data_1JUN
# 
_entry.id   1JUN 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1JUN         
WWPDB D_1000174376 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1JUN 
_pdbx_database_status.recvd_initial_deposition_date   1995-12-19 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Junius, F.K.'     1 
;O'Donoghue, S.I.
;
2 
'Nilges, M.'       3 
'King, G.F.'       4 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'High resolution NMR solution structure of the leucine zipper domain of the c-Jun homodimer.' J.Biol.Chem.      271 13663 
13667 1996 JBCHA3 US 0021-9258 0071 ?                                        8662824 10.1074/jbc.271.23.13663 
1       
;Calculation of Symmetric Multimer Structures from NMR Data Using a Priori Knowledge of the Monomer Structure, Co-Monomer Restraints, and Interface Mapping: The Case of Leucine Zippers
;
'To be Published' ?   ?     ?     ?    ?      ?  ?         0353 ?                                        ?       ? 
2       'Structural Studies of the Leucine Zipper Domain of the Oncoprotein C-Jun' Thesis            ?   ?     ?     1995 ?      
AT ?         2081 'Sydney : University of Sydney (Thesis)' ?       ?                        
3       
;Nuclear Magnetic Resonance Characterization of the Jun Leucine Zipper Domain: Unusual Properties of Coiled-Coil Interfacial Polar Residues
;
Biochemistry      34  6164  ?     1995 BICHAW US 0006-2960 0033 ?                                        ?       ? 
4       'The Solution Structure of the Leucine Zipper Motif of the Jun Oncoprotein Homodimer' Eur.J.Biochem.    214 415   ?     
1993 EJBCAI IX 0014-2956 0262 ?                                        ?       ?                        
5       
;Determination of the Structure of Symmetric Coiled-Coil Proteins from NMR Data: Application of the Leucine Zipper Proteins Jun and GCN4
;
'Protein Eng.'    6   557   ?     1993 PRENE9 UK 0269-2139 0859 ?                                        ?       ? 
6       'Preferential Heterodimer Formation by Isolated Leucine Zippers from Fos and Jun' Science           245 646   ?     1989 
SCIEAS US 0036-8075 0038 ?                                        ?       ?                        
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Junius, F.K.'       1  
primary 
;O'Donoghue, S.I.
;
2  
primary 'Nilges, M.'         3  
primary 'Weiss, A.S.'        4  
primary 'King, G.F.'         5  
1       
;O'Donoghue, S.I.
;
6  
1       'King, G.F.'         7  
1       'Nilges, M.'         8  
2       'Junius, F.K.'       9  
3       'Junius, F.K.'       10 
3       'Mackay, J.P.'       11 
3       'Bubb, W.A.'         12 
3       'Jensen, S.A.'       13 
3       'Weiss, A.S.'        14 
3       'King, G.F.'         15 
4       'Junius, F.K.'       16 
4       'Weiss, A.S.'        17 
4       'King, G.F.'         18 
5       
;O'Donoghue, S.I.
;
19 
5       'Junius, F.K.'       20 
5       'King, G.F.'         21 
6       
;O'Shea, E.K.
;
22 
6       'Rutkowski, R.'      23 
6       'Stafford III, W.F.' 24 
6       'Kim, P.S.'          25 
# 
_cell.entry_id           1JUN 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1JUN 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'C-JUN HOMODIMER' 
_entity.formula_weight             4883.714 
_entity.pdbx_number_of_molecules   2 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              'INS(272-275), INS(315)' 
_entity.pdbx_fragment              'LEUCINE ZIPPER DOMAIN, RESIDUES 272 - 315' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'JUNLZ, JUNP1N' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       '(ACE)CGGRIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNY' 
_entity_poly.pdbx_seq_one_letter_code_can   XCGGRIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNY 
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  ACE n 
1 2  CYS n 
1 3  GLY n 
1 4  GLY n 
1 5  ARG n 
1 6  ILE n 
1 7  ALA n 
1 8  ARG n 
1 9  LEU n 
1 10 GLU n 
1 11 GLU n 
1 12 LYS n 
1 13 VAL n 
1 14 LYS n 
1 15 THR n 
1 16 LEU n 
1 17 LYS n 
1 18 ALA n 
1 19 GLN n 
1 20 ASN n 
1 21 SER n 
1 22 GLU n 
1 23 LEU n 
1 24 ALA n 
1 25 SER n 
1 26 THR n 
1 27 ALA n 
1 28 ASN n 
1 29 MET n 
1 30 LEU n 
1 31 ARG n 
1 32 GLU n 
1 33 GLN n 
1 34 VAL n 
1 35 ALA n 
1 36 GLN n 
1 37 LEU n 
1 38 LYS n 
1 39 GLN n 
1 40 LYS n 
1 41 VAL n 
1 42 MET n 
1 43 ASN n 
1 44 TYR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    AP1_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P05412 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   MCGGRIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNY 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1JUN A 2 ? 44 ? P05412 2 ? 44 ? 273 315 
2 1 1JUN B 2 ? 44 ? P05412 2 ? 44 ? 273 315 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACE non-polymer         . 'ACETYL GROUP'  ? 'C2 H4 O'        44.053  
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         310 
_pdbx_nmr_exptl_sample_conditions.pressure            ? 
_pdbx_nmr_exptl_sample_conditions.pH                  3.6 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_ensemble.entry_id                             1JUN 
_pdbx_nmr_ensemble.conformers_calculated_total_number   ? 
_pdbx_nmr_ensemble.conformers_submitted_total_number    7 
_pdbx_nmr_ensemble.conformer_selection_criteria         ? 
# 
_pdbx_nmr_software.classification   refinement 
_pdbx_nmr_software.name             X-PLOR 
_pdbx_nmr_software.version          3.1 
_pdbx_nmr_software.authors          BRUNGER 
_pdbx_nmr_software.ordinal          1 
# 
_exptl.entry_id          1JUN 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  1JUN 
_struct.title                     'NMR STUDY OF C-JUN HOMODIMER' 
_struct.pdbx_descriptor           'C-JUN HOMODIMER' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1JUN 
_struct_keywords.pdbx_keywords   'TRANSCRIPTION REGULATION' 
_struct_keywords.text            
'TRANSCRIPTION REGULATION, DNA-BINDING REGULATORY PROTEIN, ONCOGENE PROTEIN, TRANSCRIPTION ACTIVATION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ARG A 5 ? VAL A 41 ? ARG A 276 VAL A 312 1 ? 37 
HELX_P HELX_P2 2 ARG B 5 ? VAL B 41 ? ARG B 276 VAL B 312 1 ? 37 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 2 SG ? ? ? 1_555 B CYS 2 SG ? ? A CYS 273 B CYS 273 1_555 ? ? ? ? ? ? ? 2.020 ? 
covale1 covale ? ? A ACE 1 C  ? ? ? 1_555 A CYS 2 N  ? ? A ACE 272 A CYS 273 1_555 ? ? ? ? ? ? ? 1.304 ? 
covale2 covale ? ? B ACE 1 C  ? ? ? 1_555 B CYS 2 N  ? ? B ACE 272 B CYS 273 1_555 ? ? ? ? ? ? ? 1.306 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
_database_PDB_matrix.entry_id          1JUN 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1JUN 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
HETATM 1    C C    . ACE A 1 1  ? 0.900   34.283  2.873   1.00 0.00 ? 272 ACE A C    1 
HETATM 2    O O    . ACE A 1 1  ? -0.087  34.344  3.577   1.00 0.00 ? 272 ACE A O    1 
HETATM 3    C CH3  . ACE A 1 1  ? 2.026   35.313  2.993   1.00 0.00 ? 272 ACE A CH3  1 
HETATM 4    H H1   . ACE A 1 1  ? 1.793   36.011  3.783   1.00 0.00 ? 272 ACE A H1   1 
HETATM 5    H H2   . ACE A 1 1  ? 2.952   34.807  3.219   1.00 0.00 ? 272 ACE A H2   1 
HETATM 6    H H3   . ACE A 1 1  ? 2.126   35.847  2.060   1.00 0.00 ? 272 ACE A H3   1 
ATOM   7    N N    . CYS A 1 2  ? 1.042   33.339  1.985   1.00 0.00 ? 273 CYS A N    1 
ATOM   8    C CA   . CYS A 1 2  ? 0.005   32.327  1.824   1.00 0.00 ? 273 CYS A CA   1 
ATOM   9    C C    . CYS A 1 2  ? -0.203  31.594  3.152   1.00 0.00 ? 273 CYS A C    1 
ATOM   10   O O    . CYS A 1 2  ? 0.626   31.653  4.039   1.00 0.00 ? 273 CYS A O    1 
ATOM   11   C CB   . CYS A 1 2  ? 0.426   31.325  0.748   1.00 0.00 ? 273 CYS A CB   1 
ATOM   12   S SG   . CYS A 1 2  ? 0.773   32.205  -0.795  1.00 0.00 ? 273 CYS A SG   1 
ATOM   13   H H    . CYS A 1 2  ? 1.847   33.307  1.426   1.00 0.00 ? 273 CYS A H    1 
ATOM   14   H HA   . CYS A 1 2  ? -0.919  32.804  1.528   1.00 0.00 ? 273 CYS A HA   1 
ATOM   15   H HB2  . CYS A 1 2  ? 1.313   30.802  1.072   1.00 0.00 ? 273 CYS A HB2  1 
ATOM   16   H HB3  . CYS A 1 2  ? -0.372  30.614  0.586   1.00 0.00 ? 273 CYS A HB3  1 
ATOM   17   N N    . GLY A 1 3  ? -1.301  30.906  3.296   1.00 0.00 ? 274 GLY A N    1 
ATOM   18   C CA   . GLY A 1 3  ? -1.552  30.186  4.540   1.00 0.00 ? 274 GLY A CA   1 
ATOM   19   C C    . GLY A 1 3  ? -2.884  29.439  4.441   1.00 0.00 ? 274 GLY A C    1 
ATOM   20   O O    . GLY A 1 3  ? -3.858  29.802  5.069   1.00 0.00 ? 274 GLY A O    1 
ATOM   21   H H    . GLY A 1 3  ? -1.958  30.871  2.568   1.00 0.00 ? 274 GLY A H    1 
ATOM   22   H HA2  . GLY A 1 3  ? -0.753  29.478  4.713   1.00 0.00 ? 274 GLY A HA2  1 
ATOM   23   H HA3  . GLY A 1 3  ? -1.599  30.887  5.359   1.00 0.00 ? 274 GLY A HA3  1 
ATOM   24   N N    . GLY A 1 4  ? -2.934  28.396  3.659   1.00 0.00 ? 275 GLY A N    1 
ATOM   25   C CA   . GLY A 1 4  ? -4.177  27.645  3.525   1.00 0.00 ? 275 GLY A CA   1 
ATOM   26   C C    . GLY A 1 4  ? -3.976  26.488  2.545   1.00 0.00 ? 275 GLY A C    1 
ATOM   27   O O    . GLY A 1 4  ? -4.202  25.340  2.871   1.00 0.00 ? 275 GLY A O    1 
ATOM   28   H H    . GLY A 1 4  ? -2.137  28.118  3.160   1.00 0.00 ? 275 GLY A H    1 
ATOM   29   H HA2  . GLY A 1 4  ? -4.465  27.254  4.492   1.00 0.00 ? 275 GLY A HA2  1 
ATOM   30   H HA3  . GLY A 1 4  ? -4.953  28.296  3.153   1.00 0.00 ? 275 GLY A HA3  1 
ATOM   31   N N    . ARG A 1 5  ? -3.559  26.782  1.344   1.00 0.00 ? 276 ARG A N    1 
ATOM   32   C CA   . ARG A 1 5  ? -3.352  25.720  0.365   1.00 0.00 ? 276 ARG A CA   1 
ATOM   33   C C    . ARG A 1 5  ? -2.135  24.884  0.765   1.00 0.00 ? 276 ARG A C    1 
ATOM   34   O O    . ARG A 1 5  ? -2.019  23.730  0.404   1.00 0.00 ? 276 ARG A O    1 
ATOM   35   C CB   . ARG A 1 5  ? -3.122  26.336  -1.016  1.00 0.00 ? 276 ARG A CB   1 
ATOM   36   C CG   . ARG A 1 5  ? -4.456  26.435  -1.759  1.00 0.00 ? 276 ARG A CG   1 
ATOM   37   C CD   . ARG A 1 5  ? -4.388  27.565  -2.787  1.00 0.00 ? 276 ARG A CD   1 
ATOM   38   N NE   . ARG A 1 5  ? -5.730  27.842  -3.288  1.00 0.00 ? 276 ARG A NE   1 
ATOM   39   C CZ   . ARG A 1 5  ? -5.967  28.948  -3.939  1.00 0.00 ? 276 ARG A CZ   1 
ATOM   40   N NH1  . ARG A 1 5  ? -5.465  30.076  -3.517  1.00 0.00 ? 276 ARG A NH1  1 
ATOM   41   N NH2  . ARG A 1 5  ? -6.709  28.926  -5.014  1.00 0.00 ? 276 ARG A NH2  1 
ATOM   42   H H    . ARG A 1 5  ? -3.384  27.714  1.099   1.00 0.00 ? 276 ARG A H    1 
ATOM   43   H HA   . ARG A 1 5  ? -4.227  25.088  0.332   1.00 0.00 ? 276 ARG A HA   1 
ATOM   44   H HB2  . ARG A 1 5  ? -2.697  27.323  -0.904  1.00 0.00 ? 276 ARG A HB2  1 
ATOM   45   H HB3  . ARG A 1 5  ? -2.443  25.714  -1.579  1.00 0.00 ? 276 ARG A HB3  1 
ATOM   46   H HG2  . ARG A 1 5  ? -4.656  25.500  -2.264  1.00 0.00 ? 276 ARG A HG2  1 
ATOM   47   H HG3  . ARG A 1 5  ? -5.247  26.639  -1.053  1.00 0.00 ? 276 ARG A HG3  1 
ATOM   48   H HD2  . ARG A 1 5  ? -3.988  28.453  -2.322  1.00 0.00 ? 276 ARG A HD2  1 
ATOM   49   H HD3  . ARG A 1 5  ? -3.752  27.268  -3.606  1.00 0.00 ? 276 ARG A HD3  1 
ATOM   50   H HE   . ARG A 1 5  ? -6.453  27.199  -3.135  1.00 0.00 ? 276 ARG A HE   1 
ATOM   51   H HH11 . ARG A 1 5  ? -4.898  30.094  -2.695  1.00 0.00 ? 276 ARG A HH11 1 
ATOM   52   H HH12 . ARG A 1 5  ? -5.649  30.923  -4.016  1.00 0.00 ? 276 ARG A HH12 1 
ATOM   53   H HH21 . ARG A 1 5  ? -7.093  28.061  -5.337  1.00 0.00 ? 276 ARG A HH21 1 
ATOM   54   H HH22 . ARG A 1 5  ? -6.892  29.772  -5.513  1.00 0.00 ? 276 ARG A HH22 1 
ATOM   55   N N    . ILE A 1 6  ? -1.227  25.456  1.508   1.00 0.00 ? 277 ILE A N    1 
ATOM   56   C CA   . ILE A 1 6  ? -0.047  24.705  1.920   1.00 0.00 ? 277 ILE A CA   1 
ATOM   57   C C    . ILE A 1 6  ? -0.446  23.662  2.967   1.00 0.00 ? 277 ILE A C    1 
ATOM   58   O O    . ILE A 1 6  ? -0.312  22.473  2.755   1.00 0.00 ? 277 ILE A O    1 
ATOM   59   C CB   . ILE A 1 6  ? 0.983   25.661  2.524   1.00 0.00 ? 277 ILE A CB   1 
ATOM   60   C CG1  . ILE A 1 6  ? 1.427   26.670  1.461   1.00 0.00 ? 277 ILE A CG1  1 
ATOM   61   C CG2  . ILE A 1 6  ? 2.197   24.867  3.009   1.00 0.00 ? 277 ILE A CG2  1 
ATOM   62   C CD1  . ILE A 1 6  ? 0.544   27.916  1.539   1.00 0.00 ? 277 ILE A CD1  1 
ATOM   63   H H    . ILE A 1 6  ? -1.340  26.388  1.790   1.00 0.00 ? 277 ILE A H    1 
ATOM   64   H HA   . ILE A 1 6  ? 0.385   24.209  1.063   1.00 0.00 ? 277 ILE A HA   1 
ATOM   65   H HB   . ILE A 1 6  ? 0.540   26.187  3.357   1.00 0.00 ? 277 ILE A HB   1 
ATOM   66   H HG12 . ILE A 1 6  ? 2.457   26.946  1.636   1.00 0.00 ? 277 ILE A HG12 1 
ATOM   67   H HG13 . ILE A 1 6  ? 1.334   26.225  0.482   1.00 0.00 ? 277 ILE A HG13 1 
ATOM   68   H HG21 . ILE A 1 6  ? 2.610   24.303  2.186   1.00 0.00 ? 277 ILE A HG21 1 
ATOM   69   H HG22 . ILE A 1 6  ? 2.944   25.546  3.390   1.00 0.00 ? 277 ILE A HG22 1 
ATOM   70   H HG23 . ILE A 1 6  ? 1.893   24.189  3.793   1.00 0.00 ? 277 ILE A HG23 1 
ATOM   71   H HD11 . ILE A 1 6  ? -0.037  27.889  2.450   1.00 0.00 ? 277 ILE A HD11 1 
ATOM   72   H HD12 . ILE A 1 6  ? 1.165   28.798  1.533   1.00 0.00 ? 277 ILE A HD12 1 
ATOM   73   H HD13 . ILE A 1 6  ? -0.121  27.939  0.689   1.00 0.00 ? 277 ILE A HD13 1 
ATOM   74   N N    . ALA A 1 7  ? -0.937  24.100  4.094   1.00 0.00 ? 278 ALA A N    1 
ATOM   75   C CA   . ALA A 1 7  ? -1.336  23.155  5.132   1.00 0.00 ? 278 ALA A CA   1 
ATOM   76   C C    . ALA A 1 7  ? -2.189  22.045  4.514   1.00 0.00 ? 278 ALA A C    1 
ATOM   77   O O    . ALA A 1 7  ? -2.040  20.883  4.835   1.00 0.00 ? 278 ALA A O    1 
ATOM   78   C CB   . ALA A 1 7  ? -2.147  23.888  6.203   1.00 0.00 ? 278 ALA A CB   1 
ATOM   79   H H    . ALA A 1 7  ? -1.037  25.063  4.244   1.00 0.00 ? 278 ALA A H    1 
ATOM   80   H HA   . ALA A 1 7  ? -0.456  22.723  5.583   1.00 0.00 ? 278 ALA A HA   1 
ATOM   81   H HB1  . ALA A 1 7  ? -2.544  24.803  5.790   1.00 0.00 ? 278 ALA A HB1  1 
ATOM   82   H HB2  . ALA A 1 7  ? -2.961  23.258  6.531   1.00 0.00 ? 278 ALA A HB2  1 
ATOM   83   H HB3  . ALA A 1 7  ? -1.508  24.118  7.043   1.00 0.00 ? 278 ALA A HB3  1 
ATOM   84   N N    . ARG A 1 8  ? -3.086  22.392  3.629   1.00 0.00 ? 279 ARG A N    1 
ATOM   85   C CA   . ARG A 1 8  ? -3.926  21.375  3.009   1.00 0.00 ? 279 ARG A CA   1 
ATOM   86   C C    . ARG A 1 8  ? -3.043  20.361  2.282   1.00 0.00 ? 279 ARG A C    1 
ATOM   87   O O    . ARG A 1 8  ? -3.076  19.179  2.564   1.00 0.00 ? 279 ARG A O    1 
ATOM   88   C CB   . ARG A 1 8  ? -4.878  22.036  2.009   1.00 0.00 ? 279 ARG A CB   1 
ATOM   89   C CG   . ARG A 1 8  ? -6.050  22.668  2.763   1.00 0.00 ? 279 ARG A CG   1 
ATOM   90   C CD   . ARG A 1 8  ? -7.281  21.767  2.650   1.00 0.00 ? 279 ARG A CD   1 
ATOM   91   N NE   . ARG A 1 8  ? -6.893  20.375  2.858   1.00 0.00 ? 279 ARG A NE   1 
ATOM   92   C CZ   . ARG A 1 8  ? -7.803  19.477  3.121   1.00 0.00 ? 279 ARG A CZ   1 
ATOM   93   N NH1  . ARG A 1 8  ? -8.504  18.955  2.152   1.00 0.00 ? 279 ARG A NH1  1 
ATOM   94   N NH2  . ARG A 1 8  ? -8.012  19.102  4.353   1.00 0.00 ? 279 ARG A NH2  1 
ATOM   95   H H    . ARG A 1 8  ? -3.191  23.334  3.383   1.00 0.00 ? 279 ARG A H    1 
ATOM   96   H HA   . ARG A 1 8  ? -4.500  20.871  3.771   1.00 0.00 ? 279 ARG A HA   1 
ATOM   97   H HB2  . ARG A 1 8  ? -4.349  22.798  1.458   1.00 0.00 ? 279 ARG A HB2  1 
ATOM   98   H HB3  . ARG A 1 8  ? -5.253  21.291  1.324   1.00 0.00 ? 279 ARG A HB3  1 
ATOM   99   H HG2  . ARG A 1 8  ? -5.785  22.787  3.806   1.00 0.00 ? 279 ARG A HG2  1 
ATOM   100  H HG3  . ARG A 1 8  ? -6.273  23.634  2.338   1.00 0.00 ? 279 ARG A HG3  1 
ATOM   101  H HD2  . ARG A 1 8  ? -8.007  22.052  3.397   1.00 0.00 ? 279 ARG A HD2  1 
ATOM   102  H HD3  . ARG A 1 8  ? -7.716  21.874  1.667   1.00 0.00 ? 279 ARG A HD3  1 
ATOM   103  H HE   . ARG A 1 8  ? -5.951  20.116  2.800   1.00 0.00 ? 279 ARG A HE   1 
ATOM   104  H HH11 . ARG A 1 8  ? -8.345  19.242  1.208   1.00 0.00 ? 279 ARG A HH11 1 
ATOM   105  H HH12 . ARG A 1 8  ? -9.201  18.267  2.355   1.00 0.00 ? 279 ARG A HH12 1 
ATOM   106  H HH21 . ARG A 1 8  ? -7.475  19.503  5.096   1.00 0.00 ? 279 ARG A HH21 1 
ATOM   107  H HH22 . ARG A 1 8  ? -8.709  18.415  4.556   1.00 0.00 ? 279 ARG A HH22 1 
ATOM   108  N N    . LEU A 1 9  ? -2.250  20.810  1.348   1.00 0.00 ? 280 LEU A N    1 
ATOM   109  C CA   . LEU A 1 9  ? -1.384  19.889  0.623   1.00 0.00 ? 280 LEU A CA   1 
ATOM   110  C C    . LEU A 1 9  ? -0.657  18.984  1.619   1.00 0.00 ? 280 LEU A C    1 
ATOM   111  O O    . LEU A 1 9  ? -0.304  17.863  1.312   1.00 0.00 ? 280 LEU A O    1 
ATOM   112  C CB   . LEU A 1 9  ? -0.359  20.681  -0.192  1.00 0.00 ? 280 LEU A CB   1 
ATOM   113  C CG   . LEU A 1 9  ? -1.084  21.522  -1.244  1.00 0.00 ? 280 LEU A CG   1 
ATOM   114  C CD1  . LEU A 1 9  ? -0.235  22.745  -1.593  1.00 0.00 ? 280 LEU A CD1  1 
ATOM   115  C CD2  . LEU A 1 9  ? -1.305  20.679  -2.502  1.00 0.00 ? 280 LEU A CD2  1 
ATOM   116  H H    . LEU A 1 9  ? -2.236  21.767  1.135   1.00 0.00 ? 280 LEU A H    1 
ATOM   117  H HA   . LEU A 1 9  ? -1.979  19.283  -0.044  1.00 0.00 ? 280 LEU A HA   1 
ATOM   118  H HB2  . LEU A 1 9  ? 0.197   21.331  0.467   1.00 0.00 ? 280 LEU A HB2  1 
ATOM   119  H HB3  . LEU A 1 9  ? 0.317   19.998  -0.682  1.00 0.00 ? 280 LEU A HB3  1 
ATOM   120  H HG   . LEU A 1 9  ? -2.037  21.846  -0.852  1.00 0.00 ? 280 LEU A HG   1 
ATOM   121  H HD11 . LEU A 1 9  ? 0.608   22.803  -0.921  1.00 0.00 ? 280 LEU A HD11 1 
ATOM   122  H HD12 . LEU A 1 9  ? 0.120   22.658  -2.610  1.00 0.00 ? 280 LEU A HD12 1 
ATOM   123  H HD13 . LEU A 1 9  ? -0.834  23.639  -1.497  1.00 0.00 ? 280 LEU A HD13 1 
ATOM   124  H HD21 . LEU A 1 9  ? -0.590  19.871  -2.525  1.00 0.00 ? 280 LEU A HD21 1 
ATOM   125  H HD22 . LEU A 1 9  ? -2.307  20.275  -2.493  1.00 0.00 ? 280 LEU A HD22 1 
ATOM   126  H HD23 . LEU A 1 9  ? -1.176  21.299  -3.378  1.00 0.00 ? 280 LEU A HD23 1 
ATOM   127  N N    . GLU A 1 10 ? -0.429  19.464  2.812   1.00 0.00 ? 281 GLU A N    1 
ATOM   128  C CA   . GLU A 1 10 ? 0.261   18.649  3.805   1.00 0.00 ? 281 GLU A CA   1 
ATOM   129  C C    . GLU A 1 10 ? -0.664  17.518  4.262   1.00 0.00 ? 281 GLU A C    1 
ATOM   130  O O    . GLU A 1 10 ? -0.301  16.358  4.236   1.00 0.00 ? 281 GLU A O    1 
ATOM   131  C CB   . GLU A 1 10 ? 0.640   19.518  5.007   1.00 0.00 ? 281 GLU A CB   1 
ATOM   132  C CG   . GLU A 1 10 ? 2.108   19.932  4.894   1.00 0.00 ? 281 GLU A CG   1 
ATOM   133  C CD   . GLU A 1 10 ? 2.951   19.093  5.857   1.00 0.00 ? 281 GLU A CD   1 
ATOM   134  O OE1  . GLU A 1 10 ? 2.687   17.906  5.964   1.00 0.00 ? 281 GLU A OE1  1 
ATOM   135  O OE2  . GLU A 1 10 ? 3.844   19.652  6.472   1.00 0.00 ? 281 GLU A OE2  1 
ATOM   136  H H    . GLU A 1 10 ? -0.720  20.370  3.039   1.00 0.00 ? 281 GLU A H    1 
ATOM   137  H HA   . GLU A 1 10 ? 1.156   18.230  3.370   1.00 0.00 ? 281 GLU A HA   1 
ATOM   138  H HB2  . GLU A 1 10 ? 0.017   20.400  5.022   1.00 0.00 ? 281 GLU A HB2  1 
ATOM   139  H HB3  . GLU A 1 10 ? 0.495   18.957  5.917   1.00 0.00 ? 281 GLU A HB3  1 
ATOM   140  H HG2  . GLU A 1 10 ? 2.450   19.771  3.882   1.00 0.00 ? 281 GLU A HG2  1 
ATOM   141  H HG3  . GLU A 1 10 ? 2.209   20.976  5.147   1.00 0.00 ? 281 GLU A HG3  1 
ATOM   142  N N    . GLU A 1 11 ? -1.857  17.845  4.678   1.00 0.00 ? 282 GLU A N    1 
ATOM   143  C CA   . GLU A 1 11 ? -2.783  16.809  5.121   1.00 0.00 ? 282 GLU A CA   1 
ATOM   144  C C    . GLU A 1 11 ? -2.901  15.744  4.029   1.00 0.00 ? 282 GLU A C    1 
ATOM   145  O O    . GLU A 1 11 ? -3.015  14.565  4.304   1.00 0.00 ? 282 GLU A O    1 
ATOM   146  C CB   . GLU A 1 11 ? -4.156  17.429  5.382   1.00 0.00 ? 282 GLU A CB   1 
ATOM   147  C CG   . GLU A 1 11 ? -4.435  17.441  6.887   1.00 0.00 ? 282 GLU A CG   1 
ATOM   148  C CD   . GLU A 1 11 ? -5.777  18.128  7.151   1.00 0.00 ? 282 GLU A CD   1 
ATOM   149  O OE1  . GLU A 1 11 ? -5.991  19.197  6.605   1.00 0.00 ? 282 GLU A OE1  1 
ATOM   150  O OE2  . GLU A 1 11 ? -6.568  17.572  7.897   1.00 0.00 ? 282 GLU A OE2  1 
ATOM   151  H H    . GLU A 1 11 ? -2.132  18.786  4.689   1.00 0.00 ? 282 GLU A H    1 
ATOM   152  H HA   . GLU A 1 11 ? -2.413  16.358  6.029   1.00 0.00 ? 282 GLU A HA   1 
ATOM   153  H HB2  . GLU A 1 11 ? -4.171  18.443  5.005   1.00 0.00 ? 282 GLU A HB2  1 
ATOM   154  H HB3  . GLU A 1 11 ? -4.916  16.849  4.881   1.00 0.00 ? 282 GLU A HB3  1 
ATOM   155  H HG2  . GLU A 1 11 ? -4.471  16.425  7.254   1.00 0.00 ? 282 GLU A HG2  1 
ATOM   156  H HG3  . GLU A 1 11 ? -3.652  17.980  7.394   1.00 0.00 ? 282 GLU A HG3  1 
ATOM   157  N N    . LYS A 1 12 ? -2.870  16.153  2.791   1.00 0.00 ? 283 LYS A N    1 
ATOM   158  C CA   . LYS A 1 12 ? -2.975  15.194  1.700   1.00 0.00 ? 283 LYS A CA   1 
ATOM   159  C C    . LYS A 1 12 ? -1.736  14.299  1.696   1.00 0.00 ? 283 LYS A C    1 
ATOM   160  O O    . LYS A 1 12 ? -1.831  13.092  1.595   1.00 0.00 ? 283 LYS A O    1 
ATOM   161  C CB   . LYS A 1 12 ? -3.066  15.945  0.371   1.00 0.00 ? 283 LYS A CB   1 
ATOM   162  C CG   . LYS A 1 12 ? -4.247  15.411  -0.440  1.00 0.00 ? 283 LYS A CG   1 
ATOM   163  C CD   . LYS A 1 12 ? -4.575  16.389  -1.570  1.00 0.00 ? 283 LYS A CD   1 
ATOM   164  C CE   . LYS A 1 12 ? -3.845  15.961  -2.844  1.00 0.00 ? 283 LYS A CE   1 
ATOM   165  N NZ   . LYS A 1 12 ? -4.467  14.718  -3.380  1.00 0.00 ? 283 LYS A NZ   1 
ATOM   166  H H    . LYS A 1 12 ? -2.775  17.108  2.594   1.00 0.00 ? 283 LYS A H    1 
ATOM   167  H HA   . LYS A 1 12 ? -3.860  14.589  1.832   1.00 0.00 ? 283 LYS A HA   1 
ATOM   168  H HB2  . LYS A 1 12 ? -3.209  16.999  0.564   1.00 0.00 ? 283 LYS A HB2  1 
ATOM   169  H HB3  . LYS A 1 12 ? -2.152  15.801  -0.187  1.00 0.00 ? 283 LYS A HB3  1 
ATOM   170  H HG2  . LYS A 1 12 ? -3.988  14.448  -0.859  1.00 0.00 ? 283 LYS A HG2  1 
ATOM   171  H HG3  . LYS A 1 12 ? -5.107  15.304  0.203   1.00 0.00 ? 283 LYS A HG3  1 
ATOM   172  H HD2  . LYS A 1 12 ? -5.641  16.389  -1.747  1.00 0.00 ? 283 LYS A HD2  1 
ATOM   173  H HD3  . LYS A 1 12 ? -4.257  17.382  -1.290  1.00 0.00 ? 283 LYS A HD3  1 
ATOM   174  H HE2  . LYS A 1 12 ? -3.917  16.748  -3.581  1.00 0.00 ? 283 LYS A HE2  1 
ATOM   175  H HE3  . LYS A 1 12 ? -2.805  15.776  -2.618  1.00 0.00 ? 283 LYS A HE3  1 
ATOM   176  H HZ1  . LYS A 1 12 ? -5.476  14.700  -3.130  1.00 0.00 ? 283 LYS A HZ1  1 
ATOM   177  H HZ2  . LYS A 1 12 ? -4.368  14.699  -4.415  1.00 0.00 ? 283 LYS A HZ2  1 
ATOM   178  H HZ3  . LYS A 1 12 ? -3.991  13.889  -2.970  1.00 0.00 ? 283 LYS A HZ3  1 
ATOM   179  N N    . VAL A 1 13 ? -0.574  14.880  1.809   1.00 0.00 ? 284 VAL A N    1 
ATOM   180  C CA   . VAL A 1 13 ? 0.643   14.080  1.816   1.00 0.00 ? 284 VAL A CA   1 
ATOM   181  C C    . VAL A 1 13 ? 0.614   13.134  3.016   1.00 0.00 ? 284 VAL A C    1 
ATOM   182  O O    . VAL A 1 13 ? 1.321   12.146  3.059   1.00 0.00 ? 284 VAL A O    1 
ATOM   183  C CB   . VAL A 1 13 ? 1.860   15.000  1.921   1.00 0.00 ? 284 VAL A CB   1 
ATOM   184  C CG1  . VAL A 1 13 ? 3.121   14.156  2.113   1.00 0.00 ? 284 VAL A CG1  1 
ATOM   185  C CG2  . VAL A 1 13 ? 1.988   15.824  0.638   1.00 0.00 ? 284 VAL A CG2  1 
ATOM   186  H H    . VAL A 1 13 ? -0.521  15.855  1.892   1.00 0.00 ? 284 VAL A H    1 
ATOM   187  H HA   . VAL A 1 13 ? 0.705   13.506  0.904   1.00 0.00 ? 284 VAL A HA   1 
ATOM   188  H HB   . VAL A 1 13 ? 1.738   15.663  2.766   1.00 0.00 ? 284 VAL A HB   1 
ATOM   189  H HG11 . VAL A 1 13 ? 3.021   13.230  1.568   1.00 0.00 ? 284 VAL A HG11 1 
ATOM   190  H HG12 . VAL A 1 13 ? 3.978   14.701  1.745   1.00 0.00 ? 284 VAL A HG12 1 
ATOM   191  H HG13 . VAL A 1 13 ? 3.254   13.943  3.164   1.00 0.00 ? 284 VAL A HG13 1 
ATOM   192  H HG21 . VAL A 1 13 ? 1.102   15.691  0.036   1.00 0.00 ? 284 VAL A HG21 1 
ATOM   193  H HG22 . VAL A 1 13 ? 2.100   16.868  0.890   1.00 0.00 ? 284 VAL A HG22 1 
ATOM   194  H HG23 . VAL A 1 13 ? 2.853   15.493  0.082   1.00 0.00 ? 284 VAL A HG23 1 
ATOM   195  N N    . LYS A 1 14 ? -0.199  13.428  3.992   1.00 0.00 ? 285 LYS A N    1 
ATOM   196  C CA   . LYS A 1 14 ? -0.275  12.565  5.165   1.00 0.00 ? 285 LYS A CA   1 
ATOM   197  C C    . LYS A 1 14 ? -1.107  11.327  4.828   1.00 0.00 ? 285 LYS A C    1 
ATOM   198  O O    . LYS A 1 14 ? -0.721  10.211  5.113   1.00 0.00 ? 285 LYS A O    1 
ATOM   199  C CB   . LYS A 1 14 ? -0.932  13.325  6.318   1.00 0.00 ? 285 LYS A CB   1 
ATOM   200  C CG   . LYS A 1 14 ? 0.095   13.556  7.428   1.00 0.00 ? 285 LYS A CG   1 
ATOM   201  C CD   . LYS A 1 14 ? 1.340   14.223  6.840   1.00 0.00 ? 285 LYS A CD   1 
ATOM   202  C CE   . LYS A 1 14 ? 1.637   15.514  7.606   1.00 0.00 ? 285 LYS A CE   1 
ATOM   203  N NZ   . LYS A 1 14 ? 3.067   15.523  8.028   1.00 0.00 ? 285 LYS A NZ   1 
ATOM   204  H H    . LYS A 1 14 ? -0.762  14.229  3.936   1.00 0.00 ? 285 LYS A H    1 
ATOM   205  H HA   . LYS A 1 14 ? 0.720   12.264  5.454   1.00 0.00 ? 285 LYS A HA   1 
ATOM   206  H HB2  . LYS A 1 14 ? -1.297  14.278  5.959   1.00 0.00 ? 285 LYS A HB2  1 
ATOM   207  H HB3  . LYS A 1 14 ? -1.757  12.747  6.707   1.00 0.00 ? 285 LYS A HB3  1 
ATOM   208  H HG2  . LYS A 1 14 ? -0.334  14.195  8.186   1.00 0.00 ? 285 LYS A HG2  1 
ATOM   209  H HG3  . LYS A 1 14 ? 0.369   12.609  7.867   1.00 0.00 ? 285 LYS A HG3  1 
ATOM   210  H HD2  . LYS A 1 14 ? 2.182   13.552  6.925   1.00 0.00 ? 285 LYS A HD2  1 
ATOM   211  H HD3  . LYS A 1 14 ? 1.167   14.456  5.801   1.00 0.00 ? 285 LYS A HD3  1 
ATOM   212  H HE2  . LYS A 1 14 ? 1.445   16.363  6.968   1.00 0.00 ? 285 LYS A HE2  1 
ATOM   213  H HE3  . LYS A 1 14 ? 1.004   15.569  8.479   1.00 0.00 ? 285 LYS A HE3  1 
ATOM   214  H HZ1  . LYS A 1 14 ? 3.632   14.978  7.347   1.00 0.00 ? 285 LYS A HZ1  1 
ATOM   215  H HZ2  . LYS A 1 14 ? 3.410   16.504  8.059   1.00 0.00 ? 285 LYS A HZ2  1 
ATOM   216  H HZ3  . LYS A 1 14 ? 3.152   15.094  8.971   1.00 0.00 ? 285 LYS A HZ3  1 
ATOM   217  N N    . THR A 1 15 ? -2.249  11.515  4.223   1.00 0.00 ? 286 THR A N    1 
ATOM   218  C CA   . THR A 1 15 ? -3.086  10.371  3.877   1.00 0.00 ? 286 THR A CA   1 
ATOM   219  C C    . THR A 1 15 ? -2.360  9.503   2.846   1.00 0.00 ? 286 THR A C    1 
ATOM   220  O O    . THR A 1 15 ? -2.522  8.299   2.811   1.00 0.00 ? 286 THR A O    1 
ATOM   221  C CB   . THR A 1 15 ? -4.409  10.865  3.287   1.00 0.00 ? 286 THR A CB   1 
ATOM   222  O OG1  . THR A 1 15 ? -4.863  11.991  4.028   1.00 0.00 ? 286 THR A OG1  1 
ATOM   223  C CG2  . THR A 1 15 ? -5.451  9.748   3.359   1.00 0.00 ? 286 THR A CG2  1 
ATOM   224  H H    . THR A 1 15 ? -2.543  12.424  4.002   1.00 0.00 ? 286 THR A H    1 
ATOM   225  H HA   . THR A 1 15 ? -3.284  9.788   4.764   1.00 0.00 ? 286 THR A HA   1 
ATOM   226  H HB   . THR A 1 15 ? -4.261  11.149  2.257   1.00 0.00 ? 286 THR A HB   1 
ATOM   227  H HG1  . THR A 1 15 ? -5.627  12.357  3.575   1.00 0.00 ? 286 THR A HG1  1 
ATOM   228  H HG21 . THR A 1 15 ? -5.097  8.967   4.015   1.00 0.00 ? 286 THR A HG21 1 
ATOM   229  H HG22 . THR A 1 15 ? -6.379  10.146  3.742   1.00 0.00 ? 286 THR A HG22 1 
ATOM   230  H HG23 . THR A 1 15 ? -5.613  9.344   2.370   1.00 0.00 ? 286 THR A HG23 1 
ATOM   231  N N    . LEU A 1 16 ? -1.565  10.105  2.005   1.00 0.00 ? 287 LEU A N    1 
ATOM   232  C CA   . LEU A 1 16 ? -0.848  9.333   0.997   1.00 0.00 ? 287 LEU A CA   1 
ATOM   233  C C    . LEU A 1 16 ? 0.229   8.481   1.675   1.00 0.00 ? 287 LEU A C    1 
ATOM   234  O O    . LEU A 1 16 ? 0.314   7.288   1.467   1.00 0.00 ? 287 LEU A O    1 
ATOM   235  C CB   . LEU A 1 16 ? -0.190  10.285  -0.004  1.00 0.00 ? 287 LEU A CB   1 
ATOM   236  C CG   . LEU A 1 16 ? -1.271  11.024  -0.793  1.00 0.00 ? 287 LEU A CG   1 
ATOM   237  C CD1  . LEU A 1 16 ? -0.655  12.236  -1.493  1.00 0.00 ? 287 LEU A CD1  1 
ATOM   238  C CD2  . LEU A 1 16 ? -1.870  10.082  -1.840  1.00 0.00 ? 287 LEU A CD2  1 
ATOM   239  H H    . LEU A 1 16 ? -1.451  11.077  2.050   1.00 0.00 ? 287 LEU A H    1 
ATOM   240  H HA   . LEU A 1 16 ? -1.539  8.689   0.476   1.00 0.00 ? 287 LEU A HA   1 
ATOM   241  H HB2  . LEU A 1 16 ? 0.420   11.001  0.529   1.00 0.00 ? 287 LEU A HB2  1 
ATOM   242  H HB3  . LEU A 1 16 ? 0.429   9.721   -0.685  1.00 0.00 ? 287 LEU A HB3  1 
ATOM   243  H HG   . LEU A 1 16 ? -2.047  11.355  -0.118  1.00 0.00 ? 287 LEU A HG   1 
ATOM   244  H HD11 . LEU A 1 16 ? 0.131   12.646  -0.878  1.00 0.00 ? 287 LEU A HD11 1 
ATOM   245  H HD12 . LEU A 1 16 ? -0.245  11.931  -2.444  1.00 0.00 ? 287 LEU A HD12 1 
ATOM   246  H HD13 . LEU A 1 16 ? -1.416  12.985  -1.653  1.00 0.00 ? 287 LEU A HD13 1 
ATOM   247  H HD21 . LEU A 1 16 ? -1.544  9.071   -1.643  1.00 0.00 ? 287 LEU A HD21 1 
ATOM   248  H HD22 . LEU A 1 16 ? -2.947  10.128  -1.793  1.00 0.00 ? 287 LEU A HD22 1 
ATOM   249  H HD23 . LEU A 1 16 ? -1.540  10.381  -2.824  1.00 0.00 ? 287 LEU A HD23 1 
ATOM   250  N N    . LYS A 1 17 ? 1.054   9.087   2.485   1.00 0.00 ? 288 LYS A N    1 
ATOM   251  C CA   . LYS A 1 17 ? 2.103   8.332   3.159   1.00 0.00 ? 288 LYS A CA   1 
ATOM   252  C C    . LYS A 1 17 ? 1.470   7.213   3.993   1.00 0.00 ? 288 LYS A C    1 
ATOM   253  O O    . LYS A 1 17 ? 2.026   6.142   4.135   1.00 0.00 ? 288 LYS A O    1 
ATOM   254  C CB   . LYS A 1 17 ? 2.895   9.265   4.076   1.00 0.00 ? 288 LYS A CB   1 
ATOM   255  C CG   . LYS A 1 17 ? 4.337   9.371   3.577   1.00 0.00 ? 288 LYS A CG   1 
ATOM   256  C CD   . LYS A 1 17 ? 4.641   10.821  3.193   1.00 0.00 ? 288 LYS A CD   1 
ATOM   257  C CE   . LYS A 1 17 ? 4.912   11.639  4.458   1.00 0.00 ? 288 LYS A CE   1 
ATOM   258  N NZ   . LYS A 1 17 ? 6.378   11.867  4.597   1.00 0.00 ? 288 LYS A NZ   1 
ATOM   259  H H    . LYS A 1 17 ? 0.970   10.052  2.638   1.00 0.00 ? 288 LYS A H    1 
ATOM   260  H HA   . LYS A 1 17 ? 2.766   7.902   2.426   1.00 0.00 ? 288 LYS A HA   1 
ATOM   261  H HB2  . LYS A 1 17 ? 2.440   10.246  4.072   1.00 0.00 ? 288 LYS A HB2  1 
ATOM   262  H HB3  . LYS A 1 17 ? 2.893   8.871   5.081   1.00 0.00 ? 288 LYS A HB3  1 
ATOM   263  H HG2  . LYS A 1 17 ? 5.012   9.055   4.358   1.00 0.00 ? 288 LYS A HG2  1 
ATOM   264  H HG3  . LYS A 1 17 ? 4.466   8.737   2.711   1.00 0.00 ? 288 LYS A HG3  1 
ATOM   265  H HD2  . LYS A 1 17 ? 5.510   10.850  2.552   1.00 0.00 ? 288 LYS A HD2  1 
ATOM   266  H HD3  . LYS A 1 17 ? 3.795   11.240  2.670   1.00 0.00 ? 288 LYS A HD3  1 
ATOM   267  H HE2  . LYS A 1 17 ? 4.404   12.589  4.388   1.00 0.00 ? 288 LYS A HE2  1 
ATOM   268  H HE3  . LYS A 1 17 ? 4.549   11.098  5.319   1.00 0.00 ? 288 LYS A HE3  1 
ATOM   269  H HZ1  . LYS A 1 17 ? 6.816   11.902  3.653   1.00 0.00 ? 288 LYS A HZ1  1 
ATOM   270  H HZ2  . LYS A 1 17 ? 6.544   12.770  5.084   1.00 0.00 ? 288 LYS A HZ2  1 
ATOM   271  H HZ3  . LYS A 1 17 ? 6.799   11.092  5.148   1.00 0.00 ? 288 LYS A HZ3  1 
ATOM   272  N N    . ALA A 1 18 ? 0.313   7.454   4.545   1.00 0.00 ? 289 ALA A N    1 
ATOM   273  C CA   . ALA A 1 18 ? -0.340  6.430   5.354   1.00 0.00 ? 289 ALA A CA   1 
ATOM   274  C C    . ALA A 1 18 ? -0.689  5.228   4.476   1.00 0.00 ? 289 ALA A C    1 
ATOM   275  O O    . ALA A 1 18 ? -0.133  4.158   4.622   1.00 0.00 ? 289 ALA A O    1 
ATOM   276  C CB   . ALA A 1 18 ? -1.624  6.998   5.958   1.00 0.00 ? 289 ALA A CB   1 
ATOM   277  H H    . ALA A 1 18 ? -0.118  8.325   4.419   1.00 0.00 ? 289 ALA A H    1 
ATOM   278  H HA   . ALA A 1 18 ? 0.323   6.118   6.146   1.00 0.00 ? 289 ALA A HA   1 
ATOM   279  H HB1  . ALA A 1 18 ? -1.768  8.011   5.614   1.00 0.00 ? 289 ALA A HB1  1 
ATOM   280  H HB2  . ALA A 1 18 ? -2.463  6.390   5.652   1.00 0.00 ? 289 ALA A HB2  1 
ATOM   281  H HB3  . ALA A 1 18 ? -1.549  6.990   7.037   1.00 0.00 ? 289 ALA A HB3  1 
ATOM   282  N N    . GLN A 1 19 ? -1.615  5.398   3.571   1.00 0.00 ? 290 GLN A N    1 
ATOM   283  C CA   . GLN A 1 19 ? -2.004  4.292   2.704   1.00 0.00 ? 290 GLN A CA   1 
ATOM   284  C C    . GLN A 1 19 ? -0.751  3.560   2.213   1.00 0.00 ? 290 GLN A C    1 
ATOM   285  O O    . GLN A 1 19 ? -0.740  2.353   2.078   1.00 0.00 ? 290 GLN A O    1 
ATOM   286  C CB   . GLN A 1 19 ? -2.784  4.831   1.505   1.00 0.00 ? 290 GLN A CB   1 
ATOM   287  C CG   . GLN A 1 19 ? -4.274  4.891   1.851   1.00 0.00 ? 290 GLN A CG   1 
ATOM   288  C CD   . GLN A 1 19 ? -4.952  5.969   1.003   1.00 0.00 ? 290 GLN A CD   1 
ATOM   289  O OE1  . GLN A 1 19 ? -5.390  6.978   1.519   1.00 0.00 ? 290 GLN A OE1  1 
ATOM   290  N NE2  . GLN A 1 19 ? -5.056  5.798   -0.286  1.00 0.00 ? 290 GLN A NE2  1 
ATOM   291  H H    . GLN A 1 19 ? -2.052  6.270   3.477   1.00 0.00 ? 290 GLN A H    1 
ATOM   292  H HA   . GLN A 1 19 ? -2.627  3.607   3.259   1.00 0.00 ? 290 GLN A HA   1 
ATOM   293  H HB2  . GLN A 1 19 ? -2.431  5.822   1.262   1.00 0.00 ? 290 GLN A HB2  1 
ATOM   294  H HB3  . GLN A 1 19 ? -2.641  4.178   0.658   1.00 0.00 ? 290 GLN A HB3  1 
ATOM   295  H HG2  . GLN A 1 19 ? -4.731  3.933   1.649   1.00 0.00 ? 290 GLN A HG2  1 
ATOM   296  H HG3  . GLN A 1 19 ? -4.392  5.132   2.897   1.00 0.00 ? 290 GLN A HG3  1 
ATOM   297  H HE21 . GLN A 1 19 ? -4.702  4.985   -0.702  1.00 0.00 ? 290 GLN A HE21 1 
ATOM   298  H HE22 . GLN A 1 19 ? -5.490  6.483   -0.837  1.00 0.00 ? 290 GLN A HE22 1 
ATOM   299  N N    . ASN A 1 20 ? 0.304   4.282   1.948   1.00 0.00 ? 291 ASN A N    1 
ATOM   300  C CA   . ASN A 1 20 ? 1.527   3.641   1.481   1.00 0.00 ? 291 ASN A CA   1 
ATOM   301  C C    . ASN A 1 20 ? 1.987   2.611   2.516   1.00 0.00 ? 291 ASN A C    1 
ATOM   302  O O    . ASN A 1 20 ? 2.227   1.463   2.198   1.00 0.00 ? 291 ASN A O    1 
ATOM   303  C CB   . ASN A 1 20 ? 2.616   4.698   1.290   1.00 0.00 ? 291 ASN A CB   1 
ATOM   304  C CG   . ASN A 1 20 ? 3.507   4.308   0.108   1.00 0.00 ? 291 ASN A CG   1 
ATOM   305  O OD1  . ASN A 1 20 ? 3.263   3.316   -0.552  1.00 0.00 ? 291 ASN A OD1  1 
ATOM   306  N ND2  . ASN A 1 20 ? 4.537   5.052   -0.190  1.00 0.00 ? 291 ASN A ND2  1 
ATOM   307  H H    . ASN A 1 20 ? 0.273   5.254   2.065   1.00 0.00 ? 291 ASN A H    1 
ATOM   308  H HA   . ASN A 1 20 ? 1.336   3.147   0.539   1.00 0.00 ? 291 ASN A HA   1 
ATOM   309  H HB2  . ASN A 1 20 ? 2.157   5.657   1.095   1.00 0.00 ? 291 ASN A HB2  1 
ATOM   310  H HB3  . ASN A 1 20 ? 3.217   4.760   2.185   1.00 0.00 ? 291 ASN A HB3  1 
ATOM   311  H HD21 . ASN A 1 20 ? 4.734   5.851   0.342   1.00 0.00 ? 291 ASN A HD21 1 
ATOM   312  H HD22 . ASN A 1 20 ? 5.114   4.811   -0.945  1.00 0.00 ? 291 ASN A HD22 1 
ATOM   313  N N    . SER A 1 21 ? 2.108   3.011   3.754   1.00 0.00 ? 292 SER A N    1 
ATOM   314  C CA   . SER A 1 21 ? 2.541   2.070   4.784   1.00 0.00 ? 292 SER A CA   1 
ATOM   315  C C    . SER A 1 21 ? 1.523   0.933   4.893   1.00 0.00 ? 292 SER A C    1 
ATOM   316  O O    . SER A 1 21 ? 1.838   -0.153  5.339   1.00 0.00 ? 292 SER A O    1 
ATOM   317  C CB   . SER A 1 21 ? 2.639   2.797   6.127   1.00 0.00 ? 292 SER A CB   1 
ATOM   318  O OG   . SER A 1 21 ? 3.506   3.916   5.993   1.00 0.00 ? 292 SER A OG   1 
ATOM   319  H H    . SER A 1 21 ? 1.909   3.941   3.991   1.00 0.00 ? 292 SER A H    1 
ATOM   320  H HA   . SER A 1 21 ? 3.507   1.667   4.522   1.00 0.00 ? 292 SER A HA   1 
ATOM   321  H HB2  . SER A 1 21 ? 1.663   3.139   6.426   1.00 0.00 ? 292 SER A HB2  1 
ATOM   322  H HB3  . SER A 1 21 ? 3.026   2.116   6.874   1.00 0.00 ? 292 SER A HB3  1 
ATOM   323  H HG   . SER A 1 21 ? 4.373   3.661   6.317   1.00 0.00 ? 292 SER A HG   1 
ATOM   324  N N    . GLU A 1 22 ? 0.305   1.172   4.492   1.00 0.00 ? 293 GLU A N    1 
ATOM   325  C CA   . GLU A 1 22 ? -0.711  0.128   4.572   1.00 0.00 ? 293 GLU A CA   1 
ATOM   326  C C    . GLU A 1 22 ? -0.393  -0.971  3.558   1.00 0.00 ? 293 GLU A C    1 
ATOM   327  O O    . GLU A 1 22 ? -0.051  -2.081  3.914   1.00 0.00 ? 293 GLU A O    1 
ATOM   328  C CB   . GLU A 1 22 ? -2.083  0.728   4.260   1.00 0.00 ? 293 GLU A CB   1 
ATOM   329  C CG   . GLU A 1 22 ? -2.886  0.873   5.553   1.00 0.00 ? 293 GLU A CG   1 
ATOM   330  C CD   . GLU A 1 22 ? -4.366  0.615   5.266   1.00 0.00 ? 293 GLU A CD   1 
ATOM   331  O OE1  . GLU A 1 22 ? -4.721  -0.537  5.074   1.00 0.00 ? 293 GLU A OE1  1 
ATOM   332  O OE2  . GLU A 1 22 ? -5.121  1.574   5.242   1.00 0.00 ? 293 GLU A OE2  1 
ATOM   333  H H    . GLU A 1 22 ? 0.073   2.056   4.137   1.00 0.00 ? 293 GLU A H    1 
ATOM   334  H HA   . GLU A 1 22 ? -0.720  -0.290  5.567   1.00 0.00 ? 293 GLU A HA   1 
ATOM   335  H HB2  . GLU A 1 22 ? -1.955  1.700   3.804   1.00 0.00 ? 293 GLU A HB2  1 
ATOM   336  H HB3  . GLU A 1 22 ? -2.613  0.078   3.580   1.00 0.00 ? 293 GLU A HB3  1 
ATOM   337  H HG2  . GLU A 1 22 ? -2.530  0.158   6.281   1.00 0.00 ? 293 GLU A HG2  1 
ATOM   338  H HG3  . GLU A 1 22 ? -2.766  1.873   5.942   1.00 0.00 ? 293 GLU A HG3  1 
ATOM   339  N N    . LEU A 1 23 ? -0.508  -0.672  2.292   1.00 0.00 ? 294 LEU A N    1 
ATOM   340  C CA   . LEU A 1 23 ? -0.224  -1.675  1.273   1.00 0.00 ? 294 LEU A CA   1 
ATOM   341  C C    . LEU A 1 23 ? 1.192   -2.219  1.466   1.00 0.00 ? 294 LEU A C    1 
ATOM   342  O O    . LEU A 1 23 ? 1.531   -3.280  0.981   1.00 0.00 ? 294 LEU A O    1 
ATOM   343  C CB   . LEU A 1 23 ? -0.345  -1.041  -0.114  1.00 0.00 ? 294 LEU A CB   1 
ATOM   344  C CG   . LEU A 1 23 ? -1.722  -1.355  -0.700  1.00 0.00 ? 294 LEU A CG   1 
ATOM   345  C CD1  . LEU A 1 23 ? -2.107  -0.271  -1.707  1.00 0.00 ? 294 LEU A CD1  1 
ATOM   346  C CD2  . LEU A 1 23 ? -1.674  -2.712  -1.406  1.00 0.00 ? 294 LEU A CD2  1 
ATOM   347  H H    . LEU A 1 23 ? -0.789  0.229   2.027   1.00 0.00 ? 294 LEU A H    1 
ATOM   348  H HA   . LEU A 1 23 ? -0.934  -2.483  1.359   1.00 0.00 ? 294 LEU A HA   1 
ATOM   349  H HB2  . LEU A 1 23 ? -0.223  0.029   -0.031  1.00 0.00 ? 294 LEU A HB2  1 
ATOM   350  H HB3  . LEU A 1 23 ? 0.421   -1.443  -0.759  1.00 0.00 ? 294 LEU A HB3  1 
ATOM   351  H HG   . LEU A 1 23 ? -2.452  -1.385  0.094   1.00 0.00 ? 294 LEU A HG   1 
ATOM   352  H HD11 . LEU A 1 23 ? -1.384  0.531   -1.670  1.00 0.00 ? 294 LEU A HD11 1 
ATOM   353  H HD12 . LEU A 1 23 ? -2.127  -0.693  -2.702  1.00 0.00 ? 294 LEU A HD12 1 
ATOM   354  H HD13 . LEU A 1 23 ? -3.086  0.116   -1.463  1.00 0.00 ? 294 LEU A HD13 1 
ATOM   355  H HD21 . LEU A 1 23 ? -0.665  -3.093  -1.386  1.00 0.00 ? 294 LEU A HD21 1 
ATOM   356  H HD22 . LEU A 1 23 ? -2.332  -3.404  -0.899  1.00 0.00 ? 294 LEU A HD22 1 
ATOM   357  H HD23 . LEU A 1 23 ? -1.997  -2.596  -2.431  1.00 0.00 ? 294 LEU A HD23 1 
ATOM   358  N N    . ALA A 1 24 ? 2.026   -1.503  2.172   1.00 0.00 ? 295 ALA A N    1 
ATOM   359  C CA   . ALA A 1 24 ? 3.390   -1.975  2.386   1.00 0.00 ? 295 ALA A CA   1 
ATOM   360  C C    . ALA A 1 24 ? 3.370   -3.157  3.358   1.00 0.00 ? 295 ALA A C    1 
ATOM   361  O O    . ALA A 1 24 ? 3.949   -4.195  3.101   1.00 0.00 ? 295 ALA A O    1 
ATOM   362  C CB   . ALA A 1 24 ? 4.237   -0.845  2.971   1.00 0.00 ? 295 ALA A CB   1 
ATOM   363  H H    . ALA A 1 24 ? 1.737   -0.649  2.556   1.00 0.00 ? 295 ALA A H    1 
ATOM   364  H HA   . ALA A 1 24 ? 3.813   -2.291  1.445   1.00 0.00 ? 295 ALA A HA   1 
ATOM   365  H HB1  . ALA A 1 24 ? 3.786   -0.493  3.888   1.00 0.00 ? 295 ALA A HB1  1 
ATOM   366  H HB2  . ALA A 1 24 ? 5.233   -1.211  3.176   1.00 0.00 ? 295 ALA A HB2  1 
ATOM   367  H HB3  . ALA A 1 24 ? 4.292   -0.031  2.262   1.00 0.00 ? 295 ALA A HB3  1 
ATOM   368  N N    . SER A 1 25 ? 2.708   -3.010  4.473   1.00 0.00 ? 296 SER A N    1 
ATOM   369  C CA   . SER A 1 25 ? 2.653   -4.104  5.437   1.00 0.00 ? 296 SER A CA   1 
ATOM   370  C C    . SER A 1 25 ? 1.910   -5.287  4.816   1.00 0.00 ? 296 SER A C    1 
ATOM   371  O O    . SER A 1 25 ? 2.241   -6.432  5.054   1.00 0.00 ? 296 SER A O    1 
ATOM   372  C CB   . SER A 1 25 ? 1.920   -3.641  6.696   1.00 0.00 ? 296 SER A CB   1 
ATOM   373  O OG   . SER A 1 25 ? 2.803   -3.715  7.807   1.00 0.00 ? 296 SER A OG   1 
ATOM   374  H H    . SER A 1 25 ? 2.248   -2.165  4.662   1.00 0.00 ? 296 SER A H    1 
ATOM   375  H HA   . SER A 1 25 ? 3.658   -4.404  5.698   1.00 0.00 ? 296 SER A HA   1 
ATOM   376  H HB2  . SER A 1 25 ? 1.592   -2.623  6.570   1.00 0.00 ? 296 SER A HB2  1 
ATOM   377  H HB3  . SER A 1 25 ? 1.060   -4.277  6.863   1.00 0.00 ? 296 SER A HB3  1 
ATOM   378  H HG   . SER A 1 25 ? 2.350   -4.175  8.517   1.00 0.00 ? 296 SER A HG   1 
ATOM   379  N N    . THR A 1 26 ? 0.910   -5.020  4.021   1.00 0.00 ? 297 THR A N    1 
ATOM   380  C CA   . THR A 1 26 ? 0.164   -6.107  3.397   1.00 0.00 ? 297 THR A CA   1 
ATOM   381  C C    . THR A 1 26 ? 1.111   -6.931  2.524   1.00 0.00 ? 297 THR A C    1 
ATOM   382  O O    . THR A 1 26 ? 1.181   -8.139  2.633   1.00 0.00 ? 297 THR A O    1 
ATOM   383  C CB   . THR A 1 26 ? -0.956  -5.528  2.531   1.00 0.00 ? 297 THR A CB   1 
ATOM   384  O OG1  . THR A 1 26 ? -1.643  -4.518  3.260   1.00 0.00 ? 297 THR A OG1  1 
ATOM   385  C CG2  . THR A 1 26 ? -1.935  -6.639  2.150   1.00 0.00 ? 297 THR A CG2  1 
ATOM   386  H H    . THR A 1 26 ? 0.661   -4.090  3.842   1.00 0.00 ? 297 THR A H    1 
ATOM   387  H HA   . THR A 1 26 ? -0.262  -6.739  4.160   1.00 0.00 ? 297 THR A HA   1 
ATOM   388  H HB   . THR A 1 26 ? -0.536  -5.102  1.634   1.00 0.00 ? 297 THR A HB   1 
ATOM   389  H HG1  . THR A 1 26 ? -2.327  -4.943  3.783   1.00 0.00 ? 297 THR A HG1  1 
ATOM   390  H HG21 . THR A 1 26 ? -1.441  -7.596  2.231   1.00 0.00 ? 297 THR A HG21 1 
ATOM   391  H HG22 . THR A 1 26 ? -2.785  -6.614  2.816   1.00 0.00 ? 297 THR A HG22 1 
ATOM   392  H HG23 . THR A 1 26 ? -2.269  -6.491  1.133   1.00 0.00 ? 297 THR A HG23 1 
ATOM   393  N N    . ALA A 1 27 ? 1.845   -6.286  1.659   1.00 0.00 ? 298 ALA A N    1 
ATOM   394  C CA   . ALA A 1 27 ? 2.769   -7.014  0.800   1.00 0.00 ? 298 ALA A CA   1 
ATOM   395  C C    . ALA A 1 27 ? 3.815   -7.720  1.666   1.00 0.00 ? 298 ALA A C    1 
ATOM   396  O O    . ALA A 1 27 ? 4.344   -8.752  1.302   1.00 0.00 ? 298 ALA A O    1 
ATOM   397  C CB   . ALA A 1 27 ? 3.463   -6.034  -0.143  1.00 0.00 ? 298 ALA A CB   1 
ATOM   398  H H    . ALA A 1 27 ? 1.775   -5.311  1.589   1.00 0.00 ? 298 ALA A H    1 
ATOM   399  H HA   . ALA A 1 27 ? 2.226   -7.746  0.223   1.00 0.00 ? 298 ALA A HA   1 
ATOM   400  H HB1  . ALA A 1 27 ? 3.342   -5.028  0.231   1.00 0.00 ? 298 ALA A HB1  1 
ATOM   401  H HB2  . ALA A 1 27 ? 4.514   -6.272  -0.202  1.00 0.00 ? 298 ALA A HB2  1 
ATOM   402  H HB3  . ALA A 1 27 ? 3.022   -6.108  -1.128  1.00 0.00 ? 298 ALA A HB3  1 
ATOM   403  N N    . ASN A 1 28 ? 4.118   -7.172  2.811   1.00 0.00 ? 299 ASN A N    1 
ATOM   404  C CA   . ASN A 1 28 ? 5.106   -7.797  3.681   1.00 0.00 ? 299 ASN A CA   1 
ATOM   405  C C    . ASN A 1 28 ? 4.543   -9.110  4.227   1.00 0.00 ? 299 ASN A C    1 
ATOM   406  O O    . ASN A 1 28 ? 5.260   -10.071 4.426   1.00 0.00 ? 299 ASN A O    1 
ATOM   407  C CB   . ASN A 1 28 ? 5.430   -6.857  4.844   1.00 0.00 ? 299 ASN A CB   1 
ATOM   408  C CG   . ASN A 1 28 ? 6.348   -5.736  4.357   1.00 0.00 ? 299 ASN A CG   1 
ATOM   409  O OD1  . ASN A 1 28 ? 5.964   -4.582  4.345   1.00 0.00 ? 299 ASN A OD1  1 
ATOM   410  N ND2  . ASN A 1 28 ? 7.553   -6.026  3.953   1.00 0.00 ? 299 ASN A ND2  1 
ATOM   411  H H    . ASN A 1 28 ? 3.680   -6.340  3.086   1.00 0.00 ? 299 ASN A H    1 
ATOM   412  H HA   . ASN A 1 28 ? 6.007   -7.996  3.119   1.00 0.00 ? 299 ASN A HA   1 
ATOM   413  H HB2  . ASN A 1 28 ? 4.513   -6.433  5.228   1.00 0.00 ? 299 ASN A HB2  1 
ATOM   414  H HB3  . ASN A 1 28 ? 5.925   -7.411  5.627   1.00 0.00 ? 299 ASN A HB3  1 
ATOM   415  H HD21 . ASN A 1 28 ? 7.863   -6.956  3.964   1.00 0.00 ? 299 ASN A HD21 1 
ATOM   416  H HD22 . ASN A 1 28 ? 8.150   -5.315  3.639   1.00 0.00 ? 299 ASN A HD22 1 
ATOM   417  N N    . MET A 1 29 ? 3.262   -9.160  4.472   1.00 0.00 ? 300 MET A N    1 
ATOM   418  C CA   . MET A 1 29 ? 2.666   -10.384 4.996   1.00 0.00 ? 300 MET A CA   1 
ATOM   419  C C    . MET A 1 29 ? 2.593   -11.434 3.882   1.00 0.00 ? 300 MET A C    1 
ATOM   420  O O    . MET A 1 29 ? 2.903   -12.591 4.088   1.00 0.00 ? 300 MET A O    1 
ATOM   421  C CB   . MET A 1 29 ? 1.255   -10.085 5.508   1.00 0.00 ? 300 MET A CB   1 
ATOM   422  C CG   . MET A 1 29 ? 1.012   -10.852 6.810   1.00 0.00 ? 300 MET A CG   1 
ATOM   423  S SD   . MET A 1 29 ? 1.983   -10.104 8.141   1.00 0.00 ? 300 MET A SD   1 
ATOM   424  C CE   . MET A 1 29 ? 0.801   -10.402 9.478   1.00 0.00 ? 300 MET A CE   1 
ATOM   425  H H    . MET A 1 29 ? 2.701   -8.374  4.305   1.00 0.00 ? 300 MET A H    1 
ATOM   426  H HA   . MET A 1 29 ? 3.271   -10.761 5.807   1.00 0.00 ? 300 MET A HA   1 
ATOM   427  H HB2  . MET A 1 29 ? 1.156   -9.025  5.691   1.00 0.00 ? 300 MET A HB2  1 
ATOM   428  H HB3  . MET A 1 29 ? 0.531   -10.393 4.770   1.00 0.00 ? 300 MET A HB3  1 
ATOM   429  H HG2  . MET A 1 29 ? -0.037  -10.809 7.060   1.00 0.00 ? 300 MET A HG2  1 
ATOM   430  H HG3  . MET A 1 29 ? 1.310   -11.883 6.682   1.00 0.00 ? 300 MET A HG3  1 
ATOM   431  H HE1  . MET A 1 29 ? -0.198  -10.465 9.068   1.00 0.00 ? 300 MET A HE1  1 
ATOM   432  H HE2  . MET A 1 29 ? 1.042   -11.328 9.974   1.00 0.00 ? 300 MET A HE2  1 
ATOM   433  H HE3  . MET A 1 29 ? 0.853   -9.590  10.191  1.00 0.00 ? 300 MET A HE3  1 
ATOM   434  N N    . LEU A 1 30 ? 2.186   -11.039 2.708   1.00 0.00 ? 301 LEU A N    1 
ATOM   435  C CA   . LEU A 1 30 ? 2.094   -11.996 1.609   1.00 0.00 ? 301 LEU A CA   1 
ATOM   436  C C    . LEU A 1 30 ? 3.499   -12.435 1.194   1.00 0.00 ? 301 LEU A C    1 
ATOM   437  O O    . LEU A 1 30 ? 3.680   -13.465 0.575   1.00 0.00 ? 301 LEU A O    1 
ATOM   438  C CB   . LEU A 1 30 ? 1.393   -11.342 0.417   1.00 0.00 ? 301 LEU A CB   1 
ATOM   439  C CG   . LEU A 1 30 ? 0.050   -10.762 0.864   1.00 0.00 ? 301 LEU A CG   1 
ATOM   440  C CD1  . LEU A 1 30 ? -0.209  -9.449  0.125   1.00 0.00 ? 301 LEU A CD1  1 
ATOM   441  C CD2  . LEU A 1 30 ? -1.066  -11.757 0.541   1.00 0.00 ? 301 LEU A CD2  1 
ATOM   442  H H    . LEU A 1 30 ? 1.940   -10.101 2.563   1.00 0.00 ? 301 LEU A H    1 
ATOM   443  H HA   . LEU A 1 30 ? 1.527   -12.857 1.930   1.00 0.00 ? 301 LEU A HA   1 
ATOM   444  H HB2  . LEU A 1 30 ? 2.014   -10.552 0.024   1.00 0.00 ? 301 LEU A HB2  1 
ATOM   445  H HB3  . LEU A 1 30 ? 1.223   -12.083 -0.349  1.00 0.00 ? 301 LEU A HB3  1 
ATOM   446  H HG   . LEU A 1 30 ? 0.075   -10.578 1.929   1.00 0.00 ? 301 LEU A HG   1 
ATOM   447  H HD11 . LEU A 1 30 ? 0.695   -9.134  -0.376  1.00 0.00 ? 301 LEU A HD11 1 
ATOM   448  H HD12 . LEU A 1 30 ? -0.992  -9.595  -0.603  1.00 0.00 ? 301 LEU A HD12 1 
ATOM   449  H HD13 . LEU A 1 30 ? -0.512  -8.692  0.833   1.00 0.00 ? 301 LEU A HD13 1 
ATOM   450  H HD21 . LEU A 1 30 ? -0.633  -12.683 0.193   1.00 0.00 ? 301 LEU A HD21 1 
ATOM   451  H HD22 . LEU A 1 30 ? -1.650  -11.944 1.429   1.00 0.00 ? 301 LEU A HD22 1 
ATOM   452  H HD23 . LEU A 1 30 ? -1.702  -11.346 -0.229  1.00 0.00 ? 301 LEU A HD23 1 
ATOM   453  N N    . ARG A 1 31 ? 4.496   -11.660 1.524   1.00 0.00 ? 302 ARG A N    1 
ATOM   454  C CA   . ARG A 1 31 ? 5.858   -12.024 1.152   1.00 0.00 ? 302 ARG A CA   1 
ATOM   455  C C    . ARG A 1 31 ? 6.383   -13.091 2.115   1.00 0.00 ? 302 ARG A C    1 
ATOM   456  O O    . ARG A 1 31 ? 6.843   -14.140 1.709   1.00 0.00 ? 302 ARG A O    1 
ATOM   457  C CB   . ARG A 1 31 ? 6.755   -10.788 1.224   1.00 0.00 ? 302 ARG A CB   1 
ATOM   458  C CG   . ARG A 1 31 ? 7.043   -10.279 -0.190  1.00 0.00 ? 302 ARG A CG   1 
ATOM   459  C CD   . ARG A 1 31 ? 7.924   -9.031  -0.112  1.00 0.00 ? 302 ARG A CD   1 
ATOM   460  N NE   . ARG A 1 31 ? 8.521   -8.775  -1.418  1.00 0.00 ? 302 ARG A NE   1 
ATOM   461  C CZ   . ARG A 1 31 ? 9.056   -7.612  -1.674  1.00 0.00 ? 302 ARG A CZ   1 
ATOM   462  N NH1  . ARG A 1 31 ? 8.299   -6.605  -2.010  1.00 0.00 ? 302 ARG A NH1  1 
ATOM   463  N NH2  . ARG A 1 31 ? 10.350  -7.457  -1.595  1.00 0.00 ? 302 ARG A NH2  1 
ATOM   464  H H    . ARG A 1 31 ? 4.329   -10.832 2.021   1.00 0.00 ? 302 ARG A H    1 
ATOM   465  H HA   . ARG A 1 31 ? 5.865   -12.413 0.145   1.00 0.00 ? 302 ARG A HA   1 
ATOM   466  H HB2  . ARG A 1 31 ? 6.257   -10.015 1.791   1.00 0.00 ? 302 ARG A HB2  1 
ATOM   467  H HB3  . ARG A 1 31 ? 7.686   -11.046 1.707   1.00 0.00 ? 302 ARG A HB3  1 
ATOM   468  H HG2  . ARG A 1 31 ? 7.553   -11.047 -0.753  1.00 0.00 ? 302 ARG A HG2  1 
ATOM   469  H HG3  . ARG A 1 31 ? 6.114   -10.030 -0.679  1.00 0.00 ? 302 ARG A HG3  1 
ATOM   470  H HD2  . ARG A 1 31 ? 7.322   -8.183  0.180   1.00 0.00 ? 302 ARG A HD2  1 
ATOM   471  H HD3  . ARG A 1 31 ? 8.706   -9.187  0.616   1.00 0.00 ? 302 ARG A HD3  1 
ATOM   472  H HE   . ARG A 1 31 ? 8.520   -9.475  -2.103  1.00 0.00 ? 302 ARG A HE   1 
ATOM   473  H HH11 . ARG A 1 31 ? 7.307   -6.723  -2.071  1.00 0.00 ? 302 ARG A HH11 1 
ATOM   474  H HH12 . ARG A 1 31 ? 8.709   -5.715  -2.207  1.00 0.00 ? 302 ARG A HH12 1 
ATOM   475  H HH21 . ARG A 1 31 ? 10.930  -8.231  -1.337  1.00 0.00 ? 302 ARG A HH21 1 
ATOM   476  H HH22 . ARG A 1 31 ? 10.759  -6.568  -1.791  1.00 0.00 ? 302 ARG A HH22 1 
ATOM   477  N N    . GLU A 1 32 ? 6.325   -12.826 3.391   1.00 0.00 ? 303 GLU A N    1 
ATOM   478  C CA   . GLU A 1 32 ? 6.816   -13.797 4.364   1.00 0.00 ? 303 GLU A CA   1 
ATOM   479  C C    . GLU A 1 32 ? 6.028   -15.102 4.234   1.00 0.00 ? 303 GLU A C    1 
ATOM   480  O O    . GLU A 1 32 ? 6.567   -16.181 4.387   1.00 0.00 ? 303 GLU A O    1 
ATOM   481  C CB   . GLU A 1 32 ? 6.639   -13.234 5.775   1.00 0.00 ? 303 GLU A CB   1 
ATOM   482  C CG   . GLU A 1 32 ? 5.148   -13.073 6.077   1.00 0.00 ? 303 GLU A CG   1 
ATOM   483  C CD   . GLU A 1 32 ? 4.970   -12.439 7.458   1.00 0.00 ? 303 GLU A CD   1 
ATOM   484  O OE1  . GLU A 1 32 ? 5.627   -11.445 7.721   1.00 0.00 ? 303 GLU A OE1  1 
ATOM   485  O OE2  . GLU A 1 32 ? 4.180   -12.958 8.230   1.00 0.00 ? 303 GLU A OE2  1 
ATOM   486  H H    . GLU A 1 32 ? 5.956   -11.971 3.698   1.00 0.00 ? 303 GLU A H    1 
ATOM   487  H HA   . GLU A 1 32 ? 7.862   -13.988 4.185   1.00 0.00 ? 303 GLU A HA   1 
ATOM   488  H HB2  . GLU A 1 32 ? 7.082   -13.912 6.491   1.00 0.00 ? 303 GLU A HB2  1 
ATOM   489  H HB3  . GLU A 1 32 ? 7.123   -12.271 5.842   1.00 0.00 ? 303 GLU A HB3  1 
ATOM   490  H HG2  . GLU A 1 32 ? 4.695   -12.440 5.328   1.00 0.00 ? 303 GLU A HG2  1 
ATOM   491  H HG3  . GLU A 1 32 ? 4.672   -14.043 6.064   1.00 0.00 ? 303 GLU A HG3  1 
ATOM   492  N N    . GLN A 1 33 ? 4.754   -15.018 3.960   1.00 0.00 ? 304 GLN A N    1 
ATOM   493  C CA   . GLN A 1 33 ? 3.958   -16.234 3.834   1.00 0.00 ? 304 GLN A CA   1 
ATOM   494  C C    . GLN A 1 33 ? 4.295   -16.936 2.516   1.00 0.00 ? 304 GLN A C    1 
ATOM   495  O O    . GLN A 1 33 ? 4.415   -18.143 2.460   1.00 0.00 ? 304 GLN A O    1 
ATOM   496  C CB   . GLN A 1 33 ? 2.469   -15.880 3.870   1.00 0.00 ? 304 GLN A CB   1 
ATOM   497  C CG   . GLN A 1 33 ? 2.046   -15.270 2.533   1.00 0.00 ? 304 GLN A CG   1 
ATOM   498  C CD   . GLN A 1 33 ? 0.540   -14.999 2.553   1.00 0.00 ? 304 GLN A CD   1 
ATOM   499  O OE1  . GLN A 1 33 ? -0.082  -14.889 1.515   1.00 0.00 ? 304 GLN A OE1  1 
ATOM   500  N NE2  . GLN A 1 33 ? -0.078  -14.889 3.698   1.00 0.00 ? 304 GLN A NE2  1 
ATOM   501  H H    . GLN A 1 33 ? 4.334   -14.141 3.842   1.00 0.00 ? 304 GLN A H    1 
ATOM   502  H HA   . GLN A 1 33 ? 4.186   -16.896 4.657   1.00 0.00 ? 304 GLN A HA   1 
ATOM   503  H HB2  . GLN A 1 33 ? 1.893   -16.774 4.056   1.00 0.00 ? 304 GLN A HB2  1 
ATOM   504  H HB3  . GLN A 1 33 ? 2.290   -15.166 4.660   1.00 0.00 ? 304 GLN A HB3  1 
ATOM   505  H HG2  . GLN A 1 33 ? 2.577   -14.343 2.374   1.00 0.00 ? 304 GLN A HG2  1 
ATOM   506  H HG3  . GLN A 1 33 ? 2.274   -15.959 1.734   1.00 0.00 ? 304 GLN A HG3  1 
ATOM   507  H HE21 . GLN A 1 33 ? 0.422   -14.978 4.536   1.00 0.00 ? 304 GLN A HE21 1 
ATOM   508  H HE22 . GLN A 1 33 ? -1.043  -14.716 3.720   1.00 0.00 ? 304 GLN A HE22 1 
ATOM   509  N N    . VAL A 1 34 ? 4.450   -16.190 1.456   1.00 0.00 ? 305 VAL A N    1 
ATOM   510  C CA   . VAL A 1 34 ? 4.776   -16.809 0.177   1.00 0.00 ? 305 VAL A CA   1 
ATOM   511  C C    . VAL A 1 34 ? 6.204   -17.354 0.234   1.00 0.00 ? 305 VAL A C    1 
ATOM   512  O O    . VAL A 1 34 ? 6.604   -18.162 -0.582  1.00 0.00 ? 305 VAL A O    1 
ATOM   513  C CB   . VAL A 1 34 ? 4.670   -15.771 -0.941  1.00 0.00 ? 305 VAL A CB   1 
ATOM   514  C CG1  . VAL A 1 34 ? 5.258   -16.350 -2.230  1.00 0.00 ? 305 VAL A CG1  1 
ATOM   515  C CG2  . VAL A 1 34 ? 3.197   -15.418 -1.168  1.00 0.00 ? 305 VAL A CG2  1 
ATOM   516  H H    . VAL A 1 34 ? 4.353   -15.218 1.521   1.00 0.00 ? 305 VAL A H    1 
ATOM   517  H HA   . VAL A 1 34 ? 4.089   -17.618 -0.017  1.00 0.00 ? 305 VAL A HA   1 
ATOM   518  H HB   . VAL A 1 34 ? 5.217   -14.882 -0.664  1.00 0.00 ? 305 VAL A HB   1 
ATOM   519  H HG11 . VAL A 1 34 ? 4.930   -17.373 -2.347  1.00 0.00 ? 305 VAL A HG11 1 
ATOM   520  H HG12 . VAL A 1 34 ? 4.920   -15.766 -3.073  1.00 0.00 ? 305 VAL A HG12 1 
ATOM   521  H HG13 . VAL A 1 34 ? 6.335   -16.320 -2.179  1.00 0.00 ? 305 VAL A HG13 1 
ATOM   522  H HG21 . VAL A 1 34 ? 2.696   -15.338 -0.215  1.00 0.00 ? 305 VAL A HG21 1 
ATOM   523  H HG22 . VAL A 1 34 ? 3.130   -14.476 -1.690  1.00 0.00 ? 305 VAL A HG22 1 
ATOM   524  H HG23 . VAL A 1 34 ? 2.729   -16.191 -1.759  1.00 0.00 ? 305 VAL A HG23 1 
ATOM   525  N N    . ALA A 1 35 ? 6.973   -16.923 1.196   1.00 0.00 ? 306 ALA A N    1 
ATOM   526  C CA   . ALA A 1 35 ? 8.343   -17.407 1.309   1.00 0.00 ? 306 ALA A CA   1 
ATOM   527  C C    . ALA A 1 35 ? 8.340   -18.766 2.011   1.00 0.00 ? 306 ALA A C    1 
ATOM   528  O O    . ALA A 1 35 ? 8.946   -19.714 1.552   1.00 0.00 ? 306 ALA A O    1 
ATOM   529  C CB   . ALA A 1 35 ? 9.172   -16.413 2.124   1.00 0.00 ? 306 ALA A CB   1 
ATOM   530  H H    . ALA A 1 35 ? 6.628   -16.275 1.845   1.00 0.00 ? 306 ALA A H    1 
ATOM   531  H HA   . ALA A 1 35 ? 8.772   -17.510 0.324   1.00 0.00 ? 306 ALA A HA   1 
ATOM   532  H HB1  . ALA A 1 35 ? 8.557   -15.985 2.903   1.00 0.00 ? 306 ALA A HB1  1 
ATOM   533  H HB2  . ALA A 1 35 ? 10.012  -16.925 2.570   1.00 0.00 ? 306 ALA A HB2  1 
ATOM   534  H HB3  . ALA A 1 35 ? 9.531   -15.627 1.476   1.00 0.00 ? 306 ALA A HB3  1 
ATOM   535  N N    . GLN A 1 36 ? 7.657   -18.871 3.119   1.00 0.00 ? 307 GLN A N    1 
ATOM   536  C CA   . GLN A 1 36 ? 7.612   -20.145 3.828   1.00 0.00 ? 307 GLN A CA   1 
ATOM   537  C C    . GLN A 1 36 ? 6.924   -21.183 2.943   1.00 0.00 ? 307 GLN A C    1 
ATOM   538  O O    . GLN A 1 36 ? 7.296   -22.340 2.919   1.00 0.00 ? 307 GLN A O    1 
ATOM   539  C CB   . GLN A 1 36 ? 6.826   -19.982 5.131   1.00 0.00 ? 307 GLN A CB   1 
ATOM   540  C CG   . GLN A 1 36 ? 7.394   -18.807 5.930   1.00 0.00 ? 307 GLN A CG   1 
ATOM   541  C CD   . GLN A 1 36 ? 6.527   -18.564 7.167   1.00 0.00 ? 307 GLN A CD   1 
ATOM   542  O OE1  . GLN A 1 36 ? 6.908   -18.910 8.267   1.00 0.00 ? 307 GLN A OE1  1 
ATOM   543  N NE2  . GLN A 1 36 ? 5.368   -17.978 7.031   1.00 0.00 ? 307 GLN A NE2  1 
ATOM   544  H H    . GLN A 1 36 ? 7.170   -18.096 3.470   1.00 0.00 ? 307 GLN A H    1 
ATOM   545  H HA   . GLN A 1 36 ? 8.618   -20.468 4.052   1.00 0.00 ? 307 GLN A HA   1 
ATOM   546  H HB2  . GLN A 1 36 ? 5.786   -19.794 4.903   1.00 0.00 ? 307 GLN A HB2  1 
ATOM   547  H HB3  . GLN A 1 36 ? 6.909   -20.885 5.716   1.00 0.00 ? 307 GLN A HB3  1 
ATOM   548  H HG2  . GLN A 1 36 ? 8.405   -19.035 6.236   1.00 0.00 ? 307 GLN A HG2  1 
ATOM   549  H HG3  . GLN A 1 36 ? 7.395   -17.920 5.314   1.00 0.00 ? 307 GLN A HG3  1 
ATOM   550  H HE21 . GLN A 1 36 ? 5.061   -17.698 6.144   1.00 0.00 ? 307 GLN A HE21 1 
ATOM   551  H HE22 . GLN A 1 36 ? 4.805   -17.819 7.817   1.00 0.00 ? 307 GLN A HE22 1 
ATOM   552  N N    . LEU A 1 37 ? 5.925   -20.776 2.209   1.00 0.00 ? 308 LEU A N    1 
ATOM   553  C CA   . LEU A 1 37 ? 5.228   -21.714 1.337   1.00 0.00 ? 308 LEU A CA   1 
ATOM   554  C C    . LEU A 1 37 ? 6.151   -22.111 0.184   1.00 0.00 ? 308 LEU A C    1 
ATOM   555  O O    . LEU A 1 37 ? 6.289   -23.273 -0.142  1.00 0.00 ? 308 LEU A O    1 
ATOM   556  C CB   . LEU A 1 37 ? 3.967   -21.051 0.781   1.00 0.00 ? 308 LEU A CB   1 
ATOM   557  C CG   . LEU A 1 37 ? 2.747   -21.532 1.568   1.00 0.00 ? 308 LEU A CG   1 
ATOM   558  C CD1  . LEU A 1 37 ? 1.720   -20.401 1.659   1.00 0.00 ? 308 LEU A CD1  1 
ATOM   559  C CD2  . LEU A 1 37 ? 2.121   -22.731 0.854   1.00 0.00 ? 308 LEU A CD2  1 
ATOM   560  H H    . LEU A 1 37 ? 5.645   -19.838 2.242   1.00 0.00 ? 308 LEU A H    1 
ATOM   561  H HA   . LEU A 1 37 ? 4.953   -22.594 1.900   1.00 0.00 ? 308 LEU A HA   1 
ATOM   562  H HB2  . LEU A 1 37 ? 4.056   -19.977 0.872   1.00 0.00 ? 308 LEU A HB2  1 
ATOM   563  H HB3  . LEU A 1 37 ? 3.850   -21.315 -0.260  1.00 0.00 ? 308 LEU A HB3  1 
ATOM   564  H HG   . LEU A 1 37 ? 3.052   -21.821 2.563   1.00 0.00 ? 308 LEU A HG   1 
ATOM   565  H HD11 . LEU A 1 37 ? 2.204   -19.456 1.467   1.00 0.00 ? 308 LEU A HD11 1 
ATOM   566  H HD12 . LEU A 1 37 ? 0.942   -20.562 0.926   1.00 0.00 ? 308 LEU A HD12 1 
ATOM   567  H HD13 . LEU A 1 37 ? 1.285   -20.389 2.647   1.00 0.00 ? 308 LEU A HD13 1 
ATOM   568  H HD21 . LEU A 1 37 ? 2.798   -23.092 0.094   1.00 0.00 ? 308 LEU A HD21 1 
ATOM   569  H HD22 . LEU A 1 37 ? 1.931   -23.518 1.569   1.00 0.00 ? 308 LEU A HD22 1 
ATOM   570  H HD23 . LEU A 1 37 ? 1.190   -22.432 0.393   1.00 0.00 ? 308 LEU A HD23 1 
ATOM   571  N N    . LYS A 1 38 ? 6.783   -21.153 -0.435  1.00 0.00 ? 309 LYS A N    1 
ATOM   572  C CA   . LYS A 1 38 ? 7.679   -21.465 -1.542  1.00 0.00 ? 309 LYS A CA   1 
ATOM   573  C C    . LYS A 1 38 ? 8.675   -22.539 -1.101  1.00 0.00 ? 309 LYS A C    1 
ATOM   574  O O    . LYS A 1 38 ? 8.927   -23.493 -1.808  1.00 0.00 ? 309 LYS A O    1 
ATOM   575  C CB   . LYS A 1 38 ? 8.439   -20.202 -1.953  1.00 0.00 ? 309 LYS A CB   1 
ATOM   576  C CG   . LYS A 1 38 ? 7.618   -19.421 -2.981  1.00 0.00 ? 309 LYS A CG   1 
ATOM   577  C CD   . LYS A 1 38 ? 7.799   -20.049 -4.364  1.00 0.00 ? 309 LYS A CD   1 
ATOM   578  C CE   . LYS A 1 38 ? 7.281   -19.086 -5.433  1.00 0.00 ? 309 LYS A CE   1 
ATOM   579  N NZ   . LYS A 1 38 ? 6.550   -19.855 -6.481  1.00 0.00 ? 309 LYS A NZ   1 
ATOM   580  H H    . LYS A 1 38 ? 6.656   -20.223 -0.155  1.00 0.00 ? 309 LYS A H    1 
ATOM   581  H HA   . LYS A 1 38 ? 7.104   -21.827 -2.382  1.00 0.00 ? 309 LYS A HA   1 
ATOM   582  H HB2  . LYS A 1 38 ? 8.610   -19.585 -1.083  1.00 0.00 ? 309 LYS A HB2  1 
ATOM   583  H HB3  . LYS A 1 38 ? 9.387   -20.479 -2.390  1.00 0.00 ? 309 LYS A HB3  1 
ATOM   584  H HG2  . LYS A 1 38 ? 6.573   -19.451 -2.705  1.00 0.00 ? 309 LYS A HG2  1 
ATOM   585  H HG3  . LYS A 1 38 ? 7.953   -18.396 -3.006  1.00 0.00 ? 309 LYS A HG3  1 
ATOM   586  H HD2  . LYS A 1 38 ? 8.848   -20.246 -4.533  1.00 0.00 ? 309 LYS A HD2  1 
ATOM   587  H HD3  . LYS A 1 38 ? 7.244   -20.973 -4.415  1.00 0.00 ? 309 LYS A HD3  1 
ATOM   588  H HE2  . LYS A 1 38 ? 6.611   -18.370 -4.980  1.00 0.00 ? 309 LYS A HE2  1 
ATOM   589  H HE3  . LYS A 1 38 ? 8.113   -18.566 -5.884  1.00 0.00 ? 309 LYS A HE3  1 
ATOM   590  H HZ1  . LYS A 1 38 ? 6.520   -20.859 -6.216  1.00 0.00 ? 309 LYS A HZ1  1 
ATOM   591  H HZ2  . LYS A 1 38 ? 5.579   -19.489 -6.565  1.00 0.00 ? 309 LYS A HZ2  1 
ATOM   592  H HZ3  . LYS A 1 38 ? 7.040   -19.752 -7.391  1.00 0.00 ? 309 LYS A HZ3  1 
ATOM   593  N N    . GLN A 1 39 ? 9.243   -22.387 0.063   1.00 0.00 ? 310 GLN A N    1 
ATOM   594  C CA   . GLN A 1 39 ? 10.204  -23.376 0.541   1.00 0.00 ? 310 GLN A CA   1 
ATOM   595  C C    . GLN A 1 39 ? 9.531   -24.747 0.619   1.00 0.00 ? 310 GLN A C    1 
ATOM   596  O O    . GLN A 1 39 ? 10.107  -25.755 0.253   1.00 0.00 ? 310 GLN A O    1 
ATOM   597  C CB   . GLN A 1 39 ? 10.700  -22.972 1.931   1.00 0.00 ? 310 GLN A CB   1 
ATOM   598  C CG   . GLN A 1 39 ? 11.350  -21.588 1.860   1.00 0.00 ? 310 GLN A CG   1 
ATOM   599  C CD   . GLN A 1 39 ? 12.664  -21.681 1.082   1.00 0.00 ? 310 GLN A CD   1 
ATOM   600  O OE1  . GLN A 1 39 ? 12.853  -20.987 0.102   1.00 0.00 ? 310 GLN A OE1  1 
ATOM   601  N NE2  . GLN A 1 39 ? 13.585  -22.514 1.480   1.00 0.00 ? 310 GLN A NE2  1 
ATOM   602  H H    . GLN A 1 39 ? 9.026   -21.608 0.617   1.00 0.00 ? 310 GLN A H    1 
ATOM   603  H HA   . GLN A 1 39 ? 11.041  -23.423 -0.137  1.00 0.00 ? 310 GLN A HA   1 
ATOM   604  H HB2  . GLN A 1 39 ? 9.866   -22.944 2.617   1.00 0.00 ? 310 GLN A HB2  1 
ATOM   605  H HB3  . GLN A 1 39 ? 11.427  -23.691 2.276   1.00 0.00 ? 310 GLN A HB3  1 
ATOM   606  H HG2  . GLN A 1 39 ? 10.682  -20.903 1.359   1.00 0.00 ? 310 GLN A HG2  1 
ATOM   607  H HG3  . GLN A 1 39 ? 11.549  -21.232 2.858   1.00 0.00 ? 310 GLN A HG3  1 
ATOM   608  H HE21 . GLN A 1 39 ? 13.432  -23.075 2.269   1.00 0.00 ? 310 GLN A HE21 1 
ATOM   609  H HE22 . GLN A 1 39 ? 14.430  -22.581 0.989   1.00 0.00 ? 310 GLN A HE22 1 
ATOM   610  N N    . LYS A 1 40 ? 8.316   -24.798 1.094   1.00 0.00 ? 311 LYS A N    1 
ATOM   611  C CA   . LYS A 1 40 ? 7.623   -26.077 1.195   1.00 0.00 ? 311 LYS A CA   1 
ATOM   612  C C    . LYS A 1 40 ? 7.422   -26.662 -0.206  1.00 0.00 ? 311 LYS A C    1 
ATOM   613  O O    . LYS A 1 40 ? 7.373   -27.863 -0.386  1.00 0.00 ? 311 LYS A O    1 
ATOM   614  C CB   . LYS A 1 40 ? 6.261   -25.869 1.859   1.00 0.00 ? 311 LYS A CB   1 
ATOM   615  C CG   . LYS A 1 40 ? 6.092   -26.872 3.000   1.00 0.00 ? 311 LYS A CG   1 
ATOM   616  C CD   . LYS A 1 40 ? 5.635   -26.138 4.263   1.00 0.00 ? 311 LYS A CD   1 
ATOM   617  C CE   . LYS A 1 40 ? 6.816   -25.991 5.223   1.00 0.00 ? 311 LYS A CE   1 
ATOM   618  N NZ   . LYS A 1 40 ? 7.491   -24.683 4.983   1.00 0.00 ? 311 LYS A NZ   1 
ATOM   619  H H    . LYS A 1 40 ? 7.871   -23.975 1.385   1.00 0.00 ? 311 LYS A H    1 
ATOM   620  H HA   . LYS A 1 40 ? 8.211   -26.760 1.790   1.00 0.00 ? 311 LYS A HA   1 
ATOM   621  H HB2  . LYS A 1 40 ? 6.202   -24.863 2.251   1.00 0.00 ? 311 LYS A HB2  1 
ATOM   622  H HB3  . LYS A 1 40 ? 5.478   -26.017 1.132   1.00 0.00 ? 311 LYS A HB3  1 
ATOM   623  H HG2  . LYS A 1 40 ? 5.351   -27.610 2.723   1.00 0.00 ? 311 LYS A HG2  1 
ATOM   624  H HG3  . LYS A 1 40 ? 7.033   -27.363 3.192   1.00 0.00 ? 311 LYS A HG3  1 
ATOM   625  H HD2  . LYS A 1 40 ? 5.263   -25.160 3.994   1.00 0.00 ? 311 LYS A HD2  1 
ATOM   626  H HD3  . LYS A 1 40 ? 4.851   -26.702 4.744   1.00 0.00 ? 311 LYS A HD3  1 
ATOM   627  H HE2  . LYS A 1 40 ? 6.460   -26.030 6.241   1.00 0.00 ? 311 LYS A HE2  1 
ATOM   628  H HE3  . LYS A 1 40 ? 7.519   -26.794 5.056   1.00 0.00 ? 311 LYS A HE3  1 
ATOM   629  H HZ1  . LYS A 1 40 ? 6.771   -23.942 4.853   1.00 0.00 ? 311 LYS A HZ1  1 
ATOM   630  H HZ2  . LYS A 1 40 ? 8.090   -24.447 5.799   1.00 0.00 ? 311 LYS A HZ2  1 
ATOM   631  H HZ3  . LYS A 1 40 ? 8.081   -24.749 4.129   1.00 0.00 ? 311 LYS A HZ3  1 
ATOM   632  N N    . VAL A 1 41 ? 7.306   -25.824 -1.199  1.00 0.00 ? 312 VAL A N    1 
ATOM   633  C CA   . VAL A 1 41 ? 7.110   -26.325 -2.555  1.00 0.00 ? 312 VAL A CA   1 
ATOM   634  C C    . VAL A 1 41 ? 8.449   -26.802 -3.121  1.00 0.00 ? 312 VAL A C    1 
ATOM   635  O O    . VAL A 1 41 ? 8.497   -27.613 -4.024  1.00 0.00 ? 312 VAL A O    1 
ATOM   636  C CB   . VAL A 1 41 ? 6.552   -25.206 -3.436  1.00 0.00 ? 312 VAL A CB   1 
ATOM   637  C CG1  . VAL A 1 41 ? 6.494   -25.681 -4.889  1.00 0.00 ? 312 VAL A CG1  1 
ATOM   638  C CG2  . VAL A 1 41 ? 5.142   -24.844 -2.963  1.00 0.00 ? 312 VAL A CG2  1 
ATOM   639  H H    . VAL A 1 41 ? 7.348   -24.860 -1.034  1.00 0.00 ? 312 VAL A H    1 
ATOM   640  H HA   . VAL A 1 41 ? 6.414   -27.148 -2.536  1.00 0.00 ? 312 VAL A HA   1 
ATOM   641  H HB   . VAL A 1 41 ? 7.192   -24.340 -3.366  1.00 0.00 ? 312 VAL A HB   1 
ATOM   642  H HG11 . VAL A 1 41 ? 7.427   -26.156 -5.151  1.00 0.00 ? 312 VAL A HG11 1 
ATOM   643  H HG12 . VAL A 1 41 ? 5.686   -26.390 -5.005  1.00 0.00 ? 312 VAL A HG12 1 
ATOM   644  H HG13 . VAL A 1 41 ? 6.324   -24.835 -5.538  1.00 0.00 ? 312 VAL A HG13 1 
ATOM   645  H HG21 . VAL A 1 41 ? 5.115   -24.841 -1.883  1.00 0.00 ? 312 VAL A HG21 1 
ATOM   646  H HG22 . VAL A 1 41 ? 4.880   -23.864 -3.331  1.00 0.00 ? 312 VAL A HG22 1 
ATOM   647  H HG23 . VAL A 1 41 ? 4.438   -25.572 -3.338  1.00 0.00 ? 312 VAL A HG23 1 
ATOM   648  N N    . MET A 1 42 ? 9.537   -26.309 -2.596  1.00 0.00 ? 313 MET A N    1 
ATOM   649  C CA   . MET A 1 42 ? 10.842  -26.730 -3.094  1.00 0.00 ? 313 MET A CA   1 
ATOM   650  C C    . MET A 1 42 ? 11.071  -28.200 -2.736  1.00 0.00 ? 313 MET A C    1 
ATOM   651  O O    . MET A 1 42 ? 11.556  -28.520 -1.670  1.00 0.00 ? 313 MET A O    1 
ATOM   652  C CB   . MET A 1 42 ? 11.935  -25.870 -2.455  1.00 0.00 ? 313 MET A CB   1 
ATOM   653  C CG   . MET A 1 42 ? 11.736  -24.409 -2.856  1.00 0.00 ? 313 MET A CG   1 
ATOM   654  S SD   . MET A 1 42 ? 12.929  -23.968 -4.144  1.00 0.00 ? 313 MET A SD   1 
ATOM   655  C CE   . MET A 1 42 ? 12.548  -22.201 -4.212  1.00 0.00 ? 313 MET A CE   1 
ATOM   656  H H    . MET A 1 42 ? 9.477   -25.657 -1.867  1.00 0.00 ? 313 MET A H    1 
ATOM   657  H HA   . MET A 1 42 ? 10.874  -26.611 -4.168  1.00 0.00 ? 313 MET A HA   1 
ATOM   658  H HB2  . MET A 1 42 ? 11.880  -25.961 -1.380  1.00 0.00 ? 313 MET A HB2  1 
ATOM   659  H HB3  . MET A 1 42 ? 12.903  -26.206 -2.796  1.00 0.00 ? 313 MET A HB3  1 
ATOM   660  H HG2  . MET A 1 42 ? 10.733  -24.272 -3.234  1.00 0.00 ? 313 MET A HG2  1 
ATOM   661  H HG3  . MET A 1 42 ? 11.886  -23.775 -1.994  1.00 0.00 ? 313 MET A HG3  1 
ATOM   662  H HE1  . MET A 1 42 ? 11.729  -21.984 -3.540  1.00 0.00 ? 313 MET A HE1  1 
ATOM   663  H HE2  . MET A 1 42 ? 13.414  -21.632 -3.914  1.00 0.00 ? 313 MET A HE2  1 
ATOM   664  H HE3  . MET A 1 42 ? 12.274  -21.931 -5.223  1.00 0.00 ? 313 MET A HE3  1 
ATOM   665  N N    . ASN A 1 43 ? 10.725  -29.096 -3.620  1.00 0.00 ? 314 ASN A N    1 
ATOM   666  C CA   . ASN A 1 43 ? 10.919  -30.512 -3.334  1.00 0.00 ? 314 ASN A CA   1 
ATOM   667  C C    . ASN A 1 43 ? 10.518  -31.339 -4.557  1.00 0.00 ? 314 ASN A C    1 
ATOM   668  O O    . ASN A 1 43 ? 9.740   -32.268 -4.462  1.00 0.00 ? 314 ASN A O    1 
ATOM   669  C CB   . ASN A 1 43 ? 10.056  -30.915 -2.138  1.00 0.00 ? 314 ASN A CB   1 
ATOM   670  C CG   . ASN A 1 43 ? 10.795  -31.960 -1.301  1.00 0.00 ? 314 ASN A CG   1 
ATOM   671  O OD1  . ASN A 1 43 ? 11.442  -31.628 -0.327  1.00 0.00 ? 314 ASN A OD1  1 
ATOM   672  N ND2  . ASN A 1 43 ? 10.727  -33.218 -1.641  1.00 0.00 ? 314 ASN A ND2  1 
ATOM   673  H H    . ASN A 1 43 ? 10.335  -28.816 -4.473  1.00 0.00 ? 314 ASN A H    1 
ATOM   674  H HA   . ASN A 1 43 ? 11.958  -30.693 -3.102  1.00 0.00 ? 314 ASN A HA   1 
ATOM   675  H HB2  . ASN A 1 43 ? 9.853   -30.044 -1.531  1.00 0.00 ? 314 ASN A HB2  1 
ATOM   676  H HB3  . ASN A 1 43 ? 9.125   -31.333 -2.490  1.00 0.00 ? 314 ASN A HB3  1 
ATOM   677  H HD21 . ASN A 1 43 ? 10.204  -33.484 -2.426  1.00 0.00 ? 314 ASN A HD21 1 
ATOM   678  H HD22 . ASN A 1 43 ? 11.197  -33.896 -1.111  1.00 0.00 ? 314 ASN A HD22 1 
ATOM   679  N N    . TYR A 1 44 ? 11.035  -31.004 -5.708  1.00 0.00 ? 315 TYR A N    1 
ATOM   680  C CA   . TYR A 1 44 ? 10.685  -31.749 -6.912  1.00 0.00 ? 315 TYR A CA   1 
ATOM   681  C C    . TYR A 1 44 ? 11.689  -31.424 -8.021  1.00 0.00 ? 315 TYR A C    1 
ATOM   682  O O    . TYR A 1 44 ? 12.035  -32.329 -8.763  1.00 0.00 ? 315 TYR A O    1 
ATOM   683  C CB   . TYR A 1 44 ? 9.274   -31.354 -7.360  1.00 0.00 ? 315 TYR A CB   1 
ATOM   684  C CG   . TYR A 1 44 ? 8.923   -32.077 -8.640  1.00 0.00 ? 315 TYR A CG   1 
ATOM   685  C CD1  . TYR A 1 44 ? 9.137   -33.459 -8.750  1.00 0.00 ? 315 TYR A CD1  1 
ATOM   686  C CD2  . TYR A 1 44 ? 8.381   -31.363 -9.722  1.00 0.00 ? 315 TYR A CD2  1 
ATOM   687  C CE1  . TYR A 1 44 ? 8.810   -34.130 -9.939  1.00 0.00 ? 315 TYR A CE1  1 
ATOM   688  C CE2  . TYR A 1 44 ? 8.054   -32.033 -10.912 1.00 0.00 ? 315 TYR A CE2  1 
ATOM   689  C CZ   . TYR A 1 44 ? 8.269   -33.416 -11.021 1.00 0.00 ? 315 TYR A CZ   1 
ATOM   690  O OH   . TYR A 1 44 ? 7.948   -34.074 -12.190 1.00 0.00 ? 315 TYR A OH   1 
ATOM   691  O OXT  . TYR A 1 44 ? 12.092  -30.277 -8.111  1.00 0.00 ? 315 TYR A OXT  1 
ATOM   692  H H    . TYR A 1 44 ? 11.655  -30.247 -5.764  1.00 0.00 ? 315 TYR A H    1 
ATOM   693  H HA   . TYR A 1 44 ? 10.709  -32.807 -6.701  1.00 0.00 ? 315 TYR A HA   1 
ATOM   694  H HB2  . TYR A 1 44 ? 8.565   -31.621 -6.591  1.00 0.00 ? 315 TYR A HB2  1 
ATOM   695  H HB3  . TYR A 1 44 ? 9.236   -30.287 -7.529  1.00 0.00 ? 315 TYR A HB3  1 
ATOM   696  H HD1  . TYR A 1 44 ? 9.553   -34.009 -7.917  1.00 0.00 ? 315 TYR A HD1  1 
ATOM   697  H HD2  . TYR A 1 44 ? 8.216   -30.298 -9.639  1.00 0.00 ? 315 TYR A HD2  1 
ATOM   698  H HE1  . TYR A 1 44 ? 8.974   -35.194 -10.023 1.00 0.00 ? 315 TYR A HE1  1 
ATOM   699  H HE2  . TYR A 1 44 ? 7.638   -31.483 -11.743 1.00 0.00 ? 315 TYR A HE2  1 
ATOM   700  H HH   . TYR A 1 44 ? 8.747   -34.154 -12.714 1.00 0.00 ? 315 TYR A HH   1 
HETATM 701  C C    . ACE B 1 1  ? 2.693   34.339  -4.553  1.00 0.00 ? 272 ACE B C    1 
HETATM 702  O O    . ACE B 1 1  ? 3.686   34.405  -5.248  1.00 0.00 ? 272 ACE B O    1 
HETATM 703  C CH3  . ACE B 1 1  ? 1.580   35.384  -4.658  1.00 0.00 ? 272 ACE B CH3  1 
HETATM 704  H H1   . ACE B 1 1  ? 1.823   36.091  -5.438  1.00 0.00 ? 272 ACE B H1   1 
HETATM 705  H H2   . ACE B 1 1  ? 0.647   34.894  -4.895  1.00 0.00 ? 272 ACE B H2   1 
HETATM 706  H H3   . ACE B 1 1  ? 1.485   35.905  -3.717  1.00 0.00 ? 272 ACE B H3   1 
ATOM   707  N N    . CYS B 1 2  ? 2.534   33.375  -3.687  1.00 0.00 ? 273 CYS B N    1 
ATOM   708  C CA   . CYS B 1 2  ? 3.561   32.350  -3.545  1.00 0.00 ? 273 CYS B CA   1 
ATOM   709  C C    . CYS B 1 2  ? 3.758   31.633  -4.882  1.00 0.00 ? 273 CYS B C    1 
ATOM   710  O O    . CYS B 1 2  ? 2.926   31.708  -5.765  1.00 0.00 ? 273 CYS B O    1 
ATOM   711  C CB   . CYS B 1 2  ? 3.127   31.337  -2.483  1.00 0.00 ? 273 CYS B CB   1 
ATOM   712  S SG   . CYS B 1 2  ? 2.789   32.200  -0.928  1.00 0.00 ? 273 CYS B SG   1 
ATOM   713  H H    . CYS B 1 2  ? 1.726   33.338  -3.135  1.00 0.00 ? 273 CYS B H    1 
ATOM   714  H HA   . CYS B 1 2  ? 4.489   32.808  -3.242  1.00 0.00 ? 273 CYS B HA   1 
ATOM   715  H HB2  . CYS B 1 2  ? 2.233   30.831  -2.814  1.00 0.00 ? 273 CYS B HB2  1 
ATOM   716  H HB3  . CYS B 1 2  ? 3.915   30.615  -2.329  1.00 0.00 ? 273 CYS B HB3  1 
ATOM   717  N N    . GLY B 1 3  ? 4.853   30.940  -5.039  1.00 0.00 ? 274 GLY B N    1 
ATOM   718  C CA   . GLY B 1 3  ? 5.094   30.238  -6.295  1.00 0.00 ? 274 GLY B CA   1 
ATOM   719  C C    . GLY B 1 3  ? 6.415   29.473  -6.209  1.00 0.00 ? 274 GLY B C    1 
ATOM   720  O O    . GLY B 1 3  ? 7.396   29.839  -6.824  1.00 0.00 ? 274 GLY B O    1 
ATOM   721  H H    . GLY B 1 3  ? 5.512   30.893  -4.316  1.00 0.00 ? 274 GLY B H    1 
ATOM   722  H HA2  . GLY B 1 3  ? 4.285   29.545  -6.480  1.00 0.00 ? 274 GLY B HA2  1 
ATOM   723  H HA3  . GLY B 1 3  ? 5.149   30.952  -7.101  1.00 0.00 ? 274 GLY B HA3  1 
ATOM   724  N N    . GLY B 1 4  ? 6.449   28.412  -5.448  1.00 0.00 ? 275 GLY B N    1 
ATOM   725  C CA   . GLY B 1 4  ? 7.682   27.642  -5.327  1.00 0.00 ? 275 GLY B CA   1 
ATOM   726  C C    . GLY B 1 4  ? 7.466   26.475  -4.361  1.00 0.00 ? 275 GLY B C    1 
ATOM   727  O O    . GLY B 1 4  ? 7.672   25.327  -4.705  1.00 0.00 ? 275 GLY B O    1 
ATOM   728  H H    . GLY B 1 4  ? 5.646   28.134  -4.959  1.00 0.00 ? 275 GLY B H    1 
ATOM   729  H HA2  . GLY B 1 4  ? 7.966   27.262  -6.298  1.00 0.00 ? 275 GLY B HA2  1 
ATOM   730  H HA3  . GLY B 1 4  ? 8.465   28.277  -4.945  1.00 0.00 ? 275 GLY B HA3  1 
ATOM   731  N N    . ARG B 1 5  ? 7.060   26.757  -3.154  1.00 0.00 ? 276 ARG B N    1 
ATOM   732  C CA   . ARG B 1 5  ? 6.841   25.685  -2.191  1.00 0.00 ? 276 ARG B CA   1 
ATOM   733  C C    . ARG B 1 5  ? 5.613   24.871  -2.599  1.00 0.00 ? 276 ARG B C    1 
ATOM   734  O O    . ARG B 1 5  ? 5.477   23.715  -2.249  1.00 0.00 ? 276 ARG B O    1 
ATOM   735  C CB   . ARG B 1 5  ? 6.621   26.284  -0.800  1.00 0.00 ? 276 ARG B CB   1 
ATOM   736  C CG   . ARG B 1 5  ? 7.956   26.350  -0.057  1.00 0.00 ? 276 ARG B CG   1 
ATOM   737  C CD   . ARG B 1 5  ? 7.904   27.464  0.992   1.00 0.00 ? 276 ARG B CD   1 
ATOM   738  N NE   . ARG B 1 5  ? 9.250   27.723  1.490   1.00 0.00 ? 276 ARG B NE   1 
ATOM   739  C CZ   . ARG B 1 5  ? 9.502   28.816  2.157   1.00 0.00 ? 276 ARG B CZ   1 
ATOM   740  N NH1  . ARG B 1 5  ? 9.014   29.956  1.752   1.00 0.00 ? 276 ARG B NH1  1 
ATOM   741  N NH2  . ARG B 1 5  ? 10.243  28.767  3.231   1.00 0.00 ? 276 ARG B NH2  1 
ATOM   742  H H    . ARG B 1 5  ? 6.903   27.689  -2.895  1.00 0.00 ? 276 ARG B H    1 
ATOM   743  H HA   . ARG B 1 5  ? 7.707   25.041  -2.168  1.00 0.00 ? 276 ARG B HA   1 
ATOM   744  H HB2  . ARG B 1 5  ? 6.211   27.280  -0.899  1.00 0.00 ? 276 ARG B HB2  1 
ATOM   745  H HB3  . ARG B 1 5  ? 5.933   25.664  -0.246  1.00 0.00 ? 276 ARG B HB3  1 
ATOM   746  H HG2  . ARG B 1 5  ? 8.144   25.405  0.429   1.00 0.00 ? 276 ARG B HG2  1 
ATOM   747  H HG3  . ARG B 1 5  ? 8.749   26.558  -0.760  1.00 0.00 ? 276 ARG B HG3  1 
ATOM   748  H HD2  . ARG B 1 5  ? 7.508   28.363  0.543   1.00 0.00 ? 276 ARG B HD2  1 
ATOM   749  H HD3  . ARG B 1 5  ? 7.268   27.159  1.810   1.00 0.00 ? 276 ARG B HD3  1 
ATOM   750  H HE   . ARG B 1 5  ? 9.967   27.076  1.321   1.00 0.00 ? 276 ARG B HE   1 
ATOM   751  H HH11 . ARG B 1 5  ? 8.445   29.991  0.929   1.00 0.00 ? 276 ARG B HH11 1 
ATOM   752  H HH12 . ARG B 1 5  ? 9.207   30.793  2.264   1.00 0.00 ? 276 ARG B HH12 1 
ATOM   753  H HH21 . ARG B 1 5  ? 10.618  27.892  3.541   1.00 0.00 ? 276 ARG B HH21 1 
ATOM   754  H HH22 . ARG B 1 5  ? 10.437  29.603  3.743   1.00 0.00 ? 276 ARG B HH22 1 
ATOM   755  N N    . ILE B 1 6  ? 4.714   25.463  -3.339  1.00 0.00 ? 277 ILE B N    1 
ATOM   756  C CA   . ILE B 1 6  ? 3.523   24.735  -3.760  1.00 0.00 ? 277 ILE B CA   1 
ATOM   757  C C    . ILE B 1 6  ? 3.906   23.704  -4.825  1.00 0.00 ? 277 ILE B C    1 
ATOM   758  O O    . ILE B 1 6  ? 3.759   22.513  -4.634  1.00 0.00 ? 277 ILE B O    1 
ATOM   759  C CB   . ILE B 1 6  ? 2.503   25.714  -4.343  1.00 0.00 ? 277 ILE B CB   1 
ATOM   760  C CG1  . ILE B 1 6  ? 2.073   26.706  -3.261  1.00 0.00 ? 277 ILE B CG1  1 
ATOM   761  C CG2  . ILE B 1 6  ? 1.279   24.942  -4.840  1.00 0.00 ? 277 ILE B CG2  1 
ATOM   762  C CD1  . ILE B 1 6  ? 2.967   27.946  -3.321  1.00 0.00 ? 277 ILE B CD1  1 
ATOM   763  H H    . ILE B 1 6  ? 4.842   26.394  -3.614  1.00 0.00 ? 277 ILE B H    1 
ATOM   764  H HA   . ILE B 1 6  ? 3.090   24.230  -2.910  1.00 0.00 ? 277 ILE B HA   1 
ATOM   765  H HB   . ILE B 1 6  ? 2.949   26.250  -5.168  1.00 0.00 ? 277 ILE B HB   1 
ATOM   766  H HG12 . ILE B 1 6  ? 1.045   26.995  -3.424  1.00 0.00 ? 277 ILE B HG12 1 
ATOM   767  H HG13 . ILE B 1 6  ? 2.168   26.243  -2.290  1.00 0.00 ? 277 ILE B HG13 1 
ATOM   768  H HG21 . ILE B 1 6  ? 0.863   24.365  -4.027  1.00 0.00 ? 277 ILE B HG21 1 
ATOM   769  H HG22 . ILE B 1 6  ? 0.537   25.636  -5.204  1.00 0.00 ? 277 ILE B HG22 1 
ATOM   770  H HG23 . ILE B 1 6  ? 1.572   24.277  -5.638  1.00 0.00 ? 277 ILE B HG23 1 
ATOM   771  H HD11 . ILE B 1 6  ? 3.541   27.933  -4.236  1.00 0.00 ? 277 ILE B HD11 1 
ATOM   772  H HD12 . ILE B 1 6  ? 2.354   28.834  -3.294  1.00 0.00 ? 277 ILE B HD12 1 
ATOM   773  H HD13 . ILE B 1 6  ? 3.640   27.945  -2.474  1.00 0.00 ? 277 ILE B HD13 1 
ATOM   774  N N    . ALA B 1 7  ? 4.398   24.155  -5.948  1.00 0.00 ? 278 ALA B N    1 
ATOM   775  C CA   . ALA B 1 7  ? 4.782   23.223  -7.002  1.00 0.00 ? 278 ALA B CA   1 
ATOM   776  C C    . ALA B 1 7  ? 5.625   22.094  -6.406  1.00 0.00 ? 278 ALA B C    1 
ATOM   777  O O    . ALA B 1 7  ? 5.461   20.940  -6.747  1.00 0.00 ? 278 ALA B O    1 
ATOM   778  C CB   . ALA B 1 7  ? 5.596   23.964  -8.065  1.00 0.00 ? 278 ALA B CB   1 
ATOM   779  H H    . ALA B 1 7  ? 4.509   25.119  -6.082  1.00 0.00 ? 278 ALA B H    1 
ATOM   780  H HA   . ALA B 1 7  ? 3.894   22.808  -7.457  1.00 0.00 ? 278 ALA B HA   1 
ATOM   781  H HB1  . ALA B 1 7  ? 5.998   24.872  -7.643  1.00 0.00 ? 278 ALA B HB1  1 
ATOM   782  H HB2  . ALA B 1 7  ? 6.405   23.334  -8.402  1.00 0.00 ? 278 ALA B HB2  1 
ATOM   783  H HB3  . ALA B 1 7  ? 4.957   24.207  -8.901  1.00 0.00 ? 278 ALA B HB3  1 
ATOM   784  N N    . ARG B 1 8  ? 6.526   22.416  -5.520  1.00 0.00 ? 279 ARG B N    1 
ATOM   785  C CA   . ARG B 1 8  ? 7.357   21.380  -4.918  1.00 0.00 ? 279 ARG B CA   1 
ATOM   786  C C    . ARG B 1 8  ? 6.466   20.364  -4.205  1.00 0.00 ? 279 ARG B C    1 
ATOM   787  O O    . ARG B 1 8  ? 6.487   19.187  -4.503  1.00 0.00 ? 279 ARG B O    1 
ATOM   788  C CB   . ARG B 1 8  ? 8.320   22.014  -3.911  1.00 0.00 ? 279 ARG B CB   1 
ATOM   789  C CG   . ARG B 1 8  ? 9.501   22.641  -4.657  1.00 0.00 ? 279 ARG B CG   1 
ATOM   790  C CD   . ARG B 1 8  ? 10.719  21.721  -4.558  1.00 0.00 ? 279 ARG B CD   1 
ATOM   791  N NE   . ARG B 1 8  ? 10.310  20.339  -4.787  1.00 0.00 ? 279 ARG B NE   1 
ATOM   792  C CZ   . ARG B 1 8  ? 11.206  19.432  -5.066  1.00 0.00 ? 279 ARG B CZ   1 
ATOM   793  N NH1  . ARG B 1 8  ? 11.902  18.884  -4.106  1.00 0.00 ? 279 ARG B NH1  1 
ATOM   794  N NH2  . ARG B 1 8  ? 11.409  19.074  -6.304  1.00 0.00 ? 279 ARG B NH2  1 
ATOM   795  H H    . ARG B 1 8  ? 6.643   23.354  -5.256  1.00 0.00 ? 279 ARG B H    1 
ATOM   796  H HA   . ARG B 1 8  ? 7.925   20.881  -5.691  1.00 0.00 ? 279 ARG B HA   1 
ATOM   797  H HB2  . ARG B 1 8  ? 7.802   22.776  -3.348  1.00 0.00 ? 279 ARG B HB2  1 
ATOM   798  H HB3  . ARG B 1 8  ? 8.686   21.255  -3.235  1.00 0.00 ? 279 ARG B HB3  1 
ATOM   799  H HG2  . ARG B 1 8  ? 9.236   22.777  -5.696  1.00 0.00 ? 279 ARG B HG2  1 
ATOM   800  H HG3  . ARG B 1 8  ? 9.737   23.597  -4.218  1.00 0.00 ? 279 ARG B HG3  1 
ATOM   801  H HD2  . ARG B 1 8  ? 11.447  22.008  -5.303  1.00 0.00 ? 279 ARG B HD2  1 
ATOM   802  H HD3  . ARG B 1 8  ? 11.156  21.807  -3.575  1.00 0.00 ? 279 ARG B HD3  1 
ATOM   803  H HE   . ARG B 1 8  ? 9.363   20.091  -4.732  1.00 0.00 ? 279 ARG B HE   1 
ATOM   804  H HH11 . ARG B 1 8  ? 11.748  19.158  -3.157  1.00 0.00 ? 279 ARG B HH11 1 
ATOM   805  H HH12 . ARG B 1 8  ? 12.590  18.190  -4.322  1.00 0.00 ? 279 ARG B HH12 1 
ATOM   806  H HH21 . ARG B 1 8  ? 10.877  19.494  -7.039  1.00 0.00 ? 279 ARG B HH21 1 
ATOM   807  H HH22 . ARG B 1 8  ? 12.096  18.379  -6.518  1.00 0.00 ? 279 ARG B HH22 1 
ATOM   808  N N    . LEU B 1 9  ? 5.679   20.808  -3.264  1.00 0.00 ? 280 LEU B N    1 
ATOM   809  C CA   . LEU B 1 9  ? 4.804   19.885  -2.550  1.00 0.00 ? 280 LEU B CA   1 
ATOM   810  C C    . LEU B 1 9  ? 4.064   19.005  -3.559  1.00 0.00 ? 280 LEU B C    1 
ATOM   811  O O    . LEU B 1 9  ? 3.700   17.883  -3.269  1.00 0.00 ? 280 LEU B O    1 
ATOM   812  C CB   . LEU B 1 9  ? 3.789   20.677  -1.722  1.00 0.00 ? 280 LEU B CB   1 
ATOM   813  C CG   . LEU B 1 9  ? 4.525   21.492  -0.657  1.00 0.00 ? 280 LEU B CG   1 
ATOM   814  C CD1  . LEU B 1 9  ? 3.691   22.719  -0.286  1.00 0.00 ? 280 LEU B CD1  1 
ATOM   815  C CD2  . LEU B 1 9  ? 4.740   20.627  0.587   1.00 0.00 ? 280 LEU B CD2  1 
ATOM   816  H H    . LEU B 1 9  ? 5.675   21.762  -3.037  1.00 0.00 ? 280 LEU B H    1 
ATOM   817  H HA   . LEU B 1 9  ? 5.393   19.264  -1.894  1.00 0.00 ? 280 LEU B HA   1 
ATOM   818  H HB2  . LEU B 1 9  ? 3.239   21.344  -2.370  1.00 0.00 ? 280 LEU B HB2  1 
ATOM   819  H HB3  . LEU B 1 9  ? 3.105   19.995  -1.241  1.00 0.00 ? 280 LEU B HB3  1 
ATOM   820  H HG   . LEU B 1 9  ? 5.481   21.811  -1.045  1.00 0.00 ? 280 LEU B HG   1 
ATOM   821  H HD11 . LEU B 1 9  ? 2.854   22.805  -0.964  1.00 0.00 ? 280 LEU B HD11 1 
ATOM   822  H HD12 . LEU B 1 9  ? 3.324   22.612  0.725   1.00 0.00 ? 280 LEU B HD12 1 
ATOM   823  H HD13 . LEU B 1 9  ? 4.303   23.606  -0.356  1.00 0.00 ? 280 LEU B HD13 1 
ATOM   824  H HD21 . LEU B 1 9  ? 4.014   19.827  0.599   1.00 0.00 ? 280 LEU B HD21 1 
ATOM   825  H HD22 . LEU B 1 9  ? 5.735   20.208  0.567   1.00 0.00 ? 280 LEU B HD22 1 
ATOM   826  H HD23 . LEU B 1 9  ? 4.621   21.234  1.472   1.00 0.00 ? 280 LEU B HD23 1 
ATOM   827  N N    . GLU B 1 10 ? 3.839   19.506  -4.743  1.00 0.00 ? 281 GLU B N    1 
ATOM   828  C CA   . GLU B 1 10 ? 3.138   18.715  -5.748  1.00 0.00 ? 281 GLU B CA   1 
ATOM   829  C C    . GLU B 1 10 ? 4.048   17.580  -6.224  1.00 0.00 ? 281 GLU B C    1 
ATOM   830  O O    . GLU B 1 10 ? 3.675   16.424  -6.209  1.00 0.00 ? 281 GLU B O    1 
ATOM   831  C CB   . GLU B 1 10 ? 2.769   19.607  -6.935  1.00 0.00 ? 281 GLU B CB   1 
ATOM   832  C CG   . GLU B 1 10 ? 1.308   20.044  -6.809  1.00 0.00 ? 281 GLU B CG   1 
ATOM   833  C CD   . GLU B 1 10 ? 0.448   19.234  -7.782  1.00 0.00 ? 281 GLU B CD   1 
ATOM   834  O OE1  . GLU B 1 10 ? 0.706   18.051  -7.927  1.00 0.00 ? 281 GLU B OE1  1 
ATOM   835  O OE2  . GLU B 1 10 ? -0.455  19.811  -8.363  1.00 0.00 ? 281 GLU B OE2  1 
ATOM   836  H H    . GLU B 1 10 ? 4.141   20.413  -4.956  1.00 0.00 ? 281 GLU B H    1 
ATOM   837  H HA   . GLU B 1 10 ? 2.239   18.300  -5.318  1.00 0.00 ? 281 GLU B HA   1 
ATOM   838  H HB2  . GLU B 1 10 ? 3.407   20.480  -6.942  1.00 0.00 ? 281 GLU B HB2  1 
ATOM   839  H HB3  . GLU B 1 10 ? 2.901   19.058  -7.854  1.00 0.00 ? 281 GLU B HB3  1 
ATOM   840  H HG2  . GLU B 1 10 ? 0.968   19.873  -5.798  1.00 0.00 ? 281 GLU B HG2  1 
ATOM   841  H HG3  . GLU B 1 10 ? 1.224   21.094  -7.046  1.00 0.00 ? 281 GLU B HG3  1 
ATOM   842  N N    . GLU B 1 11 ? 5.243   17.899  -6.643  1.00 0.00 ? 282 GLU B N    1 
ATOM   843  C CA   . GLU B 1 11 ? 6.156   16.859  -7.103  1.00 0.00 ? 282 GLU B CA   1 
ATOM   844  C C    . GLU B 1 11 ? 6.261   15.776  -6.029  1.00 0.00 ? 282 GLU B C    1 
ATOM   845  O O    . GLU B 1 11 ? 6.357   14.599  -6.323  1.00 0.00 ? 282 GLU B O    1 
ATOM   846  C CB   . GLU B 1 11 ? 7.537   17.468  -7.355  1.00 0.00 ? 282 GLU B CB   1 
ATOM   847  C CG   . GLU B 1 11 ? 7.814   17.504  -8.859  1.00 0.00 ? 282 GLU B CG   1 
ATOM   848  C CD   . GLU B 1 11 ? 9.159   18.187  -9.114  1.00 0.00 ? 282 GLU B CD   1 
ATOM   849  O OE1  . GLU B 1 11 ? 9.384   19.242  -8.542  1.00 0.00 ? 282 GLU B OE1  1 
ATOM   850  O OE2  . GLU B 1 11 ? 9.944   17.644  -9.875  1.00 0.00 ? 282 GLU B OE2  1 
ATOM   851  H H    . GLU B 1 11 ? 5.528   18.837  -6.644  1.00 0.00 ? 282 GLU B H    1 
ATOM   852  H HA   . GLU B 1 11 ? 5.780   16.428  -8.019  1.00 0.00 ? 282 GLU B HA   1 
ATOM   853  H HB2  . GLU B 1 11 ? 7.565   18.472  -6.958  1.00 0.00 ? 282 GLU B HB2  1 
ATOM   854  H HB3  . GLU B 1 11 ? 8.289   16.867  -6.866  1.00 0.00 ? 282 GLU B HB3  1 
ATOM   855  H HG2  . GLU B 1 11 ? 7.843   16.495  -9.245  1.00 0.00 ? 282 GLU B HG2  1 
ATOM   856  H HG3  . GLU B 1 11 ? 7.032   18.060  -9.357  1.00 0.00 ? 282 GLU B HG3  1 
ATOM   857  N N    . LYS B 1 12 ? 6.239   16.166  -4.785  1.00 0.00 ? 283 LYS B N    1 
ATOM   858  C CA   . LYS B 1 12 ? 6.332   15.189  -3.709  1.00 0.00 ? 283 LYS B CA   1 
ATOM   859  C C    . LYS B 1 12 ? 5.082   14.308  -3.718  1.00 0.00 ? 283 LYS B C    1 
ATOM   860  O O    . LYS B 1 12 ? 5.161   13.099  -3.637  1.00 0.00 ? 283 LYS B O    1 
ATOM   861  C CB   . LYS B 1 12 ? 6.433   15.917  -2.369  1.00 0.00 ? 283 LYS B CB   1 
ATOM   862  C CG   . LYS B 1 12 ? 7.605   15.349  -1.566  1.00 0.00 ? 283 LYS B CG   1 
ATOM   863  C CD   . LYS B 1 12 ? 7.951   16.307  -0.424  1.00 0.00 ? 283 LYS B CD   1 
ATOM   864  C CE   . LYS B 1 12 ? 7.226   15.868  0.849   1.00 0.00 ? 283 LYS B CE   1 
ATOM   865  N NZ   . LYS B 1 12 ? 7.834   14.606  1.357   1.00 0.00 ? 283 LYS B NZ   1 
ATOM   866  H H    . LYS B 1 12 ? 6.159   17.118  -4.573  1.00 0.00 ? 283 LYS B H    1 
ATOM   867  H HA   . LYS B 1 12 ? 7.208   14.574  -3.852  1.00 0.00 ? 283 LYS B HA   1 
ATOM   868  H HB2  . LYS B 1 12 ? 6.592   16.972  -2.545  1.00 0.00 ? 283 LYS B HB2  1 
ATOM   869  H HB3  . LYS B 1 12 ? 5.517   15.778  -1.814  1.00 0.00 ? 283 LYS B HB3  1 
ATOM   870  H HG2  . LYS B 1 12 ? 7.330   14.387  -1.159  1.00 0.00 ? 283 LYS B HG2  1 
ATOM   871  H HG3  . LYS B 1 12 ? 8.463   15.236  -2.211  1.00 0.00 ? 283 LYS B HG3  1 
ATOM   872  H HD2  . LYS B 1 12 ? 9.018   16.293  -0.255  1.00 0.00 ? 283 LYS B HD2  1 
ATOM   873  H HD3  . LYS B 1 12 ? 7.641   17.307  -0.686  1.00 0.00 ? 283 LYS B HD3  1 
ATOM   874  H HE2  . LYS B 1 12 ? 7.315   16.639  1.599   1.00 0.00 ? 283 LYS B HE2  1 
ATOM   875  H HE3  . LYS B 1 12 ? 6.181   15.700  0.628   1.00 0.00 ? 283 LYS B HE3  1 
ATOM   876  H HZ1  . LYS B 1 12 ? 8.840   14.578  1.099   1.00 0.00 ? 283 LYS B HZ1  1 
ATOM   877  H HZ2  . LYS B 1 12 ? 7.743   14.569  2.393   1.00 0.00 ? 283 LYS B HZ2  1 
ATOM   878  H HZ3  . LYS B 1 12 ? 7.344   13.790  0.935   1.00 0.00 ? 283 LYS B HZ3  1 
ATOM   879  N N    . VAL B 1 13 ? 3.927   14.906  -3.818  1.00 0.00 ? 284 VAL B N    1 
ATOM   880  C CA   . VAL B 1 13 ? 2.699   14.121  -3.836  1.00 0.00 ? 284 VAL B CA   1 
ATOM   881  C C    . VAL B 1 13 ? 2.711   13.195  -5.052  1.00 0.00 ? 284 VAL B C    1 
ATOM   882  O O    . VAL B 1 13 ? 1.990   12.220  -5.112  1.00 0.00 ? 284 VAL B O    1 
ATOM   883  C CB   . VAL B 1 13 ? 1.492   15.057  -3.921  1.00 0.00 ? 284 VAL B CB   1 
ATOM   884  C CG1  . VAL B 1 13 ? 0.222   14.233  -4.129  1.00 0.00 ? 284 VAL B CG1  1 
ATOM   885  C CG2  . VAL B 1 13 ? 1.375   15.856  -2.621  1.00 0.00 ? 284 VAL B CG2  1 
ATOM   886  H H    . VAL B 1 13 ? 3.884   15.882  -3.884  1.00 0.00 ? 284 VAL B H    1 
ATOM   887  H HA   . VAL B 1 13 ? 2.633   13.532  -2.934  1.00 0.00 ? 284 VAL B HA   1 
ATOM   888  H HB   . VAL B 1 13 ? 1.623   15.735  -4.753  1.00 0.00 ? 284 VAL B HB   1 
ATOM   889  H HG11 . VAL B 1 13 ? 0.307   13.298  -3.595  1.00 0.00 ? 284 VAL B HG11 1 
ATOM   890  H HG12 . VAL B 1 13 ? -0.630  14.784  -3.756  1.00 0.00 ? 284 VAL B HG12 1 
ATOM   891  H HG13 . VAL B 1 13 ? 0.089   14.034  -5.183  1.00 0.00 ? 284 VAL B HG13 1 
ATOM   892  H HG21 . VAL B 1 13 ? 2.262   15.703  -2.024  1.00 0.00 ? 284 VAL B HG21 1 
ATOM   893  H HG22 . VAL B 1 13 ? 1.274   16.906  -2.852  1.00 0.00 ? 284 VAL B HG22 1 
ATOM   894  H HG23 . VAL B 1 13 ? 0.509   15.523  -2.071  1.00 0.00 ? 284 VAL B HG23 1 
ATOM   895  N N    . LYS B 1 14 ? 3.530   13.494  -6.023  1.00 0.00 ? 285 LYS B N    1 
ATOM   896  C CA   . LYS B 1 14 ? 3.592   12.650  -7.210  1.00 0.00 ? 285 LYS B CA   1 
ATOM   897  C C    . LYS B 1 14 ? 4.409   11.395  -6.898  1.00 0.00 ? 285 LYS B C    1 
ATOM   898  O O    . LYS B 1 14 ? 4.009   10.289  -7.205  1.00 0.00 ? 285 LYS B O    1 
ATOM   899  C CB   . LYS B 1 14 ? 4.255   13.421  -8.353  1.00 0.00 ? 285 LYS B CB   1 
ATOM   900  C CG   . LYS B 1 14 ? 3.228   13.683  -9.456  1.00 0.00 ? 285 LYS B CG   1 
ATOM   901  C CD   . LYS B 1 14 ? 1.992   14.356  -8.854  1.00 0.00 ? 285 LYS B CD   1 
ATOM   902  C CE   . LYS B 1 14 ? 1.712   15.663  -9.598  1.00 0.00 ? 285 LYS B CE   1 
ATOM   903  N NZ   . LYS B 1 14 ? 0.282   15.700  -10.015 1.00 0.00 ? 285 LYS B NZ   1 
ATOM   904  H H    . LYS B 1 14 ? 4.105   14.284  -5.952  1.00 0.00 ? 285 LYS B H    1 
ATOM   905  H HA   . LYS B 1 14 ? 2.592   12.366  -7.502  1.00 0.00 ? 285 LYS B HA   1 
ATOM   906  H HB2  . LYS B 1 14 ? 4.633   14.362  -7.980  1.00 0.00 ? 285 LYS B HB2  1 
ATOM   907  H HB3  . LYS B 1 14 ? 5.072   12.839  -8.754  1.00 0.00 ? 285 LYS B HB3  1 
ATOM   908  H HG2  . LYS B 1 14 ? 3.663   14.328  -10.205 1.00 0.00 ? 285 LYS B HG2  1 
ATOM   909  H HG3  . LYS B 1 14 ? 2.940   12.747  -9.909  1.00 0.00 ? 285 LYS B HG3  1 
ATOM   910  H HD2  . LYS B 1 14 ? 1.142   13.697  -8.948  1.00 0.00 ? 285 LYS B HD2  1 
ATOM   911  H HD3  . LYS B 1 14 ? 2.170   14.569  -7.811  1.00 0.00 ? 285 LYS B HD3  1 
ATOM   912  H HE2  . LYS B 1 14 ? 1.918   16.499  -8.945  1.00 0.00 ? 285 LYS B HE2  1 
ATOM   913  H HE3  . LYS B 1 14 ? 2.344   15.723  -10.471 1.00 0.00 ? 285 LYS B HE3  1 
ATOM   914  H HZ1  . LYS B 1 14 ? -0.289  15.144  -9.346  1.00 0.00 ? 285 LYS B HZ1  1 
ATOM   915  H HZ2  . LYS B 1 14 ? -0.052  16.686  -10.021 1.00 0.00 ? 285 LYS B HZ2  1 
ATOM   916  H HZ3  . LYS B 1 14 ? 0.187   15.296  -10.968 1.00 0.00 ? 285 LYS B HZ3  1 
ATOM   917  N N    . THR B 1 15 ? 5.553   11.558  -6.290  1.00 0.00 ? 286 THR B N    1 
ATOM   918  C CA   . THR B 1 15 ? 6.377   10.398  -5.965  1.00 0.00 ? 286 THR B CA   1 
ATOM   919  C C    . THR B 1 15 ? 5.641   9.521   -4.948  1.00 0.00 ? 286 THR B C    1 
ATOM   920  O O    . THR B 1 15 ? 5.781   8.314   -4.939  1.00 0.00 ? 286 THR B O    1 
ATOM   921  C CB   . THR B 1 15 ? 7.706   10.865  -5.371  1.00 0.00 ? 286 THR B CB   1 
ATOM   922  O OG1  . THR B 1 15 ? 8.174   11.996  -6.092  1.00 0.00 ? 286 THR B OG1  1 
ATOM   923  C CG2  . THR B 1 15 ? 8.733   9.737   -5.464  1.00 0.00 ? 286 THR B CG2  1 
ATOM   924  H H    . THR B 1 15 ? 5.858   12.459  -6.051  1.00 0.00 ? 286 THR B H    1 
ATOM   925  H HA   . THR B 1 15 ? 6.566   9.828   -6.862  1.00 0.00 ? 286 THR B HA   1 
ATOM   926  H HB   . THR B 1 15 ? 7.563   11.131  -4.335  1.00 0.00 ? 286 THR B HB   1 
ATOM   927  H HG1  . THR B 1 15 ? 8.940   12.347  -5.630  1.00 0.00 ? 286 THR B HG1  1 
ATOM   928  H HG21 . THR B 1 15 ? 8.361   8.963   -6.119  1.00 0.00 ? 286 THR B HG21 1 
ATOM   929  H HG22 . THR B 1 15 ? 9.661   10.125  -5.858  1.00 0.00 ? 286 THR B HG22 1 
ATOM   930  H HG23 . THR B 1 15 ? 8.906   9.324   -4.480  1.00 0.00 ? 286 THR B HG23 1 
ATOM   931  N N    . LEU B 1 16 ? 4.862   10.118  -4.089  1.00 0.00 ? 287 LEU B N    1 
ATOM   932  C CA   . LEU B 1 16 ? 4.137   9.336   -3.095  1.00 0.00 ? 287 LEU B CA   1 
ATOM   933  C C    . LEU B 1 16 ? 3.049   8.512   -3.787  1.00 0.00 ? 287 LEU B C    1 
ATOM   934  O O    . LEU B 1 16 ? 2.950   7.315   -3.600  1.00 0.00 ? 287 LEU B O    1 
ATOM   935  C CB   . LEU B 1 16 ? 3.492   10.278  -2.077  1.00 0.00 ? 287 LEU B CB   1 
ATOM   936  C CG   . LEU B 1 16 ? 4.585   10.992  -1.278  1.00 0.00 ? 287 LEU B CG   1 
ATOM   937  C CD1  . LEU B 1 16 ? 3.983   12.202  -0.557  1.00 0.00 ? 287 LEU B CD1  1 
ATOM   938  C CD2  . LEU B 1 16 ? 5.175   10.028  -0.248  1.00 0.00 ? 287 LEU B CD2  1 
ATOM   939  H H    . LEU B 1 16 ? 4.764   11.092  -4.114  1.00 0.00 ? 287 LEU B H    1 
ATOM   940  H HA   . LEU B 1 16 ? 4.822   8.675   -2.586  1.00 0.00 ? 287 LEU B HA   1 
ATOM   941  H HB2  . LEU B 1 16 ? 2.889   11.010  -2.594  1.00 0.00 ? 287 LEU B HB2  1 
ATOM   942  H HB3  . LEU B 1 16 ? 2.871   9.711   -1.402  1.00 0.00 ? 287 LEU B HB3  1 
ATOM   943  H HG   . LEU B 1 16 ? 5.363   11.326  -1.950  1.00 0.00 ? 287 LEU B HG   1 
ATOM   944  H HD11 . LEU B 1 16 ? 3.199   12.628  -1.164  1.00 0.00 ? 287 LEU B HD11 1 
ATOM   945  H HD12 . LEU B 1 16 ? 3.576   11.887  0.391   1.00 0.00 ? 287 LEU B HD12 1 
ATOM   946  H HD13 . LEU B 1 16 ? 4.753   12.941  -0.393  1.00 0.00 ? 287 LEU B HD13 1 
ATOM   947  H HD21 . LEU B 1 16 ? 4.839   9.025   -0.460  1.00 0.00 ? 287 LEU B HD21 1 
ATOM   948  H HD22 . LEU B 1 16 ? 6.253   10.065  -0.296  1.00 0.00 ? 287 LEU B HD22 1 
ATOM   949  H HD23 . LEU B 1 16 ? 4.849   10.315  0.742   1.00 0.00 ? 287 LEU B HD23 1 
ATOM   950  N N    . LYS B 1 17 ? 2.230   9.142   -4.584  1.00 0.00 ? 288 LYS B N    1 
ATOM   951  C CA   . LYS B 1 17 ? 1.171   8.410   -5.269  1.00 0.00 ? 288 LYS B CA   1 
ATOM   952  C C    . LYS B 1 17 ? 1.788   7.301   -6.126  1.00 0.00 ? 288 LYS B C    1 
ATOM   953  O O    . LYS B 1 17 ? 1.219   6.240   -6.291  1.00 0.00 ? 288 LYS B O    1 
ATOM   954  C CB   . LYS B 1 17 ? 0.387   9.371   -6.167  1.00 0.00 ? 288 LYS B CB   1 
ATOM   955  C CG   . LYS B 1 17 ? -1.051  9.489   -5.659  1.00 0.00 ? 288 LYS B CG   1 
ATOM   956  C CD   . LYS B 1 17 ? -1.335  10.938  -5.255  1.00 0.00 ? 288 LYS B CD   1 
ATOM   957  C CE   . LYS B 1 17 ? -1.596  11.775  -6.508  1.00 0.00 ? 288 LYS B CE   1 
ATOM   958  N NZ   . LYS B 1 17 ? -3.060  12.018  -6.649  1.00 0.00 ? 288 LYS B NZ   1 
ATOM   959  H H    . LYS B 1 17 ? 2.326   10.108  -4.720  1.00 0.00 ? 288 LYS B H    1 
ATOM   960  H HA   . LYS B 1 17 ? 0.503   7.975   -4.542  1.00 0.00 ? 288 LYS B HA   1 
ATOM   961  H HB2  . LYS B 1 17 ? 0.857   10.345  -6.148  1.00 0.00 ? 288 LYS B HB2  1 
ATOM   962  H HB3  . LYS B 1 17 ? 0.380   8.996   -7.179  1.00 0.00 ? 288 LYS B HB3  1 
ATOM   963  H HG2  . LYS B 1 17 ? -1.733  9.191   -6.441  1.00 0.00 ? 288 LYS B HG2  1 
ATOM   964  H HG3  . LYS B 1 17 ? -1.184  8.846   -4.802  1.00 0.00 ? 288 LYS B HG3  1 
ATOM   965  H HD2  . LYS B 1 17 ? -2.203  10.967  -4.613  1.00 0.00 ? 288 LYS B HD2  1 
ATOM   966  H HD3  . LYS B 1 17 ? -0.483  11.338  -4.728  1.00 0.00 ? 288 LYS B HD3  1 
ATOM   967  H HE2  . LYS B 1 17 ? -1.082  12.721  -6.423  1.00 0.00 ? 288 LYS B HE2  1 
ATOM   968  H HE3  . LYS B 1 17 ? -1.234  11.246  -7.378  1.00 0.00 ? 288 LYS B HE3  1 
ATOM   969  H HZ1  . LYS B 1 17 ? -3.501  12.035  -5.707  1.00 0.00 ? 288 LYS B HZ1  1 
ATOM   970  H HZ2  . LYS B 1 17 ? -3.216  12.932  -7.119  1.00 0.00 ? 288 LYS B HZ2  1 
ATOM   971  H HZ3  . LYS B 1 17 ? -3.484  11.256  -7.218  1.00 0.00 ? 288 LYS B HZ3  1 
ATOM   972  N N    . ALA B 1 18 ? 2.950   7.539   -6.673  1.00 0.00 ? 289 ALA B N    1 
ATOM   973  C CA   . ALA B 1 18 ? 3.590   6.523   -7.501  1.00 0.00 ? 289 ALA B CA   1 
ATOM   974  C C    . ALA B 1 18 ? 3.930   5.301   -6.646  1.00 0.00 ? 289 ALA B C    1 
ATOM   975  O O    . ALA B 1 18 ? 3.363   4.240   -6.808  1.00 0.00 ? 289 ALA B O    1 
ATOM   976  C CB   . ALA B 1 18 ? 4.878   7.086   -8.100  1.00 0.00 ? 289 ALA B CB   1 
ATOM   977  H H    . ALA B 1 18 ? 3.393   8.401   -6.527  1.00 0.00 ? 289 ALA B H    1 
ATOM   978  H HA   . ALA B 1 18 ? 2.922   6.232   -8.297  1.00 0.00 ? 289 ALA B HA   1 
ATOM   979  H HB1  . ALA B 1 18 ? 5.029   8.095   -7.743  1.00 0.00 ? 289 ALA B HB1  1 
ATOM   980  H HB2  . ALA B 1 18 ? 5.714   6.469   -7.799  1.00 0.00 ? 289 ALA B HB2  1 
ATOM   981  H HB3  . ALA B 1 18 ? 4.802   7.092   -9.178  1.00 0.00 ? 289 ALA B HB3  1 
ATOM   982  N N    . GLN B 1 19 ? 4.861   5.446   -5.743  1.00 0.00 ? 290 GLN B N    1 
ATOM   983  C CA   . GLN B 1 19 ? 5.243   4.321   -4.897  1.00 0.00 ? 290 GLN B CA   1 
ATOM   984  C C    . GLN B 1 19 ? 3.987   3.591   -4.415  1.00 0.00 ? 290 GLN B C    1 
ATOM   985  O O    . GLN B 1 19 ? 3.978   2.387   -4.261  1.00 0.00 ? 290 GLN B O    1 
ATOM   986  C CB   . GLN B 1 19 ? 6.031   4.832   -3.690  1.00 0.00 ? 290 GLN B CB   1 
ATOM   987  C CG   . GLN B 1 19 ? 7.521   4.872   -4.034  1.00 0.00 ? 290 GLN B CG   1 
ATOM   988  C CD   . GLN B 1 19 ? 8.216   5.925   -3.168  1.00 0.00 ? 290 GLN B CD   1 
ATOM   989  O OE1  . GLN B 1 19 ? 8.668   6.937   -3.667  1.00 0.00 ? 290 GLN B OE1  1 
ATOM   990  N NE2  . GLN B 1 19 ? 8.321   5.729   -1.882  1.00 0.00 ? 290 GLN B NE2  1 
ATOM   991  H H    . GLN B 1 19 ? 5.308   6.311   -5.635  1.00 0.00 ? 290 GLN B H    1 
ATOM   992  H HA   . GLN B 1 19 ? 5.859   3.642   -5.465  1.00 0.00 ? 290 GLN B HA   1 
ATOM   993  H HB2  . GLN B 1 19 ? 5.692   5.825   -3.434  1.00 0.00 ? 290 GLN B HB2  1 
ATOM   994  H HB3  . GLN B 1 19 ? 5.875   4.170   -2.852  1.00 0.00 ? 290 GLN B HB3  1 
ATOM   995  H HG2  . GLN B 1 19 ? 7.961   3.904   -3.846  1.00 0.00 ? 290 GLN B HG2  1 
ATOM   996  H HG3  . GLN B 1 19 ? 7.643   5.129   -5.075  1.00 0.00 ? 290 GLN B HG3  1 
ATOM   997  H HE21 . GLN B 1 19 ? 7.956   4.913   -1.480  1.00 0.00 ? 290 GLN B HE21 1 
