    4  
ATOM   9758  C  CA   . CYS A 1 38  ? -16.353 10.987 40.188 1.00 0.00 ? 38  CYS A CA   4  
ATOM   9759  C  C    . CYS A 1 38  ? -17.456 12.012 40.463 1.00 0.00 ? 38  CYS A C    4  
ATOM   9760  O  O    . CYS A 1 38  ? -17.261 13.198 40.287 1.00 0.00 ? 38  CYS A O    4  
ATOM   9761  C  CB   . CYS A 1 38  ? -14.993 11.691 40.315 1.00 0.00 ? 38  CYS A CB   4  
ATOM   9762  S  SG   . CYS A 1 38  ? -14.271 12.384 38.807 1.00 0.00 ? 38  CYS A SG   4  
ATOM   9763  H  H    . CYS A 1 38  ? -17.214 10.711 38.235 1.00 0.00 ? 38  CYS A H    4  
ATOM   9764  H  HA   . CYS A 1 38  ? -16.429 10.169 40.896 1.00 0.00 ? 38  CYS A HA   4  
ATOM   9765  H  HB2  . CYS A 1 38  ? -15.098 12.497 41.028 1.00 0.00 ? 38  CYS A HB2  4  
ATOM   9766  H  HB3  . CYS A 1 38  ? -14.285 10.984 40.723 1.00 0.00 ? 38  CYS A HB3  4  
ATOM   9767  H  HG   . CYS A 1 38  ? -13.376 12.046 38.724 1.00 0.00 ? 38  CYS A HG   4  
ATOM   9768  N  N    . PRO A 1 39  ? -18.604 11.527 40.893 1.00 0.00 ? 39  PRO A N    4  
ATOM   9769  C  CA   . PRO A 1 39  ? -19.735 12.399 41.193 1.00 0.00 ? 39  PRO A CA   4  
ATOM   9770  C  C    . PRO A 1 39  ? -19.416 13.336 42.355 1.00 0.00 ? 39  PRO A C    4  
ATOM   9771  O  O    . PRO A 1 39  ? -20.301 13.929 42.940 1.00 0.00 ? 39  PRO A O    4  
ATOM   9772  C  CB   . PRO A 1 39  ? -20.881 11.442 41.588 1.00 0.00 ? 39  PRO A CB   4  
ATOM   9773  C  CG   . PRO A 1 39  ? -20.338 9.987  41.447 1.00 0.00 ? 39  PRO A CG   4  
ATOM   9774  C  CD   . PRO A 1 39  ? -18.844 10.093 41.100 1.00 0.00 ? 39  PRO A CD   4  
ATOM   9775  H  HA   . PRO A 1 39  ? -19.996 12.978 40.311 1.00 0.00 ? 39  PRO A HA   4  
ATOM   9776  H  HB2  . PRO A 1 39  ? -21.181 11.627 42.610 1.00 0.00 ? 39  PRO A HB2  4  
ATOM   9777  H  HB3  . PRO A 1 39  ? -21.726 11.587 40.931 1.00 0.00 ? 39  PRO A HB3  4  
ATOM   9778  H  HG2  . PRO A 1 39  ? -20.465 9.451  42.376 1.00 0.00 ? 39  PRO A HG2  4  
ATOM   9779  H  HG3  . PRO A 1 39  ? -20.864 9.470  40.657 1.00 0.00 ? 39  PRO A HG3  4  
ATOM   9780  H  HD2  . PRO A 1 39  ? -18.245 9.729  41.922 1.00 0.00 ? 39  PRO A HD2  4  
ATOM   9781  H  HD3  . PRO A 1 39  ? -18.620 9.542  40.198 1.00 0.00 ? 39  PRO A HD3  4  
ATOM   9782  N  N    . SER A 1 40  ? -18.154 13.448 42.666 1.00 0.00 ? 40  SER A N    4  
ATOM   9783  C  CA   . SER A 1 40  ? -17.754 14.337 43.783 1.00 0.00 ? 40  SER A CA   4  
ATOM   9784  C  C    . SER A 1 40  ? -17.472 15.744 43.274 1.00 0.00 ? 40  SER A C    4  
ATOM   9785  O  O    . SER A 1 40  ? -18.293 16.630 43.403 1.00 0.00 ? 40  SER A O    4  
ATOM   9786  C  CB   . SER A 1 40  ? -16.470 13.775 44.413 1.00 0.00 ? 40  SER A CB   4  
ATOM   9787  O  OG   . SER A 1 40  ? -16.933 12.775 45.308 1.00 0.00 ? 40  SER A OG   4  
ATOM   9788  H  H    . SER A 1 40  ? -17.475 12.948 42.166 1.00 0.00 ? 40  SER A H    4  
ATOM   9789  H  HA   . SER A 1 40  ? -18.561 14.378 44.514 1.00 0.00 ? 40  SER A HA   4  
ATOM   9790  H  HB2  . SER A 1 40  ? -15.834 13.336 43.659 1.00 0.00 ? 40  SER A HB2  4  
ATOM   9791  H  HB3  . SER A 1 40  ? -15.940 14.545 44.954 1.00 0.00 ? 40  SER A HB3  4  
ATOM   9792  H  HG   . SER A 1 40  ? -17.061 11.966 44.808 1.00 0.00 ? 40  SER A HG   4  
ATOM   9793  N  N    . GLY A 1 41  ? -16.312 15.925 42.703 1.00 0.00 ? 41  GLY A N    4  
ATOM   9794  C  CA   . GLY A 1 41  ? -15.957 17.273 42.179 1.00 0.00 ? 41  GLY A CA   4  
ATOM   9795  C  C    . GLY A 1 41  ? -14.448 17.513 42.288 1.00 0.00 ? 41  GLY A C    4  
ATOM   9796  O  O    . GLY A 1 41  ? -13.815 17.931 41.339 1.00 0.00 ? 41  GLY A O    4  
ATOM   9797  H  H    . GLY A 1 41  ? -15.679 15.180 42.622 1.00 0.00 ? 41  GLY A H    4  
ATOM   9798  H  HA2  . GLY A 1 41  ? -16.254 17.341 41.142 1.00 0.00 ? 41  GLY A HA2  4  
ATOM   9799  H  HA3  . GLY A 1 41  ? -16.481 18.026 42.749 1.00 0.00 ? 41  GLY A HA3  4  
ATOM   9800  N  N    . ARG A 1 42  ? -13.905 17.243 43.444 1.00 0.00 ? 42  ARG A N    4  
ATOM   9801  C  CA   . ARG A 1 42  ? -12.445 17.450 43.629 1.00 0.00 ? 42  ARG A CA   4  
ATOM   9802  C  C    . ARG A 1 42  ? -11.669 16.177 43.319 1.00 0.00 ? 42  ARG A C    4  
ATOM   9803  O  O    . ARG A 1 42  ? -12.223 15.094 43.324 1.00 0.00 ? 42  ARG A O    4  
ATOM   9804  C  CB   . ARG A 1 42  ? -12.189 17.823 45.104 1.00 0.00 ? 42  ARG A CB   4  
ATOM   9805  C  CG   . ARG A 1 42  ? -12.104 19.350 45.253 1.00 0.00 ? 42  ARG A CG   4  
ATOM   9806  C  CD   . ARG A 1 42  ? -13.514 19.910 45.420 1.00 0.00 ? 42  ARG A CD   4  
ATOM   9807  N  NE   . ARG A 1 42  ? -13.469 21.394 45.300 1.00 0.00 ? 42  ARG A NE   4  
ATOM   9808  C  CZ   . ARG A 1 42  ? -14.480 22.024 44.768 1.00 0.00 ? 42  ARG A CZ   4  
ATOM   9809  N  NH1  . ARG A 1 42  ? -14.782 21.790 43.520 1.00 0.00 ? 42  ARG A NH1  4  
ATOM   9810  N  NH2  . ARG A 1 42  ? -15.158 22.865 45.502 1.00 0.00 ? 42  ARG A NH2  4  
ATOM   9811  H  H    . ARG A 1 42  ? -14.454 16.906 44.183 1.00 0.00 ? 42  ARG A H    4  
ATOM   9812  H  HA   . ARG A 1 42  ? -12.110 18.239 42.961 1.00 0.00 ? 42  ARG A HA   4  
ATOM   9813  H  HB2  . ARG A 1 42  ? -12.996 17.447 45.715 1.00 0.00 ? 42  ARG A HB2  4  
ATOM   9814  H  HB3  . ARG A 1 42  ? -11.263 17.376 45.433 1.00 0.00 ? 42  ARG A HB3  4  
ATOM   9815  H  HG2  . ARG A 1 42  ? -11.513 19.595 46.123 1.00 0.00 ? 42  ARG A HG2  4  
ATOM   9816  H  HG3  . ARG A 1 42  ? -11.641 19.782 44.380 1.00 0.00 ? 42  ARG A HG3  4  
ATOM   9817  H  HD2  . ARG A 1 42  ? -14.160 19.509 44.655 1.00 0.00 ? 42  ARG A HD2  4  
ATOM   9818  H  HD3  . ARG A 1 42  ? -13.901 19.641 46.392 1.00 0.00 ? 42  ARG A HD3  4  
ATOM   9819  H  HE   . ARG A 1 42  ? -12.687 21.893 45.618 1.00 0.00 ? 42  ARG A HE   4  
ATOM   9820  H  HH11 . ARG A 1 42  ? -14.241 21.138 42.989 1.00 0.00 ? 42  ARG A HH11 4  
ATOM   9821  H  HH12 . ARG A 1 42  ? -15.553 22.264 43.095 1.00 0.00 ? 42  ARG A HH12 4  
ATOM   9822  H  HH21 . ARG A 1 42  ? -14.899 23.018 46.455 1.00 0.00 ? 42  ARG A HH21 4  
ATOM   9823  H  HH22 . ARG A 1 42  ? -15.938 23.354 45.110 1.00 0.00 ? 42  ARG A HH22 4  
ATOM   9824  N  N    . ILE A 1 43  ? -10.396 16.340 43.054 1.00 0.00 ? 43  ILE A N    4  
ATOM   9825  C  CA   . ILE A 1 43  ? -9.539  15.164 42.738 1.00 0.00 ? 43  ILE A CA   4  
ATOM   9826  C  C    . ILE A 1 43  ? -8.299  15.168 43.626 1.00 0.00 ? 43  ILE A C    4  
ATOM   9827  O  O    . ILE A 1 43  ? -7.564  16.137 43.662 1.00 0.00 ? 43  ILE A O    4  
ATOM   9828  C  CB   . ILE A 1 43  ? -9.100  15.259 41.277 1.00 0.00 ? 43  ILE A CB   4  
ATOM   9829  C  CG1  . ILE A 1 43  ? -10.316 15.447 40.380 1.00 0.00 ? 43  ILE A CG1  4  
ATOM   9830  C  CG2  . ILE A 1 43  ? -8.402  13.947 40.887 1.00 0.00 ? 43  ILE A CG2  4  
ATOM   9831  C  CD1  . ILE A 1 43  ? -9.879  15.342 38.917 1.00 0.00 ? 43  ILE A CD1  4  
ATOM   9832  H  H    . ILE A 1 43  ? -10.007 17.240 43.063 1.00 0.00 ? 43  ILE A H    4  
ATOM   9833  H  HA   . ILE A 1 43  ? -10.100 14.249 42.919 1.00 0.00 ? 43  ILE A HA   4  
ATOM   9834  H  HB   . ILE A 1 43  ? -8.430  16.106 41.158 1.00 0.00 ? 43  ILE A HB   4  
ATOM   9835  H  HG12 . ILE A 1 43  ? -11.047 14.683 40.597 1.00 0.00 ? 43  ILE A HG12 4  
ATOM   9836  H  HG13 . ILE A 1 43  ? -10.753 16.418 40.559 1.00 0.00 ? 43  ILE A HG13 4  
ATOM   9837  H  HG21 . ILE A 1 43  ? -7.578  13.759 41.559 1.00 0.00 ? 43  ILE A HG21 4  
ATOM   9838  H  HG22 . ILE A 1 43  ? -9.104  13.129 40.948 1.00 0.00 ? 43  ILE A HG22 4  
ATOM   9839  H  HG23 . ILE A 1 43  ? -8.027  14.019 39.876 1.00 0.00 ? 43  ILE A HG23 4  
ATOM   9840  H  HD11 . ILE A 1 43  ? -8.903  15.789 38.795 1.00 0.00 ? 43  ILE A HD11 4  
ATOM   9841  H  HD12 . ILE A 1 43  ? -9.832  14.303 38.624 1.00 0.00 ? 43  ILE A HD12 4  
ATOM   9842  H  HD13 . ILE A 1 43  ? -10.588 15.857 38.287 1.00 0.00 ? 43  ILE A HD13 4  
ATOM   9843  N  N    . THR A 1 44  ? -8.090  14.087 44.326 1.00 0.00 ? 44  THR A N    4  
ATOM   9844  C  CA   . THR A 1 44  ? -6.903  14.010 45.218 1.00 0.00 ? 44  THR A CA   4  
ATOM   9845  C  C    . THR A 1 44  ? -5.636  13.695 44.429 1.00 0.00 ? 44  THR A C    4  
ATOM   9846  O  O    . THR A 1 44  ? -5.694  13.346 43.267 1.00 0.00 ? 44  THR A O    4  
ATOM   9847  C  CB   . THR A 1 44  ? -7.140  12.888 46.234 1.00 0.00 ? 44  THR A CB   4  
ATOM   9848  O  OG1  . THR A 1 44  ? -7.872  11.900 45.536 1.00 0.00 ? 44  THR A OG1  4  
ATOM   9849  C  CG2  . THR A 1 44  ? -8.088  13.353 47.351 1.00 0.00 ? 44  THR A CG2  4  
ATOM   9850  H  H    . THR A 1 44  ? -8.711  13.331 44.265 1.00 0.00 ? 44  THR A H    4  
ATOM   9851  H  HA   . THR A 1 44  ? -6.778  14.968 45.723 1.00 0.00 ? 44  THR A HA   4  
ATOM   9852  H  HB   . THR A 1 44  ? -6.206  12.483 46.614 1.00 0.00 ? 44  THR A HB   4  
ATOM   9853  H  HG1  . THR A 1 44  ? -7.254  11.397 45.001 1.00 0.00 ? 44  THR A HG1  4  
ATOM   9854  H  HG21 . THR A 1 44  ? -7.742  14.293 47.755 1.00 0.00 ? 44  THR A HG21 4  
ATOM   9855  H  HG22 . THR A 1 44  ? -9.084  13.482 46.954 1.00 0.00 ? 44  THR A HG22 4  
ATOM   9856  H  HG23 . THR A 1 44  ? -8.113  12.615 48.139 1.00 0.00 ? 44  THR A HG23 4  
ATOM   9857  N  N    . ARG A 1 45  ? -4.510  13.826 45.082 1.00 0.00 ? 45  ARG A N    4  
ATOM   9858  C  CA   . ARG A 1 45  ? -3.227  13.540 44.393 1.00 0.00 ? 45  ARG A CA   4  
ATOM   9859  C  C    . ARG A 1 45  ? -2.964  12.040 44.344 1.00 0.00 ? 45  ARG A C    4  
ATOM   9860  O  O    . ARG A 1 45  ? -2.397  11.537 43.395 1.00 0.00 ? 45  ARG A O    4  
ATOM   9861  C  CB   . ARG A 1 45  ? -2.088  14.214 45.181 1.00 0.00 ? 45  ARG A CB   4  
ATOM   9862  C  CG   . ARG A 1 45  ? -0.752  13.912 44.492 1.00 0.00 ? 45  ARG A CG   4  
ATOM   9863  C  CD   . ARG A 1 45  ? 0.395   14.406 45.378 1.00 0.00 ? 45  ARG A CD   4  
ATOM   9864  N  NE   . ARG A 1 45  ? 0.192   15.853 45.675 1.00 0.00 ? 45  ARG A NE   4  
ATOM   9865  C  CZ   . ARG A 1 45  ? 1.216   16.586 46.020 1.00 0.00 ? 45  ARG A CZ   4  
ATOM   9866  N  NH1  . ARG A 1 45  ? 2.206   16.723 45.179 1.00 0.00 ? 45  ARG A NH1  4  
ATOM   9867  N  NH2  . ARG A 1 45  ? 1.216   17.159 47.192 1.00 0.00 ? 45  ARG A NH2  4  
ATOM   9868  H  H    . ARG A 1 45  ? -4.513  14.112 46.019 1.00 0.00 ? 45  ARG A H    4  
ATOM   9869  H  HA   . ARG A 1 45  ? -3.276  13.925 43.375 1.00 0.00 ? 45  ARG A HA   4  
ATOM   9870  H  HB2  . ARG A 1 45  ? -2.249  15.282 45.208 1.00 0.00 ? 45  ARG A HB2  4  
ATOM   9871  H  HB3  . ARG A 1 45  ? -2.070  13.833 46.191 1.00 0.00 ? 45  ARG A HB3  4  
ATOM   9872  H  HG2  . ARG A 1 45  ? -0.657  12.848 44.336 1.00 0.00 ? 45  ARG A HG2  4  
ATOM   9873  H  HG3  . ARG A 1 45  ? -0.715  14.415 43.537 1.00 0.00 ? 45  ARG A HG3  4  
ATOM   9874  H  HD2  . ARG A 1 45  ? 0.412   13.849 46.303 1.00 0.00 ? 45  ARG A HD2  4  
ATOM   9875  H  HD3  . ARG A 1 45  ? 1.337   14.275 44.865 1.00 0.00 ? 45  ARG A HD3  4  
ATOM   9876  H  HE   . ARG A 1 45  ? -0.701  16.249 45.613 1.00 0.00 ? 45  ARG A HE   4  
ATOM   9877  H  HH11 . ARG A 1 45  ? 2.172   16.271 44.288 1.00 0.00 ? 45  ARG A HH11 4  
ATOM   9878  H  HH12 . ARG A 1 45  ? 2.998   17.281 45.427 1.00 0.00 ? 45  ARG A HH12 4  
ATOM   9879  H  HH21 . ARG A 1 45  ? 0.441   17.030 47.811 1.00 0.00 ? 45  ARG A HH21 4  
ATOM   9880  H  HH22 . ARG A 1 45  ? 1.991   17.725 47.473 1.00 0.00 ? 45  ARG A HH22 4  
ATOM   9881  N  N    . GLN A 1 46  ? -3.382  11.352 45.371 1.00 0.00 ? 46  GLN A N    4  
ATOM   9882  C  CA   . GLN A 1 46  ? -3.165  9.887  45.399 1.00 0.00 ? 46  GLN A CA   4  
ATOM   9883  C  C    . GLN A 1 46  ? -3.994  9.198  44.324 1.00 0.00 ? 46  GLN A C    4  
ATOM   9884  O  O    . GLN A 1 46  ? -3.538  8.272  43.684 1.00 0.00 ? 46  GLN A O    4  
ATOM   9885  C  CB   . GLN A 1 46  ? -3.600  9.357  46.773 1.00 0.00 ? 46  GLN A CB   4  
ATOM   9886  C  CG   . GLN A 1 46  ? -2.516  9.679  47.803 1.00 0.00 ? 46  GLN A CG   4  
ATOM   9887  C  CD   . GLN A 1 46  ? -2.199  11.174 47.752 1.00 0.00 ? 46  GLN A CD   4  
ATOM   9888  O  OE1  . GLN A 1 46  ? -2.917  11.991 48.295 1.00 0.00 ? 46  GLN A OE1  4  
ATOM   9889  N  NE2  . GLN A 1 46  ? -1.136  11.576 47.111 1.00 0.00 ? 46  GLN A NE2  4  
ATOM   9890  H  H    . GLN A 1 46  ? -3.834  11.800 46.116 1.00 0.00 ? 46  GLN A H    4  
ATOM   9891  H  HA   . GLN A 1 46  ? -2.109  9.680  45.220 1.00 0.00 ? 46  GLN A HA   4  
ATOM   9892  H  HB2  . GLN A 1 46  ? -4.528  9.826  47.065 1.00 0.00 ? 46  GLN A HB2  4  
ATOM   9893  H  HB3  . GLN A 1 46  ? -3.745  8.288  46.721 1.00 0.00 ? 46  GLN A HB3  4  
ATOM   9894  H  HG2  . GLN A 1 46  ? -2.862  9.420  48.792 1.00 0.00 ? 46  GLN A HG2  4  
ATOM   9895  H  HG3  . GLN A 1 46  ? -1.620  9.116  47.579 1.00 0.00 ? 46  GLN A HG3  4  
ATOM   9896  H  HE21 . GLN A 1 46  ? -0.553  10.923 46.671 1.00 0.00 ? 46  GLN A HE21 4  
ATOM   9897  H  HE22 . GLN A 1 46  ? -0.920  12.531 47.069 1.00 0.00 ? 46  GLN A HE22 4  
ATOM   9898  N  N    . GLU A 1 47  ? -5.199  9.663  44.146 1.00 0.00 ? 47  GLU A N    4  
ATOM   9899  C  CA   . GLU A 1 47  ? -6.071  9.046  43.119 1.00 0.00 ? 47  GLU A CA   4  
ATOM   9900  C  C    . GLU A 1 47  ? -5.711  9.547  41.730 1.00 0.00 ? 47  GLU A C    4  
ATOM   9901  O  O    . GLU A 1 47  ? -6.011  8.908  40.746 1.00 0.00 ? 47  GLU A O    4  
ATOM   9902  C  CB   . GLU A 1 47  ? -7.524  9.430  43.415 1.00 0.00 ? 47  GLU A CB   4  
ATOM   9903  C  CG   . GLU A 1 47  ? -8.436  8.727  42.410 1.00 0.00 ? 47  GLU A CG   4  
ATOM   9904  C  CD   . GLU A 1 47  ? -9.861  8.681  42.964 1.00 0.00 ? 47  GLU A CD   4  
ATOM   9905  O  OE1  . GLU A 1 47  ? -10.338 9.746  43.318 1.00 0.00 ? 47  GLU A OE1  4  
ATOM   9906  O  OE2  . GLU A 1 47  ? -10.392 7.583  43.002 1.00 0.00 ? 47  GLU A OE2  4  
ATOM   9907  H  H    . GLU A 1 47  ? -5.526  10.413 44.686 1.00 0.00 ? 47  GLU A H    4  
ATOM   9908  H  HA   . GLU A 1 47  ? -5.944  7.963  43.145 1.00 0.00 ? 47  GLU A HA   4  
ATOM   9909  H  HB2  . GLU A 1 47  ? -7.784  9.125  44.418 1.00 0.00 ? 47  GLU A HB2  4  
ATOM   9910  H  HB3  . GLU A 1 47  ? -7.643  10.500 43.326 1.00 0.00 ? 47  GLU A HB3  4  
ATOM   9911  H  HG2  . GLU A 1 47  ? -8.431  9.264  41.474 1.00 0.00 ? 47  GLU A HG2  4  
ATOM   9912  H  HG3  . GLU A 1 47  ? -8.084  7.718  42.242 1.00 0.00 ? 47  GLU A HG3  4  
ATOM   9913  N  N    . PHE A 1 48  ? -5.079  10.684 41.668 1.00 0.00 ? 48  PHE A N    4  
ATOM   9914  C  CA   . PHE A 1 48  ? -4.703  11.220 40.343 1.00 0.00 ? 48  PHE A CA   4  
ATOM   9915  C  C    . PHE A 1 48  ? -4.085  10.125 39.486 1.00 0.00 ? 48  PHE A C    4  
ATOM   9916  O  O    . PHE A 1 48  ? -4.461  9.936  38.346 1.00 0.00 ? 48  PHE A O    4  
ATOM   9917  C  CB   . PHE A 1 48  ? -3.673  12.340 40.539 1.00 0.00 ? 48  PHE A CB   4  
ATOM   9918  C  CG   . PHE A 1 48  ? -3.506  13.099 39.222 1.00 0.00 ? 48  PHE A CG   4  
ATOM   9919  C  CD1  . PHE A 1 48  ? -4.465  14.009 38.810 1.00 0.00 ? 48  PHE A CD1  4  
ATOM   9920  C  CD2  . PHE A 1 48  ? -2.400  12.878 38.419 1.00 0.00 ? 48  PHE A CD2  4  
ATOM   9921  C  CE1  . PHE A 1 48  ? -4.319  14.683 37.616 1.00 0.00 ? 48  PHE A CE1  4  
ATOM   9922  C  CE2  . PHE A 1 48  ? -2.258  13.556 37.226 1.00 0.00 ? 48  PHE A CE2  4  
ATOM   9923  C  CZ   . PHE A 1 48  ? -3.217  14.457 36.826 1.00 0.00 ? 48  PHE A CZ   4  
ATOM   9924  H  H    . PHE A 1 48  ? -4.855  11.175 42.486 1.00 0.00 ? 48  PHE A H    4  
ATOM   9925  H  HA   . PHE A 1 48  ? -5.597  11.597 39.846 1.00 0.00 ? 48  PHE A HA   4  
ATOM   9926  H  HB2  . PHE A 1 48  ? -4.014  13.023 41.303 1.00 0.00 ? 48  PHE A HB2  4  
ATOM   9927  H  HB3  . PHE A 1 48  ? -2.722  11.919 40.832 1.00 0.00 ? 48  PHE A HB3  4  
ATOM   9928  H  HD1  . PHE A 1 48  ? -5.332  14.191 39.427 1.00 0.00 ? 48  PHE A HD1  4  
ATOM   9929  H  HD2  . PHE A 1 48  ? -1.646  12.170 38.728 1.00 0.00 ? 48  PHE A HD2  4  
ATOM   9930  H  HE1  . PHE A 1 48  ? -5.073  15.390 37.300 1.00 0.00 ? 48  PHE A HE1  4  
ATOM   9931  H  HE2  . PHE A 1 48  ? -1.393  13.378 36.604 1.00 0.00 ? 48  PHE A HE2  4  
ATOM   9932  H  HZ   . PHE A 1 48  ? -3.106  14.985 35.891 1.00 0.00 ? 48  PHE A HZ   4  
ATOM   9933  N  N    . GLN A 1 49  ? -3.146  9.419  40.053 1.00 0.00 ? 49  GLN A N    4  
ATOM   9934  C  CA   . GLN A 1 49  ? -2.490  8.331  39.290 1.00 0.00 ? 49  GLN A CA   4  
ATOM   9935  C  C    . GLN A 1 49  ? -3.523  7.366  38.703 1.00 0.00 ? 49  GLN A C    4  
ATOM   9936  O  O    . GLN A 1 49  ? -3.326  6.826  37.632 1.00 0.00 ? 49  GLN A O    4  
ATOM   9937  C  CB   . GLN A 1 49  ? -1.582  7.550  40.250 1.00 0.00 ? 49  GLN A CB   4  
ATOM   9938  C  CG   . GLN A 1 49  ? -0.770  6.529  39.452 1.00 0.00 ? 49  GLN A CG   4  
ATOM   9939  C  CD   . GLN A 1 49  ? -0.140  5.519  40.413 1.00 0.00 ? 49  GLN A CD   4  
ATOM   9940  O  OE1  . GLN A 1 49  ? 0.073   5.802  41.576 1.00 0.00 ? 49  GLN A OE1  4  
ATOM   9941  N  NE2  . GLN A 1 49  ? 0.174   4.333  39.970 1.00 0.00 ? 49  GLN A NE2  4  
ATOM   9942  H  H    . GLN A 1 49  ? -2.865  9.615  40.974 1.00 0.00 ? 49  GLN A H    4  
ATOM   9943  H  HA   . GLN A 1 49  ? -1.911  8.768  38.478 1.00 0.00 ? 49  GLN A HA   4  
ATOM   9944  H  HB2  . GLN A 1 49  ? -0.913  8.232  40.754 1.00 0.00 ? 49  GLN A HB2  4  
ATOM   9945  H  HB3  . GLN A 1 49  ? -2.186  7.039  40.986 1.00 0.00 ? 49  GLN A HB3  4  
ATOM   9946  H  HG2  . GLN A 1 49  ? -1.416  6.007  38.761 1.00 0.00 ? 49  GLN A HG2  4  
ATOM   9947  H  HG3  . GLN A 1 49  ? 0.009   7.031  38.900 1.00 0.00 ? 49  GLN A HG3  4  
ATOM   9948  H  HE21 . GLN A 1 49  ? 0.005   4.100  39.033 1.00 0.00 ? 49  GLN A HE21 4  
ATOM   9949  H  HE22 . GLN A 1 49  ? 0.579   3.675  40.573 1.00 0.00 ? 49  GLN A HE22 4  
ATOM   9950  N  N    . THR A 1 50  ? -4.606  7.164  39.411 1.00 0.00 ? 50  THR A N    4  
ATOM   9951  C  CA   . THR A 1 50  ? -5.645  6.236  38.892 1.00 0.00 ? 50  THR A CA   4  
ATOM   9952  C  C    . THR A 1 50  ? -6.281  6.787  37.621 1.00 0.00 ? 50  THR A C    4  
ATOM   9953  O  O    . THR A 1 50  ? -6.734  6.038  36.777 1.00 0.00 ? 50  THR A O    4  
ATOM   9954  C  CB   . THR A 1 50  ? -6.732  6.067  39.961 1.00 0.00 ? 50  THR A CB   4  
ATOM   9955  O  OG1  . THR A 1 50  ? -6.059  5.575  41.101 1.00 0.00 ? 50  THR A OG1  4  
ATOM   9956  C  CG2  . THR A 1 50  ? -7.708  4.944  39.576 1.00 0.00 ? 50  THR A CG2  4  
ATOM   9957  H  H    . THR A 1 50  ? -4.734  7.622  40.270 1.00 0.00 ? 50  THR A H    4  
ATOM   9958  H  HA   . THR A 1 50  ? -5.178  5.278  38.664 1.00 0.00 ? 50  THR A HA   4  
ATOM   9959  H  HB   . THR A 1 50  ? -7.234  7.003  40.184 1.00 0.00 ? 50  THR A HB   4  
ATOM   9960  H  HG1  . THR A 1 50  ? -5.121  5.747  40.988 1.00 0.00 ? 50  THR A HG1  4  
ATOM   9961  H  HG21 . THR A 1 50  ? -7.254  4.306  38.832 1.00 0.00 ? 50  THR A HG21 4  
ATOM   9962  H  HG22 . THR A 1 50  ? -7.950  4.356  40.449 1.00 0.00 ? 50  THR A HG22 4  