ATOM   998  H HE22 . GLN B 1 19 ? 8.764   6.398   -1.320  1.00 0.00 ? 290 GLN B HE22 1 
ATOM   999  N N    . ASN B 1 20 ? 2.927   4.313   -4.180  1.00 0.00 ? 291 ASN B N    1 
ATOM   1000 C CA   . ASN B 1 20 ? 1.699   3.673   -3.723  1.00 0.00 ? 291 ASN B CA   1 
ATOM   1001 C C    . ASN B 1 20 ? 1.239   2.661   -4.773  1.00 0.00 ? 291 ASN B C    1 
ATOM   1002 O O    . ASN B 1 20 ? 1.032   1.499   -4.482  1.00 0.00 ? 291 ASN B O    1 
ATOM   1003 C CB   . ASN B 1 20 ? 0.613   4.732   -3.526  1.00 0.00 ? 291 ASN B CB   1 
ATOM   1004 C CG   . ASN B 1 20 ? -0.020  4.562   -2.145  1.00 0.00 ? 291 ASN B CG   1 
ATOM   1005 O OD1  . ASN B 1 20 ? 0.569   4.923   -1.146  1.00 0.00 ? 291 ASN B OD1  1 
ATOM   1006 N ND2  . ASN B 1 20 ? -1.204  4.024   -2.045  1.00 0.00 ? 291 ASN B ND2  1 
ATOM   1007 H H    . ASN B 1 20 ? 2.953   5.283   -4.314  1.00 0.00 ? 291 ASN B H    1 
ATOM   1008 H HA   . ASN B 1 20 ? 1.881   3.167   -2.788  1.00 0.00 ? 291 ASN B HA   1 
ATOM   1009 H HB2  . ASN B 1 20 ? 1.051   5.716   -3.605  1.00 0.00 ? 291 ASN B HB2  1 
ATOM   1010 H HB3  . ASN B 1 20 ? -0.147  4.614   -4.285  1.00 0.00 ? 291 ASN B HB3  1 
ATOM   1011 H HD21 . ASN B 1 20 ? -1.679  3.732   -2.851  1.00 0.00 ? 291 ASN B HD21 1 
ATOM   1012 H HD22 . ASN B 1 20 ? -1.620  3.911   -1.165  1.00 0.00 ? 291 ASN B HD22 1 
ATOM   1013 N N    . SER B 1 21 ? 1.083   3.092   -5.993  1.00 0.00 ? 292 SER B N    1 
ATOM   1014 C CA   . SER B 1 21 ? 0.647   2.175   -7.040  1.00 0.00 ? 292 SER B CA   1 
ATOM   1015 C C    . SER B 1 21 ? 1.655   1.030   -7.163  1.00 0.00 ? 292 SER B C    1 
ATOM   1016 O O    . SER B 1 21 ? 1.335   -0.042  -7.638  1.00 0.00 ? 292 SER B O    1 
ATOM   1017 C CB   . SER B 1 21 ? 0.560   2.925   -8.369  1.00 0.00 ? 292 SER B CB   1 
ATOM   1018 O OG   . SER B 1 21 ? -0.282  4.060   -8.214  1.00 0.00 ? 292 SER B OG   1 
ATOM   1019 H H    . SER B 1 21 ? 1.257   4.033   -6.207  1.00 0.00 ? 292 SER B H    1 
ATOM   1020 H HA   . SER B 1 21 ? -0.324  1.777   -6.789  1.00 0.00 ? 292 SER B HA   1 
ATOM   1021 H HB2  . SER B 1 21 ? 1.544   3.252   -8.665  1.00 0.00 ? 292 SER B HB2  1 
ATOM   1022 H HB3  . SER B 1 21 ? 0.159   2.267   -9.127  1.00 0.00 ? 292 SER B HB3  1 
ATOM   1023 H HG   . SER B 1 21 ? -1.171  3.806   -8.472  1.00 0.00 ? 292 SER B HG   1 
ATOM   1024 N N    . GLU B 1 22 ? 2.869   1.248   -6.740  1.00 0.00 ? 293 GLU B N    1 
ATOM   1025 C CA   . GLU B 1 22 ? 3.875   0.196   -6.831  1.00 0.00 ? 293 GLU B CA   1 
ATOM   1026 C C    . GLU B 1 22 ? 3.546   -0.915  -5.830  1.00 0.00 ? 293 GLU B C    1 
ATOM   1027 O O    . GLU B 1 22 ? 3.187   -2.013  -6.203  1.00 0.00 ? 293 GLU B O    1 
ATOM   1028 C CB   . GLU B 1 22 ? 5.253   0.778   -6.508  1.00 0.00 ? 293 GLU B CB   1 
ATOM   1029 C CG   . GLU B 1 22 ? 6.061   0.927   -7.798  1.00 0.00 ? 293 GLU B CG   1 
ATOM   1030 C CD   . GLU B 1 22 ? 7.533   0.624   -7.517  1.00 0.00 ? 293 GLU B CD   1 
ATOM   1031 O OE1  . GLU B 1 22 ? 7.860   -0.539  -7.356  1.00 0.00 ? 293 GLU B OE1  1 
ATOM   1032 O OE2  . GLU B 1 22 ? 8.311   1.564   -7.465  1.00 0.00 ? 293 GLU B OE2  1 
ATOM   1033 H H    . GLU B 1 22 ? 3.106   2.122   -6.361  1.00 0.00 ? 293 GLU B H    1 
ATOM   1034 H HA   . GLU B 1 22 ? 3.882   -0.210  -7.830  1.00 0.00 ? 293 GLU B HA   1 
ATOM   1035 H HB2  . GLU B 1 22 ? 5.135   1.745   -6.043  1.00 0.00 ? 293 GLU B HB2  1 
ATOM   1036 H HB3  . GLU B 1 22 ? 5.775   0.115   -5.835  1.00 0.00 ? 293 GLU B HB3  1 
ATOM   1037 H HG2  . GLU B 1 22 ? 5.687   0.235   -8.540  1.00 0.00 ? 293 GLU B HG2  1 
ATOM   1038 H HG3  . GLU B 1 22 ? 5.967   1.937   -8.167  1.00 0.00 ? 293 GLU B HG3  1 
ATOM   1039 N N    . LEU B 1 23 ? 3.667   -0.636  -4.561  1.00 0.00 ? 294 LEU B N    1 
ATOM   1040 C CA   . LEU B 1 23 ? 3.373   -1.651  -3.558  1.00 0.00 ? 294 LEU B CA   1 
ATOM   1041 C C    . LEU B 1 23 ? 1.948   -2.174  -3.756  1.00 0.00 ? 294 LEU B C    1 
ATOM   1042 O O    . LEU B 1 23 ? 1.595   -3.235  -3.281  1.00 0.00 ? 294 LEU B O    1 
ATOM   1043 C CB   . LEU B 1 23 ? 3.504   -1.041  -2.161  1.00 0.00 ? 294 LEU B CB   1 
ATOM   1044 C CG   . LEU B 1 23 ? 4.880   -1.379  -1.584  1.00 0.00 ? 294 LEU B CG   1 
ATOM   1045 C CD1  . LEU B 1 23 ? 5.278   -0.317  -0.559  1.00 0.00 ? 294 LEU B CD1  1 
ATOM   1046 C CD2  . LEU B 1 23 ? 4.823   -2.748  -0.906  1.00 0.00 ? 294 LEU B CD2  1 
ATOM   1047 H H    . LEU B 1 23 ? 3.962   0.257   -4.282  1.00 0.00 ? 294 LEU B H    1 
ATOM   1048 H HA   . LEU B 1 23 ? 4.072   -2.468  -3.657  1.00 0.00 ? 294 LEU B HA   1 
ATOM   1049 H HB2  . LEU B 1 23 ? 3.393   0.031   -2.227  1.00 0.00 ? 294 LEU B HB2  1 
ATOM   1050 H HB3  . LEU B 1 23 ? 2.737   -1.444  -1.519  1.00 0.00 ? 294 LEU B HB3  1 
ATOM   1051 H HG   . LEU B 1 23 ? 5.609   -1.400  -2.382  1.00 0.00 ? 294 LEU B HG   1 
ATOM   1052 H HD11 . LEU B 1 23 ? 4.567   0.494   -0.584  1.00 0.00 ? 294 LEU B HD11 1 
ATOM   1053 H HD12 . LEU B 1 23 ? 5.290   -0.756  0.428   1.00 0.00 ? 294 LEU B HD12 1 
ATOM   1054 H HD13 . LEU B 1 23 ? 6.263   0.060   -0.795  1.00 0.00 ? 294 LEU B HD13 1 
ATOM   1055 H HD21 . LEU B 1 23 ? 3.810   -3.122  -0.931  1.00 0.00 ? 294 LEU B HD21 1 
ATOM   1056 H HD22 . LEU B 1 23 ? 5.474   -3.436  -1.426  1.00 0.00 ? 294 LEU B HD22 1 
ATOM   1057 H HD23 . LEU B 1 23 ? 5.146   -2.655  0.121   1.00 0.00 ? 294 LEU B HD23 1 
ATOM   1058 N N    . ALA B 1 24 ? 1.125   -1.439  -4.454  1.00 0.00 ? 295 ALA B N    1 
ATOM   1059 C CA   . ALA B 1 24 ? -0.244  -1.890  -4.673  1.00 0.00 ? 295 ALA B CA   1 
ATOM   1060 C C    . ALA B 1 24 ? -0.242  -3.056  -5.664  1.00 0.00 ? 295 ALA B C    1 
ATOM   1061 O O    . ALA B 1 24 ? -0.835  -4.089  -5.423  1.00 0.00 ? 295 ALA B O    1 
ATOM   1062 C CB   . ALA B 1 24 ? -1.079  -0.739  -5.237  1.00 0.00 ? 295 ALA B CB   1 
ATOM   1063 H H    . ALA B 1 24 ? 1.428   -0.586  -4.829  1.00 0.00 ? 295 ALA B H    1 
ATOM   1064 H HA   . ALA B 1 24 ? -0.670  -2.215  -3.736  1.00 0.00 ? 295 ALA B HA   1 
ATOM   1065 H HB1  . ALA B 1 24 ? -0.632  -0.387  -6.156  1.00 0.00 ? 295 ALA B HB1  1 
ATOM   1066 H HB2  . ALA B 1 24 ? -2.082  -1.086  -5.435  1.00 0.00 ? 295 ALA B HB2  1 
ATOM   1067 H HB3  . ALA B 1 24 ? -1.111  0.067   -4.520  1.00 0.00 ? 295 ALA B HB3  1 
ATOM   1068 N N    . SER B 1 25 ? 0.420   -2.901  -6.778  1.00 0.00 ? 296 SER B N    1 
ATOM   1069 C CA   . SER B 1 25 ? 0.459   -3.978  -7.759  1.00 0.00 ? 296 SER B CA   1 
ATOM   1070 C C    . SER B 1 25 ? 1.188   -5.181  -7.157  1.00 0.00 ? 296 SER B C    1 
ATOM   1071 O O    . SER B 1 25 ? 0.840   -6.318  -7.406  1.00 0.00 ? 296 SER B O    1 
ATOM   1072 C CB   . SER B 1 25 ? 1.199   -3.505  -9.011  1.00 0.00 ? 296 SER B CB   1 
ATOM   1073 O OG   . SER B 1 25 ? 0.311   -3.539  -10.120 1.00 0.00 ? 296 SER B OG   1 
ATOM   1074 H H    . SER B 1 25 ? 0.894   -2.060  -6.954  1.00 0.00 ? 296 SER B H    1 
ATOM   1075 H HA   . SER B 1 25 ? -0.547  -4.261  -8.023  1.00 0.00 ? 296 SER B HA   1 
ATOM   1076 H HB2  . SER B 1 25 ? 1.548   -2.496  -8.865  1.00 0.00 ? 296 SER B HB2  1 
ATOM   1077 H HB3  . SER B 1 25 ? 2.047   -4.153  -9.193  1.00 0.00 ? 296 SER B HB3  1 
ATOM   1078 H HG   . SER B 1 25 ? 0.746   -4.013  -10.833 1.00 0.00 ? 296 SER B HG   1 
ATOM   1079 N N    . THR B 1 26 ? 2.197   -4.940  -6.365  1.00 0.00 ? 297 THR B N    1 
ATOM   1080 C CA   . THR B 1 26 ? 2.929   -6.046  -5.760  1.00 0.00 ? 297 THR B CA   1 
ATOM   1081 C C    . THR B 1 26 ? 1.973   -6.872  -4.899  1.00 0.00 ? 297 THR B C    1 
ATOM   1082 O O    . THR B 1 26 ? 1.884   -8.077  -5.032  1.00 0.00 ? 297 THR B O    1 
ATOM   1083 C CB   . THR B 1 26 ? 4.058   -5.496  -4.886  1.00 0.00 ? 297 THR B CB   1 
ATOM   1084 O OG1  . THR B 1 26 ? 4.757   -4.486  -5.602  1.00 0.00 ? 297 THR B OG1  1 
ATOM   1085 C CG2  . THR B 1 26 ? 5.021   -6.626  -4.522  1.00 0.00 ? 297 THR B CG2  1 
ATOM   1086 H H    . THR B 1 26 ? 2.461   -4.015  -6.176  1.00 0.00 ? 297 THR B H    1 
ATOM   1087 H HA   . THR B 1 26 ? 3.345   -6.670  -6.535  1.00 0.00 ? 297 THR B HA   1 
ATOM   1088 H HB   . THR B 1 26 ? 3.643   -5.077  -3.982  1.00 0.00 ? 297 THR B HB   1 
ATOM   1089 H HG1  . THR B 1 26 ? 5.437   -4.912  -6.127  1.00 0.00 ? 297 THR B HG1  1 
ATOM   1090 H HG21 . THR B 1 26 ? 4.518   -7.576  -4.625  1.00 0.00 ? 297 THR B HG21 1 
ATOM   1091 H HG22 . THR B 1 26 ? 5.876   -6.597  -5.182  1.00 0.00 ? 297 THR B HG22 1 
ATOM   1092 H HG23 . THR B 1 26 ? 5.350   -6.502  -3.500  1.00 0.00 ? 297 THR B HG23 1 
ATOM   1093 N N    . ALA B 1 27 ? 1.254   -6.234  -4.018  1.00 0.00 ? 298 ALA B N    1 
ATOM   1094 C CA   . ALA B 1 27 ? 0.322   -6.964  -3.168  1.00 0.00 ? 298 ALA B CA   1 
ATOM   1095 C C    . ALA B 1 27 ? -0.736  -7.641  -4.042  1.00 0.00 ? 298 ALA B C    1 
ATOM   1096 O O    . ALA B 1 27 ? -1.272  -8.674  -3.696  1.00 0.00 ? 298 ALA B O    1 
ATOM   1097 C CB   . ALA B 1 27 ? -0.356  -5.991  -2.205  1.00 0.00 ? 298 ALA B CB   1 
ATOM   1098 H H    . ALA B 1 27 ? 1.340   -5.262  -3.929  1.00 0.00 ? 298 ALA B H    1 
ATOM   1099 H HA   . ALA B 1 27 ? 0.858   -7.712  -2.604  1.00 0.00 ? 298 ALA B HA   1 
ATOM   1100 H HB1  . ALA B 1 27 ? -0.208  -4.980  -2.554  1.00 0.00 ? 298 ALA B HB1  1 
ATOM   1101 H HB2  . ALA B 1 27 ? -1.414  -6.205  -2.162  1.00 0.00 ? 298 ALA B HB2  1 
ATOM   1102 H HB3  . ALA B 1 27 ? 0.074   -6.099  -1.221  1.00 0.00 ? 298 ALA B HB3  1 
ATOM   1103 N N    . ASN B 1 28 ? -1.037  -7.067  -5.175  1.00 0.00 ? 299 ASN B N    1 
ATOM   1104 C CA   . ASN B 1 28 ? -2.036  -7.665  -6.053  1.00 0.00 ? 299 ASN B CA   1 
ATOM   1105 C C    . ASN B 1 28 ? -1.491  -8.976  -6.624  1.00 0.00 ? 299 ASN B C    1 
ATOM   1106 O O    . ASN B 1 28 ? -2.221  -9.924  -6.835  1.00 0.00 ? 299 ASN B O    1 
ATOM   1107 C CB   . ASN B 1 28 ? -2.352  -6.701  -7.199  1.00 0.00 ? 299 ASN B CB   1 
ATOM   1108 C CG   . ASN B 1 28 ? -3.261  -5.582  -6.691  1.00 0.00 ? 299 ASN B CG   1 
ATOM   1109 O OD1  . ASN B 1 28 ? -2.871  -4.430  -6.667  1.00 0.00 ? 299 ASN B OD1  1 
ATOM   1110 N ND2  . ASN B 1 28 ? -4.465  -5.871  -6.281  1.00 0.00 ? 299 ASN B ND2  1 
ATOM   1111 H H    . ASN B 1 28 ? -0.591  -6.235  -5.435  1.00 0.00 ? 299 ASN B H    1 
ATOM   1112 H HA   . ASN B 1 28 ? -2.938  -7.863  -5.492  1.00 0.00 ? 299 ASN B HA   1 
ATOM   1113 H HB2  . ASN B 1 28 ? -1.432  -6.277  -7.575  1.00 0.00 ? 299 ASN B HB2  1 
ATOM   1114 H HB3  . ASN B 1 28 ? -2.852  -7.237  -7.992  1.00 0.00 ? 299 ASN B HB3  1 
ATOM   1115 H HD21 . ASN B 1 28 ? -4.778  -6.799  -6.299  1.00 0.00 ? 299 ASN B HD21 1 
ATOM   1116 H HD22 . ASN B 1 28 ? -5.057  -5.160  -5.956  1.00 0.00 ? 299 ASN B HD22 1 
ATOM   1117 N N    . MET B 1 29 ? -0.212  -9.036  -6.875  1.00 0.00 ? 300 MET B N    1 
ATOM   1118 C CA   . MET B 1 29 ? 0.369   -10.258 -7.422  1.00 0.00 ? 300 MET B CA   1 
ATOM   1119 C C    . MET B 1 29 ? 0.432   -11.328 -6.327  1.00 0.00 ? 300 MET B C    1 
ATOM   1120 O O    . MET B 1 29 ? 0.114   -12.479 -6.555  1.00 0.00 ? 300 MET B O    1 
ATOM   1121 C CB   . MET B 1 29 ? 1.781   -9.967  -7.931  1.00 0.00 ? 300 MET B CB   1 
ATOM   1122 C CG   . MET B 1 29 ? 2.015   -10.720 -9.243  1.00 0.00 ? 300 MET B CG   1 
ATOM   1123 S SD   . MET B 1 29 ? 1.041   -9.955  -10.563 1.00 0.00 ? 300 MET B SD   1 
ATOM   1124 C CE   . MET B 1 29 ? 2.225   -10.224 -11.904 1.00 0.00 ? 300 MET B CE   1 
ATOM   1125 H H    . MET B 1 29 ? 0.359   -8.260  -6.697  1.00 0.00 ? 300 MET B H    1 
ATOM   1126 H HA   . MET B 1 29 ? -0.241  -10.612 -8.237  1.00 0.00 ? 300 MET B HA   1 
ATOM   1127 H HB2  . MET B 1 29 ? 1.890   -8.905  -8.101  1.00 0.00 ? 300 MET B HB2  1 
ATOM   1128 H HB3  . MET B 1 29 ? 2.503   -10.291 -7.198  1.00 0.00 ? 300 MET B HB3  1 
ATOM   1129 H HG2  . MET B 1 29 ? 3.063   -10.679 -9.499  1.00 0.00 ? 300 MET B HG2  1 
ATOM   1130 H HG3  . MET B 1 29 ? 1.713   -11.750 -9.124  1.00 0.00 ? 300 MET B HG3  1 
ATOM   1131 H HE1  . MET B 1 29 ? 3.224   -10.286 -11.494 1.00 0.00 ? 300 MET B HE1  1 
ATOM   1132 H HE2  . MET B 1 29 ? 1.990   -11.145 -12.414 1.00 0.00 ? 300 MET B HE2  1 
ATOM   1133 H HE3  . MET B 1 29 ? 2.168   -9.403  -12.604 1.00 0.00 ? 300 MET B HE3  1 
ATOM   1134 N N    . LEU B 1 30 ? 0.841   -10.959 -5.145  1.00 0.00 ? 301 LEU B N    1 
ATOM   1135 C CA   . LEU B 1 30 ? 0.924   -11.935 -4.065  1.00 0.00 ? 301 LEU B CA   1 
ATOM   1136 C C    . LEU B 1 30 ? -0.487  -12.361 -3.650  1.00 0.00 ? 301 LEU B C    1 
ATOM   1137 O O    . LEU B 1 30 ? -0.678  -13.400 -3.048  1.00 0.00 ? 301 LEU B O    1 
ATOM   1138 C CB   . LEU B 1 30 ? 1.638   -11.313 -2.864  1.00 0.00 ? 301 LEU B CB   1 
ATOM   1139 C CG   . LEU B 1 30 ? 2.985   -10.740 -3.308  1.00 0.00 ? 301 LEU B CG   1 
ATOM   1140 C CD1  . LEU B 1 30 ? 3.262   -9.443  -2.547  1.00 0.00 ? 301 LEU B CD1  1 
ATOM   1141 C CD2  . LEU B 1 30 ? 4.091   -11.753 -3.005  1.00 0.00 ? 301 LEU B CD2  1 
ATOM   1142 H H    . LEU B 1 30 ? 1.094   -10.026 -4.983  1.00 0.00 ? 301 LEU B H    1 
ATOM   1143 H HA   . LEU B 1 30 ? 1.478   -12.798 -4.402  1.00 0.00 ? 301 LEU B HA   1 
ATOM   1144 H HB2  . LEU B 1 30 ? 1.028   -10.524 -2.452  1.00 0.00 ? 301 LEU B HB2  1 
ATOM   1145 H HB3  . LEU B 1 30 ? 1.802   -12.070 -2.113  1.00 0.00 ? 301 LEU B HB3  1 
ATOM   1146 H HG   . LEU B 1 30 ? 2.957   -10.538 -4.368  1.00 0.00 ? 301 LEU B HG   1 
ATOM   1147 H HD11 . LEU B 1 30 ? 2.366   -9.127  -2.034  1.00 0.00 ? 301 LEU B HD11 1 
ATOM   1148 H HD12 . LEU B 1 30 ? 4.050   -9.608  -1.828  1.00 0.00 ? 301 LEU B HD12 1 
ATOM   1149 H HD13 . LEU B 1 30 ? 3.567   -8.676  -3.244  1.00 0.00 ? 301 LEU B HD13 1 
ATOM   1150 H HD21 . LEU B 1 30 ? 3.650   -12.677 -2.660  1.00 0.00 ? 301 LEU B HD21 1 
ATOM   1151 H HD22 . LEU B 1 30 ? 4.663   -11.940 -3.902  1.00 0.00 ? 301 LEU B HD22 1 
ATOM   1152 H HD23 . LEU B 1 30 ? 4.741   -11.358 -2.239  1.00 0.00 ? 301 LEU B HD23 1 
ATOM   1153 N N    . ARG B 1 31 ? -1.474  -11.569 -3.965  1.00 0.00 ? 302 ARG B N    1 
ATOM   1154 C CA   . ARG B 1 31 ? -2.840  -11.923 -3.593  1.00 0.00 ? 302 ARG B CA   1 
ATOM   1155 C C    . ARG B 1 31 ? -3.382  -12.967 -4.573  1.00 0.00 ? 302 ARG B C    1 
ATOM   1156 O O    . ARG B 1 31 ? -3.864  -14.012 -4.181  1.00 0.00 ? 302 ARG B O    1 
ATOM   1157 C CB   . ARG B 1 31 ? -3.722  -10.674 -3.643  1.00 0.00 ? 302 ARG B CB   1 
ATOM   1158 C CG   . ARG B 1 31 ? -3.995  -10.182 -2.221  1.00 0.00 ? 302 ARG B CG   1 
ATOM   1159 C CD   . ARG B 1 31 ? -4.867  -8.925  -2.274  1.00 0.00 ? 302 ARG B CD   1 
ATOM   1160 N NE   . ARG B 1 31 ? -5.456  -8.684  -0.962  1.00 0.00 ? 302 ARG B NE   1 
ATOM   1161 C CZ   . ARG B 1 31 ? -5.978  -7.521  -0.685  1.00 0.00 ? 302 ARG B CZ   1 
ATOM   1162 N NH1  . ARG B 1 31 ? -5.210  -6.526  -0.334  1.00 0.00 ? 302 ARG B NH1  1 
ATOM   1163 N NH2  . ARG B 1 31 ? -7.271  -7.354  -0.758  1.00 0.00 ? 302 ARG B NH2  1 
ATOM   1164 H H    . ARG B 1 31 ? -1.298  -10.736 -4.449  1.00 0.00 ? 302 ARG B H    1 
ATOM   1165 H HA   . ARG B 1 31 ? -2.849  -12.328 -2.593  1.00 0.00 ? 302 ARG B HA   1 
ATOM   1166 H HB2  . ARG B 1 31 ? -3.215  -9.899  -4.201  1.00 0.00 ? 302 ARG B HB2  1 
ATOM   1167 H HB3  . ARG B 1 31 ? -4.657  -10.911 -4.126  1.00 0.00 ? 302 ARG B HB3  1 
ATOM   1168 H HG2  . ARG B 1 31 ? -4.508  -10.954 -1.666  1.00 0.00 ? 302 ARG B HG2  1 
ATOM   1169 H HG3  . ARG B 1 31 ? -3.060  -9.948  -1.734  1.00 0.00 ? 302 ARG B HG3  1 
ATOM   1170 H HD2  . ARG B 1 31 ? -4.259  -8.077  -2.558  1.00 0.00 ? 302 ARG B HD2  1 
ATOM   1171 H HD3  . ARG B 1 31 ? -5.653  -9.064  -3.001  1.00 0.00 ? 302 ARG B HD3  1 
ATOM   1172 H HE   . ARG B 1 31 ? -5.457  -9.395  -0.288  1.00 0.00 ? 302 ARG B HE   1 
ATOM   1173 H HH11 . ARG B 1 31 ? -4.219  -6.655  -0.280  1.00 0.00 ? 302 ARG B HH11 1 
ATOM   1174 H HH12 . ARG B 1 31 ? -5.611  -5.635  -0.122  1.00 0.00 ? 302 ARG B HH12 1 
ATOM   1175 H HH21 . ARG B 1 31 ? -7.860  -8.117  -1.024  1.00 0.00 ? 302 ARG B HH21 1 
ATOM   1176 H HH22 . ARG B 1 31 ? -7.673  -6.464  -0.544  1.00 0.00 ? 302 ARG B HH22 1 
ATOM   1177 N N    . GLU B 1 32 ? -3.313  -12.689 -5.844  1.00 0.00 ? 303 GLU B N    1 
ATOM   1178 C CA   . GLU B 1 32 ? -3.817  -13.637 -6.832  1.00 0.00 ? 303 GLU B CA   1 
ATOM   1179 C C    . GLU B 1 32 ? -3.044  -14.954 -6.726  1.00 0.00 ? 303 GLU B C    1 
ATOM   1180 O O    . GLU B 1 32 ? -3.598  -16.023 -6.892  1.00 0.00 ? 303 GLU B O    1 
ATOM   1181 C CB   . GLU B 1 32 ? -3.639  -13.055 -8.234  1.00 0.00 ? 303 GLU B CB   1 
ATOM   1182 C CG   . GLU B 1 32 ? -2.147  -12.912 -8.541  1.00 0.00 ? 303 GLU B CG   1 
ATOM   1183 C CD   . GLU B 1 32 ? -1.967  -12.250 -9.908  1.00 0.00 ? 303 GLU B CD   1 
ATOM   1184 O OE1  . GLU B 1 32 ? -2.611  -11.242 -10.145 1.00 0.00 ? 303 GLU B OE1  1 
ATOM   1185 O OE2  . GLU B 1 32 ? -1.186  -12.761 -10.694 1.00 0.00 ? 303 GLU B OE2  1 
ATOM   1186 H H    . GLU B 1 32 ? -2.924  -11.838 -6.139  1.00 0.00 ? 303 GLU B H    1 
ATOM   1187 H HA   . GLU B 1 32 ? -4.866  -13.819 -6.651  1.00 0.00 ? 303 GLU B HA   1 
ATOM   1188 H HB2  . GLU B 1 32 ? -4.096  -13.713 -8.957  1.00 0.00 ? 303 GLU B HB2  1 
ATOM   1189 H HB3  . GLU B 1 32 ? -4.109  -12.083 -8.283  1.00 0.00 ? 303 GLU B HB3  1 
ATOM   1190 H HG2  . GLU B 1 32 ? -1.680  -12.304 -7.779  1.00 0.00 ? 303 GLU B HG2  1 
ATOM   1191 H HG3  . GLU B 1 32 ? -1.687  -13.889 -8.554  1.00 0.00 ? 303 GLU B HG3  1 
ATOM   1192 N N    . GLN B 1 33 ? -1.770  -14.889 -6.455  1.00 0.00 ? 304 GLN B N    1 
ATOM   1193 C CA   . GLN B 1 33 ? -0.988  -16.116 -6.350  1.00 0.00 ? 304 GLN B CA   1 
ATOM   1194 C C    . GLN B 1 33 ? -1.329  -16.834 -5.041  1.00 0.00 ? 304 GLN B C    1 
ATOM   1195 O O    . GLN B 1 33 ? -1.460  -18.040 -5.002  1.00 0.00 ? 304 GLN B O    1 
ATOM   1196 C CB   . GLN B 1 33 ? 0.506   -15.779 -6.385  1.00 0.00 ? 304 GLN B CB   1 
ATOM   1197 C CG   . GLN B 1 33 ? 0.941   -15.200 -5.036  1.00 0.00 ? 304 GLN B CG   1 
ATOM   1198 C CD   . GLN B 1 33 ? 2.450   -14.941 -5.057  1.00 0.00 ? 304 GLN B CD   1 
ATOM   1199 O OE1  . GLN B 1 33 ? 3.078   -14.855 -4.019  1.00 0.00 ? 304 GLN B OE1  1 
ATOM   1200 N NE2  . GLN B 1 33 ? 3.063   -14.812 -6.202  1.00 0.00 ? 304 GLN B NE2  1 
ATOM   1201 H H    . GLN B 1 33 ? -1.337  -14.018 -6.325  1.00 0.00 ? 304 GLN B H    1 
ATOM   1202 H HA   . GLN B 1 33 ? -1.225  -16.762 -7.182  1.00 0.00 ? 304 GLN B HA   1 
ATOM   1203 H HB2  . GLN B 1 33 ? 1.071   -16.676 -6.590  1.00 0.00 ? 304 GLN B HB2  1 
ATOM   1204 H HB3  . GLN B 1 33 ? 0.691   -15.052 -7.161  1.00 0.00 ? 304 GLN B HB3  1 
ATOM   1205 H HG2  . GLN B 1 33 ? 0.418   -14.273 -4.855  1.00 0.00 ? 304 GLN B HG2  1 
ATOM   1206 H HG3  . GLN B 1 33 ? 0.711   -15.905 -4.250  1.00 0.00 ? 304 GLN B HG3  1 
ATOM   1207 H HE21 . GLN B 1 33 ? 2.557   -14.881 -7.040  1.00 0.00 ? 304 GLN B HE21 1 
ATOM   1208 H HE22 . GLN B 1 33 ? 4.028   -14.650 -6.225  1.00 0.00 ? 304 GLN B HE22 1 
ATOM   1209 N N    . VAL B 1 34 ? -1.476  -16.102 -3.970  1.00 0.00 ? 305 VAL B N    1 
ATOM   1210 C CA   . VAL B 1 34 ? -1.806  -16.737 -2.700  1.00 0.00 ? 305 VAL B CA   1 
ATOM   1211 C C    . VAL B 1 34 ? -3.240  -17.267 -2.761  1.00 0.00 ? 305 VAL B C    1 
ATOM   1212 O O    . VAL B 1 34 ? -3.647  -18.082 -1.958  1.00 0.00 ? 305 VAL B O    1 
ATOM   1213 C CB   . VAL B 1 34 ? -1.686  -15.716 -1.567  1.00 0.00 ? 305 VAL B CB   1 
ATOM   1214 C CG1  . VAL B 1 34 ? -2.269  -16.310 -0.285  1.00 0.00 ? 305 VAL B CG1  1 
ATOM   1215 C CG2  . VAL B 1 34 ? -0.210  -15.376 -1.345  1.00 0.00 ? 305 VAL B CG2  1 
ATOM   1216 H H    . VAL B 1 34 ? -1.370  -15.130 -4.021  1.00 0.00 ? 305 VAL B H    1 
ATOM   1217 H HA   . VAL B 1 34 ? -1.127  -17.556 -2.519  1.00 0.00 ? 305 VAL B HA   1 
ATOM   1218 H HB   . VAL B 1 34 ? -2.229  -14.821 -1.829  1.00 0.00 ? 305 VAL B HB   1 
ATOM   1219 H HG11 . VAL B 1 34 ? -1.949  -17.337 -0.185  1.00 0.00 ? 305 VAL B HG11 1 
ATOM   1220 H HG12 . VAL B 1 34 ? -1.923  -15.741 0.566   1.00 0.00 ? 305 VAL B HG12 1 
ATOM   1221 H HG13 . VAL B 1 34 ? -3.347  -16.273 -0.327  1.00 0.00 ? 305 VAL B HG13 1 
ATOM   1222 H HG21 . VAL B 1 34 ? 0.287   -15.290 -2.299  1.00 0.00 ? 305 VAL B HG21 1 
ATOM   1223 H HG22 . VAL B 1 34 ? -0.134  -14.440 -0.812  1.00 0.00 ? 305 VAL B HG22 1 
ATOM   1224 H HG23 . VAL B 1 34 ? 0.256   -16.159 -0.765  1.00 0.00 ? 305 VAL B HG23 1 
ATOM   1225 N N    . ALA B 1 35 ? -4.007  -16.811 -3.713  1.00 0.00 ? 306 ALA B N    1 
ATOM   1226 C CA   . ALA B 1 35 ? -5.382  -17.278 -3.829  1.00 0.00 ? 306 ALA B CA   1 
ATOM   1227 C C    . ALA B 1 35 ? -5.399  -18.624 -4.555  1.00 0.00 ? 306 ALA B C    1 
ATOM   1228 O O    . ALA B 1 35 ? -6.016  -19.573 -4.111  1.00 0.00 ? 306 ALA B O    1 
ATOM   1229 C CB   . ALA B 1 35 ? -6.204  -16.260 -4.623  1.00 0.00 ? 306 ALA B CB   1 
ATOM   1230 H H    . ALA B 1 35 ? -3.657  -16.155 -4.352  1.00 0.00 ? 306 ALA B H    1 
ATOM   1231 H HA   . ALA B 1 35 ? -5.809  -17.393 -2.845  1.00 0.00 ? 306 ALA B HA   1 
ATOM   1232 H HB1  . ALA B 1 35 ? -5.583  -15.812 -5.383  1.00 0.00 ? 306 ALA B HB1  1 
ATOM   1233 H HB2  . ALA B 1 35 ? -7.041  -16.759 -5.090  1.00 0.00 ? 306 ALA B HB2  1 
ATOM   1234 H HB3  . ALA B 1 35 ? -6.568  -15.492 -3.956  1.00 0.00 ? 306 ALA B HB3  1 
ATOM   1235 N N    . GLN B 1 36 ? -4.719  -18.719 -5.665  1.00 0.00 ? 307 GLN B N    1 
ATOM   1236 C CA   . GLN B 1 36 ? -4.693  -19.981 -6.396  1.00 0.00 ? 307 GLN B CA   1 
ATOM   1237 C C    . GLN B 1 36 ? -4.014  -21.043 -5.529  1.00 0.00 ? 307 GLN B C    1 
ATOM   1238 O O    . GLN B 1 36 ? -4.401  -22.195 -5.523  1.00 0.00 ? 307 GLN B O    1 
ATOM   1239 C CB   . GLN B 1 36 ? -3.910  -19.806 -7.698  1.00 0.00 ? 307 GLN B CB   1 
ATOM   1240 C CG   . GLN B 1 36 ? -4.464  -18.610 -8.474  1.00 0.00 ? 307 GLN B CG   1 
ATOM   1241 C CD   . GLN B 1 36 ? -3.595  -18.353 -9.707  1.00 0.00 ? 307 GLN B CD   1 
ATOM   1242 O OE1  . GLN B 1 36 ? -3.982  -18.673 -10.814 1.00 0.00 ? 307 GLN B OE1  1 
ATOM   1243 N NE2  . GLN B 1 36 ? -2.427  -17.787 -9.562  1.00 0.00 ? 307 GLN B NE2  1 
ATOM   1244 H H    . GLN B 1 36 ? -4.222  -17.945 -6.004  1.00 0.00 ? 307 GLN B H    1 
ATOM   1245 H HA   . GLN B 1 36 ? -5.703  -20.290 -6.621  1.00 0.00 ? 307 GLN B HA   1 
ATOM   1246 H HB2  . GLN B 1 36 ? -2.867  -19.638 -7.470  1.00 0.00 ? 307 GLN B HB2  1 
ATOM   1247 H HB3  . GLN B 1 36 ? -4.008  -20.698 -8.298  1.00 0.00 ? 307 GLN B HB3  1 
ATOM   1248 H HG2  . GLN B 1 36 ? -5.478  -18.820 -8.784  1.00 0.00 ? 307 GLN B HG2  1 
ATOM   1249 H HG3  . GLN B 1 36 ? -4.455  -17.733 -7.843  1.00 0.00 ? 307 GLN B HG3  1 
ATOM   1250 H HE21 . GLN B 1 36 ? -2.116  -17.528 -8.670  1.00 0.00 ? 307 GLN B HE21 1 
ATOM   1251 H HE22 . GLN B 1 36 ? -1.864  -17.619 -10.346 1.00 0.00 ? 307 GLN B HE22 1 
ATOM   1252 N N    . LEU B 1 37 ? -3.006  -20.661 -4.795  1.00 0.00 ? 308 LEU B N    1 
ATOM   1253 C CA   . LEU B 1 37 ? -2.317  -21.621 -3.941  1.00 0.00 ? 308 LEU B CA   1 
ATOM   1254 C C    . LEU B 1 37 ? -3.241  -22.025 -2.791  1.00 0.00 ? 308 LEU B C    1 
ATOM   1255 O O    . LEU B 1 37 ? -3.386  -23.190 -2.475  1.00 0.00 ? 308 LEU B O    1 
ATOM   1256 C CB   . LEU B 1 37 ? -1.046  -20.981 -3.379  1.00 0.00 ? 308 LEU B CB   1 
ATOM   1257 C CG   . LEU B 1 37 ? 0.165   -21.463 -4.177  1.00 0.00 ? 308 LEU B CG   1 
ATOM   1258 C CD1  . LEU B 1 37 ? 1.207   -20.346 -4.250  1.00 0.00 ? 308 LEU B CD1  1 
ATOM   1259 C CD2  . LEU B 1 37 ? 0.776   -22.686 -3.490  1.00 0.00 ? 308 LEU B CD2  1 
ATOM   1260 H H    . LEU B 1 37 ? -2.714  -19.725 -4.812  1.00 0.00 ? 308 LEU B H    1 
ATOM   1261 H HA   . LEU B 1 37 ? -2.055  -22.495 -4.519  1.00 0.00 ? 308 LEU B HA   1 
ATOM   1262 H HB2  . LEU B 1 37 ? -1.123  -19.905 -3.453  1.00 0.00 ? 308 LEU B HB2  1 
ATOM   1263 H HB3  . LEU B 1 37 ? -0.928  -21.264 -2.344  1.00 0.00 ? 308 LEU B HB3  1 
ATOM   1264 H HG   . LEU B 1 37 ? -0.147  -21.729 -5.179  1.00 0.00 ? 308 LEU B HG   1 
ATOM   1265 H HD11 . LEU B 1 37 ? 0.736   -19.399 -4.030  1.00 0.00 ? 308 LEU B HD11 1 
ATOM   1266 H HD12 . LEU B 1 37 ? 1.989   -20.535 -3.530  1.00 0.00 ? 308 LEU B HD12 1 
ATOM   1267 H HD13 . LEU B 1 37 ? 1.633   -20.314 -5.242  1.00 0.00 ? 308 LEU B HD13 1 
ATOM   1268 H HD21 . LEU B 1 37 ? 0.088   -23.060 -2.745  1.00 0.00 ? 308 LEU B HD21 1 
ATOM   1269 H HD22 . LEU B 1 37 ? 0.966   -23.454 -4.224  1.00 0.00 ? 308 LEU B HD22 1 
ATOM   1270 H HD23 . LEU B 1 37 ? 1.704   -22.405 -3.014  1.00 0.00 ? 308 LEU B HD23 1 
ATOM   1271 N N    . LYS B 1 38 ? -3.868  -21.069 -2.162  1.00 0.00 ? 309 LYS B N    1 
ATOM   1272 C CA   . LYS B 1 38 ? -4.765  -21.386 -1.057  1.00 0.00 ? 309 LYS B CA   1 
ATOM   1273 C C    . LYS B 1 38 ? -5.775  -22.443 -1.511  1.00 0.00 ? 309 LYS B C    1 
ATOM   1274 O O    . LYS B 1 38 ? -6.034  -23.408 -0.818  1.00 0.00 ? 309 LYS B O    1 
ATOM   1275 C CB   . LYS B 1 38 ? -5.510  -20.123 -0.625  1.00 0.00 ? 309 LYS B CB   1 
ATOM   1276 C CG   . LYS B 1 38 ? -4.682  -19.373 0.421   1.00 0.00 ? 309 LYS B CG   1 
ATOM   1277 C CD   . LYS B 1 38 ? -4.874  -20.028 1.790   1.00 0.00 ? 309 LYS B CD   1 
ATOM   1278 C CE   . LYS B 1 38 ? -4.345  -19.096 2.881   1.00 0.00 ? 309 LYS B CE   1 
ATOM   1279 N NZ   . LYS B 1 38 ? -3.612  -19.893 3.903   1.00 0.00 ? 309 LYS B NZ   1 
ATOM   1280 H H    . LYS B 1 38 ? -3.738  -20.136 -2.433  1.00 0.00 ? 309 LYS B H    1 
ATOM   1281 H HA   . LYS B 1 38 ? -4.192  -21.768 -0.224  1.00 0.00 ? 309 LYS B HA   1 
ATOM   1282 H HB2  . LYS B 1 38 ? -5.667  -19.488 -1.485  1.00 0.00 ? 309 LYS B HB2  1 
ATOM   1283 H HB3  . LYS B 1 38 ? -6.463  -20.396 -0.198  1.00 0.00 ? 309 LYS B HB3  1 
ATOM   1284 H HG2  . LYS B 1 38 ? -3.638  -19.408 0.146   1.00 0.00 ? 309 LYS B HG2  1 
ATOM   1285 H HG3  . LYS B 1 38 ? -5.008  -18.345 0.468   1.00 0.00 ? 309 LYS B HG3  1 
ATOM   1286 H HD2  . LYS B 1 38 ? -5.924  -20.217 1.955   1.00 0.00 ? 309 LYS B HD2  1 
ATOM   1287 H HD3  . LYS B 1 38 ? -4.330  -20.961 1.822   1.00 0.00 ? 309 LYS B HD3  1 
ATOM   1288 H HE2  . LYS B 1 38 ? -3.676  -18.371 2.443   1.00 0.00 ? 309 LYS B HE2  1 
ATOM   1289 H HE3  . LYS B 1 38 ? -5.174  -18.584 3.349   1.00 0.00 ? 309 LYS B HE3  1 
ATOM   1290 H HZ1  . LYS B 1 38 ? -3.596  -20.893 3.617   1.00 0.00 ? 309 LYS B HZ1  1 
ATOM   1291 H HZ2  . LYS B 1 38 ? -2.638  -19.539 3.984   1.00 0.00 ? 309 LYS B HZ2  1 
ATOM   1292 H HZ3  . LYS B 1 38 ? -4.092  -19.807 4.820   1.00 0.00 ? 309 LYS B HZ3  1 
ATOM   1293 N N    . GLN B 1 39 ? -6.348  -22.267 -2.670  1.00 0.00 ? 310 GLN B N    1 
ATOM   1294 C CA   . GLN B 1 39 ? -7.319  -23.238 -3.160  1.00 0.00 ? 310 GLN B CA   1 
ATOM   1295 C C    . GLN B 1 39 ? -6.661  -24.615 -3.263  1.00 0.00 ? 310 GLN B C    1 
ATOM   1296 O O    . GLN B 1 39 ? -7.244  -25.621 -2.910  1.00 0.00 ? 310 GLN B O    1 
ATOM   1297 C CB   . GLN B 1 39 ? -7.818  -22.805 -4.540  1.00 0.00 ? 310 GLN B CB   1 
ATOM   1298 C CG   . GLN B 1 39 ? -8.447  -21.414 -4.444  1.00 0.00 ? 310 GLN B CG   1 
ATOM   1299 C CD   . GLN B 1 39 ? -9.764  -21.503 -3.671  1.00 0.00 ? 310 GLN B CD   1 
ATOM   1300 O OE1  . GLN B 1 39 ? -9.945  -20.829 -2.677  1.00 0.00 ? 310 GLN B OE1  1 
ATOM   1301 N NE2  . GLN B 1 39 ? -10.699 -22.312 -4.090  1.00 0.00 ? 310 GLN B NE2  1 
ATOM   1302 H H    . GLN B 1 39 ? -6.124  -21.481 -3.212  1.00 0.00 ? 310 GLN B H    1 
ATOM   1303 H HA   . GLN B 1 39 ? -8.154  -23.287 -2.477  1.00 0.00 ? 310 GLN B HA   1 
ATOM   1304 H HB2  . GLN B 1 39 ? -6.987  -22.778 -5.230  1.00 0.00 ? 310 GLN B HB2  1 
ATOM   1305 H HB3  . GLN B 1 39 ? -8.556  -23.509 -4.893  1.00 0.00 ? 310 GLN B HB3  1 
ATOM   1306 H HG2  . GLN B 1 39 ? -7.770  -20.748 -3.930  1.00 0.00 ? 310 GLN B HG2  1 
ATOM   1307 H HG3  . GLN B 1 39 ? -8.638  -21.036 -5.437  1.00 0.00 ? 310 GLN B HG3  1 
ATOM   1308 H HE21 . GLN B 1 39 ? -10.554 -22.856 -4.892  1.00 0.00 ? 310 GLN B HE21 1 
ATOM   1309 H HE22 . GLN B 1 39 ? -11.546 -22.377 -3.601  1.00 0.00 ? 310 GLN B HE22 1 
ATOM   1310 N N    . LYS B 1 40 ? -5.449  -24.669 -3.744  1.00 0.00 ? 311 LYS B N    1 
ATOM   1311 C CA   . LYS B 1 40 ? -4.771  -25.954 -3.868  1.00 0.00 ? 311 LYS B CA   1 
ATOM   1312 C C    . LYS B 1 40 ? -4.575  -26.565 -2.478  1.00 0.00 ? 311 LYS B C    1 
ATOM   1313 O O    . LYS B 1 40 ? -4.535  -27.770 -2.319  1.00 0.00 ? 311 LYS B O    1 
ATOM   1314 C CB   . LYS B 1 40 ? -3.409  -25.751 -4.532  1.00 0.00 ? 311 LYS B CB   1 
ATOM   1315 C CG   . LYS B 1 40 ? -3.252  -26.738 -5.691  1.00 0.00 ? 311 LYS B CG   1 
ATOM   1316 C CD   . LYS B 1 40 ? -2.795  -25.986 -6.944  1.00 0.00 ? 311 LYS B CD   1 
ATOM   1317 C CE   . LYS B 1 40 ? -3.981  -25.808 -7.894  1.00 0.00 ? 311 LYS B CE   1 
ATOM   1318 N NZ   . LYS B 1 40 ? -4.638  -24.497 -7.627  1.00 0.00 ? 311 LYS B NZ   1 
ATOM   1319 H H    . LYS B 1 40 ? -4.996  -23.847 -4.025  1.00 0.00 ? 311 LYS B H    1 
ATOM   1320 H HA   . LYS B 1 40 ? -5.368  -26.620 -4.473  1.00 0.00 ? 311 LYS B HA   1 
ATOM   1321 H HB2  . LYS B 1 40 ? -3.340  -24.740 -4.907  1.00 0.00 ? 311 LYS B HB2  1 
ATOM   1322 H HB3  . LYS B 1 40 ? -2.626  -25.921 -3.808  1.00 0.00 ? 311 LYS B HB3  1 
ATOM   1323 H HG2  . LYS B 1 40 ? -2.516  -27.485 -5.429  1.00 0.00 ? 311 LYS B HG2  1 
ATOM   1324 H HG3  . LYS B 1 40 ? -4.199  -27.216 -5.887  1.00 0.00 ? 311 LYS B HG3  1 
ATOM   1325 H HD2  . LYS B 1 40 ? -2.410  -25.017 -6.662  1.00 0.00 ? 311 LYS B HD2  1 
ATOM   1326 H HD3  . LYS B 1 40 ? -2.019  -26.552 -7.439  1.00 0.00 ? 311 LYS B HD3  1 
ATOM   1327 H HE2  . LYS B 1 40 ? -3.630  -25.835 -8.915  1.00 0.00 ? 311 LYS B HE2  1 
ATOM   1328 H HE3  . LYS B 1 40 ? -4.691  -26.606 -7.735  1.00 0.00 ? 311 LYS B HE3  1 
ATOM   1329 H HZ1  . LYS B 1 40 ? -3.910  -23.767 -7.486  1.00 0.00 ? 311 LYS B HZ1  1 
ATOM   1330 H HZ2  . LYS B 1 40 ? -5.236  -24.238 -8.436  1.00 0.00 ? 311 LYS B HZ2  1 
ATOM   1331 H HZ3  . LYS B 1 40 ? -5.227  -24.571 -6.773  1.00 0.00 ? 311 LYS B HZ3  1 
ATOM   1332 N N    . VAL B 1 41 ? -4.450  -25.745 -1.471  1.00 0.00 ? 312 VAL B N    1 
ATOM   1333 C CA   . VAL B 1 41 ? -4.258  -26.271 -0.123  1.00 0.00 ? 312 VAL B CA   1 
ATOM   1334 C C    . VAL B 1 41 ? -5.601  -26.741 0.436   1.00 0.00 ? 312 VAL B C    1 
ATOM   1335 O O    . VAL B 1 41 ? -5.658  -27.569 1.325   1.00 0.00 ? 312 VAL B O    1 
ATOM   1336 C CB   . VAL B 1 41 ? -3.684  -25.174 0.774   1.00 0.00 ? 312 VAL B CB   1 
ATOM   1337 C CG1  . VAL B 1 41 ? -3.626  -25.674 2.218   1.00 0.00 ? 312 VAL B CG1  1 
ATOM   1338 C CG2  . VAL B 1 41 ? -2.273  -24.817 0.302   1.00 0.00 ? 312 VAL B CG2  1 
ATOM   1339 H H    . VAL B 1 41 ? -4.483  -24.777 -1.619  1.00 0.00 ? 312 VAL B H    1 
ATOM   1340 H HA   . VAL B 1 41 ? -3.571  -27.103 -0.156  1.00 0.00 ? 312 VAL B HA   1 
ATOM   1341 H HB   . VAL B 1 41 ? -4.316  -24.299 0.722   1.00 0.00 ? 312 VAL B HB   1 
ATOM   1342 H HG11 . VAL B 1 41 ? -4.569  -26.134 2.478   1.00 0.00 ? 312 VAL B HG11 1 
ATOM   1343 H HG12 . VAL B 1 41 ? -2.832  -26.401 2.316   1.00 0.00 ? 312 VAL B HG12 1 
ATOM   1344 H HG13 . VAL B 1 41 ? -3.437  -24.843 2.880   1.00 0.00 ? 312 VAL B HG13 1 
ATOM   1345 H HG21 . VAL B 1 41 ? -2.251  -24.787 -0.777  1.00 0.00 ? 312 VAL B HG21 1 
ATOM   1346 H HG22 . VAL B 1 41 ? -1.996  -23.849 0.693   1.00 0.00 ? 312 VAL B HG22 1 
ATOM   1347 H HG23 . VAL B 1 41 ? -1.576  -25.562 0.657   1.00 0.00 ? 312 VAL B HG23 1 
ATOM   1348 N N    . MET B 1 42 ? -6.683  -26.223 -0.075  1.00 0.00 ? 313 MET B N    1 
ATOM   1349 C CA   . MET B 1 42 ? -7.992  -26.637 0.417   1.00 0.00 ? 313 MET B CA   1 
ATOM   1350 C C    . MET B 1 42 ? -8.239  -28.098 0.036   1.00 0.00 ? 313 MET B C    1 
ATOM   1351 O O    . MET B 1 42 ? -8.738  -28.395 -1.031  1.00 0.00 ? 313 MET B O    1 
ATOM   1352 C CB   . MET B 1 42 ? -9.076  -25.754 -0.206  1.00 0.00 ? 313 MET B CB   1 
ATOM   1353 C CG   . MET B 1 42 ? -8.857  -24.300 0.217   1.00 0.00 ? 313 MET B CG   1 
ATOM   1354 S SD   . MET B 1 42 ? -10.040 -23.865 1.515   1.00 0.00 ? 313 MET B SD   1 
ATOM   1355 C CE   . MET B 1 42 ? -9.624  -22.107 1.620   1.00 0.00 ? 313 MET B CE   1 
ATOM   1356 H H    . MET B 1 42 ? -6.616  -25.559 -0.793  1.00 0.00 ? 313 MET B H    1 
ATOM   1357 H HA   . MET B 1 42 ? -8.021  -26.535 1.492   1.00 0.00 ? 313 MET B HA   1 
ATOM   1358 H HB2  . MET B 1 42 ? -9.024  -25.829 -1.282  1.00 0.00 ? 313 MET B HB2  1 
ATOM   1359 H HB3  . MET B 1 42 ? -10.047 -26.083 0.134   1.00 0.00 ? 313 MET B HB3  1 
ATOM   1360 H HG2  . MET B 1 42 ? -7.852  -24.183 0.592   1.00 0.00 ? 313 MET B HG2  1 
ATOM   1361 H HG3  . MET B 1 42 ? -9.002  -23.653 -0.635  1.00 0.00 ? 313 MET B HG3  1 
ATOM   1362 H HE1  . MET B 1 42 ? -8.791  -21.895 0.963   1.00 0.00 ? 313 MET B HE1  1 
ATOM   1363 H HE2  . MET B 1 42 ? -10.474 -21.516 1.319   1.00 0.00 ? 313 MET B HE2  1 
ATOM   1364 H HE3  . MET B 1 42 ? -9.359  -21.861 2.638   1.00 0.00 ? 313 MET B HE3  1 
ATOM   1365 N N    . ASN B 1 43 ? -7.896  -29.013 0.901   1.00 0.00 ? 314 ASN B N    1 
ATOM   1366 C CA   . ASN B 1 43 ? -8.108  -30.422 0.594   1.00 0.00 ? 314 ASN B CA   1 
ATOM   1367 C C    . ASN B 1 43 ? -7.714  -31.272 1.803   1.00 0.00 ? 314 ASN B C    1 
ATOM   1368 O O    . ASN B 1 43 ? -6.950  -32.210 1.693   1.00 0.00 ? 314 ASN B O    1 
ATOM   1369 C CB   . ASN B 1 43 ? -7.248  -30.816 -0.609  1.00 0.00 ? 314 ASN B CB   1 
ATOM   1370 C CG   . ASN B 1 43 ? -8.003  -31.837 -1.465  1.00 0.00 ? 314 ASN B CG   1 
ATOM   1371 O OD1  . ASN B 1 43 ? -8.643  -31.479 -2.434  1.00 0.00 ? 314 ASN B OD1  1 
ATOM   1372 N ND2  . ASN B 1 43 ? -7.954  -33.101 -1.145  1.00 0.00 ? 314 ASN B ND2  1 
ATOM   1373 H H    . ASN B 1 43 ? -7.495  -28.753 1.756   1.00 0.00 ? 314 ASN B H    1 
ATOM   1374 H HA   . ASN B 1 43 ? -9.148  -30.587 0.360   1.00 0.00 ? 314 ASN B HA   1 
ATOM   1375 H HB2  . ASN B 1 43 ? -7.034  -29.938 -1.201  1.00 0.00 ? 314 ASN B HB2  1 
ATOM   1376 H HB3  . ASN B 1 43 ? -6.324  -31.252 -0.265  1.00 0.00 ? 314 ASN B HB3  1 
ATOM   1377 H HD21 . ASN B 1 43 ? -7.437  -33.389 -0.362  1.00 0.00 ? 314 ASN B HD21 1 
ATOM   1378 H HD22 . ASN B 1 43 ? -8.434  -33.761 -1.684  1.00 0.00 ? 314 ASN B HD22 1 
ATOM   1379 N N    . TYR B 1 44 ? -8.228  -30.951 2.959   1.00 0.00 ? 315 TYR B N    1 
ATOM   1380 C CA   . TYR B 1 44 ? -7.887  -31.723 4.149   1.00 0.00 ? 315 TYR B CA   1 
ATOM   1381 C C    . TYR B 1 44 ? -8.881  -31.398 5.268   1.00 0.00 ? 315 TYR B C    1 
ATOM   1382 O O    . TYR B 1 44 ? -9.257  -32.312 5.984   1.00 0.00 ? 315 TYR B O    1 
ATOM   1383 C CB   . TYR B 1 44 ? -6.468  -31.365 4.600   1.00 0.00 ? 315 TYR B CB   1 
ATOM   1384 C CG   . TYR B 1 44 ? -6.128  -32.120 5.865   1.00 0.00 ? 315 TYR B CG   1 
ATOM   1385 C CD1  . TYR B 1 44 ? -6.366  -33.501 5.945   1.00 0.00 ? 315 TYR B CD1  1 
ATOM   1386 C CD2  . TYR B 1 44 ? -5.574  -31.438 6.960   1.00 0.00 ? 315 TYR B CD2  1 
ATOM   1387 C CE1  . TYR B 1 44 ? -6.051  -34.201 7.121   1.00 0.00 ? 315 TYR B CE1  1 
ATOM   1388 C CE2  . TYR B 1 44 ? -5.258  -32.138 8.136   1.00 0.00 ? 315 TYR B CE2  1 
ATOM   1389 C CZ   . TYR B 1 44 ? -5.496  -33.519 8.216   1.00 0.00 ? 315 TYR B CZ   1 
ATOM   1390 O OH   . TYR B 1 44 ? -5.187  -34.207 9.372   1.00 0.00 ? 315 TYR B OH   1 
ATOM   1391 O OXT  . TYR B 1 44 ? -9.248  -30.241 5.389   1.00 0.00 ? 315 TYR B OXT  1 
ATOM   1392 H H    . TYR B 1 44 ? -8.840  -30.190 3.029   1.00 0.00 ? 315 TYR B H    1 
ATOM   1393 H HA   . TYR B 1 44 ? -7.935  -32.778 3.921   1.00 0.00 ? 315 TYR B HA   1 
ATOM   1394 H HB2  . TYR B 1 44 ? -5.767  -31.633 3.823   1.00 0.00 ? 315 TYR B HB2  1 
ATOM   1395 H HB3  . TYR B 1 44 ? -6.408  -30.304 4.789   1.00 0.00 ? 315 TYR B HB3  1 
ATOM   1396 H HD1  . TYR B 1 44 ? -6.793  -34.026 5.103   1.00 0.00 ? 315 TYR B HD1  1 
ATOM   1397 H HD2  . TYR B 1 44 ? -5.391  -30.376 6.899   1.00 0.00 ? 315 TYR B HD2  1 
ATOM   1398 H HE1  . TYR B 1 44 ? -6.234  -35.264 7.183   1.00 0.00 ? 315 TYR B HE1  1 
ATOM   1399 H HE2  . TYR B 1 44 ? -4.832  -31.614 8.978   1.00 0.00 ? 315 TYR B HE2  1 
ATOM   1400 H HH   . TYR B 1 44 ? -5.989  -34.283 9.895   1.00 0.00 ? 315 TYR B HH   1 
HETATM 1401 C C    . ACE A 1 1  ? -2.186  31.134  -0.834  1.00 0.00 ? 272 ACE A C    2 
HETATM 1402 O O    . ACE A 1 1  ? -1.972  30.054  -1.348  1.00 0.00 ? 272 ACE A O    2 
HETATM 1403 C CH3  . ACE A 1 1  ? -3.182  32.121  -1.447  1.00 0.00 ? 272 ACE A CH3  2 
HETATM 1404 H H1   . ACE A 1 1  ? -4.065  31.588  -1.768  1.00 0.00 ? 272 ACE A H1   2 
HETATM 1405 H H2   . ACE A 1 1  ? -3.456  32.861  -0.710  1.00 0.00 ? 272 ACE A H2   2 
HETATM 1406 H H3   . ACE A 1 1  ? -2.727  32.610  -2.296  1.00 0.00 ? 272 ACE A H3   2 
ATOM   1407 N N    . CYS A 1 2  ? -1.575  31.496  0.261   1.00 0.00 ? 273 CYS A N    2 
ATOM   1408 C CA   . CYS A 1 2  ? -0.615  30.598  0.891   1.00 0.00 ? 273 CYS A CA   2 
ATOM   1409 C C    . CYS A 1 2  ? -0.915  30.502  2.389   1.00 0.00 ? 273 CYS A C    2 
ATOM   1410 O O    . CYS A 1 2  ? -0.493  31.331  3.170   1.00 0.00 ? 273 CYS A O    2 
ATOM   1411 C CB   . CYS A 1 2  ? 0.801   31.141  0.687   1.00 0.00 ? 273 CYS A CB   2 
ATOM   1412 S SG   . CYS A 1 2  ? 1.876   29.815  0.084   1.00 0.00 ? 273 CYS A SG   2 
ATOM   1413 H H    . CYS A 1 2  ? -1.762  32.372  0.659   1.00 0.00 ? 273 CYS A H    2 
ATOM   1414 H HA   . CYS A 1 2  ? -0.690  29.618  0.445   1.00 0.00 ? 273 CYS A HA   2 
ATOM   1415 H HB2  . CYS A 1 2  ? 0.779   31.943  -0.035  1.00 0.00 ? 273 CYS A HB2  2 
ATOM   1416 H HB3  . CYS A 1 2  ? 1.183   31.514  1.627   1.00 0.00 ? 273 CYS A HB3  2 
ATOM   1417 N N    . GLY A 1 3  ? -1.640  29.495  2.797   1.00 0.00 ? 274 GLY A N    2 
ATOM   1418 C CA   . GLY A 1 3  ? -1.957  29.353  4.213   1.00 0.00 ? 274 GLY A CA   2 
ATOM   1419 C C    . GLY A 1 3  ? -3.187  28.459  4.379   1.00 0.00 ? 274 GLY A C    2 
ATOM   1420 O O    . GLY A 1 3  ? -3.335  27.768  5.367   1.00 0.00 ? 274 GLY A O    2 
ATOM   1421 H H    . GLY A 1 3  ? -1.970  28.837  2.151   1.00 0.00 ? 274 GLY A H    2 
ATOM   1422 H HA2  . GLY A 1 3  ? -1.115  28.910  4.726   1.00 0.00 ? 274 GLY A HA2  2 
ATOM   1423 H HA3  . GLY A 1 3  ? -2.164  30.324  4.635   1.00 0.00 ? 274 GLY A HA3  2 
ATOM   1424 N N    . GLY A 1 4  ? -4.072  28.465  3.420   1.00 0.00 ? 275 GLY A N    2 
ATOM   1425 C CA   . GLY A 1 4  ? -5.266  27.633  3.524   1.00 0.00 ? 275 GLY A CA   2 
ATOM   1426 C C    . GLY A 1 4  ? -5.128  26.419  2.605   1.00 0.00 ? 275 GLY A C    2 
ATOM   1427 O O    . GLY A 1 4  ? -5.767  25.404  2.802   1.00 0.00 ? 275 GLY A O    2 
ATOM   1428 H H    . GLY A 1 4  ? -3.936  29.030  2.630   1.00 0.00 ? 275 GLY A H    2 
ATOM   1429 H HA2  . GLY A 1 4  ? -5.384  27.302  4.547   1.00 0.00 ? 275 GLY A HA2  2 
ATOM   1430 H HA3  . GLY A 1 4  ? -6.132  28.206  3.228   1.00 0.00 ? 275 GLY A HA3  2 
ATOM   1431 N N    . ARG A 1 5  ? -4.301  26.512  1.600   1.00 0.00 ? 276 ARG A N    2 
ATOM   1432 C CA   . ARG A 1 5  ? -4.130  25.386  0.690   1.00 0.00 ? 276 ARG A CA   2 
ATOM   1433 C C    . ARG A 1 5  ? -2.997  24.492  1.197   1.00 0.00 ? 276 ARG A C    2 
ATOM   1434 O O    . ARG A 1 5  ? -2.923  23.323  0.872   1.00 0.00 ? 276 ARG A O    2 
ATOM   1435 C CB   . ARG A 1 5  ? -3.783  25.905  -0.707  1.00 0.00 ? 276 ARG A CB   2 
ATOM   1436 C CG   . ARG A 1 5  ? -4.896  26.832  -1.200  1.00 0.00 ? 276 ARG A CG   2 
ATOM   1437 C CD   . ARG A 1 5  ? -4.318  28.221  -1.478  1.00 0.00 ? 276 ARG A CD   2 
ATOM   1438 N NE   . ARG A 1 5  ? -4.368  28.503  -2.912  1.00 0.00 ? 276 ARG A NE   2 
ATOM   1439 C CZ   . ARG A 1 5  ? -4.139  27.554  -3.781  1.00 0.00 ? 276 ARG A CZ   2 
ATOM   1440 N NH1  . ARG A 1 5  ? -2.910  27.231  -4.085  1.00 0.00 ? 276 ARG A NH1  2 
ATOM   1441 N NH2  . ARG A 1 5  ? -5.138  26.928  -4.345  1.00 0.00 ? 276 ARG A NH2  2 
ATOM   1442 H H    . ARG A 1 5  ? -3.795  27.339  1.457   1.00 0.00 ? 276 ARG A H    2 
ATOM   1443 H HA   . ARG A 1 5  ? -5.046  24.817  0.644   1.00 0.00 ? 276 ARG A HA   2 
ATOM   1444 H HB2  . ARG A 1 5  ? -2.850  26.450  -0.667  1.00 0.00 ? 276 ARG A HB2  2 
ATOM   1445 H HB3  . ARG A 1 5  ? -3.684  25.072  -1.387  1.00 0.00 ? 276 ARG A HB3  2 
ATOM   1446 H HG2  . ARG A 1 5  ? -5.323  26.429  -2.107  1.00 0.00 ? 276 ARG A HG2  2 
ATOM   1447 H HG3  . ARG A 1 5  ? -5.662  26.907  -0.442  1.00 0.00 ? 276 ARG A HG3  2 
ATOM   1448 H HD2  . ARG A 1 5  ? -4.898  28.962  -0.951  1.00 0.00 ? 276 ARG A HD2  2 
ATOM   1449 H HD3  . ARG A 1 5  ? -3.293  28.259  -1.136  1.00 0.00 ? 276 ARG A HD3  2 
ATOM   1450 H HE   . ARG A 1 5  ? -4.577  29.409  -3.224  1.00 0.00 ? 276 ARG A HE   2 
ATOM   1451 H HH11 . ARG A 1 5  ? -2.146  27.709  -3.654  1.00 0.00 ? 276 ARG A HH11 2 
ATOM   1452 H HH12 . ARG A 1 5  ? -2.734  26.504  -4.750  1.00 0.00 ? 276 ARG A HH12 2 
ATOM   1453 H HH21 . ARG A 1 5  ? -6.078  27.177  -4.112  1.00 0.00 ? 276 ARG A HH21 2 
ATOM   1454 H HH22 . ARG A 1 5  ? -4.962  26.202  -5.010  1.00 0.00 ? 276 ARG A HH22 2 
ATOM   1455 N N    . ILE A 1 6  ? -2.114  25.031  1.991   1.00 0.00 ? 277 ILE A N    2 
ATOM   1456 C CA   . ILE A 1 6  ? -1.011  24.231  2.507   1.00 0.00 ? 277 ILE A CA   2 
ATOM   1457 C C    . ILE A 1 6  ? -1.539  23.254  3.560   1.00 0.00 ? 277 ILE A C    2 
ATOM   1458 O O    . ILE A 1 6  ? -1.073  22.138  3.673   1.00 0.00 ? 277 ILE A O    2 
ATOM   1459 C CB   . ILE A 1 6  ? 0.036   25.151  3.138   1.00 0.00 ? 277 ILE A CB   2 
ATOM   1460 C CG1  . ILE A 1 6  ? 0.738   25.947  2.037   1.00 0.00 ? 277 ILE A CG1  2 
ATOM   1461 C CG2  . ILE A 1 6  ? 1.066   24.312  3.896   1.00 0.00 ? 277 ILE A CG2  2 
ATOM   1462 C CD1  . ILE A 1 6  ? 0.817   27.420  2.441   1.00 0.00 ? 277 ILE A CD1  2 
ATOM   1463 H H    . ILE A 1 6  ? -2.192  25.976  2.241   1.00 0.00 ? 277 ILE A H    2 
ATOM   1464 H HA   . ILE A 1 6  ? -0.558  23.677  1.698   1.00 0.00 ? 277 ILE A HA   2 
ATOM   1465 H HB   . ILE A 1 6  ? -0.448  25.830  3.823   1.00 0.00 ? 277 ILE A HB   2 
ATOM   1466 H HG12 . ILE A 1 6  ? 1.737   25.558  1.892   1.00 0.00 ? 277 ILE A HG12 2 
ATOM   1467 H HG13 . ILE A 1 6  ? 0.180   25.858  1.117   1.00 0.00 ? 277 ILE A HG13 2 
ATOM   1468 H HG21 . ILE A 1 6  ? 0.564   23.714  4.643   1.00 0.00 ? 277 ILE A HG21 2 
ATOM   1469 H HG22 . ILE A 1 6  ? 1.581   23.663  3.203   1.00 0.00 ? 277 ILE A HG22 2 
ATOM   1470 H HG23 . ILE A 1 6  ? 1.778   24.965  4.376   1.00 0.00 ? 277 ILE A HG23 2 
ATOM   1471 H HD11 . ILE A 1 6  ? 0.018   27.647  3.130   1.00 0.00 ? 277 ILE A HD11 2 
ATOM   1472 H HD12 . ILE A 1 6  ? 1.768   27.613  2.917   1.00 0.00 ? 277 ILE A HD12 2 
ATOM   1473 H HD13 . ILE A 1 6  ? 0.722   28.040  1.562   1.00 0.00 ? 277 ILE A HD13 2 
ATOM   1474 N N    . ALA A 1 7  ? -2.511  23.662  4.331   1.00 0.00 ? 278 ALA A N    2 
ATOM   1475 C CA   . ALA A 1 7  ? -3.055  22.772  5.349   1.00 0.00 ? 278 ALA A CA   2 
ATOM   1476 C C    . ALA A 1 7  ? -3.643  21.532  4.672   1.00 0.00 ? 278 ALA A C    2 
ATOM   1477 O O    . ALA A 1 7  ? -3.371  20.413  5.060   1.00 0.00 ? 278 ALA A O    2 
ATOM   1478 C CB   . ALA A 1 7  ? -4.152  23.499  6.131   1.00 0.00 ? 278 ALA A CB   2 
ATOM   1479 H H    . ALA A 1 7  ? -2.875  24.566  4.223   1.00 0.00 ? 278 ALA A H    2 
ATOM   1480 H HA   . ALA A 1 7  ? -2.268  22.475  6.026   1.00 0.00 ? 278 ALA A HA   2 
ATOM   1481 H HB1  . ALA A 1 7  ? -4.117  24.554  5.904   1.00 0.00 ? 278 ALA A HB1  2 
ATOM   1482 H HB2  . ALA A 1 7  ? -5.116  23.101  5.850   1.00 0.00 ? 278 ALA A HB2  2 
ATOM   1483 H HB3  . ALA A 1 7  ? -3.996  23.351  7.189   1.00 0.00 ? 278 ALA A HB3  2 
ATOM   1484 N N    . ARG A 1 8  ? -4.446  21.723  3.663   1.00 0.00 ? 279 ARG A N    2 
ATOM   1485 C CA   . ARG A 1 8  ? -5.038  20.583  2.974   1.00 0.00 ? 279 ARG A CA   2 
ATOM   1486 C C    . ARG A 1 8  ? -3.930  19.747  2.329   1.00 0.00 ? 279 ARG A C    2 
ATOM   1487 O O    . ARG A 1 8  ? -3.901  18.538  2.448   1.00 0.00 ? 279 ARG A O    2 
ATOM   1488 C CB   . ARG A 1 8  ? -5.995  21.082  1.889   1.00 0.00 ? 279 ARG A CB   2 
ATOM   1489 C CG   . ARG A 1 8  ? -7.383  21.304  2.493   1.00 0.00 ? 279 ARG A CG   2 
ATOM   1490 C CD   . ARG A 1 8  ? -8.250  22.089  1.506   1.00 0.00 ? 279 ARG A CD   2 
ATOM   1491 N NE   . ARG A 1 8  ? -9.658  21.892  1.831   1.00 0.00 ? 279 ARG A NE   2 
ATOM   1492 C CZ   . ARG A 1 8  ? -10.560 22.695  1.338   1.00 0.00 ? 279 ARG A CZ   2 
ATOM   1493 N NH1  . ARG A 1 8  ? -10.511 23.041  0.081   1.00 0.00 ? 279 ARG A NH1  2 
ATOM   1494 N NH2  . ARG A 1 8  ? -11.514 23.152  2.103   1.00 0.00 ? 279 ARG A NH2  2 
ATOM   1495 H H    . ARG A 1 8  ? -4.650  22.635  3.366   1.00 0.00 ? 279 ARG A H    2 
ATOM   1496 H HA   . ARG A 1 8  ? -5.583  19.976  3.681   1.00 0.00 ? 279 ARG A HA   2 
ATOM   1497 H HB2  . ARG A 1 8  ? -5.625  22.014  1.484   1.00 0.00 ? 279 ARG A HB2  2 
ATOM   1498 H HB3  . ARG A 1 8  ? -6.061  20.348  1.100   1.00 0.00 ? 279 ARG A HB3  2 
ATOM   1499 H HG2  . ARG A 1 8  ? -7.844  20.348  2.697   1.00 0.00 ? 279 ARG A HG2  2 
ATOM   1500 H HG3  . ARG A 1 8  ? -7.292  21.863  3.411   1.00 0.00 ? 279 ARG A HG3  2 
ATOM   1501 H HD2  . ARG A 1 8  ? -8.009  23.140  1.573   1.00 0.00 ? 279 ARG A HD2  2 
ATOM   1502 H HD3  . ARG A 1 8  ? -8.061  21.739  0.502   1.00 0.00 ? 279 ARG A HD3  2 
ATOM   1503 H HE   . ARG A 1 8  ? -9.926  21.156  2.420   1.00 0.00 ? 279 ARG A HE   2 
ATOM   1504 H HH11 . ARG A 1 8  ? -9.780  22.690  -0.505  1.00 0.00 ? 279 ARG A HH11 2 
ATOM   1505 H HH12 . ARG A 1 8  ? -11.202 23.656  -0.297  1.00 0.00 ? 279 ARG A HH12 2 
ATOM   1506 H HH21 . ARG A 1 8  ? -11.552 22.887  3.067   1.00 0.00 ? 279 ARG A HH21 2 
ATOM   1507 H HH22 . ARG A 1 8  ? -12.206 23.768  1.726   1.00 0.00 ? 279 ARG A HH22 2 
ATOM   1508 N N    . LEU A 1 9  ? -3.019  20.384  1.645   1.00 0.00 ? 280 LEU A N    2 
ATOM   1509 C CA   . LEU A 1 9  ? -1.937  19.646  1.004   1.00 0.00 ? 280 LEU A CA   2 
ATOM   1510 C C    . LEU A 1 9  ? -1.226  18.770  2.038   1.00 0.00 ? 280 LEU A C    2 
ATOM   1511 O O    . LEU A 1 9  ? -0.949  17.612  1.800   1.00 0.00 ? 280 LEU A O    2 
ATOM   1512 C CB   . LEU A 1 9  ? -0.938  20.631  0.396   1.00 0.00 ? 280 LEU A CB   2 
ATOM   1513 C CG   . LEU A 1 9  ? -1.332  20.933  -1.050  1.00 0.00 ? 280 LEU A CG   2 
ATOM   1514 C CD1  . LEU A 1 9  ? -0.780  22.301  -1.456  1.00 0.00 ? 280 LEU A CD1  2 
ATOM   1515 C CD2  . LEU A 1 9  ? -0.752  19.857  -1.970  1.00 0.00 ? 280 LEU A CD2  2 
ATOM   1516 H H    . LEU A 1 9  ? -3.063  21.359  1.561   1.00 0.00 ? 280 LEU A H    2 
ATOM   1517 H HA   . LEU A 1 9  ? -2.342  19.020  0.222   1.00 0.00 ? 280 LEU A HA   2 
ATOM   1518 H HB2  . LEU A 1 9  ? -0.941  21.547  0.970   1.00 0.00 ? 280 LEU A HB2  2 
ATOM   1519 H HB3  . LEU A 1 9  ? 0.052   20.199  0.414   1.00 0.00 ? 280 LEU A HB3  2 
ATOM   1520 H HG   . LEU A 1 9  ? -2.410  20.940  -1.135  1.00 0.00 ? 280 LEU A HG   2 
ATOM   1521 H HD11 . LEU A 1 9  ? -0.106  22.659  -0.692  1.00 0.00 ? 280 LEU A HD11 2 
ATOM   1522 H HD12 . LEU A 1 9  ? -0.249  22.212  -2.392  1.00 0.00 ? 280 LEU A HD12 2 
ATOM   1523 H HD13 . LEU A 1 9  ? -1.596  23.000  -1.571  1.00 0.00 ? 280 LEU A HD13 2 
ATOM   1524 H HD21 . LEU A 1 9  ? 0.233   19.580  -1.624  1.00 0.00 ? 280 LEU A HD21 2 
ATOM   1525 H HD22 . LEU A 1 9  ? -1.394  18.990  -1.961  1.00 0.00 ? 280 LEU A HD22 2 
ATOM   1526 H HD23 . LEU A 1 9  ? -0.683  20.242  -2.977  1.00 0.00 ? 280 LEU A HD23 2 
ATOM   1527 N N    . GLU A 1 10 ? -0.924  19.315  3.185   1.00 0.00 ? 281 GLU A N    2 
ATOM   1528 C CA   . GLU A 1 10 ? -0.242  18.529  4.207   1.00 0.00 ? 281 GLU A CA   2 
ATOM   1529 C C    . GLU A 1 10 ? -1.120  17.342  4.611   1.00 0.00 ? 281 GLU A C    2 
ATOM   1530 O O    . GLU A 1 10 ? -0.671  16.215  4.658   1.00 0.00 ? 281 GLU A O    2 
ATOM   1531 C CB   . GLU A 1 10 ? 0.030   19.406  5.432   1.00 0.00 ? 281 GLU A CB   2 
ATOM   1532 C CG   . GLU A 1 10 ? 1.151   20.396  5.113   1.00 0.00 ? 281 GLU A CG   2 
ATOM   1533 C CD   . GLU A 1 10 ? 2.394   20.041  5.931   1.00 0.00 ? 281 GLU A CD   2 
ATOM   1534 O OE1  . GLU A 1 10 ? 2.239   19.412  6.965   1.00 0.00 ? 281 GLU A OE1  2 
ATOM   1535 O OE2  . GLU A 1 10 ? 3.480   20.403  5.509   1.00 0.00 ? 281 GLU A OE2  2 
ATOM   1536 H H    . GLU A 1 10 ? -1.153  20.253  3.359   1.00 0.00 ? 281 GLU A H    2 
ATOM   1537 H HA   . GLU A 1 10 ? 0.693   18.164  3.814   1.00 0.00 ? 281 GLU A HA   2 
ATOM   1538 H HB2  . GLU A 1 10 ? -0.868  19.950  5.691   1.00 0.00 ? 281 GLU A HB2  2 
ATOM   1539 H HB3  . GLU A 1 10 ? 0.326   18.785  6.262   1.00 0.00 ? 281 GLU A HB3  2 
ATOM   1540 H HG2  . GLU A 1 10 ? 1.385   20.347  4.059   1.00 0.00 ? 281 GLU A HG2  2 
ATOM   1541 H HG3  . GLU A 1 10 ? 0.831   21.396  5.364   1.00 0.00 ? 281 GLU A HG3  2 
ATOM   1542 N N    . GLU A 1 11 ? -2.369  17.585  4.899   1.00 0.00 ? 282 GLU A N    2 
ATOM   1543 C CA   . GLU A 1 11 ? -3.250  16.490  5.286   1.00 0.00 ? 282 GLU A CA   2 
ATOM   1544 C C    . GLU A 1 11 ? -3.330  15.482  4.139   1.00 0.00 ? 282 GLU A C    2 
ATOM   1545 O O    . GLU A 1 11 ? -3.523  14.300  4.347   1.00 0.00 ? 282 GLU A O    2 
ATOM   1546 C CB   . GLU A 1 11 ? -4.647  17.035  5.586   1.00 0.00 ? 282 GLU A CB   2 
ATOM   1547 C CG   . GLU A 1 11 ? -4.833  17.161  7.099   1.00 0.00 ? 282 GLU A CG   2 
ATOM   1548 C CD   . GLU A 1 11 ? -6.146  16.492  7.510   1.00 0.00 ? 282 GLU A CD   2 
ATOM   1549 O OE1  . GLU A 1 11 ? -7.059  16.476  6.700   1.00 0.00 ? 282 GLU A OE1  2 
ATOM   1550 O OE2  . GLU A 1 11 ? -6.216  16.005  8.626   1.00 0.00 ? 282 GLU A OE2  2 
ATOM   1551 H H    . GLU A 1 11 ? -2.715  18.500  4.852   1.00 0.00 ? 282 GLU A H    2 
ATOM   1552 H HA   . GLU A 1 11 ? -2.857  16.004  6.167   1.00 0.00 ? 282 GLU A HA   2 
ATOM   1553 H HB2  . GLU A 1 11 ? -4.759  18.007  5.126   1.00 0.00 ? 282 GLU A HB2  2 
ATOM   1554 H HB3  . GLU A 1 11 ? -5.389  16.360  5.189   1.00 0.00 ? 282 GLU A HB3  2 
ATOM   1555 H HG2  . GLU A 1 11 ? -4.008  16.679  7.604   1.00 0.00 ? 282 GLU A HG2  2 
ATOM   1556 H HG3  . GLU A 1 11 ? -4.864  18.205  7.373   1.00 0.00 ? 282 GLU A HG3  2 
ATOM   1557 N N    . LYS A 1 12 ? -3.183  15.942  2.927   1.00 0.00 ? 283 LYS A N    2 
ATOM   1558 C CA   . LYS A 1 12 ? -3.248  15.035  1.789   1.00 0.00 ? 283 LYS A CA   2 
ATOM   1559 C C    . LYS A 1 12 ? -1.991  14.163  1.757   1.00 0.00 ? 283 LYS A C    2 
ATOM   1560 O O    . LYS A 1 12 ? -2.066  12.957  1.634   1.00 0.00 ? 283 LYS A O    2 
ATOM   1561 C CB   . LYS A 1 12 ? -3.337  15.849  0.496   1.00 0.00 ? 283 LYS A CB   2 
ATOM   1562 C CG   . LYS A 1 12 ? -4.738  15.713  -0.100  1.00 0.00 ? 283 LYS A CG   2 
ATOM   1563 C CD   . LYS A 1 12 ? -4.631  15.393  -1.593  1.00 0.00 ? 283 LYS A CD   2 
ATOM   1564 C CE   . LYS A 1 12 ? -4.907  16.657  -2.408  1.00 0.00 ? 283 LYS A CE   2 
ATOM   1565 N NZ   . LYS A 1 12 ? -4.587  16.403  -3.841  1.00 0.00 ? 283 LYS A NZ   2 
ATOM   1566 H H    . LYS A 1 12 ? -3.028  16.899  2.783   1.00 0.00 ? 283 LYS A H    2 
ATOM   1567 H HA   . LYS A 1 12 ? -4.121  14.407  1.877   1.00 0.00 ? 283 LYS A HA   2 
ATOM   1568 H HB2  . LYS A 1 12 ? -3.136  16.889  0.713   1.00 0.00 ? 283 LYS A HB2  2 
ATOM   1569 H HB3  . LYS A 1 12 ? -2.609  15.481  -0.212  1.00 0.00 ? 283 LYS A HB3  2 
ATOM   1570 H HG2  . LYS A 1 12 ? -5.267  14.915  0.402   1.00 0.00 ? 283 LYS A HG2  2 
ATOM   1571 H HG3  . LYS A 1 12 ? -5.277  16.640  0.029   1.00 0.00 ? 283 LYS A HG3  2 
ATOM   1572 H HD2  . LYS A 1 12 ? -3.636  15.032  -1.812  1.00 0.00 ? 283 LYS A HD2  2 
ATOM   1573 H HD3  . LYS A 1 12 ? -5.353  14.635  -1.852  1.00 0.00 ? 283 LYS A HD3  2 
ATOM   1574 H HE2  . LYS A 1 12 ? -5.948  16.925  -2.313  1.00 0.00 ? 283 LYS A HE2  2 
ATOM   1575 H HE3  . LYS A 1 12 ? -4.292  17.464  -2.039  1.00 0.00 ? 283 LYS A HE3  2 
ATOM   1576 H HZ1  . LYS A 1 12 ? -4.569  15.379  -4.017  1.00 0.00 ? 283 LYS A HZ1  2 
ATOM   1577 H HZ2  . LYS A 1 12 ? -5.313  16.843  -4.442  1.00 0.00 ? 283 LYS A HZ2  2 
ATOM   1578 H HZ3  . LYS A 1 12 ? -3.657  16.812  -4.066  1.00 0.00 ? 283 LYS A HZ3  2 
ATOM   1579 N N    . VAL A 1 13 ? -0.837  14.762  1.866   1.00 0.00 ? 284 VAL A N    2 
ATOM   1580 C CA   . VAL A 1 13 ? 0.391   13.979  1.842   1.00 0.00 ? 284 VAL A CA   2 
ATOM   1581 C C    . VAL A 1 13 ? 0.383   12.989  3.008   1.00 0.00 ? 284 VAL A C    2 
ATOM   1582 O O    . VAL A 1 13 ? 0.992   11.938  2.949   1.00 0.00 ? 284 VAL A O    2 
ATOM   1583 C CB   . VAL A 1 13 ? 1.597   14.910  1.971   1.00 0.00 ? 284 VAL A CB   2 
ATOM   1584 C CG1  . VAL A 1 13 ? 2.880   14.078  2.037   1.00 0.00 ? 284 VAL A CG1  2 
ATOM   1585 C CG2  . VAL A 1 13 ? 1.655   15.838  0.756   1.00 0.00 ? 284 VAL A CG2  2 
ATOM   1586 H H    . VAL A 1 13 ? -0.795  15.738  1.964   1.00 0.00 ? 284 VAL A H    2 
ATOM   1587 H HA   . VAL A 1 13 ? 0.456   13.438  0.910   1.00 0.00 ? 284 VAL A HA   2 
ATOM   1588 H HB   . VAL A 1 13 ? 1.503   15.498  2.873   1.00 0.00 ? 284 VAL A HB   2 
ATOM   1589 H HG11 . VAL A 1 13 ? 2.850   13.308  1.280   1.00 0.00 ? 284 VAL A HG11 2 
ATOM   1590 H HG12 . VAL A 1 13 ? 3.733   14.718  1.866   1.00 0.00 ? 284 VAL A HG12 2 
ATOM   1591 H HG13 . VAL A 1 13 ? 2.963   13.621  3.012   1.00 0.00 ? 284 VAL A HG13 2 
ATOM   1592 H HG21 . VAL A 1 13 ? 0.653   16.027  0.400   1.00 0.00 ? 284 VAL A HG21 2 
ATOM   1593 H HG22 . VAL A 1 13 ? 2.120   16.771  1.037   1.00 0.00 ? 284 VAL A HG22 2 
ATOM   1594 H HG23 . VAL A 1 13 ? 2.233   15.369  -0.027  1.00 0.00 ? 284 VAL A HG23 2 
ATOM   1595 N N    . LYS A 1 14 ? -0.305  13.313  4.068   1.00 0.00 ? 285 LYS A N    2 
ATOM   1596 C CA   . LYS A 1 14 ? -0.354  12.409  5.211   1.00 0.00 ? 285 LYS A CA   2 
ATOM   1597 C C    . LYS A 1 14 ? -1.187  11.179  4.847   1.00 0.00 ? 285 LYS A C    2 
ATOM   1598 O O    . LYS A 1 14 ? -0.755  10.055  5.008   1.00 0.00 ? 285 LYS A O    2 
ATOM   1599 C CB   . LYS A 1 14 ? -0.990  13.124  6.404   1.00 0.00 ? 285 LYS A CB   2 
ATOM   1600 C CG   . LYS A 1 14 ? -0.192  12.812  7.671   1.00 0.00 ? 285 LYS A CG   2 
ATOM   1601 C CD   . LYS A 1 14 ? 0.018   11.301  7.785   1.00 0.00 ? 285 LYS A CD   2 
ATOM   1602 C CE   . LYS A 1 14 ? 0.623   10.970  9.150   1.00 0.00 ? 285 LYS A CE   2 
ATOM   1603 N NZ   . LYS A 1 14 ? -0.240  9.975   9.848   1.00 0.00 ? 285 LYS A NZ   2 
ATOM   1604 H H    . LYS A 1 14 ? -0.790  14.165  4.096   1.00 0.00 ? 285 LYS A H    2 
ATOM   1605 H HA   . LYS A 1 14 ? 0.648   12.101  5.470   1.00 0.00 ? 285 LYS A HA   2 
ATOM   1606 H HB2  . LYS A 1 14 ? -0.986  14.190  6.228   1.00 0.00 ? 285 LYS A HB2  2 
ATOM   1607 H HB3  . LYS A 1 14 ? -2.006  12.782  6.529   1.00 0.00 ? 285 LYS A HB3  2 
ATOM   1608 H HG2  . LYS A 1 14 ? 0.767   13.307  7.623   1.00 0.00 ? 285 LYS A HG2  2 
ATOM   1609 H HG3  . LYS A 1 14 ? -0.736  13.164  8.534   1.00 0.00 ? 285 LYS A HG3  2 
ATOM   1610 H HD2  . LYS A 1 14 ? -0.932  10.797  7.679   1.00 0.00 ? 285 LYS A HD2  2 
ATOM   1611 H HD3  . LYS A 1 14 ? 0.689   10.970  7.006   1.00 0.00 ? 285 LYS A HD3  2 
ATOM   1612 H HE2  . LYS A 1 14 ? 1.611   10.557  9.015   1.00 0.00 ? 285 LYS A HE2  2 
ATOM   1613 H HE3  . LYS A 1 14 ? 0.688   11.870  9.743   1.00 0.00 ? 285 LYS A HE3  2 
ATOM   1614 H HZ1  . LYS A 1 14 ? -1.228  10.103  9.548   1.00 0.00 ? 285 LYS A HZ1  2 
ATOM   1615 H HZ2  . LYS A 1 14 ? 0.075   9.014   9.609   1.00 0.00 ? 285 LYS A HZ2  2 
ATOM   1616 H HZ3  . LYS A 1 14 ? -0.169  10.114  10.875  1.00 0.00 ? 285 LYS A HZ3  2 
ATOM   1617 N N    . THR A 1 15 ? -2.381  11.383  4.357   1.00 0.00 ? 286 THR A N    2 
ATOM   1618 C CA   . THR A 1 15 ? -3.220  10.247  3.990   1.00 0.00 ? 286 THR A CA   2 
ATOM   1619 C C    . THR A 1 15 ? -2.463  9.356   3.004   1.00 0.00 ? 286 THR A C    2 
ATOM   1620 O O    . THR A 1 15 ? -2.412  8.151   3.153   1.00 0.00 ? 286 THR A O    2 
ATOM   1621 C CB   . THR A 1 15 ? -4.510  10.752  3.341   1.00 0.00 ? 286 THR A CB   2 
ATOM   1622 O OG1  . THR A 1 15 ? -4.494  12.172  3.302   1.00 0.00 ? 286 THR A OG1  2 
ATOM   1623 C CG2  . THR A 1 15 ? -5.713  10.275  4.155   1.00 0.00 ? 286 THR A CG2  2 
ATOM   1624 H H    . THR A 1 15 ? -2.712  12.297  4.234   1.00 0.00 ? 286 THR A H    2 
ATOM   1625 H HA   . THR A 1 15 ? -3.463  9.678   4.876   1.00 0.00 ? 286 THR A HA   2 
ATOM   1626 H HB   . THR A 1 15 ? -4.583  10.364  2.337   1.00 0.00 ? 286 THR A HB   2 
ATOM   1627 H HG1  . THR A 1 15 ? -4.950  12.453  2.505   1.00 0.00 ? 286 THR A HG1  2 
ATOM   1628 H HG21 . THR A 1 15 ? -5.439  10.211  5.198   1.00 0.00 ? 286 THR A HG21 2 
ATOM   1629 H HG22 . THR A 1 15 ? -6.527  10.977  4.040   1.00 0.00 ? 286 THR A HG22 2 
ATOM   1630 H HG23 . THR A 1 15 ? -6.023  9.302   3.804   1.00 0.00 ? 286 THR A HG23 2 
ATOM   1631 N N    . LEU A 1 16 ? -1.868  9.941   1.999   1.00 0.00 ? 287 LEU A N    2 
ATOM   1632 C CA   . LEU A 1 16 ? -1.127  9.142   1.030   1.00 0.00 ? 287 LEU A CA   2 
ATOM   1633 C C    . LEU A 1 16 ? -0.133  8.250   1.772   1.00 0.00 ? 287 LEU A C    2 
ATOM   1634 O O    . LEU A 1 16 ? -0.135  7.042   1.625   1.00 0.00 ? 287 LEU A O    2 
ATOM   1635 C CB   . LEU A 1 16 ? -0.370  10.068  0.074   1.00 0.00 ? 287 LEU A CB   2 
ATOM   1636 C CG   . LEU A 1 16 ? -1.199  10.283  -1.193  1.00 0.00 ? 287 LEU A CG   2 
ATOM   1637 C CD1  . LEU A 1 16 ? -1.612  11.753  -1.290  1.00 0.00 ? 287 LEU A CD1  2 
ATOM   1638 C CD2  . LEU A 1 16 ? -0.361  9.909   -2.418  1.00 0.00 ? 287 LEU A CD2  2 
ATOM   1639 H H    . LEU A 1 16 ? -1.917  10.914  1.898   1.00 0.00 ? 287 LEU A H    2 
ATOM   1640 H HA   . LEU A 1 16 ? -1.814  8.529   0.467   1.00 0.00 ? 287 LEU A HA   2 
ATOM   1641 H HB2  . LEU A 1 16 ? -0.196  11.018  0.557   1.00 0.00 ? 287 LEU A HB2  2 
ATOM   1642 H HB3  . LEU A 1 16 ? 0.576   9.619   -0.189  1.00 0.00 ? 287 LEU A HB3  2 
ATOM   1643 H HG   . LEU A 1 16 ? -2.083  9.662   -1.155  1.00 0.00 ? 287 LEU A HG   2 
ATOM   1644 H HD11 . LEU A 1 16 ? -0.996  12.344  -0.628  1.00 0.00 ? 287 LEU A HD11 2 
ATOM   1645 H HD12 . LEU A 1 16 ? -1.482  12.097  -2.306  1.00 0.00 ? 287 LEU A HD12 2 
ATOM   1646 H HD13 . LEU A 1 16 ? -2.648  11.856  -1.004  1.00 0.00 ? 287 LEU A HD13 2 
ATOM   1647 H HD21 . LEU A 1 16 ? 0.079   8.934   -2.269  1.00 0.00 ? 287 LEU A HD21 2 
ATOM   1648 H HD22 . LEU A 1 16 ? -0.994  9.889   -3.293  1.00 0.00 ? 287 LEU A HD22 2 
ATOM   1649 H HD23 . LEU A 1 16 ? 0.422   10.639  -2.555  1.00 0.00 ? 287 LEU A HD23 2 
ATOM   1650 N N    . LYS A 1 17 ? 0.718   8.833   2.573   1.00 0.00 ? 288 LYS A N    2 
ATOM   1651 C CA   . LYS A 1 17 ? 1.687   8.034   3.313   1.00 0.00 ? 288 LYS A CA   2 
ATOM   1652 C C    . LYS A 1 17 ? 0.958   6.895   4.028   1.00 0.00 ? 288 LYS A C    2 
ATOM   1653 O O    . LYS A 1 17 ? 1.450   5.788   4.117   1.00 0.00 ? 288 LYS A O    2 
ATOM   1654 C CB   . LYS A 1 17 ? 2.396   8.915   4.343   1.00 0.00 ? 288 LYS A CB   2 
ATOM   1655 C CG   . LYS A 1 17 ? 3.879   9.024   3.989   1.00 0.00 ? 288 LYS A CG   2 
ATOM   1656 C CD   . LYS A 1 17 ? 4.235   10.489  3.729   1.00 0.00 ? 288 LYS A CD   2 
ATOM   1657 C CE   . LYS A 1 17 ? 4.516   11.191  5.060   1.00 0.00 ? 288 LYS A CE   2 
ATOM   1658 N NZ   . LYS A 1 17 ? 5.643   12.150  4.889   1.00 0.00 ? 288 LYS A NZ   2 
ATOM   1659 H H    . LYS A 1 17 ? 0.701   9.806   2.680   1.00 0.00 ? 288 LYS A H    2 
ATOM   1660 H HA   . LYS A 1 17 ? 2.415   7.624   2.629   1.00 0.00 ? 288 LYS A HA   2 
ATOM   1661 H HB2  . LYS A 1 17 ? 1.951   9.900   4.341   1.00 0.00 ? 288 LYS A HB2  2 
ATOM   1662 H HB3  . LYS A 1 17 ? 2.292   8.477   5.324   1.00 0.00 ? 288 LYS A HB3  2 
ATOM   1663 H HG2  . LYS A 1 17 ? 4.473   8.648   4.810   1.00 0.00 ? 288 LYS A HG2  2 
ATOM   1664 H HG3  . LYS A 1 17 ? 4.082   8.444   3.102   1.00 0.00 ? 288 LYS A HG3  2 
ATOM   1665 H HD2  . LYS A 1 17 ? 5.114   10.540  3.103   1.00 0.00 ? 288 LYS A HD2  2 
ATOM   1666 H HD3  . LYS A 1 17 ? 3.410   10.978  3.234   1.00 0.00 ? 288 LYS A HD3  2 
ATOM   1667 H HE2  . LYS A 1 17 ? 3.633   11.726  5.378   1.00 0.00 ? 288 LYS A HE2  2 
ATOM   1668 H HE3  . LYS A 1 17 ? 4.778   10.455  5.806   1.00 0.00 ? 288 LYS A HE3  2 
ATOM   1669 H HZ1  . LYS A 1 17 ? 6.167   11.917  4.019   1.00 0.00 ? 288 LYS A HZ1  2 
ATOM   1670 H HZ2  . LYS A 1 17 ? 5.269   13.117  4.820   1.00 0.00 ? 288 LYS A HZ2  2 
ATOM   1671 H HZ3  . LYS A 1 17 ? 6.282   12.084  5.706   1.00 0.00 ? 288 LYS A HZ3  2 
ATOM   1672 N N    . ALA A 1 18 ? -0.215  7.159   4.536   1.00 0.00 ? 289 ALA A N    2 
ATOM   1673 C CA   . ALA A 1 18 ? -0.962  6.116   5.228   1.00 0.00 ? 289 ALA A CA   2 
ATOM   1674 C C    . ALA A 1 18 ? -1.123  4.910   4.304   1.00 0.00 ? 289 ALA A C    2 
ATOM   1675 O O    . ALA A 1 18 ? -0.623  3.836   4.573   1.00 0.00 ? 289 ALA A O    2 
ATOM   1676 C CB   . ALA A 1 18 ? -2.345  6.645   5.608   1.00 0.00 ? 289 ALA A CB   2 
ATOM   1677 H H    . ALA A 1 18 ? -0.594  8.058   4.450   1.00 0.00 ? 289 ALA A H    2 
ATOM   1678 H HA   . ALA A 1 18 ? -0.432  5.821   6.120   1.00 0.00 ? 289 ALA A HA   2 
ATOM   1679 H HB1  . ALA A 1 18 ? -2.461  7.651   5.235   1.00 0.00 ? 289 ALA A HB1  2 
ATOM   1680 H HB2  . ALA A 1 18 ? -3.104  6.010   5.171   1.00 0.00 ? 289 ALA A HB2  2 
ATOM   1681 H HB3  . ALA A 1 18 ? -2.449  6.643   6.682   1.00 0.00 ? 289 ALA A HB3  2 
ATOM   1682 N N    . GLN A 1 19 ? -1.822  5.080   3.216   1.00 0.00 ? 290 GLN A N    2 
ATOM   1683 C CA   . GLN A 1 19 ? -2.017  3.969   2.296   1.00 0.00 ? 290 GLN A CA   2 
ATOM   1684 C C    . GLN A 1 19 ? -0.671  3.295   2.020   1.00 0.00 ? 290 GLN A C    2 
ATOM   1685 O O    . GLN A 1 19 ? -0.569  2.084   1.975   1.00 0.00 ? 290 GLN A O    2 
ATOM   1686 C CB   . GLN A 1 19 ? -2.604  4.489   0.982   1.00 0.00 ? 290 GLN A CB   2 
ATOM   1687 C CG   . GLN A 1 19 ? -4.060  4.906   1.199   1.00 0.00 ? 290 GLN A CG   2 
ATOM   1688 C CD   . GLN A 1 19 ? -4.470  5.907   0.117   1.00 0.00 ? 290 GLN A CD   2 
ATOM   1689 O OE1  . GLN A 1 19 ? -4.860  7.018   0.418   1.00 0.00 ? 290 GLN A OE1  2 
ATOM   1690 N NE2  . GLN A 1 19 ? -4.400  5.558   -1.138  1.00 0.00 ? 290 GLN A NE2  2 
ATOM   1691 H H    . GLN A 1 19 ? -2.219  5.955   3.020   1.00 0.00 ? 290 GLN A H    2 
ATOM   1692 H HA   . GLN A 1 19 ? -2.697  3.256   2.735   1.00 0.00 ? 290 GLN A HA   2 
ATOM   1693 H HB2  . GLN A 1 19 ? -2.031  5.341   0.644   1.00 0.00 ? 290 GLN A HB2  2 
ATOM   1694 H HB3  . GLN A 1 19 ? -2.563  3.709   0.237   1.00 0.00 ? 290 GLN A HB3  2 
ATOM   1695 H HG2  . GLN A 1 19 ? -4.696  4.034   1.145   1.00 0.00 ? 290 GLN A HG2  2 
ATOM   1696 H HG3  . GLN A 1 19 ? -4.162  5.366   2.170   1.00 0.00 ? 290 GLN A HG3  2 
ATOM   1697 H HE21 . GLN A 1 19 ? -4.086  4.662   -1.380  1.00 0.00 ? 290 GLN A HE21 2 
ATOM   1698 H HE22 . GLN A 1 19 ? -4.660  6.192   -1.839  1.00 0.00 ? 290 GLN A HE22 2 
ATOM   1699 N N    . ASN A 1 20 ? 0.361   4.071   1.834   1.00 0.00 ? 291 ASN A N    2 
ATOM   1700 C CA   . ASN A 1 20 ? 1.674   3.494   1.563   1.00 0.00 ? 291 ASN A CA   2 
ATOM   1701 C C    . ASN A 1 20 ? 2.010   2.455   2.636   1.00 0.00 ? 291 ASN A C    2 
ATOM   1702 O O    . ASN A 1 20 ? 2.188   1.289   2.349   1.00 0.00 ? 291 ASN A O    2 
ATOM   1703 C CB   . ASN A 1 20 ? 2.729   4.603   1.578   1.00 0.00 ? 291 ASN A CB   2 
ATOM   1704 C CG   . ASN A 1 20 ? 3.793   4.310   0.519   1.00 0.00 ? 291 ASN A CG   2 
ATOM   1705 O OD1  . ASN A 1 20 ? 3.479   4.124   -0.640  1.00 0.00 ? 291 ASN A OD1  2 
ATOM   1706 N ND2  . ASN A 1 20 ? 5.049   4.261   0.870   1.00 0.00 ? 291 ASN A ND2  2 
ATOM   1707 H H    . ASN A 1 20 ? 0.254   5.044   1.874   1.00 0.00 ? 291 ASN A H    2 
ATOM   1708 H HA   . ASN A 1 20 ? 1.667   3.021   0.594   1.00 0.00 ? 291 ASN A HA   2 
ATOM   1709 H HB2  . ASN A 1 20 ? 2.257   5.551   1.362   1.00 0.00 ? 291 ASN A HB2  2 
ATOM   1710 H HB3  . ASN A 1 20 ? 3.194   4.645   2.550   1.00 0.00 ? 291 ASN A HB3  2 
ATOM   1711 H HD21 . ASN A 1 20 ? 5.302   4.411   1.804   1.00 0.00 ? 291 ASN A HD21 2 
ATOM   1712 H HD22 . ASN A 1 20 ? 5.738   4.075   0.200   1.00 0.00 ? 291 ASN A HD22 2 
ATOM   1713 N N    . SER A 1 21 ? 2.104   2.870   3.870   1.00 0.00 ? 292 SER A N    2 
ATOM   1714 C CA   . SER A 1 21 ? 2.426   1.929   4.936   1.00 0.00 ? 292 SER A CA   2 
ATOM   1715 C C    . SER A 1 21 ? 1.335   0.858   5.024   1.00 0.00 ? 292 SER A C    2 
ATOM   1716 O O    . SER A 1 21 ? 1.564   -0.240  5.488   1.00 0.00 ? 292 SER A O    2 
ATOM   1717 C CB   . SER A 1 21 ? 2.513   2.676   6.267   1.00 0.00 ? 292 SER A CB   2 
ATOM   1718 O OG   . SER A 1 21 ? 3.860   2.671   6.722   1.00 0.00 ? 292 SER A OG   2 
ATOM   1719 H H    . SER A 1 21 ? 1.961   3.817   4.080   1.00 0.00 ? 292 SER A H    2 
ATOM   1720 H HA   . SER A 1 21 ? 3.374   1.458   4.728   1.00 0.00 ? 292 SER A HA   2 
ATOM   1721 H HB2  . SER A 1 21 ? 2.189   3.694   6.131   1.00 0.00 ? 292 SER A HB2  2 
ATOM   1722 H HB3  . SER A 1 21 ? 1.874   2.191   6.993   1.00 0.00 ? 292 SER A HB3  2 
ATOM   1723 H HG   . SER A 1 21 ? 4.431   2.562   5.959   1.00 0.00 ? 292 SER A HG   2 
ATOM   1724 N N    . GLU A 1 22 ? 0.147   1.171   4.583   1.00 0.00 ? 293 GLU A N    2 
ATOM   1725 C CA   . GLU A 1 22 ? -0.934  0.195   4.643   1.00 0.00 ? 293 GLU A CA   2 
ATOM   1726 C C    . GLU A 1 22 ? -0.674  -0.923  3.631   1.00 0.00 ? 293 GLU A C    2 
ATOM   1727 O O    . GLU A 1 22 ? -0.278  -2.016  3.985   1.00 0.00 ? 293 GLU A O    2 
ATOM   1728 C CB   . GLU A 1 22 ? -2.262  0.881   4.311   1.00 0.00 ? 293 GLU A CB   2 
ATOM   1729 C CG   . GLU A 1 22 ? -2.903  1.402   5.597   1.00 0.00 ? 293 GLU A CG   2 
ATOM   1730 C CD   . GLU A 1 22 ? -4.039  2.366   5.246   1.00 0.00 ? 293 GLU A CD   2 
ATOM   1731 O OE1  . GLU A 1 22 ? -4.774  2.072   4.318   1.00 0.00 ? 293 GLU A OE1  2 
ATOM   1732 O OE2  . GLU A 1 22 ? -4.153  3.382   5.911   1.00 0.00 ? 293 GLU A OE2  2 
ATOM   1733 H H    . GLU A 1 22 ? -0.020  2.064   4.214   1.00 0.00 ? 293 GLU A H    2 
ATOM   1734 H HA   . GLU A 1 22 ? -0.988  -0.225  5.636   1.00 0.00 ? 293 GLU A HA   2 
ATOM   1735 H HB2  . GLU A 1 22 ? -2.080  1.706   3.638   1.00 0.00 ? 293 GLU A HB2  2 
ATOM   1736 H HB3  . GLU A 1 22 ? -2.927  0.172   3.841   1.00 0.00 ? 293 GLU A HB3  2 
ATOM   1737 H HG2  . GLU A 1 22 ? -3.298  0.571   6.164   1.00 0.00 ? 293 GLU A HG2  2 
ATOM   1738 H HG3  . GLU A 1 22 ? -2.162  1.922   6.186   1.00 0.00 ? 293 GLU A HG3  2 
ATOM   1739 N N    . LEU A 1 23 ? -0.897  -0.659  2.372   1.00 0.00 ? 294 LEU A N    2 
ATOM   1740 C CA   . LEU A 1 23 ? -0.673  -1.681  1.357   1.00 0.00 ? 294 LEU A CA   2 
ATOM   1741 C C    . LEU A 1 23 ? 0.729   -2.273  1.519   1.00 0.00 ? 294 LEU A C    2 
ATOM   1742 O O    . LEU A 1 23 ? 0.914   -3.473  1.493   1.00 0.00 ? 294 LEU A O    2 
ATOM   1743 C CB   . LEU A 1 23 ? -0.810  -1.057  -0.032  1.00 0.00 ? 294 LEU A CB   2 
ATOM   1744 C CG   . LEU A 1 23 ? -2.292  -0.904  -0.377  1.00 0.00 ? 294 LEU A CG   2 
ATOM   1745 C CD1  . LEU A 1 23 ? -2.541  0.486   -0.964  1.00 0.00 ? 294 LEU A CD1  2 
ATOM   1746 C CD2  . LEU A 1 23 ? -2.687  -1.967  -1.405  1.00 0.00 ? 294 LEU A CD2  2 
ATOM   1747 H H    . LEU A 1 23 ? -1.219  0.229   2.110   1.00 0.00 ? 294 LEU A H    2 
ATOM   1748 H HA   . LEU A 1 23 ? -1.407  -2.465  1.470   1.00 0.00 ? 294 LEU A HA   2 
ATOM   1749 H HB2  . LEU A 1 23 ? -0.335  -0.087  -0.039  1.00 0.00 ? 294 LEU A HB2  2 
ATOM   1750 H HB3  . LEU A 1 23 ? -0.336  -1.694  -0.762  1.00 0.00 ? 294 LEU A HB3  2 
ATOM   1751 H HG   . LEU A 1 23 ? -2.885  -1.027  0.518   1.00 0.00 ? 294 LEU A HG   2 
ATOM   1752 H HD11 . LEU A 1 23 ? -1.873  0.650   -1.796  1.00 0.00 ? 294 LEU A HD11 2 
ATOM   1753 H HD12 . LEU A 1 23 ? -3.564  0.557   -1.303  1.00 0.00 ? 294 LEU A HD12 2 
ATOM   1754 H HD13 . LEU A 1 23 ? -2.361  1.233   -0.205  1.00 0.00 ? 294 LEU A HD13 2 
ATOM   1755 H HD21 . LEU A 1 23 ? -1.806  -2.305  -1.930  1.00 0.00 ? 294 LEU A HD21 2 
ATOM   1756 H HD22 . LEU A 1 23 ? -3.146  -2.804  -0.897  1.00 0.00 ? 294 LEU A HD22 2 
ATOM   1757 H HD23 . LEU A 1 23 ? -3.387  -1.545  -2.110  1.00 0.00 ? 294 LEU A HD23 2 
ATOM   1758 N N    . ALA A 1 24 ? 1.721   -1.441  1.682   1.00 0.00 ? 295 ALA A N    2 
ATOM   1759 C CA   . ALA A 1 24 ? 3.080   -1.948  1.838   1.00 0.00 ? 295 ALA A CA   2 
ATOM   1760 C C    . ALA A 1 24 ? 3.092   -3.075  2.873   1.00 0.00 ? 295 ALA A C    2 
ATOM   1761 O O    . ALA A 1 24 ? 3.477   -4.191  2.585   1.00 0.00 ? 295 ALA A O    2 
ATOM   1762 C CB   . ALA A 1 24 ? 3.998   -0.816  2.306   1.00 0.00 ? 295 ALA A CB   2 
ATOM   1763 H H    . ALA A 1 24 ? 1.553   -0.475  1.698   1.00 0.00 ? 295 ALA A H    2 
ATOM   1764 H HA   . ALA A 1 24 ? 3.434   -2.326  0.891   1.00 0.00 ? 295 ALA A HA   2 
ATOM   1765 H HB1  . ALA A 1 24 ? 3.981   -0.016  1.581   1.00 0.00 ? 295 ALA A HB1  2 
ATOM   1766 H HB2  . ALA A 1 24 ? 3.655   -0.445  3.260   1.00 0.00 ? 295 ALA A HB2  2 
ATOM   1767 H HB3  . ALA A 1 24 ? 5.006   -1.189  2.406   1.00 0.00 ? 295 ALA A HB3  2 
ATOM   1768 N N    . SER A 1 25 ? 2.675   -2.792  4.077   1.00 0.00 ? 296 SER A N    2 
ATOM   1769 C CA   . SER A 1 25 ? 2.666   -3.822  5.109   1.00 0.00 ? 296 SER A CA   2 
ATOM   1770 C C    . SER A 1 25 ? 2.004   -5.091  4.565   1.00 0.00 ? 296 SER A C    2 
ATOM   1771 O O    . SER A 1 25 ? 2.527   -6.179  4.695   1.00 0.00 ? 296 SER A O    2 
ATOM   1772 C CB   . SER A 1 25 ? 1.886   -3.321  6.324   1.00 0.00 ? 296 SER A CB   2 
ATOM   1773 O OG   . SER A 1 25 ? 2.446   -3.879  7.505   1.00 0.00 ? 296 SER A OG   2 
ATOM   1774 H H    . SER A 1 25 ? 2.371   -1.885  4.288   1.00 0.00 ? 296 SER A H    2 
ATOM   1775 H HA   . SER A 1 25 ? 3.680   -4.046  5.404   1.00 0.00 ? 296 SER A HA   2 
ATOM   1776 H HB2  . SER A 1 25 ? 1.948   -2.247  6.376   1.00 0.00 ? 296 SER A HB2  2 
ATOM   1777 H HB3  . SER A 1 25 ? 0.849   -3.615  6.230   1.00 0.00 ? 296 SER A HB3  2 
ATOM   1778 H HG   . SER A 1 25 ? 3.088   -3.256  7.853   1.00 0.00 ? 296 SER A HG   2 
ATOM   1779 N N    . THR A 1 26 ? 0.856   -4.961  3.958   1.00 0.00 ? 297 THR A N    2 
ATOM   1780 C CA   . THR A 1 26 ? 0.179   -6.138  3.422   1.00 0.00 ? 297 THR A CA   2 
ATOM   1781 C C    . THR A 1 26 ? 1.111   -6.866  2.452   1.00 0.00 ? 297 THR A C    2 
ATOM   1782 O O    . THR A 1 26 ? 1.359   -8.049  2.583   1.00 0.00 ? 297 THR A O    2 
ATOM   1783 C CB   . THR A 1 26 ? -1.091  -5.708  2.686   1.00 0.00 ? 297 THR A CB   2 
ATOM   1784 O OG1  . THR A 1 26 ? -1.786  -4.747  3.468   1.00 0.00 ? 297 THR A OG1  2 
ATOM   1785 C CG2  . THR A 1 26 ? -1.986  -6.927  2.454   1.00 0.00 ? 297 THR A CG2  2 
ATOM   1786 H H    . THR A 1 26 ? 0.448   -4.076  3.864   1.00 0.00 ? 297 THR A H    2 
ATOM   1787 H HA   . THR A 1 26 ? -0.084  -6.800  4.232   1.00 0.00 ? 297 THR A HA   2 
ATOM   1788 H HB   . THR A 1 26 ? -0.827  -5.274  1.733   1.00 0.00 ? 297 THR A HB   2 
ATOM   1789 H HG1  . THR A 1 26 ? -1.591  -3.877  3.112   1.00 0.00 ? 297 THR A HG1  2 
ATOM   1790 H HG21 . THR A 1 26 ? -2.249  -7.367  3.404   1.00 0.00 ? 297 THR A HG21 2 
ATOM   1791 H HG22 . THR A 1 26 ? -2.886  -6.621  1.940   1.00 0.00 ? 297 THR A HG22 2 
ATOM   1792 H HG23 . THR A 1 26 ? -1.458  -7.653  1.853   1.00 0.00 ? 297 THR A HG23 2 
ATOM   1793 N N    . ALA A 1 27 ? 1.631   -6.170  1.480   1.00 0.00 ? 298 ALA A N    2 
ATOM   1794 C CA   . ALA A 1 27 ? 2.527   -6.809  0.524   1.00 0.00 ? 298 ALA A CA   2 
ATOM   1795 C C    . ALA A 1 27 ? 3.713   -7.423  1.269   1.00 0.00 ? 298 ALA A C    2 
ATOM   1796 O O    . ALA A 1 27 ? 4.325   -8.368  0.812   1.00 0.00 ? 298 ALA A O    2 
ATOM   1797 C CB   . ALA A 1 27 ? 3.035   -5.765  -0.470  1.00 0.00 ? 298 ALA A CB   2 
ATOM   1798 H H    . ALA A 1 27 ? 1.418   -5.218  1.392   1.00 0.00 ? 298 ALA A H    2 
ATOM   1799 H HA   . ALA A 1 27 ? 1.996   -7.582  -0.009  1.00 0.00 ? 298 ALA A HA   2 
ATOM   1800 H HB1  . ALA A 1 27 ? 2.654   -4.793  -0.195  1.00 0.00 ? 298 ALA A HB1  2 
ATOM   1801 H HB2  . ALA A 1 27 ? 4.114   -5.748  -0.453  1.00 0.00 ? 298 ALA A HB2  2 
ATOM   1802 H HB3  . ALA A 1 27 ? 2.695   -6.017  -1.464  1.00 0.00 ? 298 ALA A HB3  2 
ATOM   1803 N N    . ASN A 1 28 ? 4.044   -6.892  2.414   1.00 0.00 ? 299 ASN A N    2 
ATOM   1804 C CA   . ASN A 1 28 ? 5.169   -7.431  3.172   1.00 0.00 ? 299 ASN A CA   2 
ATOM   1805 C C    . ASN A 1 28 ? 4.795   -8.803  3.742   1.00 0.00 ? 299 ASN A C    2 
ATOM   1806 O O    . ASN A 1 28 ? 5.523   -9.764  3.595   1.00 0.00 ? 299 ASN A O    2 
ATOM   1807 C CB   . ASN A 1 28 ? 5.511   -6.479  4.320   1.00 0.00 ? 299 ASN A CB   2 
ATOM   1808 C CG   . ASN A 1 28 ? 6.802   -6.939  4.998   1.00 0.00 ? 299 ASN A CG   2 
ATOM   1809 O OD1  . ASN A 1 28 ? 6.837   -7.981  5.622   1.00 0.00 ? 299 ASN A OD1  2 
ATOM   1810 N ND2  . ASN A 1 28 ? 7.873   -6.200  4.903   1.00 0.00 ? 299 ASN A ND2  2 
ATOM   1811 H H    . ASN A 1 28 ? 3.539   -6.129  2.764   1.00 0.00 ? 299 ASN A H    2 
ATOM   1812 H HA   . ASN A 1 28 ? 6.026   -7.532  2.523   1.00 0.00 ? 299 ASN A HA   2 
ATOM   1813 H HB2  . ASN A 1 28 ? 5.644   -5.480  3.930   1.00 0.00 ? 299 ASN A HB2  2 
ATOM   1814 H HB3  . ASN A 1 28 ? 4.708   -6.480  5.041   1.00 0.00 ? 299 ASN A HB3  2 
ATOM   1815 H HD21 . ASN A 1 28 ? 7.845   -5.360  4.400   1.00 0.00 ? 299 ASN A HD21 2 
ATOM   1816 H HD22 . ASN A 1 28 ? 8.706   -6.486  5.334   1.00 0.00 ? 299 ASN A HD22 2 
ATOM   1817 N N    . MET A 1 29 ? 3.667   -8.901  4.392   1.00 0.00 ? 300 MET A N    2 
ATOM   1818 C CA   . MET A 1 29 ? 3.261   -10.182 4.958   1.00 0.00 ? 300 MET A CA   2 
ATOM   1819 C C    . MET A 1 29 ? 3.018   -11.189 3.832   1.00 0.00 ? 300 MET A C    2 
ATOM   1820 O O    . MET A 1 29 ? 3.558   -12.278 3.831   1.00 0.00 ? 300 MET A O    2 
ATOM   1821 C CB   . MET A 1 29 ? 1.974   -10.000 5.765   1.00 0.00 ? 300 MET A CB   2 
ATOM   1822 C CG   . MET A 1 29 ? 1.425   -11.370 6.165   1.00 0.00 ? 300 MET A CG   2 
ATOM   1823 S SD   . MET A 1 29 ? -0.214  -11.168 6.907   1.00 0.00 ? 300 MET A SD   2 
ATOM   1824 C CE   . MET A 1 29 ? 0.341   -10.665 8.553   1.00 0.00 ? 300 MET A CE   2 
ATOM   1825 H H    . MET A 1 29 ? 3.095   -8.113  4.501   1.00 0.00 ? 300 MET A H    2 
ATOM   1826 H HA   . MET A 1 29 ? 4.040   -10.551 5.609   1.00 0.00 ? 300 MET A HA   2 
ATOM   1827 H HB2  . MET A 1 29 ? 2.183   -9.421  6.653   1.00 0.00 ? 300 MET A HB2  2 
ATOM   1828 H HB3  . MET A 1 29 ? 1.242   -9.483  5.161   1.00 0.00 ? 300 MET A HB3  2 
ATOM   1829 H HG2  . MET A 1 29 ? 1.349   -11.997 5.289   1.00 0.00 ? 300 MET A HG2  2 
ATOM   1830 H HG3  . MET A 1 29 ? 2.090   -11.829 6.881   1.00 0.00 ? 300 MET A HG3  2 
ATOM   1831 H HE1  . MET A 1 29 ? 1.118   -11.337 8.891   1.00 0.00 ? 300 MET A HE1  2 
ATOM   1832 H HE2  . MET A 1 29 ? 0.726   -9.655  8.509   1.00 0.00 ? 300 MET A HE2  2 
ATOM   1833 H HE3  . MET A 1 29 ? -0.488  -10.702 9.241   1.00 0.00 ? 300 MET A HE3  2 
ATOM   1834 N N    . LEU A 1 30 ? 2.207   -10.835 2.873   1.00 0.00 ? 301 LEU A N    2 
ATOM   1835 C CA   . LEU A 1 30 ? 1.931   -11.751 1.773   1.00 0.00 ? 301 LEU A CA   2 
ATOM   1836 C C    . LEU A 1 30 ? 3.244   -12.342 1.252   1.00 0.00 ? 301 LEU A C    2 
ATOM   1837 O O    . LEU A 1 30 ? 3.423   -13.543 1.213   1.00 0.00 ? 301 LEU A O    2 
ATOM   1838 C CB   . LEU A 1 30 ? 1.228   -10.995 0.644   1.00 0.00 ? 301 LEU A CB   2 
ATOM   1839 C CG   . LEU A 1 30 ? -0.089  -10.414 1.164   1.00 0.00 ? 301 LEU A CG   2 
ATOM   1840 C CD1  . LEU A 1 30 ? -0.684  -9.475  0.114   1.00 0.00 ? 301 LEU A CD1  2 
ATOM   1841 C CD2  . LEU A 1 30 ? -1.071  -11.554 1.444   1.00 0.00 ? 301 LEU A CD2  2 
ATOM   1842 H H    . LEU A 1 30 ? 1.780   -9.953  2.895   1.00 0.00 ? 301 LEU A H    2 
ATOM   1843 H HA   . LEU A 1 30 ? 1.291   -12.549 2.121   1.00 0.00 ? 301 LEU A HA   2 
ATOM   1844 H HB2  . LEU A 1 30 ? 1.865   -10.193 0.298   1.00 0.00 ? 301 LEU A HB2  2 
ATOM   1845 H HB3  . LEU A 1 30 ? 1.023   -11.671 -0.170  1.00 0.00 ? 301 LEU A HB3  2 
ATOM   1846 H HG   . LEU A 1 30 ? 0.096   -9.864  2.076   1.00 0.00 ? 301 LEU A HG   2 
ATOM   1847 H HD11 . LEU A 1 30 ? 0.021   -8.687  -0.106  1.00 0.00 ? 301 LEU A HD11 2 
ATOM   1848 H HD12 . LEU A 1 30 ? -0.894  -10.030 -0.788  1.00 0.00 ? 301 LEU A HD12 2 
ATOM   1849 H HD13 . LEU A 1 30 ? -1.599  -9.045  0.493   1.00 0.00 ? 301 LEU A HD13 2 
ATOM   1850 H HD21 . LEU A 1 30 ? -0.734  -12.450 0.943   1.00 0.00 ? 301 LEU A HD21 2 
ATOM   1851 H HD22 . LEU A 1 30 ? -1.121  -11.733 2.508   1.00 0.00 ? 301 LEU A HD22 2 
ATOM   1852 H HD23 . LEU A 1 30 ? -2.050  -11.282 1.078   1.00 0.00 ? 301 LEU A HD23 2 
ATOM   1853 N N    . ARG A 1 31 ? 4.163   -11.507 0.848   1.00 0.00 ? 302 ARG A N    2 
ATOM   1854 C CA   . ARG A 1 31 ? 5.433   -12.010 0.338   1.00 0.00 ? 302 ARG A CA   2 
ATOM   1855 C C    . ARG A 1 31 ? 6.068   -12.949 1.367   1.00 0.00 ? 302 ARG A C    2 
ATOM   1856 O O    . ARG A 1 31 ? 6.667   -13.949 1.024   1.00 0.00 ? 302 ARG A O    2 
ATOM   1857 C CB   . ARG A 1 31 ? 6.375   -10.836 0.072   1.00 0.00 ? 302 ARG A CB   2 
ATOM   1858 C CG   . ARG A 1 31 ? 7.320   -11.188 -1.079  1.00 0.00 ? 302 ARG A CG   2 
ATOM   1859 C CD   . ARG A 1 31 ? 7.330   -10.047 -2.097  1.00 0.00 ? 302 ARG A CD   2 
ATOM   1860 N NE   . ARG A 1 31 ? 8.558   -9.275  -1.949  1.00 0.00 ? 302 ARG A NE   2 
ATOM   1861 C CZ   . ARG A 1 31 ? 8.924   -8.442  -2.885  1.00 0.00 ? 302 ARG A CZ   2 
ATOM   1862 N NH1  . ARG A 1 31 ? 9.019   -8.849  -4.121  1.00 0.00 ? 302 ARG A NH1  2 
ATOM   1863 N NH2  . ARG A 1 31 ? 9.192   -7.201  -2.584  1.00 0.00 ? 302 ARG A NH2  2 
ATOM   1864 H H    . ARG A 1 31 ? 3.997   -10.542 0.885   1.00 0.00 ? 302 ARG A H    2 
ATOM   1865 H HA   . ARG A 1 31 ? 5.263   -12.549 -0.583  1.00 0.00 ? 302 ARG A HA   2 
ATOM   1866 H HB2  . ARG A 1 31 ? 5.796   -9.963  -0.192  1.00 0.00 ? 302 ARG A HB2  2 
ATOM   1867 H HB3  . ARG A 1 31 ? 6.955   -10.630 0.960   1.00 0.00 ? 302 ARG A HB3  2 
ATOM   1868 H HG2  . ARG A 1 31 ? 8.319   -11.335 -0.693  1.00 0.00 ? 302 ARG A HG2  2 
ATOM   1869 H HG3  . ARG A 1 31 ? 6.982   -12.093 -1.560  1.00 0.00 ? 302 ARG A HG3  2 
ATOM   1870 H HD2  . ARG A 1 31 ? 7.280   -10.453 -3.096  1.00 0.00 ? 302 ARG A HD2  2 
ATOM   1871 H HD3  . ARG A 1 31 ? 6.478   -9.405  -1.928  1.00 0.00 ? 302 ARG A HD3  2 
ATOM   1872 H HE   . ARG A 1 31 ? 9.112   -9.383  -1.148  1.00 0.00 ? 302 ARG A HE   2 
ATOM   1873 H HH11 . ARG A 1 31 ? 8.814   -9.800  -4.351  1.00 0.00 ? 302 ARG A HH11 2 
ATOM   1874 H HH12 . ARG A 1 31 ? 9.300   -8.210  -4.837  1.00 0.00 ? 302 ARG A HH12 2 
ATOM   1875 H HH21 . ARG A 1 31 ? 9.119   -6.889  -1.637  1.00 0.00 ? 302 ARG A HH21 2 
ATOM   1876 H HH22 . ARG A 1 31 ? 9.472   -6.562  -3.301  1.00 0.00 ? 302 ARG A HH22 2 
ATOM   1877 N N    . GLU A 1 32 ? 5.948   -12.633 2.628   1.00 0.00 ? 303 GLU A N    2 
ATOM   1878 C CA   . GLU A 1 32 ? 6.538   -13.486 3.653   1.00 0.00 ? 303 GLU A CA   2 
ATOM   1879 C C    . GLU A 1 32 ? 5.902   -14.878 3.595   1.00 0.00 ? 303 GLU A C    2 
ATOM   1880 O O    . GLU A 1 32 ? 6.578   -15.883 3.696   1.00 0.00 ? 303 GLU A O    2 
ATOM   1881 C CB   . GLU A 1 32 ? 6.296   -12.870 5.032   1.00 0.00 ? 303 GLU A CB   2 
ATOM   1882 C CG   . GLU A 1 32 ? 7.139   -11.601 5.176   1.00 0.00 ? 303 GLU A CG   2 
ATOM   1883 C CD   . GLU A 1 32 ? 8.153   -11.787 6.307   1.00 0.00 ? 303 GLU A CD   2 
ATOM   1884 O OE1  . GLU A 1 32 ? 7.762   -12.280 7.352   1.00 0.00 ? 303 GLU A OE1  2 
ATOM   1885 O OE2  . GLU A 1 32 ? 9.304   -11.434 6.108   1.00 0.00 ? 303 GLU A OE2  2 
ATOM   1886 H H    . GLU A 1 32 ? 5.465   -11.820 2.885   1.00 0.00 ? 303 GLU A H    2 
ATOM   1887 H HA   . GLU A 1 32 ? 7.601   -13.571 3.482   1.00 0.00 ? 303 GLU A HA   2 
ATOM   1888 H HB2  . GLU A 1 32 ? 5.249   -12.623 5.136   1.00 0.00 ? 303 GLU A HB2  2 
ATOM   1889 H HB3  . GLU A 1 32 ? 6.580   -13.576 5.796   1.00 0.00 ? 303 GLU A HB3  2 
ATOM   1890 H HG2  . GLU A 1 32 ? 7.662   -11.408 4.251   1.00 0.00 ? 303 GLU A HG2  2 
ATOM   1891 H HG3  . GLU A 1 32 ? 6.495   -10.765 5.408   1.00 0.00 ? 303 GLU A HG3  2 
ATOM   1892 N N    . GLN A 1 33 ? 4.610   -14.948 3.433   1.00 0.00 ? 304 GLN A N    2 
ATOM   1893 C CA   . GLN A 1 33 ? 3.956   -16.251 3.371   1.00 0.00 ? 304 GLN A CA   2 
ATOM   1894 C C    . GLN A 1 33 ? 4.432   -16.992 2.121   1.00 0.00 ? 304 GLN A C    2 
ATOM   1895 O O    . GLN A 1 33 ? 5.013   -18.056 2.199   1.00 0.00 ? 304 GLN A O    2 
ATOM   1896 C CB   . GLN A 1 33 ? 2.437   -16.072 3.307   1.00 0.00 ? 304 GLN A CB   2 
ATOM   1897 C CG   . GLN A 1 33 ? 2.010   -14.891 4.181   1.00 0.00 ? 304 GLN A CG   2 
ATOM   1898 C CD   . GLN A 1 33 ? 2.714   -14.974 5.538   1.00 0.00 ? 304 GLN A CD   2 
ATOM   1899 O OE1  . GLN A 1 33 ? 2.683   -15.998 6.190   1.00 0.00 ? 304 GLN A OE1  2 
ATOM   1900 N NE2  . GLN A 1 33 ? 3.352   -13.931 5.993   1.00 0.00 ? 304 GLN A NE2  2 
ATOM   1901 H H    . GLN A 1 33 ? 4.081   -14.128 3.352   1.00 0.00 ? 304 GLN A H    2 
ATOM   1902 H HA   . GLN A 1 33 ? 4.214   -16.825 4.248   1.00 0.00 ? 304 GLN A HA   2 
ATOM   1903 H HB2  . GLN A 1 33 ? 2.141   -15.888 2.284   1.00 0.00 ? 304 GLN A HB2  2 
ATOM   1904 H HB3  . GLN A 1 33 ? 1.956   -16.972 3.663   1.00 0.00 ? 304 GLN A HB3  2 
ATOM   1905 H HG2  . GLN A 1 33 ? 2.277   -13.967 3.691   1.00 0.00 ? 304 GLN A HG2  2 
ATOM   1906 H HG3  . GLN A 1 33 ? 0.942   -14.923 4.331   1.00 0.00 ? 304 GLN A HG3  2 
ATOM   1907 H HE21 . GLN A 1 33 ? 3.378   -13.103 5.468   1.00 0.00 ? 304 GLN A HE21 2 
ATOM   1908 H HE22 . GLN A 1 33 ? 3.806   -13.974 6.861   1.00 0.00 ? 304 GLN A HE22 2 
ATOM   1909 N N    . VAL A 1 34 ? 4.191   -16.435 0.966   1.00 0.00 ? 305 VAL A N    2 
ATOM   1910 C CA   . VAL A 1 34 ? 4.619   -17.090 -0.264  1.00 0.00 ? 305 VAL A CA   2 
ATOM   1911 C C    . VAL A 1 34 ? 6.114   -17.407 -0.175  1.00 0.00 ? 305 VAL A C    2 
ATOM   1912 O O    . VAL A 1 34 ? 6.608   -18.304 -0.828  1.00 0.00 ? 305 VAL A O    2 
ATOM   1913 C CB   . VAL A 1 34 ? 4.363   -16.163 -1.452  1.00 0.00 ? 305 VAL A CB   2 
ATOM   1914 C CG1  . VAL A 1 34 ? 4.447   -16.964 -2.753  1.00 0.00 ? 305 VAL A CG1  2 
ATOM   1915 C CG2  . VAL A 1 34 ? 2.969   -15.545 -1.324  1.00 0.00 ? 305 VAL A CG2  2 
ATOM   1916 H H    . VAL A 1 34 ? 3.720   -15.576 0.926   1.00 0.00 ? 305 VAL A H    2 
ATOM   1917 H HA   . VAL A 1 34 ? 4.063   -18.006 -0.398  1.00 0.00 ? 305 VAL A HA   2 
ATOM   1918 H HB   . VAL A 1 34 ? 5.107   -15.379 -1.464  1.00 0.00 ? 305 VAL A HB   2 
ATOM   1919 H HG11 . VAL A 1 34 ? 4.934   -17.909 -2.564  1.00 0.00 ? 305 VAL A HG11 2 
ATOM   1920 H HG12 . VAL A 1 34 ? 3.450   -17.142 -3.131  1.00 0.00 ? 305 VAL A HG12 2 
ATOM   1921 H HG13 . VAL A 1 34 ? 5.013   -16.406 -3.484  1.00 0.00 ? 305 VAL A HG13 2 
ATOM   1922 H HG21 . VAL A 1 34 ? 2.419   -16.054 -0.547  1.00 0.00 ? 305 VAL A HG21 2 
ATOM   1923 H HG22 . VAL A 1 34 ? 3.061   -14.498 -1.073  1.00 0.00 ? 305 VAL A HG22 2 
ATOM   1924 H HG23 . VAL A 1 34 ? 2.443   -15.644 -2.262  1.00 0.00 ? 305 VAL A HG23 2 
ATOM   1925 N N    . ALA A 1 35 ? 6.837   -16.674 0.626   1.00 0.00 ? 306 ALA A N    2 
ATOM   1926 C CA   . ALA A 1 35 ? 8.268   -16.925 0.754   1.00 0.00 ? 306 ALA A CA   2 
ATOM   1927 C C    . ALA A 1 35 ? 8.493   -18.186 1.593   1.00 0.00 ? 306 ALA A C    2 
ATOM   1928 O O    . ALA A 1 35 ? 9.287   -19.038 1.249   1.00 0.00 ? 306 ALA A O    2 
ATOM   1929 C CB   . ALA A 1 35 ? 8.937   -15.731 1.439   1.00 0.00 ? 306 ALA A CB   2 
ATOM   1930 H H    . ALA A 1 35 ? 6.418   -15.954 1.143   1.00 0.00 ? 306 ALA A H    2 
ATOM   1931 H HA   . ALA A 1 35 ? 8.699   -17.062 -0.227  1.00 0.00 ? 306 ALA A HA   2 
ATOM   1932 H HB1  . ALA A 1 35 ? 8.333   -15.411 2.275   1.00 0.00 ? 306 ALA A HB1  2 
ATOM   1933 H HB2  . ALA A 1 35 ? 9.916   -16.020 1.790   1.00 0.00 ? 306 ALA A HB2  2 
ATOM   1934 H HB3  . ALA A 1 35 ? 9.033   -14.919 0.733   1.00 0.00 ? 306 ALA A HB3  2 
ATOM   1935 N N    . GLN A 1 36 ? 7.799   -18.309 2.691   1.00 0.00 ? 307 GLN A N    2 
ATOM   1936 C CA   . GLN A 1 36 ? 7.970   -19.488 3.532   1.00 0.00 ? 307 GLN A CA   2 
ATOM   1937 C C    . GLN A 1 36 ? 7.238   -20.673 2.900   1.00 0.00 ? 307 GLN A C    2 
ATOM   1938 O O    . GLN A 1 36 ? 7.492   -21.816 3.223   1.00 0.00 ? 307 GLN A O    2 
ATOM   1939 C CB   . GLN A 1 36 ? 7.394   -19.212 4.921   1.00 0.00 ? 307 GLN A CB   2 
ATOM   1940 C CG   . GLN A 1 36 ? 5.927   -18.795 4.792   1.00 0.00 ? 307 GLN A CG   2 
ATOM   1941 C CD   . GLN A 1 36 ? 5.255   -18.856 6.165   1.00 0.00 ? 307 GLN A CD   2 
ATOM   1942 O OE1  . GLN A 1 36 ? 4.231   -19.491 6.325   1.00 0.00 ? 307 GLN A OE1  2 
ATOM   1943 N NE2  . GLN A 1 36 ? 5.793   -18.220 7.170   1.00 0.00 ? 307 GLN A NE2  2 
ATOM   1944 H H    . GLN A 1 36 ? 7.164   -17.610 2.950   1.00 0.00 ? 307 GLN A H    2 
ATOM   1945 H HA   . GLN A 1 36 ? 9.021   -19.721 3.620   1.00 0.00 ? 307 GLN A HA   2 
ATOM   1946 H HB2  . GLN A 1 36 ? 7.463   -20.107 5.524   1.00 0.00 ? 307 GLN A HB2  2 
ATOM   1947 H HB3  . GLN A 1 36 ? 7.951   -18.417 5.391   1.00 0.00 ? 307 GLN A HB3  2 
ATOM   1948 H HG2  . GLN A 1 36 ? 5.872   -17.786 4.408   1.00 0.00 ? 307 GLN A HG2  2 
ATOM   1949 H HG3  . GLN A 1 36 ? 5.419   -19.465 4.115   1.00 0.00 ? 307 GLN A HG3  2 
ATOM   1950 H HE21 . GLN A 1 36 ? 6.619   -17.709 7.041   1.00 0.00 ? 307 GLN A HE21 2 
ATOM   1951 H HE22 . GLN A 1 36 ? 5.370   -18.253 8.054   1.00 0.00 ? 307 GLN A HE22 2 
ATOM   1952 N N    . LEU A 1 37 ? 6.333   -20.408 2.000   1.00 0.00 ? 308 LEU A N    2 
ATOM   1953 C CA   . LEU A 1 37 ? 5.602   -21.494 1.359   1.00 0.00 ? 308 LEU A CA   2 
ATOM   1954 C C    . LEU A 1 37 ? 6.419   -22.028 0.182   1.00 0.00 ? 308 LEU A C    2 
ATOM   1955 O O    . LEU A 1 37 ? 6.625   -23.218 0.045   1.00 0.00 ? 308 LEU A O    2 
ATOM   1956 C CB   . LEU A 1 37 ? 4.256   -20.974 0.855   1.00 0.00 ? 308 LEU A CB   2 
ATOM   1957 C CG   . LEU A 1 37 ? 3.181   -21.229 1.912   1.00 0.00 ? 308 LEU A CG   2 
ATOM   1958 C CD1  . LEU A 1 37 ? 2.415   -19.934 2.184   1.00 0.00 ? 308 LEU A CD1  2 
ATOM   1959 C CD2  . LEU A 1 37 ? 2.209   -22.297 1.404   1.00 0.00 ? 308 LEU A CD2  2 
ATOM   1960 H H    . LEU A 1 37 ? 6.145   -19.478 1.752   1.00 0.00 ? 308 LEU A H    2 
ATOM   1961 H HA   . LEU A 1 37 ? 5.438   -22.287 2.072   1.00 0.00 ? 308 LEU A HA   2 
ATOM   1962 H HB2  . LEU A 1 37 ? 4.329   -19.914 0.663   1.00 0.00 ? 308 LEU A HB2  2 
ATOM   1963 H HB3  . LEU A 1 37 ? 3.990   -21.488 -0.057  1.00 0.00 ? 308 LEU A HB3  2 
ATOM   1964 H HG   . LEU A 1 37 ? 3.647   -21.570 2.825   1.00 0.00 ? 308 LEU A HG   2 
ATOM   1965 H HD11 . LEU A 1 37 ? 3.000   -19.091 1.846   1.00 0.00 ? 308 LEU A HD11 2 
ATOM   1966 H HD12 . LEU A 1 37 ? 1.473   -19.954 1.654   1.00 0.00 ? 308 LEU A HD12 2 
ATOM   1967 H HD13 . LEU A 1 37 ? 2.228   -19.840 3.244   1.00 0.00 ? 308 LEU A HD13 2 
ATOM   1968 H HD21 . LEU A 1 37 ? 2.057   -22.168 0.342   1.00 0.00 ? 308 LEU A HD21 2 
ATOM   1969 H HD22 . LEU A 1 37 ? 2.620   -23.278 1.592   1.00 0.00 ? 308 LEU A HD22 2 
ATOM   1970 H HD23 . LEU A 1 37 ? 1.264   -22.198 1.917   1.00 0.00 ? 308 LEU A HD23 2 
ATOM   1971 N N    . LYS A 1 38 ? 6.888   -21.157 -0.670  1.00 0.00 ? 309 LYS A N    2 
ATOM   1972 C CA   . LYS A 1 38 ? 7.676   -21.604 -1.811  1.00 0.00 ? 309 LYS A CA   2 
ATOM   1973 C C    . LYS A 1 38 ? 9.037   -22.102 -1.322  1.00 0.00 ? 309 LYS A C    2 
ATOM   1974 O O    . LYS A 1 38 ? 9.514   -23.139 -1.736  1.00 0.00 ? 309 LYS A O    2 
ATOM   1975 C CB   . LYS A 1 38 ? 7.873   -20.441 -2.784  1.00 0.00 ? 309 LYS A CB   2 
ATOM   1976 C CG   . LYS A 1 38 ? 6.796   -20.493 -3.867  1.00 0.00 ? 309 LYS A CG   2 
ATOM   1977 C CD   . LYS A 1 38 ? 5.421   -20.653 -3.216  1.00 0.00 ? 309 LYS A CD   2 
ATOM   1978 C CE   . LYS A 1 38 ? 4.333   -20.248 -4.210  1.00 0.00 ? 309 LYS A CE   2 
ATOM   1979 N NZ   . LYS A 1 38 ? 4.516   -21.003 -5.482  1.00 0.00 ? 309 LYS A NZ   2 
ATOM   1980 H H    . LYS A 1 38 ? 6.711   -20.202 -0.540  1.00 0.00 ? 309 LYS A H    2 
ATOM   1981 H HA   . LYS A 1 38 ? 7.157   -22.408 -2.314  1.00 0.00 ? 309 LYS A HA   2 
ATOM   1982 H HB2  . LYS A 1 38 ? 7.800   -19.507 -2.245  1.00 0.00 ? 309 LYS A HB2  2 
ATOM   1983 H HB3  . LYS A 1 38 ? 8.848   -20.516 -3.243  1.00 0.00 ? 309 LYS A HB3  2 
ATOM   1984 H HG2  . LYS A 1 38 ? 6.819   -19.578 -4.442  1.00 0.00 ? 309 LYS A HG2  2 
ATOM   1985 H HG3  . LYS A 1 38 ? 6.983   -21.333 -4.520  1.00 0.00 ? 309 LYS A HG3  2 
ATOM   1986 H HD2  . LYS A 1 38 ? 5.279   -21.683 -2.925  1.00 0.00 ? 309 LYS A HD2  2 
ATOM   1987 H HD3  . LYS A 1 38 ? 5.361   -20.020 -2.342  1.00 0.00 ? 309 LYS A HD3  2 
ATOM   1988 H HE2  . LYS A 1 38 ? 3.363   -20.473 -3.794  1.00 0.00 ? 309 LYS A HE2  2 
ATOM   1989 H HE3  . LYS A 1 38 ? 4.402   -19.188 -4.408  1.00 0.00 ? 309 LYS A HE3  2 
ATOM   1990 H HZ1  . LYS A 1 38 ? 4.486   -22.023 -5.286  1.00 0.00 ? 309 LYS A HZ1  2 
ATOM   1991 H HZ2  . LYS A 1 38 ? 3.754   -20.757 -6.143  1.00 0.00 ? 309 LYS A HZ2  2 
ATOM   1992 H HZ3  . LYS A 1 38 ? 5.435   -20.757 -5.901  1.00 0.00 ? 309 LYS A HZ3  2 
ATOM   1993 N N    . GLN A 1 39 ? 9.665   -21.371 -0.443  1.00 0.00 ? 310 GLN A N    2 
ATOM   1994 C CA   . GLN A 1 39 ? 10.965  -21.796 0.063   1.00 0.00 ? 310 GLN A CA   2 
ATOM   1995 C C    . GLN A 1 39 ? 10.852  -23.217 0.617   1.00 0.00 ? 310 GLN A C    2 
ATOM   1996 O O    . GLN A 1 39 ? 11.722  -24.042 0.418   1.00 0.00 ? 310 GLN A O    2 
ATOM   1997 C CB   . GLN A 1 39 ? 11.417  -20.849 1.177   1.00 0.00 ? 310 GLN A CB   2 
ATOM   1998 C CG   . GLN A 1 39 ? 11.765  -19.484 0.579   1.00 0.00 ? 310 GLN A CG   2 
ATOM   1999 C CD   . GLN A 1 39 ? 13.273  -19.401 0.339   1.00 0.00 ? 310 GLN A CD   2 
ATOM   2000 O OE1  . GLN A 1 39 ? 13.827  -20.186 -0.405  1.00 0.00 ? 310 GLN A OE1  2 
ATOM   2001 N NE2  . GLN A 1 39 ? 13.967  -18.475 0.943   1.00 0.00 ? 310 GLN A NE2  2 
ATOM   2002 H H    . GLN A 1 39 ? 9.262   -20.538 -0.120  1.00 0.00 ? 310 GLN A H    2 
ATOM   2003 H HA   . GLN A 1 39 ? 11.688  -21.777 -0.739  1.00 0.00 ? 310 GLN A HA   2 
ATOM   2004 H HB2  . GLN A 1 39 ? 10.620  -20.735 1.898   1.00 0.00 ? 310 GLN A HB2  2 
ATOM   2005 H HB3  . GLN A 1 39 ? 12.288  -21.258 1.665   1.00 0.00 ? 310 GLN A HB3  2 
ATOM   2006 H HG2  . GLN A 1 39 ? 11.242  -19.359 -0.358  1.00 0.00 ? 310 GLN A HG2  2 
ATOM   2007 H HG3  . GLN A 1 39 ? 11.468  -18.705 1.264   1.00 0.00 ? 310 GLN A HG3  2 
ATOM   2008 H HE21 . GLN A 1 39 ? 13.521  -17.841 1.543   1.00 0.00 ? 310 GLN A HE21 2 
ATOM   2009 H HE22 . GLN A 1 39 ? 14.934  -18.413 0.796   1.00 0.00 ? 310 GLN A HE22 2 
ATOM   2010 N N    . LYS A 1 40 ? 9.787   -23.510 1.312   1.00 0.00 ? 311 LYS A N    2 
ATOM   2011 C CA   . LYS A 1 40 ? 9.622   -24.849 1.865   1.00 0.00 ? 311 LYS A CA   2 
ATOM   2012 C C    . LYS A 1 40 ? 9.613   -25.877 0.732   1.00 0.00 ? 311 LYS A C    2 
ATOM   2013 O O    . LYS A 1 40 ? 10.124  -26.971 0.870   1.00 0.00 ? 311 LYS A O    2 
ATOM   2014 C CB   . LYS A 1 40 ? 8.301   -24.925 2.633   1.00 0.00 ? 311 LYS A CB   2 
ATOM   2015 C CG   . LYS A 1 40 ? 8.461   -25.858 3.835   1.00 0.00 ? 311 LYS A CG   2 
ATOM   2016 C CD   . LYS A 1 40 ? 7.262   -25.697 4.771   1.00 0.00 ? 311 LYS A CD   2 
ATOM   2017 C CE   . LYS A 1 40 ? 7.671   -26.076 6.195   1.00 0.00 ? 311 LYS A CE   2 
ATOM   2018 N NZ   . LYS A 1 40 ? 6.470   -26.532 6.952   1.00 0.00 ? 311 LYS A NZ   2 
ATOM   2019 H H    . LYS A 1 40 ? 9.096   -22.828 1.461   1.00 0.00 ? 311 LYS A H    2 
ATOM   2020 H HA   . LYS A 1 40 ? 10.439  -25.063 2.539   1.00 0.00 ? 311 LYS A HA   2 
ATOM   2021 H HB2  . LYS A 1 40 ? 8.028   -23.938 2.977   1.00 0.00 ? 311 LYS A HB2  2 
ATOM   2022 H HB3  . LYS A 1 40 ? 7.529   -25.306 1.984   1.00 0.00 ? 311 LYS A HB3  2 
ATOM   2023 H HG2  . LYS A 1 40 ? 8.516   -26.881 3.490   1.00 0.00 ? 311 LYS A HG2  2 
ATOM   2024 H HG3  . LYS A 1 40 ? 9.366   -25.609 4.367   1.00 0.00 ? 311 LYS A HG3  2 
ATOM   2025 H HD2  . LYS A 1 40 ? 6.926   -24.670 4.752   1.00 0.00 ? 311 LYS A HD2  2 
ATOM   2026 H HD3  . LYS A 1 40 ? 6.461   -26.344 4.444   1.00 0.00 ? 311 LYS A HD3  2 
ATOM   2027 H HE2  . LYS A 1 40 ? 8.399   -26.874 6.160   1.00 0.00 ? 311 LYS A HE2  2 
ATOM   2028 H HE3  . LYS A 1 40 ? 8.101   -25.216 6.686   1.00 0.00 ? 311 LYS A HE3  2 
ATOM   2029 H HZ1  . LYS A 1 40 ? 5.915   -27.184 6.362   1.00 0.00 ? 311 LYS A HZ1  2 
ATOM   2030 H HZ2  . LYS A 1 40 ? 6.771   -27.023 7.817   1.00 0.00 ? 311 LYS A HZ2  2 
ATOM   2031 H HZ3  . LYS A 1 40 ? 5.887   -25.707 7.203   1.00 0.00 ? 311 LYS A HZ3  2 
ATOM   2032 N N    . VAL A 1 41 ? 9.034   -25.536 -0.387  1.00 0.00 ? 312 VAL A N    2 
ATOM   2033 C CA   . VAL A 1 41 ? 8.992   -26.477 -1.501  1.00 0.00 ? 312 VAL A CA   2 
ATOM   2034 C C    . VAL A 1 41 ? 10.352  -26.506 -2.202  1.00 0.00 ? 312 VAL A C    2 
ATOM   2035 O O    . VAL A 1 41 ? 10.885  -27.556 -2.500  1.00 0.00 ? 312 VAL A O    2 
ATOM   2036 C CB   . VAL A 1 41 ? 7.915   -26.043 -2.496  1.00 0.00 ? 312 VAL A CB   2 
ATOM   2037 C CG1  . VAL A 1 41 ? 7.708   -27.146 -3.538  1.00 0.00 ? 312 VAL A CG1  2 
ATOM   2038 C CG2  . VAL A 1 41 ? 6.602   -25.796 -1.750  1.00 0.00 ? 312 VAL A CG2  2 
ATOM   2039 H H    . VAL A 1 41 ? 8.625   -24.650 -0.478  1.00 0.00 ? 312 VAL A H    2 
ATOM   2040 H HA   . VAL A 1 41 ? 8.758   -27.464 -1.130  1.00 0.00 ? 312 VAL A HA   2 
ATOM   2041 H HB   . VAL A 1 41 ? 8.227   -25.136 -2.991  1.00 0.00 ? 312 VAL A HB   2 
ATOM   2042 H HG11 . VAL A 1 41 ? 8.332   -27.993 -3.294  1.00 0.00 ? 312 VAL A HG11 2 
ATOM   2043 H HG12 . VAL A 1 41 ? 6.672   -27.451 -3.538  1.00 0.00 ? 312 VAL A HG12 2 
ATOM   2044 H HG13 . VAL A 1 41 ? 7.972   -26.772 -4.516  1.00 0.00 ? 312 VAL A HG13 2 
ATOM   2045 H HG21 . VAL A 1 41 ? 6.681   -26.183 -0.744  1.00 0.00 ? 312 VAL A HG21 2 
ATOM   2046 H HG22 . VAL A 1 41 ? 6.402   -24.736 -1.714  1.00 0.00 ? 312 VAL A HG22 2 
ATOM   2047 H HG23 . VAL A 1 41 ? 5.795   -26.297 -2.265  1.00 0.00 ? 312 VAL A HG23 2 
ATOM   2048 N N    . MET A 1 42 ? 10.917  -25.361 -2.471  1.00 0.00 ? 313 MET A N    2 
ATOM   2049 C CA   . MET A 1 42 ? 12.212  -25.329 -3.141  1.00 0.00 ? 313 MET A CA   2 
ATOM   2050 C C    . MET A 1 42 ? 13.324  -25.560 -2.116  1.00 0.00 ? 313 MET A C    2 
ATOM   2051 O O    . MET A 1 42 ? 13.421  -24.868 -1.122  1.00 0.00 ? 313 MET A O    2 
ATOM   2052 C CB   . MET A 1 42 ? 12.408  -23.967 -3.809  1.00 0.00 ? 313 MET A CB   2 
ATOM   2053 C CG   . MET A 1 42 ? 12.100  -24.084 -5.304  1.00 0.00 ? 313 MET A CG   2 
ATOM   2054 S SD   . MET A 1 42 ? 13.226  -23.018 -6.238  1.00 0.00 ? 313 MET A SD   2 
ATOM   2055 C CE   . MET A 1 42 ? 12.020  -22.421 -7.448  1.00 0.00 ? 313 MET A CE   2 
ATOM   2056 H H    . MET A 1 42 ? 10.471  -24.523 -2.225  1.00 0.00 ? 313 MET A H    2 
ATOM   2057 H HA   . MET A 1 42 ? 12.248  -26.104 -3.892  1.00 0.00 ? 313 MET A HA   2 
ATOM   2058 H HB2  . MET A 1 42 ? 11.742  -23.246 -3.359  1.00 0.00 ? 313 MET A HB2  2 
ATOM   2059 H HB3  . MET A 1 42 ? 13.429  -23.644 -3.679  1.00 0.00 ? 313 MET A HB3  2 
ATOM   2060 H HG2  . MET A 1 42 ? 12.231  -25.109 -5.619  1.00 0.00 ? 313 MET A HG2  2 
ATOM   2061 H HG3  . MET A 1 42 ? 11.081  -23.778 -5.486  1.00 0.00 ? 313 MET A HG3  2 
ATOM   2062 H HE1  . MET A 1 42 ? 11.021  -22.564 -7.060  1.00 0.00 ? 313 MET A HE1  2 
ATOM   2063 H HE2  . MET A 1 42 ? 12.192  -21.371 -7.638  1.00 0.00 ? 313 MET A HE2  2 
ATOM   2064 H HE3  . MET A 1 42 ? 12.127  -22.974 -8.368  1.00 0.00 ? 313 MET A HE3  2 
ATOM   2065 N N    . ASN A 1 43 ? 14.165  -26.531 -2.350  1.00 0.00 ? 314 ASN A N    2 
ATOM   2066 C CA   . ASN A 1 43 ? 15.246  -26.803 -1.410  1.00 0.00 ? 314 ASN A CA   2 
ATOM   2067 C C    . ASN A 1 43 ? 14.660  -27.058 -0.020  1.00 0.00 ? 314 ASN A C    2 
ATOM   2068 O O    . ASN A 1 43 ? 13.512  -26.765 0.244   1.00 0.00 ? 314 ASN A O    2 
ATOM   2069 C CB   . ASN A 1 43 ? 16.191  -25.601 -1.355  1.00 0.00 ? 314 ASN A CB   2 
ATOM   2070 C CG   . ASN A 1 43 ? 17.633  -26.093 -1.214  1.00 0.00 ? 314 ASN A CG   2 