ATOM   9963  H  HG23 . THR A 1 50  ? -8.614  5.371  39.172 1.00 0.00 ? 50  THR A HG23 4  
ATOM   9964  N  N    . ILE A 1 51  ? -6.304  8.086  37.505 1.00 0.00 ? 51  ILE A N    4  
ATOM   9965  C  CA   . ILE A 1 51  ? -6.906  8.696  36.294 1.00 0.00 ? 51  ILE A CA   4  
ATOM   9966  C  C    . ILE A 1 51  ? -5.882  8.782  35.169 1.00 0.00 ? 51  ILE A C    4  
ATOM   9967  O  O    . ILE A 1 51  ? -6.180  8.487  34.028 1.00 0.00 ? 51  ILE A O    4  
ATOM   9968  C  CB   . ILE A 1 51  ? -7.369  10.109 36.644 1.00 0.00 ? 51  ILE A CB   4  
ATOM   9969  C  CG1  . ILE A 1 51  ? -8.319  10.062 37.832 1.00 0.00 ? 51  ILE A CG1  4  
ATOM   9970  C  CG2  . ILE A 1 51  ? -8.124  10.690 35.437 1.00 0.00 ? 51  ILE A CG2  4  
ATOM   9971  C  CD1  . ILE A 1 51  ? -9.028  11.412 37.962 1.00 0.00 ? 51  ILE A CD1  4  
ATOM   9972  H  H    . ILE A 1 51  ? -5.930  8.652  38.211 1.00 0.00 ? 51  ILE A H    4  
ATOM   9973  H  HA   . ILE A 1 51  ? -7.745  8.082  35.965 1.00 0.00 ? 51  ILE A HA   4  
ATOM   9974  H  HB   . ILE A 1 51  ? -6.503  10.724 36.897 1.00 0.00 ? 51  ILE A HB   4  
ATOM   9975  H  HG12 . ILE A 1 51  ? -9.049  9.281  37.681 1.00 0.00 ? 51  ILE A HG12 4  
ATOM   9976  H  HG13 . ILE A 1 51  ? -7.762  9.856  38.734 1.00 0.00 ? 51  ILE A HG13 4  
ATOM   9977  H  HG21 . ILE A 1 51  ? -7.621  10.410 34.523 1.00 0.00 ? 51  ILE A HG21 4  
ATOM   9978  H  HG22 . ILE A 1 51  ? -9.134  10.306 35.419 1.00 0.00 ? 51  ILE A HG22 4  
ATOM   9979  H  HG23 . ILE A 1 51  ? -8.154  11.767 35.509 1.00 0.00 ? 51  ILE A HG23 4  
ATOM   9980  H  HD11 . ILE A 1 51  ? -8.333  12.210 37.748 1.00 0.00 ? 51  ILE A HD11 4  
ATOM   9981  H  HD12 . ILE A 1 51  ? -9.852  11.460 37.263 1.00 0.00 ? 51  ILE A HD12 4  
ATOM   9982  H  HD13 . ILE A 1 51  ? -9.406  11.530 38.966 1.00 0.00 ? 51  ILE A HD13 4  
ATOM   9983  N  N    . TYR A 1 52  ? -4.690  9.188  35.512 1.00 0.00 ? 52  TYR A N    4  
ATOM   9984  C  CA   . TYR A 1 52  ? -3.631  9.301  34.479 1.00 0.00 ? 52  TYR A CA   4  
ATOM   9985  C  C    . TYR A 1 52  ? -3.213  7.923  33.976 1.00 0.00 ? 52  TYR A C    4  
ATOM   9986  O  O    . TYR A 1 52  ? -2.526  7.805  32.981 1.00 0.00 ? 52  TYR A O    4  
ATOM   9987  C  CB   . TYR A 1 52  ? -2.411  9.983  35.118 1.00 0.00 ? 52  TYR A CB   4  
ATOM   9988  C  CG   . TYR A 1 52  ? -1.835  11.014 34.144 1.00 0.00 ? 52  TYR A CG   4  
ATOM   9989  C  CD1  . TYR A 1 52  ? -2.595  12.088 33.728 1.00 0.00 ? 52  TYR A CD1  4  
ATOM   9990  C  CD2  . TYR A 1 52  ? -0.545  10.885 33.669 1.00 0.00 ? 52  TYR A CD2  4  
ATOM   9991  C  CE1  . TYR A 1 52  ? -2.075  13.020 32.854 1.00 0.00 ? 52  TYR A CE1  4  
ATOM   9992  C  CE2  . TYR A 1 52  ? -0.023  11.817 32.795 1.00 0.00 ? 52  TYR A CE2  4  
ATOM   9993  C  CZ   . TYR A 1 52  ? -0.784  12.891 32.380 1.00 0.00 ? 52  TYR A CZ   4  
ATOM   9994  O  OH   . TYR A 1 52  ? -0.264  13.823 31.504 1.00 0.00 ? 52  TYR A OH   4  
ATOM   9995  H  H    . TYR A 1 52  ? -4.495  9.415  36.445 1.00 0.00 ? 52  TYR A H    4  
ATOM   9996  H  HA   . TYR A 1 52  ? -4.010  9.887  33.643 1.00 0.00 ? 52  TYR A HA   4  
ATOM   9997  H  HB2  . TYR A 1 52  ? -2.706  10.481 36.030 1.00 0.00 ? 52  TYR A HB2  4  
ATOM   9998  H  HB3  . TYR A 1 52  ? -1.655  9.245  35.342 1.00 0.00 ? 52  TYR A HB3  4  
ATOM   9999  H  HD1  . TYR A 1 52  ? -3.606  12.201 34.091 1.00 0.00 ? 52  TYR A HD1  4  
ATOM   10000 H  HD2  . TYR A 1 52  ? 0.061   10.050 33.986 1.00 0.00 ? 52  TYR A HD2  4  
ATOM   10001 H  HE1  . TYR A 1 52  ? -2.681  13.855 32.537 1.00 0.00 ? 52  TYR A HE1  4  
ATOM   10002 H  HE2  . TYR A 1 52  ? 0.987   11.704 32.431 1.00 0.00 ? 52  TYR A HE2  4  
ATOM   10003 H  HH   . TYR A 1 52  ? -0.467  14.696 31.846 1.00 0.00 ? 52  TYR A HH   4  
ATOM   10004 N  N    . SER A 1 53  ? -3.636  6.905  34.674 1.00 0.00 ? 53  SER A N    4  
ATOM   10005 C  CA   . SER A 1 53  ? -3.274  5.530  34.252 1.00 0.00 ? 53  SER A CA   4  
ATOM   10006 C  C    . SER A 1 53  ? -4.227  5.018  33.180 1.00 0.00 ? 53  SER A C    4  
ATOM   10007 O  O    . SER A 1 53  ? -3.920  4.080  32.471 1.00 0.00 ? 53  SER A O    4  
ATOM   10008 C  CB   . SER A 1 53  ? -3.367  4.606  35.476 1.00 0.00 ? 53  SER A CB   4  
ATOM   10009 O  OG   . SER A 1 53  ? -4.666  4.850  35.995 1.00 0.00 ? 53  SER A OG   4  
ATOM   10010 H  H    . SER A 1 53  ? -4.189  7.048  35.471 1.00 0.00 ? 53  SER A H    4  
ATOM   10011 H  HA   . SER A 1 53  ? -2.261  5.539  33.851 1.00 0.00 ? 53  SER A HA   4  
ATOM   10012 H  HB2  . SER A 1 53  ? -3.269  3.572  35.184 1.00 0.00 ? 53  SER A HB2  4  
ATOM   10013 H  HB3  . SER A 1 53  ? -2.617  4.866  36.209 1.00 0.00 ? 53  SER A HB3  4  
ATOM   10014 H  HG   . SER A 1 53  ? -4.852  4.178  36.655 1.00 0.00 ? 53  SER A HG   4  
ATOM   10015 N  N    . LYS A 1 54  ? -5.369  5.640  33.080 1.00 0.00 ? 54  LYS A N    4  
ATOM   10016 C  CA   . LYS A 1 54  ? -6.349  5.198  32.059 1.00 0.00 ? 54  LYS A CA   4  
ATOM   10017 C  C    . LYS A 1 54  ? -5.800  5.417  30.655 1.00 0.00 ? 54  LYS A C    4  
ATOM   10018 O  O    . LYS A 1 54  ? -6.149  4.708  29.732 1.00 0.00 ? 54  LYS A O    4  
ATOM   10019 C  CB   . LYS A 1 54  ? -7.630  6.031  32.221 1.00 0.00 ? 54  LYS A CB   4  
ATOM   10020 C  CG   . LYS A 1 54  ? -8.239  5.756  33.596 1.00 0.00 ? 54  LYS A CG   4  
ATOM   10021 C  CD   . LYS A 1 54  ? -9.754  5.967  33.524 1.00 0.00 ? 54  LYS A CD   4  
ATOM   10022 C  CE   . LYS A 1 54  ? -10.042 7.344  32.923 1.00 0.00 ? 54  LYS A CE   4  
ATOM   10023 N  NZ   . LYS A 1 54  ? -9.215  8.388  33.590 1.00 0.00 ? 54  LYS A NZ   4  
ATOM   10024 H  H    . LYS A 1 54  ? -5.578  6.390  33.675 1.00 0.00 ? 54  LYS A H    4  
ATOM   10025 H  HA   . LYS A 1 54  ? -6.555  4.138  32.199 1.00 0.00 ? 54  LYS A HA   4  
ATOM   10026 H  HB2  . LYS A 1 54  ? -7.394  7.081  32.131 1.00 0.00 ? 54  LYS A HB2  4  
ATOM   10027 H  HB3  . LYS A 1 54  ? -8.336  5.760  31.450 1.00 0.00 ? 54  LYS A HB3  4  
ATOM   10028 H  HG2  . LYS A 1 54  ? -8.027  4.739  33.890 1.00 0.00 ? 54  LYS A HG2  4  
ATOM   10029 H  HG3  . LYS A 1 54  ? -7.813  6.431  34.323 1.00 0.00 ? 54  LYS A HG3  4  
ATOM   10030 H  HD2  . LYS A 1 54  ? -10.198 5.200  32.907 1.00 0.00 ? 54  LYS A HD2  4  
ATOM   10031 H  HD3  . LYS A 1 54  ? -10.175 5.910  34.517 1.00 0.00 ? 54  LYS A HD3  4  
ATOM   10032 H  HE2  . LYS A 1 54  ? -9.812  7.334  31.868 1.00 0.00 ? 54  LYS A HE2  4  
ATOM   10033 H  HE3  . LYS A 1 54  ? -11.086 7.585  33.053 1.00 0.00 ? 54  LYS A HE3  4  
ATOM   10034 H  HZ1  . LYS A 1 54  ? -8.651  7.950  34.346 1.00 0.00 ? 54  LYS A HZ1  4  
ATOM   10035 H  HZ2  . LYS A 1 54  ? -8.581  8.826  32.893 1.00 0.00 ? 54  LYS A HZ2  4  
ATOM   10036 H  HZ3  . LYS A 1 54  ? -9.837  9.114  33.998 1.00 0.00 ? 54  LYS A HZ3  4  
ATOM   10037 N  N    . PHE A 1 55  ? -4.947  6.399  30.520 1.00 0.00 ? 55  PHE A N    4  
ATOM   10038 C  CA   . PHE A 1 55  ? -4.363  6.682  29.189 1.00 0.00 ? 55  PHE A CA   4  
ATOM   10039 C  C    . PHE A 1 55  ? -3.017  5.984  29.016 1.00 0.00 ? 55  PHE A C    4  
ATOM   10040 O  O    . PHE A 1 55  ? -2.543  5.819  27.910 1.00 0.00 ? 55  PHE A O    4  
ATOM   10041 C  CB   . PHE A 1 55  ? -4.155  8.198  29.067 1.00 0.00 ? 55  PHE A CB   4  
ATOM   10042 C  CG   . PHE A 1 55  ? -5.447  8.915  29.464 1.00 0.00 ? 55  PHE A CG   4  
ATOM   10043 C  CD1  . PHE A 1 55  ? -5.689  9.243  30.787 1.00 0.00 ? 55  PHE A CD1  4  
ATOM   10044 C  CD2  . PHE A 1 55  ? -6.391  9.244  28.506 1.00 0.00 ? 55  PHE A CD2  4  
ATOM   10045 C  CE1  . PHE A 1 55  ? -6.855  9.889  31.142 1.00 0.00 ? 55  PHE A CE1  4  
ATOM   10046 C  CE2  . PHE A 1 55  ? -7.556  9.890  28.866 1.00 0.00 ? 55  PHE A CE2  4  
ATOM   10047 C  CZ   . PHE A 1 55  ? -7.787  10.210 30.183 1.00 0.00 ? 55  PHE A CZ   4  
ATOM   10048 H  H    . PHE A 1 55  ? -4.698  6.943  31.292 1.00 0.00 ? 55  PHE A H    4  
ATOM   10049 H  HA   . PHE A 1 55  ? -5.045  6.326  28.423 1.00 0.00 ? 55  PHE A HA   4  
ATOM   10050 H  HB2  . PHE A 1 55  ? -3.355  8.513  29.722 1.00 0.00 ? 55  PHE A HB2  4  
ATOM   10051 H  HB3  . PHE A 1 55  ? -3.903  8.453  28.048 1.00 0.00 ? 55  PHE A HB3  4  
ATOM   10052 H  HD1  . PHE A 1 55  ? -4.962  8.992  31.544 1.00 0.00 ? 55  PHE A HD1  4  
ATOM   10053 H  HD2  . PHE A 1 55  ? -6.215  8.992  27.470 1.00 0.00 ? 55  PHE A HD2  4  
ATOM   10054 H  HE1  . PHE A 1 55  ? -7.037  10.141 32.177 1.00 0.00 ? 55  PHE A HE1  4  
ATOM   10055 H  HE2  . PHE A 1 55  ? -8.288  10.142 28.114 1.00 0.00 ? 55  PHE A HE2  4  
ATOM   10056 H  HZ   . PHE A 1 55  ? -8.699  10.716 30.464 1.00 0.00 ? 55  PHE A HZ   4  
ATOM   10057 N  N    . PHE A 1 56  ? -2.423  5.589  30.117 1.00 0.00 ? 56  PHE A N    4  
ATOM   10058 C  CA   . PHE A 1 56  ? -1.107  4.899  30.030 1.00 0.00 ? 56  PHE A CA   4  
ATOM   10059 C  C    . PHE A 1 56  ? -0.995  3.764  31.053 1.00 0.00 ? 56  PHE A C    4  
ATOM   10060 O  O    . PHE A 1 56  ? -0.090  3.740  31.863 1.00 0.00 ? 56  PHE A O    4  
ATOM   10061 C  CB   . PHE A 1 56  ? -0.006  5.931  30.322 1.00 0.00 ? 56  PHE A CB   4  
ATOM   10062 C  CG   . PHE A 1 56  ? -0.254  7.186  29.483 1.00 0.00 ? 56  PHE A CG   4  
ATOM   10063 C  CD1  . PHE A 1 56  ? -0.084  7.159  28.110 1.00 0.00 ? 56  PHE A CD1  4  
ATOM   10064 C  CD2  . PHE A 1 56  ? -0.654  8.368  30.087 1.00 0.00 ? 56  PHE A CD2  4  
ATOM   10065 C  CE1  . PHE A 1 56  ? -0.310  8.293  27.355 1.00 0.00 ? 56  PHE A CE1  4  
ATOM   10066 C  CE2  . PHE A 1 56  ? -0.879  9.499  29.330 1.00 0.00 ? 56  PHE A CE2  4  
ATOM   10067 C  CZ   . PHE A 1 56  ? -0.706  9.461  27.965 1.00 0.00 ? 56  PHE A CZ   4  
ATOM   10068 H  H    . PHE A 1 56  ? -2.842  5.746  30.989 1.00 0.00 ? 56  PHE A H    4  
ATOM   10069 H  HA   . PHE A 1 56  ? -0.986  4.483  29.032 1.00 0.00 ? 56  PHE A HA   4  
ATOM   10070 H  HB2  . PHE A 1 56  ? -0.019  6.193  31.370 1.00 0.00 ? 56  PHE A HB2  4  
ATOM   10071 H  HB3  . PHE A 1 56  ? 0.959   5.518  30.068 1.00 0.00 ? 56  PHE A HB3  4  
ATOM   10072 H  HD1  . PHE A 1 56  ? 0.227   6.245  27.626 1.00 0.00 ? 56  PHE A HD1  4  
ATOM   10073 H  HD2  . PHE A 1 56  ? -0.791  8.404  31.158 1.00 0.00 ? 56  PHE A HD2  4  
ATOM   10074 H  HE1  . PHE A 1 56  ? -0.175  8.264  26.285 1.00 0.00 ? 56  PHE A HE1  4  
ATOM   10075 H  HE2  . PHE A 1 56  ? -1.190  10.416 29.807 1.00 0.00 ? 56  PHE A HE2  4  
ATOM   10076 H  HZ   . PHE A 1 56  ? -0.883  10.346 27.374 1.00 0.00 ? 56  PHE A HZ   4  
ATOM   10077 N  N    . PRO A 1 57  ? -1.934  2.837  30.992 1.00 0.00 ? 57  PRO A N    4  
ATOM   10078 C  CA   . PRO A 1 57  ? -1.947  1.697  31.909 1.00 0.00 ? 57  PRO A CA   4  
ATOM   10079 C  C    . PRO A 1 57  ? -0.822  0.714  31.587 1.00 0.00 ? 57  PRO A C    4  
ATOM   10080 O  O    . PRO A 1 57  ? -0.717  -0.332 32.196 1.00 0.00 ? 57  PRO A O    4  
ATOM   10081 C  CB   . PRO A 1 57  ? -3.299  1.002  31.646 1.00 0.00 ? 57  PRO A CB   4  
ATOM   10082 C  CG   . PRO A 1 57  ? -3.925  1.672  30.384 1.00 0.00 ? 57  PRO A CG   4  
ATOM   10083 C  CD   . PRO A 1 57  ? -3.046  2.883  30.031 1.00 0.00 ? 57  PRO A CD   4  
ATOM   10084 H  HA   . PRO A 1 57  ? -1.871  2.038  32.935 1.00 0.00 ? 57  PRO A HA   4  
ATOM   10085 H  HB2  . PRO A 1 57  ? -3.145  -0.052 31.465 1.00 0.00 ? 57  PRO A HB2  4  
ATOM   10086 H  HB3  . PRO A 1 57  ? -3.952  1.132  32.496 1.00 0.00 ? 57  PRO A HB3  4  
ATOM   10087 H  HG2  . PRO A 1 57  ? -3.938  0.973  29.563 1.00 0.00 ? 57  PRO A HG2  4  
ATOM   10088 H  HG3  . PRO A 1 57  ? -4.932  1.996  30.599 1.00 0.00 ? 57  PRO A HG3  4  
ATOM   10089 H  HD2  . PRO A 1 57  ? -2.671  2.802  29.022 1.00 0.00 ? 57  PRO A HD2  4  
ATOM   10090 H  HD3  . PRO A 1 57  ? -3.607  3.790  30.150 1.00 0.00 ? 57  PRO A HD3  4  
ATOM   10091 N  N    . GLU A 1 58  ? -0.003  1.069  30.636 1.00 0.00 ? 58  GLU A N    4  
ATOM   10092 C  CA   . GLU A 1 58  ? 1.115   0.167  30.265 1.00 0.00 ? 58  GLU A CA   4  
ATOM   10093 C  C    . GLU A 1 58  ? 2.303   0.323  31.207 1.00 0.00 ? 58  GLU A C    4  
ATOM   10094 O  O    . GLU A 1 58  ? 2.768   -0.640 31.785 1.00 0.00 ? 58  GLU A O    4  
ATOM   10095 C  CB   . GLU A 1 58  ? 1.567   0.517  28.836 1.00 0.00 ? 58  GLU A CB   4  
ATOM   10096 C  CG   . GLU A 1 58  ? 1.269   1.993  28.556 1.00 0.00 ? 58  GLU A CG   4  
ATOM   10097 C  CD   . GLU A 1 58  ? 1.864   2.379  27.199 1.00 0.00 ? 58  GLU A CD   4  
ATOM   10098 O  OE1  . GLU A 1 58  ? 3.069   2.565  27.169 1.00 0.00 ? 58  GLU A OE1  4  
ATOM   10099 O  OE2  . GLU A 1 58  ? 1.079   2.465  26.269 1.00 0.00 ? 58  GLU A OE2  4  
ATOM   10100 H  H    . GLU A 1 58  ? -0.124  1.923  30.172 1.00 0.00 ? 58  GLU A H    4  
ATOM   10101 H  HA   . GLU A 1 58  ? 0.766   -0.860 30.314 1.00 0.00 ? 58  GLU A HA   4  
ATOM   10102 H  HB2  . GLU A 1 58  ? 2.627   0.336  28.736 1.00 0.00 ? 58  GLU A HB2  4  
ATOM   10103 H  HB3  . GLU A 1 58  ? 1.035   -0.099 28.127 1.00 0.00 ? 58  GLU A HB3  4  
ATOM   10104 H  HG2  . GLU A 1 58  ? 0.202   2.154  28.536 1.00 0.00 ? 58  GLU A HG2  4  
ATOM   10105 H  HG3  . GLU A 1 58  ? 1.709   2.609  29.328 1.00 0.00 ? 58  GLU A HG3  4  
ATOM   10106 N  N    . ALA A 1 59  ? 2.773   1.528  31.347 1.00 0.00 ? 59  ALA A N    4  
ATOM   10107 C  CA   . ALA A 1 59  ? 3.926   1.760  32.241 1.00 0.00 ? 59  ALA A CA   4  
ATOM   10108 C  C    . ALA A 1 59  ? 3.472   2.123  33.648 1.00 0.00 ? 59  ALA A C    4  
ATOM   10109 O  O    . ALA A 1 59  ? 2.437   1.677  34.102 1.00 0.00 ? 59  ALA A O    4  
ATOM   10110 C  CB   . ALA A 1 59  ? 4.739   2.919  31.663 1.00 0.00 ? 59  ALA A CB   4  
ATOM   10111 H  H    . ALA A 1 59  ? 2.369   2.275  30.863 1.00 0.00 ? 59  ALA A H    4  
ATOM   10112 H  HA   . ALA A 1 59  ? 4.526   0.855  32.286 1.00 0.00 ? 59  ALA A HA   4  
ATOM   10113 H  HB1  . ALA A 1 59  ? 4.393   3.138  30.664 1.00 0.00 ? 59  ALA A HB1  4  
ATOM   10114 H  HB2  . ALA A 1 59  ? 4.618   3.797  32.280 1.00 0.00 ? 59  ALA A HB2  4  
ATOM   10115 H  HB3  . ALA A 1 59  ? 5.783   2.649  31.627 1.00 0.00 ? 59  ALA A HB3  4  
ATOM   10116 N  N    . ASP A 1 60  ? 4.265   2.927  34.314 1.00 0.00 ? 60  ASP A N    4  
ATOM   10117 C  CA   . ASP A 1 60  ? 3.910   3.339  35.692 1.00 0.00 ? 60  ASP A CA   4  
ATOM   10118 C  C    . ASP A 1 60  ? 4.181   4.823  35.902 1.00 0.00 ? 60  ASP A C    4  
ATOM   10119 O  O    . ASP A 1 60  ? 5.064   5.202  36.646 1.00 0.00 ? 60  ASP A O    4  
ATOM   10120 C  CB   . ASP A 1 60  ? 4.783   2.537  36.671 1.00 0.00 ? 60  ASP A CB   4  
ATOM   10121 C  CG   . ASP A 1 60  ? 4.245   1.108  36.772 1.00 0.00 ? 60  ASP A CG   4  
ATOM   10122 O  OD1  . ASP A 1 60  ? 3.206   0.963  37.394 1.00 0.00 ? 60  ASP A OD1  4  
ATOM   10123 O  OD2  . ASP A 1 60  ? 4.905   0.241  36.222 1.00 0.00 ? 60  ASP A OD2  4  
ATOM   10124 H  H    . ASP A 1 60  ? 5.094   3.254  33.901 1.00 0.00 ? 60  ASP A H    4  
ATOM   10125 H  HA   . ASP A 1 60  ? 2.855   3.142  35.867 1.00 0.00 ? 60  ASP A HA   4  
ATOM   10126 H  HB2  . ASP A 1 60  ? 5.803   2.511  36.314 1.00 0.00 ? 60  ASP A HB2  4  
ATOM   10127 H  HB3  . ASP A 1 60  ? 4.757   2.998  37.646 1.00 0.00 ? 60  ASP A HB3  4  
ATOM   10128 N  N    . PRO A 1 61  ? 3.405   5.639  35.228 1.00 0.00 ? 61  PRO A N    4  
ATOM   10129 C  CA   . PRO A 1 61  ? 3.542   7.089  35.327 1.00 0.00 ? 61  PRO A CA   4  
ATOM   10130 C  C    . PRO A 1 61  ? 3.217   7.566  36.733 1.00 0.00 ? 61  PRO A C    4  
ATOM   10131 O  O    . PRO A 1 61  ? 2.741   8.667  36.936 1.00 0.00 ? 61  PRO A O    4  
ATOM   10132 C  CB   . PRO A 1 61  ? 2.509   7.654  34.323 1.00 0.00 ? 61  PRO A CB   4  
ATOM   10133 C  CG   . PRO A 1 61  ? 1.756   6.436  33.702 1.00 0.00 ? 61  PRO A CG   4  
ATOM   10134 C  CD   . PRO A 1 61  ? 2.354   5.161  34.324 1.00 0.00 ? 61  PRO A CD   4  
ATOM   10135 H  HA   . PRO A 1 61  ? 4.550   7.381  35.064 1.00 0.00 ? 61  PRO A HA   4  
ATOM   10136 H  HB2  . PRO A 1 61  ? 1.810   8.298  34.830 1.00 0.00 ? 61  PRO A HB2  4  
ATOM   10137 H  HB3  . PRO A 1 61  ? 3.015   8.210  33.548 1.00 0.00 ? 61  PRO A HB3  4  
ATOM   10138 H  HG2  . PRO A 1 61  ? 0.702   6.499  33.931 1.00 0.00 ? 61  PRO A HG2  4  
ATOM   10139 H  HG3  . PRO A 1 61  ? 1.893   6.424  32.631 1.00 0.00 ? 61  PRO A HG3  4  
ATOM   10140 H  HD2  . PRO A 1 61  ? 1.601   4.622  34.880 1.00 0.00 ? 61  PRO A HD2  4  
ATOM   10141 H  HD3  . PRO A 1 61  ? 2.781   4.528  33.561 1.00 0.00 ? 61  PRO A HD3  4  
ATOM   10142 N  N    . LYS A 1 62  ? 3.496   6.728  37.681 1.00 0.00 ? 62  LYS A N    4  
ATOM   10143 C  CA   . LYS A 1 62  ? 3.215   7.096  39.085 1.00 0.00 ? 62  LYS A CA   4  
ATOM   10144 C  C    . LYS A 1 62  ? 4.054   8.291  39.506 1.00 0.00 ? 62  LYS A C    4  
ATOM   10145 O  O    . LYS A 1 62  ? 3.577   9.180  40.184 1.00 0.00 ? 62  LYS A O    4  
ATOM   10146 C  CB   . LYS A 1 62  ? 3.567   5.886  39.978 1.00 0.00 ? 62  LYS A CB   4  
ATOM   10147 C  CG   . LYS A 1 62  ? 3.767   6.352  41.426 1.00 0.00 ? 62  LYS A CG   4  
ATOM   10148 C  CD   . LYS A 1 62  ? 3.999   5.127  42.319 1.00 0.00 ? 62  LYS A CD   4  
ATOM   10149 C  CE   . LYS A 1 62  ? 5.371   4.525  42.001 1.00 0.00 ? 62  LYS A CE   4  
ATOM   10150 N  NZ   . LYS A 1 62  ? 6.367   5.602  41.744 1.00 0.00 ? 62  LYS A NZ   4  
ATOM   10151 H  H    . LYS A 1 62  ? 3.899   5.861  37.464 1.00 0.00 ? 62  LYS A H    4  
ATOM   10152 H  HA   . LYS A 1 62  ? 2.164   7.355  39.176 1.00 0.00 ? 62  LYS A HA   4  
ATOM   10153 H  HB2  . LYS A 1 62  ? 2.765   5.163  39.940 1.00 0.00 ? 62  LYS A HB2  4  
ATOM   10154 H  HB3  . LYS A 1 62  ? 4.475   5.423  39.620 1.00 0.00 ? 62  LYS A HB3  4  
ATOM   10155 H  HG2  . LYS A 1 62  ? 4.622   7.008  41.484 1.00 0.00 ? 62  LYS A HG2  4  
ATOM   10156 H  HG3  . LYS A 1 62  ? 2.890   6.884  41.761 1.00 0.00 ? 62  LYS A HG3  4  
ATOM   10157 H  HD2  . LYS A 1 62  ? 3.965   5.423  43.357 1.00 0.00 ? 62  LYS A HD2  4  
ATOM   10158 H  HD3  . LYS A 1 62  ? 3.229   4.393  42.136 1.00 0.00 ? 62  LYS A HD3  4  
ATOM   10159 H  HE2  . LYS A 1 62  ? 5.706   3.927  42.836 1.00 0.00 ? 62  LYS A HE2  4  
ATOM   10160 H  HE3  . LYS A 1 62  ? 5.296   3.896  41.126 1.00 0.00 ? 62  LYS A HE3  4  
ATOM   10161 H  HZ1  . LYS A 1 62  ? 6.290   6.329  42.482 1.00 0.00 ? 62  LYS A HZ1  4  
ATOM   10162 H  HZ2  . LYS A 1 62  ? 7.325   5.197  41.754 1.00 0.00 ? 62  LYS A HZ2  4  
ATOM   10163 H  HZ3  . LYS A 1 62  ? 6.181   6.030  40.813 1.00 0.00 ? 62  LYS A HZ3  4  
ATOM   10164 N  N    . ALA A 1 63  ? 5.288   8.296  39.096 1.00 0.00 ? 63  ALA A N    4  
ATOM   10165 C  CA   . ALA A 1 63  ? 6.167   9.426  39.463 1.00 0.00 ? 63  ALA A CA   4  
ATOM   10166 C  C    . ALA A 1 63  ? 5.903   10.629 38.571 1.00 0.00 ? 63  ALA A C    4  