ATOM   2071 O OD1  . ASN A 1 43 ? 18.104  -26.324 -0.117  1.00 0.00 ? 314 ASN A OD1  2 
ATOM   2072 N ND2  . ASN A 1 43 ? 18.360  -26.263 -2.284  1.00 0.00 ? 314 ASN A ND2  2 
ATOM   2073 H H    . ASN A 1 43 ? 14.069  -27.078 -3.157  1.00 0.00 ? 314 ASN A H    2 
ATOM   2074 H HA   . ASN A 1 43 ? 15.794  -27.675 -1.735  1.00 0.00 ? 314 ASN A HA   2 
ATOM   2075 H HB2  . ASN A 1 43 ? 16.094  -25.025 -2.264  1.00 0.00 ? 314 ASN A HB2  2 
ATOM   2076 H HB3  . ASN A 1 43 ? 15.939  -24.984 -0.507  1.00 0.00 ? 314 ASN A HB3  2 
ATOM   2077 H HD21 . ASN A 1 43 ? 17.980  -26.077 -3.169  1.00 0.00 ? 314 ASN A HD21 2 
ATOM   2078 H HD22 . ASN A 1 43 ? 19.285  -26.577 -2.204  1.00 0.00 ? 314 ASN A HD22 2 
ATOM   2079 N N    . TYR A 1 44 ? 15.443  -27.604 0.873   1.00 0.00 ? 315 TYR A N    2 
ATOM   2080 C CA   . TYR A 1 44 ? 14.943  -27.873 2.217   1.00 0.00 ? 315 TYR A CA   2 
ATOM   2081 C C    . TYR A 1 44 ? 15.639  -26.944 3.214   1.00 0.00 ? 315 TYR A C    2 
ATOM   2082 O O    . TYR A 1 44 ? 16.659  -26.378 2.854   1.00 0.00 ? 315 TYR A O    2 
ATOM   2083 C CB   . TYR A 1 44 ? 15.232  -29.329 2.587   1.00 0.00 ? 315 TYR A CB   2 
ATOM   2084 C CG   . TYR A 1 44 ? 13.990  -30.160 2.371   1.00 0.00 ? 315 TYR A CG   2 
ATOM   2085 C CD1  . TYR A 1 44 ? 13.470  -30.320 1.076   1.00 0.00 ? 315 TYR A CD1  2 
ATOM   2086 C CD2  . TYR A 1 44 ? 13.356  -30.773 3.463   1.00 0.00 ? 315 TYR A CD2  2 
ATOM   2087 C CE1  . TYR A 1 44 ? 12.315  -31.094 0.874   1.00 0.00 ? 315 TYR A CE1  2 
ATOM   2088 C CE2  . TYR A 1 44 ? 12.201  -31.546 3.262   1.00 0.00 ? 315 TYR A CE2  2 
ATOM   2089 C CZ   . TYR A 1 44 ? 11.680  -31.707 1.967   1.00 0.00 ? 315 TYR A CZ   2 
ATOM   2090 O OH   . TYR A 1 44 ? 10.546  -32.466 1.769   1.00 0.00 ? 315 TYR A OH   2 
ATOM   2091 O OXT  . TYR A 1 44 ? 15.141  -26.814 4.319   1.00 0.00 ? 315 TYR A OXT  2 
ATOM   2092 H H    . TYR A 1 44 ? 16.366  -27.834 0.639   1.00 0.00 ? 315 TYR A H    2 
ATOM   2093 H HA   . TYR A 1 44 ? 13.878  -27.700 2.246   1.00 0.00 ? 315 TYR A HA   2 
ATOM   2094 H HB2  . TYR A 1 44 ? 16.031  -29.706 1.967   1.00 0.00 ? 315 TYR A HB2  2 
ATOM   2095 H HB3  . TYR A 1 44 ? 15.524  -29.385 3.625   1.00 0.00 ? 315 TYR A HB3  2 
ATOM   2096 H HD1  . TYR A 1 44 ? 13.958  -29.850 0.236   1.00 0.00 ? 315 TYR A HD1  2 
ATOM   2097 H HD2  . TYR A 1 44 ? 13.755  -30.650 4.458   1.00 0.00 ? 315 TYR A HD2  2 
ATOM   2098 H HE1  . TYR A 1 44 ? 11.915  -31.217 -0.121  1.00 0.00 ? 315 TYR A HE1  2 
ATOM   2099 H HE2  . TYR A 1 44 ? 11.713  -32.017 4.102   1.00 0.00 ? 315 TYR A HE2  2 
ATOM   2100 H HH   . TYR A 1 44 ? 10.816  -33.315 1.411   1.00 0.00 ? 315 TYR A HH   2 
HETATM 2101 C C    . ACE B 1 1  ? 5.704   31.090  -0.950  1.00 0.00 ? 272 ACE B C    2 
HETATM 2102 O O    . ACE B 1 1  ? 5.480   30.001  -0.462  1.00 0.00 ? 272 ACE B O    2 
HETATM 2103 C CH3  . ACE B 1 1  ? 6.707   32.054  -0.313  1.00 0.00 ? 272 ACE B CH3  2 
HETATM 2104 H H1   . ACE B 1 1  ? 7.581   31.506  0.008   1.00 0.00 ? 272 ACE B H1   2 
HETATM 2105 H H2   . ACE B 1 1  ? 6.998   32.802  -1.036  1.00 0.00 ? 272 ACE B H2   2 
HETATM 2106 H H3   . ACE B 1 1  ? 6.252   32.536  0.540   1.00 0.00 ? 272 ACE B H3   2 
ATOM   2107 N N    . CYS B 1 2  ? 5.099   31.483  -2.037  1.00 0.00 ? 273 CYS B N    2 
ATOM   2108 C CA   . CYS B 1 2  ? 4.132   30.608  -2.690  1.00 0.00 ? 273 CYS B CA   2 
ATOM   2109 C C    . CYS B 1 2  ? 4.443   30.532  -4.187  1.00 0.00 ? 273 CYS B C    2 
ATOM   2110 O O    . CYS B 1 2  ? 4.036   31.377  -4.958  1.00 0.00 ? 273 CYS B O    2 
ATOM   2111 C CB   . CYS B 1 2  ? 2.722   31.166  -2.489  1.00 0.00 ? 273 CYS B CB   2 
ATOM   2112 S SG   . CYS B 1 2  ? 1.624   29.844  -1.920  1.00 0.00 ? 273 CYS B SG   2 
ATOM   2113 H H    . CYS B 1 2  ? 5.294   32.366  -2.415  1.00 0.00 ? 273 CYS B H    2 
ATOM   2114 H HA   . CYS B 1 2  ? 4.191   29.620  -2.259  1.00 0.00 ? 273 CYS B HA   2 
ATOM   2115 H HB2  . CYS B 1 2  ? 2.748   31.954  -1.750  1.00 0.00 ? 273 CYS B HB2  2 
ATOM   2116 H HB3  . CYS B 1 2  ? 2.354   31.561  -3.424  1.00 0.00 ? 273 CYS B HB3  2 
ATOM   2117 N N    . GLY B 1 3  ? 5.160   29.524  -4.603  1.00 0.00 ? 274 GLY B N    2 
ATOM   2118 C CA   . GLY B 1 3  ? 5.487   29.400  -6.020  1.00 0.00 ? 274 GLY B CA   2 
ATOM   2119 C C    . GLY B 1 3  ? 6.704   28.489  -6.191  1.00 0.00 ? 274 GLY B C    2 
ATOM   2120 O O    . GLY B 1 3  ? 6.842   27.803  -7.185  1.00 0.00 ? 274 GLY B O    2 
ATOM   2121 H H    . GLY B 1 3  ? 5.479   28.852  -3.966  1.00 0.00 ? 274 GLY B H    2 
ATOM   2122 H HA2  . GLY B 1 3  ? 4.642   28.978  -6.546  1.00 0.00 ? 274 GLY B HA2  2 
ATOM   2123 H HA3  . GLY B 1 3  ? 5.713   30.375  -6.423  1.00 0.00 ? 274 GLY B HA3  2 
ATOM   2124 N N    . GLY B 1 4  ? 7.590   28.478  -5.234  1.00 0.00 ? 275 GLY B N    2 
ATOM   2125 C CA   . GLY B 1 4  ? 8.772   27.630  -5.346  1.00 0.00 ? 275 GLY B CA   2 
ATOM   2126 C C    . GLY B 1 4  ? 8.613   26.404  -4.446  1.00 0.00 ? 275 GLY B C    2 
ATOM   2127 O O    . GLY B 1 4  ? 9.235   25.381  -4.658  1.00 0.00 ? 275 GLY B O    2 
ATOM   2128 H H    . GLY B 1 4  ? 7.463   29.040  -4.441  1.00 0.00 ? 275 GLY B H    2 
ATOM   2129 H HA2  . GLY B 1 4  ? 8.891   27.313  -6.372  1.00 0.00 ? 275 GLY B HA2  2 
ATOM   2130 H HA3  . GLY B 1 4  ? 9.644   28.186  -5.036  1.00 0.00 ? 275 GLY B HA3  2 
ATOM   2131 N N    . ARG B 1 5  ? 7.784   26.495  -3.442  1.00 0.00 ? 276 ARG B N    2 
ATOM   2132 C CA   . ARG B 1 5  ? 7.592   25.357  -2.550  1.00 0.00 ? 276 ARG B CA   2 
ATOM   2133 C C    . ARG B 1 5  ? 6.452   24.483  -3.078  1.00 0.00 ? 276 ARG B C    2 
ATOM   2134 O O    . ARG B 1 5  ? 6.369   23.308  -2.783  1.00 0.00 ? 276 ARG B O    2 
ATOM   2135 C CB   . ARG B 1 5  ? 7.242   25.859  -1.148  1.00 0.00 ? 276 ARG B CB   2 
ATOM   2136 C CG   . ARG B 1 5  ? 8.358   26.772  -0.638  1.00 0.00 ? 276 ARG B CG   2 
ATOM   2137 C CD   . ARG B 1 5  ? 7.788   28.162  -0.343  1.00 0.00 ? 276 ARG B CD   2 
ATOM   2138 N NE   . ARG B 1 5  ? 7.832   28.424  1.094   1.00 0.00 ? 276 ARG B NE   2 
ATOM   2139 C CZ   . ARG B 1 5  ? 7.592   27.465  1.949   1.00 0.00 ? 276 ARG B CZ   2 
ATOM   2140 N NH1  . ARG B 1 5  ? 6.361   27.150  2.246   1.00 0.00 ? 276 ARG B NH1  2 
ATOM   2141 N NH2  . ARG B 1 5  ? 8.583   26.823  2.505   1.00 0.00 ? 276 ARG B NH2  2 
ATOM   2142 H H    . ARG B 1 5  ? 7.291   27.327  -3.287  1.00 0.00 ? 276 ARG B H    2 
ATOM   2143 H HA   . ARG B 1 5  ? 8.500   24.776  -2.505  1.00 0.00 ? 276 ARG B HA   2 
ATOM   2144 H HB2  . ARG B 1 5  ? 6.313   26.410  -1.184  1.00 0.00 ? 276 ARG B HB2  2 
ATOM   2145 H HB3  . ARG B 1 5  ? 7.135   25.018  -0.479  1.00 0.00 ? 276 ARG B HB3  2 
ATOM   2146 H HG2  . ARG B 1 5  ? 8.780   26.354  0.265   1.00 0.00 ? 276 ARG B HG2  2 
ATOM   2147 H HG3  . ARG B 1 5  ? 9.127   26.853  -1.390  1.00 0.00 ? 276 ARG B HG3  2 
ATOM   2148 H HD2  . ARG B 1 5  ? 8.375   28.906  -0.858  1.00 0.00 ? 276 ARG B HD2  2 
ATOM   2149 H HD3  . ARG B 1 5  ? 6.765   28.211  -0.690  1.00 0.00 ? 276 ARG B HD3  2 
ATOM   2150 H HE   . ARG B 1 5  ? 8.045   29.324  1.420   1.00 0.00 ? 276 ARG B HE   2 
ATOM   2151 H HH11 . ARG B 1 5  ? 5.603   27.641  1.819   1.00 0.00 ? 276 ARG B HH11 2 
ATOM   2152 H HH12 . ARG B 1 5  ? 6.178   26.416  2.900   1.00 0.00 ? 276 ARG B HH12 2 
ATOM   2153 H HH21 . ARG B 1 5  ? 9.526   27.066  2.278   1.00 0.00 ? 276 ARG B HH21 2 
ATOM   2154 H HH22 . ARG B 1 5  ? 8.398   26.090  3.159   1.00 0.00 ? 276 ARG B HH22 2 
ATOM   2155 N N    . ILE B 1 6  ? 5.573   25.050  -3.858  1.00 0.00 ? 277 ILE B N    2 
ATOM   2156 C CA   . ILE B 1 6  ? 4.463   24.271  -4.393  1.00 0.00 ? 277 ILE B CA   2 
ATOM   2157 C C    . ILE B 1 6  ? 4.986   23.303  -5.457  1.00 0.00 ? 277 ILE B C    2 
ATOM   2158 O O    . ILE B 1 6  ? 4.506   22.194  -5.590  1.00 0.00 ? 277 ILE B O    2 
ATOM   2159 C CB   . ILE B 1 6  ? 3.434   25.214  -5.018  1.00 0.00 ? 277 ILE B CB   2 
ATOM   2160 C CG1  . ILE B 1 6  ? 2.737   26.008  -3.911  1.00 0.00 ? 277 ILE B CG1  2 
ATOM   2161 C CG2  . ILE B 1 6  ? 2.396   24.399  -5.792  1.00 0.00 ? 277 ILE B CG2  2 
ATOM   2162 C CD1  . ILE B 1 6  ? 2.682   27.487  -4.299  1.00 0.00 ? 277 ILE B CD1  2 
ATOM   2163 H H    . ILE B 1 6  ? 5.659   26.000  -4.084  1.00 0.00 ? 277 ILE B H    2 
ATOM   2164 H HA   . ILE B 1 6  ? 3.998   23.712  -3.596  1.00 0.00 ? 277 ILE B HA   2 
ATOM   2165 H HB   . ILE B 1 6  ? 3.933   25.895  -5.693  1.00 0.00 ? 277 ILE B HB   2 
ATOM   2166 H HG12 . ILE B 1 6  ? 1.732   25.633  -3.778  1.00 0.00 ? 277 ILE B HG12 2 
ATOM   2167 H HG13 . ILE B 1 6  ? 3.287   25.900  -2.990  1.00 0.00 ? 277 ILE B HG13 2 
ATOM   2168 H HG21 . ILE B 1 6  ? 2.890   23.822  -6.559  1.00 0.00 ? 277 ILE B HG21 2 
ATOM   2169 H HG22 . ILE B 1 6  ? 1.882   23.734  -5.114  1.00 0.00 ? 277 ILE B HG22 2 
ATOM   2170 H HG23 . ILE B 1 6  ? 1.681   25.068  -6.249  1.00 0.00 ? 277 ILE B HG23 2 
ATOM   2171 H HD11 . ILE B 1 6  ? 3.484   27.708  -4.987  1.00 0.00 ? 277 ILE B HD11 2 
ATOM   2172 H HD12 . ILE B 1 6  ? 1.734   27.701  -4.768  1.00 0.00 ? 277 ILE B HD12 2 
ATOM   2173 H HD13 . ILE B 1 6  ? 2.790   28.095  -3.412  1.00 0.00 ? 277 ILE B HD13 2 
ATOM   2174 N N    . ALA B 1 7  ? 5.967   23.709  -6.214  1.00 0.00 ? 278 ALA B N    2 
ATOM   2175 C CA   . ALA B 1 7  ? 6.507   22.828  -7.243  1.00 0.00 ? 278 ALA B CA   2 
ATOM   2176 C C    . ALA B 1 7  ? 7.076   21.570  -6.583  1.00 0.00 ? 278 ALA B C    2 
ATOM   2177 O O    . ALA B 1 7  ? 6.791   20.461  -6.986  1.00 0.00 ? 278 ALA B O    2 
ATOM   2178 C CB   . ALA B 1 7  ? 7.618   23.551  -8.006  1.00 0.00 ? 278 ALA B CB   2 
ATOM   2179 H H    . ALA B 1 7  ? 6.343   24.607  -6.091  1.00 0.00 ? 278 ALA B H    2 
ATOM   2180 H HA   . ALA B 1 7  ? 5.722   22.550  -7.930  1.00 0.00 ? 278 ALA B HA   2 
ATOM   2181 H HB1  . ALA B 1 7  ? 7.602   24.602  -7.756  1.00 0.00 ? 278 ALA B HB1  2 
ATOM   2182 H HB2  . ALA B 1 7  ? 8.575   23.131  -7.735  1.00 0.00 ? 278 ALA B HB2  2 
ATOM   2183 H HB3  . ALA B 1 7  ? 7.462   23.432  -9.068  1.00 0.00 ? 278 ALA B HB3  2 
ATOM   2184 N N    . ARG B 1 8  ? 7.879   21.736  -5.567  1.00 0.00 ? 279 ARG B N    2 
ATOM   2185 C CA   . ARG B 1 8  ? 8.453   20.578  -4.892  1.00 0.00 ? 279 ARG B CA   2 
ATOM   2186 C C    . ARG B 1 8  ? 7.332   19.747  -4.266  1.00 0.00 ? 279 ARG B C    2 
ATOM   2187 O O    . ARG B 1 8  ? 7.290   18.540  -4.401  1.00 0.00 ? 279 ARG B O    2 
ATOM   2188 C CB   . ARG B 1 8  ? 9.411   21.049  -3.796  1.00 0.00 ? 279 ARG B CB   2 
ATOM   2189 C CG   . ARG B 1 8  ? 10.801  21.274  -4.393  1.00 0.00 ? 279 ARG B CG   2 
ATOM   2190 C CD   . ARG B 1 8  ? 11.672  22.032  -3.387  1.00 0.00 ? 279 ARG B CD   2 
ATOM   2191 N NE   . ARG B 1 8  ? 13.079  21.818  -3.706  1.00 0.00 ? 279 ARG B NE   2 
ATOM   2192 C CZ   . ARG B 1 8  ? 13.990  22.601  -3.193  1.00 0.00 ? 279 ARG B CZ   2 
ATOM   2193 N NH1  . ARG B 1 8  ? 13.939  22.922  -1.930  1.00 0.00 ? 279 ARG B NH1  2 
ATOM   2194 N NH2  . ARG B 1 8  ? 14.952  23.060  -3.945  1.00 0.00 ? 279 ARG B NH2  2 
ATOM   2195 H H    . ARG B 1 8  ? 8.095   22.640  -5.257  1.00 0.00 ? 279 ARG B H    2 
ATOM   2196 H HA   . ARG B 1 8  ? 8.993   19.975  -5.606  1.00 0.00 ? 279 ARG B HA   2 
ATOM   2197 H HB2  . ARG B 1 8  ? 9.046   21.974  -3.373  1.00 0.00 ? 279 ARG B HB2  2 
ATOM   2198 H HB3  . ARG B 1 8  ? 9.471   20.298  -3.022  1.00 0.00 ? 279 ARG B HB3  2 
ATOM   2199 H HG2  . ARG B 1 8  ? 11.255  20.320  -4.618  1.00 0.00 ? 279 ARG B HG2  2 
ATOM   2200 H HG3  . ARG B 1 8  ? 10.715  21.854  -5.299  1.00 0.00 ? 279 ARG B HG3  2 
ATOM   2201 H HD2  . ARG B 1 8  ? 11.447  23.087  -3.439  1.00 0.00 ? 279 ARG B HD2  2 
ATOM   2202 H HD3  . ARG B 1 8  ? 11.471  21.668  -2.390  1.00 0.00 ? 279 ARG B HD3  2 
ATOM   2203 H HE   . ARG B 1 8  ? 13.341  21.088  -4.303  1.00 0.00 ? 279 ARG B HE   2 
ATOM   2204 H HH11 . ARG B 1 8  ? 13.201  22.569  -1.354  1.00 0.00 ? 279 ARG B HH11 2 
ATOM   2205 H HH12 . ARG B 1 8  ? 14.637  23.521  -1.538  1.00 0.00 ? 279 ARG B HH12 2 
ATOM   2206 H HH21 . ARG B 1 8  ? 14.991  22.814  -4.914  1.00 0.00 ? 279 ARG B HH21 2 
ATOM   2207 H HH22 . ARG B 1 8  ? 15.649  23.660  -3.553  1.00 0.00 ? 279 ARG B HH22 2 
ATOM   2208 N N    . LEU B 1 9  ? 6.423   20.383  -3.579  1.00 0.00 ? 280 LEU B N    2 
ATOM   2209 C CA   . LEU B 1 9  ? 5.330   19.648  -2.953  1.00 0.00 ? 280 LEU B CA   2 
ATOM   2210 C C    . LEU B 1 9  ? 4.614   18.796  -4.004  1.00 0.00 ? 280 LEU B C    2 
ATOM   2211 O O    . LEU B 1 9  ? 4.319   17.639  -3.782  1.00 0.00 ? 280 LEU B O    2 
ATOM   2212 C CB   . LEU B 1 9  ? 4.338   20.637  -2.337  1.00 0.00 ? 280 LEU B CB   2 
ATOM   2213 C CG   . LEU B 1 9  ? 4.731   20.916  -0.886  1.00 0.00 ? 280 LEU B CG   2 
ATOM   2214 C CD1  . LEU B 1 9  ? 4.194   22.286  -0.466  1.00 0.00 ? 280 LEU B CD1  2 
ATOM   2215 C CD2  . LEU B 1 9  ? 4.135   19.837  0.019   1.00 0.00 ? 280 LEU B CD2  2 
ATOM   2216 H H    . LEU B 1 9  ? 6.478   21.357  -3.480  1.00 0.00 ? 280 LEU B H    2 
ATOM   2217 H HA   . LEU B 1 9  ? 5.724   19.008  -2.178  1.00 0.00 ? 280 LEU B HA   2 
ATOM   2218 H HB2  . LEU B 1 9  ? 4.353   21.559  -2.899  1.00 0.00 ? 280 LEU B HB2  2 
ATOM   2219 H HB3  . LEU B 1 9  ? 3.345   20.214  -2.364  1.00 0.00 ? 280 LEU B HB3  2 
ATOM   2220 H HG   . LEU B 1 9  ? 5.808   20.910  -0.797  1.00 0.00 ? 280 LEU B HG   2 
ATOM   2221 H HD11 . LEU B 1 9  ? 3.529   22.662  -1.230  1.00 0.00 ? 280 LEU B HD11 2 
ATOM   2222 H HD12 . LEU B 1 9  ? 3.655   22.191  0.465   1.00 0.00 ? 280 LEU B HD12 2 
ATOM   2223 H HD13 . LEU B 1 9  ? 5.018   22.972  -0.337  1.00 0.00 ? 280 LEU B HD13 2 
ATOM   2224 H HD21 . LEU B 1 9  ? 3.158   19.559  -0.347  1.00 0.00 ? 280 LEU B HD21 2 
ATOM   2225 H HD22 . LEU B 1 9  ? 4.780   18.971  0.018   1.00 0.00 ? 280 LEU B HD22 2 
ATOM   2226 H HD23 . LEU B 1 9  ? 4.047   20.220  1.026   1.00 0.00 ? 280 LEU B HD23 2 
ATOM   2227 N N    . GLU B 1 10 ? 4.328   19.359  -5.147  1.00 0.00 ? 281 GLU B N    2 
ATOM   2228 C CA   . GLU B 1 10 ? 3.643   18.594  -6.183  1.00 0.00 ? 281 GLU B CA   2 
ATOM   2229 C C    . GLU B 1 10 ? 4.512   17.405  -6.599  1.00 0.00 ? 281 GLU B C    2 
ATOM   2230 O O    . GLU B 1 10 ? 4.052   16.283  -6.665  1.00 0.00 ? 281 GLU B O    2 
ATOM   2231 C CB   . GLU B 1 10 ? 3.386   19.491  -7.396  1.00 0.00 ? 281 GLU B CB   2 
ATOM   2232 C CG   . GLU B 1 10 ? 2.273   20.487  -7.067  1.00 0.00 ? 281 GLU B CG   2 
ATOM   2233 C CD   . GLU B 1 10 ? 1.030   20.159  -7.898  1.00 0.00 ? 281 GLU B CD   2 
ATOM   2234 O OE1  . GLU B 1 10 ? 1.187   19.565  -8.952  1.00 0.00 ? 281 GLU B OE1  2 
ATOM   2235 O OE2  . GLU B 1 10 ? -0.056  20.509  -7.466  1.00 0.00 ? 281 GLU B OE2  2 
ATOM   2236 H H    . GLU B 1 10 ? 4.571   20.294  -5.306  1.00 0.00 ? 281 GLU B H    2 
ATOM   2237 H HA   . GLU B 1 10 ? 2.702   18.231  -5.799  1.00 0.00 ? 281 GLU B HA   2 
ATOM   2238 H HB2  . GLU B 1 10 ? 4.290   20.028  -7.645  1.00 0.00 ? 281 GLU B HB2  2 
ATOM   2239 H HB3  . GLU B 1 10 ? 3.085   18.883  -8.236  1.00 0.00 ? 281 GLU B HB3  2 
ATOM   2240 H HG2  . GLU B 1 10 ? 2.031   20.422  -6.016  1.00 0.00 ? 281 GLU B HG2  2 
ATOM   2241 H HG3  . GLU B 1 10 ? 2.605   21.488  -7.299  1.00 0.00 ? 281 GLU B HG3  2 
ATOM   2242 N N    . GLU B 1 11 ? 5.765   17.640  -6.879  1.00 0.00 ? 282 GLU B N    2 
ATOM   2243 C CA   . GLU B 1 11 ? 6.637   16.542  -7.277  1.00 0.00 ? 282 GLU B CA   2 
ATOM   2244 C C    . GLU B 1 11 ? 6.702   15.516  -6.144  1.00 0.00 ? 282 GLU B C    2 
ATOM   2245 O O    . GLU B 1 11 ? 6.890   14.337  -6.368  1.00 0.00 ? 282 GLU B O    2 
ATOM   2246 C CB   . GLU B 1 11 ? 8.041   17.079  -7.562  1.00 0.00 ? 282 GLU B CB   2 
ATOM   2247 C CG   . GLU B 1 11 ? 8.237   17.226  -9.071  1.00 0.00 ? 282 GLU B CG   2 
ATOM   2248 C CD   . GLU B 1 11 ? 9.527   16.520  -9.491  1.00 0.00 ? 282 GLU B CD   2 
ATOM   2249 O OE1  . GLU B 1 11 ? 10.439  16.466  -8.683  1.00 0.00 ? 282 GLU B OE1  2 
ATOM   2250 O OE2  . GLU B 1 11 ? 9.582   16.045  -10.614 1.00 0.00 ? 282 GLU B OE2  2 
ATOM   2251 H H    . GLU B 1 11 ? 6.120   18.551  -6.817  1.00 0.00 ? 282 GLU B H    2 
ATOM   2252 H HA   . GLU B 1 11 ? 6.245   16.073  -8.167  1.00 0.00 ? 282 GLU B HA   2 
ATOM   2253 H HB2  . GLU B 1 11 ? 8.160   18.041  -7.086  1.00 0.00 ? 282 GLU B HB2  2 
ATOM   2254 H HB3  . GLU B 1 11 ? 8.776   16.390  -7.171  1.00 0.00 ? 282 GLU B HB3  2 
ATOM   2255 H HG2  . GLU B 1 11 ? 7.398   16.782  -9.588  1.00 0.00 ? 282 GLU B HG2  2 
ATOM   2256 H HG3  . GLU B 1 11 ? 8.303   18.273  -9.325  1.00 0.00 ? 282 GLU B HG3  2 
ATOM   2257 N N    . LYS B 1 12 ? 6.548   15.960  -4.927  1.00 0.00 ? 283 LYS B N    2 
ATOM   2258 C CA   . LYS B 1 12 ? 6.597   15.039  -3.800  1.00 0.00 ? 283 LYS B CA   2 
ATOM   2259 C C    . LYS B 1 12 ? 5.331   14.181  -3.786  1.00 0.00 ? 283 LYS B C    2 
ATOM   2260 O O    . LYS B 1 12 ? 5.391   12.973  -3.675  1.00 0.00 ? 283 LYS B O    2 
ATOM   2261 C CB   . LYS B 1 12 ? 6.689   15.835  -2.497  1.00 0.00 ? 283 LYS B CB   2 
ATOM   2262 C CG   . LYS B 1 12 ? 8.087   15.674  -1.897  1.00 0.00 ? 283 LYS B CG   2 
ATOM   2263 C CD   . LYS B 1 12 ? 7.968   15.331  -0.411  1.00 0.00 ? 283 LYS B CD   2 
ATOM   2264 C CE   . LYS B 1 12 ? 8.247   16.581  0.426   1.00 0.00 ? 283 LYS B CE   2 
ATOM   2265 N NZ   . LYS B 1 12 ? 7.910   16.308  1.852   1.00 0.00 ? 283 LYS B NZ   2 
ATOM   2266 H H    . LYS B 1 12 ? 6.398   16.916  -4.771  1.00 0.00 ? 283 LYS B H    2 
ATOM   2267 H HA   . LYS B 1 12 ? 7.464   14.401  -3.892  1.00 0.00 ? 283 LYS B HA   2 
ATOM   2268 H HB2  . LYS B 1 12 ? 6.501   16.879  -2.700  1.00 0.00 ? 283 LYS B HB2  2 
ATOM   2269 H HB3  . LYS B 1 12 ? 5.955   15.465  -1.798  1.00 0.00 ? 283 LYS B HB3  2 
ATOM   2270 H HG2  . LYS B 1 12 ? 8.610   14.881  -2.410  1.00 0.00 ? 283 LYS B HG2  2 
ATOM   2271 H HG3  . LYS B 1 12 ? 8.635   16.597  -2.008  1.00 0.00 ? 283 LYS B HG3  2 
ATOM   2272 H HD2  . LYS B 1 12 ? 6.970   14.972  -0.204  1.00 0.00 ? 283 LYS B HD2  2 
ATOM   2273 H HD3  . LYS B 1 12 ? 8.686   14.564  -0.160  1.00 0.00 ? 283 LYS B HD3  2 
ATOM   2274 H HE2  . LYS B 1 12 ? 9.292   16.842  0.347   1.00 0.00 ? 283 LYS B HE2  2 
ATOM   2275 H HE3  . LYS B 1 12 ? 7.643   17.399  0.064   1.00 0.00 ? 283 LYS B HE3  2 
ATOM   2276 H HZ1  . LYS B 1 12 ? 7.897   15.282  2.016   1.00 0.00 ? 283 LYS B HZ1  2 
ATOM   2277 H HZ2  . LYS B 1 12 ? 8.624   16.746  2.467   1.00 0.00 ? 283 LYS B HZ2  2 
ATOM   2278 H HZ3  . LYS B 1 12 ? 6.973   16.706  2.069   1.00 0.00 ? 283 LYS B HZ3  2 
ATOM   2279 N N    . VAL B 1 13 ? 4.184   14.794  -3.898  1.00 0.00 ? 284 VAL B N    2 
ATOM   2280 C CA   . VAL B 1 13 ? 2.946   14.024  -3.889  1.00 0.00 ? 284 VAL B CA   2 
ATOM   2281 C C    . VAL B 1 13 ? 2.950   13.048  -5.067  1.00 0.00 ? 284 VAL B C    2 
ATOM   2282 O O    . VAL B 1 13 ? 2.337   11.999  -5.020  1.00 0.00 ? 284 VAL B O    2 
ATOM   2283 C CB   . VAL B 1 13 ? 1.752   14.971  -4.012  1.00 0.00 ? 284 VAL B CB   2 
ATOM   2284 C CG1  . VAL B 1 13 ? 0.461   14.155  -4.094  1.00 0.00 ? 284 VAL B CG1  2 
ATOM   2285 C CG2  . VAL B 1 13 ? 1.699   15.885  -2.785  1.00 0.00 ? 284 VAL B CG2  2 
ATOM   2286 H H    . VAL B 1 13 ? 4.153   15.771  -3.987  1.00 0.00 ? 284 VAL B H    2 
ATOM   2287 H HA   . VAL B 1 13 ? 2.871   13.471  -2.964  1.00 0.00 ? 284 VAL B HA   2 
ATOM   2288 H HB   . VAL B 1 13 ? 1.857   15.569  -4.905  1.00 0.00 ? 284 VAL B HB   2 
ATOM   2289 H HG11 . VAL B 1 13 ? 0.471   13.386  -3.337  1.00 0.00 ? 284 VAL B HG11 2 
ATOM   2290 H HG12 . VAL B 1 13 ? -0.387  14.806  -3.935  1.00 0.00 ? 284 VAL B HG12 2 
ATOM   2291 H HG13 . VAL B 1 13 ? 0.385   13.699  -5.069  1.00 0.00 ? 284 VAL B HG13 2 
ATOM   2292 H HG21 . VAL B 1 13 ? 2.701   16.050  -2.417  1.00 0.00 ? 284 VAL B HG21 2 
ATOM   2293 H HG22 . VAL B 1 13 ? 1.255   16.830  -3.060  1.00 0.00 ? 284 VAL B HG22 2 
ATOM   2294 H HG23 . VAL B 1 13 ? 1.104   15.417  -2.014  1.00 0.00 ? 284 VAL B HG23 2 
ATOM   2295 N N    . LYS B 1 14 ? 3.637   13.384  -6.124  1.00 0.00 ? 285 LYS B N    2 
ATOM   2296 C CA   . LYS B 1 14 ? 3.680   12.494  -7.278  1.00 0.00 ? 285 LYS B CA   2 
ATOM   2297 C C    . LYS B 1 14 ? 4.496   11.249  -6.926  1.00 0.00 ? 285 LYS B C    2 
ATOM   2298 O O    . LYS B 1 14 ? 4.050   10.132  -7.100  1.00 0.00 ? 285 LYS B O    2 
ATOM   2299 C CB   . LYS B 1 14 ? 4.334   13.216  -8.458  1.00 0.00 ? 285 LYS B CB   2 
ATOM   2300 C CG   . LYS B 1 14 ? 3.535   12.935  -9.733  1.00 0.00 ? 285 LYS B CG   2 
ATOM   2301 C CD   . LYS B 1 14 ? 3.306   11.428  -9.872  1.00 0.00 ? 285 LYS B CD   2 
ATOM   2302 C CE   . LYS B 1 14 ? 2.711   11.127  -11.248 1.00 0.00 ? 285 LYS B CE   2 
ATOM   2303 N NZ   . LYS B 1 14 ? 3.572   10.139  -11.956 1.00 0.00 ? 285 LYS B NZ   2 
ATOM   2304 H H    . LYS B 1 14 ? 4.124   14.234  -6.141  1.00 0.00 ? 285 LYS B H    2 
ATOM   2305 H HA   . LYS B 1 14 ? 2.676   12.203  -7.547  1.00 0.00 ? 285 LYS B HA   2 
ATOM   2306 H HB2  . LYS B 1 14 ? 4.345   14.280  -8.267  1.00 0.00 ? 285 LYS B HB2  2 
ATOM   2307 H HB3  . LYS B 1 14 ? 5.344   12.861  -8.583  1.00 0.00 ? 285 LYS B HB3  2 
ATOM   2308 H HG2  . LYS B 1 14 ? 2.582   13.441  -9.680  1.00 0.00 ? 285 LYS B HG2  2 
ATOM   2309 H HG3  . LYS B 1 14 ? 4.087   13.294  -10.589 1.00 0.00 ? 285 LYS B HG3  2 
ATOM   2310 H HD2  . LYS B 1 14 ? 4.249   10.911  -9.765  1.00 0.00 ? 285 LYS B HD2  2 
ATOM   2311 H HD3  . LYS B 1 14 ? 2.623   11.097  -9.106  1.00 0.00 ? 285 LYS B HD3  2 
ATOM   2312 H HE2  . LYS B 1 14 ? 1.718   10.719  -11.130 1.00 0.00 ? 285 LYS B HE2  2 
ATOM   2313 H HE3  . LYS B 1 14 ? 2.659   12.038  -11.826 1.00 0.00 ? 285 LYS B HE3  2 
ATOM   2314 H HZ1  . LYS B 1 14 ? 4.563   10.268  -11.660 1.00 0.00 ? 285 LYS B HZ1  2 
ATOM   2315 H HZ2  . LYS B 1 14 ? 3.262   9.174   -11.721 1.00 0.00 ? 285 LYS B HZ2  2 
ATOM   2316 H HZ3  . LYS B 1 14 ? 3.496   10.283  -12.982 1.00 0.00 ? 285 LYS B HZ3  2 
ATOM   2317 N N    . THR B 1 15 ? 5.690   11.430  -6.429  1.00 0.00 ? 286 THR B N    2 
ATOM   2318 C CA   . THR B 1 15 ? 6.512   10.280  -6.072  1.00 0.00 ? 286 THR B CA   2 
ATOM   2319 C C    . THR B 1 15 ? 5.737   9.385   -5.104  1.00 0.00 ? 286 THR B C    2 
ATOM   2320 O O    . THR B 1 15 ? 5.666   8.183   -5.275  1.00 0.00 ? 286 THR B O    2 
ATOM   2321 C CB   . THR B 1 15 ? 7.803   10.761  -5.406  1.00 0.00 ? 286 THR B CB   2 
ATOM   2322 O OG1  . THR B 1 15 ? 7.798   12.180  -5.338  1.00 0.00 ? 286 THR B OG1  2 
ATOM   2323 C CG2  . THR B 1 15 ? 9.007   10.292  -6.224  1.00 0.00 ? 286 THR B CG2  2 
ATOM   2324 H H    . THR B 1 15 ? 6.032   12.339  -6.294  1.00 0.00 ? 286 THR B H    2 
ATOM   2325 H HA   . THR B 1 15 ? 6.756   9.721   -6.964  1.00 0.00 ? 286 THR B HA   2 
ATOM   2326 H HB   . THR B 1 15 ? 7.869   10.352  -4.409  1.00 0.00 ? 286 THR B HB   2 
ATOM   2327 H HG1  . THR B 1 15 ? 8.256   12.440  -4.535  1.00 0.00 ? 286 THR B HG1  2 
ATOM   2328 H HG21 . THR B 1 15 ? 8.738   10.249  -7.268  1.00 0.00 ? 286 THR B HG21 2 
ATOM   2329 H HG22 . THR B 1 15 ? 9.825   10.984  -6.090  1.00 0.00 ? 286 THR B HG22 2 
ATOM   2330 H HG23 . THR B 1 15 ? 9.308   9.309   -5.889  1.00 0.00 ? 286 THR B HG23 2 
ATOM   2331 N N    . LEU B 1 16 ? 5.152   9.959   -4.089  1.00 0.00 ? 287 LEU B N    2 
ATOM   2332 C CA   . LEU B 1 16 ? 4.395   9.157   -3.136  1.00 0.00 ? 287 LEU B CA   2 
ATOM   2333 C C    . LEU B 1 16 ? 3.393   8.287   -3.897  1.00 0.00 ? 287 LEU B C    2 
ATOM   2334 O O    . LEU B 1 16 ? 3.380   7.079   -3.767  1.00 0.00 ? 287 LEU B O    2 
ATOM   2335 C CB   . LEU B 1 16 ? 3.645   10.078  -2.170  1.00 0.00 ? 287 LEU B CB   2 
ATOM   2336 C CG   . LEU B 1 16 ? 4.473   10.269  -0.899  1.00 0.00 ? 287 LEU B CG   2 
ATOM   2337 C CD1  . LEU B 1 16 ? 4.905   11.733  -0.786  1.00 0.00 ? 287 LEU B CD1  2 
ATOM   2338 C CD2  . LEU B 1 16 ? 3.628   9.893   0.320   1.00 0.00 ? 287 LEU B CD2  2 
ATOM   2339 H H    . LEU B 1 16 ? 5.219   10.930  -3.969  1.00 0.00 ? 287 LEU B H    2 
ATOM   2340 H HA   . LEU B 1 16 ? 5.071   8.526   -2.578  1.00 0.00 ? 287 LEU B HA   2 
ATOM   2341 H HB2  . LEU B 1 16 ? 3.481   11.036  -2.643  1.00 0.00 ? 287 LEU B HB2  2 
ATOM   2342 H HB3  . LEU B 1 16 ? 2.695   9.634   -1.915  1.00 0.00 ? 287 LEU B HB3  2 
ATOM   2343 H HG   . LEU B 1 16 ? 5.349   9.638   -0.942  1.00 0.00 ? 287 LEU B HG   2 
ATOM   2344 H HD11 . LEU B 1 16 ? 4.312   12.336  -1.459  1.00 0.00 ? 287 LEU B HD11 2 
ATOM   2345 H HD12 . LEU B 1 16 ? 4.757   12.074  0.228   1.00 0.00 ? 287 LEU B HD12 2 
ATOM   2346 H HD13 . LEU B 1 16 ? 5.949   11.822  -1.047  1.00 0.00 ? 287 LEU B HD13 2 
ATOM   2347 H HD21 . LEU B 1 16 ? 3.177   8.924   0.162   1.00 0.00 ? 287 LEU B HD21 2 
ATOM   2348 H HD22 . LEU B 1 16 ? 4.257   9.857   1.197   1.00 0.00 ? 287 LEU B HD22 2 
ATOM   2349 H HD23 . LEU B 1 16 ? 2.853   10.632  0.463   1.00 0.00 ? 287 LEU B HD23 2 
ATOM   2350 N N    . LYS B 1 17 ? 2.556   8.893   -4.694  1.00 0.00 ? 288 LYS B N    2 
ATOM   2351 C CA   . LYS B 1 17 ? 1.581   8.117   -5.451  1.00 0.00 ? 288 LYS B CA   2 
ATOM   2352 C C    . LYS B 1 17 ? 2.298   6.981   -6.181  1.00 0.00 ? 288 LYS B C    2 
ATOM   2353 O O    . LYS B 1 17 ? 1.789   5.885   -6.299  1.00 0.00 ? 288 LYS B O    2 
ATOM   2354 C CB   . LYS B 1 17 ? 0.889   9.023   -6.472  1.00 0.00 ? 288 LYS B CB   2 
ATOM   2355 C CG   . LYS B 1 17 ? -0.594  9.150   -6.122  1.00 0.00 ? 288 LYS B CG   2 
ATOM   2356 C CD   . LYS B 1 17 ? -0.932  10.617  -5.852  1.00 0.00 ? 288 LYS B CD   2 
ATOM   2357 C CE   . LYS B 1 17 ? -1.197  11.334  -7.176  1.00 0.00 ? 288 LYS B CE   2 
ATOM   2358 N NZ   . LYS B 1 17 ? -2.313  12.306  -7.002  1.00 0.00 ? 288 LYS B NZ   2 
ATOM   2359 H H    . LYS B 1 17 ? 2.585   9.868   -4.786  1.00 0.00 ? 288 LYS B H    2 
ATOM   2360 H HA   . LYS B 1 17 ? 0.843   7.706   -4.777  1.00 0.00 ? 288 LYS B HA   2 
ATOM   2361 H HB2  . LYS B 1 17 ? 1.348   10.001  -6.453  1.00 0.00 ? 288 LYS B HB2  2 
ATOM   2362 H HB3  . LYS B 1 17 ? 0.990   8.596   -7.458  1.00 0.00 ? 288 LYS B HB3  2 
ATOM   2363 H HG2  . LYS B 1 17 ? -1.190  8.788   -6.949  1.00 0.00 ? 288 LYS B HG2  2 
ATOM   2364 H HG3  . LYS B 1 17 ? -0.808  8.564   -5.241  1.00 0.00 ? 288 LYS B HG3  2 
ATOM   2365 H HD2  . LYS B 1 17 ? -1.812  10.675  -5.228  1.00 0.00 ? 288 LYS B HD2  2 
ATOM   2366 H HD3  . LYS B 1 17 ? -0.102  11.091  -5.347  1.00 0.00 ? 288 LYS B HD3  2 
ATOM   2367 H HE2  . LYS B 1 17 ? -0.305  11.861  -7.485  1.00 0.00 ? 288 LYS B HE2  2 
ATOM   2368 H HE3  . LYS B 1 17 ? -1.465  10.609  -7.930  1.00 0.00 ? 288 LYS B HE3  2 
ATOM   2369 H HZ1  . LYS B 1 17 ? -2.842  12.073  -6.135  1.00 0.00 ? 288 LYS B HZ1  2 
ATOM   2370 H HZ2  . LYS B 1 17 ? -1.928  13.268  -6.925  1.00 0.00 ? 288 LYS B HZ2  2 
ATOM   2371 H HZ3  . LYS B 1 17 ? -2.951  12.254  -7.821  1.00 0.00 ? 288 LYS B HZ3  2 
ATOM   2372 N N    . ALA B 1 18 ? 3.481   7.237   -6.669  1.00 0.00 ? 289 ALA B N    2 
ATOM   2373 C CA   . ALA B 1 18 ? 4.220   6.196   -7.375  1.00 0.00 ? 289 ALA B CA   2 
ATOM   2374 C C    . ALA B 1 18 ? 4.367   4.973   -6.471  1.00 0.00 ? 289 ALA B C    2 
ATOM   2375 O O    . ALA B 1 18 ? 3.866   3.906   -6.765  1.00 0.00 ? 289 ALA B O    2 
ATOM   2376 C CB   . ALA B 1 18 ? 5.611   6.715   -7.740  1.00 0.00 ? 289 ALA B CB   2 
ATOM   2377 H H    . ALA B 1 18 ? 3.874   8.128   -6.561  1.00 0.00 ? 289 ALA B H    2 
ATOM   2378 H HA   . ALA B 1 18 ? 3.692   5.922   -8.274  1.00 0.00 ? 289 ALA B HA   2 
ATOM   2379 H HB1  . ALA B 1 18 ? 5.730   7.721   -7.364  1.00 0.00 ? 289 ALA B HB1  2 
ATOM   2380 H HB2  . ALA B 1 18 ? 6.360   6.074   -7.297  1.00 0.00 ? 289 ALA B HB2  2 
ATOM   2381 H HB3  . ALA B 1 18 ? 5.725   6.716   -8.813  1.00 0.00 ? 289 ALA B HB3  2 
ATOM   2382 N N    . GLN B 1 19 ? 5.055   5.119   -5.374  1.00 0.00 ? 290 GLN B N    2 
ATOM   2383 C CA   . GLN B 1 19 ? 5.239   3.989   -4.472  1.00 0.00 ? 290 GLN B CA   2 
ATOM   2384 C C    . GLN B 1 19 ? 3.891   3.307   -4.223  1.00 0.00 ? 290 GLN B C    2 
ATOM   2385 O O    . GLN B 1 19 ? 3.785   2.097   -4.239  1.00 0.00 ? 290 GLN B O    2 
ATOM   2386 C CB   . GLN B 1 19 ? 5.813   4.484   -3.144  1.00 0.00 ? 290 GLN B CB   2 
ATOM   2387 C CG   . GLN B 1 19 ? 7.277   4.886   -3.338  1.00 0.00 ? 290 GLN B CG   2 
ATOM   2388 C CD   . GLN B 1 19 ? 7.687   5.873   -2.244  1.00 0.00 ? 290 GLN B CD   2 
ATOM   2389 O OE1  . GLN B 1 19 ? 8.094   6.981   -2.531  1.00 0.00 ? 290 GLN B OE1  2 
ATOM   2390 N NE2  . GLN B 1 19 ? 7.596   5.515   -0.993  1.00 0.00 ? 290 GLN B NE2  2 
ATOM   2391 H H    . GLN B 1 19 ? 5.455   5.989   -5.158  1.00 0.00 ? 290 GLN B H    2 
ATOM   2392 H HA   . GLN B 1 19 ? 5.923   3.285   -4.917  1.00 0.00 ? 290 GLN B HA   2 
ATOM   2393 H HB2  . GLN B 1 19 ? 5.247   5.339   -2.803  1.00 0.00 ? 290 GLN B HB2  2 
ATOM   2394 H HB3  . GLN B 1 19 ? 5.753   3.696   -2.409  1.00 0.00 ? 290 GLN B HB3  2 
ATOM   2395 H HG2  . GLN B 1 19 ? 7.902   4.006   -3.282  1.00 0.00 ? 290 GLN B HG2  2 
ATOM   2396 H HG3  . GLN B 1 19 ? 7.397   5.352   -4.304  1.00 0.00 ? 290 GLN B HG3  2 
ATOM   2397 H HE21 . GLN B 1 19 ? 7.268   4.621   -0.761  1.00 0.00 ? 290 GLN B HE21 2 
ATOM   2398 H HE22 . GLN B 1 19 ? 7.856   6.141   -0.284  1.00 0.00 ? 290 GLN B HE22 2 
ATOM   2399 N N    . ASN B 1 20 ? 2.861   4.073   -3.991  1.00 0.00 ? 291 ASN B N    2 
ATOM   2400 C CA   . ASN B 1 20 ? 1.551   3.479   -3.746  1.00 0.00 ? 291 ASN B CA   2 
ATOM   2401 C C    . ASN B 1 20 ? 1.225   2.477   -4.856  1.00 0.00 ? 291 ASN B C    2 
ATOM   2402 O O    . ASN B 1 20 ? 1.097   1.293   -4.617  1.00 0.00 ? 291 ASN B O    2 
ATOM   2403 C CB   . ASN B 1 20 ? 0.489   4.579   -3.722  1.00 0.00 ? 291 ASN B CB   2 
ATOM   2404 C CG   . ASN B 1 20 ? 0.168   4.949   -2.273  1.00 0.00 ? 291 ASN B CG   2 
ATOM   2405 O OD1  . ASN B 1 20 ? 0.950   4.690   -1.381  1.00 0.00 ? 291 ASN B OD1  2 
ATOM   2406 N ND2  . ASN B 1 20 ? -0.957  5.550   -2.000  1.00 0.00 ? 291 ASN B ND2  2 
ATOM   2407 H H    . ASN B 1 20 ? 2.967   5.047   -3.981  1.00 0.00 ? 291 ASN B H    2 
ATOM   2408 H HA   . ASN B 1 20 ? 1.561   2.970   -2.793  1.00 0.00 ? 291 ASN B HA   2 
ATOM   2409 H HB2  . ASN B 1 20 ? 0.860   5.448   -4.245  1.00 0.00 ? 291 ASN B HB2  2 
ATOM   2410 H HB3  . ASN B 1 20 ? -0.408  4.222   -4.207  1.00 0.00 ? 291 ASN B HB3  2 
ATOM   2411 H HD21 . ASN B 1 20 ? -1.589  5.760   -2.719  1.00 0.00 ? 291 ASN B HD21 2 
ATOM   2412 H HD22 . ASN B 1 20 ? -1.172  5.792   -1.075  1.00 0.00 ? 291 ASN B HD22 2 
ATOM   2413 N N    . SER B 1 21 ? 1.087   2.942   -6.068  1.00 0.00 ? 292 SER B N    2 
ATOM   2414 C CA   . SER B 1 21 ? 0.772   2.033   -7.164  1.00 0.00 ? 292 SER B CA   2 
ATOM   2415 C C    . SER B 1 21 ? 1.857   0.957   -7.264  1.00 0.00 ? 292 SER B C    2 
ATOM   2416 O O    . SER B 1 21 ? 1.620   -0.134  -7.747  1.00 0.00 ? 292 SER B O    2 
ATOM   2417 C CB   . SER B 1 21 ? 0.709   2.816   -8.476  1.00 0.00 ? 292 SER B CB   2 
ATOM   2418 O OG   . SER B 1 21 ? -0.634  2.844   -8.945  1.00 0.00 ? 292 SER B OG   2 
ATOM   2419 H H    . SER B 1 21 ? 1.192   3.901   -6.241  1.00 0.00 ? 292 SER B H    2 
ATOM   2420 H HA   . SER B 1 21 ? -0.183  1.565   -6.981  1.00 0.00 ? 292 SER B HA   2 
ATOM   2421 H HB2  . SER B 1 21 ? 1.047   3.826   -8.311  1.00 0.00 ? 292 SER B HB2  2 
ATOM   2422 H HB3  . SER B 1 21 ? 1.347   2.341   -9.210  1.00 0.00 ? 292 SER B HB3  2 
ATOM   2423 H HG   . SER B 1 21 ? -1.215  2.707   -8.193  1.00 0.00 ? 292 SER B HG   2 
ATOM   2424 N N    . GLU B 1 22 ? 3.044   1.254   -6.814  1.00 0.00 ? 293 GLU B N    2 
ATOM   2425 C CA   . GLU B 1 22 ? 4.117   0.270   -6.884  1.00 0.00 ? 293 GLU B CA   2 
ATOM   2426 C C    . GLU B 1 22 ? 3.840   -0.862  -5.892  1.00 0.00 ? 293 GLU B C    2 
ATOM   2427 O O    . GLU B 1 22 ? 3.445   -1.948  -6.268  1.00 0.00 ? 293 GLU B O    2 
ATOM   2428 C CB   . GLU B 1 22 ? 5.447   0.939   -6.531  1.00 0.00 ? 293 GLU B CB   2 
ATOM   2429 C CG   . GLU B 1 22 ? 6.107   1.470   -7.805  1.00 0.00 ? 293 GLU B CG   2 
ATOM   2430 C CD   . GLU B 1 22 ? 7.257   2.408   -7.431  1.00 0.00 ? 293 GLU B CD   2 
ATOM   2431 O OE1  . GLU B 1 22 ? 7.971   2.093   -6.494  1.00 0.00 ? 293 GLU B OE1  2 
ATOM   2432 O OE2  . GLU B 1 22 ? 7.401   3.427   -8.088  1.00 0.00 ? 293 GLU B OE2  2 
ATOM   2433 H H    . GLU B 1 22 ? 3.215   2.139   -6.430  1.00 0.00 ? 293 GLU B H    2 
ATOM   2434 H HA   . GLU B 1 22 ? 4.174   -0.133  -7.884  1.00 0.00 ? 293 GLU B HA   2 
ATOM   2435 H HB2  . GLU B 1 22 ? 5.267   1.758   -5.850  1.00 0.00 ? 293 GLU B HB2  2 
ATOM   2436 H HB3  . GLU B 1 22 ? 6.100   0.218   -6.063  1.00 0.00 ? 293 GLU B HB3  2 
ATOM   2437 H HG2  . GLU B 1 22 ? 6.492   0.640   -8.382  1.00 0.00 ? 293 GLU B HG2  2 
ATOM   2438 H HG3  . GLU B 1 22 ? 5.380   2.010   -8.391  1.00 0.00 ? 293 GLU B HG3  2 
ATOM   2439 N N    . LEU B 1 23 ? 4.048   -0.616  -4.628  1.00 0.00 ? 294 LEU B N    2 
ATOM   2440 C CA   . LEU B 1 23 ? 3.808   -1.653  -3.631  1.00 0.00 ? 294 LEU B CA   2 
ATOM   2441 C C    . LEU B 1 23 ? 2.398   -2.222  -3.805  1.00 0.00 ? 294 LEU B C    2 
ATOM   2442 O O    . LEU B 1 23 ? 2.197   -3.421  -3.793  1.00 0.00 ? 294 LEU B O    2 
ATOM   2443 C CB   . LEU B 1 23 ? 3.950   -1.053  -2.231  1.00 0.00 ? 294 LEU B CB   2 
ATOM   2444 C CG   . LEU B 1 23 ? 5.433   -0.922  -1.882  1.00 0.00 ? 294 LEU B CG   2 
ATOM   2445 C CD1  . LEU B 1 23 ? 5.695   0.458   -1.274  1.00 0.00 ? 294 LEU B CD1  2 
ATOM   2446 C CD2  . LEU B 1 23 ? 5.816   -2.005  -0.871  1.00 0.00 ? 294 LEU B CD2  2 
ATOM   2447 H H    . LEU B 1 23 ? 4.369   0.267   -4.348  1.00 0.00 ? 294 LEU B H    2 
ATOM   2448 H HA   . LEU B 1 23 ? 4.532   -2.444  -3.754  1.00 0.00 ? 294 LEU B HA   2 
ATOM   2449 H HB2  . LEU B 1 23 ? 3.485   -0.077  -2.209  1.00 0.00 ? 294 LEU B HB2  2 
ATOM   2450 H HB3  . LEU B 1 23 ? 3.469   -1.699  -1.512  1.00 0.00 ? 294 LEU B HB3  2 
ATOM   2451 H HG   . LEU B 1 23 ? 6.024   -1.038  -2.779  1.00 0.00 ? 294 LEU B HG   2 
ATOM   2452 H HD11 . LEU B 1 23 ? 5.021   0.620   -0.445  1.00 0.00 ? 294 LEU B HD11 2 
ATOM   2453 H HD12 . LEU B 1 23 ? 6.715   0.508   -0.923  1.00 0.00 ? 294 LEU B HD12 2 
ATOM   2454 H HD13 . LEU B 1 23 ? 5.534   1.219   -2.023  1.00 0.00 ? 294 LEU B HD13 2 
ATOM   2455 H HD21 . LEU B 1 23 ? 4.935   -2.322  -0.333  1.00 0.00 ? 294 LEU B HD21 2 
ATOM   2456 H HD22 . LEU B 1 23 ? 6.243   -2.849  -1.393  1.00 0.00 ? 294 LEU B HD22 2 
ATOM   2457 H HD23 . LEU B 1 23 ? 6.539   -1.607  -0.175  1.00 0.00 ? 294 LEU B HD23 2 
ATOM   2458 N N    . ALA B 1 24 ? 1.418   -1.375  -3.967  1.00 0.00 ? 295 ALA B N    2 
ATOM   2459 C CA   . ALA B 1 24 ? 0.054   -1.862  -4.135  1.00 0.00 ? 295 ALA B CA   2 
ATOM   2460 C C    . ALA B 1 24 ? 0.034   -2.977  -5.184  1.00 0.00 ? 295 ALA B C    2 
ATOM   2461 O O    . ALA B 1 24 ? -0.369  -4.090  -4.914  1.00 0.00 ? 295 ALA B O    2 
ATOM   2462 C CB   . ALA B 1 24 ? -0.847  -0.714  -4.593  1.00 0.00 ? 295 ALA B CB   2 
ATOM   2463 H H    . ALA B 1 24 ? 1.600   -0.412  -3.972  1.00 0.00 ? 295 ALA B H    2 
ATOM   2464 H HA   . ALA B 1 24 ? -0.308  -2.248  -3.194  1.00 0.00 ? 295 ALA B HA   2 
ATOM   2465 H HB1  . ALA B 1 24 ? -0.826  0.076   -3.856  1.00 0.00 ? 295 ALA B HB1  2 
ATOM   2466 H HB2  . ALA B 1 24 ? -0.491  -0.333  -5.539  1.00 0.00 ? 295 ALA B HB2  2 
ATOM   2467 H HB3  . ALA B 1 24 ? -1.859  -1.074  -4.707  1.00 0.00 ? 295 ALA B HB3  2 
ATOM   2468 N N    . SER B 1 25 ? 0.464   -2.685  -6.381  1.00 0.00 ? 296 SER B N    2 
ATOM   2469 C CA   . SER B 1 25 ? 0.467   -3.702  -7.425  1.00 0.00 ? 296 SER B CA   2 
ATOM   2470 C C    . SER B 1 25 ? 1.111   -4.985  -6.891  1.00 0.00 ? 296 SER B C    2 
ATOM   2471 O O    . SER B 1 25 ? 0.575   -6.067  -7.038  1.00 0.00 ? 296 SER B O    2 
ATOM   2472 C CB   . SER B 1 25 ? 1.260   -3.196  -8.630  1.00 0.00 ? 296 SER B CB   2 
ATOM   2473 O OG   . SER B 1 25 ? 0.700   -3.732  -9.820  1.00 0.00 ? 296 SER B OG   2 
ATOM   2474 H H    . SER B 1 25 ? 0.784   -1.779  -6.578  1.00 0.00 ? 296 SER B H    2 
ATOM   2475 H HA   . SER B 1 25 ? -0.548  -3.909  -7.728  1.00 0.00 ? 296 SER B HA   2 
ATOM   2476 H HB2  . SER B 1 25 ? 1.212   -2.120  -8.669  1.00 0.00 ? 296 SER B HB2  2 
ATOM   2477 H HB3  . SER B 1 25 ? 2.294   -3.504  -8.535  1.00 0.00 ? 296 SER B HB3  2 
ATOM   2478 H HG   . SER B 1 25 ? 0.070   -3.095  -10.165 1.00 0.00 ? 296 SER B HG   2 
ATOM   2479 N N    . THR B 1 26 ? 2.257   -4.876  -6.277  1.00 0.00 ? 297 THR B N    2 
ATOM   2480 C CA   . THR B 1 26 ? 2.917   -6.066  -5.751  1.00 0.00 ? 297 THR B CA   2 
ATOM   2481 C C    . THR B 1 26 ? 1.969   -6.795  -4.798  1.00 0.00 ? 297 THR B C    2 
ATOM   2482 O O    . THR B 1 26 ? 1.707   -7.972  -4.945  1.00 0.00 ? 297 THR B O    2 
ATOM   2483 C CB   . THR B 1 26 ? 4.186   -5.659  -4.999  1.00 0.00 ? 297 THR B CB   2 
ATOM   2484 O OG1  . THR B 1 26 ? 4.895   -4.692  -5.760  1.00 0.00 ? 297 THR B OG1  2 
ATOM   2485 C CG2  . THR B 1 26 ? 5.070   -6.889  -4.784  1.00 0.00 ? 297 THR B CG2  2 
ATOM   2486 H H    . THR B 1 26 ? 2.674   -3.997  -6.170  1.00 0.00 ? 297 THR B H    2 
ATOM   2487 H HA   . THR B 1 26 ? 3.178   -6.722  -6.566  1.00 0.00 ? 297 THR B HA   2 
ATOM   2488 H HB   . THR B 1 26 ? 3.920   -5.241  -4.041  1.00 0.00 ? 297 THR B HB   2 
ATOM   2489 H HG1  . THR B 1 26 ? 4.703   -3.826  -5.392  1.00 0.00 ? 297 THR B HG1  2 
ATOM   2490 H HG21 . THR B 1 26 ? 5.325   -7.321  -5.741  1.00 0.00 ? 297 THR B HG21 2 
ATOM   2491 H HG22 . THR B 1 26 ? 5.972   -6.599  -4.268  1.00 0.00 ? 297 THR B HG22 2 
ATOM   2492 H HG23 . THR B 1 26 ? 4.535   -7.618  -4.192  1.00 0.00 ? 297 THR B HG23 2 
ATOM   2493 N N    . ALA B 1 27 ? 1.451   -6.105  -3.819  1.00 0.00 ? 298 ALA B N    2 
ATOM   2494 C CA   . ALA B 1 27 ? 0.539   -6.744  -2.878  1.00 0.00 ? 298 ALA B CA   2 
ATOM   2495 C C    . ALA B 1 27 ? -0.648  -7.337  -3.640  1.00 0.00 ? 298 ALA B C    2 
ATOM   2496 O O    . ALA B 1 27 ? -1.271  -8.282  -3.200  1.00 0.00 ? 298 ALA B O    2 
ATOM   2497 C CB   . ALA B 1 27 ? 0.034   -5.706  -1.877  1.00 0.00 ? 298 ALA B CB   2 
ATOM   2498 H H    . ALA B 1 27 ? 1.674   -5.156  -3.718  1.00 0.00 ? 298 ALA B H    2 
ATOM   2499 H HA   . ALA B 1 27 ? 1.058   -7.529  -2.349  1.00 0.00 ? 298 ALA B HA   2 
ATOM   2500 H HB1  . ALA B 1 27 ? 0.434   -4.736  -2.134  1.00 0.00 ? 298 ALA B HB1  2 
ATOM   2501 H HB2  . ALA B 1 27 ? -1.044  -5.671  -1.908  1.00 0.00 ? 298 ALA B HB2  2 
ATOM   2502 H HB3  . ALA B 1 27 ? 0.358   -5.977  -0.883  1.00 0.00 ? 298 ALA B HB3  2 
ATOM   2503 N N    . ASN B 1 28 ? -0.964  -6.788  -4.780  1.00 0.00 ? 299 ASN B N    2 
ATOM   2504 C CA   . ASN B 1 28 ? -2.088  -7.304  -5.555  1.00 0.00 ? 299 ASN B CA   2 
ATOM   2505 C C    . ASN B 1 28 ? -1.722  -8.669  -6.144  1.00 0.00 ? 299 ASN B C    2 
ATOM   2506 O O    . ASN B 1 28 ? -2.461  -9.626  -6.020  1.00 0.00 ? 299 ASN B O    2 
ATOM   2507 C CB   . ASN B 1 28 ? -2.414  -6.330  -6.689  1.00 0.00 ? 299 ASN B CB   2 
ATOM   2508 C CG   . ASN B 1 28 ? -3.709  -6.762  -7.378  1.00 0.00 ? 299 ASN B CG   2 
ATOM   2509 O OD1  . ASN B 1 28 ? -3.756  -7.794  -8.017  1.00 0.00 ? 299 ASN B OD1  2 
ATOM   2510 N ND2  . ASN B 1 28 ? -4.770  -6.010  -7.275  1.00 0.00 ? 299 ASN B ND2  2 
ATOM   2511 H H    . ASN B 1 28 ? -0.447  -6.025  -5.116  1.00 0.00 ? 299 ASN B H    2 
ATOM   2512 H HA   . ASN B 1 28 ? -2.949  -7.407  -4.913  1.00 0.00 ? 299 ASN B HA   2 
ATOM   2513 H HB2  . ASN B 1 28 ? -2.534  -5.335  -6.284  1.00 0.00 ? 299 ASN B HB2  2 
ATOM   2514 H HB3  . ASN B 1 28 ? -1.608  -6.331  -7.407  1.00 0.00 ? 299 ASN B HB3  2 
ATOM   2515 H HD21 . ASN B 1 28 ? -4.733  -5.178  -6.759  1.00 0.00 ? 299 ASN B HD21 2 
ATOM   2516 H HD22 . ASN B 1 28 ? -5.606  -6.277  -7.712  1.00 0.00 ? 299 ASN B HD22 2 
ATOM   2517 N N    . MET B 1 29 ? -0.592  -8.767  -6.787  1.00 0.00 ? 300 MET B N    2 
ATOM   2518 C CA   . MET B 1 29 ? -0.193  -10.043 -7.373  1.00 0.00 ? 300 MET B CA   2 
ATOM   2519 C C    . MET B 1 29 ? 0.031   -11.073 -6.262  1.00 0.00 ? 300 MET B C    2 
ATOM   2520 O O    . MET B 1 29 ? -0.514  -12.157 -6.289  1.00 0.00 ? 300 MET B O    2 
ATOM   2521 C CB   . MET B 1 29 ? 1.103   -9.859  -8.166  1.00 0.00 ? 300 MET B CB   2 
ATOM   2522 C CG   . MET B 1 29 ? 1.638   -11.226 -8.593  1.00 0.00 ? 300 MET B CG   2 
ATOM   2523 S SD   . MET B 1 29 ? 3.286   -11.030 -9.315  1.00 0.00 ? 300 MET B SD   2 
ATOM   2524 C CE   . MET B 1 29 ? 2.750   -10.510 -10.963 1.00 0.00 ? 300 MET B CE   2 
ATOM   2525 H H    . MET B 1 29 ? -0.010  -7.983  -6.879  1.00 0.00 ? 300 MET B H    2 
ATOM   2526 H HA   . MET B 1 29 ? -0.970  -10.393 -8.036  1.00 0.00 ? 300 MET B HA   2 
ATOM   2527 H HB2  . MET B 1 29 ? 0.906   -9.258  -9.042  1.00 0.00 ? 300 MET B HB2  2 
ATOM   2528 H HB3  . MET B 1 29 ? 1.836   -9.365  -7.547  1.00 0.00 ? 300 MET B HB3  2 
ATOM   2529 H HG2  . MET B 1 29 ? 1.698   -11.875 -7.730  1.00 0.00 ? 300 MET B HG2  2 
ATOM   2530 H HG3  . MET B 1 29 ? 0.973   -11.662 -9.324  1.00 0.00 ? 300 MET B HG3  2 
ATOM   2531 H HE1  . MET B 1 29 ? 1.971   -11.173 -11.314 1.00 0.00 ? 300 MET B HE1  2 
ATOM   2532 H HE2  . MET B 1 29 ? 2.375   -9.497  -10.916 1.00 0.00 ? 300 MET B HE2  2 
ATOM   2533 H HE3  . MET B 1 29 ? 3.585   -10.550 -11.644 1.00 0.00 ? 300 MET B HE3  2 
ATOM   2534 N N    . LEU B 1 30 ? 0.833   -10.741 -5.289  1.00 0.00 ? 301 LEU B N    2 
ATOM   2535 C CA   . LEU B 1 30 ? 1.090   -11.680 -4.202  1.00 0.00 ? 301 LEU B CA   2 
ATOM   2536 C C    . LEU B 1 30 ? -0.233  -12.263 -3.700  1.00 0.00 ? 301 LEU B C    2 
ATOM   2537 O O    . LEU B 1 30 ? -0.427  -13.462 -3.681  1.00 0.00 ? 301 LEU B O    2 
ATOM   2538 C CB   . LEU B 1 30 ? 1.796   -10.952 -3.056  1.00 0.00 ? 301 LEU B CB   2 
ATOM   2539 C CG   . LEU B 1 30 ? 3.121   -10.376 -3.559  1.00 0.00 ? 301 LEU B CG   2 
ATOM   2540 C CD1  . LEU B 1 30 ? 3.715   -9.453  -2.494  1.00 0.00 ? 301 LEU B CD1  2 
ATOM   2541 C CD2  . LEU B 1 30 ? 4.097   -11.520 -3.842  1.00 0.00 ? 301 LEU B CD2  2 
ATOM   2542 H H    . LEU B 1 30 ? 1.264   -9.861  -5.287  1.00 0.00 ? 301 LEU B H    2 
ATOM   2543 H HA   . LEU B 1 30 ? 1.722   -12.479 -4.559  1.00 0.00 ? 301 LEU B HA   2 
ATOM   2544 H HB2  . LEU B 1 30 ? 1.167   -10.150 -2.699  1.00 0.00 ? 301 LEU B HB2  2 
ATOM   2545 H HB3  . LEU B 1 30 ? 1.989   -11.645 -2.252  1.00 0.00 ? 301 LEU B HB3  2 
ATOM   2546 H HG   . LEU B 1 30 ? 2.948   -9.814  -4.466  1.00 0.00 ? 301 LEU B HG   2 
ATOM   2547 H HD11 . LEU B 1 30 ? 3.016   -8.659  -2.274  1.00 0.00 ? 301 LEU B HD11 2 
ATOM   2548 H HD12 . LEU B 1 30 ? 3.910   -10.019 -1.595  1.00 0.00 ? 301 LEU B HD12 2 
ATOM   2549 H HD13 . LEU B 1 30 ? 4.638   -9.028  -2.859  1.00 0.00 ? 301 LEU B HD13 2 
ATOM   2550 H HD21 . LEU B 1 30 ? 3.740   -12.423 -3.371  1.00 0.00 ? 301 LEU B HD21 2 
ATOM   2551 H HD22 . LEU B 1 30 ? 4.170   -11.675 -4.909  1.00 0.00 ? 301 LEU B HD22 2 
ATOM   2552 H HD23 . LEU B 1 30 ? 5.070   -11.268 -3.448  1.00 0.00 ? 301 LEU B HD23 2 
ATOM   2553 N N    . ARG B 1 31 ? -1.144  -11.424 -3.289  1.00 0.00 ? 302 ARG B N    2 
ATOM   2554 C CA   . ARG B 1 31 ? -2.425  -11.919 -2.794  1.00 0.00 ? 302 ARG B CA   2 
ATOM   2555 C C    . ARG B 1 31 ? -3.063  -12.836 -3.841  1.00 0.00 ? 302 ARG B C    2 
ATOM   2556 O O    . ARG B 1 31 ? -3.675  -13.833 -3.515  1.00 0.00 ? 302 ARG B O    2 
ATOM   2557 C CB   . ARG B 1 31 ? -3.355  -10.737 -2.520  1.00 0.00 ? 302 ARG B CB   2 
ATOM   2558 C CG   . ARG B 1 31 ? -4.312  -11.091 -1.379  1.00 0.00 ? 302 ARG B CG   2 
ATOM   2559 C CD   . ARG B 1 31 ? -4.311  -9.964  -0.345  1.00 0.00 ? 302 ARG B CD   2 
ATOM   2560 N NE   . ARG B 1 31 ? -5.528  -9.174  -0.488  1.00 0.00 ? 302 ARG B NE   2 
ATOM   2561 C CZ   . ARG B 1 31 ? -5.887  -8.349  0.458   1.00 0.00 ? 302 ARG B CZ   2 
ATOM   2562 N NH1  . ARG B 1 31 ? -5.989  -8.771  1.689   1.00 0.00 ? 302 ARG B NH1  2 
ATOM   2563 N NH2  . ARG B 1 31 ? -6.140  -7.101  0.172   1.00 0.00 ? 302 ARG B NH2  2 
ATOM   2564 H H    . ARG B 1 31 ? -0.967  -10.460 -3.309  1.00 0.00 ? 302 ARG B H    2 
ATOM   2565 H HA   . ARG B 1 31 ? -2.269  -12.471 -1.880  1.00 0.00 ? 302 ARG B HA   2 
ATOM   2566 H HB2  . ARG B 1 31 ? -2.767  -9.873  -2.242  1.00 0.00 ? 302 ARG B HB2  2 
ATOM   2567 H HB3  . ARG B 1 31 ? -3.926  -10.514 -3.408  1.00 0.00 ? 302 ARG B HB3  2 
ATOM   2568 H HG2  . ARG B 1 31 ? -5.310  -11.219 -1.774  1.00 0.00 ? 302 ARG B HG2  2 
ATOM   2569 H HG3  . ARG B 1 31 ? -3.989  -12.008 -0.910  1.00 0.00 ? 302 ARG B HG3  2 
ATOM   2570 H HD2  . ARG B 1 31 ? -4.271  -10.386 0.648   1.00 0.00 ? 302 ARG B HD2  2 
ATOM   2571 H HD3  . ARG B 1 31 ? -3.448  -9.332  -0.503  1.00 0.00 ? 302 ARG B HD3  2 
ATOM   2572 H HE   . ARG B 1 31 ? -6.078  -9.264  -1.294  1.00 0.00 ? 302 ARG B HE   2 
ATOM   2573 H HH11 . ARG B 1 31 ? -5.794  -9.727  1.907   1.00 0.00 ? 302 ARG B HH11 2 
ATOM   2574 H HH12 . ARG B 1 31 ? -6.263  -8.138  2.413   1.00 0.00 ? 302 ARG B HH12 2 
ATOM   2575 H HH21 . ARG B 1 31 ? -6.061  -6.778  -0.771  1.00 0.00 ? 302 ARG B HH21 2 
ATOM   2576 H HH22 . ARG B 1 31 ? -6.415  -6.468  0.896   1.00 0.00 ? 302 ARG B HH22 2 
ATOM   2577 N N    . GLU B 1 32 ? -2.929  -12.505 -5.096  1.00 0.00 ? 303 GLU B N    2 
ATOM   2578 C CA   . GLU B 1 32 ? -3.522  -13.336 -6.138  1.00 0.00 ? 303 GLU B CA   2 
ATOM   2579 C C    . GLU B 1 32 ? -2.903  -14.736 -6.097  1.00 0.00 ? 303 GLU B C    2 
ATOM   2580 O O    . GLU B 1 32 ? -3.591  -15.731 -6.216  1.00 0.00 ? 303 GLU B O    2 
ATOM   2581 C CB   . GLU B 1 32 ? -3.263  -12.702 -7.505  1.00 0.00 ? 303 GLU B CB   2 
ATOM   2582 C CG   . GLU B 1 32 ? -4.091  -11.422 -7.638  1.00 0.00 ? 303 GLU B CG   2 
ATOM   2583 C CD   . GLU B 1 32 ? -5.100  -11.582 -8.776  1.00 0.00 ? 303 GLU B CD   2 
ATOM   2584 O OE1  . GLU B 1 32 ? -4.709  -12.073 -9.823  1.00 0.00 ? 303 GLU B OE1  2 
ATOM   2585 O OE2  . GLU B 1 32 ? -6.246  -11.210 -8.584  1.00 0.00 ? 303 GLU B OE2  2 
ATOM   2586 H H    . GLU B 1 32 ? -2.435  -11.694 -5.338  1.00 0.00 ? 303 GLU B H    2 
ATOM   2587 H HA   . GLU B 1 32 ? -4.586  -13.411 -5.975  1.00 0.00 ? 303 GLU B HA   2 
ATOM   2588 H HB2  . GLU B 1 32 ? -2.213  -12.465 -7.599  1.00 0.00 ? 303 GLU B HB2  2 
ATOM   2589 H HB3  . GLU B 1 32 ? -3.547  -13.394 -8.283  1.00 0.00 ? 303 GLU B HB3  2 
ATOM   2590 H HG2  . GLU B 1 32 ? -4.618  -11.238 -6.712  1.00 0.00 ? 303 GLU B HG2  2 
ATOM   2591 H HG3  . GLU B 1 32 ? -3.438  -10.591 -7.852  1.00 0.00 ? 303 GLU B HG3  2 
ATOM   2592 N N    . GLN B 1 33 ? -1.612  -14.825 -5.930  1.00 0.00 ? 304 GLN B N    2 
ATOM   2593 C CA   . GLN B 1 33 ? -0.976  -16.138 -5.883  1.00 0.00 ? 304 GLN B CA   2 
ATOM   2594 C C    . GLN B 1 33 ? -1.467  -16.890 -4.646  1.00 0.00 ? 304 GLN B C    2 
ATOM   2595 O O    . GLN B 1 33 ? -2.058  -17.948 -4.743  1.00 0.00 ? 304 GLN B O    2 
ATOM   2596 C CB   . GLN B 1 33 ? 0.546   -15.980 -5.810  1.00 0.00 ? 304 GLN B CB   2 
ATOM   2597 C CG   . GLN B 1 33 ? 0.990   -14.788 -6.660  1.00 0.00 ? 304 GLN B CG   2 
ATOM   2598 C CD   . GLN B 1 33 ? 0.290   -14.835 -8.021  1.00 0.00 ? 304 GLN B CD   2 
ATOM   2599 O OE1  . GLN B 1 33 ? 0.321   -15.844 -8.698  1.00 0.00 ? 304 GLN B OE1  2 
ATOM   2600 N NE2  . GLN B 1 33 ? -0.344  -13.780 -8.452  1.00 0.00 ? 304 GLN B NE2  2 
ATOM   2601 H H    . GLN B 1 33 ? -1.073  -14.013 -5.835  1.00 0.00 ? 304 GLN B H    2 
ATOM   2602 H HA   . GLN B 1 33 ? -1.236  -16.695 -6.771  1.00 0.00 ? 304 GLN B HA   2 
ATOM   2603 H HB2  . GLN B 1 33 ? 0.840   -15.819 -4.784  1.00 0.00 ? 304 GLN B HB2  2 
ATOM   2604 H HB3  . GLN B 1 33 ? 1.015   -16.878 -6.181  1.00 0.00 ? 304 GLN B HB3  2 
ATOM   2605 H HG2  . GLN B 1 33 ? 0.735   -13.869 -6.154  1.00 0.00 ? 304 GLN B HG2  2 
ATOM   2606 H HG3  . GLN B 1 33 ? 2.059   -14.831 -6.807  1.00 0.00 ? 304 GLN B HG3  2 
ATOM   2607 H HE21 . GLN B 1 33 ? -0.369  -12.966 -7.906  1.00 0.00 ? 304 GLN B HE21 2 
ATOM   2608 H HE22 . GLN B 1 33 ? -0.795  -13.800 -9.321  1.00 0.00 ? 304 GLN B HE22 2 
ATOM   2609 N N    . VAL B 1 34 ? -1.226  -16.353 -3.482  1.00 0.00 ? 305 VAL B N    2 
ATOM   2610 C CA   . VAL B 1 34 ? -1.670  -17.021 -2.264  1.00 0.00 ? 305 VAL B CA   2 
ATOM   2611 C C    . VAL B 1 34 ? -3.165  -17.323 -2.367  1.00 0.00 ? 305 VAL B C    2 
ATOM   2612 O O    . VAL B 1 34 ? -3.670  -18.234 -1.741  1.00 0.00 ? 305 VAL B O    2 
ATOM   2613 C CB   . VAL B 1 34 ? -1.414  -16.111 -1.062  1.00 0.00 ? 305 VAL B CB   2 
ATOM   2614 C CG1  . VAL B 1 34 ? -1.515  -16.928 0.227   1.00 0.00 ? 305 VAL B CG1  2 
ATOM   2615 C CG2  . VAL B 1 34 ? -0.014  -15.504 -1.171  1.00 0.00 ? 305 VAL B CG2  2 
ATOM   2616 H H    . VAL B 1 34 ? -0.746  -15.499 -3.427  1.00 0.00 ? 305 VAL B H    2 
ATOM   2617 H HA   . VAL B 1 34 ? -1.123  -17.943 -2.139  1.00 0.00 ? 305 VAL B HA   2 
ATOM   2618 H HB   . VAL B 1 34 ? -2.151  -15.322 -1.046  1.00 0.00 ? 305 VAL B HB   2 
ATOM   2619 H HG11 . VAL B 1 34 ? -1.981  -17.879 0.015   1.00 0.00 ? 305 VAL B HG11 2 
ATOM   2620 H HG12 . VAL B 1 34 ? -0.525  -17.093 0.627   1.00 0.00 ? 305 VAL B HG12 2 
ATOM   2621 H HG13 . VAL B 1 34 ? -2.110  -16.388 0.949   1.00 0.00 ? 305 VAL B HG13 2 
ATOM   2622 H HG21 . VAL B 1 34 ? 0.536   -16.003 -1.954  1.00 0.00 ? 305 VAL B HG21 2 
ATOM   2623 H HG22 . VAL B 1 34 ? -0.095  -14.452 -1.403  1.00 0.00 ? 305 VAL B HG22 2 
ATOM   2624 H HG23 . VAL B 1 34 ? 0.506   -15.626 -0.231  1.00 0.00 ? 305 VAL B HG23 2 
ATOM   2625 N N    . ALA B 1 35 ? -3.879  -16.565 -3.154  1.00 0.00 ? 306 ALA B N    2 
ATOM   2626 C CA   . ALA B 1 35 ? -5.311  -16.802 -3.294  1.00 0.00 ? 306 ALA B CA   2 
ATOM   2627 C C    . ALA B 1 35 ? -5.543  -18.048 -4.152  1.00 0.00 ? 306 ALA B C    2 
ATOM   2628 O O    . ALA B 1 35 ? -6.340  -18.902 -3.821  1.00 0.00 ? 306 ALA B O    2 
ATOM   2629 C CB   . ALA B 1 35 ? -5.965  -15.592 -3.965  1.00 0.00 ? 306 ALA B CB   2 
ATOM   2630 H H    . ALA B 1 35 ? -3.452  -15.835 -3.650  1.00 0.00 ? 306 ALA B H    2 
ATOM   2631 H HA   . ALA B 1 35 ? -5.750  -16.949 -2.318  1.00 0.00 ? 306 ALA B HA   2 
ATOM   2632 H HB1  . ALA B 1 35 ? -5.352  -15.265 -4.793  1.00 0.00 ? 306 ALA B HB1  2 
ATOM   2633 H HB2  . ALA B 1 35 ? -6.944  -15.867 -4.329  1.00 0.00 ? 306 ALA B HB2  2 
ATOM   2634 H HB3  . ALA B 1 35 ? -6.059  -14.789 -3.249  1.00 0.00 ? 306 ALA B HB3  2 
ATOM   2635 N N    . GLN B 1 36 ? -4.851  -18.158 -5.253  1.00 0.00 ? 307 GLN B N    2 
ATOM   2636 C CA   . GLN B 1 36 ? -5.029  -19.322 -6.113  1.00 0.00 ? 307 GLN B CA   2 
ATOM   2637 C C    . GLN B 1 36 ? -4.317  -20.525 -5.493  1.00 0.00 ? 307 GLN B C    2 
ATOM   2638 O O    . GLN B 1 36 ? -4.581  -21.660 -5.835  1.00 0.00 ? 307 GLN B O    2 
ATOM   2639 C CB   . GLN B 1 36 ? -4.437  -19.032 -7.493  1.00 0.00 ? 307 GLN B CB   2 
ATOM   2640 C CG   . GLN B 1 36 ? -2.968  -18.629 -7.345  1.00 0.00 ? 307 GLN B CG   2 
ATOM   2641 C CD   . GLN B 1 36 ? -2.283  -18.683 -8.713  1.00 0.00 ? 307 GLN B CD   2 
ATOM   2642 O OE1  . GLN B 1 36 ? -1.268  -19.331 -8.871  1.00 0.00 ? 307 GLN B OE1  2 
ATOM   2643 N NE2  . GLN B 1 36 ? -2.801  -18.026 -9.713  1.00 0.00 ? 307 GLN B NE2  2 
ATOM   2644 H H    . GLN B 1 36 ? -4.212  -17.457 -5.503  1.00 0.00 ? 307 GLN B H    2 
ATOM   2645 H HA   . GLN B 1 36 ? -6.082  -19.540 -6.212  1.00 0.00 ? 307 GLN B HA   2 
ATOM   2646 H HB2  . GLN B 1 36 ? -4.508  -19.918 -8.109  1.00 0.00 ? 307 GLN B HB2  2 
ATOM   2647 H HB3  . GLN B 1 36 ? -4.984  -18.225 -7.957  1.00 0.00 ? 307 GLN B HB3  2 
ATOM   2648 H HG2  . GLN B 1 36 ? -2.908  -17.625 -6.951  1.00 0.00 ? 307 GLN B HG2  2 
ATOM   2649 H HG3  . GLN B 1 36 ? -2.473  -19.311 -6.670  1.00 0.00 ? 307 GLN B HG3  2 
ATOM   2650 H HE21 . GLN B 1 36 ? -3.621  -17.502 -9.586  1.00 0.00 ? 307 GLN B HE21 2 
ATOM   2651 H HE22 . GLN B 1 36 ? -2.370  -18.053 -10.593 1.00 0.00 ? 307 GLN B HE22 2 
ATOM   2652 N N    . LEU B 1 37 ? -3.416  -20.286 -4.580  1.00 0.00 ? 308 LEU B N    2 
ATOM   2653 C CA   . LEU B 1 37 ? -2.704  -21.392 -3.952  1.00 0.00 ? 308 LEU B CA   2 
ATOM   2654 C C    . LEU B 1 37 ? -3.536  -21.931 -2.787  1.00 0.00 ? 308 LEU B C    2 
ATOM   2655 O O    . LEU B 1 37 ? -3.762  -23.119 -2.672  1.00 0.00 ? 308 LEU B O    2 
ATOM   2656 C CB   . LEU B 1 37 ? -1.353  -20.898 -3.432  1.00 0.00 ? 308 LEU B CB   2 
ATOM   2657 C CG   . LEU B 1 37 ? -0.277  -21.143 -4.491  1.00 0.00 ? 308 LEU B CG   2 
ATOM   2658 C CD1  . LEU B 1 37 ? 0.502   -19.850 -4.736  1.00 0.00 ? 308 LEU B CD1  2 
ATOM   2659 C CD2  . LEU B 1 37 ? 0.683   -22.229 -3.997  1.00 0.00 ? 308 LEU B CD2  2 
ATOM   2660 H H    . LEU B 1 37 ? -3.218  -19.363 -4.317  1.00 0.00 ? 308 LEU B H    2 
ATOM   2661 H HA   . LEU B 1 37 ? -2.546  -22.177 -4.677  1.00 0.00 ? 308 LEU B HA   2 
ATOM   2662 H HB2  . LEU B 1 37 ? -1.415  -19.841 -3.219  1.00 0.00 ? 308 LEU B HB2  2 
ATOM   2663 H HB3  . LEU B 1 37 ? -1.097  -21.433 -2.529  1.00 0.00 ? 308 LEU B HB3  2 
ATOM   2664 H HG   . LEU B 1 37 ? -0.743  -21.463 -5.410  1.00 0.00 ? 308 LEU B HG   2 
ATOM   2665 H HD11 . LEU B 1 37 ? -0.073  -19.009 -4.379  1.00 0.00 ? 308 LEU B HD11 2 
ATOM   2666 H HD12 . LEU B 1 37 ? 1.444   -19.891 -4.210  1.00 0.00 ? 308 LEU B HD12 2 
ATOM   2667 H HD13 . LEU B 1 37 ? 0.686   -19.736 -5.794  1.00 0.00 ? 308 LEU B HD13 2 
ATOM   2668 H HD21 . LEU B 1 37 ? 0.842   -22.115 -2.935  1.00 0.00 ? 308 LEU B HD21 2 
ATOM   2669 H HD22 . LEU B 1 37 ? 0.258   -23.202 -4.195  1.00 0.00 ? 308 LEU B HD22 2 
ATOM   2670 H HD23 . LEU B 1 37 ? 1.627   -22.137 -4.514  1.00 0.00 ? 308 LEU B HD23 2 
ATOM   2671 N N    . LYS B 1 38 ? -3.994  -21.066 -1.925  1.00 0.00 ? 309 LYS B N    2 
ATOM   2672 C CA   . LYS B 1 38 ? -4.795  -21.521 -0.795  1.00 0.00 ? 309 LYS B CA   2 
ATOM   2673 C C    . LYS B 1 38 ? -6.159  -21.994 -1.300  1.00 0.00 ? 309 LYS B C    2 
ATOM   2674 O O    . LYS B 1 38 ? -6.649  -23.036 -0.912  1.00 0.00 ? 309 LYS B O    2 
ATOM   2675 C CB   . LYS B 1 38 ? -4.986  -20.369 0.193   1.00 0.00 ? 309 LYS B CB   2 
ATOM   2676 C CG   . LYS B 1 38 ? -3.920  -20.451 1.286   1.00 0.00 ? 309 LYS B CG   2 
ATOM   2677 C CD   . LYS B 1 38 ? -2.541  -20.617 0.643   1.00 0.00 ? 309 LYS B CD   2 
ATOM   2678 C CE   . LYS B 1 38 ? -1.457  -20.229 1.650   1.00 0.00 ? 309 LYS B CE   2 
ATOM   2679 N NZ   . LYS B 1 38 ? -1.655  -20.995 2.913   1.00 0.00 ? 309 LYS B NZ   2 
ATOM   2680 H H    . LYS B 1 38 ? -3.801  -20.112 -2.037  1.00 0.00 ? 309 LYS B H    2 
ATOM   2681 H HA   . LYS B 1 38 ? -4.291  -22.337 -0.301  1.00 0.00 ? 309 LYS B HA   2 
ATOM   2682 H HB2  . LYS B 1 38 ? -4.895  -19.427 -0.330  1.00 0.00 ? 309 LYS B HB2  2 
ATOM   2683 H HB3  . LYS B 1 38 ? -5.965  -20.437 0.642   1.00 0.00 ? 309 LYS B HB3  2 
ATOM   2684 H HG2  . LYS B 1 38 ? -3.937  -19.545 1.874   1.00 0.00 ? 309 LYS B HG2  2 
ATOM   2685 H HG3  . LYS B 1 38 ? -4.122  -21.299 1.923   1.00 0.00 ? 309 LYS B HG3  2 
ATOM   2686 H HD2  . LYS B 1 38 ? -2.406  -21.648 0.345   1.00 0.00 ? 309 LYS B HD2  2 
ATOM   2687 H HD3  . LYS B 1 38 ? -2.469  -19.980 -0.224  1.00 0.00 ? 309 LYS B HD3  2 
ATOM   2688 H HE2  . LYS B 1 38 ? -0.486  -20.458 1.239   1.00 0.00 ? 309 LYS B HE2  2 
ATOM   2689 H HE3  . LYS B 1 38 ? -1.521  -19.171 1.857   1.00 0.00 ? 309 LYS B HE3  2 
ATOM   2690 H HZ1  . LYS B 1 38 ? -1.641  -22.014 2.706   1.00 0.00 ? 309 LYS B HZ1  2 
ATOM   2691 H HZ2  . LYS B 1 38 ? -0.891  -20.768 3.580   1.00 0.00 ? 309 LYS B HZ2  2 
ATOM   2692 H HZ3  . LYS B 1 38 ? -2.572  -20.738 3.333   1.00 0.00 ? 309 LYS B HZ3  2 
ATOM   2693 N N    . GLN B 1 39 ? -6.777  -21.239 -2.168  1.00 0.00 ? 310 GLN B N    2 
ATOM   2694 C CA   . GLN B 1 39 ? -8.078  -21.640 -2.688  1.00 0.00 ? 310 GLN B CA   2 
ATOM   2695 C C    . GLN B 1 39 ? -7.977  -23.053 -3.264  1.00 0.00 ? 310 GLN B C    2 
ATOM   2696 O O    . GLN B 1 39 ? -8.859  -23.870 -3.088  1.00 0.00 ? 310 GLN B O    2 
ATOM   2697 C CB   . GLN B 1 39 ? -8.511  -20.669 -3.788  1.00 0.00 ? 310 GLN B CB   2 
ATOM   2698 C CG   . GLN B 1 39 ? -8.841  -19.309 -3.170  1.00 0.00 ? 310 GLN B CG   2 
ATOM   2699 C CD   . GLN B 1 39 ? -10.350 -19.203 -2.942  1.00 0.00 ? 310 GLN B CD   2 
ATOM   2700 O OE1  . GLN B 1 39 ? -10.919 -19.975 -2.197  1.00 0.00 ? 310 GLN B OE1  2 
ATOM   2701 N NE2  . GLN B 1 39 ? -11.028 -18.273 -3.559  1.00 0.00 ? 310 GLN B NE2  2 
ATOM   2702 H H    . GLN B 1 39 ? -6.364  -20.403 -2.471  1.00 0.00 ? 310 GLN B H    2 
ATOM   2703 H HA   . GLN B 1 39 ? -8.805  -21.627 -1.890  1.00 0.00 ? 310 GLN B HA   2 
ATOM   2704 H HB2  . GLN B 1 39 ? -7.709  -20.556 -4.503  1.00 0.00 ? 310 GLN B HB2  2 
ATOM   2705 H HB3  . GLN B 1 39 ? -9.387  -21.057 -4.286  1.00 0.00 ? 310 GLN B HB3  2 
ATOM   2706 H HG2  . GLN B 1 39 ? -8.325  -19.208 -2.226  1.00 0.00 ? 310 GLN B HG2  2 
ATOM   2707 H HG3  . GLN B 1 39 ? -8.525  -18.524 -3.840  1.00 0.00 ? 310 GLN B HG3  2 
ATOM   2708 H HE21 . GLN B 1 39 ? -10.568 -17.650 -4.161  1.00 0.00 ? 310 GLN B HE21 2 
ATOM   2709 H HE22 . GLN B 1 39 ? -11.994 -18.197 -3.419  1.00 0.00 ? 310 GLN B HE22 2 
ATOM   2710 N N    . LYS B 1 40 ? -6.908  -23.348 -3.953  1.00 0.00 ? 311 LYS B N    2 
ATOM   2711 C CA   . LYS B 1 40 ? -6.756  -24.680 -4.528  1.00 0.00 ? 311 LYS B CA   2 
ATOM   2712 C C    . LYS B 1 40 ? -6.768  -25.726 -3.410  1.00 0.00 ? 311 LYS B C    2 
ATOM   2713 O O    . LYS B 1 40 ? -7.290  -26.811 -3.569  1.00 0.00 ? 311 LYS B O    2 
ATOM   2714 C CB   . LYS B 1 40 ? -5.430  -24.758 -5.287  1.00 0.00 ? 311 LYS B CB   2 
ATOM   2715 C CG   . LYS B 1 40 ? -5.592  -25.670 -6.505  1.00 0.00 ? 311 LYS B CG   2 
ATOM   2716 C CD   . LYS B 1 40 ? -4.386  -25.504 -7.432  1.00 0.00 ? 311 LYS B CD   2 
ATOM   2717 C CE   . LYS B 1 40 ? -4.786  -25.867 -8.862  1.00 0.00 ? 311 LYS B CE   2 
ATOM   2718 N NZ   . LYS B 1 40 ? -3.585  -26.330 -9.612  1.00 0.00 ? 311 LYS B NZ   2 
ATOM   2719 H H    . LYS B 1 40 ? -6.209  -22.673 -4.084  1.00 0.00 ? 311 LYS B H    2 
ATOM   2720 H HA   . LYS B 1 40 ? -7.571  -24.873 -5.210  1.00 0.00 ? 311 LYS B HA   2 
ATOM   2721 H HB2  . LYS B 1 40 ? -5.142  -23.769 -5.613  1.00 0.00 ? 311 LYS B HB2  2 
ATOM   2722 H HB3  . LYS B 1 40 ? -4.667  -25.161 -4.638  1.00 0.00 ? 311 LYS B HB3  2 
ATOM   2723 H HG2  . LYS B 1 40 ? -5.659  -26.697 -6.179  1.00 0.00 ? 311 LYS B HG2  2 
ATOM   2724 H HG3  . LYS B 1 40 ? -6.492  -25.401 -7.039  1.00 0.00 ? 311 LYS B HG3  2 
ATOM   2725 H HD2  . LYS B 1 40 ? -4.047  -24.479 -7.400  1.00 0.00 ? 311 LYS B HD2  2 
ATOM   2726 H HD3  . LYS B 1 40 ? -3.589  -26.157 -7.105  1.00 0.00 ? 311 LYS B HD3  2 
ATOM   2727 H HE2  . LYS B 1 40 ? -5.523  -26.656 -8.840  1.00 0.00 ? 311 LYS B HE2  2 
ATOM   2728 H HE3  . LYS B 1 40 ? -5.203  -24.999 -9.350  1.00 0.00 ? 311 LYS B HE3  2 
ATOM   2729 H HZ1  . LYS B 1 40 ? -3.044  -26.997 -9.025  1.00 0.00 ? 311 LYS B HZ1  2 
ATOM   2730 H HZ2  . LYS B 1 40 ? -3.883  -26.804 -10.487 1.00 0.00 ? 311 LYS B HZ2  2 
ATOM   2731 H HZ3  . LYS B 1 40 ? -2.987  -25.511 -9.847  1.00 0.00 ? 311 LYS B HZ3  2 
ATOM   2732 N N    . VAL B 1 41 ? -6.193  -25.409 -2.282  1.00 0.00 ? 312 VAL B N    2 
ATOM   2733 C CA   . VAL B 1 41 ? -6.170  -26.368 -1.182  1.00 0.00 ? 312 VAL B CA   2 
ATOM   2734 C C    . VAL B 1 41 ? -7.536  -26.392 -0.493  1.00 0.00 ? 312 VAL B C    2 
ATOM   2735 O O    . VAL B 1 41 ? -8.088  -27.441 -0.225  1.00 0.00 ? 312 VAL B O    2 
ATOM   2736 C CB   . VAL B 1 41 ? -5.097  -25.961 -0.171  1.00 0.00 ? 312 VAL B CB   2 
ATOM   2737 C CG1  . VAL B 1 41 ? -4.912  -27.080 0.855   1.00 0.00 ? 312 VAL B CG1  2 
ATOM   2738 C CG2  . VAL B 1 41 ? -3.775  -25.717 -0.902  1.00 0.00 ? 312 VAL B CG2  2 
ATOM   2739 H H    . VAL B 1 41 ? -5.775  -24.530 -2.174  1.00 0.00 ? 312 VAL B H    2 
ATOM   2740 H HA   . VAL B 1 41 ? -5.945  -27.351 -1.567  1.00 0.00 ? 312 VAL B HA   2 
ATOM   2741 H HB   . VAL B 1 41 ? -5.403  -25.057 0.334   1.00 0.00 ? 312 VAL B HB   2 
ATOM   2742 H HG11 . VAL B 1 41 ? -5.547  -27.915 0.597   1.00 0.00 ? 312 VAL B HG11 2 
ATOM   2743 H HG12 . VAL B 1 41 ? -3.880  -27.399 0.857   1.00 0.00 ? 312 VAL B HG12 2 
ATOM   2744 H HG13 . VAL B 1 41 ? -5.177  -26.716 1.837   1.00 0.00 ? 312 VAL B HG13 2 
ATOM   2745 H HG21 . VAL B 1 41 ? -3.848  -26.093 -1.913  1.00 0.00 ? 312 VAL B HG21 2 
ATOM   2746 H HG22 . VAL B 1 41 ? -3.567  -24.659 -0.926  1.00 0.00 ? 312 VAL B HG22 2 
ATOM   2747 H HG23 . VAL B 1 41 ? -2.977  -26.230 -0.385  1.00 0.00 ? 312 VAL B HG23 2 
ATOM   2748 N N    . MET B 1 42 ? -8.086  -25.245 -0.203  1.00 0.00 ? 313 MET B N    2 
ATOM   2749 C CA   . MET B 1 42 ? -9.387  -25.207 0.456   1.00 0.00 ? 313 MET B CA   2 
ATOM   2750 C C    . MET B 1 42 ? -10.493 -25.409 -0.581  1.00 0.00 ? 313 MET B C    2 
ATOM   2751 O O    . MET B 1 42 ? -10.571 -24.702 -1.567  1.00 0.00 ? 313 MET B O    2 
ATOM   2752 C CB   . MET B 1 42 ? -9.572  -23.852 1.144   1.00 0.00 ? 313 MET B CB   2 
ATOM   2753 C CG   . MET B 1 42 ? -9.267  -23.993 2.636   1.00 0.00 ? 313 MET B CG   2 
ATOM   2754 S SD   . MET B 1 42 ? -10.386 -22.932 3.584   1.00 0.00 ? 313 MET B SD   2 
ATOM   2755 C CE   . MET B 1 42 ? -9.174  -22.349 4.794   1.00 0.00 ? 313 MET B CE   2 
ATOM   2756 H H    . MET B 1 42 ? -7.625  -24.409 -0.426  1.00 0.00 ? 313 MET B H    2 
ATOM   2757 H HA   . MET B 1 42 ? -9.439  -25.993 1.195   1.00 0.00 ? 313 MET B HA   2 
ATOM   2758 H HB2  . MET B 1 42 ? -8.898  -23.130 0.705   1.00 0.00 ? 313 MET B HB2  2 
ATOM   2759 H HB3  . MET B 1 42 ? -10.591 -23.519 1.017   1.00 0.00 ? 313 MET B HB3  2 
ATOM   2760 H HG2  . MET B 1 42 ? -9.406  -25.022 2.937   1.00 0.00 ? 313 MET B HG2  2 
ATOM   2761 H HG3  . MET B 1 42 ? -8.246  -23.699 2.825   1.00 0.00 ? 313 MET B HG3  2 
ATOM   2762 H HE1  . MET B 1 42 ? -8.177  -22.497 4.404   1.00 0.00 ? 313 MET B HE1  2 
ATOM   2763 H HE2  . MET B 1 42 ? -9.339  -21.299 4.991   1.00 0.00 ? 313 MET B HE2  2 
ATOM   2764 H HE3  . MET B 1 42 ? -9.285  -22.905 5.712   1.00 0.00 ? 313 MET B HE3  2 
ATOM   2765 N N    . ASN B 1 43 ? -11.349 -26.370 -0.368  1.00 0.00 ? 314 ASN B N    2 
ATOM   2766 C CA   . ASN B 1 43 ? -12.427 -26.614 -1.320  1.00 0.00 ? 314 ASN B CA   2 
ATOM   2767 C C    . ASN B 1 43 ? -11.833 -26.860 -2.709  1.00 0.00 ? 314 ASN B C    2 
ATOM   2768 O O    . ASN B 1 43 ? -10.677 -26.581 -2.960  1.00 0.00 ? 314 ASN B O    2 
ATOM   2769 C CB   . ASN B 1 43 ? -13.353 -25.398 -1.368  1.00 0.00 ? 314 ASN B CB   2 
ATOM   2770 C CG   . ASN B 1 43 ? -14.802 -25.865 -1.524  1.00 0.00 ? 314 ASN B CG   2 
ATOM   2771 O OD1  . ASN B 1 43 ? -15.270 -26.070 -2.625  1.00 0.00 ? 314 ASN B OD1  2 
ATOM   2772 N ND2  . ASN B 1 43 ? -15.535 -26.044 -0.460  1.00 0.00 ? 314 ASN B ND2  2 
ATOM   2773 H H    . ASN B 1 43 ? -11.268 -26.929 0.434   1.00 0.00 ? 314 ASN B H    2 
ATOM   2774 H HA   . ASN B 1 43 ? -12.990 -27.482 -1.011  1.00 0.00 ? 314 ASN B HA   2 
ATOM   2775 H HB2  . ASN B 1 43 ? -13.253 -24.834 -0.452  1.00 0.00 ? 314 ASN B HB2  2 
ATOM   2776 H HB3  . ASN B 1 43 ? -13.086 -24.774 -2.207  1.00 0.00 ? 314 ASN B HB3  2 
ATOM   2777 H HD21 . ASN B 1 43 ? -15.157 -25.878 0.429   1.00 0.00 ? 314 ASN B HD21 2 
ATOM   2778 H HD22 . ASN B 1 43 ? -16.464 -26.342 -0.549  1.00 0.00 ? 314 ASN B HD22 2 
ATOM   2779 N N    . TYR B 1 44 ? -12.617 -27.381 -3.614  1.00 0.00 ? 315 TYR B N    2 
ATOM   2780 C CA   . TYR B 1 44 ? -12.111 -27.638 -4.959  1.00 0.00 ? 315 TYR B CA   2 
ATOM   2781 C C    . TYR B 1 44 ? -12.791 -26.689 -5.948  1.00 0.00 ? 315 TYR B C    2 
ATOM   2782 O O    . TYR B 1 44 ? -13.808 -26.119 -5.589  1.00 0.00 ? 315 TYR B O    2 
ATOM   2783 C CB   . TYR B 1 44 ? -12.414 -29.087 -5.348  1.00 0.00 ? 315 TYR B CB   2 
ATOM   2784 C CG   . TYR B 1 44 ? -11.182 -29.934 -5.134  1.00 0.00 ? 315 TYR B CG   2 
ATOM   2785 C CD1  . TYR B 1 44 ? -10.674 -30.118 -3.838  1.00 0.00 ? 315 TYR B CD1  2 
ATOM   2786 C CD2  . TYR B 1 44 ? -10.547 -30.538 -6.230  1.00 0.00 ? 315 TYR B CD2  2 
ATOM   2787 C CE1  . TYR B 1 44 ? -9.529  -30.906 -3.639  1.00 0.00 ? 315 TYR B CE1  2 
ATOM   2788 C CE2  . TYR B 1 44 ? -9.401  -31.326 -6.031  1.00 0.00 ? 315 TYR B CE2  2 
ATOM   2789 C CZ   . TYR B 1 44 ? -8.893  -31.510 -4.735  1.00 0.00 ? 315 TYR B CZ   2 
ATOM   2790 O OH   . TYR B 1 44 ? -7.767  -32.285 -4.539  1.00 0.00 ? 315 TYR B OH   2 
ATOM   2791 O OXT  . TYR B 1 44 ? -12.282 -26.551 -7.049  1.00 0.00 ? 315 TYR B OXT  2 
ATOM   2792 H H    . TYR B 1 44 ? -13.546 -27.597 -3.391  1.00 0.00 ? 315 TYR B H    2 
ATOM   2793 H HA   . TYR B 1 44 ? -11.044 -27.478 -4.979  1.00 0.00 ? 315 TYR B HA   2 
ATOM   2794 H HB2  . TYR B 1 44 ? -13.221 -29.463 -4.737  1.00 0.00 ? 315 TYR B HB2  2 
ATOM   2795 H HB3  . TYR B 1 44 ? -12.700 -29.127 -6.388  1.00 0.00 ? 315 TYR B HB3  2 
ATOM   2796 H HD1  . TYR B 1 44 ? -11.163 -29.653 -2.995  1.00 0.00 ? 315 TYR B HD1  2 
ATOM   2797 H HD2  . TYR B 1 44 ? -10.938 -30.397 -7.226  1.00 0.00 ? 315 TYR B HD2  2 
ATOM   2798 H HE1  . TYR B 1 44 ? -9.137  -31.047 -2.642  1.00 0.00 ? 315 TYR B HE1  2 
ATOM   2799 H HE2  . TYR B 1 44 ? -8.912  -31.790 -6.874  1.00 0.00 ? 315 TYR B HE2  2 
ATOM   2800 H HH   . TYR B 1 44 ? -8.049  -33.135 -4.195  1.00 0.00 ? 315 TYR B HH   2 
HETATM 2801 C C    . ACE A 1 1  ? -0.227  34.887  2.272   1.00 0.00 ? 272 ACE A C    3 
HETATM 2802 O O    . ACE A 1 1  ? -1.175  34.871  1.513   1.00 0.00 ? 272 ACE A O    3 
HETATM 2803 C CH3  . ACE A 1 1  ? 0.282   36.195  2.882   1.00 0.00 ? 272 ACE A CH3  3 
HETATM 2804 H H1   . ACE A 1 1  ? -0.545  36.878  3.009   1.00 0.00 ? 272 ACE A H1   3 
HETATM 2805 H H2   . ACE A 1 1  ? 0.732   35.992  3.842   1.00 0.00 ? 272 ACE A H2   3 
HETATM 2806 H H3   . ACE A 1 1  ? 1.015   36.636  2.224   1.00 0.00 ? 272 ACE A H3   3 
ATOM   2807 N N    . CYS A 1 2  ? 0.397   33.787  2.597   1.00 0.00 ? 273 CYS A N    3 
ATOM   2808 C CA   . CYS A 1 2  ? -0.042  32.511  2.047   1.00 0.00 ? 273 CYS A CA   3 
ATOM   2809 C C    . CYS A 1 2  ? -0.463  31.581  3.187   1.00 0.00 ? 273 CYS A C    3 
ATOM   2810 O O    . CYS A 1 2  ? 0.256   31.400  4.151   1.00 0.00 ? 273 CYS A O    3 
ATOM   2811 C CB   . CYS A 1 2  ? 1.104   31.870  1.261   1.00 0.00 ? 273 CYS A CB   3 
ATOM   2812 S SG   . CYS A 1 2  ? 0.827   32.104  -0.512  1.00 0.00 ? 273 CYS A SG   3 
ATOM   2813 H H    . CYS A 1 2  ? 1.160   33.820  3.209   1.00 0.00 ? 273 CYS A H    3 
ATOM   2814 H HA   . CYS A 1 2  ? -0.881  32.672  1.385   1.00 0.00 ? 273 CYS A HA   3 
ATOM   2815 H HB2  . CYS A 1 2  ? 2.038   32.334  1.545   1.00 0.00 ? 273 CYS A HB2  3 
ATOM   2816 H HB3  . CYS A 1 2  ? 1.146   30.813  1.483   1.00 0.00 ? 273 CYS A HB3  3 
ATOM   2817 N N    . GLY A 1 3  ? -1.621  30.987  3.082   1.00 0.00 ? 274 GLY A N    3 
ATOM   2818 C CA   . GLY A 1 3  ? -2.076  30.088  4.137   1.00 0.00 ? 274 GLY A CA   3 
ATOM   2819 C C    . GLY A 1 3  ? -3.458  29.539  3.777   1.00 0.00 ? 274 GLY A C    3 
ATOM   2820 O O    . GLY A 1 3  ? -4.417  30.275  3.659   1.00 0.00 ? 274 GLY A O    3 
ATOM   2821 H H    . GLY A 1 3  ? -2.183  31.145  2.295   1.00 0.00 ? 274 GLY A H    3 
ATOM   2822 H HA2  . GLY A 1 3  ? -1.376  29.270  4.238   1.00 0.00 ? 274 GLY A HA2  3 
ATOM   2823 H HA3  . GLY A 1 3  ? -2.140  30.627  5.068   1.00 0.00 ? 274 GLY A HA3  3 
ATOM   2824 N N    . GLY A 1 4  ? -3.567  28.251  3.598   1.00 0.00 ? 275 GLY A N    3 
ATOM   2825 C CA   . GLY A 1 4  ? -4.859  27.669  3.251   1.00 0.00 ? 275 GLY A CA   3 
ATOM   2826 C C    . GLY A 1 4  ? -4.648  26.443  2.363   1.00 0.00 ? 275 GLY A C    3 
ATOM   2827 O O    . GLY A 1 4  ? -5.201  25.389  2.604   1.00 0.00 ? 275 GLY A O    3 
ATOM   2828 H H    . GLY A 1 4  ? -2.781  27.674  3.698   1.00 0.00 ? 275 GLY A H    3 
ATOM   2829 H HA2  . GLY A 1 4  ? -5.376  27.379  4.156   1.00 0.00 ? 275 GLY A HA2  3 
ATOM   2830 H HA3  . GLY A 1 4  ? -5.450  28.398  2.717   1.00 0.00 ? 275 GLY A HA3  3 
ATOM   2831 N N    . ARG A 1 5  ? -3.852  26.573  1.337   1.00 0.00 ? 276 ARG A N    3 
ATOM   2832 C CA   . ARG A 1 5  ? -3.610  25.437  0.454   1.00 0.00 ? 276 ARG A CA   3 
ATOM   2833 C C    . ARG A 1 5  ? -2.579  24.508  1.093   1.00 0.00 ? 276 ARG A C    3 
ATOM   2834 O O    . ARG A 1 5  ? -2.629  23.304  0.936   1.00 0.00 ? 276 ARG A O    3 
ATOM   2835 C CB   . ARG A 1 5  ? -3.077  25.942  -0.889  1.00 0.00 ? 276 ARG A CB   3 
ATOM   2836 C CG   . ARG A 1 5  ? -4.203  25.929  -1.925  1.00 0.00 ? 276 ARG A CG   3 
ATOM   2837 C CD   . ARG A 1 5  ? -5.152  27.100  -1.664  1.00 0.00 ? 276 ARG A CD   3 
ATOM   2838 N NE   . ARG A 1 5  ? -6.528  26.664  -1.870  1.00 0.00 ? 276 ARG A NE   3 
ATOM   2839 C CZ   . ARG A 1 5  ? -7.517  27.388  -1.422  1.00 0.00 ? 276 ARG A CZ   3 
ATOM   2840 N NH1  . ARG A 1 5  ? -7.624  27.627  -0.144  1.00 0.00 ? 276 ARG A NH1  3 
ATOM   2841 N NH2  . ARG A 1 5  ? -8.397  27.873  -2.253  1.00 0.00 ? 276 ARG A NH2  3 
ATOM   2842 H H    . ARG A 1 5  ? -3.415  27.432  1.162   1.00 0.00 ? 276 ARG A H    3 
ATOM   2843 H HA   . ARG A 1 5  ? -4.532  24.901  0.295   1.00 0.00 ? 276 ARG A HA   3 
ATOM   2844 H HB2  . ARG A 1 5  ? -2.704  26.949  -0.772  1.00 0.00 ? 276 ARG A HB2  3 
ATOM   2845 H HB3  . ARG A 1 5  ? -2.277  25.299  -1.221  1.00 0.00 ? 276 ARG A HB3  3 
ATOM   2846 H HG2  . ARG A 1 5  ? -3.781  26.021  -2.915  1.00 0.00 ? 276 ARG A HG2  3 
ATOM   2847 H HG3  . ARG A 1 5  ? -4.750  25.002  -1.852  1.00 0.00 ? 276 ARG A HG3  3 
ATOM   2848 H HD2  . ARG A 1 5  ? -5.031  27.441  -0.645  1.00 0.00 ? 276 ARG A HD2  3 
ATOM   2849 H HD3  . ARG A 1 5  ? -4.923  27.907  -2.343  1.00 0.00 ? 276 ARG A HD3  3 
ATOM   2850 H HE   . ARG A 1 5  ? -6.709  25.827  -2.346  1.00 0.00 ? 276 ARG A HE   3 
ATOM   2851 H HH11 . ARG A 1 5  ? -6.949  27.254  0.493   1.00 0.00 ? 276 ARG A HH11 3 
ATOM   2852 H HH12 . ARG A 1 5  ? -8.381  28.181  0.199   1.00 0.00 ? 276 ARG A HH12 3 
ATOM   2853 H HH21 . ARG A 1 5  ? -8.313  27.691  -3.233  1.00 0.00 ? 276 ARG A HH21 3 
ATOM   2854 H HH22 . ARG A 1 5  ? -9.155  28.430  -1.909  1.00 0.00 ? 276 ARG A HH22 3 
ATOM   2855 N N    . ILE A 1 6  ? -1.642  25.059  1.811   1.00 0.00 ? 277 ILE A N    3 
ATOM   2856 C CA   . ILE A 1 6  ? -0.622  24.232  2.446   1.00 0.00 ? 277 ILE A CA   3 
ATOM   2857 C C    . ILE A 1 6  ? -1.291  23.191  3.349   1.00 0.00 ? 277 ILE A C    3 
ATOM   2858 O O    . ILE A 1 6  ? -1.056  22.006  3.223   1.00 0.00 ? 277 ILE A O    3 
ATOM   2859 C CB   . ILE A 1 6  ? 0.299   25.119  3.283   1.00 0.00 ? 277 ILE A CB   3 
ATOM   2860 C CG1  . ILE A 1 6  ? 1.055   26.080  2.360   1.00 0.00 ? 277 ILE A CG1  3 
ATOM   2861 C CG2  . ILE A 1 6  ? 1.302   24.249  4.041   1.00 0.00 ? 277 ILE A CG2  3 
ATOM   2862 C CD1  . ILE A 1 6  ? 1.982   26.969  3.191   1.00 0.00 ? 277 ILE A CD1  3 
ATOM   2863 H H    . ILE A 1 6  ? -1.619  26.032  1.920   1.00 0.00 ? 277 ILE A H    3 
ATOM   2864 H HA   . ILE A 1 6  ? -0.042  23.730  1.687   1.00 0.00 ? 277 ILE A HA   3 
ATOM   2865 H HB   . ILE A 1 6  ? -0.291  25.686  3.989   1.00 0.00 ? 277 ILE A HB   3 
ATOM   2866 H HG12 . ILE A 1 6  ? 1.638   25.512  1.650   1.00 0.00 ? 277 ILE A HG12 3 
ATOM   2867 H HG13 . ILE A 1 6  ? 0.345   26.701  1.829   1.00 0.00 ? 277 ILE A HG13 3 
ATOM   2868 H HG21 . ILE A 1 6  ? 0.796   23.383  4.440   1.00 0.00 ? 277 ILE A HG21 3 
ATOM   2869 H HG22 . ILE A 1 6  ? 2.084   23.931  3.368   1.00 0.00 ? 277 ILE A HG22 3 
ATOM   2870 H HG23 . ILE A 1 6  ? 1.733   24.820  4.851   1.00 0.00 ? 277 ILE A HG23 3 
ATOM   2871 H HD11 . ILE A 1 6  ? 1.598   27.047  4.198   1.00 0.00 ? 277 ILE A HD11 3 
ATOM   2872 H HD12 . ILE A 1 6  ? 2.970   26.534  3.215   1.00 0.00 ? 277 ILE A HD12 3 
ATOM   2873 H HD13 . ILE A 1 6  ? 2.031   27.953  2.747   1.00 0.00 ? 277 ILE A HD13 3 
ATOM   2874 N N    . ALA A 1 7  ? -2.120  23.625  4.258   1.00 0.00 ? 278 ALA A N    3 
ATOM   2875 C CA   . ALA A 1 7  ? -2.785  22.681  5.149   1.00 0.00 ? 278 ALA A CA   3 
ATOM   2876 C C    . ALA A 1 7  ? -3.399  21.544  4.330   1.00 0.00 ? 278 ALA A C    3 
ATOM   2877 O O    . ALA A 1 7  ? -3.270  20.385  4.668   1.00 0.00 ? 278 ALA A O    3 
ATOM   2878 C CB   . ALA A 1 7  ? -3.886  23.404  5.925   1.00 0.00 ? 278 ALA A CB   3 
ATOM   2879 H H    . ALA A 1 7  ? -2.293  24.586  4.344   1.00 0.00 ? 278 ALA A H    3 
ATOM   2880 H HA   . ALA A 1 7  ? -2.064  22.277  5.845   1.00 0.00 ? 278 ALA A HA   3 
ATOM   2881 H HB1  . ALA A 1 7  ? -3.730  24.470  5.865   1.00 0.00 ? 278 ALA A HB1  3 
ATOM   2882 H HB2  . ALA A 1 7  ? -4.848  23.156  5.498   1.00 0.00 ? 278 ALA A HB2  3 
ATOM   2883 H HB3  . ALA A 1 7  ? -3.862  23.092  6.959   1.00 0.00 ? 278 ALA A HB3  3 
ATOM   2884 N N    . ARG A 1 8  ? -4.068  21.865  3.258   1.00 0.00 ? 279 ARG A N    3 
ATOM   2885 C CA   . ARG A 1 8  ? -4.679  20.823  2.440   1.00 0.00 ? 279 ARG A CA   3 
ATOM   2886 C C    . ARG A 1 8  ? -3.590  19.911  1.867   1.00 0.00 ? 279 ARG A C    3 
ATOM   2887 O O    . ARG A 1 8  ? -3.667  18.703  1.963   1.00 0.00 ? 279 ARG A O    3 
ATOM   2888 C CB   . ARG A 1 8  ? -5.460  21.469  1.293   1.00 0.00 ? 279 ARG A CB   3 
ATOM   2889 C CG   . ARG A 1 8  ? -6.447  22.491  1.858   1.00 0.00 ? 279 ARG A CG   3 
ATOM   2890 C CD   . ARG A 1 8  ? -7.814  21.832  2.047   1.00 0.00 ? 279 ARG A CD   3 
ATOM   2891 N NE   . ARG A 1 8  ? -8.365  22.219  3.341   1.00 0.00 ? 279 ARG A NE   3 
ATOM   2892 C CZ   . ARG A 1 8  ? -9.633  22.037  3.590   1.00 0.00 ? 279 ARG A CZ   3 
ATOM   2893 N NH1  . ARG A 1 8  ? -10.523 22.834  3.063   1.00 0.00 ? 279 ARG A NH1  3 
ATOM   2894 N NH2  . ARG A 1 8  ? -10.013 21.058  4.366   1.00 0.00 ? 279 ARG A NH2  3 
ATOM   2895 H H    . ARG A 1 8  ? -4.163  22.807  3.002   1.00 0.00 ? 279 ARG A H    3 
ATOM   2896 H HA   . ARG A 1 8  ? -5.354  20.240  3.047   1.00 0.00 ? 279 ARG A HA   3 
ATOM   2897 H HB2  . ARG A 1 8  ? -4.772  21.963  0.623   1.00 0.00 ? 279 ARG A HB2  3 
ATOM   2898 H HB3  . ARG A 1 8  ? -6.004  20.706  0.754   1.00 0.00 ? 279 ARG A HB3  3 
ATOM   2899 H HG2  . ARG A 1 8  ? -6.085  22.851  2.811   1.00 0.00 ? 279 ARG A HG2  3 
ATOM   2900 H HG3  . ARG A 1 8  ? -6.541  23.319  1.172   1.00 0.00 ? 279 ARG A HG3  3 
ATOM   2901 H HD2  . ARG A 1 8  ? -8.482  22.155  1.261   1.00 0.00 ? 279 ARG A HD2  3 
ATOM   2902 H HD3  . ARG A 1 8  ? -7.705  20.759  2.009   1.00 0.00 ? 279 ARG A HD3  3 
ATOM   2903 H HE   . ARG A 1 8  ? -7.784  22.613  4.023   1.00 0.00 ? 279 ARG A HE   3 
ATOM   2904 H HH11 . ARG A 1 8  ? -10.232 23.585  2.469   1.00 0.00 ? 279 ARG A HH11 3 
ATOM   2905 H HH12 . ARG A 1 8  ? -11.494 22.695  3.254   1.00 0.00 ? 279 ARG A HH12 3 
ATOM   2906 H HH21 . ARG A 1 8  ? -9.332  20.448  4.770   1.00 0.00 ? 279 ARG A HH21 3 
ATOM   2907 H HH22 . ARG A 1 8  ? -10.985 20.920  4.556   1.00 0.00 ? 279 ARG A HH22 3 
ATOM   2908 N N    . LEU A 1 9  ? -2.577  20.480  1.271   1.00 0.00 ? 280 LEU A N    3 
ATOM   2909 C CA   . LEU A 1 9  ? -1.511  19.657  0.707   1.00 0.00 ? 280 LEU A CA   3 
ATOM   2910 C C    . LEU A 1 9  ? -0.909  18.775  1.803   1.00 0.00 ? 280 LEU A C    3 
ATOM   2911 O O    . LEU A 1 9  ? -0.903  17.564  1.705   1.00 0.00 ? 280 LEU A O    3 
ATOM   2912 C CB   . LEU A 1 9  ? -0.423  20.562  0.124   1.00 0.00 ? 280 LEU A CB   3 
ATOM   2913 C CG   . LEU A 1 9  ? -0.629  20.702  -1.385  1.00 0.00 ? 280 LEU A CG   3 
ATOM   2914 C CD1  . LEU A 1 9  ? 0.206   21.871  -1.909  1.00 0.00 ? 280 LEU A CD1  3 
ATOM   2915 C CD2  . LEU A 1 9  ? -0.190  19.412  -2.081  1.00 0.00 ? 280 LEU A CD2  3 
ATOM   2916 H H    . LEU A 1 9  ? -2.534  21.456  1.202   1.00 0.00 ? 280 LEU A H    3 
ATOM   2917 H HA   . LEU A 1 9  ? -1.914  19.034  -0.077  1.00 0.00 ? 280 LEU A HA   3 
ATOM   2918 H HB2  . LEU A 1 9  ? -0.480  21.535  0.589   1.00 0.00 ? 280 LEU A HB2  3 
ATOM   2919 H HB3  . LEU A 1 9  ? 0.545   20.127  0.314   1.00 0.00 ? 280 LEU A HB3  3 
ATOM   2920 H HG   . LEU A 1 9  ? -1.674  20.888  -1.590  1.00 0.00 ? 280 LEU A HG   3 
ATOM   2921 H HD11 . LEU A 1 9  ? 0.441   22.540  -1.095  1.00 0.00 ? 280 LEU A HD11 3 
ATOM   2922 H HD12 . LEU A 1 9  ? 1.121   21.495  -2.341  1.00 0.00 ? 280 LEU A HD12 3 
ATOM   2923 H HD13 . LEU A 1 9  ? -0.353  22.404  -2.662  1.00 0.00 ? 280 LEU A HD13 3 
ATOM   2924 H HD21 . LEU A 1 9  ? -0.583  18.561  -1.542  1.00 0.00 ? 280 LEU A HD21 3 
ATOM   2925 H HD22 . LEU A 1 9  ? -0.568  19.402  -3.093  1.00 0.00 ? 280 LEU A HD22 3 
ATOM   2926 H HD23 . LEU A 1 9  ? 0.888   19.361  -2.099  1.00 0.00 ? 280 LEU A HD23 3 
ATOM   2927 N N    . GLU A 1 10 ? -0.399  19.373  2.845   1.00 0.00 ? 281 GLU A N    3 
ATOM   2928 C CA   . GLU A 1 10 ? 0.191   18.584  3.922   1.00 0.00 ? 281 GLU A CA   3 
ATOM   2929 C C    . GLU A 1 10 ? -0.778  17.475  4.336   1.00 0.00 ? 281 GLU A C    3 
ATOM   2930 O O    . GLU A 1 10 ? -0.386  16.346  4.553   1.00 0.00 ? 281 GLU A O    3 
ATOM   2931 C CB   . GLU A 1 10 ? 0.473   19.491  5.123   1.00 0.00 ? 281 GLU A CB   3 
ATOM   2932 C CG   . GLU A 1 10 ? 1.984   19.597  5.339   1.00 0.00 ? 281 GLU A CG   3 
ATOM   2933 C CD   . GLU A 1 10 ? 2.403   18.663  6.476   1.00 0.00 ? 281 GLU A CD   3 
ATOM   2934 O OE1  . GLU A 1 10 ? 2.325   19.081  7.620   1.00 0.00 ? 281 GLU A OE1  3 
ATOM   2935 O OE2  . GLU A 1 10 ? 2.795   17.545  6.184   1.00 0.00 ? 281 GLU A OE2  3 
ATOM   2936 H H    . GLU A 1 10 ? -0.411  20.351  2.905   1.00 0.00 ? 281 GLU A H    3 
ATOM   2937 H HA   . GLU A 1 10 ? 1.117   18.145  3.580   1.00 0.00 ? 281 GLU A HA   3 
ATOM   2938 H HB2  . GLU A 1 10 ? 0.065   20.472  4.934   1.00 0.00 ? 281 GLU A HB2  3 
ATOM   2939 H HB3  . GLU A 1 10 ? 0.014   19.072  6.005   1.00 0.00 ? 281 GLU A HB3  3 
ATOM   2940 H HG2  . GLU A 1 10 ? 2.497   19.314  4.432   1.00 0.00 ? 281 GLU A HG2  3 
ATOM   2941 H HG3  . GLU A 1 10 ? 2.241   20.612  5.598   1.00 0.00 ? 281 GLU A HG3  3 
ATOM   2942 N N    . GLU A 1 11 ? -2.040  17.787  4.449   1.00 0.00 ? 282 GLU A N    3 
ATOM   2943 C CA   . GLU A 1 11 ? -3.010  16.770  4.841   1.00 0.00 ? 282 GLU A CA   3 
ATOM   2944 C C    . GLU A 1 11 ? -2.982  15.625  3.829   1.00 0.00 ? 282 GLU A C    3 
ATOM   2945 O O    . GLU A 1 11 ? -3.145  14.472  4.175   1.00 0.00 ? 282 GLU A O    3 
ATOM   2946 C CB   . GLU A 1 11 ? -4.409  17.386  4.877   1.00 0.00 ? 282 GLU A CB   3 
ATOM   2947 C CG   . GLU A 1 11 ? -4.758  17.780  6.313   1.00 0.00 ? 282 GLU A CG   3 
ATOM   2948 C CD   . GLU A 1 11 ? -6.279  17.846  6.469   1.00 0.00 ? 282 GLU A CD   3 
ATOM   2949 O OE1  . GLU A 1 11 ? -6.924  18.378  5.582   1.00 0.00 ? 282 GLU A OE1  3 
ATOM   2950 O OE2  . GLU A 1 11 ? -6.773  17.361  7.476   1.00 0.00 ? 282 GLU A OE2  3 
ATOM   2951 H H    . GLU A 1 11 ? -2.337  18.703  4.269   1.00 0.00 ? 282 GLU A H    3 
ATOM   2952 H HA   . GLU A 1 11 ? -2.759  16.392  5.820   1.00 0.00 ? 282 GLU A HA   3 
ATOM   2953 H HB2  . GLU A 1 11 ? -4.434  18.263  4.247   1.00 0.00 ? 282 GLU A HB2  3 
ATOM   2954 H HB3  . GLU A 1 11 ? -5.129  16.665  4.519   1.00 0.00 ? 282 GLU A HB3  3 
ATOM   2955 H HG2  . GLU A 1 11 ? -4.356  17.046  6.997   1.00 0.00 ? 282 GLU A HG2  3 
ATOM   2956 H HG3  . GLU A 1 11 ? -4.335  18.749  6.534   1.00 0.00 ? 282 GLU A HG3  3 
ATOM   2957 N N    . LYS A 1 12 ? -2.775  15.935  2.579   1.00 0.00 ? 283 LYS A N    3 
ATOM   2958 C CA   . LYS A 1 12 ? -2.738  14.889  1.564   1.00 0.00 ? 283 LYS A CA   3 
ATOM   2959 C C    . LYS A 1 12 ? -1.419  14.117  1.674   1.00 0.00 ? 283 LYS A C    3 
ATOM   2960 O O    . LYS A 1 12 ? -1.400  12.902  1.693   1.00 0.00 ? 283 LYS A O    3 
ATOM   2961 C CB   . LYS A 1 12 ? -2.842  15.523  0.177   1.00 0.00 ? 283 LYS A CB   3 
ATOM   2962 C CG   . LYS A 1 12 ? -3.149  14.440  -0.859  1.00 0.00 ? 283 LYS A CG   3 
ATOM   2963 C CD   . LYS A 1 12 ? -4.025  15.026  -1.968  1.00 0.00 ? 283 LYS A CD   3 
ATOM   2964 C CE   . LYS A 1 12 ? -3.348  16.267  -2.552  1.00 0.00 ? 283 LYS A CE   3 
ATOM   2965 N NZ   . LYS A 1 12 ? -4.196  17.463  -2.290  1.00 0.00 ? 283 LYS A NZ   3 
ATOM   2966 H H    . LYS A 1 12 ? -2.646  16.870  2.321   1.00 0.00 ? 283 LYS A H    3 
ATOM   2967 H HA   . LYS A 1 12 ? -3.565  14.212  1.713   1.00 0.00 ? 283 LYS A HA   3 
ATOM   2968 H HB2  . LYS A 1 12 ? -3.634  16.258  0.176   1.00 0.00 ? 283 LYS A HB2  3 
ATOM   2969 H HB3  . LYS A 1 12 ? -1.907  16.001  -0.070  1.00 0.00 ? 283 LYS A HB3  3 
ATOM   2970 H HG2  . LYS A 1 12 ? -2.224  14.075  -1.283  1.00 0.00 ? 283 LYS A HG2  3 
ATOM   2971 H HG3  . LYS A 1 12 ? -3.674  13.625  -0.382  1.00 0.00 ? 283 LYS A HG3  3 
ATOM   2972 H HD2  . LYS A 1 12 ? -4.157  14.289  -2.746  1.00 0.00 ? 283 LYS A HD2  3 
ATOM   2973 H HD3  . LYS A 1 12 ? -4.986  15.299  -1.561  1.00 0.00 ? 283 LYS A HD3  3 
ATOM   2974 H HE2  . LYS A 1 12 ? -2.383  16.403  -2.087  1.00 0.00 ? 283 LYS A HE2  3 
ATOM   2975 H HE3  . LYS A 1 12 ? -3.221  16.140  -3.617  1.00 0.00 ? 283 LYS A HE3  3 
ATOM   2976 H HZ1  . LYS A 1 12 ? -5.180  17.254  -2.553  1.00 0.00 ? 283 LYS A HZ1  3 
ATOM   2977 H HZ2  . LYS A 1 12 ? -4.152  17.707  -1.279  1.00 0.00 ? 283 LYS A HZ2  3 
ATOM   2978 H HZ3  . LYS A 1 12 ? -3.853  18.264  -2.857  1.00 0.00 ? 283 LYS A HZ3  3 
ATOM   2979 N N    . VAL A 1 13 ? -0.318  14.814  1.745   1.00 0.00 ? 284 VAL A N    3 
ATOM   2980 C CA   . VAL A 1 13 ? 0.968   14.134  1.848   1.00 0.00 ? 284 VAL A CA   3 
ATOM   2981 C C    . VAL A 1 13 ? 0.948   13.185  3.048   1.00 0.00 ? 284 VAL A C    3 
ATOM   2982 O O    . VAL A 1 13 ? 1.565   12.138  3.032   1.00 0.00 ? 284 VAL A O    3 
ATOM   2983 C CB   . VAL A 1 13 ? 2.080   15.169  2.030   1.00 0.00 ? 284 VAL A CB   3 
ATOM   2984 C CG1  . VAL A 1 13 ? 3.411   14.454  2.271   1.00 0.00 ? 284 VAL A CG1  3 
ATOM   2985 C CG2  . VAL A 1 13 ? 2.186   16.029  0.769   1.00 0.00 ? 284 VAL A CG2  3 
ATOM   2986 H H    . VAL A 1 13 ? -0.355  15.792  1.725   1.00 0.00 ? 284 VAL A H    3 
ATOM   2987 H HA   . VAL A 1 13 ? 1.152   13.569  0.946   1.00 0.00 ? 284 VAL A HA   3 
ATOM   2988 H HB   . VAL A 1 13 ? 1.851   15.797  2.879   1.00 0.00 ? 284 VAL A HB   3 
ATOM   2989 H HG11 . VAL A 1 13 ? 3.222   13.433  2.571   1.00 0.00 ? 284 VAL A HG11 3 
ATOM   2990 H HG12 . VAL A 1 13 ? 3.992   14.459  1.358   1.00 0.00 ? 284 VAL A HG12 3 
ATOM   2991 H HG13 . VAL A 1 13 ? 3.959   14.963  3.048   1.00 0.00 ? 284 VAL A HG13 3 
ATOM   2992 H HG21 . VAL A 1 13 ? 1.226   16.479  0.559   1.00 0.00 ? 284 VAL A HG21 3 
ATOM   2993 H HG22 . VAL A 1 13 ? 2.922   16.805  0.923   1.00 0.00 ? 284 VAL A HG22 3 
ATOM   2994 H HG23 . VAL A 1 13 ? 2.484   15.411  -0.064  1.00 0.00 ? 284 VAL A HG23 3 
ATOM   2995 N N    . LYS A 1 14 ? 0.248   13.542  4.089   1.00 0.00 ? 285 LYS A N    3 
ATOM   2996 C CA   . LYS A 1 14 ? 0.197   12.675  5.261   1.00 0.00 ? 285 LYS A CA   3 
ATOM   2997 C C    . LYS A 1 14 ? -0.681  11.460  4.954   1.00 0.00 ? 285 LYS A C    3 
ATOM   2998 O O    . LYS A 1 14 ? -0.271  10.328  5.117   1.00 0.00 ? 285 LYS A O    3 
ATOM   2999 C CB   . LYS A 1 14 ? -0.386  13.444  6.448   1.00 0.00 ? 285 LYS A CB   3 
ATOM   3000 C CG   . LYS A 1 14 ? -0.099  12.679  7.742   1.00 0.00 ? 285 LYS A CG   3 
ATOM   3001 C CD   . LYS A 1 14 ? 1.413   12.601  7.966   1.00 0.00 ? 285 LYS A CD   3 
ATOM   3002 C CE   . LYS A 1 14 ? 1.763   13.233  9.314   1.00 0.00 ? 285 LYS A CE   3 
ATOM   3003 N NZ   . LYS A 1 14 ? 1.817   14.715  9.169   1.00 0.00 ? 285 LYS A NZ   3 
ATOM   3004 H H    . LYS A 1 14 ? -0.241  14.392  4.084   1.00 0.00 ? 285 LYS A H    3 
ATOM   3005 H HA   . LYS A 1 14 ? 1.195   12.343  5.504   1.00 0.00 ? 285 LYS A HA   3 
ATOM   3006 H HB2  . LYS A 1 14 ? 0.067   14.424  6.498   1.00 0.00 ? 285 LYS A HB2  3 
ATOM   3007 H HB3  . LYS A 1 14 ? -1.453  13.546  6.321   1.00 0.00 ? 285 LYS A HB3  3 
ATOM   3008 H HG2  . LYS A 1 14 ? -0.561  13.191  8.573   1.00 0.00 ? 285 LYS A HG2  3 
ATOM   3009 H HG3  . LYS A 1 14 ? -0.500  11.679  7.666   1.00 0.00 ? 285 LYS A HG3  3 
ATOM   3010 H HD2  . LYS A 1 14 ? 1.725   11.566  7.958   1.00 0.00 ? 285 LYS A HD2  3 
ATOM   3011 H HD3  . LYS A 1 14 ? 1.921   13.135  7.176   1.00 0.00 ? 285 LYS A HD3  3 
ATOM   3012 H HE2  . LYS A 1 14 ? 1.010   12.968  10.041  1.00 0.00 ? 285 LYS A HE2  3 
ATOM   3013 H HE3  . LYS A 1 14 ? 2.725   12.869  9.643   1.00 0.00 ? 285 LYS A HE3  3 
ATOM   3014 H HZ1  . LYS A 1 14 ? 1.142   15.017  8.438   1.00 0.00 ? 285 LYS A HZ1  3 
ATOM   3015 H HZ2  . LYS A 1 14 ? 1.568   15.160  10.077  1.00 0.00 ? 285 LYS A HZ2  3 
ATOM   3016 H HZ3  . LYS A 1 14 ? 2.775   15.003  8.893   1.00 0.00 ? 285 LYS A HZ3  3 
ATOM   3017 N N    . THR A 1 15 ? -1.886  11.685  4.503   1.00 0.00 ? 286 THR A N    3 
ATOM   3018 C CA   . THR A 1 15 ? -2.763  10.564  4.188   1.00 0.00 ? 286 THR A CA   3 
ATOM   3019 C C    . THR A 1 15 ? -2.023  9.592   3.268   1.00 0.00 ? 286 THR A C    3 
ATOM   3020 O O    . THR A 1 15 ? -2.127  8.390   3.406   1.00 0.00 ? 286 THR A O    3 
ATOM   3021 C CB   . THR A 1 15 ? -4.021  11.080  3.484   1.00 0.00 ? 286 THR A CB   3 
ATOM   3022 O OG1  . THR A 1 15 ? -4.728  11.951  4.356   1.00 0.00 ? 286 THR A OG1  3 
ATOM   3023 C CG2  . THR A 1 15 ? -4.916  9.899   3.104   1.00 0.00 ? 286 THR A CG2  3 
ATOM   3024 H H    . THR A 1 15 ? -2.198  12.604  4.373   1.00 0.00 ? 286 THR A H    3 
ATOM   3025 H HA   . THR A 1 15 ? -3.044  10.058  5.100   1.00 0.00 ? 286 THR A HA   3 
ATOM   3026 H HB   . THR A 1 15 ? -3.741  11.616  2.591   1.00 0.00 ? 286 THR A HB   3 
ATOM   3027 H HG1  . THR A 1 15 ? -5.607  12.086  3.995   1.00 0.00 ? 286 THR A HG1  3 
ATOM   3028 H HG21 . THR A 1 15 ? -4.343  8.984   3.149   1.00 0.00 ? 286 THR A HG21 3 
ATOM   3029 H HG22 . THR A 1 15 ? -5.745  9.839   3.794   1.00 0.00 ? 286 THR A HG22 3 
ATOM   3030 H HG23 . THR A 1 15 ? -5.291  10.040  2.102   1.00 0.00 ? 286 THR A HG23 3 
ATOM   3031 N N    . LEU A 1 16 ? -1.270  10.105  2.333   1.00 0.00 ? 287 LEU A N    3 
ATOM   3032 C CA   . LEU A 1 16 ? -0.535  9.231   1.427   1.00 0.00 ? 287 LEU A CA   3 
ATOM   3033 C C    . LEU A 1 16 ? 0.434   8.365   2.236   1.00 0.00 ? 287 LEU A C    3 
ATOM   3034 O O    . LEU A 1 16 ? 0.348   7.152   2.233   1.00 0.00 ? 287 LEU A O    3 
ATOM   3035 C CB   . LEU A 1 16 ? 0.256   10.079  0.430   1.00 0.00 ? 287 LEU A CB   3 
ATOM   3036 C CG   . LEU A 1 16 ? -0.602  10.349  -0.808  1.00 0.00 ? 287 LEU A CG   3 
ATOM   3037 C CD1  . LEU A 1 16 ? 0.001   11.511  -1.599  1.00 0.00 ? 287 LEU A CD1  3 
ATOM   3038 C CD2  . LEU A 1 16 ? -0.634  9.097   -1.687  1.00 0.00 ? 287 LEU A CD2  3 
ATOM   3039 H H    . LEU A 1 16 ? -1.197  11.078  2.243   1.00 0.00 ? 287 LEU A H    3 
ATOM   3040 H HA   . LEU A 1 16 ? -1.228  8.598   0.893   1.00 0.00 ? 287 LEU A HA   3 
ATOM   3041 H HB2  . LEU A 1 16 ? 0.528   11.018  0.892   1.00 0.00 ? 287 LEU A HB2  3 
ATOM   3042 H HB3  . LEU A 1 16 ? 1.151   9.550   0.137   1.00 0.00 ? 287 LEU A HB3  3 
ATOM   3043 H HG   . LEU A 1 16 ? -1.605  10.604  -0.502  1.00 0.00 ? 287 LEU A HG   3 
ATOM   3044 H HD11 . LEU A 1 16 ? 1.014   11.268  -1.882  1.00 0.00 ? 287 LEU A HD11 3 
ATOM   3045 H HD12 . LEU A 1 16 ? -0.586  11.684  -2.488  1.00 0.00 ? 287 LEU A HD12 3 
ATOM   3046 H HD13 . LEU A 1 16 ? 0.001   12.402  -0.989  1.00 0.00 ? 287 LEU A HD13 3 
ATOM   3047 H HD21 . LEU A 1 16 ? 0.376   8.759   -1.869  1.00 0.00 ? 287 LEU A HD21 3 
ATOM   3048 H HD22 . LEU A 1 16 ? -1.189  8.319   -1.183  1.00 0.00 ? 287 LEU A HD22 3 
ATOM   3049 H HD23 . LEU A 1 16 ? -1.112  9.330   -2.627  1.00 0.00 ? 287 LEU A HD23 3 
ATOM   3050 N N    . LYS A 1 17 ? 1.352   8.981   2.929   1.00 0.00 ? 288 LYS A N    3 
ATOM   3051 C CA   . LYS A 1 17 ? 2.307   8.216   3.722   1.00 0.00 ? 288 LYS A CA   3 
ATOM   3052 C C    . LYS A 1 17 ? 1.564   7.122   4.490   1.00 0.00 ? 288 LYS A C    3 
ATOM   3053 O O    . LYS A 1 17 ? 2.105   6.072   4.775   1.00 0.00 ? 288 LYS A O    3 
ATOM   3054 C CB   . LYS A 1 17 ? 3.012   9.146   4.711   1.00 0.00 ? 288 LYS A CB   3 
ATOM   3055 C CG   . LYS A 1 17 ? 4.517   9.132   4.442   1.00 0.00 ? 288 LYS A CG   3 
ATOM   3056 C CD   . LYS A 1 17 ? 4.884   10.305  3.530   1.00 0.00 ? 288 LYS A CD   3 
ATOM   3057 C CE   . LYS A 1 17 ? 5.099   11.560  4.375   1.00 0.00 ? 288 LYS A CE   3 
ATOM   3058 N NZ   . LYS A 1 17 ? 6.381   11.440  5.127   1.00 0.00 ? 288 LYS A NZ   3 
ATOM   3059 H H    . LYS A 1 17 ? 1.401   9.960   2.917   1.00 0.00 ? 288 LYS A H    3 
ATOM   3060 H HA   . LYS A 1 17 ? 3.039   7.765   3.069   1.00 0.00 ? 288 LYS A HA   3 
ATOM   3061 H HB2  . LYS A 1 17 ? 2.632   10.150  4.592   1.00 0.00 ? 288 LYS A HB2  3 
ATOM   3062 H HB3  . LYS A 1 17 ? 2.825   8.807   5.720   1.00 0.00 ? 288 LYS A HB3  3 
ATOM   3063 H HG2  . LYS A 1 17 ? 5.050   9.222   5.376   1.00 0.00 ? 288 LYS A HG2  3 
ATOM   3064 H HG3  . LYS A 1 17 ? 4.788   8.206   3.959   1.00 0.00 ? 288 LYS A HG3  3 
ATOM   3065 H HD2  . LYS A 1 17 ? 5.790   10.072  2.991   1.00 0.00 ? 288 LYS A HD2  3 
ATOM   3066 H HD3  . LYS A 1 17 ? 4.083   10.479  2.827   1.00 0.00 ? 288 LYS A HD3  3 
ATOM   3067 H HE2  . LYS A 1 17 ? 5.142   12.426  3.730   1.00 0.00 ? 288 LYS A HE2  3 
ATOM   3068 H HE3  . LYS A 1 17 ? 4.281   11.671  5.072   1.00 0.00 ? 288 LYS A HE3  3 
ATOM   3069 H HZ1  . LYS A 1 17 ? 6.902   10.606  4.794   1.00 0.00 ? 288 LYS A HZ1  3 
ATOM   3070 H HZ2  . LYS A 1 17 ? 6.956   12.291  4.971   1.00 0.00 ? 288 LYS A HZ2  3 
ATOM   3071 H HZ3  . LYS A 1 17 ? 6.177   11.340  6.144   1.00 0.00 ? 288 LYS A HZ3  3 
ATOM   3072 N N    . ALA A 1 18 ? 0.325   7.355   4.823   1.00 0.00 ? 289 ALA A N    3 
ATOM   3073 C CA   . ALA A 1 18 ? -0.439  6.348   5.550   1.00 0.00 ? 289 ALA A CA   3 
ATOM   3074 C C    . ALA A 1 18 ? -0.681  5.144   4.642   1.00 0.00 ? 289 ALA A C    3 
ATOM   3075 O O    . ALA A 1 18 ? -0.283  4.035   4.943   1.00 0.00 ? 289 ALA A O    3 
ATOM   3076 C CB   . ALA A 1 18 ? -1.786  6.933   5.972   1.00 0.00 ? 289 ALA A CB   3 
ATOM   3077 H H    . ALA A 1 18 ? -0.094  8.206   4.580   1.00 0.00 ? 289 ALA A H    3 
ATOM   3078 H HA   . ALA A 1 18 ? 0.110   6.040   6.427   1.00 0.00 ? 289 ALA A HA   3 
ATOM   3079 H HB1  . ALA A 1 18 ? -1.764  8.008   5.861   1.00 0.00 ? 289 ALA A HB1  3 
ATOM   3080 H HB2  . ALA A 1 18 ? -2.566  6.523   5.346   1.00 0.00 ? 289 ALA A HB2  3 
ATOM   3081 H HB3  . ALA A 1 18 ? -1.982  6.680   7.002   1.00 0.00 ? 289 ALA A HB3  3 
ATOM   3082 N N    . GLN A 1 19 ? -1.332  5.354   3.533   1.00 0.00 ? 290 GLN A N    3 
ATOM   3083 C CA   . GLN A 1 19 ? -1.599  4.247   2.624   1.00 0.00 ? 290 GLN A CA   3 
ATOM   3084 C C    . GLN A 1 19 ? -0.299  3.492   2.341   1.00 0.00 ? 290 GLN A C    3 
ATOM   3085 O O    . GLN A 1 19 ? -0.286  2.284   2.214   1.00 0.00 ? 290 GLN A O    3 
ATOM   3086 C CB   . GLN A 1 19 ? -2.176  4.789   1.316   1.00 0.00 ? 290 GLN A CB   3 
ATOM   3087 C CG   . GLN A 1 19 ? -3.705  4.761   1.385   1.00 0.00 ? 290 GLN A CG   3 
ATOM   3088 C CD   . GLN A 1 19 ? -4.285  5.175   0.032   1.00 0.00 ? 290 GLN A CD   3 
ATOM   3089 O OE1  . GLN A 1 19 ? -5.258  4.609   -0.425  1.00 0.00 ? 290 GLN A OE1  3 
ATOM   3090 N NE2  . GLN A 1 19 ? -3.726  6.148   -0.635  1.00 0.00 ? 290 GLN A NE2  3 
ATOM   3091 H H    . GLN A 1 19 ? -1.645  6.255   3.310   1.00 0.00 ? 290 GLN A H    3 
ATOM   3092 H HA   . GLN A 1 19 ? -2.313  3.578   3.081   1.00 0.00 ? 290 GLN A HA   3 
ATOM   3093 H HB2  . GLN A 1 19 ? -1.839  5.803   1.166   1.00 0.00 ? 290 GLN A HB2  3 
ATOM   3094 H HB3  . GLN A 1 19 ? -1.844  4.172   0.493   1.00 0.00 ? 290 GLN A HB3  3 
ATOM   3095 H HG2  . GLN A 1 19 ? -4.037  3.762   1.629   1.00 0.00 ? 290 GLN A HG2  3 
ATOM   3096 H HG3  . GLN A 1 19 ? -4.044  5.449   2.144   1.00 0.00 ? 290 GLN A HG3  3 
ATOM   3097 H HE21 . GLN A 1 19 ? -2.942  6.606   -0.269  1.00 0.00 ? 290 GLN A HE21 3 
ATOM   3098 H HE22 . GLN A 1 19 ? -4.092  6.421   -1.503  1.00 0.00 ? 290 GLN A HE22 3 
ATOM   3099 N N    . ASN A 1 20 ? 0.799   4.192   2.243   1.00 0.00 ? 291 ASN A N    3 
ATOM   3100 C CA   . ASN A 1 20 ? 2.064   3.522   1.976   1.00 0.00 ? 291 ASN A CA   3 
ATOM   3101 C C    . ASN A 1 20 ? 2.361   2.539   3.108   1.00 0.00 ? 291 ASN A C    3 
ATOM   3102 O O    . ASN A 1 20 ? 2.609   1.371   2.881   1.00 0.00 ? 291 ASN A O    3 
ATOM   3103 C CB   . ASN A 1 20 ? 3.188   4.556   1.892   1.00 0.00 ? 291 ASN A CB   3 
ATOM   3104 C CG   . ASN A 1 20 ? 4.505   3.852   1.561   1.00 0.00 ? 291 ASN A CG   3 
ATOM   3105 O OD1  . ASN A 1 20 ? 4.984   3.929   0.447   1.00 0.00 ? 291 ASN A OD1  3 
ATOM   3106 N ND2  . ASN A 1 20 ? 5.114   3.163   2.485   1.00 0.00 ? 291 ASN A ND2  3 
ATOM   3107 H H    . ASN A 1 20 ? 0.772   5.166   2.350   1.00 0.00 ? 291 ASN A H    3 
ATOM   3108 H HA   . ASN A 1 20 ? 1.999   2.986   1.042   1.00 0.00 ? 291 ASN A HA   3 
ATOM   3109 H HB2  . ASN A 1 20 ? 2.958   5.276   1.120   1.00 0.00 ? 291 ASN A HB2  3 
ATOM   3110 H HB3  . ASN A 1 20 ? 3.283   5.063   2.841   1.00 0.00 ? 291 ASN A HB3  3 
ATOM   3111 H HD21 . ASN A 1 20 ? 4.728   3.100   3.385   1.00 0.00 ? 291 ASN A HD21 3 
ATOM   3112 H HD22 . ASN A 1 20 ? 5.958   2.707   2.281   1.00 0.00 ? 291 ASN A HD22 3 
ATOM   3113 N N    . SER A 1 21 ? 2.335   3.001   4.328   1.00 0.00 ? 292 SER A N    3 
ATOM   3114 C CA   . SER A 1 21 ? 2.608   2.112   5.451   1.00 0.00 ? 292 SER A CA   3 
ATOM   3115 C C    . SER A 1 21 ? 1.571   0.987   5.467   1.00 0.00 ? 292 SER A C    3 
ATOM   3116 O O    . SER A 1 21 ? 1.839   -0.112  5.914   1.00 0.00 ? 292 SER A O    3 
ATOM   3117 C CB   . SER A 1 21 ? 2.526   2.900   6.758   1.00 0.00 ? 292 SER A CB   3 
ATOM   3118 O OG   . SER A 1 21 ? 1.972   4.183   6.499   1.00 0.00 ? 292 SER A OG   3 
ATOM   3119 H H    . SER A 1 21 ? 2.132   3.946   4.490   1.00 0.00 ? 292 SER A H    3 
ATOM   3120 H HA   . SER A 1 21 ? 3.597   1.691   5.346   1.00 0.00 ? 292 SER A HA   3 
ATOM   3121 H HB2  . SER A 1 21 ? 1.897   2.377   7.458   1.00 0.00 ? 292 SER A HB2  3 
ATOM   3122 H HB3  . SER A 1 21 ? 3.520   3.003   7.177   1.00 0.00 ? 292 SER A HB3  3 
ATOM   3123 H HG   . SER A 1 21 ? 1.973   4.678   7.320   1.00 0.00 ? 292 SER A HG   3 
ATOM   3124 N N    . GLU A 1 22 ? 0.388   1.250   4.980   1.00 0.00 ? 293 GLU A N    3 
ATOM   3125 C CA   . GLU A 1 22 ? -0.641  0.219   4.967   1.00 0.00 ? 293 GLU A CA   3 
ATOM   3126 C C    . GLU A 1 22 ? -0.304  -0.829  3.904   1.00 0.00 ? 293 GLU A C    3 
ATOM   3127 O O    . GLU A 1 22 ? 0.054   -1.948  4.213   1.00 0.00 ? 293 GLU A O    3 
ATOM   3128 C CB   . GLU A 1 22 ? -1.997  0.854   4.644   1.00 0.00 ? 293 GLU A CB   3 
ATOM   3129 C CG   . GLU A 1 22 ? -2.344  1.890   5.715   1.00 0.00 ? 293 GLU A CG   3 
ATOM   3130 C CD   . GLU A 1 22 ? -3.011  1.192   6.901   1.00 0.00 ? 293 GLU A CD   3 
ATOM   3131 O OE1  . GLU A 1 22 ? -2.559  0.119   7.264   1.00 0.00 ? 293 GLU A OE1  3 
ATOM   3132 O OE2  . GLU A 1 22 ? -3.963  1.745   7.430   1.00 0.00 ? 293 GLU A OE2  3 
ATOM   3133 H H    . GLU A 1 22 ? 0.194   2.142   4.623   1.00 0.00 ? 293 GLU A H    3 
ATOM   3134 H HA   . GLU A 1 22 ? -0.690  -0.255  5.936   1.00 0.00 ? 293 GLU A HA   3 
ATOM   3135 H HB2  . GLU A 1 22 ? -1.946  1.336   3.679   1.00 0.00 ? 293 GLU A HB2  3 
ATOM   3136 H HB3  . GLU A 1 22 ? -2.758  0.088   4.625   1.00 0.00 ? 293 GLU A HB3  3 
ATOM   3137 H HG2  . GLU A 1 22 ? -1.441  2.382   6.045   1.00 0.00 ? 293 GLU A HG2  3 
ATOM   3138 H HG3  . GLU A 1 22 ? -3.023  2.620   5.302   1.00 0.00 ? 293 GLU A HG3  3 
ATOM   3139 N N    . LEU A 1 23 ? -0.416  -0.475  2.652   1.00 0.00 ? 294 LEU A N    3 
ATOM   3140 C CA   . LEU A 1 23 ? -0.109  -1.430  1.593   1.00 0.00 ? 294 LEU A CA   3 
ATOM   3141 C C    . LEU A 1 23 ? 1.273   -2.038  1.837   1.00 0.00 ? 294 LEU A C    3 
ATOM   3142 O O    . LEU A 1 23 ? 1.554   -3.148  1.430   1.00 0.00 ? 294 LEU A O    3 
ATOM   3143 C CB   . LEU A 1 23 ? -0.121  -0.713  0.241   1.00 0.00 ? 294 LEU A CB   3 
ATOM   3144 C CG   . LEU A 1 23 ? -1.491  -0.890  -0.416  1.00 0.00 ? 294 LEU A CG   3 