ATOM   10167 O  O    . ALA A 1 63  ? 6.078   11.755 38.981 1.00 0.00 ? 63  ALA A O    4  
ATOM   10168 C  CB   . ALA A 1 63  ? 7.624   8.984  39.274 1.00 0.00 ? 63  ALA A CB   4  
ATOM   10169 H  H    . ALA A 1 63  ? 5.630   7.560  38.548 1.00 0.00 ? 63  ALA A H    4  
ATOM   10170 H  HA   . ALA A 1 63  ? 5.978   9.702  40.500 1.00 0.00 ? 63  ALA A HA   4  
ATOM   10171 H  HB1  . ALA A 1 63  ? 7.727   8.459  38.336 1.00 0.00 ? 63  ALA A HB1  4  
ATOM   10172 H  HB2  . ALA A 1 63  ? 8.270   9.850  39.269 1.00 0.00 ? 63  ALA A HB2  4  
ATOM   10173 H  HB3  . ALA A 1 63  ? 7.915   8.329  40.081 1.00 0.00 ? 63  ALA A HB3  4  
ATOM   10174 N  N    . TYR A 1 64  ? 5.477   10.369 37.368 1.00 0.00 ? 64  TYR A N    4  
ATOM   10175 C  CA   . TYR A 1 64  ? 5.200   11.490 36.439 1.00 0.00 ? 64  TYR A CA   4  
ATOM   10176 C  C    . TYR A 1 64  ? 3.790   12.037 36.628 1.00 0.00 ? 64  TYR A C    4  
ATOM   10177 O  O    . TYR A 1 64  ? 3.536   13.196 36.367 1.00 0.00 ? 64  TYR A O    4  
ATOM   10178 C  CB   . TYR A 1 64  ? 5.332   10.973 35.000 1.00 0.00 ? 64  TYR A CB   4  
ATOM   10179 C  CG   . TYR A 1 64  ? 5.063   12.123 34.030 1.00 0.00 ? 64  TYR A CG   4  
ATOM   10180 C  CD1  . TYR A 1 64  ? 3.773   12.428 33.645 1.00 0.00 ? 64  TYR A CD1  4  
ATOM   10181 C  CD2  . TYR A 1 64  ? 6.106   12.876 33.531 1.00 0.00 ? 64  TYR A CD2  4  
ATOM   10182 C  CE1  . TYR A 1 64  ? 3.530   13.471 32.774 1.00 0.00 ? 64  TYR A CE1  4  
ATOM   10183 C  CE2  . TYR A 1 64  ? 5.863   13.919 32.661 1.00 0.00 ? 64  TYR A CE2  4  
ATOM   10184 C  CZ   . TYR A 1 64  ? 4.574   14.224 32.275 1.00 0.00 ? 64  TYR A CZ   4  
ATOM   10185 O  OH   . TYR A 1 64  ? 4.332   15.265 31.405 1.00 0.00 ? 64  TYR A OH   4  
ATOM   10186 H  H    . TYR A 1 64  ? 5.341   9.442  37.080 1.00 0.00 ? 64  TYR A H    4  
ATOM   10187 H  HA   . TYR A 1 64  ? 5.915   12.289 36.627 1.00 0.00 ? 64  TYR A HA   4  
ATOM   10188 H  HB2  . TYR A 1 64  ? 6.331   10.594 34.839 1.00 0.00 ? 64  TYR A HB2  4  
ATOM   10189 H  HB3  . TYR A 1 64  ? 4.617   10.183 34.827 1.00 0.00 ? 64  TYR A HB3  4  
ATOM   10190 H  HD1  . TYR A 1 64  ? 2.948   11.847 34.029 1.00 0.00 ? 64  TYR A HD1  4  
ATOM   10191 H  HD2  . TYR A 1 64  ? 7.119   12.649 33.823 1.00 0.00 ? 64  TYR A HD2  4  
ATOM   10192 H  HE1  . TYR A 1 64  ? 2.515   13.701 32.483 1.00 0.00 ? 64  TYR A HE1  4  
ATOM   10193 H  HE2  . TYR A 1 64  ? 6.688   14.502 32.279 1.00 0.00 ? 64  TYR A HE2  4  
ATOM   10194 H  HH   . TYR A 1 64  ? 5.060   15.306 30.782 1.00 0.00 ? 64  TYR A HH   4  
ATOM   10195 N  N    . ALA A 1 65  ? 2.895   11.201 37.079 1.00 0.00 ? 65  ALA A N    4  
ATOM   10196 C  CA   . ALA A 1 65  ? 1.503   11.675 37.282 1.00 0.00 ? 65  ALA A CA   4  
ATOM   10197 C  C    . ALA A 1 65  ? 1.385   12.493 38.559 1.00 0.00 ? 65  ALA A C    4  
ATOM   10198 O  O    . ALA A 1 65  ? 0.454   13.256 38.724 1.00 0.00 ? 65  ALA A O    4  
ATOM   10199 C  CB   . ALA A 1 65  ? 0.587   10.448 37.395 1.00 0.00 ? 65  ALA A CB   4  
ATOM   10200 H  H    . ALA A 1 65  ? 3.139   10.268 37.283 1.00 0.00 ? 65  ALA A H    4  
ATOM   10201 H  HA   . ALA A 1 65  ? 1.213   12.300 36.435 1.00 0.00 ? 65  ALA A HA   4  
ATOM   10202 H  HB1  . ALA A 1 65  ? 0.704   9.824  36.521 1.00 0.00 ? 65  ALA A HB1  4  
ATOM   10203 H  HB2  . ALA A 1 65  ? 0.847   9.879  38.275 1.00 0.00 ? 65  ALA A HB2  4  
ATOM   10204 H  HB3  . ALA A 1 65  ? -0.442  10.768 37.469 1.00 0.00 ? 65  ALA A HB3  4  
ATOM   10205 N  N    . GLN A 1 66  ? 2.327   12.324 39.444 1.00 0.00 ? 66  GLN A N    4  
ATOM   10206 C  CA   . GLN A 1 66  ? 2.273   13.091 40.711 1.00 0.00 ? 66  GLN A CA   4  
ATOM   10207 C  C    . GLN A 1 66  ? 3.013   14.416 40.576 1.00 0.00 ? 66  GLN A C    4  
ATOM   10208 O  O    . GLN A 1 66  ? 2.790   15.336 41.338 1.00 0.00 ? 66  GLN A O    4  
ATOM   10209 C  CB   . GLN A 1 66  ? 2.927   12.251 41.817 1.00 0.00 ? 66  GLN A CB   4  
ATOM   10210 C  CG   . GLN A 1 66  ? 1.964   11.124 42.218 1.00 0.00 ? 66  GLN A CG   4  
ATOM   10211 C  CD   . GLN A 1 66  ? 2.666   10.183 43.201 1.00 0.00 ? 66  GLN A CD   4  
ATOM   10212 O  OE1  . GLN A 1 66  ? 2.271   9.048  43.379 1.00 0.00 ? 66  GLN A OE1  4  
ATOM   10213 N  NE2  . GLN A 1 66  ? 3.710   10.613 43.856 1.00 0.00 ? 66  GLN A NE2  4  
ATOM   10214 H  H    . GLN A 1 66  ? 3.072   11.708 39.267 1.00 0.00 ? 66  GLN A H    4  
ATOM   10215 H  HA   . GLN A 1 66  ? 1.229   13.297 40.952 1.00 0.00 ? 66  GLN A HA   4  
ATOM   10216 H  HB2  . GLN A 1 66  ? 3.851   11.828 41.452 1.00 0.00 ? 66  GLN A HB2  4  
ATOM   10217 H  HB3  . GLN A 1 66  ? 3.135   12.875 42.672 1.00 0.00 ? 66  GLN A HB3  4  
ATOM   10218 H  HG2  . GLN A 1 66  ? 1.086   11.543 42.690 1.00 0.00 ? 66  GLN A HG2  4  
ATOM   10219 H  HG3  . GLN A 1 66  ? 1.665   10.567 41.341 1.00 0.00 ? 66  GLN A HG3  4  
ATOM   10220 H  HE21 . GLN A 1 66  ? 4.034   11.527 43.717 1.00 0.00 ? 66  GLN A HE21 4  
ATOM   10221 H  HE22 . GLN A 1 66  ? 4.169   10.022 44.489 1.00 0.00 ? 66  GLN A HE22 4  
ATOM   10222 N  N    . HIS A 1 67  ? 3.884   14.492 39.605 1.00 0.00 ? 67  HIS A N    4  
ATOM   10223 C  CA   . HIS A 1 67  ? 4.644   15.748 39.407 1.00 0.00 ? 67  HIS A CA   4  
ATOM   10224 C  C    . HIS A 1 67  ? 3.753   16.811 38.774 1.00 0.00 ? 67  HIS A C    4  
ATOM   10225 O  O    . HIS A 1 67  ? 3.865   17.983 39.073 1.00 0.00 ? 67  HIS A O    4  
ATOM   10226 C  CB   . HIS A 1 67  ? 5.819   15.465 38.453 1.00 0.00 ? 67  HIS A CB   4  
ATOM   10227 C  CG   . HIS A 1 67  ? 6.945   14.760 39.213 1.00 0.00 ? 67  HIS A CG   4  
ATOM   10228 N  ND1  . HIS A 1 67  ? 7.315   15.047 40.370 1.00 0.00 ? 67  HIS A ND1  4  
ATOM   10229 C  CD2  . HIS A 1 67  ? 7.767   13.720 38.810 1.00 0.00 ? 67  HIS A CD2  4  
ATOM   10230 C  CE1  . HIS A 1 67  ? 8.277   14.310 40.747 1.00 0.00 ? 67  HIS A CE1  4  
ATOM   10231 N  NE2  . HIS A 1 67  ? 8.637   13.426 39.813 1.00 0.00 ? 67  HIS A NE2  4  
ATOM   10232 H  H    . HIS A 1 67  ? 4.033   13.724 39.015 1.00 0.00 ? 67  HIS A H    4  
ATOM   10233 H  HA   . HIS A 1 67  ? 5.001   16.108 40.373 1.00 0.00 ? 67  HIS A HA   4  
ATOM   10234 H  HB2  . HIS A 1 67  ? 5.487   14.834 37.644 1.00 0.00 ? 67  HIS A HB2  4  
ATOM   10235 H  HB3  . HIS A 1 67  ? 6.192   16.393 38.052 1.00 0.00 ? 67  HIS A HB3  4  
ATOM   10236 H  HD1  . HIS A 1 67  ? 6.912   15.752 40.919 1.00 0.00 ? 67  HIS A HD1  4  
ATOM   10237 H  HD2  . HIS A 1 67  ? 7.716   13.211 37.851 1.00 0.00 ? 67  HIS A HD2  4  
ATOM   10238 H  HE1  . HIS A 1 67  ? 8.751   14.389 41.714 1.00 0.00 ? 67  HIS A HE1  4  
ATOM   10239 N  N    . VAL A 1 68  ? 2.882   16.374 37.905 1.00 0.00 ? 68  VAL A N    4  
ATOM   10240 C  CA   . VAL A 1 68  ? 1.966   17.326 37.230 1.00 0.00 ? 68  VAL A CA   4  
ATOM   10241 C  C    . VAL A 1 68  ? 1.018   17.986 38.231 1.00 0.00 ? 68  VAL A C    4  
ATOM   10242 O  O    . VAL A 1 68  ? 0.309   18.917 37.899 1.00 0.00 ? 68  VAL A O    4  
ATOM   10243 C  CB   . VAL A 1 68  ? 1.141   16.540 36.198 1.00 0.00 ? 68  VAL A CB   4  
ATOM   10244 C  CG1  . VAL A 1 68  ? -0.017  17.411 35.708 1.00 0.00 ? 68  VAL A CG1  4  
ATOM   10245 C  CG2  . VAL A 1 68  ? 2.036   16.183 35.010 1.00 0.00 ? 68  VAL A CG2  4  
ATOM   10246 H  H    . VAL A 1 68  ? 2.832   15.416 37.699 1.00 0.00 ? 68  VAL A H    4  
ATOM   10247 H  HA   . VAL A 1 68  ? 2.556   18.099 36.743 1.00 0.00 ? 68  VAL A HA   4  
ATOM   10248 H  HB   . VAL A 1 68  ? 0.755   15.635 36.649 1.00 0.00 ? 68  VAL A HB   4  
ATOM   10249 H  HG11 . VAL A 1 68  ? 0.324   18.425 35.568 1.00 0.00 ? 68  VAL A HG11 4  
ATOM   10250 H  HG12 . VAL A 1 68  ? -0.388  17.027 34.768 1.00 0.00 ? 68  VAL A HG12 4  
ATOM   10251 H  HG13 . VAL A 1 68  ? -0.814  17.400 36.436 1.00 0.00 ? 68  VAL A HG13 4  
ATOM   10252 H  HG21 . VAL A 1 68  ? 2.947   15.724 35.366 1.00 0.00 ? 68  VAL A HG21 4  
ATOM   10253 H  HG22 . VAL A 1 68  ? 1.521   15.491 34.360 1.00 0.00 ? 68  VAL A HG22 4  
ATOM   10254 H  HG23 . VAL A 1 68  ? 2.280   17.076 34.455 1.00 0.00 ? 68  VAL A HG23 4  
ATOM   10255 N  N    . PHE A 1 69  ? 1.021   17.489 39.437 1.00 0.00 ? 69  PHE A N    4  
ATOM   10256 C  CA   . PHE A 1 69  ? 0.130   18.069 40.475 1.00 0.00 ? 69  PHE A CA   4  
ATOM   10257 C  C    . PHE A 1 69  ? 0.680   19.392 40.990 1.00 0.00 ? 69  PHE A C    4  
ATOM   10258 O  O    . PHE A 1 69  ? 0.234   20.446 40.582 1.00 0.00 ? 69  PHE A O    4  
ATOM   10259 C  CB   . PHE A 1 69  ? 0.045   17.064 41.640 1.00 0.00 ? 69  PHE A CB   4  
ATOM   10260 C  CG   . PHE A 1 69  ? -1.304  17.190 42.348 1.00 0.00 ? 69  PHE A CG   4  
ATOM   10261 C  CD1  . PHE A 1 69  ? -2.469  16.784 41.722 1.00 0.00 ? 69  PHE A CD1  4  
ATOM   10262 C  CD2  . PHE A 1 69  ? -1.373  17.691 43.637 1.00 0.00 ? 69  PHE A CD2  4  
ATOM   10263 C  CE1  . PHE A 1 69  ? -3.681  16.876 42.376 1.00 0.00 ? 69  PHE A CE1  4  
ATOM   10264 C  CE2  . PHE A 1 69  ? -2.585  17.782 44.287 1.00 0.00 ? 69  PHE A CE2  4  
ATOM   10265 C  CZ   . PHE A 1 69  ? -3.738  17.374 43.656 1.00 0.00 ? 69  PHE A CZ   4  
ATOM   10266 H  H    . PHE A 1 69  ? 1.608   16.737 39.657 1.00 0.00 ? 69  PHE A H    4  
ATOM   10267 H  HA   . PHE A 1 69  ? -0.851  18.249 40.040 1.00 0.00 ? 69  PHE A HA   4  
ATOM   10268 H  HB2  . PHE A 1 69  ? 0.152   16.058 41.260 1.00 0.00 ? 69  PHE A HB2  4  
ATOM   10269 H  HB3  . PHE A 1 69  ? 0.835   17.257 42.349 1.00 0.00 ? 69  PHE A HB3  4  
ATOM   10270 H  HD1  . PHE A 1 69  ? -2.428  16.392 40.717 1.00 0.00 ? 69  PHE A HD1  4  
ATOM   10271 H  HD2  . PHE A 1 69  ? -0.471  18.013 44.137 1.00 0.00 ? 69  PHE A HD2  4  
ATOM   10272 H  HE1  . PHE A 1 69  ? -4.586  16.557 41.881 1.00 0.00 ? 69  PHE A HE1  4  
ATOM   10273 H  HE2  . PHE A 1 69  ? -2.630  18.173 45.292 1.00 0.00 ? 69  PHE A HE2  4  
ATOM   10274 H  HZ   . PHE A 1 69  ? -4.687  17.448 44.166 1.00 0.00 ? 69  PHE A HZ   4  
ATOM   10275 N  N    . ARG A 1 70  ? 1.636   19.321 41.879 1.00 0.00 ? 70  ARG A N    4  
ATOM   10276 C  CA   . ARG A 1 70  ? 2.211   20.574 42.417 1.00 0.00 ? 70  ARG A CA   4  
ATOM   10277 C  C    . ARG A 1 70  ? 2.479   21.549 41.279 1.00 0.00 ? 70  ARG A C    4  
ATOM   10278 O  O    . ARG A 1 70  ? 2.521   22.748 41.472 1.00 0.00 ? 70  ARG A O    4  
ATOM   10279 C  CB   . ARG A 1 70  ? 3.541   20.232 43.126 1.00 0.00 ? 70  ARG A CB   4  
ATOM   10280 C  CG   . ARG A 1 70  ? 4.069   21.463 43.879 1.00 0.00 ? 70  ARG A CG   4  
ATOM   10281 C  CD   . ARG A 1 70  ? 3.291   21.642 45.188 1.00 0.00 ? 70  ARG A CD   4  
ATOM   10282 N  NE   . ARG A 1 70  ? 3.400   20.397 45.997 1.00 0.00 ? 70  ARG A NE   4  
ATOM   10283 C  CZ   . ARG A 1 70  ? 2.997   20.407 47.239 1.00 0.00 ? 70  ARG A CZ   4  
ATOM   10284 N  NH1  . ARG A 1 70  ? 1.982   21.159 47.567 1.00 0.00 ? 70  ARG A NH1  4  
ATOM   10285 N  NH2  . ARG A 1 70  ? 3.626   19.670 48.111 1.00 0.00 ? 70  ARG A NH2  4  
ATOM   10286 H  H    . ARG A 1 70  ? 1.971   18.453 42.180 1.00 0.00 ? 70  ARG A H    4  
ATOM   10287 H  HA   . ARG A 1 70  ? 1.501   21.021 43.110 1.00 0.00 ? 70  ARG A HA   4  
ATOM   10288 H  HB2  . ARG A 1 70  ? 3.378   19.425 43.825 1.00 0.00 ? 70  ARG A HB2  4  
ATOM   10289 H  HB3  . ARG A 1 70  ? 4.268   19.919 42.392 1.00 0.00 ? 70  ARG A HB3  4  
ATOM   10290 H  HG2  . ARG A 1 70  ? 5.118   21.324 44.101 1.00 0.00 ? 70  ARG A HG2  4  
ATOM   10291 H  HG3  . ARG A 1 70  ? 3.955   22.340 43.267 1.00 0.00 ? 70  ARG A HG3  4  
ATOM   10292 H  HD2  . ARG A 1 70  ? 3.705   22.467 45.748 1.00 0.00 ? 70  ARG A HD2  4  
ATOM   10293 H  HD3  . ARG A 1 70  ? 2.253   21.841 44.975 1.00 0.00 ? 70  ARG A HD3  4  
ATOM   10294 H  HE   . ARG A 1 70  ? 3.769   19.580 45.602 1.00 0.00 ? 70  ARG A HE   4  
ATOM   10295 H  HH11 . ARG A 1 70  ? 1.526   21.716 46.872 1.00 0.00 ? 70  ARG A HH11 4  
ATOM   10296 H  HH12 . ARG A 1 70  ? 1.660   21.180 48.513 1.00 0.00 ? 70  ARG A HH12 4  
ATOM   10297 H  HH21 . ARG A 1 70  ? 4.403   19.108 47.825 1.00 0.00 ? 70  ARG A HH21 4  
ATOM   10298 H  HH22 . ARG A 1 70  ? 3.332   19.665 49.067 1.00 0.00 ? 70  ARG A HH22 4  
ATOM   10299 N  N    . SER A 1 71  ? 2.638   21.010 40.100 1.00 0.00 ? 71  SER A N    4  
ATOM   10300 C  CA   . SER A 1 71  ? 2.901   21.874 38.938 1.00 0.00 ? 71  SER A CA   4  
ATOM   10301 C  C    . SER A 1 71  ? 1.808   22.918 38.767 1.00 0.00 ? 71  SER A C    4  
ATOM   10302 O  O    . SER A 1 71  ? 2.068   24.001 38.282 1.00 0.00 ? 71  SER A O    4  
ATOM   10303 C  CB   . SER A 1 71  ? 2.933   20.997 37.684 1.00 0.00 ? 71  SER A CB   4  
ATOM   10304 O  OG   . SER A 1 71  ? 3.516   21.830 36.694 1.00 0.00 ? 71  SER A OG   4  
ATOM   10305 H  H    . SER A 1 71  ? 2.589   20.039 39.987 1.00 0.00 ? 71  SER A H    4  
ATOM   10306 H  HA   . SER A 1 71  ? 3.855   22.379 39.080 1.00 0.00 ? 71  SER A HA   4  
ATOM   10307 H  HB2  . SER A 1 71  ? 3.542   20.123 37.844 1.00 0.00 ? 71  SER A HB2  4  
ATOM   10308 H  HB3  . SER A 1 71  ? 1.933   20.712 37.390 1.00 0.00 ? 71  SER A HB3  4  
ATOM   10309 H  HG   . SER A 1 71  ? 3.331   22.742 36.929 1.00 0.00 ? 71  SER A HG   4  
ATOM   10310 N  N    . PHE A 1 72  ? 0.597   22.584 39.163 1.00 0.00 ? 72  PHE A N    4  
ATOM   10311 C  CA   . PHE A 1 72  ? -0.499  23.581 39.009 1.00 0.00 ? 72  PHE A CA   4  
ATOM   10312 C  C    . PHE A 1 72  ? -1.540  23.486 40.128 1.00 0.00 ? 72  PHE A C    4  
ATOM   10313 O  O    . PHE A 1 72  ? -2.350  24.377 40.287 1.00 0.00 ? 72  PHE A O    4  
ATOM   10314 C  CB   . PHE A 1 72  ? -1.182  23.327 37.648 1.00 0.00 ? 72  PHE A CB   4  
ATOM   10315 C  CG   . PHE A 1 72  ? -2.444  22.482 37.837 1.00 0.00 ? 72  PHE A CG   4  
ATOM   10316 C  CD1  . PHE A 1 72  ? -2.414  21.323 38.595 1.00 0.00 ? 72  PHE A CD1  4  
ATOM   10317 C  CD2  . PHE A 1 72  ? -3.633  22.866 37.244 1.00 0.00 ? 72  PHE A CD2  4  
ATOM   10318 C  CE1  . PHE A 1 72  ? -3.558  20.565 38.753 1.00 0.00 ? 72  PHE A CE1  4  
ATOM   10319 C  CE2  . PHE A 1 72  ? -4.769  22.107 37.404 1.00 0.00 ? 72  PHE A CE2  4  
ATOM   10320 C  CZ   . PHE A 1 72  ? -4.734  20.958 38.158 1.00 0.00 ? 72  PHE A CZ   4  
ATOM   10321 H  H    . PHE A 1 72  ? 0.417   21.688 39.546 1.00 0.00 ? 72  PHE A H    4  
ATOM   10322 H  HA   . PHE A 1 72  ? -0.065  24.580 39.031 1.00 0.00 ? 72  PHE A HA   4  
ATOM   10323 H  HB2  . PHE A 1 72  ? -1.454  24.269 37.197 1.00 0.00 ? 72  PHE A HB2  4  
ATOM   10324 H  HB3  . PHE A 1 72  ? -0.502  22.805 36.993 1.00 0.00 ? 72  PHE A HB3  4  
ATOM   10325 H  HD1  . PHE A 1 72  ? -1.493  21.010 39.063 1.00 0.00 ? 72  PHE A HD1  4  
ATOM   10326 H  HD2  . PHE A 1 72  ? -3.669  23.768 36.651 1.00 0.00 ? 72  PHE A HD2  4  
ATOM   10327 H  HE1  . PHE A 1 72  ? -3.528  19.661 39.343 1.00 0.00 ? 72  PHE A HE1  4  
ATOM   10328 H  HE2  . PHE A 1 72  ? -5.690  22.413 36.934 1.00 0.00 ? 72  PHE A HE2  4  
ATOM   10329 H  HZ   . PHE A 1 72  ? -5.628  20.366 38.285 1.00 0.00 ? 72  PHE A HZ   4  
ATOM   10330 N  N    . ASP A 1 73  ? -1.506  22.422 40.887 1.00 0.00 ? 73  ASP A N    4  
ATOM   10331 C  CA   . ASP A 1 73  ? -2.507  22.301 41.985 1.00 0.00 ? 73  ASP A CA   4  
ATOM   10332 C  C    . ASP A 1 73  ? -2.007  22.955 43.256 1.00 0.00 ? 73  ASP A C    4  
ATOM   10333 O  O    . ASP A 1 73  ? -2.465  22.646 44.339 1.00 0.00 ? 73  ASP A O    4  
ATOM   10334 C  CB   . ASP A 1 73  ? -2.767  20.823 42.274 1.00 0.00 ? 73  ASP A CB   4  
ATOM   10335 C  CG   . ASP A 1 73  ? -3.955  20.715 43.235 1.00 0.00 ? 73  ASP A CG   4  
ATOM   10336 O  OD1  . ASP A 1 73  ? -4.923  21.417 42.979 1.00 0.00 ? 73  ASP A OD1  4  
ATOM   10337 O  OD2  . ASP A 1 73  ? -3.828  19.946 44.170 1.00 0.00 ? 73  ASP A OD2  4  
ATOM   10338 H  H    . ASP A 1 73  ? -0.840  21.721 40.739 1.00 0.00 ? 73  ASP A H    4  
ATOM   10339 H  HA   . ASP A 1 73  ? -3.422  22.799 41.677 1.00 0.00 ? 73  ASP A HA   4  
ATOM   10340 H  HB2  . ASP A 1 73  ? -2.997  20.306 41.359 1.00 0.00 ? 73  ASP A HB2  4  
ATOM   10341 H  HB3  . ASP A 1 73  ? -1.896  20.378 42.729 1.00 0.00 ? 73  ASP A HB3  4  
ATOM   10342 N  N    . ALA A 1 74  ? -1.079  23.843 43.104 1.00 0.00 ? 74  ALA A N    4  
ATOM   10343 C  CA   . ALA A 1 74  ? -0.528  24.538 44.287 1.00 0.00 ? 74  ALA A CA   4  
ATOM   10344 C  C    . ALA A 1 74  ? -1.243  25.865 44.493 1.00 0.00 ? 74  ALA A C    4  
ATOM   10345 O  O    . ALA A 1 74  ? -0.797  26.708 45.246 1.00 0.00 ? 74  ALA A O    4  
ATOM   10346 C  CB   . ALA A 1 74  ? 0.964   24.805 44.043 1.00 0.00 ? 74  ALA A CB   4  
ATOM   10347 H  H    . ALA A 1 74  ? -0.748  24.052 42.211 1.00 0.00 ? 74  ALA A H    4  
ATOM   10348 H  HA   . ALA A 1 74  ? -0.673  23.914 45.166 1.00 0.00 ? 74  ALA A HA   4  
ATOM   10349 H  HB1  . ALA A 1 74  ? 1.136   24.981 42.992 1.00 0.00 ? 74  ALA A HB1  4  
ATOM   10350 H  HB2  . ALA A 1 74  ? 1.277   25.672 44.606 1.00 0.00 ? 74  ALA A HB2  4  
ATOM   10351 H  HB3  . ALA A 1 74  ? 1.544   23.948 44.358 1.00 0.00 ? 74  ALA A HB3  4  
ATOM   10352 N  N    . ASN A 1 75  ? -2.350  26.021 43.815 1.00 0.00 ? 75  ASN A N    4  
ATOM   10353 C  CA   . ASN A 1 75  ? -3.122  27.277 43.942 1.00 0.00 ? 75  ASN A CA   4  
ATOM   10354 C  C    . ASN A 1 75  ? -3.958  27.281 45.218 1.00 0.00 ? 75  ASN A C    4  
ATOM   10355 O  O    . ASN A 1 75  ? -5.153  27.493 45.174 1.00 0.00 ? 75  ASN A O    4  
ATOM   10356 C  CB   . ASN A 1 75  ? -4.065  27.379 42.731 1.00 0.00 ? 75  ASN A CB   4  
ATOM   10357 C  CG   . ASN A 1 75  ? -4.744  26.025 42.495 1.00 0.00 ? 75  ASN A CG   4  
ATOM   10358 O  OD1  . ASN A 1 75  ? -5.083  25.314 43.423 1.00 0.00 ? 75  ASN A OD1  4  
ATOM   10359 N  ND2  . ASN A 1 75  ? -4.961  25.632 41.269 1.00 0.00 ? 75  ASN A ND2  4  
ATOM   10360 H  H    . ASN A 1 75  ? -2.668  25.307 43.224 1.00 0.00 ? 75  ASN A H    4  
ATOM   10361 H  HA   . ASN A 1 75  ? -2.432  28.118 43.967 1.00 0.00 ? 75  ASN A HA   4  
ATOM   10362 H  HB2  . ASN A 1 75  ? -4.821  28.127 42.917 1.00 0.00 ? 75  ASN A HB2  4  
ATOM   10363 H  HB3  . ASN A 1 75  ? -3.502  27.651 41.851 1.00 0.00 ? 75  ASN A HB3  4  
ATOM   10364 H  HD21 . ASN A 1 75  ? -4.692  26.200 40.517 1.00 0.00 ? 75  ASN A HD21 4  
ATOM   10365 H  HD22 . ASN A 1 75  ? -5.395  24.768 41.100 1.00 0.00 ? 75  ASN A HD22 4  
ATOM   10366 N  N    . SER A 1 76  ? -3.308  27.048 46.333 1.00 0.00 ? 76  SER A N    4  
ATOM   10367 C  CA   . SER A 1 76  ? -4.046  27.033 47.624 1.00 0.00 ? 76  SER A CA   4  
ATOM   10368 C  C    . SER A 1 76  ? -5.383  26.319 47.475 1.00 0.00 ? 76  SER A C    4  
ATOM   10369 O  O    . SER A 1 76  ? -6.430  26.924 47.598 1.00 0.00 ? 76  SER A O    4  
ATOM   10370 C  CB   . SER A 1 76  ? -4.302  28.486 48.055 1.00 0.00 ? 76  SER A CB   4  
ATOM   10371 O  OG   . SER A 1 76  ? -5.217  28.981 47.090 1.00 0.00 ? 76  SER A OG   4  