ATOM   3145 C CD1  . LEU A 1 23 ? -1.957  0.449   -0.990  1.00 0.00 ? 294 LEU A CD1  3 
ATOM   3146 C CD2  . LEU A 1 23 ? -1.384  -1.918  -1.545  1.00 0.00 ? 294 LEU A CD2  3 
ATOM   3147 H H    . LEU A 1 23 ? -0.708  0.433   2.424   1.00 0.00 ? 294 LEU A H    3 
ATOM   3148 H HA   . LEU A 1 23 ? -0.851  -2.213  1.588   1.00 0.00 ? 294 LEU A HA   3 
ATOM   3149 H HB2  . LEU A 1 23 ? 0.075   0.340   0.390   1.00 0.00 ? 294 LEU A HB2  3 
ATOM   3150 H HB3  . LEU A 1 23 ? 0.639   -1.135  -0.397  1.00 0.00 ? 294 LEU A HB3  3 
ATOM   3151 H HG   . LEU A 1 23 ? -2.203  -1.232  0.320   1.00 0.00 ? 294 LEU A HG   3 
ATOM   3152 H HD11 . LEU A 1 23 ? -1.175  0.870   -1.604  1.00 0.00 ? 294 LEU A HD11 3 
ATOM   3153 H HD12 . LEU A 1 23 ? -2.841  0.294   -1.592  1.00 0.00 ? 294 LEU A HD12 3 
ATOM   3154 H HD13 . LEU A 1 23 ? -2.188  1.128   -0.183  1.00 0.00 ? 294 LEU A HD13 3 
ATOM   3155 H HD21 . LEU A 1 23 ? -0.525  -1.689  -2.162  1.00 0.00 ? 294 LEU A HD21 3 
ATOM   3156 H HD22 . LEU A 1 23 ? -1.270  -2.905  -1.122  1.00 0.00 ? 294 LEU A HD22 3 
ATOM   3157 H HD23 . LEU A 1 23 ? -2.279  -1.885  -2.149  1.00 0.00 ? 294 LEU A HD23 3 
ATOM   3158 N N    . ALA A 1 24 ? 2.141   -1.322  2.499   1.00 0.00 ? 295 ALA A N    3 
ATOM   3159 C CA   . ALA A 1 24 ? 3.475   -1.851  2.759   1.00 0.00 ? 295 ALA A CA   3 
ATOM   3160 C C    . ALA A 1 24 ? 3.367   -3.078  3.668   1.00 0.00 ? 295 ALA A C    3 
ATOM   3161 O O    . ALA A 1 24 ? 3.855   -4.144  3.348   1.00 0.00 ? 295 ALA A O    3 
ATOM   3162 C CB   . ALA A 1 24 ? 4.324   -0.780  3.446   1.00 0.00 ? 295 ALA A CB   3 
ATOM   3163 H H    . ALA A 1 24 ? 1.896   -0.429  2.820   1.00 0.00 ? 295 ALA A H    3 
ATOM   3164 H HA   . ALA A 1 24 ? 3.939   -2.133  1.827   1.00 0.00 ? 295 ALA A HA   3 
ATOM   3165 H HB1  . ALA A 1 24 ? 3.759   -0.332  4.251   1.00 0.00 ? 295 ALA A HB1  3 
ATOM   3166 H HB2  . ALA A 1 24 ? 5.221   -1.232  3.844   1.00 0.00 ? 295 ALA A HB2  3 
ATOM   3167 H HB3  . ALA A 1 24 ? 4.592   -0.018  2.728   1.00 0.00 ? 295 ALA A HB3  3 
ATOM   3168 N N    . SER A 1 25 ? 2.735   -2.935  4.799   1.00 0.00 ? 296 SER A N    3 
ATOM   3169 C CA   . SER A 1 25 ? 2.602   -4.067  5.711   1.00 0.00 ? 296 SER A CA   3 
ATOM   3170 C C    . SER A 1 25 ? 1.838   -5.196  5.015   1.00 0.00 ? 296 SER A C    3 
ATOM   3171 O O    . SER A 1 25 ? 2.173   -6.358  5.146   1.00 0.00 ? 296 SER A O    3 
ATOM   3172 C CB   . SER A 1 25 ? 1.838   -3.629  6.960   1.00 0.00 ? 296 SER A CB   3 
ATOM   3173 O OG   . SER A 1 25 ? 2.348   -4.327  8.090   1.00 0.00 ? 296 SER A OG   3 
ATOM   3174 H H    . SER A 1 25 ? 2.350   -2.066  5.040   1.00 0.00 ? 296 SER A H    3 
ATOM   3175 H HA   . SER A 1 25 ? 3.582   -4.417  5.994   1.00 0.00 ? 296 SER A HA   3 
ATOM   3176 H HB2  . SER A 1 25 ? 1.965   -2.571  7.110   1.00 0.00 ? 296 SER A HB2  3 
ATOM   3177 H HB3  . SER A 1 25 ? 0.786   -3.848  6.832   1.00 0.00 ? 296 SER A HB3  3 
ATOM   3178 H HG   . SER A 1 25 ? 2.928   -3.731  8.568   1.00 0.00 ? 296 SER A HG   3 
ATOM   3179 N N    . THR A 1 26 ? 0.811   -4.868  4.279   1.00 0.00 ? 297 THR A N    3 
ATOM   3180 C CA   . THR A 1 26 ? 0.041   -5.902  3.595   1.00 0.00 ? 297 THR A CA   3 
ATOM   3181 C C    . THR A 1 26 ? 0.966   -6.712  2.685   1.00 0.00 ? 297 THR A C    3 
ATOM   3182 O O    . THR A 1 26 ? 0.997   -7.925  2.737   1.00 0.00 ? 297 THR A O    3 
ATOM   3183 C CB   . THR A 1 26 ? -1.062  -5.251  2.759   1.00 0.00 ? 297 THR A CB   3 
ATOM   3184 O OG1  . THR A 1 26 ? -2.037  -4.682  3.624   1.00 0.00 ? 297 THR A OG1  3 
ATOM   3185 C CG2  . THR A 1 26 ? -1.721  -6.307  1.870   1.00 0.00 ? 297 THR A CG2  3 
ATOM   3186 H H    . THR A 1 26 ? 0.555   -3.927  4.188   1.00 0.00 ? 297 THR A H    3 
ATOM   3187 H HA   . THR A 1 26 ? -0.404  -6.559  4.324   1.00 0.00 ? 297 THR A HA   3 
ATOM   3188 H HB   . THR A 1 26 ? -0.636  -4.477  2.137   1.00 0.00 ? 297 THR A HB   3 
ATOM   3189 H HG1  . THR A 1 26 ? -1.711  -3.826  3.915   1.00 0.00 ? 297 THR A HG1  3 
ATOM   3190 H HG21 . THR A 1 26 ? -1.951  -7.182  2.459   1.00 0.00 ? 297 THR A HG21 3 
ATOM   3191 H HG22 . THR A 1 26 ? -2.630  -5.906  1.448   1.00 0.00 ? 297 THR A HG22 3 
ATOM   3192 H HG23 . THR A 1 26 ? -1.044  -6.579  1.074   1.00 0.00 ? 297 THR A HG23 3 
ATOM   3193 N N    . ALA A 1 27 ? 1.720   -6.052  1.850   1.00 0.00 ? 298 ALA A N    3 
ATOM   3194 C CA   . ALA A 1 27 ? 2.621   -6.771  0.959   1.00 0.00 ? 298 ALA A CA   3 
ATOM   3195 C C    . ALA A 1 27 ? 3.578   -7.627  1.787   1.00 0.00 ? 298 ALA A C    3 
ATOM   3196 O O    . ALA A 1 27 ? 3.636   -8.833  1.637   1.00 0.00 ? 298 ALA A O    3 
ATOM   3197 C CB   . ALA A 1 27 ? 3.420   -5.771  0.125   1.00 0.00 ? 298 ALA A CB   3 
ATOM   3198 H H    . ALA A 1 27 ? 1.682   -5.072  1.823   1.00 0.00 ? 298 ALA A H    3 
ATOM   3199 H HA   . ALA A 1 27 ? 2.047   -7.406  0.301   1.00 0.00 ? 298 ALA A HA   3 
ATOM   3200 H HB1  . ALA A 1 27 ? 3.402   -4.806  0.609   1.00 0.00 ? 298 ALA A HB1  3 
ATOM   3201 H HB2  . ALA A 1 27 ? 4.441   -6.111  0.035   1.00 0.00 ? 298 ALA A HB2  3 
ATOM   3202 H HB3  . ALA A 1 27 ? 2.980   -5.687  -0.858  1.00 0.00 ? 298 ALA A HB3  3 
ATOM   3203 N N    . ASN A 1 28 ? 4.328   -7.017  2.664   1.00 0.00 ? 299 ASN A N    3 
ATOM   3204 C CA   . ASN A 1 28 ? 5.257   -7.784  3.486   1.00 0.00 ? 299 ASN A CA   3 
ATOM   3205 C C    . ASN A 1 28 ? 4.542   -9.015  4.043   1.00 0.00 ? 299 ASN A C    3 
ATOM   3206 O O    . ASN A 1 28 ? 5.134   -10.061 4.230   1.00 0.00 ? 299 ASN A O    3 
ATOM   3207 C CB   . ASN A 1 28 ? 5.754   -6.914  4.644   1.00 0.00 ? 299 ASN A CB   3 
ATOM   3208 C CG   . ASN A 1 28 ? 7.249   -6.640  4.472   1.00 0.00 ? 299 ASN A CG   3 
ATOM   3209 O OD1  . ASN A 1 28 ? 8.013   -7.539  4.179   1.00 0.00 ? 299 ASN A OD1  3 
ATOM   3210 N ND2  . ASN A 1 28 ? 7.703   -5.429  4.643   1.00 0.00 ? 299 ASN A ND2  3 
ATOM   3211 H H    . ASN A 1 28 ? 4.264   -6.045  2.772   1.00 0.00 ? 299 ASN A H    3 
ATOM   3212 H HA   . ASN A 1 28 ? 6.098   -8.096  2.885   1.00 0.00 ? 299 ASN A HA   3 
ATOM   3213 H HB2  . ASN A 1 28 ? 5.214   -5.979  4.646   1.00 0.00 ? 299 ASN A HB2  3 
ATOM   3214 H HB3  . ASN A 1 28 ? 5.589   -7.428  5.577   1.00 0.00 ? 299 ASN A HB3  3 
ATOM   3215 H HD21 . ASN A 1 28 ? 7.087   -4.703  4.879   1.00 0.00 ? 299 ASN A HD21 3 
ATOM   3216 H HD22 . ASN A 1 28 ? 8.659   -5.244  4.535   1.00 0.00 ? 299 ASN A HD22 3 
ATOM   3217 N N    . MET A 1 29 ? 3.268   -8.903  4.307   1.00 0.00 ? 300 MET A N    3 
ATOM   3218 C CA   . MET A 1 29 ? 2.527   -10.040 4.838   1.00 0.00 ? 300 MET A CA   3 
ATOM   3219 C C    . MET A 1 29 ? 2.457   -11.139 3.775   1.00 0.00 ? 300 MET A C    3 
ATOM   3220 O O    . MET A 1 29 ? 2.914   -12.247 3.982   1.00 0.00 ? 300 MET A O    3 
ATOM   3221 C CB   . MET A 1 29 ? 1.111   -9.596  5.210   1.00 0.00 ? 300 MET A CB   3 
ATOM   3222 C CG   . MET A 1 29 ? 0.350   -10.773 5.826   1.00 0.00 ? 300 MET A CG   3 
ATOM   3223 S SD   . MET A 1 29 ? -0.474  -10.230 7.342   1.00 0.00 ? 300 MET A SD   3 
ATOM   3224 C CE   . MET A 1 29 ? -1.250  -8.743  6.660   1.00 0.00 ? 300 MET A CE   3 
ATOM   3225 H H    . MET A 1 29 ? 2.810   -8.052  4.147   1.00 0.00 ? 300 MET A H    3 
ATOM   3226 H HA   . MET A 1 29 ? 3.027   -10.419 5.717   1.00 0.00 ? 300 MET A HA   3 
ATOM   3227 H HB2  . MET A 1 29 ? 1.165   -8.787  5.925   1.00 0.00 ? 300 MET A HB2  3 
ATOM   3228 H HB3  . MET A 1 29 ? 0.594   -9.262  4.324   1.00 0.00 ? 300 MET A HB3  3 
ATOM   3229 H HG2  . MET A 1 29 ? -0.387  -11.134 5.123   1.00 0.00 ? 300 MET A HG2  3 
ATOM   3230 H HG3  . MET A 1 29 ? 1.044   -11.567 6.058   1.00 0.00 ? 300 MET A HG3  3 
ATOM   3231 H HE1  . MET A 1 29 ? -1.329  -8.841  5.585   1.00 0.00 ? 300 MET A HE1  3 
ATOM   3232 H HE2  . MET A 1 29 ? -2.233  -8.621  7.088   1.00 0.00 ? 300 MET A HE2  3 
ATOM   3233 H HE3  . MET A 1 29 ? -0.647  -7.881  6.897   1.00 0.00 ? 300 MET A HE3  3 
ATOM   3234 N N    . LEU A 1 30 ? 1.889   -10.841 2.637   1.00 0.00 ? 301 LEU A N    3 
ATOM   3235 C CA   . LEU A 1 30 ? 1.794   -11.845 1.585   1.00 0.00 ? 301 LEU A CA   3 
ATOM   3236 C C    . LEU A 1 30 ? 3.200   -12.273 1.161   1.00 0.00 ? 301 LEU A C    3 
ATOM   3237 O O    . LEU A 1 30 ? 3.386   -13.292 0.528   1.00 0.00 ? 301 LEU A O    3 
ATOM   3238 C CB   . LEU A 1 30 ? 1.055   -11.255 0.381   1.00 0.00 ? 301 LEU A CB   3 
ATOM   3239 C CG   . LEU A 1 30 ? -0.323  -10.762 0.820   1.00 0.00 ? 301 LEU A CG   3 
ATOM   3240 C CD1  . LEU A 1 30 ? -1.086  -10.229 -0.395  1.00 0.00 ? 301 LEU A CD1  3 
ATOM   3241 C CD2  . LEU A 1 30 ? -1.105  -11.921 1.442   1.00 0.00 ? 301 LEU A CD2  3 
ATOM   3242 H H    . LEU A 1 30 ? 1.529   -9.943  2.492   1.00 0.00 ? 301 LEU A H    3 
ATOM   3243 H HA   . LEU A 1 30 ? 1.252   -12.703 1.952   1.00 0.00 ? 301 LEU A HA   3 
ATOM   3244 H HB2  . LEU A 1 30 ? 1.625   -10.429 -0.019  1.00 0.00 ? 301 LEU A HB2  3 
ATOM   3245 H HB3  . LEU A 1 30 ? 0.940   -12.015 -0.378  1.00 0.00 ? 301 LEU A HB3  3 
ATOM   3246 H HG   . LEU A 1 30 ? -0.209  -9.971  1.548   1.00 0.00 ? 301 LEU A HG   3 
ATOM   3247 H HD11 . LEU A 1 30 ? -0.385  -9.837  -1.116  1.00 0.00 ? 301 LEU A HD11 3 
ATOM   3248 H HD12 . LEU A 1 30 ? -1.656  -11.030 -0.843  1.00 0.00 ? 301 LEU A HD12 3 
ATOM   3249 H HD13 . LEU A 1 30 ? -1.756  -9.442  -0.082  1.00 0.00 ? 301 LEU A HD13 3 
ATOM   3250 H HD21 . LEU A 1 30 ? -0.846  -12.841 0.940   1.00 0.00 ? 301 LEU A HD21 3 
ATOM   3251 H HD22 . LEU A 1 30 ? -0.857  -12.002 2.491   1.00 0.00 ? 301 LEU A HD22 3 
ATOM   3252 H HD23 . LEU A 1 30 ? -2.165  -11.739 1.336   1.00 0.00 ? 301 LEU A HD23 3 
ATOM   3253 N N    . ARG A 1 31 ? 4.192   -11.496 1.505   1.00 0.00 ? 302 ARG A N    3 
ATOM   3254 C CA   . ARG A 1 31 ? 5.556   -11.845 1.132   1.00 0.00 ? 302 ARG A CA   3 
ATOM   3255 C C    . ARG A 1 31 ? 6.053   -12.988 2.020   1.00 0.00 ? 302 ARG A C    3 
ATOM   3256 O O    . ARG A 1 31 ? 6.593   -13.968 1.544   1.00 0.00 ? 302 ARG A O    3 
ATOM   3257 C CB   . ARG A 1 31 ? 6.459   -10.626 1.319   1.00 0.00 ? 302 ARG A CB   3 
ATOM   3258 C CG   . ARG A 1 31 ? 7.503   -10.588 0.203   1.00 0.00 ? 302 ARG A CG   3 
ATOM   3259 C CD   . ARG A 1 31 ? 8.832   -11.134 0.732   1.00 0.00 ? 302 ARG A CD   3 
ATOM   3260 N NE   . ARG A 1 31 ? 9.864   -11.009 -0.296  1.00 0.00 ? 302 ARG A NE   3 
ATOM   3261 C CZ   . ARG A 1 31 ? 9.568   -11.206 -1.554  1.00 0.00 ? 302 ARG A CZ   3 
ATOM   3262 N NH1  . ARG A 1 31 ? 8.772   -12.182 -1.892  1.00 0.00 ? 302 ARG A NH1  3 
ATOM   3263 N NH2  . ARG A 1 31 ? 10.073  -10.427 -2.470  1.00 0.00 ? 302 ARG A NH2  3 
ATOM   3264 H H    . ARG A 1 31 ? 4.020   -10.678 2.014   1.00 0.00 ? 302 ARG A H    3 
ATOM   3265 H HA   . ARG A 1 31 ? 5.580   -12.154 0.097   1.00 0.00 ? 302 ARG A HA   3 
ATOM   3266 H HB2  . ARG A 1 31 ? 5.860   -9.727  1.284   1.00 0.00 ? 302 ARG A HB2  3 
ATOM   3267 H HB3  . ARG A 1 31 ? 6.956   -10.690 2.275   1.00 0.00 ? 302 ARG A HB3  3 
ATOM   3268 H HG2  . ARG A 1 31 ? 7.168   -11.194 -0.626  1.00 0.00 ? 302 ARG A HG2  3 
ATOM   3269 H HG3  . ARG A 1 31 ? 7.640   -9.569  -0.127  1.00 0.00 ? 302 ARG A HG3  3 
ATOM   3270 H HD2  . ARG A 1 31 ? 9.129   -10.570 1.603   1.00 0.00 ? 302 ARG A HD2  3 
ATOM   3271 H HD3  . ARG A 1 31 ? 8.711   -12.173 1.001   1.00 0.00 ? 302 ARG A HD3  3 
ATOM   3272 H HE   . ARG A 1 31 ? 10.778  -10.774 -0.041  1.00 0.00 ? 302 ARG A HE   3 
ATOM   3273 H HH11 . ARG A 1 31 ? 8.386   -12.780 -1.190  1.00 0.00 ? 302 ARG A HH11 3 
ATOM   3274 H HH12 . ARG A 1 31 ? 8.548   -12.333 -2.855  1.00 0.00 ? 302 ARG A HH12 3 
ATOM   3275 H HH21 . ARG A 1 31 ? 10.683  -9.678  -2.213  1.00 0.00 ? 302 ARG A HH21 3 
ATOM   3276 H HH22 . ARG A 1 31 ? 9.848   -10.577 -3.434  1.00 0.00 ? 302 ARG A HH22 3 
ATOM   3277 N N    . GLU A 1 32 ? 5.880   -12.870 3.308   1.00 0.00 ? 303 GLU A N    3 
ATOM   3278 C CA   . GLU A 1 32 ? 6.336   -13.924 4.206   1.00 0.00 ? 303 GLU A CA   3 
ATOM   3279 C C    . GLU A 1 32 ? 5.546   -15.206 3.933   1.00 0.00 ? 303 GLU A C    3 
ATOM   3280 O O    . GLU A 1 32 ? 6.079   -16.298 3.990   1.00 0.00 ? 303 GLU A O    3 
ATOM   3281 C CB   . GLU A 1 32 ? 6.123   -13.488 5.658   1.00 0.00 ? 303 GLU A CB   3 
ATOM   3282 C CG   . GLU A 1 32 ? 4.721   -12.895 5.816   1.00 0.00 ? 303 GLU A CG   3 
ATOM   3283 C CD   . GLU A 1 32 ? 4.380   -12.787 7.304   1.00 0.00 ? 303 GLU A CD   3 
ATOM   3284 O OE1  . GLU A 1 32 ? 4.686   -13.718 8.029   1.00 0.00 ? 303 GLU A OE1  3 
ATOM   3285 O OE2  . GLU A 1 32 ? 3.817   -11.777 7.690   1.00 0.00 ? 303 GLU A OE2  3 
ATOM   3286 H H    . GLU A 1 32 ? 5.446   -12.070 3.670   1.00 0.00 ? 303 GLU A H    3 
ATOM   3287 H HA   . GLU A 1 32 ? 7.386   -14.107 4.040   1.00 0.00 ? 303 GLU A HA   3 
ATOM   3288 H HB2  . GLU A 1 32 ? 6.228   -14.345 6.308   1.00 0.00 ? 303 GLU A HB2  3 
ATOM   3289 H HB3  . GLU A 1 32 ? 6.859   -12.744 5.922   1.00 0.00 ? 303 GLU A HB3  3 
ATOM   3290 H HG2  . GLU A 1 32 ? 4.695   -11.911 5.369   1.00 0.00 ? 303 GLU A HG2  3 
ATOM   3291 H HG3  . GLU A 1 32 ? 4.001   -13.532 5.329   1.00 0.00 ? 303 GLU A HG3  3 
ATOM   3292 N N    . GLN A 1 33 ? 4.282   -15.088 3.635   1.00 0.00 ? 304 GLN A N    3 
ATOM   3293 C CA   . GLN A 1 33 ? 3.488   -16.282 3.364   1.00 0.00 ? 304 GLN A CA   3 
ATOM   3294 C C    . GLN A 1 33 ? 4.029   -16.970 2.113   1.00 0.00 ? 304 GLN A C    3 
ATOM   3295 O O    . GLN A 1 33 ? 4.483   -18.097 2.157   1.00 0.00 ? 304 GLN A O    3 
ATOM   3296 C CB   . GLN A 1 33 ? 2.026   -15.893 3.135   1.00 0.00 ? 304 GLN A CB   3 
ATOM   3297 C CG   . GLN A 1 33 ? 1.649   -14.750 4.077   1.00 0.00 ? 304 GLN A CG   3 
ATOM   3298 C CD   . GLN A 1 33 ? 0.358   -15.105 4.820   1.00 0.00 ? 304 GLN A CD   3 
ATOM   3299 O OE1  . GLN A 1 33 ? -0.681  -15.260 4.211   1.00 0.00 ? 304 GLN A OE1  3 
ATOM   3300 N NE2  . GLN A 1 33 ? 0.381   -15.241 6.118   1.00 0.00 ? 304 GLN A NE2  3 
ATOM   3301 H H    . GLN A 1 33 ? 3.868   -14.200 3.590   1.00 0.00 ? 304 GLN A H    3 
ATOM   3302 H HA   . GLN A 1 33 ? 3.552   -16.956 4.205   1.00 0.00 ? 304 GLN A HA   3 
ATOM   3303 H HB2  . GLN A 1 33 ? 1.895   -15.574 2.112   1.00 0.00 ? 304 GLN A HB2  3 
ATOM   3304 H HB3  . GLN A 1 33 ? 1.393   -16.743 3.333   1.00 0.00 ? 304 GLN A HB3  3 
ATOM   3305 H HG2  . GLN A 1 33 ? 2.446   -14.595 4.790   1.00 0.00 ? 304 GLN A HG2  3 
ATOM   3306 H HG3  . GLN A 1 33 ? 1.499   -13.849 3.504   1.00 0.00 ? 304 GLN A HG3  3 
ATOM   3307 H HE21 . GLN A 1 33 ? 1.221   -15.116 6.608   1.00 0.00 ? 304 GLN A HE21 3 
ATOM   3308 H HE22 . GLN A 1 33 ? -0.439  -15.469 6.601   1.00 0.00 ? 304 GLN A HE22 3 
ATOM   3309 N N    . VAL A 1 34 ? 3.992   -16.298 0.997   1.00 0.00 ? 305 VAL A N    3 
ATOM   3310 C CA   . VAL A 1 34 ? 4.499   -16.896 -0.234  1.00 0.00 ? 305 VAL A CA   3 
ATOM   3311 C C    . VAL A 1 34 ? 5.860   -17.542 0.044   1.00 0.00 ? 305 VAL A C    3 
ATOM   3312 O O    . VAL A 1 34 ? 6.193   -18.572 -0.508  1.00 0.00 ? 305 VAL A O    3 
ATOM   3313 C CB   . VAL A 1 34 ? 4.650   -15.812 -1.303  1.00 0.00 ? 305 VAL A CB   3 
ATOM   3314 C CG1  . VAL A 1 34 ? 5.488   -16.350 -2.464  1.00 0.00 ? 305 VAL A CG1  3 
ATOM   3315 C CG2  . VAL A 1 34 ? 3.266   -15.412 -1.818  1.00 0.00 ? 305 VAL A CG2  3 
ATOM   3316 H H    . VAL A 1 34 ? 3.625   -15.388 0.987   1.00 0.00 ? 305 VAL A H    3 
ATOM   3317 H HA   . VAL A 1 34 ? 3.809   -17.650 -0.581  1.00 0.00 ? 305 VAL A HA   3 
ATOM   3318 H HB   . VAL A 1 34 ? 5.141   -14.950 -0.875  1.00 0.00 ? 305 VAL A HB   3 
ATOM   3319 H HG11 . VAL A 1 34 ? 6.454   -16.666 -2.095  1.00 0.00 ? 305 VAL A HG11 3 
ATOM   3320 H HG12 . VAL A 1 34 ? 4.981   -17.193 -2.913  1.00 0.00 ? 305 VAL A HG12 3 
ATOM   3321 H HG13 . VAL A 1 34 ? 5.621   -15.575 -3.203  1.00 0.00 ? 305 VAL A HG13 3 
ATOM   3322 H HG21 . VAL A 1 34 ? 2.538   -16.143 -1.495  1.00 0.00 ? 305 VAL A HG21 3 
ATOM   3323 H HG22 . VAL A 1 34 ? 3.002   -14.442 -1.425  1.00 0.00 ? 305 VAL A HG22 3 
ATOM   3324 H HG23 . VAL A 1 34 ? 3.283   -15.373 -2.897  1.00 0.00 ? 305 VAL A HG23 3 
ATOM   3325 N N    . ALA A 1 35 ? 6.646   -16.946 0.897   1.00 0.00 ? 306 ALA A N    3 
ATOM   3326 C CA   . ALA A 1 35 ? 7.953   -17.515 1.204   1.00 0.00 ? 306 ALA A CA   3 
ATOM   3327 C C    . ALA A 1 35 ? 7.764   -18.850 1.928   1.00 0.00 ? 306 ALA A C    3 
ATOM   3328 O O    . ALA A 1 35 ? 8.530   -19.777 1.751   1.00 0.00 ? 306 ALA A O    3 
ATOM   3329 C CB   . ALA A 1 35 ? 8.735   -16.555 2.099   1.00 0.00 ? 306 ALA A CB   3 
ATOM   3330 H H    . ALA A 1 35 ? 6.359   -16.116 1.334   1.00 0.00 ? 306 ALA A H    3 
ATOM   3331 H HA   . ALA A 1 35 ? 8.500   -17.678 0.286   1.00 0.00 ? 306 ALA A HA   3 
ATOM   3332 H HB1  . ALA A 1 35 ? 8.046   -15.906 2.619   1.00 0.00 ? 306 ALA A HB1  3 
ATOM   3333 H HB2  . ALA A 1 35 ? 9.309   -17.120 2.819   1.00 0.00 ? 306 ALA A HB2  3 
ATOM   3334 H HB3  . ALA A 1 35 ? 9.401   -15.960 1.493   1.00 0.00 ? 306 ALA A HB3  3 
ATOM   3335 N N    . GLN A 1 36 ? 6.748   -18.957 2.739   1.00 0.00 ? 307 GLN A N    3 
ATOM   3336 C CA   . GLN A 1 36 ? 6.516   -20.206 3.456   1.00 0.00 ? 307 GLN A CA   3 
ATOM   3337 C C    . GLN A 1 36 ? 5.915   -21.235 2.496   1.00 0.00 ? 307 GLN A C    3 
ATOM   3338 O O    . GLN A 1 36 ? 6.413   -22.335 2.357   1.00 0.00 ? 307 GLN A O    3 
ATOM   3339 C CB   . GLN A 1 36 ? 5.544   -19.962 4.610   1.00 0.00 ? 307 GLN A CB   3 
ATOM   3340 C CG   . GLN A 1 36 ? 5.877   -18.629 5.285   1.00 0.00 ? 307 GLN A CG   3 
ATOM   3341 C CD   . GLN A 1 36 ? 5.972   -18.833 6.798   1.00 0.00 ? 307 GLN A CD   3 
ATOM   3342 O OE1  . GLN A 1 36 ? 6.382   -19.880 7.258   1.00 0.00 ? 307 GLN A OE1  3 
ATOM   3343 N NE2  . GLN A 1 36 ? 5.607   -17.870 7.599   1.00 0.00 ? 307 GLN A NE2  3 
ATOM   3344 H H    . GLN A 1 36 ? 6.139   -18.198 2.867   1.00 0.00 ? 307 GLN A H    3 
ATOM   3345 H HA   . GLN A 1 36 ? 7.452   -20.579 3.845   1.00 0.00 ? 307 GLN A HA   3 
ATOM   3346 H HB2  . GLN A 1 36 ? 4.533   -19.930 4.231   1.00 0.00 ? 307 GLN A HB2  3 
ATOM   3347 H HB3  . GLN A 1 36 ? 5.634   -20.760 5.333   1.00 0.00 ? 307 GLN A HB3  3 
ATOM   3348 H HG2  . GLN A 1 36 ? 6.822   -18.262 4.910   1.00 0.00 ? 307 GLN A HG2  3 
ATOM   3349 H HG3  . GLN A 1 36 ? 5.100   -17.912 5.067   1.00 0.00 ? 307 GLN A HG3  3 
ATOM   3350 H HE21 . GLN A 1 36 ? 5.277   -17.025 7.229   1.00 0.00 ? 307 GLN A HE21 3 
ATOM   3351 H HE22 . GLN A 1 36 ? 5.663   -17.991 8.570   1.00 0.00 ? 307 GLN A HE22 3 
ATOM   3352 N N    . LEU A 1 37 ? 4.848   -20.884 1.834   1.00 0.00 ? 308 LEU A N    3 
ATOM   3353 C CA   . LEU A 1 37 ? 4.226   -21.820 0.904   1.00 0.00 ? 308 LEU A CA   3 
ATOM   3354 C C    . LEU A 1 37 ? 5.276   -22.325 -0.090  1.00 0.00 ? 308 LEU A C    3 
ATOM   3355 O O    . LEU A 1 37 ? 5.213   -23.445 -0.558  1.00 0.00 ? 308 LEU A O    3 
ATOM   3356 C CB   . LEU A 1 37 ? 3.104   -21.109 0.146   1.00 0.00 ? 308 LEU A CB   3 
ATOM   3357 C CG   . LEU A 1 37 ? 1.895   -20.945 1.068   1.00 0.00 ? 308 LEU A CG   3 
ATOM   3358 C CD1  . LEU A 1 37 ? 1.235   -19.589 0.807   1.00 0.00 ? 308 LEU A CD1  3 
ATOM   3359 C CD2  . LEU A 1 37 ? 0.888   -22.064 0.792   1.00 0.00 ? 308 LEU A CD2  3 
ATOM   3360 H H    . LEU A 1 37 ? 4.463   -19.992 1.962   1.00 0.00 ? 308 LEU A H    3 
ATOM   3361 H HA   . LEU A 1 37 ? 3.817   -22.656 1.451   1.00 0.00 ? 308 LEU A HA   3 
ATOM   3362 H HB2  . LEU A 1 37 ? 3.448   -20.137 -0.178  1.00 0.00 ? 308 LEU A HB2  3 
ATOM   3363 H HB3  . LEU A 1 37 ? 2.821   -21.697 -0.714  1.00 0.00 ? 308 LEU A HB3  3 
ATOM   3364 H HG   . LEU A 1 37 ? 2.220   -20.995 2.097   1.00 0.00 ? 308 LEU A HG   3 
ATOM   3365 H HD11 . LEU A 1 37 ? 1.622   -19.173 -0.111  1.00 0.00 ? 308 LEU A HD11 3 
ATOM   3366 H HD12 . LEU A 1 37 ? 0.166   -19.720 0.722   1.00 0.00 ? 308 LEU A HD12 3 
ATOM   3367 H HD13 . LEU A 1 37 ? 1.452   -18.920 1.627   1.00 0.00 ? 308 LEU A HD13 3 
ATOM   3368 H HD21 . LEU A 1 37 ? 1.338   -22.803 0.149   1.00 0.00 ? 308 LEU A HD21 3 
ATOM   3369 H HD22 . LEU A 1 37 ? 0.600   -22.526 1.725   1.00 0.00 ? 308 LEU A HD22 3 
ATOM   3370 H HD23 . LEU A 1 37 ? 0.014   -21.650 0.311   1.00 0.00 ? 308 LEU A HD23 3 
ATOM   3371 N N    . LYS A 1 38 ? 6.244   -21.510 -0.412  1.00 0.00 ? 309 LYS A N    3 
ATOM   3372 C CA   . LYS A 1 38 ? 7.271   -21.940 -1.352  1.00 0.00 ? 309 LYS A CA   3 
ATOM   3373 C C    . LYS A 1 38 ? 8.345   -22.732 -0.603  1.00 0.00 ? 309 LYS A C    3 
ATOM   3374 O O    . LYS A 1 38 ? 8.613   -23.876 -0.912  1.00 0.00 ? 309 LYS A O    3 
ATOM   3375 C CB   . LYS A 1 38 ? 7.903   -20.715 -2.016  1.00 0.00 ? 309 LYS A CB   3 
ATOM   3376 C CG   . LYS A 1 38 ? 7.206   -20.449 -3.351  1.00 0.00 ? 309 LYS A CG   3 
ATOM   3377 C CD   . LYS A 1 38 ? 6.373   -19.171 -3.246  1.00 0.00 ? 309 LYS A CD   3 
ATOM   3378 C CE   . LYS A 1 38 ? 5.809   -18.816 -4.622  1.00 0.00 ? 309 LYS A CE   3 
ATOM   3379 N NZ   . LYS A 1 38 ? 6.877   -18.962 -5.651  1.00 0.00 ? 309 LYS A NZ   3 
ATOM   3380 H H    . LYS A 1 38 ? 6.279   -20.612 -0.022  1.00 0.00 ? 309 LYS A H    3 
ATOM   3381 H HA   . LYS A 1 38 ? 6.825   -22.567 -2.110  1.00 0.00 ? 309 LYS A HA   3 
ATOM   3382 H HB2  . LYS A 1 38 ? 7.791   -19.856 -1.370  1.00 0.00 ? 309 LYS A HB2  3 
ATOM   3383 H HB3  . LYS A 1 38 ? 8.952   -20.901 -2.191  1.00 0.00 ? 309 LYS A HB3  3 
ATOM   3384 H HG2  . LYS A 1 38 ? 7.947   -20.333 -4.129  1.00 0.00 ? 309 LYS A HG2  3 
ATOM   3385 H HG3  . LYS A 1 38 ? 6.558   -21.278 -3.591  1.00 0.00 ? 309 LYS A HG3  3 
ATOM   3386 H HD2  . LYS A 1 38 ? 5.561   -19.330 -2.551  1.00 0.00 ? 309 LYS A HD2  3 
ATOM   3387 H HD3  . LYS A 1 38 ? 6.997   -18.363 -2.894  1.00 0.00 ? 309 LYS A HD3  3 
ATOM   3388 H HE2  . LYS A 1 38 ? 4.990   -19.480 -4.858  1.00 0.00 ? 309 LYS A HE2  3 
ATOM   3389 H HE3  . LYS A 1 38 ? 5.455   -17.796 -4.615  1.00 0.00 ? 309 LYS A HE3  3 
ATOM   3390 H HZ1  . LYS A 1 38 ? 7.806   -18.807 -5.211  1.00 0.00 ? 309 LYS A HZ1  3 
ATOM   3391 H HZ2  . LYS A 1 38 ? 6.844   -19.921 -6.053  1.00 0.00 ? 309 LYS A HZ2  3 
ATOM   3392 H HZ3  . LYS A 1 38 ? 6.728   -18.262 -6.407  1.00 0.00 ? 309 LYS A HZ3  3 
ATOM   3393 N N    . GLN A 1 39 ? 8.958   -22.139 0.384   1.00 0.00 ? 310 GLN A N    3 
ATOM   3394 C CA   . GLN A 1 39 ? 9.985   -22.852 1.133   1.00 0.00 ? 310 GLN A CA   3 
ATOM   3395 C C    . GLN A 1 39 ? 9.469   -24.248 1.485   1.00 0.00 ? 310 GLN A C    3 
ATOM   3396 O O    . GLN A 1 39 ? 10.167  -25.233 1.345   1.00 0.00 ? 310 GLN A O    3 
ATOM   3397 C CB   . GLN A 1 39 ? 10.310  -22.086 2.419   1.00 0.00 ? 310 GLN A CB   3 
ATOM   3398 C CG   . GLN A 1 39 ? 11.095  -20.819 2.077   1.00 0.00 ? 310 GLN A CG   3 
ATOM   3399 C CD   . GLN A 1 39 ? 12.454  -21.199 1.486   1.00 0.00 ? 310 GLN A CD   3 
ATOM   3400 O OE1  . GLN A 1 39 ? 12.774  -20.821 0.378   1.00 0.00 ? 310 GLN A OE1  3 
ATOM   3401 N NE2  . GLN A 1 39 ? 13.270  -21.938 2.186   1.00 0.00 ? 310 GLN A NE2  3 
ATOM   3402 H H    . GLN A 1 39 ? 8.727   -21.218 0.622   1.00 0.00 ? 310 GLN A H    3 
ATOM   3403 H HA   . GLN A 1 39 ? 10.878  -22.937 0.533   1.00 0.00 ? 310 GLN A HA   3 
ATOM   3404 H HB2  . GLN A 1 39 ? 9.390   -21.819 2.919   1.00 0.00 ? 310 GLN A HB2  3 
ATOM   3405 H HB3  . GLN A 1 39 ? 10.904  -22.711 3.070   1.00 0.00 ? 310 GLN A HB3  3 
ATOM   3406 H HG2  . GLN A 1 39 ? 10.540  -20.235 1.357   1.00 0.00 ? 310 GLN A HG2  3 
ATOM   3407 H HG3  . GLN A 1 39 ? 11.246  -20.236 2.974   1.00 0.00 ? 310 GLN A HG3  3 
ATOM   3408 H HE21 . GLN A 1 39 ? 13.012  -22.242 3.081   1.00 0.00 ? 310 GLN A HE21 3 
ATOM   3409 H HE22 . GLN A 1 39 ? 14.144  -22.187 1.818   1.00 0.00 ? 310 GLN A HE22 3 
ATOM   3410 N N    . LYS A 1 40 ? 8.249   -24.339 1.939   1.00 0.00 ? 311 LYS A N    3 
ATOM   3411 C CA   . LYS A 1 40 ? 7.696   -25.641 2.288   1.00 0.00 ? 311 LYS A CA   3 
ATOM   3412 C C    . LYS A 1 40 ? 7.937   -26.615 1.134   1.00 0.00 ? 311 LYS A C    3 
ATOM   3413 O O    . LYS A 1 40 ? 8.369   -27.734 1.332   1.00 0.00 ? 311 LYS A O    3 
ATOM   3414 C CB   . LYS A 1 40 ? 6.192   -25.507 2.538   1.00 0.00 ? 311 LYS A CB   3 
ATOM   3415 C CG   . LYS A 1 40 ? 5.656   -26.801 3.154   1.00 0.00 ? 311 LYS A CG   3 
ATOM   3416 C CD   . LYS A 1 40 ? 5.627   -27.899 2.091   1.00 0.00 ? 311 LYS A CD   3 
ATOM   3417 C CE   . LYS A 1 40 ? 4.317   -28.681 2.198   1.00 0.00 ? 311 LYS A CE   3 
ATOM   3418 N NZ   . LYS A 1 40 ? 4.219   -29.301 3.550   1.00 0.00 ? 311 LYS A NZ   3 
ATOM   3419 H H    . LYS A 1 40 ? 7.703   -23.531 2.041   1.00 0.00 ? 311 LYS A H    3 
ATOM   3420 H HA   . LYS A 1 40 ? 8.176   -26.013 3.181   1.00 0.00 ? 311 LYS A HA   3 
ATOM   3421 H HB2  . LYS A 1 40 ? 6.013   -24.684 3.216   1.00 0.00 ? 311 LYS A HB2  3 
ATOM   3422 H HB3  . LYS A 1 40 ? 5.686   -25.319 1.604   1.00 0.00 ? 311 LYS A HB3  3 
ATOM   3423 H HG2  . LYS A 1 40 ? 6.297   -27.104 3.968   1.00 0.00 ? 311 LYS A HG2  3 
ATOM   3424 H HG3  . LYS A 1 40 ? 4.655   -26.636 3.526   1.00 0.00 ? 311 LYS A HG3  3 
ATOM   3425 H HD2  . LYS A 1 40 ? 5.701   -27.452 1.110   1.00 0.00 ? 311 LYS A HD2  3 
ATOM   3426 H HD3  . LYS A 1 40 ? 6.460   -28.570 2.242   1.00 0.00 ? 311 LYS A HD3  3 
ATOM   3427 H HE2  . LYS A 1 40 ? 3.484   -28.013 2.047   1.00 0.00 ? 311 LYS A HE2  3 
ATOM   3428 H HE3  . LYS A 1 40 ? 4.298   -29.456 1.445   1.00 0.00 ? 311 LYS A HE3  3 
ATOM   3429 H HZ1  . LYS A 1 40 ? 4.640   -28.664 4.256   1.00 0.00 ? 311 LYS A HZ1  3 
ATOM   3430 H HZ2  . LYS A 1 40 ? 3.218   -29.465 3.783   1.00 0.00 ? 311 LYS A HZ2  3 
ATOM   3431 H HZ3  . LYS A 1 40 ? 4.730   -30.206 3.556   1.00 0.00 ? 311 LYS A HZ3  3 
ATOM   3432 N N    . VAL A 1 41 ? 7.662   -26.198 -0.072  1.00 0.00 ? 312 VAL A N    3 
ATOM   3433 C CA   . VAL A 1 41 ? 7.875   -27.079 -1.215  1.00 0.00 ? 312 VAL A CA   3 
ATOM   3434 C C    . VAL A 1 41 ? 9.370   -27.377 -1.351  1.00 0.00 ? 312 VAL A C    3 
ATOM   3435 O O    . VAL A 1 41 ? 9.768   -28.487 -1.649  1.00 0.00 ? 312 VAL A O    3 
ATOM   3436 C CB   . VAL A 1 41 ? 7.372   -26.397 -2.487  1.00 0.00 ? 312 VAL A CB   3 
ATOM   3437 C CG1  . VAL A 1 41 ? 7.799   -27.211 -3.709  1.00 0.00 ? 312 VAL A CG1  3 
ATOM   3438 C CG2  . VAL A 1 41 ? 5.845   -26.306 -2.447  1.00 0.00 ? 312 VAL A CG2  3 
ATOM   3439 H H    . VAL A 1 41 ? 7.316   -25.291 -0.210  1.00 0.00 ? 312 VAL A H    3 
ATOM   3440 H HA   . VAL A 1 41 ? 7.334   -28.001 -1.064  1.00 0.00 ? 312 VAL A HA   3 
ATOM   3441 H HB   . VAL A 1 41 ? 7.792   -25.402 -2.552  1.00 0.00 ? 312 VAL A HB   3 
ATOM   3442 H HG11 . VAL A 1 41 ? 8.351   -28.081 -3.385  1.00 0.00 ? 312 VAL A HG11 3 
ATOM   3443 H HG12 . VAL A 1 41 ? 6.925   -27.522 -4.259  1.00 0.00 ? 312 VAL A HG12 3 
ATOM   3444 H HG13 . VAL A 1 41 ? 8.427   -26.603 -4.344  1.00 0.00 ? 312 VAL A HG13 3 
ATOM   3445 H HG21 . VAL A 1 41 ? 5.502   -26.443 -1.430  1.00 0.00 ? 312 VAL A HG21 3 
ATOM   3446 H HG22 . VAL A 1 41 ? 5.532   -25.335 -2.803  1.00 0.00 ? 312 VAL A HG22 3 
ATOM   3447 H HG23 . VAL A 1 41 ? 5.421   -27.074 -3.075  1.00 0.00 ? 312 VAL A HG23 3 
ATOM   3448 N N    . MET A 1 42 ? 10.200  -26.394 -1.138  1.00 0.00 ? 313 MET A N    3 
ATOM   3449 C CA   . MET A 1 42 ? 11.636  -26.613 -1.253  1.00 0.00 ? 313 MET A CA   3 
ATOM   3450 C C    . MET A 1 42 ? 12.180  -27.135 0.079   1.00 0.00 ? 313 MET A C    3 
ATOM   3451 O O    . MET A 1 42 ? 12.676  -26.383 0.895   1.00 0.00 ? 313 MET A O    3 
ATOM   3452 C CB   . MET A 1 42 ? 12.326  -25.292 -1.602  1.00 0.00 ? 313 MET A CB   3 
ATOM   3453 C CG   . MET A 1 42 ? 13.824  -25.535 -1.799  1.00 0.00 ? 313 MET A CG   3 
ATOM   3454 S SD   . MET A 1 42 ? 14.196  -25.609 -3.568  1.00 0.00 ? 313 MET A SD   3 
ATOM   3455 C CE   . MET A 1 42 ? 15.909  -26.175 -3.416  1.00 0.00 ? 313 MET A CE   3 
ATOM   3456 H H    . MET A 1 42 ? 9.857   -25.507 -0.899  1.00 0.00 ? 313 MET A H    3 
ATOM   3457 H HA   . MET A 1 42 ? 11.831  -27.335 -2.030  1.00 0.00 ? 313 MET A HA   3 
ATOM   3458 H HB2  . MET A 1 42 ? 11.903  -24.895 -2.513  1.00 0.00 ? 313 MET A HB2  3 
ATOM   3459 H HB3  . MET A 1 42 ? 12.181  -24.585 -0.799  1.00 0.00 ? 313 MET A HB3  3 
ATOM   3460 H HG2  . MET A 1 42 ? 14.382  -24.729 -1.347  1.00 0.00 ? 313 MET A HG2  3 
ATOM   3461 H HG3  . MET A 1 42 ? 14.101  -26.470 -1.334  1.00 0.00 ? 313 MET A HG3  3 
ATOM   3462 H HE1  . MET A 1 42 ? 16.423  -25.575 -2.682  1.00 0.00 ? 313 MET A HE1  3 
ATOM   3463 H HE2  . MET A 1 42 ? 15.918  -27.210 -3.105  1.00 0.00 ? 313 MET A HE2  3 
ATOM   3464 H HE3  . MET A 1 42 ? 16.406  -26.075 -4.372  1.00 0.00 ? 313 MET A HE3  3 
ATOM   3465 N N    . ASN A 1 43 ? 12.095  -28.417 0.306   1.00 0.00 ? 314 ASN A N    3 
ATOM   3466 C CA   . ASN A 1 43 ? 12.598  -28.966 1.559   1.00 0.00 ? 314 ASN A CA   3 
ATOM   3467 C C    . ASN A 1 43 ? 13.136  -30.378 1.317   1.00 0.00 ? 314 ASN A C    3 
ATOM   3468 O O    . ASN A 1 43 ? 12.414  -31.351 1.404   1.00 0.00 ? 314 ASN A O    3 
ATOM   3469 C CB   . ASN A 1 43 ? 11.469  -29.019 2.587   1.00 0.00 ? 314 ASN A CB   3 
ATOM   3470 C CG   . ASN A 1 43 ? 12.038  -28.739 3.980   1.00 0.00 ? 314 ASN A CG   3 
ATOM   3471 O OD1  . ASN A 1 43 ? 13.234  -28.614 4.146   1.00 0.00 ? 314 ASN A OD1  3 
ATOM   3472 N ND2  . ASN A 1 43 ? 11.224  -28.636 4.996   1.00 0.00 ? 314 ASN A ND2  3 
ATOM   3473 H H    . ASN A 1 43 ? 11.692  -29.009 -0.364  1.00 0.00 ? 314 ASN A H    3 
ATOM   3474 H HA   . ASN A 1 43 ? 13.393  -28.339 1.932   1.00 0.00 ? 314 ASN A HA   3 
ATOM   3475 H HB2  . ASN A 1 43 ? 10.724  -28.274 2.343   1.00 0.00 ? 314 ASN A HB2  3 
ATOM   3476 H HB3  . ASN A 1 43 ? 11.015  -30.000 2.575   1.00 0.00 ? 314 ASN A HB3  3 
ATOM   3477 H HD21 . ASN A 1 43 ? 10.258  -28.738 4.861   1.00 0.00 ? 314 ASN A HD21 3 
ATOM   3478 H HD22 . ASN A 1 43 ? 11.578  -28.456 5.891   1.00 0.00 ? 314 ASN A HD22 3 
ATOM   3479 N N    . TYR A 1 44 ? 14.402  -30.497 1.019   1.00 0.00 ? 315 TYR A N    3 
ATOM   3480 C CA   . TYR A 1 44 ? 14.977  -31.817 0.780   1.00 0.00 ? 315 TYR A CA   3 
ATOM   3481 C C    . TYR A 1 44 ? 14.801  -32.685 2.030   1.00 0.00 ? 315 TYR A C    3 
ATOM   3482 O O    . TYR A 1 44 ? 14.574  -32.123 3.089   1.00 0.00 ? 315 TYR A O    3 
ATOM   3483 C CB   . TYR A 1 44 ? 16.468  -31.675 0.464   1.00 0.00 ? 315 TYR A CB   3 
ATOM   3484 C CG   . TYR A 1 44 ? 16.716  -32.047 -0.978  1.00 0.00 ? 315 TYR A CG   3 
ATOM   3485 C CD1  . TYR A 1 44 ? 16.933  -33.390 -1.330  1.00 0.00 ? 315 TYR A CD1  3 
ATOM   3486 C CD2  . TYR A 1 44 ? 16.730  -31.051 -1.968  1.00 0.00 ? 315 TYR A CD2  3 
ATOM   3487 C CE1  . TYR A 1 44 ? 17.164  -33.735 -2.671  1.00 0.00 ? 315 TYR A CE1  3 
ATOM   3488 C CE2  . TYR A 1 44 ? 16.962  -31.397 -3.310  1.00 0.00 ? 315 TYR A CE2  3 
ATOM   3489 C CZ   . TYR A 1 44 ? 17.178  -32.740 -3.661  1.00 0.00 ? 315 TYR A CZ   3 
ATOM   3490 O OH   . TYR A 1 44 ? 17.405  -33.080 -4.980  1.00 0.00 ? 315 TYR A OH   3 
ATOM   3491 O OXT  . TYR A 1 44 ? 14.896  -33.895 1.905   1.00 0.00 ? 315 TYR A OXT  3 
ATOM   3492 H H    . TYR A 1 44 ? 14.967  -29.699 0.958   1.00 0.00 ? 315 TYR A H    3 
ATOM   3493 H HA   . TYR A 1 44 ? 14.476  -32.283 -0.055  1.00 0.00 ? 315 TYR A HA   3 
ATOM   3494 H HB2  . TYR A 1 44 ? 16.774  -30.652 0.629   1.00 0.00 ? 315 TYR A HB2  3 
ATOM   3495 H HB3  . TYR A 1 44 ? 17.038  -32.329 1.107   1.00 0.00 ? 315 TYR A HB3  3 
ATOM   3496 H HD1  . TYR A 1 44 ? 16.922  -34.155 -0.569  1.00 0.00 ? 315 TYR A HD1  3 
ATOM   3497 H HD2  . TYR A 1 44 ? 16.564  -30.019 -1.698  1.00 0.00 ? 315 TYR A HD2  3 
ATOM   3498 H HE1  . TYR A 1 44 ? 17.331  -34.768 -2.940  1.00 0.00 ? 315 TYR A HE1  3 
ATOM   3499 H HE2  . TYR A 1 44 ? 16.972  -30.631 -4.071  1.00 0.00 ? 315 TYR A HE2  3 
ATOM   3500 H HH   . TYR A 1 44 ? 16.688  -33.651 -5.265  1.00 0.00 ? 315 TYR A HH   3 
HETATM 3501 C C    . ACE B 1 1  ? 3.799   34.913  -4.044  1.00 0.00 ? 272 ACE B C    3 
HETATM 3502 O O    . ACE B 1 1  ? 4.742   34.877  -3.277  1.00 0.00 ? 272 ACE B O    3 
HETATM 3503 C CH3  . ACE B 1 1  ? 3.315   36.234  -4.643  1.00 0.00 ? 272 ACE B CH3  3 
HETATM 3504 H H1   . ACE B 1 1  ? 4.153   36.906  -4.759  1.00 0.00 ? 272 ACE B H1   3 
HETATM 3505 H H2   . ACE B 1 1  ? 2.866   36.049  -5.608  1.00 0.00 ? 272 ACE B H2   3 
HETATM 3506 H H3   . ACE B 1 1  ? 2.584   36.681  -3.986  1.00 0.00 ? 272 ACE B H3   3 
ATOM   3507 N N    . CYS B 1 2  ? 3.164   33.826  -4.385  1.00 0.00 ? 273 CYS B N    3 
ATOM   3508 C CA   . CYS B 1 2  ? 3.582   32.537  -3.845  1.00 0.00 ? 273 CYS B CA   3 
ATOM   3509 C C    . CYS B 1 2  ? 4.002   31.614  -4.990  1.00 0.00 ? 273 CYS B C    3 
ATOM   3510 O O    . CYS B 1 2  ? 3.293   31.452  -5.962  1.00 0.00 ? 273 CYS B O    3 
ATOM   3511 C CB   . CYS B 1 2  ? 2.421   31.905  -3.076  1.00 0.00 ? 273 CYS B CB   3 
ATOM   3512 S SG   . CYS B 1 2  ? 2.686   32.125  -1.299  1.00 0.00 ? 273 CYS B SG   3 
ATOM   3513 H H    . CYS B 1 2  ? 2.406   33.875  -5.005  1.00 0.00 ? 273 CYS B H    3 
ATOM   3514 H HA   . CYS B 1 2  ? 4.418   32.683  -3.176  1.00 0.00 ? 273 CYS B HA   3 
ATOM   3515 H HB2  . CYS B 1 2  ? 1.496   32.382  -3.366  1.00 0.00 ? 273 CYS B HB2  3 
ATOM   3516 H HB3  . CYS B 1 2  ? 2.371   30.850  -3.305  1.00 0.00 ? 273 CYS B HB3  3 
ATOM   3517 N N    . GLY B 1 3  ? 5.153   31.008  -4.882  1.00 0.00 ? 274 GLY B N    3 
ATOM   3518 C CA   . GLY B 1 3  ? 5.611   30.114  -5.939  1.00 0.00 ? 274 GLY B CA   3 
ATOM   3519 C C    . GLY B 1 3  ? 6.980   29.544  -5.568  1.00 0.00 ? 274 GLY B C    3 
ATOM   3520 O O    . GLY B 1 3  ? 7.948   30.266  -5.428  1.00 0.00 ? 274 GLY B O    3 
ATOM   3521 H H    . GLY B 1 3  ? 5.709   31.153  -4.088  1.00 0.00 ? 274 GLY B H    3 
ATOM   3522 H HA2  . GLY B 1 3  ? 4.902   29.307  -6.059  1.00 0.00 ? 274 GLY B HA2  3 
ATOM   3523 H HA3  . GLY B 1 3  ? 5.694   30.663  -6.865  1.00 0.00 ? 274 GLY B HA3  3 
ATOM   3524 N N    . GLY B 1 4  ? 7.071   28.253  -5.403  1.00 0.00 ? 275 GLY B N    3 
ATOM   3525 C CA   . GLY B 1 4  ? 8.351   27.650  -5.047  1.00 0.00 ? 275 GLY B CA   3 
ATOM   3526 C C    . GLY B 1 4  ? 8.113   26.414  -4.181  1.00 0.00 ? 275 GLY B C    3 
ATOM   3527 O O    . GLY B 1 4  ? 8.646   25.352  -4.436  1.00 0.00 ? 275 GLY B O    3 
ATOM   3528 H H    . GLY B 1 4  ? 6.278   27.687  -5.519  1.00 0.00 ? 275 GLY B H    3 
ATOM   3529 H HA2  . GLY B 1 4  ? 8.877   27.366  -5.949  1.00 0.00 ? 275 GLY B HA2  3 
ATOM   3530 H HA3  . GLY B 1 4  ? 8.941   28.364  -4.493  1.00 0.00 ? 275 GLY B HA3  3 
ATOM   3531 N N    . ARG B 1 5  ? 7.314   26.541  -3.156  1.00 0.00 ? 276 ARG B N    3 
ATOM   3532 C CA   . ARG B 1 5  ? 7.047   25.398  -2.292  1.00 0.00 ? 276 ARG B CA   3 
ATOM   3533 C C    . ARG B 1 5  ? 6.017   24.487  -2.961  1.00 0.00 ? 276 ARG B C    3 
ATOM   3534 O O    . ARG B 1 5  ? 6.057   23.279  -2.825  1.00 0.00 ? 276 ARG B O    3 
ATOM   3535 C CB   . ARG B 1 5  ? 6.497   25.890  -0.951  1.00 0.00 ? 276 ARG B CB   3 
ATOM   3536 C CG   . ARG B 1 5  ? 7.604   25.849  0.104   1.00 0.00 ? 276 ARG B CG   3 
ATOM   3537 C CD   . ARG B 1 5  ? 8.571   27.011  -0.126  1.00 0.00 ? 276 ARG B CD   3 
ATOM   3538 N NE   . ARG B 1 5  ? 9.938   26.552  0.087   1.00 0.00 ? 276 ARG B NE   3 
ATOM   3539 C CZ   . ARG B 1 5  ? 10.943  27.272  -0.333  1.00 0.00 ? 276 ARG B CZ   3 
ATOM   3540 N NH1  . ARG B 1 5  ? 11.070  27.533  -1.604  1.00 0.00 ? 276 ARG B NH1  3 
ATOM   3541 N NH2  . ARG B 1 5  ? 11.817  27.729  0.519   1.00 0.00 ? 276 ARG B NH2  3 
ATOM   3542 H H    . ARG B 1 5  ? 6.894   27.406  -2.968  1.00 0.00 ? 276 ARG B H    3 
ATOM   3543 H HA   . ARG B 1 5  ? 7.961   24.849  -2.125  1.00 0.00 ? 276 ARG B HA   3 
ATOM   3544 H HB2  . ARG B 1 5  ? 6.137   26.903  -1.059  1.00 0.00 ? 276 ARG B HB2  3 
ATOM   3545 H HB3  . ARG B 1 5  ? 5.683   25.251  -0.641  1.00 0.00 ? 276 ARG B HB3  3 
ATOM   3546 H HG2  . ARG B 1 5  ? 7.165   25.933  1.088   1.00 0.00 ? 276 ARG B HG2  3 
ATOM   3547 H HG3  . ARG B 1 5  ? 8.141   24.915  0.027   1.00 0.00 ? 276 ARG B HG3  3 
ATOM   3548 H HD2  . ARG B 1 5  ? 8.467   27.370  -1.139  1.00 0.00 ? 276 ARG B HD2  3 
ATOM   3549 H HD3  . ARG B 1 5  ? 8.345   27.810  0.565   1.00 0.00 ? 276 ARG B HD3  3 
ATOM   3550 H HE   . ARG B 1 5  ? 10.103  25.704  0.548   1.00 0.00 ? 276 ARG B HE   3 
ATOM   3551 H HH11 . ARG B 1 5  ? 10.398  27.181  -2.257  1.00 0.00 ? 276 ARG B HH11 3 
ATOM   3552 H HH12 . ARG B 1 5  ? 11.839  28.083  -1.928  1.00 0.00 ? 276 ARG B HH12 3 
ATOM   3553 H HH21 . ARG B 1 5  ? 11.719  27.529  1.493   1.00 0.00 ? 276 ARG B HH21 3 
ATOM   3554 H HH22 . ARG B 1 5  ? 12.588  28.281  0.196   1.00 0.00 ? 276 ARG B HH22 3 
ATOM   3555 N N    . ILE B 1 6  ? 5.092   25.058  -3.678  1.00 0.00 ? 277 ILE B N    3 
ATOM   3556 C CA   . ILE B 1 6  ? 4.072   24.252  -4.340  1.00 0.00 ? 277 ILE B CA   3 
ATOM   3557 C C    . ILE B 1 6  ? 4.744   23.219  -5.248  1.00 0.00 ? 277 ILE B C    3 
ATOM   3558 O O    . ILE B 1 6  ? 4.491   22.034  -5.149  1.00 0.00 ? 277 ILE B O    3 
ATOM   3559 C CB   . ILE B 1 6  ? 3.172   25.162  -5.176  1.00 0.00 ? 277 ILE B CB   3 
ATOM   3560 C CG1  . ILE B 1 6  ? 2.410   26.110  -4.248  1.00 0.00 ? 277 ILE B CG1  3 
ATOM   3561 C CG2  . ILE B 1 6  ? 2.177   24.313  -5.967  1.00 0.00 ? 277 ILE B CG2  3 
ATOM   3562 C CD1  . ILE B 1 6  ? 1.509   27.027  -5.076  1.00 0.00 ? 277 ILE B CD1  3 
ATOM   3563 H H    . ILE B 1 6  ? 5.080   26.033  -3.769  1.00 0.00 ? 277 ILE B H    3 
ATOM   3564 H HA   . ILE B 1 6  ? 3.476   23.745  -3.597  1.00 0.00 ? 277 ILE B HA   3 
ATOM   3565 H HB   . ILE B 1 6  ? 3.778   25.737  -5.861  1.00 0.00 ? 277 ILE B HB   3 
ATOM   3566 H HG12 . ILE B 1 6  ? 1.806   25.533  -3.562  1.00 0.00 ? 277 ILE B HG12 3 
ATOM   3567 H HG13 . ILE B 1 6  ? 3.113   26.709  -3.689  1.00 0.00 ? 277 ILE B HG13 3 
ATOM   3568 H HG21 . ILE B 1 6  ? 2.682   23.450  -6.373  1.00 0.00 ? 277 ILE B HG21 3 
ATOM   3569 H HG22 . ILE B 1 6  ? 1.380   23.989  -5.312  1.00 0.00 ? 277 ILE B HG22 3 
ATOM   3570 H HG23 . ILE B 1 6  ? 1.765   24.899  -6.773  1.00 0.00 ? 277 ILE B HG23 3 
ATOM   3571 H HD11 . ILE B 1 6  ? 1.897   27.097  -6.083  1.00 0.00 ? 277 ILE B HD11 3 
ATOM   3572 H HD12 . ILE B 1 6  ? 0.509   26.619  -5.103  1.00 0.00 ? 277 ILE B HD12 3 
ATOM   3573 H HD13 . ILE B 1 6  ? 1.486   28.009  -4.630  1.00 0.00 ? 277 ILE B HD13 3 
ATOM   3574 N N    . ALA B 1 7  ? 5.596   23.654  -6.136  1.00 0.00 ? 278 ALA B N    3 
ATOM   3575 C CA   . ALA B 1 7  ? 6.263   22.716  -7.031  1.00 0.00 ? 278 ALA B CA   3 
ATOM   3576 C C    . ALA B 1 7  ? 6.848   21.558  -6.217  1.00 0.00 ? 278 ALA B C    3 
ATOM   3577 O O    . ALA B 1 7  ? 6.706   20.405  -6.572  1.00 0.00 ? 278 ALA B O    3 
ATOM   3578 C CB   . ALA B 1 7  ? 7.390   23.434  -7.777  1.00 0.00 ? 278 ALA B CB   3 
ATOM   3579 H H    . ALA B 1 7  ? 5.784   24.613  -6.203  1.00 0.00 ? 278 ALA B H    3 
ATOM   3580 H HA   . ALA B 1 7  ? 5.550   22.330  -7.743  1.00 0.00 ? 278 ALA B HA   3 
ATOM   3581 H HB1  . ALA B 1 7  ? 7.253   24.502  -7.693  1.00 0.00 ? 278 ALA B HB1  3 
ATOM   3582 H HB2  . ALA B 1 7  ? 8.340   23.156  -7.347  1.00 0.00 ? 278 ALA B HB2  3 
ATOM   3583 H HB3  . ALA B 1 7  ? 7.368   23.149  -8.818  1.00 0.00 ? 278 ALA B HB3  3 
ATOM   3584 N N    . ARG B 1 8  ? 7.507   21.856  -5.131  1.00 0.00 ? 279 ARG B N    3 
ATOM   3585 C CA   . ARG B 1 8  ? 8.090   20.794  -4.317  1.00 0.00 ? 279 ARG B CA   3 
ATOM   3586 C C    . ARG B 1 8  ? 6.980   19.888  -3.778  1.00 0.00 ? 279 ARG B C    3 
ATOM   3587 O O    . ARG B 1 8  ? 7.041   18.680  -3.894  1.00 0.00 ? 279 ARG B O    3 
ATOM   3588 C CB   . ARG B 1 8  ? 8.858   21.414  -3.147  1.00 0.00 ? 279 ARG B CB   3 
ATOM   3589 C CG   . ARG B 1 8  ? 9.868   22.431  -3.681  1.00 0.00 ? 279 ARG B CG   3 
ATOM   3590 C CD   . ARG B 1 8  ? 11.227  21.756  -3.867  1.00 0.00 ? 279 ARG B CD   3 
ATOM   3591 N NE   . ARG B 1 8  ? 11.801  22.160  -5.145  1.00 0.00 ? 279 ARG B NE   3 
ATOM   3592 C CZ   . ARG B 1 8  ? 13.067  21.963  -5.384  1.00 0.00 ? 279 ARG B CZ   3 
ATOM   3593 N NH1  . ARG B 1 8  ? 13.962  22.740  -4.836  1.00 0.00 ? 279 ARG B NH1  3 
ATOM   3594 N NH2  . ARG B 1 8  ? 13.441  20.990  -6.170  1.00 0.00 ? 279 ARG B NH2  3 
ATOM   3595 H H    . ARG B 1 8  ? 7.613   22.791  -4.862  1.00 0.00 ? 279 ARG B H    3 
ATOM   3596 H HA   . ARG B 1 8  ? 8.769   20.211  -4.919  1.00 0.00 ? 279 ARG B HA   3 
ATOM   3597 H HB2  . ARG B 1 8  ? 8.164   21.907  -2.482  1.00 0.00 ? 279 ARG B HB2  3 
ATOM   3598 H HB3  . ARG B 1 8  ? 9.382   20.638  -2.610  1.00 0.00 ? 279 ARG B HB3  3 
ATOM   3599 H HG2  . ARG B 1 8  ? 9.524   22.818  -4.630  1.00 0.00 ? 279 ARG B HG2  3 
ATOM   3600 H HG3  . ARG B 1 8  ? 9.966   23.244  -2.977  1.00 0.00 ? 279 ARG B HG3  3 
ATOM   3601 H HD2  . ARG B 1 8  ? 11.889  22.052  -3.065  1.00 0.00 ? 279 ARG B HD2  3 
ATOM   3602 H HD3  . ARG B 1 8  ? 11.100  20.683  -3.852  1.00 0.00 ? 279 ARG B HD3  3 
ATOM   3603 H HE   . ARG B 1 8  ? 11.232  22.579  -5.826  1.00 0.00 ? 279 ARG B HE   3 
ATOM   3604 H HH11 . ARG B 1 8  ? 13.677  23.486  -4.234  1.00 0.00 ? 279 ARG B HH11 3 
ATOM   3605 H HH12 . ARG B 1 8  ? 14.934  22.590  -5.018  1.00 0.00 ? 279 ARG B HH12 3 
ATOM   3606 H HH21 . ARG B 1 8  ? 12.756  20.396  -6.588  1.00 0.00 ? 279 ARG B HH21 3 
ATOM   3607 H HH22 . ARG B 1 8  ? 14.413  20.840  -6.351  1.00 0.00 ? 279 ARG B HH22 3 
ATOM   3608 N N    . LEU B 1 9  ? 5.967   20.460  -3.186  1.00 0.00 ? 280 LEU B N    3 
ATOM   3609 C CA   . LEU B 1 9  ? 4.881   19.646  -2.651  1.00 0.00 ? 280 LEU B CA   3 
ATOM   3610 C C    . LEU B 1 9  ? 4.286   18.786  -3.769  1.00 0.00 ? 280 LEU B C    3 
ATOM   3611 O O    . LEU B 1 9  ? 4.269   17.574  -3.689  1.00 0.00 ? 280 LEU B O    3 
ATOM   3612 C CB   . LEU B 1 9  ? 3.796   20.556  -2.075  1.00 0.00 ? 280 LEU B CB   3 
ATOM   3613 C CG   . LEU B 1 9  ? 3.978   20.673  -0.562  1.00 0.00 ? 280 LEU B CG   3 
ATOM   3614 C CD1  . LEU B 1 9  ? 3.142   21.843  -0.034  1.00 0.00 ? 280 LEU B CD1  3 
ATOM   3615 C CD2  . LEU B 1 9  ? 3.517   19.377  0.110   1.00 0.00 ? 280 LEU B CD2  3 
ATOM   3616 H H    . LEU B 1 9  ? 5.937   21.436  -3.102  1.00 0.00 ? 280 LEU B H    3 
ATOM   3617 H HA   . LEU B 1 9  ? 5.263   19.006  -1.870  1.00 0.00 ? 280 LEU B HA   3 
ATOM   3618 H HB2  . LEU B 1 9  ? 3.871   21.535  -2.525  1.00 0.00 ? 280 LEU B HB2  3 
ATOM   3619 H HB3  . LEU B 1 9  ? 2.823   20.136  -2.287  1.00 0.00 ? 280 LEU B HB3  3 
ATOM   3620 H HG   . LEU B 1 9  ? 5.021   20.847  -0.336  1.00 0.00 ? 280 LEU B HG   3 
ATOM   3621 H HD11 . LEU B 1 9  ? 2.938   22.531  -0.841  1.00 0.00 ? 280 LEU B HD11 3 
ATOM   3622 H HD12 . LEU B 1 9  ? 2.211   21.468  0.365   1.00 0.00 ? 280 LEU B HD12 3 
ATOM   3623 H HD13 . LEU B 1 9  ? 3.689   22.352  0.745   1.00 0.00 ? 280 LEU B HD13 3 
ATOM   3624 H HD21 . LEU B 1 9  ? 3.909   18.530  -0.436  1.00 0.00 ? 280 LEU B HD21 3 
ATOM   3625 H HD22 . LEU B 1 9  ? 3.880   19.350  1.126   1.00 0.00 ? 280 LEU B HD22 3 
ATOM   3626 H HD23 . LEU B 1 9  ? 2.438   19.336  0.112   1.00 0.00 ? 280 LEU B HD23 3 
ATOM   3627 N N    . GLU B 1 10 ? 3.797   19.402  -4.810  1.00 0.00 ? 281 GLU B N    3 
ATOM   3628 C CA   . GLU B 1 10 ? 3.215   18.635  -5.906  1.00 0.00 ? 281 GLU B CA   3 
ATOM   3629 C C    . GLU B 1 10 ? 4.177   17.519  -6.319  1.00 0.00 ? 281 GLU B C    3 
ATOM   3630 O O    . GLU B 1 10 ? 3.777   16.397  -6.553  1.00 0.00 ? 281 GLU B O    3 
ATOM   3631 C CB   . GLU B 1 10 ? 2.964   19.559  -7.099  1.00 0.00 ? 281 GLU B CB   3 
ATOM   3632 C CG   . GLU B 1 10 ? 1.457   19.690  -7.334  1.00 0.00 ? 281 GLU B CG   3 
ATOM   3633 C CD   . GLU B 1 10 ? 1.040   18.775  -8.487  1.00 0.00 ? 281 GLU B CD   3 
ATOM   3634 O OE1  . GLU B 1 10 ? 1.121   19.211  -9.623  1.00 0.00 ? 281 GLU B OE1  3 
ATOM   3635 O OE2  . GLU B 1 10 ? 0.645   17.653  -8.213  1.00 0.00 ? 281 GLU B OE2  3 
ATOM   3636 H H    . GLU B 1 10 ? 3.820   20.381  -4.854  1.00 0.00 ? 281 GLU B H    3 
ATOM   3637 H HA   . GLU B 1 10 ? 2.280   18.203  -5.584  1.00 0.00 ? 281 GLU B HA   3 
ATOM   3638 H HB2  . GLU B 1 10 ? 3.382   20.534  -6.893  1.00 0.00 ? 281 GLU B HB2  3 
ATOM   3639 H HB3  . GLU B 1 10 ? 3.428   19.145  -7.980  1.00 0.00 ? 281 GLU B HB3  3 
ATOM   3640 H HG2  . GLU B 1 10 ? 0.926   19.405  -6.437  1.00 0.00 ? 281 GLU B HG2  3 
ATOM   3641 H HG3  . GLU B 1 10 ? 1.220   20.713  -7.584  1.00 0.00 ? 281 GLU B HG3  3 
ATOM   3642 N N    . GLU B 1 11 ? 5.444   17.819  -6.413  1.00 0.00 ? 282 GLU B N    3 
ATOM   3643 C CA   . GLU B 1 11 ? 6.407   16.796  -6.804  1.00 0.00 ? 282 GLU B CA   3 
ATOM   3644 C C    . GLU B 1 11 ? 6.351   15.638  -5.806  1.00 0.00 ? 282 GLU B C    3 
ATOM   3645 O O    . GLU B 1 11 ? 6.512   14.488  -6.164  1.00 0.00 ? 282 GLU B O    3 
ATOM   3646 C CB   . GLU B 1 11 ? 7.814   17.396  -6.811  1.00 0.00 ? 282 GLU B CB   3 
ATOM   3647 C CG   . GLU B 1 11 ? 8.194   17.793  -8.241  1.00 0.00 ? 282 GLU B CG   3 
ATOM   3648 C CD   . GLU B 1 11 ? 9.718   17.836  -8.371  1.00 0.00 ? 282 GLU B CD   3 
ATOM   3649 O OE1  . GLU B 1 11 ? 10.354  18.357  -7.470  1.00 0.00 ? 282 GLU B OE1  3 
ATOM   3650 O OE2  . GLU B 1 11 ? 10.220  17.350  -9.370  1.00 0.00 ? 282 GLU B OE2  3 
ATOM   3651 H H    . GLU B 1 11 ? 5.748   18.730  -6.220  1.00 0.00 ? 282 GLU B H    3 
ATOM   3652 H HA   . GLU B 1 11 ? 6.166   16.433  -7.791  1.00 0.00 ? 282 GLU B HA   3 
ATOM   3653 H HB2  . GLU B 1 11 ? 7.836   18.270  -6.177  1.00 0.00 ? 282 GLU B HB2  3 
ATOM   3654 H HB3  . GLU B 1 11 ? 8.519   16.665  -6.444  1.00 0.00 ? 282 GLU B HB3  3 
ATOM   3655 H HG2  . GLU B 1 11 ? 7.792   17.067  -8.933  1.00 0.00 ? 282 GLU B HG2  3 
ATOM   3656 H HG3  . GLU B 1 11 ? 7.787   18.767  -8.462  1.00 0.00 ? 282 GLU B HG3  3 
ATOM   3657 N N    . LYS B 1 12 ? 6.124   15.933  -4.556  1.00 0.00 ? 283 LYS B N    3 
ATOM   3658 C CA   . LYS B 1 12 ? 6.058   14.874  -3.557  1.00 0.00 ? 283 LYS B CA   3 
ATOM   3659 C C    . LYS B 1 12 ? 4.734   14.120  -3.696  1.00 0.00 ? 283 LYS B C    3 
ATOM   3660 O O    . LYS B 1 12 ? 4.701   12.906  -3.734  1.00 0.00 ? 283 LYS B O    3 
ATOM   3661 C CB   . LYS B 1 12 ? 6.152   15.489  -2.160  1.00 0.00 ? 283 LYS B CB   3 
ATOM   3662 C CG   . LYS B 1 12 ? 6.429   14.389  -1.134  1.00 0.00 ? 283 LYS B CG   3 
ATOM   3663 C CD   . LYS B 1 12 ? 7.294   14.948  -0.004  1.00 0.00 ? 283 LYS B CD   3 
ATOM   3664 C CE   . LYS B 1 12 ? 6.622   16.190  0.587   1.00 0.00 ? 283 LYS B CE   3 
ATOM   3665 N NZ   . LYS B 1 12 ? 7.489   17.381  0.354   1.00 0.00 ? 283 LYS B NZ   3 
ATOM   3666 H H    . LYS B 1 12 ? 5.997   16.866  -4.289  1.00 0.00 ? 283 LYS B H    3 
ATOM   3667 H HA   . LYS B 1 12 ? 6.881   14.190  -3.701  1.00 0.00 ? 283 LYS B HA   3 
ATOM   3668 H HB2  . LYS B 1 12 ? 6.953   16.214  -2.139  1.00 0.00 ? 283 LYS B HB2  3 
ATOM   3669 H HB3  . LYS B 1 12 ? 5.219   15.976  -1.918  1.00 0.00 ? 283 LYS B HB3  3 
ATOM   3670 H HG2  . LYS B 1 12 ? 5.493   14.030  -0.731  1.00 0.00 ? 283 LYS B HG2  3 
ATOM   3671 H HG3  . LYS B 1 12 ? 6.951   13.574  -1.613  1.00 0.00 ? 283 LYS B HG3  3 
ATOM   3672 H HD2  . LYS B 1 12 ? 7.408   14.200  0.767   1.00 0.00 ? 283 LYS B HD2  3 
ATOM   3673 H HD3  . LYS B 1 12 ? 8.265   15.218  -0.391  1.00 0.00 ? 283 LYS B HD3  3 
ATOM   3674 H HE2  . LYS B 1 12 ? 5.666   16.344  0.109   1.00 0.00 ? 283 LYS B HE2  3 
ATOM   3675 H HE3  . LYS B 1 12 ? 6.479   16.051  1.648   1.00 0.00 ? 283 LYS B HE3  3 
ATOM   3676 H HZ1  . LYS B 1 12 ? 8.471   17.150  0.606   1.00 0.00 ? 283 LYS B HZ1  3 
ATOM   3677 H HZ2  . LYS B 1 12 ? 7.443   17.652  -0.649  1.00 0.00 ? 283 LYS B HZ2  3 
ATOM   3678 H HZ3  . LYS B 1 12 ? 7.158   18.170  0.944   1.00 0.00 ? 283 LYS B HZ3  3 
ATOM   3679 N N    . VAL B 1 13 ? 3.642   14.831  -3.771  1.00 0.00 ? 284 VAL B N    3 
ATOM   3680 C CA   . VAL B 1 13 ? 2.349   14.168  -3.901  1.00 0.00 ? 284 VAL B CA   3 
ATOM   3681 C C    . VAL B 1 13 ? 2.376   13.235  -5.113  1.00 0.00 ? 284 VAL B C    3 
ATOM   3682 O O    . VAL B 1 13 ? 1.747   12.196  -5.120  1.00 0.00 ? 284 VAL B O    3 
ATOM   3683 C CB   . VAL B 1 13 ? 1.253   15.218  -4.086  1.00 0.00 ? 284 VAL B CB   3 
ATOM   3684 C CG1  . VAL B 1 13 ? -0.082  14.522  -4.362  1.00 0.00 ? 284 VAL B CG1  3 
ATOM   3685 C CG2  . VAL B 1 13 ? 1.134   16.058  -2.813  1.00 0.00 ? 284 VAL B CG2  3 
ATOM   3686 H H    . VAL B 1 13 ? 3.691   15.809  -3.736  1.00 0.00 ? 284 VAL B H    3 
ATOM   3687 H HA   . VAL B 1 13 ? 2.150   13.594  -3.010  1.00 0.00 ? 284 VAL B HA   3 
ATOM   3688 H HB   . VAL B 1 13 ? 1.504   15.857  -4.920  1.00 0.00 ? 284 VAL B HB   3 
ATOM   3689 H HG11 . VAL B 1 13 ? 0.099   13.501  -4.667  1.00 0.00 ? 284 VAL B HG11 3 
ATOM   3690 H HG12 . VAL B 1 13 ? -0.684  14.528  -3.465  1.00 0.00 ? 284 VAL B HG12 3 
ATOM   3691 H HG13 . VAL B 1 13 ? -0.604  15.045  -5.149  1.00 0.00 ? 284 VAL B HG13 3 
ATOM   3692 H HG21 . VAL B 1 13 ? 2.092   16.500  -2.582  1.00 0.00 ? 284 VAL B HG21 3 
ATOM   3693 H HG22 . VAL B 1 13 ? 0.404   16.840  -2.966  1.00 0.00 ? 284 VAL B HG22 3 
ATOM   3694 H HG23 . VAL B 1 13 ? 0.821   15.427  -1.994  1.00 0.00 ? 284 VAL B HG23 3 
ATOM   3695 N N    . LYS B 1 14 ? 3.097   13.595  -6.138  1.00 0.00 ? 285 LYS B N    3 
ATOM   3696 C CA   . LYS B 1 14 ? 3.155   12.741  -7.320  1.00 0.00 ? 285 LYS B CA   3 
ATOM   3697 C C    . LYS B 1 14 ? 4.018   11.516  -7.016  1.00 0.00 ? 285 LYS B C    3 
ATOM   3698 O O    . LYS B 1 14 ? 3.597   10.389  -7.192  1.00 0.00 ? 285 LYS B O    3 
ATOM   3699 C CB   . LYS B 1 14 ? 3.763   13.518  -8.489  1.00 0.00 ? 285 LYS B CB   3 
ATOM   3700 C CG   . LYS B 1 14 ? 3.489   12.769  -9.795  1.00 0.00 ? 285 LYS B CG   3 
ATOM   3701 C CD   . LYS B 1 14 ? 1.980   12.716  -10.047 1.00 0.00 ? 285 LYS B CD   3 
ATOM   3702 C CE   . LYS B 1 14 ? 1.664   13.373  -11.393 1.00 0.00 ? 285 LYS B CE   3 
ATOM   3703 N NZ   . LYS B 1 14 ? 1.619   14.852  -11.223 1.00 0.00 ? 285 LYS B NZ   3 
ATOM   3704 H H    . LYS B 1 14 ? 3.598   14.437  -6.115  1.00 0.00 ? 285 LYS B H    3 
ATOM   3705 H HA   . LYS B 1 14 ? 2.157   12.423  -7.582  1.00 0.00 ? 285 LYS B HA   3 
ATOM   3706 H HB2  . LYS B 1 14 ? 3.320   14.501  -8.537  1.00 0.00 ? 285 LYS B HB2  3 
ATOM   3707 H HB3  . LYS B 1 14 ? 4.830   13.609  -8.347  1.00 0.00 ? 285 LYS B HB3  3 
ATOM   3708 H HG2  . LYS B 1 14 ? 3.973   13.281  -10.614 1.00 0.00 ? 285 LYS B HG2  3 
ATOM   3709 H HG3  . LYS B 1 14 ? 3.874   11.762  -9.722  1.00 0.00 ? 285 LYS B HG3  3 
ATOM   3710 H HD2  . LYS B 1 14 ? 1.654   11.686  -10.063 1.00 0.00 ? 285 LYS B HD2  3 
ATOM   3711 H HD3  . LYS B 1 14 ? 1.466   13.245  -9.260  1.00 0.00 ? 285 LYS B HD3  3 
ATOM   3712 H HE2  . LYS B 1 14 ? 2.430   13.115  -12.108 1.00 0.00 ? 285 LYS B HE2  3 
ATOM   3713 H HE3  . LYS B 1 14 ? 0.706   13.022  -11.748 1.00 0.00 ? 285 LYS B HE3  3 
ATOM   3714 H HZ1  . LYS B 1 14 ? 2.277   15.137  -10.470 1.00 0.00 ? 285 LYS B HZ1  3 
ATOM   3715 H HZ2  . LYS B 1 14 ? 1.894   15.311  -12.117 1.00 0.00 ? 285 LYS B HZ2  3 
ATOM   3716 H HZ3  . LYS B 1 14 ? 0.654   15.145  -10.967 1.00 0.00 ? 285 LYS B HZ3  3 
ATOM   3717 N N    . THR B 1 15 ? 5.220   11.722  -6.551  1.00 0.00 ? 286 THR B N    3 
ATOM   3718 C CA   . THR B 1 15 ? 6.082   10.588  -6.237  1.00 0.00 ? 286 THR B CA   3 
ATOM   3719 C C    . THR B 1 15 ? 5.318   9.613   -5.339  1.00 0.00 ? 286 THR B C    3 
ATOM   3720 O O    . THR B 1 15 ? 5.416   8.411   -5.488  1.00 0.00 ? 286 THR B O    3 
ATOM   3721 C CB   . THR B 1 15 ? 7.335   11.081  -5.512  1.00 0.00 ? 286 THR B CB   3 
ATOM   3722 O OG1  . THR B 1 15 ? 8.063   11.954  -6.365  1.00 0.00 ? 286 THR B OG1  3 
ATOM   3723 C CG2  . THR B 1 15 ? 8.211   9.884   -5.135  1.00 0.00 ? 286 THR B CG2  3 
ATOM   3724 H H    . THR B 1 15 ? 5.542   12.637  -6.409  1.00 0.00 ? 286 THR B H    3 
ATOM   3725 H HA   . THR B 1 15 ? 6.369   10.089  -7.151  1.00 0.00 ? 286 THR B HA   3 
ATOM   3726 H HB   . THR B 1 15 ? 7.050   11.608  -4.614  1.00 0.00 ? 286 THR B HB   3 
ATOM   3727 H HG1  . THR B 1 15 ? 8.937   12.075  -5.988  1.00 0.00 ? 286 THR B HG1  3 
ATOM   3728 H HG21 . THR B 1 15 ? 7.626   8.979   -5.183  1.00 0.00 ? 286 THR B HG21 3 
ATOM   3729 H HG22 . THR B 1 15 ? 9.040   9.814   -5.824  1.00 0.00 ? 286 THR B HG22 3 
ATOM   3730 H HG23 . THR B 1 15 ? 8.589   10.017  -4.132  1.00 0.00 ? 286 THR B HG23 3 
ATOM   3731 N N    . LEU B 1 16 ? 4.554   10.124  -4.412  1.00 0.00 ? 287 LEU B N    3 
ATOM   3732 C CA   . LEU B 1 16 ? 3.796   9.249   -3.526  1.00 0.00 ? 287 LEU B CA   3 
ATOM   3733 C C    . LEU B 1 16 ? 2.830   8.404   -4.359  1.00 0.00 ? 287 LEU B C    3 
ATOM   3734 O O    . LEU B 1 16 ? 2.902   7.190   -4.372  1.00 0.00 ? 287 LEU B O    3 
ATOM   3735 C CB   . LEU B 1 16 ? 2.999   10.093  -2.531  1.00 0.00 ? 287 LEU B CB   3 
ATOM   3736 C CG   . LEU B 1 16 ? 3.837   10.334  -1.273  1.00 0.00 ? 287 LEU B CG   3 
ATOM   3737 C CD1  . LEU B 1 16 ? 3.230   11.487  -0.471  1.00 0.00 ? 287 LEU B CD1  3 
ATOM   3738 C CD2  . LEU B 1 16 ? 3.842   9.065   -0.415  1.00 0.00 ? 287 LEU B CD2  3 
ATOM   3739 H H    . LEU B 1 16 ? 4.488   11.097  -4.314  1.00 0.00 ? 287 LEU B H    3 
ATOM   3740 H HA   . LEU B 1 16 ? 4.473   8.600   -2.990  1.00 0.00 ? 287 LEU B HA   3 
ATOM   3741 H HB2  . LEU B 1 16 ? 2.749   11.042  -2.984  1.00 0.00 ? 287 LEU B HB2  3 
ATOM   3742 H HB3  . LEU B 1 16 ? 2.092   9.573   -2.262  1.00 0.00 ? 287 LEU B HB3  3 
ATOM   3743 H HG   . LEU B 1 16 ? 4.848   10.584  -1.558  1.00 0.00 ? 287 LEU B HG   3 
ATOM   3744 H HD11 . LEU B 1 16 ? 2.208   11.251  -0.218  1.00 0.00 ? 287 LEU B HD11 3 
ATOM   3745 H HD12 . LEU B 1 16 ? 3.803   11.634  0.433   1.00 0.00 ? 287 LEU B HD12 3 
ATOM   3746 H HD13 . LEU B 1 16 ? 3.256   12.390  -1.065  1.00 0.00 ? 287 LEU B HD13 3 
ATOM   3747 H HD21 . LEU B 1 16 ? 2.827   8.737   -0.253  1.00 0.00 ? 287 LEU B HD21 3 
ATOM   3748 H HD22 . LEU B 1 16 ? 4.395   8.289   -0.926  1.00 0.00 ? 287 LEU B HD22 3 
ATOM   3749 H HD23 . LEU B 1 16 ? 4.308   9.276   0.533   1.00 0.00 ? 287 LEU B HD23 3 
ATOM   3750 N N    . LYS B 1 17 ? 1.926   9.039   -5.055  1.00 0.00 ? 288 LYS B N    3 
ATOM   3751 C CA   . LYS B 1 17 ? 0.975   8.295   -5.873  1.00 0.00 ? 288 LYS B CA   3 
ATOM   3752 C C    . LYS B 1 17 ? 1.716   7.203   -6.646  1.00 0.00 ? 288 LYS B C    3 
ATOM   3753 O O    . LYS B 1 17 ? 1.166   6.165   -6.956  1.00 0.00 ? 288 LYS B O    3 
ATOM   3754 C CB   . LYS B 1 17 ? 0.293   9.247   -6.854  1.00 0.00 ? 288 LYS B CB   3 
ATOM   3755 C CG   . LYS B 1 17 ? -1.217  9.245   -6.604  1.00 0.00 ? 288 LYS B CG   3 
ATOM   3756 C CD   . LYS B 1 17 ? -1.585  10.412  -5.684  1.00 0.00 ? 288 LYS B CD   3 
ATOM   3757 C CE   . LYS B 1 17 ? -1.773  11.680  -6.518  1.00 0.00 ? 288 LYS B CE   3 
ATOM   3758 N NZ   . LYS B 1 17 ? -3.043  11.581  -7.293  1.00 0.00 ? 288 LYS B NZ   3 
ATOM   3759 H H    . LYS B 1 17 ? 1.887   10.018  -5.029  1.00 0.00 ? 288 LYS B H    3 
ATOM   3760 H HA   . LYS B 1 17 ? 0.229   7.842   -5.235  1.00 0.00 ? 288 LYS B HA   3 
ATOM   3761 H HB2  . LYS B 1 17 ? 0.680   10.246  -6.716  1.00 0.00 ? 288 LYS B HB2  3 
ATOM   3762 H HB3  . LYS B 1 17 ? 0.486   8.923   -7.866  1.00 0.00 ? 288 LYS B HB3  3 
ATOM   3763 H HG2  . LYS B 1 17 ? -1.740  9.348   -7.545  1.00 0.00 ? 288 LYS B HG2  3 
ATOM   3764 H HG3  . LYS B 1 17 ? -1.503  8.316   -6.134  1.00 0.00 ? 288 LYS B HG3  3 
ATOM   3765 H HD2  . LYS B 1 17 ? -2.503  10.182  -5.163  1.00 0.00 ? 288 LYS B HD2  3 
ATOM   3766 H HD3  . LYS B 1 17 ? -0.792  10.568  -4.968  1.00 0.00 ? 288 LYS B HD3  3 
ATOM   3767 H HE2  . LYS B 1 17 ? -1.817  12.539  -5.865  1.00 0.00 ? 288 LYS B HE2  3 
ATOM   3768 H HE3  . LYS B 1 17 ? -0.943  11.789  -7.201  1.00 0.00 ? 288 LYS B HE3  3 
ATOM   3769 H HZ1  . LYS B 1 17 ? -3.578  10.748  -6.976  1.00 0.00 ? 288 LYS B HZ1  3 
ATOM   3770 H HZ2  . LYS B 1 17 ? -3.613  12.437  -7.138  1.00 0.00 ? 288 LYS B HZ2  3 
ATOM   3771 H HZ3  . LYS B 1 17 ? -2.825  11.488  -8.307  1.00 0.00 ? 288 LYS B HZ3  3 
ATOM   3772 N N    . ALA B 1 18 ? 2.962   7.428   -6.958  1.00 0.00 ? 289 ALA B N    3 
ATOM   3773 C CA   . ALA B 1 18 ? 3.723   6.424   -7.692  1.00 0.00 ? 289 ALA B CA   3 
ATOM   3774 C C    . ALA B 1 18 ? 3.931   5.201   -6.800  1.00 0.00 ? 289 ALA B C    3 
ATOM   3775 O O    . ALA B 1 18 ? 3.521   4.104   -7.125  1.00 0.00 ? 289 ALA B O    3 
ATOM   3776 C CB   . ALA B 1 18 ? 5.083   6.996   -8.085  1.00 0.00 ? 289 ALA B CB   3 
ATOM   3777 H H    . ALA B 1 18 ? 3.389   8.270   -6.698  1.00 0.00 ? 289 ALA B H    3 
ATOM   3778 H HA   . ALA B 1 18 ? 3.181   6.137   -8.581  1.00 0.00 ? 289 ALA B HA   3 
ATOM   3779 H HB1  . ALA B 1 18 ? 5.068   8.071   -7.974  1.00 0.00 ? 289 ALA B HB1  3 
ATOM   3780 H HB2  . ALA B 1 18 ? 5.846   6.577   -7.444  1.00 0.00 ? 289 ALA B HB2  3 
ATOM   3781 H HB3  . ALA B 1 18 ? 5.298   6.742   -9.113  1.00 0.00 ? 289 ALA B HB3  3 
ATOM   3782 N N    . GLN B 1 19 ? 4.570   5.383   -5.677  1.00 0.00 ? 290 GLN B N    3 
ATOM   3783 C CA   . GLN B 1 19 ? 4.804   4.257   -4.783  1.00 0.00 ? 290 GLN B CA   3 
ATOM   3784 C C    . GLN B 1 19 ? 3.482   3.530   -4.528  1.00 0.00 ? 290 GLN B C    3 
ATOM   3785 O O    . GLN B 1 19 ? 3.438   2.320   -4.427  1.00 0.00 ? 290 GLN B O    3 
ATOM   3786 C CB   . GLN B 1 19 ? 5.374   4.766   -3.460  1.00 0.00 ? 290 GLN B CB   3 
ATOM   3787 C CG   . GLN B 1 19 ? 6.903   4.733   -3.514  1.00 0.00 ? 290 GLN B CG   3 
ATOM   3788 C CD   . GLN B 1 19 ? 7.474   5.133   -2.153  1.00 0.00 ? 290 GLN B CD   3 
ATOM   3789 O OE1  . GLN B 1 19 ? 8.447   4.565   -1.699  1.00 0.00 ? 290 GLN B OE1  3 
ATOM   3790 N NE2  . GLN B 1 19 ? 6.908   6.096   -1.480  1.00 0.00 ? 290 GLN B NE2  3 
ATOM   3791 H H    . GLN B 1 19 ? 4.893   6.276   -5.437  1.00 0.00 ? 290 GLN B H    3 
ATOM   3792 H HA   . GLN B 1 19 ? 5.508   3.579   -5.241  1.00 0.00 ? 290 GLN B HA   3 
ATOM   3793 H HB2  . GLN B 1 19 ? 5.043   5.781   -3.291  1.00 0.00 ? 290 GLN B HB2  3 
ATOM   3794 H HB3  . GLN B 1 19 ? 5.031   4.136   -2.653  1.00 0.00 ? 290 GLN B HB3  3 
ATOM   3795 H HG2  . GLN B 1 19 ? 7.231   3.733   -3.763  1.00 0.00 ? 290 GLN B HG2  3 
ATOM   3796 H HG3  . GLN B 1 19 ? 7.253   5.423   -4.266  1.00 0.00 ? 290 GLN B HG3  3 
ATOM   3797 H HE21 . GLN B 1 19 ? 6.123   6.554   -1.846  1.00 0.00 ? 290 GLN B HE21 3 
ATOM   3798 H HE22 . GLN B 1 19 ? 7.267   6.361   -0.607  1.00 0.00 ? 290 GLN B HE22 3 
ATOM   3799 N N    . ASN B 1 20 ? 2.403   4.257   -4.426  1.00 0.00 ? 291 ASN B N    3 
ATOM   3800 C CA   . ASN B 1 20 ? 1.114   3.622   -4.184  1.00 0.00 ? 291 ASN B CA   3 
ATOM   3801 C C    . ASN B 1 20 ? 0.808   2.648   -5.325  1.00 0.00 ? 291 ASN B C    3 
ATOM   3802 O O    . ASN B 1 20 ? 0.494   1.495   -5.105  1.00 0.00 ? 291 ASN B O    3 
ATOM   3803 C CB   . ASN B 1 20 ? 0.021   4.691   -4.118  1.00 0.00 ? 291 ASN B CB   3 
ATOM   3804 C CG   . ASN B 1 20 ? -0.012  5.305   -2.716  1.00 0.00 ? 291 ASN B CG   3 
ATOM   3805 O OD1  . ASN B 1 20 ? 1.018   5.496   -2.100  1.00 0.00 ? 291 ASN B OD1  3 
ATOM   3806 N ND2  . ASN B 1 20 ? -1.160  5.625   -2.183  1.00 0.00 ? 291 ASN B ND2  3 
ATOM   3807 H H    . ASN B 1 20 ? 2.461   5.232   -4.513  1.00 0.00 ? 291 ASN B H    3 
ATOM   3808 H HA   . ASN B 1 20 ? 1.144   3.083   -3.249  1.00 0.00 ? 291 ASN B HA   3 
ATOM   3809 H HB2  . ASN B 1 20 ? 0.228   5.462   -4.846  1.00 0.00 ? 291 ASN B HB2  3 
ATOM   3810 H HB3  . ASN B 1 20 ? -0.937  4.241   -4.334  1.00 0.00 ? 291 ASN B HB3  3 
ATOM   3811 H HD21 . ASN B 1 20 ? -1.991  5.472   -2.681  1.00 0.00 ? 291 ASN B HD21 3 
ATOM   3812 H HD22 . ASN B 1 20 ? -1.191  6.018   -1.287  1.00 0.00 ? 291 ASN B HD22 3 
ATOM   3813 N N    . SER B 1 21 ? 0.899   3.104   -6.543  1.00 0.00 ? 292 SER B N    3 
ATOM   3814 C CA   . SER B 1 21 ? 0.622   2.225   -7.676  1.00 0.00 ? 292 SER B CA   3 
ATOM   3815 C C    . SER B 1 21 ? 1.644   1.087   -7.696  1.00 0.00 ? 292 SER B C    3 
ATOM   3816 O O    . SER B 1 21 ? 1.366   -0.001  -8.161  1.00 0.00 ? 292 SER B O    3 
ATOM   3817 C CB   . SER B 1 21 ? 0.721   3.024   -8.976  1.00 0.00 ? 292 SER B CB   3 
ATOM   3818 O OG   . SER B 1 21 ? 1.288   4.298   -8.703  1.00 0.00 ? 292 SER B OG   3 
ATOM   3819 H H    . SER B 1 21 ? 1.155   4.037   -6.701  1.00 0.00 ? 292 SER B H    3 
ATOM   3820 H HA   . SER B 1 21 ? -0.373  1.818   -7.581  1.00 0.00 ? 292 SER B HA   3 
ATOM   3821 H HB2  . SER B 1 21 ? 1.350   2.498   -9.677  1.00 0.00 ? 292 SER B HB2  3 
ATOM   3822 H HB3  . SER B 1 21 ? -0.267  3.142   -9.402  1.00 0.00 ? 292 SER B HB3  3 
ATOM   3823 H HG   . SER B 1 21 ? 1.319   4.792   -9.526  1.00 0.00 ? 292 SER B HG   3 
ATOM   3824 N N    . GLU B 1 22 ? 2.824   1.327   -7.195  1.00 0.00 ? 293 GLU B N    3 
ATOM   3825 C CA   . GLU B 1 22 ? 3.841   0.282   -7.187  1.00 0.00 ? 293 GLU B CA   3 
ATOM   3826 C C    . GLU B 1 22 ? 3.475   -0.777  -6.145  1.00 0.00 ? 293 GLU B C    3 
ATOM   3827 O O    . GLU B 1 22 ? 3.110   -1.889  -6.476  1.00 0.00 ? 293 GLU B O    3 
ATOM   3828 C CB   . GLU B 1 22 ? 5.199   0.893   -6.839  1.00 0.00 ? 293 GLU B CB   3 
ATOM   3829 C CG   . GLU B 1 22 ? 5.575   1.938   -7.893  1.00 0.00 ? 293 GLU B CG   3 
ATOM   3830 C CD   . GLU B 1 22 ? 6.249   1.247   -9.080  1.00 0.00 ? 293 GLU B CD   3 
ATOM   3831 O OE1  . GLU B 1 22 ? 5.782   0.190   -9.467  1.00 0.00 ? 293 GLU B OE1  3 
ATOM   3832 O OE2  . GLU B 1 22 ? 7.220   1.788   -9.580  1.00 0.00 ? 293 GLU B OE2  3 
ATOM   3833 H H    . GLU B 1 22 ? 3.029   2.211   -6.825  1.00 0.00 ? 293 GLU B H    3 
ATOM   3834 H HA   . GLU B 1 22 ? 3.894   -0.177  -8.164  1.00 0.00 ? 293 GLU B HA   3 
ATOM   3835 H HB2  . GLU B 1 22 ? 5.143   1.363   -5.867  1.00 0.00 ? 293 GLU B HB2  3 
ATOM   3836 H HB3  . GLU B 1 22 ? 5.949   0.117   -6.823  1.00 0.00 ? 293 GLU B HB3  3 
ATOM   3837 H HG2  . GLU B 1 22 ? 4.683   2.447   -8.230  1.00 0.00 ? 293 GLU B HG2  3 
ATOM   3838 H HG3  . GLU B 1 22 ? 6.257   2.656   -7.461  1.00 0.00 ? 293 GLU B HG3  3 
ATOM   3839 N N    . LEU B 1 23 ? 3.575   -0.443  -4.886  1.00 0.00 ? 294 LEU B N    3 
ATOM   3840 C CA   . LEU B 1 23 ? 3.241   -1.409  -3.847  1.00 0.00 ? 294 LEU B CA   3 
ATOM   3841 C C    . LEU B 1 23 ? 1.855   -1.995  -4.117  1.00 0.00 ? 294 LEU B C    3 
ATOM   3842 O O    . LEU B 1 23 ? 1.554   -3.106  -3.729  1.00 0.00 ? 294 LEU B O    3 
ATOM   3843 C CB   . LEU B 1 23 ? 3.244   -0.713  -2.484  1.00 0.00 ? 294 LEU B CB   3 
ATOM   3844 C CG   . LEU B 1 23 ? 4.600   -0.924  -1.807  1.00 0.00 ? 294 LEU B CG   3 
ATOM   3845 C CD1  . LEU B 1 23 ? 5.078   0.395   -1.197  1.00 0.00 ? 294 LEU B CD1  3 
ATOM   3846 C CD2  . LEU B 1 23 ? 4.457   -1.972  -0.700  1.00 0.00 ? 294 LEU B CD2  3 
ATOM   3847 H H    . LEU B 1 23 ? 3.872   0.459   -4.642  1.00 0.00 ? 294 LEU B H    3 
ATOM   3848 H HA   . LEU B 1 23 ? 3.974   -2.202  -3.844  1.00 0.00 ? 294 LEU B HA   3 
ATOM   3849 H HB2  . LEU B 1 23 ? 3.069   0.344   -2.620  1.00 0.00 ? 294 LEU B HB2  3 
ATOM   3850 H HB3  . LEU B 1 23 ? 2.466   -1.131  -1.865  1.00 0.00 ? 294 LEU B HB3  3 
ATOM   3851 H HG   . LEU B 1 23 ? 5.319   -1.264  -2.538  1.00 0.00 ? 294 LEU B HG   3 
ATOM   3852 H HD11 . LEU B 1 23 ? 4.292   0.818   -0.591  1.00 0.00 ? 294 LEU B HD11 3 
ATOM   3853 H HD12 . LEU B 1 23 ? 5.949   0.216   -0.584  1.00 0.00 ? 294 LEU B HD12 3 
ATOM   3854 H HD13 . LEU B 1 23 ? 5.332   1.086   -1.990  1.00 0.00 ? 294 LEU B HD13 3 
ATOM   3855 H HD21 . LEU B 1 23 ? 3.598   -1.738  -0.091  1.00 0.00 ? 294 LEU B HD21 3 
ATOM   3856 H HD22 . LEU B 1 23 ? 4.329   -2.948  -1.144  1.00 0.00 ? 294 LEU B HD22 3 
ATOM   3857 H HD23 . LEU B 1 23 ? 5.345   -1.969  -0.085  1.00 0.00 ? 294 LEU B HD23 3 
ATOM   3858 N N    . ALA B 1 24 ? 1.006   -1.259  -4.780  1.00 0.00 ? 295 ALA B N    3 
ATOM   3859 C CA   . ALA B 1 24 ? -0.330  -1.765  -5.068  1.00 0.00 ? 295 ALA B CA   3 
ATOM   3860 C C    . ALA B 1 24 ? -0.229  -2.978  -5.994  1.00 0.00 ? 295 ALA B C    3 
ATOM   3861 O O    . ALA B 1 24 ? -0.748  -4.038  -5.706  1.00 0.00 ? 295 ALA B O    3 
ATOM   3862 C CB   . ALA B 1 24 ? -1.157  -0.672  -5.749  1.00 0.00 ? 295 ALA B CB   3 
ATOM   3863 H H    . ALA B 1 24 ? 1.268   -0.364  -5.083  1.00 0.00 ? 295 ALA B H    3 
ATOM   3864 H HA   . ALA B 1 24 ? -0.812  -2.054  -4.145  1.00 0.00 ? 295 ALA B HA   3 
ATOM   3865 H HB1  . ALA B 1 24 ? -0.576  -0.226  -6.545  1.00 0.00 ? 295 ALA B HB1  3 
ATOM   3866 H HB2  . ALA B 1 24 ? -2.057  -1.103  -6.157  1.00 0.00 ? 295 ALA B HB2  3 
ATOM   3867 H HB3  . ALA B 1 24 ? -1.415  0.087   -5.025  1.00 0.00 ? 295 ALA B HB3  3 
ATOM   3868 N N    . SER B 1 25 ? 0.437   -2.832  -7.107  1.00 0.00 ? 296 SER B N    3 
ATOM   3869 C CA   . SER B 1 25 ? 0.567   -3.951  -8.033  1.00 0.00 ? 296 SER B CA   3 
ATOM   3870 C C    . SER B 1 25 ? 1.307   -5.102  -7.347  1.00 0.00 ? 296 SER B C    3 
ATOM   3871 O O    . SER B 1 25 ? 0.966   -6.257  -7.509  1.00 0.00 ? 296 SER B O    3 
ATOM   3872 C CB   . SER B 1 25 ? 1.354   -3.504  -9.265  1.00 0.00 ? 296 SER B CB   3 
ATOM   3873 O OG   . SER B 1 25 ? 0.855   -4.181  -10.412 1.00 0.00 ? 296 SER B OG   3 
ATOM   3874 H H    . SER B 1 25 ? 0.847   -1.969  -7.322  1.00 0.00 ? 296 SER B H    3 
ATOM   3875 H HA   . SER B 1 25 ? -0.414  -4.284  -8.336  1.00 0.00 ? 296 SER B HA   3 
ATOM   3876 H HB2  . SER B 1 25 ? 1.236   -2.442  -9.404  1.00 0.00 ? 296 SER B HB2  3 
ATOM   3877 H HB3  . SER B 1 25 ? 2.401   -3.732  -9.124  1.00 0.00 ? 296 SER B HB3  3 
ATOM   3878 H HG   . SER B 1 25 ? 0.280   -3.578  -10.887 1.00 0.00 ? 296 SER B HG   3 
ATOM   3879 N N    . THR B 1 26 ? 2.322   -4.798  -6.584  1.00 0.00 ? 297 THR B N    3 
ATOM   3880 C CA   . THR B 1 26 ? 3.069   -5.855  -5.908  1.00 0.00 ? 297 THR B CA   3 
ATOM   3881 C C    . THR B 1 26 ? 2.121   -6.667  -5.022  1.00 0.00 ? 297 THR B C    3 
ATOM   3882 O O    . THR B 1 26 ? 2.071   -7.878  -5.100  1.00 0.00 ? 297 THR B O    3 
ATOM   3883 C CB   . THR B 1 26 ? 4.170   -5.232  -5.047  1.00 0.00 ? 297 THR B CB   3 
ATOM   3884 O OG1  . THR B 1 26 ? 5.167   -4.672  -5.888  1.00 0.00 ? 297 THR B OG1  3 
ATOM   3885 C CG2  . THR B 1 26 ? 4.795   -6.311  -4.160  1.00 0.00 ? 297 THR B CG2  3 
ATOM   3886 H H    . THR B 1 26 ? 2.586   -3.862  -6.468  1.00 0.00 ? 297 THR B H    3 
ATOM   3887 H HA   . THR B 1 26 ? 3.515   -6.505  -6.643  1.00 0.00 ? 297 THR B HA   3 
ATOM   3888 H HB   . THR B 1 26 ? 3.747   -4.460  -4.423  1.00 0.00 ? 297 THR B HB   3 
ATOM   3889 H HG1  . THR B 1 26 ? 4.851   -3.815  -6.190  1.00 0.00 ? 297 THR B HG1  3 
ATOM   3890 H HG21 . THR B 1 26 ? 5.047   -7.172  -4.763  1.00 0.00 ? 297 THR B HG21 3 
ATOM   3891 H HG22 . THR B 1 26 ? 5.690   -5.922  -3.698  1.00 0.00 ? 297 THR B HG22 3 
ATOM   3892 H HG23 . THR B 1 26 ? 4.091   -6.600  -3.394  1.00 0.00 ? 297 THR B HG23 3 
ATOM   3893 N N    . ALA B 1 27 ? 1.371   -6.010  -4.182  1.00 0.00 ? 298 ALA B N    3 
ATOM   3894 C CA   . ALA B 1 27 ? 0.448   -6.732  -3.315  1.00 0.00 ? 298 ALA B CA   3 
ATOM   3895 C C    . ALA B 1 27 ? -0.507  -7.566  -4.168  1.00 0.00 ? 298 ALA B C    3 
ATOM   3896 O O    . ALA B 1 27 ? -0.581  -8.772  -4.037  1.00 0.00 ? 298 ALA B O    3 
ATOM   3897 C CB   . ALA B 1 27 ? -0.352  -5.734  -2.478  1.00 0.00 ? 298 ALA B CB   3 
ATOM   3898 H H    . ALA B 1 27 ? 1.425   -5.033  -4.135  1.00 0.00 ? 298 ALA B H    3 
ATOM   3899 H HA   . ALA B 1 27 ? 1.006   -7.383  -2.658  1.00 0.00 ? 298 ALA B HA   3 
ATOM   3900 H HB1  . ALA B 1 27 ? -0.320  -4.762  -2.949  1.00 0.00 ? 298 ALA B HB1  3 
ATOM   3901 H HB2  . ALA B 1 27 ? -1.377  -6.065  -2.406  1.00 0.00 ? 298 ALA B HB2  3 
ATOM   3902 H HB3  . ALA B 1 27 ? 0.076   -5.669  -1.488  1.00 0.00 ? 298 ALA B HB3  3 
ATOM   3903 N N    . ASN B 1 28 ? -1.238  -6.935  -5.046  1.00 0.00 ? 299 ASN B N    3 
ATOM   3904 C CA   . ASN B 1 28 ? -2.164  -7.679  -5.892  1.00 0.00 ? 299 ASN B CA   3 
ATOM   3905 C C    . ASN B 1 28 ? -1.456  -8.911  -6.457  1.00 0.00 ? 299 ASN B C    3 
ATOM   3906 O O    . ASN B 1 28 ? -2.059  -9.947  -6.661  1.00 0.00 ? 299 ASN B O    3 
ATOM   3907 C CB   . ASN B 1 28 ? -2.635  -6.785  -7.042  1.00 0.00 ? 299 ASN B CB   3 
ATOM   3908 C CG   . ASN B 1 28 ? -4.130  -6.501  -6.891  1.00 0.00 ? 299 ASN B CG   3 
ATOM   3909 O OD1  . ASN B 1 28 ? -4.904  -7.395  -6.612  1.00 0.00 ? 299 ASN B OD1  3 
ATOM   3910 N ND2  . ASN B 1 28 ? -4.573  -5.286  -7.065  1.00 0.00 ? 299 ASN B ND2  3 
ATOM   3911 H H    . ASN B 1 28 ? -1.162  -5.962  -5.138  1.00 0.00 ? 299 ASN B H    3 
ATOM   3912 H HA   . ASN B 1 28 ? -3.017  -7.988  -5.307  1.00 0.00 ? 299 ASN B HA   3 
ATOM   3913 H HB2  . ASN B 1 28 ? -2.087  -5.855  -7.022  1.00 0.00 ? 299 ASN B HB2  3 
ATOM   3914 H HB3  . ASN B 1 28 ? -2.458  -7.288  -7.982  1.00 0.00 ? 299 ASN B HB3  3 
ATOM   3915 H HD21 . ASN B 1 28 ? -3.948  -4.565  -7.292  1.00 0.00 ? 299 ASN B HD21 3 
ATOM   3916 H HD22 . ASN B 1 28 ? -5.527  -5.093  -6.969  1.00 0.00 ? 299 ASN B HD22 3 
ATOM   3917 N N    . MET B 1 29 ? -0.180  -8.809  -6.709  1.00 0.00 ? 300 MET B N    3 
ATOM   3918 C CA   . MET B 1 29 ? 0.552   -9.950  -7.246  1.00 0.00 ? 300 MET B CA   3 
ATOM   3919 C C    . MET B 1 29 ? 0.595   -11.064 -6.198  1.00 0.00 ? 300 MET B C    3 
ATOM   3920 O O    . MET B 1 29 ? 0.130   -12.164 -6.425  1.00 0.00 ? 300 MET B O    3 
ATOM   3921 C CB   . MET B 1 29 ? 1.979   -9.520  -7.595  1.00 0.00 ? 300 MET B CB   3 
ATOM   3922 C CG   . MET B 1 29 ? 2.730   -10.697 -8.218  1.00 0.00 ? 300 MET B CG   3 
ATOM   3923 S SD   . MET B 1 29 ? 3.592   -10.144 -9.711  1.00 0.00 ? 300 MET B SD   3 
ATOM   3924 C CE   . MET B 1 29 ? 4.375   -8.680  -8.990  1.00 0.00 ? 300 MET B CE   3 
ATOM   3925 H H    . MET B 1 29 ? 0.288   -7.966  -6.535  1.00 0.00 ? 300 MET B H    3 
ATOM   3926 H HA   . MET B 1 29 ? 0.057   -10.309 -8.136  1.00 0.00 ? 300 MET B HA   3 
ATOM   3927 H HB2  . MET B 1 29 ? 1.945   -8.701  -8.299  1.00 0.00 ? 300 MET B HB2  3 
ATOM   3928 H HB3  . MET B 1 29 ? 2.491   -9.204  -6.699  1.00 0.00 ? 300 MET B HB3  3 
ATOM   3929 H HG2  . MET B 1 29 ? 3.448   -11.082 -7.509  1.00 0.00 ? 300 MET B HG2  3 
ATOM   3930 H HG3  . MET B 1 29 ? 2.028   -11.477 -8.476  1.00 0.00 ? 300 MET B HG3  3 
ATOM   3931 H HE1  . MET B 1 29 ? 4.435   -8.797  -7.917  1.00 0.00 ? 300 MET B HE1  3 
ATOM   3932 H HE2  . MET B 1 29 ? 5.369   -8.564  -9.401  1.00 0.00 ? 300 MET B HE2  3 
ATOM   3933 H HE3  . MET B 1 29 ? 3.789   -7.806  -9.220  1.00 0.00 ? 300 MET B HE3  3 
ATOM   3934 N N    . LEU B 1 30 ? 1.146   -10.786 -5.049  1.00 0.00 ? 301 LEU B N    3 
ATOM   3935 C CA   . LEU B 1 30 ? 1.215   -11.805 -4.007  1.00 0.00 ? 301 LEU B CA   3 
ATOM   3936 C C    . LEU B 1 30 ? -0.200  -12.222 -3.609  1.00 0.00 ? 301 LEU B C    3 
ATOM   3937 O O    . LEU B 1 30 ? -0.408  -13.254 -3.000  1.00 0.00 ? 301 LEU B O    3 
ATOM   3938 C CB   . LEU B 1 30 ? 1.944   -11.239 -2.785  1.00 0.00 ? 301 LEU B CB   3 
ATOM   3939 C CG   . LEU B 1 30 ? 3.334   -10.753 -3.198  1.00 0.00 ? 301 LEU B CG   3 
ATOM   3940 C CD1  . LEU B 1 30 ? 4.083   -10.244 -1.966  1.00 0.00 ? 301 LEU B CD1  3 
ATOM   3941 C CD2  . LEU B 1 30 ? 4.112   -11.912 -3.827  1.00 0.00 ? 301 LEU B CD2  3 
ATOM   3942 H H    . LEU B 1 30 ? 1.513   -9.892  -4.884  1.00 0.00 ? 301 LEU B H    3 
ATOM   3943 H HA   . LEU B 1 30 ? 1.753   -12.663 -4.378  1.00 0.00 ? 301 LEU B HA   3 
ATOM   3944 H HB2  . LEU B 1 30 ? 1.377   -10.412 -2.381  1.00 0.00 ? 301 LEU B HB2  3 
ATOM   3945 H HB3  . LEU B 1 30 ? 2.041   -12.010 -2.036  1.00 0.00 ? 301 LEU B HB3  3 
ATOM   3946 H HG   . LEU B 1 30 ? 3.234   -9.952  -3.916  1.00 0.00 ? 301 LEU B HG   3 
ATOM   3947 H HD11 . LEU B 1 30 ? 3.375   -9.861  -1.245  1.00 0.00 ? 301 LEU B HD11 3 
ATOM   3948 H HD12 . LEU B 1 30 ? 4.644   -11.055 -1.526  1.00 0.00 ? 301 LEU B HD12 3 
ATOM   3949 H HD13 . LEU B 1 30 ? 4.761   -9.455  -2.258  1.00 0.00 ? 301 LEU B HD13 3 
ATOM   3950 H HD21 . LEU B 1 30 ? 3.840   -12.835 -3.335  1.00 0.00 ? 301 LEU B HD21 3 
ATOM   3951 H HD22 . LEU B 1 30 ? 3.872   -11.980 -4.876  1.00 0.00 ? 301 LEU B HD22 3 
ATOM   3952 H HD23 . LEU B 1 30 ? 5.172   -11.739 -3.707  1.00 0.00 ? 301 LEU B HD23 3 
ATOM   3953 N N    . ARG B 1 31 ? -1.179  -11.427 -3.948  1.00 0.00 ? 302 ARG B N    3 
ATOM   3954 C CA   . ARG B 1 31 ? -2.550  -11.766 -3.599  1.00 0.00 ? 302 ARG B CA   3 
ATOM   3955 C C    . ARG B 1 31 ? -3.046  -12.893 -4.508  1.00 0.00 ? 302 ARG B C    3 
ATOM   3956 O O    . ARG B 1 31 ? -3.600  -13.873 -4.053  1.00 0.00 ? 302 ARG B O    3 
ATOM   3957 C CB   . ARG B 1 31 ? -3.439  -10.535 -3.784  1.00 0.00 ? 302 ARG B CB   3 
ATOM   3958 C CG   . ARG B 1 31 ? -4.496  -10.496 -2.681  1.00 0.00 ? 302 ARG B CG   3 
ATOM   3959 C CD   . ARG B 1 31 ? -5.824  -11.021 -3.232  1.00 0.00 ? 302 ARG B CD   3 
ATOM   3960 N NE   . ARG B 1 31 ? -6.867  -10.894 -2.216  1.00 0.00 ? 302 ARG B NE   3 
ATOM   3961 C CZ   . ARG B 1 31 ? -6.591  -11.109 -0.957  1.00 0.00 ? 302 ARG B CZ   3 
ATOM   3962 N NH1  . ARG B 1 31 ? -5.816  -12.102 -0.619  1.00 0.00 ? 302 ARG B NH1  3 
ATOM   3963 N NH2  . ARG B 1 31 ? -7.090  -10.331 -0.038  1.00 0.00 ? 302 ARG B NH2  3 
ATOM   3964 H H    . ARG B 1 31 ? -0.989  -10.599 -4.437  1.00 0.00 ? 302 ARG B H    3 
ATOM   3965 H HA   . ARG B 1 31 ? -2.594  -12.087 -2.570  1.00 0.00 ? 302 ARG B HA   3 
ATOM   3966 H HB2  . ARG B 1 31 ? -2.831  -9.643  -3.735  1.00 0.00 ? 302 ARG B HB2  3 
ATOM   3967 H HB3  . ARG B 1 31 ? -3.926  -10.584 -4.746  1.00 0.00 ? 302 ARG B HB3  3 
ATOM   3968 H HG2  . ARG B 1 31 ? -4.177  -11.116 -1.856  1.00 0.00 ? 302 ARG B HG2  3 
ATOM   3969 H HG3  . ARG B 1 31 ? -4.626  -9.480  -2.342  1.00 0.00 ? 302 ARG B HG3  3 
ATOM   3970 H HD2  . ARG B 1 31 ? -6.105  -10.445 -4.101  1.00 0.00 ? 302 ARG B HD2  3 
ATOM   3971 H HD3  . ARG B 1 31 ? -5.712  -12.060 -3.511  1.00 0.00 ? 302 ARG B HD3  3 
ATOM   3972 H HE   . ARG B 1 31 ? -7.775  -10.645 -2.480  1.00 0.00 ? 302 ARG B HE   3 
ATOM   3973 H HH11 . ARG B 1 31 ? -5.433  -12.700 -1.322  1.00 0.00 ? 302 ARG B HH11 3 
ATOM   3974 H HH12 . ARG B 1 31 ? -5.605  -12.266 0.346   1.00 0.00 ? 302 ARG B HH12 3 
ATOM   3975 H HH21 . ARG B 1 31 ? -7.686  -9.568  -0.296  1.00 0.00 ? 302 ARG B HH21 3 
ATOM   3976 H HH22 . ARG B 1 31 ? -6.879  -10.494 0.926   1.00 0.00 ? 302 ARG B HH22 3 
ATOM   3977 N N    . GLU B 1 32 ? -2.854  -12.757 -5.793  1.00 0.00 ? 303 GLU B N    3 
ATOM   3978 C CA   . GLU B 1 32 ? -3.307  -13.794 -6.710  1.00 0.00 ? 303 GLU B CA   3 
ATOM   3979 C C    . GLU B 1 32 ? -2.538  -15.091 -6.445  1.00 0.00 ? 303 GLU B C    3 
ATOM   3980 O O    . GLU B 1 32 ? -3.083  -16.174 -6.524  1.00 0.00 ? 303 GLU B O    3 
ATOM   3981 C CB   . GLU B 1 32 ? -3.068  -13.343 -8.153  1.00 0.00 ? 303 GLU B CB   3 
ATOM   3982 C CG   . GLU B 1 32 ? -1.656  -12.768 -8.285  1.00 0.00 ? 303 GLU B CG   3 
ATOM   3983 C CD   . GLU B 1 32 ? -1.292  -12.640 -9.765  1.00 0.00 ? 303 GLU B CD   3 
ATOM   3984 O OE1  . GLU B 1 32 ? -1.601  -13.556 -10.511 1.00 0.00 ? 303 GLU B OE1  3 
ATOM   3985 O OE2  . GLU B 1 32 ? -0.711  -11.630 -10.128 1.00 0.00 ? 303 GLU B OE2  3 
ATOM   3986 H H    . GLU B 1 32 ? -2.407  -11.957 -6.139  1.00 0.00 ? 303 GLU B H    3 
ATOM   3987 H HA   . GLU B 1 32 ? -4.362  -13.969 -6.563  1.00 0.00 ? 303 GLU B HA   3 
ATOM   3988 H HB2  . GLU B 1 32 ? -3.175  -14.189 -8.816  1.00 0.00 ? 303 GLU B HB2  3 
ATOM   3989 H HB3  . GLU B 1 32 ? -3.790  -12.586 -8.418  1.00 0.00 ? 303 GLU B HB3  3 
ATOM   3990 H HG2  . GLU B 1 32 ? -1.620  -11.793 -7.820  1.00 0.00 ? 303 GLU B HG2  3 
ATOM   3991 H HG3  . GLU B 1 32 ? -0.952  -13.425 -7.799  1.00 0.00 ? 303 GLU B HG3  3 
ATOM   3992 N N    . GLN B 1 33 ? -1.277  -14.991 -6.126  1.00 0.00 ? 304 GLN B N    3 
ATOM   3993 C CA   . GLN B 1 33 ? -0.500  -16.197 -5.860  1.00 0.00 ? 304 GLN B CA   3 
ATOM   3994 C C    . GLN B 1 33 ? -1.066  -16.894 -4.624  1.00 0.00 ? 304 GLN B C    3 
ATOM   3995 O O    . GLN B 1 33 ? -1.521  -18.019 -4.687  1.00 0.00 ? 304 GLN B O    3 
ATOM   3996 C CB   . GLN B 1 33 ? 0.964   -15.829 -5.609  1.00 0.00 ? 304 GLN B CB   3 
ATOM   3997 C CG   . GLN B 1 33 ? 1.364   -14.674 -6.527  1.00 0.00 ? 304 GLN B CG   3 
ATOM   3998 C CD   . GLN B 1 33 ? 2.664   -15.028 -7.254  1.00 0.00 ? 304 GLN B CD   3 
ATOM   3999 O OE1  . GLN B 1 33 ? 3.695   -15.197 -6.634  1.00 0.00 ? 304 GLN B OE1  3 
ATOM   4000 N NE2  . GLN B 1 33 ? 2.658   -15.148 -8.554  1.00 0.00 ? 304 GLN B NE2  3 
ATOM   4001 H H    . GLN B 1 33 ? -0.852  -14.108 -6.061  1.00 0.00 ? 304 GLN B H    3 
ATOM   4002 H HA   . GLN B 1 33 ? -0.562  -16.862 -6.709  1.00 0.00 ? 304 GLN B HA   3 
ATOM   4003 H HB2  . GLN B 1 33 ? 1.087   -15.530 -4.578  1.00 0.00 ? 304 GLN B HB2  3 
ATOM   4004 H HB3  . GLN B 1 33 ? 1.590   -16.683 -5.815  1.00 0.00 ? 304 GLN B HB3  3 
ATOM   4005 H HG2  . GLN B 1 33 ? 0.580   -14.502 -7.249  1.00 0.00 ? 304 GLN B HG2  3 
ATOM   4006 H HG3  . GLN B 1 33 ? 1.515   -13.784 -5.937  1.00 0.00 ? 304 GLN B HG3  3 
ATOM   4007 H HE21 . GLN B 1 33 ? 1.826   -15.013 -9.056  1.00 0.00 ? 304 GLN B HE21 3 
ATOM   4008 H HE22 . GLN B 1 33 ? 3.485   -15.375 -9.028  1.00 0.00 ? 304 GLN B HE22 3 
ATOM   4009 N N    . VAL B 1 34 ? -1.045  -16.231 -3.502  1.00 0.00 ? 305 VAL B N    3 
ATOM   4010 C CA   . VAL B 1 34 ? -1.576  -16.839 -2.288  1.00 0.00 ? 305 VAL B CA   3 
ATOM   4011 C C    . VAL B 1 34 ? -2.942  -17.460 -2.590  1.00 0.00 ? 305 VAL B C    3 
ATOM   4012 O O    . VAL B 1 34 ? -3.302  -18.484 -2.046  1.00 0.00 ? 305 VAL B O    3 
ATOM   4013 C CB   . VAL B 1 34 ? -1.725  -15.767 -1.205  1.00 0.00 ? 305 VAL B CB   3 
ATOM   4014 C CG1  . VAL B 1 34 ? -2.590  -16.306 -0.062  1.00 0.00 ? 305 VAL B CG1  3 
ATOM   4015 C CG2  . VAL B 1 34 ? -0.340  -15.402 -0.662  1.00 0.00 ? 305 VAL B CG2  3 
ATOM   4016 H H    . VAL B 1 34 ? -0.675  -15.324 -3.478  1.00 0.00 ? 305 VAL B H    3 
ATOM   4017 H HA   . VAL B 1 34 ? -0.901  -17.608 -1.942  1.00 0.00 ? 305 VAL B HA   3 
ATOM   4018 H HB   . VAL B 1 34 ? -2.192  -14.890 -1.628  1.00 0.00 ? 305 VAL B HB   3 
ATOM   4019 H HG11 . VAL B 1 34 ? -3.552  -16.605 -0.452  1.00 0.00 ? 305 VAL B HG11 3 
ATOM   4020 H HG12 . VAL B 1 34 ? -2.102  -17.159 0.386   1.00 0.00 ? 305 VAL B HG12 3 
ATOM   4021 H HG13 . VAL B 1 34 ? -2.725  -15.534 0.682   1.00 0.00 ? 305 VAL B HG13 3 
ATOM   4022 H HG21 . VAL B 1 34 ? 0.380   -16.139 -0.985  1.00 0.00 ? 305 VAL B HG21 3 
ATOM   4023 H HG22 . VAL B 1 34 ? -0.053  -14.429 -1.035  1.00 0.00 ? 305 VAL B HG22 3 
ATOM   4024 H HG23 . VAL B 1 34 ? -0.371  -15.378 0.417   1.00 0.00 ? 305 VAL B HG23 3 
ATOM   4025 N N    . ALA B 1 35 ? -3.703  -16.849 -3.456  1.00 0.00 ? 306 ALA B N    3 
ATOM   4026 C CA   . ALA B 1 35 ? -5.013  -17.397 -3.786  1.00 0.00 ? 306 ALA B CA   3 
ATOM   4027 C C    . ALA B 1 35 ? -4.834  -18.721 -4.530  1.00 0.00 ? 306 ALA B C    3 
ATOM   4028 O O    . ALA B 1 35 ? -5.621  -19.635 -4.388  1.00 0.00 ? 306 ALA B O    3 
ATOM   4029 C CB   . ALA B 1 35 ? -5.772  -16.410 -4.675  1.00 0.00 ? 306 ALA B CB   3 
ATOM   4030 H H    . ALA B 1 35 ? -3.393  -16.025 -3.886  1.00 0.00 ? 306 ALA B H    3 
ATOM   4031 H HA   . ALA B 1 35 ? -5.572  -17.566 -2.878  1.00 0.00 ? 306 ALA B HA   3 
ATOM   4032 H HB1  . ALA B 1 35 ? -5.068  -15.765 -5.179  1.00 0.00 ? 306 ALA B HB1  3 
ATOM   4033 H HB2  . ALA B 1 35 ? -6.350  -16.955 -5.406  1.00 0.00 ? 306 ALA B HB2  3 
ATOM   4034 H HB3  . ALA B 1 35 ? -6.435  -15.813 -4.064  1.00 0.00 ? 306 ALA B HB3  3 
ATOM   4035 N N    . GLN B 1 36 ? -3.802  -18.833 -5.320  1.00 0.00 ? 307 GLN B N    3 
ATOM   4036 C CA   . GLN B 1 36 ? -3.576  -20.073 -6.053  1.00 0.00 ? 307 GLN B CA   3 
ATOM   4037 C C    . GLN B 1 36 ? -2.998  -21.124 -5.103  1.00 0.00 ? 307 GLN B C    3 
ATOM   4038 O O    . GLN B 1 36 ? -3.510  -22.219 -4.988  1.00 0.00 ? 307 GLN B O    3 
ATOM   4039 C CB   . GLN B 1 36 ? -2.587  -19.823 -7.194  1.00 0.00 ? 307 GLN B CB   3 
ATOM   4040 C CG   . GLN B 1 36 ? -2.901  -18.480 -7.857  1.00 0.00 ? 307 GLN B CG   3 
ATOM   4041 C CD   . GLN B 1 36 ? -2.975  -18.665 -9.373  1.00 0.00 ? 307 GLN B CD   3 
ATOM   4042 O OE1  . GLN B 1 36 ? -3.394  -19.701 -9.851  1.00 0.00 ? 307 GLN B OE1  3 
ATOM   4043 N NE2  . GLN B 1 36 ? -2.585  -17.697 -10.156 1.00 0.00 ? 307 GLN B NE2  3 
ATOM   4044 H H    . GLN B 1 36 ? -3.177  -18.084 -5.417  1.00 0.00 ? 307 GLN B H    3 
ATOM   4045 H HA   . GLN B 1 36 ? -4.511  -20.427 -6.460  1.00 0.00 ? 307 GLN B HA   3 
ATOM   4046 H HB2  . GLN B 1 36 ? -1.582  -19.804 -6.802  1.00 0.00 ? 307 GLN B HB2  3 
ATOM   4047 H HB3  . GLN B 1 36 ? -2.674  -20.611 -7.926  1.00 0.00 ? 307 GLN B HB3  3 
ATOM   4048 H HG2  . GLN B 1 36 ? -3.850  -18.113 -7.491  1.00 0.00 ? 307 GLN B HG2  3 
ATOM   4049 H HG3  . GLN B 1 36 ? -2.124  -17.771 -7.620  1.00 0.00 ? 307 GLN B HG3  3 
ATOM   4050 H HE21 . GLN B 1 36 ? -2.247  -16.860 -9.772  1.00 0.00 ? 307 GLN B HE21 3 
ATOM   4051 H HE22 . GLN B 1 36 ? -2.626  -17.806 -11.129 1.00 0.00 ? 307 GLN B HE22 3 
ATOM   4052 N N    . LEU B 1 37 ? -1.937  -20.795 -4.420  1.00 0.00 ? 308 LEU B N    3 
ATOM   4053 C CA   . LEU B 1 37 ? -1.340  -21.750 -3.496  1.00 0.00 ? 308 LEU B CA   3 
ATOM   4054 C C    . LEU B 1 37 ? -2.410  -22.258 -2.527  1.00 0.00 ? 308 LEU B C    3 
ATOM   4055 O O    . LEU B 1 37 ? -2.363  -23.383 -2.070  1.00 0.00 ? 308 LEU B O    3 
ATOM   4056 C CB   . LEU B 1 37 ? -0.221  -21.064 -2.711  1.00 0.00 ? 308 LEU B CB   3 
ATOM   4057 C CG   . LEU B 1 37 ? 1.006   -20.903 -3.609  1.00 0.00 ? 308 LEU B CG   3 
ATOM   4058 C CD1  . LEU B 1 37 ? 1.677   -19.560 -3.322  1.00 0.00 ? 308 LEU B CD1  3 
ATOM   4059 C CD2  . LEU B 1 37 ? 1.995   -22.038 -3.330  1.00 0.00 ? 308 LEU B CD2  3 
ATOM   4060 H H    . LEU B 1 37 ? -1.541  -19.905 -4.527  1.00 0.00 ? 308 LEU B H    3 
ATOM   4061 H HA   . LEU B 1 37 ? -0.931  -22.583 -4.050  1.00 0.00 ? 308 LEU B HA   3 
ATOM   4062 H HB2  . LEU B 1 37 ? -0.558  -20.091 -2.383  1.00 0.00 ? 308 LEU B HB2  3 
ATOM   4063 H HB3  . LEU B 1 37 ? 0.040   -21.664 -1.852  1.00 0.00 ? 308 LEU B HB3  3 
ATOM   4064 H HG   . LEU B 1 37 ? 0.700   -20.937 -4.645  1.00 0.00 ? 308 LEU B HG   3 
ATOM   4065 H HD11 . LEU B 1 37 ? 1.285   -19.151 -2.402  1.00 0.00 ? 308 LEU B HD11 3 
ATOM   4066 H HD12 . LEU B 1 37 ? 2.744   -19.704 -3.225  1.00 0.00 ? 308 LEU B HD12 3 
ATOM   4067 H HD13 . LEU B 1 37 ? 1.479   -18.876 -4.135  1.00 0.00 ? 308 LEU B HD13 3 
ATOM   4068 H HD21 . LEU B 1 37 ? 1.524   -22.780 -2.701  1.00 0.00 ? 308 LEU B HD21 3 
ATOM   4069 H HD22 . LEU B 1 37 ? 2.295   -22.492 -4.263  1.00 0.00 ? 308 LEU B HD22 3 
ATOM   4070 H HD23 . LEU B 1 37 ? 2.864   -21.640 -2.827  1.00 0.00 ? 308 LEU B HD23 3 
ATOM   4071 N N    . LYS B 1 38 ? -3.374  -21.438 -2.209  1.00 0.00 ? 309 LYS B N    3 
ATOM   4072 C CA   . LYS B 1 38 ? -4.421  -21.867 -1.292  1.00 0.00 ? 309 LYS B CA   3 
ATOM   4073 C C    . LYS B 1 38 ? -5.490  -22.638 -2.067  1.00 0.00 ? 309 LYS B C    3 
ATOM   4074 O O    . LYS B 1 38 ? -5.775  -23.784 -1.779  1.00 0.00 ? 309 LYS B O    3 
ATOM   4075 C CB   . LYS B 1 38 ? -5.050  -20.644 -0.623  1.00 0.00 ? 309 LYS B CB   3 
ATOM   4076 C CG   . LYS B 1 38 ? -4.376  -20.406 0.730   1.00 0.00 ? 309 LYS B CG   3 
ATOM   4077 C CD   . LYS B 1 38 ? -3.523  -19.139 0.659   1.00 0.00 ? 309 LYS B CD   3 
ATOM   4078 C CE   . LYS B 1 38 ? -2.979  -18.812 2.050   1.00 0.00 ? 309 LYS B CE   3 
ATOM   4079 N NZ   . LYS B 1 38 ? -4.068  -18.962 3.058   1.00 0.00 ? 309 LYS B NZ   3 
ATOM   4080 H H    . LYS B 1 38 ? -3.395  -20.535 -2.589  1.00 0.00 ? 309 LYS B H    3 
ATOM   4081 H HA   . LYS B 1 38 ? -3.994  -22.508 -0.534  1.00 0.00 ? 309 LYS B HA   3 
ATOM   4082 H HB2  . LYS B 1 38 ? -4.914  -19.778 -1.253  1.00 0.00 ? 309 LYS B HB2  3 
ATOM   4083 H HB3  . LYS B 1 38 ? -6.106  -20.820 -0.470  1.00 0.00 ? 309 LYS B HB3  3 
ATOM   4084 H HG2  . LYS B 1 38 ? -5.132  -20.290 1.493   1.00 0.00 ? 309 LYS B HG2  3 
ATOM   4085 H HG3  . LYS B 1 38 ? -3.745  -21.248 0.970   1.00 0.00 ? 309 LYS B HG3  3 
ATOM   4086 H HD2  . LYS B 1 38 ? -2.699  -19.300 -0.023  1.00 0.00 ? 309 LYS B HD2  3 
ATOM   4087 H HD3  . LYS B 1 38 ? -4.127  -18.318 0.307   1.00 0.00 ? 309 LYS B HD3  3 
ATOM   4088 H HE2  . LYS B 1 38 ? -2.171  -19.489 2.290   1.00 0.00 ? 309 LYS B HE2  3 
ATOM   4089 H HE3  . LYS B 1 38 ? -2.613  -17.796 2.065   1.00 0.00 ? 309 LYS B HE3  3 
ATOM   4090 H HZ1  . LYS B 1 38 ? -4.985  -18.779 2.605   1.00 0.00 ? 309 LYS B HZ1  3 
ATOM   4091 H HZ2  . LYS B 1 38 ? -4.058  -19.931 3.436   1.00 0.00 ? 309 LYS B HZ2  3 
ATOM   4092 H HZ3  . LYS B 1 38 ? -3.919  -18.284 3.832   1.00 0.00 ? 309 LYS B HZ3  3 
ATOM   4093 N N    . GLN B 1 39 ? -6.086  -22.022 -3.053  1.00 0.00 ? 310 GLN B N    3 
ATOM   4094 C CA   . GLN B 1 39 ? -7.110  -22.712 -3.828  1.00 0.00 ? 310 GLN B CA   3 
ATOM   4095 C C    . GLN B 1 39 ? -6.607  -24.108 -4.192  1.00 0.00 ? 310 GLN B C    3 
ATOM   4096 O O    . GLN B 1 39 ? -7.321  -25.086 -4.083  1.00 0.00 ? 310 GLN B O    3 
ATOM   4097 C CB   . GLN B 1 39 ? -7.406  -21.924 -5.107  1.00 0.00 ? 310 GLN B CB   3 
ATOM   4098 C CG   . GLN B 1 39 ? -8.186  -20.656 -4.760  1.00 0.00 ? 310 GLN B CG   3 
ATOM   4099 C CD   . GLN B 1 39 ? -9.555  -21.034 -4.193  1.00 0.00 ? 310 GLN B CD   3 
ATOM   4100 O OE1  . GLN B 1 39 ? -9.883  -20.683 -3.077  1.00 0.00 ? 310 GLN B OE1  3 
ATOM   4101 N NE2  . GLN B 1 39 ? -10.376 -21.742 -4.922  1.00 0.00 ? 310 GLN B NE2  3 
ATOM   4102 H H    . GLN B 1 39 ? -5.842  -21.099 -3.273  1.00 0.00 ? 310 GLN B H    3 
ATOM   4103 H HA   . GLN B 1 39 ? -8.012  -22.795 -3.241  1.00 0.00 ? 310 GLN B HA   3 
ATOM   4104 H HB2  . GLN B 1 39 ? -6.476  -21.656 -5.588  1.00 0.00 ? 310 GLN B HB2  3 
ATOM   4105 H HB3  . GLN B 1 39 ? -7.995  -22.534 -5.777  1.00 0.00 ? 310 GLN B HB3  3 
ATOM   4106 H HG2  . GLN B 1 39 ? -7.638  -20.086 -4.023  1.00 0.00 ? 310 GLN B HG2  3 
ATOM   4107 H HG3  . GLN B 1 39 ? -8.320  -20.059 -5.649  1.00 0.00 ? 310 GLN B HG3  3 
ATOM   4108 H HE21 . GLN B 1 39 ? -10.113 -22.024 -5.822  1.00 0.00 ? 310 GLN B HE21 3 
ATOM   4109 H HE22 . GLN B 1 39 ? -11.256 -21.989 -4.568  1.00 0.00 ? 310 GLN B HE22 3 
ATOM   4110 N N    . LYS B 1 40 ? -5.378  -24.210 -4.622  1.00 0.00 ? 311 LYS B N    3 
ATOM   4111 C CA   . LYS B 1 40 ? -4.837  -25.515 -4.980  1.00 0.00 ? 311 LYS B CA   3 
ATOM   4112 C C    . LYS B 1 40 ? -5.105  -26.502 -3.843  1.00 0.00 ? 311 LYS B C    3 
ATOM   4113 O O    . LYS B 1 40 ? -5.547  -27.613 -4.062  1.00 0.00 ? 311 LYS B O    3 
ATOM   4114 C CB   . LYS B 1 40 ? -3.328  -25.396 -5.211  1.00 0.00 ? 311 LYS B CB   3 
ATOM   4115 C CG   . LYS B 1 40 ? -2.802  -26.690 -5.837  1.00 0.00 ? 311 LYS B CG   3 
ATOM   4116 C CD   . LYS B 1 40 ? -2.800  -27.803 -4.788  1.00 0.00 ? 311 LYS B CD   3 
ATOM   4117 C CE   . LYS B 1 40 ? -1.494  -28.592 -4.883  1.00 0.00 ? 311 LYS B CE   3 
ATOM   4118 N NZ   . LYS B 1 40 ? -1.375  -29.195 -6.241  1.00 0.00 ? 311 LYS B NZ   3 
ATOM   4119 H H    . LYS B 1 40 ? -4.819  -23.410 -4.700  1.00 0.00 ? 311 LYS B H    3 
ATOM   4120 H HA   . LYS B 1 40 ? -5.311  -25.867 -5.884  1.00 0.00 ? 311 LYS B HA   3 
ATOM   4121 H HB2  . LYS B 1 40 ? -3.130  -24.567 -5.875  1.00 0.00 ? 311 LYS B HB2  3 
ATOM   4122 H HB3  . LYS B 1 40 ? -2.832  -25.229 -4.267  1.00 0.00 ? 311 LYS B HB3  3 
ATOM   4123 H HG2  . LYS B 1 40 ? -3.438  -26.973 -6.664  1.00 0.00 ? 311 LYS B HG2  3 
ATOM   4124 H HG3  . LYS B 1 40 ? -1.795  -26.532 -6.195  1.00 0.00 ? 311 LYS B HG3  3 
ATOM   4125 H HD2  . LYS B 1 40 ? -2.889  -27.368 -3.804  1.00 0.00 ? 311 LYS B HD2  3 
ATOM   4126 H HD3  . LYS B 1 40 ? -3.633  -28.465 -4.966  1.00 0.00 ? 311 LYS B HD3  3 
ATOM   4127 H HE2  . LYS B 1 40 ? -0.659  -27.930 -4.710  1.00 0.00 ? 311 LYS B HE2  3 
ATOM   4128 H HE3  . LYS B 1 40 ? -1.491  -29.375 -4.139  1.00 0.00 ? 311 LYS B HE3  3 
ATOM   4129 H HZ1  . LYS B 1 40 ? -1.759  -28.538 -6.947  1.00 0.00 ? 311 LYS B HZ1  3 
ATOM   4130 H HZ2  . LYS B 1 40 ? -0.372  -29.383 -6.450  1.00 0.00 ? 311 LYS B HZ2  3 
ATOM   4131 H HZ3  . LYS B 1 40 ? -1.909  -30.086 -6.272  1.00 0.00 ? 311 LYS B HZ3  3 
ATOM   4132 N N    . VAL B 1 41 ? -4.844  -26.104 -2.628  1.00 0.00 ? 312 VAL B N    3 
ATOM   4133 C CA   . VAL B 1 41 ? -5.082  -26.997 -1.500  1.00 0.00 ? 312 VAL B CA   3 
ATOM   4134 C C    . VAL B 1 41 ? -6.582  -27.278 -1.388  1.00 0.00 ? 312 VAL B C    3 
ATOM   4135 O O    . VAL B 1 41 ? -6.998  -28.386 -1.113  1.00 0.00 ? 312 VAL B O    3 
ATOM   4136 C CB   . VAL B 1 41 ? -4.588  -26.337 -0.213  1.00 0.00 ? 312 VAL B CB   3 
ATOM   4137 C CG1  . VAL B 1 41 ? -5.041  -27.162 0.992   1.00 0.00 ? 312 VAL B CG1  3 
ATOM   4138 C CG2  . VAL B 1 41 ? -3.059  -26.264 -0.233  1.00 0.00 ? 312 VAL B CG2  3 
ATOM   4139 H H    . VAL B 1 41 ? -4.490  -25.203 -2.474  1.00 0.00 ? 312 VAL B H    3 
ATOM   4140 H HA   . VAL B 1 41 ? -4.552  -27.924 -1.655  1.00 0.00 ? 312 VAL B HA   3 
ATOM   4141 H HB   . VAL B 1 41 ? -4.997  -25.339 -0.139  1.00 0.00 ? 312 VAL B HB   3 
ATOM   4142 H HG11 . VAL B 1 41 ? -5.602  -28.019 0.650   1.00 0.00 ? 312 VAL B HG11 3 
ATOM   4143 H HG12 . VAL B 1 41 ? -4.176  -27.497 1.546   1.00 0.00 ? 312 VAL B HG12 3 
ATOM   4144 H HG13 . VAL B 1 41 ? -5.666  -26.554 1.631   1.00 0.00 ? 312 VAL B HG13 3 
ATOM   4145 H HG21 . VAL B 1 41 ? -2.707  -26.381 -1.247  1.00 0.00 ? 312 VAL B HG21 3 
ATOM   4146 H HG22 . VAL B 1 41 ? -2.739  -25.305 0.151   1.00 0.00 ? 312 VAL B HG22 3 
ATOM   4147 H HG23 . VAL B 1 41 ? -2.654  -27.052 0.383   1.00 0.00 ? 312 VAL B HG23 3 
ATOM   4148 N N    . MET B 1 42 ? -7.397  -26.279 -1.598  1.00 0.00 ? 313 MET B N    3 
ATOM   4149 C CA   . MET B 1 42 ? -8.838  -26.482 -1.504  1.00 0.00 ? 313 MET B CA   3 
ATOM   4150 C C    . MET B 1 42 ? -9.369  -26.978 -2.851  1.00 0.00 ? 313 MET B C    3 
ATOM   4151 O O    . MET B 1 42 ? -9.846  -26.210 -3.662  1.00 0.00 ? 313 MET B O    3 
ATOM   4152 C CB   . MET B 1 42 ? -9.517  -25.159 -1.147  1.00 0.00 ? 313 MET B CB   3 
ATOM   4153 C CG   . MET B 1 42 ? -11.019 -25.385 -0.976  1.00 0.00 ? 313 MET B CG   3 
ATOM   4154 S SD   . MET B 1 42 ? -11.418 -25.478 0.787   1.00 0.00 ? 313 MET B SD   3 
ATOM   4155 C CE   . MET B 1 42 ? -13.129 -26.040 0.606   1.00 0.00 ? 313 MET B CE   3 
ATOM   4156 H H    . MET B 1 42 ? -7.040  -25.394 -1.818  1.00 0.00 ? 313 MET B H    3 
ATOM   4157 H HA   . MET B 1 42 ? -9.051  -27.214 -0.740  1.00 0.00 ? 313 MET B HA   3 
ATOM   4158 H HB2  . MET B 1 42 ? -9.101  -24.779 -0.223  1.00 0.00 ? 313 MET B HB2  3 
ATOM   4159 H HB3  . MET B 1 42 ? -9.351  -24.444 -1.937  1.00 0.00 ? 313 MET B HB3  3 
ATOM   4160 H HG2  . MET B 1 42 ? -11.560 -24.567 -1.425  1.00 0.00 ? 313 MET B HG2  3 
ATOM   4161 H HG3  . MET B 1 42 ? -11.300 -26.310 -1.457  1.00 0.00 ? 313 MET B HG3  3 
ATOM   4162 H HE1  . MET B 1 42 ? -13.633 -25.428 -0.126  1.00 0.00 ? 313 MET B HE1  3 
ATOM   4163 H HE2  . MET B 1 42 ? -13.134 -27.070 0.276   1.00 0.00 ? 313 MET B HE2  3 
ATOM   4164 H HE3  . MET B 1 42 ? -13.637 -25.956 1.555   1.00 0.00 ? 313 MET B HE3  3 
ATOM   4165 N N    . ASN B 1 43 ? -9.292  -28.258 -3.096  1.00 0.00 ? 314 ASN B N    3 
ATOM   4166 C CA   . ASN B 1 43 ? -9.786  -28.785 -4.364  1.00 0.00 ? 314 ASN B CA   3 
ATOM   4167 C C    . ASN B 1 43 ? -10.341 -30.194 -4.152  1.00 0.00 ? 314 ASN B C    3 
ATOM   4168 O O    . ASN B 1 43 ? -9.630  -31.174 -4.243  1.00 0.00 ? 314 ASN B O    3 
ATOM   4169 C CB   . ASN B 1 43 ? -8.639  -28.835 -5.376  1.00 0.00 ? 314 ASN B CB   3 
ATOM   4170 C CG   . ASN B 1 43 ? -9.185  -28.534 -6.774  1.00 0.00 ? 314 ASN B CG   3 
ATOM   4171 O OD1  . ASN B 1 43 ? -10.377 -28.392 -6.957  1.00 0.00 ? 314 ASN B OD1  3 
ATOM   4172 N ND2  . ASN B 1 43 ? -8.356  -28.431 -7.777  1.00 0.00 ? 314 ASN B ND2  3 
ATOM   4173 H H    . ASN B 1 43 ? -8.905  -28.864 -2.431  1.00 0.00 ? 314 ASN B H    3 
ATOM   4174 H HA   . ASN B 1 43 ? -10.567 -28.143 -4.741  1.00 0.00 ? 314 ASN B HA   3 
ATOM   4175 H HB2  . ASN B 1 43 ? -7.894  -28.100 -5.113  1.00 0.00 ? 314 ASN B HB2  3 
ATOM   4176 H HB3  . ASN B 1 43 ? -8.195  -29.819 -5.370  1.00 0.00 ? 314 ASN B HB3  3 
ATOM   4177 H HD21 . ASN B 1 43 ? -7.394  -28.547 -7.632  1.00 0.00 ? 314 ASN B HD21 3 
ATOM   4178 H HD22 . ASN B 1 43 ? -8.695  -28.240 -8.676  1.00 0.00 ? 314 ASN B HD22 3 
ATOM   4179 N N    . TYR B 1 44 ? -11.613 -30.301 -3.866  1.00 0.00 ? 315 TYR B N    3 
ATOM   4180 C CA   . TYR B 1 44 ? -12.206 -31.617 -3.650  1.00 0.00 ? 315 TYR B CA   3 
ATOM   4181 C C    . TYR B 1 44 ? -12.032 -32.471 -4.910  1.00 0.00 ? 315 TYR B C    3 
ATOM   4182 O O    . TYR B 1 44 ? -11.787 -31.898 -5.960  1.00 0.00 ? 315 TYR B O    3 
ATOM   4183 C CB   . TYR B 1 44 ? -13.697 -31.458 -3.344  1.00 0.00 ? 315 TYR B CB   3 
ATOM   4184 C CG   . TYR B 1 44 ? -13.964 -31.844 -1.908  1.00 0.00 ? 315 TYR B CG   3 
ATOM   4185 C CD1  . TYR B 1 44 ? -14.200 -33.187 -1.573  1.00 0.00 ? 315 TYR B CD1  3 
ATOM   4186 C CD2  . TYR B 1 44 ? -13.976 -30.858 -0.907  1.00 0.00 ? 315 TYR B CD2  3 
ATOM   4187 C CE1  . TYR B 1 44 ? -14.448 -33.544 -0.239  1.00 0.00 ? 315 TYR B CE1  3 
ATOM   4188 C CE2  . TYR B 1 44 ? -14.224 -31.217 0.428   1.00 0.00 ? 315 TYR B CE2  3 
ATOM   4189 C CZ   . TYR B 1 44 ? -14.459 -32.559 0.763   1.00 0.00 ? 315 TYR B CZ   3 
ATOM   4190 O OH   . TYR B 1 44 ? -14.704 -32.911 2.074   1.00 0.00 ? 315 TYR B OH   3 
ATOM   4191 O OXT  . TYR B 1 44 ? -12.145 -33.681 -4.802  1.00 0.00 ? 315 TYR B OXT  3 
ATOM   4192 H H    . TYR B 1 44 ? -12.167 -29.497 -3.797  1.00 0.00 ? 315 TYR B H    3 
ATOM   4193 H HA   . TYR B 1 44 ? -11.718 -32.100 -2.818  1.00 0.00 ? 315 TYR B HA   3 
ATOM   4194 H HB2  . TYR B 1 44 ? -13.988 -30.429 -3.500  1.00 0.00 ? 315 TYR B HB2  3 
ATOM   4195 H HB3  . TYR B 1 44 ? -14.272 -32.097 -3.998  1.00 0.00 ? 315 TYR B HB3  3 
ATOM   4196 H HD1  . TYR B 1 44 ? -14.190 -33.945 -2.342  1.00 0.00 ? 315 TYR B HD1  3 
ATOM   4197 H HD2  . TYR B 1 44 ? -13.795 -29.825 -1.164  1.00 0.00 ? 315 TYR B HD2  3 
ATOM   4198 H HE1  . TYR B 1 44 ? -14.629 -34.577 0.018   1.00 0.00 ? 315 TYR B HE1  3 
ATOM   4199 H HE2  . TYR B 1 44 ? -14.233 -30.459 1.197   1.00 0.00 ? 315 TYR B HE2  3 
ATOM   4200 H HH   . TYR B 1 44 ? -14.003 -33.502 2.358   1.00 0.00 ? 315 TYR B HH   3 
HETATM 4201 C C    . ACE A 1 1  ? 3.184   28.428  3.401   1.00 0.00 ? 272 ACE A C    4 
HETATM 4202 O O    . ACE A 1 1  ? 4.032   28.960  2.713   1.00 0.00 ? 272 ACE A O    4 
HETATM 4203 C CH3  . ACE A 1 1  ? 3.540   27.292  4.363   1.00 0.00 ? 272 ACE A CH3  4 
HETATM 4204 H H1   . ACE A 1 1  ? 4.613   27.217  4.449   1.00 0.00 ? 272 ACE A H1   4 
HETATM 4205 H H2   . ACE A 1 1  ? 3.115   27.498  5.335   1.00 0.00 ? 272 ACE A H2   4 
HETATM 4206 H H3   . ACE A 1 1  ? 3.143   26.362  3.986   1.00 0.00 ? 272 ACE A H3   4 
ATOM   4207 N N    . CYS A 1 2  ? 1.935   28.802  3.348   1.00 0.00 ? 273 CYS A N    4 
ATOM   4208 C CA   . CYS A 1 2  ? 1.534   29.879  2.450   1.00 0.00 ? 273 CYS A CA   4 
ATOM   4209 C C    . CYS A 1 2  ? 0.110   30.321  2.792   1.00 0.00 ? 273 CYS A C    4 
ATOM   4210 O O    . CYS A 1 2  ? -0.203  31.496  2.792   1.00 0.00 ? 273 CYS A O    4 
ATOM   4211 C CB   . CYS A 1 2  ? 1.579   29.382  1.005   1.00 0.00 ? 273 CYS A CB   4 
ATOM   4212 S SG   . CYS A 1 2  ? 2.352   30.641  -0.042  1.00 0.00 ? 273 CYS A SG   4 
ATOM   4213 H H    . CYS A 1 2  ? 1.267   28.360  3.911   1.00 0.00 ? 273 CYS A H    4 
ATOM   4214 H HA   . CYS A 1 2  ? 2.210   30.714  2.563   1.00 0.00 ? 273 CYS A HA   4 
ATOM   4215 H HB2  . CYS A 1 2  ? 2.155   28.470  0.954   1.00 0.00 ? 273 CYS A HB2  4 
ATOM   4216 H HB3  . CYS A 1 2  ? 0.574   29.192  0.657   1.00 0.00 ? 273 CYS A HB3  4 
ATOM   4217 N N    . GLY A 1 3  ? -0.754  29.389  3.086   1.00 0.00 ? 274 GLY A N    4 
ATOM   4218 C CA   . GLY A 1 3  ? -2.128  29.747  3.424   1.00 0.00 ? 274 GLY A CA   4 
ATOM   4219 C C    . GLY A 1 3  ? -2.815  28.557  4.097   1.00 0.00 ? 274 GLY A C    4 
ATOM   4220 O O    . GLY A 1 3  ? -2.218  27.847  4.882   1.00 0.00 ? 274 GLY A O    4 
ATOM   4221 H H    . GLY A 1 3  ? -0.481  28.448  3.081   1.00 0.00 ? 274 GLY A H    4 
ATOM   4222 H HA2  . GLY A 1 3  ? -2.123  30.592  4.098   1.00 0.00 ? 274 GLY A HA2  4 
ATOM   4223 H HA3  . GLY A 1 3  ? -2.665  30.005  2.524   1.00 0.00 ? 274 GLY A HA3  4 
ATOM   4224 N N    . GLY A 1 4  ? -4.064  28.335  3.798   1.00 0.00 ? 275 GLY A N    4 
ATOM   4225 C CA   . GLY A 1 4  ? -4.773  27.217  4.408   1.00 0.00 ? 275 GLY A CA   4 
ATOM   4226 C C    . GLY A 1 4  ? -4.755  26.019  3.457   1.00 0.00 ? 275 GLY A C    4 
ATOM   4227 O O    . GLY A 1 4  ? -4.815  24.881  3.874   1.00 0.00 ? 275 GLY A O    4 
ATOM   4228 H H    . GLY A 1 4  ? -4.529  28.920  3.163   1.00 0.00 ? 275 GLY A H    4 
ATOM   4229 H HA2  . GLY A 1 4  ? -4.288  26.949  5.336   1.00 0.00 ? 275 GLY A HA2  4 
ATOM   4230 H HA3  . GLY A 1 4  ? -5.795  27.500  4.603   1.00 0.00 ? 275 GLY A HA3  4 
ATOM   4231 N N    . ARG A 1 5  ? -4.672  26.268  2.179   1.00 0.00 ? 276 ARG A N    4 
ATOM   4232 C CA   . ARG A 1 5  ? -4.650  25.167  1.222   1.00 0.00 ? 276 ARG A CA   4 
ATOM   4233 C C    . ARG A 1 5  ? -3.403  24.312  1.459   1.00 0.00 ? 276 ARG A C    4 
ATOM   4234 O O    . ARG A 1 5  ? -3.417  23.112  1.275   1.00 0.00 ? 276 ARG A O    4 
ATOM   4235 C CB   . ARG A 1 5  ? -4.628  25.723  -0.202  1.00 0.00 ? 276 ARG A CB   4 
ATOM   4236 C CG   . ARG A 1 5  ? -6.027  25.613  -0.814  1.00 0.00 ? 276 ARG A CG   4 
ATOM   4237 C CD   . ARG A 1 5  ? -6.096  26.461  -2.086  1.00 0.00 ? 276 ARG A CD   4 
ATOM   4238 N NE   . ARG A 1 5  ? -6.152  27.878  -1.735  1.00 0.00 ? 276 ARG A NE   4 
ATOM   4239 C CZ   . ARG A 1 5  ? -6.830  28.274  -0.690  1.00 0.00 ? 276 ARG A CZ   4 
ATOM   4240 N NH1  . ARG A 1 5  ? -8.120  28.079  -0.638  1.00 0.00 ? 276 ARG A NH1  4 
ATOM   4241 N NH2  . ARG A 1 5  ? -6.219  28.866  0.299   1.00 0.00 ? 276 ARG A NH2  4 
ATOM   4242 H H    . ARG A 1 5  ? -4.625  27.194  1.860   1.00 0.00 ? 276 ARG A H    4 
ATOM   4243 H HA   . ARG A 1 5  ? -5.533  24.558  1.355   1.00 0.00 ? 276 ARG A HA   4 
ATOM   4244 H HB2  . ARG A 1 5  ? -4.325  26.760  -0.178  1.00 0.00 ? 276 ARG A HB2  4 
ATOM   4245 H HB3  . ARG A 1 5  ? -3.930  25.156  -0.799  1.00 0.00 ? 276 ARG A HB3  4 
ATOM   4246 H HG2  . ARG A 1 5  ? -6.232  24.580  -1.057  1.00 0.00 ? 276 ARG A HG2  4 
ATOM   4247 H HG3  . ARG A 1 5  ? -6.758  25.968  -0.106  1.00 0.00 ? 276 ARG A HG3  4 
ATOM   4248 H HD2  . ARG A 1 5  ? -5.218  26.278  -2.687  1.00 0.00 ? 276 ARG A HD2  4 
ATOM   4249 H HD3  . ARG A 1 5  ? -6.979  26.191  -2.650  1.00 0.00 ? 276 ARG A HD3  4 
ATOM   4250 H HE   . ARG A 1 5  ? -5.677  28.536  -2.285  1.00 0.00 ? 276 ARG A HE   4 
ATOM   4251 H HH11 . ARG A 1 5  ? -8.587  27.626  -1.395  1.00 0.00 ? 276 ARG A HH11 4 
ATOM   4252 H HH12 . ARG A 1 5  ? -8.638  28.381  0.162   1.00 0.00 ? 276 ARG A HH12 4 
ATOM   4253 H HH21 . ARG A 1 5  ? -5.231  29.017  0.258   1.00 0.00 ? 276 ARG A HH21 4 
ATOM   4254 H HH22 . ARG A 1 5  ? -6.739  29.168  1.099   1.00 0.00 ? 276 ARG A HH22 4 
ATOM   4255 N N    . ILE A 1 6  ? -2.325  24.922  1.872   1.00 0.00 ? 277 ILE A N    4 
ATOM   4256 C CA   . ILE A 1 6  ? -1.108  24.156  2.119   1.00 0.00 ? 277 ILE A CA   4 
ATOM   4257 C C    . ILE A 1 6  ? -1.299  23.311  3.380   1.00 0.00 ? 277 ILE A C    4 
ATOM   4258 O O    . ILE A 1 6  ? -0.838  22.188  3.460   1.00 0.00 ? 277 ILE A O    4 
ATOM   4259 C CB   . ILE A 1 6  ? 0.070   25.112  2.312   1.00 0.00 ? 277 ILE A CB   4 
ATOM   4260 C CG1  . ILE A 1 6  ? 0.450   25.728  0.964   1.00 0.00 ? 277 ILE A CG1  4 
ATOM   4261 C CG2  . ILE A 1 6  ? 1.267   24.341  2.873   1.00 0.00 ? 277 ILE A CG2  4 
ATOM   4262 C CD1  . ILE A 1 6  ? -0.644  26.704  0.522   1.00 0.00 ? 277 ILE A CD1  4 
ATOM   4263 H H    . ILE A 1 6  ? -2.333  25.891  2.019   1.00 0.00 ? 277 ILE A H    4 
ATOM   4264 H HA   . ILE A 1 6  ? -0.912  23.511  1.278   1.00 0.00 ? 277 ILE A HA   4 
ATOM   4265 H HB   . ILE A 1 6  ? -0.210  25.895  3.003   1.00 0.00 ? 277 ILE A HB   4 
ATOM   4266 H HG12 . ILE A 1 6  ? 1.387   26.256  1.060   1.00 0.00 ? 277 ILE A HG12 4 
ATOM   4267 H HG13 . ILE A 1 6  ? 0.550   24.945  0.227   1.00 0.00 ? 277 ILE A HG13 4 
ATOM   4268 H HG21 . ILE A 1 6  ? 1.364   23.400  2.352   1.00 0.00 ? 277 ILE A HG21 4 
ATOM   4269 H HG22 . ILE A 1 6  ? 2.167   24.923  2.737   1.00 0.00 ? 277 ILE A HG22 4 
ATOM   4270 H HG23 . ILE A 1 6  ? 1.115   24.157  3.926   1.00 0.00 ? 277 ILE A HG23 4 
ATOM   4271 H HD11 . ILE A 1 6  ? -0.993  27.265  1.376   1.00 0.00 ? 277 ILE A HD11 4 
ATOM   4272 H HD12 . ILE A 1 6  ? -0.242  27.384  -0.215  1.00 0.00 ? 277 ILE A HD12 4 
ATOM   4273 H HD13 . ILE A 1 6  ? -1.467  26.152  0.093   1.00 0.00 ? 277 ILE A HD13 4 
ATOM   4274 N N    . ALA A 1 7  ? -1.981  23.835  4.361   1.00 0.00 ? 278 ALA A N    4 
ATOM   4275 C CA   . ALA A 1 7  ? -2.201  23.071  5.582   1.00 0.00 ? 278 ALA A CA   4 
ATOM   4276 C C    . ALA A 1 7  ? -2.859  21.740  5.220   1.00 0.00 ? 278 ALA A C    4 
ATOM   4277 O O    . ALA A 1 7  ? -2.325  20.679  5.483   1.00 0.00 ? 278 ALA A O    4 
ATOM   4278 C CB   . ALA A 1 7  ? -3.120  23.858  6.520   1.00 0.00 ? 278 ALA A CB   4 
ATOM   4279 H H    . ALA A 1 7  ? -2.349  24.740  4.275   1.00 0.00 ? 278 ALA A H    4 
ATOM   4280 H HA   . ALA A 1 7  ? -1.257  22.889  6.071   1.00 0.00 ? 278 ALA A HA   4 
ATOM   4281 H HB1  . ALA A 1 7  ? -2.751  24.868  6.623   1.00 0.00 ? 278 ALA A HB1  4 
ATOM   4282 H HB2  . ALA A 1 7  ? -4.119  23.879  6.110   1.00 0.00 ? 278 ALA A HB2  4 
ATOM   4283 H HB3  . ALA A 1 7  ? -3.138  23.380  7.489   1.00 0.00 ? 278 ALA A HB3  4 
ATOM   4284 N N    . ARG A 1 8  ? -4.012  21.786  4.609   1.00 0.00 ? 279 ARG A N    4 
ATOM   4285 C CA   . ARG A 1 8  ? -4.685  20.553  4.227   1.00 0.00 ? 279 ARG A CA   4 
ATOM   4286 C C    . ARG A 1 8  ? -3.753  19.726  3.339   1.00 0.00 ? 279 ARG A C    4 
ATOM   4287 O O    . ARG A 1 8  ? -3.580  18.540  3.535   1.00 0.00 ? 279 ARG A O    4 
ATOM   4288 C CB   . ARG A 1 8  ? -5.961  20.890  3.452   1.00 0.00 ? 279 ARG A CB   4 
ATOM   4289 C CG   . ARG A 1 8  ? -7.158  20.209  4.119   1.00 0.00 ? 279 ARG A CG   4 
ATOM   4290 C CD   . ARG A 1 8  ? -7.807  19.240  3.128   1.00 0.00 ? 279 ARG A CD   4 
ATOM   4291 N NE   . ARG A 1 8  ? -8.916  19.903  2.452   1.00 0.00 ? 279 ARG A NE   4 
ATOM   4292 C CZ   . ARG A 1 8  ? -9.414  19.390  1.361   1.00 0.00 ? 279 ARG A CZ   4 
ATOM   4293 N NH1  . ARG A 1 8  ? -9.284  18.114  1.119   1.00 0.00 ? 279 ARG A NH1  4 
ATOM   4294 N NH2  . ARG A 1 8  ? -10.042 20.154  0.509   1.00 0.00 ? 279 ARG A NH2  4 
ATOM   4295 H H    . ARG A 1 8  ? -4.420  22.652  4.400   1.00 0.00 ? 279 ARG A H    4 
ATOM   4296 H HA   . ARG A 1 8  ? -4.939  19.988  5.112   1.00 0.00 ? 279 ARG A HA   4 
ATOM   4297 H HB2  . ARG A 1 8  ? -6.109  21.960  3.453   1.00 0.00 ? 279 ARG A HB2  4 
ATOM   4298 H HB3  . ARG A 1 8  ? -5.868  20.537  2.437   1.00 0.00 ? 279 ARG A HB3  4 
ATOM   4299 H HG2  . ARG A 1 8  ? -6.825  19.666  4.991   1.00 0.00 ? 279 ARG A HG2  4 
ATOM   4300 H HG3  . ARG A 1 8  ? -7.879  20.957  4.411   1.00 0.00 ? 279 ARG A HG3  4 
ATOM   4301 H HD2  . ARG A 1 8  ? -7.075  18.926  2.398   1.00 0.00 ? 279 ARG A HD2  4 
ATOM   4302 H HD3  . ARG A 1 8  ? -8.174  18.375  3.662   1.00 0.00 ? 279 ARG A HD3  4 
ATOM   4303 H HE   . ARG A 1 8  ? -9.286  20.732  2.819   1.00 0.00 ? 279 ARG A HE   4 
ATOM   4304 H HH11 . ARG A 1 8  ? -8.803  17.528  1.772   1.00 0.00 ? 279 ARG A HH11 4 
ATOM   4305 H HH12 . ARG A 1 8  ? -9.666  17.721  0.282   1.00 0.00 ? 279 ARG A HH12 4 
ATOM   4306 H HH21 . ARG A 1 8  ? -10.143 21.131  0.694   1.00 0.00 ? 279 ARG A HH21 4 
ATOM   4307 H HH22 . ARG A 1 8  ? -10.425 19.761  -0.328  1.00 0.00 ? 279 ARG A HH22 4 
ATOM   4308 N N    . LEU A 1 9  ? -3.148  20.349  2.364   1.00 0.00 ? 280 LEU A N    4 
ATOM   4309 C CA   . LEU A 1 9  ? -2.245  19.620  1.480   1.00 0.00 ? 280 LEU A CA   4 
ATOM   4310 C C    . LEU A 1 9  ? -1.246  18.823  2.322   1.00 0.00 ? 280 LEU A C    4 
ATOM   4311 O O    . LEU A 1 9  ? -0.978  17.668  2.053   1.00 0.00 ? 280 LEU A O    4 
ATOM   4312 C CB   . LEU A 1 9  ? -1.491  20.614  0.592   1.00 0.00 ? 280 LEU A CB   4 
ATOM   4313 C CG   . LEU A 1 9  ? -2.077  20.583  -0.819  1.00 0.00 ? 280 LEU A CG   4 
ATOM   4314 C CD1  . LEU A 1 9  ? -2.208  22.011  -1.350  1.00 0.00 ? 280 LEU A CD1  4 
ATOM   4315 C CD2  . LEU A 1 9  ? -1.149  19.782  -1.737  1.00 0.00 ? 280 LEU A CD2  4 
ATOM   4316 H H    . LEU A 1 9  ? -3.301  21.307  2.226   1.00 0.00 ? 280 LEU A H    4 
ATOM   4317 H HA   . LEU A 1 9  ? -2.815  18.946  0.860   1.00 0.00 ? 280 LEU A HA   4 
ATOM   4318 H HB2  . LEU A 1 9  ? -1.588  21.608  1.002   1.00 0.00 ? 280 LEU A HB2  4 
ATOM   4319 H HB3  . LEU A 1 9  ? -0.448  20.339  0.553   1.00 0.00 ? 280 LEU A HB3  4 
ATOM   4320 H HG   . LEU A 1 9  ? -3.053  20.116  -0.795  1.00 0.00 ? 280 LEU A HG   4 
ATOM   4321 H HD11 . LEU A 1 9  ? -1.301  22.558  -1.141  1.00 0.00 ? 280 LEU A HD11 4 
ATOM   4322 H HD12 . LEU A 1 9  ? -2.374  21.984  -2.417  1.00 0.00 ? 280 LEU A HD12 4 
ATOM   4323 H HD13 . LEU A 1 9  ? -3.043  22.498  -0.868  1.00 0.00 ? 280 LEU A HD13 4 
ATOM   4324 H HD21 . LEU A 1 9  ? -0.271  19.481  -1.187  1.00 0.00 ? 280 LEU A HD21 4 
ATOM   4325 H HD22 . LEU A 1 9  ? -1.667  18.905  -2.096  1.00 0.00 ? 280 LEU A HD22 4 
ATOM   4326 H HD23 . LEU A 1 9  ? -0.856  20.396  -2.576  1.00 0.00 ? 280 LEU A HD23 4 
ATOM   4327 N N    . GLU A 1 10 ? -0.692  19.429  3.336   1.00 0.00 ? 281 GLU A N    4 
ATOM   4328 C CA   . GLU A 1 10 ? 0.267   18.717  4.172   1.00 0.00 ? 281 GLU A CA   4 
ATOM   4329 C C    . GLU A 1 10 ? -0.446  17.575  4.898   1.00 0.00 ? 281 GLU A C    4 
ATOM   4330 O O    . GLU A 1 10 ? 0.121   16.527  5.132   1.00 0.00 ? 281 GLU A O    4 
ATOM   4331 C CB   . GLU A 1 10 ? 0.869   19.680  5.196   1.00 0.00 ? 281 GLU A CB   4 
ATOM   4332 C CG   . GLU A 1 10 ? 2.195   20.227  4.662   1.00 0.00 ? 281 GLU A CG   4 
ATOM   4333 C CD   . GLU A 1 10 ? 3.331   19.268  5.031   1.00 0.00 ? 281 GLU A CD   4 
ATOM   4334 O OE1  . GLU A 1 10 ? 3.602   19.130  6.213   1.00 0.00 ? 281 GLU A OE1  4 
ATOM   4335 O OE2  . GLU A 1 10 ? 3.908   18.689  4.125   1.00 0.00 ? 281 GLU A OE2  4 
ATOM   4336 H H    . GLU A 1 10 ? -0.921  20.360  3.536   1.00 0.00 ? 281 GLU A H    4 
ATOM   4337 H HA   . GLU A 1 10 ? 1.054   18.314  3.552   1.00 0.00 ? 281 GLU A HA   4 
ATOM   4338 H HB2  . GLU A 1 10 ? 0.185   20.498  5.368   1.00 0.00 ? 281 GLU A HB2  4 
ATOM   4339 H HB3  . GLU A 1 10 ? 1.047   19.155  6.124   1.00 0.00 ? 281 GLU A HB3  4 
ATOM   4340 H HG2  . GLU A 1 10 ? 2.138   20.322  3.587   1.00 0.00 ? 281 GLU A HG2  4 
ATOM   4341 H HG3  . GLU A 1 10 ? 2.388   21.195  5.099   1.00 0.00 ? 281 GLU A HG3  4 
ATOM   4342 N N    . GLU A 1 11 ? -1.689  17.766  5.248   1.00 0.00 ? 282 GLU A N    4 
ATOM   4343 C CA   . GLU A 1 11 ? -2.420  16.709  5.935   1.00 0.00 ? 282 GLU A CA   4 
ATOM   4344 C C    . GLU A 1 11 ? -2.668  15.565  4.951   1.00 0.00 ? 282 GLU A C    4 
ATOM   4345 O O    . GLU A 1 11 ? -2.581  14.403  5.296   1.00 0.00 ? 282 GLU A O    4 
ATOM   4346 C CB   . GLU A 1 11 ? -3.761  17.252  6.436   1.00 0.00 ? 282 GLU A CB   4 
ATOM   4347 C CG   . GLU A 1 11 ? -3.679  17.499  7.944   1.00 0.00 ? 282 GLU A CG   4 
ATOM   4348 C CD   . GLU A 1 11 ? -5.014  17.133  8.593   1.00 0.00 ? 282 GLU A CD   4 
ATOM   4349 O OE1  . GLU A 1 11 ? -6.014  17.727  8.224   1.00 0.00 ? 282 GLU A OE1  4 
ATOM   4350 O OE2  . GLU A 1 11 ? -5.015  16.264  9.450   1.00 0.00 ? 282 GLU A OE2  4 
ATOM   4351 H H    . GLU A 1 11 ? -2.131  18.616  5.044   1.00 0.00 ? 282 GLU A H    4 
ATOM   4352 H HA   . GLU A 1 11 ? -1.840  16.349  6.771   1.00 0.00 ? 282 GLU A HA   4 
ATOM   4353 H HB2  . GLU A 1 11 ? -3.984  18.179  5.929   1.00 0.00 ? 282 GLU A HB2  4 
ATOM   4354 H HB3  . GLU A 1 11 ? -4.539  16.532  6.234   1.00 0.00 ? 282 GLU A HB3  4 
ATOM   4355 H HG2  . GLU A 1 11 ? -2.893  16.890  8.365   1.00 0.00 ? 282 GLU A HG2  4 
ATOM   4356 H HG3  . GLU A 1 11 ? -3.466  18.542  8.126   1.00 0.00 ? 282 GLU A HG3  4 
ATOM   4357 N N    . LYS A 1 12 ? -2.966  15.890  3.725   1.00 0.00 ? 283 LYS A N    4 
ATOM   4358 C CA   . LYS A 1 12 ? -3.204  14.852  2.730   1.00 0.00 ? 283 LYS A CA   4 
ATOM   4359 C C    . LYS A 1 12 ? -1.900  14.088  2.488   1.00 0.00 ? 283 LYS A C    4 
ATOM   4360 O O    . LYS A 1 12 ? -1.900  12.892  2.275   1.00 0.00 ? 283 LYS A O    4 
ATOM   4361 C CB   . LYS A 1 12 ? -3.674  15.497  1.426   1.00 0.00 ? 283 LYS A CB   4 
ATOM   4362 C CG   . LYS A 1 12 ? -5.178  15.273  1.258   1.00 0.00 ? 283 LYS A CG   4 
ATOM   4363 C CD   . LYS A 1 12 ? -5.583  15.587  -0.183  1.00 0.00 ? 283 LYS A CD   4 
ATOM   4364 C CE   . LYS A 1 12 ? -6.137  17.011  -0.259  1.00 0.00 ? 283 LYS A CE   4 
ATOM   4365 N NZ   . LYS A 1 12 ? -6.708  17.250  -1.614  1.00 0.00 ? 283 LYS A NZ   4 
ATOM   4366 H H    . LYS A 1 12 ? -3.023  16.834  3.468   1.00 0.00 ? 283 LYS A H    4 
ATOM   4367 H HA   . LYS A 1 12 ? -3.961  14.172  3.091   1.00 0.00 ? 283 LYS A HA   4 
ATOM   4368 H HB2  . LYS A 1 12 ? -3.468  16.557  1.456   1.00 0.00 ? 283 LYS A HB2  4 
ATOM   4369 H HB3  . LYS A 1 12 ? -3.150  15.052  0.595   1.00 0.00 ? 283 LYS A HB3  4 
ATOM   4370 H HG2  . LYS A 1 12 ? -5.414  14.243  1.483   1.00 0.00 ? 283 LYS A HG2  4 
ATOM   4371 H HG3  . LYS A 1 12 ? -5.716  15.923  1.932   1.00 0.00 ? 283 LYS A HG3  4 
ATOM   4372 H HD2  . LYS A 1 12 ? -4.721  15.500  -0.828  1.00 0.00 ? 283 LYS A HD2  4 
ATOM   4373 H HD3  . LYS A 1 12 ? -6.343  14.890  -0.504  1.00 0.00 ? 283 LYS A HD3  4 
ATOM   4374 H HE2  . LYS A 1 12 ? -6.911  17.137  0.484   1.00 0.00 ? 283 LYS A HE2  4 
ATOM   4375 H HE3  . LYS A 1 12 ? -5.341  17.717  -0.073  1.00 0.00 ? 283 LYS A HE3  4 
ATOM   4376 H HZ1  . LYS A 1 12 ? -6.792  16.347  -2.120  1.00 0.00 ? 283 LYS A HZ1  4 
ATOM   4377 H HZ2  . LYS A 1 12 ? -7.648  17.683  -1.523  1.00 0.00 ? 283 LYS A HZ2  4 
ATOM   4378 H HZ3  . LYS A 1 12 ? -6.083  17.889  -2.146  1.00 0.00 ? 283 LYS A HZ3  4 
ATOM   4379 N N    . VAL A 1 13 ? -0.790  14.773  2.524   1.00 0.00 ? 284 VAL A N    4 
ATOM   4380 C CA   . VAL A 1 13 ? 0.487   14.104  2.311   1.00 0.00 ? 284 VAL A CA   4 
ATOM   4381 C C    . VAL A 1 13 ? 0.687   13.054  3.403   1.00 0.00 ? 284 VAL A C    4 
ATOM   4382 O O    . VAL A 1 13 ? 0.914   11.892  3.129   1.00 0.00 ? 284 VAL A O    4 
ATOM   4383 C CB   . VAL A 1 13 ? 1.620   15.128  2.373   1.00 0.00 ? 284 VAL A CB   4 
ATOM   4384 C CG1  . VAL A 1 13 ? 2.958   14.426  2.131   1.00 0.00 ? 284 VAL A CG1  4 
ATOM   4385 C CG2  . VAL A 1 13 ? 1.404   16.195  1.299   1.00 0.00 ? 284 VAL A CG2  4 
ATOM   4386 H H    . VAL A 1 13 ? -0.814  15.736  2.703   1.00 0.00 ? 284 VAL A H    4 
ATOM   4387 H HA   . VAL A 1 13 ? 0.486   13.625  1.343   1.00 0.00 ? 284 VAL A HA   4 
ATOM   4388 H HB   . VAL A 1 13 ? 1.631   15.593  3.348   1.00 0.00 ? 284 VAL A HB   4 
ATOM   4389 H HG11 . VAL A 1 13 ? 3.048   13.582  2.797   1.00 0.00 ? 284 VAL A HG11 4 
ATOM   4390 H HG12 . VAL A 1 13 ? 3.003   14.081  1.108   1.00 0.00 ? 284 VAL A HG12 4 
ATOM   4391 H HG13 . VAL A 1 13 ? 3.766   15.117  2.312   1.00 0.00 ? 284 VAL A HG13 4 
ATOM   4392 H HG21 . VAL A 1 13 ? 0.349   16.275  1.075   1.00 0.00 ? 284 VAL A HG21 4 
ATOM   4393 H HG22 . VAL A 1 13 ? 1.768   17.147  1.657   1.00 0.00 ? 284 VAL A HG22 4 
ATOM   4394 H HG23 . VAL A 1 13 ? 1.940   15.919  0.404   1.00 0.00 ? 284 VAL A HG23 4 
ATOM   4395 N N    . LYS A 1 14 ? 0.601   13.453  4.642   1.00 0.00 ? 285 LYS A N    4 
ATOM   4396 C CA   . LYS A 1 14 ? 0.778   12.499  5.729   1.00 0.00 ? 285 LYS A CA   4 
ATOM   4397 C C    . LYS A 1 14 ? -0.199  11.338  5.541   1.00 0.00 ? 285 LYS A C    4 
ATOM   4398 O O    . LYS A 1 14 ? 0.156   10.186  5.690   1.00 0.00 ? 285 LYS A O    4 
ATOM   4399 C CB   . LYS A 1 14 ? 0.501   13.192  7.066   1.00 0.00 ? 285 LYS A CB   4 
ATOM   4400 C CG   . LYS A 1 14 ? 1.793   13.255  7.886   1.00 0.00 ? 285 LYS A CG   4 
ATOM   4401 C CD   . LYS A 1 14 ? 2.880   13.961  7.073   1.00 0.00 ? 285 LYS A CD   4 
ATOM   4402 C CE   . LYS A 1 14 ? 4.227   13.283  7.326   1.00 0.00 ? 285 LYS A CE   4 
ATOM   4403 N NZ   . LYS A 1 14 ? 5.251   14.316  7.653   1.00 0.00 ? 285 LYS A NZ   4 
ATOM   4404 H H    . LYS A 1 14 ? 0.414   14.394  4.842   1.00 0.00 ? 285 LYS A H    4 
ATOM   4405 H HA   . LYS A 1 14 ? 1.789   12.126  5.721   1.00 0.00 ? 285 LYS A HA   4 
ATOM   4406 H HB2  . LYS A 1 14 ? 0.141   14.194  6.885   1.00 0.00 ? 285 LYS A HB2  4 
ATOM   4407 H HB3  . LYS A 1 14 ? -0.242  12.634  7.614   1.00 0.00 ? 285 LYS A HB3  4 
ATOM   4408 H HG2  . LYS A 1 14 ? 1.612   13.802  8.800   1.00 0.00 ? 285 LYS A HG2  4 
ATOM   4409 H HG3  . LYS A 1 14 ? 2.117   12.253  8.124   1.00 0.00 ? 285 LYS A HG3  4 
ATOM   4410 H HD2  . LYS A 1 14 ? 2.638   13.904  6.023   1.00 0.00 ? 285 LYS A HD2  4 
ATOM   4411 H HD3  . LYS A 1 14 ? 2.939   14.997  7.372   1.00 0.00 ? 285 LYS A HD3  4 
ATOM   4412 H HE2  . LYS A 1 14 ? 4.134   12.593  8.152   1.00 0.00 ? 285 LYS A HE2  4 
ATOM   4413 H HE3  . LYS A 1 14 ? 4.531   12.743  6.440   1.00 0.00 ? 285 LYS A HE3  4 
ATOM   4414 H HZ1  . LYS A 1 14 ? 5.072   15.171  7.089   1.00 0.00 ? 285 LYS A HZ1  4 
ATOM   4415 H HZ2  . LYS A 1 14 ? 5.196   14.549  8.666   1.00 0.00 ? 285 LYS A HZ2  4 
ATOM   4416 H HZ3  . LYS A 1 14 ? 6.199   13.949  7.433   1.00 0.00 ? 285 LYS A HZ3  4 
ATOM   4417 N N    . THR A 1 15 ? -1.427  11.631  5.208   1.00 0.00 ? 286 THR A N    4 
ATOM   4418 C CA   . THR A 1 15 ? -2.399  10.566  5.007   1.00 0.00 ? 286 THR A CA   4 
ATOM   4419 C C    . THR A 1 15 ? -1.864  9.595   3.952   1.00 0.00 ? 286 THR A C    4 
ATOM   4420 O O    . THR A 1 15 ? -1.918  8.392   4.114   1.00 0.00 ? 286 THR A O    4 
ATOM   4421 C CB   . THR A 1 15 ? -3.725  11.164  4.531   1.00 0.00 ? 286 THR A CB   4 
ATOM   4422 O OG1  . THR A 1 15 ? -4.293  11.945  5.573   1.00 0.00 ? 286 THR A OG1  4 
ATOM   4423 C CG2  . THR A 1 15 ? -4.689  10.039  4.150   1.00 0.00 ? 286 THR A CG2  4 
ATOM   4424 H H    . THR A 1 15 ? -1.692  12.566  5.089   1.00 0.00 ? 286 THR A H    4 
ATOM   4425 H HA   . THR A 1 15 ? -2.557  10.039  5.937   1.00 0.00 ? 286 THR A HA   4 
ATOM   4426 H HB   . THR A 1 15 ? -3.549  11.788  3.666   1.00 0.00 ? 286 THR A HB   4 
ATOM   4427 H HG1  . THR A 1 15 ? -4.953  12.523  5.184   1.00 0.00 ? 286 THR A HG1  4 
ATOM   4428 H HG21 . THR A 1 15 ? -4.373  9.120   4.619   1.00 0.00 ? 286 THR A HG21 4 
ATOM   4429 H HG22 . THR A 1 15 ? -5.684  10.290  4.484   1.00 0.00 ? 286 THR A HG22 4 
ATOM   4430 H HG23 . THR A 1 15 ? -4.690  9.912   3.076   1.00 0.00 ? 286 THR A HG23 4 
ATOM   4431 N N    . LEU A 1 16 ? -1.340  10.113  2.874   1.00 0.00 ? 287 LEU A N    4 
ATOM   4432 C CA   . LEU A 1 16 ? -0.805  9.243   1.835   1.00 0.00 ? 287 LEU A CA   4 
ATOM   4433 C C    . LEU A 1 16 ? 0.305   8.377   2.432   1.00 0.00 ? 287 LEU A C    4 
ATOM   4434 O O    . LEU A 1 16 ? 0.280   7.166   2.338   1.00 0.00 ? 287 LEU A O    4 
ATOM   4435 C CB   . LEU A 1 16 ? -0.231  10.095  0.700   1.00 0.00 ? 287 LEU A CB   4 
ATOM   4436 C CG   . LEU A 1 16 ? -1.240  10.168  -0.447  1.00 0.00 ? 287 LEU A CG   4 
ATOM   4437 C CD1  . LEU A 1 16 ? -0.848  11.298  -1.400  1.00 0.00 ? 287 LEU A CD1  4 
ATOM   4438 C CD2  . LEU A 1 16 ? -1.240  8.840   -1.208  1.00 0.00 ? 287 LEU A CD2  4 
ATOM   4439 H H    . LEU A 1 16 ? -1.302  11.086  2.766   1.00 0.00 ? 287 LEU A H    4 
ATOM   4440 H HA   . LEU A 1 16 ? -1.591  8.611   1.450   1.00 0.00 ? 287 LEU A HA   4 
ATOM   4441 H HB2  . LEU A 1 16 ? -0.029  11.093  1.065   1.00 0.00 ? 287 LEU A HB2  4 
ATOM   4442 H HB3  . LEU A 1 16 ? 0.685   9.650   0.343   1.00 0.00 ? 287 LEU A HB3  4 
ATOM   4443 H HG   . LEU A 1 16 ? -2.227  10.357  -0.049  1.00 0.00 ? 287 LEU A HG   4 
ATOM   4444 H HD11 . LEU A 1 16 ? -0.312  12.059  -0.853  1.00 0.00 ? 287 LEU A HD11 4 
ATOM   4445 H HD12 . LEU A 1 16 ? -0.217  10.906  -2.183  1.00 0.00 ? 287 LEU A HD12 4 
ATOM   4446 H HD13 . LEU A 1 16 ? -1.739  11.728  -1.835  1.00 0.00 ? 287 LEU A HD13 4 
ATOM   4447 H HD21 . LEU A 1 16 ? -0.705  8.097   -0.636  1.00 0.00 ? 287 LEU A HD21 4 
ATOM   4448 H HD22 . LEU A 1 16 ? -2.258  8.513   -1.360  1.00 0.00 ? 287 LEU A HD22 4 
ATOM   4449 H HD23 . LEU A 1 16 ? -0.759  8.972   -2.165  1.00 0.00 ? 287 LEU A HD23 4 
ATOM   4450 N N    . LYS A 1 17 ? 1.278   8.990   3.050   1.00 0.00 ? 288 LYS A N    4 
ATOM   4451 C CA   . LYS A 1 17 ? 2.362   8.222   3.645   1.00 0.00 ? 288 LYS A CA   4 
ATOM   4452 C C    . LYS A 1 17 ? 1.774   7.071   4.461   1.00 0.00 ? 288 LYS A C    4 
ATOM   4453 O O    . LYS A 1 17 ? 2.240   5.951   4.404   1.00 0.00 ? 288 LYS A O    4 
ATOM   4454 C CB   . LYS A 1 17 ? 3.191   9.127   4.559   1.00 0.00 ? 288 LYS A CB   4 
ATOM   4455 C CG   . LYS A 1 17 ? 4.620   9.224   4.025   1.00 0.00 ? 288 LYS A CG   4 
ATOM   4456 C CD   . LYS A 1 17 ? 4.687   10.299  2.938   1.00 0.00 ? 288 LYS A CD   4 
ATOM   4457 C CE   . LYS A 1 17 ? 5.199   11.606  3.543   1.00 0.00 ? 288 LYS A CE   4 
ATOM   4458 N NZ   . LYS A 1 17 ? 6.578   11.876  3.047   1.00 0.00 ? 288 LYS A NZ   4 
ATOM   4459 H H    . LYS A 1 17 ? 1.276   9.968   3.117   1.00 0.00 ? 288 LYS A H    4 
ATOM   4460 H HA   . LYS A 1 17 ? 2.994   7.825   2.865   1.00 0.00 ? 288 LYS A HA   4 
ATOM   4461 H HB2  . LYS A 1 17 ? 2.747   10.113  4.584   1.00 0.00 ? 288 LYS A HB2  4 
ATOM   4462 H HB3  . LYS A 1 17 ? 3.208   8.713   5.556   1.00 0.00 ? 288 LYS A HB3  4 
ATOM   4463 H HG2  . LYS A 1 17 ? 5.290   9.484   4.831   1.00 0.00 ? 288 LYS A HG2  4 
ATOM   4464 H HG3  . LYS A 1 17 ? 4.913   8.272   3.605   1.00 0.00 ? 288 LYS A HG3  4 
ATOM   4465 H HD2  . LYS A 1 17 ? 5.357   9.976   2.153   1.00 0.00 ? 288 LYS A HD2  4 
ATOM   4466 H HD3  . LYS A 1 17 ? 3.702   10.456  2.526   1.00 0.00 ? 288 LYS A HD3  4 
ATOM   4467 H HE2  . LYS A 1 17 ? 4.548   12.417  3.255   1.00 0.00 ? 288 LYS A HE2  4 
ATOM   4468 H HE3  . LYS A 1 17 ? 5.215   11.522  4.620   1.00 0.00 ? 288 LYS A HE3  4 
ATOM   4469 H HZ1  . LYS A 1 17 ? 6.709   11.426  2.119   1.00 0.00 ? 288 LYS A HZ1  4 
ATOM   4470 H HZ2  . LYS A 1 17 ? 6.719   12.904  2.957   1.00 0.00 ? 288 LYS A HZ2  4 
ATOM   4471 H HZ3  . LYS A 1 17 ? 7.271   11.489  3.718   1.00 0.00 ? 288 LYS A HZ3  4 
ATOM   4472 N N    . ALA A 1 18 ? 0.746   7.337   5.220   1.00 0.00 ? 289 ALA A N    4 
ATOM   4473 C CA   . ALA A 1 18 ? 0.137   6.280   6.020   1.00 0.00 ? 289 ALA A CA   4 
ATOM   4474 C C    . ALA A 1 18 ? -0.225  5.108   5.111   1.00 0.00 ? 289 ALA A C    4 
ATOM   4475 O O    . ALA A 1 18 ? 0.266   4.009   5.270   1.00 0.00 ? 289 ALA A O    4 
ATOM   4476 C CB   . ALA A 1 18 ? -1.132  6.807   6.687   1.00 0.00 ? 289 ALA A CB   4 
ATOM   4477 H H    . ALA A 1 18 ? 0.382   8.246   5.252   1.00 0.00 ? 289 ALA A H    4 
ATOM   4478 H HA   . ALA A 1 18 ? 0.833   5.951   6.776   1.00 0.00 ? 289 ALA A HA   4 
ATOM   4479 H HB1  . ALA A 1 18 ? -1.257  7.853   6.449   1.00 0.00 ? 289 ALA A HB1  4 
ATOM   4480 H HB2  . ALA A 1 18 ? -1.985  6.251   6.326   1.00 0.00 ? 289 ALA A HB2  4 
ATOM   4481 H HB3  . ALA A 1 18 ? -1.051  6.689   7.758   1.00 0.00 ? 289 ALA A HB3  4 
ATOM   4482 N N    . GLN A 1 19 ? -1.086  5.335   4.156   1.00 0.00 ? 290 GLN A N    4 
ATOM   4483 C CA   . GLN A 1 19 ? -1.472  4.258   3.257   1.00 0.00 ? 290 GLN A CA   4 
ATOM   4484 C C    . GLN A 1 19 ? -0.217  3.545   2.751   1.00 0.00 ? 290 GLN A C    4 
ATOM   4485 O O    . GLN A 1 19 ? -0.200  2.343   2.580   1.00 0.00 ? 290 GLN A O    4 
ATOM   4486 C CB   . GLN A 1 19 ? -2.250  4.831   2.071   1.00 0.00 ? 290 GLN A CB   4 
ATOM   4487 C CG   . GLN A 1 19 ? -3.579  5.410   2.559   1.00 0.00 ? 290 GLN A CG   4 
ATOM   4488 C CD   . GLN A 1 19 ? -4.318  6.055   1.385   1.00 0.00 ? 290 GLN A CD   4 
ATOM   4489 O OE1  . GLN A 1 19 ? -4.680  7.214   1.443   1.00 0.00 ? 290 GLN A OE1  4 
ATOM   4490 N NE2  . GLN A 1 19 ? -4.559  5.348   0.316   1.00 0.00 ? 290 GLN A NE2  4 
ATOM   4491 H H    . GLN A 1 19 ? -1.472  6.230   4.045   1.00 0.00 ? 290 GLN A H    4 
ATOM   4492 H HA   . GLN A 1 19 ? -2.098  3.556   3.789   1.00 0.00 ? 290 GLN A HA   4 
ATOM   4493 H HB2  . GLN A 1 19 ? -1.666  5.610   1.603   1.00 0.00 ? 290 GLN A HB2  4 
ATOM   4494 H HB3  . GLN A 1 19 ? -2.442  4.047   1.354   1.00 0.00 ? 290 GLN A HB3  4 
ATOM   4495 H HG2  . GLN A 1 19 ? -4.185  4.617   2.975   1.00 0.00 ? 290 GLN A HG2  4 
ATOM   4496 H HG3  . GLN A 1 19 ? -3.391  6.156   3.317   1.00 0.00 ? 290 GLN A HG3  4 
ATOM   4497 H HE21 . GLN A 1 19 ? -4.268  4.413   0.269   1.00 0.00 ? 290 GLN A HE21 4 
ATOM   4498 H HE22 . GLN A 1 19 ? -5.031  5.752   -0.442  1.00 0.00 ? 290 GLN A HE22 4 
ATOM   4499 N N    . ASN A 1 20 ? 0.838   4.278   2.513   1.00 0.00 ? 291 ASN A N    4 
ATOM   4500 C CA   . ASN A 1 20 ? 2.062   3.652   2.032   1.00 0.00 ? 291 ASN A CA   4 
ATOM   4501 C C    . ASN A 1 20 ? 2.541   2.628   3.063   1.00 0.00 ? 291 ASN A C    4 
ATOM   4502 O O    . ASN A 1 20 ? 2.902   1.518   2.728   1.00 0.00 ? 291 ASN A O    4 
ATOM   4503 C CB   . ASN A 1 20 ? 3.140   4.719   1.832   1.00 0.00 ? 291 ASN A CB   4 
ATOM   4504 C CG   . ASN A 1 20 ? 4.230   4.176   0.904   1.00 0.00 ? 291 ASN A CG   4 
ATOM   4505 O OD1  . ASN A 1 20 ? 5.175   3.560   1.352   1.00 0.00 ? 291 ASN A OD1  4 
ATOM   4506 N ND2  . ASN A 1 20 ? 4.136   4.381   -0.382  1.00 0.00 ? 291 ASN A ND2  4 
ATOM   4507 H H    . ASN A 1 20 ? 0.805   5.247   2.658   1.00 0.00 ? 291 ASN A H    4 
ATOM   4508 H HA   . ASN A 1 20 ? 1.871   3.155   1.095   1.00 0.00 ? 291 ASN A HA   4 
ATOM   4509 H HB2  . ASN A 1 20 ? 2.697   5.599   1.391   1.00 0.00 ? 291 ASN A HB2  4 
ATOM   4510 H HB3  . ASN A 1 20 ? 3.578   4.975   2.786   1.00 0.00 ? 291 ASN A HB3  4 
ATOM   4511 H HD21 . ASN A 1 20 ? 3.374   4.879   -0.744  1.00 0.00 ? 291 ASN A HD21 4 
ATOM   4512 H HD22 . ASN A 1 20 ? 4.827   4.038   -0.984  1.00 0.00 ? 291 ASN A HD22 4 
ATOM   4513 N N    . SER A 1 21 ? 2.537   2.991   4.316   1.00 0.00 ? 292 SER A N    4 
ATOM   4514 C CA   . SER A 1 21 ? 2.973   2.056   5.346   1.00 0.00 ? 292 SER A CA   4 
ATOM   4515 C C    . SER A 1 21 ? 1.982   0.892   5.411   1.00 0.00 ? 292 SER A C    4 
ATOM   4516 O O    . SER A 1 21 ? 2.333   -0.222  5.745   1.00 0.00 ? 292 SER A O    4 
ATOM   4517 C CB   . SER A 1 21 ? 3.017   2.766   6.698   1.00 0.00 ? 292 SER A CB   4 
ATOM   4518 O OG   . SER A 1 21 ? 4.331   3.258   6.928   1.00 0.00 ? 292 SER A OG   4 
ATOM   4519 H H    . SER A 1 21 ? 2.237   3.890   4.567   1.00 0.00 ? 292 SER A H    4 
ATOM   4520 H HA   . SER A 1 21 ? 3.955   1.680   5.102   1.00 0.00 ? 292 SER A HA   4 
ATOM   4521 H HB2  . SER A 1 21 ? 2.327   3.593   6.696   1.00 0.00 ? 292 SER A HB2  4 
ATOM   4522 H HB3  . SER A 1 21 ? 2.740   2.071   7.479   1.00 0.00 ? 292 SER A HB3  4 
ATOM   4523 H HG   . SER A 1 21 ? 4.325   3.746   7.755   1.00 0.00 ? 292 SER A HG   4 
ATOM   4524 N N    . GLU A 1 22 ? 0.741   1.146   5.093   1.00 0.00 ? 293 GLU A N    4 
ATOM   4525 C CA   . GLU A 1 22 ? -0.258  0.084   5.131   1.00 0.00 ? 293 GLU A CA   4 
ATOM   4526 C C    . GLU A 1 22 ? 0.003   -0.896  3.987   1.00 0.00 ? 293 GLU A C    4 
ATOM   4527 O O    . GLU A 1 22 ? 0.073   -2.093  4.183   1.00 0.00 ? 293 GLU A O    4 
ATOM   4528 C CB   . GLU A 1 22 ? -1.652  0.692   4.972   1.00 0.00 ? 293 GLU A CB   4 
ATOM   4529 C CG   . GLU A 1 22 ? -2.086  1.327   6.296   1.00 0.00 ? 293 GLU A CG   4 
ATOM   4530 C CD   . GLU A 1 22 ? -3.611  1.287   6.405   1.00 0.00 ? 293 GLU A CD   4 
ATOM   4531 O OE1  . GLU A 1 22 ? -4.254  1.117   5.382   1.00 0.00 ? 293 GLU A OE1  4 
ATOM   4532 O OE2  . GLU A 1 22 ? -4.112  1.428   7.509   1.00 0.00 ? 293 GLU A OE2  4 
ATOM   4533 H H    . GLU A 1 22 ? 0.481   2.051   4.824   1.00 0.00 ? 293 GLU A H    4 
ATOM   4534 H HA   . GLU A 1 22 ? -0.197  -0.436  6.074   1.00 0.00 ? 293 GLU A HA   4 
ATOM   4535 H HB2  . GLU A 1 22 ? -1.629  1.449   4.200   1.00 0.00 ? 293 GLU A HB2  4 
ATOM   4536 H HB3  . GLU A 1 22 ? -2.353  -0.081  4.698   1.00 0.00 ? 293 GLU A HB3  4 
ATOM   4537 H HG2  . GLU A 1 22 ? -1.652  0.775   7.119   1.00 0.00 ? 293 GLU A HG2  4 
ATOM   4538 H HG3  . GLU A 1 22 ? -1.751  2.351   6.332   1.00 0.00 ? 293 GLU A HG3  4 
ATOM   4539 N N    . LEU A 1 23 ? 0.147   -0.397  2.789   1.00 0.00 ? 294 LEU A N    4 
ATOM   4540 C CA   . LEU A 1 23 ? 0.395   -1.278  1.655   1.00 0.00 ? 294 LEU A CA   4 
ATOM   4541 C C    . LEU A 1 23 ? 1.751   -1.969  1.835   1.00 0.00 ? 294 LEU A C    4 
ATOM   4542 O O    . LEU A 1 23 ? 1.909   -3.134  1.528   1.00 0.00 ? 294 LEU A O    4 
ATOM   4543 C CB   . LEU A 1 23 ? 0.409   -0.457  0.366   1.00 0.00 ? 294 LEU A CB   4 
ATOM   4544 C CG   . LEU A 1 23 ? -0.945  -0.578  -0.333  1.00 0.00 ? 294 LEU A CG   4 
ATOM   4545 C CD1  . LEU A 1 23 ? -1.353  0.785   -0.900  1.00 0.00 ? 294 LEU A CD1  4 
ATOM   4546 C CD2  . LEU A 1 23 ? -0.842  -1.592  -1.475  1.00 0.00 ? 294 LEU A CD2  4 
ATOM   4547 H H    . LEU A 1 23 ? 0.086   0.571   2.652   1.00 0.00 ? 294 LEU A H    4 
ATOM   4548 H HA   . LEU A 1 23 ? -0.384  -2.022  1.598   1.00 0.00 ? 294 LEU A HA   4 
ATOM   4549 H HB2  . LEU A 1 23 ? 0.601   0.580   0.601   1.00 0.00 ? 294 LEU A HB2  4 
ATOM   4550 H HB3  . LEU A 1 23 ? 1.183   -0.826  -0.289  1.00 0.00 ? 294 LEU A HB3  4 
ATOM   4551 H HG   . LEU A 1 23 ? -1.690  -0.908  0.377   1.00 0.00 ? 294 LEU A HG   4 
ATOM   4552 H HD11 . LEU A 1 23 ? -0.490  1.265   -1.337  1.00 0.00 ? 294 LEU A HD11 4 
ATOM   4553 H HD12 . LEU A 1 23 ? -2.110  0.647   -1.659  1.00 0.00 ? 294 LEU A HD12 4 
ATOM   4554 H HD13 . LEU A 1 23 ? -1.746  1.401   -0.106  1.00 0.00 ? 294 LEU A HD13 4 
ATOM   4555 H HD21 . LEU A 1 23 ? 0.108   -1.475  -1.975  1.00 0.00 ? 294 LEU A HD21 4 
ATOM   4556 H HD22 . LEU A 1 23 ? -0.917  -2.593  -1.076  1.00 0.00 ? 294 LEU A HD22 4 
ATOM   4557 H HD23 . LEU A 1 23 ? -1.641  -1.425  -2.181  1.00 0.00 ? 294 LEU A HD23 4 
ATOM   4558 N N    . ALA A 1 24 ? 2.727   -1.259  2.327   1.00 0.00 ? 295 ALA A N    4 
ATOM   4559 C CA   . ALA A 1 24 ? 4.042   -1.861  2.522   1.00 0.00 ? 295 ALA A CA   4 
ATOM   4560 C C    . ALA A 1 24 ? 3.936   -2.995  3.544   1.00 0.00 ? 295 ALA A C    4 
ATOM   4561 O O    . ALA A 1 24 ? 4.446   -4.079  3.339   1.00 0.00 ? 295 ALA A O    4 
ATOM   4562 C CB   . ALA A 1 24 ? 5.020   -0.801  3.032   1.00 0.00 ? 295 ALA A CB   4 
ATOM   4563 H H    . ALA A 1 24 ? 2.578   -0.321  2.569   1.00 0.00 ? 295 ALA A H    4 
ATOM   4564 H HA   . ALA A 1 24 ? 4.400   -2.255  1.582   1.00 0.00 ? 295 ALA A HA   4 
ATOM   4565 H HB1  . ALA A 1 24 ? 4.466   0.026   3.454   1.00 0.00 ? 295 ALA A HB1  4 
ATOM   4566 H HB2  . ALA A 1 24 ? 5.655   -1.232  3.791   1.00 0.00 ? 295 ALA A HB2  4 
ATOM   4567 H HB3  . ALA A 1 24 ? 5.626   -0.447  2.213   1.00 0.00 ? 295 ALA A HB3  4 
ATOM   4568 N N    . SER A 1 25 ? 3.280   -2.752  4.645   1.00 0.00 ? 296 SER A N    4 
ATOM   4569 C CA   . SER A 1 25 ? 3.145   -3.792  5.660   1.00 0.00 ? 296 SER A CA   4 
ATOM   4570 C C    . SER A 1 25 ? 2.337   -4.961  5.090   1.00 0.00 ? 296 SER A C    4 
ATOM   4571 O O    . SER A 1 25 ? 2.723   -6.107  5.197   1.00 0.00 ? 296 SER A O    4 
ATOM   4572 C CB   . SER A 1 25 ? 2.425   -3.223  6.881   1.00 0.00 ? 296 SER A CB   4 
ATOM   4573 O OG   . SER A 1 25 ? 2.785   -3.975  8.033   1.00 0.00 ? 296 SER A OG   4 
ATOM   4574 H H    . SER A 1 25 ? 2.877   -1.870  4.792   1.00 0.00 ? 296 SER A H    4 
ATOM   4575 H HA   . SER A 1 25 ? 4.126   -4.140  5.951   1.00 0.00 ? 296 SER A HA   4 
ATOM   4576 H HB2  . SER A 1 25 ? 2.714   -2.196  7.025   1.00 0.00 ? 296 SER A HB2  4 
ATOM   4577 H HB3  . SER A 1 25 ? 1.355   -3.275  6.724   1.00 0.00 ? 296 SER A HB3  4 
ATOM   4578 H HG   . SER A 1 25 ? 2.029   -3.991  8.625   1.00 0.00 ? 296 SER A HG   4 
ATOM   4579 N N    . THR A 1 26 ? 1.216   -4.676  4.485   1.00 0.00 ? 297 THR A N    4 
ATOM   4580 C CA   . THR A 1 26 ? 0.396   -5.744  3.924   1.00 0.00 ? 297 THR A CA   4 
ATOM   4581 C C    . THR A 1 26 ? 1.222   -6.552  2.919   1.00 0.00 ? 297 THR A C    4 
ATOM   4582 O O    . THR A 1 26 ? 1.310   -7.761  3.004   1.00 0.00 ? 297 THR A O    4 
ATOM   4583 C CB   . THR A 1 26 ? -0.817  -5.137  3.217   1.00 0.00 ? 297 THR A CB   4 
ATOM   4584 O OG1  . THR A 1 26 ? -1.530  -4.312  4.129   1.00 0.00 ? 297 THR A OG1  4 
ATOM   4585 C CG2  . THR A 1 26 ? -1.731  -6.254  2.715   1.00 0.00 ? 297 THR A CG2  4 
ATOM   4586 H H    . THR A 1 26 ? 0.923   -3.745  4.412   1.00 0.00 ? 297 THR A H    4 
ATOM   4587 H HA   . THR A 1 26 ? 0.061   -6.394  4.717   1.00 0.00 ? 297 THR A HA   4 
ATOM   4588 H HB   . THR A 1 26 ? -0.487  -4.543  2.378   1.00 0.00 ? 297 THR A HB   4 
ATOM   4589 H HG1  . THR A 1 26 ? -1.184  -3.420  4.056   1.00 0.00 ? 297 THR A HG1  4 
ATOM   4590 H HG21 . THR A 1 26 ? -1.253  -7.210  2.875   1.00 0.00 ? 297 THR A HG21 4 
ATOM   4591 H HG22 . THR A 1 26 ? -2.667  -6.224  3.254   1.00 0.00 ? 297 THR A HG22 4 
ATOM   4592 H HG23 . THR A 1 26 ? -1.919  -6.119  1.659   1.00 0.00 ? 297 THR A HG23 4 
ATOM   4593 N N    . ALA A 1 27 ? 1.826   -5.896  1.967   1.00 0.00 ? 298 ALA A N    4 
ATOM   4594 C CA   . ALA A 1 27 ? 2.624   -6.614  0.978   1.00 0.00 ? 298 ALA A CA   4 
ATOM   4595 C C    . ALA A 1 27 ? 3.591   -7.561  1.692   1.00 0.00 ? 298 ALA A C    4 
ATOM   4596 O O    . ALA A 1 27 ? 3.630   -8.744  1.418   1.00 0.00 ? 298 ALA A O    4 
ATOM   4597 C CB   . ALA A 1 27 ? 3.416   -5.611  0.139   1.00 0.00 ? 298 ALA A CB   4 
ATOM   4598 H H    . ALA A 1 27 ? 1.742   -4.921  1.915   1.00 0.00 ? 298 ALA A H    4 
ATOM   4599 H HA   . ALA A 1 27 ? 1.971   -7.183  0.335   1.00 0.00 ? 298 ALA A HA   4 
ATOM   4600 H HB1  . ALA A 1 27 ? 3.145   -4.607  0.428   1.00 0.00 ? 298 ALA A HB1  4 
ATOM   4601 H HB2  . ALA A 1 27 ? 4.473   -5.762  0.303   1.00 0.00 ? 298 ALA A HB2  4 
ATOM   4602 H HB3  . ALA A 1 27 ? 3.188   -5.758  -0.907  1.00 0.00 ? 298 ALA A HB3  4 
ATOM   4603 N N    . ASN A 1 28 ? 4.375   -7.051  2.601   1.00 0.00 ? 299 ASN A N    4 
ATOM   4604 C CA   . ASN A 1 28 ? 5.319   -7.905  3.313   1.00 0.00 ? 299 ASN A CA   4 
ATOM   4605 C C    . ASN A 1 28 ? 4.572   -9.090  3.929   1.00 0.00 ? 299 ASN A C    4 
ATOM   4606 O O    . ASN A 1 28 ? 5.074   -10.195 3.976   1.00 0.00 ? 299 ASN A O    4 
ATOM   4607 C CB   . ASN A 1 28 ? 6.003   -7.101  4.420   1.00 0.00 ? 299 ASN A CB   4 
ATOM   4608 C CG   . ASN A 1 28 ? 7.231   -6.388  3.849   1.00 0.00 ? 299 ASN A CG   4 
ATOM   4609 O OD1  . ASN A 1 28 ? 7.327   -6.183  2.657   1.00 0.00 ? 299 ASN A OD1  4 
ATOM   4610 N ND2  . ASN A 1 28 ? 8.180   -6.001  4.657   1.00 0.00 ? 299 ASN A ND2  4 
ATOM   4611 H H    . ASN A 1 28 ? 4.330   -6.094  2.807   1.00 0.00 ? 299 ASN A H    4 
ATOM   4612 H HA   . ASN A 1 28 ? 6.066   -8.271  2.622   1.00 0.00 ? 299 ASN A HA   4 
ATOM   4613 H HB2  . ASN A 1 28 ? 5.311   -6.369  4.814   1.00 0.00 ? 299 ASN A HB2  4 
ATOM   4614 H HB3  . ASN A 1 28 ? 6.311   -7.766  5.213   1.00 0.00 ? 299 ASN A HB3  4 
ATOM   4615 H HD21 . ASN A 1 28 ? 8.102   -6.168  5.620   1.00 0.00 ? 299 ASN A HD21 4 
ATOM   4616 H HD22 . ASN A 1 28 ? 8.968   -5.543  4.301   1.00 0.00 ? 299 ASN A HD22 4 
ATOM   4617 N N    . MET A 1 29 ? 3.378   -8.868  4.403   1.00 0.00 ? 300 MET A N    4 
ATOM   4618 C CA   . MET A 1 29 ? 2.616   -9.959  5.002   1.00 0.00 ? 300 MET A CA   4 
ATOM   4619 C C    . MET A 1 29 ? 2.383   -11.053 3.959   1.00 0.00 ? 300 MET A C    4 
ATOM   4620 O O    . MET A 1 29 ? 2.496   -12.229 4.243   1.00 0.00 ? 300 MET A O    4 
ATOM   4621 C CB   . MET A 1 29 ? 1.268   -9.430  5.496   1.00 0.00 ? 300 MET A CB   4 
ATOM   4622 C CG   . MET A 1 29 ? 1.181   -9.589  7.015   1.00 0.00 ? 300 MET A CG   4 
ATOM   4623 S SD   . MET A 1 29 ? -0.169  -8.567  7.653   1.00 0.00 ? 300 MET A SD   4 
ATOM   4624 C CE   . MET A 1 29 ? -1.397  -9.887  7.813   1.00 0.00 ? 300 MET A CE   4 
ATOM   4625 H H    . MET A 1 29 ? 2.990   -7.969  4.356   1.00 0.00 ? 300 MET A H    4 
ATOM   4626 H HA   . MET A 1 29 ? 3.168   -10.368 5.837   1.00 0.00 ? 300 MET A HA   4 
ATOM   4627 H HB2  . MET A 1 29 ? 1.176   -8.384  5.238   1.00 0.00 ? 300 MET A HB2  4 
ATOM   4628 H HB3  . MET A 1 29 ? 0.470   -9.987  5.034   1.00 0.00 ? 300 MET A HB3  4 
ATOM   4629 H HG2  . MET A 1 29 ? 0.996   -10.625 7.260   1.00 0.00 ? 300 MET A HG2  4 
ATOM   4630 H HG3  . MET A 1 29 ? 2.114   -9.275  7.464   1.00 0.00 ? 300 MET A HG3  4 
ATOM   4631 H HE1  . MET A 1 29 ? -0.936  -10.837 7.578   1.00 0.00 ? 300 MET A HE1  4 
ATOM   4632 H HE2  . MET A 1 29 ? -1.775  -9.904  8.824   1.00 0.00 ? 300 MET A HE2  4 
ATOM   4633 H HE3  . MET A 1 29 ? -2.212  -9.707  7.129   1.00 0.00 ? 300 MET A HE3  4 
ATOM   4634 N N    . LEU A 1 30 ? 2.054   -10.675 2.753   1.00 0.00 ? 301 LEU A N    4 
ATOM   4635 C CA   . LEU A 1 30 ? 1.816   -11.670 1.714   1.00 0.00 ? 301 LEU A CA   4 
ATOM   4636 C C    . LEU A 1 30 ? 3.137   -12.345 1.336   1.00 0.00 ? 301 LEU A C    4 
ATOM   4637 O O    . LEU A 1 30 ? 3.156   -13.451 0.831   1.00 0.00 ? 301 LEU A O    4 
ATOM   4638 C CB   . LEU A 1 30 ? 1.222   -10.989 0.480   1.00 0.00 ? 301 LEU A CB   4 
ATOM   4639 C CG   . LEU A 1 30 ? -0.007  -10.175 0.885   1.00 0.00 ? 301 LEU A CG   4 
ATOM   4640 C CD1  . LEU A 1 30 ? -0.459  -9.313  -0.296  1.00 0.00 ? 301 LEU A CD1  4 
ATOM   4641 C CD2  . LEU A 1 30 ? -1.139  -11.126 1.282   1.00 0.00 ? 301 LEU A CD2  4 
ATOM   4642 H H    . LEU A 1 30 ? 1.968   -9.721  2.547   1.00 0.00 ? 301 LEU A H    4 
ATOM   4643 H HA   . LEU A 1 30 ? 1.124   -12.413 2.081   1.00 0.00 ? 301 LEU A HA   4 
ATOM   4644 H HB2  . LEU A 1 30 ? 1.961   -10.334 0.042   1.00 0.00 ? 301 LEU A HB2  4 
ATOM   4645 H HB3  . LEU A 1 30 ? 0.934   -11.739 -0.241  1.00 0.00 ? 301 LEU A HB3  4 
ATOM   4646 H HG   . LEU A 1 30 ? 0.242   -9.539  1.721   1.00 0.00 ? 301 LEU A HG   4 
ATOM   4647 H HD11 . LEU A 1 30 ? 0.311   -9.308  -1.053  1.00 0.00 ? 301 LEU A HD11 4 
ATOM   4648 H HD12 . LEU A 1 30 ? -1.370  -9.719  -0.710  1.00 0.00 ? 301 LEU A HD12 4 
ATOM   4649 H HD13 . LEU A 1 30 ? -0.637  -8.303  0.044   1.00 0.00 ? 301 LEU A HD13 4 
ATOM   4650 H HD21 . LEU A 1 30 ? -1.076  -12.028 0.690   1.00 0.00 ? 301 LEU A HD21 4 
ATOM   4651 H HD22 . LEU A 1 30 ? -1.048  -11.375 2.329   1.00 0.00 ? 301 LEU A HD22 4 
ATOM   4652 H HD23 . LEU A 1 30 ? -2.090  -10.647 1.108   1.00 0.00 ? 301 LEU A HD23 4 
ATOM   4653 N N    . ARG A 1 31 ? 4.240   -11.690 1.569   1.00 0.00 ? 302 ARG A N    4 
ATOM   4654 C CA   . ARG A 1 31 ? 5.527   -12.283 1.220   1.00 0.00 ? 302 ARG A CA   4 
ATOM   4655 C C    . ARG A 1 31 ? 5.948   -13.282 2.301   1.00 0.00 ? 302 ARG A C    4 
ATOM   4656 O O    . ARG A 1 31 ? 6.292   -14.412 2.016   1.00 0.00 ? 302 ARG A O    4 
ATOM   4657 C CB   . ARG A 1 31 ? 6.582   -11.183 1.108   1.00 0.00 ? 302 ARG A CB   4 
ATOM   4658 C CG   . ARG A 1 31 ? 7.145   -11.157 -0.314  1.00 0.00 ? 302 ARG A CG   4 
ATOM   4659 C CD   . ARG A 1 31 ? 8.650   -10.884 -0.263  1.00 0.00 ? 302 ARG A CD   4 
ATOM   4660 N NE   . ARG A 1 31 ? 9.329   -11.714 -1.250  1.00 0.00 ? 302 ARG A NE   4 
ATOM   4661 C CZ   . ARG A 1 31 ? 10.557  -11.441 -1.598  1.00 0.00 ? 302 ARG A CZ   4 
ATOM   4662 N NH1  . ARG A 1 31 ? 11.549  -11.820 -0.842  1.00 0.00 ? 302 ARG A NH1  4 
ATOM   4663 N NH2  . ARG A 1 31 ? 10.792  -10.792 -2.706  1.00 0.00 ? 302 ARG A NH2  4 
ATOM   4664 H H    . ARG A 1 31 ? 4.204   -10.798 1.972   1.00 0.00 ? 302 ARG A H    4 
ATOM   4665 H HA   . ARG A 1 31 ? 5.443   -12.794 0.273   1.00 0.00 ? 302 ARG A HA   4 
ATOM   4666 H HB2  . ARG A 1 31 ? 6.130   -10.227 1.333   1.00 0.00 ? 302 ARG A HB2  4 
ATOM   4667 H HB3  . ARG A 1 31 ? 7.380   -11.376 1.807   1.00 0.00 ? 302 ARG A HB3  4 
ATOM   4668 H HG2  . ARG A 1 31 ? 6.969   -12.112 -0.788  1.00 0.00 ? 302 ARG A HG2  4 
ATOM   4669 H HG3  . ARG A 1 31 ? 6.659   -10.378 -0.882  1.00 0.00 ? 302 ARG A HG3  4 
ATOM   4670 H HD2  . ARG A 1 31 ? 8.833   -9.842  -0.482  1.00 0.00 ? 302 ARG A HD2  4 
ATOM   4671 H HD3  . ARG A 1 31 ? 9.025   -11.116 0.723   1.00 0.00 ? 302 ARG A HD3  4 
ATOM   4672 H HE   . ARG A 1 31 ? 8.864   -12.478 -1.650  1.00 0.00 ? 302 ARG A HE   4 
ATOM   4673 H HH11 . ARG A 1 31 ? 11.369  -12.319 0.007   1.00 0.00 ? 302 ARG A HH11 4 
ATOM   4674 H HH12 . ARG A 1 31 ? 12.490  -11.611 -1.109  1.00 0.00 ? 302 ARG A HH12 4 
ATOM   4675 H HH21 . ARG A 1 31 ? 10.031  -10.502 -3.287  1.00 0.00 ? 302 ARG A HH21 4 
ATOM   4676 H HH22 . ARG A 1 31 ? 11.732  -10.583 -2.974  1.00 0.00 ? 302 ARG A HH22 4 
ATOM   4677 N N    . GLU A 1 32 ? 5.934   -12.874 3.541   1.00 0.00 ? 303 GLU A N    4 
ATOM   4678 C CA   . GLU A 1 32 ? 6.334   -13.781 4.612   1.00 0.00 ? 303 GLU A CA   4 
ATOM   4679 C C    . GLU A 1 32 ? 5.402   -14.997 4.635   1.00 0.00 ? 303 GLU A C    4 
ATOM   4680 O O    . GLU A 1 32 ? 5.801   -16.086 4.998   1.00 0.00 ? 303 GLU A O    4 
ATOM   4681 C CB   . GLU A 1 32 ? 6.256   -13.052 5.956   1.00 0.00 ? 303 GLU A CB   4 
ATOM   4682 C CG   . GLU A 1 32 ? 4.795   -12.749 6.293   1.00 0.00 ? 303 GLU A CG   4 
ATOM   4683 C CD   . GLU A 1 32 ? 4.730   -11.933 7.586   1.00 0.00 ? 303 GLU A CD   4 
ATOM   4684 O OE1  . GLU A 1 32 ? 5.728   -11.887 8.285   1.00 0.00 ? 303 GLU A OE1  4 
ATOM   4685 O OE2  . GLU A 1 32 ? 3.682   -11.371 7.854   1.00 0.00 ? 303 GLU A OE2  4 
ATOM   4686 H H    . GLU A 1 32 ? 5.659   -11.957 3.753   1.00 0.00 ? 303 GLU A H    4 
ATOM   4687 H HA   . GLU A 1 32 ? 7.348   -14.109 4.443   1.00 0.00 ? 303 GLU A HA   4 
ATOM   4688 H HB2  . GLU A 1 32 ? 6.685   -13.676 6.727   1.00 0.00 ? 303 GLU A HB2  4 
ATOM   4689 H HB3  . GLU A 1 32 ? 6.810   -12.127 5.895   1.00 0.00 ? 303 GLU A HB3  4 
ATOM   4690 H HG2  . GLU A 1 32 ? 4.350   -12.184 5.487   1.00 0.00 ? 303 GLU A HG2  4 
ATOM   4691 H HG3  . GLU A 1 32 ? 4.257   -13.675 6.426   1.00 0.00 ? 303 GLU A HG3  4 
ATOM   4692 N N    . GLN A 1 33 ? 4.167   -14.822 4.255   1.00 0.00 ? 304 GLN A N    4 
ATOM   4693 C CA   . GLN A 1 33 ? 3.241   -15.951 4.262   1.00 0.00 ? 304 GLN A CA   4 
ATOM   4694 C C    . GLN A 1 33 ? 3.498   -16.835 3.041   1.00 0.00 ? 304 GLN A C    4 
ATOM   4695 O O    . GLN A 1 33 ? 3.476   -18.047 3.126   1.00 0.00 ? 304 GLN A O    4 
ATOM   4696 C CB   . GLN A 1 33 ? 1.801   -15.435 4.233   1.00 0.00 ? 304 GLN A CB   4 
ATOM   4697 C CG   . GLN A 1 33 ? 1.501   -14.835 2.859   1.00 0.00 ? 304 GLN A CG   4 
ATOM   4698 C CD   . GLN A 1 33 ? 0.047   -14.355 2.817   1.00 0.00 ? 304 GLN A CD   4 
ATOM   4699 O OE1  . GLN A 1 33 ? -0.526  -14.211 1.755   1.00 0.00 ? 304 GLN A OE1  4 
ATOM   4700 N NE2  . GLN A 1 33 ? -0.578  -14.099 3.935   1.00 0.00 ? 304 GLN A NE2  4 
ATOM   4701 H H    . GLN A 1 33 ? 3.860   -13.937 3.965   1.00 0.00 ? 304 GLN A H    4 
ATOM   4702 H HA   . GLN A 1 33 ? 3.392   -16.530 5.161   1.00 0.00 ? 304 GLN A HA   4 
ATOM   4703 H HB2  . GLN A 1 33 ? 1.122   -16.252 4.427   1.00 0.00 ? 304 GLN A HB2  4 
ATOM   4704 H HB3  . GLN A 1 33 ? 1.677   -14.674 4.989   1.00 0.00 ? 304 GLN A HB3  4 
ATOM   4705 H HG2  . GLN A 1 33 ? 2.162   -14.001 2.677   1.00 0.00 ? 304 GLN A HG2  4 
ATOM   4706 H HG3  . GLN A 1 33 ? 1.651   -15.586 2.097   1.00 0.00 ? 304 GLN A HG3  4 
ATOM   4707 H HE21 . GLN A 1 33 ? -0.119  -14.217 4.791   1.00 0.00 ? 304 GLN A HE21 4 
ATOM   4708 H HE22 . GLN A 1 33 ? -1.508  -13.791 3.917   1.00 0.00 ? 304 GLN A HE22 4 
ATOM   4709 N N    . VAL A 1 34 ? 3.745   -16.243 1.904   1.00 0.00 ? 305 VAL A N    4 
ATOM   4710 C CA   . VAL A 1 34 ? 4.001   -17.041 0.711   1.00 0.00 ? 305 VAL A CA   4 
ATOM   4711 C C    . VAL A 1 34 ? 5.214   -17.940 0.957   1.00 0.00 ? 305 VAL A C    4 
ATOM   4712 O O    . VAL A 1 34 ? 5.172   -19.131 0.722   1.00 0.00 ? 305 VAL A O    4 
ATOM   4713 C CB   . VAL A 1 34 ? 4.282   -16.115 -0.474  1.00 0.00 ? 305 VAL A CB   4 
ATOM   4714 C CG1  . VAL A 1 34 ? 4.770   -16.941 -1.665  1.00 0.00 ? 305 VAL A CG1  4 
ATOM   4715 C CG2  . VAL A 1 34 ? 2.995   -15.380 -0.859  1.00 0.00 ? 305 VAL A CG2  4 
ATOM   4716 H H    . VAL A 1 34 ? 3.761   -15.265 1.855   1.00 0.00 ? 305 VAL A H    4 
ATOM   4717 H HA   . VAL A 1 34 ? 3.138   -17.653 0.491   1.00 0.00 ? 305 VAL A HA   4 
ATOM   4718 H HB   . VAL A 1 34 ? 5.040   -15.397 -0.199  1.00 0.00 ? 305 VAL A HB   4 
ATOM   4719 H HG11 . VAL A 1 34 ? 4.087   -17.760 -1.840  1.00 0.00 ? 305 VAL A HG11 4 
ATOM   4720 H HG12 . VAL A 1 34 ? 4.814   -16.316 -2.545  1.00 0.00 ? 305 VAL A HG12 4 
ATOM   4721 H HG13 . VAL A 1 34 ? 5.754   -17.333 -1.453  1.00 0.00 ? 305 VAL A HG13 4 
ATOM   4722 H HG21 . VAL A 1 34 ? 2.357   -15.292 0.007   1.00 0.00 ? 305 VAL A HG21 4 
ATOM   4723 H HG22 . VAL A 1 34 ? 3.239   -14.395 -1.228  1.00 0.00 ? 305 VAL A HG22 4 
ATOM   4724 H HG23 . VAL A 1 34 ? 2.481   -15.936 -1.630  1.00 0.00 ? 305 VAL A HG23 4 
ATOM   4725 N N    . ALA A 1 35 ? 6.291   -17.382 1.437   1.00 0.00 ? 306 ALA A N    4 
ATOM   4726 C CA   . ALA A 1 35 ? 7.476   -18.190 1.698   1.00 0.00 ? 306 ALA A CA   4 
ATOM   4727 C C    . ALA A 1 35 ? 7.144   -19.225 2.776   1.00 0.00 ? 306 ALA A C    4 
ATOM   4728 O O    . ALA A 1 35 ? 7.568   -20.362 2.711   1.00 0.00 ? 306 ALA A O    4 
ATOM   4729 C CB   . ALA A 1 35 ? 8.614   -17.291 2.183   1.00 0.00 ? 306 ALA A CB   4 
ATOM   4730 H H    . ALA A 1 35 ? 6.304   -16.420 1.624   1.00 0.00 ? 306 ALA A H    4 
ATOM   4731 H HA   . ALA A 1 35 ? 7.776   -18.696 0.793   1.00 0.00 ? 306 ALA A HA   4 
ATOM   4732 H HB1  . ALA A 1 35 ? 8.312   -16.258 2.110   1.00 0.00 ? 306 ALA A HB1  4 
ATOM   4733 H HB2  . ALA A 1 35 ? 8.849   -17.528 3.211   1.00 0.00 ? 306 ALA A HB2  4 
ATOM   4734 H HB3  . ALA A 1 35 ? 9.487   -17.455 1.569   1.00 0.00 ? 306 ALA A HB3  4 
ATOM   4735 N N    . GLN A 1 36 ? 6.384   -18.839 3.764   1.00 0.00 ? 307 GLN A N    4 
ATOM   4736 C CA   . GLN A 1 36 ? 6.028   -19.781 4.819   1.00 0.00 ? 307 GLN A CA   4 
ATOM   4737 C C    . GLN A 1 36 ? 5.142   -20.878 4.230   1.00 0.00 ? 307 GLN A C    4 
ATOM   4738 O O    . GLN A 1 36 ? 5.106   -21.992 4.711   1.00 0.00 ? 307 GLN A O    4 
ATOM   4739 C CB   . GLN A 1 36 ? 5.268   -19.047 5.924   1.00 0.00 ? 307 GLN A CB   4 
ATOM   4740 C CG   . GLN A 1 36 ? 6.254   -18.547 6.982   1.00 0.00 ? 307 GLN A CG   4 
ATOM   4741 C CD   . GLN A 1 36 ? 5.841   -17.150 7.447   1.00 0.00 ? 307 GLN A CD   4 
ATOM   4742 O OE1  . GLN A 1 36 ? 6.679   -16.333 7.775   1.00 0.00 ? 307 GLN A OE1  4 
ATOM   4743 N NE2  . GLN A 1 36 ? 4.575   -16.838 7.488   1.00 0.00 ? 307 GLN A NE2  4 
ATOM   4744 H H    . GLN A 1 36 ? 6.048   -17.919 3.794   1.00 0.00 ? 307 GLN A H    4 
ATOM   4745 H HA   . GLN A 1 36 ? 6.924   -20.222 5.229   1.00 0.00 ? 307 GLN A HA   4 
ATOM   4746 H HB2  . GLN A 1 36 ? 4.739   -18.204 5.500   1.00 0.00 ? 307 GLN A HB2  4 
ATOM   4747 H HB3  . GLN A 1 36 ? 4.561   -19.720 6.385   1.00 0.00 ? 307 GLN A HB3  4 
ATOM   4748 H HG2  . GLN A 1 36 ? 6.252   -19.223 7.823   1.00 0.00 ? 307 GLN A HG2  4 
ATOM   4749 H HG3  . GLN A 1 36 ? 7.246   -18.505 6.557   1.00 0.00 ? 307 GLN A HG3  4 
ATOM   4750 H HE21 . GLN A 1 36 ? 3.898   -17.494 7.223   1.00 0.00 ? 307 GLN A HE21 4 
ATOM   4751 H HE22 . GLN A 1 36 ? 4.300   -15.944 7.785   1.00 0.00 ? 307 GLN A HE22 4 
ATOM   4752 N N    . LEU A 1 37 ? 4.422   -20.566 3.186   1.00 0.00 ? 308 LEU A N    4 
ATOM   4753 C CA   . LEU A 1 37 ? 3.555   -21.560 2.569   1.00 0.00 ? 308 LEU A CA   4 
ATOM   4754 C C    . LEU A 1 37 ? 4.392   -22.468 1.667   1.00 0.00 ? 308 LEU A C    4 
ATOM   4755 O O    . LEU A 1 37 ? 4.439   -23.669 1.847   1.00 0.00 ? 308 LEU A O    4 
ATOM   4756 C CB   . LEU A 1 37 ? 2.490   -20.852 1.732   1.00 0.00 ? 308 LEU A CB   4 
ATOM   4757 C CG   . LEU A 1 37 ? 1.171   -20.812 2.506   1.00 0.00 ? 308 LEU A CG   4 
ATOM   4758 C CD1  . LEU A 1 37 ? 0.334   -19.624 2.026   1.00 0.00 ? 308 LEU A CD1  4 
ATOM   4759 C CD2  . LEU A 1 37 ? 0.397   -22.110 2.261   1.00 0.00 ? 308 LEU A CD2  4 
ATOM   4760 H H    . LEU A 1 37 ? 4.469   -19.659 2.815   1.00 0.00 ? 308 LEU A H    4 
ATOM   4761 H HA   . LEU A 1 37 ? 3.078   -22.152 3.336   1.00 0.00 ? 308 LEU A HA   4 
ATOM   4762 H HB2  . LEU A 1 37 ? 2.813   -19.843 1.518   1.00 0.00 ? 308 LEU A HB2  4 
ATOM   4763 H HB3  . LEU A 1 37 ? 2.344   -21.389 0.805   1.00 0.00 ? 308 LEU A HB3  4 
ATOM   4764 H HG   . LEU A 1 37 ? 1.376   -20.706 3.561   1.00 0.00 ? 308 LEU A HG   4 
ATOM   4765 H HD11 . LEU A 1 37 ? 0.233   -19.664 0.953   1.00 0.00 ? 308 LEU A HD11 4 
ATOM   4766 H HD12 . LEU A 1 37 ? -0.643  -19.663 2.482   1.00 0.00 ? 308 LEU A HD12 4 
ATOM   4767 H HD13 . LEU A 1 37 ? 0.824   -18.701 2.307   1.00 0.00 ? 308 LEU A HD13 4 
ATOM   4768 H HD21 . LEU A 1 37 ? 1.025   -22.808 1.729   1.00 0.00 ? 308 LEU A HD21 4 
ATOM   4769 H HD22 . LEU A 1 37 ? 0.103   -22.538 3.206   1.00 0.00 ? 308 LEU A HD22 4 
ATOM   4770 H HD23 . LEU A 1 37 ? -0.484  -21.898 1.672   1.00 0.00 ? 308 LEU A HD23 4 
ATOM   4771 N N    . LYS A 1 38 ? 5.055   -21.902 0.695   1.00 0.00 ? 309 LYS A N    4 
ATOM   4772 C CA   . LYS A 1 38 ? 5.869   -22.715 -0.197  1.00 0.00 ? 309 LYS A CA   4 
ATOM   4773 C C    . LYS A 1 38 ? 6.738   -23.663 0.631   1.00 0.00 ? 309 LYS A C    4 
ATOM   4774 O O    . LYS A 1 38 ? 6.910   -24.818 0.295   1.00 0.00 ? 309 LYS A O    4 
ATOM   4775 C CB   . LYS A 1 38 ? 6.767   -21.806 -1.038  1.00 0.00 ? 309 LYS A CB   4 
ATOM   4776 C CG   . LYS A 1 38 ? 6.010   -21.368 -2.292  1.00 0.00 ? 309 LYS A CG   4 
ATOM   4777 C CD   . LYS A 1 38 ? 5.575   -19.910 -2.142  1.00 0.00 ? 309 LYS A CD   4 
ATOM   4778 C CE   . LYS A 1 38 ? 6.073   -19.103 -3.343  1.00 0.00 ? 309 LYS A CE   4 
ATOM   4779 N NZ   . LYS A 1 38 ? 7.468   -18.646 -3.090  1.00 0.00 ? 309 LYS A NZ   4 
ATOM   4780 H H    . LYS A 1 38 ? 5.004   -20.932 0.568   1.00 0.00 ? 309 LYS A H    4 
ATOM   4781 H HA   . LYS A 1 38 ? 5.229   -23.286 -0.851  1.00 0.00 ? 309 LYS A HA   4 
ATOM   4782 H HB2  . LYS A 1 38 ? 7.041   -20.936 -0.459  1.00 0.00 ? 309 LYS A HB2  4 
ATOM   4783 H HB3  . LYS A 1 38 ? 7.656   -22.344 -1.328  1.00 0.00 ? 309 LYS A HB3  4 
ATOM   4784 H HG2  . LYS A 1 38 ? 6.652   -21.466 -3.155  1.00 0.00 ? 309 LYS A HG2  4 
ATOM   4785 H HG3  . LYS A 1 38 ? 5.135   -21.988 -2.421  1.00 0.00 ? 309 LYS A HG3  4 
ATOM   4786 H HD2  . LYS A 1 38 ? 4.498   -19.860 -2.092  1.00 0.00 ? 309 LYS A HD2  4 
ATOM   4787 H HD3  . LYS A 1 38 ? 5.997   -19.502 -1.237  1.00 0.00 ? 309 LYS A HD3  4 
ATOM   4788 H HE2  . LYS A 1 38 ? 6.051   -19.724 -4.226  1.00 0.00 ? 309 LYS A HE2  4 
ATOM   4789 H HE3  . LYS A 1 38 ? 5.433   -18.246 -3.490  1.00 0.00 ? 309 LYS A HE3  4 
ATOM   4790 H HZ1  . LYS A 1 38 ? 7.746   -18.894 -2.120  1.00 0.00 ? 309 LYS A HZ1  4 
ATOM   4791 H HZ2  . LYS A 1 38 ? 8.112   -19.109 -3.764  1.00 0.00 ? 309 LYS A HZ2  4 
ATOM   4792 H HZ3  . LYS A 1 38 ? 7.523   -17.615 -3.211  1.00 0.00 ? 309 LYS A HZ3  4 
ATOM   4793 N N    . GLN A 1 39 ? 7.286   -23.183 1.715   1.00 0.00 ? 310 GLN A N    4 
ATOM   4794 C CA   . GLN A 1 39 ? 8.123   -24.036 2.550   1.00 0.00 ? 310 GLN A CA   4 
ATOM   4795 C C    . GLN A 1 39 ? 7.332   -25.279 2.965   1.00 0.00 ? 310 GLN A C    4 
ATOM   4796 O O    . GLN A 1 39 ? 7.756   -26.397 2.747   1.00 0.00 ? 310 GLN A O    4 
ATOM   4797 C CB   . GLN A 1 39 ? 8.553   -23.266 3.800   1.00 0.00 ? 310 GLN A CB   4 
ATOM   4798 C CG   . GLN A 1 39 ? 9.388   -22.051 3.389   1.00 0.00 ? 310 GLN A CG   4 
ATOM   4799 C CD   . GLN A 1 39 ? 10.870  -22.350 3.615   1.00 0.00 ? 310 GLN A CD   4 
ATOM   4800 O OE1  . GLN A 1 39 ? 11.382  -23.343 3.137   1.00 0.00 ? 310 GLN A OE1  4 
ATOM   4801 N NE2  . GLN A 1 39 ? 11.588  -21.526 4.330   1.00 0.00 ? 310 GLN A NE2  4 
ATOM   4802 H H    . GLN A 1 39 ? 7.133   -22.248 1.969   1.00 0.00 ? 310 GLN A H    4 
ATOM   4803 H HA   . GLN A 1 39 ? 8.999   -24.336 1.995   1.00 0.00 ? 310 GLN A HA   4 
ATOM   4804 H HB2  . GLN A 1 39 ? 7.676   -22.935 4.339   1.00 0.00 ? 310 GLN A HB2  4 
ATOM   4805 H HB3  . GLN A 1 39 ? 9.144   -23.909 4.433   1.00 0.00 ? 310 GLN A HB3  4 
ATOM   4806 H HG2  . GLN A 1 39 ? 9.218   -21.835 2.344   1.00 0.00 ? 310 GLN A HG2  4 
ATOM   4807 H HG3  . GLN A 1 39 ? 9.099   -21.198 3.985   1.00 0.00 ? 310 GLN A HG3  4 
ATOM   4808 H HE21 . GLN A 1 39 ? 11.176  -20.725 4.716   1.00 0.00 ? 310 GLN A HE21 4 
ATOM   4809 H HE22 . GLN A 1 39 ? 12.539  -21.709 4.482   1.00 0.00 ? 310 GLN A HE22 4 
ATOM   4810 N N    . LYS A 1 40 ? 6.186   -25.093 3.564   1.00 0.00 ? 311 LYS A N    4 
ATOM   4811 C CA   . LYS A 1 40 ? 5.391   -26.240 3.983   1.00 0.00 ? 311 LYS A CA   4 
ATOM   4812 C C    . LYS A 1 40 ? 5.202   -27.189 2.795   1.00 0.00 ? 311 LYS A C    4 
ATOM   4813 O O    . LYS A 1 40 ? 4.997   -28.374 2.962   1.00 0.00 ? 311 LYS A O    4 
ATOM   4814 C CB   . LYS A 1 40 ? 4.026   -25.764 4.481   1.00 0.00 ? 311 LYS A CB   4 
ATOM   4815 C CG   . LYS A 1 40 ? 3.215   -26.964 4.972   1.00 0.00 ? 311 LYS A CG   4 
ATOM   4816 C CD   . LYS A 1 40 ? 1.758   -26.811 4.534   1.00 0.00 ? 311 LYS A CD   4 
ATOM   4817 C CE   . LYS A 1 40 ? 0.925   -26.282 5.704   1.00 0.00 ? 311 LYS A CE   4 
ATOM   4818 N NZ   . LYS A 1 40 ? 0.609   -27.403 6.634   1.00 0.00 ? 311 LYS A NZ   4 
ATOM   4819 H H    . LYS A 1 40 ? 5.862   -24.183 3.733   1.00 0.00 ? 311 LYS A H    4 
ATOM   4820 H HA   . LYS A 1 40 ? 5.902   -26.761 4.779   1.00 0.00 ? 311 LYS A HA   4 
ATOM   4821 H HB2  . LYS A 1 40 ? 4.163   -25.063 5.292   1.00 0.00 ? 311 LYS A HB2  4 
ATOM   4822 H HB3  . LYS A 1 40 ? 3.497   -25.281 3.673   1.00 0.00 ? 311 LYS A HB3  4 
ATOM   4823 H HG2  . LYS A 1 40 ? 3.625   -27.872 4.553   1.00 0.00 ? 311 LYS A HG2  4 
ATOM   4824 H HG3  . LYS A 1 40 ? 3.261   -27.013 6.051   1.00 0.00 ? 311 LYS A HG3  4 
ATOM   4825 H HD2  . LYS A 1 40 ? 1.702   -26.116 3.708   1.00 0.00 ? 311 LYS A HD2  4 
ATOM   4826 H HD3  . LYS A 1 40 ? 1.372   -27.771 4.225   1.00 0.00 ? 311 LYS A HD3  4 
ATOM   4827 H HE2  . LYS A 1 40 ? 1.485   -25.525 6.231   1.00 0.00 ? 311 LYS A HE2  4 
ATOM   4828 H HE3  . LYS A 1 40 ? 0.007   -25.855 5.328   1.00 0.00 ? 311 LYS A HE3  4 
ATOM   4829 H HZ1  . LYS A 1 40 ? 0.669   -28.306 6.123   1.00 0.00 ? 311 LYS A HZ1  4 
ATOM   4830 H HZ2  . LYS A 1 40 ? 1.291   -27.402 7.422   1.00 0.00 ? 311 LYS A HZ2  4 
ATOM   4831 H HZ3  . LYS A 1 40 ? -0.353  -27.282 7.008   1.00 0.00 ? 311 LYS A HZ3  4 
ATOM   4832 N N    . VAL A 1 41 ? 5.272   -26.675 1.598   1.00 0.00 ? 312 VAL A N    4 
ATOM   4833 C CA   . VAL A 1 41 ? 5.101   -27.529 0.428   1.00 0.00 ? 312 VAL A CA   4 
ATOM   4834 C C    . VAL A 1 41 ? 6.458   -28.112 0.025   1.00 0.00 ? 312 VAL A C    4 
ATOM   4835 O O    . VAL A 1 41 ? 6.538   -29.078 -0.706  1.00 0.00 ? 312 VAL A O    4 
ATOM   4836 C CB   . VAL A 1 41 ? 4.532   -26.706 -0.727  1.00 0.00 ? 312 VAL A CB   4 
ATOM   4837 C CG1  . VAL A 1 41 ? 4.397   -27.592 -1.968  1.00 0.00 ? 312 VAL A CG1  4 
ATOM   4838 C CG2  . VAL A 1 41 ? 3.154   -26.166 -0.336  1.00 0.00 ? 312 VAL A CG2  4 
ATOM   4839 H H    . VAL A 1 41 ? 5.440   -25.717 1.485   1.00 0.00 ? 312 VAL A H    4 
ATOM   4840 H HA   . VAL A 1 41 ? 4.420   -28.334 0.666   1.00 0.00 ? 312 VAL A HA   4 
ATOM   4841 H HB   . VAL A 1 41 ? 5.197   -25.883 -0.944  1.00 0.00 ? 312 VAL A HB   4 
ATOM   4842 H HG11 . VAL A 1 41 ? 4.299   -28.623 -1.665  1.00 0.00 ? 312 VAL A HG11 4 
ATOM   4843 H HG12 . VAL A 1 41 ? 3.522   -27.295 -2.528  1.00 0.00 ? 312 VAL A HG12 4 
ATOM   4844 H HG13 . VAL A 1 41 ? 5.275   -27.481 -2.587  1.00 0.00 ? 312 VAL A HG13 4 
ATOM   4845 H HG21 . VAL A 1 41 ? 3.222   -25.665 0.618   1.00 0.00 ? 312 VAL A HG21 4 
ATOM   4846 H HG22 . VAL A 1 41 ? 2.815   -25.467 -1.085  1.00 0.00 ? 312 VAL A HG22 4 
ATOM   4847 H HG23 . VAL A 1 41 ? 2.454   -26.985 -0.264  1.00 0.00 ? 312 VAL A HG23 4 
ATOM   4848 N N    . MET A 1 42 ? 7.526   -27.530 0.501   1.00 0.00 ? 313 MET A N    4 
ATOM   4849 C CA   . MET A 1 42 ? 8.848   -28.039 0.157   1.00 0.00 ? 313 MET A CA   4 
ATOM   4850 C C    . MET A 1 42 ? 9.113   -29.325 0.943   1.00 0.00 ? 313 MET A C    4 
ATOM   4851 O O    . MET A 1 42 ? 8.863   -29.398 2.130   1.00 0.00 ? 313 MET A O    4 
ATOM   4852 C CB   . MET A 1 42 ? 9.906   -26.994 0.516   1.00 0.00 ? 313 MET A CB   4 
ATOM   4853 C CG   . MET A 1 42 ? 10.894  -26.847 -0.644  1.00 0.00 ? 313 MET A CG   4 
ATOM   4854 S SD   . MET A 1 42 ? 12.045  -28.241 -0.637  1.00 0.00 ? 313 MET A SD   4 
ATOM   4855 C CE   . MET A 1 42 ? 13.575  -27.274 -0.677  1.00 0.00 ? 313 MET A CE   4 
ATOM   4856 H H    . MET A 1 42 ? 7.438   -26.753 1.090   1.00 0.00 ? 313 MET A H    4 
ATOM   4857 H HA   . MET A 1 42 ? 8.893   -28.247 -0.902  1.00 0.00 ? 313 MET A HA   4 
ATOM   4858 H HB2  . MET A 1 42 ? 9.426   -26.045 0.703   1.00 0.00 ? 313 MET A HB2  4 
ATOM   4859 H HB3  . MET A 1 42 ? 10.439  -27.309 1.400   1.00 0.00 ? 313 MET A HB3  4 
ATOM   4860 H HG2  . MET A 1 42 ? 10.353  -26.830 -1.578  1.00 0.00 ? 313 MET A HG2  4 
ATOM   4861 H HG3  . MET A 1 42 ? 11.444  -25.923 -0.532  1.00 0.00 ? 313 MET A HG3  4 
ATOM   4862 H HE1  . MET A 1 42 ? 13.505  -26.523 -1.452  1.00 0.00 ? 313 MET A HE1  4 
ATOM   4863 H HE2  . MET A 1 42 ? 13.722  -26.796 0.283   1.00 0.00 ? 313 MET A HE2  4 
ATOM   4864 H HE3  . MET A 1 42 ? 14.409  -27.924 -0.884  1.00 0.00 ? 313 MET A HE3  4 
ATOM   4865 N N    . ASN A 1 43 ? 9.614   -30.341 0.295   1.00 0.00 ? 314 ASN A N    4 
ATOM   4866 C CA   . ASN A 1 43 ? 9.882   -31.590 0.998   1.00 0.00 ? 314 ASN A CA   4 
ATOM   4867 C C    . ASN A 1 43 ? 11.220  -32.168 0.530   1.00 0.00 ? 314 ASN A C    4 
ATOM   4868 O O    . ASN A 1 43 ? 12.247  -31.958 1.148   1.00 0.00 ? 314 ASN A O    4 
ATOM   4869 C CB   . ASN A 1 43 ? 8.762   -32.590 0.706   1.00 0.00 ? 314 ASN A CB   4 
ATOM   4870 C CG   . ASN A 1 43 ? 9.078   -33.925 1.382   1.00 0.00 ? 314 ASN A CG   4 
ATOM   4871 O OD1  . ASN A 1 43 ? 10.026  -34.593 1.019   1.00 0.00 ? 314 ASN A OD1  4 
ATOM   4872 N ND2  . ASN A 1 43 ? 8.321   -34.345 2.358   1.00 0.00 ? 314 ASN A ND2  4 
ATOM   4873 H H    . ASN A 1 43 ? 9.809   -30.265 -0.663  1.00 0.00 ? 314 ASN A H    4 
ATOM   4874 H HA   . ASN A 1 43 ? 9.923   -31.402 2.060   1.00 0.00 ? 314 ASN A HA   4 
ATOM   4875 H HB2  . ASN A 1 43 ? 7.828   -32.205 1.090   1.00 0.00 ? 314 ASN A HB2  4 
ATOM   4876 H HB3  . ASN A 1 43 ? 8.678   -32.738 -0.359  1.00 0.00 ? 314 ASN A HB3  4 
ATOM   4877 H HD21 . ASN A 1 43 ? 7.556   -33.806 2.650   1.00 0.00 ? 314 ASN A HD21 4 
ATOM   4878 H HD22 . ASN A 1 43 ? 8.515   -35.198 2.797   1.00 0.00 ? 314 ASN A HD22 4 
ATOM   4879 N N    . TYR A 1 44 ? 11.223  -32.888 -0.561  1.00 0.00 ? 315 TYR A N    4 
ATOM   4880 C CA   . TYR A 1 44 ? 12.471  -33.459 -1.061  1.00 0.00 ? 315 TYR A CA   4 
ATOM   4881 C C    . TYR A 1 44 ? 12.170  -34.389 -2.240  1.00 0.00 ? 315 TYR A C    4 
ATOM   4882 O O    . TYR A 1 44 ? 11.544  -35.413 -2.016  1.00 0.00 ? 315 TYR A O    4 
ATOM   4883 C CB   . TYR A 1 44 ? 13.162  -34.252 0.053   1.00 0.00 ? 315 TYR A CB   4 
ATOM   4884 C CG   . TYR A 1 44 ? 14.535  -33.675 0.301   1.00 0.00 ? 315 TYR A CG   4 
ATOM   4885 C CD1  . TYR A 1 44 ? 15.418  -33.483 -0.774  1.00 0.00 ? 315 TYR A CD1  4 
ATOM   4886 C CD2  . TYR A 1 44 ? 14.928  -33.329 1.603   1.00 0.00 ? 315 TYR A CD2  4 
ATOM   4887 C CE1  . TYR A 1 44 ? 16.695  -32.946 -0.546  1.00 0.00 ? 315 TYR A CE1  4 
ATOM   4888 C CE2  . TYR A 1 44 ? 16.205  -32.791 1.831   1.00 0.00 ? 315 TYR A CE2  4 
ATOM   4889 C CZ   . TYR A 1 44 ? 17.088  -32.599 0.756   1.00 0.00 ? 315 TYR A CZ   4 
ATOM   4890 O OH   . TYR A 1 44 ? 18.344  -32.071 0.981   1.00 0.00 ? 315 TYR A OH   4 
ATOM   4891 O OXT  . TYR A 1 44 ? 12.569  -34.061 -3.344  1.00 0.00 ? 315 TYR A OXT  4 
ATOM   4892 H H    . TYR A 1 44 ? 10.389  -33.042 -1.049  1.00 0.00 ? 315 TYR A H    4 
ATOM   4893 H HA   . TYR A 1 44 ? 13.122  -32.664 -1.391  1.00 0.00 ? 315 TYR A HA   4 
ATOM   4894 H HB2  . TYR A 1 44 ? 12.575  -34.188 0.958   1.00 0.00 ? 315 TYR A HB2  4 
ATOM   4895 H HB3  . TYR A 1 44 ? 13.255  -35.286 -0.242  1.00 0.00 ? 315 TYR A HB3  4 
ATOM   4896 H HD1  . TYR A 1 44 ? 15.114  -33.749 -1.776  1.00 0.00 ? 315 TYR A HD1  4 
ATOM   4897 H HD2  . TYR A 1 44 ? 14.249  -33.476 2.430   1.00 0.00 ? 315 TYR A HD2  4 
ATOM   4898 H HE1  . TYR A 1 44 ? 17.373  -32.799 -1.373  1.00 0.00 ? 315 TYR A HE1  4 
ATOM   4899 H HE2  . TYR A 1 44 ? 16.509  -32.525 2.832   1.00 0.00 ? 315 TYR A HE2  4 
ATOM   4900 H HH   . TYR A 1 44 ? 18.924  -32.371 0.278   1.00 0.00 ? 315 TYR A HH   4 
HETATM 4901 C C    . ACE B 1 1  ? 0.331   28.518  -5.187  1.00 0.00 ? 272 ACE B C    4 
HETATM 4902 O O    . ACE B 1 1  ? -0.507  29.049  -4.487  1.00 0.00 ? 272 ACE B O    4 
HETATM 4903 C CH3  . ACE B 1 1  ? -0.043  27.405  -6.169  1.00 0.00 ? 272 ACE B CH3  4 
HETATM 4904 H H1   . ACE B 1 1  ? -1.118  27.348  -6.256  1.00 0.00 ? 272 ACE B H1   4 
HETATM 4905 H H2   . ACE B 1 1  ? 0.387   27.620  -7.136  1.00 0.00 ? 272 ACE B H2   4 
HETATM 4906 H H3   . ACE B 1 1  ? 0.340   26.463  -5.807  1.00 0.00 ? 272 ACE B H3   4 
ATOM   4907 N N    . CYS B 1 2  ? 1.585   28.877  -5.132  1.00 0.00 ? 273 CYS B N    4 
ATOM   4908 C CA   . CYS B 1 2  ? 2.003   29.933  -4.218  1.00 0.00 ? 273 CYS B CA   4 
ATOM   4909 C C    . CYS B 1 2  ? 3.431   30.361  -4.558  1.00 0.00 ? 273 CYS B C    4 
ATOM   4910 O O    . CYS B 1 2  ? 3.762   31.531  -4.536  1.00 0.00 ? 273 CYS B O    4 
ATOM   4911 C CB   . CYS B 1 2  ? 1.952   29.413  -2.780  1.00 0.00 ? 273 CYS B CB   4 
ATOM   4912 S SG   . CYS B 1 2  ? 1.209   30.670  -1.709  1.00 0.00 ? 273 CYS B SG   4 
ATOM   4913 H H    . CYS B 1 2  ? 2.246   28.437  -5.708  1.00 0.00 ? 273 CYS B H    4 
ATOM   4914 H HA   . CYS B 1 2  ? 1.339   30.779  -4.316  1.00 0.00 ? 273 CYS B HA   4 
ATOM   4915 H HB2  . CYS B 1 2  ? 1.359   28.512  -2.744  1.00 0.00 ? 273 CYS B HB2  4 
ATOM   4916 H HB3  . CYS B 1 2  ? 2.955   29.197  -2.441  1.00 0.00 ? 273 CYS B HB3  4 
ATOM   4917 N N    . GLY B 1 3  ? 4.283   29.423  -4.871  1.00 0.00 ? 274 GLY B N    4 
ATOM   4918 C CA   . GLY B 1 3  ? 5.659   29.770  -5.204  1.00 0.00 ? 274 GLY B CA   4 
ATOM   4919 C C    . GLY B 1 3  ? 6.332   28.583  -5.894  1.00 0.00 ? 274 GLY B C    4 
ATOM   4920 O O    . GLY B 1 3  ? 5.727   27.891  -6.690  1.00 0.00 ? 274 GLY B O    4 
ATOM   4921 H H    . GLY B 1 3  ? 3.996   28.486  -4.882  1.00 0.00 ? 274 GLY B H    4 
ATOM   4922 H HA2  . GLY B 1 3  ? 5.665   30.624  -5.865  1.00 0.00 ? 274 GLY B HA2  4 
ATOM   4923 H HA3  . GLY B 1 3  ? 6.201   30.008  -4.302  1.00 0.00 ? 274 GLY B HA3  4 
ATOM   4924 N N    . GLY B 1 4  ? 7.580   28.339  -5.597  1.00 0.00 ? 275 GLY B N    4 
ATOM   4925 C CA   . GLY B 1 4  ? 8.272   27.219  -6.224  1.00 0.00 ? 275 GLY B CA   4 
ATOM   4926 C C    . GLY B 1 4  ? 8.238   26.009  -5.290  1.00 0.00 ? 275 GLY B C    4 
ATOM   4927 O O    . GLY B 1 4  ? 8.283   24.875  -5.725  1.00 0.00 ? 275 GLY B O    4 
ATOM   4928 H H    . GLY B 1 4  ? 8.048   28.908  -4.952  1.00 0.00 ? 275 GLY B H    4 
ATOM   4929 H HA2  . GLY B 1 4  ? 7.783   26.970  -7.156  1.00 0.00 ? 275 GLY B HA2  4 
ATOM   4930 H HA3  . GLY B 1 4  ? 9.298   27.491  -6.414  1.00 0.00 ? 275 GLY B HA3  4 
ATOM   4931 N N    . ARG B 1 5  ? 8.158   26.239  -4.008  1.00 0.00 ? 276 ARG B N    4 
ATOM   4932 C CA   . ARG B 1 5  ? 8.122   25.122  -3.069  1.00 0.00 ? 276 ARG B CA   4 
ATOM   4933 C C    . ARG B 1 5  ? 6.863   24.289  -3.320  1.00 0.00 ? 276 ARG B C    4 
ATOM   4934 O O    . ARG B 1 5  ? 6.862   23.085  -3.151  1.00 0.00 ? 276 ARG B O    4 
ATOM   4935 C CB   . ARG B 1 5  ? 8.109   25.656  -1.637  1.00 0.00 ? 276 ARG B CB   4 
ATOM   4936 C CG   . ARG B 1 5  ? 9.505   25.518  -1.028  1.00 0.00 ? 276 ARG B CG   4 
ATOM   4937 C CD   . ARG B 1 5  ? 9.587   26.339  0.262   1.00 0.00 ? 276 ARG B CD   4 
ATOM   4938 N NE   . ARG B 1 5  ? 9.656   27.762  -0.061  1.00 0.00 ? 276 ARG B NE   4 
ATOM   4939 C CZ   . ARG B 1 5  ? 10.335  28.172  -1.100  1.00 0.00 ? 276 ARG B CZ   4 
ATOM   4940 N NH1  . ARG B 1 5  ? 11.623  27.969  -1.159  1.00 0.00 ? 276 ARG B NH1  4 
ATOM   4941 N NH2  . ARG B 1 5  ? 9.725   28.785  -2.078  1.00 0.00 ? 276 ARG B NH2  4 
ATOM   4942 H H    . ARG B 1 5  ? 8.121   27.160  -3.676  1.00 0.00 ? 276 ARG B H    4 
ATOM   4943 H HA   . ARG B 1 5  ? 8.996   24.505  -3.212  1.00 0.00 ? 276 ARG B HA   4 
ATOM   4944 H HB2  . ARG B 1 5  ? 7.819   26.697  -1.643  1.00 0.00 ? 276 ARG B HB2  4 
ATOM   4945 H HB3  . ARG B 1 5  ? 7.403   25.090  -1.048  1.00 0.00 ? 276 ARG B HB3  4 
ATOM   4946 H HG2  . ARG B 1 5  ? 9.698   24.477  -0.806  1.00 0.00 ? 276 ARG B HG2  4 
ATOM   4947 H HG3  . ARG B 1 5  ? 10.242  25.879  -1.729  1.00 0.00 ? 276 ARG B HG3  4 
ATOM   4948 H HD2  . ARG B 1 5  ? 8.708   26.152  0.860   1.00 0.00 ? 276 ARG B HD2  4 
ATOM   4949 H HD3  . ARG B 1 5  ? 10.468  26.048  0.815   1.00 0.00 ? 276 ARG B HD3  4 
ATOM   4950 H HE   . ARG B 1 5  ? 9.191   28.413  0.505   1.00 0.00 ? 276 ARG B HE   4 
ATOM   4951 H HH11 . ARG B 1 5  ? 12.091  27.500  -0.410  1.00 0.00 ? 276 ARG B HH11 4 
ATOM   4952 H HH12 . ARG B 1 5  ? 12.144  28.283  -1.954  1.00 0.00 ? 276 ARG B HH12 4 
ATOM   4953 H HH21 . ARG B 1 5  ? 8.739   28.941  -2.032  1.00 0.00 ? 276 ARG B HH21 4 
ATOM   4954 H HH22 . ARG B 1 5  ? 10.245  29.100  -2.872  1.00 0.00 ? 276 ARG B HH22 4 
ATOM   4955 N N    . ILE B 1 6  ? 5.795   24.917  -3.728  1.00 0.00 ? 277 ILE B N    4 
ATOM   4956 C CA   . ILE B 1 6  ? 4.570   24.171  -3.987  1.00 0.00 ? 277 ILE B CA   4 
ATOM   4957 C C    . ILE B 1 6  ? 4.751   23.344  -5.262  1.00 0.00 ? 277 ILE B C    4 
ATOM   4958 O O    . ILE B 1 6  ? 4.271   22.232  -5.366  1.00 0.00 ? 277 ILE B O    4 
ATOM   4959 C CB   . ILE B 1 6  ? 3.402   25.142  -4.164  1.00 0.00 ? 277 ILE B CB   4 
ATOM   4960 C CG1  . ILE B 1 6  ? 3.024   25.736  -2.806  1.00 0.00 ? 277 ILE B CG1  4 
ATOM   4961 C CG2  . ILE B 1 6  ? 2.199   24.396  -4.745  1.00 0.00 ? 277 ILE B CG2  4 
ATOM   4962 C CD1  . ILE B 1 6  ? 4.122   26.698  -2.346  1.00 0.00 ? 277 ILE B CD1  4 
ATOM   4963 H H    . ILE B 1 6  ? 5.816   25.886  -3.862  1.00 0.00 ? 277 ILE B H    4 
ATOM   4964 H HA   . ILE B 1 6  ? 4.365   23.512  -3.157  1.00 0.00 ? 277 ILE B HA   4 
ATOM   4965 H HB   . ILE B 1 6  ? 3.692   25.935  -4.839  1.00 0.00 ? 277 ILE B HB   4 
ATOM   4966 H HG12 . ILE B 1 6  ? 2.091   26.270  -2.894  1.00 0.00 ? 277 ILE B HG12 4 
ATOM   4967 H HG13 . ILE B 1 6  ? 2.919   24.941  -2.083  1.00 0.00 ? 277 ILE B HG13 4 
ATOM   4968 H HG21 . ILE B 1 6  ? 2.080   23.452  -4.234  1.00 0.00 ? 277 ILE B HG21 4 
ATOM   4969 H HG22 . ILE B 1 6  ? 1.307   24.992  -4.612  1.00 0.00 ? 277 ILE B HG22 4 
ATOM   4970 H HG23 . ILE B 1 6  ? 2.358   24.217  -5.798  1.00 0.00 ? 277 ILE B HG23 4 
ATOM   4971 H HD11 . ILE B 1 6  ? 4.483   27.263  -3.192  1.00 0.00 ? 277 ILE B HD11 4 
ATOM   4972 H HD12 . ILE B 1 6  ? 3.721   27.372  -1.604  1.00 0.00 ? 277 ILE B HD12 4 
ATOM   4973 H HD13 . ILE B 1 6  ? 4.938   26.133  -1.916  1.00 0.00 ? 277 ILE B HD13 4 
ATOM   4974 N N    . ALA B 1 7  ? 5.447   23.877  -6.230  1.00 0.00 ? 278 ALA B N    4 
ATOM   4975 C CA   . ALA B 1 7  ? 5.664   23.134  -7.465  1.00 0.00 ? 278 ALA B CA   4 
ATOM   4976 C C    . ALA B 1 7  ? 6.302   21.787  -7.125  1.00 0.00 ? 278 ALA B C    4 
ATOM   4977 O O    . ALA B 1 7  ? 5.760   20.738  -7.413  1.00 0.00 ? 278 ALA B O    4 
ATOM   4978 C CB   . ALA B 1 7  ? 6.595   23.925  -8.386  1.00 0.00 ? 278 ALA B CB   4 
ATOM   4979 H H    . ALA B 1 7  ? 5.832   24.772  -6.123  1.00 0.00 ? 278 ALA B H    4 
ATOM   4980 H HA   . ALA B 1 7  ? 4.718   22.971  -7.960  1.00 0.00 ? 278 ALA B HA   4 
ATOM   4981 H HB1  . ALA B 1 7  ? 6.238   24.942  -8.468  1.00 0.00 ? 278 ALA B HB1  4 
ATOM   4982 H HB2  . ALA B 1 7  ? 7.593   23.926  -7.973  1.00 0.00 ? 278 ALA B HB2  4 
ATOM   4983 H HB3  . ALA B 1 7  ? 6.609   23.468  -9.364  1.00 0.00 ? 278 ALA B HB3  4 
ATOM   4984 N N    . ARG B 1 8  ? 7.451   21.808  -6.507  1.00 0.00 ? 279 ARG B N    4 
ATOM   4985 C CA   . ARG B 1 8  ? 8.111   20.558  -6.147  1.00 0.00 ? 279 ARG B CA   4 
ATOM   4986 C C    . ARG B 1 8  ? 7.166   19.728  -5.275  1.00 0.00 ? 279 ARG B C    4 
ATOM   4987 O O    . ARG B 1 8  ? 6.979   18.548  -5.494  1.00 0.00 ? 279 ARG B O    4 
ATOM   4988 C CB   . ARG B 1 8  ? 9.389   20.865  -5.367  1.00 0.00 ? 279 ARG B CB   4 
ATOM   4989 C CG   . ARG B 1 8  ? 10.576  20.175  -6.039  1.00 0.00 ? 279 ARG B CG   4 
ATOM   4990 C CD   . ARG B 1 8  ? 11.211  19.185  -5.059  1.00 0.00 ? 279 ARG B CD   4 
ATOM   4991 N NE   . ARG B 1 8  ? 12.328  19.826  -4.374  1.00 0.00 ? 279 ARG B NE   4 
ATOM   4992 C CZ   . ARG B 1 8  ? 12.817  19.296  -3.286  1.00 0.00 ? 279 ARG B CZ   4 
ATOM   4993 N NH1  . ARG B 1 8  ? 12.676  18.018  -3.062  1.00 0.00 ? 279 ARG B NH1  4 
ATOM   4994 N NH2  . ARG B 1 8  ? 13.446  20.044  -2.422  1.00 0.00 ? 279 ARG B NH2  4 
ATOM   4995 H H    . ARG B 1 8  ? 7.869   22.664  -6.279  1.00 0.00 ? 279 ARG B H    4 
ATOM   4996 H HA   . ARG B 1 8  ? 8.355   20.007  -7.042  1.00 0.00 ? 279 ARG B HA   4 
ATOM   4997 H HB2  . ARG B 1 8  ? 9.554   21.933  -5.352  1.00 0.00 ? 279 ARG B HB2  4 
ATOM   4998 H HB3  . ARG B 1 8  ? 9.290   20.502  -4.354  1.00 0.00 ? 279 ARG B HB3  4 
ATOM   4999 H HG2  . ARG B 1 8  ? 10.237  19.646  -6.917  1.00 0.00 ? 279 ARG B HG2  4 
ATOM   5000 H HG3  . ARG B 1 8  ? 11.309  20.914  -6.324  1.00 0.00 ? 279 ARG B HG3  4 
ATOM   5001 H HD2  . ARG B 1 8  ? 10.474  18.875  -4.333  1.00 0.00 ? 279 ARG B HD2  4 
ATOM   5002 H HD3  . ARG B 1 8  ? 11.568  18.322  -5.600  1.00 0.00 ? 279 ARG B HD3  4 
ATOM   5003 H HE   . ARG B 1 8  ? 12.712  20.653  -4.731  1.00 0.00 ? 279 ARG B HE   4 
ATOM   5004 H HH11 . ARG B 1 8  ? 12.192  17.445  -3.725  1.00 0.00 ? 279 ARG B HH11 4 
ATOM   5005 H HH12 . ARG B 1 8  ? 13.050  17.613  -2.229  1.00 0.00 ? 279 ARG B HH12 4 
ATOM   5006 H HH21 . ARG B 1 8  ? 13.554  21.023  -2.594  1.00 0.00 ? 279 ARG B HH21 4 
ATOM   5007 H HH22 . ARG B 1 8  ? 13.821  19.638  -1.590  1.00 0.00 ? 279 ARG B HH22 4 
ATOM   5008 N N    . LEU B 1 9  ? 6.570   20.338  -4.288  1.00 0.00 ? 280 LEU B N    4 
ATOM   5009 C CA   . LEU B 1 9  ? 5.657   19.606  -3.420  1.00 0.00 ? 280 LEU B CA   4 
ATOM   5010 C C    . LEU B 1 9  ? 4.650   18.836  -4.277  1.00 0.00 ? 280 LEU B C    4 
ATOM   5011 O O    . LEU B 1 9  ? 4.371   17.679  -4.033  1.00 0.00 ? 280 LEU B O    4 
ATOM   5012 C CB   . LEU B 1 9  ? 4.914   20.590  -2.514  1.00 0.00 ? 280 LEU B CB   4 
ATOM   5013 C CG   . LEU B 1 9  ? 5.498   20.526  -1.102  1.00 0.00 ? 280 LEU B CG   4 
ATOM   5014 C CD1  . LEU B 1 9  ? 5.653   21.945  -0.550  1.00 0.00 ? 280 LEU B CD1  4 
ATOM   5015 C CD2  . LEU B 1 9  ? 4.559   19.727  -0.197  1.00 0.00 ? 280 LEU B CD2  4 
ATOM   5016 H H    . LEU B 1 9  ? 6.735   21.292  -4.132  1.00 0.00 ? 280 LEU B H    4 
ATOM   5017 H HA   . LEU B 1 9  ? 6.217   18.911  -2.812  1.00 0.00 ? 280 LEU B HA   4 
ATOM   5018 H HB2  . LEU B 1 9  ? 5.022   21.590  -2.907  1.00 0.00 ? 280 LEU B HB2  4 
ATOM   5019 H HB3  . LEU B 1 9  ? 3.867   20.326  -2.480  1.00 0.00 ? 280 LEU B HB3  4 
ATOM   5020 H HG   . LEU B 1 9  ? 6.466   20.046  -1.135  1.00 0.00 ? 280 LEU B HG   4 
ATOM   5021 H HD11 . LEU B 1 9  ? 4.749   22.506  -0.742  1.00 0.00 ? 280 LEU B HD11 4 
ATOM   5022 H HD12 . LEU B 1 9  ? 5.828   21.899  0.515   1.00 0.00 ? 280 LEU B HD12 4 
ATOM   5023 H HD13 . LEU B 1 9  ? 6.487   22.430  -1.033  1.00 0.00 ? 280 LEU B HD13 4 
ATOM   5024 H HD21 . LEU B 1 9  ? 3.679   19.442  -0.754  1.00 0.00 ? 280 LEU B HD21 4 
ATOM   5025 H HD22 . LEU B 1 9  ? 5.066   18.840  0.153   1.00 0.00 ? 280 LEU B HD22 4 
ATOM   5026 H HD23 . LEU B 1 9  ? 4.270   20.334  0.648   1.00 0.00 ? 280 LEU B HD23 4 
ATOM   5027 N N    . GLU B 1 10 ? 4.101   19.468  -5.277  1.00 0.00 ? 281 GLU B N    4 
ATOM   5028 C CA   . GLU B 1 10 ? 3.134   18.783  -6.128  1.00 0.00 ? 281 GLU B CA   4 
ATOM   5029 C C    . GLU B 1 10 ? 3.834   17.644  -6.870  1.00 0.00 ? 281 GLU B C    4 
ATOM   5030 O O    . GLU B 1 10 ? 3.252   16.608  -7.125  1.00 0.00 ? 281 GLU B O    4 
ATOM   5031 C CB   . GLU B 1 10 ? 2.549   19.772  -7.139  1.00 0.00 ? 281 GLU B CB   4 
ATOM   5032 C CG   . GLU B 1 10 ? 1.226   20.323  -6.602  1.00 0.00 ? 281 GLU B CG   4 
ATOM   5033 C CD   . GLU B 1 10 ? 0.084   19.380  -6.986  1.00 0.00 ? 281 GLU B CD   4 
ATOM   5034 O OE1  . GLU B 1 10 ? -0.174  19.248  -8.171  1.00 0.00 ? 281 GLU B OE1  4 
ATOM   5035 O OE2  . GLU B 1 10 ? -0.510  18.805  -6.089  1.00 0.00 ? 281 GLU B OE2  4 
ATOM   5036 H H    . GLU B 1 10 ? 4.340   20.401  -5.458  1.00 0.00 ? 281 GLU B H    4 
ATOM   5037 H HA   . GLU B 1 10 ? 2.340   18.382  -5.517  1.00 0.00 ? 281 GLU B HA   4 
ATOM   5038 H HB2  . GLU B 1 10 ? 3.245   20.584  -7.291  1.00 0.00 ? 281 GLU B HB2  4 
ATOM   5039 H HB3  . GLU B 1 10 ? 2.372   19.266  -8.075  1.00 0.00 ? 281 GLU B HB3  4 
ATOM   5040 H HG2  . GLU B 1 10 ? 1.281   20.405  -5.525  1.00 0.00 ? 281 GLU B HG2  4 
ATOM   5041 H HG3  . GLU B 1 10 ? 1.042   21.299  -7.028  1.00 0.00 ? 281 GLU B HG3  4 
ATOM   5042 N N    . GLU B 1 11 ? 5.081   17.822  -7.212  1.00 0.00 ? 282 GLU B N    4 
ATOM   5043 C CA   . GLU B 1 11 ? 5.800   16.765  -7.913  1.00 0.00 ? 282 GLU B CA   4 
ATOM   5044 C C    . GLU B 1 11 ? 6.029   15.604  -6.946  1.00 0.00 ? 282 GLU B C    4 
ATOM   5045 O O    . GLU B 1 11 ? 5.922   14.448  -7.308  1.00 0.00 ? 282 GLU B O    4 
ATOM   5046 C CB   . GLU B 1 11 ? 7.147   17.297  -8.406  1.00 0.00 ? 282 GLU B CB   4 
ATOM   5047 C CG   . GLU B 1 11 ? 7.070   17.576  -9.907  1.00 0.00 ? 282 GLU B CG   4 
ATOM   5048 C CD   . GLU B 1 11 ? 8.397   17.199  -10.566 1.00 0.00 ? 282 GLU B CD   4 
ATOM   5049 O OE1  . GLU B 1 11 ? 9.407   17.764  -10.183 1.00 0.00 ? 282 GLU B OE1  4 
ATOM   5050 O OE2  . GLU B 1 11 ? 8.379   16.352  -11.444 1.00 0.00 ? 282 GLU B OE2  4 
ATOM   5051 H H    . GLU B 1 11 ? 5.535   18.662  -6.991  1.00 0.00 ? 282 GLU B H    4 
ATOM   5052 H HA   . GLU B 1 11 ? 5.215   16.426  -8.755  1.00 0.00 ? 282 GLU B HA   4 
ATOM   5053 H HB2  . GLU B 1 11 ? 7.387   18.210  -7.878  1.00 0.00 ? 282 GLU B HB2  4 
ATOM   5054 H HB3  . GLU B 1 11 ? 7.915   16.561  -8.219  1.00 0.00 ? 282 GLU B HB3  4 
ATOM   5055 H HG2  . GLU B 1 11 ? 6.270   16.991  -10.340 1.00 0.00 ? 282 GLU B HG2  4 
ATOM   5056 H HG3  . GLU B 1 11 ? 6.875   18.626  -10.067 1.00 0.00 ? 282 GLU B HG3  4 
ATOM   5057 N N    . LYS B 1 12 ? 6.334   15.905  -5.715  1.00 0.00 ? 283 LYS B N    4 
ATOM   5058 C CA   . LYS B 1 12 ? 6.558   14.850  -4.738  1.00 0.00 ? 283 LYS B CA   4 
ATOM   5059 C C    . LYS B 1 12 ? 5.244   14.101  -4.507  1.00 0.00 ? 283 LYS B C    4 
ATOM   5060 O O    . LYS B 1 12 ? 5.227   12.903  -4.308  1.00 0.00 ? 283 LYS B O    4 
ATOM   5061 C CB   . LYS B 1 12 ? 7.036   15.468  -3.424  1.00 0.00 ? 283 LYS B CB   4 
ATOM   5062 C CG   . LYS B 1 12 ? 8.534   15.207  -3.253  1.00 0.00 ? 283 LYS B CG   4 
ATOM   5063 C CD   . LYS B 1 12 ? 8.943   15.504  -1.807  1.00 0.00 ? 283 LYS B CD   4 
ATOM   5064 C CE   . LYS B 1 12 ? 9.513   16.922  -1.718  1.00 0.00 ? 283 LYS B CE   4 
ATOM   5065 N NZ   . LYS B 1 12 ? 10.088  17.141  -0.362  1.00 0.00 ? 283 LYS B NZ   4 
ATOM   5066 H H    . LYS B 1 12 ? 6.408   16.845  -5.447  1.00 0.00 ? 283 LYS B H    4 
ATOM   5067 H HA   . LYS B 1 12 ? 7.306   14.165  -5.107  1.00 0.00 ? 283 LYS B HA   4 
ATOM   5068 H HB2  . LYS B 1 12 ? 6.855   16.534  -3.443  1.00 0.00 ? 283 LYS B HB2  4 
ATOM   5069 H HB3  . LYS B 1 12 ? 6.498   15.025  -2.600  1.00 0.00 ? 283 LYS B HB3  4 
ATOM   5070 H HG2  . LYS B 1 12 ? 8.747   14.173  -3.482  1.00 0.00 ? 283 LYS B HG2  4 
ATOM   5071 H HG3  . LYS B 1 12 ? 9.091   15.847  -3.919  1.00 0.00 ? 283 LYS B HG3  4 
ATOM   5072 H HD2  . LYS B 1 12 ? 8.078   15.420  -1.165  1.00 0.00 ? 283 LYS B HD2  4 
ATOM   5073 H HD3  . LYS B 1 12 ? 9.694   14.797  -1.494  1.00 0.00 ? 283 LYS B HD3  4 
ATOM   5074 H HE2  . LYS B 1 12 ? 10.284  17.046  -2.461  1.00 0.00 ? 283 LYS B HE2  4 
ATOM   5075 H HE3  . LYS B 1 12 ? 8.722   17.638  -1.896  1.00 0.00 ? 283 LYS B HE3  4 
ATOM   5076 H HZ1  . LYS B 1 12 ? 10.158  16.232  0.137   1.00 0.00 ? 283 LYS B HZ1  4 
ATOM   5077 H HZ2  . LYS B 1 12 ? 11.035  17.560  -0.450  1.00 0.00 ? 283 LYS B HZ2  4 
ATOM   5078 H HZ3  . LYS B 1 12 ? 9.471   17.786  0.175   1.00 0.00 ? 283 LYS B HZ3  4 
ATOM   5079 N N    . VAL B 1 13 ? 4.143   14.800  -4.540  1.00 0.00 ? 284 VAL B N    4 
ATOM   5080 C CA   . VAL B 1 13 ? 2.857   14.144  -4.336  1.00 0.00 ? 284 VAL B CA   4 
ATOM   5081 C C    . VAL B 1 13 ? 2.642   13.114  -5.444  1.00 0.00 ? 284 VAL B C    4 
ATOM   5082 O O    . VAL B 1 13 ? 2.401   11.951  -5.189  1.00 0.00 ? 284 VAL B O    4 
ATOM   5083 C CB   . VAL B 1 13 ? 1.737   15.184  -4.384  1.00 0.00 ? 284 VAL B CB   4 
ATOM   5084 C CG1  . VAL B 1 13 ? 0.389   14.498  -4.152  1.00 0.00 ? 284 VAL B CG1  4 
ATOM   5085 C CG2  . VAL B 1 13 ? 1.967   16.235  -3.294  1.00 0.00 ? 284 VAL B CG2  4 
ATOM   5086 H H    . VAL B 1 13 ? 4.179   15.765  -4.707  1.00 0.00 ? 284 VAL B H    4 
ATOM   5087 H HA   . VAL B 1 13 ? 2.851   13.652  -3.376  1.00 0.00 ? 284 VAL B HA   4 
ATOM   5088 H HB   . VAL B 1 13 ? 1.732   15.663  -5.353  1.00 0.00 ? 284 VAL B HB   4 
ATOM   5089 H HG11 . VAL B 1 13 ? 0.292   13.659  -4.825  1.00 0.00 ? 284 VAL B HG11 4 
ATOM   5090 H HG12 . VAL B 1 13 ? 0.337   14.147  -3.131  1.00 0.00 ? 284 VAL B HG12 4 
ATOM   5091 H HG13 . VAL B 1 13 ? -0.409  15.201  -4.332  1.00 0.00 ? 284 VAL B HG13 4 
ATOM   5092 H HG21 . VAL B 1 13 ? 3.023   16.301  -3.076  1.00 0.00 ? 284 VAL B HG21 4 
ATOM   5093 H HG22 . VAL B 1 13 ? 1.610   17.195  -3.639  1.00 0.00 ? 284 VAL B HG22 4 
ATOM   5094 H HG23 . VAL B 1 13 ? 1.432   15.951  -2.403  1.00 0.00 ? 284 VAL B HG23 4 
ATOM   5095 N N    . LYS B 1 14 ? 2.736   13.531  -6.678  1.00 0.00 ? 285 LYS B N    4 
ATOM   5096 C CA   . LYS B 1 14 ? 2.547   12.597  -7.778  1.00 0.00 ? 285 LYS B CA   4 
ATOM   5097 C C    . LYS B 1 14 ? 3.506   11.418  -7.607  1.00 0.00 ? 285 LYS B C    4 
ATOM   5098 O O    . LYS B 1 14 ? 3.134   10.274  -7.770  1.00 0.00 ? 285 LYS B O    4 
ATOM   5099 C CB   . LYS B 1 14 ? 2.835   13.305  -9.105  1.00 0.00 ? 285 LYS B CB   4 
ATOM   5100 C CG   . LYS B 1 14 ? 1.547   13.394  -9.926  1.00 0.00 ? 285 LYS B CG   4 
ATOM   5101 C CD   . LYS B 1 14 ? 0.468   14.106  -9.108  1.00 0.00 ? 285 LYS B CD   4 
ATOM   5102 C CE   . LYS B 1 14 ? -0.888  13.452  -9.373  1.00 0.00 ? 285 LYS B CE   4 
ATOM   5103 N NZ   . LYS B 1 14 ? -1.898  14.504  -9.683  1.00 0.00 ? 285 LYS B NZ   4 
ATOM   5104 H H    . LYS B 1 14 ? 2.934   14.473  -6.862  1.00 0.00 ? 285 LYS B H    4 
ATOM   5105 H HA   . LYS B 1 14 ? 1.529   12.238  -7.777  1.00 0.00 ? 285 LYS B HA   4 
ATOM   5106 H HB2  . LYS B 1 14 ? 3.207   14.300  -8.908  1.00 0.00 ? 285 LYS B HB2  4 
ATOM   5107 H HB3  . LYS B 1 14 ? 3.574   12.747  -9.659  1.00 0.00 ? 285 LYS B HB3  4 
ATOM   5108 H HG2  . LYS B 1 14 ? 1.737   13.951  -10.833 1.00 0.00 ? 285 LYS B HG2  4 
ATOM   5109 H HG3  . LYS B 1 14 ? 1.209   12.401  -10.177 1.00 0.00 ? 285 LYS B HG3  4 
ATOM   5110 H HD2  . LYS B 1 14 ? 0.706   14.032  -8.057  1.00 0.00 ? 285 LYS B HD2  4 
ATOM   5111 H HD3  . LYS B 1 14 ? 0.425   15.147  -9.395  1.00 0.00 ? 285 LYS B HD3  4 
ATOM   5112 H HE2  . LYS B 1 14 ? -0.805  12.775  -10.211 1.00 0.00 ? 285 LYS B HE2  4 
ATOM   5113 H HE3  . LYS B 1 14 ? -1.200  12.901  -8.496  1.00 0.00 ? 285 LYS B HE3  4 
ATOM   5114 H HZ1  . LYS B 1 14 ? -1.705  15.349  -9.106  1.00 0.00 ? 285 LYS B HZ1  4 
ATOM   5115 H HZ2  . LYS B 1 14 ? -1.841  14.751  -10.692 1.00 0.00 ? 285 LYS B HZ2  4 
ATOM   5116 H HZ3  . LYS B 1 14 ? -2.850  14.147  -9.465  1.00 0.00 ? 285 LYS B HZ3  4 
ATOM   5117 N N    . THR B 1 15 ? 4.738   11.691  -7.271  1.00 0.00 ? 286 THR B N    4 
ATOM   5118 C CA   . THR B 1 15 ? 5.697   10.609  -7.087  1.00 0.00 ? 286 THR B CA   4 
ATOM   5119 C C    . THR B 1 15 ? 5.147   9.627   -6.049  1.00 0.00 ? 286 THR B C    4 
ATOM   5120 O O    . THR B 1 15 ? 5.189   8.426   -6.229  1.00 0.00 ? 286 THR B O    4 
ATOM   5121 C CB   . THR B 1 15 ? 7.030   11.180  -6.598  1.00 0.00 ? 286 THR B CB   4 
ATOM   5122 O OG1  . THR B 1 15 ? 7.606   11.975  -7.625  1.00 0.00 ? 286 THR B OG1  4 
ATOM   5123 C CG2  . THR B 1 15 ? 7.980   10.034  -6.244  1.00 0.00 ? 286 THR B CG2  4 
ATOM   5124 H H    . THR B 1 15 ? 5.016   12.621  -7.141  1.00 0.00 ? 286 THR B H    4 
ATOM   5125 H HA   . THR B 1 15 ? 5.847   10.094  -8.024  1.00 0.00 ? 286 THR B HA   4 
ATOM   5126 H HB   . THR B 1 15 ? 6.863   11.787  -5.722  1.00 0.00 ? 286 THR B HB   4 
ATOM   5127 H HG1  . THR B 1 15 ? 8.298   12.509  -7.232  1.00 0.00 ? 286 THR B HG1  4 
ATOM   5128 H HG21 . THR B 1 15 ? 7.653   9.130   -6.735  1.00 0.00 ? 286 THR B HG21 4 
ATOM   5129 H HG22 . THR B 1 15 ? 8.979   10.281  -6.573  1.00 0.00 ? 286 THR B HG22 4 
ATOM   5130 H HG23 . THR B 1 15 ? 7.980   9.884   -5.174  1.00 0.00 ? 286 THR B HG23 4 
ATOM   5131 N N    . LEU B 1 16 ? 4.625   10.133  -4.965  1.00 0.00 ? 287 LEU B N    4 
ATOM   5132 C CA   . LEU B 1 16 ? 4.077   9.255   -3.939  1.00 0.00 ? 287 LEU B CA   4 
ATOM   5133 C C    . LEU B 1 16 ? 2.956   8.412   -4.551  1.00 0.00 ? 287 LEU B C    4 
ATOM   5134 O O    . LEU B 1 16 ? 2.963   7.199   -4.471  1.00 0.00 ? 287 LEU B O    4 
ATOM   5135 C CB   . LEU B 1 16 ? 3.514   10.094  -2.791  1.00 0.00 ? 287 LEU B CB   4 
ATOM   5136 C CG   . LEU B 1 16 ? 4.522   10.132  -1.642  1.00 0.00 ? 287 LEU B CG   4 
ATOM   5137 C CD1  . LEU B 1 16 ? 4.146   11.252  -0.671  1.00 0.00 ? 287 LEU B CD1  4 
ATOM   5138 C CD2  . LEU B 1 16 ? 4.505   8.792   -0.904  1.00 0.00 ? 287 LEU B CD2  4 
ATOM   5139 H H    . LEU B 1 16 ? 4.598   11.105  -4.843  1.00 0.00 ? 287 LEU B H    4 
ATOM   5140 H HA   . LEU B 1 16 ? 4.854   8.606   -3.566  1.00 0.00 ? 287 LEU B HA   4 
ATOM   5141 H HB2  . LEU B 1 16 ? 3.325   11.099  -3.139  1.00 0.00 ? 287 LEU B HB2  4 
ATOM   5142 H HB3  . LEU B 1 16 ? 2.591   9.655   -2.442  1.00 0.00 ? 287 LEU B HB3  4 
ATOM   5143 H HG   . LEU B 1 16 ? 5.511   10.316  -2.037  1.00 0.00 ? 287 LEU B HG   4 
ATOM   5144 H HD11 . LEU B 1 16 ? 3.613   12.026  -1.204  1.00 0.00 ? 287 LEU B HD11 4 
ATOM   5145 H HD12 . LEU B 1 16 ? 3.516   10.854  0.112   1.00 0.00 ? 287 LEU B HD12 4 
ATOM   5146 H HD13 . LEU B 1 16 ? 5.042   11.667  -0.234  1.00 0.00 ? 287 LEU B HD13 4 
ATOM   5147 H HD21 . LEU B 1 16 ? 3.963   8.065   -1.491  1.00 0.00 ? 287 LEU B HD21 4 
ATOM   5148 H HD22 . LEU B 1 16 ? 5.518   8.450   -0.753  1.00 0.00 ? 287 LEU B HD22 4 
ATOM   5149 H HD23 . LEU B 1 16 ? 4.021   8.915   0.052   1.00 0.00 ? 287 LEU B HD23 4 
ATOM   5150 N N    . LYS B 1 17 ? 1.997   9.047   -5.168  1.00 0.00 ? 288 LYS B N    4 
ATOM   5151 C CA   . LYS B 1 17 ? 0.903   8.300   -5.776  1.00 0.00 ? 288 LYS B CA   4 
ATOM   5152 C C    . LYS B 1 17 ? 1.480   7.159   -6.615  1.00 0.00 ? 288 LYS B C    4 
ATOM   5153 O O    . LYS B 1 17 ? 0.990   6.047   -6.591  1.00 0.00 ? 288 LYS B O    4 
ATOM   5154 C CB   . LYS B 1 17 ? 0.084   9.231   -6.672  1.00 0.00 ? 288 LYS B CB   4 
ATOM   5155 C CG   . LYS B 1 17 ? -1.344  9.335   -6.131  1.00 0.00 ? 288 LYS B CG   4 
ATOM   5156 C CD   . LYS B 1 17 ? -1.395  10.394  -5.027  1.00 0.00 ? 288 LYS B CD   4 
ATOM   5157 C CE   . LYS B 1 17 ? -1.881  11.720  -5.614  1.00 0.00 ? 288 LYS B CE   4 
ATOM   5158 N NZ   . LYS B 1 17 ? -3.259  12.005  -5.123  1.00 0.00 ? 288 LYS B NZ   4 
ATOM   5159 H H    . LYS B 1 17 ? 2.012   10.025  -5.224  1.00 0.00 ? 288 LYS B H    4 
ATOM   5160 H HA   . LYS B 1 17 ? 0.268   7.893   -5.004  1.00 0.00 ? 288 LYS B HA   4 
ATOM   5161 H HB2  . LYS B 1 17 ? 0.539   10.210  -6.684  1.00 0.00 ? 288 LYS B HB2  4 
ATOM   5162 H HB3  . LYS B 1 17 ? 0.058   8.834   -7.676  1.00 0.00 ? 288 LYS B HB3  4 
ATOM   5163 H HG2  . LYS B 1 17 ? -2.013  9.616   -6.931  1.00 0.00 ? 288 LYS B HG2  4 
ATOM   5164 H HG3  . LYS B 1 17 ? -1.647  8.381   -5.726  1.00 0.00 ? 288 LYS B HG3  4 
ATOM   5165 H HD2  . LYS B 1 17 ? -2.073  10.071  -4.251  1.00 0.00 ? 288 LYS B HD2  4 
ATOM   5166 H HD3  . LYS B 1 17 ? -0.408  10.527  -4.609  1.00 0.00 ? 288 LYS B HD3  4 
ATOM   5167 H HE2  . LYS B 1 17 ? -1.218  12.515  -5.305  1.00 0.00 ? 288 LYS B HE2  4 
ATOM   5168 H HE3  . LYS B 1 17 ? -1.890  11.656  -6.691  1.00 0.00 ? 288 LYS B HE3  4 
ATOM   5169 H HZ1  . LYS B 1 17 ? -3.401  11.544  -4.202  1.00 0.00 ? 288 LYS B HZ1  4 
ATOM   5170 H HZ2  . LYS B 1 17 ? -3.385  13.033  -5.021  1.00 0.00 ? 288 LYS B HZ2  4 
ATOM   5171 H HZ3  . LYS B 1 17 ? -3.951  11.637  -5.803  1.00 0.00 ? 288 LYS B HZ3  4 
ATOM   5172 N N    . ALA B 1 18 ? 2.522   7.425   -7.355  1.00 0.00 ? 289 ALA B N    4 
ATOM   5173 C CA   . ALA B 1 18 ? 3.122   6.378   -8.173  1.00 0.00 ? 289 ALA B CA   4 
ATOM   5174 C C    . ALA B 1 18 ? 3.469   5.184   -7.285  1.00 0.00 ? 289 ALA B C    4 
ATOM   5175 O O    . ALA B 1 18 ? 2.969   4.092   -7.469  1.00 0.00 ? 289 ALA B O    4 
ATOM   5176 C CB   . ALA B 1 18 ? 4.397   6.905   -8.828  1.00 0.00 ? 289 ALA B CB   4 
ATOM   5177 H H    . ALA B 1 18 ? 2.903   8.327   -7.358  1.00 0.00 ? 289 ALA B H    4 
ATOM   5178 H HA   . ALA B 1 18 ? 2.424   6.071   -8.937  1.00 0.00 ? 289 ALA B HA   4 
ATOM   5179 H HB1  . ALA B 1 18 ? 4.529   7.947   -8.575  1.00 0.00 ? 289 ALA B HB1  4 
ATOM   5180 H HB2  . ALA B 1 18 ? 5.244   6.338   -8.468  1.00 0.00 ? 289 ALA B HB2  4 
ATOM   5181 H HB3  . ALA B 1 18 ? 4.323   6.801   -9.901  1.00 0.00 ? 289 ALA B HB3  4 
ATOM   5182 N N    . GLN B 1 19 ? 4.328   5.384   -6.324  1.00 0.00 ? 290 GLN B N    4 
ATOM   5183 C CA   . GLN B 1 19 ? 4.701   4.287   -5.445  1.00 0.00 ? 290 GLN B CA   4 
ATOM   5184 C C    . GLN B 1 19 ? 3.439   3.577   -4.954  1.00 0.00 ? 290 GLN B C    4 
ATOM   5185 O O    . GLN B 1 19 ? 3.402   2.370   -4.826  1.00 0.00 ? 290 GLN B O    4 
ATOM   5186 C CB   . GLN B 1 19 ? 5.481   4.829   -4.247  1.00 0.00 ? 290 GLN B CB   4 
ATOM   5187 C CG   . GLN B 1 19 ? 6.819   5.402   -4.723  1.00 0.00 ? 290 GLN B CG   4 
ATOM   5188 C CD   . GLN B 1 19 ? 7.559   6.024   -3.538  1.00 0.00 ? 290 GLN B CD   4 
ATOM   5189 O OE1  . GLN B 1 19 ? 7.926   7.182   -3.576  1.00 0.00 ? 290 GLN B OE1  4 
ATOM   5190 N NE2  . GLN B 1 19 ? 7.797   5.297   -2.481  1.00 0.00 ? 290 GLN B NE2  4 
ATOM   5191 H H    . GLN B 1 19 ? 4.720   6.273   -6.192  1.00 0.00 ? 290 GLN B H    4 
ATOM   5192 H HA   . GLN B 1 19 ? 5.319   3.589   -5.990  1.00 0.00 ? 290 GLN B HA   4 
ATOM   5193 H HB2  . GLN B 1 19 ? 4.907   5.607   -3.765  1.00 0.00 ? 290 GLN B HB2  4 
ATOM   5194 H HB3  . GLN B 1 19 ? 5.666   4.029   -3.545  1.00 0.00 ? 290 GLN B HB3  4 
ATOM   5195 H HG2  . GLN B 1 19 ? 7.417   4.610   -5.148  1.00 0.00 ? 290 GLN B HG2  4 
ATOM   5196 H HG3  . GLN B 1 19 ? 6.640   6.160   -5.471  1.00 0.00 ? 290 GLN B HG3  4 
ATOM   5197 H HE21 . GLN B 1 19 ? 7.502   4.363   -2.450  1.00 0.00 ? 290 GLN B HE21 4 
ATOM   5198 H HE22 . GLN B 1 19 ? 8.271   5.685   -1.715  1.00 0.00 ? 290 GLN B HE22 4 
ATOM   5199 N N    . ASN B 1 20 ? 2.398   4.318   -4.682  1.00 0.00 ? 291 ASN B N    4 
ATOM   5200 C CA   . ASN B 1 20 ? 1.166   3.696   -4.214  1.00 0.00 ? 291 ASN B CA   4 
ATOM   5201 C C    . ASN B 1 20 ? 0.680   2.695   -5.265  1.00 0.00 ? 291 ASN B C    4 
ATOM   5202 O O    . ASN B 1 20 ? 0.327   1.575   -4.953  1.00 0.00 ? 291 ASN B O    4 
ATOM   5203 C CB   . ASN B 1 20 ? 0.098   4.771   -3.996  1.00 0.00 ? 291 ASN B CB   4 
ATOM   5204 C CG   . ASN B 1 20 ? -0.166  4.928   -2.497  1.00 0.00 ? 291 ASN B CG   4 
ATOM   5205 O OD1  . ASN B 1 20 ? -1.101  4.358   -1.970  1.00 0.00 ? 291 ASN B OD1  4 
ATOM   5206 N ND2  . ASN B 1 20 ? 0.625   5.682   -1.782  1.00 0.00 ? 291 ASN B ND2  4 
ATOM   5207 H H    . ASN B 1 20 ? 2.445   5.291   -4.794  1.00 0.00 ? 291 ASN B H    4 
ATOM   5208 H HA   . ASN B 1 20 ? 1.353   3.181   -3.285  1.00 0.00 ? 291 ASN B HA   4 
ATOM   5209 H HB2  . ASN B 1 20 ? 0.446   5.710   -4.402  1.00 0.00 ? 291 ASN B HB2  4 
ATOM   5210 H HB3  . ASN B 1 20 ? -0.815  4.479   -4.493  1.00 0.00 ? 291 ASN B HB3  4 
ATOM   5211 H HD21 . ASN B 1 20 ? 1.379   6.139   -2.206  1.00 0.00 ? 291 ASN B HD21 4 
ATOM   5212 H HD22 . ASN B 1 20 ? 0.463   5.788   -0.821  1.00 0.00 ? 291 ASN B HD22 4 
ATOM   5213 N N    . SER B 1 21 ? 0.668   3.087   -6.509  1.00 0.00 ? 292 SER B N    4 
ATOM   5214 C CA   . SER B 1 21 ? 0.225   2.174   -7.557  1.00 0.00 ? 292 SER B CA   4 
ATOM   5215 C C    . SER B 1 21 ? 1.201   1.000   -7.641  1.00 0.00 ? 292 SER B C    4 
ATOM   5216 O O    . SER B 1 21 ? 0.833   -0.105  -7.988  1.00 0.00 ? 292 SER B O    4 
ATOM   5217 C CB   . SER B 1 21 ? 0.191   2.908   -8.896  1.00 0.00 ? 292 SER B CB   4 
ATOM   5218 O OG   . SER B 1 21 ? -1.116  3.421   -9.120  1.00 0.00 ? 292 SER B OG   4 
ATOM   5219 H H    . SER B 1 21 ? 0.964   3.991   -6.741  1.00 0.00 ? 292 SER B H    4 
ATOM   5220 H HA   . SER B 1 21 ? -0.763  1.807   -7.321  1.00 0.00 ? 292 SER B HA   4 
ATOM   5221 H HB2  . SER B 1 21 ? 0.894   3.725   -8.881  1.00 0.00 ? 292 SER B HB2  4 
ATOM   5222 H HB3  . SER B 1 21 ? 0.459   2.220   -9.689  1.00 0.00 ? 292 SER B HB3  4 
ATOM   5223 H HG   . SER B 1 21 ? -1.107  3.903   -9.951  1.00 0.00 ? 292 SER B HG   4 
ATOM   5224 N N    . GLU B 1 22 ? 2.445   1.233   -7.323  1.00 0.00 ? 293 GLU B N    4 
ATOM   5225 C CA   . GLU B 1 22 ? 3.431   0.160   -7.379  1.00 0.00 ? 293 GLU B CA   4 
ATOM   5226 C C    . GLU B 1 22 ? 3.157   -0.837  -6.249  1.00 0.00 ? 293 GLU B C    4 
ATOM   5227 O O    . GLU B 1 22 ? 3.080   -2.029  -6.466  1.00 0.00 ? 293 GLU B O    4 
ATOM   5228 C CB   . GLU B 1 22 ? 4.833   0.747   -7.211  1.00 0.00 ? 293 GLU B CB   4 
ATOM   5229 C CG   . GLU B 1 22 ? 5.277   1.394   -8.524  1.00 0.00 ? 293 GLU B CG   4 
ATOM   5230 C CD   . GLU B 1 22 ? 6.801   1.334   -8.632  1.00 0.00 ? 293 GLU B CD   4 
ATOM   5231 O OE1  . GLU B 1 22 ? 7.443   1.177   -7.606  1.00 0.00 ? 293 GLU B OE1  4 
ATOM   5232 O OE2  . GLU B 1 22 ? 7.303   1.447   -9.738  1.00 0.00 ? 293 GLU B OE2  4 
ATOM   5233 H H    . GLU B 1 22 ? 2.718   2.132   -7.044  1.00 0.00 ? 293 GLU B H    4 
ATOM   5234 H HA   . GLU B 1 22 ? 3.363   -0.345  -8.330  1.00 0.00 ? 293 GLU B HA   4 
ATOM   5235 H HB2  . GLU B 1 22 ? 4.818   1.493   -6.428  1.00 0.00 ? 293 GLU B HB2  4 
ATOM   5236 H HB3  . GLU B 1 22 ? 5.523   -0.038  -6.946  1.00 0.00 ? 293 GLU B HB3  4 
ATOM   5237 H HG2  . GLU B 1 22 ? 4.835   0.860   -9.354  1.00 0.00 ? 293 GLU B HG2  4 
ATOM   5238 H HG3  . GLU B 1 22 ? 4.956   2.424   -8.547  1.00 0.00 ? 293 GLU B HG3  4 
ATOM   5239 N N    . LEU B 1 23 ? 3.013   -0.354  -5.046  1.00 0.00 ? 294 LEU B N    4 
ATOM   5240 C CA   . LEU B 1 23 ? 2.753   -1.251  -3.925  1.00 0.00 ? 294 LEU B CA   4 
ATOM   5241 C C    . LEU B 1 23 ? 1.390   -1.923  -4.116  1.00 0.00 ? 294 LEU B C    4 
ATOM   5242 O O    . LEU B 1 23 ? 1.216   -3.088  -3.819  1.00 0.00 ? 294 LEU B O    4 
ATOM   5243 C CB   . LEU B 1 23 ? 2.749   -0.448  -2.624  1.00 0.00 ? 294 LEU B CB   4 
ATOM   5244 C CG   . LEU B 1 23 ? 4.101   -0.599  -1.924  1.00 0.00 ? 294 LEU B CG   4 
ATOM   5245 C CD1  . LEU B 1 23 ? 4.525   0.749   -1.338  1.00 0.00 ? 294 LEU B CD1  4 
ATOM   5246 C CD2  . LEU B 1 23 ? 3.981   -1.629  -0.799  1.00 0.00 ? 294 LEU B CD2  4 
ATOM   5247 H H    . LEU B 1 23 ? 3.080   0.610   -4.893  1.00 0.00 ? 294 LEU B H    4 
ATOM   5248 H HA   . LEU B 1 23 ? 3.524   -2.005  -3.880  1.00 0.00 ? 294 LEU B HA   4 
ATOM   5249 H HB2  . LEU B 1 23 ? 2.570   0.593   -2.845  1.00 0.00 ? 294 LEU B HB2  4 
ATOM   5250 H HB3  . LEU B 1 23 ? 1.968   -0.818  -1.977  1.00 0.00 ? 294 LEU B HB3  4 
ATOM   5251 H HG   . LEU B 1 23 ? 4.840   -0.930  -2.639  1.00 0.00 ? 294 LEU B HG   4 
ATOM   5252 H HD11 . LEU B 1 23 ? 3.668   1.239   -0.901  1.00 0.00 ? 294 LEU B HD11 4 
ATOM   5253 H HD12 . LEU B 1 23 ? 5.276   0.591   -0.578  1.00 0.00 ? 294 LEU B HD12 4 
ATOM   5254 H HD13 . LEU B 1 23 ? 4.934   1.369   -2.123  1.00 0.00 ? 294 LEU B HD13 4 
ATOM   5255 H HD21 . LEU B 1 23 ? 3.031   -1.503  -0.296  1.00 0.00 ? 294 LEU B HD21 4 
ATOM   5256 H HD22 . LEU B 1 23 ? 4.041   -2.623  -1.213  1.00 0.00 ? 294 LEU B HD22 4 
ATOM   5257 H HD23 . LEU B 1 23 ? 4.784   -1.483  -0.091  1.00 0.00 ? 294 LEU B HD23 4 
ATOM   5258 N N    . ALA B 1 24 ? 0.423   -1.197  -4.607  1.00 0.00 ? 295 ALA B N    4 
ATOM   5259 C CA   . ALA B 1 24 ? -0.896  -1.782  -4.810  1.00 0.00 ? 295 ALA B CA   4 
ATOM   5260 C C    . ALA B 1 24 ? -0.805  -2.897  -5.853  1.00 0.00 ? 295 ALA B C    4 
ATOM   5261 O O    . ALA B 1 24 ? -1.333  -3.975  -5.669  1.00 0.00 ? 295 ALA B O    4 
ATOM   5262 C CB   . ALA B 1 24 ? -1.862  -0.701  -5.302  1.00 0.00 ? 295 ALA B CB   4 
ATOM   5263 H H    . ALA B 1 24 ? 0.584   -0.258  -4.839  1.00 0.00 ? 295 ALA B H    4 
ATOM   5264 H HA   . ALA B 1 24 ? -1.259  -2.187  -3.877  1.00 0.00 ? 295 ALA B HA   4 
ATOM   5265 H HB1  . ALA B 1 24 ? -1.302  0.124   -5.714  1.00 0.00 ? 295 ALA B HB1  4 
ATOM   5266 H HB2  . ALA B 1 24 ? -2.507  -1.115  -6.063  1.00 0.00 ? 295 ALA B HB2  4 
ATOM   5267 H HB3  . ALA B 1 24 ? -2.461  -0.352  -4.474  1.00 0.00 ? 295 ALA B HB3  4 
ATOM   5268 N N    . SER B 1 25 ? -0.137  -2.646  -6.947  1.00 0.00 ? 296 SER B N    4 
ATOM   5269 C CA   . SER B 1 25 ? -0.015  -3.670  -7.977  1.00 0.00 ? 296 SER B CA   4 
ATOM   5270 C C    . SER B 1 25 ? 0.778   -4.858  -7.427  1.00 0.00 ? 296 SER B C    4 
ATOM   5271 O O    . SER B 1 25 ? 0.386   -5.999  -7.566  1.00 0.00 ? 296 SER B O    4 
ATOM   5272 C CB   . SER B 1 25 ? 0.713   -3.089  -9.190  1.00 0.00 ? 296 SER B CB   4 
ATOM   5273 O OG   . SER B 1 25 ? 0.341   -3.812  -10.355 1.00 0.00 ? 296 SER B OG   4 
ATOM   5274 H H    . SER B 1 25 ? 0.280   -1.769  -7.074  1.00 0.00 ? 296 SER B H    4 
ATOM   5275 H HA   . SER B 1 25 ? -0.998  -4.001  -8.276  1.00 0.00 ? 296 SER B HA   4 
ATOM   5276 H HB2  . SER B 1 25 ? 0.441   -2.054  -9.312  1.00 0.00 ? 296 SER B HB2  4 
ATOM   5277 H HB3  . SER B 1 25 ? 1.782   -3.160  -9.033  1.00 0.00 ? 296 SER B HB3  4 
ATOM   5278 H HG   . SER B 1 25 ? 1.095   -3.821  -10.951 1.00 0.00 ? 296 SER B HG   4 
ATOM   5279 N N    . THR B 1 26 ? 1.896   -4.598  -6.805  1.00 0.00 ? 297 THR B N    4 
ATOM   5280 C CA   . THR B 1 26 ? 2.701   -5.685  -6.261  1.00 0.00 ? 297 THR B CA   4 
ATOM   5281 C C    . THR B 1 26 ? 1.866   -6.498  -5.269  1.00 0.00 ? 297 THR B C    4 
ATOM   5282 O O    . THR B 1 26 ? 1.766   -7.704  -5.372  1.00 0.00 ? 297 THR B O    4 
ATOM   5283 C CB   . THR B 1 26 ? 3.924   -5.104  -5.545  1.00 0.00 ? 297 THR B CB   4 
ATOM   5284 O OG1  . THR B 1 26 ? 4.641   -4.268  -6.441  1.00 0.00 ? 297 THR B OG1  4 
ATOM   5285 C CG2  . THR B 1 26 ? 4.827   -6.244  -5.070  1.00 0.00 ? 297 THR B CG2  4 
ATOM   5286 H H    . THR B 1 26 ? 2.197   -3.669  -6.706  1.00 0.00 ? 297 THR B H    4 
ATOM   5287 H HA   . THR B 1 26 ? 3.030   -6.326  -7.064  1.00 0.00 ? 297 THR B HA   4 
ATOM   5288 H HB   . THR B 1 26 ? 3.602   -4.527  -4.693  1.00 0.00 ? 297 THR B HB   4 
ATOM   5289 H HG1  . THR B 1 26 ? 4.271   -3.385  -6.384  1.00 0.00 ? 297 THR B HG1  4 
ATOM   5290 H HG21 . THR B 1 26 ? 4.340   -7.190  -5.253  1.00 0.00 ? 297 THR B HG21 4 