ATOM   10372 H  H    . SER A 1 76  ? -2.342  26.884 46.315 1.00 0.00 ? 76  SER A H    4  
ATOM   10373 H  HA   . SER A 1 76  ? -3.446  26.508 48.367 1.00 0.00 ? 76  SER A HA   4  
ATOM   10374 H  HB2  . SER A 1 76  ? -4.743  28.521 49.041 1.00 0.00 ? 76  SER A HB2  4  
ATOM   10375 H  HB3  . SER A 1 76  ? -3.387  29.060 48.031 1.00 0.00 ? 76  SER A HB3  4  
ATOM   10376 H  HG   . SER A 1 76  ? -5.446  29.881 47.332 1.00 0.00 ? 76  SER A HG   4  
ATOM   10377 N  N    . ASP A 1 77  ? -5.322  25.043 47.209 1.00 0.00 ? 77  ASP A N    4  
ATOM   10378 C  CA   . ASP A 1 77  ? -6.576  24.267 47.046 1.00 0.00 ? 77  ASP A CA   4  
ATOM   10379 C  C    . ASP A 1 77  ? -6.416  22.859 47.603 1.00 0.00 ? 77  ASP A C    4  
ATOM   10380 O  O    . ASP A 1 77  ? -7.229  22.399 48.381 1.00 0.00 ? 77  ASP A O    4  
ATOM   10381 C  CB   . ASP A 1 77  ? -6.886  24.173 45.545 1.00 0.00 ? 77  ASP A CB   4  
ATOM   10382 C  CG   . ASP A 1 77  ? -8.245  23.502 45.346 1.00 0.00 ? 77  ASP A CG   4  
ATOM   10383 O  OD1  . ASP A 1 77  ? -8.823  23.135 46.356 1.00 0.00 ? 77  ASP A OD1  4  
ATOM   10384 O  OD2  . ASP A 1 77  ? -8.628  23.392 44.192 1.00 0.00 ? 77  ASP A OD2  4  
ATOM   10385 H  H    . ASP A 1 77  ? -4.453  24.599 47.115 1.00 0.00 ? 77  ASP A H    4  
ATOM   10386 H  HA   . ASP A 1 77  ? -7.381  24.771 47.578 1.00 0.00 ? 77  ASP A HA   4  
ATOM   10387 H  HB2  . ASP A 1 77  ? -6.911  25.163 45.115 1.00 0.00 ? 77  ASP A HB2  4  
ATOM   10388 H  HB3  . ASP A 1 77  ? -6.124  23.589 45.050 1.00 0.00 ? 77  ASP A HB3  4  
ATOM   10389 N  N    . GLY A 1 78  ? -5.366  22.199 47.197 1.00 0.00 ? 78  GLY A N    4  
ATOM   10390 C  CA   . GLY A 1 78  ? -5.134  20.814 47.692 1.00 0.00 ? 78  GLY A CA   4  
ATOM   10391 C  C    . GLY A 1 78  ? -5.854  19.802 46.799 1.00 0.00 ? 78  GLY A C    4  
ATOM   10392 O  O    . GLY A 1 78  ? -5.618  18.613 46.886 1.00 0.00 ? 78  GLY A O    4  
ATOM   10393 H  H    . GLY A 1 78  ? -4.736  22.611 46.569 1.00 0.00 ? 78  GLY A H    4  
ATOM   10394 H  HA2  . GLY A 1 78  ? -4.074  20.606 47.685 1.00 0.00 ? 78  GLY A HA2  4  
ATOM   10395 H  HA3  . GLY A 1 78  ? -5.507  20.730 48.702 1.00 0.00 ? 78  GLY A HA3  4  
ATOM   10396 N  N    . THR A 1 79  ? -6.721  20.299 45.959 1.00 0.00 ? 79  THR A N    4  
ATOM   10397 C  CA   . THR A 1 79  ? -7.468  19.391 45.053 1.00 0.00 ? 79  THR A CA   4  
ATOM   10398 C  C    . THR A 1 79  ? -7.705  20.053 43.706 1.00 0.00 ? 79  THR A C    4  
ATOM   10399 O  O    . THR A 1 79  ? -7.636  21.260 43.585 1.00 0.00 ? 79  THR A O    4  
ATOM   10400 C  CB   . THR A 1 79  ? -8.829  19.083 45.683 1.00 0.00 ? 79  THR A CB   4  
ATOM   10401 O  OG1  . THR A 1 79  ? -9.344  20.335 46.087 1.00 0.00 ? 79  THR A OG1  4  
ATOM   10402 C  CG2  . THR A 1 79  ? -8.668  18.293 46.989 1.00 0.00 ? 79  THR A CG2  4  
ATOM   10403 H  H    . THR A 1 79  ? -6.878  21.267 45.927 1.00 0.00 ? 79  THR A H    4  
ATOM   10404 H  HA   . THR A 1 79  ? -6.892  18.479 44.905 1.00 0.00 ? 79  THR A HA   4  
ATOM   10405 H  HB   . THR A 1 79  ? -9.499  18.599 44.977 1.00 0.00 ? 79  THR A HB   4  
ATOM   10406 H  HG1  . THR A 1 79  ? -10.071 20.560 45.501 1.00 0.00 ? 79  THR A HG1  4  
ATOM   10407 H  HG21 . THR A 1 79  ? -7.944  18.782 47.623 1.00 0.00 ? 79  THR A HG21 4  
ATOM   10408 H  HG22 . THR A 1 79  ? -9.617  18.245 47.505 1.00 0.00 ? 79  THR A HG22 4  
ATOM   10409 H  HG23 . THR A 1 79  ? -8.332  17.291 46.770 1.00 0.00 ? 79  THR A HG23 4  
ATOM   10410 N  N    . LEU A 1 80  ? -7.978  19.256 42.712 1.00 0.00 ? 80  LEU A N    4  
ATOM   10411 C  CA   . LEU A 1 80  ? -8.222  19.835 41.372 1.00 0.00 ? 80  LEU A CA   4  
ATOM   10412 C  C    . LEU A 1 80  ? -9.690  20.198 41.208 1.00 0.00 ? 80  LEU A C    4  
ATOM   10413 O  O    . LEU A 1 80  ? -10.500 19.927 42.072 1.00 0.00 ? 80  LEU A O    4  
ATOM   10414 C  CB   . LEU A 1 80  ? -7.844  18.796 40.307 1.00 0.00 ? 80  LEU A CB   4  
ATOM   10415 C  CG   . LEU A 1 80  ? -6.541  18.109 40.715 1.00 0.00 ? 80  LEU A CG   4  
ATOM   10416 C  CD1  . LEU A 1 80  ? -5.971  17.356 39.510 1.00 0.00 ? 80  LEU A CD1  4  
ATOM   10417 C  CD2  . LEU A 1 80  ? -5.540  19.170 41.169 1.00 0.00 ? 80  LEU A CD2  4  
ATOM   10418 H  H    . LEU A 1 80  ? -8.017  18.285 42.849 1.00 0.00 ? 80  LEU A H    4  
ATOM   10419 H  HA   . LEU A 1 80  ? -7.622  20.738 41.263 1.00 0.00 ? 80  LEU A HA   4  
ATOM   10420 H  HB2  . LEU A 1 80  ? -8.631  18.063 40.219 1.00 0.00 ? 80  LEU A HB2  4  
ATOM   10421 H  HB3  . LEU A 1 80  ? -7.711  19.286 39.354 1.00 0.00 ? 80  LEU A HB3  4  
ATOM   10422 H  HG   . LEU A 1 80  ? -6.729  17.419 41.522 1.00 0.00 ? 80  LEU A HG   4  
ATOM   10423 H  HD11 . LEU A 1 80  ? -6.103  17.948 38.615 1.00 0.00 ? 80  LEU A HD11 4  
ATOM   10424 H  HD12 . LEU A 1 80  ? -4.919  17.168 39.661 1.00 0.00 ? 80  LEU A HD12 4  
ATOM   10425 H  HD13 . LEU A 1 80  ? -6.486  16.415 39.391 1.00 0.00 ? 80  LEU A HD13 4  
ATOM   10426 H  HD21 . LEU A 1 80  ? -5.617  20.041 40.534 1.00 0.00 ? 80  LEU A HD21 4  
ATOM   10427 H  HD22 . LEU A 1 80  ? -5.751  19.454 42.188 1.00 0.00 ? 80  LEU A HD22 4  
ATOM   10428 H  HD23 . LEU A 1 80  ? -4.539  18.776 41.111 1.00 0.00 ? 80  LEU A HD23 4  
ATOM   10429 N  N    . ASP A 1 81  ? -10.006 20.801 40.099 1.00 0.00 ? 81  ASP A N    4  
ATOM   10430 C  CA   . ASP A 1 81  ? -11.414 21.190 39.856 1.00 0.00 ? 81  ASP A CA   4  
ATOM   10431 C  C    . ASP A 1 81  ? -11.748 21.098 38.373 1.00 0.00 ? 81  ASP A C    4  
ATOM   10432 O  O    . ASP A 1 81  ? -10.868 21.092 37.535 1.00 0.00 ? 81  ASP A O    4  
ATOM   10433 C  CB   . ASP A 1 81  ? -11.608 22.641 40.323 1.00 0.00 ? 81  ASP A CB   4  
ATOM   10434 C  CG   . ASP A 1 81  ? -11.038 23.593 39.272 1.00 0.00 ? 81  ASP A CG   4  
ATOM   10435 O  OD1  . ASP A 1 81  ? -11.600 23.601 38.188 1.00 0.00 ? 81  ASP A OD1  4  
ATOM   10436 O  OD2  . ASP A 1 81  ? -10.076 24.258 39.611 1.00 0.00 ? 81  ASP A OD2  4  
ATOM   10437 H  H    . ASP A 1 81  ? -9.318  20.991 39.430 1.00 0.00 ? 81  ASP A H    4  
ATOM   10438 H  HA   . ASP A 1 81  ? -12.069 20.515 40.409 1.00 0.00 ? 81  ASP A HA   4  
ATOM   10439 H  HB2  . ASP A 1 81  ? -12.659 22.846 40.457 1.00 0.00 ? 81  ASP A HB2  4  
ATOM   10440 H  HB3  . ASP A 1 81  ? -11.092 22.796 41.260 1.00 0.00 ? 81  ASP A HB3  4  
ATOM   10441 N  N    . PHE A 1 82  ? -13.012 21.030 38.077 1.00 0.00 ? 82  PHE A N    4  
ATOM   10442 C  CA   . PHE A 1 82  ? -13.429 20.937 36.657 1.00 0.00 ? 82  PHE A CA   4  
ATOM   10443 C  C    . PHE A 1 82  ? -12.620 21.881 35.760 1.00 0.00 ? 82  PHE A C    4  
ATOM   10444 O  O    . PHE A 1 82  ? -12.053 21.456 34.774 1.00 0.00 ? 82  PHE A O    4  
ATOM   10445 C  CB   . PHE A 1 82  ? -14.917 21.301 36.565 1.00 0.00 ? 82  PHE A CB   4  
ATOM   10446 C  CG   . PHE A 1 82  ? -15.081 22.820 36.582 1.00 0.00 ? 82  PHE A CG   4  
ATOM   10447 C  CD1  . PHE A 1 82  ? -15.049 23.539 35.404 1.00 0.00 ? 82  PHE A CD1  4  
ATOM   10448 C  CD2  . PHE A 1 82  ? -15.292 23.490 37.770 1.00 0.00 ? 82  PHE A CD2  4  
ATOM   10449 C  CE1  . PHE A 1 82  ? -15.231 24.902 35.413 1.00 0.00 ? 82  PHE A CE1  4  
ATOM   10450 C  CE2  . PHE A 1 82  ? -15.472 24.856 37.775 1.00 0.00 ? 82  PHE A CE2  4  
ATOM   10451 C  CZ   . PHE A 1 82  ? -15.441 25.560 36.599 1.00 0.00 ? 82  PHE A CZ   4  
ATOM   10452 H  H    . PHE A 1 82  ? -13.687 21.037 38.788 1.00 0.00 ? 82  PHE A H    4  
ATOM   10453 H  HA   . PHE A 1 82  ? -13.268 19.914 36.315 1.00 0.00 ? 82  PHE A HA   4  
ATOM   10454 H  HB2  . PHE A 1 82  ? -15.332 20.909 35.649 1.00 0.00 ? 82  PHE A HB2  4  
ATOM   10455 H  HB3  . PHE A 1 82  ? -15.448 20.878 37.406 1.00 0.00 ? 82  PHE A HB3  4  
ATOM   10456 H  HD1  . PHE A 1 82  ? -14.873 23.031 34.474 1.00 0.00 ? 82  PHE A HD1  4  
ATOM   10457 H  HD2  . PHE A 1 82  ? -15.316 22.941 38.697 1.00 0.00 ? 82  PHE A HD2  4  
ATOM   10458 H  HE1  . PHE A 1 82  ? -15.199 25.457 34.485 1.00 0.00 ? 82  PHE A HE1  4  
ATOM   10459 H  HE2  . PHE A 1 82  ? -15.630 25.373 38.703 1.00 0.00 ? 82  PHE A HE2  4  
ATOM   10460 H  HZ   . PHE A 1 82  ? -15.582 26.630 36.607 1.00 0.00 ? 82  PHE A HZ   4  
ATOM   10461 N  N    . LYS A 1 83  ? -12.577 23.146 36.110 1.00 0.00 ? 83  LYS A N    4  
ATOM   10462 C  CA   . LYS A 1 83  ? -11.801 24.097 35.262 1.00 0.00 ? 83  LYS A CA   4  
ATOM   10463 C  C    . LYS A 1 83  ? -10.309 23.789 35.322 1.00 0.00 ? 83  LYS A C    4  
ATOM   10464 O  O    . LYS A 1 83  ? -9.556  24.193 34.460 1.00 0.00 ? 83  LYS A O    4  
ATOM   10465 C  CB   . LYS A 1 83  ? -12.044 25.533 35.761 1.00 0.00 ? 83  LYS A CB   4  
ATOM   10466 C  CG   . LYS A 1 83  ? -11.080 26.489 35.053 1.00 0.00 ? 83  LYS A CG   4  
ATOM   10467 C  CD   . LYS A 1 83  ? -11.462 27.930 35.398 1.00 0.00 ? 83  LYS A CD   4  
ATOM   10468 C  CE   . LYS A 1 83  ? -10.832 28.876 34.375 1.00 0.00 ? 83  LYS A CE   4  
ATOM   10469 N  NZ   . LYS A 1 83  ? -11.390 30.247 34.524 1.00 0.00 ? 83  LYS A NZ   4  
ATOM   10470 H  H    . LYS A 1 83  ? -13.045 23.460 36.911 1.00 0.00 ? 83  LYS A H    4  
ATOM   10471 H  HA   . LYS A 1 83  ? -12.132 23.990 34.235 1.00 0.00 ? 83  LYS A HA   4  
ATOM   10472 H  HB2  . LYS A 1 83  ? -13.054 25.825 35.540 1.00 0.00 ? 83  LYS A HB2  4  
ATOM   10473 H  HB3  . LYS A 1 83  ? -11.890 25.579 36.825 1.00 0.00 ? 83  LYS A HB3  4  
ATOM   10474 H  HG2  . LYS A 1 83  ? -10.072 26.294 35.376 1.00 0.00 ? 83  LYS A HG2  4  
ATOM   10475 H  HG3  . LYS A 1 83  ? -11.146 26.342 33.982 1.00 0.00 ? 83  LYS A HG3  4  
ATOM   10476 H  HD2  . LYS A 1 83  ? -12.536 28.036 35.375 1.00 0.00 ? 83  LYS A HD2  4  
ATOM   10477 H  HD3  . LYS A 1 83  ? -11.103 28.173 36.386 1.00 0.00 ? 83  LYS A HD3  4  
ATOM   10478 H  HE2  . LYS A 1 83  ? -9.763  28.912 34.525 1.00 0.00 ? 83  LYS A HE2  4  
ATOM   10479 H  HE3  . LYS A 1 83  ? -11.036 28.518 33.376 1.00 0.00 ? 83  LYS A HE3  4  
ATOM   10480 H  HZ1  . LYS A 1 83  ? -12.359 30.186 34.895 1.00 0.00 ? 83  LYS A HZ1  4  
ATOM   10481 H  HZ2  . LYS A 1 83  ? -10.800 30.791 35.183 1.00 0.00 ? 83  LYS A HZ2  4  
ATOM   10482 H  HZ3  . LYS A 1 83  ? -11.402 30.718 33.598 1.00 0.00 ? 83  LYS A HZ3  4  
ATOM   10483 N  N    . GLU A 1 84  ? -9.907  23.081 36.340 1.00 0.00 ? 84  GLU A N    4  
ATOM   10484 C  CA   . GLU A 1 84  ? -8.467  22.738 36.465 1.00 0.00 ? 84  GLU A CA   4  
ATOM   10485 C  C    . GLU A 1 84  ? -8.177  21.422 35.746 1.00 0.00 ? 84  GLU A C    4  
ATOM   10486 O  O    . GLU A 1 84  ? -7.122  21.241 35.169 1.00 0.00 ? 84  GLU A O    4  
ATOM   10487 C  CB   . GLU A 1 84  ? -8.136  22.574 37.958 1.00 0.00 ? 84  GLU A CB   4  
ATOM   10488 C  CG   . GLU A 1 84  ? -7.523  23.874 38.492 1.00 0.00 ? 84  GLU A CG   4  
ATOM   10489 C  CD   . GLU A 1 84  ? -7.185  23.700 39.977 1.00 0.00 ? 84  GLU A CD   4  
ATOM   10490 O  OE1  . GLU A 1 84  ? -8.074  23.962 40.769 1.00 0.00 ? 84  GLU A OE1  4  
ATOM   10491 O  OE2  . GLU A 1 84  ? -6.056  23.315 40.234 1.00 0.00 ? 84  GLU A OE2  4  
ATOM   10492 H  H    . GLU A 1 84  ? -10.547 22.779 37.016 1.00 0.00 ? 84  GLU A H    4  
ATOM   10493 H  HA   . GLU A 1 84  ? -7.869  23.532 36.015 1.00 0.00 ? 84  GLU A HA   4  
ATOM   10494 H  HB2  . GLU A 1 84  ? -9.037  22.352 38.503 1.00 0.00 ? 84  GLU A HB2  4  
ATOM   10495 H  HB3  . GLU A 1 84  ? -7.435  21.763 38.087 1.00 0.00 ? 84  GLU A HB3  4  
ATOM   10496 H  HG2  . GLU A 1 84  ? -6.623  24.107 37.946 1.00 0.00 ? 84  GLU A HG2  4  
ATOM   10497 H  HG3  . GLU A 1 84  ? -8.228  24.684 38.378 1.00 0.00 ? 84  GLU A HG3  4  
ATOM   10498 N  N    . TYR A 1 85  ? -9.130  20.527 35.797 1.00 0.00 ? 85  TYR A N    4  
ATOM   10499 C  CA   . TYR A 1 85  ? -8.948  19.213 35.128 1.00 0.00 ? 85  TYR A CA   4  
ATOM   10500 C  C    . TYR A 1 85  ? -8.818  19.401 33.620 1.00 0.00 ? 85  TYR A C    4  
ATOM   10501 O  O    . TYR A 1 85  ? -7.963  18.812 32.986 1.00 0.00 ? 85  TYR A O    4  
ATOM   10502 C  CB   . TYR A 1 85  ? -10.197 18.358 35.430 1.00 0.00 ? 85  TYR A CB   4  
ATOM   10503 C  CG   . TYR A 1 85  ? -9.960  16.903 35.017 1.00 0.00 ? 85  TYR A CG   4  
ATOM   10504 C  CD1  . TYR A 1 85  ? -9.141  16.085 35.767 1.00 0.00 ? 85  TYR A CD1  4  
ATOM   10505 C  CD2  . TYR A 1 85  ? -10.597 16.378 33.909 1.00 0.00 ? 85  TYR A CD2  4  
ATOM   10506 C  CE1  . TYR A 1 85  ? -8.962  14.762 35.416 1.00 0.00 ? 85  TYR A CE1  4  
ATOM   10507 C  CE2  . TYR A 1 85  ? -10.417 15.055 33.558 1.00 0.00 ? 85  TYR A CE2  4  
ATOM   10508 C  CZ   . TYR A 1 85  ? -9.599  14.237 34.310 1.00 0.00 ? 85  TYR A CZ   4  
ATOM   10509 O  OH   . TYR A 1 85  ? -9.422  12.913 33.962 1.00 0.00 ? 85  TYR A OH   4  
ATOM   10510 H  H    . TYR A 1 85  ? -9.961  20.723 36.277 1.00 0.00 ? 85  TYR A H    4  
ATOM   10511 H  HA   . TYR A 1 85  ? -8.044  18.741 35.507 1.00 0.00 ? 85  TYR A HA   4  
ATOM   10512 H  HB2  . TYR A 1 85  ? -10.412 18.393 36.488 1.00 0.00 ? 85  TYR A HB2  4  
ATOM   10513 H  HB3  . TYR A 1 85  ? -11.044 18.747 34.885 1.00 0.00 ? 85  TYR A HB3  4  
ATOM   10514 H  HD1  . TYR A 1 85  ? -8.635  16.482 36.635 1.00 0.00 ? 85  TYR A HD1  4  
ATOM   10515 H  HD2  . TYR A 1 85  ? -11.239 17.008 33.311 1.00 0.00 ? 85  TYR A HD2  4  
ATOM   10516 H  HE1  . TYR A 1 85  ? -8.318  14.133 36.012 1.00 0.00 ? 85  TYR A HE1  4  
ATOM   10517 H  HE2  . TYR A 1 85  ? -10.921 14.657 32.689 1.00 0.00 ? 85  TYR A HE2  4  
ATOM   10518 H  HH   . TYR A 1 85  ? -9.012  12.887 33.095 1.00 0.00 ? 85  TYR A HH   4  
ATOM   10519 N  N    . VAL A 1 86  ? -9.671  20.224 33.075 1.00 0.00 ? 86  VAL A N    4  
ATOM   10520 C  CA   . VAL A 1 86  ? -9.622  20.474 31.613 1.00 0.00 ? 86  VAL A CA   4  
ATOM   10521 C  C    . VAL A 1 86  ? -8.229  20.949 31.190 1.00 0.00 ? 86  VAL A C    4  
ATOM   10522 O  O    . VAL A 1 86  ? -7.812  20.735 30.071 1.00 0.00 ? 86  VAL A O    4  
ATOM   10523 C  CB   . VAL A 1 86  ? -10.653 21.563 31.273 1.00 0.00 ? 86  VAL A CB   4  
ATOM   10524 C  CG1  . VAL A 1 86  ? -10.525 22.714 32.268 1.00 0.00 ? 86  VAL A CG1  4  
ATOM   10525 C  CG2  . VAL A 1 86  ? -10.393 22.082 29.857 1.00 0.00 ? 86  VAL A CG2  4  
ATOM   10526 H  H    . VAL A 1 86  ? -10.341 20.675 33.629 1.00 0.00 ? 86  VAL A H    4  
ATOM   10527 H  HA   . VAL A 1 86  ? -9.855  19.555 31.090 1.00 0.00 ? 86  VAL A HA   4  
ATOM   10528 H  HB   . VAL A 1 86  ? -11.648 21.148 31.329 1.00 0.00 ? 86  VAL A HB   4  
ATOM   10529 H  HG11 . VAL A 1 86  ? -10.329 22.327 33.254 1.00 0.00 ? 86  VAL A HG11 4  
ATOM   10530 H  HG12 . VAL A 1 86  ? -9.715  23.362 31.973 1.00 0.00 ? 86  VAL A HG12 4  
ATOM   10531 H  HG13 . VAL A 1 86  ? -11.440 23.277 32.288 1.00 0.00 ? 86  VAL A HG13 4  
ATOM   10532 H  HG21 . VAL A 1 86  ? -10.298 21.248 29.175 1.00 0.00 ? 86  VAL A HG21 4  
ATOM   10533 H  HG22 . VAL A 1 86  ? -11.216 22.705 29.541 1.00 0.00 ? 86  VAL A HG22 4  
ATOM   10534 H  HG23 . VAL A 1 86  ? -9.482  22.660 29.840 1.00 0.00 ? 86  VAL A HG23 4  
ATOM   10535 N  N    . ILE A 1 87  ? -7.532  21.583 32.101 1.00 0.00 ? 87  ILE A N    4  
ATOM   10536 C  CA   . ILE A 1 87  ? -6.162  22.082 31.775 1.00 0.00 ? 87  ILE A CA   4  
ATOM   10537 C  C    . ILE A 1 87  ? -5.156  20.937 31.734 1.00 0.00 ? 87  ILE A C    4  
ATOM   10538 O  O    . ILE A 1 87  ? -4.554  20.673 30.714 1.00 0.00 ? 87  ILE A O    4  
ATOM   10539 C  CB   . ILE A 1 87  ? -5.737  23.061 32.869 1.00 0.00 ? 87  ILE A CB   4  
ATOM   10540 C  CG1  . ILE A 1 87  ? -6.824  24.109 33.075 1.00 0.00 ? 87  ILE A CG1  4  
ATOM   10541 C  CG2  . ILE A 1 87  ? -4.444  23.767 32.423 1.00 0.00 ? 87  ILE A CG2  4  
ATOM   10542 C  CD1  . ILE A 1 87  ? -6.702  25.195 32.000 1.00 0.00 ? 87  ILE A CD1  4  
ATOM   10543 H  H    . ILE A 1 87  ? -7.911  21.731 32.994 1.00 0.00 ? 87  ILE A H    4  
ATOM   10544 H  HA   . ILE A 1 87  ? -6.175  22.577 30.798 1.00 0.00 ? 87  ILE A HA   4  
ATOM   10545 H  HB   . ILE A 1 87  ? -5.581  22.514 33.802 1.00 0.00 ? 87  ILE A HB   4  
ATOM   10546 H  HG12 . ILE A 1 87  ? -7.792  23.639 33.003 1.00 0.00 ? 87  ILE A HG12 4  
ATOM   10547 H  HG13 . ILE A 1 87  ? -6.719  24.552 34.053 1.00 0.00 ? 87  ILE A HG13 4  
ATOM   10548 H  HG21 . ILE A 1 87  ? -4.563  24.146 31.419 1.00 0.00 ? 87  ILE A HG21 4  
ATOM   10549 H  HG22 . ILE A 1 87  ? -4.225  24.586 33.090 1.00 0.00 ? 87  ILE A HG22 4  
ATOM   10550 H  HG23 . ILE A 1 87  ? -3.621  23.067 32.441 1.00 0.00 ? 87  ILE A HG23 4  
ATOM   10551 H  HD11 . ILE A 1 87  ? -6.644  24.737 31.023 1.00 0.00 ? 87  ILE A HD11 4  
ATOM   10552 H  HD12 . ILE A 1 87  ? -7.566  25.842 32.039 1.00 0.00 ? 87  ILE A HD12 4  
ATOM   10553 H  HD13 . ILE A 1 87  ? -5.813  25.782 32.173 1.00 0.00 ? 87  ILE A HD13 4  
ATOM   10554 N  N    . ALA A 1 88  ? -4.998  20.268 32.844 1.00 0.00 ? 88  ALA A N    4  
ATOM   10555 C  CA   . ALA A 1 88  ? -4.033  19.140 32.884 1.00 0.00 ? 88  ALA A CA   4  
ATOM   10556 C  C    . ALA A 1 88  ? -4.314  18.117 31.782 1.00 0.00 ? 88  ALA A C    4  
ATOM   10557 O  O    . ALA A 1 88  ? -3.425  17.732 31.045 1.00 0.00 ? 88  ALA A O    4  
ATOM   10558 C  CB   . ALA A 1 88  ? -4.163  18.443 34.246 1.00 0.00 ? 88  ALA A CB   4  
ATOM   10559 H  H    . ALA A 1 88  ? -5.521  20.503 33.647 1.00 0.00 ? 88  ALA A H    4  
ATOM   10560 H  HA   . ALA A 1 88  ? -3.027  19.534 32.750 1.00 0.00 ? 88  ALA A HA   4  
ATOM   10561 H  HB1  . ALA A 1 88  ? -5.183  18.123 34.395 1.00 0.00 ? 88  ALA A HB1  4  
ATOM   10562 H  HB2  . ALA A 1 88  ? -3.512  17.582 34.278 1.00 0.00 ? 88  ALA A HB2  4  
ATOM   10563 H  HB3  . ALA A 1 88  ? -3.887  19.127 35.034 1.00 0.00 ? 88  ALA A HB3  4  
ATOM   10564 N  N    . LEU A 1 89  ? -5.544  17.701 31.685 1.00 0.00 ? 89  LEU A N    4  
ATOM   10565 C  CA   . LEU A 1 89  ? -5.898  16.705 30.642 1.00 0.00 ? 89  LEU A CA   4  
ATOM   10566 C  C    . LEU A 1 89  ? -5.514  17.189 29.243 1.00 0.00 ? 89  LEU A C    4  
ATOM   10567 O  O    . LEU A 1 89  ? -4.773  16.529 28.541 1.00 0.00 ? 89  LEU A O    4  
ATOM   10568 C  CB   . LEU A 1 89  ? -7.408  16.467 30.691 1.00 0.00 ? 89  LEU A CB   4  
ATOM   10569 C  CG   . LEU A 1 89  ? -7.686  15.196 31.507 1.00 0.00 ? 89  LEU A CG   4  
ATOM   10570 C  CD1  . LEU A 1 89  ? -7.386  13.960 30.652 1.00 0.00 ? 89  LEU A CD1  4  
ATOM   10571 C  CD2  . LEU A 1 89  ? -6.793  15.177 32.754 1.00 0.00 ? 89  LEU A CD2  4  
ATOM   10572 H  H    . LEU A 1 89  ? -6.229  18.040 32.295 1.00 0.00 ? 89  LEU A H    4  
ATOM   10573 H  HA   . LEU A 1 89  ? -5.366  15.785 30.849 1.00 0.00 ? 89  LEU A HA   4  
ATOM   10574 H  HB2  . LEU A 1 89  ? -7.896  17.311 31.156 1.00 0.00 ? 89  LEU A HB2  4  
ATOM   10575 H  HB3  . LEU A 1 89  ? -7.791  16.345 29.689 1.00 0.00 ? 89  LEU A HB3  4  
ATOM   10576 H  HG   . LEU A 1 89  ? -8.711  15.183 31.804 1.00 0.00 ? 89  LEU A HG   4  
ATOM   10577 H  HD11 . LEU A 1 89  ? -7.860  14.060 29.687 1.00 0.00 ? 89  LEU A HD11 4  
ATOM   10578 H  HD12 . LEU A 1 89  ? -6.321  13.859 30.517 1.00 0.00 ? 89  LEU A HD12 4  
ATOM   10579 H  HD13 . LEU A 1 89  ? -7.765  13.076 31.144 1.00 0.00 ? 89  LEU A HD13 4  
ATOM   10580 H  HD21 . LEU A 1 89  ? -6.491  16.180 33.002 1.00 0.00 ? 89  LEU A HD21 4  
ATOM   10581 H  HD22 . LEU A 1 89  ? -7.336  14.758 33.584 1.00 0.00 ? 89  LEU A HD22 4  
ATOM   10582 H  HD23 . LEU A 1 89  ? -5.916  14.576 32.567 1.00 0.00 ? 89  LEU A HD23 4  
ATOM   10583 N  N    . HIS A 1 90  ? -6.021  18.331 28.858 1.00 0.00 ? 90  HIS A N    4  
ATOM   10584 C  CA   . HIS A 1 90  ? -5.685  18.855 27.509 1.00 0.00 ? 90  HIS A CA   4  
ATOM   10585 C  C    . HIS A 1 90  ? -4.198  19.191 27.403 1.00 0.00 ? 90  HIS A C    4  
ATOM   10586 O  O    . HIS A 1 90  ? -3.584  18.970 26.377 1.00 0.00 ? 90  HIS A O    4  
ATOM   10587 C  CB   . HIS A 1 90  ? -6.523  20.129 27.253 1.00 0.00 ? 90  HIS A CB   4  
ATOM   10588 C  CG   . HIS A 1 90  ? -5.717  21.375 27.641 1.00 0.00 ? 90  HIS A CG   4  
ATOM   10589 N  ND1  . HIS A 1 90  ? -6.051  22.196 28.521 1.00 0.00 ? 90  HIS A ND1  4  
ATOM   10590 C  CD2  . HIS A 1 90  ? -4.526  21.852 27.127 1.00 0.00 ? 90  HIS A CD2  4  
ATOM   10591 C  CE1  . HIS A 1 90  ? -5.208  23.138 28.624 1.00 0.00 ? 90  HIS A CE1  4  
ATOM   10592 N  NE2  . HIS A 1 90  ? -4.192  23.005 27.771 1.00 0.00 ? 90  HIS A NE2  4  
ATOM   10593 H  H    . HIS A 1 90  ? -6.617  18.836 29.452 1.00 0.00 ? 90  HIS A H    4  
ATOM   10594 H  HA   . HIS A 1 90  ? -5.921  18.086 26.770 1.00 0.00 ? 90  HIS A HA   4  
ATOM   10595 H  HB2  . HIS A 1 90  ? -6.784  20.188 26.207 1.00 0.00 ? 90  HIS A HB2  4  
ATOM   10596 H  HB3  . HIS A 1 90  ? -7.427  20.093 27.841 1.00 0.00 ? 90  HIS A HB3  4  
ATOM   10597 H  HD1  . HIS A 1 90  ? -6.864  22.120 29.065 1.00 0.00 ? 90  HIS A HD1  4  
ATOM   10598 H  HD2  . HIS A 1 90  ? -3.951  21.386 26.340 1.00 0.00 ? 90  HIS A HD2  4  
ATOM   10599 H  HE1  . HIS A 1 90  ? -5.305  23.957 29.320 1.00 0.00 ? 90  HIS A HE1  4  
ATOM   10600 N  N    . MET A 1 91  ? -3.644  19.718 28.461 1.00 0.00 ? 91  MET A N    4  
ATOM   10601 C  CA   . MET A 1 91  ? -2.201  20.068 28.424 1.00 0.00 ? 91  MET A CA   4  
ATOM   10602 C  C    . MET A 1 91  ? -1.388  18.913 27.851 1.00 0.00 ? 91  MET A C    4  
ATOM   10603 O  O    . MET A 1 91  ? -0.490  19.116 27.058 1.00 0.00 ? 91  MET A O    4  
ATOM   10604 C  CB   . MET A 1 91  ? -1.725  20.340 29.862 1.00 0.00 ? 91  MET A CB   4  
ATOM   10605 C  CG   . MET A 1 91  ? -1.841  21.840 30.159 1.00 0.00 ? 91  MET A CG   4  
ATOM   10606 S  SD   . MET A 1 91  ? -0.796  22.965 29.205 1.00 0.00 ? 91  MET A SD   4  
ATOM   10607 C  CE   . MET A 1 91  ? -1.607  24.504 29.711 1.00 0.00 ? 91  MET A CE   4  
ATOM   10608 H  H    . MET A 1 91  ? -4.173  19.880 29.270 1.00 0.00 ? 91  MET A H    4  
ATOM   10609 H  HA   . MET A 1 91  ? -2.064  20.947 27.795 1.00 0.00 ? 91  MET A HA   4  
ATOM   10610 H  HB2  . MET A 1 91  ? -2.336  19.784 30.556 1.00 0.00 ? 91  MET A HB2  4  
ATOM   10611 H  HB3  . MET A 1 91  ? -0.697  20.029 29.968 1.00 0.00 ? 91  MET A HB3  4  
ATOM   10612 H  HG2  . MET A 1 91  ? -2.865  22.135 30.000 1.00 0.00 ? 91  MET A HG2  4  
ATOM   10613 H  HG3  . MET A 1 91  ? -1.616  21.992 31.204 1.00 0.00 ? 91  MET A HG3  4  
ATOM   10614 H  HE1  . MET A 1 91  ? -2.672  24.418 29.552 1.00 0.00 ? 91  MET A HE1  4  
ATOM   10615 H  HE2  . MET A 1 91  ? -1.414  24.685 30.759 1.00 0.00 ? 91  MET A HE2  4  
ATOM   10616 H  HE3  . MET A 1 91  ? -1.221  25.325 29.126 1.00 0.00 ? 91  MET A HE3  4  
ATOM   10617 N  N    . THR A 1 92  ? -1.718  17.720 28.266 1.00 0.00 ? 92  THR A N    4  
ATOM   10618 C  CA   . THR A 1 92  ? -0.978  16.541 27.757 1.00 0.00 ? 92  THR A CA   4  
ATOM   10619 C  C    . THR A 1 92  ? -1.226  16.341 26.265 1.00 0.00 ? 92  THR A C    4  
ATOM   10620 O  O    . THR A 1 92  ? -0.959  15.285 25.727 1.00 0.00 ? 92  THR A O    4  
ATOM   10621 C  CB   . THR A 1 92  ? -1.470  15.299 28.503 1.00 0.00 ? 92  THR A CB   4  
ATOM   10622 O  OG1  . THR A 1 92  ? -1.658  15.715 29.840 1.00 0.00 ? 92  THR A OG1  4  
ATOM   10623 C  CG2  . THR A 1 92  ? -0.366  14.235 28.579 1.00 0.00 ? 92  THR A CG2  4  
ATOM   10624 H  H    . THR A 1 92  ? -2.449  17.605 28.913 1.00 0.00 ? 92  THR A H    4  
ATOM   10625 H  HA   . THR A 1 92  ? 0.089   16.693 27.922 1.00 0.00 ? 92  THR A HA   4  
ATOM   10626 H  HB   . THR A 1 92  ? -2.397  14.916 28.082 1.00 0.00 ? 92  THR A HB   4  
ATOM   10627 H  HG1  . THR A 1 92  ? -0.977  15.304 30.377 1.00 0.00 ? 92  THR A HG1  4  
ATOM   10628 H  HG21 . THR A 1 92  ? 0.012   14.030 27.588 1.00 0.00 ? 92  THR A HG21 4  
ATOM   10629 H  HG22 . THR A 1 92  ? 0.442   14.592 29.201 1.00 0.00 ? 92  THR A HG22 4  
ATOM   10630 H  HG23 . THR A 1 92  ? -0.766  13.325 29.002 1.00 0.00 ? 92  THR A HG23 4  
ATOM   10631 N  N    . SER A 1 93  ? -1.732  17.358 25.623 1.00 0.00 ? 93  SER A N    4  
ATOM   10632 C  CA   . SER A 1 93  ? -2.001  17.234 24.168 1.00 0.00 ? 93  SER A CA   4  
ATOM   10633 C  C    . SER A 1 93  ? -2.340  18.588 23.556 1.00 0.00 ? 93  SER A C    4  
ATOM   10634 O  O    . SER A 1 93  ? -1.579  19.529 23.664 1.00 0.00 ? 93  SER A O    4  
ATOM   10635 C  CB   . SER A 1 93  ? -3.200  16.293 23.974 1.00 0.00 ? 93  SER A CB   4  
ATOM   10636 O  OG   . SER A 1 93  ? -4.290  16.994 24.553 1.00 0.00 ? 93  SER A OG   4  
ATOM   10637 H  H    . SER A 1 93  ? -1.933  18.193 26.095 1.00 0.00 ? 93  SER A H    4  
ATOM   10638 H  HA   . SER A 1 93  ? -1.114  16.836 23.677 1.00 0.00 ? 93  SER A HA   4  
ATOM   10639 H  HB2  . SER A 1 93  ? -3.382  16.117 22.924 1.00 0.00 ? 93  SER A HB2  4  
ATOM   10640 H  HB3  . SER A 1 93  ? -3.040  15.358 24.490 1.00 0.00 ? 93  SER A HB3  4  
ATOM   10641 H  HG   . SER A 1 93  ? -4.527  16.552 25.372 1.00 0.00 ? 93  SER A HG   4  
ATOM   10642 N  N    . ALA A 1 94  ? -3.479  18.658 22.920 1.00 0.00 ? 94  ALA A N    4  
ATOM   10643 C  CA   . ALA A 1 94  ? -3.889  19.939 22.292 1.00 0.00 ? 94  ALA A CA   4  
ATOM   10644 C  C    . ALA A 1 94  ? -2.877  20.375 21.239 1.00 0.00 ? 94  ALA A C    4  
ATOM   10645 O  O    . ALA A 1 94  ? -2.934  21.483 20.740 1.00 0.00 ? 94  ALA A O    4  
ATOM   10646 C  CB   . ALA A 1 94  ? -3.966  21.016 23.386 1.00 0.00 ? 94  ALA A CB   4  
ATOM   10647 H  H    . ALA A 1 94  ? -4.060  17.871 22.859 1.00 0.00 ? 94  ALA A H    4  
ATOM   10648 H  HA   . ALA A 1 94  ? -4.860  19.804 21.815 1.00 0.00 ? 94  ALA A HA   4  
ATOM   10649 H  HB1  . ALA A 1 94  ? -4.346  20.582 24.299 1.00 0.00 ? 94  ALA A HB1  4  
ATOM   10650 H  HB2  . ALA A 1 94  ? -2.982  21.421 23.568 1.00 0.00 ? 94  ALA A HB2  4  
ATOM   10651 H  HB3  . ALA A 1 94  ? -4.624  21.812 23.069 1.00 0.00 ? 94  ALA A HB3  4  
ATOM   10652 N  N    . GLY A 1 95  ? -1.966  19.497 20.921 1.00 0.00 ? 95  GLY A N    4  
ATOM   10653 C  CA   . GLY A 1 95  ? -0.938  19.845 19.899 1.00 0.00 ? 95  GLY A CA   4  
ATOM   10654 C  C    . GLY A 1 95  ? 0.320   20.400 20.570 1.00 0.00 ? 95  GLY A C    4  
ATOM   10655 O  O    . GLY A 1 95  ? 0.479   20.300 21.771 1.00 0.00 ? 95  GLY A O    4  
ATOM   10656 H  H    . GLY A 1 95  ? -1.957  18.615 21.350 1.00 0.00 ? 95  GLY A H    4  
ATOM   10657 H  HA2  . GLY A 1 95  ? -0.680  18.960 19.338 1.00 0.00 ? 95  GLY A HA2  4  
ATOM   10658 H  HA3  . GLY A 1 95  ? -1.341  20.587 19.226 1.00 0.00 ? 95  GLY A HA3  4  
ATOM   10659 N  N    . LYS A 1 96  ? 1.187   20.977 19.770 1.00 0.00 ? 96  LYS A N    4  
ATOM   10660 C  CA   . LYS A 1 96  ? 2.446   21.550 20.325 1.00 0.00 ? 96  LYS A CA   4  
ATOM   10661 C  C    . LYS A 1 96  ? 2.649   22.977 19.835 1.00 0.00 ? 96  LYS A C    4  
ATOM   10662 O  O    . LYS A 1 96  ? 3.152   23.193 18.749 1.00 0.00 ? 96  LYS A O    4  
ATOM   10663 C  CB   . LYS A 1 96  ? 3.620   20.687 19.835 1.00 0.00 ? 96  LYS A CB   4  
ATOM   10664 C  CG   . LYS A 1 96  ? 4.934   21.303 20.315 1.00 0.00 ? 96  LYS A CG   4  
ATOM   10665 C  CD   . LYS A 1 96  ? 6.075   20.317 20.052 1.00 0.00 ? 96  LYS A CD   4  
ATOM   10666 C  CE   . LYS A 1 96  ? 7.412   21.043 20.202 1.00 0.00 ? 96  LYS A CE   4  
ATOM   10667 N  NZ   . LYS A 1 96  ? 7.518   22.149 19.210 1.00 0.00 ? 96  LYS A NZ   4  
ATOM   10668 H  H    . LYS A 1 96  ? 1.007   21.029 18.808 1.00 0.00 ? 96  LYS A H    4  
ATOM   10669 H  HA   . LYS A 1 96  ? 2.394   21.554 21.411 1.00 0.00 ? 96  LYS A HA   4  
ATOM   10670 H  HB2  . LYS A 1 96  ? 3.523   19.686 20.230 1.00 0.00 ? 96  LYS A HB2  4  
ATOM   10671 H  HB3  . LYS A 1 96  ? 3.612   20.643 18.756 1.00 0.00 ? 96  LYS A HB3  4  
ATOM   10672 H  HG2  . LYS A 1 96  ? 5.120   22.224 19.780 1.00 0.00 ? 96  LYS A HG2  4  
ATOM   10673 H  HG3  . LYS A 1 96  ? 4.873   21.514 21.372 1.00 0.00 ? 96  LYS A HG3  4  
ATOM   10674 H  HD2  . LYS A 1 96  ? 6.022   19.504 20.761 1.00 0.00 ? 96  LYS A HD2  4  
ATOM   10675 H  HD3  . LYS A 1 96  ? 5.989   19.921 19.051 1.00 0.00 ? 96  LYS A HD3  4  
ATOM   10676 H  HE2  . LYS A 1 96  ? 7.492   21.454 21.198 1.00 0.00 ? 96  LYS A HE2  4  
ATOM   10677 H  HE3  . LYS A 1 96  ? 8.223   20.346 20.043 1.00 0.00 ? 96  LYS A HE3  4  
ATOM   10678 H  HZ1  . LYS A 1 96  ? 7.052   21.866 18.324 1.00 0.00 ? 96  LYS A HZ1  4  
ATOM   10679 H  HZ2  . LYS A 1 96  ? 7.055   22.999 19.588 1.00 0.00 ? 96  LYS A HZ2  4  
ATOM   10680 H  HZ3  . LYS A 1 96  ? 8.521   22.353 19.025 1.00 0.00 ? 96  LYS A HZ3  4  
ATOM   10681 N  N    . THR A 1 97  ? 2.250   23.925 20.650 1.00 0.00 ? 97  THR A N    4  
ATOM   10682 C  CA   . THR A 1 97  ? 2.405   25.355 20.263 1.00 0.00 ? 97  THR A CA   4  
ATOM   10683 C  C    . THR A 1 97  ? 3.480   26.032 21.108 1.00 0.00 ? 97  THR A C    4  
ATOM   10684 O  O    . THR A 1 97  ? 4.200   25.380 21.838 1.00 0.00 ? 97  THR A O    4  
ATOM   10685 C  CB   . THR A 1 97  ? 1.070   26.066 20.512 1.00 0.00 ? 97  THR A CB   4  
ATOM   10686 O  OG1  . THR A 1 97  ? 0.767   25.825 21.871 1.00 0.00 ? 97  THR A OG1  4  
ATOM   10687 C  CG2  . THR A 1 97  ? -0.066  25.383 19.736 1.00 0.00 ? 97  THR A CG2  4  
ATOM   10688 H  H    . THR A 1 97  ? 1.852   23.692 21.514 1.00 0.00 ? 97  THR A H    4  
ATOM   10689 H  HA   . THR A 1 97  ? 2.687   25.418 19.214 1.00 0.00 ? 97  THR A HA   4  
ATOM   10690 H  HB   . THR A 1 97  ? 1.137   27.133 20.313 1.00 0.00 ? 97  THR A HB   4  
ATOM   10691 H  HG1  . THR A 1 97  ? 1.265   26.451 22.401 1.00 0.00 ? 97  THR A HG1  4  
ATOM   10692 H  HG21 . THR A 1 97  ? -0.136  24.345 20.027 1.00 0.00 ? 97  THR A HG21 4  
ATOM   10693 H  HG22 . THR A 1 97  ? -1.003  25.876 19.953 1.00 0.00 ? 97  THR A HG22 4  
ATOM   10694 H  HG23 . THR A 1 97  ? 0.129   25.443 18.676 1.00 0.00 ? 97  THR A HG23 4  
ATOM   10695 N  N    . ASN A 1 98  ? 3.567   27.330 20.990 1.00 0.00 ? 98  ASN A N    4  
ATOM   10696 C  CA   . ASN A 1 98  ? 4.587   28.068 21.776 1.00 0.00 ? 98  ASN A CA   4  
ATOM   10697 C  C    . ASN A 1 98  ? 3.993   28.589 23.079 1.00 0.00 ? 98  ASN A C    4  
ATOM   10698 O  O    . ASN A 1 98  ? 4.698   28.809 24.043 1.00 0.00 ? 98  ASN A O    4  
ATOM   10699 C  CB   . ASN A 1 98  ? 5.072   29.264 20.941 1.00 0.00 ? 98  ASN A CB   4  
ATOM   10700 C  CG   . ASN A 1 98  ? 6.030   28.769 19.855 1.00 0.00 ? 98  ASN A CG   4  
ATOM   10701 O  OD1  . ASN A 1 98  ? 7.234   28.804 20.010 1.00 0.00 ? 98  ASN A OD1  4  
ATOM   10702 N  ND2  . ASN A 1 98  ? 5.536   28.301 18.741 1.00 0.00 ? 98  ASN A ND2  4  
ATOM   10703 H  H    . ASN A 1 98  ? 2.964   27.814 20.388 1.00 0.00 ? 98  ASN A H    4  
ATOM   10704 H  HA   . ASN A 1 98  ? 5.414   27.397 22.008 1.00 0.00 ? 98  ASN A HA   4  
ATOM   10705 H  HB2  . ASN A 1 98  ? 4.227   29.751 20.477 1.00 0.00 ? 98  ASN A HB2  4  
ATOM   10706 H  HB3  . ASN A 1 98  ? 5.587   29.969 21.576 1.00 0.00 ? 98  ASN A HB3  4  
ATOM   10707 H  HD21 . ASN A 1 98  ? 4.566   28.270 18.609 1.00 0.00 ? 98  ASN A HD21 4  
ATOM   10708 H  HD22 . ASN A 1 98  ? 6.137   27.981 18.035 1.00 0.00 ? 98  ASN A HD22 4  
ATOM   10709 N  N    . GLN A 1 99  ? 2.701   28.780 23.084 1.00 0.00 ? 99  GLN A N    4  
ATOM   10710 C  CA   . GLN A 1 99  ? 2.043   29.286 24.313 1.00 0.00 ? 99  GLN A CA   4  
ATOM   10711 C  C    . GLN A 1 99  ? 1.856   28.162 25.325 1.00 0.00 ? 99  GLN A C    4  
ATOM   10712 O  O    . GLN A 1 99  ? 0.769   27.937 25.817 1.00 0.00 ? 99  GLN A O    4  
ATOM   10713 C  CB   . GLN A 1 99  ? 0.667   29.847 23.927 1.00 0.00 ? 99  GLN A CB   4  
ATOM   10714 C  CG   . GLN A 1 99  ? 0.862   31.127 23.111 1.00 0.00 ? 99  GLN A CG   4  
ATOM   10715 C  CD   . GLN A 1 99  ? 1.585   30.788 21.805 1.00 0.00 ? 99  GLN A CD   4  
ATOM   10716 O  OE1  . GLN A 1 99  ? 1.269   29.823 21.139 1.00 0.00 ? 99  GLN A OE1  4  
ATOM   10717 N  NE2  . GLN A 1 99  ? 2.560   31.558 21.402 1.00 0.00 ? 99  GLN A NE2  4  
ATOM   10718 H  H    . GLN A 1 99  ? 2.170   28.589 22.282 1.00 0.00 ? 99  GLN A H    4  
ATOM   10719 H  HA   . GLN A 1 99  ? 2.668   30.061 24.755 1.00 0.00 ? 99  GLN A HA   4  
ATOM   10720 H  HB2  . GLN A 1 99  ? 0.130   29.118 23.339 1.00 0.00 ? 99  GLN A HB2  4  
ATOM   10721 H  HB3  . GLN A 1 99  ? 0.102   30.068 24.821 1.00 0.00 ? 99  GLN A HB3  4  
ATOM   10722 H  HG2  . GLN A 1 99  ? -0.098  31.567 22.884 1.00 0.00 ? 99  GLN A HG2  4  
ATOM   10723 H  HG3  . GLN A 1 99  ? 1.455   31.834 23.673 1.00 0.00 ? 99  GLN A HG3  4  
ATOM   10724 H  HE21 . GLN A 1 99  ? 2.819   32.339 21.933 1.00 0.00 ? 99  GLN A HE21 4  
ATOM   10725 H  HE22 . GLN A 1 99  ? 3.032   31.355 20.567 1.00 0.00 ? 99  GLN A HE22 4  
ATOM   10726 N  N    . LYS A 1 100 ? 2.928   27.477 25.617 1.00 0.00 ? 100 LYS A N    4  
ATOM   10727 C  CA   . LYS A 1 100 ? 2.847   26.362 26.593 1.00 0.00 ? 100 LYS A CA   4  
ATOM   10728 C  C    . LYS A 1 100 ? 4.196   26.156 27.275 1.00 0.00 ? 100 LYS A C    4  
ATOM   10729 O  O    . LYS A 1 100 ? 4.311   25.394 28.215 1.00 0.00 ? 100 LYS A O    4  
ATOM   10730 C  CB   . LYS A 1 100 ? 2.479   25.079 25.831 1.00 0.00 ? 100 LYS A CB   4  
ATOM   10731 C  CG   . LYS A 1 100 ? 2.006   24.021 26.828 1.00 0.00 ? 100 LYS A CG   4  
ATOM   10732 C  CD   . LYS A 1 100 ? 1.035   23.069 26.126 1.00 0.00 ? 100 LYS A CD   4  
ATOM   10733 C  CE   . LYS A 1 100 ? 1.711   22.484 24.885 1.00 0.00 ? 100 LYS A CE   4  
ATOM   10734 N  NZ   . LYS A 1 100 ? 0.962   21.291 24.398 1.00 0.00 ? 100 LYS A NZ   4  
ATOM   10735 H  H    . LYS A 1 100 ? 3.783   27.698 25.193 1.00 0.00 ? 100 LYS A H    4  
ATOM   10736 H  HA   . LYS A 1 100 ? 2.091   26.598 27.349 1.00 0.00 ? 100 LYS A HA   4  
ATOM   10737 H  HB2  . LYS A 1 100 ? 1.691   25.290 25.123 1.00 0.00 ? 100 LYS A HB2  4  
ATOM   10738 H  HB3  . LYS A 1 100 ? 3.346   24.714 25.298 1.00 0.00 ? 100 LYS A HB3  4  
ATOM   10739 H  HG2  . LYS A 1 100 ? 2.855   23.466 27.198 1.00 0.00 ? 100 LYS A HG2  4  
ATOM   10740 H  HG3  . LYS A 1 100 ? 1.508   24.501 27.657 1.00 0.00 ? 100 LYS A HG3  4  
ATOM   10741 H  HD2  . LYS A 1 100 ? 0.761   22.270 26.800 1.00 0.00 ? 100 LYS A HD2  4  
ATOM   10742 H  HD3  . LYS A 1 100 ? 0.145   23.607 25.835 1.00 0.00 ? 100 LYS A HD3  4  
ATOM   10743 H  HE2  . LYS A 1 100 ? 1.737   23.228 24.102 1.00 0.00 ? 100 LYS A HE2  4  
ATOM   10744 H  HE3  . LYS A 1 100 ? 2.723   22.191 25.126 1.00 0.00 ? 100 LYS A HE3  4  
ATOM   10745 H  HZ1  . LYS A 1 100 ? 0.381   20.907 25.171 1.00 0.00 ? 100 LYS A HZ1  4  
ATOM   10746 H  HZ2  . LYS A 1 100 ? 0.346   21.567 23.607 1.00 0.00 ? 100 LYS A HZ2  4  
ATOM   10747 H  HZ3  . LYS A 1 100 ? 1.635   20.566 24.076 1.00 0.00 ? 100 LYS A HZ3  4  
ATOM   10748 N  N    . LEU A 1 101 ? 5.194   26.845 26.786 1.00 0.00 ? 101 LEU A N    4  
ATOM   10749 C  CA   . LEU A 1 101 ? 6.545   26.707 27.386 1.00 0.00 ? 101 LEU A CA   4  
ATOM   10750 C  C    . LEU A 1 101 ? 6.583   27.304 28.787 1.00 0.00 ? 101 LEU A C    4  
ATOM   10751 O  O    . LEU A 1 101 ? 6.770   26.599 29.759 1.00 0.00 ? 101 LEU A O    4  
ATOM   10752 C  CB   . LEU A 1 101 ? 7.548   27.463 26.498 1.00 0.00 ? 101 LEU A CB   4  
ATOM   10753 C  CG   . LEU A 1 101 ? 8.241   26.470 25.561 1.00 0.00 ? 101 LEU A CG   4  
ATOM   10754 C  CD1  . LEU A 1 101 ? 8.704   27.206 24.302 1.00 0.00 ? 101 LEU A CD1  4  
ATOM   10755 C  CD2  . LEU A 1 101 ? 9.458   25.871 26.271 1.00 0.00 ? 101 LEU A CD2  4  
ATOM   10756 H  H    . LEU A 1 101 ? 5.051   27.449 26.026 1.00 0.00 ? 101 LEU A H    4  
ATOM   10757 H  HA   . LEU A 1 101 ? 6.801   25.651 27.443 1.00 0.00 ? 101 LEU A HA   4  
ATOM   10758 H  HB2  . LEU A 1 101 ? 7.027   28.209 25.915 1.00 0.00 ? 101 LEU A HB2  4  
ATOM   10759 H  HB3  . LEU A 1 101 ? 8.285   27.952 27.118 1.00 0.00 ? 101 LEU A HB3  4  
ATOM   10760 H  HG   . LEU A 1 101 ? 7.552   25.683 25.290 1.00 0.00 ? 101 LEU A HG   4  
ATOM   10761 H  HD11 . LEU A 1 101 ? 9.311   28.056 24.579 1.00 0.00 ? 101 LEU A HD11 4  
ATOM   10762 H  HD12 . LEU A 1 101 ? 9.289   26.539 23.685 1.00 0.00 ? 101 LEU A HD12 4  
ATOM   10763 H  HD13 . LEU A 1 101 ? 7.847   27.548 23.743 1.00 0.00 ? 101 LEU A HD13 4  
ATOM   10764 H  HD21 . LEU A 1 101 ? 10.058  26.662 26.696 1.00 0.00 ? 101 LEU A HD21 4  
ATOM   10765 H  HD22 . LEU A 1 101 ? 9.132   25.209 27.059 1.00 0.00 ? 101 LEU A HD22 4  
ATOM   10766 H  HD23 . LEU A 1 101 ? 10.055  25.313 25.564 1.00 0.00 ? 101 LEU A HD23 4  
ATOM   10767 N  N    . GLU A 1 102 ? 6.407   28.596 28.869 1.00 0.00 ? 102 GLU A N    4  
ATOM   10768 C  CA   . GLU A 1 102 ? 6.431   29.250 30.202 1.00 0.00 ? 102 GLU A CA   4  
ATOM   10769 C  C    . GLU A 1 102 ? 5.617   28.451 31.211 1.00 0.00 ? 102 GLU A C    4  
ATOM   10770 O  O    . GLU A 1 102 ? 6.029   28.270 32.339 1.00 0.00 ? 102 GLU A O    4  
ATOM   10771 C  CB   . GLU A 1 102 ? 5.819   30.656 30.068 1.00 0.00 ? 102 GLU A CB   4  
ATOM   10772 C  CG   . GLU A 1 102 ? 4.591   30.591 29.157 1.00 0.00 ? 102 GLU A CG   4  
ATOM   10773 C  CD   . GLU A 1 102 ? 3.749   31.855 29.350 1.00 0.00 ? 102 GLU A CD   4  
ATOM   10774 O  OE1  . GLU A 1 102 ? 3.601   32.237 30.499 1.00 0.00 ? 102 GLU A OE1  4  
ATOM   10775 O  OE2  . GLU A 1 102 ? 3.301   32.367 28.337 1.00 0.00 ? 102 GLU A OE2  4  
ATOM   10776 H  H    . GLU A 1 102 ? 6.262   29.128 28.059 1.00 0.00 ? 102 GLU A H    4  
ATOM   10777 H  HA   . GLU A 1 102 ? 7.463   29.307 30.547 1.00 0.00 ? 102 GLU A HA   4  
ATOM   10778 H  HB2  . GLU A 1 102 ? 5.528   31.019 31.043 1.00 0.00 ? 102 GLU A HB2  4  
ATOM   10779 H  HB3  . GLU A 1 102 ? 6.549   31.330 29.643 1.00 0.00 ? 102 GLU A HB3  4  
ATOM   10780 H  HG2  . GLU A 1 102 ? 4.905   30.524 28.125 1.00 0.00 ? 102 GLU A HG2  4  