ATOM   5291 H HG22 . THR B 1 26 ? 5.762   -6.209  -5.611  1.00 0.00 ? 297 THR B HG22 4 
ATOM   5292 H HG23 . THR B 1 26 ? 5.018   -6.134  -4.013  1.00 0.00 ? 297 THR B HG23 4 
ATOM   5293 N N    . ALA B 1 27 ? 1.266   -5.849  -4.310  1.00 0.00 ? 298 ALA B N    4 
ATOM   5294 C CA   . ALA B 1 27 ? 0.459   -6.570  -3.336  1.00 0.00 ? 298 ALA B CA   4 
ATOM   5295 C C    . ALA B 1 27 ? -0.520  -7.494  -4.065  1.00 0.00 ? 298 ALA B C    4 
ATOM   5296 O O    . ALA B 1 27 ? -0.573  -8.682  -3.810  1.00 0.00 ? 298 ALA B O    4 
ATOM   5297 C CB   . ALA B 1 27 ? -0.324  -5.572  -2.479  1.00 0.00 ? 298 ALA B CB   4 
ATOM   5298 H H    . ALA B 1 27 ? 1.361   -4.876  -4.245  1.00 0.00 ? 298 ALA B H    4 
ATOM   5299 H HA   . ALA B 1 27 ? 1.102   -7.158  -2.699  1.00 0.00 ? 298 ALA B HA   4 
ATOM   5300 H HB1  . ALA B 1 27 ? -0.041  -4.564  -2.752  1.00 0.00 ? 298 ALA B HB1  4 
ATOM   5301 H HB2  . ALA B 1 27 ? -1.382  -5.705  -2.647  1.00 0.00 ? 298 ALA B HB2  4 
ATOM   5302 H HB3  . ALA B 1 27 ? -0.101  -5.738  -1.437  1.00 0.00 ? 298 ALA B HB3  4 
ATOM   5303 N N    . ASN B 1 28 ? -1.295  -6.962  -4.968  1.00 0.00 ? 299 ASN B N    4 
ATOM   5304 C CA   . ASN B 1 28 ? -2.247  -7.794  -5.694  1.00 0.00 ? 299 ASN B CA   4 
ATOM   5305 C C    . ASN B 1 28 ? -1.513  -8.977  -6.327  1.00 0.00 ? 299 ASN B C    4 
ATOM   5306 O O    . ASN B 1 28 ? -2.023  -10.078 -6.384  1.00 0.00 ? 299 ASN B O    4 
ATOM   5307 C CB   . ASN B 1 28 ? -2.920  -6.963  -6.790  1.00 0.00 ? 299 ASN B CB   4 
ATOM   5308 C CG   . ASN B 1 28 ? -4.137  -6.239  -6.209  1.00 0.00 ? 299 ASN B CG   4 
ATOM   5309 O OD1  . ASN B 1 28 ? -4.228  -6.043  -5.014  1.00 0.00 ? 299 ASN B OD1  4 
ATOM   5310 N ND2  . ASN B 1 28 ? -5.081  -5.832  -7.011  1.00 0.00 ? 299 ASN B ND2  4 
ATOM   5311 H H    . ASN B 1 28 ? -1.237  -6.002  -5.159  1.00 0.00 ? 299 ASN B H    4 
ATOM   5312 H HA   . ASN B 1 28 ? -2.999  -8.159  -5.012  1.00 0.00 ? 299 ASN B HA   4 
ATOM   5313 H HB2  . ASN B 1 28 ? -2.217  -6.238  -7.173  1.00 0.00 ? 299 ASN B HB2  4 
ATOM   5314 H HB3  . ASN B 1 28 ? -3.239  -7.614  -7.590  1.00 0.00 ? 299 ASN B HB3  4 
ATOM   5315 H HD21 . ASN B 1 28 ? -5.008  -5.989  -7.976  1.00 0.00 ? 299 ASN B HD21 4 
ATOM   5316 H HD22 . ASN B 1 28 ? -5.865  -5.367  -6.650  1.00 0.00 ? 299 ASN B HD22 4 
ATOM   5317 N N    . MET B 1 29 ? -0.319  -8.759  -6.803  1.00 0.00 ? 300 MET B N    4 
ATOM   5318 C CA   . MET B 1 29 ? 0.433   -9.847  -7.420  1.00 0.00 ? 300 MET B CA   4 
ATOM   5319 C C    . MET B 1 29 ? 0.652   -10.960 -6.392  1.00 0.00 ? 300 MET B C    4 
ATOM   5320 O O    . MET B 1 29 ? 0.522   -12.131 -6.694  1.00 0.00 ? 300 MET B O    4 
ATOM   5321 C CB   . MET B 1 29 ? 1.786   -9.324  -7.902  1.00 0.00 ? 300 MET B CB   4 
ATOM   5322 C CG   . MET B 1 29 ? 1.878   -9.470  -9.423  1.00 0.00 ? 300 MET B CG   4 
ATOM   5323 S SD   . MET B 1 29 ? 3.241   -8.453  -10.044 1.00 0.00 ? 300 MET B SD   4 
ATOM   5324 C CE   . MET B 1 29 ? 4.458   -9.781  -10.211 1.00 0.00 ? 300 MET B CE   4 
ATOM   5325 H H    . MET B 1 29 ? 0.075   -7.864  -6.747  1.00 0.00 ? 300 MET B H    4 
ATOM   5326 H HA   . MET B 1 29 ? -0.123  -10.237 -8.259  1.00 0.00 ? 300 MET B HA   4 
ATOM   5327 H HB2  . MET B 1 29 ? 1.888   -8.283  -7.634  1.00 0.00 ? 300 MET B HB2  4 
ATOM   5328 H HB3  . MET B 1 29 ? 2.579   -9.895  -7.440  1.00 0.00 ? 300 MET B HB3  4 
ATOM   5329 H HG2  . MET B 1 29 ? 2.058   -10.505 -9.675  1.00 0.00 ? 300 MET B HG2  4 
ATOM   5330 H HG3  . MET B 1 29 ? 0.952   -9.146  -9.872  1.00 0.00 ? 300 MET B HG3  4 
ATOM   5331 H HE1  . MET B 1 29 ? 3.987   -10.728 -9.989  1.00 0.00 ? 300 MET B HE1  4 
ATOM   5332 H HE2  . MET B 1 29 ? 4.843   -9.790  -11.222 1.00 0.00 ? 300 MET B HE2  4 
ATOM   5333 H HE3  . MET B 1 29 ? 5.270   -9.616  -9.522  1.00 0.00 ? 300 MET B HE3  4 
ATOM   5334 N N    . LEU B 1 30 ? 0.984   -10.606 -5.181  1.00 0.00 ? 301 LEU B N    4 
ATOM   5335 C CA   . LEU B 1 30 ? 1.209   -11.620 -4.159  1.00 0.00 ? 301 LEU B CA   4 
ATOM   5336 C C    . LEU B 1 30 ? -0.119  -12.287 -3.792  1.00 0.00 ? 301 LEU B C    4 
ATOM   5337 O O    . LEU B 1 30 ? -0.151  -13.399 -3.309  1.00 0.00 ? 301 LEU B O    4 
ATOM   5338 C CB   . LEU B 1 30 ? 1.808   -10.965 -2.913  1.00 0.00 ? 301 LEU B CB   4 
ATOM   5339 C CG   . LEU B 1 30 ? 3.052   -10.162 -3.302  1.00 0.00 ? 301 LEU B CG   4 
ATOM   5340 C CD1  . LEU B 1 30 ? 3.513   -9.328  -2.106  1.00 0.00 ? 301 LEU B CD1  4 
ATOM   5341 C CD2  . LEU B 1 30 ? 4.169   -11.122 -3.716  1.00 0.00 ? 301 LEU B CD2  4 
ATOM   5342 H H    . LEU B 1 30 ? 1.082   -9.656  -4.959  1.00 0.00 ? 301 LEU B H    4 
ATOM   5343 H HA   . LEU B 1 30 ? 1.893   -12.365 -4.535  1.00 0.00 ? 301 LEU B HA   4 
ATOM   5344 H HB2  . LEU B 1 30 ? 1.078   -10.306 -2.465  1.00 0.00 ? 301 LEU B HB2  4 
ATOM   5345 H HB3  . LEU B 1 30 ? 2.085   -11.730 -2.201  1.00 0.00 ? 301 LEU B HB3  4 
ATOM   5346 H HG   . LEU B 1 30 ? 2.812   -9.506  -4.126  1.00 0.00 ? 301 LEU B HG   4 
ATOM   5347 H HD11 . LEU B 1 30 ? 2.749   -9.335  -1.343  1.00 0.00 ? 301 LEU B HD11 4 
ATOM   5348 H HD12 . LEU B 1 30 ? 4.425   -9.747  -1.705  1.00 0.00 ? 301 LEU B HD12 4 
ATOM   5349 H HD13 . LEU B 1 30 ? 3.695   -8.311  -2.425  1.00 0.00 ? 301 LEU B HD13 4 
ATOM   5350 H HD21 . LEU B 1 30 ? 4.092   -12.033 -3.140  1.00 0.00 ? 301 LEU B HD21 4 
ATOM   5351 H HD22 . LEU B 1 30 ? 4.074   -11.351 -4.766  1.00 0.00 ? 301 LEU B HD22 4 
ATOM   5352 H HD23 . LEU B 1 30 ? 5.127   -10.659 -3.531  1.00 0.00 ? 301 LEU B HD23 4 
ATOM   5353 N N    . ARG B 1 31 ? -1.215  -11.613 -4.014  1.00 0.00 ? 302 ARG B N    4 
ATOM   5354 C CA   . ARG B 1 31 ? -2.508  -12.197 -3.678  1.00 0.00 ? 302 ARG B CA   4 
ATOM   5355 C C    . ARG B 1 31 ? -2.940  -13.172 -4.776  1.00 0.00 ? 302 ARG B C    4 
ATOM   5356 O O    . ARG B 1 31 ? -3.293  -14.305 -4.509  1.00 0.00 ? 302 ARG B O    4 
ATOM   5357 C CB   . ARG B 1 31 ? -3.550  -11.085 -3.549  1.00 0.00 ? 302 ARG B CB   4 
ATOM   5358 C CG   . ARG B 1 31 ? -4.120  -11.079 -2.129  1.00 0.00 ? 302 ARG B CG   4 
ATOM   5359 C CD   . ARG B 1 31 ? -5.621  -10.786 -2.179  1.00 0.00 ? 302 ARG B CD   4 
ATOM   5360 N NE   . ARG B 1 31 ? -6.312  -11.630 -1.213  1.00 0.00 ? 302 ARG B NE   4 
ATOM   5361 C CZ   . ARG B 1 31 ? -7.538  -11.350 -0.860  1.00 0.00 ? 302 ARG B CZ   4 
ATOM   5362 N NH1  . ARG B 1 31 ? -8.534  -11.700 -1.628  1.00 0.00 ? 302 ARG B NH1  4 
ATOM   5363 N NH2  . ARG B 1 31 ? -7.768  -10.720 0.260   1.00 0.00 ? 302 ARG B NH2  4 
ATOM   5364 H H    . ARG B 1 31 ? -1.168  -10.714 -4.402  1.00 0.00 ? 302 ARG B H    4 
ATOM   5365 H HA   . ARG B 1 31 ? -2.432  -12.724 -2.740  1.00 0.00 ? 302 ARG B HA   4 
ATOM   5366 H HB2  . ARG B 1 31 ? -3.087  -10.132 -3.758  1.00 0.00 ? 302 ARG B HB2  4 
ATOM   5367 H HB3  . ARG B 1 31 ? -4.350  -11.260 -4.253  1.00 0.00 ? 302 ARG B HB3  4 
ATOM   5368 H HG2  . ARG B 1 31 ? -3.956  -12.044 -1.670  1.00 0.00 ? 302 ARG B HG2  4 
ATOM   5369 H HG3  . ARG B 1 31 ? -3.626  -10.316 -1.546  1.00 0.00 ? 302 ARG B HG3  4 
ATOM   5370 H HD2  . ARG B 1 31 ? -5.794  -9.748  -1.939  1.00 0.00 ? 302 ARG B HD2  4 
ATOM   5371 H HD3  . ARG B 1 31 ? -5.994  -10.994 -3.173  1.00 0.00 ? 302 ARG B HD3  4 
ATOM   5372 H HE   . ARG B 1 31 ? -5.858  -12.408 -0.828  1.00 0.00 ? 302 ARG B HE   4 
ATOM   5373 H HH11 . ARG B 1 31 ? -8.357  -12.183 -2.487  1.00 0.00 ? 302 ARG B HH11 4 
ATOM   5374 H HH12 . ARG B 1 31 ? -9.473  -11.486 -1.357  1.00 0.00 ? 302 ARG B HH12 4 
ATOM   5375 H HH21 . ARG B 1 31 ? -7.005  -10.452 0.848   1.00 0.00 ? 302 ARG B HH21 4 
ATOM   5376 H HH22 . ARG B 1 31 ? -8.706  -10.506 0.529   1.00 0.00 ? 302 ARG B HH22 4 
ATOM   5377 N N    . GLU B 1 32 ? -2.923  -12.744 -6.008  1.00 0.00 ? 303 GLU B N    4 
ATOM   5378 C CA   . GLU B 1 32 ? -3.331  -13.628 -7.094  1.00 0.00 ? 303 GLU B CA   4 
ATOM   5379 C C    . GLU B 1 32 ? -2.418  -14.856 -7.135  1.00 0.00 ? 303 GLU B C    4 
ATOM   5380 O O    . GLU B 1 32 ? -2.829  -15.934 -7.517  1.00 0.00 ? 303 GLU B O    4 
ATOM   5381 C CB   . GLU B 1 32 ? -3.242  -12.878 -8.424  1.00 0.00 ? 303 GLU B CB   4 
ATOM   5382 C CG   . GLU B 1 32 ? -1.775  -12.596 -8.757  1.00 0.00 ? 303 GLU B CG   4 
ATOM   5383 C CD   . GLU B 1 32 ? -1.694  -11.753 -10.031 1.00 0.00 ? 303 GLU B CD   4 
ATOM   5384 O OE1  . GLU B 1 32 ? -2.692  -11.673 -10.729 1.00 0.00 ? 303 GLU B OE1  4 
ATOM   5385 O OE2  . GLU B 1 32 ? -0.636  -11.201 -10.286 1.00 0.00 ? 303 GLU B OE2  4 
ATOM   5386 H H    . GLU B 1 32 ? -2.640  -11.826 -6.204  1.00 0.00 ? 303 GLU B H    4 
ATOM   5387 H HA   . GLU B 1 32 ? -4.352  -13.946 -6.932  1.00 0.00 ? 303 GLU B HA   4 
ATOM   5388 H HB2  . GLU B 1 32 ? -3.679  -13.480 -9.207  1.00 0.00 ? 303 GLU B HB2  4 
ATOM   5389 H HB3  . GLU B 1 32 ? -3.777  -11.944 -8.348  1.00 0.00 ? 303 GLU B HB3  4 
ATOM   5390 H HG2  . GLU B 1 32 ? -1.318  -12.059 -7.937  1.00 0.00 ? 303 GLU B HG2  4 
ATOM   5391 H HG3  . GLU B 1 32 ? -1.255  -13.529 -8.911  1.00 0.00 ? 303 GLU B HG3  4 
ATOM   5392 N N    . GLN B 1 33 ? -1.179  -14.704 -6.751  1.00 0.00 ? 304 GLN B N    4 
ATOM   5393 C CA   . GLN B 1 33 ? -0.267  -15.844 -6.777  1.00 0.00 ? 304 GLN B CA   4 
ATOM   5394 C C    . GLN B 1 33 ? -0.537  -16.744 -5.571  1.00 0.00 ? 304 GLN B C    4 
ATOM   5395 O O    . GLN B 1 33 ? -0.536  -17.955 -5.678  1.00 0.00 ? 304 GLN B O    4 
ATOM   5396 C CB   . GLN B 1 33 ? 1.178   -15.347 -6.737  1.00 0.00 ? 304 GLN B CB   4 
ATOM   5397 C CG   . GLN B 1 33 ? 1.486   -14.775 -5.353  1.00 0.00 ? 304 GLN B CG   4 
ATOM   5398 C CD   . GLN B 1 33 ? 2.943   -14.309 -5.304  1.00 0.00 ? 304 GLN B CD   4 
ATOM   5399 O OE1  . GLN B 1 33 ? 3.518   -14.192 -4.240  1.00 0.00 ? 304 GLN B OE1  4 
ATOM   5400 N NE2  . GLN B 1 33 ? 3.569   -14.038 -6.417  1.00 0.00 ? 304 GLN B NE2  4 
ATOM   5401 H H    . GLN B 1 33 ? -0.862  -13.828 -6.448  1.00 0.00 ? 304 GLN B H    4 
ATOM   5402 H HA   . GLN B 1 33 ? -0.426  -16.406 -7.686  1.00 0.00 ? 304 GLN B HA   4 
ATOM   5403 H HB2  . GLN B 1 33 ? 1.847   -16.170 -6.945  1.00 0.00 ? 304 GLN B HB2  4 
ATOM   5404 H HB3  . GLN B 1 33 ? 1.313   -14.576 -7.481  1.00 0.00 ? 304 GLN B HB3  4 
ATOM   5405 H HG2  . GLN B 1 33 ? 0.833   -13.937 -5.157  1.00 0.00 ? 304 GLN B HG2  4 
ATOM   5406 H HG3  . GLN B 1 33 ? 1.328   -15.536 -4.605  1.00 0.00 ? 304 GLN B HG3  4 
ATOM   5407 H HE21 . GLN B 1 33 ? 3.106   -14.131 -7.275  1.00 0.00 ? 304 GLN B HE21 4 
ATOM   5408 H HE22 . GLN B 1 33 ? 4.501   -13.738 -6.393  1.00 0.00 ? 304 GLN B HE22 4 
ATOM   5409 N N    . VAL B 1 34 ? -0.772  -16.168 -4.424  1.00 0.00 ? 305 VAL B N    4 
ATOM   5410 C CA   . VAL B 1 34 ? -1.040  -16.981 -3.243  1.00 0.00 ? 305 VAL B CA   4 
ATOM   5411 C C    . VAL B 1 34 ? -2.262  -17.864 -3.506  1.00 0.00 ? 305 VAL B C    4 
ATOM   5412 O O    . VAL B 1 34 ? -2.234  -19.059 -3.292  1.00 0.00 ? 305 VAL B O    4 
ATOM   5413 C CB   . VAL B 1 34 ? -1.313  -16.071 -2.044  1.00 0.00 ? 305 VAL B CB   4 
ATOM   5414 C CG1  . VAL B 1 34 ? -1.809  -16.913 -0.867  1.00 0.00 ? 305 VAL B CG1  4 
ATOM   5415 C CG2  . VAL B 1 34 ? -0.022  -15.354 -1.647  1.00 0.00 ? 305 VAL B CG2  4 
ATOM   5416 H H    . VAL B 1 34 ? -0.772  -15.191 -4.357  1.00 0.00 ? 305 VAL B H    4 
ATOM   5417 H HA   . VAL B 1 34 ? -0.185  -17.607 -3.032  1.00 0.00 ? 305 VAL B HA   4 
ATOM   5418 H HB   . VAL B 1 34 ? -2.066  -15.342 -2.308  1.00 0.00 ? 305 VAL B HB   4 
ATOM   5419 H HG11 . VAL B 1 34 ? -1.138  -17.744 -0.708  1.00 0.00 ? 305 VAL B HG11 4 
ATOM   5420 H HG12 . VAL B 1 34 ? -1.840  -16.303 0.024   1.00 0.00 ? 305 VAL B HG12 4 
ATOM   5421 H HG13 . VAL B 1 34 ? -2.801  -17.286 -1.082  1.00 0.00 ? 305 VAL B HG13 4 
ATOM   5422 H HG21 . VAL B 1 34 ? 0.614   -15.252 -2.515  1.00 0.00 ? 305 VAL B HG21 4 
ATOM   5423 H HG22 . VAL B 1 34 ? -0.259  -14.377 -1.256  1.00 0.00 ? 305 VAL B HG22 4 
ATOM   5424 H HG23 . VAL B 1 34 ? 0.491   -15.930 -0.891  1.00 0.00 ? 305 VAL B HG23 4 
ATOM   5425 N N    . ALA B 1 35 ? -3.334  -17.285 -3.976  1.00 0.00 ? 306 ALA B N    4 
ATOM   5426 C CA   . ALA B 1 35 ? -4.526  -18.079 -4.252  1.00 0.00 ? 306 ALA B CA   4 
ATOM   5427 C C    . ALA B 1 35 ? -4.207  -19.098 -5.347  1.00 0.00 ? 306 ALA B C    4 
ATOM   5428 O O    . ALA B 1 35 ? -4.639  -20.233 -5.298  1.00 0.00 ? 306 ALA B O    4 
ATOM   5429 C CB   . ALA B 1 35 ? -5.654  -17.158 -4.724  1.00 0.00 ? 306 ALA B CB   4 
ATOM   5430 H H    . ALA B 1 35 ? -3.336  -16.320 -4.146  1.00 0.00 ? 306 ALA B H    4 
ATOM   5431 H HA   . ALA B 1 35 ? -4.833  -18.594 -3.356  1.00 0.00 ? 306 ALA B HA   4 
ATOM   5432 H HB1  . ALA B 1 35 ? -5.338  -16.129 -4.643  1.00 0.00 ? 306 ALA B HB1  4 
ATOM   5433 H HB2  . ALA B 1 35 ? -5.895  -17.382 -5.752  1.00 0.00 ? 306 ALA B HB2  4 
ATOM   5434 H HB3  . ALA B 1 35 ? -6.528  -17.316 -4.108  1.00 0.00 ? 306 ALA B HB3  4 
ATOM   5435 N N    . GLN B 1 36 ? -3.446  -18.703 -6.331  1.00 0.00 ? 307 GLN B N    4 
ATOM   5436 C CA   . GLN B 1 36 ? -3.099  -19.632 -7.402  1.00 0.00 ? 307 GLN B CA   4 
ATOM   5437 C C    . GLN B 1 36 ? -2.226  -20.748 -6.830  1.00 0.00 ? 307 GLN B C    4 
ATOM   5438 O O    . GLN B 1 36 ? -2.200  -21.853 -7.334  1.00 0.00 ? 307 GLN B O    4 
ATOM   5439 C CB   . GLN B 1 36 ? -2.328  -18.887 -8.494  1.00 0.00 ? 307 GLN B CB   4 
ATOM   5440 C CG   . GLN B 1 36 ? -3.309  -18.356 -9.542  1.00 0.00 ? 307 GLN B CG   4 
ATOM   5441 C CD   . GLN B 1 36 ? -2.873  -16.958 -9.985  1.00 0.00 ? 307 GLN B CD   4 
ATOM   5442 O OE1  . GLN B 1 36 ? -3.699  -16.124 -10.301 1.00 0.00 ? 307 GLN B OE1  4 
ATOM   5443 N NE2  . GLN B 1 36 ? -1.603  -16.665 -10.024 1.00 0.00 ? 307 GLN B NE2  4 
ATOM   5444 H H    . GLN B 1 36 ? -3.103  -17.785 -6.348  1.00 0.00 ? 307 GLN B H    4 
ATOM   5445 H HA   . GLN B 1 36 ? -4.000  -20.054 -7.821  1.00 0.00 ? 307 GLN B HA   4 
ATOM   5446 H HB2  . GLN B 1 36 ? -1.788  -18.060 -8.053  1.00 0.00 ? 307 GLN B HB2  4 
ATOM   5447 H HB3  . GLN B 1 36 ? -1.631  -19.562 -8.966  1.00 0.00 ? 307 GLN B HB3  4 
ATOM   5448 H HG2  . GLN B 1 36 ? -3.318  -19.019 -10.394 1.00 0.00 ? 307 GLN B HG2  4 
ATOM   5449 H HG3  . GLN B 1 36 ? -4.298  -18.304 -9.115  1.00 0.00 ? 307 GLN B HG3  4 
ATOM   5450 H HE21 . GLN B 1 36 ? -0.937  -17.338 -9.767  1.00 0.00 ? 307 GLN B HE21 4 
ATOM   5451 H HE22 . GLN B 1 36 ? -1.314  -15.772 -10.307 1.00 0.00 ? 307 GLN B HE22 4 
ATOM   5452 N N    . LEU B 1 37 ? -1.509  -20.464 -5.777  1.00 0.00 ? 308 LEU B N    4 
ATOM   5453 C CA   . LEU B 1 37 ? -0.655  -21.480 -5.177  1.00 0.00 ? 308 LEU B CA   4 
ATOM   5454 C C    . LEU B 1 37 ? -1.503  -22.390 -4.288  1.00 0.00 ? 308 LEU B C    4 
ATOM   5455 O O    . LEU B 1 37 ? -1.565  -23.587 -4.490  1.00 0.00 ? 308 LEU B O    4 
ATOM   5456 C CB   . LEU B 1 37 ? 0.421   -20.799 -4.328  1.00 0.00 ? 308 LEU B CB   4 
ATOM   5457 C CG   . LEU B 1 37 ? 1.738   -20.762 -5.103  1.00 0.00 ? 308 LEU B CG   4 
ATOM   5458 C CD1  . LEU B 1 37 ? 2.591   -19.595 -4.602  1.00 0.00 ? 308 LEU B CD1  4 
ATOM   5459 C CD2  . LEU B 1 37 ? 2.494   -22.075 -4.885  1.00 0.00 ? 308 LEU B CD2  4 
ATOM   5460 H H    . LEU B 1 37 ? -1.549  -19.565 -5.387  1.00 0.00 ? 308 LEU B H    4 
ATOM   5461 H HA   . LEU B 1 37 ? -0.186  -22.064 -5.952  1.00 0.00 ? 308 LEU B HA   4 
ATOM   5462 H HB2  . LEU B 1 37 ? 0.110   -19.790 -4.098  1.00 0.00 ? 308 LEU B HB2  4 
ATOM   5463 H HB3  . LEU B 1 37 ? 0.560   -21.351 -3.412  1.00 0.00 ? 308 LEU B HB3  4 
ATOM   5464 H HG   . LEU B 1 37 ? 1.534   -20.631 -6.155  1.00 0.00 ? 308 LEU B HG   4 
ATOM   5465 H HD11 . LEU B 1 37 ? 2.686   -19.654 -3.527  1.00 0.00 ? 308 LEU B HD11 4 
ATOM   5466 H HD12 . LEU B 1 37 ? 3.572   -19.647 -5.052  1.00 0.00 ? 308 LEU B HD12 4 
ATOM   5467 H HD13 . LEU B 1 37 ? 2.120   -18.661 -4.872  1.00 0.00 ? 308 LEU B HD13 4 
ATOM   5468 H HD21 . LEU B 1 37 ? 1.852   -22.780 -4.377  1.00 0.00 ? 308 LEU B HD21 4 
ATOM   5469 H HD22 . LEU B 1 37 ? 2.792   -22.482 -5.840  1.00 0.00 ? 308 LEU B HD22 4 
ATOM   5470 H HD23 . LEU B 1 37 ? 3.372   -21.889 -4.282  1.00 0.00 ? 308 LEU B HD23 4 
ATOM   5471 N N    . LYS B 1 38 ? -2.157  -21.833 -3.308  1.00 0.00 ? 309 LYS B N    4 
ATOM   5472 C CA   . LYS B 1 38 ? -2.984  -22.649 -2.428  1.00 0.00 ? 309 LYS B CA   4 
ATOM   5473 C C    . LYS B 1 38 ? -3.862  -23.574 -3.273  1.00 0.00 ? 309 LYS B C    4 
ATOM   5474 O O    . LYS B 1 38 ? -4.048  -24.732 -2.956  1.00 0.00 ? 309 LYS B O    4 
ATOM   5475 C CB   . LYS B 1 38 ? -3.869  -21.745 -1.572  1.00 0.00 ? 309 LYS B CB   4 
ATOM   5476 C CG   . LYS B 1 38 ? -3.108  -21.337 -0.310  1.00 0.00 ? 309 LYS B CG   4 
ATOM   5477 C CD   . LYS B 1 38 ? -2.653  -19.883 -0.439  1.00 0.00 ? 309 LYS B CD   4 
ATOM   5478 C CE   . LYS B 1 38 ? -3.140  -19.087 0.773   1.00 0.00 ? 309 LYS B CE   4 
ATOM   5479 N NZ   . LYS B 1 38 ? -4.529  -18.607 0.526   1.00 0.00 ? 309 LYS B NZ   4 
ATOM   5480 H H    . LYS B 1 38 ? -2.095  -20.865 -3.162  1.00 0.00 ? 309 LYS B H    4 
ATOM   5481 H HA   . LYS B 1 38 ? -2.350  -23.239 -1.784  1.00 0.00 ? 309 LYS B HA   4 
ATOM   5482 H HB2  . LYS B 1 38 ? -4.134  -20.861 -2.136  1.00 0.00 ? 309 LYS B HB2  4 
ATOM   5483 H HB3  . LYS B 1 38 ? -4.766  -22.277 -1.292  1.00 0.00 ? 309 LYS B HB3  4 
ATOM   5484 H HG2  . LYS B 1 38 ? -3.753  -21.438 0.549   1.00 0.00 ? 309 LYS B HG2  4 
ATOM   5485 H HG3  . LYS B 1 38 ? -2.243  -21.971 -0.190  1.00 0.00 ? 309 LYS B HG3  4 
ATOM   5486 H HD2  . LYS B 1 38 ? -1.574  -19.849 -0.484  1.00 0.00 ? 309 LYS B HD2  4 
ATOM   5487 H HD3  . LYS B 1 38 ? -3.066  -19.456 -1.340  1.00 0.00 ? 309 LYS B HD3  4 
ATOM   5488 H HE2  . LYS B 1 38 ? -3.130  -19.721 1.648   1.00 0.00 ? 309 LYS B HE2  4 
ATOM   5489 H HE3  . LYS B 1 38 ? -2.490  -18.242 0.934   1.00 0.00 ? 309 LYS B HE3  4 
ATOM   5490 H HZ1  . LYS B 1 38 ? -4.805  -18.830 -0.452  1.00 0.00 ? 309 LYS B HZ1  4 
ATOM   5491 H HZ2  . LYS B 1 38 ? -5.180  -19.078 1.188   1.00 0.00 ? 309 LYS B HZ2  4 
ATOM   5492 H HZ3  . LYS B 1 38 ? -4.572  -17.578 0.670   1.00 0.00 ? 309 LYS B HZ3  4 
ATOM   5493 N N    . GLN B 1 39 ? -4.404  -23.069 -4.348  1.00 0.00 ? 310 GLN B N    4 
ATOM   5494 C CA   . GLN B 1 39 ? -5.252  -23.898 -5.197  1.00 0.00 ? 310 GLN B CA   4 
ATOM   5495 C C    . GLN B 1 39 ? -4.475  -25.141 -5.633  1.00 0.00 ? 310 GLN B C    4 
ATOM   5496 O O    . GLN B 1 39 ? -4.911  -26.257 -5.435  1.00 0.00 ? 310 GLN B O    4 
ATOM   5497 C CB   . GLN B 1 39 ? -5.672  -23.099 -6.432  1.00 0.00 ? 310 GLN B CB   4 
ATOM   5498 C CG   . GLN B 1 39 ? -6.490  -21.881 -6.002  1.00 0.00 ? 310 GLN B CG   4 
ATOM   5499 C CD   . GLN B 1 39 ? -7.976  -22.150 -6.242  1.00 0.00 ? 310 GLN B CD   4 
ATOM   5500 O OE1  . GLN B 1 39 ? -8.503  -23.150 -5.796  1.00 0.00 ? 310 GLN B OE1  4 
ATOM   5501 N NE2  . GLN B 1 39 ? -8.678  -21.297 -6.936  1.00 0.00 ? 310 GLN B NE2  4 
ATOM   5502 H H    . GLN B 1 39 ? -4.242  -22.131 -4.584  1.00 0.00 ? 310 GLN B H    4 
ATOM   5503 H HA   . GLN B 1 39 ? -6.132  -24.197 -4.648  1.00 0.00 ? 310 GLN B HA   4 
ATOM   5504 H HB2  . GLN B 1 39 ? -4.792  -22.774 -6.967  1.00 0.00 ? 310 GLN B HB2  4 
ATOM   5505 H HB3  . GLN B 1 39 ? -6.274  -23.723 -7.077  1.00 0.00 ? 310 GLN B HB3  4 
ATOM   5506 H HG2  . GLN B 1 39 ? -6.323  -21.690 -4.951  1.00 0.00 ? 310 GLN B HG2  4 
ATOM   5507 H HG3  . GLN B 1 39 ? -6.185  -21.020 -6.577  1.00 0.00 ? 310 GLN B HG3  4 
ATOM   5508 H HE21 . GLN B 1 39 ? -8.252  -20.492 -7.296  1.00 0.00 ? 310 GLN B HE21 4 
ATOM   5509 H HE22 . GLN B 1 39 ? -9.630  -21.460 -7.095  1.00 0.00 ? 310 GLN B HE22 4 
ATOM   5510 N N    . LYS B 1 40 ? -3.327  -24.958 -6.226  1.00 0.00 ? 311 LYS B N    4 
ATOM   5511 C CA   . LYS B 1 40 ? -2.543  -26.108 -6.664  1.00 0.00 ? 311 LYS B CA   4 
ATOM   5512 C C    . LYS B 1 40 ? -2.365  -27.078 -5.495  1.00 0.00 ? 311 LYS B C    4 
ATOM   5513 O O    . LYS B 1 40 ? -2.168  -28.262 -5.680  1.00 0.00 ? 311 LYS B O    4 
ATOM   5514 C CB   . LYS B 1 40 ? -1.173  -25.639 -7.153  1.00 0.00 ? 311 LYS B CB   4 
ATOM   5515 C CG   . LYS B 1 40 ? -0.376  -26.840 -7.665  1.00 0.00 ? 311 LYS B CG   4 
ATOM   5516 C CD   . LYS B 1 40 ? 1.082   -26.714 -7.218  1.00 0.00 ? 311 LYS B CD   4 
ATOM   5517 C CE   . LYS B 1 40 ? 1.928   -26.182 -8.375  1.00 0.00 ? 311 LYS B CE   4 
ATOM   5518 N NZ   . LYS B 1 40 ? 2.230   -27.293 -9.320  1.00 0.00 ? 311 LYS B NZ   4 
ATOM   5519 H H    . LYS B 1 40 ? -2.990  -24.049 -6.377  1.00 0.00 ? 311 LYS B H    4 
ATOM   5520 H HA   . LYS B 1 40 ? -3.060  -26.609 -7.470  1.00 0.00 ? 311 LYS B HA   4 
ATOM   5521 H HB2  . LYS B 1 40 ? -1.301  -24.924 -7.951  1.00 0.00 ? 311 LYS B HB2  4 
ATOM   5522 H HB3  . LYS B 1 40 ? -0.638  -25.176 -6.337  1.00 0.00 ? 311 LYS B HB3  4 
ATOM   5523 H HG2  . LYS B 1 40 ? -0.799  -27.750 -7.265  1.00 0.00 ? 311 LYS B HG2  4 
ATOM   5524 H HG3  . LYS B 1 40 ? -0.418  -26.865 -8.744  1.00 0.00 ? 311 LYS B HG3  4 
ATOM   5525 H HD2  . LYS B 1 40 ? 1.143   -26.031 -6.381  1.00 0.00 ? 311 LYS B HD2  4 
ATOM   5526 H HD3  . LYS B 1 40 ? 1.452   -27.684 -6.920  1.00 0.00 ? 311 LYS B HD3  4 
ATOM   5527 H HE2  . LYS B 1 40 ? 1.383   -25.407 -8.893  1.00 0.00 ? 311 LYS B HE2  4 
ATOM   5528 H HE3  . LYS B 1 40 ? 2.852   -25.777 -7.989  1.00 0.00 ? 311 LYS B HE3  4 
ATOM   5529 H HZ1  . LYS B 1 40 ? 2.161   -28.203 -8.821  1.00 0.00 ? 311 LYS B HZ1  4 
ATOM   5530 H HZ2  . LYS B 1 40 ? 1.546   -27.276 -10.106 1.00 0.00 ? 311 LYS B HZ2  4 
ATOM   5531 H HZ3  . LYS B 1 40 ? 3.193   -27.179 -9.696  1.00 0.00 ? 311 LYS B HZ3  4 
ATOM   5532 N N    . VAL B 1 41 ? -2.437  -26.585 -4.288  1.00 0.00 ? 312 VAL B N    4 
ATOM   5533 C CA   . VAL B 1 41 ? -2.278  -27.460 -3.132  1.00 0.00 ? 312 VAL B CA   4 
ATOM   5534 C C    . VAL B 1 41 ? -3.642  -28.035 -2.740  1.00 0.00 ? 312 VAL B C    4 
ATOM   5535 O O    . VAL B 1 41 ? -3.734  -29.013 -2.027  1.00 0.00 ? 312 VAL B O    4 
ATOM   5536 C CB   . VAL B 1 41 ? -1.701  -26.663 -1.962  1.00 0.00 ? 312 VAL B CB   4 
ATOM   5537 C CG1  . VAL B 1 41 ? -1.582  -27.570 -0.735  1.00 0.00 ? 312 VAL B CG1  4 
ATOM   5538 C CG2  . VAL B 1 41 ? -0.314  -26.138 -2.341  1.00 0.00 ? 312 VAL B CG2  4 
ATOM   5539 H H    . VAL B 1 41 ? -2.599  -25.627 -4.159  1.00 0.00 ? 312 VAL B H    4 
ATOM   5540 H HA   . VAL B 1 41 ? -1.607  -28.268 -3.382  1.00 0.00 ? 312 VAL B HA   4 
ATOM   5541 H HB   . VAL B 1 41 ? -2.353  -25.833 -1.734  1.00 0.00 ? 312 VAL B HB   4 
ATOM   5542 H HG11 . VAL B 1 41 ? -1.492  -28.598 -1.054  1.00 0.00 ? 312 VAL B HG11 4 
ATOM   5543 H HG12 . VAL B 1 41 ? -0.709  -27.290 -0.164  1.00 0.00 ? 312 VAL B HG12 4 
ATOM   5544 H HG13 . VAL B 1 41 ? -2.463  -27.460 -0.119  1.00 0.00 ? 312 VAL B HG13 4 
ATOM   5545 H HG21 . VAL B 1 41 ? -0.370  -25.626 -3.292  1.00 0.00 ? 312 VAL B HG21 4 
ATOM   5546 H HG22 . VAL B 1 41 ? 0.030   -25.449 -1.583  1.00 0.00 ? 312 VAL B HG22 4 
ATOM   5547 H HG23 . VAL B 1 41 ? 0.376   -26.964 -2.417  1.00 0.00 ? 312 VAL B HG23 4 
ATOM   5548 N N    . MET B 1 42 ? -4.703  -27.432 -3.207  1.00 0.00 ? 313 MET B N    4 
ATOM   5549 C CA   . MET B 1 42 ? -6.033  -27.932 -2.873  1.00 0.00 ? 313 MET B CA   4 
ATOM   5550 C C    . MET B 1 42 ? -6.310  -29.201 -3.682  1.00 0.00 ? 313 MET B C    4 
ATOM   5551 O O    . MET B 1 42 ? -6.060  -29.256 -4.871  1.00 0.00 ? 313 MET B O    4 
ATOM   5552 C CB   . MET B 1 42 ? -7.079  -26.868 -3.214  1.00 0.00 ? 313 MET B CB   4 
ATOM   5553 C CG   . MET B 1 42 ? -8.062  -26.727 -2.051  1.00 0.00 ? 313 MET B CG   4 
ATOM   5554 S SD   . MET B 1 42 ? -9.236  -28.104 -2.083  1.00 0.00 ? 313 MET B SD   4 
ATOM   5555 C CE   . MET B 1 42 ? -10.749 -27.114 -2.022  1.00 0.00 ? 313 MET B CE   4 
ATOM   5556 H H    . MET B 1 42 ? -4.606  -26.646 -3.782  1.00 0.00 ? 313 MET B H    4 
ATOM   5557 H HA   . MET B 1 42 ? -6.079  -28.159 -1.819  1.00 0.00 ? 313 MET B HA   4 
ATOM   5558 H HB2  . MET B 1 42 ? -6.584  -25.923 -3.386  1.00 0.00 ? 313 MET B HB2  4 
ATOM   5559 H HB3  . MET B 1 42 ? -7.614  -27.162 -4.103  1.00 0.00 ? 313 MET B HB3  4 
ATOM   5560 H HG2  . MET B 1 42 ? -7.520  -26.737 -1.117  1.00 0.00 ? 313 MET B HG2  4 
ATOM   5561 H HG3  . MET B 1 42 ? -8.599  -25.794 -2.146  1.00 0.00 ? 313 MET B HG3  4 
ATOM   5562 H HE1  . MET B 1 42 ? -10.667 -26.380 -1.231  1.00 0.00 ? 313 MET B HE1  4 
ATOM   5563 H HE2  . MET B 1 42 ? -10.889 -26.614 -2.971  1.00 0.00 ? 313 MET B HE2  4 
ATOM   5564 H HE3  . MET B 1 42 ? -11.594 -27.756 -1.828  1.00 0.00 ? 313 MET B HE3  4 
ATOM   5565 N N    . ASN B 1 43 ? -6.822  -30.222 -3.052  1.00 0.00 ? 314 ASN B N    4 
ATOM   5566 C CA   . ASN B 1 43 ? -7.102  -31.455 -3.778  1.00 0.00 ? 314 ASN B CA   4 
ATOM   5567 C C    . ASN B 1 43 ? -8.447  -32.028 -3.321  1.00 0.00 ? 314 ASN B C    4 
ATOM   5568 O O    . ASN B 1 43 ? -9.468  -31.807 -3.941  1.00 0.00 ? 314 ASN B O    4 
ATOM   5569 C CB   . ASN B 1 43 ? -5.993  -32.473 -3.505  1.00 0.00 ? 314 ASN B CB   4 
ATOM   5570 C CG   . ASN B 1 43 ? -6.326  -33.792 -4.203  1.00 0.00 ? 314 ASN B CG   4 
ATOM   5571 O OD1  . ASN B 1 43 ? -7.281  -34.455 -3.853  1.00 0.00 ? 314 ASN B OD1  4 
ATOM   5572 N ND2  . ASN B 1 43 ? -5.570  -34.205 -5.184  1.00 0.00 ? 314 ASN B ND2  4 
ATOM   5573 H H    . ASN B 1 43 ? -7.014  -30.162 -2.093  1.00 0.00 ? 314 ASN B H    4 
ATOM   5574 H HA   . ASN B 1 43 ? -7.142  -31.248 -4.836  1.00 0.00 ? 314 ASN B HA   4 
ATOM   5575 H HB2  . ASN B 1 43 ? -5.056  -32.092 -3.882  1.00 0.00 ? 314 ASN B HB2  4 
ATOM   5576 H HB3  . ASN B 1 43 ? -5.912  -32.641 -2.442  1.00 0.00 ? 314 ASN B HB3  4 
ATOM   5577 H HD21 . ASN B 1 43 ? -4.799  -33.670 -5.467  1.00 0.00 ? 314 ASN B HD21 4 
ATOM   5578 H HD22 . ASN B 1 43 ? -5.775  -35.049 -5.638  1.00 0.00 ? 314 ASN B HD22 4 
ATOM   5579 N N    . TYR B 1 44 ? -8.459  -32.753 -2.232  1.00 0.00 ? 315 TYR B N    4 
ATOM   5580 C CA   . TYR B 1 44 ? -9.711  -33.319 -1.739  1.00 0.00 ? 315 TYR B CA   4 
ATOM   5581 C C    . TYR B 1 44 ? -9.416  -34.271 -0.577  1.00 0.00 ? 315 TYR B C    4 
ATOM   5582 O O    . TYR B 1 44 ? -8.806  -35.299 -0.821  1.00 0.00 ? 315 TYR B O    4 
ATOM   5583 C CB   . TYR B 1 44 ? -10.413 -34.086 -2.864  1.00 0.00 ? 315 TYR B CB   4 
ATOM   5584 C CG   . TYR B 1 44 ? -11.779 -33.486 -3.101  1.00 0.00 ? 315 TYR B CG   4 
ATOM   5585 C CD1  . TYR B 1 44 ? -12.657 -33.298 -2.021  1.00 0.00 ? 315 TYR B CD1  4 
ATOM   5586 C CD2  . TYR B 1 44 ? -12.171 -33.115 -4.397  1.00 0.00 ? 315 TYR B CD2  4 
ATOM   5587 C CE1  . TYR B 1 44 ? -13.926 -32.739 -2.237  1.00 0.00 ? 315 TYR B CE1  4 
ATOM   5588 C CE2  . TYR B 1 44 ? -13.440 -32.556 -4.613  1.00 0.00 ? 315 TYR B CE2  4 
ATOM   5589 C CZ   . TYR B 1 44 ? -14.319 -32.369 -3.534  1.00 0.00 ? 315 TYR B CZ   4 
ATOM   5590 O OH   . TYR B 1 44 ? -15.567 -31.818 -3.748  1.00 0.00 ? 315 TYR B OH   4 
ATOM   5591 O OXT  . TYR B 1 44 ? -9.806  -33.956 0.534   1.00 0.00 ? 315 TYR B OXT  4 
ATOM   5592 H H    . TYR B 1 44 ? -7.626  -32.911 -1.741  1.00 0.00 ? 315 TYR B H    4 
ATOM   5593 H HA   . TYR B 1 44 ? -10.352 -32.522 -1.394  1.00 0.00 ? 315 TYR B HA   4 
ATOM   5594 H HB2  . TYR B 1 44 ? -9.827  -34.016 -3.769  1.00 0.00 ? 315 TYR B HB2  4 
ATOM   5595 H HB3  . TYR B 1 44 ? -10.520 -35.123 -2.584  1.00 0.00 ? 315 TYR B HB3  4 
ATOM   5596 H HD1  . TYR B 1 44 ? -12.356 -33.584 -1.024  1.00 0.00 ? 315 TYR B HD1  4 
ATOM   5597 H HD2  . TYR B 1 44 ? -11.494 -33.259 -5.227  1.00 0.00 ? 315 TYR B HD2  4 
ATOM   5598 H HE1  . TYR B 1 44 ? -14.602 -32.596 -1.407  1.00 0.00 ? 315 TYR B HE1  4 
ATOM   5599 H HE2  . TYR B 1 44 ? -13.742 -32.270 -5.610  1.00 0.00 ? 315 TYR B HE2  4 
ATOM   5600 H HH   . TYR B 1 44 ? -16.149 -32.117 -3.044  1.00 0.00 ? 315 TYR B HH   4 
HETATM 5601 C C    . ACE A 1 1  ? -2.723  31.560  -2.940  1.00 0.00 ? 272 ACE A C    5 
HETATM 5602 O O    . ACE A 1 1  ? -3.448  30.604  -2.745  1.00 0.00 ? 272 ACE A O    5 
HETATM 5603 C CH3  . ACE A 1 1  ? -3.052  32.599  -4.015  1.00 0.00 ? 272 ACE A CH3  5 
HETATM 5604 H H1   . ACE A 1 1  ? -3.354  32.098  -4.923  1.00 0.00 ? 272 ACE A H1   5 
HETATM 5605 H H2   . ACE A 1 1  ? -3.856  33.232  -3.668  1.00 0.00 ? 272 ACE A H2   5 
HETATM 5606 H H3   . ACE A 1 1  ? -2.178  33.203  -4.211  1.00 0.00 ? 272 ACE A H3   5 
ATOM   5607 N N    . CYS A 1 2  ? -1.633  31.737  -2.246  1.00 0.00 ? 273 CYS A N    5 
ATOM   5608 C CA   . CYS A 1 2  ? -1.266  30.779  -1.209  1.00 0.00 ? 273 CYS A CA   5 
ATOM   5609 C C    . CYS A 1 2  ? -1.932  31.173  0.110   1.00 0.00 ? 273 CYS A C    5 
ATOM   5610 O O    . CYS A 1 2  ? -2.254  32.323  0.336   1.00 0.00 ? 273 CYS A O    5 
ATOM   5611 C CB   . CYS A 1 2  ? 0.255   30.780  -1.032  1.00 0.00 ? 273 CYS A CB   5 
ATOM   5612 S SG   . CYS A 1 2  ? 0.811   32.449  -0.607  1.00 0.00 ? 273 CYS A SG   5 
ATOM   5613 H H    . CYS A 1 2  ? -1.062  32.514  -2.421  1.00 0.00 ? 273 CYS A H    5 
ATOM   5614 H HA   . CYS A 1 2  ? -1.592  29.792  -1.498  1.00 0.00 ? 273 CYS A HA   5 
ATOM   5615 H HB2  . CYS A 1 2  ? 0.525   30.098  -0.238  1.00 0.00 ? 273 CYS A HB2  5 
ATOM   5616 H HB3  . CYS A 1 2  ? 0.724   30.465  -1.952  1.00 0.00 ? 273 CYS A HB3  5 
ATOM   5617 N N    . GLY A 1 3  ? -2.139  30.228  0.987   1.00 0.00 ? 274 GLY A N    5 
ATOM   5618 C CA   . GLY A 1 3  ? -2.768  30.546  2.263   1.00 0.00 ? 274 GLY A CA   5 
ATOM   5619 C C    . GLY A 1 3  ? -4.069  29.754  2.410   1.00 0.00 ? 274 GLY A C    5 
ATOM   5620 O O    . GLY A 1 3  ? -5.083  30.097  1.834   1.00 0.00 ? 274 GLY A O    5 
ATOM   5621 H H    . GLY A 1 3  ? -1.870  29.308  0.789   1.00 0.00 ? 274 GLY A H    5 
ATOM   5622 H HA2  . GLY A 1 3  ? -2.095  30.287  3.069   1.00 0.00 ? 274 GLY A HA2  5 
ATOM   5623 H HA3  . GLY A 1 3  ? -2.988  31.601  2.305   1.00 0.00 ? 274 GLY A HA3  5 
ATOM   5624 N N    . GLY A 1 4  ? -4.051  28.700  3.181   1.00 0.00 ? 275 GLY A N    5 
ATOM   5625 C CA   . GLY A 1 4  ? -5.261  27.908  3.363   1.00 0.00 ? 275 GLY A CA   5 
ATOM   5626 C C    . GLY A 1 4  ? -5.194  26.650  2.495   1.00 0.00 ? 275 GLY A C    5 
ATOM   5627 O O    . GLY A 1 4  ? -5.706  25.609  2.856   1.00 0.00 ? 275 GLY A O    5 
ATOM   5628 H H    . GLY A 1 4  ? -3.224  28.444  3.638   1.00 0.00 ? 275 GLY A H    5 
ATOM   5629 H HA2  . GLY A 1 4  ? -5.352  27.626  4.403   1.00 0.00 ? 275 GLY A HA2  5 
ATOM   5630 H HA3  . GLY A 1 4  ? -6.122  28.492  3.072   1.00 0.00 ? 275 GLY A HA3  5 
ATOM   5631 N N    . ARG A 1 5  ? -4.573  26.736  1.351   1.00 0.00 ? 276 ARG A N    5 
ATOM   5632 C CA   . ARG A 1 5  ? -4.485  25.569  0.482   1.00 0.00 ? 276 ARG A CA   5 
ATOM   5633 C C    . ARG A 1 5  ? -3.278  24.717  0.886   1.00 0.00 ? 276 ARG A C    5 
ATOM   5634 O O    . ARG A 1 5  ? -3.232  23.530  0.630   1.00 0.00 ? 276 ARG A O    5 
ATOM   5635 C CB   . ARG A 1 5  ? -4.327  26.022  -0.971  1.00 0.00 ? 276 ARG A CB   5 
ATOM   5636 C CG   . ARG A 1 5  ? -5.711  26.237  -1.591  1.00 0.00 ? 276 ARG A CG   5 
ATOM   5637 C CD   . ARG A 1 5  ? -5.838  25.398  -2.863  1.00 0.00 ? 276 ARG A CD   5 
ATOM   5638 N NE   . ARG A 1 5  ? -6.139  24.016  -2.506  1.00 0.00 ? 276 ARG A NE   5 
ATOM   5639 C CZ   . ARG A 1 5  ? -6.597  23.193  -3.410  1.00 0.00 ? 276 ARG A CZ   5 
ATOM   5640 N NH1  . ARG A 1 5  ? -6.088  23.195  -4.612  1.00 0.00 ? 276 ARG A NH1  5 
ATOM   5641 N NH2  . ARG A 1 5  ? -7.564  22.370  -3.111  1.00 0.00 ? 276 ARG A NH2  5 
ATOM   5642 H H    . ARG A 1 5  ? -4.169  27.586  1.077   1.00 0.00 ? 276 ARG A H    5 
ATOM   5643 H HA   . ARG A 1 5  ? -5.385  24.982  0.578   1.00 0.00 ? 276 ARG A HA   5 
ATOM   5644 H HB2  . ARG A 1 5  ? -3.769  26.946  -1.002  1.00 0.00 ? 276 ARG A HB2  5 
ATOM   5645 H HB3  . ARG A 1 5  ? -3.800  25.264  -1.531  1.00 0.00 ? 276 ARG A HB3  5 
ATOM   5646 H HG2  . ARG A 1 5  ? -6.471  25.941  -0.883  1.00 0.00 ? 276 ARG A HG2  5 
ATOM   5647 H HG3  . ARG A 1 5  ? -5.835  27.281  -1.837  1.00 0.00 ? 276 ARG A HG3  5 
ATOM   5648 H HD2  . ARG A 1 5  ? -6.633  25.792  -3.476  1.00 0.00 ? 276 ARG A HD2  5 
ATOM   5649 H HD3  . ARG A 1 5  ? -4.910  25.432  -3.412  1.00 0.00 ? 276 ARG A HD3  5 
ATOM   5650 H HE   . ARG A 1 5  ? -5.995  23.704  -1.587  1.00 0.00 ? 276 ARG A HE   5 
ATOM   5651 H HH11 . ARG A 1 5  ? -5.349  23.827  -4.841  1.00 0.00 ? 276 ARG A HH11 5 
ATOM   5652 H HH12 . ARG A 1 5  ? -6.440  22.566  -5.305  1.00 0.00 ? 276 ARG A HH12 5 
ATOM   5653 H HH21 . ARG A 1 5  ? -7.953  22.369  -2.191  1.00 0.00 ? 276 ARG A HH21 5 
ATOM   5654 H HH22 . ARG A 1 5  ? -7.916  21.739  -3.803  1.00 0.00 ? 276 ARG A HH22 5 
ATOM   5655 N N    . ILE A 1 6  ? -2.301  25.313  1.513   1.00 0.00 ? 277 ILE A N    5 
ATOM   5656 C CA   . ILE A 1 6  ? -1.126  24.552  1.923   1.00 0.00 ? 277 ILE A CA   5 
ATOM   5657 C C    . ILE A 1 6  ? -1.530  23.529  2.987   1.00 0.00 ? 277 ILE A C    5 
ATOM   5658 O O    . ILE A 1 6  ? -0.947  22.470  3.094   1.00 0.00 ? 277 ILE A O    5 
ATOM   5659 C CB   . ILE A 1 6  ? -0.071  25.503  2.493   1.00 0.00 ? 277 ILE A CB   5 
ATOM   5660 C CG1  . ILE A 1 6  ? 0.587   26.274  1.347   1.00 0.00 ? 277 ILE A CG1  5 
ATOM   5661 C CG2  . ILE A 1 6  ? 0.997   24.701  3.242   1.00 0.00 ? 277 ILE A CG2  5 
ATOM   5662 C CD1  . ILE A 1 6  ? 0.455   27.776  1.600   1.00 0.00 ? 277 ILE A CD1  5 
ATOM   5663 H H    . ILE A 1 6  ? -2.358  26.272  1.710   1.00 0.00 ? 277 ILE A H    5 
ATOM   5664 H HA   . ILE A 1 6  ? -0.717  24.036  1.067   1.00 0.00 ? 277 ILE A HA   5 
ATOM   5665 H HB   . ILE A 1 6  ? -0.543  26.198  3.174   1.00 0.00 ? 277 ILE A HB   5 
ATOM   5666 H HG12 . ILE A 1 6  ? 1.633   26.009  1.289   1.00 0.00 ? 277 ILE A HG12 5 
ATOM   5667 H HG13 . ILE A 1 6  ? 0.099   26.023  0.417   1.00 0.00 ? 277 ILE A HG13 5 
ATOM   5668 H HG21 . ILE A 1 6  ? 1.332   23.883  2.620   1.00 0.00 ? 277 ILE A HG21 5 
ATOM   5669 H HG22 . ILE A 1 6  ? 1.833   25.342  3.475   1.00 0.00 ? 277 ILE A HG22 5 
ATOM   5670 H HG23 . ILE A 1 6  ? 0.576   24.308  4.155   1.00 0.00 ? 277 ILE A HG23 5 
ATOM   5671 H HD11 . ILE A 1 6  ? 0.758   27.999  2.612   1.00 0.00 ? 277 ILE A HD11 5 
ATOM   5672 H HD12 . ILE A 1 6  ? 1.085   28.315  0.908   1.00 0.00 ? 277 ILE A HD12 5 
ATOM   5673 H HD13 . ILE A 1 6  ? -0.574  28.076  1.458   1.00 0.00 ? 277 ILE A HD13 5 
ATOM   5674 N N    . ALA A 1 7  ? -2.525  23.834  3.773   1.00 0.00 ? 278 ALA A N    5 
ATOM   5675 C CA   . ALA A 1 7  ? -2.955  22.895  4.804   1.00 0.00 ? 278 ALA A CA   5 
ATOM   5676 C C    . ALA A 1 7  ? -3.563  21.659  4.138   1.00 0.00 ? 278 ALA A C    5 
ATOM   5677 O O    . ALA A 1 7  ? -3.435  20.553  4.625   1.00 0.00 ? 278 ALA A O    5 
ATOM   5678 C CB   . ALA A 1 7  ? -4.000  23.560  5.699   1.00 0.00 ? 278 ALA A CB   5 
ATOM   5679 H H    . ALA A 1 7  ? -2.987  24.694  3.670   1.00 0.00 ? 278 ALA A H    5 
ATOM   5680 H HA   . ALA A 1 7  ? -2.104  22.602  5.399   1.00 0.00 ? 278 ALA A HA   5 
ATOM   5681 H HB1  . ALA A 1 7  ? -3.868  24.631  5.674   1.00 0.00 ? 278 ALA A HB1  5 
ATOM   5682 H HB2  . ALA A 1 7  ? -4.990  23.309  5.347   1.00 0.00 ? 278 ALA A HB2  5 
ATOM   5683 H HB3  . ALA A 1 7  ? -3.880  23.208  6.714   1.00 0.00 ? 278 ALA A HB3  5 
ATOM   5684 N N    . ARG A 1 8  ? -4.223  21.837  3.027   1.00 0.00 ? 279 ARG A N    5 
ATOM   5685 C CA   . ARG A 1 8  ? -4.825  20.698  2.345   1.00 0.00 ? 279 ARG A CA   5 
ATOM   5686 C C    . ARG A 1 8  ? -3.722  19.832  1.732   1.00 0.00 ? 279 ARG A C    5 
ATOM   5687 O O    . ARG A 1 8  ? -3.646  18.644  1.975   1.00 0.00 ? 279 ARG A O    5 
ATOM   5688 C CB   . ARG A 1 8  ? -5.755  21.198  1.236   1.00 0.00 ? 279 ARG A CB   5 
ATOM   5689 C CG   . ARG A 1 8  ? -7.211  20.994  1.659   1.00 0.00 ? 279 ARG A CG   5 
ATOM   5690 C CD   . ARG A 1 8  ? -8.025  22.239  1.307   1.00 0.00 ? 279 ARG A CD   5 
ATOM   5691 N NE   . ARG A 1 8  ? -9.445  21.954  1.474   1.00 0.00 ? 279 ARG A NE   5 
ATOM   5692 C CZ   . ARG A 1 8  ? -10.304 22.935  1.539   1.00 0.00 ? 279 ARG A CZ   5 
ATOM   5693 N NH1  . ARG A 1 8  ? -10.017 24.091  1.005   1.00 0.00 ? 279 ARG A NH1  5 
ATOM   5694 N NH2  . ARG A 1 8  ? -11.450 22.761  2.137   1.00 0.00 ? 279 ARG A NH2  5 
ATOM   5695 H H    . ARG A 1 8  ? -4.313  22.737  2.651   1.00 0.00 ? 279 ARG A H    5 
ATOM   5696 H HA   . ARG A 1 8  ? -5.392  20.113  3.052   1.00 0.00 ? 279 ARG A HA   5 
ATOM   5697 H HB2  . ARG A 1 8  ? -5.574  22.250  1.063   1.00 0.00 ? 279 ARG A HB2  5 
ATOM   5698 H HB3  . ARG A 1 8  ? -5.563  20.645  0.330   1.00 0.00 ? 279 ARG A HB3  5 
ATOM   5699 H HG2  . ARG A 1 8  ? -7.618  20.138  1.141   1.00 0.00 ? 279 ARG A HG2  5 
ATOM   5700 H HG3  . ARG A 1 8  ? -7.257  20.826  2.725   1.00 0.00 ? 279 ARG A HG3  5 
ATOM   5701 H HD2  . ARG A 1 8  ? -7.741  23.052  1.960   1.00 0.00 ? 279 ARG A HD2  5 
ATOM   5702 H HD3  . ARG A 1 8  ? -7.833  22.518  0.282   1.00 0.00 ? 279 ARG A HD3  5 
ATOM   5703 H HE   . ARG A 1 8  ? -9.755  21.027  1.537   1.00 0.00 ? 279 ARG A HE   5 
ATOM   5704 H HH11 . ARG A 1 8  ? -9.139  24.225  0.545   1.00 0.00 ? 279 ARG A HH11 5 
ATOM   5705 H HH12 . ARG A 1 8  ? -10.674 24.842  1.054   1.00 0.00 ? 279 ARG A HH12 5 
ATOM   5706 H HH21 . ARG A 1 8  ? -11.670 21.876  2.547   1.00 0.00 ? 279 ARG A HH21 5 
ATOM   5707 H HH22 . ARG A 1 8  ? -12.106 23.513  2.187   1.00 0.00 ? 279 ARG A HH22 5 
ATOM   5708 N N    . LEU A 1 9  ? -2.866  20.417  0.940   1.00 0.00 ? 280 LEU A N    5 
ATOM   5709 C CA   . LEU A 1 9  ? -1.792  19.642  0.330   1.00 0.00 ? 280 LEU A CA   5 
ATOM   5710 C C    . LEU A 1 9  ? -1.037  18.873  1.418   1.00 0.00 ? 280 LEU A C    5 
ATOM   5711 O O    . LEU A 1 9  ? -0.675  17.727  1.244   1.00 0.00 ? 280 LEU A O    5 
ATOM   5712 C CB   . LEU A 1 9  ? -0.827  20.585  -0.392  1.00 0.00 ? 280 LEU A CB   5 
ATOM   5713 C CG   . LEU A 1 9  ? -1.197  20.655  -1.875  1.00 0.00 ? 280 LEU A CG   5 
ATOM   5714 C CD1  . LEU A 1 9  ? -0.761  22.005  -2.448  1.00 0.00 ? 280 LEU A CD1  5 
ATOM   5715 C CD2  . LEU A 1 9  ? -0.488  19.529  -2.630  1.00 0.00 ? 280 LEU A CD2  5 
ATOM   5716 H H    . LEU A 1 9  ? -2.942  21.376  0.758   1.00 0.00 ? 280 LEU A H    5 
ATOM   5717 H HA   . LEU A 1 9  ? -2.208  18.945  -0.380  1.00 0.00 ? 280 LEU A HA   5 
ATOM   5718 H HB2  . LEU A 1 9  ? -0.895  21.570  0.044   1.00 0.00 ? 280 LEU A HB2  5 
ATOM   5719 H HB3  . LEU A 1 9  ? 0.182   20.214  -0.292  1.00 0.00 ? 280 LEU A HB3  5 
ATOM   5720 H HG   . LEU A 1 9  ? -2.267  20.548  -1.984  1.00 0.00 ? 280 LEU A HG   5 
ATOM   5721 H HD11 . LEU A 1 9  ? 0.297   22.143  -2.278  1.00 0.00 ? 280 LEU A HD11 5 
ATOM   5722 H HD12 . LEU A 1 9  ? -0.961  22.028  -3.508  1.00 0.00 ? 280 LEU A HD12 5 
ATOM   5723 H HD13 . LEU A 1 9  ? -1.310  22.798  -1.960  1.00 0.00 ? 280 LEU A HD13 5 
ATOM   5724 H HD21 . LEU A 1 9  ? -0.199  18.755  -1.934  1.00 0.00 ? 280 LEU A HD21 5 
ATOM   5725 H HD22 . LEU A 1 9  ? -1.157  19.117  -3.371  1.00 0.00 ? 280 LEU A HD22 5 
ATOM   5726 H HD23 . LEU A 1 9  ? 0.393   19.921  -3.118  1.00 0.00 ? 280 LEU A HD23 5 
ATOM   5727 N N    . GLU A 1 10 ? -0.800  19.496  2.541   1.00 0.00 ? 281 GLU A N    5 
ATOM   5728 C CA   . GLU A 1 10 ? -0.089  18.813  3.615   1.00 0.00 ? 281 GLU A CA   5 
ATOM   5729 C C    . GLU A 1 10 ? -0.880  17.574  4.039   1.00 0.00 ? 281 GLU A C    5 
ATOM   5730 O O    . GLU A 1 10 ? -0.342  16.493  4.161   1.00 0.00 ? 281 GLU A O    5 
ATOM   5731 C CB   . GLU A 1 10 ? 0.060   19.758  4.810   1.00 0.00 ? 281 GLU A CB   5 
ATOM   5732 C CG   . GLU A 1 10 ? 1.471   20.346  4.826   1.00 0.00 ? 281 GLU A CG   5 
ATOM   5733 C CD   . GLU A 1 10 ? 2.435   19.349  5.469   1.00 0.00 ? 281 GLU A CD   5 
ATOM   5734 O OE1  . GLU A 1 10 ? 2.165   18.930  6.583   1.00 0.00 ? 281 GLU A OE1  5 
ATOM   5735 O OE2  . GLU A 1 10 ? 3.426   19.021  4.839   1.00 0.00 ? 281 GLU A OE2  5 
ATOM   5736 H H    . GLU A 1 10 ? -1.102  20.419  2.662   1.00 0.00 ? 281 GLU A H    5 
ATOM   5737 H HA   . GLU A 1 10 ? 0.890   18.516  3.270   1.00 0.00 ? 281 GLU A HA   5 
ATOM   5738 H HB2  . GLU A 1 10 ? -0.664  20.556  4.729   1.00 0.00 ? 281 GLU A HB2  5 
ATOM   5739 H HB3  . GLU A 1 10 ? -0.109  19.210  5.727   1.00 0.00 ? 281 GLU A HB3  5 
ATOM   5740 H HG2  . GLU A 1 10 ? 1.786   20.550  3.812   1.00 0.00 ? 281 GLU A HG2  5 
ATOM   5741 H HG3  . GLU A 1 10 ? 1.473   21.264  5.394   1.00 0.00 ? 281 GLU A HG3  5 
ATOM   5742 N N    . GLU A 1 11 ? -2.159  17.725  4.258   1.00 0.00 ? 282 GLU A N    5 
ATOM   5743 C CA   . GLU A 1 11 ? -2.968  16.581  4.660   1.00 0.00 ? 282 GLU A CA   5 
ATOM   5744 C C    . GLU A 1 11 ? -2.948  15.536  3.546   1.00 0.00 ? 282 GLU A C    5 
ATOM   5745 O O    . GLU A 1 11 ? -3.246  14.376  3.761   1.00 0.00 ? 282 GLU A O    5 
ATOM   5746 C CB   . GLU A 1 11 ? -4.408  17.036  4.908   1.00 0.00 ? 282 GLU A CB   5 
ATOM   5747 C CG   . GLU A 1 11 ? -4.550  17.524  6.351   1.00 0.00 ? 282 GLU A CG   5 
ATOM   5748 C CD   . GLU A 1 11 ? -5.928  18.165  6.540   1.00 0.00 ? 282 GLU A CD   5 
ATOM   5749 O OE1  . GLU A 1 11 ? -6.228  19.099  5.813   1.00 0.00 ? 282 GLU A OE1  5 
ATOM   5750 O OE2  . GLU A 1 11 ? -6.657  17.710  7.406   1.00 0.00 ? 282 GLU A OE2  5 
ATOM   5751 H H    . GLU A 1 11 ? -2.573  18.605  4.149   1.00 0.00 ? 282 GLU A H    5 
ATOM   5752 H HA   . GLU A 1 11 ? -2.566  16.153  5.564   1.00 0.00 ? 282 GLU A HA   5 
ATOM   5753 H HB2  . GLU A 1 11 ? -4.652  17.840  4.230   1.00 0.00 ? 282 GLU A HB2  5 
ATOM   5754 H HB3  . GLU A 1 11 ? -5.080  16.208  4.743   1.00 0.00 ? 282 GLU A HB3  5 
ATOM   5755 H HG2  . GLU A 1 11 ? -4.447  16.687  7.026   1.00 0.00 ? 282 GLU A HG2  5 
ATOM   5756 H HG3  . GLU A 1 11 ? -3.785  18.255  6.562   1.00 0.00 ? 282 GLU A HG3  5 
ATOM   5757 N N    . LYS A 1 12 ? -2.601  15.936  2.355   1.00 0.00 ? 283 LYS A N    5 
ATOM   5758 C CA   . LYS A 1 12 ? -2.561  14.988  1.249   1.00 0.00 ? 283 LYS A CA   5 
ATOM   5759 C C    . LYS A 1 12 ? -1.282  14.154  1.342   1.00 0.00 ? 283 LYS A C    5 
ATOM   5760 O O    . LYS A 1 12 ? -1.303  12.951  1.172   1.00 0.00 ? 283 LYS A O    5 
ATOM   5761 C CB   . LYS A 1 12 ? -2.581  15.749  -0.077  1.00 0.00 ? 283 LYS A CB   5 
ATOM   5762 C CG   . LYS A 1 12 ? -3.317  14.917  -1.130  1.00 0.00 ? 283 LYS A CG   5 
ATOM   5763 C CD   . LYS A 1 12 ? -4.589  15.648  -1.562  1.00 0.00 ? 283 LYS A CD   5 
ATOM   5764 C CE   . LYS A 1 12 ? -4.941  15.252  -2.998  1.00 0.00 ? 283 LYS A CE   5 
ATOM   5765 N NZ   . LYS A 1 12 ? -5.417  13.839  -3.019  1.00 0.00 ? 283 LYS A NZ   5 
ATOM   5766 H H    . LYS A 1 12 ? -2.364  16.875  2.203   1.00 0.00 ? 283 LYS A H    5 
ATOM   5767 H HA   . LYS A 1 12 ? -3.419  14.337  1.303   1.00 0.00 ? 283 LYS A HA   5 
ATOM   5768 H HB2  . LYS A 1 12 ? -3.089  16.693  0.060   1.00 0.00 ? 283 LYS A HB2  5 
ATOM   5769 H HB3  . LYS A 1 12 ? -1.569  15.929  -0.406  1.00 0.00 ? 283 LYS A HB3  5 
ATOM   5770 H HG2  . LYS A 1 12 ? -2.675  14.773  -1.986  1.00 0.00 ? 283 LYS A HG2  5 
ATOM   5771 H HG3  . LYS A 1 12 ? -3.581  13.959  -0.711  1.00 0.00 ? 283 LYS A HG3  5 
ATOM   5772 H HD2  . LYS A 1 12 ? -5.401  15.377  -0.902  1.00 0.00 ? 283 LYS A HD2  5 
ATOM   5773 H HD3  . LYS A 1 12 ? -4.425  16.715  -1.515  1.00 0.00 ? 283 LYS A HD3  5 
ATOM   5774 H HE2  . LYS A 1 12 ? -5.723  15.899  -3.368  1.00 0.00 ? 283 LYS A HE2  5 
ATOM   5775 H HE3  . LYS A 1 12 ? -4.067  15.349  -3.623  1.00 0.00 ? 283 LYS A HE3  5 
ATOM   5776 H HZ1  . LYS A 1 12 ? -6.080  13.684  -2.235  1.00 0.00 ? 283 LYS A HZ1  5 
ATOM   5777 H HZ2  . LYS A 1 12 ? -5.895  13.648  -3.923  1.00 0.00 ? 283 LYS A HZ2  5 
ATOM   5778 H HZ3  . LYS A 1 12 ? -4.604  13.199  -2.919  1.00 0.00 ? 283 LYS A HZ3  5 
ATOM   5779 N N    . VAL A 1 13 ? -0.169  14.779  1.616   1.00 0.00 ? 284 VAL A N    5 
ATOM   5780 C CA   . VAL A 1 13 ? 1.075   14.029  1.721   1.00 0.00 ? 284 VAL A CA   5 
ATOM   5781 C C    . VAL A 1 13 ? 1.018   13.148  2.971   1.00 0.00 ? 284 VAL A C    5 
ATOM   5782 O O    . VAL A 1 13 ? 1.660   12.120  3.049   1.00 0.00 ? 284 VAL A O    5 
ATOM   5783 C CB   . VAL A 1 13 ? 2.254   14.996  1.830   1.00 0.00 ? 284 VAL A CB   5 
ATOM   5784 C CG1  . VAL A 1 13 ? 3.543   14.206  2.072   1.00 0.00 ? 284 VAL A CG1  5 
ATOM   5785 C CG2  . VAL A 1 13 ? 2.383   15.791  0.528   1.00 0.00 ? 284 VAL A CG2  5 
ATOM   5786 H H    . VAL A 1 13 ? -0.173  15.750  1.753   1.00 0.00 ? 284 VAL A H    5 
ATOM   5787 H HA   . VAL A 1 13 ? 1.198   13.408  0.846   1.00 0.00 ? 284 VAL A HA   5 
ATOM   5788 H HB   . VAL A 1 13 ? 2.089   15.675  2.654   1.00 0.00 ? 284 VAL A HB   5 
ATOM   5789 H HG11 . VAL A 1 13 ? 3.703   13.521  1.253   1.00 0.00 ? 284 VAL A HG11 5 
ATOM   5790 H HG12 . VAL A 1 13 ? 4.376   14.889  2.140   1.00 0.00 ? 284 VAL A HG12 5 
ATOM   5791 H HG13 . VAL A 1 13 ? 3.456   13.650  2.995   1.00 0.00 ? 284 VAL A HG13 5 
ATOM   5792 H HG21 . VAL A 1 13 ? 1.411   15.893  0.071   1.00 0.00 ? 284 VAL A HG21 5 
ATOM   5793 H HG22 . VAL A 1 13 ? 2.784   16.771  0.744   1.00 0.00 ? 284 VAL A HG22 5 
ATOM   5794 H HG23 . VAL A 1 13 ? 3.046   15.271  -0.147  1.00 0.00 ? 284 VAL A HG23 5 
ATOM   5795 N N    . LYS A 1 14 ? 0.246   13.544  3.945   1.00 0.00 ? 285 LYS A N    5 
ATOM   5796 C CA   . LYS A 1 14 ? 0.140   12.749  5.162   1.00 0.00 ? 285 LYS A CA   5 
ATOM   5797 C C    . LYS A 1 14 ? -0.714  11.513  4.878   1.00 0.00 ? 285 LYS A C    5 
ATOM   5798 O O    . LYS A 1 14 ? -0.253  10.393  4.973   1.00 0.00 ? 285 LYS A O    5 
ATOM   5799 C CB   . LYS A 1 14 ? -0.517  13.583  6.263   1.00 0.00 ? 285 LYS A CB   5 
ATOM   5800 C CG   . LYS A 1 14 ? 0.533   13.967  7.307   1.00 0.00 ? 285 LYS A CG   5 
ATOM   5801 C CD   . LYS A 1 14 ? 1.645   14.779  6.641   1.00 0.00 ? 285 LYS A CD   5 
ATOM   5802 C CE   . LYS A 1 14 ? 2.968   14.526  7.367   1.00 0.00 ? 285 LYS A CE   5 
ATOM   5803 N NZ   . LYS A 1 14 ? 4.103   14.824  6.450   1.00 0.00 ? 285 LYS A NZ   5 
ATOM   5804 H H    . LYS A 1 14 ? -0.267  14.376  3.855   1.00 0.00 ? 285 LYS A H    5 
ATOM   5805 H HA   . LYS A 1 14 ? 1.125   12.443  5.481   1.00 0.00 ? 285 LYS A HA   5 
ATOM   5806 H HB2  . LYS A 1 14 ? -0.942  14.478  5.833   1.00 0.00 ? 285 LYS A HB2  5 
ATOM   5807 H HB3  . LYS A 1 14 ? -1.297  13.006  6.736   1.00 0.00 ? 285 LYS A HB3  5 
ATOM   5808 H HG2  . LYS A 1 14 ? 0.069   14.560  8.083   1.00 0.00 ? 285 LYS A HG2  5 
ATOM   5809 H HG3  . LYS A 1 14 ? 0.955   13.072  7.743   1.00 0.00 ? 285 LYS A HG3  5 
ATOM   5810 H HD2  . LYS A 1 14 ? 1.739   14.479  5.607   1.00 0.00 ? 285 LYS A HD2  5 
ATOM   5811 H HD3  . LYS A 1 14 ? 1.405   15.830  6.692   1.00 0.00 ? 285 LYS A HD3  5 
ATOM   5812 H HE2  . LYS A 1 14 ? 3.031   15.165  8.236   1.00 0.00 ? 285 LYS A HE2  5 
ATOM   5813 H HE3  . LYS A 1 14 ? 3.017   13.493  7.676   1.00 0.00 ? 285 LYS A HE3  5 
ATOM   5814 H HZ1  . LYS A 1 14 ? 3.736   15.210  5.556   1.00 0.00 ? 285 LYS A HZ1  5 
ATOM   5815 H HZ2  . LYS A 1 14 ? 4.735   15.521  6.892   1.00 0.00 ? 285 LYS A HZ2  5 
ATOM   5816 H HZ3  . LYS A 1 14 ? 4.632   13.948  6.257   1.00 0.00 ? 285 LYS A HZ3  5 
ATOM   5817 N N    . THR A 1 15 ? -1.957  11.708  4.523   1.00 0.00 ? 286 THR A N    5 
ATOM   5818 C CA   . THR A 1 15 ? -2.816  10.567  4.232   1.00 0.00 ? 286 THR A CA   5 
ATOM   5819 C C    . THR A 1 15 ? -2.101  9.642   3.245   1.00 0.00 ? 286 THR A C    5 
ATOM   5820 O O    . THR A 1 15 ? -2.208  8.432   3.321   1.00 0.00 ? 286 THR A O    5 
ATOM   5821 C CB   . THR A 1 15 ? -4.128  11.062  3.617   1.00 0.00 ? 286 THR A CB   5 
ATOM   5822 O OG1  . THR A 1 15 ? -4.854  11.802  4.586   1.00 0.00 ? 286 THR A OG1  5 
ATOM   5823 C CG2  . THR A 1 15 ? -4.962  9.867   3.155   1.00 0.00 ? 286 THR A CG2  5 
ATOM   5824 H H    . THR A 1 15 ? -2.307  12.620  4.447   1.00 0.00 ? 286 THR A H    5 
ATOM   5825 H HA   . THR A 1 15 ? -3.027  10.030  5.145   1.00 0.00 ? 286 THR A HA   5 
ATOM   5826 H HB   . THR A 1 15 ? -3.912  11.694  2.768   1.00 0.00 ? 286 THR A HB   5 
ATOM   5827 H HG1  . THR A 1 15 ? -4.693  11.405  5.444   1.00 0.00 ? 286 THR A HG1  5 
ATOM   5828 H HG21 . THR A 1 15 ? -4.985  9.122   3.936   1.00 0.00 ? 286 THR A HG21 5 
ATOM   5829 H HG22 . THR A 1 15 ? -5.968  10.192  2.936   1.00 0.00 ? 286 THR A HG22 5 
ATOM   5830 H HG23 . THR A 1 15 ? -4.520  9.442   2.266   1.00 0.00 ? 286 THR A HG23 5 
ATOM   5831 N N    . LEU A 1 16 ? -1.369  10.205  2.324   1.00 0.00 ? 287 LEU A N    5 
ATOM   5832 C CA   . LEU A 1 16 ? -0.653  9.384   1.355   1.00 0.00 ? 287 LEU A CA   5 
ATOM   5833 C C    . LEU A 1 16 ? 0.354   8.503   2.093   1.00 0.00 ? 287 LEU A C    5 
ATOM   5834 O O    . LEU A 1 16 ? 0.399   7.304   1.907   1.00 0.00 ? 287 LEU A O    5 
ATOM   5835 C CB   . LEU A 1 16 ? 0.083   10.287  0.365   1.00 0.00 ? 287 LEU A CB   5 
ATOM   5836 C CG   . LEU A 1 16 ? -0.682  10.330  -0.958  1.00 0.00 ? 287 LEU A CG   5 
ATOM   5837 C CD1  . LEU A 1 16 ? -0.003  11.316  -1.911  1.00 0.00 ? 287 LEU A CD1  5 
ATOM   5838 C CD2  . LEU A 1 16 ? -0.689  8.936   -1.590  1.00 0.00 ? 287 LEU A CD2  5 
ATOM   5839 H H    . LEU A 1 16 ? -1.295  11.181  2.287   1.00 0.00 ? 287 LEU A H    5 
ATOM   5840 H HA   . LEU A 1 16 ? -1.356  8.762   0.821   1.00 0.00 ? 287 LEU A HA   5 
ATOM   5841 H HB2  . LEU A 1 16 ? 0.157   11.285  0.772   1.00 0.00 ? 287 LEU A HB2  5 
ATOM   5842 H HB3  . LEU A 1 16 ? 1.076   9.896   0.191   1.00 0.00 ? 287 LEU A HB3  5 
ATOM   5843 H HG   . LEU A 1 16 ? -1.699  10.650  -0.775  1.00 0.00 ? 287 LEU A HG   5 
ATOM   5844 H HD11 . LEU A 1 16 ? 0.639   11.976  -1.347  1.00 0.00 ? 287 LEU A HD11 5 
ATOM   5845 H HD12 . LEU A 1 16 ? 0.586   10.771  -2.633  1.00 0.00 ? 287 LEU A HD12 5 
ATOM   5846 H HD13 . LEU A 1 16 ? -0.754  11.898  -2.424  1.00 0.00 ? 287 LEU A HD13 5 
ATOM   5847 H HD21 . LEU A 1 16 ? 0.239   8.434   -1.360  1.00 0.00 ? 287 LEU A HD21 5 
ATOM   5848 H HD22 . LEU A 1 16 ? -1.515  8.365   -1.192  1.00 0.00 ? 287 LEU A HD22 5 
ATOM   5849 H HD23 . LEU A 1 16 ? -0.795  9.026   -2.660  1.00 0.00 ? 287 LEU A HD23 5 
ATOM   5850 N N    . LYS A 1 17 ? 1.159   9.089   2.935   1.00 0.00 ? 288 LYS A N    5 
ATOM   5851 C CA   . LYS A 1 17 ? 2.137   8.301   3.677   1.00 0.00 ? 288 LYS A CA   5 
ATOM   5852 C C    . LYS A 1 17 ? 1.401   7.230   4.483   1.00 0.00 ? 288 LYS A C    5 
ATOM   5853 O O    . LYS A 1 17 ? 1.965   6.224   4.862   1.00 0.00 ? 288 LYS A O    5 
ATOM   5854 C CB   . LYS A 1 17 ? 2.913   9.212   4.626   1.00 0.00 ? 288 LYS A CB   5 
ATOM   5855 C CG   . LYS A 1 17 ? 4.410   9.113   4.322   1.00 0.00 ? 288 LYS A CG   5 
ATOM   5856 C CD   . LYS A 1 17 ? 4.879   10.397  3.635   1.00 0.00 ? 288 LYS A CD   5 
ATOM   5857 C CE   . LYS A 1 17 ? 4.784   11.566  4.617   1.00 0.00 ? 288 LYS A CE   5 
ATOM   5858 N NZ   . LYS A 1 17 ? 6.016   12.398  4.516   1.00 0.00 ? 288 LYS A NZ   5 
ATOM   5859 H H    . LYS A 1 17 ? 1.104   10.058  3.076   1.00 0.00 ? 288 LYS A H    5 
ATOM   5860 H HA   . LYS A 1 17 ? 2.820   7.830   2.987   1.00 0.00 ? 288 LYS A HA   5 
ATOM   5861 H HB2  . LYS A 1 17 ? 2.586   10.234  4.494   1.00 0.00 ? 288 LYS A HB2  5 
ATOM   5862 H HB3  . LYS A 1 17 ? 2.735   8.907   5.647   1.00 0.00 ? 288 LYS A HB3  5 
ATOM   5863 H HG2  . LYS A 1 17 ? 4.957   8.978   5.244   1.00 0.00 ? 288 LYS A HG2  5 
ATOM   5864 H HG3  . LYS A 1 17 ? 4.590   8.272   3.671   1.00 0.00 ? 288 LYS A HG3  5 
ATOM   5865 H HD2  . LYS A 1 17 ? 5.902   10.277  3.311   1.00 0.00 ? 288 LYS A HD2  5 
ATOM   5866 H HD3  . LYS A 1 17 ? 4.251   10.597  2.779   1.00 0.00 ? 288 LYS A HD3  5 
ATOM   5867 H HE2  . LYS A 1 17 ? 3.921   12.169  4.377   1.00 0.00 ? 288 LYS A HE2  5 
ATOM   5868 H HE3  . LYS A 1 17 ? 4.689   11.184  5.621   1.00 0.00 ? 288 LYS A HE3  5 
ATOM   5869 H HZ1  . LYS A 1 17 ? 6.788   11.831  4.114   1.00 0.00 ? 288 LYS A HZ1  5 
ATOM   5870 H HZ2  . LYS A 1 17 ? 5.830   13.218  3.901   1.00 0.00 ? 288 LYS A HZ2  5 
ATOM   5871 H HZ3  . LYS A 1 17 ? 6.290   12.730  5.462   1.00 0.00 ? 288 LYS A HZ3  5 
ATOM   5872 N N    . ALA A 1 18 ? 0.140   7.444   4.748   1.00 0.00 ? 289 ALA A N    5 
ATOM   5873 C CA   . ALA A 1 18 ? -0.624  6.467   5.511   1.00 0.00 ? 289 ALA A CA   5 
ATOM   5874 C C    . ALA A 1 18 ? -0.862  5.223   4.656   1.00 0.00 ? 289 ALA A C    5 
ATOM   5875 O O    . ALA A 1 18 ? -0.339  4.160   4.927   1.00 0.00 ? 289 ALA A O    5 
ATOM   5876 C CB   . ALA A 1 18 ? -1.973  7.068   5.903   1.00 0.00 ? 289 ALA A CB   5 
ATOM   5877 H H    . ALA A 1 18 ? -0.293  8.264   4.430   1.00 0.00 ? 289 ALA A H    5 
ATOM   5878 H HA   . ALA A 1 18 ? -0.079  6.196   6.403   1.00 0.00 ? 289 ALA A HA   5 
ATOM   5879 H HB1  . ALA A 1 18 ? -2.039  8.079   5.528   1.00 0.00 ? 289 ALA A HB1  5 
ATOM   5880 H HB2  . ALA A 1 18 ? -2.768  6.472   5.474   1.00 0.00 ? 289 ALA A HB2  5 
ATOM   5881 H HB3  . ALA A 1 18 ? -2.067  7.074   6.979   1.00 0.00 ? 289 ALA A HB3  5 
ATOM   5882 N N    . GLN A 1 19 ? -1.657  5.347   3.630   1.00 0.00 ? 290 GLN A N    5 
ATOM   5883 C CA   . GLN A 1 19 ? -1.934  4.194   2.783   1.00 0.00 ? 290 GLN A CA   5 
ATOM   5884 C C    . GLN A 1 19 ? -0.627  3.668   2.177   1.00 0.00 ? 290 GLN A C    5 
ATOM   5885 O O    . GLN A 1 19 ? -0.570  2.564   1.674   1.00 0.00 ? 290 GLN A O    5 
ATOM   5886 C CB   . GLN A 1 19 ? -2.893  4.597   1.662   1.00 0.00 ? 290 GLN A CB   5 
ATOM   5887 C CG   . GLN A 1 19 ? -2.319  5.791   0.897   1.00 0.00 ? 290 GLN A CG   5 
ATOM   5888 C CD   . GLN A 1 19 ? -3.401  6.385   -0.007  1.00 0.00 ? 290 GLN A CD   5 
ATOM   5889 O OE1  . GLN A 1 19 ? -4.389  6.907   0.469   1.00 0.00 ? 290 GLN A OE1  5 
ATOM   5890 N NE2  . GLN A 1 19 ? -3.256  6.323   -1.303  1.00 0.00 ? 290 GLN A NE2  5 
ATOM   5891 H H    . GLN A 1 19 ? -2.075  6.213   3.434   1.00 0.00 ? 290 GLN A H    5 
ATOM   5892 H HA   . GLN A 1 19 ? -2.390  3.419   3.379   1.00 0.00 ? 290 GLN A HA   5 
ATOM   5893 H HB2  . GLN A 1 19 ? -3.024  3.765   0.984   1.00 0.00 ? 290 GLN A HB2  5 
ATOM   5894 H HB3  . GLN A 1 19 ? -3.848  4.870   2.085   1.00 0.00 ? 290 GLN A HB3  5 
ATOM   5895 H HG2  . GLN A 1 19 ? -1.984  6.541   1.599   1.00 0.00 ? 290 GLN A HG2  5 
ATOM   5896 H HG3  . GLN A 1 19 ? -1.487  5.466   0.292   1.00 0.00 ? 290 GLN A HG3  5 
ATOM   5897 H HE21 . GLN A 1 19 ? -2.461  5.901   -1.687  1.00 0.00 ? 290 GLN A HE21 5 
ATOM   5898 H HE22 . GLN A 1 19 ? -3.943  6.700   -1.892  1.00 0.00 ? 290 GLN A HE22 5 
ATOM   5899 N N    . ASN A 1 20 ? 0.419   4.447   2.218   1.00 0.00 ? 291 ASN A N    5 
ATOM   5900 C CA   . ASN A 1 20 ? 1.685   3.991   1.656   1.00 0.00 ? 291 ASN A CA   5 
ATOM   5901 C C    . ASN A 1 20 ? 2.305   2.943   2.581   1.00 0.00 ? 291 ASN A C    5 
ATOM   5902 O O    . ASN A 1 20 ? 2.641   1.852   2.163   1.00 0.00 ? 291 ASN A O    5 
ATOM   5903 C CB   . ASN A 1 20 ? 2.644   5.175   1.510   1.00 0.00 ? 291 ASN A CB   5 
ATOM   5904 C CG   . ASN A 1 20 ? 3.602   4.915   0.346   1.00 0.00 ? 291 ASN A CG   5 
ATOM   5905 O OD1  . ASN A 1 20 ? 3.496   5.535   -0.694  1.00 0.00 ? 291 ASN A OD1  5 
ATOM   5906 N ND2  . ASN A 1 20 ? 4.541   4.016   0.475   1.00 0.00 ? 291 ASN A ND2  5 
ATOM   5907 H H    . ASN A 1 20 ? 0.355   5.335   2.627   1.00 0.00 ? 291 ASN A H    5 
ATOM   5908 H HA   . ASN A 1 20 ? 1.511   3.553   0.684   1.00 0.00 ? 291 ASN A HA   5 
ATOM   5909 H HB2  . ASN A 1 20 ? 2.078   6.075   1.319   1.00 0.00 ? 291 ASN A HB2  5 
ATOM   5910 H HB3  . ASN A 1 20 ? 3.210   5.293   2.420   1.00 0.00 ? 291 ASN A HB3  5 
ATOM   5911 H HD21 . ASN A 1 20 ? 4.628   3.515   1.312   1.00 0.00 ? 291 ASN A HD21 5 
ATOM   5912 H HD22 . ASN A 1 20 ? 5.159   3.843   -0.266  1.00 0.00 ? 291 ASN A HD22 5 
ATOM   5913 N N    . SER A 1 21 ? 2.456   3.261   3.837   1.00 0.00 ? 292 SER A N    5 
ATOM   5914 C CA   . SER A 1 21 ? 3.039   2.300   4.766   1.00 0.00 ? 292 SER A CA   5 
ATOM   5915 C C    . SER A 1 21 ? 2.084   1.116   4.935   1.00 0.00 ? 292 SER A C    5 
ATOM   5916 O O    . SER A 1 21 ? 2.494   0.014   5.241   1.00 0.00 ? 292 SER A O    5 
ATOM   5917 C CB   . SER A 1 21 ? 3.263   2.971   6.122   1.00 0.00 ? 292 SER A CB   5 
ATOM   5918 O OG   . SER A 1 21 ? 4.341   2.327   6.790   1.00 0.00 ? 292 SER A OG   5 
ATOM   5919 H H    . SER A 1 21 ? 2.178   4.146   4.156   1.00 0.00 ? 292 SER A H    5 
ATOM   5920 H HA   . SER A 1 21 ? 3.983   1.951   4.378   1.00 0.00 ? 292 SER A HA   5 
ATOM   5921 H HB2  . SER A 1 21 ? 3.506   4.010   5.977   1.00 0.00 ? 292 SER A HB2  5 
ATOM   5922 H HB3  . SER A 1 21 ? 2.361   2.893   6.715   1.00 0.00 ? 292 SER A HB3  5 
ATOM   5923 H HG   . SER A 1 21 ? 4.041   1.458   7.069   1.00 0.00 ? 292 SER A HG   5 
ATOM   5924 N N    . GLU A 1 22 ? 0.814   1.335   4.734   1.00 0.00 ? 293 GLU A N    5 
ATOM   5925 C CA   . GLU A 1 22 ? -0.147  0.248   4.876   1.00 0.00 ? 293 GLU A CA   5 
ATOM   5926 C C    . GLU A 1 22 ? 0.082   -0.787  3.773   1.00 0.00 ? 293 GLU A C    5 
ATOM   5927 O O    . GLU A 1 22 ? 0.375   -1.936  4.037   1.00 0.00 ? 293 GLU A O    5 
ATOM   5928 C CB   . GLU A 1 22 ? -1.569  0.804   4.768   1.00 0.00 ? 293 GLU A CB   5 
ATOM   5929 C CG   . GLU A 1 22 ? -2.130  1.053   6.169   1.00 0.00 ? 293 GLU A CG   5 
ATOM   5930 C CD   . GLU A 1 22 ? -3.203  2.142   6.103   1.00 0.00 ? 293 GLU A CD   5 
ATOM   5931 O OE1  . GLU A 1 22 ? -4.194  1.929   5.423   1.00 0.00 ? 293 GLU A OE1  5 
ATOM   5932 O OE2  . GLU A 1 22 ? -3.016  3.170   6.733   1.00 0.00 ? 293 GLU A OE2  5 
ATOM   5933 H H    . GLU A 1 22 ? 0.505   2.232   4.485   1.00 0.00 ? 293 GLU A H    5 
ATOM   5934 H HA   . GLU A 1 22 ? -0.020  -0.220  5.841   1.00 0.00 ? 293 GLU A HA   5 
ATOM   5935 H HB2  . GLU A 1 22 ? -1.549  1.734   4.215   1.00 0.00 ? 293 GLU A HB2  5 
ATOM   5936 H HB3  . GLU A 1 22 ? -2.196  0.092   4.251   1.00 0.00 ? 293 GLU A HB3  5 
ATOM   5937 H HG2  . GLU A 1 22 ? -2.564  0.140   6.550   1.00 0.00 ? 293 GLU A HG2  5 
ATOM   5938 H HG3  . GLU A 1 22 ? -1.333  1.374   6.823   1.00 0.00 ? 293 GLU A HG3  5 
ATOM   5939 N N    . LEU A 1 23 ? -0.052  -0.390  2.537   1.00 0.00 ? 294 LEU A N    5 
ATOM   5940 C CA   . LEU A 1 23 ? 0.150   -1.331  1.439   1.00 0.00 ? 294 LEU A CA   5 
ATOM   5941 C C    . LEU A 1 23 ? 1.523   -1.993  1.580   1.00 0.00 ? 294 LEU A C    5 
ATOM   5942 O O    . LEU A 1 23 ? 1.682   -3.171  1.331   1.00 0.00 ? 294 LEU A O    5 
ATOM   5943 C CB   . LEU A 1 23 ? 0.075   -0.585  0.106   1.00 0.00 ? 294 LEU A CB   5 
ATOM   5944 C CG   . LEU A 1 23 ? -1.375  -0.554  -0.380  1.00 0.00 ? 294 LEU A CG   5 
ATOM   5945 C CD1  . LEU A 1 23 ? -1.495  0.398   -1.571  1.00 0.00 ? 294 LEU A CD1  5 
ATOM   5946 C CD2  . LEU A 1 23 ? -1.797  -1.962  -0.810  1.00 0.00 ? 294 LEU A CD2  5 
ATOM   5947 H H    . LEU A 1 23 ? -0.292  0.541   2.344   1.00 0.00 ? 294 LEU A H    5 
ATOM   5948 H HA   . LEU A 1 23 ? -0.619  -2.088  1.470   1.00 0.00 ? 294 LEU A HA   5 
ATOM   5949 H HB2  . LEU A 1 23 ? 0.433   0.426   0.238   1.00 0.00 ? 294 LEU A HB2  5 
ATOM   5950 H HB3  . LEU A 1 23 ? 0.686   -1.091  -0.625  1.00 0.00 ? 294 LEU A HB3  5 
ATOM   5951 H HG   . LEU A 1 23 ? -2.015  -0.212  0.420   1.00 0.00 ? 294 LEU A HG   5 
ATOM   5952 H HD11 . LEU A 1 23 ? -1.020  1.338   -1.330  1.00 0.00 ? 294 LEU A HD11 5 
ATOM   5953 H HD12 . LEU A 1 23 ? -1.010  -0.040  -2.432  1.00 0.00 ? 294 LEU A HD12 5 
ATOM   5954 H HD13 . LEU A 1 23 ? -2.537  0.569   -1.792  1.00 0.00 ? 294 LEU A HD13 5 
ATOM   5955 H HD21 . LEU A 1 23 ? -0.944  -2.484  -1.218  1.00 0.00 ? 294 LEU A HD21 5 
ATOM   5956 H HD22 . LEU A 1 23 ? -2.175  -2.501  0.047   1.00 0.00 ? 294 LEU A HD22 5 
ATOM   5957 H HD23 . LEU A 1 23 ? -2.570  -1.892  -1.560  1.00 0.00 ? 294 LEU A HD23 5 
ATOM   5958 N N    . ALA A 1 24 ? 2.517   -1.244  1.974   1.00 0.00 ? 295 ALA A N    5 
ATOM   5959 C CA   . ALA A 1 24 ? 3.849   -1.819  2.122   1.00 0.00 ? 295 ALA A CA   5 
ATOM   5960 C C    . ALA A 1 24 ? 3.796   -2.985  3.114   1.00 0.00 ? 295 ALA A C    5 
ATOM   5961 O O    . ALA A 1 24 ? 4.323   -4.050  2.862   1.00 0.00 ? 295 ALA A O    5 
ATOM   5962 C CB   . ALA A 1 24 ? 4.812   -0.750  2.643   1.00 0.00 ? 295 ALA A CB   5 
ATOM   5963 H H    . ALA A 1 24 ? 2.369   -0.295  2.168   1.00 0.00 ? 295 ALA A H    5 
ATOM   5964 H HA   . ALA A 1 24 ? 4.195   -2.177  1.165   1.00 0.00 ? 295 ALA A HA   5 
ATOM   5965 H HB1  . ALA A 1 24 ? 4.249   0.106   2.985   1.00 0.00 ? 295 ALA A HB1  5 
ATOM   5966 H HB2  . ALA A 1 24 ? 5.387   -1.152  3.462   1.00 0.00 ? 295 ALA A HB2  5 
ATOM   5967 H HB3  . ALA A 1 24 ? 5.478   -0.449  1.849   1.00 0.00 ? 295 ALA A HB3  5 
ATOM   5968 N N    . SER A 1 25 ? 3.167   -2.790  4.240   1.00 0.00 ? 296 SER A N    5 
ATOM   5969 C CA   . SER A 1 25 ? 3.084   -3.860  5.227   1.00 0.00 ? 296 SER A CA   5 
ATOM   5970 C C    . SER A 1 25 ? 2.394   -5.078  4.610   1.00 0.00 ? 296 SER A C    5 
ATOM   5971 O O    . SER A 1 25 ? 2.953   -6.155  4.545   1.00 0.00 ? 296 SER A O    5 
ATOM   5972 C CB   . SER A 1 25 ? 2.284   -3.378  6.435   1.00 0.00 ? 296 SER A CB   5 
ATOM   5973 O OG   . SER A 1 25 ? 2.324   -4.371  7.452   1.00 0.00 ? 296 SER A OG   5 
ATOM   5974 H H    . SER A 1 25 ? 2.751   -1.922  4.423   1.00 0.00 ? 296 SER A H    5 
ATOM   5975 H HA   . SER A 1 25 ? 4.080   -4.133  5.544   1.00 0.00 ? 296 SER A HA   5 
ATOM   5976 H HB2  . SER A 1 25 ? 2.713   -2.466  6.816   1.00 0.00 ? 296 SER A HB2  5 
ATOM   5977 H HB3  . SER A 1 25 ? 1.259   -3.195  6.136   1.00 0.00 ? 296 SER A HB3  5 
ATOM   5978 H HG   . SER A 1 25 ? 3.137   -4.872  7.345   1.00 0.00 ? 296 SER A HG   5 
ATOM   5979 N N    . THR A 1 26 ? 1.181   -4.919  4.159   1.00 0.00 ? 297 THR A N    5 
ATOM   5980 C CA   . THR A 1 26 ? 0.467   -6.044  3.563   1.00 0.00 ? 297 THR A CA   5 
ATOM   5981 C C    . THR A 1 26 ? 1.338   -6.696  2.485   1.00 0.00 ? 297 THR A C    5 
ATOM   5982 O O    . THR A 1 26 ? 1.182   -7.859  2.170   1.00 0.00 ? 297 THR A O    5 
ATOM   5983 C CB   . THR A 1 26 ? -0.835  -5.545  2.931   1.00 0.00 ? 297 THR A CB   5 
ATOM   5984 O OG1  . THR A 1 26 ? -1.593  -4.838  3.902   1.00 0.00 ? 297 THR A OG1  5 
ATOM   5985 C CG2  . THR A 1 26 ? -1.644  -6.737  2.416   1.00 0.00 ? 297 THR A CG2  5 
ATOM   5986 H H    . THR A 1 26 ? 0.745   -4.043  4.222   1.00 0.00 ? 297 THR A H    5 
ATOM   5987 H HA   . THR A 1 26 ? 0.238   -6.770  4.327   1.00 0.00 ? 297 THR A HA   5 
ATOM   5988 H HB   . THR A 1 26 ? -0.605  -4.889  2.106   1.00 0.00 ? 297 THR A HB   5 
ATOM   5989 H HG1  . THR A 1 26 ? -1.315  -5.137  4.772   1.00 0.00 ? 297 THR A HG1  5 
ATOM   5990 H HG21 . THR A 1 26 ? -0.974  -7.550  2.175   1.00 0.00 ? 297 THR A HG21 5 
ATOM   5991 H HG22 . THR A 1 26 ? -2.337  -7.059  3.180   1.00 0.00 ? 297 THR A HG22 5 
ATOM   5992 H HG23 . THR A 1 26 ? -2.191  -6.446  1.532   1.00 0.00 ? 297 THR A HG23 5 
ATOM   5993 N N    . ALA A 1 27 ? 2.247   -5.956  1.913   1.00 0.00 ? 298 ALA A N    5 
ATOM   5994 C CA   . ALA A 1 27 ? 3.101   -6.522  0.875   1.00 0.00 ? 298 ALA A CA   5 
ATOM   5995 C C    . ALA A 1 27 ? 4.079   -7.526  1.493   1.00 0.00 ? 298 ALA A C    5 
ATOM   5996 O O    . ALA A 1 27 ? 4.124   -8.678  1.111   1.00 0.00 ? 298 ALA A O    5 
ATOM   5997 C CB   . ALA A 1 27 ? 3.886   -5.400  0.195   1.00 0.00 ? 298 ALA A CB   5 
ATOM   5998 H H    . ALA A 1 27 ? 2.353   -5.019  2.178   1.00 0.00 ? 298 ALA A H    5 
ATOM   5999 H HA   . ALA A 1 27 ? 2.488   -7.023  0.140   1.00 0.00 ? 298 ALA A HA   5 
ATOM   6000 H HB1  . ALA A 1 27 ? 3.261   -4.524  0.109   1.00 0.00 ? 298 ALA A HB1  5 
ATOM   6001 H HB2  . ALA A 1 27 ? 4.758   -5.162  0.788   1.00 0.00 ? 298 ALA A HB2  5 
ATOM   6002 H HB3  . ALA A 1 27 ? 4.197   -5.721  -0.788  1.00 0.00 ? 298 ALA A HB3  5 
ATOM   6003 N N    . ASN A 1 28 ? 4.866   -7.095  2.440   1.00 0.00 ? 299 ASN A N    5 
ATOM   6004 C CA   . ASN A 1 28 ? 5.829   -8.000  3.062   1.00 0.00 ? 299 ASN A CA   5 
ATOM   6005 C C    . ASN A 1 28 ? 5.094   -9.137  3.780   1.00 0.00 ? 299 ASN A C    5 
ATOM   6006 O O    . ASN A 1 28 ? 5.669   -10.163 4.083   1.00 0.00 ? 299 ASN A O    5 
ATOM   6007 C CB   . ASN A 1 28 ? 6.673   -7.224  4.074   1.00 0.00 ? 299 ASN A CB   5 
ATOM   6008 C CG   . ASN A 1 28 ? 5.767   -6.677  5.178   1.00 0.00 ? 299 ASN A CG   5 
ATOM   6009 O OD1  . ASN A 1 28 ? 4.832   -7.331  5.593   1.00 0.00 ? 299 ASN A OD1  5 
ATOM   6010 N ND2  . ASN A 1 28 ? 6.005   -5.493  5.676   1.00 0.00 ? 299 ASN A ND2  5 
ATOM   6011 H H    . ASN A 1 28 ? 4.817   -6.159  2.728   1.00 0.00 ? 299 ASN A H    5 
ATOM   6012 H HA   . ASN A 1 28 ? 6.476   -8.414  2.303   1.00 0.00 ? 299 ASN A HA   5 
ATOM   6013 H HB2  . ASN A 1 28 ? 7.413   -7.882  4.507   1.00 0.00 ? 299 ASN A HB2  5 
ATOM   6014 H HB3  . ASN A 1 28 ? 7.167   -6.403  3.577   1.00 0.00 ? 299 ASN A HB3  5 
ATOM   6015 H HD21 . ASN A 1 28 ? 6.759   -4.965  5.341   1.00 0.00 ? 299 ASN A HD21 5 
ATOM   6016 H HD22 . ASN A 1 28 ? 5.430   -5.135  6.385   1.00 0.00 ? 299 ASN A HD22 5 
ATOM   6017 N N    . MET A 1 29 ? 3.832   -8.964  4.061   1.00 0.00 ? 300 MET A N    5 
ATOM   6018 C CA   . MET A 1 29 ? 3.090   -10.015 4.751   1.00 0.00 ? 300 MET A CA   5 
ATOM   6019 C C    . MET A 1 29 ? 2.691   -11.109 3.755   1.00 0.00 ? 300 MET A C    5 
ATOM   6020 O O    . MET A 1 29 ? 2.756   -12.286 4.051   1.00 0.00 ? 300 MET A O    5 
ATOM   6021 C CB   . MET A 1 29 ? 1.835   -9.419  5.386   1.00 0.00 ? 300 MET A CB   5 
ATOM   6022 C CG   . MET A 1 29 ? 2.232   -8.550  6.582   1.00 0.00 ? 300 MET A CG   5 
ATOM   6023 S SD   . MET A 1 29 ? 1.669   -9.333  8.114   1.00 0.00 ? 300 MET A SD   5 
ATOM   6024 C CE   . MET A 1 29 ? 1.384   -7.812  9.052   1.00 0.00 ? 300 MET A CE   5 
ATOM   6025 H H    . MET A 1 29 ? 3.383   -8.128  3.814   1.00 0.00 ? 300 MET A H    5 
ATOM   6026 H HA   . MET A 1 29 ? 3.713   -10.445 5.522   1.00 0.00 ? 300 MET A HA   5 
ATOM   6027 H HB2  . MET A 1 29 ? 1.315   -8.816  4.658   1.00 0.00 ? 300 MET A HB2  5 
ATOM   6028 H HB3  . MET A 1 29 ? 1.188   -10.215 5.724   1.00 0.00 ? 300 MET A HB3  5 
ATOM   6029 H HG2  . MET A 1 29 ? 3.307   -8.442  6.606   1.00 0.00 ? 300 MET A HG2  5 
ATOM   6030 H HG3  . MET A 1 29 ? 1.775   -7.576  6.486   1.00 0.00 ? 300 MET A HG3  5 
ATOM   6031 H HE1  . MET A 1 29 ? 1.066   -7.029  8.385   1.00 0.00 ? 300 MET A HE1  5 
ATOM   6032 H HE2  . MET A 1 29 ? 0.617   -7.987  9.793   1.00 0.00 ? 300 MET A HE2  5 
ATOM   6033 H HE3  . MET A 1 29 ? 2.302   -7.515  9.541   1.00 0.00 ? 300 MET A HE3  5 
ATOM   6034 N N    . LEU A 1 30 ? 2.273   -10.734 2.579   1.00 0.00 ? 301 LEU A N    5 
ATOM   6035 C CA   . LEU A 1 30 ? 1.878   -11.735 1.596   1.00 0.00 ? 301 LEU A CA   5 
ATOM   6036 C C    . LEU A 1 30 ? 3.126   -12.431 1.045   1.00 0.00 ? 301 LEU A C    5 
ATOM   6037 O O    . LEU A 1 30 ? 3.087   -13.583 0.663   1.00 0.00 ? 301 LEU A O    5 
ATOM   6038 C CB   . LEU A 1 30 ? 1.121   -11.055 0.454   1.00 0.00 ? 301 LEU A CB   5 
ATOM   6039 C CG   . LEU A 1 30 ? -0.134  -10.379 1.010   1.00 0.00 ? 301 LEU A CG   5 
ATOM   6040 C CD1  . LEU A 1 30 ? -0.752  -9.484  -0.065  1.00 0.00 ? 301 LEU A CD1  5 
ATOM   6041 C CD2  . LEU A 1 30 ? -1.146  -11.448 1.428   1.00 0.00 ? 301 LEU A CD2  5 
ATOM   6042 H H    . LEU A 1 30 ? 2.224   -9.781  2.355   1.00 0.00 ? 301 LEU A H    5 
ATOM   6043 H HA   . LEU A 1 30 ? 1.236   -12.466 2.064   1.00 0.00 ? 301 LEU A HA   5 
ATOM   6044 H HB2  . LEU A 1 30 ? 1.757   -10.315 -0.008  1.00 0.00 ? 301 LEU A HB2  5 
ATOM   6045 H HB3  . LEU A 1 30 ? 0.833   -11.795 -0.279  1.00 0.00 ? 301 LEU A HB3  5 
ATOM   6046 H HG   . LEU A 1 30 ? 0.132   -9.778  1.868   1.00 0.00 ? 301 LEU A HG   5 
ATOM   6047 H HD11 . LEU A 1 30 ? -0.337  -9.739  -1.028  1.00 0.00 ? 301 LEU A HD11 5 
ATOM   6048 H HD12 . LEU A 1 30 ? -1.823  -9.632  -0.085  1.00 0.00 ? 301 LEU A HD12 5 
ATOM   6049 H HD13 . LEU A 1 30 ? -0.537  -8.450  0.160   1.00 0.00 ? 301 LEU A HD13 5 
ATOM   6050 H HD21 . LEU A 1 30 ? -1.066  -12.297 0.764   1.00 0.00 ? 301 LEU A HD21 5 
ATOM   6051 H HD22 . LEU A 1 30 ? -0.942  -11.762 2.439   1.00 0.00 ? 301 LEU A HD22 5 
ATOM   6052 H HD23 . LEU A 1 30 ? -2.144  -11.042 1.371   1.00 0.00 ? 301 LEU A HD23 5 
ATOM   6053 N N    . ARG A 1 31 ? 4.231   -11.741 1.005   1.00 0.00 ? 302 ARG A N    5 
ATOM   6054 C CA   . ARG A 1 31 ? 5.451   -12.351 0.490   1.00 0.00 ? 302 ARG A CA   5 
ATOM   6055 C C    . ARG A 1 31 ? 6.005   -13.333 1.524   1.00 0.00 ? 302 ARG A C    5 
ATOM   6056 O O    . ARG A 1 31 ? 6.345   -14.456 1.209   1.00 0.00 ? 302 ARG A O    5 
ATOM   6057 C CB   . ARG A 1 31 ? 6.490   -11.262 0.215   1.00 0.00 ? 302 ARG A CB   5 
ATOM   6058 C CG   . ARG A 1 31 ? 7.699   -11.874 -0.495  1.00 0.00 ? 302 ARG A CG   5 
ATOM   6059 C CD   . ARG A 1 31 ? 8.360   -10.817 -1.383  1.00 0.00 ? 302 ARG A CD   5 
ATOM   6060 N NE   . ARG A 1 31 ? 9.548   -10.282 -0.718  1.00 0.00 ? 302 ARG A NE   5 
ATOM   6061 C CZ   . ARG A 1 31 ? 9.557   -10.102 0.576   1.00 0.00 ? 302 ARG A CZ   5 
ATOM   6062 N NH1  . ARG A 1 31 ? 8.630   -9.376  1.141   1.00 0.00 ? 302 ARG A NH1  5 
ATOM   6063 N NH2  . ARG A 1 31 ? 10.490  -10.649 1.307   1.00 0.00 ? 302 ARG A NH2  5 
ATOM   6064 H H    . ARG A 1 31 ? 4.242   -10.812 1.318   1.00 0.00 ? 302 ARG A H    5 
ATOM   6065 H HA   . ARG A 1 31 ? 5.234   -12.878 -0.427  1.00 0.00 ? 302 ARG A HA   5 
ATOM   6066 H HB2  . ARG A 1 31 ? 6.052   -10.498 -0.412  1.00 0.00 ? 302 ARG A HB2  5 
ATOM   6067 H HB3  . ARG A 1 31 ? 6.808   -10.824 1.149   1.00 0.00 ? 302 ARG A HB3  5 
ATOM   6068 H HG2  . ARG A 1 31 ? 8.409   -12.225 0.240   1.00 0.00 ? 302 ARG A HG2  5 
ATOM   6069 H HG3  . ARG A 1 31 ? 7.375   -12.703 -1.107  1.00 0.00 ? 302 ARG A HG3  5 
ATOM   6070 H HD2  . ARG A 1 31 ? 8.651   -11.267 -2.320  1.00 0.00 ? 302 ARG A HD2  5 
ATOM   6071 H HD3  . ARG A 1 31 ? 7.660   -10.018 -1.571  1.00 0.00 ? 302 ARG A HD3  5 
ATOM   6072 H HE   . ARG A 1 31 ? 10.343  -10.058 -1.245  1.00 0.00 ? 302 ARG A HE   5 
ATOM   6073 H HH11 . ARG A 1 31 ? 7.914   -8.957  0.581   1.00 0.00 ? 302 ARG A HH11 5 
ATOM   6074 H HH12 . ARG A 1 31 ? 8.634   -9.239  2.130   1.00 0.00 ? 302 ARG A HH12 5 
ATOM   6075 H HH21 . ARG A 1 31 ? 11.200  -11.206 0.874   1.00 0.00 ? 302 ARG A HH21 5 
ATOM   6076 H HH22 . ARG A 1 31 ? 10.496  -10.511 2.297   1.00 0.00 ? 302 ARG A HH22 5 
ATOM   6077 N N    . GLU A 1 32 ? 6.106   -12.916 2.757   1.00 0.00 ? 303 GLU A N    5 
ATOM   6078 C CA   . GLU A 1 32 ? 6.631   -13.805 3.787   1.00 0.00 ? 303 GLU A CA   5 
ATOM   6079 C C    . GLU A 1 32 ? 5.759   -15.061 3.876   1.00 0.00 ? 303 GLU A C    5 
ATOM   6080 O O    . GLU A 1 32 ? 6.255   -16.158 4.044   1.00 0.00 ? 303 GLU A O    5 
ATOM   6081 C CB   . GLU A 1 32 ? 6.626   -13.084 5.138   1.00 0.00 ? 303 GLU A CB   5 
ATOM   6082 C CG   . GLU A 1 32 ? 5.185   -12.878 5.604   1.00 0.00 ? 303 GLU A CG   5 
ATOM   6083 C CD   . GLU A 1 32 ? 5.181   -12.204 6.978   1.00 0.00 ? 303 GLU A CD   5 
ATOM   6084 O OE1  . GLU A 1 32 ? 5.450   -11.016 7.032   1.00 0.00 ? 303 GLU A OE1  5 
ATOM   6085 O OE2  . GLU A 1 32 ? 4.909   -12.888 7.950   1.00 0.00 ? 303 GLU A OE2  5 
ATOM   6086 H H    . GLU A 1 32 ? 5.829   -12.005 2.990   1.00 0.00 ? 303 GLU A H    5 
ATOM   6087 H HA   . GLU A 1 32 ? 7.641   -14.087 3.536   1.00 0.00 ? 303 GLU A HA   5 
ATOM   6088 H HB2  . GLU A 1 32 ? 7.159   -13.680 5.864   1.00 0.00 ? 303 GLU A HB2  5 
ATOM   6089 H HB3  . GLU A 1 32 ? 7.109   -12.124 5.035   1.00 0.00 ? 303 GLU A HB3  5 
ATOM   6090 H HG2  . GLU A 1 32 ? 4.664   -12.252 4.894   1.00 0.00 ? 303 GLU A HG2  5 
ATOM   6091 H HG3  . GLU A 1 32 ? 4.689   -13.834 5.674   1.00 0.00 ? 303 GLU A HG3  5 
ATOM   6092 N N    . GLN A 1 33 ? 4.467   -14.912 3.771   1.00 0.00 ? 304 GLN A N    5 
ATOM   6093 C CA   . GLN A 1 33 ? 3.598   -16.080 3.853   1.00 0.00 ? 304 GLN A CA   5 
ATOM   6094 C C    . GLN A 1 33 ? 3.759   -16.932 2.591   1.00 0.00 ? 304 GLN A C    5 
ATOM   6095 O O    . GLN A 1 33 ? 3.633   -18.140 2.628   1.00 0.00 ? 304 GLN A O    5 
ATOM   6096 C CB   . GLN A 1 33 ? 2.139   -15.633 3.993   1.00 0.00 ? 304 GLN A CB   5 
ATOM   6097 C CG   . GLN A 1 33 ? 1.716   -14.856 2.747   1.00 0.00 ? 304 GLN A CG   5 
ATOM   6098 C CD   . GLN A 1 33 ? 0.240   -14.470 2.866   1.00 0.00 ? 304 GLN A CD   5 
ATOM   6099 O OE1  . GLN A 1 33 ? -0.426  -14.255 1.874   1.00 0.00 ? 304 GLN A OE1  5 
ATOM   6100 N NE2  . GLN A 1 33 ? -0.303  -14.372 4.050   1.00 0.00 ? 304 GLN A NE2  5 
ATOM   6101 H H    . GLN A 1 33 ? 4.081   -14.019 3.639   1.00 0.00 ? 304 GLN A H    5 
ATOM   6102 H HA   . GLN A 1 33 ? 3.872   -16.668 4.716   1.00 0.00 ? 304 GLN A HA   5 
ATOM   6103 H HB2  . GLN A 1 33 ? 1.506   -16.501 4.110   1.00 0.00 ? 304 GLN A HB2  5 
ATOM   6104 H HB3  . GLN A 1 33 ? 2.041   -14.999 4.861   1.00 0.00 ? 304 GLN A HB3  5 
ATOM   6105 H HG2  . GLN A 1 33 ? 2.316   -13.962 2.657   1.00 0.00 ? 304 GLN A HG2  5 
ATOM   6106 H HG3  . GLN A 1 33 ? 1.854   -15.473 1.872   1.00 0.00 ? 304 GLN A HG3  5 
ATOM   6107 H HE21 . GLN A 1 33 ? 0.233   -14.545 4.852   1.00 0.00 ? 304 GLN A HE21 5 
ATOM   6108 H HE22 . GLN A 1 33 ? -1.249  -14.127 4.136   1.00 0.00 ? 304 GLN A HE22 5 
ATOM   6109 N N    . VAL A 1 34 ? 4.045   -16.318 1.474   1.00 0.00 ? 305 VAL A N    5 
ATOM   6110 C CA   . VAL A 1 34 ? 4.216   -17.091 0.249   1.00 0.00 ? 305 VAL A CA   5 
ATOM   6111 C C    . VAL A 1 34 ? 5.438   -18.000 0.396   1.00 0.00 ? 305 VAL A C    5 
ATOM   6112 O O    . VAL A 1 34 ? 5.426   -19.147 -0.009  1.00 0.00 ? 305 VAL A O    5 
ATOM   6113 C CB   . VAL A 1 34 ? 4.423   -16.144 -0.934  1.00 0.00 ? 305 VAL A CB   5 
ATOM   6114 C CG1  . VAL A 1 34 ? 4.856   -16.947 -2.162  1.00 0.00 ? 305 VAL A CG1  5 
ATOM   6115 C CG2  . VAL A 1 34 ? 3.109   -15.417 -1.240  1.00 0.00 ? 305 VAL A CG2  5 
ATOM   6116 H H    . VAL A 1 34 ? 4.149   -15.344 1.460   1.00 0.00 ? 305 VAL A H    5 
ATOM   6117 H HA   . VAL A 1 34 ? 3.338   -17.694 0.078   1.00 0.00 ? 305 VAL A HA   5 
ATOM   6118 H HB   . VAL A 1 34 ? 5.187   -15.421 -0.687  1.00 0.00 ? 305 VAL A HB   5 
ATOM   6119 H HG11 . VAL A 1 34 ? 4.844   -18.000 -1.926  1.00 0.00 ? 305 VAL A HG11 5 
ATOM   6120 H HG12 . VAL A 1 34 ? 4.176   -16.752 -2.978  1.00 0.00 ? 305 VAL A HG12 5 
ATOM   6121 H HG13 . VAL A 1 34 ? 5.855   -16.653 -2.449  1.00 0.00 ? 305 VAL A HG13 5 
ATOM   6122 H HG21 . VAL A 1 34 ? 2.487   -15.413 -0.356  1.00 0.00 ? 305 VAL A HG21 5 
ATOM   6123 H HG22 . VAL A 1 34 ? 3.319   -14.401 -1.536  1.00 0.00 ? 305 VAL A HG22 5 
ATOM   6124 H HG23 . VAL A 1 34 ? 2.594   -15.928 -2.040  1.00 0.00 ? 305 VAL A HG23 5 
ATOM   6125 N N    . ALA A 1 35 ? 6.492   -17.499 0.980   1.00 0.00 ? 306 ALA A N    5 
ATOM   6126 C CA   . ALA A 1 35 ? 7.686   -18.317 1.158   1.00 0.00 ? 306 ALA A CA   5 
ATOM   6127 C C    . ALA A 1 35 ? 7.388   -19.425 2.166   1.00 0.00 ? 306 ALA A C    5 
ATOM   6128 O O    . ALA A 1 35 ? 7.851   -20.541 2.035   1.00 0.00 ? 306 ALA A O    5 
ATOM   6129 C CB   . ALA A 1 35 ? 8.832   -17.445 1.677   1.00 0.00 ? 306 ALA A CB   5 
ATOM   6130 H H    . ALA A 1 35 ? 6.480   -16.574 1.303   1.00 0.00 ? 306 ALA A H    5 
ATOM   6131 H HA   . ALA A 1 35 ? 7.969   -18.754 0.211   1.00 0.00 ? 306 ALA A HA   5 
ATOM   6132 H HB1  . ALA A 1 35 ? 8.806   -16.485 1.183   1.00 0.00 ? 306 ALA A HB1  5 
ATOM   6133 H HB2  . ALA A 1 35 ? 8.722   -17.304 2.742   1.00 0.00 ? 306 ALA A HB2  5 
ATOM   6134 H HB3  . ALA A 1 35 ? 9.774   -17.930 1.474   1.00 0.00 ? 306 ALA A HB3  5 
ATOM   6135 N N    . GLN A 1 36 ? 6.612   -19.129 3.173   1.00 0.00 ? 307 GLN A N    5 
ATOM   6136 C CA   . GLN A 1 36 ? 6.286   -20.144 4.167   1.00 0.00 ? 307 GLN A CA   5 
ATOM   6137 C C    . GLN A 1 36 ? 5.536   -21.290 3.485   1.00 0.00 ? 307 GLN A C    5 
ATOM   6138 O O    . GLN A 1 36 ? 5.727   -22.447 3.803   1.00 0.00 ? 307 GLN A O    5 
ATOM   6139 C CB   . GLN A 1 36 ? 5.401   -19.529 5.253   1.00 0.00 ? 307 GLN A CB   5 
ATOM   6140 C CG   . GLN A 1 36 ? 6.270   -19.068 6.425   1.00 0.00 ? 307 GLN A CG   5 
ATOM   6141 C CD   . GLN A 1 36 ? 5.381   -18.754 7.628   1.00 0.00 ? 307 GLN A CD   5 
ATOM   6142 O OE1  . GLN A 1 36 ? 5.709   -19.096 8.746   1.00 0.00 ? 307 GLN A OE1  5 
ATOM   6143 N NE2  . GLN A 1 36 ? 4.258   -18.113 7.444   1.00 0.00 ? 307 GLN A NE2  5 
ATOM   6144 H H    . GLN A 1 36 ? 6.246   -18.223 3.259   1.00 0.00 ? 307 GLN A H    5 
ATOM   6145 H HA   . GLN A 1 36 ? 7.195   -20.520 4.612   1.00 0.00 ? 307 GLN A HA   5 
ATOM   6146 H HB2  . GLN A 1 36 ? 4.867   -18.683 4.845   1.00 0.00 ? 307 GLN A HB2  5 
ATOM   6147 H HB3  . GLN A 1 36 ? 4.695   -20.267 5.602   1.00 0.00 ? 307 GLN A HB3  5 
ATOM   6148 H HG2  . GLN A 1 36 ? 6.967   -19.853 6.685   1.00 0.00 ? 307 GLN A HG2  5 
ATOM   6149 H HG3  . GLN A 1 36 ? 6.816   -18.182 6.141   1.00 0.00 ? 307 GLN A HG3  5 
ATOM   6150 H HE21 . GLN A 1 36 ? 3.994   -17.836 6.541   1.00 0.00 ? 307 GLN A HE21 5 
ATOM   6151 H HE22 . GLN A 1 36 ? 3.682   -17.906 8.208   1.00 0.00 ? 307 GLN A HE22 5 
ATOM   6152 N N    . LEU A 1 37 ? 4.687   -20.972 2.549   1.00 0.00 ? 308 LEU A N    5 
ATOM   6153 C CA   . LEU A 1 37 ? 3.940   -22.015 1.856   1.00 0.00 ? 308 LEU A CA   5 
ATOM   6154 C C    . LEU A 1 37 ? 4.910   -22.896 1.065   1.00 0.00 ? 308 LEU A C    5 
ATOM   6155 O O    . LEU A 1 37 ? 4.886   -24.106 1.162   1.00 0.00 ? 308 LEU A O    5 
ATOM   6156 C CB   . LEU A 1 37 ? 2.936   -21.370 0.899   1.00 0.00 ? 308 LEU A CB   5 
ATOM   6157 C CG   . LEU A 1 37 ? 1.561   -21.308 1.566   1.00 0.00 ? 308 LEU A CG   5 
ATOM   6158 C CD1  . LEU A 1 37 ? 0.926   -19.941 1.301   1.00 0.00 ? 308 LEU A CD1  5 
ATOM   6159 C CD2  . LEU A 1 37 ? 0.666   -22.406 0.987   1.00 0.00 ? 308 LEU A CD2  5 
ATOM   6160 H H    . LEU A 1 37 ? 4.551   -20.032 2.308   1.00 0.00 ? 308 LEU A H    5 
ATOM   6161 H HA   . LEU A 1 37 ? 3.411   -22.618 2.577   1.00 0.00 ? 308 LEU A HA   5 
ATOM   6162 H HB2  . LEU A 1 37 ? 3.266   -20.369 0.656   1.00 0.00 ? 308 LEU A HB2  5 
ATOM   6163 H HB3  . LEU A 1 37 ? 2.870   -21.957 -0.004  1.00 0.00 ? 308 LEU A HB3  5 
ATOM   6164 H HG   . LEU A 1 37 ? 1.671   -21.453 2.631   1.00 0.00 ? 308 LEU A HG   5 
ATOM   6165 H HD11 . LEU A 1 37 ? 1.300   -19.545 0.368   1.00 0.00 ? 308 LEU A HD11 5 
ATOM   6166 H HD12 . LEU A 1 37 ? -0.146  -20.049 1.242   1.00 0.00 ? 308 LEU A HD12 5 
ATOM   6167 H HD13 . LEU A 1 37 ? 1.178   -19.266 2.104   1.00 0.00 ? 308 LEU A HD13 5 
ATOM   6168 H HD21 . LEU A 1 37 ? 1.163   -22.872 0.150   1.00 0.00 ? 308 LEU A HD21 5 
ATOM   6169 H HD22 . LEU A 1 37 ? 0.468   -23.147 1.747   1.00 0.00 ? 308 LEU A HD22 5 
ATOM   6170 H HD23 . LEU A 1 37 ? -0.266  -21.973 0.656   1.00 0.00 ? 308 LEU A HD23 5 
ATOM   6171 N N    . LYS A 1 38 ? 5.764   -22.296 0.280   1.00 0.00 ? 309 LYS A N    5 
ATOM   6172 C CA   . LYS A 1 38 ? 6.714   -23.082 -0.500  1.00 0.00 ? 309 LYS A CA   5 
ATOM   6173 C C    . LYS A 1 38 ? 7.643   -23.846 0.449   1.00 0.00 ? 309 LYS A C    5 
ATOM   6174 O O    . LYS A 1 38 ? 8.280   -24.807 0.066   1.00 0.00 ? 309 LYS A O    5 
ATOM   6175 C CB   . LYS A 1 38 ? 7.546   -22.148 -1.381  1.00 0.00 ? 309 LYS A CB   5 
ATOM   6176 C CG   . LYS A 1 38 ? 6.622   -21.384 -2.331  1.00 0.00 ? 309 LYS A CG   5 
ATOM   6177 C CD   . LYS A 1 38 ? 6.226   -22.289 -3.498  1.00 0.00 ? 309 LYS A CD   5 
ATOM   6178 C CE   . LYS A 1 38 ? 5.934   -21.434 -4.732  1.00 0.00 ? 309 LYS A CE   5 
ATOM   6179 N NZ   . LYS A 1 38 ? 5.654   -22.320 -5.898  1.00 0.00 ? 309 LYS A NZ   5 
ATOM   6180 H H    . LYS A 1 38 ? 5.767   -21.318 0.216   1.00 0.00 ? 309 LYS A H    5 
ATOM   6181 H HA   . LYS A 1 38 ? 6.180   -23.781 -1.122  1.00 0.00 ? 309 LYS A HA   5 
ATOM   6182 H HB2  . LYS A 1 38 ? 8.083   -21.448 -0.758  1.00 0.00 ? 309 LYS A HB2  5 
ATOM   6183 H HB3  . LYS A 1 38 ? 8.248   -22.730 -1.959  1.00 0.00 ? 309 LYS A HB3  5 
ATOM   6184 H HG2  . LYS A 1 38 ? 5.734   -21.075 -1.798  1.00 0.00 ? 309 LYS A HG2  5 
ATOM   6185 H HG3  . LYS A 1 38 ? 7.136   -20.513 -2.712  1.00 0.00 ? 309 LYS A HG3  5 
ATOM   6186 H HD2  . LYS A 1 38 ? 7.038   -22.970 -3.716  1.00 0.00 ? 309 LYS A HD2  5 
ATOM   6187 H HD3  . LYS A 1 38 ? 5.344   -22.852 -3.237  1.00 0.00 ? 309 LYS A HD3  5 
ATOM   6188 H HE2  . LYS A 1 38 ? 5.075   -20.808 -4.541  1.00 0.00 ? 309 LYS A HE2  5 
ATOM   6189 H HE3  . LYS A 1 38 ? 6.789   -20.811 -4.951  1.00 0.00 ? 309 LYS A HE3  5 
ATOM   6190 H HZ1  . LYS A 1 38 ? 5.325   -23.246 -5.558  1.00 0.00 ? 309 LYS A HZ1  5 
ATOM   6191 H HZ2  . LYS A 1 38 ? 4.916   -21.891 -6.492  1.00 0.00 ? 309 LYS A HZ2  5 
ATOM   6192 H HZ3  . LYS A 1 38 ? 6.522   -22.442 -6.457  1.00 0.00 ? 309 LYS A HZ3  5 
ATOM   6193 N N    . GLN A 1 39 ? 7.723   -23.427 1.682   1.00 0.00 ? 310 GLN A N    5 
ATOM   6194 C CA   . GLN A 1 39 ? 8.594   -24.113 2.630   1.00 0.00 ? 310 GLN A CA   5 
ATOM   6195 C C    . GLN A 1 39 ? 8.072   -25.531 2.877   1.00 0.00 ? 310 GLN A C    5 
ATOM   6196 O O    . GLN A 1 39 ? 8.834   -26.468 3.005   1.00 0.00 ? 310 GLN A O    5 
ATOM   6197 C CB   . GLN A 1 39 ? 8.618   -23.340 3.949   1.00 0.00 ? 310 GLN A CB   5 
ATOM   6198 C CG   . GLN A 1 39 ? 9.950   -23.589 4.662   1.00 0.00 ? 310 GLN A CG   5 
ATOM   6199 C CD   . GLN A 1 39 ? 11.028  -22.689 4.058   1.00 0.00 ? 310 GLN A CD   5 
ATOM   6200 O OE1  . GLN A 1 39 ? 10.978  -21.483 4.198   1.00 0.00 ? 310 GLN A OE1  5 
ATOM   6201 N NE2  . GLN A 1 39 ? 12.010  -23.227 3.388   1.00 0.00 ? 310 GLN A NE2  5 
ATOM   6202 H H    . GLN A 1 39 ? 7.202   -22.648 1.970   1.00 0.00 ? 310 GLN A H    5 
ATOM   6203 H HA   . GLN A 1 39 ? 9.594   -24.163 2.226   1.00 0.00 ? 310 GLN A HA   5 
ATOM   6204 H HB2  . GLN A 1 39 ? 8.507   -22.284 3.750   1.00 0.00 ? 310 GLN A HB2  5 
ATOM   6205 H HB3  . GLN A 1 39 ? 7.808   -23.676 4.579   1.00 0.00 ? 310 GLN A HB3  5 
ATOM   6206 H HG2  . GLN A 1 39 ? 9.841   -23.367 5.715   1.00 0.00 ? 310 GLN A HG2  5 
ATOM   6207 H HG3  . GLN A 1 39 ? 10.236  -24.623 4.540   1.00 0.00 ? 310 GLN A HG3  5 
ATOM   6208 H HE21 . GLN A 1 39 ? 12.051  -24.200 3.277   1.00 0.00 ? 310 GLN A HE21 5 
ATOM   6209 H HE22 . GLN A 1 39 ? 12.705  -22.659 2.996   1.00 0.00 ? 310 GLN A HE22 5 
ATOM   6210 N N    . LYS A 1 40 ? 6.779   -25.698 2.952   1.00 0.00 ? 311 LYS A N    5 
ATOM   6211 C CA   . LYS A 1 40 ? 6.230   -27.028 3.191   1.00 0.00 ? 311 LYS A CA   5 
ATOM   6212 C C    . LYS A 1 40 ? 6.059   -27.759 1.857   1.00 0.00 ? 311 LYS A C    5 
ATOM   6213 O O    . LYS A 1 40 ? 6.039   -28.973 1.802   1.00 0.00 ? 311 LYS A O    5 
ATOM   6214 C CB   . LYS A 1 40 ? 4.870   -26.903 3.882   1.00 0.00 ? 311 LYS A CB   5 
ATOM   6215 C CG   . LYS A 1 40 ? 5.057   -26.284 5.269   1.00 0.00 ? 311 LYS A CG   5 
ATOM   6216 C CD   . LYS A 1 40 ? 3.781   -26.481 6.091   1.00 0.00 ? 311 LYS A CD   5 
ATOM   6217 C CE   . LYS A 1 40 ? 3.944   -25.803 7.453   1.00 0.00 ? 311 LYS A CE   5 
ATOM   6218 N NZ   . LYS A 1 40 ? 2.645   -25.193 7.860   1.00 0.00 ? 311 LYS A NZ   5 
ATOM   6219 H H    . LYS A 1 40 ? 6.179   -24.930 2.850   1.00 0.00 ? 311 LYS A H    5 
ATOM   6220 H HA   . LYS A 1 40 ? 6.903   -27.587 3.823   1.00 0.00 ? 311 LYS A HA   5 
ATOM   6221 H HB2  . LYS A 1 40 ? 4.221   -26.275 3.290   1.00 0.00 ? 311 LYS A HB2  5 
ATOM   6222 H HB3  . LYS A 1 40 ? 4.428   -27.883 3.985   1.00 0.00 ? 311 LYS A HB3  5 
ATOM   6223 H HG2  . LYS A 1 40 ? 5.886   -26.763 5.768   1.00 0.00 ? 311 LYS A HG2  5 
ATOM   6224 H HG3  . LYS A 1 40 ? 5.258   -25.228 5.167   1.00 0.00 ? 311 LYS A HG3  5 
ATOM   6225 H HD2  . LYS A 1 40 ? 2.945   -26.044 5.567   1.00 0.00 ? 311 LYS A HD2  5 
ATOM   6226 H HD3  . LYS A 1 40 ? 3.605   -27.536 6.236   1.00 0.00 ? 311 LYS A HD3  5 
ATOM   6227 H HE2  . LYS A 1 40 ? 4.244   -26.535 8.187   1.00 0.00 ? 311 LYS A HE2  5 
ATOM   6228 H HE3  . LYS A 1 40 ? 4.697   -25.032 7.385   1.00 0.00 ? 311 LYS A HE3  5 
ATOM   6229 H HZ1  . LYS A 1 40 ? 1.863   -25.710 7.413   1.00 0.00 ? 311 LYS A HZ1  5 
ATOM   6230 H HZ2  . LYS A 1 40 ? 2.546   -25.248 8.894   1.00 0.00 ? 311 LYS A HZ2  5 
ATOM   6231 H HZ3  . LYS A 1 40 ? 2.621   -24.196 7.561   1.00 0.00 ? 311 LYS A HZ3  5 
ATOM   6232 N N    . VAL A 1 41 ? 5.935   -27.032 0.780   1.00 0.00 ? 312 VAL A N    5 
ATOM   6233 C CA   . VAL A 1 41 ? 5.766   -27.676 -0.518  1.00 0.00 ? 312 VAL A CA   5 
ATOM   6234 C C    . VAL A 1 41 ? 7.101   -28.275 -0.970  1.00 0.00 ? 312 VAL A C    5 
ATOM   6235 O O    . VAL A 1 41 ? 7.147   -29.134 -1.827  1.00 0.00 ? 312 VAL A O    5 
ATOM   6236 C CB   . VAL A 1 41 ? 5.301   -26.641 -1.543  1.00 0.00 ? 312 VAL A CB   5 
ATOM   6237 C CG1  . VAL A 1 41 ? 4.748   -27.357 -2.776  1.00 0.00 ? 312 VAL A CG1  5 
ATOM   6238 C CG2  . VAL A 1 41 ? 4.203   -25.771 -0.926  1.00 0.00 ? 312 VAL A CG2  5 
ATOM   6239 H H    . VAL A 1 41 ? 5.951   -26.054 0.845   1.00 0.00 ? 312 VAL A H    5 
ATOM   6240 H HA   . VAL A 1 41 ? 5.028   -28.459 -0.438  1.00 0.00 ? 312 VAL A HA   5 
ATOM   6241 H HB   . VAL A 1 41 ? 6.136   -26.021 -1.832  1.00 0.00 ? 312 VAL A HB   5 
ATOM   6242 H HG11 . VAL A 1 41 ? 5.230   -28.318 -2.883  1.00 0.00 ? 312 VAL A HG11 5 
ATOM   6243 H HG12 . VAL A 1 41 ? 3.683   -27.497 -2.665  1.00 0.00 ? 312 VAL A HG12 5 
ATOM   6244 H HG13 . VAL A 1 41 ? 4.942   -26.760 -3.656  1.00 0.00 ? 312 VAL A HG13 5 
ATOM   6245 H HG21 . VAL A 1 41 ? 4.007   -26.098 0.083   1.00 0.00 ? 312 VAL A HG21 5 
ATOM   6246 H HG22 . VAL A 1 41 ? 4.527   -24.740 -0.913  1.00 0.00 ? 312 VAL A HG22 5 
ATOM   6247 H HG23 . VAL A 1 41 ? 3.302   -25.855 -1.513  1.00 0.00 ? 312 VAL A HG23 5 
ATOM   6248 N N    . MET A 1 42 ? 8.186   -27.829 -0.399  1.00 0.00 ? 313 MET A N    5 
ATOM   6249 C CA   . MET A 1 42 ? 9.486   -28.361 -0.790  1.00 0.00 ? 313 MET A CA   5 
ATOM   6250 C C    . MET A 1 42 ? 9.571   -29.840 -0.402  1.00 0.00 ? 313 MET A C    5 
ATOM   6251 O O    . MET A 1 42 ? 9.789   -30.179 0.744   1.00 0.00 ? 313 MET A O    5 
ATOM   6252 C CB   . MET A 1 42 ? 10.593  -27.581 -0.078  1.00 0.00 ? 313 MET A CB   5 
ATOM   6253 C CG   . MET A 1 42 ? 11.947  -28.225 -0.379  1.00 0.00 ? 313 MET A CG   5 
ATOM   6254 S SD   . MET A 1 42 ? 13.149  -26.937 -0.792  1.00 0.00 ? 313 MET A SD   5 
ATOM   6255 C CE   . MET A 1 42 ? 13.067  -26.038 0.776   1.00 0.00 ? 313 MET A CE   5 
ATOM   6256 H H    . MET A 1 42 ? 8.128   -27.135 0.290   1.00 0.00 ? 313 MET A H    5 
ATOM   6257 H HA   . MET A 1 42 ? 9.609   -28.262 -1.858  1.00 0.00 ? 313 MET A HA   5 
ATOM   6258 H HB2  . MET A 1 42 ? 10.594  -26.558 -0.427  1.00 0.00 ? 313 MET A HB2  5 
ATOM   6259 H HB3  . MET A 1 42 ? 10.418  -27.598 0.987   1.00 0.00 ? 313 MET A HB3  5 
ATOM   6260 H HG2  . MET A 1 42 ? 12.288  -28.771 0.489   1.00 0.00 ? 313 MET A HG2  5 
ATOM   6261 H HG3  . MET A 1 42 ? 11.845  -28.904 -1.214  1.00 0.00 ? 313 MET A HG3  5 
ATOM   6262 H HE1  . MET A 1 42 ? 13.332  -26.705 1.586   1.00 0.00 ? 313 MET A HE1  5 
ATOM   6263 H HE2  . MET A 1 42 ? 13.758  -25.211 0.755   1.00 0.00 ? 313 MET A HE2  5 
ATOM   6264 H HE3  . MET A 1 42 ? 12.064  -25.664 0.923   1.00 0.00 ? 313 MET A HE3  5 
ATOM   6265 N N    . ASN A 1 43 ? 9.402   -30.721 -1.349  1.00 0.00 ? 314 ASN A N    5 
ATOM   6266 C CA   . ASN A 1 43 ? 9.473   -32.145 -1.044  1.00 0.00 ? 314 ASN A CA   5 
ATOM   6267 C C    . ASN A 1 43 ? 9.692   -32.931 -2.340  1.00 0.00 ? 314 ASN A C    5 
ATOM   6268 O O    . ASN A 1 43 ? 8.765   -33.456 -2.924  1.00 0.00 ? 314 ASN A O    5 
ATOM   6269 C CB   . ASN A 1 43 ? 8.165   -32.595 -0.388  1.00 0.00 ? 314 ASN A CB   5 
ATOM   6270 C CG   . ASN A 1 43 ? 8.479   -33.485 0.817   1.00 0.00 ? 314 ASN A CG   5 
ATOM   6271 O OD1  . ASN A 1 43 ? 9.541   -34.066 0.899   1.00 0.00 ? 314 ASN A OD1  5 
ATOM   6272 N ND2  . ASN A 1 43 ? 7.589   -33.615 1.763   1.00 0.00 ? 314 ASN A ND2  5 
ATOM   6273 H H    . ASN A 1 43 ? 9.227   -30.425 -2.267  1.00 0.00 ? 314 ASN A H    5 
ATOM   6274 H HA   . ASN A 1 43 ? 10.295  -32.327 -0.368  1.00 0.00 ? 314 ASN A HA   5 
ATOM   6275 H HB2  . ASN A 1 43 ? 7.610   -31.728 -0.060  1.00 0.00 ? 314 ASN A HB2  5 
ATOM   6276 H HB3  . ASN A 1 43 ? 7.578   -33.153 -1.101  1.00 0.00 ? 314 ASN A HB3  5 
ATOM   6277 H HD21 . ASN A 1 43 ? 6.732   -33.146 1.698   1.00 0.00 ? 314 ASN A HD21 5 
ATOM   6278 H HD22 . ASN A 1 43 ? 7.780   -34.183 2.540   1.00 0.00 ? 314 ASN A HD22 5 
ATOM   6279 N N    . TYR A 1 44 ? 10.915  -33.017 -2.792  1.00 0.00 ? 315 TYR A N    5 
ATOM   6280 C CA   . TYR A 1 44 ? 11.191  -33.751 -4.021  1.00 0.00 ? 315 TYR A CA   5 
ATOM   6281 C C    . TYR A 1 44 ? 11.769  -35.125 -3.674  1.00 0.00 ? 315 TYR A C    5 
ATOM   6282 O O    . TYR A 1 44 ? 12.575  -35.620 -4.446  1.00 0.00 ? 315 TYR A O    5 
ATOM   6283 C CB   . TYR A 1 44 ? 12.198  -32.972 -4.868  1.00 0.00 ? 315 TYR A CB   5 
ATOM   6284 C CG   . TYR A 1 44 ? 11.493  -31.833 -5.567  1.00 0.00 ? 315 TYR A CG   5 
ATOM   6285 C CD1  . TYR A 1 44 ? 11.064  -30.716 -4.832  1.00 0.00 ? 315 TYR A CD1  5 
ATOM   6286 C CD2  . TYR A 1 44 ? 11.267  -31.892 -6.951  1.00 0.00 ? 315 TYR A CD2  5 
ATOM   6287 C CE1  . TYR A 1 44 ? 10.408  -29.659 -5.482  1.00 0.00 ? 315 TYR A CE1  5 
ATOM   6288 C CE2  . TYR A 1 44 ? 10.612  -30.835 -7.602  1.00 0.00 ? 315 TYR A CE2  5 
ATOM   6289 C CZ   . TYR A 1 44 ? 10.182  -29.718 -6.867  1.00 0.00 ? 315 TYR A CZ   5 
ATOM   6290 O OH   . TYR A 1 44 ? 9.537   -28.678 -7.505  1.00 0.00 ? 315 TYR A OH   5 
ATOM   6291 O OXT  . TYR A 1 44 ? 11.398  -35.658 -2.641  1.00 0.00 ? 315 TYR A OXT  5 
ATOM   6292 H H    . TYR A 1 44 ? 11.647  -32.586 -2.304  1.00 0.00 ? 315 TYR A H    5 
ATOM   6293 H HA   . TYR A 1 44 ? 10.275  -33.877 -4.579  1.00 0.00 ? 315 TYR A HA   5 
ATOM   6294 H HB2  . TYR A 1 44 ? 12.975  -32.577 -4.230  1.00 0.00 ? 315 TYR A HB2  5 
ATOM   6295 H HB3  . TYR A 1 44 ? 12.635  -33.630 -5.605  1.00 0.00 ? 315 TYR A HB3  5 
ATOM   6296 H HD1  . TYR A 1 44 ? 11.237  -30.672 -3.767  1.00 0.00 ? 315 TYR A HD1  5 
ATOM   6297 H HD2  . TYR A 1 44 ? 11.598  -32.751 -7.517  1.00 0.00 ? 315 TYR A HD2  5 
ATOM   6298 H HE1  . TYR A 1 44 ? 10.077  -28.799 -4.917  1.00 0.00 ? 315 TYR A HE1  5 
ATOM   6299 H HE2  . TYR A 1 44 ? 10.437  -30.879 -8.667  1.00 0.00 ? 315 TYR A HE2  5 
ATOM   6300 H HH   . TYR A 1 44 ? 8.610   -28.709 -7.260  1.00 0.00 ? 315 TYR A HH   5 
HETATM 6301 C C    . ACE B 1 1  ? 6.314   31.476  1.204   1.00 0.00 ? 272 ACE B C    5 
HETATM 6302 O O    . ACE B 1 1  ? 7.029   30.518  0.986   1.00 0.00 ? 272 ACE B O    5 
HETATM 6303 C CH3  . ACE B 1 1  ? 6.662   32.493  2.293   1.00 0.00 ? 272 ACE B CH3  5 
HETATM 6304 H H1   . ACE B 1 1  ? 6.958   31.973  3.191   1.00 0.00 ? 272 ACE B H1   5 
HETATM 6305 H H2   . ACE B 1 1  ? 7.476   33.118  1.955   1.00 0.00 ? 272 ACE B H2   5 
HETATM 6306 H H3   . ACE B 1 1  ? 5.799   33.109  2.501   1.00 0.00 ? 272 ACE B H3   5 
ATOM   6307 N N    . CYS B 1 2  ? 5.221   31.675  0.520   1.00 0.00 ? 273 CYS B N    5 
ATOM   6308 C CA   . CYS B 1 2  ? 4.837   30.739  -0.529  1.00 0.00 ? 273 CYS B CA   5 
ATOM   6309 C C    . CYS B 1 2  ? 5.503   31.147  -1.846  1.00 0.00 ? 273 CYS B C    5 
ATOM   6310 O O    . CYS B 1 2  ? 5.843   32.295  -2.051  1.00 0.00 ? 273 CYS B O    5 
ATOM   6311 C CB   . CYS B 1 2  ? 3.318   30.761  -0.700  1.00 0.00 ? 273 CYS B CB   5 
ATOM   6312 S SG   . CYS B 1 2  ? 2.777   32.448  -1.069  1.00 0.00 ? 273 CYS B SG   5 
ATOM   6313 H H    . CYS B 1 2  ? 4.658   32.454  0.711   1.00 0.00 ? 273 CYS B H    5 
ATOM   6314 H HA   . CYS B 1 2  ? 5.153   29.743  -0.260  1.00 0.00 ? 273 CYS B HA   5 
ATOM   6315 H HB2  . CYS B 1 2  ? 3.036   30.108  -1.513  1.00 0.00 ? 273 CYS B HB2  5 
ATOM   6316 H HB3  . CYS B 1 2  ? 2.850   30.425  0.211   1.00 0.00 ? 273 CYS B HB3  5 
ATOM   6317 N N    . GLY B 1 3  ? 5.690   30.217  -2.741  1.00 0.00 ? 274 GLY B N    5 
ATOM   6318 C CA   . GLY B 1 3  ? 6.315   30.547  -4.016  1.00 0.00 ? 274 GLY B CA   5 
ATOM   6319 C C    . GLY B 1 3  ? 7.605   29.741  -4.182  1.00 0.00 ? 274 GLY B C    5 
ATOM   6320 O O    . GLY B 1 3  ? 8.626   30.057  -3.602  1.00 0.00 ? 274 GLY B O    5 
ATOM   6321 H H    . GLY B 1 3  ? 5.406   29.297  -2.557  1.00 0.00 ? 274 GLY B H    5 
ATOM   6322 H HA2  . GLY B 1 3  ? 5.635   30.309  -4.822  1.00 0.00 ? 274 GLY B HA2  5 
ATOM   6323 H HA3  . GLY B 1 3  ? 6.550   31.600  -4.041  1.00 0.00 ? 274 GLY B HA3  5 
ATOM   6324 N N    . GLY B 1 4  ? 7.571   28.704  -4.973  1.00 0.00 ? 275 GLY B N    5 
ATOM   6325 C CA   . GLY B 1 4  ? 8.771   27.899  -5.175  1.00 0.00 ? 275 GLY B CA   5 
ATOM   6326 C C    . GLY B 1 4  ? 8.692   26.628  -4.329  1.00 0.00 ? 275 GLY B C    5 
ATOM   6327 O O    . GLY B 1 4  ? 9.184   25.585  -4.713  1.00 0.00 ? 275 GLY B O    5 
ATOM   6328 H H    . GLY B 1 4  ? 6.739   28.467  -5.434  1.00 0.00 ? 275 GLY B H    5 
ATOM   6329 H HA2  . GLY B 1 4  ? 8.853   27.634  -6.220  1.00 0.00 ? 275 GLY B HA2  5 
ATOM   6330 H HA3  . GLY B 1 4  ? 9.638   28.469  -4.879  1.00 0.00 ? 275 GLY B HA3  5 
ATOM   6331 N N    . ARG B 1 5  ? 8.081   26.703  -3.178  1.00 0.00 ? 276 ARG B N    5 
ATOM   6332 C CA   . ARG B 1 5  ? 7.981   25.520  -2.331  1.00 0.00 ? 276 ARG B CA   5 
ATOM   6333 C C    . ARG B 1 5  ? 6.760   24.694  -2.742  1.00 0.00 ? 276 ARG B C    5 
ATOM   6334 O O    . ARG B 1 5  ? 6.694   23.504  -2.502  1.00 0.00 ? 276 ARG B O    5 
ATOM   6335 C CB   . ARG B 1 5  ? 7.838   25.950  -0.869  1.00 0.00 ? 276 ARG B CB   5 
ATOM   6336 C CG   . ARG B 1 5  ? 9.226   26.140  -0.254  1.00 0.00 ? 276 ARG B CG   5 
ATOM   6337 C CD   . ARG B 1 5  ? 9.354   25.277  1.001   1.00 0.00 ? 276 ARG B CD   5 
ATOM   6338 N NE   . ARG B 1 5  ? 9.634   23.899  0.618   1.00 0.00 ? 276 ARG B NE   5 
ATOM   6339 C CZ   . ARG B 1 5  ? 10.090  23.054  1.503   1.00 0.00 ? 276 ARG B CZ   5 
ATOM   6340 N NH1  . ARG B 1 5  ? 9.591   23.040  2.707   1.00 0.00 ? 276 ARG B NH1  5 
ATOM   6341 N NH2  . ARG B 1 5  ? 11.045  22.225  1.182   1.00 0.00 ? 276 ARG B NH2  5 
ATOM   6342 H H    . ARG B 1 5  ? 7.693   27.554  -2.884  1.00 0.00 ? 276 ARG B H    5 
ATOM   6343 H HA   . ARG B 1 5  ? 8.872   24.922  -2.441  1.00 0.00 ? 276 ARG B HA   5 
ATOM   6344 H HB2  . ARG B 1 5  ? 7.290   26.881  -0.819  1.00 0.00 ? 276 ARG B HB2  5 
ATOM   6345 H HB3  . ARG B 1 5  ? 7.305   25.188  -0.319  1.00 0.00 ? 276 ARG B HB3  5 
ATOM   6346 H HG2  . ARG B 1 5  ? 9.978   25.848  -0.973  1.00 0.00 ? 276 ARG B HG2  5 
ATOM   6347 H HG3  . ARG B 1 5  ? 9.364   27.179  0.009   1.00 0.00 ? 276 ARG B HG3  5 
ATOM   6348 H HD2  . ARG B 1 5  ? 10.160  25.651  1.615   1.00 0.00 ? 276 ARG B HD2  5 
ATOM   6349 H HD3  . ARG B 1 5  ? 8.431   25.312  1.559   1.00 0.00 ? 276 ARG B HD3  5 
ATOM   6350 H HE   . ARG B 1 5  ? 9.480   23.606  -0.306  1.00 0.00 ? 276 ARG B HE   5 
ATOM   6351 H HH11 . ARG B 1 5  ? 8.858   23.674  2.952   1.00 0.00 ? 276 ARG B HH11 5 
ATOM   6352 H HH12 . ARG B 1 5  ? 9.939   22.393  3.385   1.00 0.00 ? 276 ARG B HH12 5 
ATOM   6353 H HH21 . ARG B 1 5  ? 11.430  22.237  0.258   1.00 0.00 ? 276 ARG B HH21 5 
ATOM   6354 H HH22 . ARG B 1 5  ? 11.394  21.579  1.860   1.00 0.00 ? 276 ARG B HH22 5 
ATOM   6355 N N    . ILE B 1 6  ? 5.790   25.312  -3.360  1.00 0.00 ? 277 ILE B N    5 
ATOM   6356 C CA   . ILE B 1 6  ? 4.603   24.572  -3.774  1.00 0.00 ? 277 ILE B CA   5 
ATOM   6357 C C    . ILE B 1 6  ? 4.988   23.563  -4.860  1.00 0.00 ? 277 ILE B C    5 
ATOM   6358 O O    . ILE B 1 6  ? 4.387   22.513  -4.982  1.00 0.00 ? 277 ILE B O    5 
ATOM   6359 C CB   . ILE B 1 6  ? 3.557   25.548  -4.322  1.00 0.00 ? 277 ILE B CB   5 
ATOM   6360 C CG1  . ILE B 1 6  ? 2.913   26.306  -3.158  1.00 0.00 ? 277 ILE B CG1  5 
ATOM   6361 C CG2  . ILE B 1 6  ? 2.477   24.774  -5.082  1.00 0.00 ? 277 ILE B CG2  5 
ATOM   6362 C CD1  . ILE B 1 6  ? 3.067   27.811  -3.380  1.00 0.00 ? 277 ILE B CD1  5 
ATOM   6363 H H    . ILE B 1 6  ? 5.859   26.272  -3.545  1.00 0.00 ? 277 ILE B H    5 
ATOM   6364 H HA   . ILE B 1 6  ? 4.192   24.048  -2.925  1.00 0.00 ? 277 ILE B HA   5 