ATOM   10781 H  HG3  . GLU A 1 102 ? 3.997   29.728 29.405 1.00 0.00 ? 102 GLU A HG3  4  
ATOM   10782 N  N    . TRP A 1 103 ? 4.476   27.980 30.787 1.00 0.00 ? 103 TRP A N    4  
ATOM   10783 C  CA   . TRP A 1 103 ? 3.629   27.193 31.711 1.00 0.00 ? 103 TRP A CA   4  
ATOM   10784 C  C    . TRP A 1 103 ? 4.333   25.911 32.124 1.00 0.00 ? 103 TRP A C    4  
ATOM   10785 O  O    . TRP A 1 103 ? 4.223   25.474 33.254 1.00 0.00 ? 103 TRP A O    4  
ATOM   10786 C  CB   . TRP A 1 103 ? 2.325   26.837 30.990 1.00 0.00 ? 103 TRP A CB   4  
ATOM   10787 C  CG   . TRP A 1 103 ? 1.158   27.082 31.947 1.00 0.00 ? 103 TRP A CG   4  
ATOM   10788 C  CD1  . TRP A 1 103 ? 0.768   26.219 32.868 1.00 0.00 ? 103 TRP A CD1  4  
ATOM   10789 C  CD2  . TRP A 1 103 ? 0.430   28.175 31.979 1.00 0.00 ? 103 TRP A CD2  4  
ATOM   10790 N  NE1  . TRP A 1 103 ? -0.255  26.846 33.480 1.00 0.00 ? 103 TRP A NE1  4  
ATOM   10791 C  CE2  . TRP A 1 103 ? -0.534  28.100 32.971 1.00 0.00 ? 103 TRP A CE2  4  
ATOM   10792 C  CE3  . TRP A 1 103 ? 0.521   29.315 31.198 1.00 0.00 ? 103 TRP A CE3  4  
ATOM   10793 C  CZ2  . TRP A 1 103 ? -1.398  29.155 33.177 1.00 0.00 ? 103 TRP A CZ2  4  
ATOM   10794 C  CZ3  . TRP A 1 103 ? -0.347  30.369 31.409 1.00 0.00 ? 103 TRP A CZ3  4  
ATOM   10795 C  CH2  . TRP A 1 103 ? -1.305  30.287 32.398 1.00 0.00 ? 103 TRP A CH2  4  
ATOM   10796 H  H    . TRP A 1 103 ? 4.187   28.138 29.865 1.00 0.00 ? 103 TRP A H    4  
ATOM   10797 H  HA   . TRP A 1 103 ? 3.423   27.785 32.599 1.00 0.00 ? 103 TRP A HA   4  
ATOM   10798 H  HB2  . TRP A 1 103 ? 2.210   27.452 30.112 1.00 0.00 ? 103 TRP A HB2  4  
ATOM   10799 H  HB3  . TRP A 1 103 ? 2.340   25.798 30.701 1.00 0.00 ? 103 TRP A HB3  4  
ATOM   10800 H  HD1  . TRP A 1 103 ? 1.207   25.267 33.114 1.00 0.00 ? 103 TRP A HD1  4  
ATOM   10801 H  HE1  . TRP A 1 103 ? -0.760  26.445 34.217 1.00 0.00 ? 103 TRP A HE1  4  
ATOM   10802 H  HE3  . TRP A 1 103 ? 1.267   29.382 30.423 1.00 0.00 ? 103 TRP A HE3  4  
ATOM   10803 H  HZ2  . TRP A 1 103 ? -2.148  29.092 33.953 1.00 0.00 ? 103 TRP A HZ2  4  
ATOM   10804 H  HZ3  . TRP A 1 103 ? -0.274  31.257 30.801 1.00 0.00 ? 103 TRP A HZ3  4  
ATOM   10805 H  HH2  . TRP A 1 103 ? -1.980  31.115 32.565 1.00 0.00 ? 103 TRP A HH2  4  
ATOM   10806 N  N    . ALA A 1 104 ? 5.051   25.332 31.204 1.00 0.00 ? 104 ALA A N    4  
ATOM   10807 C  CA   . ALA A 1 104 ? 5.770   24.079 31.524 1.00 0.00 ? 104 ALA A CA   4  
ATOM   10808 C  C    . ALA A 1 104 ? 6.724   24.285 32.695 1.00 0.00 ? 104 ALA A C    4  
ATOM   10809 O  O    . ALA A 1 104 ? 6.912   23.399 33.506 1.00 0.00 ? 104 ALA A O    4  
ATOM   10810 C  CB   . ALA A 1 104 ? 6.583   23.658 30.290 1.00 0.00 ? 104 ALA A CB   4  
ATOM   10811 H  H    . ALA A 1 104 ? 5.115   25.724 30.307 1.00 0.00 ? 104 ALA A H    4  
ATOM   10812 H  HA   . ALA A 1 104 ? 5.043   23.311 31.789 1.00 0.00 ? 104 ALA A HA   4  
ATOM   10813 H  HB1  . ALA A 1 104 ? 5.946   23.657 29.417 1.00 0.00 ? 104 ALA A HB1  4  
ATOM   10814 H  HB2  . ALA A 1 104 ? 7.397   24.350 30.136 1.00 0.00 ? 104 ALA A HB2  4  
ATOM   10815 H  HB3  . ALA A 1 104 ? 6.983   22.666 30.439 1.00 0.00 ? 104 ALA A HB3  4  
ATOM   10816 N  N    . PHE A 1 105 ? 7.307   25.455 32.767 1.00 0.00 ? 105 PHE A N    4  
ATOM   10817 C  CA   . PHE A 1 105 ? 8.250   25.731 33.882 1.00 0.00 ? 105 PHE A CA   4  
ATOM   10818 C  C    . PHE A 1 105 ? 7.692   25.221 35.203 1.00 0.00 ? 105 PHE A C    4  
ATOM   10819 O  O    . PHE A 1 105 ? 8.396   24.603 35.977 1.00 0.00 ? 105 PHE A O    4  
ATOM   10820 C  CB   . PHE A 1 105 ? 8.456   27.248 33.988 1.00 0.00 ? 105 PHE A CB   4  
ATOM   10821 C  CG   . PHE A 1 105 ? 9.635   27.534 34.923 1.00 0.00 ? 105 PHE A CG   4  
ATOM   10822 C  CD1  . PHE A 1 105 ? 9.434   27.669 36.288 1.00 0.00 ? 105 PHE A CD1  4  
ATOM   10823 C  CD2  . PHE A 1 105 ? 10.918  27.665 34.418 1.00 0.00 ? 105 PHE A CD2  4  
ATOM   10824 C  CE1  . PHE A 1 105 ? 10.498  27.930 37.129 1.00 0.00 ? 105 PHE A CE1  4  
ATOM   10825 C  CE2  . PHE A 1 105 ? 11.980  27.928 35.263 1.00 0.00 ? 105 PHE A CE2  4  
ATOM   10826 C  CZ   . PHE A 1 105 ? 11.769  28.059 36.617 1.00 0.00 ? 105 PHE A CZ   4  
ATOM   10827 H  H    . PHE A 1 105 ? 7.123   26.145 32.092 1.00 0.00 ? 105 PHE A H    4  
ATOM   10828 H  HA   . PHE A 1 105 ? 9.194   25.227 33.678 1.00 0.00 ? 105 PHE A HA   4  
ATOM   10829 H  HB2  . PHE A 1 105 ? 8.667   27.659 33.011 1.00 0.00 ? 105 PHE A HB2  4  
ATOM   10830 H  HB3  . PHE A 1 105 ? 7.564   27.711 34.383 1.00 0.00 ? 105 PHE A HB3  4  
ATOM   10831 H  HD1  . PHE A 1 105 ? 8.439   27.568 36.696 1.00 0.00 ? 105 PHE A HD1  4  
ATOM   10832 H  HD2  . PHE A 1 105 ? 11.090  27.561 33.357 1.00 0.00 ? 105 PHE A HD2  4  
ATOM   10833 H  HE1  . PHE A 1 105 ? 10.333  28.034 38.192 1.00 0.00 ? 105 PHE A HE1  4  
ATOM   10834 H  HE2  . PHE A 1 105 ? 12.977  28.028 34.860 1.00 0.00 ? 105 PHE A HE2  4  
ATOM   10835 H  HZ   . PHE A 1 105 ? 12.602  28.270 37.278 1.00 0.00 ? 105 PHE A HZ   4  
ATOM   10836 N  N    . SER A 1 106 ? 6.435   25.485 35.441 1.00 0.00 ? 106 SER A N    4  
ATOM   10837 C  CA   . SER A 1 106 ? 5.829   25.017 36.709 1.00 0.00 ? 106 SER A CA   4  
ATOM   10838 C  C    . SER A 1 106 ? 6.153   23.550 36.934 1.00 0.00 ? 106 SER A C    4  
ATOM   10839 O  O    . SER A 1 106 ? 6.722   23.183 37.941 1.00 0.00 ? 106 SER A O    4  
ATOM   10840 C  CB   . SER A 1 106 ? 4.305   25.189 36.616 1.00 0.00 ? 106 SER A CB   4  
ATOM   10841 O  OG   . SER A 1 106 ? 4.134   26.346 35.811 1.00 0.00 ? 106 SER A OG   4  
ATOM   10842 H  H    . SER A 1 106 ? 5.900   25.986 34.789 1.00 0.00 ? 106 SER A H    4  
ATOM   10843 H  HA   . SER A 1 106 ? 6.239   25.596 37.531 1.00 0.00 ? 106 SER A HA   4  
ATOM   10844 H  HB2  . SER A 1 106 ? 3.851   24.333 36.142 1.00 0.00 ? 106 SER A HB2  4  
ATOM   10845 H  HB3  . SER A 1 106 ? 3.879   25.349 37.595 1.00 0.00 ? 106 SER A HB3  4  
ATOM   10846 H  HG   . SER A 1 106 ? 4.832   26.356 35.152 1.00 0.00 ? 106 SER A HG   4  
ATOM   10847 N  N    . LEU A 1 107 ? 5.783   22.735 35.989 1.00 0.00 ? 107 LEU A N    4  
ATOM   10848 C  CA   . LEU A 1 107 ? 6.062   21.288 36.127 1.00 0.00 ? 107 LEU A CA   4  
ATOM   10849 C  C    . LEU A 1 107 ? 7.569   21.074 36.175 1.00 0.00 ? 107 LEU A C    4  
ATOM   10850 O  O    . LEU A 1 107 ? 8.081   20.411 37.055 1.00 0.00 ? 107 LEU A O    4  
ATOM   10851 C  CB   . LEU A 1 107 ? 5.465   20.574 34.891 1.00 0.00 ? 107 LEU A CB   4  
ATOM   10852 C  CG   . LEU A 1 107 ? 5.869   19.089 34.868 1.00 0.00 ? 107 LEU A CG   4  
ATOM   10853 C  CD1  . LEU A 1 107 ? 7.350   18.962 34.498 1.00 0.00 ? 107 LEU A CD1  4  
ATOM   10854 C  CD2  . LEU A 1 107 ? 5.632   18.467 36.242 1.00 0.00 ? 107 LEU A CD2  4  
ATOM   10855 H  H    . LEU A 1 107 ? 5.329   23.077 35.191 1.00 0.00 ? 107 LEU A H    4  
ATOM   10856 H  HA   . LEU A 1 107 ? 5.614   20.922 37.051 1.00 0.00 ? 107 LEU A HA   4  
ATOM   10857 H  HB2  . LEU A 1 107 ? 4.386   20.650 34.925 1.00 0.00 ? 107 LEU A HB2  4  
ATOM   10858 H  HB3  . LEU A 1 107 ? 5.820   21.055 33.996 1.00 0.00 ? 107 LEU A HB3  4  
ATOM   10859 H  HG   . LEU A 1 107 ? 5.273   18.568 34.133 1.00 0.00 ? 107 LEU A HG   4  
ATOM   10860 H  HD11 . LEU A 1 107 ? 7.687   19.873 34.031 1.00 0.00 ? 107 LEU A HD11 4  
ATOM   10861 H  HD12 . LEU A 1 107 ? 7.934   18.777 35.385 1.00 0.00 ? 107 LEU A HD12 4  
ATOM   10862 H  HD13 . LEU A 1 107 ? 7.483   18.141 33.809 1.00 0.00 ? 107 LEU A HD13 4  
ATOM   10863 H  HD21 . LEU A 1 107 ? 4.647   18.722 36.589 1.00 0.00 ? 107 LEU A HD21 4  
ATOM   10864 H  HD22 . LEU A 1 107 ? 5.716   17.393 36.172 1.00 0.00 ? 107 LEU A HD22 4  
ATOM   10865 H  HD23 . LEU A 1 107 ? 6.361   18.834 36.943 1.00 0.00 ? 107 LEU A HD23 4  
ATOM   10866 N  N    . TYR A 1 108 ? 8.256   21.668 35.239 1.00 0.00 ? 108 TYR A N    4  
ATOM   10867 C  CA   . TYR A 1 108 ? 9.726   21.518 35.207 1.00 0.00 ? 108 TYR A CA   4  
ATOM   10868 C  C    . TYR A 1 108 ? 10.337  21.990 36.523 1.00 0.00 ? 108 TYR A C    4  
ATOM   10869 O  O    . TYR A 1 108 ? 11.400  21.546 36.911 1.00 0.00 ? 108 TYR A O    4  
ATOM   10870 C  CB   . TYR A 1 108 ? 10.273  22.394 34.066 1.00 0.00 ? 108 TYR A CB   4  
ATOM   10871 C  CG   . TYR A 1 108 ? 11.251  21.581 33.217 1.00 0.00 ? 108 TYR A CG   4  
ATOM   10872 C  CD1  . TYR A 1 108 ? 12.309  20.921 33.807 1.00 0.00 ? 108 TYR A CD1  4  
ATOM   10873 C  CD2  . TYR A 1 108 ? 11.096  21.504 31.847 1.00 0.00 ? 108 TYR A CD2  4  
ATOM   10874 C  CE1  . TYR A 1 108 ? 13.198  20.197 33.042 1.00 0.00 ? 108 TYR A CE1  4  
ATOM   10875 C  CE2  . TYR A 1 108 ? 11.987  20.780 31.081 1.00 0.00 ? 108 TYR A CE2  4  
ATOM   10876 C  CZ   . TYR A 1 108 ? 13.045  20.122 31.673 1.00 0.00 ? 108 TYR A CZ   4  
ATOM   10877 O  OH   . TYR A 1 108 ? 13.937  19.399 30.907 1.00 0.00 ? 108 TYR A OH   4  
ATOM   10878 H  H    . TYR A 1 108 ? 7.800   22.212 34.563 1.00 0.00 ? 108 TYR A H    4  
ATOM   10879 H  HA   . TYR A 1 108 ? 9.976   20.470 35.050 1.00 0.00 ? 108 TYR A HA   4  
ATOM   10880 H  HB2  . TYR A 1 108 ? 9.458   22.731 33.443 1.00 0.00 ? 108 TYR A HB2  4  
ATOM   10881 H  HB3  . TYR A 1 108 ? 10.786  23.251 34.475 1.00 0.00 ? 108 TYR A HB3  4  
ATOM   10882 H  HD1  . TYR A 1 108 ? 12.441  20.971 34.877 1.00 0.00 ? 108 TYR A HD1  4  
ATOM   10883 H  HD2  . TYR A 1 108 ? 10.270  22.014 31.371 1.00 0.00 ? 108 TYR A HD2  4  
ATOM   10884 H  HE1  . TYR A 1 108 ? 14.022  19.687 33.518 1.00 0.00 ? 108 TYR A HE1  4  
ATOM   10885 H  HE2  . TYR A 1 108 ? 11.854  20.729 30.010 1.00 0.00 ? 108 TYR A HE2  4  
ATOM   10886 H  HH   . TYR A 1 108 ? 14.792  19.421 31.347 1.00 0.00 ? 108 TYR A HH   4  
ATOM   10887 N  N    . ASP A 1 109 ? 9.642   22.881 37.188 1.00 0.00 ? 109 ASP A N    4  
ATOM   10888 C  CA   . ASP A 1 109 ? 10.156  23.403 38.480 1.00 0.00 ? 109 ASP A CA   4  
ATOM   10889 C  C    . ASP A 1 109 ? 9.456   22.726 39.648 1.00 0.00 ? 109 ASP A C    4  
ATOM   10890 O  O    . ASP A 1 109 ? 8.686   23.344 40.354 1.00 0.00 ? 109 ASP A O    4  
ATOM   10891 C  CB   . ASP A 1 109 ? 9.870   24.910 38.539 1.00 0.00 ? 109 ASP A CB   4  
ATOM   10892 C  CG   . ASP A 1 109 ? 10.633  25.525 39.714 1.00 0.00 ? 109 ASP A CG   4  
ATOM   10893 O  OD1  . ASP A 1 109 ? 11.464  24.812 40.252 1.00 0.00 ? 109 ASP A OD1  4  
ATOM   10894 O  OD2  . ASP A 1 109 ? 10.342  26.673 40.007 1.00 0.00 ? 109 ASP A OD2  4  
ATOM   10895 H  H    . ASP A 1 109 ? 8.786   23.197 36.839 1.00 0.00 ? 109 ASP A H    4  
ATOM   10896 H  HA   . ASP A 1 109 ? 11.225  23.209 38.546 1.00 0.00 ? 109 ASP A HA   4  
ATOM   10897 H  HB2  . ASP A 1 109 ? 10.190  25.380 37.620 1.00 0.00 ? 109 ASP A HB2  4  
ATOM   10898 H  HB3  . ASP A 1 109 ? 8.811   25.076 38.674 1.00 0.00 ? 109 ASP A HB3  4  
ATOM   10899 N  N    . VAL A 1 110 ? 9.731   21.463 39.820 1.00 0.00 ? 110 VAL A N    4  
ATOM   10900 C  CA   . VAL A 1 110 ? 9.096   20.715 40.936 1.00 0.00 ? 110 VAL A CA   4  
ATOM   10901 C  C    . VAL A 1 110 ? 9.050   21.561 42.205 1.00 0.00 ? 110 VAL A C    4  
ATOM   10902 O  O    . VAL A 1 110 ? 8.247   21.322 43.086 1.00 0.00 ? 110 VAL A O    4  
ATOM   10903 C  CB   . VAL A 1 110 ? 9.934   19.457 41.210 1.00 0.00 ? 110 VAL A CB   4  
ATOM   10904 C  CG1  . VAL A 1 110 ? 9.278   18.646 42.329 1.00 0.00 ? 110 VAL A CG1  4  
ATOM   10905 C  CG2  . VAL A 1 110 ? 9.995   18.606 39.939 1.00 0.00 ? 110 VAL A CG2  4  
ATOM   10906 H  H    . VAL A 1 110 ? 10.350  21.010 39.211 1.00 0.00 ? 110 VAL A H    4  
ATOM   10907 H  HA   . VAL A 1 110 ? 8.078   20.449 40.651 1.00 0.00 ? 110 VAL A HA   4  
ATOM   10908 H  HB   . VAL A 1 110 ? 10.933  19.742 41.505 1.00 0.00 ? 110 VAL A HB   4  
ATOM   10909 H  HG11 . VAL A 1 110 ? 8.206   18.635 42.191 1.00 0.00 ? 110 VAL A HG11 4  
ATOM   10910 H  HG12 . VAL A 1 110 ? 9.649   17.633 42.310 1.00 0.00 ? 110 VAL A HG12 4  
ATOM   10911 H  HG13 . VAL A 1 110 ? 9.508   19.092 43.285 1.00 0.00 ? 110 VAL A HG13 4  
ATOM   10912 H  HG21 . VAL A 1 110 ? 10.071  19.247 39.074 1.00 0.00 ? 110 VAL A HG21 4  
ATOM   10913 H  HG22 . VAL A 1 110 ? 10.856  17.955 39.977 1.00 0.00 ? 110 VAL A HG22 4  
ATOM   10914 H  HG23 . VAL A 1 110 ? 9.100   18.005 39.859 1.00 0.00 ? 110 VAL A HG23 4  
ATOM   10915 N  N    . ASP A 1 111 ? 9.916   22.537 42.276 1.00 0.00 ? 111 ASP A N    4  
ATOM   10916 C  CA   . ASP A 1 111 ? 9.937   23.406 43.478 1.00 0.00 ? 111 ASP A CA   4  
ATOM   10917 C  C    . ASP A 1 111 ? 9.021   24.609 43.287 1.00 0.00 ? 111 ASP A C    4  
ATOM   10918 O  O    . ASP A 1 111 ? 8.063   24.782 44.015 1.00 0.00 ? 111 ASP A O    4  
ATOM   10919 C  CB   . ASP A 1 111 ? 11.374  23.912 43.688 1.00 0.00 ? 111 ASP A CB   4  
ATOM   10920 C  CG   . ASP A 1 111 ? 12.310  22.718 43.878 1.00 0.00 ? 111 ASP A CG   4  
ATOM   10921 O  OD1  . ASP A 1 111 ? 11.924  21.840 44.633 1.00 0.00 ? 111 ASP A OD1  4  
ATOM   10922 O  OD2  . ASP A 1 111 ? 13.361  22.749 43.257 1.00 0.00 ? 111 ASP A OD2  4  
ATOM   10923 H  H    . ASP A 1 111 ? 10.546  22.693 41.542 1.00 0.00 ? 111 ASP A H    4  
ATOM   10924 H  HA   . ASP A 1 111 ? 9.597   22.832 44.339 1.00 0.00 ? 111 ASP A HA   4  
ATOM   10925 H  HB2  . ASP A 1 111 ? 11.690  24.481 42.826 1.00 0.00 ? 111 ASP A HB2  4  
ATOM   10926 H  HB3  . ASP A 1 111 ? 11.414  24.541 44.566 1.00 0.00 ? 111 ASP A HB3  4  
ATOM   10927 N  N    . GLY A 1 112 ? 9.338   25.419 42.305 1.00 0.00 ? 112 GLY A N    4  
ATOM   10928 C  CA   . GLY A 1 112 ? 8.499   26.628 42.036 1.00 0.00 ? 112 GLY A CA   4  
ATOM   10929 C  C    . GLY A 1 112 ? 9.255   27.900 42.428 1.00 0.00 ? 112 GLY A C    4  
ATOM   10930 O  O    . GLY A 1 112 ? 8.674   28.962 42.537 1.00 0.00 ? 112 GLY A O    4  
ATOM   10931 H  H    . GLY A 1 112 ? 10.123  25.232 41.750 1.00 0.00 ? 112 GLY A H    4  
ATOM   10932 H  HA2  . GLY A 1 112 ? 8.261   26.667 40.983 1.00 0.00 ? 112 GLY A HA2  4  
ATOM   10933 H  HA3  . GLY A 1 112 ? 7.585   26.569 42.604 1.00 0.00 ? 112 GLY A HA3  4  
ATOM   10934 N  N    . ASN A 1 113 ? 10.538  27.766 42.635 1.00 0.00 ? 113 ASN A N    4  
ATOM   10935 C  CA   . ASN A 1 113 ? 11.340  28.953 43.019 1.00 0.00 ? 113 ASN A CA   4  
ATOM   10936 C  C    . ASN A 1 113 ? 11.765  29.742 41.782 1.00 0.00 ? 113 ASN A C    4  
ATOM   10937 O  O    . ASN A 1 113 ? 12.817  30.347 41.755 1.00 0.00 ? 113 ASN A O    4  
ATOM   10938 C  CB   . ASN A 1 113 ? 12.598  28.465 43.763 1.00 0.00 ? 113 ASN A CB   4  
ATOM   10939 C  CG   . ASN A 1 113 ? 13.139  27.208 43.076 1.00 0.00 ? 113 ASN A CG   4  
ATOM   10940 O  OD1  . ASN A 1 113 ? 13.998  26.524 43.598 1.00 0.00 ? 113 ASN A OD1  4  
ATOM   10941 N  ND2  . ASN A 1 113 ? 12.664  26.869 41.908 1.00 0.00 ? 113 ASN A ND2  4  
ATOM   10942 H  H    . ASN A 1 113 ? 10.965  26.890 42.536 1.00 0.00 ? 113 ASN A H    4  
ATOM   10943 H  HA   . ASN A 1 113 ? 10.736  29.595 43.659 1.00 0.00 ? 113 ASN A HA   4  
ATOM   10944 H  HB2  . ASN A 1 113 ? 13.356  29.234 43.750 1.00 0.00 ? 113 ASN A HB2  4  
ATOM   10945 H  HB3  . ASN A 1 113 ? 12.348  28.230 44.787 1.00 0.00 ? 113 ASN A HB3  4  
ATOM   10946 H  HD21 . ASN A 1 113 ? 11.972  27.418 41.483 1.00 0.00 ? 113 ASN A HD21 4  
ATOM   10947 H  HD22 . ASN A 1 113 ? 13.001  26.068 41.457 1.00 0.00 ? 113 ASN A HD22 4  
ATOM   10948 N  N    . GLY A 1 114 ? 10.931  29.722 40.778 1.00 0.00 ? 114 GLY A N    4  
ATOM   10949 C  CA   . GLY A 1 114 ? 11.266  30.467 39.530 1.00 0.00 ? 114 GLY A CA   4  
ATOM   10950 C  C    . GLY A 1 114 ? 12.667  30.089 39.043 1.00 0.00 ? 114 GLY A C    4  
ATOM   10951 O  O    . GLY A 1 114 ? 13.254  30.783 38.236 1.00 0.00 ? 114 GLY A O    4  
ATOM   10952 H  H    . GLY A 1 114 ? 10.092  29.221 40.843 1.00 0.00 ? 114 GLY A H    4  
ATOM   10953 H  HA2  . GLY A 1 114 ? 10.544  30.224 38.765 1.00 0.00 ? 114 GLY A HA2  4  
ATOM   10954 H  HA3  . GLY A 1 114 ? 11.232  31.529 39.728 1.00 0.00 ? 114 GLY A HA3  4  
ATOM   10955 N  N    . THR A 1 115 ? 13.171  28.995 39.542 1.00 0.00 ? 115 THR A N    4  
ATOM   10956 C  CA   . THR A 1 115 ? 14.524  28.559 39.121 1.00 0.00 ? 115 THR A CA   4  
ATOM   10957 C  C    . THR A 1 115 ? 14.646  27.040 39.175 1.00 0.00 ? 115 THR A C    4  
ATOM   10958 O  O    . THR A 1 115 ? 14.291  26.422 40.159 1.00 0.00 ? 115 THR A O    4  
ATOM   10959 C  CB   . THR A 1 115 ? 15.547  29.174 40.078 1.00 0.00 ? 115 THR A CB   4  
ATOM   10960 O  OG1  . THR A 1 115 ? 14.948  29.115 41.357 1.00 0.00 ? 115 THR A OG1  4  
ATOM   10961 C  CG2  . THR A 1 115 ? 15.717  30.674 39.801 1.00 0.00 ? 115 THR A CG2  4  
ATOM   10962 H  H    . THR A 1 115 ? 12.661  28.466 40.186 1.00 0.00 ? 115 THR A H    4  
ATOM   10963 H  HA   . THR A 1 115 ? 14.698  28.893 38.101 1.00 0.00 ? 115 THR A HA   4  
ATOM   10964 H  HB   . THR A 1 115 ? 16.490  28.632 40.066 1.00 0.00 ? 115 THR A HB   4  
ATOM   10965 H  HG1  . THR A 1 115 ? 14.902  28.193 41.621 1.00 0.00 ? 115 THR A HG1  4  
ATOM   10966 H  HG21 . THR A 1 115 ? 15.931  30.829 38.754 1.00 0.00 ? 115 THR A HG21 4  
ATOM   10967 H  HG22 . THR A 1 115 ? 14.809  31.198 40.060 1.00 0.00 ? 115 THR A HG22 4  
ATOM   10968 H  HG23 . THR A 1 115 ? 16.533  31.063 40.391 1.00 0.00 ? 115 THR A HG23 4  
ATOM   10969 N  N    . ILE A 1 116 ? 15.150  26.465 38.112 1.00 0.00 ? 116 ILE A N    4  
ATOM   10970 C  CA   . ILE A 1 116 ? 15.305  24.986 38.080 1.00 0.00 ? 116 ILE A CA   4  
ATOM   10971 C  C    . ILE A 1 116 ? 16.725  24.579 38.452 1.00 0.00 ? 116 ILE A C    4  
ATOM   10972 O  O    . ILE A 1 116 ? 17.685  25.105 37.920 1.00 0.00 ? 116 ILE A O    4  
ATOM   10973 C  CB   . ILE A 1 116 ? 15.014  24.501 36.661 1.00 0.00 ? 116 ILE A CB   4  
ATOM   10974 C  CG1  . ILE A 1 116 ? 13.650  25.005 36.214 1.00 0.00 ? 116 ILE A CG1  4  
ATOM   10975 C  CG2  . ILE A 1 116 ? 14.989  22.962 36.666 1.00 0.00 ? 116 ILE A CG2  4  
ATOM   10976 C  CD1  . ILE A 1 116 ? 13.347  24.459 34.817 1.00 0.00 ? 116 ILE A CD1  4  
ATOM   10977 H  H    . ILE A 1 116 ? 15.425  27.006 37.341 1.00 0.00 ? 116 ILE A H    4  
ATOM   10978 H  HA   . ILE A 1 116 ? 14.612  24.541 38.791 1.00 0.00 ? 116 ILE A HA   4  
ATOM   10979 H  HB   . ILE A 1 116 ? 15.780  24.878 35.982 1.00 0.00 ? 116 ILE A HB   4  
ATOM   10980 H  HG12 . ILE A 1 116 ? 12.893  24.668 36.908 1.00 0.00 ? 116 ILE A HG12 4  
ATOM   10981 H  HG13 . ILE A 1 116 ? 13.652  26.084 36.190 1.00 0.00 ? 116 ILE A HG13 4  
ATOM   10982 H  HG21 . ILE A 1 116 ? 15.865  22.585 37.170 1.00 0.00 ? 116 ILE A HG21 4  
ATOM   10983 H  HG22 . ILE A 1 116 ? 14.104  22.613 37.180 1.00 0.00 ? 116 ILE A HG22 4  
ATOM   10984 H  HG23 . ILE A 1 116 ? 14.978  22.594 35.650 1.00 0.00 ? 116 ILE A HG23 4  
ATOM   10985 H  HD11 . ILE A 1 116 ? 14.243  24.484 34.214 1.00 0.00 ? 116 ILE A HD11 4  
ATOM   10986 H  HD12 . ILE A 1 116 ? 12.997  23.440 34.892 1.00 0.00 ? 116 ILE A HD12 4  
ATOM   10987 H  HD13 . ILE A 1 116 ? 12.586  25.063 34.347 1.00 0.00 ? 116 ILE A HD13 4  
ATOM   10988 N  N    . SER A 1 117 ? 16.828  23.641 39.364 1.00 0.00 ? 117 SER A N    4  
ATOM   10989 C  CA   . SER A 1 117 ? 18.167  23.172 39.797 1.00 0.00 ? 117 SER A CA   4  
ATOM   10990 C  C    . SER A 1 117 ? 18.506  21.827 39.161 1.00 0.00 ? 117 SER A C    4  
ATOM   10991 O  O    . SER A 1 117 ? 17.725  21.277 38.407 1.00 0.00 ? 117 SER A O    4  
ATOM   10992 C  CB   . SER A 1 117 ? 18.146  23.000 41.324 1.00 0.00 ? 117 SER A CB   4  
ATOM   10993 O  OG   . SER A 1 117 ? 17.547  24.196 41.800 1.00 0.00 ? 117 SER A OG   4  
ATOM   10994 H  H    . SER A 1 117 ? 16.025  23.252 39.757 1.00 0.00 ? 117 SER A H    4  
ATOM   10995 H  HA   . SER A 1 117 ? 18.914  23.902 39.502 1.00 0.00 ? 117 SER A HA   4  
ATOM   10996 H  HB2  . SER A 1 117 ? 17.550  22.146 41.605 1.00 0.00 ? 117 SER A HB2  4  
ATOM   10997 H  HB3  . SER A 1 117 ? 19.150  22.905 41.712 1.00 0.00 ? 117 SER A HB3  4  
ATOM   10998 H  HG   . SER A 1 117 ? 16.966  24.531 41.113 1.00 0.00 ? 117 SER A HG   4  
ATOM   10999 N  N    . LYS A 1 118 ? 19.666  21.321 39.480 1.00 0.00 ? 118 LYS A N    4  
ATOM   11000 C  CA   . LYS A 1 118 ? 20.075  20.016 38.907 1.00 0.00 ? 118 LYS A CA   4  
ATOM   11001 C  C    . LYS A 1 118 ? 19.191  18.890 39.432 1.00 0.00 ? 118 LYS A C    4  
ATOM   11002 O  O    . LYS A 1 118 ? 18.548  18.197 38.669 1.00 0.00 ? 118 LYS A O    4  
ATOM   11003 C  CB   . LYS A 1 118 ? 21.527  19.738 39.323 1.00 0.00 ? 118 LYS A CB   4  
ATOM   11004 C  CG   . LYS A 1 118 ? 22.032  18.498 38.582 1.00 0.00 ? 118 LYS A CG   4  
ATOM   11005 C  CD   . LYS A 1 118 ? 22.871  18.938 37.381 1.00 0.00 ? 118 LYS A CD   4  
ATOM   11006 C  CE   . LYS A 1 118 ? 23.376  17.697 36.641 1.00 0.00 ? 118 LYS A CE   4  
ATOM   11007 N  NZ   . LYS A 1 118 ? 24.200  18.091 35.463 1.00 0.00 ? 118 LYS A NZ   4  
ATOM   11008 H  H    . LYS A 1 118 ? 20.262  21.799 40.094 1.00 0.00 ? 118 LYS A H    4  
ATOM   11009 H  HA   . LYS A 1 118 ? 19.984  20.061 37.822 1.00 0.00 ? 118 LYS A HA   4  
ATOM   11010 H  HB2  . LYS A 1 118 ? 22.145  20.587 39.072 1.00 0.00 ? 118 LYS A HB2  4  
ATOM   11011 H  HB3  . LYS A 1 118 ? 21.575  19.568 40.388 1.00 0.00 ? 118 LYS A HB3  4  
ATOM   11012 H  HG2  . LYS A 1 118 ? 22.637  17.900 39.248 1.00 0.00 ? 118 LYS A HG2  4  
ATOM   11013 H  HG3  . LYS A 1 118 ? 21.192  17.911 38.243 1.00 0.00 ? 118 LYS A HG3  4  
ATOM   11014 H  HD2  . LYS A 1 118 ? 22.266  19.536 36.715 1.00 0.00 ? 118 LYS A HD2  4  
ATOM   11015 H  HD3  . LYS A 1 118 ? 23.711  19.526 37.719 1.00 0.00 ? 118 LYS A HD3  4  
ATOM   11016 H  HE2  . LYS A 1 118 ? 23.978  17.098 37.308 1.00 0.00 ? 118 LYS A HE2  4  
ATOM   11017 H  HE3  . LYS A 1 118 ? 22.535  17.111 36.302 1.00 0.00 ? 118 LYS A HE3  4  
ATOM   11018 H  HZ1  . LYS A 1 118 ? 23.901  19.030 35.130 1.00 0.00 ? 118 LYS A HZ1  4  
ATOM   11019 H  HZ2  . LYS A 1 118 ? 25.203  18.124 35.737 1.00 0.00 ? 118 LYS A HZ2  4  
ATOM   11020 H  HZ3  . LYS A 1 118 ? 24.070  17.396 34.701 1.00 0.00 ? 118 LYS A HZ3  4  
ATOM   11021 N  N    . ASN A 1 119 ? 19.174  18.728 40.727 1.00 0.00 ? 119 ASN A N    4  
ATOM   11022 C  CA   . ASN A 1 119 ? 18.337  17.652 41.314 1.00 0.00 ? 119 ASN A CA   4  
ATOM   11023 C  C    . ASN A 1 119 ? 16.961  17.618 40.662 1.00 0.00 ? 119 ASN A C    4  
ATOM   11024 O  O    . ASN A 1 119 ? 16.465  16.567 40.307 1.00 0.00 ? 119 ASN A O    4  
ATOM   11025 C  CB   . ASN A 1 119 ? 18.165  17.935 42.815 1.00 0.00 ? 119 ASN A CB   4  
ATOM   11026 C  CG   . ASN A 1 119 ? 17.531  16.717 43.489 1.00 0.00 ? 119 ASN A CG   4  
ATOM   11027 O  OD1  . ASN A 1 119 ? 17.060  16.788 44.608 1.00 0.00 ? 119 ASN A OD1  4  
ATOM   11028 N  ND2  . ASN A 1 119 ? 17.496  15.583 42.845 1.00 0.00 ? 119 ASN A ND2  4  
ATOM   11029 H  H    . ASN A 1 119 ? 19.709  19.310 41.306 1.00 0.00 ? 119 ASN A H    4  
ATOM   11030 H  HA   . ASN A 1 119 ? 18.829  16.693 41.155 1.00 0.00 ? 119 ASN A HA   4  
ATOM   11031 H  HB2  . ASN A 1 119 ? 19.129  18.130 43.263 1.00 0.00 ? 119 ASN A HB2  4  
ATOM   11032 H  HB3  . ASN A 1 119 ? 17.527  18.794 42.955 1.00 0.00 ? 119 ASN A HB3  4  
ATOM   11033 H  HD21 . ASN A 1 119 ? 17.874  15.520 41.943 1.00 0.00 ? 119 ASN A HD21 4  
ATOM   11034 H  HD22 . ASN A 1 119 ? 17.093  14.793 43.263 1.00 0.00 ? 119 ASN A HD22 4  
ATOM   11035 N  N    . GLU A 1 120 ? 16.367  18.771 40.514 1.00 0.00 ? 120 GLU A N    4  
ATOM   11036 C  CA   . GLU A 1 120 ? 15.024  18.821 39.886 1.00 0.00 ? 120 GLU A CA   4  
ATOM   11037 C  C    . GLU A 1 120 ? 15.037  18.149 38.520 1.00 0.00 ? 120 GLU A C    4  
ATOM   11038 O  O    . GLU A 1 120 ? 14.323  17.189 38.289 1.00 0.00 ? 120 GLU A O    4  
ATOM   11039 C  CB   . GLU A 1 120 ? 14.628  20.293 39.705 1.00 0.00 ? 120 GLU A CB   4  
ATOM   11040 C  CG   . GLU A 1 120 ? 14.669  20.994 41.064 1.00 0.00 ? 120 GLU A CG   4  
ATOM   11041 C  CD   . GLU A 1 120 ? 14.185  22.437 40.902 1.00 0.00 ? 120 GLU A CD   4  
ATOM   11042 O  OE1  . GLU A 1 120 ? 12.976  22.599 40.856 1.00 0.00 ? 120 GLU A OE1  4  
ATOM   11043 O  OE2  . GLU A 1 120 ? 15.049  23.294 40.833 1.00 0.00 ? 120 GLU A OE2  4  
ATOM   11044 H  H    . GLU A 1 120 ? 16.804  19.594 40.815 1.00 0.00 ? 120 GLU A H    4  
ATOM   11045 H  HA   . GLU A 1 120 ? 14.313  18.305 40.530 1.00 0.00 ? 120 GLU A HA   4  
ATOM   11046 H  HB2  . GLU A 1 120 ? 15.317  20.773 39.026 1.00 0.00 ? 120 GLU A HB2  4  
ATOM   11047 H  HB3  . GLU A 1 120 ? 13.629  20.351 39.297 1.00 0.00 ? 120 GLU A HB3  4  
ATOM   11048 H  HG2  . GLU A 1 120 ? 14.027  20.479 41.762 1.00 0.00 ? 120 GLU A HG2  4  
ATOM   11049 H  HG3  . GLU A 1 120 ? 15.680  20.998 41.443 1.00 0.00 ? 120 GLU A HG3  4  
ATOM   11050 N  N    . VAL A 1 121 ? 15.847  18.661 37.633 1.00 0.00 ? 121 VAL A N    4  
ATOM   11051 C  CA   . VAL A 1 121 ? 15.913  18.059 36.279 1.00 0.00 ? 121 VAL A CA   4  
ATOM   11052 C  C    . VAL A 1 121 ? 16.196  16.566 36.365 1.00 0.00 ? 121 VAL A C    4  
ATOM   11053 O  O    . VAL A 1 121 ? 15.841  15.814 35.480 1.00 0.00 ? 121 VAL A O    4  
ATOM   11054 C  CB   . VAL A 1 121 ? 17.050  18.734 35.496 1.00 0.00 ? 121 VAL A CB   4  
ATOM   11055 C  CG1  . VAL A 1 121 ? 17.108  18.143 34.085 1.00 0.00 ? 121 VAL A CG1  4  
ATOM   11056 C  CG2  . VAL A 1 121 ? 16.774  20.236 35.401 1.00 0.00 ? 121 VAL A CG2  4  
ATOM   11057 H  H    . VAL A 1 121 ? 16.405  19.436 37.860 1.00 0.00 ? 121 VAL A H    4  
ATOM   11058 H  HA   . VAL A 1 121 ? 14.957  18.210 35.779 1.00 0.00 ? 121 VAL A HA   4  
ATOM   11059 H  HB   . VAL A 1 121 ? 17.991  18.567 35.999 1.00 0.00 ? 121 VAL A HB   4  
ATOM   11060 H  HG11 . VAL A 1 121 ? 16.152  18.268 33.598 1.00 0.00 ? 121 VAL A HG11 4  
ATOM   11061 H  HG12 . VAL A 1 121 ? 17.869  18.648 33.509 1.00 0.00 ? 121 VAL A HG12 4  
ATOM   11062 H  HG13 . VAL A 1 121 ? 17.344  17.091 34.139 1.00 0.00 ? 121 VAL A HG13 4  
ATOM   11063 H  HG21 . VAL A 1 121 ? 16.655  20.649 36.392 1.00 0.00 ? 121 VAL A HG21 4  
ATOM   11064 H  HG22 . VAL A 1 121 ? 17.600  20.728 34.908 1.00 0.00 ? 121 VAL A HG22 4  
ATOM   11065 H  HG23 . VAL A 1 121 ? 15.870  20.405 34.834 1.00 0.00 ? 121 VAL A HG23 4  
ATOM   11066 N  N    . LEU A 1 122 ? 16.832  16.160 37.431 1.00 0.00 ? 122 LEU A N    4  
ATOM   11067 C  CA   . LEU A 1 122 ? 17.141  14.720 37.583 1.00 0.00 ? 122 LEU A CA   4  
ATOM   11068 C  C    . LEU A 1 122 ? 15.863  13.915 37.783 1.00 0.00 ? 122 LEU A C    4  
ATOM   11069 O  O    . LEU A 1 122 ? 15.666  12.894 37.155 1.00 0.00 ? 122 LEU A O    4  
ATOM   11070 C  CB   . LEU A 1 122 ? 18.045  14.541 38.815 1.00 0.00 ? 122 LEU A CB   4  
ATOM   11071 C  CG   . LEU A 1 122 ? 19.309  13.785 38.399 1.00 0.00 ? 122 LEU A CG   4  
ATOM   11072 C  CD1  . LEU A 1 122 ? 20.346  13.883 39.520 1.00 0.00 ? 122 LEU A CD1  4  
ATOM   11073 C  CD2  . LEU A 1 122 ? 18.961  12.315 38.159 1.00 0.00 ? 122 LEU A CD2  4  
ATOM   11074 H  H    . LEU A 1 122 ? 17.103  16.801 38.122 1.00 0.00 ? 122 LEU A H    4  
ATOM   11075 H  HA   . LEU A 1 122 ? 17.642  14.369 36.682 1.00 0.00 ? 122 LEU A HA   4  
ATOM   11076 H  HB2  . LEU A 1 122 ? 18.315  15.508 39.212 1.00 0.00 ? 122 LEU A HB2  4  
ATOM   11077 H  HB3  . LEU A 1 122 ? 17.521  13.980 39.574 1.00 0.00 ? 122 LEU A HB3  4  
ATOM   11078 H  HG   . LEU A 1 122 ? 19.710  14.217 37.494 1.00 0.00 ? 122 LEU A HG   4  
ATOM   11079 H  HD11 . LEU A 1 122 ? 20.541  14.920 39.745 1.00 0.00 ? 122 LEU A HD11 4  
ATOM   11080 H  HD12 . LEU A 1 122 ? 19.971  13.391 40.406 1.00 0.00 ? 122 LEU A HD12 4  
ATOM   11081 H  HD13 . LEU A 1 122 ? 21.264  13.406 39.210 1.00 0.00 ? 122 LEU A HD13 4  
ATOM   11082 H  HD21 . LEU A 1 122 ? 18.343  11.950 38.967 1.00 0.00 ? 122 LEU A HD21 4  
ATOM   11083 H  HD22 . LEU A 1 122 ? 18.423  12.214 37.228 1.00 0.00 ? 122 LEU A HD22 4  
ATOM   11084 H  HD23 . LEU A 1 122 ? 19.866  11.728 38.112 1.00 0.00 ? 122 LEU A HD23 4  
ATOM   11085 N  N    . GLU A 1 123 ? 15.014  14.388 38.657 1.00 0.00 ? 123 GLU A N    4  
ATOM   11086 C  CA   . GLU A 1 123 ? 13.748  13.657 38.902 1.00 0.00 ? 123 GLU A CA   4  
ATOM   11087 C  C    . GLU A 1 123 ? 12.938  13.566 37.621 1.00 0.00 ? 123 GLU A C    4  
ATOM   11088 O  O    . GLU A 1 123 ? 12.626  12.487 37.157 1.00 0.00 ? 123 GLU A O    4  
ATOM   11089 C  CB   . GLU A 1 123 ? 12.927  14.429 39.945 1.00 0.00 ? 123 GLU A CB   4  
ATOM   11090 C  CG   . GLU A 1 123 ? 12.148  13.431 40.806 1.00 0.00 ? 123 GLU A CG   4  
ATOM   11091 C  CD   . GLU A 1 123 ? 13.133  12.602 41.633 1.00 0.00 ? 123 GLU A CD   4  
ATOM   11092 O  OE1  . GLU A 1 123 ? 13.490  13.087 42.693 1.00 0.00 ? 123 GLU A OE1  4  
ATOM   11093 O  OE2  . GLU A 1 123 ? 13.472  11.530 41.158 1.00 0.00 ? 123 GLU A OE2  4  
ATOM   11094 H  H    . GLU A 1 123 ? 15.211  15.214 39.144 1.00 0.00 ? 123 GLU A H    4  
ATOM   11095 H  HA   . GLU A 1 123 ? 13.978  12.652 39.252 1.00 0.00 ? 123 GLU A HA   4  
ATOM   11096 H  HB2  . GLU A 1 123 ? 13.587  15.009 40.570 1.00 0.00 ? 123 GLU A HB2  4  
ATOM   11097 H  HB3  . GLU A 1 123 ? 12.237  15.092 39.444 1.00 0.00 ? 123 GLU A HB3  4  
ATOM   11098 H  HG2  . GLU A 1 123 ? 11.483  13.962 41.469 1.00 0.00 ? 123 GLU A HG2  4  
ATOM   11099 H  HG3  . GLU A 1 123 ? 11.571  12.773 40.172 1.00 0.00 ? 123 GLU A HG3  4  
ATOM   11100 N  N    . ILE A 1 124 ? 12.608  14.702 37.071 1.00 0.00 ? 124 ILE A N    4  
ATOM   11101 C  CA   . ILE A 1 124 ? 11.819  14.695 35.818 1.00 0.00 ? 124 ILE A CA   4  
ATOM   11102 C  C    . ILE A 1 124 ? 12.410  13.699 34.837 1.00 0.00 ? 124 ILE A C    4  
ATOM   11103 O  O    . ILE A 1 124 ? 11.704  12.888 34.270 1.00 0.00 ? 124 ILE A O    4  
ATOM   11104 C  CB   . ILE A 1 124 ? 11.874  16.094 35.196 1.00 0.00 ? 124 ILE A CB   4  
ATOM   11105 C  CG1  . ILE A 1 124 ? 11.532  17.153 36.244 1.00 0.00 ? 124 ILE A CG1  4  
ATOM   11106 C  CG2  . ILE A 1 124 ? 10.839  16.164 34.059 1.00 0.00 ? 124 ILE A CG2  4  
ATOM   11107 C  CD1  . ILE A 1 124 ? 10.063  17.016 36.664 1.00 0.00 ? 124 ILE A CD1  4  
ATOM   11108 H  H    . ILE A 1 124 ? 12.883  15.550 37.482 1.00 0.00 ? 124 ILE A H    4  
ATOM   11109 H  HA   . ILE A 1 124 ? 10.794  14.405 36.043 1.00 0.00 ? 124 ILE A HA   4  
ATOM   11110 H  HB   . ILE A 1 124 ? 12.881  16.277 34.816 1.00 0.00 ? 124 ILE A HB   4  
ATOM   11111 H  HG12 . ILE A 1 124 ? 12.167  17.027 37.107 1.00 0.00 ? 124 ILE A HG12 4  
ATOM   11112 H  HG13 . ILE A 1 124 ? 11.696  18.136 35.828 1.00 0.00 ? 124 ILE A HG13 4  
ATOM   11113 H  HG21 . ILE A 1 124 ? 9.973   15.573 34.317 1.00 0.00 ? 124 ILE A HG21 4  
ATOM   11114 H  HG22 . ILE A 1 124 ? 10.536  17.190 33.906 1.00 0.00 ? 124 ILE A HG22 4  
ATOM   11115 H  HG23 . ILE A 1 124 ? 11.271  15.782 33.148 1.00 0.00 ? 124 ILE A HG23 4  
ATOM   11116 H  HD11 . ILE A 1 124 ? 9.423   17.100 35.799 1.00 0.00 ? 124 ILE A HD11 4  
ATOM   11117 H  HD12 . ILE A 1 124 ? 9.905   16.058 37.132 1.00 0.00 ? 124 ILE A HD12 4  
ATOM   11118 H  HD13 . ILE A 1 124 ? 9.813   17.797 37.364 1.00 0.00 ? 124 ILE A HD13 4  
ATOM   11119 N  N    . VAL A 1 125 ? 13.699  13.776 34.651 1.00 0.00 ? 125 VAL A N    4  
ATOM   11120 C  CA   . VAL A 1 125 ? 14.351  12.840 33.712 1.00 0.00 ? 125 VAL A CA   4  
ATOM   11121 C  C    . VAL A 1 125 ? 14.067  11.406 34.127 1.00 0.00 ? 125 VAL A C    4  
ATOM   11122 O  O    . VAL A 1 125 ? 13.741  10.570 33.309 1.00 0.00 ? 125 VAL A O    4  
ATOM   11123 C  CB   . VAL A 1 125 ? 15.865  13.082 33.757 1.00 0.00 ? 125 VAL A CB   4  
ATOM   11124 C  CG1  . VAL A 1 125 ? 16.587  11.857 33.194 1.00 0.00 ? 125 VAL A CG1  4  
ATOM   11125 C  CG2  . VAL A 1 125 ? 16.205  14.305 32.901 1.00 0.00 ? 125 VAL A CG2  4  
ATOM   11126 H  H    . VAL A 1 125 ? 14.230  14.448 35.129 1.00 0.00 ? 125 VAL A H    4  
ATOM   11127 H  HA   . VAL A 1 125 ? 13.957  13.008 32.710 1.00 0.00 ? 125 VAL A HA   4  
ATOM   11128 H  HB   . VAL A 1 125 ? 16.176  13.253 34.775 1.00 0.00 ? 125 VAL A HB   4  
ATOM   11129 H  HG11 . VAL A 1 125 ? 16.023  11.447 32.369 1.00 0.00 ? 125 VAL A HG11 4  
ATOM   11130 H  HG12 . VAL A 1 125 ? 17.570  12.139 32.847 1.00 0.00 ? 125 VAL A HG12 4  
ATOM   11131 H  HG13 . VAL A 1 125 ? 16.685  11.106 33.965 1.00 0.00 ? 125 VAL A HG13 4  
ATOM   11132 H  HG21 . VAL A 1 125 ? 15.423  15.044 32.996 1.00 0.00 ? 125 VAL A HG21 4  
ATOM   11133 H  HG22 . VAL A 1 125 ? 17.140  14.732 33.232 1.00 0.00 ? 125 VAL A HG22 4  
ATOM   11134 H  HG23 . VAL A 1 125 ? 16.294  14.012 31.866 1.00 0.00 ? 125 VAL A HG23 4  
ATOM   11135 N  N    . THR A 1 126 ? 14.198  11.145 35.403 1.00 0.00 ? 126 THR A N    4  
ATOM   11136 C  CA   . THR A 1 126 ? 13.939  9.774  35.893 1.00 0.00 ? 126 THR A CA   4  
ATOM   11137 C  C    . THR A 1 126 ? 12.450  9.469  35.814 1.00 0.00 ? 126 THR A C    4  
ATOM   11138 O  O    . THR A 1 126 ? 12.049  8.449  35.292 1.00 0.00 ? 126 THR A O    4  
ATOM   11139 C  CB   . THR A 1 126 ? 14.390  9.685  37.354 1.00 0.00 ? 126 THR A CB   4  
ATOM   11140 O  OG1  . THR A 1 126 ? 15.796  9.822  37.319 1.00 0.00 ? 126 THR A OG1  4  
ATOM   11141 C  CG2  . THR A 1 126 ? 14.154  8.275  37.913 1.00 0.00 ? 126 THR A CG2  4  
ATOM   11142 H  H    . THR A 1 126 ? 14.465  11.851 36.028 1.00 0.00 ? 126 THR A H    4  
ATOM   11143 H  HA   . THR A 1 126 ? 14.483  9.063  35.271 1.00 0.00 ? 126 THR A HA   4  
ATOM   11144 H  HB   . THR A 1 126 ? 13.939  10.464 37.965 1.00 0.00 ? 126 THR A HB   4  
ATOM   11145 H  HG1  . THR A 1 126 ? 16.000  10.743 37.134 1.00 0.00 ? 126 THR A HG1  4  
ATOM   11146 H  HG21 . THR A 1 126 ? 14.687  7.551  37.315 1.00 0.00 ? 126 THR A HG21 4  
ATOM   11147 H  HG22 . THR A 1 126 ? 14.508  8.224  38.933 1.00 0.00 ? 126 THR A HG22 4  
ATOM   11148 H  HG23 . THR A 1 126 ? 13.099  8.046  37.890 1.00 0.00 ? 126 THR A HG23 4  
ATOM   11149 N  N    . ALA A 1 127 ? 11.653  10.367 36.336 1.00 0.00 ? 127 ALA A N    4  
ATOM   11150 C  CA   . ALA A 1 127 ? 10.190  10.145 36.297 1.00 0.00 ? 127 ALA A CA   4  
ATOM   11151 C  C    . ALA A 1 127 ? 9.780   9.697  34.902 1.00 0.00 ? 127 ALA A C    4  
ATOM   11152 O  O    . ALA A 1 127 ? 9.141   8.678  34.730 1.00 0.00 ? 127 ALA A O    4  
ATOM   11153 C  CB   . ALA A 1 127 ? 9.491   11.474 36.627 1.00 0.00 ? 127 ALA A CB   4  
ATOM   11154 H  H    . ALA A 1 127 ? 12.021  11.176 36.748 1.00 0.00 ? 127 ALA A H    4  
ATOM   11155 H  HA   . ALA A 1 127 ? 9.925   9.370  37.017 1.00 0.00 ? 127 ALA A HA   4  
ATOM   11156 H  HB1  . ALA A 1 127 ? 10.022  11.978 37.421 1.00 0.00 ? 127 ALA A HB1  4  
ATOM   11157 H  HB2  . ALA A 1 127 ? 9.479   12.107 35.752 1.00 0.00 ? 127 ALA A HB2  4  
ATOM   11158 H  HB3  . ALA A 1 127 ? 8.477   11.285 36.943 1.00 0.00 ? 127 ALA A HB3  4  
ATOM   11159 N  N    . ILE A 1 128 ? 10.146  10.476 33.928 1.00 0.00 ? 128 ILE A N    4  
ATOM   11160 C  CA   . ILE A 1 128 ? 9.789   10.107 32.541 1.00 0.00 ? 128 ILE A CA   4  
ATOM   11161 C  C    . ILE A 1 128 ? 10.252  8.681  32.252 1.00 0.00 ? 128 ILE A C    4  
ATOM   11162 O  O    . ILE A 1 128 ? 9.494   7.855  31.771 1.00 0.00 ? 128 ILE A O    4  
ATOM   11163 C  CB   . ILE A 1 128 ? 10.504  11.065 31.586 1.00 0.00 ? 128 ILE A CB   4  
ATOM   11164 C  CG1  . ILE A 1 128 ? 9.850   12.437 31.645 1.00 0.00 ? 128 ILE A CG1  4  
ATOM   11165 C  CG2  . ILE A 1 128 ? 10.372  10.519 30.155 1.00 0.00 ? 128 ILE A CG2  4  
ATOM   11166 C  CD1  . ILE A 1 128 ? 10.779  13.468 30.997 1.00 0.00 ? 128 ILE A CD1  4  
ATOM   11167 H  H    . ILE A 1 128 ? 10.640  11.304 34.113 1.00 0.00 ? 128 ILE A H    4  
ATOM   11168 H  HA   . ILE A 1 128 ? 8.707   10.165 32.422 1.00 0.00 ? 128 ILE A HA   4  
ATOM   11169 H  HB   . ILE A 1 128 ? 11.553  11.151 31.878 1.00 0.00 ? 128 ILE A HB   4  
ATOM   11170 H  HG12 . ILE A 1 128 ? 8.908   12.414 31.116 1.00 0.00 ? 128 ILE A HG12 4  
ATOM   11171 H  HG13 . ILE A 1 128 ? 9.668   12.709 32.674 1.00 0.00 ? 128 ILE A HG13 4  
ATOM   11172 H  HG21 . ILE A 1 128 ? 9.339   10.285 29.947 1.00 0.00 ? 128 ILE A HG21 4  
ATOM   11173 H  HG22 . ILE A 1 128 ? 10.718  11.260 29.449 1.00 0.00 ? 128 ILE A HG22 4  
ATOM   11174 H  HG23 . ILE A 1 128 ? 10.967  9.625  30.051 1.00 0.00 ? 128 ILE A HG23 4  
ATOM   11175 H  HD11 . ILE A 1 128 ? 11.802  13.265 31.279 1.00 0.00 ? 128 ILE A HD11 4  
ATOM   11176 H  HD12 . ILE A 1 128 ? 10.689  13.415 29.922 1.00 0.00 ? 128 ILE A HD12 4  
ATOM   11177 H  HD13 . ILE A 1 128 ? 10.510  14.461 31.328 1.00 0.00 ? 128 ILE A HD13 4  
ATOM   11178 N  N    . PHE A 1 129 ? 11.494  8.412  32.556 1.00 0.00 ? 129 PHE A N    4  
ATOM   11179 C  CA   . PHE A 1 129 ? 12.017  7.052  32.308 1.00 0.00 ? 129 PHE A CA   4  
ATOM   11180 C  C    . PHE A 1 129 ? 11.037  6.013  32.829 1.00 0.00 ? 129 PHE A C    4  
ATOM   11181 O  O    . PHE A 1 129 ? 10.854  4.971  32.229 1.00 0.00 ? 129 PHE A O    4  
ATOM   11182 C  CB   . PHE A 1 129 ? 13.358  6.900  33.047 1.00 0.00 ? 129 PHE A CB   4  
ATOM   11183 C  CG   . PHE A 1 129 ? 14.467  6.638  32.024 1.00 0.00 ? 129 PHE A CG   4  
ATOM   11184 C  CD1  . PHE A 1 129 ? 14.663  7.505  30.960 1.00 0.00 ? 129 PHE A CD1  4  
ATOM   11185 C  CD2  . PHE A 1 129 ? 15.289  5.530  32.146 1.00 0.00 ? 129 PHE A CD2  4  
ATOM   11186 C  CE1  . PHE A 1 129 ? 15.661  7.265  30.039 1.00 0.00 ? 129 PHE A CE1  4  
ATOM   11187 C  CE2  . PHE A 1 129 ? 16.285  5.293  31.221 1.00 0.00 ? 129 PHE A CE2  4  
ATOM   11188 C  CZ   . PHE A 1 129 ? 16.470  6.160  30.169 1.00 0.00 ? 129 PHE A CZ   4  
ATOM   11189 H  H    . PHE A 1 129 ? 12.070  9.103  32.946 1.00 0.00 ? 129 PHE A H    4  