ATOM   6365 H HB   . ILE B 1 6  ? 4.034   26.249  -4.991  1.00 0.00 ? 277 ILE B HB   5 
ATOM   6366 H HG12 . ILE B 1 6  ? 1.864   26.054  -3.103  1.00 0.00 ? 277 ILE B HG12 5 
ATOM   6367 H HG13 . ILE B 1 6  ? 3.399   26.027  -2.235  1.00 0.00 ? 277 ILE B HG13 5 
ATOM   6368 H HG21 . ILE B 1 6  ? 2.134   23.948  -4.477  1.00 0.00 ? 277 ILE B HG21 5 
ATOM   6369 H HG22 . ILE B 1 6  ? 1.647   25.432  -5.298  1.00 0.00 ? 277 ILE B HG22 5 
ATOM   6370 H HG23 . ILE B 1 6  ? 2.889   24.396  -6.007  1.00 0.00 ? 277 ILE B HG23 5 
ATOM   6371 H HD11 . ILE B 1 6  ? 2.752   28.061  -4.382  1.00 0.00 ? 277 ILE B HD11 5 
ATOM   6372 H HD12 . ILE B 1 6  ? 2.457   28.344  -2.667  1.00 0.00 ? 277 ILE B HD12 5 
ATOM   6373 H HD13 . ILE B 1 6  ? 4.102   28.089  -3.248  1.00 0.00 ? 277 ILE B HD13 5 
ATOM   6374 N N    . ALA B 1 7  ? 5.984   23.867  -5.643  1.00 0.00 ? 278 ALA B N    5 
ATOM   6375 C CA   . ALA B 1 7  ? 6.394   22.941  -6.691  1.00 0.00 ? 278 ALA B CA   5 
ATOM   6376 C C    . ALA B 1 7  ? 6.993   21.686  -6.051  1.00 0.00 ? 278 ALA B C    5 
ATOM   6377 O O    . ALA B 1 7  ? 6.848   20.590  -6.556  1.00 0.00 ? 278 ALA B O    5 
ATOM   6378 C CB   . ALA B 1 7  ? 7.441   23.607  -7.585  1.00 0.00 ? 278 ALA B CB   5 
ATOM   6379 H H    . ALA B 1 7  ? 6.458   24.718  -5.528  1.00 0.00 ? 278 ALA B H    5 
ATOM   6380 H HA   . ALA B 1 7  ? 5.537   22.668  -7.287  1.00 0.00 ? 278 ALA B HA   5 
ATOM   6381 H HB1  . ALA B 1 7  ? 7.320   24.680  -7.545  1.00 0.00 ? 278 ALA B HB1  5 
ATOM   6382 H HB2  . ALA B 1 7  ? 8.431   23.344  -7.239  1.00 0.00 ? 278 ALA B HB2  5 
ATOM   6383 H HB3  . ALA B 1 7  ? 7.314   23.269  -8.603  1.00 0.00 ? 278 ALA B HB3  5 
ATOM   6384 N N    . ARG B 1 8  ? 7.661   21.839  -4.942  1.00 0.00 ? 279 ARG B N    5 
ATOM   6385 C CA   . ARG B 1 8  ? 8.253   20.681  -4.280  1.00 0.00 ? 279 ARG B CA   5 
ATOM   6386 C C    . ARG B 1 8  ? 7.143   19.818  -3.679  1.00 0.00 ? 279 ARG B C    5 
ATOM   6387 O O    . ARG B 1 8  ? 7.053   18.634  -3.941  1.00 0.00 ? 279 ARG B O    5 
ATOM   6388 C CB   . ARG B 1 8  ? 9.193   21.154  -3.169  1.00 0.00 ? 279 ARG B CB   5 
ATOM   6389 C CG   . ARG B 1 8  ? 10.644  20.933  -3.599  1.00 0.00 ? 279 ARG B CG   5 
ATOM   6390 C CD   . ARG B 1 8  ? 11.479  22.161  -3.232  1.00 0.00 ? 279 ARG B CD   5 
ATOM   6391 N NE   . ARG B 1 8  ? 12.894  21.861  -3.414  1.00 0.00 ? 279 ARG B NE   5 
ATOM   6392 C CZ   . ARG B 1 8  ? 13.765  22.831  -3.468  1.00 0.00 ? 279 ARG B CZ   5 
ATOM   6393 N NH1  . ARG B 1 8  ? 13.501  23.977  -2.904  1.00 0.00 ? 279 ARG B NH1  5 
ATOM   6394 N NH2  . ARG B 1 8  ? 14.900  22.654  -4.089  1.00 0.00 ? 279 ARG B NH2  5 
ATOM   6395 H H    . ARG B 1 8  ? 7.764   22.732  -4.552  1.00 0.00 ? 279 ARG B H    5 
ATOM   6396 H HA   . ARG B 1 8  ? 8.812   20.103  -5.001  1.00 0.00 ? 279 ARG B HA   5 
ATOM   6397 H HB2  . ARG B 1 8  ? 9.029   22.204  -2.979  1.00 0.00 ? 279 ARG B HB2  5 
ATOM   6398 H HB3  . ARG B 1 8  ? 8.998   20.591  -2.268  1.00 0.00 ? 279 ARG B HB3  5 
ATOM   6399 H HG2  . ARG B 1 8  ? 11.041  20.063  -3.096  1.00 0.00 ? 279 ARG B HG2  5 
ATOM   6400 H HG3  . ARG B 1 8  ? 10.683  20.781  -4.669  1.00 0.00 ? 279 ARG B HG3  5 
ATOM   6401 H HD2  . ARG B 1 8  ? 11.202  22.989  -3.869  1.00 0.00 ? 279 ARG B HD2  5 
ATOM   6402 H HD3  . ARG B 1 8  ? 11.298  22.424  -2.201  1.00 0.00 ? 279 ARG B HD3  5 
ATOM   6403 H HE   . ARG B 1 8  ? 13.189  20.930  -3.495  1.00 0.00 ? 279 ARG B HE   5 
ATOM   6404 H HH11 . ARG B 1 8  ? 12.633  24.113  -2.429  1.00 0.00 ? 279 ARG B HH11 5 
ATOM   6405 H HH12 . ARG B 1 8  ? 14.170  24.721  -2.946  1.00 0.00 ? 279 ARG B HH12 5 
ATOM   6406 H HH21 . ARG B 1 8  ? 15.102  21.775  -4.521  1.00 0.00 ? 279 ARG B HH21 5 
ATOM   6407 H HH22 . ARG B 1 8  ? 15.569  23.396  -4.130  1.00 0.00 ? 279 ARG B HH22 5 
ATOM   6408 N N    . LEU B 1 9  ? 6.296   20.400  -2.875  1.00 0.00 ? 280 LEU B N    5 
ATOM   6409 C CA   . LEU B 1 9  ? 5.216   19.626  -2.271  1.00 0.00 ? 280 LEU B CA   5 
ATOM   6410 C C    . LEU B 1 9  ? 4.447   18.886  -3.369  1.00 0.00 ? 280 LEU B C    5 
ATOM   6411 O O    . LEU B 1 9  ? 4.074   17.740  -3.214  1.00 0.00 ? 280 LEU B O    5 
ATOM   6412 C CB   . LEU B 1 9  ? 4.268   20.568  -1.528  1.00 0.00 ? 280 LEU B CB   5 
ATOM   6413 C CG   . LEU B 1 9  ? 4.650   20.613  -0.047  1.00 0.00 ? 280 LEU B CG   5 
ATOM   6414 C CD1  . LEU B 1 9  ? 4.235   21.960  0.549   1.00 0.00 ? 280 LEU B CD1  5 
ATOM   6415 C CD2  . LEU B 1 9  ? 3.932   19.486  0.699   1.00 0.00 ? 280 LEU B CD2  5 
ATOM   6416 H H    . LEU B 1 9  ? 6.385   21.355  -2.676  1.00 0.00 ? 280 LEU B H    5 
ATOM   6417 H HA   . LEU B 1 9  ? 5.628   18.911  -1.576  1.00 0.00 ? 280 LEU B HA   5 
ATOM   6418 H HB2  . LEU B 1 9  ? 4.341   21.560  -1.949  1.00 0.00 ? 280 LEU B HB2  5 
ATOM   6419 H HB3  . LEU B 1 9  ? 3.254   20.210  -1.626  1.00 0.00 ? 280 LEU B HB3  5 
ATOM   6420 H HG   . LEU B 1 9  ? 5.718   20.488  0.052   1.00 0.00 ? 280 LEU B HG   5 
ATOM   6421 H HD11 . LEU B 1 9  ? 3.179   22.114  0.391   1.00 0.00 ? 280 LEU B HD11 5 
ATOM   6422 H HD12 . LEU B 1 9  ? 4.446   21.967  1.607   1.00 0.00 ? 280 LEU B HD12 5 
ATOM   6423 H HD13 . LEU B 1 9  ? 4.789   22.751  0.067   1.00 0.00 ? 280 LEU B HD13 5 
ATOM   6424 H HD21 . LEU B 1 9  ? 3.630   18.724  -0.005  1.00 0.00 ? 280 LEU B HD21 5 
ATOM   6425 H HD22 . LEU B 1 9  ? 4.599   19.056  1.430   1.00 0.00 ? 280 LEU B HD22 5 
ATOM   6426 H HD23 . LEU B 1 9  ? 3.058   19.882  1.195   1.00 0.00 ? 280 LEU B HD23 5 
ATOM   6427 N N    . GLU B 1 10 ? 4.210   19.532  -4.478  1.00 0.00 ? 281 GLU B N    5 
ATOM   6428 C CA   . GLU B 1 10 ? 3.484   18.878  -5.561  1.00 0.00 ? 281 GLU B CA   5 
ATOM   6429 C C    . GLU B 1 10 ? 4.258   17.638  -6.013  1.00 0.00 ? 281 GLU B C    5 
ATOM   6430 O O    . GLU B 1 10 ? 3.704   16.568  -6.161  1.00 0.00 ? 281 GLU B O    5 
ATOM   6431 C CB   . GLU B 1 10 ? 3.341   19.846  -6.737  1.00 0.00 ? 281 GLU B CB   5 
ATOM   6432 C CG   . GLU B 1 10 ? 1.937   20.454  -6.734  1.00 0.00 ? 281 GLU B CG   5 
ATOM   6433 C CD   . GLU B 1 10 ? 0.958   19.482  -7.393  1.00 0.00 ? 281 GLU B CD   5 
ATOM   6434 O OE1  . GLU B 1 10 ? 1.205   19.101  -8.526  1.00 0.00 ? 281 GLU B OE1  5 
ATOM   6435 O OE2  . GLU B 1 10 ? -0.021  19.135  -6.755  1.00 0.00 ? 281 GLU B OE2  5 
ATOM   6436 H H    . GLU B 1 10 ? 4.521   20.455  -4.583  1.00 0.00 ? 281 GLU B H    5 
ATOM   6437 H HA   . GLU B 1 10 ? 2.504   18.587  -5.215  1.00 0.00 ? 281 GLU B HA   5 
ATOM   6438 H HB2  . GLU B 1 10 ? 4.075   20.635  -6.646  1.00 0.00 ? 281 GLU B HB2  5 
ATOM   6439 H HB3  . GLU B 1 10 ? 3.498   19.314  -7.664  1.00 0.00 ? 281 GLU B HB3  5 
ATOM   6440 H HG2  . GLU B 1 10 ? 1.630   20.641  -5.715  1.00 0.00 ? 281 GLU B HG2  5 
ATOM   6441 H HG3  . GLU B 1 10 ? 1.945   21.382  -7.283  1.00 0.00 ? 281 GLU B HG3  5 
ATOM   6442 N N    . GLU B 1 11 ? 5.538   17.775  -6.226  1.00 0.00 ? 282 GLU B N    5 
ATOM   6443 C CA   . GLU B 1 11 ? 6.333   16.630  -6.652  1.00 0.00 ? 282 GLU B CA   5 
ATOM   6444 C C    . GLU B 1 11 ? 6.306   15.563  -5.557  1.00 0.00 ? 282 GLU B C    5 
ATOM   6445 O O    . GLU B 1 11 ? 6.590   14.406  -5.795  1.00 0.00 ? 282 GLU B O    5 
ATOM   6446 C CB   . GLU B 1 11 ? 7.776   17.071  -6.901  1.00 0.00 ? 282 GLU B CB   5 
ATOM   6447 C CG   . GLU B 1 11 ? 7.915   17.582  -8.337  1.00 0.00 ? 282 GLU B CG   5 
ATOM   6448 C CD   . GLU B 1 11 ? 9.297   18.216  -8.521  1.00 0.00 ? 282 GLU B CD   5 
ATOM   6449 O OE1  . GLU B 1 11 ? 9.604   19.142  -7.788  1.00 0.00 ? 282 GLU B OE1  5 
ATOM   6450 O OE2  . GLU B 1 11 ? 10.022  17.764  -9.390  1.00 0.00 ? 282 GLU B OE2  5 
ATOM   6451 H H    . GLU B 1 11 ? 5.967   18.646  -6.095  1.00 0.00 ? 282 GLU B H    5 
ATOM   6452 H HA   . GLU B 1 11 ? 5.918   16.221  -7.563  1.00 0.00 ? 282 GLU B HA   5 
ATOM   6453 H HB2  . GLU B 1 11 ? 8.034   17.862  -6.211  1.00 0.00 ? 282 GLU B HB2  5 
ATOM   6454 H HB3  . GLU B 1 11 ? 8.440   16.234  -6.754  1.00 0.00 ? 282 GLU B HB3  5 
ATOM   6455 H HG2  . GLU B 1 11 ? 7.802   16.756  -9.024  1.00 0.00 ? 282 GLU B HG2  5 
ATOM   6456 H HG3  . GLU B 1 11 ? 7.155   18.321  -8.532  1.00 0.00 ? 282 GLU B HG3  5 
ATOM   6457 N N    . LYS B 1 12 ? 5.967   15.947  -4.357  1.00 0.00 ? 283 LYS B N    5 
ATOM   6458 C CA   . LYS B 1 12 ? 5.923   14.977  -3.269  1.00 0.00 ? 283 LYS B CA   5 
ATOM   6459 C C    . LYS B 1 12 ? 4.636   14.159  -3.370  1.00 0.00 ? 283 LYS B C    5 
ATOM   6460 O O    . LYS B 1 12 ? 4.645   12.953  -3.225  1.00 0.00 ? 283 LYS B O    5 
ATOM   6461 C CB   . LYS B 1 12 ? 5.959   15.713  -1.930  1.00 0.00 ? 283 LYS B CB   5 
ATOM   6462 C CG   . LYS B 1 12 ? 6.694   14.856  -0.896  1.00 0.00 ? 283 LYS B CG   5 
ATOM   6463 C CD   . LYS B 1 12 ? 7.982   15.564  -0.468  1.00 0.00 ? 283 LYS B CD   5 
ATOM   6464 C CE   . LYS B 1 12 ? 8.341   15.147  0.960   1.00 0.00 ? 283 LYS B CE   5 
ATOM   6465 N NZ   . LYS B 1 12 ? 8.776   13.723  0.966   1.00 0.00 ? 283 LYS B NZ   5 
ATOM   6466 H H    . LYS B 1 12 ? 5.742   16.885  -4.187  1.00 0.00 ? 283 LYS B H    5 
ATOM   6467 H HA   . LYS B 1 12 ? 6.776   14.319  -3.340  1.00 0.00 ? 283 LYS B HA   5 
ATOM   6468 H HB2  . LYS B 1 12 ? 6.474   16.655  -2.051  1.00 0.00 ? 283 LYS B HB2  5 
ATOM   6469 H HB3  . LYS B 1 12 ? 4.950   15.895  -1.591  1.00 0.00 ? 283 LYS B HB3  5 
ATOM   6470 H HG2  . LYS B 1 12 ? 6.059   14.707  -0.036  1.00 0.00 ? 283 LYS B HG2  5 
ATOM   6471 H HG3  . LYS B 1 12 ? 6.940   13.899  -1.333  1.00 0.00 ? 283 LYS B HG3  5 
ATOM   6472 H HD2  . LYS B 1 12 ? 8.784   15.289  -1.138  1.00 0.00 ? 283 LYS B HD2  5 
ATOM   6473 H HD3  . LYS B 1 12 ? 7.833   16.633  -0.502  1.00 0.00 ? 283 LYS B HD3  5 
ATOM   6474 H HE2  . LYS B 1 12 ? 9.143   15.772  1.326   1.00 0.00 ? 283 LYS B HE2  5 
ATOM   6475 H HE3  . LYS B 1 12 ? 7.475   15.262  1.596   1.00 0.00 ? 283 LYS B HE3  5 
ATOM   6476 H HZ1  . LYS B 1 12 ? 9.421   13.554  0.167   1.00 0.00 ? 283 LYS B HZ1  5 
ATOM   6477 H HZ2  . LYS B 1 12 ? 9.268   13.515  1.858   1.00 0.00 ? 283 LYS B HZ2  5 
ATOM   6478 H HZ3  . LYS B 1 12 ? 7.945   13.104  0.880   1.00 0.00 ? 283 LYS B HZ3  5 
ATOM   6479 N N    . VAL B 1 13 ? 3.528   14.800  -3.623  1.00 0.00 ? 284 VAL B N    5 
ATOM   6480 C CA   . VAL B 1 13 ? 2.275   14.066  -3.736  1.00 0.00 ? 284 VAL B CA   5 
ATOM   6481 C C    . VAL B 1 13 ? 2.314   13.208  -5.001  1.00 0.00 ? 284 VAL B C    5 
ATOM   6482 O O    . VAL B 1 13 ? 1.664   12.186  -5.092  1.00 0.00 ? 284 VAL B O    5 
ATOM   6483 C CB   . VAL B 1 13 ? 1.105   15.047  -3.819  1.00 0.00 ? 284 VAL B CB   5 
ATOM   6484 C CG1  . VAL B 1 13 ? -0.192  14.275  -4.070  1.00 0.00 ? 284 VAL B CG1  5 
ATOM   6485 C CG2  . VAL B 1 13 ? 0.990   15.818  -2.503  1.00 0.00 ? 284 VAL B CG2  5 
ATOM   6486 H H    . VAL B 1 13 ? 3.539   15.773  -3.740  1.00 0.00 ? 284 VAL B H    5 
ATOM   6487 H HA   . VAL B 1 13 ? 2.150   13.431  -2.872  1.00 0.00 ? 284 VAL B HA   5 
ATOM   6488 H HB   . VAL B 1 13 ? 1.273   15.741  -4.632  1.00 0.00 ? 284 VAL B HB   5 
ATOM   6489 H HG11 . VAL B 1 13 ? -0.109  13.724  -4.996  1.00 0.00 ? 284 VAL B HG11 5 
ATOM   6490 H HG12 . VAL B 1 13 ? -0.363  13.587  -3.256  1.00 0.00 ? 284 VAL B HG12 5 
ATOM   6491 H HG13 . VAL B 1 13 ? -1.018  14.969  -4.136  1.00 0.00 ? 284 VAL B HG13 5 
ATOM   6492 H HG21 . VAL B 1 13 ? 1.965   15.888  -2.041  1.00 0.00 ? 284 VAL B HG21 5 
ATOM   6493 H HG22 . VAL B 1 13 ? 0.614   16.811  -2.698  1.00 0.00 ? 284 VAL B HG22 5 
ATOM   6494 H HG23 . VAL B 1 13 ? 0.315   15.299  -1.840  1.00 0.00 ? 284 VAL B HG23 5 
ATOM   6495 N N    . LYS B 1 14 ? 3.082   13.615  -5.975  1.00 0.00 ? 285 LYS B N    5 
ATOM   6496 C CA   . LYS B 1 14 ? 3.172   12.840  -7.205  1.00 0.00 ? 285 LYS B CA   5 
ATOM   6497 C C    . LYS B 1 14 ? 4.012   11.589  -6.949  1.00 0.00 ? 285 LYS B C    5 
ATOM   6498 O O    . LYS B 1 14 ? 3.536   10.476  -7.061  1.00 0.00 ? 285 LYS B O    5 
ATOM   6499 C CB   . LYS B 1 14 ? 3.835   13.687  -8.296  1.00 0.00 ? 285 LYS B CB   5 
ATOM   6500 C CG   . LYS B 1 14 ? 2.784   14.108  -9.326  1.00 0.00 ? 285 LYS B CG   5 
ATOM   6501 C CD   . LYS B 1 14 ? 1.690   14.923  -8.636  1.00 0.00 ? 285 LYS B CD   5 
ATOM   6502 C CE   . LYS B 1 14 ? 0.357   14.700  -9.354  1.00 0.00 ? 285 LYS B CE   5 
ATOM   6503 N NZ   . LYS B 1 14 ? -0.766  14.997  -8.421  1.00 0.00 ? 285 LYS B NZ   5 
ATOM   6504 H H    . LYS B 1 14 ? 3.602   14.440  -5.875  1.00 0.00 ? 285 LYS B H    5 
ATOM   6505 H HA   . LYS B 1 14 ? 2.182   12.553  -7.526  1.00 0.00 ? 285 LYS B HA   5 
ATOM   6506 H HB2  . LYS B 1 14 ? 4.276   14.567  -7.850  1.00 0.00 ? 285 LYS B HB2  5 
ATOM   6507 H HB3  . LYS B 1 14 ? 4.603   13.107  -8.784  1.00 0.00 ? 285 LYS B HB3  5 
ATOM   6508 H HG2  . LYS B 1 14 ? 3.253   14.709  -10.093 1.00 0.00 ? 285 LYS B HG2  5 
ATOM   6509 H HG3  . LYS B 1 14 ? 2.347   13.229  -9.775  1.00 0.00 ? 285 LYS B HG3  5 
ATOM   6510 H HD2  . LYS B 1 14 ? 1.601   14.608  -7.607  1.00 0.00 ? 285 LYS B HD2  5 
ATOM   6511 H HD3  . LYS B 1 14 ? 1.945   15.971  -8.673  1.00 0.00 ? 285 LYS B HD3  5 
ATOM   6512 H HE2  . LYS B 1 14 ? 0.295   15.354  -10.212 1.00 0.00 ? 285 LYS B HE2  5 
ATOM   6513 H HE3  . LYS B 1 14 ? 0.292   13.672  -9.681  1.00 0.00 ? 285 LYS B HE3  5 
ATOM   6514 H HZ1  . LYS B 1 14 ? -0.384  15.345  -7.519  1.00 0.00 ? 285 LYS B HZ1  5 
ATOM   6515 H HZ2  . LYS B 1 14 ? -1.380  15.724  -8.838  1.00 0.00 ? 285 LYS B HZ2  5 
ATOM   6516 H HZ3  . LYS B 1 14 ? -1.315  14.129  -8.256  1.00 0.00 ? 285 LYS B HZ3  5 
ATOM   6517 N N    . THR B 1 15 ? 5.257   11.761  -6.600  1.00 0.00 ? 286 THR B N    5 
ATOM   6518 C CA   . THR B 1 15 ? 6.105   10.605  -6.336  1.00 0.00 ? 286 THR B CA   5 
ATOM   6519 C C    . THR B 1 15 ? 5.387   9.673   -5.357  1.00 0.00 ? 286 THR B C    5 
ATOM   6520 O O    . THR B 1 15 ? 5.480   8.463   -5.448  1.00 0.00 ? 286 THR B O    5 
ATOM   6521 C CB   . THR B 1 15 ? 7.427   11.072  -5.723  1.00 0.00 ? 286 THR B CB   5 
ATOM   6522 O OG1  . THR B 1 15 ? 8.160   11.811  -6.690  1.00 0.00 ? 286 THR B OG1  5 
ATOM   6523 C CG2  . THR B 1 15 ? 8.246   9.858   -5.279  1.00 0.00 ? 286 THR B CG2  5 
ATOM   6524 H H    . THR B 1 15 ? 5.621   12.668  -6.510  1.00 0.00 ? 286 THR B H    5 
ATOM   6525 H HA   . THR B 1 15 ? 6.300   10.080  -7.258  1.00 0.00 ? 286 THR B HA   5 
ATOM   6526 H HB   . THR B 1 15 ? 7.229   11.697  -4.866  1.00 0.00 ? 286 THR B HB   5 
ATOM   6527 H HG1  . THR B 1 15 ? 7.965   11.442  -7.555  1.00 0.00 ? 286 THR B HG1  5 
ATOM   6528 H HG21 . THR B 1 15 ? 8.258   9.124   -6.071  1.00 0.00 ? 286 THR B HG21 5 
ATOM   6529 H HG22 . THR B 1 15 ? 9.257   10.166  -5.059  1.00 0.00 ? 286 THR B HG22 5 
ATOM   6530 H HG23 . THR B 1 15 ? 7.800   9.426   -4.395  1.00 0.00 ? 286 THR B HG23 5 
ATOM   6531 N N    . LEU B 1 16 ? 4.661   10.229  -4.425  1.00 0.00 ? 287 LEU B N    5 
ATOM   6532 C CA   . LEU B 1 16 ? 3.942   9.403   -3.464  1.00 0.00 ? 287 LEU B CA   5 
ATOM   6533 C C    . LEU B 1 16 ? 2.919   8.547   -4.208  1.00 0.00 ? 287 LEU B C    5 
ATOM   6534 O O    . LEU B 1 16 ? 2.853   7.347   -4.033  1.00 0.00 ? 287 LEU B O    5 
ATOM   6535 C CB   . LEU B 1 16 ? 3.223   10.299  -2.453  1.00 0.00 ? 287 LEU B CB   5 
ATOM   6536 C CG   . LEU B 1 16 ? 4.001   10.310  -1.135  1.00 0.00 ? 287 LEU B CG   5 
ATOM   6537 C CD1  . LEU B 1 16 ? 3.336   11.285  -0.160  1.00 0.00 ? 287 LEU B CD1  5 
ATOM   6538 C CD2  . LEU B 1 16 ? 3.997   8.905   -0.531  1.00 0.00 ? 287 LEU B CD2  5 
ATOM   6539 H H    . LEU B 1 16 ? 4.597   11.206  -4.376  1.00 0.00 ? 287 LEU B H    5 
ATOM   6540 H HA   . LEU B 1 16 ? 4.640   8.763   -2.945  1.00 0.00 ? 287 LEU B HA   5 
ATOM   6541 H HB2  . LEU B 1 16 ? 3.162   11.305  -2.843  1.00 0.00 ? 287 LEU B HB2  5 
ATOM   6542 H HB3  . LEU B 1 16 ? 2.228   9.919   -2.278  1.00 0.00 ? 287 LEU B HB3  5 
ATOM   6543 H HG   . LEU B 1 16 ? 5.019   10.622  -1.320  1.00 0.00 ? 287 LEU B HG   5 
ATOM   6544 H HD11 . LEU B 1 16 ? 2.694   11.959  -0.706  1.00 0.00 ? 287 LEU B HD11 5 
ATOM   6545 H HD12 . LEU B 1 16 ? 2.752   10.732  0.559   1.00 0.00 ? 287 LEU B HD12 5 
ATOM   6546 H HD13 . LEU B 1 16 ? 4.099   11.852  0.354   1.00 0.00 ? 287 LEU B HD13 5 
ATOM   6547 H HD21 . LEU B 1 16 ? 3.067   8.411   -0.772  1.00 0.00 ? 287 LEU B HD21 5 
ATOM   6548 H HD22 . LEU B 1 16 ? 4.822   8.336   -0.936  1.00 0.00 ? 287 LEU B HD22 5 
ATOM   6549 H HD23 . LEU B 1 16 ? 4.100   8.975   0.541   1.00 0.00 ? 287 LEU B HD23 5 
ATOM   6550 N N    . LYS B 1 17 ? 2.124   9.156   -5.045  1.00 0.00 ? 288 LYS B N    5 
ATOM   6551 C CA   . LYS B 1 17 ? 1.133   8.393   -5.793  1.00 0.00 ? 288 LYS B CA   5 
ATOM   6552 C C    . LYS B 1 17 ? 1.852   7.327   -6.623  1.00 0.00 ? 288 LYS B C    5 
ATOM   6553 O O    . LYS B 1 17 ? 1.272   6.339   -7.022  1.00 0.00 ? 288 LYS B O    5 
ATOM   6554 C CB   . LYS B 1 17 ? 0.358   9.330   -6.721  1.00 0.00 ? 288 LYS B CB   5 
ATOM   6555 C CG   . LYS B 1 17 ? -1.136  9.245   -6.406  1.00 0.00 ? 288 LYS B CG   5 
ATOM   6556 C CD   . LYS B 1 17 ? -1.582  10.522  -5.691  1.00 0.00 ? 288 LYS B CD   5 
ATOM   6557 C CE   . LYS B 1 17 ? -1.476  11.709  -6.650  1.00 0.00 ? 288 LYS B CE   5 
ATOM   6558 N NZ   . LYS B 1 17 ? -2.702  12.549  -6.537  1.00 0.00 ? 288 LYS B NZ   5 
ATOM   6559 H H    . LYS B 1 17 ? 2.196   10.125  -5.176  1.00 0.00 ? 288 LYS B H    5 
ATOM   6560 H HA   . LYS B 1 17 ? 0.449   7.917   -5.107  1.00 0.00 ? 288 LYS B HA   5 
ATOM   6561 H HB2  . LYS B 1 17 ? 0.700   10.345  -6.575  1.00 0.00 ? 288 LYS B HB2  5 
ATOM   6562 H HB3  . LYS B 1 17 ? 0.524   9.038   -7.747  1.00 0.00 ? 288 LYS B HB3  5 
ATOM   6563 H HG2  . LYS B 1 17 ? -1.692  9.135   -7.326  1.00 0.00 ? 288 LYS B HG2  5 
ATOM   6564 H HG3  . LYS B 1 17 ? -1.323  8.394   -5.768  1.00 0.00 ? 288 LYS B HG3  5 
ATOM   6565 H HD2  . LYS B 1 17 ? -2.604  10.413  -5.362  1.00 0.00 ? 288 LYS B HD2  5 
ATOM   6566 H HD3  . LYS B 1 17 ? -0.945  10.695  -4.835  1.00 0.00 ? 288 LYS B HD3  5 
ATOM   6567 H HE2  . LYS B 1 17 ? -0.609  12.301  -6.396  1.00 0.00 ? 288 LYS B HE2  5 
ATOM   6568 H HE3  . LYS B 1 17 ? -1.380  11.346  -7.662  1.00 0.00 ? 288 LYS B HE3  5 
ATOM   6569 H HZ1  . LYS B 1 17 ? -3.475  11.982  -6.136  1.00 0.00 ? 288 LYS B HZ1  5 
ATOM   6570 H HZ2  . LYS B 1 17 ? -2.508  13.362  -5.915  1.00 0.00 ? 288 LYS B HZ2  5 
ATOM   6571 H HZ3  . LYS B 1 17 ? -2.978  12.889  -7.479  1.00 0.00 ? 288 LYS B HZ3  5 
ATOM   6572 N N    . ALA B 1 18 ? 3.115   7.527   -6.883  1.00 0.00 ? 289 ALA B N    5 
ATOM   6573 C CA   . ALA B 1 18 ? 3.865   6.556   -7.668  1.00 0.00 ? 289 ALA B CA   5 
ATOM   6574 C C    . ALA B 1 18 ? 4.097   5.295   -6.835  1.00 0.00 ? 289 ALA B C    5 
ATOM   6575 O O    . ALA B 1 18 ? 3.548   4.246   -7.108  1.00 0.00 ? 289 ALA B O    5 
ATOM   6576 C CB   . ALA B 1 18 ? 5.218   7.151   -8.060  1.00 0.00 ? 289 ALA B CB   5 
ATOM   6577 H H    . ALA B 1 18 ? 3.561   8.334   -6.549  1.00 0.00 ? 289 ALA B H    5 
ATOM   6578 H HA   . ALA B 1 18 ? 3.311   6.304   -8.561  1.00 0.00 ? 289 ALA B HA   5 
ATOM   6579 H HB1  . ALA B 1 18 ? 5.298   8.153   -7.666  1.00 0.00 ? 289 ALA B HB1  5 
ATOM   6580 H HB2  . ALA B 1 18 ? 6.009   6.539   -7.652  1.00 0.00 ? 289 ALA B HB2  5 
ATOM   6581 H HB3  . ALA B 1 18 ? 5.301   7.178   -9.136  1.00 0.00 ? 289 ALA B HB3  5 
ATOM   6582 N N    . GLN B 1 19 ? 4.915   5.390   -5.824  1.00 0.00 ? 290 GLN B N    5 
ATOM   6583 C CA   . GLN B 1 19 ? 5.182   4.219   -4.994  1.00 0.00 ? 290 GLN B CA   5 
ATOM   6584 C C    . GLN B 1 19 ? 3.869   3.710   -4.396  1.00 0.00 ? 290 GLN B C    5 
ATOM   6585 O O    . GLN B 1 19 ? 3.783   2.598   -3.917  1.00 0.00 ? 290 GLN B O    5 
ATOM   6586 C CB   . GLN B 1 19 ? 6.145   4.596   -3.867  1.00 0.00 ? 290 GLN B CB   5 
ATOM   6587 C CG   . GLN B 1 19 ? 5.579   5.778   -3.081  1.00 0.00 ? 290 GLN B CG   5 
ATOM   6588 C CD   . GLN B 1 19 ? 6.663   6.346   -2.164  1.00 0.00 ? 290 GLN B CD   5 
ATOM   6589 O OE1  . GLN B 1 19 ? 7.651   6.880   -2.627  1.00 0.00 ? 290 GLN B OE1  5 
ATOM   6590 N NE2  . GLN B 1 19 ? 6.520   6.254   -0.870  1.00 0.00 ? 290 GLN B NE2  5 
ATOM   6591 H H    . GLN B 1 19 ? 5.352   6.246   -5.621  1.00 0.00 ? 290 GLN B H    5 
ATOM   6592 H HA   . GLN B 1 19 ? 5.625   3.447   -5.603  1.00 0.00 ? 290 GLN B HA   5 
ATOM   6593 H HB2  . GLN B 1 19 ? 6.271   3.749   -3.206  1.00 0.00 ? 290 GLN B HB2  5 
ATOM   6594 H HB3  . GLN B 1 19 ? 7.102   4.869   -4.289  1.00 0.00 ? 290 GLN B HB3  5 
ATOM   6595 H HG2  . GLN B 1 19 ? 5.251   6.544   -3.770  1.00 0.00 ? 290 GLN B HG2  5 
ATOM   6596 H HG3  . GLN B 1 19 ? 4.743   5.447   -2.484  1.00 0.00 ? 290 GLN B HG3  5 
ATOM   6597 H HE21 . GLN B 1 19 ? 5.723   5.825   -0.494  1.00 0.00 ? 290 GLN B HE21 5 
ATOM   6598 H HE22 . GLN B 1 19 ? 7.210   6.614   -0.273  1.00 0.00 ? 290 GLN B HE22 5 
ATOM   6599 N N    . ASN B 1 20 ? 2.847   4.519   -4.422  1.00 0.00 ? 291 ASN B N    5 
ATOM   6600 C CA   . ASN B 1 20 ? 1.565   4.100   -3.870  1.00 0.00 ? 291 ASN B CA   5 
ATOM   6601 C C    . ASN B 1 20 ? 0.931   3.054   -4.789  1.00 0.00 ? 291 ASN B C    5 
ATOM   6602 O O    . ASN B 1 20 ? 0.610   1.959   -4.372  1.00 0.00 ? 291 ASN B O    5 
ATOM   6603 C CB   . ASN B 1 20 ? 0.639   5.312   -3.761  1.00 0.00 ? 291 ASN B CB   5 
ATOM   6604 C CG   . ASN B 1 20 ? -0.595  4.940   -2.939  1.00 0.00 ? 291 ASN B CG   5 
ATOM   6605 O OD1  . ASN B 1 20 ? -1.705  5.000   -3.429  1.00 0.00 ? 291 ASN B OD1  5 
ATOM   6606 N ND2  . ASN B 1 20 ? -0.448  4.555   -1.702  1.00 0.00 ? 291 ASN B ND2  5 
ATOM   6607 H H    . ASN B 1 20 ? 2.939   5.411   -4.815  1.00 0.00 ? 291 ASN B H    5 
ATOM   6608 H HA   . ASN B 1 20 ? 1.717   3.675   -2.889  1.00 0.00 ? 291 ASN B HA   5 
ATOM   6609 H HB2  . ASN B 1 20 ? 1.164   6.123   -3.277  1.00 0.00 ? 291 ASN B HB2  5 
ATOM   6610 H HB3  . ASN B 1 20 ? 0.331   5.620   -4.749  1.00 0.00 ? 291 ASN B HB3  5 
ATOM   6611 H HD21 . ASN B 1 20 ? 0.448   4.505   -1.307  1.00 0.00 ? 291 ASN B HD21 5 
ATOM   6612 H HD22 . ASN B 1 20 ? -1.233  4.317   -1.166  1.00 0.00 ? 291 ASN B HD22 5 
ATOM   6613 N N    . SER B 1 21 ? 0.748   3.384   -6.039  1.00 0.00 ? 292 SER B N    5 
ATOM   6614 C CA   . SER B 1 21 ? 0.147   2.432   -6.966  1.00 0.00 ? 292 SER B CA   5 
ATOM   6615 C C    . SER B 1 21 ? 1.086   1.239   -7.156  1.00 0.00 ? 292 SER B C    5 
ATOM   6616 O O    . SER B 1 21 ? 0.661   0.148   -7.480  1.00 0.00 ? 292 SER B O    5 
ATOM   6617 C CB   . SER B 1 21 ? -0.090  3.116   -8.312  1.00 0.00 ? 292 SER B CB   5 
ATOM   6618 O OG   . SER B 1 21 ? -1.171  2.479   -8.979  1.00 0.00 ? 292 SER B OG   5 
ATOM   6619 H H    . SER B 1 21 ? 1.013   4.273   -6.354  1.00 0.00 ? 292 SER B H    5 
ATOM   6620 H HA   . SER B 1 21 ? -0.796  2.088   -6.569  1.00 0.00 ? 292 SER B HA   5 
ATOM   6621 H HB2  . SER B 1 21 ? -0.332  4.152   -8.155  1.00 0.00 ? 292 SER B HB2  5 
ATOM   6622 H HB3  . SER B 1 21 ? 0.808   3.046   -8.913  1.00 0.00 ? 292 SER B HB3  5 
ATOM   6623 H HG   . SER B 1 21 ? -0.866  1.622   -9.288  1.00 0.00 ? 292 SER B HG   5 
ATOM   6624 N N    . GLU B 1 22 ? 2.360   1.436   -6.963  1.00 0.00 ? 293 GLU B N    5 
ATOM   6625 C CA   . GLU B 1 22 ? 3.304   0.337   -7.133  1.00 0.00 ? 293 GLU B CA   5 
ATOM   6626 C C    . GLU B 1 22 ? 3.069   -0.715  -6.045  1.00 0.00 ? 293 GLU B C    5 
ATOM   6627 O O    . GLU B 1 22 ? 2.757   -1.855  -6.327  1.00 0.00 ? 293 GLU B O    5 
ATOM   6628 C CB   . GLU B 1 22 ? 4.734   0.872   -7.024  1.00 0.00 ? 293 GLU B CB   5 
ATOM   6629 C CG   . GLU B 1 22 ? 5.289   1.135   -8.425  1.00 0.00 ? 293 GLU B CG   5 
ATOM   6630 C CD   . GLU B 1 22 ? 6.381   2.205   -8.351  1.00 0.00 ? 293 GLU B CD   5 
ATOM   6631 O OE1  . GLU B 1 22 ? 7.377   1.960   -7.693  1.00 0.00 ? 293 GLU B OE1  5 
ATOM   6632 O OE2  . GLU B 1 22 ? 6.199   3.251   -8.952  1.00 0.00 ? 293 GLU B OE2  5 
ATOM   6633 H H    . GLU B 1 22 ? 2.684   2.324   -6.703  1.00 0.00 ? 293 GLU B H    5 
ATOM   6634 H HA   . GLU B 1 22 ? 3.164   -0.111  -8.104  1.00 0.00 ? 293 GLU B HA   5 
ATOM   6635 H HB2  . GLU B 1 22 ? 4.732   1.793   -6.459  1.00 0.00 ? 293 GLU B HB2  5 
ATOM   6636 H HB3  . GLU B 1 22 ? 5.353   0.143   -6.525  1.00 0.00 ? 293 GLU B HB3  5 
ATOM   6637 H HG2  . GLU B 1 22 ? 5.707   0.221   -8.823  1.00 0.00 ? 293 GLU B HG2  5 
ATOM   6638 H HG3  . GLU B 1 22 ? 4.495   1.479   -9.069  1.00 0.00 ? 293 GLU B HG3  5 
ATOM   6639 N N    . LEU B 1 23 ? 3.217   -0.341  -4.805  1.00 0.00 ? 294 LEU B N    5 
ATOM   6640 C CA   . LEU B 1 23 ? 3.010   -1.299  -3.725  1.00 0.00 ? 294 LEU B CA   5 
ATOM   6641 C C    . LEU B 1 23 ? 1.629   -1.942  -3.866  1.00 0.00 ? 294 LEU B C    5 
ATOM   6642 O O    . LEU B 1 23 ? 1.456   -3.122  -3.637  1.00 0.00 ? 294 LEU B O    5 
ATOM   6643 C CB   . LEU B 1 23 ? 3.103   -0.577  -2.378  1.00 0.00 ? 294 LEU B CB   5 
ATOM   6644 C CG   . LEU B 1 23 ? 4.554   -0.577  -1.898  1.00 0.00 ? 294 LEU B CG   5 
ATOM   6645 C CD1  . LEU B 1 23 ? 4.696   0.358   -0.697  1.00 0.00 ? 294 LEU B CD1  5 
ATOM   6646 C CD2  . LEU B 1 23 ? 4.957   -1.996  -1.492  1.00 0.00 ? 294 LEU B CD2  5 
ATOM   6647 H H    . LEU B 1 23 ? 3.471   0.583   -4.598  1.00 0.00 ? 294 LEU B H    5 
ATOM   6648 H HA   . LEU B 1 23 ? 3.768   -2.064  -3.772  1.00 0.00 ? 294 LEU B HA   5 
ATOM   6649 H HB2  . LEU B 1 23 ? 2.758   0.442   -2.490  1.00 0.00 ? 294 LEU B HB2  5 
ATOM   6650 H HB3  . LEU B 1 23 ? 2.487   -1.087  -1.652  1.00 0.00 ? 294 LEU B HB3  5 
ATOM   6651 H HG   . LEU B 1 23 ? 5.196   -0.234  -2.699  1.00 0.00 ? 294 LEU B HG   5 
ATOM   6652 H HD11 . LEU B 1 23 ? 4.237   1.308   -0.924  1.00 0.00 ? 294 LEU B HD11 5 
ATOM   6653 H HD12 . LEU B 1 23 ? 4.209   -0.081  0.160   1.00 0.00 ? 294 LEU B HD12 5 
ATOM   6654 H HD13 . LEU B 1 23 ? 5.742   0.506   -0.478  1.00 0.00 ? 294 LEU B HD13 5 
ATOM   6655 H HD21 . LEU B 1 23 ? 4.098   -2.511  -1.086  1.00 0.00 ? 294 LEU B HD21 5 
ATOM   6656 H HD22 . LEU B 1 23 ? 5.323   -2.529  -2.356  1.00 0.00 ? 294 LEU B HD22 5 
ATOM   6657 H HD23 . LEU B 1 23 ? 5.734   -1.949  -0.743  1.00 0.00 ? 294 LEU B HD23 5 
ATOM   6658 N N    . ALA B 1 24 ? 0.640   -1.175  -4.240  1.00 0.00 ? 295 ALA B N    5 
ATOM   6659 C CA   . ALA B 1 24 ? -0.699  -1.734  -4.391  1.00 0.00 ? 295 ALA B CA   5 
ATOM   6660 C C    . ALA B 1 24 ? -0.665  -2.881  -5.404  1.00 0.00 ? 295 ALA B C    5 
ATOM   6661 O O    . ALA B 1 24 ? -1.198  -3.946  -5.167  1.00 0.00 ? 295 ALA B O    5 
ATOM   6662 C CB   . ALA B 1 24 ? -1.653  -0.645  -4.887  1.00 0.00 ? 295 ALA B CB   5 
ATOM   6663 H H    . ALA B 1 24 ? 0.798   -0.224  -4.418  1.00 0.00 ? 295 ALA B H    5 
ATOM   6664 H HA   . ALA B 1 24 ? -1.044  -2.105  -3.438  1.00 0.00 ? 295 ALA B HA   5 
ATOM   6665 H HB1  . ALA B 1 24 ? -1.083  0.206   -5.227  1.00 0.00 ? 295 ALA B HB1  5 
ATOM   6666 H HB2  . ALA B 1 24 ? -2.247  -1.030  -5.703  1.00 0.00 ? 295 ALA B HB2  5 
ATOM   6667 H HB3  . ALA B 1 24 ? -2.305  -0.343  -4.079  1.00 0.00 ? 295 ALA B HB3  5 
ATOM   6668 N N    . SER B 1 25 ? -0.043  -2.672  -6.530  1.00 0.00 ? 296 SER B N    5 
ATOM   6669 C CA   . SER B 1 25 ? 0.022   -3.725  -7.536  1.00 0.00 ? 296 SER B CA   5 
ATOM   6670 C C    . SER B 1 25 ? 0.700   -4.963  -6.943  1.00 0.00 ? 296 SER B C    5 
ATOM   6671 O O    . SER B 1 25 ? 0.126   -6.032  -6.890  1.00 0.00 ? 296 SER B O    5 
ATOM   6672 C CB   . SER B 1 25 ? 0.826   -3.231  -8.741  1.00 0.00 ? 296 SER B CB   5 
ATOM   6673 O OG   . SER B 1 25 ? 0.783   -4.213  -9.768  1.00 0.00 ? 296 SER B OG   5 
ATOM   6674 H H    . SER B 1 25 ? 0.379   -1.804  -6.702  1.00 0.00 ? 296 SER B H    5 
ATOM   6675 H HA   . SER B 1 25 ? -0.977  -3.981  -7.856  1.00 0.00 ? 296 SER B HA   5 
ATOM   6676 H HB2  . SER B 1 25 ? 0.399   -2.313  -9.108  1.00 0.00 ? 296 SER B HB2  5 
ATOM   6677 H HB3  . SER B 1 25 ? 1.849   -3.054  -8.439  1.00 0.00 ? 296 SER B HB3  5 
ATOM   6678 H HG   . SER B 1 25 ? -0.029  -4.711  -9.668  1.00 0.00 ? 296 SER B HG   5 
ATOM   6679 N N    . THR B 1 26 ? 1.921   -4.827  -6.501  1.00 0.00 ? 297 THR B N    5 
ATOM   6680 C CA   . THR B 1 26 ? 2.624   -5.972  -5.928  1.00 0.00 ? 297 THR B CA   5 
ATOM   6681 C C    . THR B 1 26 ? 1.750   -6.634  -4.861  1.00 0.00 ? 297 THR B C    5 
ATOM   6682 O O    . THR B 1 26 ? 1.889   -7.807  -4.574  1.00 0.00 ? 297 THR B O    5 
ATOM   6683 C CB   . THR B 1 26 ? 3.931   -5.499  -5.291  1.00 0.00 ? 297 THR B CB   5 
ATOM   6684 O OG1  . THR B 1 26 ? 4.694   -4.781  -6.253  1.00 0.00 ? 297 THR B OG1  5 
ATOM   6685 C CG2  . THR B 1 26 ? 4.731   -6.708  -4.802  1.00 0.00 ? 297 THR B CG2  5 
ATOM   6686 H H    . THR B 1 26 ? 2.367   -3.957  -6.555  1.00 0.00 ? 297 THR B H    5 
ATOM   6687 H HA   . THR B 1 26 ? 2.843   -6.685  -6.708  1.00 0.00 ? 297 THR B HA   5 
ATOM   6688 H HB   . THR B 1 26 ? 3.712   -4.855  -4.454  1.00 0.00 ? 297 THR B HB   5 
ATOM   6689 H HG1  . THR B 1 26 ? 4.414   -5.063  -7.127  1.00 0.00 ? 297 THR B HG1  5 
ATOM   6690 H HG21 . THR B 1 26 ? 4.054   -7.517  -4.573  1.00 0.00 ? 297 THR B HG21 5 
ATOM   6691 H HG22 . THR B 1 26 ? 5.418   -7.020  -5.573  1.00 0.00 ? 297 THR B HG22 5 
ATOM   6692 H HG23 . THR B 1 26 ? 5.284   -6.437  -3.913  1.00 0.00 ? 297 THR B HG23 5 
ATOM   6693 N N    . ALA B 1 27 ? 0.857   -5.893  -4.264  1.00 0.00 ? 298 ALA B N    5 
ATOM   6694 C CA   . ALA B 1 27 ? 0.002   -6.469  -3.232  1.00 0.00 ? 298 ALA B CA   5 
ATOM   6695 C C    . ALA B 1 27 ? -0.992  -7.449  -3.864  1.00 0.00 ? 298 ALA B C    5 
ATOM   6696 O O    . ALA B 1 27 ? -1.047  -8.608  -3.509  1.00 0.00 ? 298 ALA B O    5 
ATOM   6697 C CB   . ALA B 1 27 ? -0.768  -5.349  -2.528  1.00 0.00 ? 298 ALA B CB   5 
ATOM   6698 H H    . ALA B 1 27 ? 0.765   -4.949  -4.507  1.00 0.00 ? 298 ALA B H    5 
ATOM   6699 H HA   . ALA B 1 27 ? 0.611   -6.992  -2.511  1.00 0.00 ? 298 ALA B HA   5 
ATOM   6700 H HB1  . ALA B 1 27 ? -0.132  -4.482  -2.431  1.00 0.00 ? 298 ALA B HB1  5 
ATOM   6701 H HB2  . ALA B 1 27 ? -1.643  -5.093  -3.108  1.00 0.00 ? 298 ALA B HB2  5 
ATOM   6702 H HB3  . ALA B 1 27 ? -1.071  -5.684  -1.547  1.00 0.00 ? 298 ALA B HB3  5 
ATOM   6703 N N    . ASN B 1 28 ? -1.785  -6.988  -4.795  1.00 0.00 ? 299 ASN B N    5 
ATOM   6704 C CA   . ASN B 1 28 ? -2.761  -7.868  -5.430  1.00 0.00 ? 299 ASN B CA   5 
ATOM   6705 C C    . ASN B 1 28 ? -2.045  -9.002  -6.170  1.00 0.00 ? 299 ASN B C    5 
ATOM   6706 O O    . ASN B 1 28 ? -2.636  -10.015 -6.490  1.00 0.00 ? 299 ASN B O    5 
ATOM   6707 C CB   . ASN B 1 28 ? -3.597  -7.063  -6.424  1.00 0.00 ? 299 ASN B CB   5 
ATOM   6708 C CG   . ASN B 1 28 ? -2.689  -6.506  -7.521  1.00 0.00 ? 299 ASN B CG   5 
ATOM   6709 O OD1  . ASN B 1 28 ? -1.757  -7.161  -7.944  1.00 0.00 ? 299 ASN B OD1  5 
ATOM   6710 N ND2  . ASN B 1 28 ? -2.923  -5.316  -8.002  1.00 0.00 ? 299 ASN B ND2  5 
ATOM   6711 H H    . ASN B 1 28 ? -1.728  -6.047  -5.062  1.00 0.00 ? 299 ASN B H    5 
ATOM   6712 H HA   . ASN B 1 28 ? -3.410  -8.287  -4.675  1.00 0.00 ? 299 ASN B HA   5 
ATOM   6713 H HB2  . ASN B 1 28 ? -4.347  -7.704  -6.864  1.00 0.00 ? 299 ASN B HB2  5 
ATOM   6714 H HB3  . ASN B 1 28 ? -4.079  -6.246  -5.908  1.00 0.00 ? 299 ASN B HB3  5 
ATOM   6715 H HD21 . ASN B 1 28 ? -3.672  -4.787  -7.661  1.00 0.00 ? 299 ASN B HD21 5 
ATOM   6716 H HD22 . ASN B 1 28 ? -2.345  -4.951  -8.705  1.00 0.00 ? 299 ASN B HD22 5 
ATOM   6717 N N    . MET B 1 29 ? -0.781  -8.842  -6.453  1.00 0.00 ? 300 MET B N    5 
ATOM   6718 C CA   . MET B 1 29 ? -0.058  -9.891  -7.166  1.00 0.00 ? 300 MET B CA   5 
ATOM   6719 C C    . MET B 1 29 ? 0.335   -11.006 -6.191  1.00 0.00 ? 300 MET B C    5 
ATOM   6720 O O    . MET B 1 29 ? 0.248   -12.177 -6.506  1.00 0.00 ? 300 MET B O    5 
ATOM   6721 C CB   . MET B 1 29 ? 1.201   -9.300  -7.801  1.00 0.00 ? 300 MET B CB   5 
ATOM   6722 C CG   . MET B 1 29 ? 0.807   -8.402  -8.974  1.00 0.00 ? 300 MET B CG   5 
ATOM   6723 S SD   . MET B 1 29 ? 1.342   -9.165  -10.526 1.00 0.00 ? 300 MET B SD   5 
ATOM   6724 C CE   . MET B 1 29 ? 1.636   -7.633  -11.442 1.00 0.00 ? 300 MET B CE   5 
ATOM   6725 H H    . MET B 1 29 ? -0.321  -8.017  -6.195  1.00 0.00 ? 300 MET B H    5 
ATOM   6726 H HA   . MET B 1 29 ? -0.689  -10.299 -7.942  1.00 0.00 ? 300 MET B HA   5 
ATOM   6727 H HB2  . MET B 1 29 ? 1.736   -8.719  -7.064  1.00 0.00 ? 300 MET B HB2  5 
ATOM   6728 H HB3  . MET B 1 29 ? 1.835   -10.099 -8.159  1.00 0.00 ? 300 MET B HB3  5 
ATOM   6729 H HG2  . MET B 1 29 ? -0.266  -8.277  -8.987  1.00 0.00 ? 300 MET B HG2  5 
ATOM   6730 H HG3  . MET B 1 29 ? 1.279   -7.438  -8.865  1.00 0.00 ? 300 MET B HG3  5 
ATOM   6731 H HE1  . MET B 1 29 ? 1.959   -6.861  -10.762 1.00 0.00 ? 300 MET B HE1  5 
ATOM   6732 H HE2  . MET B 1 29 ? 2.403   -7.798  -12.185 1.00 0.00 ? 300 MET B HE2  5 
ATOM   6733 H HE3  . MET B 1 29 ? 0.720   -7.322  -11.926 1.00 0.00 ? 300 MET B HE3  5 
ATOM   6734 N N    . LEU B 1 30 ? 0.767   -10.655 -5.013  1.00 0.00 ? 301 LEU B N    5 
ATOM   6735 C CA   . LEU B 1 30 ? 1.157   -11.678 -4.049  1.00 0.00 ? 301 LEU B CA   5 
ATOM   6736 C C    . LEU B 1 30 ? -0.095  -12.370 -3.505  1.00 0.00 ? 301 LEU B C    5 
ATOM   6737 O O    . LEU B 1 30 ? -0.069  -13.530 -3.146  1.00 0.00 ? 301 LEU B O    5 
ATOM   6738 C CB   . LEU B 1 30 ? 1.927   -11.026 -2.900  1.00 0.00 ? 301 LEU B CB   5 
ATOM   6739 C CG   . LEU B 1 30 ? 3.185   -10.353 -3.448  1.00 0.00 ? 301 LEU B CG   5 
ATOM   6740 C CD1  . LEU B 1 30 ? 3.821   -9.489  -2.359  1.00 0.00 ? 301 LEU B CD1  5 
ATOM   6741 C CD2  . LEU B 1 30 ? 4.182   -11.426 -3.894  1.00 0.00 ? 301 LEU B CD2  5 
ATOM   6742 H H    . LEU B 1 30 ? 0.833   -9.707  -4.775  1.00 0.00 ? 301 LEU B H    5 
ATOM   6743 H HA   . LEU B 1 30 ? 1.789   -12.408 -4.534  1.00 0.00 ? 301 LEU B HA   5 
ATOM   6744 H HB2  . LEU B 1 30 ? 1.300   -10.287 -2.419  1.00 0.00 ? 301 LEU B HB2  5 
ATOM   6745 H HB3  . LEU B 1 30 ? 2.210   -11.782 -2.181  1.00 0.00 ? 301 LEU B HB3  5 
ATOM   6746 H HG   . LEU B 1 30 ? 2.920   -9.731  -4.292  1.00 0.00 ? 301 LEU B HG   5 
ATOM   6747 H HD11 . LEU B 1 30 ? 3.409   -9.760  -1.398  1.00 0.00 ? 301 LEU B HD11 5 
ATOM   6748 H HD12 . LEU B 1 30 ? 4.889   -9.649  -2.350  1.00 0.00 ? 301 LEU B HD12 5 
ATOM   6749 H HD13 . LEU B 1 30 ? 3.614   -8.449  -2.557  1.00 0.00 ? 301 LEU B HD13 5 
ATOM   6750 H HD21 . LEU B 1 30 ? 4.098   -12.286 -3.248  1.00 0.00 ? 301 LEU B HD21 5 
ATOM   6751 H HD22 . LEU B 1 30 ? 3.965   -11.717 -4.912  1.00 0.00 ? 301 LEU B HD22 5 
ATOM   6752 H HD23 . LEU B 1 30 ? 5.185   -11.030 -3.840  1.00 0.00 ? 301 LEU B HD23 5 
ATOM   6753 N N    . ARG B 1 31 ? -1.193  -11.667 -3.443  1.00 0.00 ? 302 ARG B N    5 
ATOM   6754 C CA   . ARG B 1 31 ? -2.418  -12.273 -2.936  1.00 0.00 ? 302 ARG B CA   5 
ATOM   6755 C C    . ARG B 1 31 ? -2.988  -13.230 -3.984  1.00 0.00 ? 302 ARG B C    5 
ATOM   6756 O O    . ARG B 1 31 ? -3.328  -14.359 -3.688  1.00 0.00 ? 302 ARG B O    5 
ATOM   6757 C CB   . ARG B 1 31 ? -3.442  -11.177 -2.638  1.00 0.00 ? 302 ARG B CB   5 
ATOM   6758 C CG   . ARG B 1 31 ? -4.656  -11.789 -1.932  1.00 0.00 ? 302 ARG B CG   5 
ATOM   6759 C CD   . ARG B 1 31 ? -5.300  -10.741 -1.022  1.00 0.00 ? 302 ARG B CD   5 
ATOM   6760 N NE   . ARG B 1 31 ? -6.488  -10.182 -1.669  1.00 0.00 ? 302 ARG B NE   5 
ATOM   6761 C CZ   . ARG B 1 31 ? -6.501  -9.977  -2.960  1.00 0.00 ? 302 ARG B CZ   5 
ATOM   6762 N NH1  . ARG B 1 31 ? -5.569  -9.250  -3.514  1.00 0.00 ? 302 ARG B NH1  5 
ATOM   6763 N NH2  . ARG B 1 31 ? -7.446  -10.498 -3.693  1.00 0.00 ? 302 ARG B NH2  5 
ATOM   6764 H H    . ARG B 1 31 ? -1.194  -10.733 -3.739  1.00 0.00 ? 302 ARG B H    5 
ATOM   6765 H HA   . ARG B 1 31 ? -2.203  -12.818 -2.028  1.00 0.00 ? 302 ARG B HA   5 
ATOM   6766 H HB2  . ARG B 1 31 ? -2.995  -10.429 -2.000  1.00 0.00 ? 302 ARG B HB2  5 
ATOM   6767 H HB3  . ARG B 1 31 ? -3.760  -10.720 -3.563  1.00 0.00 ? 302 ARG B HB3  5 
ATOM   6768 H HG2  . ARG B 1 31 ? -5.374  -12.116 -2.670  1.00 0.00 ? 302 ARG B HG2  5 
ATOM   6769 H HG3  . ARG B 1 31 ? -4.341  -12.634 -1.339  1.00 0.00 ? 302 ARG B HG3  5 
ATOM   6770 H HD2  . ARG B 1 31 ? -5.590  -11.205 -0.090  1.00 0.00 ? 302 ARG B HD2  5 
ATOM   6771 H HD3  . ARG B 1 31 ? -4.589  -9.952  -0.823  1.00 0.00 ? 302 ARG B HD3  5 
ATOM   6772 H HE   . ARG B 1 31 ? -7.276  -9.962  -1.132  1.00 0.00 ? 302 ARG B HE   5 
ATOM   6773 H HH11 . ARG B 1 31 ? -4.845  -8.850  -2.950  1.00 0.00 ? 302 ARG B HH11 5 
ATOM   6774 H HH12 . ARG B 1 31 ? -5.579  -9.091  -4.501  1.00 0.00 ? 302 ARG B HH12 5 
ATOM   6775 H HH21 . ARG B 1 31 ? -8.160  -11.055 -3.268  1.00 0.00 ? 302 ARG B HH21 5 
ATOM   6776 H HH22 . ARG B 1 31 ? -7.457  -10.341 -4.681  1.00 0.00 ? 302 ARG B HH22 5 
ATOM   6777 N N    . GLU B 1 32 ? -3.098  -12.788 -5.207  1.00 0.00 ? 303 GLU B N    5 
ATOM   6778 C CA   . GLU B 1 32 ? -3.638  -13.654 -6.249  1.00 0.00 ? 303 GLU B CA   5 
ATOM   6779 C C    . GLU B 1 32 ? -2.783  -14.919 -6.363  1.00 0.00 ? 303 GLU B C    5 
ATOM   6780 O O    . GLU B 1 32 ? -3.292  -16.007 -6.548  1.00 0.00 ? 303 GLU B O    5 
ATOM   6781 C CB   . GLU B 1 32 ? -3.632  -12.910 -7.586  1.00 0.00 ? 303 GLU B CB   5 
ATOM   6782 C CG   . GLU B 1 32 ? -2.189  -12.700 -8.048  1.00 0.00 ? 303 GLU B CG   5 
ATOM   6783 C CD   . GLU B 1 32 ? -2.184  -12.004 -9.412  1.00 0.00 ? 303 GLU B CD   5 
ATOM   6784 O OE1  . GLU B 1 32 ? -2.449  -10.814 -9.448  1.00 0.00 ? 303 GLU B OE1  5 
ATOM   6785 O OE2  . GLU B 1 32 ? -1.913  -12.672 -10.395 1.00 0.00 ? 303 GLU B OE2  5 
ATOM   6786 H H    . GLU B 1 32 ? -2.822  -11.875 -5.424  1.00 0.00 ? 303 GLU B H    5 
ATOM   6787 H HA   . GLU B 1 32 ? -4.651  -13.928 -5.998  1.00 0.00 ? 303 GLU B HA   5 
ATOM   6788 H HB2  . GLU B 1 32 ? -4.166  -13.492 -8.324  1.00 0.00 ? 303 GLU B HB2  5 
ATOM   6789 H HB3  . GLU B 1 32 ? -4.112  -11.950 -7.466  1.00 0.00 ? 303 GLU B HB3  5 
ATOM   6790 H HG2  . GLU B 1 32 ? -1.668  -12.087 -7.330  1.00 0.00 ? 303 GLU B HG2  5 
ATOM   6791 H HG3  . GLU B 1 32 ? -1.694  -13.656 -8.135  1.00 0.00 ? 303 GLU B HG3  5 
ATOM   6792 N N    . GLN B 1 33 ? -1.488  -14.788 -6.259  1.00 0.00 ? 304 GLN B N    5 
ATOM   6793 C CA   . GLN B 1 33 ? -0.633  -15.965 -6.367  1.00 0.00 ? 304 GLN B CA   5 
ATOM   6794 C C    . GLN B 1 33 ? -0.798  -16.837 -5.120  1.00 0.00 ? 304 GLN B C    5 
ATOM   6795 O O    . GLN B 1 33 ? -0.688  -18.045 -5.179  1.00 0.00 ? 304 GLN B O    5 
ATOM   6796 C CB   . GLN B 1 33 ? 0.829   -15.533 -6.506  1.00 0.00 ? 304 GLN B CB   5 
ATOM   6797 C CG   . GLN B 1 33 ? 1.265   -14.773 -5.253  1.00 0.00 ? 304 GLN B CG   5 
ATOM   6798 C CD   . GLN B 1 33 ? 2.746   -14.413 -5.370  1.00 0.00 ? 304 GLN B CD   5 
ATOM   6799 O OE1  . GLN B 1 33 ? 3.419   -14.227 -4.376  1.00 0.00 ? 304 GLN B OE1  5 
ATOM   6800 N NE2  . GLN B 1 33 ? 3.290   -14.305 -6.553  1.00 0.00 ? 304 GLN B NE2  5 
ATOM   6801 H H    . GLN B 1 33 ? -1.091  -13.902 -6.113  1.00 0.00 ? 304 GLN B H    5 
ATOM   6802 H HA   . GLN B 1 33 ? -0.918  -16.534 -7.240  1.00 0.00 ? 304 GLN B HA   5 
ATOM   6803 H HB2  . GLN B 1 33 ? 1.450   -16.408 -6.633  1.00 0.00 ? 304 GLN B HB2  5 
ATOM   6804 H HB3  . GLN B 1 33 ? 0.933   -14.891 -7.368  1.00 0.00 ? 304 GLN B HB3  5 
ATOM   6805 H HG2  . GLN B 1 33 ? 0.678   -13.872 -5.157  1.00 0.00 ? 304 GLN B HG2  5 
ATOM   6806 H HG3  . GLN B 1 33 ? 1.116   -15.397 -4.385  1.00 0.00 ? 304 GLN B HG3  5 
ATOM   6807 H HE21 . GLN B 1 33 ? 2.748   -14.454 -7.356  1.00 0.00 ? 304 GLN B HE21 5 
ATOM   6808 H HE22 . GLN B 1 33 ? 4.238   -14.074 -6.637  1.00 0.00 ? 304 GLN B HE22 5 
ATOM   6809 N N    . VAL B 1 34 ? -1.069  -16.239 -3.992  1.00 0.00 ? 305 VAL B N    5 
ATOM   6810 C CA   . VAL B 1 34 ? -1.245  -17.028 -2.777  1.00 0.00 ? 305 VAL B CA   5 
ATOM   6811 C C    . VAL B 1 34 ? -2.478  -17.921 -2.936  1.00 0.00 ? 305 VAL B C    5 
ATOM   6812 O O    . VAL B 1 34 ? -2.478  -19.072 -2.546  1.00 0.00 ? 305 VAL B O    5 
ATOM   6813 C CB   . VAL B 1 34 ? -1.435  -16.097 -1.579  1.00 0.00 ? 305 VAL B CB   5 
ATOM   6814 C CG1  . VAL B 1 34 ? -1.883  -16.913 -0.364  1.00 0.00 ? 305 VAL B CG1  5 
ATOM   6815 C CG2  . VAL B 1 34 ? -0.110  -15.400 -1.263  1.00 0.00 ? 305 VAL B CG2  5 
ATOM   6816 H H    . VAL B 1 34 ? -1.161  -15.263 -3.962  1.00 0.00 ? 305 VAL B H    5 
ATOM   6817 H HA   . VAL B 1 34 ? -0.372  -17.644 -2.619  1.00 0.00 ? 305 VAL B HA   5 
ATOM   6818 H HB   . VAL B 1 34 ? -2.188  -15.357 -1.813  1.00 0.00 ? 305 VAL B HB   5 
ATOM   6819 H HG11 . VAL B 1 34 ? -1.900  -17.962 -0.621  1.00 0.00 ? 305 VAL B HG11 5 
ATOM   6820 H HG12 . VAL B 1 34 ? -1.192  -16.754 0.451   1.00 0.00 ? 305 VAL B HG12 5 
ATOM   6821 H HG13 . VAL B 1 34 ? -2.872  -16.600 -0.065  1.00 0.00 ? 305 VAL B HG13 5 
ATOM   6822 H HG21 . VAL B 1 34 ? 0.520   -15.410 -2.140  1.00 0.00 ? 305 VAL B HG21 5 
ATOM   6823 H HG22 . VAL B 1 34 ? -0.301  -14.379 -0.966  1.00 0.00 ? 305 VAL B HG22 5 
ATOM   6824 H HG23 . VAL B 1 34 ? 0.387   -15.922 -0.456  1.00 0.00 ? 305 VAL B HG23 5 
ATOM   6825 N N    . ALA B 1 35 ? -3.529  -17.398 -3.507  1.00 0.00 ? 306 ALA B N    5 
ATOM   6826 C CA   . ALA B 1 35 ? -4.732  -18.199 -3.691  1.00 0.00 ? 306 ALA B CA   5 
ATOM   6827 C C    . ALA B 1 35 ? -4.453  -19.296 -4.720  1.00 0.00 ? 306 ALA B C    5 
ATOM   6828 O O    . ALA B 1 35 ? -4.924  -20.411 -4.600  1.00 0.00 ? 306 ALA B O    5 
ATOM   6829 C CB   . ALA B 1 35 ? -5.870  -17.307 -4.190  1.00 0.00 ? 306 ALA B CB   5 
ATOM   6830 H H    . ALA B 1 35 ? -3.507  -16.469 -3.817  1.00 0.00 ? 306 ALA B H    5 
ATOM   6831 H HA   . ALA B 1 35 ? -5.015  -18.649 -2.751  1.00 0.00 ? 306 ALA B HA   5 
ATOM   6832 H HB1  . ALA B 1 35 ? -5.824  -16.351 -3.690  1.00 0.00 ? 306 ALA B HB1  5 
ATOM   6833 H HB2  . ALA B 1 35 ? -5.771  -17.160 -5.256  1.00 0.00 ? 306 ALA B HB2  5 
ATOM   6834 H HB3  . ALA B 1 35 ? -6.818  -17.779 -3.980  1.00 0.00 ? 306 ALA B HB3  5 
ATOM   6835 N N    . GLN B 1 36 ? -3.685  -18.989 -5.729  1.00 0.00 ? 307 GLN B N    5 
ATOM   6836 C CA   . GLN B 1 36 ? -3.375  -19.991 -6.742  1.00 0.00 ? 307 GLN B CA   5 
ATOM   6837 C C    . GLN B 1 36 ? -2.638  -21.157 -6.081  1.00 0.00 ? 307 GLN B C    5 
ATOM   6838 O O    . GLN B 1 36 ? -2.848  -22.306 -6.411  1.00 0.00 ? 307 GLN B O    5 
ATOM   6839 C CB   . GLN B 1 36 ? -2.486  -19.371 -7.822  1.00 0.00 ? 307 GLN B CB   5 
ATOM   6840 C CG   . GLN B 1 36 ? -3.356  -18.874 -8.978  1.00 0.00 ? 307 GLN B CG   5 
ATOM   6841 C CD   . GLN B 1 36 ? -2.467  -18.552 -10.181 1.00 0.00 ? 307 GLN B CD   5 
ATOM   6842 O OE1  . GLN B 1 36 ? -2.805  -18.871 -11.304 1.00 0.00 ? 307 GLN B OE1  5 
ATOM   6843 N NE2  . GLN B 1 36 ? -1.338  -17.927 -9.993  1.00 0.00 ? 307 GLN B NE2  5 
ATOM   6844 H H    . GLN B 1 36 ? -3.313  -18.085 -5.805  1.00 0.00 ? 307 GLN B H    5 
ATOM   6845 H HA   . GLN B 1 36 ? -4.290  -20.349 -7.189  1.00 0.00 ? 307 GLN B HA   5 
ATOM   6846 H HB2  . GLN B 1 36 ? -1.936  -18.540 -7.401  1.00 0.00 ? 307 GLN B HB2  5 
ATOM   6847 H HB3  . GLN B 1 36 ? -1.792  -20.113 -8.187  1.00 0.00 ? 307 GLN B HB3  5 
ATOM   6848 H HG2  . GLN B 1 36 ? -4.066  -19.642 -9.249  1.00 0.00 ? 307 GLN B HG2  5 
ATOM   6849 H HG3  . GLN B 1 36 ? -3.885  -17.984 -8.673  1.00 0.00 ? 307 GLN B HG3  5 
ATOM   6850 H HE21 . GLN B 1 36 ? -1.063  -17.669 -9.086  1.00 0.00 ? 307 GLN B HE21 5 
ATOM   6851 H HE22 . GLN B 1 36 ? -0.761  -17.716 -10.757 1.00 0.00 ? 307 GLN B HE22 5 
ATOM   6852 N N    . LEU B 1 37 ? -1.774  -20.866 -5.148  1.00 0.00 ? 308 LEU B N    5 
ATOM   6853 C CA   . LEU B 1 37 ? -1.037  -21.928 -4.476  1.00 0.00 ? 308 LEU B CA   5 
ATOM   6854 C C    . LEU B 1 37 ? -2.016  -22.809 -3.696  1.00 0.00 ? 308 LEU B C    5 
ATOM   6855 O O    . LEU B 1 37 ? -2.012  -24.018 -3.817  1.00 0.00 ? 308 LEU B O    5 
ATOM   6856 C CB   . LEU B 1 37 ? -0.026  -21.312 -3.510  1.00 0.00 ? 308 LEU B CB   5 
ATOM   6857 C CG   . LEU B 1 37 ? 1.349   -21.249 -4.180  1.00 0.00 ? 308 LEU B CG   5 
ATOM   6858 C CD1  . LEU B 1 37 ? 1.998   -19.895 -3.888  1.00 0.00 ? 308 LEU B CD1  5 
ATOM   6859 C CD2  . LEU B 1 37 ? 2.234   -22.368 -3.627  1.00 0.00 ? 308 LEU B CD2  5 
ATOM   6860 H H    . LEU B 1 37 ? -1.620  -19.930 -4.898  1.00 0.00 ? 308 LEU B H    5 
ATOM   6861 H HA   . LEU B 1 37 ? -0.516  -22.527 -5.208  1.00 0.00 ? 308 LEU B HA   5 
ATOM   6862 H HB2  . LEU B 1 37 ? -0.345  -20.313 -3.246  1.00 0.00 ? 308 LEU B HB2  5 
ATOM   6863 H HB3  . LEU B 1 37 ? 0.037   -21.916 -2.619  1.00 0.00 ? 308 LEU B HB3  5 
ATOM   6864 H HG   . LEU B 1 37 ? 1.234   -21.371 -5.247  1.00 0.00 ? 308 LEU B HG   5 
ATOM   6865 H HD11 . LEU B 1 37 ? 1.635   -19.517 -2.944  1.00 0.00 ? 308 LEU B HD11 5 
ATOM   6866 H HD12 . LEU B 1 37 ? 3.072   -20.015 -3.839  1.00 0.00 ? 308 LEU B HD12 5 
ATOM   6867 H HD13 . LEU B 1 37 ? 1.748   -19.199 -4.675  1.00 0.00 ? 308 LEU B HD13 5 
ATOM   6868 H HD21 . LEU B 1 37 ? 1.733   -22.850 -2.801  1.00 0.00 ? 308 LEU B HD21 5 
ATOM   6869 H HD22 . LEU B 1 37 ? 2.425   -23.093 -4.404  1.00 0.00 ? 308 LEU B HD22 5 
ATOM   6870 H HD23 . LEU B 1 37 ? 3.171   -21.952 -3.286  1.00 0.00 ? 308 LEU B HD23 5 
ATOM   6871 N N    . LYS B 1 38 ? -2.856  -22.212 -2.894  1.00 0.00 ? 309 LYS B N    5 
ATOM   6872 C CA   . LYS B 1 38 ? -3.814  -22.997 -2.123  1.00 0.00 ? 309 LYS B CA   5 
ATOM   6873 C C    . LYS B 1 38 ? -4.757  -23.731 -3.079  1.00 0.00 ? 309 LYS B C    5 
ATOM   6874 O O    . LYS B 1 38 ? -5.414  -24.684 -2.708  1.00 0.00 ? 309 LYS B O    5 
ATOM   6875 C CB   . LYS B 1 38 ? -4.626  -22.066 -1.220  1.00 0.00 ? 309 LYS B CB   5 
ATOM   6876 C CG   . LYS B 1 38 ? -3.685  -21.332 -0.263  1.00 0.00 ? 309 LYS B CG   5 
ATOM   6877 C CD   . LYS B 1 38 ? -3.300  -22.263 0.888   1.00 0.00 ? 309 LYS B CD   5 
ATOM   6878 C CE   . LYS B 1 38 ? -2.996  -21.432 2.137   1.00 0.00 ? 309 LYS B CE   5 
ATOM   6879 N NZ   . LYS B 1 38 ? -2.724  -22.342 3.284   1.00 0.00 ? 309 LYS B NZ   5 
ATOM   6880 H H    . LYS B 1 38 ? -2.842  -21.235 -2.809  1.00 0.00 ? 309 LYS B H    5 
ATOM   6881 H HA   . LYS B 1 38 ? -3.285  -23.715 -1.514  1.00 0.00 ? 309 LYS B HA   5 
ATOM   6882 H HB2  . LYS B 1 38 ? -5.156  -21.348 -1.827  1.00 0.00 ? 309 LYS B HB2  5 
ATOM   6883 H HB3  . LYS B 1 38 ? -5.335  -22.647 -0.648  1.00 0.00 ? 309 LYS B HB3  5 
ATOM   6884 H HG2  . LYS B 1 38 ? -2.796  -21.028 -0.796  1.00 0.00 ? 309 LYS B HG2  5 
ATOM   6885 H HG3  . LYS B 1 38 ? -4.183  -20.459 0.131   1.00 0.00 ? 309 LYS B HG3  5 
ATOM   6886 H HD2  . LYS B 1 38 ? -4.117  -22.938 1.095   1.00 0.00 ? 309 LYS B HD2  5 
ATOM   6887 H HD3  . LYS B 1 38 ? -2.423  -22.829 0.614   1.00 0.00 ? 309 LYS B HD3  5 
ATOM   6888 H HE2  . LYS B 1 38 ? -2.130  -20.813 1.954   1.00 0.00 ? 309 LYS B HE2  5 
ATOM   6889 H HE3  . LYS B 1 38 ? -3.845  -20.805 2.367   1.00 0.00 ? 309 LYS B HE3  5 
ATOM   6890 H HZ1  . LYS B 1 38 ? -2.412  -23.267 2.928   1.00 0.00 ? 309 LYS B HZ1  5 
ATOM   6891 H HZ2  . LYS B 1 38 ? -1.976  -21.934 3.881   1.00 0.00 ? 309 LYS B HZ2  5 
ATOM   6892 H HZ3  . LYS B 1 38 ? -3.590  -22.460 3.846   1.00 0.00 ? 309 LYS B HZ3  5 
ATOM   6893 N N    . GLN B 1 39 ? -4.831  -23.296 -4.308  1.00 0.00 ? 310 GLN B N    5 
ATOM   6894 C CA   . GLN B 1 39 ? -5.717  -23.954 -5.262  1.00 0.00 ? 310 GLN B CA   5 
ATOM   6895 C C    . GLN B 1 39 ? -5.217  -25.374 -5.537  1.00 0.00 ? 310 GLN B C    5 
ATOM   6896 O O    . GLN B 1 39 ? -5.994  -26.299 -5.676  1.00 0.00 ? 310 GLN B O    5 
ATOM   6897 C CB   . GLN B 1 39 ? -5.741  -23.159 -6.567  1.00 0.00 ? 310 GLN B CB   5 
ATOM   6898 C CG   . GLN B 1 39 ? -7.081  -23.375 -7.274  1.00 0.00 ? 310 GLN B CG   5 
ATOM   6899 C CD   . GLN B 1 39 ? -8.142  -22.474 -6.642  1.00 0.00 ? 310 GLN B CD   5 
ATOM   6900 O OE1  . GLN B 1 39 ? -8.074  -21.266 -6.751  1.00 0.00 ? 310 GLN B OE1  5 
ATOM   6901 N NE2  . GLN B 1 39 ? -9.127  -23.014 -5.979  1.00 0.00 ? 310 GLN B NE2  5 
ATOM   6902 H H    . GLN B 1 39 ? -4.295  -22.525 -4.587  1.00 0.00 ? 310 GLN B H    5 
ATOM   6903 H HA   . GLN B 1 39 ? -6.716  -23.998 -4.853  1.00 0.00 ? 310 GLN B HA   5 
ATOM   6904 H HB2  . GLN B 1 39 ? -5.612  -22.108 -6.351  1.00 0.00 ? 310 GLN B HB2  5 
ATOM   6905 H HB3  . GLN B 1 39 ? -4.940  -23.495 -7.208  1.00 0.00 ? 310 GLN B HB3  5 
ATOM   6906 H HG2  . GLN B 1 39 ? -6.979  -23.131 -8.321  1.00 0.00 ? 310 GLN B HG2  5 
ATOM   6907 H HG3  . GLN B 1 39 ? -7.380  -24.406 -7.171  1.00 0.00 ? 310 GLN B HG3  5 
ATOM   6908 H HE21 . GLN B 1 39 ? -9.183  -23.989 -5.891  1.00 0.00 ? 310 GLN B HE21 5 
ATOM   6909 H HE22 . GLN B 1 39 ? -9.814  -22.446 -5.570  1.00 0.00 ? 310 GLN B HE22 5 
ATOM   6910 N N    . LYS B 1 40 ? -3.927  -25.556 -5.618  1.00 0.00 ? 311 LYS B N    5 
ATOM   6911 C CA   . LYS B 1 40 ? -3.396  -26.890 -5.883  1.00 0.00 ? 311 LYS B CA   5 
ATOM   6912 C C    . LYS B 1 40 ? -3.226  -27.645 -4.564  1.00 0.00 ? 311 LYS B C    5 
ATOM   6913 O O    . LYS B 1 40 ? -3.216  -28.860 -4.531  1.00 0.00 ? 311 LYS B O    5 
ATOM   6914 C CB   . LYS B 1 40 ? -2.038  -26.771 -6.582  1.00 0.00 ? 311 LYS B CB   5 
ATOM   6915 C CG   . LYS B 1 40 ? -2.227  -26.127 -7.958  1.00 0.00 ? 311 LYS B CG   5 
ATOM   6916 C CD   . LYS B 1 40 ? -0.962  -26.329 -8.793  1.00 0.00 ? 311 LYS B CD   5 
ATOM   6917 C CE   . LYS B 1 40 ? -1.121  -25.619 -10.139 1.00 0.00 ? 311 LYS B CE   5 
ATOM   6918 N NZ   . LYS B 1 40 ? 0.183   -25.021 -10.543 1.00 0.00 ? 311 LYS B NZ   5 
ATOM   6919 H H    . LYS B 1 40 ? -3.316  -24.798 -5.506  1.00 0.00 ? 311 LYS B H    5 
ATOM   6920 H HA   . LYS B 1 40 ? -4.079  -27.429 -6.521  1.00 0.00 ? 311 LYS B HA   5 
ATOM   6921 H HB2  . LYS B 1 40 ? -1.379  -26.159 -5.984  1.00 0.00 ? 311 LYS B HB2  5 
ATOM   6922 H HB3  . LYS B 1 40 ? -1.608  -27.753 -6.704  1.00 0.00 ? 311 LYS B HB3  5 
ATOM   6923 H HG2  . LYS B 1 40 ? -3.069  -26.587 -8.457  1.00 0.00 ? 311 LYS B HG2  5 
ATOM   6924 H HG3  . LYS B 1 40 ? -2.412  -25.070 -7.837  1.00 0.00 ? 311 LYS B HG3  5 
ATOM   6925 H HD2  . LYS B 1 40 ? -0.113  -25.919 -8.267  1.00 0.00 ? 311 LYS B HD2  5 
ATOM   6926 H HD3  . LYS B 1 40 ? -0.806  -27.385 -8.961  1.00 0.00 ? 311 LYS B HD3  5 
ATOM   6927 H HE2  . LYS B 1 40 ? -1.436  -26.331 -10.887 1.00 0.00 ? 311 LYS B HE2  5 
ATOM   6928 H HE3  . LYS B 1 40 ? -1.862  -24.839 -10.049 1.00 0.00 ? 311 LYS B HE3  5 
ATOM   6929 H HZ1  . LYS B 1 40 ? 0.960   -25.552 -10.100 1.00 0.00 ? 311 LYS B HZ1  5 
ATOM   6930 H HZ2  . LYS B 1 40 ? 0.282   -25.069 -11.577 1.00 0.00 ? 311 LYS B HZ2  5 
ATOM   6931 H HZ3  . LYS B 1 40 ? 0.219   -24.028 -10.234 1.00 0.00 ? 311 LYS B HZ3  5 
ATOM   6932 N N    . VAL B 1 41 ? -3.089  -26.937 -3.475  1.00 0.00 ? 312 VAL B N    5 
ATOM   6933 C CA   . VAL B 1 41 ? -2.923  -27.604 -2.189  1.00 0.00 ? 312 VAL B CA   5 
ATOM   6934 C C    . VAL B 1 41 ? -4.260  -28.197 -1.741  1.00 0.00 ? 312 VAL B C    5 
ATOM   6935 O O    . VAL B 1 41 ? -4.311  -29.071 -0.898  1.00 0.00 ? 312 VAL B O    5 
ATOM   6936 C CB   . VAL B 1 41 ? -2.438  -26.593 -1.147  1.00 0.00 ? 312 VAL B CB   5 
ATOM   6937 C CG1  . VAL B 1 41 ? -1.892  -27.337 0.072   1.00 0.00 ? 312 VAL B CG1  5 
ATOM   6938 C CG2  . VAL B 1 41 ? -1.332  -25.729 -1.755  1.00 0.00 ? 312 VAL B CG2  5 
ATOM   6939 H H    . VAL B 1 41 ? -3.098  -25.959 -3.523  1.00 0.00 ? 312 VAL B H    5 
ATOM   6940 H HA   . VAL B 1 41 ? -2.193  -28.395 -2.285  1.00 0.00 ? 312 VAL B HA   5 
ATOM   6941 H HB   . VAL B 1 41 ? -3.263  -25.966 -0.845  1.00 0.00 ? 312 VAL B HB   5 
ATOM   6942 H HG11 . VAL B 1 41 ? -2.388  -28.292 0.164   1.00 0.00 ? 312 VAL B HG11 5 
ATOM   6943 H HG12 . VAL B 1 41 ? -0.830  -27.495 -0.047  1.00 0.00 ? 312 VAL B HG12 5 
ATOM   6944 H HG13 . VAL B 1 41 ? -2.071  -26.752 0.961   1.00 0.00 ? 312 VAL B HG13 5 
ATOM   6945 H HG21 . VAL B 1 41 ? -1.147  -26.042 -2.772  1.00 0.00 ? 312 VAL B HG21 5 
ATOM   6946 H HG22 . VAL B 1 41 ? -1.639  -24.693 -1.747  1.00 0.00 ? 312 VAL B HG22 5 
ATOM   6947 H HG23 . VAL B 1 41 ? -0.428  -25.840 -1.173  1.00 0.00 ? 312 VAL B HG23 5 
ATOM   6948 N N    . MET B 1 42 ? -5.344  -27.728 -2.296  1.00 0.00 ? 313 MET B N    5 
ATOM   6949 C CA   . MET B 1 42 ? -6.649  -28.252 -1.907  1.00 0.00 ? 313 MET B CA   5 
ATOM   6950 C C    . MET B 1 42 ? -6.752  -29.722 -2.321  1.00 0.00 ? 313 MET B C    5 
ATOM   6951 O O    . MET B 1 42 ? -6.984  -30.040 -3.469  1.00 0.00 ? 313 MET B O    5 
ATOM   6952 C CB   . MET B 1 42 ? -7.749  -27.446 -2.598  1.00 0.00 ? 313 MET B CB   5 
ATOM   6953 C CG   . MET B 1 42 ? -9.110  -28.076 -2.293  1.00 0.00 ? 313 MET B CG   5 
ATOM   6954 S SD   . MET B 1 42 ? -10.291 -26.778 -1.854  1.00 0.00 ? 313 MET B SD   5 
ATOM   6955 C CE   . MET B 1 42 ? -10.206 -25.858 -3.412  1.00 0.00 ? 313 MET B CE   5 
ATOM   6956 H H    . MET B 1 42 ? -5.281  -27.022 -2.974  1.00 0.00 ? 313 MET B H    5 
ATOM   6957 H HA   . MET B 1 42 ? -6.763  -28.171 -0.836  1.00 0.00 ? 313 MET B HA   5 
ATOM   6958 H HB2  . MET B 1 42 ? -7.732  -26.429 -2.235  1.00 0.00 ? 313 MET B HB2  5 
ATOM   6959 H HB3  . MET B 1 42 ? -7.584  -27.451 -3.665  1.00 0.00 ? 313 MET B HB3  5 
ATOM   6960 H HG2  . MET B 1 42 ? -9.464  -28.605 -3.165  1.00 0.00 ? 313 MET B HG2  5 
ATOM   6961 H HG3  . MET B 1 42 ? -9.011  -28.765 -1.469  1.00 0.00 ? 313 MET B HG3  5 
ATOM   6962 H HE1  . MET B 1 42 ? -10.486 -26.509 -4.228  1.00 0.00 ? 313 MET B HE1  5 
ATOM   6963 H HE2  . MET B 1 42 ? -10.885 -25.022 -3.374  1.00 0.00 ? 313 MET B HE2  5 
ATOM   6964 H HE3  . MET B 1 42 ? -9.198  -25.495 -3.559  1.00 0.00 ? 313 MET B HE3  5 
ATOM   6965 N N    . ASN B 1 43 ? -6.583  -30.622 -1.390  1.00 0.00 ? 314 ASN B N    5 
ATOM   6966 C CA   . ASN B 1 43 ? -6.672  -32.040 -1.722  1.00 0.00 ? 314 ASN B CA   5 
ATOM   6967 C C    . ASN B 1 43 ? -6.893  -32.847 -0.441  1.00 0.00 ? 314 ASN B C    5 
ATOM   6968 O O    . ASN B 1 43 ? -5.968  -33.397 0.126   1.00 0.00 ? 314 ASN B O    5 
ATOM   6969 C CB   . ASN B 1 43 ? -5.374  -32.491 -2.392  1.00 0.00 ? 314 ASN B CB   5 
ATOM   6970 C CG   . ASN B 1 43 ? -5.700  -33.359 -3.608  1.00 0.00 ? 314 ASN B CG   5 
ATOM   6971 O OD1  . ASN B 1 43 ? -6.768  -33.936 -3.689  1.00 0.00 ? 314 ASN B OD1  5 
ATOM   6972 N ND2  . ASN B 1 43 ? -4.824  -33.478 -4.567  1.00 0.00 ? 314 ASN B ND2  5 
ATOM   6973 H H    . ASN B 1 43 ? -6.398  -30.346 -0.469  1.00 0.00 ? 314 ASN B H    5 
ATOM   6974 H HA   . ASN B 1 43 ? -7.499  -32.201 -2.396  1.00 0.00 ? 314 ASN B HA   5 
ATOM   6975 H HB2  . ASN B 1 43 ? -4.812  -31.624 -2.708  1.00 0.00 ? 314 ASN B HB2  5 
ATOM   6976 H HB3  . ASN B 1 43 ? -4.787  -33.066 -1.691  1.00 0.00 ? 314 ASN B HB3  5 
ATOM   6977 H HD21 . ASN B 1 43 ? -3.962  -33.014 -4.503  1.00 0.00 ? 314 ASN B HD21 5 
ATOM   6978 H HD22 . ASN B 1 43 ? -5.024  -34.033 -5.350  1.00 0.00 ? 314 ASN B HD22 5 
ATOM   6979 N N    . TYR B 1 44 ? -8.113  -32.922 0.020   1.00 0.00 ? 315 TYR B N    5 
ATOM   6980 C CA   . TYR B 1 44 ? -8.391  -33.676 1.239   1.00 0.00 ? 315 TYR B CA   5 
ATOM   6981 C C    . TYR B 1 44 ? -8.989  -35.036 0.871   1.00 0.00 ? 315 TYR B C    5 
ATOM   6982 O O    . TYR B 1 44 ? -9.797  -35.532 1.637   1.00 0.00 ? 315 TYR B O    5 
ATOM   6983 C CB   . TYR B 1 44 ? -9.383  -32.898 2.106   1.00 0.00 ? 315 TYR B CB   5 
ATOM   6984 C CG   . TYR B 1 44 ? -8.661  -31.782 2.820   1.00 0.00 ? 315 TYR B CG   5 
ATOM   6985 C CD1  . TYR B 1 44 ? -8.220  -30.658 2.103   1.00 0.00 ? 315 TYR B CD1  5 
ATOM   6986 C CD2  . TYR B 1 44 ? -8.431  -31.868 4.203   1.00 0.00 ? 315 TYR B CD2  5 
ATOM   6987 C CE1  . TYR B 1 44 ? -7.549  -29.620 2.768   1.00 0.00 ? 315 TYR B CE1  5 
ATOM   6988 C CE2  . TYR B 1 44 ? -7.758  -30.829 4.869   1.00 0.00 ? 315 TYR B CE2  5 
ATOM   6989 C CZ   . TYR B 1 44 ? -7.318  -29.706 4.151   1.00 0.00 ? 315 TYR B CZ   5 
ATOM   6990 O OH   . TYR B 1 44 ? -6.658  -28.684 4.804   1.00 0.00 ? 315 TYR B OH   5 
ATOM   6991 O OXT  . TYR B 1 44 ? -8.627  -35.557 -0.172  1.00 0.00 ? 315 TYR B OXT  5 
ATOM   6992 H H    . TYR B 1 44 ? -8.842  -32.471 -0.452  1.00 0.00 ? 315 TYR B H    5 
ATOM   6993 H HA   . TYR B 1 44 ? -7.474  -33.822 1.788   1.00 0.00 ? 315 TYR B HA   5 
ATOM   6994 H HB2  . TYR B 1 44 ? -10.159 -32.484 1.479   1.00 0.00 ? 315 TYR B HB2  5 
ATOM   6995 H HB3  . TYR B 1 44 ? -9.825  -33.564 2.833   1.00 0.00 ? 315 TYR B HB3  5 
ATOM   6996 H HD1  . TYR B 1 44 ? -8.398  -30.592 1.040   1.00 0.00 ? 315 TYR B HD1  5 
ATOM   6997 H HD2  . TYR B 1 44 ? -8.769  -32.732 4.754   1.00 0.00 ? 315 TYR B HD2  5 
ATOM   6998 H HE1  . TYR B 1 44 ? -7.210  -28.754 2.217   1.00 0.00 ? 315 TYR B HE1  5 
ATOM   6999 H HE2  . TYR B 1 44 ? -7.581  -30.895 5.931   1.00 0.00 ? 315 TYR B HE2  5 
ATOM   7000 H HH   . TYR B 1 44 ? -5.731  -28.721 4.554   1.00 0.00 ? 315 TYR B HH   5 
HETATM 7001 C C    . ACE A 1 1  ? 4.358   31.051  3.237   1.00 0.00 ? 272 ACE A C    6 
HETATM 7002 O O    . ACE A 1 1  ? 3.820   29.962  3.214   1.00 0.00 ? 272 ACE A O    6 
HETATM 7003 C CH3  . ACE A 1 1  ? 5.818   31.205  3.667   1.00 0.00 ? 272 ACE A CH3  6 
HETATM 7004 H H1   . ACE A 1 1  ? 6.312   30.246  3.616   1.00 0.00 ? 272 ACE A H1   6 
HETATM 7005 H H2   . ACE A 1 1  ? 6.315   31.904  3.011   1.00 0.00 ? 272 ACE A H2   6 
HETATM 7006 H H3   . ACE A 1 1  ? 5.856   31.575  4.682   1.00 0.00 ? 272 ACE A H3   6 
ATOM   7007 N N    . CYS A 1 2  ? 3.713   32.131  2.893   1.00 0.00 ? 273 CYS A N    6 
ATOM   7008 C CA   . CYS A 1 2  ? 2.321   32.044  2.471   1.00 0.00 ? 273 CYS A CA   6 
ATOM   7009 C C    . CYS A 1 2  ? 1.485   31.434  3.598   1.00 0.00 ? 273 CYS A C    6 
ATOM   7010 O O    . CYS A 1 2  ? 0.959   32.130  4.442   1.00 0.00 ? 273 CYS A O    6 
ATOM   7011 C CB   . CYS A 1 2  ? 2.216   31.166  1.222   1.00 0.00 ? 273 CYS A CB   6 
ATOM   7012 S SG   . CYS A 1 2  ? 2.651   32.138  -0.241  1.00 0.00 ? 273 CYS A SG   6 
ATOM   7013 H H    . CYS A 1 2  ? 4.166   33.000  2.917   1.00 0.00 ? 273 CYS A H    6 
ATOM   7014 H HA   . CYS A 1 2  ? 1.951   33.032  2.244   1.00 0.00 ? 273 CYS A HA   6 
ATOM   7015 H HB2  . CYS A 1 2  ? 2.894   30.330  1.314   1.00 0.00 ? 273 CYS A HB2  6 
ATOM   7016 H HB3  . CYS A 1 2  ? 1.206   30.799  1.125   1.00 0.00 ? 273 CYS A HB3  6 
ATOM   7017 N N    . GLY A 1 3  ? 1.357   30.135  3.615   1.00 0.00 ? 274 GLY A N    6 
ATOM   7018 C CA   . GLY A 1 3  ? 0.573   29.493  4.663   1.00 0.00 ? 274 GLY A CA   6 
ATOM   7019 C C    . GLY A 1 3  ? -0.884  29.373  4.212   1.00 0.00 ? 274 GLY A C    6 
ATOM   7020 O O    . GLY A 1 3  ? -1.526  30.353  3.892   1.00 0.00 ? 274 GLY A O    6 
ATOM   7021 H H    . GLY A 1 3  ? 1.789   29.591  2.924   1.00 0.00 ? 274 GLY A H    6 
ATOM   7022 H HA2  . GLY A 1 3  ? 0.974   28.508  4.860   1.00 0.00 ? 274 GLY A HA2  6 
ATOM   7023 H HA3  . GLY A 1 3  ? 0.617   30.088  5.563   1.00 0.00 ? 274 GLY A HA3  6 
ATOM   7024 N N    . GLY A 1 4  ? -1.409  28.178  4.185   1.00 0.00 ? 275 GLY A N    6 
ATOM   7025 C CA   . GLY A 1 4  ? -2.795  28.003  3.765   1.00 0.00 ? 275 GLY A CA   6 
ATOM   7026 C C    . GLY A 1 4  ? -2.900  26.791  2.839   1.00 0.00 ? 275 GLY A C    6 
ATOM   7027 O O    . GLY A 1 4  ? -3.555  25.816  3.148   1.00 0.00 ? 275 GLY A O    6 
ATOM   7028 H H    . GLY A 1 4  ? -0.874  27.401  4.448   1.00 0.00 ? 275 GLY A H    6 
ATOM   7029 H HA2  . GLY A 1 4  ? -3.417  27.848  4.636   1.00 0.00 ? 275 GLY A HA2  6 
ATOM   7030 H HA3  . GLY A 1 4  ? -3.125  28.882  3.235   1.00 0.00 ? 275 GLY A HA3  6 
ATOM   7031 N N    . ARG A 1 5  ? -2.259  26.842  1.703   1.00 0.00 ? 276 ARG A N    6 
ATOM   7032 C CA   . ARG A 1 5  ? -2.325  25.717  0.777   1.00 0.00 ? 276 ARG A CA   6 
ATOM   7033 C C    . ARG A 1 5  ? -1.326  24.640  1.211   1.00 0.00 ? 276 ARG A C    6 
ATOM   7034 O O    . ARG A 1 5  ? -1.392  23.508  0.774   1.00 0.00 ? 276 ARG A O    6 
ATOM   7035 C CB   . ARG A 1 5  ? -1.979  26.194  -0.635  1.00 0.00 ? 276 ARG A CB   6 
ATOM   7036 C CG   . ARG A 1 5  ? -3.184  25.987  -1.554  1.00 0.00 ? 276 ARG A CG   6 
ATOM   7037 C CD   . ARG A 1 5  ? -3.152  27.020  -2.682  1.00 0.00 ? 276 ARG A CD   6 
ATOM   7038 N NE   . ARG A 1 5  ? -4.485  27.163  -3.262  1.00 0.00 ? 276 ARG A NE   6 
ATOM   7039 C CZ   . ARG A 1 5  ? -5.265  26.121  -3.391  1.00 0.00 ? 276 ARG A CZ   6 
ATOM   7040 N NH1  . ARG A 1 5  ? -5.022  25.235  -4.317  1.00 0.00 ? 276 ARG A NH1  6 
ATOM   7041 N NH2  . ARG A 1 5  ? -6.285  25.969  -2.592  1.00 0.00 ? 276 ARG A NH2  6 
ATOM   7042 H H    . ARG A 1 5  ? -1.737  27.639  1.471   1.00 0.00 ? 276 ARG A H    6 
ATOM   7043 H HA   . ARG A 1 5  ? -3.321  25.305  0.779   1.00 0.00 ? 276 ARG A HA   6 
ATOM   7044 H HB2  . ARG A 1 5  ? -1.721  27.243  -0.605  1.00 0.00 ? 276 ARG A HB2  6 
ATOM   7045 H HB3  . ARG A 1 5  ? -1.139  25.627  -1.010  1.00 0.00 ? 276 ARG A HB3  6 
ATOM   7046 H HG2  . ARG A 1 5  ? -3.149  24.991  -1.973  1.00 0.00 ? 276 ARG A HG2  6 
ATOM   7047 H HG3  . ARG A 1 5  ? -4.094  26.106  -0.985  1.00 0.00 ? 276 ARG A HG3  6 
ATOM   7048 H HD2  . ARG A 1 5  ? -2.832  27.973  -2.288  1.00 0.00 ? 276 ARG A HD2  6 
ATOM   7049 H HD3  . ARG A 1 5  ? -2.457  26.698  -3.444  1.00 0.00 ? 276 ARG A HD3  6 
ATOM   7050 H HE   . ARG A 1 5  ? -4.796  28.043  -3.557  1.00 0.00 ? 276 ARG A HE   6 
ATOM   7051 H HH11 . ARG A 1 5  ? -4.240  25.352  -4.929  1.00 0.00 ? 276 ARG A HH11 6 
ATOM   7052 H HH12 . ARG A 1 5  ? -5.619  24.439  -4.416  1.00 0.00 ? 276 ARG A HH12 6 
ATOM   7053 H HH21 . ARG A 1 5  ? -6.469  26.647  -1.883  1.00 0.00 ? 276 ARG A HH21 6 
ATOM   7054 H HH22 . ARG A 1 5  ? -6.881  25.170  -2.691  1.00 0.00 ? 276 ARG A HH22 6 
ATOM   7055 N N    . ILE A 1 6  ? -0.405  24.982  2.068   1.00 0.00 ? 277 ILE A N    6 
ATOM   7056 C CA   . ILE A 1 6  ? 0.574   23.998  2.519   1.00 0.00 ? 277 ILE A CA   6 
ATOM   7057 C C    . ILE A 1 6  ? -0.066  23.092  3.572   1.00 0.00 ? 277 ILE A C    6 
ATOM   7058 O O    . ILE A 1 6  ? 0.028   21.883  3.504   1.00 0.00 ? 277 ILE A O    6 
ATOM   7059 C CB   . ILE A 1 6  ? 1.781   24.714  3.126   1.00 0.00 ? 277 ILE A CB   6 
ATOM   7060 C CG1  . ILE A 1 6  ? 2.544   25.448  2.021   1.00 0.00 ? 277 ILE A CG1  6 
ATOM   7061 C CG2  . ILE A 1 6  ? 2.702   23.688  3.786   1.00 0.00 ? 277 ILE A CG2  6 
ATOM   7062 C CD1  . ILE A 1 6  ? 3.225   26.686  2.607   1.00 0.00 ? 277 ILE A CD1  6 
ATOM   7063 H H    . ILE A 1 6  ? -0.368  25.900  2.409   1.00 0.00 ? 277 ILE A H    6 
ATOM   7064 H HA   . ILE A 1 6  ? 0.898   23.401  1.679   1.00 0.00 ? 277 ILE A HA   6 
ATOM   7065 H HB   . ILE A 1 6  ? 1.443   25.425  3.867   1.00 0.00 ? 277 ILE A HB   6 
ATOM   7066 H HG12 . ILE A 1 6  ? 3.290   24.790  1.601   1.00 0.00 ? 277 ILE A HG12 6 
ATOM   7067 H HG13 . ILE A 1 6  ? 1.855   25.752  1.248   1.00 0.00 ? 277 ILE A HG13 6 
ATOM   7068 H HG21 . ILE A 1 6  ? 2.760   22.805  3.166   1.00 0.00 ? 277 ILE A HG21 6 
ATOM   7069 H HG22 . ILE A 1 6  ? 3.689   24.112  3.900   1.00 0.00 ? 277 ILE A HG22 6 
ATOM   7070 H HG23 . ILE A 1 6  ? 2.309   23.423  4.756   1.00 0.00 ? 277 ILE A HG23 6 
ATOM   7071 H HD11 . ILE A 1 6  ? 2.525   27.220  3.233   1.00 0.00 ? 277 ILE A HD11 6 
ATOM   7072 H HD12 . ILE A 1 6  ? 4.077   26.382  3.198   1.00 0.00 ? 277 ILE A HD12 6 
ATOM   7073 H HD13 . ILE A 1 6  ? 3.555   27.329  1.805   1.00 0.00 ? 277 ILE A HD13 6 
ATOM   7074 N N    . ALA A 1 7  ? -0.719  23.665  4.547   1.00 0.00 ? 278 ALA A N    6 
ATOM   7075 C CA   . ALA A 1 7  ? -1.350  22.851  5.577   1.00 0.00 ? 278 ALA A CA   6 
ATOM   7076 C C    . ALA A 1 7  ? -2.160  21.733  4.917   1.00 0.00 ? 278 ALA A C    6 
ATOM   7077 O O    . ALA A 1 7  ? -2.174  20.608  5.377   1.00 0.00 ? 278 ALA A O    6 
ATOM   7078 C CB   . ALA A 1 7  ? -2.278  23.723  6.423   1.00 0.00 ? 278 ALA A CB   6 
ATOM   7079 H H    . ALA A 1 7  ? -0.785  24.643  4.585   1.00 0.00 ? 278 ALA A H    6 
ATOM   7080 H HA   . ALA A 1 7  ? -0.590  22.418  6.211   1.00 0.00 ? 278 ALA A HA   6 
ATOM   7081 H HB1  . ALA A 1 7  ? -2.415  24.678  5.936   1.00 0.00 ? 278 ALA A HB1  6 
ATOM   7082 H HB2  . ALA A 1 7  ? -3.235  23.234  6.531   1.00 0.00 ? 278 ALA A HB2  6 
ATOM   7083 H HB3  . ALA A 1 7  ? -1.840  23.876  7.398   1.00 0.00 ? 278 ALA A HB3  6 
ATOM   7084 N N    . ARG A 1 8  ? -2.837  22.033  3.843   1.00 0.00 ? 279 ARG A N    6 
ATOM   7085 C CA   . ARG A 1 8  ? -3.628  21.011  3.169   1.00 0.00 ? 279 ARG A CA   6 
ATOM   7086 C C    . ARG A 1 8  ? -2.704  20.105  2.351   1.00 0.00 ? 279 ARG A C    6 
ATOM   7087 O O    . ARG A 1 8  ? -2.741  18.897  2.468   1.00 0.00 ? 279 ARG A O    6 
ATOM   7088 C CB   . ARG A 1 8  ? -4.643  21.680  2.239   1.00 0.00 ? 279 ARG A CB   6 
ATOM   7089 C CG   . ARG A 1 8  ? -5.218  22.924  2.921   1.00 0.00 ? 279 ARG A CG   6 
ATOM   7090 C CD   . ARG A 1 8  ? -5.645  22.576  4.346   1.00 0.00 ? 279 ARG A CD   6 
ATOM   7091 N NE   . ARG A 1 8  ? -6.885  23.273  4.678   1.00 0.00 ? 279 ARG A NE   6 
ATOM   7092 C CZ   . ARG A 1 8  ? -7.097  24.488  4.246   1.00 0.00 ? 279 ARG A CZ   6 
ATOM   7093 N NH1  . ARG A 1 8  ? -6.376  25.477  4.702   1.00 0.00 ? 279 ARG A NH1  6 
ATOM   7094 N NH2  . ARG A 1 8  ? -8.030  24.712  3.361   1.00 0.00 ? 279 ARG A NH2  6 
ATOM   7095 H H    . ARG A 1 8  ? -2.813  22.946  3.488   1.00 0.00 ? 279 ARG A H    6 
ATOM   7096 H HA   . ARG A 1 8  ? -4.152  20.418  3.905   1.00 0.00 ? 279 ARG A HA   6 
ATOM   7097 H HB2  . ARG A 1 8  ? -4.152  21.966  1.320   1.00 0.00 ? 279 ARG A HB2  6 
ATOM   7098 H HB3  . ARG A 1 8  ? -5.442  20.989  2.021   1.00 0.00 ? 279 ARG A HB3  6 
ATOM   7099 H HG2  . ARG A 1 8  ? -4.465  23.700  2.948   1.00 0.00 ? 279 ARG A HG2  6 
ATOM   7100 H HG3  . ARG A 1 8  ? -6.076  23.274  2.366   1.00 0.00 ? 279 ARG A HG3  6 
ATOM   7101 H HD2  . ARG A 1 8  ? -5.801  21.510  4.422   1.00 0.00 ? 279 ARG A HD2  6 
ATOM   7102 H HD3  . ARG A 1 8  ? -4.864  22.872  5.035   1.00 0.00 ? 279 ARG A HD3  6 
ATOM   7103 H HE   . ARG A 1 8  ? -7.562  22.826  5.228   1.00 0.00 ? 279 ARG A HE   6 
ATOM   7104 H HH11 . ARG A 1 8  ? -5.663  25.304  5.382   1.00 0.00 ? 279 ARG A HH11 6 
ATOM   7105 H HH12 . ARG A 1 8  ? -6.538  26.407  4.372   1.00 0.00 ? 279 ARG A HH12 6 
ATOM   7106 H HH21 . ARG A 1 8  ? -8.582  23.954  3.013   1.00 0.00 ? 279 ARG A HH21 6 
ATOM   7107 H HH22 . ARG A 1 8  ? -8.192  25.642  3.028   1.00 0.00 ? 279 ARG A HH22 6 
ATOM   7108 N N    . LEU A 1 9  ? -1.873  20.679  1.523   1.00 0.00 ? 280 LEU A N    6 
ATOM   7109 C CA   . LEU A 1 9  ? -0.970  19.866  0.718   1.00 0.00 ? 280 LEU A CA   6 
ATOM   7110 C C    . LEU A 1 9  ? -0.286  18.831  1.614   1.00 0.00 ? 280 LEU A C    6 
ATOM   7111 O O    . LEU A 1 9  ? -0.115  17.688  1.238   1.00 0.00 ? 280 LEU A O    6 
ATOM   7112 C CB   . LEU A 1 9  ? 0.087   20.763  0.071   1.00 0.00 ? 280 LEU A CB   6 
ATOM   7113 C CG   . LEU A 1 9  ? -0.225  20.923  -1.418  1.00 0.00 ? 280 LEU A CG   6 
ATOM   7114 C CD1  . LEU A 1 9  ? -0.081  19.571  -2.119  1.00 0.00 ? 280 LEU A CD1  6 
ATOM   7115 C CD2  . LEU A 1 9  ? -1.660  21.433  -1.585  1.00 0.00 ? 280 LEU A CD2  6 
ATOM   7116 H H    . LEU A 1 9  ? -1.858  21.656  1.443   1.00 0.00 ? 280 LEU A H    6 
ATOM   7117 H HA   . LEU A 1 9  ? -1.530  19.361  -0.053  1.00 0.00 ? 280 LEU A HA   6 
ATOM   7118 H HB2  . LEU A 1 9  ? 0.078   21.733  0.548   1.00 0.00 ? 280 LEU A HB2  6 
ATOM   7119 H HB3  . LEU A 1 9  ? 1.061   20.313  0.185   1.00 0.00 ? 280 LEU A HB3  6 
ATOM   7120 H HG   . LEU A 1 9  ? 0.464   21.632  -1.856  1.00 0.00 ? 280 LEU A HG   6 
ATOM   7121 H HD11 . LEU A 1 9  ? 0.112   18.803  -1.384  1.00 0.00 ? 280 LEU A HD11 6 
ATOM   7122 H HD12 . LEU A 1 9  ? -0.995  19.341  -2.648  1.00 0.00 ? 280 LEU A HD12 6 
ATOM   7123 H HD13 . LEU A 1 9  ? 0.739   19.615  -2.820  1.00 0.00 ? 280 LEU A HD13 6 
ATOM   7124 H HD21 . LEU A 1 9  ? -1.780  22.353  -1.034  1.00 0.00 ? 280 LEU A HD21 6 
ATOM   7125 H HD22 . LEU A 1 9  ? -1.859  21.609  -2.631  1.00 0.00 ? 280 LEU A HD22 6 
ATOM   7126 H HD23 . LEU A 1 9  ? -2.350  20.693  -1.207  1.00 0.00 ? 280 LEU A HD23 6 
ATOM   7127 N N    . GLU A 1 10 ? 0.105   19.221  2.797   1.00 0.00 ? 281 GLU A N    6 
ATOM   7128 C CA   . GLU A 1 10 ? 0.758   18.276  3.695   1.00 0.00 ? 281 GLU A CA   6 
ATOM   7129 C C    . GLU A 1 10 ? -0.279  17.279  4.214   1.00 0.00 ? 281 GLU A C    6 
ATOM   7130 O O    . GLU A 1 10 ? -0.017  16.098  4.331   1.00 0.00 ? 281 GLU A O    6 
ATOM   7131 C CB   . GLU A 1 10 ? 1.376   19.030  4.875   1.00 0.00 ? 281 GLU A CB   6 
ATOM   7132 C CG   . GLU A 1 10 ? 2.480   19.957  4.364   1.00 0.00 ? 281 GLU A CG   6 
ATOM   7133 C CD   . GLU A 1 10 ? 3.356   20.402  5.538   1.00 0.00 ? 281 GLU A CD   6 
ATOM   7134 O OE1  . GLU A 1 10 ? 3.641   19.573  6.387   1.00 0.00 ? 281 GLU A OE1  6 
ATOM   7135 O OE2  . GLU A 1 10 ? 3.724   21.565  5.567   1.00 0.00 ? 281 GLU A OE2  6 
ATOM   7136 H H    . GLU A 1 10 ? -0.044  20.144  3.083   1.00 0.00 ? 281 GLU A H    6 
ATOM   7137 H HA   . GLU A 1 10 ? 1.533   17.746  3.161   1.00 0.00 ? 281 GLU A HA   6 
ATOM   7138 H HB2  . GLU A 1 10 ? 0.614   19.615  5.368   1.00 0.00 ? 281 GLU A HB2  6 
ATOM   7139 H HB3  . GLU A 1 10 ? 1.797   18.324  5.574   1.00 0.00 ? 281 GLU A HB3  6 
ATOM   7140 H HG2  . GLU A 1 10 ? 3.087   19.429  3.641   1.00 0.00 ? 281 GLU A HG2  6 
ATOM   7141 H HG3  . GLU A 1 10 ? 2.036   20.823  3.897   1.00 0.00 ? 281 GLU A HG3  6 
ATOM   7142 N N    . GLU A 1 11 ? -1.459  17.744  4.522   1.00 0.00 ? 282 GLU A N    6 
ATOM   7143 C CA   . GLU A 1 11 ? -2.493  16.840  5.013   1.00 0.00 ? 282 GLU A CA   6 
ATOM   7144 C C    . GLU A 1 11 ? -2.666  15.697  4.017   1.00 0.00 ? 282 GLU A C    6 
ATOM   7145 O O    . GLU A 1 11 ? -2.862  14.557  4.388   1.00 0.00 ? 282 GLU A O    6 
ATOM   7146 C CB   . GLU A 1 11 ? -3.813  17.601  5.157   1.00 0.00 ? 282 GLU A CB   6 
ATOM   7147 C CG   . GLU A 1 11 ? -4.082  17.885  6.636   1.00 0.00 ? 282 GLU A CG   6 
ATOM   7148 C CD   . GLU A 1 11 ? -4.793  19.232  6.775   1.00 0.00 ? 282 GLU A CD   6 
ATOM   7149 O OE1  . GLU A 1 11 ? -5.312  19.711  5.781   1.00 0.00 ? 282 GLU A OE1  6 
ATOM   7150 O OE2  . GLU A 1 11 ? -4.806  19.761  7.874   1.00 0.00 ? 282 GLU A OE2  6 
ATOM   7151 H H    . GLU A 1 11 ? -1.655  18.698  4.416   1.00 0.00 ? 282 GLU A H    6 
ATOM   7152 H HA   . GLU A 1 11 ? -2.197  16.444  5.975   1.00 0.00 ? 282 GLU A HA   6 
ATOM   7153 H HB2  . GLU A 1 11 ? -3.751  18.533  4.614   1.00 0.00 ? 282 GLU A HB2  6 
ATOM   7154 H HB3  . GLU A 1 11 ? -4.617  17.003  4.755   1.00 0.00 ? 282 GLU A HB3  6 
ATOM   7155 H HG2  . GLU A 1 11 ? -4.707  17.103  7.043   1.00 0.00 ? 282 GLU A HG2  6 
ATOM   7156 H HG3  . GLU A 1 11 ? -3.146  17.916  7.172   1.00 0.00 ? 282 GLU A HG3  6 
ATOM   7157 N N    . LYS A 1 12 ? -2.583  15.993  2.750   1.00 0.00 ? 283 LYS A N    6 
ATOM   7158 C CA   . LYS A 1 12 ? -2.730  14.951  1.743   1.00 0.00 ? 283 LYS A CA   6 
ATOM   7159 C C    . LYS A 1 12 ? -1.505  14.037  1.789   1.00 0.00 ? 283 LYS A C    6 
ATOM   7160 O O    . LYS A 1 12 ? -1.616  12.845  1.997   1.00 0.00 ? 283 LYS A O    6 
ATOM   7161 C CB   . LYS A 1 12 ? -2.830  15.594  0.359   1.00 0.00 ? 283 LYS A CB   6 
ATOM   7162 C CG   . LYS A 1 12 ? -4.093  15.099  -0.345  1.00 0.00 ? 283 LYS A CG   6 
ATOM   7163 C CD   . LYS A 1 12 ? -5.255  16.044  -0.035  1.00 0.00 ? 283 LYS A CD   6 
ATOM   7164 C CE   . LYS A 1 12 ? -5.408  17.058  -1.169  1.00 0.00 ? 283 LYS A CE   6 
ATOM   7165 N NZ   . LYS A 1 12 ? -6.829  17.095  -1.614  1.00 0.00 ? 283 LYS A NZ   6 
ATOM   7166 H H    . LYS A 1 12 ? -2.418  16.920  2.473   1.00 0.00 ? 283 LYS A H    6 
ATOM   7167 H HA   . LYS A 1 12 ? -3.622  14.377  1.938   1.00 0.00 ? 283 LYS A HA   6 
ATOM   7168 H HB2  . LYS A 1 12 ? -2.872  16.670  0.465   1.00 0.00 ? 283 LYS A HB2  6 
ATOM   7169 H HB3  . LYS A 1 12 ? -1.964  15.324  -0.226  1.00 0.00 ? 283 LYS A HB3  6 
ATOM   7170 H HG2  . LYS A 1 12 ? -3.925  15.074  -1.414  1.00 0.00 ? 283 LYS A HG2  6 
ATOM   7171 H HG3  . LYS A 1 12 ? -4.335  14.107  0.004   1.00 0.00 ? 283 LYS A HG3  6 
ATOM   7172 H HD2  . LYS A 1 12 ? -6.168  15.472  0.063   1.00 0.00 ? 283 LYS A HD2  6 
ATOM   7173 H HD3  . LYS A 1 12 ? -5.057  16.567  0.889   1.00 0.00 ? 283 LYS A HD3  6 
ATOM   7174 H HE2  . LYS A 1 12 ? -5.113  18.036  -0.820  1.00 0.00 ? 283 LYS A HE2  6 
ATOM   7175 H HE3  . LYS A 1 12 ? -4.779  16.768  -1.999  1.00 0.00 ? 283 LYS A HE3  6 
ATOM   7176 H HZ1  . LYS A 1 12 ? -7.443  17.281  -0.797  1.00 0.00 ? 283 LYS A HZ1  6 
ATOM   7177 H HZ2  . LYS A 1 12 ? -6.952  17.852  -2.317  1.00 0.00 ? 283 LYS A HZ2  6 
ATOM   7178 H HZ3  . LYS A 1 12 ? -7.083  16.182  -2.041  1.00 0.00 ? 283 LYS A HZ3  6 
ATOM   7179 N N    . VAL A 1 13 ? -0.339  14.588  1.603   1.00 0.00 ? 284 VAL A N    6 
ATOM   7180 C CA   . VAL A 1 13 ? 0.867   13.772  1.640   1.00 0.00 ? 284 VAL A CA   6 
ATOM   7181 C C    . VAL A 1 13 ? 0.816   12.861  2.867   1.00 0.00 ? 284 VAL A C    6 
ATOM   7182 O O    . VAL A 1 13 ? 1.374   11.781  2.876   1.00 0.00 ? 284 VAL A O    6 
ATOM   7183 C CB   . VAL A 1 13 ? 2.094   14.681  1.723   1.00 0.00 ? 284 VAL A CB   6 
ATOM   7184 C CG1  . VAL A 1 13 ? 3.327   13.844  2.072   1.00 0.00 ? 284 VAL A CG1  6 
ATOM   7185 C CG2  . VAL A 1 13 ? 2.310   15.367  0.374   1.00 0.00 ? 284 VAL A CG2  6 
ATOM   7186 H H    . VAL A 1 13 ? -0.272  15.552  1.441   1.00 0.00 ? 284 VAL A H    6 
ATOM   7187 H HA   . VAL A 1 13 ? 0.926   13.170  0.745   1.00 0.00 ? 284 VAL A HA   6 
ATOM   7188 H HB   . VAL A 1 13 ? 1.939   15.426  2.489   1.00 0.00 ? 284 VAL A HB   6 
ATOM   7189 H HG11 . VAL A 1 13 ? 3.099   12.796  1.943   1.00 0.00 ? 284 VAL A HG11 6 
ATOM   7190 H HG12 . VAL A 1 13 ? 4.145   14.118  1.422   1.00 0.00 ? 284 VAL A HG12 6 
ATOM   7191 H HG13 . VAL A 1 13 ? 3.607   14.027  3.099   1.00 0.00 ? 284 VAL A HG13 6 
ATOM   7192 H HG21 . VAL A 1 13 ? 1.374   15.774  0.024   1.00 0.00 ? 284 VAL A HG21 6 
ATOM   7193 H HG22 . VAL A 1 13 ? 3.031   16.165  0.486   1.00 0.00 ? 284 VAL A HG22 6 
ATOM   7194 H HG23 . VAL A 1 13 ? 2.681   14.647  -0.342  1.00 0.00 ? 284 VAL A HG23 6 
ATOM   7195 N N    . LYS A 1 14 ? 0.146   13.288  3.902   1.00 0.00 ? 285 LYS A N    6 
ATOM   7196 C CA   . LYS A 1 14 ? 0.056   12.462  5.100   1.00 0.00 ? 285 LYS A CA   6 
ATOM   7197 C C    . LYS A 1 14 ? -0.869  11.277  4.818   1.00 0.00 ? 285 LYS A C    6 
ATOM   7198 O O    . LYS A 1 14 ? -0.531  10.138  5.074   1.00 0.00 ? 285 LYS A O    6 
ATOM   7199 C CB   . LYS A 1 14 ? -0.509  13.292  6.255   1.00 0.00 ? 285 LYS A CB   6 
ATOM   7200 C CG   . LYS A 1 14 ? 0.226   12.937  7.548   1.00 0.00 ? 285 LYS A CG   6 
ATOM   7201 C CD   . LYS A 1 14 ? 1.599   13.613  7.557   1.00 0.00 ? 285 LYS A CD   6 
ATOM   7202 C CE   . LYS A 1 14 ? 1.419   15.132  7.582   1.00 0.00 ? 285 LYS A CE   6 
ATOM   7203 N NZ   . LYS A 1 14 ? 2.420   15.737  8.504   1.00 0.00 ? 285 LYS A NZ   6 
ATOM   7204 H H    . LYS A 1 14 ? -0.299  14.160  3.872   1.00 0.00 ? 285 LYS A H    6 
ATOM   7205 H HA   . LYS A 1 14 ? 1.038   12.100  5.363   1.00 0.00 ? 285 LYS A HA   6 
ATOM   7206 H HB2  . LYS A 1 14 ? -0.377  14.343  6.043   1.00 0.00 ? 285 LYS A HB2  6 
ATOM   7207 H HB3  . LYS A 1 14 ? -1.561  13.077  6.372   1.00 0.00 ? 285 LYS A HB3  6 
ATOM   7208 H HG2  . LYS A 1 14 ? -0.349  13.277  8.396   1.00 0.00 ? 285 LYS A HG2  6 
ATOM   7209 H HG3  . LYS A 1 14 ? 0.356   11.865  7.606   1.00 0.00 ? 285 LYS A HG3  6 
ATOM   7210 H HD2  . LYS A 1 14 ? 2.149   13.301  8.435   1.00 0.00 ? 285 LYS A HD2  6 
ATOM   7211 H HD3  . LYS A 1 14 ? 2.147   13.332  6.669   1.00 0.00 ? 285 LYS A HD3  6 
ATOM   7212 H HE2  . LYS A 1 14 ? 1.561   15.528  6.586   1.00 0.00 ? 285 LYS A HE2  6 
ATOM   7213 H HE3  . LYS A 1 14 ? 0.423   15.371  7.924   1.00 0.00 ? 285 LYS A HE3  6 
ATOM   7214 H HZ1  . LYS A 1 14 ? 3.281   15.153  8.514   1.00 0.00 ? 285 LYS A HZ1  6 
ATOM   7215 H HZ2  . LYS A 1 14 ? 2.658   16.695  8.180   1.00 0.00 ? 285 LYS A HZ2  6 
ATOM   7216 H HZ3  . LYS A 1 14 ? 2.022   15.783  9.464   1.00 0.00 ? 285 LYS A HZ3  6 
ATOM   7217 N N    . THR A 1 15 ? -2.030  11.536  4.282   1.00 0.00 ? 286 THR A N    6 
ATOM   7218 C CA   . THR A 1 15 ? -2.953  10.450  3.983   1.00 0.00 ? 286 THR A CA   6 
ATOM   7219 C C    . THR A 1 15 ? -2.233  9.408   3.126   1.00 0.00 ? 286 THR A C    6 
ATOM   7220 O O    . THR A 1 15 ? -2.287  8.223   3.391   1.00 0.00 ? 286 THR A O    6 
ATOM   7221 C CB   . THR A 1 15 ? -4.156  10.998  3.215   1.00 0.00 ? 286 THR A CB   6 
ATOM   7222 O OG1  . THR A 1 15 ? -3.946  12.374  2.930   1.00 0.00 ? 286 THR A OG1  6 
ATOM   7223 C CG2  . THR A 1 15 ? -5.423  10.838  4.059   1.00 0.00 ? 286 THR A CG2  6 
ATOM   7224 H H    . THR A 1 15 ? -2.279  12.462  4.080   1.00 0.00 ? 286 THR A H    6 
ATOM   7225 H HA   . THR A 1 15 ? -3.287  9.992   4.903   1.00 0.00 ? 286 THR A HA   6 
ATOM   7226 H HB   . THR A 1 15 ? -4.273  10.453  2.292   1.00 0.00 ? 286 THR A HB   6 
ATOM   7227 H HG1  . THR A 1 15 ? -4.801  12.778  2.767   1.00 0.00 ? 286 THR A HG1  6 
ATOM   7228 H HG21 . THR A 1 15 ? -5.233  10.143  4.863   1.00 0.00 ? 286 THR A HG21 6 
ATOM   7229 H HG22 . THR A 1 15 ? -5.706  11.796  4.468   1.00 0.00 ? 286 THR A HG22 6 
ATOM   7230 H HG23 . THR A 1 15 ? -6.222  10.460  3.438   1.00 0.00 ? 286 THR A HG23 6 
ATOM   7231 N N    . LEU A 1 16 ? -1.555  9.842   2.099   1.00 0.00 ? 287 LEU A N    6 
ATOM   7232 C CA   . LEU A 1 16 ? -0.843  8.903   1.244   1.00 0.00 ? 287 LEU A CA   6 
ATOM   7233 C C    . LEU A 1 16 ? 0.142   8.093   2.089   1.00 0.00 ? 287 LEU A C    6 
ATOM   7234 O O    . LEU A 1 16 ? 0.216   6.886   1.987   1.00 0.00 ? 287 LEU A O    6 
ATOM   7235 C CB   . LEU A 1 16 ? -0.081  9.673   0.164   1.00 0.00 ? 287 LEU A CB   6 
ATOM   7236 C CG   . LEU A 1 16 ? -1.066  10.176  -0.895  1.00 0.00 ? 287 LEU A CG   6 
ATOM   7237 C CD1  . LEU A 1 16 ? -0.645  11.568  -1.367  1.00 0.00 ? 287 LEU A CD1  6 
ATOM   7238 C CD2  . LEU A 1 16 ? -1.068  9.215   -2.085  1.00 0.00 ? 287 LEU A CD2  6 
ATOM   7239 H H    . LEU A 1 16 ? -1.522  10.803  1.904   1.00 0.00 ? 287 LEU A H    6 
ATOM   7240 H HA   . LEU A 1 16 ? -1.551  8.234   0.777   1.00 0.00 ? 287 LEU A HA   6 
ATOM   7241 H HB2  . LEU A 1 16 ? 0.426   10.515  0.612   1.00 0.00 ? 287 LEU A HB2  6 
ATOM   7242 H HB3  . LEU A 1 16 ? 0.642   9.021   -0.302  1.00 0.00 ? 287 LEU A HB3  6 
ATOM   7243 H HG   . LEU A 1 16 ? -2.058  10.226  -0.470  1.00 0.00 ? 287 LEU A HG   6 
ATOM   7244 H HD11 . LEU A 1 16 ? 0.259   11.866  -0.853  1.00 0.00 ? 287 LEU A HD11 6 
ATOM   7245 H HD12 . LEU A 1 16 ? -0.463  11.550  -2.431  1.00 0.00 ? 287 LEU A HD12 6 
ATOM   7246 H HD13 . LEU A 1 16 ? -1.431  12.275  -1.148  1.00 0.00 ? 287 LEU A HD13 6 
ATOM   7247 H HD21 . LEU A 1 16 ? -0.340  8.434   -1.920  1.00 0.00 ? 287 LEU A HD21 6 
ATOM   7248 H HD22 . LEU A 1 16 ? -2.048  8.774   -2.190  1.00 0.00 ? 287 LEU A HD22 6 
ATOM   7249 H HD23 . LEU A 1 16 ? -0.817  9.754   -2.986  1.00 0.00 ? 287 LEU A HD23 6 
ATOM   7250 N N    . LYS A 1 17 ? 0.896   8.749   2.928   1.00 0.00 ? 288 LYS A N    6 
ATOM   7251 C CA   . LYS A 1 17 ? 1.850   8.029   3.762   1.00 0.00 ? 288 LYS A CA   6 
ATOM   7252 C C    . LYS A 1 17 ? 1.132   6.869   4.454   1.00 0.00 ? 288 LYS A C    6 
ATOM   7253 O O    . LYS A 1 17 ? 1.560   5.733   4.388   1.00 0.00 ? 288 LYS A O    6 
ATOM   7254 C CB   . LYS A 1 17 ? 2.427   8.975   4.816   1.00 0.00 ? 288 LYS A CB   6 
ATOM   7255 C CG   . LYS A 1 17 ? 3.900   9.247   4.506   1.00 0.00 ? 288 LYS A CG   6 
ATOM   7256 C CD   . LYS A 1 17 ? 4.005   10.363  3.465   1.00 0.00 ? 288 LYS A CD   6 
ATOM   7257 C CE   . LYS A 1 17 ? 4.393   11.671  4.154   1.00 0.00 ? 288 LYS A CE   6 
ATOM   7258 N NZ   . LYS A 1 17 ? 5.502   12.321  3.401   1.00 0.00 ? 288 LYS A NZ   6 
ATOM   7259 H H    . LYS A 1 17 ? 0.820   9.723   3.000   1.00 0.00 ? 288 LYS A H    6 
ATOM   7260 H HA   . LYS A 1 17 ? 2.649   7.645   3.148   1.00 0.00 ? 288 LYS A HA   6 
ATOM   7261 H HB2  . LYS A 1 17 ? 1.878   9.906   4.804   1.00 0.00 ? 288 LYS A HB2  6 
ATOM   7262 H HB3  . LYS A 1 17 ? 2.345   8.521   5.792   1.00 0.00 ? 288 LYS A HB3  6 
ATOM   7263 H HG2  . LYS A 1 17 ? 4.409   9.550   5.411   1.00 0.00 ? 288 LYS A HG2  6 
ATOM   7264 H HG3  . LYS A 1 17 ? 4.359   8.350   4.117   1.00 0.00 ? 288 LYS A HG3  6 
ATOM   7265 H HD2  . LYS A 1 17 ? 4.758   10.102  2.733   1.00 0.00 ? 288 LYS A HD2  6 
ATOM   7266 H HD3  . LYS A 1 17 ? 3.052   10.488  2.973   1.00 0.00 ? 288 LYS A HD3  6 
ATOM   7267 H HE2  . LYS A 1 17 ? 3.540   12.333  4.179   1.00 0.00 ? 288 LYS A HE2  6 
ATOM   7268 H HE3  . LYS A 1 17 ? 4.716   11.466  5.163   1.00 0.00 ? 288 LYS A HE3  6 
ATOM   7269 H HZ1  . LYS A 1 17 ? 5.263   12.352  2.390   1.00 0.00 ? 288 LYS A HZ1  6 
ATOM   7270 H HZ2  . LYS A 1 17 ? 5.639   13.290  3.752   1.00 0.00 ? 288 LYS A HZ2  6 
ATOM   7271 H HZ3  . LYS A 1 17 ? 6.377   11.775  3.536   1.00 0.00 ? 288 LYS A HZ3  6 
ATOM   7272 N N    . ALA A 1 18 ? 0.042   7.146   5.115   1.00 0.00 ? 289 ALA A N    6 
ATOM   7273 C CA   . ALA A 1 18 ? -0.689  6.082   5.792   1.00 0.00 ? 289 ALA A CA   6 
ATOM   7274 C C    . ALA A 1 18 ? -0.916  4.928   4.818   1.00 0.00 ? 289 ALA A C    6 
ATOM   7275 O O    . ALA A 1 18 ? -0.413  3.837   4.999   1.00 0.00 ? 289 ALA A O    6 
ATOM   7276 C CB   . ALA A 1 18 ? -2.043  6.610   6.266   1.00 0.00 ? 289 ALA A CB   6 
ATOM   7277 H H    . ALA A 1 18 ? -0.288  8.068   5.153   1.00 0.00 ? 289 ALA A H    6 
ATOM   7278 H HA   . ALA A 1 18 ? -0.121  5.734   6.641   1.00 0.00 ? 289 ALA A HA   6 
ATOM   7279 H HB1  . ALA A 1 18 ? -2.181  7.620   5.907   1.00 0.00 ? 289 ALA A HB1  6 
ATOM   7280 H HB2  . ALA A 1 18 ? -2.830  5.979   5.877   1.00 0.00 ? 289 ALA A HB2  6 
ATOM   7281 H HB3  . ALA A 1 18 ? -2.074  6.604   7.345   1.00 0.00 ? 289 ALA A HB3  6 
ATOM   7282 N N    . GLN A 1 19 ? -1.675  5.161   3.782   1.00 0.00 ? 290 GLN A N    6 
ATOM   7283 C CA   . GLN A 1 19 ? -1.932  4.101   2.818   1.00 0.00 ? 290 GLN A CA   6 
ATOM   7284 C C    . GLN A 1 19 ? -0.609  3.443   2.426   1.00 0.00 ? 290 GLN A C    6 
ATOM   7285 O O    . GLN A 1 19 ? -0.538  2.249   2.211   1.00 0.00 ? 290 GLN A O    6 
ATOM   7286 C CB   . GLN A 1 19 ? -2.600  4.690   1.574   1.00 0.00 ? 290 GLN A CB   6 
ATOM   7287 C CG   . GLN A 1 19 ? -4.121  4.637   1.737   1.00 0.00 ? 290 GLN A CG   6 
ATOM   7288 C CD   . GLN A 1 19 ? -4.750  4.045   0.475   1.00 0.00 ? 290 GLN A CD   6 
ATOM   7289 O OE1  . GLN A 1 19 ? -4.989  2.856   0.401   1.00 0.00 ? 290 GLN A OE1  6 
ATOM   7290 N NE2  . GLN A 1 19 ? -5.030  4.830   -0.530  1.00 0.00 ? 290 GLN A NE2  6 
ATOM   7291 H H    . GLN A 1 19 ? -2.074  6.048   3.656   1.00 0.00 ? 290 GLN A H    6 
ATOM   7292 H HA   . GLN A 1 19 ? -2.587  3.366   3.261   1.00 0.00 ? 290 GLN A HA   6 
ATOM   7293 H HB2  . GLN A 1 19 ? -2.288  5.717   1.449   1.00 0.00 ? 290 GLN A HB2  6 
ATOM   7294 H HB3  . GLN A 1 19 ? -2.313  4.118   0.707   1.00 0.00 ? 290 GLN A HB3  6 
ATOM   7295 H HG2  . GLN A 1 19 ? -4.371  4.019   2.588   1.00 0.00 ? 290 GLN A HG2  6 
ATOM   7296 H HG3  . GLN A 1 19 ? -4.503  5.635   1.893   1.00 0.00 ? 290 GLN A HG3  6 
ATOM   7297 H HE21 . GLN A 1 19 ? -4.839  5.789   -0.471  1.00 0.00 ? 290 GLN A HE21 6 
ATOM   7298 H HE22 . GLN A 1 19 ? -5.434  4.461   -1.343  1.00 0.00 ? 290 GLN A HE22 6 
ATOM   7299 N N    . ASN A 1 20 ? 0.443   4.213   2.334   1.00 0.00 ? 291 ASN A N    6 
ATOM   7300 C CA   . ASN A 1 20 ? 1.735   3.642   1.970   1.00 0.00 ? 291 ASN A CA   6 
ATOM   7301 C C    . ASN A 1 20 ? 2.123   2.577   2.993   1.00 0.00 ? 291 ASN A C    6 
ATOM   7302 O O    . ASN A 1 20 ? 2.197   1.404   2.687   1.00 0.00 ? 291 ASN A O    6 
ATOM   7303 C CB   . ASN A 1 20 ? 2.794   4.746   1.955   1.00 0.00 ? 291 ASN A CB   6 
ATOM   7304 C CG   . ASN A 1 20 ? 3.933   4.351   1.011   1.00 0.00 ? 291 ASN A CG   6 
ATOM   7305 O OD1  . ASN A 1 20 ? 4.364   3.215   1.003   1.00 0.00 ? 291 ASN A OD1  6 
ATOM   7306 N ND2  . ASN A 1 20 ? 4.440   5.248   0.211   1.00 0.00 ? 291 ASN A ND2  6 
ATOM   7307 H H    . ASN A 1 20 ? 0.364   5.173   2.515   1.00 0.00 ? 291 ASN A H    6 
ATOM   7308 H HA   . ASN A 1 20 ? 1.669   3.196   0.989   1.00 0.00 ? 291 ASN A HA   6 
ATOM   7309 H HB2  . ASN A 1 20 ? 2.349   5.669   1.615   1.00 0.00 ? 291 ASN A HB2  6 
ATOM   7310 H HB3  . ASN A 1 20 ? 3.188   4.881   2.951   1.00 0.00 ? 291 ASN A HB3  6 
ATOM   7311 H HD21 . ASN A 1 20 ? 4.092   6.164   0.218   1.00 0.00 ? 291 ASN A HD21 6 
ATOM   7312 H HD22 . ASN A 1 20 ? 5.170   5.005   -0.397  1.00 0.00 ? 291 ASN A HD22 6 
ATOM   7313 N N    . SER A 1 21 ? 2.370   2.975   4.211   1.00 0.00 ? 292 SER A N    6 
ATOM   7314 C CA   . SER A 1 21 ? 2.743   2.005   5.233   1.00 0.00 ? 292 SER A CA   6 
ATOM   7315 C C    . SER A 1 21 ? 1.743   0.847   5.224   1.00 0.00 ? 292 SER A C    6 
ATOM   7316 O O    . SER A 1 21 ? 2.114   -0.308  5.293   1.00 0.00 ? 292 SER A O    6 
ATOM   7317 C CB   . SER A 1 21 ? 2.729   2.682   6.606   1.00 0.00 ? 292 SER A CB   6 
ATOM   7318 O OG   . SER A 1 21 ? 1.521   3.416   6.754   1.00 0.00 ? 292 SER A OG   6 
ATOM   7319 H H    . SER A 1 21 ? 2.301   3.925   4.438   1.00 0.00 ? 292 SER A H    6 
ATOM   7320 H HA   . SER A 1 21 ? 3.733   1.629   5.030   1.00 0.00 ? 292 SER A HA   6 
ATOM   7321 H HB2  . SER A 1 21 ? 2.785   1.933   7.378   1.00 0.00 ? 292 SER A HB2  6 
ATOM   7322 H HB3  . SER A 1 21 ? 3.579   3.345   6.687   1.00 0.00 ? 292 SER A HB3  6 
ATOM   7323 H HG   . SER A 1 21 ? 1.547   4.155   6.141   1.00 0.00 ? 292 SER A HG   6 
ATOM   7324 N N    . GLU A 1 22 ? 0.477   1.149   5.135   1.00 0.00 ? 293 GLU A N    6 
ATOM   7325 C CA   . GLU A 1 22 ? -0.526  0.090   5.118   1.00 0.00 ? 293 GLU A CA   6 
ATOM   7326 C C    . GLU A 1 22 ? -0.197  -0.903  4.001   1.00 0.00 ? 293 GLU A C    6 
ATOM   7327 O O    . GLU A 1 22 ? 0.188   -2.028  4.249   1.00 0.00 ? 293 GLU A O    6 
ATOM   7328 C CB   . GLU A 1 22 ? -1.907  0.699   4.868   1.00 0.00 ? 293 GLU A CB   6 
ATOM   7329 C CG   . GLU A 1 22 ? -2.544  1.086   6.202   1.00 0.00 ? 293 GLU A CG   6 
ATOM   7330 C CD   . GLU A 1 22 ? -3.443  2.308   6.004   1.00 0.00 ? 293 GLU A CD   6 
ATOM   7331 O OE1  . GLU A 1 22 ? -3.773  2.598   4.867   1.00 0.00 ? 293 GLU A OE1  6 
ATOM   7332 O OE2  . GLU A 1 22 ? -3.787  2.932   6.994   1.00 0.00 ? 293 GLU A OE2  6 
ATOM   7333 H H    . GLU A 1 22 ? 0.200   2.087   5.079   1.00 0.00 ? 293 GLU A H    6 
ATOM   7334 H HA   . GLU A 1 22 ? -0.526  -0.422  6.069   1.00 0.00 ? 293 GLU A HA   6 
ATOM   7335 H HB2  . GLU A 1 22 ? -1.805  1.577   4.246   1.00 0.00 ? 293 GLU A HB2  6 
ATOM   7336 H HB3  . GLU A 1 22 ? -2.533  -0.025  4.368   1.00 0.00 ? 293 GLU A HB3  6 
ATOM   7337 H HG2  . GLU A 1 22 ? -3.134  0.260   6.573   1.00 0.00 ? 293 GLU A HG2  6 
ATOM   7338 H HG3  . GLU A 1 22 ? -1.770  1.325   6.917   1.00 0.00 ? 293 GLU A HG3  6 
ATOM   7339 N N    . LEU A 1 23 ? -0.349  -0.493  2.771   1.00 0.00 ? 294 LEU A N    6 
ATOM   7340 C CA   . LEU A 1 23 ? -0.053  -1.389  1.658   1.00 0.00 ? 294 LEU A CA   6 
ATOM   7341 C C    . LEU A 1 23 ? 1.269   -2.111  1.916   1.00 0.00 ? 294 LEU A C    6 
ATOM   7342 O O    . LEU A 1 23 ? 1.342   -3.324  1.892   1.00 0.00 ? 294 LEU A O    6 
ATOM   7343 C CB   . LEU A 1 23 ? 0.054   -0.575  0.367   1.00 0.00 ? 294 LEU A CB   6 
ATOM   7344 C CG   . LEU A 1 23 ? -1.279  -0.621  -0.381  1.00 0.00 ? 294 LEU A CG   6 
ATOM   7345 C CD1  . LEU A 1 23 ? -1.393  0.599   -1.296  1.00 0.00 ? 294 LEU A CD1  6 
ATOM   7346 C CD2  . LEU A 1 23 ? -1.347  -1.897  -1.225  1.00 0.00 ? 294 LEU A CD2  6 
ATOM   7347 H H    . LEU A 1 23 ? -0.660  0.419   2.595   1.00 0.00 ? 294 LEU A H    6 
ATOM   7348 H HA   . LEU A 1 23 ? -0.848  -2.115  1.558   1.00 0.00 ? 294 LEU A HA   6 
ATOM   7349 H HB2  . LEU A 1 23 ? 0.299   0.450   0.609   1.00 0.00 ? 294 LEU A HB2  6 
ATOM   7350 H HB3  . LEU A 1 23 ? 0.831   -0.992  -0.256  1.00 0.00 ? 294 LEU A HB3  6 
ATOM   7351 H HG   . LEU A 1 23 ? -2.093  -0.613  0.331   1.00 0.00 ? 294 LEU A HG   6 
ATOM   7352 H HD11 . LEU A 1 23 ? -1.040  1.476   -0.772  1.00 0.00 ? 294 LEU A HD11 6 
ATOM   7353 H HD12 . LEU A 1 23 ? -0.792  0.444   -2.180  1.00 0.00 ? 294 LEU A HD12 6 
ATOM   7354 H HD13 . LEU A 1 23 ? -2.424  0.741   -1.582  1.00 0.00 ? 294 LEU A HD13 6 
ATOM   7355 H HD21 . LEU A 1 23 ? -0.450  -1.980  -1.822  1.00 0.00 ? 294 LEU A HD21 6 
ATOM   7356 H HD22 . LEU A 1 23 ? -1.425  -2.755  -0.574  1.00 0.00 ? 294 LEU A HD22 6 
ATOM   7357 H HD23 . LEU A 1 23 ? -2.208  -1.855  -1.873  1.00 0.00 ? 294 LEU A HD23 6 
ATOM   7358 N N    . ALA A 1 24 ? 2.320   -1.375  2.155   1.00 0.00 ? 295 ALA A N    6 
ATOM   7359 C CA   . ALA A 1 24 ? 3.613   -2.003  2.404   1.00 0.00 ? 295 ALA A CA   6 
ATOM   7360 C C    . ALA A 1 24 ? 3.455   -3.129  3.431   1.00 0.00 ? 295 ALA A C    6 
ATOM   7361 O O    . ALA A 1 24 ? 4.060   -4.176  3.314   1.00 0.00 ? 295 ALA A O    6 
ATOM   7362 C CB   . ALA A 1 24 ? 4.593   -0.959  2.941   1.00 0.00 ? 295 ALA A CB   6 
ATOM   7363 H H    . ALA A 1 24 ? 2.241   -0.399  2.165   1.00 0.00 ? 295 ALA A H    6 
ATOM   7364 H HA   . ALA A 1 24 ? 3.998   -2.410  1.482   1.00 0.00 ? 295 ALA A HA   6 
ATOM   7365 H HB1  . ALA A 1 24 ? 4.044   -0.086  3.268   1.00 0.00 ? 295 ALA A HB1  6 
ATOM   7366 H HB2  . ALA A 1 24 ? 5.139   -1.374  3.776   1.00 0.00 ? 295 ALA A HB2  6 
ATOM   7367 H HB3  . ALA A 1 24 ? 5.284   -0.678  2.161   1.00 0.00 ? 295 ALA A HB3  6 
ATOM   7368 N N    . SER A 1 25 ? 2.650   -2.923  4.435   1.00 0.00 ? 296 SER A N    6 
ATOM   7369 C CA   . SER A 1 25 ? 2.465   -3.960  5.446   1.00 0.00 ? 296 SER A CA   6 
ATOM   7370 C C    . SER A 1 25 ? 1.857   -5.205  4.796   1.00 0.00 ? 296 SER A C    6 
ATOM   7371 O O    . SER A 1 25 ? 2.435   -6.272  4.820   1.00 0.00 ? 296 SER A O    6 
ATOM   7372 C CB   . SER A 1 25 ? 1.530   -3.446  6.540   1.00 0.00 ? 296 SER A CB   6 
ATOM   7373 O OG   . SER A 1 25 ? 1.931   -2.138  6.925   1.00 0.00 ? 296 SER A OG   6 
ATOM   7374 H H    . SER A 1 25 ? 2.171   -2.071  4.515   1.00 0.00 ? 296 SER A H    6 
ATOM   7375 H HA   . SER A 1 25 ? 3.418   -4.212  5.882   1.00 0.00 ? 296 SER A HA   6 
ATOM   7376 H HB2  . SER A 1 25 ? 0.520   -3.413  6.167   1.00 0.00 ? 296 SER A HB2  6 
ATOM   7377 H HB3  . SER A 1 25 ? 1.574   -4.114  7.391   1.00 0.00 ? 296 SER A HB3  6 
ATOM   7378 H HG   . SER A 1 25 ? 1.296   -1.808  7.562   1.00 0.00 ? 296 SER A HG   6 
ATOM   7379 N N    . THR A 1 26 ? 0.692   -5.080  4.220   1.00 0.00 ? 297 THR A N    6 
ATOM   7380 C CA   . THR A 1 26 ? 0.066   -6.236  3.586   1.00 0.00 ? 297 THR A CA   6 
ATOM   7381 C C    . THR A 1 26 ? 1.092   -6.952  2.707   1.00 0.00 ? 297 THR A C    6 
ATOM   7382 O O    . THR A 1 26 ? 1.198   -8.162  2.717   1.00 0.00 ? 297 THR A O    6 
ATOM   7383 C CB   . THR A 1 26 ? -1.111  -5.773  2.725   1.00 0.00 ? 297 THR A CB   6 
ATOM   7384 O OG1  . THR A 1 26 ? -1.852  -4.786  3.431   1.00 0.00 ? 297 THR A OG1  6 
ATOM   7385 C CG2  . THR A 1 26 ? -2.016  -6.965  2.413   1.00 0.00 ? 297 THR A CG2  6 
ATOM   7386 H H    . THR A 1 26 ? 0.239   -4.210  4.212   1.00 0.00 ? 297 THR A H    6 
ATOM   7387 H HA   . THR A 1 26 ? -0.290  -6.913  4.347   1.00 0.00 ? 297 THR A HA   6 
ATOM   7388 H HB   . THR A 1 26 ? -0.741  -5.356  1.802   1.00 0.00 ? 297 THR A HB   6 
ATOM   7389 H HG1  . THR A 1 26 ? -2.037  -5.126  4.308   1.00 0.00 ? 297 THR A HG1  6 
ATOM   7390 H HG21 . THR A 1 26 ? -2.118  -7.580  3.294   1.00 0.00 ? 297 THR A HG21 6 
ATOM   7391 H HG22 . THR A 1 26 ? -2.988  -6.609  2.107   1.00 0.00 ? 297 THR A HG22 6 
ATOM   7392 H HG23 . THR A 1 26 ? -1.580  -7.549  1.616   1.00 0.00 ? 297 THR A HG23 6 
ATOM   7393 N N    . ALA A 1 27 ? 1.851   -6.214  1.943   1.00 0.00 ? 298 ALA A N    6 
ATOM   7394 C CA   . ALA A 1 27 ? 2.848   -6.839  1.085   1.00 0.00 ? 298 ALA A CA   6 
ATOM   7395 C C    . ALA A 1 27 ? 3.914   -7.513  1.952   1.00 0.00 ? 298 ALA A C    6 
ATOM   7396 O O    . ALA A 1 27 ? 4.422   -8.566  1.621   1.00 0.00 ? 298 ALA A O    6 
ATOM   7397 C CB   . ALA A 1 27 ? 3.502   -5.774  0.206   1.00 0.00 ? 298 ALA A CB   6 
ATOM   7398 H H    . ALA A 1 27 ? 1.752   -5.239  1.949   1.00 0.00 ? 298 ALA A H    6 
ATOM   7399 H HA   . ALA A 1 27 ? 2.372   -7.579  0.459   1.00 0.00 ? 298 ALA A HA   6 
ATOM   7400 H HB1  . ALA A 1 27 ? 2.971   -4.841  0.317   1.00 0.00 ? 298 ALA A HB1  6 
ATOM   7401 H HB2  . ALA A 1 27 ? 4.531   -5.642  0.506   1.00 0.00 ? 298 ALA A HB2  6 
ATOM   7402 H HB3  . ALA A 1 27 ? 3.467   -6.089  -0.827  1.00 0.00 ? 298 ALA A HB3  6 
ATOM   7403 N N    . ASN A 1 28 ? 4.255   -6.914  3.060   1.00 0.00 ? 299 ASN A N    6 
ATOM   7404 C CA   . ASN A 1 28 ? 5.266   -7.509  3.928   1.00 0.00 ? 299 ASN A CA   6 
ATOM   7405 C C    . ASN A 1 28 ? 4.790   -8.887  4.391   1.00 0.00 ? 299 ASN A C    6 
ATOM   7406 O O    . ASN A 1 28 ? 5.468   -9.879  4.217   1.00 0.00 ? 299 ASN A O    6 
ATOM   7407 C CB   . ASN A 1 28 ? 5.489   -6.610  5.144   1.00 0.00 ? 299 ASN A CB   6 
ATOM   7408 C CG   . ASN A 1 28 ? 6.727   -7.084  5.910   1.00 0.00 ? 299 ASN A CG   6 
ATOM   7409 O OD1  . ASN A 1 28 ? 6.629   -7.922  6.786   1.00 0.00 ? 299 ASN A OD1  6 
ATOM   7410 N ND2  . ASN A 1 28 ? 7.894   -6.586  5.614   1.00 0.00 ? 299 ASN A ND2  6 
ATOM   7411 H H    . ASN A 1 28 ? 3.833   -6.065  3.308   1.00 0.00 ? 299 ASN A H    6 
ATOM   7412 H HA   . ASN A 1 28 ? 6.191   -7.612  3.384   1.00 0.00 ? 299 ASN A HA   6 
ATOM   7413 H HB2  . ASN A 1 28 ? 5.640   -5.590  4.816   1.00 0.00 ? 299 ASN A HB2  6 
ATOM   7414 H HB3  . ASN A 1 28 ? 4.628   -6.657  5.793   1.00 0.00 ? 299 ASN A HB3  6 
ATOM   7415 H HD21 . ASN A 1 28 ? 7.975   -5.911  4.906   1.00 0.00 ? 299 ASN A HD21 6 
ATOM   7416 H HD22 . ASN A 1 28 ? 8.692   -6.883  6.098   1.00 0.00 ? 299 ASN A HD22 6 
ATOM   7417 N N    . MET A 1 29 ? 3.625   -8.958  4.977   1.00 0.00 ? 300 MET A N    6 
ATOM   7418 C CA   . MET A 1 29 ? 3.122   -10.247 5.435   1.00 0.00 ? 300 MET A CA   6 
ATOM   7419 C C    . MET A 1 29 ? 3.061   -11.213 4.250   1.00 0.00 ? 300 MET A C    6 
ATOM   7420 O O    . MET A 1 29 ? 3.578   -12.313 4.305   1.00 0.00 ? 300 MET A O    6 
ATOM   7421 C CB   . MET A 1 29 ? 1.721   -10.076 6.026   1.00 0.00 ? 300 MET A CB   6 
ATOM   7422 C CG   . MET A 1 29 ? 1.146   -11.450 6.368   1.00 0.00 ? 300 MET A CG   6 
ATOM   7423 S SD   . MET A 1 29 ? -0.546  -11.571 5.735   1.00 0.00 ? 300 MET A SD   6 
ATOM   7424 C CE   . MET A 1 29 ? -1.212  -12.610 7.060   1.00 0.00 ? 300 MET A CE   6 
ATOM   7425 H H    . MET A 1 29 ? 3.089   -8.148  5.107   1.00 0.00 ? 300 MET A H    6 
ATOM   7426 H HA   . MET A 1 29 ? 3.784   -10.645 6.191   1.00 0.00 ? 300 MET A HA   6 
ATOM   7427 H HB2  . MET A 1 29 ? 1.779   -9.474  6.921   1.00 0.00 ? 300 MET A HB2  6 
ATOM   7428 H HB3  . MET A 1 29 ? 1.084   -9.589  5.305   1.00 0.00 ? 300 MET A HB3  6 
ATOM   7429 H HG2  . MET A 1 29 ? 1.757   -12.217 5.914   1.00 0.00 ? 300 MET A HG2  6 
ATOM   7430 H HG3  . MET A 1 29 ? 1.140   -11.582 7.440   1.00 0.00 ? 300 MET A HG3  6 
ATOM   7431 H HE1  . MET A 1 29 ? -0.455  -12.750 7.819   1.00 0.00 ? 300 MET A HE1  6 
ATOM   7432 H HE2  . MET A 1 29 ? -2.079  -12.129 7.492   1.00 0.00 ? 300 MET A HE2  6 
ATOM   7433 H HE3  . MET A 1 29 ? -1.498  -13.567 6.657   1.00 0.00 ? 300 MET A HE3  6 
ATOM   7434 N N    . LEU A 1 30 ? 2.439   -10.812 3.177   1.00 0.00 ? 301 LEU A N    6 
ATOM   7435 C CA   . LEU A 1 30 ? 2.353   -11.687 2.015   1.00 0.00 ? 301 LEU A CA   6 
ATOM   7436 C C    . LEU A 1 30 ? 3.736   -12.280 1.738   1.00 0.00 ? 301 LEU A C    6 
ATOM   7437 O O    . LEU A 1 30 ? 3.866   -13.429 1.363   1.00 0.00 ? 301 LEU A O    6 