ATOM   11190 H  HA   . PHE A 1 129 ? 12.147  6.912  31.234 1.00 0.00 ? 129 PHE A HA   4  
ATOM   11191 H  HB2  . PHE A 1 129 ? 13.580  7.805  33.591 1.00 0.00 ? 129 PHE A HB2  4  
ATOM   11192 H  HB3  . PHE A 1 129 ? 13.306  6.071  33.737 1.00 0.00 ? 129 PHE A HB3  4  
ATOM   11193 H  HD1  . PHE A 1 129 ? 14.029  8.372  30.852 1.00 0.00 ? 129 PHE A HD1  4  
ATOM   11194 H  HD2  . PHE A 1 129 ? 15.150  4.848  32.972 1.00 0.00 ? 129 PHE A HD2  4  
ATOM   11195 H  HE1  . PHE A 1 129 ? 15.805  7.943  29.212 1.00 0.00 ? 129 PHE A HE1  4  
ATOM   11196 H  HE2  . PHE A 1 129 ? 16.918  4.425  31.322 1.00 0.00 ? 129 PHE A HE2  4  
ATOM   11197 H  HZ   . PHE A 1 129 ? 17.252  5.974  29.447 1.00 0.00 ? 129 PHE A HZ   4  
ATOM   11198 N  N    . LYS A 1 130 ? 10.418  6.314  33.943 1.00 0.00 ? 130 LYS A N    4  
ATOM   11199 C  CA   . LYS A 1 130 ? 9.448   5.351  34.508 1.00 0.00 ? 130 LYS A CA   4  
ATOM   11200 C  C    . LYS A 1 130 ? 8.304   5.145  33.531 1.00 0.00 ? 130 LYS A C    4  
ATOM   11201 O  O    . LYS A 1 130 ? 7.913   4.028  33.259 1.00 0.00 ? 130 LYS A O    4  
ATOM   11202 C  CB   . LYS A 1 130 ? 8.898   5.916  35.829 1.00 0.00 ? 130 LYS A CB   4  
ATOM   11203 C  CG   . LYS A 1 130 ? 9.081   4.872  36.931 1.00 0.00 ? 130 LYS A CG   4  
ATOM   11204 C  CD   . LYS A 1 130 ? 10.533  4.906  37.414 1.00 0.00 ? 130 LYS A CD   4  
ATOM   11205 C  CE   . LYS A 1 130 ? 10.680  3.989  38.627 1.00 0.00 ? 130 LYS A CE   4  
ATOM   11206 N  NZ   . LYS A 1 130 ? 12.096  3.961  39.091 1.00 0.00 ? 130 LYS A NZ   4  
ATOM   11207 H  H    . LYS A 1 130 ? 10.595  7.164  34.397 1.00 0.00 ? 130 LYS A H    4  
ATOM   11208 H  HA   . LYS A 1 130 ? 9.948   4.396  34.671 1.00 0.00 ? 130 LYS A HA   4  
ATOM   11209 H  HB2  . LYS A 1 130 ? 9.435   6.811  36.092 1.00 0.00 ? 130 LYS A HB2  4  
ATOM   11210 H  HB3  . LYS A 1 130 ? 7.849   6.149  35.718 1.00 0.00 ? 130 LYS A HB3  4  
ATOM   11211 H  HG2  . LYS A 1 130 ? 8.419   5.093  37.754 1.00 0.00 ? 130 LYS A HG2  4  
ATOM   11212 H  HG3  . LYS A 1 130 ? 8.850   3.890  36.544 1.00 0.00 ? 130 LYS A HG3  4  
ATOM   11213 H  HD2  . LYS A 1 130 ? 11.187  4.570  36.623 1.00 0.00 ? 130 LYS A HD2  4  
ATOM   11214 H  HD3  . LYS A 1 130 ? 10.800  5.917  37.689 1.00 0.00 ? 130 LYS A HD3  4  
ATOM   11215 H  HE2  . LYS A 1 130 ? 10.052  4.346  39.430 1.00 0.00 ? 130 LYS A HE2  4  
ATOM   11216 H  HE3  . LYS A 1 130 ? 10.376  2.988  38.361 1.00 0.00 ? 130 LYS A HE3  4  
ATOM   11217 H  HZ1  . LYS A 1 130 ? 12.525  4.897  38.950 1.00 0.00 ? 130 LYS A HZ1  4  
ATOM   11218 H  HZ2  . LYS A 1 130 ? 12.125  3.715  40.101 1.00 0.00 ? 130 LYS A HZ2  4  
ATOM   11219 H  HZ3  . LYS A 1 130 ? 12.624  3.251  38.545 1.00 0.00 ? 130 LYS A HZ3  4  
ATOM   11220 N  N    . MET A 1 131 ? 7.779   6.229  33.012 1.00 0.00 ? 131 MET A N    4  
ATOM   11221 C  CA   . MET A 1 131 ? 6.660   6.088  32.048 1.00 0.00 ? 131 MET A CA   4  
ATOM   11222 C  C    . MET A 1 131 ? 7.066   5.114  30.953 1.00 0.00 ? 131 MET A C    4  
ATOM   11223 O  O    . MET A 1 131 ? 6.237   4.536  30.290 1.00 0.00 ? 131 MET A O    4  
ATOM   11224 C  CB   . MET A 1 131 ? 6.376   7.454  31.396 1.00 0.00 ? 131 MET A CB   4  
ATOM   11225 C  CG   . MET A 1 131 ? 5.828   8.415  32.443 1.00 0.00 ? 131 MET A CG   4  
ATOM   11226 S  SD   . MET A 1 131 ? 4.995   9.905  31.846 1.00 0.00 ? 131 MET A SD   4  
ATOM   11227 C  CE   . MET A 1 131 ? 3.784   9.076  30.783 1.00 0.00 ? 131 MET A CE   4  
ATOM   11228 H  H    . MET A 1 131 ? 8.119   7.120  33.259 1.00 0.00 ? 131 MET A H    4  
ATOM   11229 H  HA   . MET A 1 131 ? 5.771   5.700  32.576 1.00 0.00 ? 131 MET A HA   4  
ATOM   11230 H  HB2  . MET A 1 131 ? 7.285   7.852  30.979 1.00 0.00 ? 131 MET A HB2  4  
ATOM   11231 H  HB3  . MET A 1 131 ? 5.650   7.332  30.605 1.00 0.00 ? 131 MET A HB3  4  
ATOM   11232 H  HG2  . MET A 1 131 ? 5.131   7.875  33.054 1.00 0.00 ? 131 MET A HG2  4  
ATOM   11233 H  HG3  . MET A 1 131 ? 6.647   8.727  33.076 1.00 0.00 ? 131 MET A HG3  4  
ATOM   11234 H  HE1  . MET A 1 131 ? 3.471   8.153  31.247 1.00 0.00 ? 131 MET A HE1  4  
ATOM   11235 H  HE2  . MET A 1 131 ? 2.928   9.718  30.644 1.00 0.00 ? 131 MET A HE2  4  
ATOM   11236 H  HE3  . MET A 1 131 ? 4.233   8.863  29.825 1.00 0.00 ? 131 MET A HE3  4  
ATOM   11237 N  N    . ILE A 1 132 ? 8.356   4.976  30.773 1.00 0.00 ? 132 ILE A N    4  
ATOM   11238 C  CA   . ILE A 1 132 ? 8.856   4.046  29.728 1.00 0.00 ? 132 ILE A CA   4  
ATOM   11239 C  C    . ILE A 1 132 ? 9.195   2.691  30.340 1.00 0.00 ? 132 ILE A C    4  
ATOM   11240 O  O    . ILE A 1 132 ? 10.122  2.574  31.116 1.00 0.00 ? 132 ILE A O    4  
ATOM   11241 C  CB   . ILE A 1 132 ? 10.128  4.637  29.120 1.00 0.00 ? 132 ILE A CB   4  
ATOM   11242 C  CG1  . ILE A 1 132 ? 9.865   6.062  28.659 1.00 0.00 ? 132 ILE A CG1  4  
ATOM   11243 C  CG2  . ILE A 1 132 ? 10.526  3.792  27.898 1.00 0.00 ? 132 ILE A CG2  4  
ATOM   11244 C  CD1  . ILE A 1 132 ? 11.143  6.630  28.038 1.00 0.00 ? 132 ILE A CD1  4  
ATOM   11245 H  H    . ILE A 1 132 ? 8.989   5.497  31.315 1.00 0.00 ? 132 ILE A H    4  
ATOM   11246 H  HA   . ILE A 1 132 ? 8.087   3.915  28.972 1.00 0.00 ? 132 ILE A HA   4  
ATOM   11247 H  HB   . ILE A 1 132 ? 10.921  4.637  29.869 1.00 0.00 ? 132 ILE A HB   4  
ATOM   11248 H  HG12 . ILE A 1 132 ? 9.072   6.065  27.926 1.00 0.00 ? 132 ILE A HG12 4  
ATOM   11249 H  HG13 . ILE A 1 132 ? 9.571   6.668  29.503 1.00 0.00 ? 132 ILE A HG13 4  
ATOM   11250 H  HG21 . ILE A 1 132 ? 10.568  2.749  28.173 1.00 0.00 ? 132 ILE A HG21 4  
ATOM   11251 H  HG22 . ILE A 1 132 ? 9.797   3.924  27.111 1.00 0.00 ? 132 ILE A HG22 4  
ATOM   11252 H  HG23 . ILE A 1 132 ? 11.497  4.103  27.540 1.00 0.00 ? 132 ILE A HG23 4  
ATOM   11253 H  HD11 . ILE A 1 132 ? 11.997  6.344  28.635 1.00 0.00 ? 132 ILE A HD11 4  
ATOM   11254 H  HD12 . ILE A 1 132 ? 11.263  6.246  27.036 1.00 0.00 ? 132 ILE A HD12 4  
ATOM   11255 H  HD13 . ILE A 1 132 ? 11.082  7.708  28.001 1.00 0.00 ? 132 ILE A HD13 4  
ATOM   11256 N  N    . SER A 1 133 ? 8.441   1.689  29.980 1.00 0.00 ? 133 SER A N    4  
ATOM   11257 C  CA   . SER A 1 133 ? 8.712   0.340  30.536 1.00 0.00 ? 133 SER A CA   4  
ATOM   11258 C  C    . SER A 1 133 ? 10.210  -0.003 30.423 1.00 0.00 ? 133 SER A C    4  
ATOM   11259 O  O    . SER A 1 133 ? 10.828  0.259  29.412 1.00 0.00 ? 133 SER A O    4  
ATOM   11260 C  CB   . SER A 1 133 ? 7.910   -0.684 29.719 1.00 0.00 ? 133 SER A CB   4  
ATOM   11261 O  OG   . SER A 1 133 ? 8.287   -1.938 30.269 1.00 0.00 ? 133 SER A OG   4  
ATOM   11262 H  H    . SER A 1 133 ? 7.704   1.825  29.348 1.00 0.00 ? 133 SER A H    4  
ATOM   11263 H  HA   . SER A 1 133 ? 8.405   0.331  31.573 1.00 0.00 ? 133 SER A HA   4  
ATOM   11264 H  HB2  . SER A 1 133 ? 6.849   -0.526 29.841 1.00 0.00 ? 133 SER A HB2  4  
ATOM   11265 H  HB3  . SER A 1 133 ? 8.180   -0.638 28.675 1.00 0.00 ? 133 SER A HB3  4  
ATOM   11266 H  HG   . SER A 1 133 ? 8.887   -2.364 29.652 1.00 0.00 ? 133 SER A HG   4  
ATOM   11267 N  N    . PRO A 1 134 ? 10.767  -0.601 31.474 1.00 0.00 ? 134 PRO A N    4  
ATOM   11268 C  CA   . PRO A 1 134 ? 12.181  -0.974 31.480 1.00 0.00 ? 134 PRO A CA   4  
ATOM   11269 C  C    . PRO A 1 134 ? 12.534  -1.854 30.294 1.00 0.00 ? 134 PRO A C    4  
ATOM   11270 O  O    . PRO A 1 134 ? 13.393  -1.517 29.504 1.00 0.00 ? 134 PRO A O    4  
ATOM   11271 C  CB   . PRO A 1 134 ? 12.377  -1.776 32.782 1.00 0.00 ? 134 PRO A CB   4  
ATOM   11272 C  CG   . PRO A 1 134 ? 11.016  -1.761 33.544 1.00 0.00 ? 134 PRO A CG   4  
ATOM   11273 C  CD   . PRO A 1 134 ? 10.027  -0.948 32.693 1.00 0.00 ? 134 PRO A CD   4  
ATOM   11274 H  HA   . PRO A 1 134 ? 12.798  -0.081 31.475 1.00 0.00 ? 134 PRO A HA   4  
ATOM   11275 H  HB2  . PRO A 1 134 ? 12.658  -2.795 32.549 1.00 0.00 ? 134 PRO A HB2  4  
ATOM   11276 H  HB3  . PRO A 1 134 ? 13.144  -1.319 33.385 1.00 0.00 ? 134 PRO A HB3  4  
ATOM   11277 H  HG2  . PRO A 1 134 ? 10.652  -2.771 33.670 1.00 0.00 ? 134 PRO A HG2  4  
ATOM   11278 H  HG3  . PRO A 1 134 ? 11.139  -1.297 34.512 1.00 0.00 ? 134 PRO A HG3  4  
ATOM   11279 H  HD2  . PRO A 1 134 ? 9.159   -1.540 32.445 1.00 0.00 ? 134 PRO A HD2  4  
ATOM   11280 H  HD3  . PRO A 1 134 ? 9.734   -0.050 33.217 1.00 0.00 ? 134 PRO A HD3  4  
ATOM   11281 N  N    . GLU A 1 135 ? 11.868  -2.973 30.194 1.00 0.00 ? 135 GLU A N    4  
ATOM   11282 C  CA   . GLU A 1 135 ? 12.151  -3.890 29.067 1.00 0.00 ? 135 GLU A CA   4  
ATOM   11283 C  C    . GLU A 1 135 ? 12.317  -3.111 27.770 1.00 0.00 ? 135 GLU A C    4  
ATOM   11284 O  O    . GLU A 1 135 ? 13.016  -3.536 26.872 1.00 0.00 ? 135 GLU A O    4  
ATOM   11285 C  CB   . GLU A 1 135 ? 10.970  -4.861 28.921 1.00 0.00 ? 135 GLU A CB   4  
ATOM   11286 C  CG   . GLU A 1 135 ? 11.194  -6.061 29.845 1.00 0.00 ? 135 GLU A CG   4  
ATOM   11287 C  CD   . GLU A 1 135 ? 11.161  -5.592 31.301 1.00 0.00 ? 135 GLU A CD   4  
ATOM   11288 O  OE1  . GLU A 1 135 ? 10.162  -4.986 31.651 1.00 0.00 ? 135 GLU A OE1  4  
ATOM   11289 O  OE2  . GLU A 1 135 ? 12.136  -5.867 31.980 1.00 0.00 ? 135 GLU A OE2  4  
ATOM   11290 H  H    . GLU A 1 135 ? 11.185  -3.203 30.860 1.00 0.00 ? 135 GLU A H    4  
ATOM   11291 H  HA   . GLU A 1 135 ? 13.072  -4.429 29.279 1.00 0.00 ? 135 GLU A HA   4  
ATOM   11292 H  HB2  . GLU A 1 135 ? 10.053  -4.361 29.192 1.00 0.00 ? 135 GLU A HB2  4  
ATOM   11293 H  HB3  . GLU A 1 135 ? 10.901  -5.198 27.897 1.00 0.00 ? 135 GLU A HB3  4  
ATOM   11294 H  HG2  . GLU A 1 135 ? 10.416  -6.794 29.688 1.00 0.00 ? 135 GLU A HG2  4  
ATOM   11295 H  HG3  . GLU A 1 135 ? 12.154  -6.510 29.636 1.00 0.00 ? 135 GLU A HG3  4  
ATOM   11296 N  N    . ASP A 1 136 ? 11.669  -1.980 27.698 1.00 0.00 ? 136 ASP A N    4  
ATOM   11297 C  CA   . ASP A 1 136 ? 11.776  -1.158 26.475 1.00 0.00 ? 136 ASP A CA   4  
ATOM   11298 C  C    . ASP A 1 136 ? 12.886  -0.131 26.628 1.00 0.00 ? 136 ASP A C    4  
ATOM   11299 O  O    . ASP A 1 136 ? 13.497  0.277  25.660 1.00 0.00 ? 136 ASP A O    4  
ATOM   11300 C  CB   . ASP A 1 136 ? 10.446  -0.421 26.266 1.00 0.00 ? 136 ASP A CB   4  
ATOM   11301 C  CG   . ASP A 1 136 ? 10.443  0.230  24.881 1.00 0.00 ? 136 ASP A CG   4  
ATOM   11302 O  OD1  . ASP A 1 136 ? 10.537  -0.525 23.927 1.00 0.00 ? 136 ASP A OD1  4  
ATOM   11303 O  OD2  . ASP A 1 136 ? 10.347  1.447  24.854 1.00 0.00 ? 136 ASP A OD2  4  
ATOM   11304 H  H    . ASP A 1 136 ? 11.117  -1.681 28.445 1.00 0.00 ? 136 ASP A H    4  
ATOM   11305 H  HA   . ASP A 1 136 ? 12.000  -1.805 25.631 1.00 0.00 ? 136 ASP A HA   4  
ATOM   11306 H  HB2  . ASP A 1 136 ? 9.624   -1.118 26.334 1.00 0.00 ? 136 ASP A HB2  4  
ATOM   11307 H  HB3  . ASP A 1 136 ? 10.329  0.345  27.019 1.00 0.00 ? 136 ASP A HB3  4  
ATOM   11308 N  N    . THR A 1 137 ? 13.126  0.271  27.848 1.00 0.00 ? 137 THR A N    4  
ATOM   11309 C  CA   . THR A 1 137 ? 14.190  1.271  28.087 1.00 0.00 ? 137 THR A CA   4  
ATOM   11310 C  C    . THR A 1 137 ? 15.568  0.629  28.019 1.00 0.00 ? 137 THR A C    4  
ATOM   11311 O  O    . THR A 1 137 ? 16.576  1.308  28.025 1.00 0.00 ? 137 THR A O    4  
ATOM   11312 C  CB   . THR A 1 137 ? 14.009  1.843  29.475 1.00 0.00 ? 137 THR A CB   4  
ATOM   11313 O  OG1  . THR A 1 137 ? 12.616  1.862  29.704 1.00 0.00 ? 137 THR A OG1  4  
ATOM   11314 C  CG2  . THR A 1 137 ? 14.430  3.314  29.515 1.00 0.00 ? 137 THR A CG2  4  
ATOM   11315 H  H    . THR A 1 137 ? 12.605  -0.086 28.596 1.00 0.00 ? 137 THR A H    4  
ATOM   11316 H  HA   . THR A 1 137 ? 14.118  2.046  27.343 1.00 0.00 ? 137 THR A HA   4  
ATOM   11317 H  HB   . THR A 1 137 ? 14.514  1.247  30.209 1.00 0.00 ? 137 THR A HB   4  
ATOM   11318 H  HG1  . THR A 1 137 ? 12.306  0.953  29.715 1.00 0.00 ? 137 THR A HG1  4  
ATOM   11319 H  HG21 . THR A 1 137 ? 15.468  3.403  29.228 1.00 0.00 ? 137 THR A HG21 4  
ATOM   11320 H  HG22 . THR A 1 137 ? 13.821  3.885  28.831 1.00 0.00 ? 137 THR A HG22 4  
ATOM   11321 H  HG23 . THR A 1 137 ? 14.303  3.701  30.514 1.00 0.00 ? 137 THR A HG23 4  
ATOM   11322 N  N    . LYS A 1 138 ? 15.588  -0.669 27.976 1.00 0.00 ? 138 LYS A N    4  
ATOM   11323 C  CA   . LYS A 1 138 ? 16.887  -1.375 27.908 1.00 0.00 ? 138 LYS A CA   4  
ATOM   11324 C  C    . LYS A 1 138 ? 17.365  -1.477 26.467 1.00 0.00 ? 138 LYS A C    4  
ATOM   11325 O  O    . LYS A 1 138 ? 18.436  -1.987 26.199 1.00 0.00 ? 138 LYS A O    4  
ATOM   11326 C  CB   . LYS A 1 138 ? 16.697  -2.794 28.473 1.00 0.00 ? 138 LYS A CB   4  
ATOM   11327 C  CG   . LYS A 1 138 ? 18.034  -3.301 29.021 1.00 0.00 ? 138 LYS A CG   4  
ATOM   11328 C  CD   . LYS A 1 138 ? 17.995  -4.829 29.117 1.00 0.00 ? 138 LYS A CD   4  
ATOM   11329 C  CE   . LYS A 1 138 ? 17.199  -5.238 30.360 1.00 0.00 ? 138 LYS A CE   4  
ATOM   11330 N  NZ   . LYS A 1 138 ? 17.749  -4.576 31.576 1.00 0.00 ? 138 LYS A NZ   4  
ATOM   11331 H  H    . LYS A 1 138 ? 14.752  -1.174 27.992 1.00 0.00 ? 138 LYS A H    4  
ATOM   11332 H  HA   . LYS A 1 138 ? 17.622  -0.821 28.489 1.00 0.00 ? 138 LYS A HA   4  
ATOM   11333 H  HB2  . LYS A 1 138 ? 15.965  -2.773 29.267 1.00 0.00 ? 138 LYS A HB2  4  
ATOM   11334 H  HB3  . LYS A 1 138 ? 16.353  -3.453 27.692 1.00 0.00 ? 138 LYS A HB3  4  
ATOM   11335 H  HG2  . LYS A 1 138 ? 18.835  -2.999 28.361 1.00 0.00 ? 138 LYS A HG2  4  
ATOM   11336 H  HG3  . LYS A 1 138 ? 18.208  -2.879 30.001 1.00 0.00 ? 138 LYS A HG3  4  
ATOM   11337 H  HD2  . LYS A 1 138 ? 17.525  -5.236 28.235 1.00 0.00 ? 138 LYS A HD2  4  
ATOM   11338 H  HD3  . LYS A 1 138 ? 19.003  -5.214 29.190 1.00 0.00 ? 138 LYS A HD3  4  
ATOM   11339 H  HE2  . LYS A 1 138 ? 16.166  -4.949 30.238 1.00 0.00 ? 138 LYS A HE2  4  
ATOM   11340 H  HE3  . LYS A 1 138 ? 17.252  -6.310 30.487 1.00 0.00 ? 138 LYS A HE3  4  
ATOM   11341 H  HZ1  . LYS A 1 138 ? 18.728  -4.273 31.393 1.00 0.00 ? 138 LYS A HZ1  4  
ATOM   11342 H  HZ2  . LYS A 1 138 ? 17.169  -3.747 31.812 1.00 0.00 ? 138 LYS A HZ2  4  
ATOM   11343 H  HZ3  . LYS A 1 138 ? 17.736  -5.246 32.371 1.00 0.00 ? 138 LYS A HZ3  4  
ATOM   11344 N  N    . HIS A 1 139 ? 16.558  -0.986 25.560 1.00 0.00 ? 139 HIS A N    4  
ATOM   11345 C  CA   . HIS A 1 139 ? 16.942  -1.041 24.126 1.00 0.00 ? 139 HIS A CA   4  
ATOM   11346 C  C    . HIS A 1 139 ? 17.530  0.288  23.660 1.00 0.00 ? 139 HIS A C    4  
ATOM   11347 O  O    . HIS A 1 139 ? 18.014  0.396  22.552 1.00 0.00 ? 139 HIS A O    4  
ATOM   11348 C  CB   . HIS A 1 139 ? 15.679  -1.334 23.300 1.00 0.00 ? 139 HIS A CB   4  
ATOM   11349 C  CG   . HIS A 1 139 ? 15.109  -2.695 23.707 1.00 0.00 ? 139 HIS A CG   4  
ATOM   11350 N  ND1  . HIS A 1 139 ? 15.752  -3.597 24.283 1.00 0.00 ? 139 HIS A ND1  4  
ATOM   11351 C  CD2  . HIS A 1 139 ? 13.834  -3.203 23.537 1.00 0.00 ? 139 HIS A CD2  4  
ATOM   11352 C  CE1  . HIS A 1 139 ? 15.031  -4.619 24.496 1.00 0.00 ? 139 HIS A CE1  4  
ATOM   11353 N  NE2  . HIS A 1 139 ? 13.784  -4.463 24.052 1.00 0.00 ? 139 HIS A NE2  4  
ATOM   11354 H  H    . HIS A 1 139 ? 15.706  -0.583 25.826 1.00 0.00 ? 139 HIS A H    4  
ATOM   11355 H  HA   . HIS A 1 139 ? 17.683  -1.826 23.986 1.00 0.00 ? 139 HIS A HA   4  
ATOM   11356 H  HB2  . HIS A 1 139 ? 14.940  -0.569 23.478 1.00 0.00 ? 139 HIS A HB2  4  
ATOM   11357 H  HB3  . HIS A 1 139 ? 15.927  -1.352 22.248 1.00 0.00 ? 139 HIS A HB3  4  
ATOM   11358 H  HD1  . HIS A 1 139 ? 16.695  -3.524 24.539 1.00 0.00 ? 139 HIS A HD1  4  
ATOM   11359 H  HD2  . HIS A 1 139 ? 13.010  -2.685 23.068 1.00 0.00 ? 139 HIS A HD2  4  
ATOM   11360 H  HE1  . HIS A 1 139 ? 15.387  -5.515 24.981 1.00 0.00 ? 139 HIS A HE1  4  
ATOM   11361 N  N    . LEU A 1 140 ? 17.479  1.279  24.512 1.00 0.00 ? 140 LEU A N    4  
ATOM   11362 C  CA   . LEU A 1 140 ? 18.030  2.591  24.125 1.00 0.00 ? 140 LEU A CA   4  
ATOM   11363 C  C    . LEU A 1 140 ? 19.503  2.449  23.681 1.00 0.00 ? 140 LEU A C    4  
ATOM   11364 O  O    . LEU A 1 140 ? 20.269  1.745  24.309 1.00 0.00 ? 140 LEU A O    4  
ATOM   11365 C  CB   . LEU A 1 140 ? 17.982  3.490  25.366 1.00 0.00 ? 140 LEU A CB   4  
ATOM   11366 C  CG   . LEU A 1 140 ? 16.523  3.864  25.725 1.00 0.00 ? 140 LEU A CG   4  
ATOM   11367 C  CD1  . LEU A 1 140 ? 16.143  5.151  24.992 1.00 0.00 ? 140 LEU A CD1  4  
ATOM   11368 C  CD2  . LEU A 1 140 ? 15.533  2.752  25.337 1.00 0.00 ? 140 LEU A CD2  4  
ATOM   11369 H  H    . LEU A 1 140 ? 17.083  1.158  25.401 1.00 0.00 ? 140 LEU A H    4  
ATOM   11370 H  HA   . LEU A 1 140 ? 17.438  3.004  23.321 1.00 0.00 ? 140 LEU A HA   4  
ATOM   11371 H  HB2  . LEU A 1 140 ? 18.428  2.969  26.197 1.00 0.00 ? 140 LEU A HB2  4  
ATOM   11372 H  HB3  . LEU A 1 140 ? 18.546  4.392  25.177 1.00 0.00 ? 140 LEU A HB3  4  
ATOM   11373 H  HG   . LEU A 1 140 ? 16.460  4.020  26.780 1.00 0.00 ? 140 LEU A HG   4  
ATOM   11374 H  HD11 . LEU A 1 140 ? 16.842  5.935  25.247 1.00 0.00 ? 140 LEU A HD11 4  
ATOM   11375 H  HD12 . LEU A 1 140 ? 16.169  4.985  23.925 1.00 0.00 ? 140 LEU A HD12 4  
ATOM   11376 H  HD13 . LEU A 1 140 ? 15.148  5.457  25.280 1.00 0.00 ? 140 LEU A HD13 4  
ATOM   11377 H  HD21 . LEU A 1 140 ? 15.616  2.521  24.299 1.00 0.00 ? 140 LEU A HD21 4  
ATOM   11378 H  HD22 . LEU A 1 140 ? 15.731  1.866  25.916 1.00 0.00 ? 140 LEU A HD22 4  
ATOM   11379 H  HD23 . LEU A 1 140 ? 14.526  3.085  25.539 1.00 0.00 ? 140 LEU A HD23 4  
ATOM   11380 N  N    . PRO A 1 141 ? 19.874  3.125  22.597 1.00 0.00 ? 141 PRO A N    4  
ATOM   11381 C  CA   . PRO A 1 141 ? 21.245  3.060  22.094 1.00 0.00 ? 141 PRO A CA   4  
ATOM   11382 C  C    . PRO A 1 141 ? 22.241  3.532  23.152 1.00 0.00 ? 141 PRO A C    4  
ATOM   11383 O  O    . PRO A 1 141 ? 21.892  4.286  24.037 1.00 0.00 ? 141 PRO A O    4  
ATOM   11384 C  CB   . PRO A 1 141 ? 21.275  4.028  20.889 1.00 0.00 ? 141 PRO A CB   4  
ATOM   11385 C  CG   . PRO A 1 141 ? 19.852  4.653  20.761 1.00 0.00 ? 141 PRO A CG   4  
ATOM   11386 C  CD   . PRO A 1 141 ? 18.964  3.986  21.825 1.00 0.00 ? 141 PRO A CD   4  
ATOM   11387 H  HA   . PRO A 1 141 ? 21.479  2.045  21.788 1.00 0.00 ? 141 PRO A HA   4  
ATOM   11388 H  HB2  . PRO A 1 141 ? 22.005  4.806  21.058 1.00 0.00 ? 141 PRO A HB2  4  
ATOM   11389 H  HB3  . PRO A 1 141 ? 21.524  3.489  19.987 1.00 0.00 ? 141 PRO A HB3  4  
ATOM   11390 H  HG2  . PRO A 1 141 ? 19.899  5.718  20.934 1.00 0.00 ? 141 PRO A HG2  4  
ATOM   11391 H  HG3  . PRO A 1 141 ? 19.452  4.464  19.775 1.00 0.00 ? 141 PRO A HG3  4  
ATOM   11392 H  HD2  . PRO A 1 141 ? 18.517  4.728  22.470 1.00 0.00 ? 141 PRO A HD2  4  
ATOM   11393 H  HD3  . PRO A 1 141 ? 18.200  3.389  21.350 1.00 0.00 ? 141 PRO A HD3  4  
ATOM   11394 N  N    . GLU A 1 142 ? 23.461  3.080  23.045 1.00 0.00 ? 142 GLU