ATOM   7438 C CB   . LEU A 1 30 ? 1.893   -10.880 0.798   1.00 0.00 ? 301 LEU A CB   6 
ATOM   7439 C CG   . LEU A 1 30 ? 0.366   -10.816 0.775   1.00 0.00 ? 301 LEU A CG   6 
ATOM   7440 C CD1  . LEU A 1 30 ? -0.089  -9.920  -0.378  1.00 0.00 ? 301 LEU A CD1  6 
ATOM   7441 C CD2  . LEU A 1 30 ? -0.202  -12.223 0.580   1.00 0.00 ? 301 LEU A CD2  6 
ATOM   7442 H H    . LEU A 1 30 ? 2.033   -9.920  3.150   1.00 0.00 ? 301 LEU A H    6 
ATOM   7443 H HA   . LEU A 1 30 ? 1.651   -12.480 2.209   1.00 0.00 ? 301 LEU A HA   6 
ATOM   7444 H HB2  . LEU A 1 30 ? 2.296   -9.879  0.855   1.00 0.00 ? 301 LEU A HB2  6 
ATOM   7445 H HB3  . LEU A 1 30 ? 2.244   -11.359 -0.104  1.00 0.00 ? 301 LEU A HB3  6 
ATOM   7446 H HG   . LEU A 1 30 ? 0.009   -10.407 1.710   1.00 0.00 ? 301 LEU A HG   6 
ATOM   7447 H HD11 . LEU A 1 30 ? 0.746   -9.333  -0.728  1.00 0.00 ? 301 LEU A HD11 6 
ATOM   7448 H HD12 . LEU A 1 30 ? -0.463  -10.533 -1.185  1.00 0.00 ? 301 LEU A HD12 6 
ATOM   7449 H HD13 . LEU A 1 30 ? -0.873  -9.261  -0.036  1.00 0.00 ? 301 LEU A HD13 6 
ATOM   7450 H HD21 . LEU A 1 30 ? 0.589   -12.949 0.698   1.00 0.00 ? 301 LEU A HD21 6 
ATOM   7451 H HD22 . LEU A 1 30 ? -0.971  -12.406 1.315   1.00 0.00 ? 301 LEU A HD22 6 
ATOM   7452 H HD23 . LEU A 1 30 ? -0.622  -12.308 -0.411  1.00 0.00 ? 301 LEU A HD23 6 
ATOM   7453 N N    . ARG A 1 31 ? 4.768   -11.505 1.920   1.00 0.00 ? 302 ARG A N    6 
ATOM   7454 C CA   . ARG A 1 31 ? 6.114   -12.009 1.675   1.00 0.00 ? 302 ARG A CA   6 
ATOM   7455 C C    . ARG A 1 31 ? 6.530   -12.932 2.821   1.00 0.00 ? 302 ARG A C    6 
ATOM   7456 O O    . ARG A 1 31 ? 7.371   -13.794 2.661   1.00 0.00 ? 302 ARG A O    6 
ATOM   7457 C CB   . ARG A 1 31 ? 7.090   -10.835 1.583   1.00 0.00 ? 302 ARG A CB   6 
ATOM   7458 C CG   . ARG A 1 31 ? 8.352   -11.275 0.838   1.00 0.00 ? 302 ARG A CG   6 
ATOM   7459 C CD   . ARG A 1 31 ? 9.536   -10.415 1.282   1.00 0.00 ? 302 ARG A CD   6 
ATOM   7460 N NE   . ARG A 1 31 ? 9.849   -9.445  0.239   1.00 0.00 ? 302 ARG A NE   6 
ATOM   7461 C CZ   . ARG A 1 31 ? 10.619  -8.425  0.505   1.00 0.00 ? 302 ARG A CZ   6 
ATOM   7462 N NH1  . ARG A 1 31 ? 11.834  -8.620  0.939   1.00 0.00 ? 302 ARG A NH1  6 
ATOM   7463 N NH2  . ARG A 1 31 ? 10.173  -7.210  0.336   1.00 0.00 ? 302 ARG A NH2  6 
ATOM   7464 H H    . ARG A 1 31 ? 4.640   -10.582 2.223   1.00 0.00 ? 302 ARG A H    6 
ATOM   7465 H HA   . ARG A 1 31 ? 6.127   -12.558 0.745   1.00 0.00 ? 302 ARG A HA   6 
ATOM   7466 H HB2  . ARG A 1 31 ? 6.622   -10.018 1.055   1.00 0.00 ? 302 ARG A HB2  6 
ATOM   7467 H HB3  . ARG A 1 31 ? 7.357   -10.513 2.580   1.00 0.00 ? 302 ARG A HB3  6 
ATOM   7468 H HG2  . ARG A 1 31 ? 8.556   -12.312 1.060   1.00 0.00 ? 302 ARG A HG2  6 
ATOM   7469 H HG3  . ARG A 1 31 ? 8.201   -11.156 -0.224  1.00 0.00 ? 302 ARG A HG3  6 
ATOM   7470 H HD2  . ARG A 1 31 ? 9.281   -9.894  2.193   1.00 0.00 ? 302 ARG A HD2  6 
ATOM   7471 H HD3  . ARG A 1 31 ? 10.393  -11.047 1.458   1.00 0.00 ? 302 ARG A HD3  6 
ATOM   7472 H HE   . ARG A 1 31 ? 9.481   -9.560  -0.662  1.00 0.00 ? 302 ARG A HE   6 
ATOM   7473 H HH11 . ARG A 1 31 ? 12.175  -9.552  1.067   1.00 0.00 ? 302 ARG A HH11 6 
ATOM   7474 H HH12 . ARG A 1 31 ? 12.424  -7.841  1.143   1.00 0.00 ? 302 ARG A HH12 6 
ATOM   7475 H HH21 . ARG A 1 31 ? 9.241   -7.061  0.004   1.00 0.00 ? 302 ARG A HH21 6 
ATOM   7476 H HH22 . ARG A 1 31 ? 10.762  -6.428  0.538   1.00 0.00 ? 302 ARG A HH22 6 
ATOM   7477 N N    . GLU A 1 32 ? 5.946   -12.762 3.976   1.00 0.00 ? 303 GLU A N    6 
ATOM   7478 C CA   . GLU A 1 32 ? 6.300   -13.616 5.101   1.00 0.00 ? 303 GLU A CA   6 
ATOM   7479 C C    . GLU A 1 32 ? 5.725   -15.014 4.870   1.00 0.00 ? 303 GLU A C    6 
ATOM   7480 O O    . GLU A 1 32 ? 6.391   -16.011 5.063   1.00 0.00 ? 303 GLU A O    6 
ATOM   7481 C CB   . GLU A 1 32 ? 5.724   -13.020 6.390   1.00 0.00 ? 303 GLU A CB   6 
ATOM   7482 C CG   . GLU A 1 32 ? 5.743   -14.076 7.498   1.00 0.00 ? 303 GLU A CG   6 
ATOM   7483 C CD   . GLU A 1 32 ? 7.191   -14.429 7.846   1.00 0.00 ? 303 GLU A CD   6 
ATOM   7484 O OE1  . GLU A 1 32 ? 7.818   -15.113 7.055   1.00 0.00 ? 303 GLU A OE1  6 
ATOM   7485 O OE2  . GLU A 1 32 ? 7.646   -14.009 8.896   1.00 0.00 ? 303 GLU A OE2  6 
ATOM   7486 H H    . GLU A 1 32 ? 5.266   -12.065 4.085   1.00 0.00 ? 303 GLU A H    6 
ATOM   7487 H HA   . GLU A 1 32 ? 7.376   -13.676 5.184   1.00 0.00 ? 303 GLU A HA   6 
ATOM   7488 H HB2  . GLU A 1 32 ? 6.321   -12.171 6.691   1.00 0.00 ? 303 GLU A HB2  6 
ATOM   7489 H HB3  . GLU A 1 32 ? 4.708   -12.703 6.216   1.00 0.00 ? 303 GLU A HB3  6 
ATOM   7490 H HG2  . GLU A 1 32 ? 5.246   -13.686 8.376   1.00 0.00 ? 303 GLU A HG2  6 
ATOM   7491 H HG3  . GLU A 1 32 ? 5.231   -14.962 7.159   1.00 0.00 ? 303 GLU A HG3  6 
ATOM   7492 N N    . GLN A 1 33 ? 4.491   -15.094 4.453   1.00 0.00 ? 304 GLN A N    6 
ATOM   7493 C CA   . GLN A 1 33 ? 3.887   -16.397 4.210   1.00 0.00 ? 304 GLN A CA   6 
ATOM   7494 C C    . GLN A 1 33 ? 4.461   -16.985 2.921   1.00 0.00 ? 304 GLN A C    6 
ATOM   7495 O O    . GLN A 1 33 ? 4.543   -18.186 2.757   1.00 0.00 ? 304 GLN A O    6 
ATOM   7496 C CB   . GLN A 1 33 ? 2.371   -16.240 4.072   1.00 0.00 ? 304 GLN A CB   6 
ATOM   7497 C CG   . GLN A 1 33 ? 2.062   -15.189 3.004   1.00 0.00 ? 304 GLN A CG   6 
ATOM   7498 C CD   . GLN A 1 33 ? 0.697   -15.482 2.383   1.00 0.00 ? 304 GLN A CD   6 
ATOM   7499 O OE1  . GLN A 1 33 ? -0.130  -14.601 2.261   1.00 0.00 ? 304 GLN A OE1  6 
ATOM   7500 N NE2  . GLN A 1 33 ? 0.425   -16.692 1.979   1.00 0.00 ? 304 GLN A NE2  6 
ATOM   7501 H H    . GLN A 1 33 ? 3.972   -14.276 4.301   1.00 0.00 ? 304 GLN A H    6 
ATOM   7502 H HA   . GLN A 1 33 ? 4.105   -17.056 5.037   1.00 0.00 ? 304 GLN A HA   6 
ATOM   7503 H HB2  . GLN A 1 33 ? 1.936   -17.186 3.786   1.00 0.00 ? 304 GLN A HB2  6 
ATOM   7504 H HB3  . GLN A 1 33 ? 1.955   -15.924 5.018   1.00 0.00 ? 304 GLN A HB3  6 
ATOM   7505 H HG2  . GLN A 1 33 ? 2.049   -14.209 3.459   1.00 0.00 ? 304 GLN A HG2  6 
ATOM   7506 H HG3  . GLN A 1 33 ? 2.821   -15.221 2.237   1.00 0.00 ? 304 GLN A HG3  6 
ATOM   7507 H HE21 . GLN A 1 33 ? 1.092   -17.404 2.079   1.00 0.00 ? 304 GLN A HE21 6 
ATOM   7508 H HE22 . GLN A 1 33 ? -0.447  -16.891 1.579   1.00 0.00 ? 304 GLN A HE22 6 
ATOM   7509 N N    . VAL A 1 34 ? 4.866   -16.147 2.005   1.00 0.00 ? 305 VAL A N    6 
ATOM   7510 C CA   . VAL A 1 34 ? 5.428   -16.648 0.758   1.00 0.00 ? 305 VAL A CA   6 
ATOM   7511 C C    . VAL A 1 34 ? 6.834   -17.193 1.023   1.00 0.00 ? 305 VAL A C    6 
ATOM   7512 O O    . VAL A 1 34 ? 7.219   -18.225 0.511   1.00 0.00 ? 305 VAL A O    6 
ATOM   7513 C CB   . VAL A 1 34 ? 5.504   -15.512 -0.263  1.00 0.00 ? 305 VAL A CB   6 
ATOM   7514 C CG1  . VAL A 1 34 ? 6.341   -15.958 -1.464  1.00 0.00 ? 305 VAL A CG1  6 
ATOM   7515 C CG2  . VAL A 1 34 ? 4.094   -15.151 -0.732  1.00 0.00 ? 305 VAL A CG2  6 
ATOM   7516 H H    . VAL A 1 34 ? 4.796   -15.182 2.157   1.00 0.00 ? 305 VAL A H    6 
ATOM   7517 H HA   . VAL A 1 34 ? 4.801   -17.438 0.370   1.00 0.00 ? 305 VAL A HA   6 
ATOM   7518 H HB   . VAL A 1 34 ? 5.965   -14.648 0.195   1.00 0.00 ? 305 VAL A HB   6 
ATOM   7519 H HG11 . VAL A 1 34 ? 6.197   -17.015 -1.631  1.00 0.00 ? 305 VAL A HG11 6 
ATOM   7520 H HG12 . VAL A 1 34 ? 6.032   -15.411 -2.341  1.00 0.00 ? 305 VAL A HG12 6 
ATOM   7521 H HG13 . VAL A 1 34 ? 7.385   -15.764 -1.267  1.00 0.00 ? 305 VAL A HG13 6 
ATOM   7522 H HG21 . VAL A 1 34 ? 3.398   -15.287 0.083   1.00 0.00 ? 305 VAL A HG21 6 
ATOM   7523 H HG22 . VAL A 1 34 ? 4.073   -14.121 -1.055  1.00 0.00 ? 305 VAL A HG22 6 
ATOM   7524 H HG23 . VAL A 1 34 ? 3.814   -15.791 -1.555  1.00 0.00 ? 305 VAL A HG23 6 
ATOM   7525 N N    . ALA A 1 35 ? 7.601   -16.506 1.826   1.00 0.00 ? 306 ALA A N    6 
ATOM   7526 C CA   . ALA A 1 35 ? 8.949   -16.974 2.123   1.00 0.00 ? 306 ALA A CA   6 
ATOM   7527 C C    . ALA A 1 35 ? 8.868   -18.324 2.837   1.00 0.00 ? 306 ALA A C    6 
ATOM   7528 O O    . ALA A 1 35 ? 9.526   -19.275 2.464   1.00 0.00 ? 306 ALA A O    6 
ATOM   7529 C CB   . ALA A 1 35 ? 9.654   -15.960 3.027   1.00 0.00 ? 306 ALA A CB   6 
ATOM   7530 H H    . ALA A 1 35 ? 7.269   -15.679 2.232   1.00 0.00 ? 306 ALA A H    6 
ATOM   7531 H HA   . ALA A 1 35 ? 9.504   -17.083 1.204   1.00 0.00 ? 306 ALA A HA   6 
ATOM   7532 H HB1  . ALA A 1 35 ? 8.921   -15.298 3.465   1.00 0.00 ? 306 ALA A HB1  6 
ATOM   7533 H HB2  . ALA A 1 35 ? 10.183  -16.480 3.810   1.00 0.00 ? 306 ALA A HB2  6 
ATOM   7534 H HB3  . ALA A 1 35 ? 10.355  -15.383 2.442   1.00 0.00 ? 306 ALA A HB3  6 
ATOM   7535 N N    . GLN A 1 36 ? 8.065   -18.418 3.860   1.00 0.00 ? 307 GLN A N    6 
ATOM   7536 C CA   . GLN A 1 36 ? 7.942   -19.681 4.577   1.00 0.00 ? 307 GLN A CA   6 
ATOM   7537 C C    . GLN A 1 36 ? 7.324   -20.724 3.648   1.00 0.00 ? 307 GLN A C    6 
ATOM   7538 O O    . GLN A 1 36 ? 7.592   -21.905 3.753   1.00 0.00 ? 307 GLN A O    6 
ATOM   7539 C CB   . GLN A 1 36 ? 7.048   -19.492 5.804   1.00 0.00 ? 307 GLN A CB   6 
ATOM   7540 C CG   . GLN A 1 36 ? 5.710   -18.890 5.374   1.00 0.00 ? 307 GLN A CG   6 
ATOM   7541 C CD   . GLN A 1 36 ? 4.661   -19.999 5.277   1.00 0.00 ? 307 GLN A CD   6 
ATOM   7542 O OE1  . GLN A 1 36 ? 4.616   -20.726 4.302   1.00 0.00 ? 307 GLN A OE1  6 
ATOM   7543 N NE2  . GLN A 1 36 ? 3.808   -20.162 6.250   1.00 0.00 ? 307 GLN A NE2  6 
ATOM   7544 H H    . GLN A 1 36 ? 7.538   -17.640 4.143   1.00 0.00 ? 307 GLN A H    6 
ATOM   7545 H HA   . GLN A 1 36 ? 8.920   -20.013 4.892   1.00 0.00 ? 307 GLN A HA   6 
ATOM   7546 H HB2  . GLN A 1 36 ? 6.878   -20.447 6.279   1.00 0.00 ? 307 GLN A HB2  6 
ATOM   7547 H HB3  . GLN A 1 36 ? 7.531   -18.823 6.503   1.00 0.00 ? 307 GLN A HB3  6 
ATOM   7548 H HG2  . GLN A 1 36 ? 5.392   -18.157 6.101   1.00 0.00 ? 307 GLN A HG2  6 
ATOM   7549 H HG3  . GLN A 1 36 ? 5.821   -18.417 4.410   1.00 0.00 ? 307 GLN A HG3  6 
ATOM   7550 H HE21 . GLN A 1 36 ? 3.845   -19.577 7.034   1.00 0.00 ? 307 GLN A HE21 6 
ATOM   7551 H HE22 . GLN A 1 36 ? 3.133   -20.872 6.198   1.00 0.00 ? 307 GLN A HE22 6 
ATOM   7552 N N    . LEU A 1 37 ? 6.503   -20.295 2.730   1.00 0.00 ? 308 LEU A N    6 
ATOM   7553 C CA   . LEU A 1 37 ? 5.884   -21.235 1.805   1.00 0.00 ? 308 LEU A CA   6 
ATOM   7554 C C    . LEU A 1 37 ? 6.977   -21.929 0.989   1.00 0.00 ? 308 LEU A C    6 
ATOM   7555 O O    . LEU A 1 37 ? 7.050   -23.140 0.936   1.00 0.00 ? 308 LEU A O    6 
ATOM   7556 C CB   . LEU A 1 37 ? 4.946   -20.477 0.863   1.00 0.00 ? 308 LEU A CB   6 
ATOM   7557 C CG   . LEU A 1 37 ? 3.492   -20.793 1.221   1.00 0.00 ? 308 LEU A CG   6 
ATOM   7558 C CD1  . LEU A 1 37 ? 2.608   -19.598 0.865   1.00 0.00 ? 308 LEU A CD1  6 
ATOM   7559 C CD2  . LEU A 1 37 ? 3.029   -22.021 0.436   1.00 0.00 ? 308 LEU A CD2  6 
ATOM   7560 H H    . LEU A 1 37 ? 6.304   -19.337 2.660   1.00 0.00 ? 308 LEU A H    6 
ATOM   7561 H HA   . LEU A 1 37 ? 5.321   -21.970 2.358   1.00 0.00 ? 308 LEU A HA   6 
ATOM   7562 H HB2  . LEU A 1 37 ? 5.120   -19.415 0.961   1.00 0.00 ? 308 LEU A HB2  6 
ATOM   7563 H HB3  . LEU A 1 37 ? 5.137   -20.781 -0.156  1.00 0.00 ? 308 LEU A HB3  6 
ATOM   7564 H HG   . LEU A 1 37 ? 3.419   -20.992 2.281   1.00 0.00 ? 308 LEU A HG   6 
ATOM   7565 H HD11 . LEU A 1 37 ? 3.216   -18.710 0.788   1.00 0.00 ? 308 LEU A HD11 6 
ATOM   7566 H HD12 . LEU A 1 37 ? 2.114   -19.782 -0.077  1.00 0.00 ? 308 LEU A HD12 6 
ATOM   7567 H HD13 . LEU A 1 37 ? 1.865   -19.459 1.639   1.00 0.00 ? 308 LEU A HD13 6 
ATOM   7568 H HD21 . LEU A 1 37 ? 3.515   -22.035 -0.529  1.00 0.00 ? 308 LEU A HD21 6 
ATOM   7569 H HD22 . LEU A 1 37 ? 3.288   -22.916 0.984   1.00 0.00 ? 308 LEU A HD22 6 
ATOM   7570 H HD23 . LEU A 1 37 ? 1.959   -21.978 0.301   1.00 0.00 ? 308 LEU A HD23 6 
ATOM   7571 N N    . LYS A 1 38 ? 7.831   -21.168 0.362   1.00 0.00 ? 309 LYS A N    6 
ATOM   7572 C CA   . LYS A 1 38 ? 8.902   -21.769 -0.427  1.00 0.00 ? 309 LYS A CA   6 
ATOM   7573 C C    . LYS A 1 38 ? 9.697   -22.732 0.456   1.00 0.00 ? 309 LYS A C    6 
ATOM   7574 O O    . LYS A 1 38 ? 9.892   -23.883 0.120   1.00 0.00 ? 309 LYS A O    6 
ATOM   7575 C CB   . LYS A 1 38 ? 9.832   -20.670 -0.942  1.00 0.00 ? 309 LYS A CB   6 
ATOM   7576 C CG   . LYS A 1 38 ? 9.030   -19.663 -1.770  1.00 0.00 ? 309 LYS A CG   6 
ATOM   7577 C CD   . LYS A 1 38 ? 8.761   -20.246 -3.157  1.00 0.00 ? 309 LYS A CD   6 
ATOM   7578 C CE   . LYS A 1 38 ? 8.471   -19.111 -4.141  1.00 0.00 ? 309 LYS A CE   6 
ATOM   7579 N NZ   . LYS A 1 38 ? 7.136   -19.323 -4.765  1.00 0.00 ? 309 LYS A NZ   6 
ATOM   7580 H H    . LYS A 1 38 ? 7.756   -20.193 0.423   1.00 0.00 ? 309 LYS A H    6 
ATOM   7581 H HA   . LYS A 1 38 ? 8.480   -22.305 -1.263  1.00 0.00 ? 309 LYS A HA   6 
ATOM   7582 H HB2  . LYS A 1 38 ? 10.289  -20.164 -0.103  1.00 0.00 ? 309 LYS A HB2  6 
ATOM   7583 H HB3  . LYS A 1 38 ? 10.601  -21.110 -1.561  1.00 0.00 ? 309 LYS A HB3  6 
ATOM   7584 H HG2  . LYS A 1 38 ? 8.093   -19.456 -1.275  1.00 0.00 ? 309 LYS A HG2  6 
ATOM   7585 H HG3  . LYS A 1 38 ? 9.595   -18.749 -1.871  1.00 0.00 ? 309 LYS A HG3  6 
ATOM   7586 H HD2  . LYS A 1 38 ? 9.627   -20.800 -3.490  1.00 0.00 ? 309 LYS A HD2  6 
ATOM   7587 H HD3  . LYS A 1 38 ? 7.906   -20.906 -3.110  1.00 0.00 ? 309 LYS A HD3  6 
ATOM   7588 H HE2  . LYS A 1 38 ? 8.476   -18.169 -3.615  1.00 0.00 ? 309 LYS A HE2  6 
ATOM   7589 H HE3  . LYS A 1 38 ? 9.230   -19.098 -4.910  1.00 0.00 ? 309 LYS A HE3  6 
ATOM   7590 H HZ1  . LYS A 1 38 ? 6.590   -20.001 -4.197  1.00 0.00 ? 309 LYS A HZ1  6 
ATOM   7591 H HZ2  . LYS A 1 38 ? 6.625   -18.418 -4.808  1.00 0.00 ? 309 LYS A HZ2  6 
ATOM   7592 H HZ3  . LYS A 1 38 ? 7.260   -19.697 -5.728  1.00 0.00 ? 309 LYS A HZ3  6 
ATOM   7593 N N    . GLN A 1 39 ? 10.160  -22.265 1.580   1.00 0.00 ? 310 GLN A N    6 
ATOM   7594 C CA   . GLN A 1 39 ? 10.932  -23.124 2.473   1.00 0.00 ? 310 GLN A CA   6 
ATOM   7595 C C    . GLN A 1 39 ? 10.170  -24.428 2.723   1.00 0.00 ? 310 GLN A C    6 
ATOM   7596 O O    . GLN A 1 39 ? 10.744  -25.499 2.742   1.00 0.00 ? 310 GLN A O    6 
ATOM   7597 C CB   . GLN A 1 39 ? 11.157  -22.400 3.800   1.00 0.00 ? 310 GLN A CB   6 
ATOM   7598 C CG   . GLN A 1 39 ? 11.759  -23.368 4.818   1.00 0.00 ? 310 GLN A CG   6 
ATOM   7599 C CD   . GLN A 1 39 ? 13.069  -22.790 5.355   1.00 0.00 ? 310 GLN A CD   6 
ATOM   7600 O OE1  . GLN A 1 39 ? 13.603  -21.847 4.804   1.00 0.00 ? 310 GLN A OE1  6 
ATOM   7601 N NE2  . GLN A 1 39 ? 13.617  -23.318 6.416   1.00 0.00 ? 310 GLN A NE2  6 
ATOM   7602 H H    . GLN A 1 39 ? 9.993   -21.332 1.829   1.00 0.00 ? 310 GLN A H    6 
ATOM   7603 H HA   . GLN A 1 39 ? 11.887  -23.347 2.021   1.00 0.00 ? 310 GLN A HA   6 
ATOM   7604 H HB2  . GLN A 1 39 ? 11.832  -21.571 3.648   1.00 0.00 ? 310 GLN A HB2  6 
ATOM   7605 H HB3  . GLN A 1 39 ? 10.213  -22.031 4.173   1.00 0.00 ? 310 GLN A HB3  6 
ATOM   7606 H HG2  . GLN A 1 39 ? 11.065  -23.510 5.634   1.00 0.00 ? 310 GLN A HG2  6 
ATOM   7607 H HG3  . GLN A 1 39 ? 11.955  -24.316 4.342   1.00 0.00 ? 310 GLN A HG3  6 
ATOM   7608 H HE21 . GLN A 1 39 ? 13.187  -24.078 6.863   1.00 0.00 ? 310 GLN A HE21 6 
ATOM   7609 H HE22 . GLN A 1 39 ? 14.457  -22.955 6.767   1.00 0.00 ? 310 GLN A HE22 6 
ATOM   7610 N N    . LYS A 1 40 ? 8.882   -24.349 2.925   1.00 0.00 ? 311 LYS A N    6 
ATOM   7611 C CA   . LYS A 1 40 ? 8.107   -25.559 3.177   1.00 0.00 ? 311 LYS A CA   6 
ATOM   7612 C C    . LYS A 1 40 ? 8.176   -26.481 1.957   1.00 0.00 ? 311 LYS A C    6 
ATOM   7613 O O    . LYS A 1 40 ? 8.413   -27.667 2.077   1.00 0.00 ? 311 LYS A O    6 
ATOM   7614 C CB   . LYS A 1 40 ? 6.650   -25.187 3.455   1.00 0.00 ? 311 LYS A CB   6 
ATOM   7615 C CG   . LYS A 1 40 ? 6.137   -25.997 4.646   1.00 0.00 ? 311 LYS A CG   6 
ATOM   7616 C CD   . LYS A 1 40 ? 6.094   -27.480 4.275   1.00 0.00 ? 311 LYS A CD   6 
ATOM   7617 C CE   . LYS A 1 40 ? 5.433   -28.272 5.407   1.00 0.00 ? 311 LYS A CE   6 
ATOM   7618 N NZ   . LYS A 1 40 ? 5.425   -29.722 5.059   1.00 0.00 ? 311 LYS A NZ   6 
ATOM   7619 H H    . LYS A 1 40 ? 8.438   -23.474 2.912   1.00 0.00 ? 311 LYS A H    6 
ATOM   7620 H HA   . LYS A 1 40 ? 8.514   -26.072 4.036   1.00 0.00 ? 311 LYS A HA   6 
ATOM   7621 H HB2  . LYS A 1 40 ? 6.586   -24.132 3.680   1.00 0.00 ? 311 LYS A HB2  6 
ATOM   7622 H HB3  . LYS A 1 40 ? 6.050   -25.407 2.586   1.00 0.00 ? 311 LYS A HB3  6 
ATOM   7623 H HG2  . LYS A 1 40 ? 6.798   -25.854 5.490   1.00 0.00 ? 311 LYS A HG2  6 
ATOM   7624 H HG3  . LYS A 1 40 ? 5.142   -25.664 4.906   1.00 0.00 ? 311 LYS A HG3  6 
ATOM   7625 H HD2  . LYS A 1 40 ? 5.524   -27.607 3.367   1.00 0.00 ? 311 LYS A HD2  6 
ATOM   7626 H HD3  . LYS A 1 40 ? 7.098   -27.844 4.124   1.00 0.00 ? 311 LYS A HD3  6 
ATOM   7627 H HE2  . LYS A 1 40 ? 5.990   -28.124 6.319   1.00 0.00 ? 311 LYS A HE2  6 
ATOM   7628 H HE3  . LYS A 1 40 ? 4.420   -27.928 5.542   1.00 0.00 ? 311 LYS A HE3  6 
ATOM   7629 H HZ1  . LYS A 1 40 ? 5.418   -29.828 4.024   1.00 0.00 ? 311 LYS A HZ1  6 
ATOM   7630 H HZ2  . LYS A 1 40 ? 6.271   -30.177 5.451   1.00 0.00 ? 311 LYS A HZ2  6 
ATOM   7631 H HZ3  . LYS A 1 40 ? 4.575   -30.169 5.460   1.00 0.00 ? 311 LYS A HZ3  6 
ATOM   7632 N N    . VAL A 1 41 ? 7.969   -25.949 0.781   1.00 0.00 ? 312 VAL A N    6 
ATOM   7633 C CA   . VAL A 1 41 ? 8.022   -26.785 -0.413  1.00 0.00 ? 312 VAL A CA   6 
ATOM   7634 C C    . VAL A 1 41 ? 9.432   -27.358 -0.572  1.00 0.00 ? 312 VAL A C    6 
ATOM   7635 O O    . VAL A 1 41 ? 9.647   -28.546 -0.443  1.00 0.00 ? 312 VAL A O    6 
ATOM   7636 C CB   . VAL A 1 41 ? 7.664   -25.948 -1.641  1.00 0.00 ? 312 VAL A CB   6 
ATOM   7637 C CG1  . VAL A 1 41 ? 7.658   -26.842 -2.883  1.00 0.00 ? 312 VAL A CG1  6 
ATOM   7638 C CG2  . VAL A 1 41 ? 6.275   -25.335 -1.449  1.00 0.00 ? 312 VAL A CG2  6 
ATOM   7639 H H    . VAL A 1 41 ? 7.778   -24.992 0.704   1.00 0.00 ? 312 VAL A H    6 
ATOM   7640 H HA   . VAL A 1 41 ? 7.315   -27.596 -0.315  1.00 0.00 ? 312 VAL A HA   6 
ATOM   7641 H HB   . VAL A 1 41 ? 8.395   -25.162 -1.767  1.00 0.00 ? 312 VAL A HB   6 
ATOM   7642 H HG11 . VAL A 1 41 ? 8.467   -27.554 -2.818  1.00 0.00 ? 312 VAL A HG11 6 
ATOM   7643 H HG12 . VAL A 1 41 ? 6.718   -27.369 -2.943  1.00 0.00 ? 312 VAL A HG12 6 
ATOM   7644 H HG13 . VAL A 1 41 ? 7.787   -26.231 -3.766  1.00 0.00 ? 312 VAL A HG13 6 
ATOM   7645 H HG21 . VAL A 1 41 ? 5.824   -25.738 -0.554  1.00 0.00 ? 312 VAL A HG21 6 
ATOM   7646 H HG22 . VAL A 1 41 ? 6.364   -24.262 -1.358  1.00 0.00 ? 312 VAL A HG22 6 
ATOM   7647 H HG23 . VAL A 1 41 ? 5.655   -25.574 -2.303  1.00 0.00 ? 312 VAL A HG23 6 
ATOM   7648 N N    . MET A 1 42 ? 10.399  -26.523 -0.846  1.00 0.00 ? 313 MET A N    6 
ATOM   7649 C CA   . MET A 1 42 ? 11.762  -27.015 -1.003  1.00 0.00 ? 313 MET A CA   6 
ATOM   7650 C C    . MET A 1 42 ? 12.280  -27.502 0.352   1.00 0.00 ? 313 MET A C    6 
ATOM   7651 O O    . MET A 1 42 ? 13.123  -26.879 0.966   1.00 0.00 ? 313 MET A O    6 
ATOM   7652 C CB   . MET A 1 42 ? 12.659  -25.888 -1.520  1.00 0.00 ? 313 MET A CB   6 
ATOM   7653 C CG   . MET A 1 42 ? 13.896  -26.488 -2.192  1.00 0.00 ? 313 MET A CG   6 
ATOM   7654 S SD   . MET A 1 42 ? 14.546  -25.321 -3.412  1.00 0.00 ? 313 MET A SD   6 
ATOM   7655 C CE   . MET A 1 42 ? 13.785  -26.073 -4.872  1.00 0.00 ? 313 MET A CE   6 
ATOM   7656 H H    . MET A 1 42 ? 10.207  -25.567 -0.945  1.00 0.00 ? 313 MET A H    6 
ATOM   7657 H HA   . MET A 1 42 ? 11.772  -27.834 -1.707  1.00 0.00 ? 313 MET A HA   6 
ATOM   7658 H HB2  . MET A 1 42 ? 12.112  -25.294 -2.236  1.00 0.00 ? 313 MET A HB2  6 
ATOM   7659 H HB3  . MET A 1 42 ? 12.966  -25.266 -0.694  1.00 0.00 ? 313 MET A HB3  6 
ATOM   7660 H HG2  . MET A 1 42 ? 14.651  -26.685 -1.446  1.00 0.00 ? 313 MET A HG2  6 
ATOM   7661 H HG3  . MET A 1 42 ? 13.626  -27.411 -2.682  1.00 0.00 ? 313 MET A HG3  6 
ATOM   7662 H HE1  . MET A 1 42 ? 13.539  -27.102 -4.663  1.00 0.00 ? 313 MET A HE1  6 
ATOM   7663 H HE2  . MET A 1 42 ? 12.881  -25.534 -5.124  1.00 0.00 ? 313 MET A HE2  6 
ATOM   7664 H HE3  . MET A 1 42 ? 14.478  -26.031 -5.700  1.00 0.00 ? 313 MET A HE3  6 
ATOM   7665 N N    . ASN A 1 43 ? 11.776  -28.608 0.827   1.00 0.00 ? 314 ASN A N    6 
ATOM   7666 C CA   . ASN A 1 43 ? 12.226  -29.118 2.117   1.00 0.00 ? 314 ASN A CA   6 
ATOM   7667 C C    . ASN A 1 43 ? 12.671  -30.576 1.965   1.00 0.00 ? 314 ASN A C    6 
ATOM   7668 O O    . ASN A 1 43 ? 12.484  -31.188 0.932   1.00 0.00 ? 314 ASN A O    6 
ATOM   7669 C CB   . ASN A 1 43 ? 11.076  -29.036 3.121   1.00 0.00 ? 314 ASN A CB   6 
ATOM   7670 C CG   . ASN A 1 43 ? 11.639  -28.831 4.529   1.00 0.00 ? 314 ASN A CG   6 
ATOM   7671 O OD1  . ASN A 1 43 ? 12.821  -29.004 4.754   1.00 0.00 ? 314 ASN A OD1  6 
ATOM   7672 N ND2  . ASN A 1 43 ? 10.839  -28.468 5.493   1.00 0.00 ? 314 ASN A ND2  6 
ATOM   7673 H H    . ASN A 1 43 ? 11.094  -29.094 0.317   1.00 0.00 ? 314 ASN A H    6 
ATOM   7674 H HA   . ASN A 1 43 ? 13.055  -28.525 2.471   1.00 0.00 ? 314 ASN A HA   6 
ATOM   7675 H HB2  . ASN A 1 43 ? 10.434  -28.206 2.867   1.00 0.00 ? 314 ASN A HB2  6 
ATOM   7676 H HB3  . ASN A 1 43 ? 10.506  -29.954 3.095   1.00 0.00 ? 314 ASN A HB3  6 
ATOM   7677 H HD21 . ASN A 1 43 ? 9.885   -28.329 5.312   1.00 0.00 ? 314 ASN A HD21 6 
ATOM   7678 H HD22 . ASN A 1 43 ? 11.190  -28.332 6.398   1.00 0.00 ? 314 ASN A HD22 6 
ATOM   7679 N N    . TYR A 1 44 ? 13.252  -31.136 2.992   1.00 0.00 ? 315 TYR A N    6 
ATOM   7680 C CA   . TYR A 1 44 ? 13.697  -32.525 2.919   1.00 0.00 ? 315 TYR A CA   6 
ATOM   7681 C C    . TYR A 1 44 ? 14.718  -32.675 1.789   1.00 0.00 ? 315 TYR A C    6 
ATOM   7682 O O    . TYR A 1 44 ? 14.883  -33.783 1.309   1.00 0.00 ? 315 TYR A O    6 
ATOM   7683 C CB   . TYR A 1 44 ? 12.499  -33.441 2.650   1.00 0.00 ? 315 TYR A CB   6 
ATOM   7684 C CG   . TYR A 1 44 ? 11.697  -33.612 3.917   1.00 0.00 ? 315 TYR A CG   6 
ATOM   7685 C CD1  . TYR A 1 44 ? 12.091  -34.559 4.874   1.00 0.00 ? 315 TYR A CD1  6 
ATOM   7686 C CD2  . TYR A 1 44 ? 10.554  -32.825 4.137   1.00 0.00 ? 315 TYR A CD2  6 
ATOM   7687 C CE1  . TYR A 1 44 ? 11.344  -34.721 6.051   1.00 0.00 ? 315 TYR A CE1  6 
ATOM   7688 C CE2  . TYR A 1 44 ? 9.807   -32.985 5.315   1.00 0.00 ? 315 TYR A CE2  6 
ATOM   7689 C CZ   . TYR A 1 44 ? 10.202  -33.934 6.272   1.00 0.00 ? 315 TYR A CZ   6 
ATOM   7690 O OH   . TYR A 1 44 ? 9.468   -34.093 7.431   1.00 0.00 ? 315 TYR A OH   6 
ATOM   7691 O OXT  . TYR A 1 44 ? 15.316  -31.676 1.424   1.00 0.00 ? 315 TYR A OXT  6 
ATOM   7692 H H    . TYR A 1 44 ? 13.386  -30.624 3.817   1.00 0.00 ? 315 TYR A H    6 
ATOM   7693 H HA   . TYR A 1 44 ? 14.156  -32.805 3.856   1.00 0.00 ? 315 TYR A HA   6 
ATOM   7694 H HB2  . TYR A 1 44 ? 11.875  -33.004 1.884   1.00 0.00 ? 315 TYR A HB2  6 
ATOM   7695 H HB3  . TYR A 1 44 ? 12.852  -34.405 2.316   1.00 0.00 ? 315 TYR A HB3  6 
ATOM   7696 H HD1  . TYR A 1 44 ? 12.969  -35.165 4.704   1.00 0.00 ? 315 TYR A HD1  6 
ATOM   7697 H HD2  . TYR A 1 44 ? 10.251  -32.095 3.400   1.00 0.00 ? 315 TYR A HD2  6 
ATOM   7698 H HE1  . TYR A 1 44 ? 11.647  -35.450 6.788   1.00 0.00 ? 315 TYR A HE1  6 
ATOM   7699 H HE2  . TYR A 1 44 ? 8.929   -32.381 5.485   1.00 0.00 ? 315 TYR A HE2  6 
ATOM   7700 H HH   . TYR A 1 44 ? 9.333   -35.033 7.570   1.00 0.00 ? 315 TYR A HH   6 
HETATM 7701 C C    . ACE B 1 1  ? -0.793  31.138  -4.799  1.00 0.00 ? 272 ACE B C    6 
HETATM 7702 O O    . ACE B 1 1  ? -0.268  30.042  -4.803  1.00 0.00 ? 272 ACE B O    6 
HETATM 7703 C CH3  . ACE B 1 1  ? -2.257  31.316  -5.203  1.00 0.00 ? 272 ACE B CH3  6 
HETATM 7704 H H1   . ACE B 1 1  ? -2.764  30.364  -5.150  1.00 0.00 ? 272 ACE B H1   6 
HETATM 7705 H H2   . ACE B 1 1  ? -2.735  32.015  -4.530  1.00 0.00 ? 272 ACE B H2   6 
HETATM 7706 H H3   . ACE B 1 1  ? -2.311  31.696  -6.213  1.00 0.00 ? 272 ACE B H3   6 
ATOM   7707 N N    . CYS B 1 2  ? -0.129  32.206  -4.453  1.00 0.00 ? 273 CYS B N    6 
ATOM   7708 C CA   . CYS B 1 2  ? 1.271   32.099  -4.058  1.00 0.00 ? 273 CYS B CA   6 
ATOM   7709 C C    . CYS B 1 2  ? 2.079   31.499  -5.210  1.00 0.00 ? 273 CYS B C    6 
ATOM   7710 O O    . CYS B 1 2  ? 2.599   32.204  -6.050  1.00 0.00 ? 273 CYS B O    6 
ATOM   7711 C CB   . CYS B 1 2  ? 1.387   31.198  -2.826  1.00 0.00 ? 273 CYS B CB   6 
ATOM   7712 S SG   . CYS B 1 2  ? 0.959   32.148  -1.345  1.00 0.00 ? 273 CYS B SG   6 
ATOM   7713 H H    . CYS B 1 2  ? -0.572  33.081  -4.456  1.00 0.00 ? 273 CYS B H    6 
ATOM   7714 H HA   . CYS B 1 2  ? 1.654   33.078  -3.821  1.00 0.00 ? 273 CYS B HA   6 
ATOM   7715 H HB2  . CYS B 1 2  ? 0.711   30.362  -2.924  1.00 0.00 ? 273 CYS B HB2  6 
ATOM   7716 H HB3  . CYS B 1 2  ? 2.400   30.834  -2.739  1.00 0.00 ? 273 CYS B HB3  6 
ATOM   7717 N N    . GLY B 1 3  ? 2.189   30.197  -5.256  1.00 0.00 ? 274 GLY B N    6 
ATOM   7718 C CA   . GLY B 1 3  ? 2.948   29.568  -6.330  1.00 0.00 ? 274 GLY B CA   6 
ATOM   7719 C C    . GLY B 1 3  ? 4.410   29.417  -5.906  1.00 0.00 ? 274 GLY B C    6 
ATOM   7720 O O    . GLY B 1 3  ? 5.068   30.378  -5.560  1.00 0.00 ? 274 GLY B O    6 
ATOM   7721 H H    . GLY B 1 3  ? 1.762   29.645  -4.568  1.00 0.00 ? 274 GLY B H    6 
ATOM   7722 H HA2  . GLY B 1 3  ? 2.529   28.593  -6.542  1.00 0.00 ? 274 GLY B HA2  6 
ATOM   7723 H HA3  . GLY B 1 3  ? 2.897   30.182  -7.216  1.00 0.00 ? 274 GLY B HA3  6 
ATOM   7724 N N    . GLY B 1 4  ? 4.924   28.218  -5.930  1.00 0.00 ? 275 GLY B N    6 
ATOM   7725 C CA   . GLY B 1 4  ? 6.313   28.012  -5.537  1.00 0.00 ? 275 GLY B CA   6 
ATOM   7726 C C    . GLY B 1 4  ? 6.416   26.780  -4.638  1.00 0.00 ? 275 GLY B C    6 
ATOM   7727 O O    . GLY B 1 4  ? 7.048   25.800  -4.982  1.00 0.00 ? 275 GLY B O    6 
ATOM   7728 H H    . GLY B 1 4  ? 4.375   27.455  -6.213  1.00 0.00 ? 275 GLY B H    6 
ATOM   7729 H HA2  . GLY B 1 4  ? 6.918   27.868  -6.421  1.00 0.00 ? 275 GLY B HA2  6 
ATOM   7730 H HA3  . GLY B 1 4  ? 6.666   28.877  -4.998  1.00 0.00 ? 275 GLY B HA3  6 
ATOM   7731 N N    . ARG B 1 5  ? 5.802   26.821  -3.487  1.00 0.00 ? 276 ARG B N    6 
ATOM   7732 C CA   . ARG B 1 5  ? 5.868   25.677  -2.585  1.00 0.00 ? 276 ARG B CA   6 
ATOM   7733 C C    . ARG B 1 5  ? 4.849   24.622  -3.022  1.00 0.00 ? 276 ARG B C    6 
ATOM   7734 O O    . ARG B 1 5  ? 4.908   23.480  -2.609  1.00 0.00 ? 276 ARG B O    6 
ATOM   7735 C CB   . ARG B 1 5  ? 5.553   26.131  -1.158  1.00 0.00 ? 276 ARG B CB   6 
ATOM   7736 C CG   . ARG B 1 5  ? 6.770   25.882  -0.265  1.00 0.00 ? 276 ARG B CG   6 
ATOM   7737 C CD   . ARG B 1 5  ? 6.770   26.888  0.890   1.00 0.00 ? 276 ARG B CD   6 
ATOM   7738 N NE   . ARG B 1 5  ? 8.116   26.999  1.451   1.00 0.00 ? 276 ARG B NE   6 
ATOM   7739 C CZ   . ARG B 1 5  ? 8.883   25.946  1.541   1.00 0.00 ? 276 ARG B CZ   6 
ATOM   7740 N NH1  . ARG B 1 5  ? 8.650   25.044  2.457   1.00 0.00 ? 276 ARG B NH1  6 
ATOM   7741 N NH2  . ARG B 1 5  ? 9.883   25.794  0.715   1.00 0.00 ? 276 ARG B NH2  6 
ATOM   7742 H H    . ARG B 1 5  ? 5.301   27.620  -3.228  1.00 0.00 ? 276 ARG B H    6 
ATOM   7743 H HA   . ARG B 1 5  ? 6.860   25.251  -2.615  1.00 0.00 ? 276 ARG B HA   6 
ATOM   7744 H HB2  . ARG B 1 5  ? 5.315   27.183  -1.161  1.00 0.00 ? 276 ARG B HB2  6 
ATOM   7745 H HB3  . ARG B 1 5  ? 4.713   25.569  -0.780  1.00 0.00 ? 276 ARG B HB3  6 
ATOM   7746 H HG2  . ARG B 1 5  ? 6.726   24.878  0.131   1.00 0.00 ? 276 ARG B HG2  6 
ATOM   7747 H HG3  . ARG B 1 5  ? 7.674   26.003  -0.844  1.00 0.00 ? 276 ARG B HG3  6 
ATOM   7748 H HD2  . ARG B 1 5  ? 6.456   27.854  0.524   1.00 0.00 ? 276 ARG B HD2  6 
ATOM   7749 H HD3  . ARG B 1 5  ? 6.085   26.554  1.655   1.00 0.00 ? 276 ARG B HD3  6 
ATOM   7750 H HE   . ARG B 1 5  ? 8.444   27.869  1.761   1.00 0.00 ? 276 ARG B HE   6 
ATOM   7751 H HH11 . ARG B 1 5  ? 7.885   25.161  3.091   1.00 0.00 ? 276 ARG B HH11 6 
ATOM   7752 H HH12 . ARG B 1 5  ? 9.238   24.237  2.527   1.00 0.00 ? 276 ARG B HH12 6 
ATOM   7753 H HH21 . ARG B 1 5  ? 10.060  26.485  0.014   1.00 0.00 ? 276 ARG B HH21 6 
ATOM   7754 H HH22 . ARG B 1 5  ? 10.471  24.987  0.783   1.00 0.00 ? 276 ARG B HH22 6 
ATOM   7755 N N    . ILE B 1 6  ? 3.914   24.993  -3.853  1.00 0.00 ? 277 ILE B N    6 
ATOM   7756 C CA   . ILE B 1 6  ? 2.915   24.030  -4.301  1.00 0.00 ? 277 ILE B CA   6 
ATOM   7757 C C    . ILE B 1 6  ? 3.523   23.135  -5.385  1.00 0.00 ? 277 ILE B C    6 
ATOM   7758 O O    . ILE B 1 6  ? 3.414   21.926  -5.338  1.00 0.00 ? 277 ILE B O    6 
ATOM   7759 C CB   . ILE B 1 6  ? 1.706   24.770  -4.873  1.00 0.00 ? 277 ILE B CB   6 
ATOM   7760 C CG1  . ILE B 1 6  ? 0.971   25.488  -3.738  1.00 0.00 ? 277 ILE B CG1  6 
ATOM   7761 C CG2  . ILE B 1 6  ? 0.761   23.770  -5.539  1.00 0.00 ? 277 ILE B CG2  6 
ATOM   7762 C CD1  . ILE B 1 6  ? 0.286   26.742  -4.285  1.00 0.00 ? 277 ILE B CD1  6 
ATOM   7763 H H    . ILE B 1 6  ? 3.883   25.918  -4.175  1.00 0.00 ? 277 ILE B H    6 
ATOM   7764 H HA   . ILE B 1 6  ? 2.602   23.420  -3.469  1.00 0.00 ? 277 ILE B HA   6 
ATOM   7765 H HB   . ILE B 1 6  ? 2.038   25.494  -5.603  1.00 0.00 ? 277 ILE B HB   6 
ATOM   7766 H HG12 . ILE B 1 6  ? 0.227   24.826  -3.316  1.00 0.00 ? 277 ILE B HG12 6 
ATOM   7767 H HG13 . ILE B 1 6  ? 1.676   25.770  -2.972  1.00 0.00 ? 277 ILE B HG13 6 
ATOM   7768 H HG21 . ILE B 1 6  ? 0.688   22.882  -4.930  1.00 0.00 ? 277 ILE B HG21 6 
ATOM   7769 H HG22 . ILE B 1 6  ? -0.218  24.214  -5.646  1.00 0.00 ? 277 ILE B HG22 6 
ATOM   7770 H HG23 . ILE B 1 6  ? 1.144   23.507  -6.514  1.00 0.00 ? 277 ILE B HG23 6 
ATOM   7771 H HD11 . ILE B 1 6  ? 0.984   27.294  -4.897  1.00 0.00 ? 277 ILE B HD11 6 
ATOM   7772 H HD12 . ILE B 1 6  ? -0.568  26.456  -4.880  1.00 0.00 ? 277 ILE B HD12 6 
ATOM   7773 H HD13 . ILE B 1 6  ? -0.039  27.362  -3.463  1.00 0.00 ? 277 ILE B HD13 6 
ATOM   7774 N N    . ALA B 1 7  ? 4.162   23.717  -6.361  1.00 0.00 ? 278 ALA B N    6 
ATOM   7775 C CA   . ALA B 1 7  ? 4.761   22.915  -7.422  1.00 0.00 ? 278 ALA B CA   6 
ATOM   7776 C C    . ALA B 1 7  ? 5.572   21.777  -6.799  1.00 0.00 ? 278 ALA B C    6 
ATOM   7777 O O    . ALA B 1 7  ? 5.565   20.660  -7.280  1.00 0.00 ? 278 ALA B O    6 
ATOM   7778 C CB   . ALA B 1 7  ? 5.684   23.793  -8.271  1.00 0.00 ? 278 ALA B CB   6 
ATOM   7779 H H    . ALA B 1 7  ? 4.239   24.694  -6.383  1.00 0.00 ? 278 ALA B H    6 
ATOM   7780 H HA   . ALA B 1 7  ? 3.983   22.504  -8.047  1.00 0.00 ? 278 ALA B HA   6 
ATOM   7781 H HB1  . ALA B 1 7  ? 5.847   24.735  -7.765  1.00 0.00 ? 278 ALA B HB1  6 
ATOM   7782 H HB2  . ALA B 1 7  ? 6.628   23.291  -8.412  1.00 0.00 ? 278 ALA B HB2  6 
ATOM   7783 H HB3  . ALA B 1 7  ? 5.224   23.974  -9.232  1.00 0.00 ? 278 ALA B HB3  6 
ATOM   7784 N N    . ARG B 1 8  ? 6.270   22.048  -5.732  1.00 0.00 ? 279 ARG B N    6 
ATOM   7785 C CA   . ARG B 1 8  ? 7.064   21.004  -5.093  1.00 0.00 ? 279 ARG B CA   6 
ATOM   7786 C C    . ARG B 1 8  ? 6.144   20.093  -4.276  1.00 0.00 ? 279 ARG B C    6 
ATOM   7787 O O    . ARG B 1 8  ? 6.173   18.887  -4.411  1.00 0.00 ? 279 ARG B O    6 
ATOM   7788 C CB   . ARG B 1 8  ? 8.102   21.644  -4.169  1.00 0.00 ? 279 ARG B CB   6 
ATOM   7789 C CG   . ARG B 1 8  ? 8.676   22.895  -4.834  1.00 0.00 ? 279 ARG B CG   6 
ATOM   7790 C CD   . ARG B 1 8  ? 9.079   22.568  -6.277  1.00 0.00 ? 279 ARG B CD   6 
ATOM   7791 N NE   . ARG B 1 8  ? 10.324  23.256  -6.612  1.00 0.00 ? 279 ARG B NE   6 
ATOM   7792 C CZ   . ARG B 1 8  ? 10.557  24.459  -6.161  1.00 0.00 ? 279 ARG B CZ   6 
ATOM   7793 N NH1  . ARG B 1 8  ? 9.843   25.465  -6.587  1.00 0.00 ? 279 ARG B NH1  6 
ATOM   7794 N NH2  . ARG B 1 8  ? 11.503  24.655  -5.284  1.00 0.00 ? 279 ARG B NH2  6 
ATOM   7795 H H    . ARG B 1 8  ? 6.263   22.955  -5.358  1.00 0.00 ? 279 ARG B H    6 
ATOM   7796 H HA   . ARG B 1 8  ? 7.569   20.422  -5.850  1.00 0.00 ? 279 ARG B HA   6 
ATOM   7797 H HB2  . ARG B 1 8  ? 7.633   21.916  -3.235  1.00 0.00 ? 279 ARG B HB2  6 
ATOM   7798 H HB3  . ARG B 1 8  ? 8.899   20.940  -3.981  1.00 0.00 ? 279 ARG B HB3  6 
ATOM   7799 H HG2  . ARG B 1 8  ? 7.931   23.675  -4.838  1.00 0.00 ? 279 ARG B HG2  6 
ATOM   7800 H HG3  . ARG B 1 8  ? 9.546   23.228  -4.288  1.00 0.00 ? 279 ARG B HG3  6 
ATOM   7801 H HD2  . ARG B 1 8  ? 9.224   21.503  -6.375  1.00 0.00 ? 279 ARG B HD2  6 
ATOM   7802 H HD3  . ARG B 1 8  ? 8.294   22.888  -6.947  1.00 0.00 ? 279 ARG B HD3  6 
ATOM   7803 H HE   . ARG B 1 8  ? 10.989  22.811  -7.180  1.00 0.00 ? 279 ARG B HE   6 
ATOM   7804 H HH11 . ARG B 1 8  ? 9.118   25.315  -7.258  1.00 0.00 ? 279 ARG B HH11 6 
ATOM   7805 H HH12 . ARG B 1 8  ? 10.022  26.387  -6.241  1.00 0.00 ? 279 ARG B HH12 6 
ATOM   7806 H HH21 . ARG B 1 8  ? 12.052  23.884  -4.959  1.00 0.00 ? 279 ARG B HH21 6 
ATOM   7807 H HH22 . ARG B 1 8  ? 11.682  25.578  -4.939  1.00 0.00 ? 279 ARG B HH22 6 
ATOM   7808 N N    . LEU B 1 9  ? 5.329   20.659  -3.427  1.00 0.00 ? 280 LEU B N    6 
ATOM   7809 C CA   . LEU B 1 9  ? 4.432   19.839  -2.622  1.00 0.00 ? 280 LEU B CA   6 
ATOM   7810 C C    . LEU B 1 9  ? 3.719   18.830  -3.525  1.00 0.00 ? 280 LEU B C    6 
ATOM   7811 O O    . LEU B 1 9  ? 3.546   17.681  -3.172  1.00 0.00 ? 280 LEU B O    6 
ATOM   7812 C CB   . LEU B 1 9  ? 3.398   20.733  -1.936  1.00 0.00 ? 280 LEU B CB   6 
ATOM   7813 C CG   . LEU B 1 9  ? 3.739   20.856  -0.450  1.00 0.00 ? 280 LEU B CG   6 
ATOM   7814 C CD1  . LEU B 1 9  ? 3.598   19.489  0.222   1.00 0.00 ? 280 LEU B CD1  6 
ATOM   7815 C CD2  . LEU B 1 9  ? 5.180   21.351  -0.298  1.00 0.00 ? 280 LEU B CD2  6 
ATOM   7816 H H    . LEU B 1 9  ? 5.321   21.634  -3.332  1.00 0.00 ? 280 LEU B H    6 
ATOM   7817 H HA   . LEU B 1 9  ? 5.003   19.312  -1.873  1.00 0.00 ? 280 LEU B HA   6 
ATOM   7818 H HB2  . LEU B 1 9  ? 3.410   21.713  -2.393  1.00 0.00 ? 280 LEU B HB2  6 
ATOM   7819 H HB3  . LEU B 1 9  ? 2.416   20.298  -2.043  1.00 0.00 ? 280 LEU B HB3  6 
ATOM   7820 H HG   . LEU B 1 9  ? 3.064   21.558  0.017   1.00 0.00 ? 280 LEU B HG   6 
ATOM   7821 H HD11 . LEU B 1 9  ? 3.381   18.740  -0.526  1.00 0.00 ? 280 LEU B HD11 6 
ATOM   7822 H HD12 . LEU B 1 9  ? 4.519   19.237  0.724   1.00 0.00 ? 280 LEU B HD12 6 
ATOM   7823 H HD13 . LEU B 1 9  ? 2.794   19.523  0.942   1.00 0.00 ? 280 LEU B HD13 6 
ATOM   7824 H HD21 . LEU B 1 9  ? 5.304   22.274  -0.843  1.00 0.00 ? 280 LEU B HD21 6 
ATOM   7825 H HD22 . LEU B 1 9  ? 5.394   21.519  0.748   1.00 0.00 ? 280 LEU B HD22 6 
ATOM   7826 H HD23 . LEU B 1 9  ? 5.859   20.608  -0.688  1.00 0.00 ? 280 LEU B HD23 6 
ATOM   7827 N N    . GLU B 1 10 ? 3.311   19.248  -4.692  1.00 0.00 ? 281 GLU B N    6 
ATOM   7828 C CA   . GLU B 1 10 ? 2.632   18.329  -5.598  1.00 0.00 ? 281 GLU B CA   6 
ATOM   7829 C C    . GLU B 1 10 ? 3.647   17.330  -6.156  1.00 0.00 ? 281 GLU B C    6 
ATOM   7830 O O    . GLU B 1 10 ? 3.369   16.157  -6.293  1.00 0.00 ? 281 GLU B O    6 
ATOM   7831 C CB   . GLU B 1 10 ? 1.999   19.114  -6.749  1.00 0.00 ? 281 GLU B CB   6 
ATOM   7832 C CG   . GLU B 1 10 ? 0.909   20.037  -6.200  1.00 0.00 ? 281 GLU B CG   6 
ATOM   7833 C CD   . GLU B 1 10 ? 0.022   20.518  -7.350  1.00 0.00 ? 281 GLU B CD   6 
ATOM   7834 O OE1  . GLU B 1 10 ? -0.289  19.713  -8.211  1.00 0.00 ? 281 GLU B OE1  6 
ATOM   7835 O OE2  . GLU B 1 10 ? -0.330  21.687  -7.349  1.00 0.00 ? 281 GLU B OE2  6 
ATOM   7836 H H    . GLU B 1 10 ? 3.465   20.177  -4.962  1.00 0.00 ? 281 GLU B H    6 
ATOM   7837 H HA   . GLU B 1 10 ? 1.861   17.797  -5.060  1.00 0.00 ? 281 GLU B HA   6 
ATOM   7838 H HB2  . GLU B 1 10 ? 2.759   19.705  -7.239  1.00 0.00 ? 281 GLU B HB2  6 
ATOM   7839 H HB3  . GLU B 1 10 ? 1.564   18.427  -7.457  1.00 0.00 ? 281 GLU B HB3  6 
ATOM   7840 H HG2  . GLU B 1 10 ? 0.309   19.497  -5.483  1.00 0.00 ? 281 GLU B HG2  6 
ATOM   7841 H HG3  . GLU B 1 10 ? 1.367   20.889  -5.719  1.00 0.00 ? 281 GLU B HG3  6 
ATOM   7842 N N    . GLU B 1 11 ? 4.828   17.788  -6.473  1.00 0.00 ? 282 GLU B N    6 
ATOM   7843 C CA   . GLU B 1 11 ? 5.838   16.882  -7.001  1.00 0.00 ? 282 GLU B CA   6 
ATOM   7844 C C    . GLU B 1 11 ? 6.014   15.716  -6.030  1.00 0.00 ? 282 GLU B C    6 
ATOM   7845 O O    . GLU B 1 11 ? 6.190   14.581  -6.427  1.00 0.00 ? 282 GLU B O    6 
ATOM   7846 C CB   . GLU B 1 11 ? 7.165   17.629  -7.153  1.00 0.00 ? 282 GLU B CB   6 
ATOM   7847 C CG   . GLU B 1 11 ? 7.418   17.932  -8.632  1.00 0.00 ? 282 GLU B CG   6 
ATOM   7848 C CD   . GLU B 1 11 ? 8.150   19.268  -8.762  1.00 0.00 ? 282 GLU B CD   6 
ATOM   7849 O OE1  . GLU B 1 11 ? 8.682   19.731  -7.764  1.00 0.00 ? 282 GLU B OE1  6 
ATOM   7850 O OE2  . GLU B 1 11 ? 8.168   19.807  -9.855  1.00 0.00 ? 282 GLU B OE2  6 
ATOM   7851 H H    . GLU B 1 11 ? 5.037   18.738  -6.348  1.00 0.00 ? 282 GLU B H    6 
ATOM   7852 H HA   . GLU B 1 11 ? 5.523   16.509  -7.963  1.00 0.00 ? 282 GLU B HA   6 
ATOM   7853 H HB2  . GLU B 1 11 ? 7.121   18.555  -6.597  1.00 0.00 ? 282 GLU B HB2  6 
ATOM   7854 H HB3  . GLU B 1 11 ? 7.969   17.016  -6.770  1.00 0.00 ? 282 GLU B HB3  6 
ATOM   7855 H HG2  . GLU B 1 11 ? 8.022   17.145  -9.061  1.00 0.00 ? 282 GLU B HG2  6 
ATOM   7856 H HG3  . GLU B 1 11 ? 6.475   17.987  -9.154  1.00 0.00 ? 282 GLU B HG3  6 
ATOM   7857 N N    . LYS B 1 12 ? 5.961   15.990  -4.756  1.00 0.00 ? 283 LYS B N    6 
ATOM   7858 C CA   . LYS B 1 12 ? 6.114   14.925  -3.774  1.00 0.00 ? 283 LYS B CA   6 
ATOM   7859 C C    . LYS B 1 12 ? 4.879   14.027  -3.816  1.00 0.00 ? 283 LYS B C    6 
ATOM   7860 O O    . LYS B 1 12 ? 4.971   12.837  -4.049  1.00 0.00 ? 283 LYS B O    6 
ATOM   7861 C CB   . LYS B 1 12 ? 6.248   15.537  -2.380  1.00 0.00 ? 283 LYS B CB   6 
ATOM   7862 C CG   . LYS B 1 12 ? 7.519   15.012  -1.709  1.00 0.00 ? 283 LYS B CG   6 
ATOM   7863 C CD   . LYS B 1 12 ? 8.687   15.946  -2.025  1.00 0.00 ? 283 LYS B CD   6 
ATOM   7864 C CE   . LYS B 1 12 ? 8.872   16.939  -0.878  1.00 0.00 ? 283 LYS B CE   6 
ATOM   7865 N NZ   . LYS B 1 12 ? 10.302  16.953  -0.458  1.00 0.00 ? 283 LYS B NZ   6 
ATOM   7866 H H    . LYS B 1 12 ? 5.813   16.912  -4.458  1.00 0.00 ? 283 LYS B H    6 
ATOM   7867 H HA   . LYS B 1 12 ? 6.996   14.345  -4.000  1.00 0.00 ? 283 LYS B HA   6 
ATOM   7868 H HB2  . LYS B 1 12 ? 6.303   16.614  -2.465  1.00 0.00 ? 283 LYS B HB2  6 
ATOM   7869 H HB3  . LYS B 1 12 ? 5.391   15.265  -1.785  1.00 0.00 ? 283 LYS B HB3  6 
ATOM   7870 H HG2  . LYS B 1 12 ? 7.368   14.969  -0.640  1.00 0.00 ? 283 LYS B HG2  6 
ATOM   7871 H HG3  . LYS B 1 12 ? 7.740   14.023  -2.082  1.00 0.00 ? 283 LYS B HG3  6 
ATOM   7872 H HD2  . LYS B 1 12 ? 9.591   15.364  -2.148  1.00 0.00 ? 283 LYS B HD2  6 
ATOM   7873 H HD3  . LYS B 1 12 ? 8.479   16.487  -2.937  1.00 0.00 ? 283 LYS B HD3  6 
ATOM   7874 H HE2  . LYS B 1 12 ? 8.583   17.927  -1.205  1.00 0.00 ? 283 LYS B HE2  6 
ATOM   7875 H HE3  . LYS B 1 12 ? 8.254   16.644  -0.042  1.00 0.00 ? 283 LYS B HE3  6 
ATOM   7876 H HZ1  . LYS B 1 12 ? 10.904  17.139  -1.283  1.00 0.00 ? 283 LYS B HZ1  6 
ATOM   7877 H HZ2  . LYS B 1 12 ? 10.448  17.700  0.252   1.00 0.00 ? 283 LYS B HZ2  6 
ATOM   7878 H HZ3  . LYS B 1 12 ? 10.551  16.030  -0.047  1.00 0.00 ? 283 LYS B HZ3  6 
ATOM   7879 N N    . VAL B 1 13 ? 3.722   14.588  -3.596  1.00 0.00 ? 284 VAL B N    6 
ATOM   7880 C CA   . VAL B 1 13 ? 2.505   13.788  -3.628  1.00 0.00 ? 284 VAL B CA   6 
ATOM   7881 C C    . VAL B 1 13 ? 2.521   12.902  -4.873  1.00 0.00 ? 284 VAL B C    6 
ATOM   7882 O O    . VAL B 1 13 ? 1.952   11.829  -4.892  1.00 0.00 ? 284 VAL B O    6 
ATOM   7883 C CB   . VAL B 1 13 ? 1.287   14.712  -3.670  1.00 0.00 ? 284 VAL B CB   6 
ATOM   7884 C CG1  . VAL B 1 13 ? 0.040   13.898  -4.014  1.00 0.00 ? 284 VAL B CG1  6 
ATOM   7885 C CG2  . VAL B 1 13 ? 1.103   15.373  -2.303  1.00 0.00 ? 284 VAL B CG2  6 
ATOM   7886 H H    . VAL B 1 13 ? 3.671   15.551  -3.414  1.00 0.00 ? 284 VAL B H    6 
ATOM   7887 H HA   . VAL B 1 13 ? 2.455   13.170  -2.744  1.00 0.00 ? 284 VAL B HA   6 
ATOM   7888 H HB   . VAL B 1 13 ? 1.438   15.473  -4.423  1.00 0.00 ? 284 VAL B HB   6 
ATOM   7889 H HG11 . VAL B 1 13 ? 0.258   12.845  -3.920  1.00 0.00 ? 284 VAL B HG11 6 
ATOM   7890 H HG12 . VAL B 1 13 ? -0.761  14.160  -3.338  1.00 0.00 ? 284 VAL B HG12 6 
ATOM   7891 H HG13 . VAL B 1 13 ? -0.264  14.114  -5.028  1.00 0.00 ? 284 VAL B HG13 6 
ATOM   7892 H HG21 . VAL B 1 13 ? 2.051   15.765  -1.963  1.00 0.00 ? 284 VAL B HG21 6 
ATOM   7893 H HG22 . VAL B 1 13 ? 0.389   16.179  -2.385  1.00 0.00 ? 284 VAL B HG22 6 
ATOM   7894 H HG23 . VAL B 1 13 ? 0.741   14.642  -1.595  1.00 0.00 ? 284 VAL B HG23 6 
ATOM   7895 N N    . LYS B 1 14 ? 3.176   13.339  -5.912  1.00 0.00 ? 285 LYS B N    6 
ATOM   7896 C CA   . LYS B 1 14 ? 3.236   12.536  -7.128  1.00 0.00 ? 285 LYS B CA   6 
ATOM   7897 C C    . LYS B 1 14 ? 4.149   11.335  -6.888  1.00 0.00 ? 285 LYS B C    6 
ATOM   7898 O O    . LYS B 1 14 ? 3.792   10.205  -7.155  1.00 0.00 ? 285 LYS B O    6 
ATOM   7899 C CB   . LYS B 1 14 ? 3.789   13.382  -8.277  1.00 0.00 ? 285 LYS B CB   6 
ATOM   7900 C CG   . LYS B 1 14 ? 3.023   13.062  -9.562  1.00 0.00 ? 285 LYS B CG   6 
ATOM   7901 C CD   . LYS B 1 14 ? 1.661   13.759  -9.534  1.00 0.00 ? 285 LYS B CD   6 
ATOM   7902 C CE   . LYS B 1 14 ? 1.866   15.275  -9.525  1.00 0.00 ? 285 LYS B CE   6 
ATOM   7903 N NZ   . LYS B 1 14 ? 0.858   15.916  -10.419 1.00 0.00 ? 285 LYS B NZ   6 
ATOM   7904 H H    . LYS B 1 14 ? 3.635   14.206  -5.874  1.00 0.00 ? 285 LYS B H    6 
ATOM   7905 H HA   . LYS B 1 14 ? 2.244   12.193  -7.380  1.00 0.00 ? 285 LYS B HA   6 
ATOM   7906 H HB2  . LYS B 1 14 ? 3.675   14.430  -8.039  1.00 0.00 ? 285 LYS B HB2  6 
ATOM   7907 H HB3  . LYS B 1 14 ? 4.836   13.155  -8.418  1.00 0.00 ? 285 LYS B HB3  6 
ATOM   7908 H HG2  . LYS B 1 14 ? 3.589   13.410  -10.414 1.00 0.00 ? 285 LYS B HG2  6 
ATOM   7909 H HG3  . LYS B 1 14 ? 2.877   11.995  -9.637  1.00 0.00 ? 285 LYS B HG3  6 
ATOM   7910 H HD2  . LYS B 1 14 ? 1.095   13.475  -10.408 1.00 0.00 ? 285 LYS B HD2  6 
ATOM   7911 H HD3  . LYS B 1 14 ? 1.125   13.466  -8.645  1.00 0.00 ? 285 LYS B HD3  6 
ATOM   7912 H HE2  . LYS B 1 14 ? 1.746   15.650  -8.521  1.00 0.00 ? 285 LYS B HE2  6 
ATOM   7913 H HE3  . LYS B 1 14 ? 2.859   15.508  -9.880  1.00 0.00 ? 285 LYS B HE3  6 
ATOM   7914 H HZ1  . LYS B 1 14 ? -0.013  15.350  -10.419 1.00 0.00 ? 285 LYS B HZ1  6 
ATOM   7915 H HZ2  . LYS B 1 14 ? 0.647   16.873  -10.074 1.00 0.00 ? 285 LYS B HZ2  6 
ATOM   7916 H HZ3  . LYS B 1 14 ? 1.239   15.971  -11.386 1.00 0.00 ? 285 LYS B HZ3  6 
ATOM   7917 N N    . THR B 1 15 ? 5.326   11.569  -6.375  1.00 0.00 ? 286 THR B N    6 
ATOM   7918 C CA   . THR B 1 15 ? 6.241   10.466  -6.112  1.00 0.00 ? 286 THR B CA   6 
ATOM   7919 C C    . THR B 1 15 ? 5.523   9.414   -5.265  1.00 0.00 ? 286 THR B C    6 
ATOM   7920 O O    . THR B 1 15 ? 5.559   8.234   -5.556  1.00 0.00 ? 286 THR B O    6 
ATOM   7921 C CB   . THR B 1 15 ? 7.465   10.984  -5.355  1.00 0.00 ? 286 THR B CB   6 
ATOM   7922 O OG1  . THR B 1 15 ? 7.276   12.357  -5.037  1.00 0.00 ? 286 THR B OG1  6 
ATOM   7923 C CG2  . THR B 1 15 ? 8.713   10.827  -6.224  1.00 0.00 ? 286 THR B CG2  6 
ATOM   7924 H H    . THR B 1 15 ? 5.593   12.488  -6.161  1.00 0.00 ? 286 THR B H    6 
ATOM   7925 H HA   . THR B 1 15 ? 6.556   10.025  -7.048  1.00 0.00 ? 286 THR B HA   6 
ATOM   7926 H HB   . THR B 1 15 ? 7.592   10.418  -4.444  1.00 0.00 ? 286 THR B HB   6 
ATOM   7927 H HG1  . THR B 1 15 ? 8.140   12.751  -4.902  1.00 0.00 ? 286 THR B HG1  6 
ATOM   7928 H HG21 . THR B 1 15 ? 8.503   10.147  -7.035  1.00 0.00 ? 286 THR B HG21 6 
ATOM   7929 H HG22 . THR B 1 15 ? 8.997   11.789  -6.623  1.00 0.00 ? 286 THR B HG22 6 
ATOM   7930 H HG23 . THR B 1 15 ? 9.521   10.433  -5.624  1.00 0.00 ? 286 THR B HG23 6 
ATOM   7931 N N    . LEU B 1 16 ? 4.869   9.836   -4.218  1.00 0.00 ? 287 LEU B N    6 
ATOM   7932 C CA   . LEU B 1 16 ? 4.161   8.888   -3.368  1.00 0.00 ? 287 LEU B CA   6 
ATOM   7933 C C    . LEU B 1 16 ? 3.149   8.110   -4.212  1.00 0.00 ? 287 LEU B C    6 
ATOM   7934 O O    . LEU B 1 16 ? 3.061   6.901   -4.132  1.00 0.00 ? 287 LEU B O    6 
ATOM   7935 C CB   . LEU B 1 16 ? 3.431   9.644   -2.256  1.00 0.00 ? 287 LEU B CB   6 
ATOM   7936 C CG   . LEU B 1 16 ? 4.443   10.108  -1.207  1.00 0.00 ? 287 LEU B CG   6 
ATOM   7937 C CD1  . LEU B 1 16 ? 4.050   11.497  -0.699  1.00 0.00 ? 287 LEU B CD1  6 
ATOM   7938 C CD2  . LEU B 1 16 ? 4.452   9.122   -0.038  1.00 0.00 ? 287 LEU B CD2  6 
ATOM   7939 H H    . LEU B 1 16 ? 4.853   10.792  -4.004  1.00 0.00 ? 287 LEU B H    6 
ATOM   7940 H HA   . LEU B 1 16 ? 4.869   8.200   -2.928  1.00 0.00 ? 287 LEU B HA   6 
ATOM   7941 H HB2  . LEU B 1 16 ? 2.927   10.502  -2.678  1.00 0.00 ? 287 LEU B HB2  6 
ATOM   7942 H HB3  . LEU B 1 16 ? 2.706   8.991   -1.792  1.00 0.00 ? 287 LEU B HB3  6 
ATOM   7943 H HG   . LEU B 1 16 ? 5.427   10.154  -1.652  1.00 0.00 ? 287 LEU B HG   6 
ATOM   7944 H HD11 . LEU B 1 16 ? 3.143   11.817  -1.188  1.00 0.00 ? 287 LEU B HD11 6 
ATOM   7945 H HD12 . LEU B 1 16 ? 3.890   11.457  0.368   1.00 0.00 ? 287 LEU B HD12 6 
ATOM   7946 H HD13 . LEU B 1 16 ? 4.842   12.198  -0.918  1.00 0.00 ? 287 LEU B HD13 6 
ATOM   7947 H HD21 . LEU B 1 16 ? 3.715   8.352   -0.212  1.00 0.00 ? 287 LEU B HD21 6 
ATOM   7948 H HD22 . LEU B 1 16 ? 5.430   8.670   0.043   1.00 0.00 ? 287 LEU B HD22 6 
ATOM   7949 H HD23 . LEU B 1 16 ? 4.219   9.645   0.876   1.00 0.00 ? 287 LEU B HD23 6 
ATOM   7950 N N    . LYS B 1 17 ? 2.388   8.792   -5.024  1.00 0.00 ? 288 LYS B N    6 
ATOM   7951 C CA   . LYS B 1 17 ? 1.410   8.102   -5.856  1.00 0.00 ? 288 LYS B CA   6 
ATOM   7952 C C    . LYS B 1 17 ? 2.101   6.946   -6.583  1.00 0.00 ? 288 LYS B C    6 
ATOM   7953 O O    . LYS B 1 17 ? 1.658   5.815   -6.533  1.00 0.00 ? 288 LYS B O    6 
ATOM   7954 C CB   . LYS B 1 17 ? 0.827   9.076   -6.880  1.00 0.00 ? 288 LYS B CB   6 
ATOM   7955 C CG   . LYS B 1 17 ? -0.636  9.359   -6.538  1.00 0.00 ? 288 LYS B CG   6 
ATOM   7956 C CD   . LYS B 1 17 ? -0.710  10.453  -5.473  1.00 0.00 ? 288 LYS B CD   6 
ATOM   7957 C CE   . LYS B 1 17 ? -1.091  11.782  -6.128  1.00 0.00 ? 288 LYS B CE   6 
ATOM   7958 N NZ   . LYS B 1 17 ? -2.180  12.428  -5.344  1.00 0.00 ? 288 LYS B NZ   6 
ATOM   7959 H H    . LYS B 1 17 ? 2.477   9.767   -5.077  1.00 0.00 ? 288 LYS B H    6 
ATOM   7960 H HA   . LYS B 1 17 ? 0.618   7.715   -5.233  1.00 0.00 ? 288 LYS B HA   6 
ATOM   7961 H HB2  . LYS B 1 17 ? 1.389   9.999   -6.857  1.00 0.00 ? 288 LYS B HB2  6 
ATOM   7962 H HB3  . LYS B 1 17 ? 0.888   8.640   -7.866  1.00 0.00 ? 288 LYS B HB3  6 
ATOM   7963 H HG2  . LYS B 1 17 ? -1.156  9.687   -7.427  1.00 0.00 ? 288 LYS B HG2  6 
ATOM   7964 H HG3  . LYS B 1 17 ? -1.099  8.460   -6.161  1.00 0.00 ? 288 LYS B HG3  6 
ATOM   7965 H HD2  . LYS B 1 17 ? -1.454  10.188  -4.734  1.00 0.00 ? 288 LYS B HD2  6 
ATOM   7966 H HD3  . LYS B 1 17 ? 0.252   10.554  -4.993  1.00 0.00 ? 288 LYS B HD3  6 
ATOM   7967 H HE2  . LYS B 1 17 ? -0.229  12.432  -6.151  1.00 0.00 ? 288 LYS B HE2  6 
ATOM   7968 H HE3  . LYS B 1 17 ? -1.432  11.600  -7.136  1.00 0.00 ? 288 LYS B HE3  6 
ATOM   7969 H HZ1  . LYS B 1 17 ? -1.929  12.428  -4.335  1.00 0.00 ? 288 LYS B HZ1  6 
ATOM   7970 H HZ2  . LYS B 1 17 ? -2.308  13.408  -5.667  1.00 0.00 ? 288 LYS B HZ2  6 
ATOM   7971 H HZ3  . LYS B 1 17 ? -3.068  11.899  -5.481  1.00 0.00 ? 288 LYS B HZ3  6 
ATOM   7972 N N    . ALA B 1 18 ? 3.184   7.221   -7.255  1.00 0.00 ? 289 ALA B N    6 
ATOM   7973 C CA   . ALA B 1 18 ? 3.890   6.161   -7.965  1.00 0.00 ? 289 ALA B CA   6 
ATOM   7974 C C    . ALA B 1 18 ? 4.121   4.987   -7.018  1.00 0.00 ? 289 ALA B C    6 
ATOM   7975 O O    . ALA B 1 18 ? 3.590   3.910   -7.203  1.00 0.00 ? 289 ALA B O    6 
ATOM   7976 C CB   . ALA B 1 18 ? 5.242   6.683   -8.454  1.00 0.00 ? 289 ALA B CB   6 
ATOM   7977 H H    . ALA B 1 18 ? 3.526   8.139   -7.279  1.00 0.00 ? 289 ALA B H    6 
ATOM   7978 H HA   . ALA B 1 18 ? 3.303   5.837   -8.811  1.00 0.00 ? 289 ALA B HA   6 
ATOM   7979 H HB1  . ALA B 1 18 ? 5.395   7.685   -8.080  1.00 0.00 ? 289 ALA B HB1  6 
ATOM   7980 H HB2  . ALA B 1 18 ? 6.027   6.038   -8.087  1.00 0.00 ? 289 ALA B HB2  6 
ATOM   7981 H HB3  . ALA B 1 18 ? 5.255   6.693   -9.533  1.00 0.00 ? 289 ALA B HB3  6 
ATOM   7982 N N    . GLN B 1 19 ? 4.913   5.186   -6.001  1.00 0.00 ? 290 GLN B N    6 
ATOM   7983 C CA   . GLN B 1 19 ? 5.176   4.104   -5.063  1.00 0.00 ? 290 GLN B CA   6 
ATOM   7984 C C    . GLN B 1 19 ? 3.852   3.459   -4.652  1.00 0.00 ? 290 GLN B C    6 
ATOM   7985 O O    . GLN B 1 19 ? 3.767   2.264   -4.448  1.00 0.00 ? 290 GLN B O    6 
ATOM   7986 C CB   . GLN B 1 19 ? 5.880   4.660   -3.824  1.00 0.00 ? 290 GLN B CB   6 
ATOM   7987 C CG   . GLN B 1 19 ? 7.394   4.589   -4.020  1.00 0.00 ? 290 GLN B CG   6 
ATOM   7988 C CD   . GLN B 1 19 ? 8.040   3.963   -2.780  1.00 0.00 ? 290 GLN B CD   6 
ATOM   7989 O OE1  . GLN B 1 19 ? 8.267   2.770   -2.736  1.00 0.00 ? 290 GLN B OE1  6 
ATOM   7990 N NE2  . GLN B 1 19 ? 8.349   4.725   -1.767  1.00 0.00 ? 290 GLN B NE2  6 
ATOM   7991 H H    . GLN B 1 19 ? 5.332   6.063   -5.869  1.00 0.00 ? 290 GLN B H    6 
ATOM   7992 H HA   . GLN B 1 19 ? 5.808   3.367   -5.534  1.00 0.00 ? 290 GLN B HA   6 
ATOM   7993 H HB2  . GLN B 1 19 ? 5.583   5.688   -3.672  1.00 0.00 ? 290 GLN B HB2  6 
ATOM   7994 H HB3  . GLN B 1 19 ? 5.603   4.075   -2.959  1.00 0.00 ? 290 GLN B HB3  6 
ATOM   7995 H HG2  . GLN B 1 19 ? 7.617   3.984   -4.885  1.00 0.00 ? 290 GLN B HG2  6 
ATOM   7996 H HG3  . GLN B 1 19 ? 7.787   5.585   -4.164  1.00 0.00 ? 290 GLN B HG3  6 
ATOM   7997 H HE21 . GLN B 1 19 ? 8.167   5.688   -1.804  1.00 0.00 ? 290 GLN B HE21 6 
ATOM   7998 H HE22 . GLN B 1 19 ? 8.762   4.334   -0.970  1.00 0.00 ? 290 GLN B HE22 6 
ATOM   7999 N N    . ASN B 1 20 ? 2.817   4.244   -4.529  1.00 0.00 ? 291 ASN B N    6 
ATOM   8000 C CA   . ASN B 1 20 ? 1.524   3.692   -4.141  1.00 0.00 ? 291 ASN B CA   6 
ATOM   8001 C C    . ASN B 1 20 ? 1.084   2.656   -5.176  1.00 0.00 ? 291 ASN B C    6 
ATOM   8002 O O    . ASN B 1 20 ? 0.969   1.483   -4.884  1.00 0.00 ? 291 ASN B O    6 
ATOM   8003 C CB   . ASN B 1 20 ? 0.490   4.817   -4.068  1.00 0.00 ? 291 ASN B CB   6 
ATOM   8004 C CG   . ASN B 1 20 ? -0.666  4.393   -3.162  1.00 0.00 ? 291 ASN B CG   6 
ATOM   8005 O OD1  . ASN B 1 20 ? -1.458  3.546   -3.522  1.00 0.00 ? 291 ASN B OD1  6 
ATOM   8006 N ND2  . ASN B 1 20 ? -0.797  4.951   -1.989  1.00 0.00 ? 291 ASN B ND2  6 
ATOM   8007 H H    . ASN B 1 20 ? 2.908   5.204   -4.698  1.00 0.00 ? 291 ASN B H    6 
ATOM   8008 H HA   . ASN B 1 20 ? 1.608   3.221   -3.173  1.00 0.00 ? 291 ASN B HA   6 
ATOM   8009 H HB2  . ASN B 1 20 ? 0.956   5.707   -3.669  1.00 0.00 ? 291 ASN B HB2  6 
ATOM   8010 H HB3  . ASN B 1 20 ? 0.112   5.023   -5.060  1.00 0.00 ? 291 ASN B HB3  6 
ATOM   8011 H HD21 . ASN B 1 20 ? -0.157  5.635   -1.697  1.00 0.00 ? 291 ASN B HD21 6 
ATOM   8012 H HD22 . ASN B 1 20 ? -1.535  4.687   -1.400  1.00 0.00 ? 291 ASN B HD22 6 
ATOM   8013 N N    . SER B 1 21 ? 0.839   3.077   -6.387  1.00 0.00 ? 292 SER B N    6 
ATOM   8014 C CA   . SER B 1 21 ? 0.419   2.133   -7.417  1.00 0.00 ? 292 SER B CA   6 
ATOM   8015 C C    . SER B 1 21 ? 1.399   0.958   -7.453  1.00 0.00 ? 292 SER B C    6 
ATOM   8016 O O    . SER B 1 21 ? 1.005   -0.189  -7.541  1.00 0.00 ? 292 SER B O    6 
ATOM   8017 C CB   . SER B 1 21 ? 0.410   2.831   -8.775  1.00 0.00 ? 292 SER B CB   6 
ATOM   8018 O OG   . SER B 1 21 ? 1.624   3.551   -8.944  1.00 0.00 ? 292 SER B OG   6 
ATOM   8019 H H    . SER B 1 21 ? 0.939   4.027   -6.605  1.00 0.00 ? 292 SER B H    6 
ATOM   8020 H HA   . SER B 1 21 ? -0.572  1.771   -7.192  1.00 0.00 ? 292 SER B HA   6 
ATOM   8021 H HB2  . SER B 1 21 ? 0.320   2.098   -9.560  1.00 0.00 ? 292 SER B HB2  6 
ATOM   8022 H HB3  . SER B 1 21 ? -0.432  3.511   -8.824  1.00 0.00 ? 292 SER B HB3  6 
ATOM   8023 H HG   . SER B 1 21 ? 1.620   4.287   -8.329  1.00 0.00 ? 292 SER B HG   6 
ATOM   8024 N N    . GLU B 1 22 ? 2.672   1.234   -7.386  1.00 0.00 ? 293 GLU B N    6 
ATOM   8025 C CA   . GLU B 1 22 ? 3.656   0.159   -7.414  1.00 0.00 ? 293 GLU B CA   6 
ATOM   8026 C C    . GLU B 1 22 ? 3.336   -0.852  -6.312  1.00 0.00 ? 293 GLU B C    6 
ATOM   8027 O O    . GLU B 1 22 ? 2.932   -1.967  -6.577  1.00 0.00 ? 293 GLU B O    6 
ATOM   8028 C CB   . GLU B 1 22 ? 5.053   0.741   -7.181  1.00 0.00 ? 293 GLU B CB   6 
ATOM   8029 C CG   . GLU B 1 22 ? 5.669   1.143   -8.522  1.00 0.00 ? 293 GLU B CG   6 
ATOM   8030 C CD   . GLU B 1 22 ? 6.594   2.346   -8.319  1.00 0.00 ? 293 GLU B CD   6 
ATOM   8031 O OE1  . GLU B 1 22 ? 6.942   2.614   -7.180  1.00 0.00 ? 293 GLU B OE1  6 
ATOM   8032 O OE2  . GLU B 1 22 ? 6.936   2.979   -9.304  1.00 0.00 ? 293 GLU B OE2  6 
ATOM   8033 H H    . GLU B 1 22 ? 2.967   2.166   -7.316  1.00 0.00 ? 293 GLU B H    6 
ATOM   8034 H HA   . GLU B 1 22 ? 3.629   -0.331  -8.376  1.00 0.00 ? 293 GLU B HA   6 
ATOM   8035 H HB2  . GLU B 1 22 ? 4.979   1.608   -6.541  1.00 0.00 ? 293 GLU B HB2  6 
ATOM   8036 H HB3  . GLU B 1 22 ? 5.677   -0.002  -6.708  1.00 0.00 ? 293 GLU B HB3  6 
ATOM   8037 H HG2  . GLU B 1 22 ? 6.237   0.315   -8.919  1.00 0.00 ? 293 GLU B HG2  6 
ATOM   8038 H HG3  . GLU B 1 22 ? 4.886   1.408   -9.214  1.00 0.00 ? 293 GLU B HG3  6 
ATOM   8039 N N    . LEU B 1 23 ? 3.516   -0.471  -5.077  1.00 0.00 ? 294 LEU B N    6 
ATOM   8040 C CA   . LEU B 1 23 ? 3.229   -1.387  -3.978  1.00 0.00 ? 294 LEU B CA   6 
ATOM   8041 C C    . LEU B 1 23 ? 1.891   -2.085  -4.226  1.00 0.00 ? 294 LEU B C    6 
ATOM   8042 O O    . LEU B 1 23 ? 1.803   -3.297  -4.221  1.00 0.00 ? 294 LEU B O    6 
ATOM   8043 C CB   . LEU B 1 23 ? 3.158   -0.597  -2.668  1.00 0.00 ? 294 LEU B CB   6 
ATOM   8044 C CG   . LEU B 1 23 ? 4.505   -0.676  -1.949  1.00 0.00 ? 294 LEU B CG   6 
ATOM   8045 C CD1  . LEU B 1 23 ? 4.654   0.524   -1.013  1.00 0.00 ? 294 LEU B CD1  6 
ATOM   8046 C CD2  . LEU B 1 23 ? 4.570   -1.970  -1.132  1.00 0.00 ? 294 LEU B CD2  6 
ATOM   8047 H H    . LEU B 1 23 ? 3.843   0.434   -4.889  1.00 0.00 ? 294 LEU B H    6 
ATOM   8048 H HA   . LEU B 1 23 ? 4.015   -2.124  -3.910  1.00 0.00 ? 294 LEU B HA   6 
ATOM   8049 H HB2  . LEU B 1 23 ? 2.926   0.435   -2.884  1.00 0.00 ? 294 LEU B HB2  6 
ATOM   8050 H HB3  . LEU B 1 23 ? 2.390   -1.017  -2.037  1.00 0.00 ? 294 LEU B HB3  6 
ATOM   8051 H HG   . LEU B 1 23 ? 5.304   -0.667  -2.674  1.00 0.00 ? 294 LEU B HG   6 
ATOM   8052 H HD11 . LEU B 1 23 ? 4.310   1.416   -1.515  1.00 0.00 ? 294 LEU B HD11 6 
ATOM   8053 H HD12 . LEU B 1 23 ? 4.064   0.361   -0.123  1.00 0.00 ? 294 LEU B HD12 6 
ATOM   8054 H HD13 . LEU B 1 23 ? 5.693   0.642   -0.741  1.00 0.00 ? 294 LEU B HD13 6 
ATOM   8055 H HD21 . LEU B 1 23 ? 3.686   -2.051  -0.517  1.00 0.00 ? 294 LEU B HD21 6 
ATOM   8056 H HD22 . LEU B 1 23 ? 4.622   -2.815  -1.800  1.00 0.00 ? 294 LEU B HD22 6 
ATOM   8057 H HD23 . LEU B 1 23 ? 5.446   -1.953  -0.502  1.00 0.00 ? 294 LEU B HD23 6 
ATOM   8058 N N    . ALA B 1 24 ? 0.848   -1.330  -4.438  1.00 0.00 ? 295 ALA B N    6 
ATOM   8059 C CA   . ALA B 1 24 ? -0.457  -1.935  -4.675  1.00 0.00 ? 295 ALA B CA   6 
ATOM   8060 C C    . ALA B 1 24 ? -0.333  -3.043  -5.723  1.00 0.00 ? 295 ALA B C    6 
ATOM   8061 O O    . ALA B 1 24 ? -0.951  -4.082  -5.619  1.00 0.00 ? 295 ALA B O    6 
ATOM   8062 C CB   . ALA B 1 24 ? -1.430  -0.867  -5.174  1.00 0.00 ? 295 ALA B CB   6 
ATOM   8063 H H    . ALA B 1 24 ? 0.942   -0.355  -4.434  1.00 0.00 ? 295 ALA B H    6 
ATOM   8064 H HA   . ALA B 1 24 ? -0.830  -2.355  -3.752  1.00 0.00 ? 295 ALA B HA   6 
ATOM   8065 H HB1  . ALA B 1 24 ? -0.878  0.007   -5.486  1.00 0.00 ? 295 ALA B HB1  6 
ATOM   8066 H HB2  . ALA B 1 24 ? -1.991  -1.255  -6.012  1.00 0.00 ? 295 ALA B HB2  6 
ATOM   8067 H HB3  . ALA B 1 24 ? -2.110  -0.599  -4.379  1.00 0.00 ? 295 ALA B HB3  6 
ATOM   8068 N N    . SER B 1 25 ? 0.460   -2.829  -6.738  1.00 0.00 ? 296 SER B N    6 
ATOM   8069 C CA   . SER B 1 25 ? 0.614   -3.849  -7.770  1.00 0.00 ? 296 SER B CA   6 
ATOM   8070 C C    . SER B 1 25 ? 1.220   -5.112  -7.156  1.00 0.00 ? 296 SER B C    6 
ATOM   8071 O O    . SER B 1 25 ? 0.628   -6.172  -7.187  1.00 0.00 ? 296 SER B O    6 
ATOM   8072 C CB   . SER B 1 25 ? 1.533   -3.323  -8.873  1.00 0.00 ? 296 SER B CB   6 
ATOM   8073 O OG   . SER B 1 25 ? 1.143   -2.001  -9.220  1.00 0.00 ? 296 SER B OG   6 
ATOM   8074 H H    . SER B 1 25 ? 0.949   -1.982  -6.809  1.00 0.00 ? 296 SER B H    6 
ATOM   8075 H HA   . SER B 1 25 ? -0.352  -4.081  -8.191  1.00 0.00 ? 296 SER B HA   6 
ATOM   8076 H HB2  . SER B 1 25 ? 2.551   -3.312  -8.521  1.00 0.00 ? 296 SER B HB2  6 
ATOM   8077 H HB3  . SER B 1 25 ? 1.460   -3.971  -9.737  1.00 0.00 ? 296 SER B HB3  6 
ATOM   8078 H HG   . SER B 1 25 ? 1.778   -1.661  -9.853  1.00 0.00 ? 296 SER B HG   6 
ATOM   8079 N N    . THR B 1 26 ? 2.396   -5.011  -6.600  1.00 0.00 ? 297 THR B N    6 
ATOM   8080 C CA   . THR B 1 26 ? 3.021   -6.185  -6.001  1.00 0.00 ? 297 THR B CA   6 
ATOM   8081 C C    . THR B 1 26 ? 2.004   -6.906  -5.115  1.00 0.00 ? 297 THR B C    6 
ATOM   8082 O O    . THR B 1 26 ? 1.888   -8.116  -5.145  1.00 0.00 ? 297 THR B O    6 
ATOM   8083 C CB   . THR B 1 26 ? 4.222   -5.754  -5.158  1.00 0.00 ? 297 THR B CB   6 
ATOM   8084 O OG1  . THR B 1 26 ? 4.955   -4.759  -5.856  1.00 0.00 ? 297 THR B OG1  6 
ATOM   8085 C CG2  . THR B 1 26 ? 5.120   -6.963  -4.891  1.00 0.00 ? 297 THR B CG2  6 
ATOM   8086 H H    . THR B 1 26 ? 2.859   -4.147  -6.585  1.00 0.00 ? 297 THR B H    6 
ATOM   8087 H HA   . THR B 1 26 ? 3.354   -6.852  -6.782  1.00 0.00 ? 297 THR B HA   6 
ATOM   8088 H HB   . THR B 1 26 ? 3.876   -5.354  -4.216  1.00 0.00 ? 297 THR B HB   6 
ATOM   8089 H HG1  . THR B 1 26 ? 5.122   -5.083  -6.745  1.00 0.00 ? 297 THR B HG1  6 
ATOM   8090 H HG21 . THR B 1 26 ? 5.189   -7.564  -5.784  1.00 0.00 ? 297 THR B HG21 6 
ATOM   8091 H HG22 . THR B 1 26 ? 6.107   -6.622  -4.609  1.00 0.00 ? 297 THR B HG22 6 
ATOM   8092 H HG23 . THR B 1 26 ? 4.701   -7.554  -4.089  1.00 0.00 ? 297 THR B HG23 6 
ATOM   8093 N N    . ALA B 1 27 ? 1.265   -6.174  -4.328  1.00 0.00 ? 298 ALA B N    6 
ATOM   8094 C CA   . ALA B 1 27 ? 0.278   -6.805  -3.460  1.00 0.00 ? 298 ALA B CA   6 
ATOM   8095 C C    . ALA B 1 27 ? -0.812  -7.448  -4.320  1.00 0.00 ? 298 ALA B C    6 
ATOM   8096 O O    . ALA B 1 27 ? -1.329  -8.499  -3.999  1.00 0.00 ? 298 ALA B O    6 
ATOM   8097 C CB   . ALA B 1 27 ? -0.346  -5.749  -2.547  1.00 0.00 ? 298 ALA B CB   6 
ATOM   8098 H H    . ALA B 1 27 ? 1.374   -5.200  -4.320  1.00 0.00 ? 298 ALA B H    6 
ATOM   8099 H HA   . ALA B 1 27 ? 0.758   -7.563  -2.858  1.00 0.00 ? 298 ALA B HA   6 
ATOM   8100 H HB1  . ALA B 1 27 ? 0.197   -4.822  -2.649  1.00 0.00 ? 298 ALA B HB1  6 
ATOM   8101 H HB2  . ALA B 1 27 ? -1.377  -5.596  -2.827  1.00 0.00 ? 298 ALA B HB2  6 
ATOM   8102 H HB3  . ALA B 1 27 ? -0.295  -6.086  -1.522  1.00 0.00 ? 298 ALA B HB3  6 
ATOM   8103 N N    . ASN B 1 28 ? -1.166  -6.825  -5.410  1.00 0.00 ? 299 ASN B N    6 
ATOM   8104 C CA   . ASN B 1 28 ? -2.199  -7.389  -6.270  1.00 0.00 ? 299 ASN B CA   6 
ATOM   8105 C C    . ASN B 1 28 ? -1.748  -8.764  -6.770  1.00 0.00 ? 299 ASN B C    6 
ATOM   8106 O O    . ASN B 1 28 ? -2.432  -9.753  -6.595  1.00 0.00 ? 299 ASN B O    6 
ATOM   8107 C CB   . ASN B 1 28 ? -2.436  -6.463  -7.464  1.00 0.00 ? 299 ASN B CB   6 
ATOM   8108 C CG   . ASN B 1 28 ? -3.692  -6.910  -8.215  1.00 0.00 ? 299 ASN B CG   6 
ATOM   8109 O OD1  . ASN B 1 28 ? -3.624  -7.740  -9.101  1.00 0.00 ? 299 ASN B OD1  6 
ATOM   8110 N ND2  . ASN B 1 28 ? -4.848  -6.392  -7.894  1.00 0.00 ? 299 ASN B ND2  6 
ATOM   8111 H H    . ASN B 1 28 ? -0.735  -5.978  -5.652  1.00 0.00 ? 299 ASN B H    6 
ATOM   8112 H HA   . ASN B 1 28 ? -3.116  -7.493  -5.711  1.00 0.00 ? 299 ASN B HA   6 
ATOM   8113 H HB2  . ASN B 1 28 ? -2.565  -5.449  -7.113  1.00 0.00 ? 299 ASN B HB2  6 
ATOM   8114 H HB3  . ASN B 1 28 ? -1.587  -6.508  -8.129  1.00 0.00 ? 299 ASN B HB3  6 
ATOM   8115 H HD21 . ASN B 1 28 ? -4.902  -5.724  -7.180  1.00 0.00 ? 299 ASN B HD21 6 
ATOM   8116 H HD22 . ASN B 1 28 ? -5.657  -6.670  -8.369  1.00 0.00 ? 299 ASN B HD22 6 
ATOM   8117 N N    . MET B 1 29 ? -0.600  -8.836  -7.387  1.00 0.00 ? 300 MET B N    6 
ATOM   8118 C CA   . MET B 1 29 ? -0.122  -10.122 -7.879  1.00 0.00 ? 300 MET B CA   6 
ATOM   8119 C C    . MET B 1 29 ? -0.050  -11.109 -6.715  1.00 0.00 ? 300 MET B C    6 
ATOM   8120 O O    . MET B 1 29 ? -0.578  -12.202 -6.781  1.00 0.00 ? 300 MET B O    6 
ATOM   8121 C CB   . MET B 1 29 ? 1.269   -9.955  -8.493  1.00 0.00 ? 300 MET B CB   6 
ATOM   8122 C CG   . MET B 1 29 ? 1.820   -11.330 -8.873  1.00 0.00 ? 300 MET B CG   6 
ATOM   8123 S SD   . MET B 1 29 ? 3.522   -11.485 -8.273  1.00 0.00 ? 300 MET B SD   6 
ATOM   8124 C CE   . MET B 1 29 ? 4.150   -12.497 -9.634  1.00 0.00 ? 300 MET B CE   6 
ATOM   8125 H H    . MET B 1 29 ? -0.061  -8.028  -7.516  1.00 0.00 ? 300 MET B H    6 
ATOM   8126 H HA   . MET B 1 29 ? -0.801  -10.495 -8.628  1.00 0.00 ? 300 MET B HA   6 
ATOM   8127 H HB2  . MET B 1 29 ? 1.202   -9.334  -9.375  1.00 0.00 ? 300 MET B HB2  6 
ATOM   8128 H HB3  . MET B 1 29 ? 1.929   -9.490  -7.774  1.00 0.00 ? 300 MET B HB3  6 
ATOM   8129 H HG2  . MET B 1 29 ? 1.207   -12.098 -8.424  1.00 0.00 ? 300 MET B HG2  6 
ATOM   8130 H HG3  . MET B 1 29 ? 1.806   -11.439 -9.947  1.00 0.00 ? 300 MET B HG3  6 
ATOM   8131 H HE1  . MET B 1 29 ? 3.382   -12.607 -10.387 1.00 0.00 ? 300 MET B HE1  6 
ATOM   8132 H HE2  . MET B 1 29 ? 5.019   -12.017 -10.067 1.00 0.00 ? 300 MET B HE2  6 
ATOM   8133 H HE3  . MET B 1 29 ? 4.429   -13.470 -9.265  1.00 0.00 ? 300 MET B HE3  6 
ATOM   8134 N N    . LEU B 1 30 ? 0.595   -10.735 -5.643  1.00 0.00 ? 301 LEU B N    6 
ATOM   8135 C CA   . LEU B 1 30 ? 0.689   -11.634 -4.500  1.00 0.00 ? 301 LEU B CA   6 
ATOM   8136 C C    . LEU B 1 30 ? -0.693  -12.218 -4.210  1.00 0.00 ? 301 LEU B C    6 
ATOM   8137 O O    . LEU B 1 30 ? -0.830  -13.374 -3.858  1.00 0.00 ? 301 LEU B O    6 
ATOM   8138 C CB   . LEU B 1 30 ? 1.181   -10.858 -3.277  1.00 0.00 ? 301 LEU B CB   6 
ATOM   8139 C CG   . LEU B 1 30 ? 2.709   -10.814 -3.277  1.00 0.00 ? 301 LEU B CG   6 
ATOM   8140 C CD1  . LEU B 1 30 ? 3.194   -9.953  -2.108  1.00 0.00 ? 301 LEU B CD1  6 
ATOM   8141 C CD2  . LEU B 1 30 ? 3.259   -12.234 -3.123  1.00 0.00 ? 301 LEU B CD2  6 
ATOM   8142 H H    . LEU B 1 30 ? 1.010   -9.848  -5.606  1.00 0.00 ? 301 LEU B H    6 
ATOM   8143 H HA   . LEU B 1 30 ? 1.382   -12.432 -4.724  1.00 0.00 ? 301 LEU B HA   6 
ATOM   8144 H HB2  . LEU B 1 30 ? 0.791   -9.850  -3.311  1.00 0.00 ? 301 LEU B HB2  6 
ATOM   8145 H HB3  . LEU B 1 30 ? 0.836   -11.348 -2.379  1.00 0.00 ? 301 LEU B HB3  6 
ATOM   8146 H HG   . LEU B 1 30 ? 3.058   -10.389 -4.206  1.00 0.00 ? 301 LEU B HG   6 
ATOM   8147 H HD11 . LEU B 1 30 ? 2.373   -9.361  -1.732  1.00 0.00 ? 301 LEU B HD11 6 
ATOM   8148 H HD12 . LEU B 1 30 ? 3.568   -10.591 -1.322  1.00 0.00 ? 301 LEU B HD12 6 
ATOM   8149 H HD13 . LEU B 1 30 ? 3.982   -9.298  -2.448  1.00 0.00 ? 301 LEU B HD13 6 
ATOM   8150 H HD21 . LEU B 1 30 ? 2.457   -12.946 -3.243  1.00 0.00 ? 301 LEU B HD21 6 
ATOM   8151 H HD22 . LEU B 1 30 ? 4.012   -12.411 -3.876  1.00 0.00 ? 301 LEU B HD22 6 
ATOM   8152 H HD23 . LEU B 1 30 ? 3.697   -12.347 -2.142  1.00 0.00 ? 301 LEU B HD23 6 
ATOM   8153 N N    . ARG B 1 31 ? -1.721  -11.428 -4.358  1.00 0.00 ? 302 ARG B N    6 
ATOM   8154 C CA   . ARG B 1 31 ? -3.067  -11.921 -4.100  1.00 0.00 ? 302 ARG B CA   6 
ATOM   8155 C C    . ARG B 1 31 ? -3.513  -12.815 -5.259  1.00 0.00 ? 302 ARG B C    6 
ATOM   8156 O O    . ARG B 1 31 ? -4.365  -13.667 -5.104  1.00 0.00 ? 302 ARG B O    6 
ATOM   8157 C CB   . ARG B 1 31 ? -4.028  -10.737 -3.969  1.00 0.00 ? 302 ARG B CB   6 
ATOM   8158 C CG   . ARG B 1 31 ? -5.276  -11.178 -3.204  1.00 0.00 ? 302 ARG B CG   6 
ATOM   8159 C CD   . ARG B 1 31 ? -6.459  -10.295 -3.605  1.00 0.00 ? 302 ARG B CD   6 
ATOM   8160 N NE   . ARG B 1 31 ? -6.741  -9.343  -2.537  1.00 0.00 ? 302 ARG B NE   6 
ATOM   8161 C CZ   . ARG B 1 31 ? -7.504  -8.310  -2.765  1.00 0.00 ? 302 ARG B CZ   6 
ATOM   8162 N NH1  . ARG B 1 31 ? -8.732  -8.484  -3.172  1.00 0.00 ? 302 ARG B NH1  6 
ATOM   8163 N NH2  . ARG B 1 31 ? -7.039  -7.103  -2.585  1.00 0.00 ? 302 ARG B NH2  6 
ATOM   8164 H H    . ARG B 1 31 ? -1.585  -10.501 -4.644  1.00 0.00 ? 302 ARG B H    6 
ATOM   8165 H HA   . ARG B 1 31 ? -3.071  -12.490 -3.182  1.00 0.00 ? 302 ARG B HA   6 
ATOM   8166 H HB2  . ARG B 1 31 ? -3.538  -9.935  -3.434  1.00 0.00 ? 302 ARG B HB2  6 
ATOM   8167 H HB3  . ARG B 1 31 ? -4.312  -10.395 -4.951  1.00 0.00 ? 302 ARG B HB3  6 
ATOM   8168 H HG2  . ARG B 1 31 ? -5.498  -12.208 -3.441  1.00 0.00 ? 302 ARG B HG2  6 
ATOM   8169 H HG3  . ARG B 1 31 ? -5.101  -11.080 -2.143  1.00 0.00 ? 302 ARG B HG3  6 
ATOM   8170 H HD2  . ARG B 1 31 ? -6.217  -9.758  -4.510  1.00 0.00 ? 302 ARG B HD2  6 
ATOM   8171 H HD3  . ARG B 1 31 ? -7.328  -10.915 -3.776  1.00 0.00 ? 302 ARG B HD3  6 
ATOM   8172 H HE   . ARG B 1 31 ? -6.357  -9.480  -1.645  1.00 0.00 ? 302 ARG B HE   6 
ATOM   8173 H HH11 . ARG B 1 31 ? -9.086  -9.408  -3.309  1.00 0.00 ? 302 ARG B HH11 6 
ATOM   8174 H HH12 . ARG B 1 31 ? -9.318  -7.693  -3.347  1.00 0.00 ? 302 ARG B HH12 6 
ATOM   8175 H HH21 . ARG B 1 31 ? -6.098  -6.972  -2.272  1.00 0.00 ? 302 ARG B HH21 6 
ATOM   8176 H HH22 . ARG B 1 31 ? -7.624  -6.311  -2.760  1.00 0.00 ? 302 ARG B HH22 6 
ATOM   8177 N N    . GLU B 1 32 ? -2.941  -12.630 -6.419  1.00 0.00 ? 303 GLU B N    6 
ATOM   8178 C CA   . GLU B 1 32 ? -3.326  -13.456 -7.556  1.00 0.00 ? 303 GLU B CA   6 
ATOM   8179 C C    . GLU B 1 32 ? -2.765  -14.865 -7.363  1.00 0.00 ? 303 GLU B C    6 
ATOM   8180 O O    . GLU B 1 32 ? -3.448  -15.850 -7.568  1.00 0.00 ? 303 GLU B O    6 
ATOM   8181 C CB   . GLU B 1 32 ? -2.764  -12.843 -8.841  1.00 0.00 ? 303 GLU B CB   6 
ATOM   8182 C CG   . GLU B 1 32 ? -2.823  -13.871 -9.973  1.00 0.00 ? 303 GLU B CG   6 
ATOM   8183 C CD   . GLU B 1 32 ? -4.283  -14.190 -10.297 1.00 0.00 ? 303 GLU B CD   6 
ATOM   8184 O OE1  . GLU B 1 32 ? -4.906  -14.882 -9.511  1.00 0.00 ? 303 GLU B OE1  6 
ATOM   8185 O OE2  . GLU B 1 32 ? -4.753  -13.736 -11.328 1.00 0.00 ? 303 GLU B OE2  6 
ATOM   8186 H H    . GLU B 1 32 ? -2.253  -11.942 -6.525  1.00 0.00 ? 303 GLU B H    6 
ATOM   8187 H HA   . GLU B 1 32 ? -4.402  -13.500 -7.620  1.00 0.00 ? 303 GLU B HA   6 
ATOM   8188 H HB2  . GLU B 1 32 ? -3.349  -11.976 -9.112  1.00 0.00 ? 303 GLU B HB2  6 
ATOM   8189 H HB3  . GLU B 1 32 ? -1.737  -12.548 -8.679  1.00 0.00 ? 303 GLU B HB3  6 
ATOM   8190 H HG2  . GLU B 1 32 ? -2.337  -13.469 -10.849 1.00 0.00 ? 303 GLU B HG2  6 
ATOM   8191 H HG3  . GLU B 1 32 ? -2.320  -14.775 -9.664  1.00 0.00 ? 303 GLU B HG3  6 
ATOM   8192 N N    . GLN B 1 33 ? -1.526  -14.969 -6.967  1.00 0.00 ? 304 GLN B N    6 
ATOM   8193 C CA   . GLN B 1 33 ? -0.936  -16.285 -6.762  1.00 0.00 ? 304 GLN B CA   6 
ATOM   8194 C C    . GLN B 1 33 ? -1.495  -16.893 -5.475  1.00 0.00 ? 304 GLN B C    6 
ATOM   8195 O O    . GLN B 1 33 ? -1.587  -18.097 -5.333  1.00 0.00 ? 304 GLN B O    6 
ATOM   8196 C CB   . GLN B 1 33 ? 0.584   -16.153 -6.649  1.00 0.00 ? 304 GLN B CB   6 
ATOM   8197 C CG   . GLN B 1 33 ? 0.928   -15.125 -5.572  1.00 0.00 ? 304 GLN B CG   6 
ATOM   8198 C CD   . GLN B 1 33 ? 2.300   -15.450 -4.978  1.00 0.00 ? 304 GLN B CD   6 
ATOM   8199 O OE1  . GLN B 1 33 ? 3.137   -14.581 -4.845  1.00 0.00 ? 304 GLN B OE1  6 
ATOM   8200 N NE2  . GLN B 1 33 ? 2.564   -16.674 -4.613  1.00 0.00 ? 304 GLN B NE2  6 
ATOM   8201 H H    . GLN B 1 33 ? -0.994  -14.162 -6.803  1.00 0.00 ? 304 GLN B H    6 
ATOM   8202 H HA   . GLN B 1 33 ? -1.179  -16.924 -7.597  1.00 0.00 ? 304 GLN B HA   6 
ATOM   8203 H HB2  . GLN B 1 33 ? 1.010   -17.110 -6.385  1.00 0.00 ? 304 GLN B HB2  6 
ATOM   8204 H HB3  . GLN B 1 33 ? 0.987   -15.828 -7.596  1.00 0.00 ? 304 GLN B HB3  6 
ATOM   8205 H HG2  . GLN B 1 33 ? 0.949   -14.137 -6.010  1.00 0.00 ? 304 GLN B HG2  6 
ATOM   8206 H HG3  . GLN B 1 33 ? 0.182   -15.156 -4.791  1.00 0.00 ? 304 GLN B HG3  6 
ATOM   8207 H HE21 . GLN B 1 33 ? 1.887   -17.376 -4.721  1.00 0.00 ? 304 GLN B HE21 6 
ATOM   8208 H HE22 . GLN B 1 33 ? 3.439   -16.894 -4.232  1.00 0.00 ? 304 GLN B HE22 6 
ATOM   8209 N N    . VAL B 1 34 ? -1.875  -16.070 -4.537  1.00 0.00 ? 305 VAL B N    6 
ATOM   8210 C CA   . VAL B 1 34 ? -2.422  -16.588 -3.290  1.00 0.00 ? 305 VAL B CA   6 
ATOM   8211 C C    . VAL B 1 34 ? -3.839  -17.110 -3.541  1.00 0.00 ? 305 VAL B C    6 
ATOM   8212 O O    . VAL B 1 34 ? -4.227  -18.149 -3.045  1.00 0.00 ? 305 VAL B O    6 
ATOM   8213 C CB   . VAL B 1 34 ? -2.466  -15.472 -2.244  1.00 0.00 ? 305 VAL B CB   6 
ATOM   8214 C CG1  . VAL B 1 34 ? -3.282  -15.937 -1.035  1.00 0.00 ? 305 VAL B CG1  6 
ATOM   8215 C CG2  . VAL B 1 34 ? -1.042  -15.135 -1.799  1.00 0.00 ? 305 VAL B CG2  6 
ATOM   8216 H H    . VAL B 1 34 ? -1.796  -15.102 -4.671  1.00 0.00 ? 305 VAL B H    6 
ATOM   8217 H HA   . VAL B 1 34 ? -1.800  -17.394 -2.927  1.00 0.00 ? 305 VAL B HA   6 
ATOM   8218 H HB   . VAL B 1 34 ? -2.930  -14.596 -2.673  1.00 0.00 ? 305 VAL B HB   6 
ATOM   8219 H HG11 . VAL B 1 34 ? -3.131  -16.997 -0.884  1.00 0.00 ? 305 VAL B HG11 6 
ATOM   8220 H HG12 . VAL B 1 34 ? -2.958  -15.400 -0.154  1.00 0.00 ? 305 VAL B HG12 6 
ATOM   8221 H HG13 . VAL B 1 34 ? -4.329  -15.744 -1.210  1.00 0.00 ? 305 VAL B HG13 6 
ATOM   8222 H HG21 . VAL B 1 34 ? -0.364  -15.259 -2.630  1.00 0.00 ? 305 VAL B HG21 6 
ATOM   8223 H HG22 . VAL B 1 34 ? -1.004  -14.113 -1.453  1.00 0.00 ? 305 VAL B HG22 6 
ATOM   8224 H HG23 . VAL B 1 34 ? -0.751  -15.795 -0.995  1.00 0.00 ? 305 VAL B HG23 6 
ATOM   8225 N N    . ALA B 1 35 ? -4.611  -16.397 -4.313  1.00 0.00 ? 306 ALA B N    6 
ATOM   8226 C CA   . ALA B 1 35 ? -5.971  -16.842 -4.597  1.00 0.00 ? 306 ALA B CA   6 
ATOM   8227 C C    . ALA B 1 35 ? -5.919  -18.176 -5.342  1.00 0.00 ? 306 ALA B C    6 
ATOM   8228 O O    . ALA B 1 35 ? -6.581  -19.127 -4.976  1.00 0.00 ? 306 ALA B O    6 
ATOM   8229 C CB   . ALA B 1 35 ? -6.679  -15.801 -5.463  1.00 0.00 ? 306 ALA B CB   6 
ATOM   8230 H H    . ALA B 1 35 ? -4.277  -15.564 -4.707  1.00 0.00 ? 306 ALA B H    6 
ATOM   8231 H HA   . ALA B 1 35 ? -6.510  -16.966 -3.670  1.00 0.00 ? 306 ALA B HA   6 
ATOM   8232 H HB1  . ALA B 1 35 ? -5.947  -15.142 -5.906  1.00 0.00 ? 306 ALA B HB1  6 
ATOM   8233 H HB2  . ALA B 1 35 ? -7.232  -16.300 -6.245  1.00 0.00 ? 306 ALA B HB2  6 
ATOM   8234 H HB3  . ALA B 1 35 ? -7.360  -15.227 -4.853  1.00 0.00 ? 306 ALA B HB3  6 
ATOM   8235 N N    . GLN B 1 36 ? -5.135  -18.258 -6.382  1.00 0.00 ? 307 GLN B N    6 
ATOM   8236 C CA   . GLN B 1 36 ? -5.040  -19.506 -7.126  1.00 0.00 ? 307 GLN B CA   6 
ATOM   8237 C C    . GLN B 1 36 ? -4.419  -20.577 -6.229  1.00 0.00 ? 307 GLN B C    6 
ATOM   8238 O O    . GLN B 1 36 ? -4.704  -21.751 -6.354  1.00 0.00 ? 307 GLN B O    6 
ATOM   8239 C CB   . GLN B 1 36 ? -4.165  -19.301 -8.364  1.00 0.00 ? 307 GLN B CB   6 
ATOM   8240 C CG   . GLN B 1 36 ? -2.811  -18.728 -7.942  1.00 0.00 ? 307 GLN B CG   6 
ATOM   8241 C CD   . GLN B 1 36 ? -1.775  -19.853 -7.889  1.00 0.00 ? 307 GLN B CD   6 
ATOM   8242 O OE1  . GLN B 1 36 ? -1.721  -20.600 -6.933  1.00 0.00 ? 307 GLN B OE1  6 
ATOM   8243 N NE2  . GLN B 1 36 ? -0.946  -20.006 -8.886  1.00 0.00 ? 307 GLN B NE2  6 
ATOM   8244 H H    . GLN B 1 36 ? -4.604  -17.481 -6.657  1.00 0.00 ? 307 GLN B H    6 
ATOM   8245 H HA   . GLN B 1 36 ? -6.028  -19.820 -7.433  1.00 0.00 ? 307 GLN B HA   6 
ATOM   8246 H HB2  . GLN B 1 36 ? -4.017  -20.249 -8.861  1.00 0.00 ? 307 GLN B HB2  6 
ATOM   8247 H HB3  . GLN B 1 36 ? -4.649  -18.611 -9.038  1.00 0.00 ? 307 GLN B HB3  6 
ATOM   8248 H HG2  . GLN B 1 36 ? -2.498  -17.981 -8.658  1.00 0.00 ? 307 GLN B HG2  6 
ATOM   8249 H HG3  . GLN B 1 36 ? -2.899  -18.276 -6.965  1.00 0.00 ? 307 GLN B HG3  6 
ATOM   8250 H HE21 . GLN B 1 36 ? -0.991  -19.402 -9.658  1.00 0.00 ? 307 GLN B HE21 6 
ATOM   8251 H HE22 . GLN B 1 36 ? -0.280  -20.724 -8.863  1.00 0.00 ? 307 GLN B HE22 6 
ATOM   8252 N N    . LEU B 1 37 ? -3.576  -20.177 -5.317  1.00 0.00 ? 308 LEU B N    6 
ATOM   8253 C CA   . LEU B 1 37 ? -2.952  -21.144 -4.424  1.00 0.00 ? 308 LEU B CA   6 
ATOM   8254 C C    . LEU B 1 37 ? -4.041  -21.842 -3.606  1.00 0.00 ? 308 LEU B C    6 
ATOM   8255 O O    . LEU B 1 37 ? -4.133  -23.053 -3.581  1.00 0.00 ? 308 LEU B O    6 
ATOM   8256 C CB   . LEU B 1 37 ? -1.989  -20.418 -3.482  1.00 0.00 ? 308 LEU B CB   6 
ATOM   8257 C CG   . LEU B 1 37 ? -0.548  -20.741 -3.877  1.00 0.00 ? 308 LEU B CG   6 
ATOM   8258 C CD1  . LEU B 1 37 ? 0.356   -19.558 -3.525  1.00 0.00 ? 308 LEU B CD1  6 
ATOM   8259 C CD2  . LEU B 1 37 ? -0.077  -21.984 -3.118  1.00 0.00 ? 308 LEU B CD2  6 
ATOM   8260 H H    . LEU B 1 37 ? -3.365  -19.224 -5.232  1.00 0.00 ? 308 LEU B H    6 
ATOM   8261 H HA   . LEU B 1 37 ? -2.410  -21.874 -5.003  1.00 0.00 ? 308 LEU B HA   6 
ATOM   8262 H HB2  . LEU B 1 37 ? -2.152  -19.352 -3.553  1.00 0.00 ? 308 LEU B HB2  6 
ATOM   8263 H HB3  . LEU B 1 37 ? -2.164  -20.743 -2.468  1.00 0.00 ? 308 LEU B HB3  6 
ATOM   8264 H HG   . LEU B 1 37 ? -0.498  -20.926 -4.940  1.00 0.00 ? 308 LEU B HG   6 
ATOM   8265 H HD11 . LEU B 1 37 ? -0.244  -18.665 -3.425  1.00 0.00 ? 308 LEU B HD11 6 
ATOM   8266 H HD12 . LEU B 1 37 ? 0.862   -19.758 -2.591  1.00 0.00 ? 308 LEU B HD12 6 
ATOM   8267 H HD13 . LEU B 1 37 ? 1.086   -19.417 -4.307  1.00 0.00 ? 308 LEU B HD13 6 
ATOM   8268 H HD21 . LEU B 1 37 ? -0.536  -22.005 -2.141  1.00 0.00 ? 308 LEU B HD21 6 
ATOM   8269 H HD22 . LEU B 1 37 ? -0.362  -22.869 -3.667  1.00 0.00 ? 308 LEU B HD22 6 
ATOM   8270 H HD23 . LEU B 1 37 ? 0.996   -21.956 -3.010  1.00 0.00 ? 308 LEU B HD23 6 
ATOM   8271 N N    . LYS B 1 38 ? -4.870  -21.085 -2.942  1.00 0.00 ? 309 LYS B N    6 
ATOM   8272 C CA   . LYS B 1 38 ? -5.934  -21.687 -2.147  1.00 0.00 ? 309 LYS B CA   6 
ATOM   8273 C C    . LYS B 1 38 ? -6.758  -22.621 -3.033  1.00 0.00 ? 309 LYS B C    6 
ATOM   8274 O O    . LYS B 1 38 ? -6.963  -23.777 -2.719  1.00 0.00 ? 309 LYS B O    6 
ATOM   8275 C CB   . LYS B 1 38 ? -6.842  -20.586 -1.591  1.00 0.00 ? 309 LYS B CB   6 
ATOM   8276 C CG   . LYS B 1 38 ? -6.012  -19.611 -0.755  1.00 0.00 ? 309 LYS B CG   6 
ATOM   8277 C CD   . LYS B 1 38 ? -5.722  -20.229 0.613   1.00 0.00 ? 309 LYS B CD   6 
ATOM   8278 C CE   . LYS B 1 38 ? -5.397  -19.120 1.615   1.00 0.00 ? 309 LYS B CE   6 
ATOM   8279 N NZ   . LYS B 1 38 ? -4.051  -19.366 2.207   1.00 0.00 ? 309 LYS B NZ   6 
ATOM   8280 H H    . LYS B 1 38 ? -4.779  -20.109 -2.979  1.00 0.00 ? 309 LYS B H    6 
ATOM   8281 H HA   . LYS B 1 38 ? -5.504  -22.247 -1.329  1.00 0.00 ? 309 LYS B HA   6 
ATOM   8282 H HB2  . LYS B 1 38 ? -7.306  -20.055 -2.410  1.00 0.00 ? 309 LYS B HB2  6 
ATOM   8283 H HB3  . LYS B 1 38 ? -7.606  -21.029 -0.970  1.00 0.00 ? 309 LYS B HB3  6 
ATOM   8284 H HG2  . LYS B 1 38 ? -5.080  -19.403 -1.264  1.00 0.00 ? 309 LYS B HG2  6 
ATOM   8285 H HG3  . LYS B 1 38 ? -6.562  -18.691 -0.624  1.00 0.00 ? 309 LYS B HG3  6 
ATOM   8286 H HD2  . LYS B 1 38 ? -6.589  -20.776 0.952   1.00 0.00 ? 309 LYS B HD2  6 
ATOM   8287 H HD3  . LYS B 1 38 ? -4.879  -20.900 0.536   1.00 0.00 ? 309 LYS B HD3  6 
ATOM   8288 H HE2  . LYS B 1 38 ? -5.400  -18.165 1.111   1.00 0.00 ? 309 LYS B HE2  6 
ATOM   8289 H HE3  . LYS B 1 38 ? -6.138  -19.116 2.400   1.00 0.00 ? 309 LYS B HE3  6 
ATOM   8290 H HZ1  . LYS B 1 38 ? -3.531  -20.044 1.614   1.00 0.00 ? 309 LYS B HZ1  6 
ATOM   8291 H HZ2  . LYS B 1 38 ? -3.523  -18.472 2.252   1.00 0.00 ? 309 LYS B HZ2  6 
ATOM   8292 H HZ3  . LYS B 1 38 ? -4.161  -19.754 3.166   1.00 0.00 ? 309 LYS B HZ3  6 
ATOM   8293 N N    . GLN B 1 39 ? -7.235  -22.124 -4.141  1.00 0.00 ? 310 GLN B N    6 
ATOM   8294 C CA   . GLN B 1 39 ? -8.034  -22.954 -5.035  1.00 0.00 ? 310 GLN B CA   6 
ATOM   8295 C C    . GLN B 1 39 ? -7.294  -24.263 -5.328  1.00 0.00 ? 310 GLN B C    6 
ATOM   8296 O O    . GLN B 1 39 ? -7.880  -25.325 -5.353  1.00 0.00 ? 310 GLN B O    6 
ATOM   8297 C CB   . GLN B 1 39 ? -8.271  -22.198 -6.344  1.00 0.00 ? 310 GLN B CB   6 
ATOM   8298 C CG   . GLN B 1 39 ? -8.900  -23.137 -7.372  1.00 0.00 ? 310 GLN B CG   6 
ATOM   8299 C CD   . GLN B 1 39 ? -10.215 -22.537 -7.874  1.00 0.00 ? 310 GLN B CD   6 
ATOM   8300 O OE1  . GLN B 1 39 ? -10.724 -21.595 -7.298  1.00 0.00 ? 310 GLN B OE1  6 
ATOM   8301 N NE2  . GLN B 1 39 ? -10.790 -23.044 -8.930  1.00 0.00 ? 310 GLN B NE2  6 
ATOM   8302 H H    . GLN B 1 39 ? -7.059  -21.187 -4.371  1.00 0.00 ? 310 GLN B H    6 
ATOM   8303 H HA   . GLN B 1 39 ? -8.984  -23.173 -4.573  1.00 0.00 ? 310 GLN B HA   6 
ATOM   8304 H HB2  . GLN B 1 39 ? -8.935  -21.364 -6.162  1.00 0.00 ? 310 GLN B HB2  6 
ATOM   8305 H HB3  . GLN B 1 39 ? -7.328  -21.832 -6.723  1.00 0.00 ? 310 GLN B HB3  6 
ATOM   8306 H HG2  . GLN B 1 39 ? -8.222  -23.266 -8.204  1.00 0.00 ? 310 GLN B HG2  6 
ATOM   8307 H HG3  . GLN B 1 39 ? -9.095  -24.095 -6.914  1.00 0.00 ? 310 GLN B HG3  6 
ATOM   8308 H HE21 . GLN B 1 39 ? -10.379 -23.801 -9.396  1.00 0.00 ? 310 GLN B HE21 6 
ATOM   8309 H HE22 . GLN B 1 39 ? -11.633 -22.664 -9.258  1.00 0.00 ? 310 GLN B HE22 6 
ATOM   8310 N N    . LYS B 1 40 ? -6.010  -24.194 -5.556  1.00 0.00 ? 311 LYS B N    6 
ATOM   8311 C CA   . LYS B 1 40 ? -5.257  -25.408 -5.846  1.00 0.00 ? 311 LYS B CA   6 
ATOM   8312 C C    . LYS B 1 40 ? -5.316  -26.354 -4.641  1.00 0.00 ? 311 LYS B C    6 
ATOM   8313 O O    . LYS B 1 40 ? -5.573  -27.534 -4.782  1.00 0.00 ? 311 LYS B O    6 
ATOM   8314 C CB   . LYS B 1 40 ? -3.799  -25.048 -6.140  1.00 0.00 ? 311 LYS B CB   6 
ATOM   8315 C CG   . LYS B 1 40 ? -3.315  -25.842 -7.354  1.00 0.00 ? 311 LYS B CG   6 
ATOM   8316 C CD   . LYS B 1 40 ? -3.280  -27.333 -7.011  1.00 0.00 ? 311 LYS B CD   6 
ATOM   8317 C CE   . LYS B 1 40 ? -2.650  -28.110 -8.169  1.00 0.00 ? 311 LYS B CE   6 
ATOM   8318 N NZ   . LYS B 1 40 ? -2.660  -29.566 -7.853  1.00 0.00 ? 311 LYS B NZ   6 
ATOM   8319 H H    . LYS B 1 40 ? -5.555  -23.326 -5.536  1.00 0.00 ? 311 LYS B H    6 
ATOM   8320 H HA   . LYS B 1 40 ? -5.683  -25.899 -6.708  1.00 0.00 ? 311 LYS B HA   6 
ATOM   8321 H HB2  . LYS B 1 40 ? -3.725  -23.990 -6.346  1.00 0.00 ? 311 LYS B HB2  6 
ATOM   8322 H HB3  . LYS B 1 40 ? -3.187  -25.294 -5.284  1.00 0.00 ? 311 LYS B HB3  6 
ATOM   8323 H HG2  . LYS B 1 40 ? -3.988  -25.677 -8.183  1.00 0.00 ? 311 LYS B HG2  6 
ATOM   8324 H HG3  . LYS B 1 40 ? -2.321  -25.515 -7.626  1.00 0.00 ? 311 LYS B HG3  6 
ATOM   8325 H HD2  . LYS B 1 40 ? -2.694  -27.482 -6.114  1.00 0.00 ? 311 LYS B HD2  6 
ATOM   8326 H HD3  . LYS B 1 40 ? -4.287  -27.688 -6.848  1.00 0.00 ? 311 LYS B HD3  6 
ATOM   8327 H HE2  . LYS B 1 40 ? -3.216  -27.934 -9.071  1.00 0.00 ? 311 LYS B HE2  6 
ATOM   8328 H HE3  . LYS B 1 40 ? -1.631  -27.780 -8.312  1.00 0.00 ? 311 LYS B HE3  6 
ATOM   8329 H HZ1  . LYS B 1 40 ? -2.646  -29.697 -6.819  1.00 0.00 ? 311 LYS B HZ1  6 
ATOM   8330 H HZ2  . LYS B 1 40 ? -3.518  -30.001 -8.247  1.00 0.00 ? 311 LYS B HZ2  6 
ATOM   8331 H HZ3  . LYS B 1 40 ? -1.823  -30.018 -8.271  1.00 0.00 ? 311 LYS B HZ3  6 
ATOM   8332 N N    . VAL B 1 41 ? -5.077  -25.851 -3.462  1.00 0.00 ? 312 VAL B N    6 
ATOM   8333 C CA   . VAL B 1 41 ? -5.120  -26.711 -2.285  1.00 0.00 ? 312 VAL B CA   6 
ATOM   8334 C C    . VAL B 1 41 ? -6.534  -27.272 -2.112  1.00 0.00 ? 312 VAL B C    6 
ATOM   8335 O O    . VAL B 1 41 ? -6.765  -28.454 -2.263  1.00 0.00 ? 312 VAL B O    6 
ATOM   8336 C CB   . VAL B 1 41 ? -4.731  -25.904 -1.047  1.00 0.00 ? 312 VAL B CB   6 
ATOM   8337 C CG1  . VAL B 1 41 ? -4.717  -26.822 0.178   1.00 0.00 ? 312 VAL B CG1  6 
ATOM   8338 C CG2  . VAL B 1 41 ? -3.336  -25.306 -1.248  1.00 0.00 ? 312 VAL B CG2  6 
ATOM   8339 H H    . VAL B 1 41 ? -4.870  -24.898 -3.367  1.00 0.00 ? 312 VAL B H    6 
ATOM   8340 H HA   . VAL B 1 41 ? -4.424  -27.526 -2.412  1.00 0.00 ? 312 VAL B HA   6 
ATOM   8341 H HB   . VAL B 1 41 ? -5.447  -25.111 -0.894  1.00 0.00 ? 312 VAL B HB   6 
ATOM   8342 H HG11 . VAL B 1 41 ? -5.526  -27.533 0.104   1.00 0.00 ? 312 VAL B HG11 6 
ATOM   8343 H HG12 . VAL B 1 41 ? -3.775  -27.351 0.221   1.00 0.00 ? 312 VAL B HG12 6 
ATOM   8344 H HG13 . VAL B 1 41 ? -4.838  -26.230 1.073   1.00 0.00 ? 312 VAL B HG13 6 
ATOM   8345 H HG21 . VAL B 1 41 ? -2.908  -25.693 -2.160  1.00 0.00 ? 312 VAL B HG21 6 
ATOM   8346 H HG22 . VAL B 1 41 ? -3.412  -24.231 -1.313  1.00 0.00 ? 312 VAL B HG22 6 
ATOM   8347 H HG23 . VAL B 1 41 ? -2.708  -25.573 -0.412  1.00 0.00 ? 312 VAL B HG23 6 
ATOM   8348 N N    . MET B 1 42 ? -7.485  -26.433 -1.799  1.00 0.00 ? 313 MET B N    6 
ATOM   8349 C CA   . MET B 1 42 ? -8.852  -26.913 -1.628  1.00 0.00 ? 313 MET B CA   6 
ATOM   8350 C C    . MET B 1 42 ? -9.399  -27.366 -2.982  1.00 0.00 ? 313 MET B C    6 
ATOM   8351 O O    . MET B 1 42 ? -10.246 -26.721 -3.569  1.00 0.00 ? 313 MET B O    6 
ATOM   8352 C CB   . MET B 1 42 ? -9.727  -25.789 -1.072  1.00 0.00 ? 313 MET B CB   6 
ATOM   8353 C CG   . MET B 1 42 ? -10.952 -26.391 -0.385  1.00 0.00 ? 313 MET B CG   6 
ATOM   8354 S SD   . MET B 1 42 ? -11.560 -25.243 0.876   1.00 0.00 ? 313 MET B SD   6 
ATOM   8355 C CE   . MET B 1 42 ? -10.782 -26.040 2.303   1.00 0.00 ? 313 MET B CE   6 
ATOM   8356 H H    . MET B 1 42 ? -7.282  -25.481 -1.684  1.00 0.00 ? 313 MET B H    6 
ATOM   8357 H HA   . MET B 1 42 ? -8.857  -27.746 -0.941  1.00 0.00 ? 313 MET B HA   6 
ATOM   8358 H HB2  . MET B 1 42 ? -9.160  -25.211 -0.356  1.00 0.00 ? 313 MET B HB2  6 
ATOM   8359 H HB3  . MET B 1 42 ? -10.048 -25.149 -1.880  1.00 0.00 ? 313 MET B HB3  6 
ATOM   8360 H HG2  . MET B 1 42 ? -11.728 -26.565 -1.118  1.00 0.00 ? 313 MET B HG2  6 
ATOM   8361 H HG3  . MET B 1 42 ? -10.681 -27.327 0.081   1.00 0.00 ? 313 MET B HG3  6 
ATOM   8362 H HE1  . MET B 1 42 ? -10.544 -27.063 2.061   1.00 0.00 ? 313 MET B HE1  6 
ATOM   8363 H HE2  . MET B 1 42 ? -9.873  -25.511 2.559   1.00 0.00 ? 313 MET B HE2  6 
ATOM   8364 H HE3  . MET B 1 42 ? -11.464 -26.019 3.140   1.00 0.00 ? 313 MET B HE3  6 
ATOM   8365 N N    . ASN B 1 43 ? -8.918  -28.469 -3.488  1.00 0.00 ? 314 ASN B N    6 
ATOM   8366 C CA   . ASN B 1 43 ? -9.397  -28.949 -4.779  1.00 0.00 ? 314 ASN B CA   6 
ATOM   8367 C C    . ASN B 1 43 ? -9.856  -30.404 -4.649  1.00 0.00 ? 314 ASN B C    6 
ATOM   8368 O O    . ASN B 1 43 ? -9.657  -31.040 -3.634  1.00 0.00 ? 314 ASN B O    6 
ATOM   8369 C CB   . ASN B 1 43 ? -8.267  -28.861 -5.806  1.00 0.00 ? 314 ASN B CB   6 
ATOM   8370 C CG   . ASN B 1 43 ? -8.856  -28.614 -7.197  1.00 0.00 ? 314 ASN B CG   6 
ATOM   8371 O OD1  . ASN B 1 43 ? -10.045 -28.757 -7.399  1.00 0.00 ? 314 ASN B OD1  6 
ATOM   8372 N ND2  . ASN B 1 43 ? -8.066  -28.249 -8.169  1.00 0.00 ? 314 ASN B ND2  6 
ATOM   8373 H H    . ASN B 1 43 ? -8.233  -28.973 -3.001  1.00 0.00 ? 314 ASN B H    6 
ATOM   8374 H HA   . ASN B 1 43 ? -10.225 -28.340 -5.106  1.00 0.00 ? 314 ASN B HA   6 
ATOM   8375 H HB2  . ASN B 1 43 ? -7.607  -28.046 -5.545  1.00 0.00 ? 314 ASN B HB2  6 
ATOM   8376 H HB3  . ASN B 1 43 ? -7.711  -29.786 -5.812  1.00 0.00 ? 314 ASN B HB3  6 
ATOM   8377 H HD21 . ASN B 1 43 ? -7.105  -28.135 -8.004  1.00 0.00 ? 314 ASN B HD21 6 
ATOM   8378 H HD22 . ASN B 1 43 ? -8.433  -28.088 -9.064  1.00 0.00 ? 314 ASN B HD22 6 
ATOM   8379 N N    . TYR B 1 44 ? -10.464 -30.937 -5.675  1.00 0.00 ? 315 TYR B N    6 
ATOM   8380 C CA   . TYR B 1 44 ? -10.924 -32.322 -5.622  1.00 0.00 ? 315 TYR B CA   6 
ATOM   8381 C C    . TYR B 1 44 ? -11.924 -32.483 -4.477  1.00 0.00 ? 315 TYR B C    6 
ATOM   8382 O O    . TYR B 1 44 ? -12.094 -33.600 -4.017  1.00 0.00 ? 315 TYR B O    6 
ATOM   8383 C CB   . TYR B 1 44 ? -9.731  -33.256 -5.395  1.00 0.00 ? 315 TYR B CB   6 
ATOM   8384 C CG   . TYR B 1 44 ? -8.954  -33.408 -6.681  1.00 0.00 ? 315 TYR B CG   6 
ATOM   8385 C CD1  . TYR B 1 44 ? -9.375  -34.331 -7.650  1.00 0.00 ? 315 TYR B CD1  6 
ATOM   8386 C CD2  . TYR B 1 44 ? -7.809  -32.627 -6.905  1.00 0.00 ? 315 TYR B CD2  6 
ATOM   8387 C CE1  . TYR B 1 44 ? -8.652  -34.474 -8.844  1.00 0.00 ? 315 TYR B CE1  6 
ATOM   8388 C CE2  . TYR B 1 44 ? -7.086  -32.770 -8.101  1.00 0.00 ? 315 TYR B CE2  6 
ATOM   8389 C CZ   . TYR B 1 44 ? -7.507  -33.694 -9.071  1.00 0.00 ? 315 TYR B CZ   6 
ATOM   8390 O OH   . TYR B 1 44 ? -6.798  -33.835 -10.244 1.00 0.00 ? 315 TYR B OH   6 
ATOM   8391 O OXT  . TYR B 1 44 ? -12.504 -31.487 -4.079  1.00 0.00 ? 315 TYR B OXT  6 
ATOM   8392 H H    . TYR B 1 44 ? -10.609 -30.406 -6.486  1.00 0.00 ? 315 TYR B H    6 
ATOM   8393 H HA   . TYR B 1 44 ? -11.403 -32.577 -6.556  1.00 0.00 ? 315 TYR B HA   6 
ATOM   8394 H HB2  . TYR B 1 44 ? -9.089  -32.841 -4.632  1.00 0.00 ? 315 TYR B HB2  6 
ATOM   8395 H HB3  . TYR B 1 44 ? -10.090 -34.223 -5.077  1.00 0.00 ? 315 TYR B HB3  6 
ATOM   8396 H HD1  . TYR B 1 44 ? -10.256 -34.931 -7.477  1.00 0.00 ? 315 TYR B HD1  6 
ATOM   8397 H HD2  . TYR B 1 44 ? -7.484  -31.915 -6.160  1.00 0.00 ? 315 TYR B HD2  6 
ATOM   8398 H HE1  . TYR B 1 44 ? -8.977  -35.185 -9.590  1.00 0.00 ? 315 TYR B HE1  6 
ATOM   8399 H HE2  . TYR B 1 44 ? -6.205  -32.170 -8.274  1.00 0.00 ? 315 TYR B HE2  6 
ATOM   8400 H HH   . TYR B 1 44 ? -6.694  -34.773 -10.419 1.00 0.00 ? 315 TYR B HH   6 
HETATM 8401 C C    . ACE A 1 1  ? 4.875   32.186  3.144   1.00 0.00 ? 272 ACE A C    7 
HETATM 8402 O O    . ACE A 1 1  ? 4.224   32.774  3.984   1.00 0.00 ? 272 ACE A O    7 
HETATM 8403 C CH3  . ACE A 1 1  ? 6.401   32.291  3.105   1.00 0.00 ? 272 ACE A CH3  7 
HETATM 8404 H H1   . ACE A 1 1  ? 6.705   33.258  3.476   1.00 0.00 ? 272 ACE A H1   7 
HETATM 8405 H H2   . ACE A 1 1  ? 6.830   31.517  3.724   1.00 0.00 ? 272 ACE A H2   7 
HETATM 8406 H H3   . ACE A 1 1  ? 6.745   32.170  2.088   1.00 0.00 ? 272 ACE A H3   7 
ATOM   8407 N N    . CYS A 1 2  ? 4.299   31.444  2.238   1.00 0.00 ? 273 CYS A N    7 
ATOM   8408 C CA   . CYS A 1 2  ? 2.847   31.307  2.223   1.00 0.00 ? 273 CYS A CA   7 
ATOM   8409 C C    . CYS A 1 2  ? 2.374   30.745  3.565   1.00 0.00 ? 273 CYS A C    7 
ATOM   8410 O O    . CYS A 1 2  ? 3.159   30.516  4.464   1.00 0.00 ? 273 CYS A O    7 
ATOM   8411 C CB   . CYS A 1 2  ? 2.435   30.357  1.097   1.00 0.00 ? 273 CYS A CB   7 
ATOM   8412 S SG   . CYS A 1 2  ? 1.282   31.202  -0.014  1.00 0.00 ? 273 CYS A SG   7 
ATOM   8413 H H    . CYS A 1 2  ? 4.842   30.979  1.567   1.00 0.00 ? 273 CYS A H    7 
ATOM   8414 H HA   . CYS A 1 2  ? 2.396   32.273  2.059   1.00 0.00 ? 273 CYS A HA   7 
ATOM   8415 H HB2  . CYS A 1 2  ? 3.311   30.055  0.543   1.00 0.00 ? 273 CYS A HB2  7 
ATOM   8416 H HB3  . CYS A 1 2  ? 1.957   29.487  1.518   1.00 0.00 ? 273 CYS A HB3  7 
ATOM   8417 N N    . GLY A 1 3  ? 1.097   30.517  3.706   1.00 0.00 ? 274 GLY A N    7 
ATOM   8418 C CA   . GLY A 1 3  ? 0.585   29.980  4.962   1.00 0.00 ? 274 GLY A CA   7 
ATOM   8419 C C    . GLY A 1 3  ? -0.941  29.901  4.900   1.00 0.00 ? 274 GLY A C    7 
ATOM   8420 O O    . GLY A 1 3  ? -1.631  30.891  5.043   1.00 0.00 ? 274 GLY A O    7 
ATOM   8421 H H    . GLY A 1 3  ? 0.482   30.708  2.967   1.00 0.00 ? 274 GLY A H    7 
ATOM   8422 H HA2  . GLY A 1 3  ? 0.994   28.992  5.122   1.00 0.00 ? 274 GLY A HA2  7 
ATOM   8423 H HA3  . GLY A 1 3  ? 0.875   30.628  5.775   1.00 0.00 ? 274 GLY A HA3  7 
ATOM   8424 N N    . GLY A 1 4  ? -1.472  28.730  4.683   1.00 0.00 ? 275 GLY A N    7 
ATOM   8425 C CA   . GLY A 1 4  ? -2.923  28.587  4.611   1.00 0.00 ? 275 GLY A CA   7 
ATOM   8426 C C    . GLY A 1 4  ? -3.276  27.356  3.778   1.00 0.00 ? 275 GLY A C    7 
ATOM   8427 O O    . GLY A 1 4  ? -3.863  26.410  4.265   1.00 0.00 ? 275 GLY A O    7 
ATOM   8428 H H    . GLY A 1 4  ? -0.898  27.944  4.568   1.00 0.00 ? 275 GLY A H    7 
ATOM   8429 H HA2  . GLY A 1 4  ? -3.322  28.477  5.609   1.00 0.00 ? 275 GLY A HA2  7 
ATOM   8430 H HA3  . GLY A 1 4  ? -3.347  29.464  4.147   1.00 0.00 ? 275 GLY A HA3  7 
ATOM   8431 N N    . ARG A 1 5  ? -2.921  27.358  2.521   1.00 0.00 ? 276 ARG A N    7 
ATOM   8432 C CA   . ARG A 1 5  ? -3.228  26.211  1.675   1.00 0.00 ? 276 ARG A CA   7 
ATOM   8433 C C    . ARG A 1 5  ? -2.033  25.255  1.663   1.00 0.00 ? 276 ARG A C    7 
ATOM   8434 O O    . ARG A 1 5  ? -2.182  24.066  1.465   1.00 0.00 ? 276 ARG A O    7 
ATOM   8435 C CB   . ARG A 1 5  ? -3.514  26.690  0.251   1.00 0.00 ? 276 ARG A CB   7 
ATOM   8436 C CG   . ARG A 1 5  ? -4.810  27.500  0.233   1.00 0.00 ? 276 ARG A CG   7 
ATOM   8437 C CD   . ARG A 1 5  ? -5.977  26.606  0.659   1.00 0.00 ? 276 ARG A CD   7 
ATOM   8438 N NE   . ARG A 1 5  ? -7.237  27.261  0.331   1.00 0.00 ? 276 ARG A NE   7 
ATOM   8439 C CZ   . ARG A 1 5  ? -8.345  26.569  0.305   1.00 0.00 ? 276 ARG A CZ   7 
ATOM   8440 N NH1  . ARG A 1 5  ? -8.456  25.550  -0.503  1.00 0.00 ? 276 ARG A NH1  7 
ATOM   8441 N NH2  . ARG A 1 5  ? -9.336  26.896  1.086   1.00 0.00 ? 276 ARG A NH2  7 
ATOM   8442 H H    . ARG A 1 5  ? -2.447  28.129  2.148   1.00 0.00 ? 276 ARG A H    7 
ATOM   8443 H HA   . ARG A 1 5  ? -4.095  25.700  2.062   1.00 0.00 ? 276 ARG A HA   7 
ATOM   8444 H HB2  . ARG A 1 5  ? -2.696  27.309  -0.091  1.00 0.00 ? 276 ARG A HB2  7 
ATOM   8445 H HB3  . ARG A 1 5  ? -3.616  25.835  -0.402  1.00 0.00 ? 276 ARG A HB3  7 
ATOM   8446 H HG2  . ARG A 1 5  ? -4.723  28.332  0.919   1.00 0.00 ? 276 ARG A HG2  7 
ATOM   8447 H HG3  . ARG A 1 5  ? -4.990  27.872  -0.763  1.00 0.00 ? 276 ARG A HG3  7 
ATOM   8448 H HD2  . ARG A 1 5  ? -5.915  25.662  0.137   1.00 0.00 ? 276 ARG A HD2  7 
ATOM   8449 H HD3  . ARG A 1 5  ? -5.928  26.434  1.724   1.00 0.00 ? 276 ARG A HD3  7 
ATOM   8450 H HE   . ARG A 1 5  ? -7.254  28.220  0.133   1.00 0.00 ? 276 ARG A HE   7 
ATOM   8451 H HH11 . ARG A 1 5  ? -7.693  25.300  -1.100  1.00 0.00 ? 276 ARG A HH11 7 
ATOM   8452 H HH12 . ARG A 1 5  ? -9.303  25.019  -0.525  1.00 0.00 ? 276 ARG A HH12 7 
ATOM   8453 H HH21 . ARG A 1 5  ? -9.251  27.676  1.705   1.00 0.00 ? 276 ARG A HH21 7 
ATOM   8454 H HH22 . ARG A 1 5  ? -10.185 26.365  1.066   1.00 0.00 ? 276 ARG A HH22 7 
ATOM   8455 N N    . ILE A 1 6  ? -0.851  25.766  1.865   1.00 0.00 ? 277 ILE A N    7 
ATOM   8456 C CA   . ILE A 1 6  ? 0.327   24.910  1.859   1.00 0.00 ? 277 ILE A CA   7 
ATOM   8457 C C    . ILE A 1 6  ? 0.269   23.931  3.039   1.00 0.00 ? 277 ILE A C    7 
ATOM   8458 O O    . ILE A 1 6  ? 0.454   22.742  2.874   1.00 0.00 ? 277 ILE A O    7 
ATOM   8459 C CB   . ILE A 1 6  ? 1.585   25.775  1.966   1.00 0.00 ? 277 ILE A CB   7 
ATOM   8460 C CG1  . ILE A 1 6  ? 1.460   26.734  3.154   1.00 0.00 ? 277 ILE A CG1  7 
ATOM   8461 C CG2  . ILE A 1 6  ? 1.758   26.582  0.680   1.00 0.00 ? 277 ILE A CG2  7 
ATOM   8462 C CD1  . ILE A 1 6  ? 2.216   26.162  4.354   1.00 0.00 ? 277 ILE A CD1  7 
ATOM   8463 H H    . ILE A 1 6  ? -0.751  26.727  2.015   1.00 0.00 ? 277 ILE A H    7 
ATOM   8464 H HA   . ILE A 1 6  ? 0.358   24.355  0.935   1.00 0.00 ? 277 ILE A HA   7 
ATOM   8465 H HB   . ILE A 1 6  ? 2.441   25.139  2.107   1.00 0.00 ? 277 ILE A HB   7 
ATOM   8466 H HG12 . ILE A 1 6  ? 1.881   27.692  2.885   1.00 0.00 ? 277 ILE A HG12 7 
ATOM   8467 H HG13 . ILE A 1 6  ? 0.422   26.858  3.411   1.00 0.00 ? 277 ILE A HG13 7 
ATOM   8468 H HG21 . ILE A 1 6  ? 0.791   26.898  0.321   1.00 0.00 ? 277 ILE A HG21 7 
ATOM   8469 H HG22 . ILE A 1 6  ? 2.370   27.450  0.878   1.00 0.00 ? 277 ILE A HG22 7 
ATOM   8470 H HG23 . ILE A 1 6  ? 2.238   25.968  -0.069  1.00 0.00 ? 277 ILE A HG23 7 
ATOM   8471 H HD11 . ILE A 1 6  ? 2.728   25.257  4.060   1.00 0.00 ? 277 ILE A HD11 7 
ATOM   8472 H HD12 . ILE A 1 6  ? 2.937   26.885  4.703   1.00 0.00 ? 277 ILE A HD12 7 
ATOM   8473 H HD13 . ILE A 1 6  ? 1.517   25.938  5.147   1.00 0.00 ? 277 ILE A HD13 7 
ATOM   8474 N N    . ALA A 1 7  ? 0.017   24.417  4.224   1.00 0.00 ? 278 ALA A N    7 
ATOM   8475 C CA   . ALA A 1 7  ? -0.048  23.524  5.377   1.00 0.00 ? 278 ALA A CA   7 
ATOM   8476 C C    . ALA A 1 7  ? -1.196  22.534  5.187   1.00 0.00 ? 278 ALA A C    7 
ATOM   8477 O O    . ALA A 1 7  ? -1.188  21.446  5.728   1.00 0.00 ? 278 ALA A O    7 
ATOM   8478 C CB   . ALA A 1 7  ? -0.282  24.345  6.645   1.00 0.00 ? 278 ALA A CB   7 
ATOM   8479 H H    . ALA A 1 7  ? -0.130  25.378  4.340   1.00 0.00 ? 278 ALA A H    7 
ATOM   8480 H HA   . ALA A 1 7  ? 0.883   22.985  5.465   1.00 0.00 ? 278 ALA A HA   7 
ATOM   8481 H HB1  . ALA A 1 7  ? -0.349  25.392  6.390   1.00 0.00 ? 278 ALA A HB1  7 
ATOM   8482 H HB2  . ALA A 1 7  ? -1.204  24.030  7.113   1.00 0.00 ? 278 ALA A HB2  7 
ATOM   8483 H HB3  . ALA A 1 7  ? 0.539   24.192  7.329   1.00 0.00 ? 278 ALA A HB3  7 
ATOM   8484 N N    . ARG A 1 8  ? -2.186  22.900  4.420   1.00 0.00 ? 279 ARG A N    7 
ATOM   8485 C CA   . ARG A 1 8  ? -3.308  21.998  4.196   1.00 0.00 ? 279 ARG A CA   7 
ATOM   8486 C C    . ARG A 1 8  ? -2.846  20.828  3.328   1.00 0.00 ? 279 ARG A C    7 
ATOM   8487 O O    . ARG A 1 8  ? -2.813  19.693  3.764   1.00 0.00 ? 279 ARG A O    7 
ATOM   8488 C CB   . ARG A 1 8  ? -4.435  22.754  3.491   1.00 0.00 ? 279 ARG A CB   7 
ATOM   8489 C CG   . ARG A 1 8  ? -5.323  23.433  4.535   1.00 0.00 ? 279 ARG A CG   7 
ATOM   8490 C CD   . ARG A 1 8  ? -5.951  22.371  5.441   1.00 0.00 ? 279 ARG A CD   7 
ATOM   8491 N NE   . ARG A 1 8  ? -7.110  22.932  6.120   1.00 0.00 ? 279 ARG A NE   7 
ATOM   8492 C CZ   . ARG A 1 8  ? -7.986  22.140  6.677   1.00 0.00 ? 279 ARG A CZ   7 
ATOM   8493 N NH1  . ARG A 1 8  ? -8.958  21.640  5.963   1.00 0.00 ? 279 ARG A NH1  7 
ATOM   8494 N NH2  . ARG A 1 8  ? -7.890  21.847  7.944   1.00 0.00 ? 279 ARG A NH2  7 
ATOM   8495 H H    . ARG A 1 8  ? -2.173  23.782  3.991   1.00 0.00 ? 279 ARG A H    7 
ATOM   8496 H HA   . ARG A 1 8  ? -3.665  21.625  5.146   1.00 0.00 ? 279 ARG A HA   7 
ATOM   8497 H HB2  . ARG A 1 8  ? -4.012  23.501  2.835   1.00 0.00 ? 279 ARG A HB2  7 
ATOM   8498 H HB3  . ARG A 1 8  ? -5.028  22.060  2.914   1.00 0.00 ? 279 ARG A HB3  7 
ATOM   8499 H HG2  . ARG A 1 8  ? -4.727  24.108  5.131   1.00 0.00 ? 279 ARG A HG2  7 
ATOM   8500 H HG3  . ARG A 1 8  ? -6.106  23.986  4.039   1.00 0.00 ? 279 ARG A HG3  7 
ATOM   8501 H HD2  . ARG A 1 8  ? -6.257  21.524  4.842   1.00 0.00 ? 279 ARG A HD2  7 
ATOM   8502 H HD3  . ARG A 1 8  ? -5.226  22.051  6.174   1.00 0.00 ? 279 ARG A HD3  7 
ATOM   8503 H HE   . ARG A 1 8  ? -7.234  23.904  6.160   1.00 0.00 ? 279 ARG A HE   7 
ATOM   8504 H HH11 . ARG A 1 8  ? -9.032  21.864  4.992   1.00 0.00 ? 279 ARG A HH11 7 
ATOM   8505 H HH12 . ARG A 1 8  ? -9.628  21.033  6.389   1.00 0.00 ? 279 ARG A HH12 7 
ATOM   8506 H HH21 . ARG A 1 8  ? -7.146  22.230  8.491   1.00 0.00 ? 279 ARG A HH21 7 
ATOM   8507 H HH22 . ARG A 1 8  ? -8.561  21.239  8.369   1.00 0.00 ? 279 ARG A HH22 7 
ATOM   8508 N N    . LEU A 1 9  ? -2.477  21.094  2.105   1.00 0.00 ? 280 LEU A N    7 
ATOM   8509 C CA   . LEU A 1 9  ? -2.018  20.020  1.237   1.00 0.00 ? 280 LEU A CA   7 
ATOM   8510 C C    . LEU A 1 9  ? -0.915  19.240  1.954   1.00 0.00 ? 280 LEU A C    7 
ATOM   8511 O O    . LEU A 1 9  ? -0.650  18.095  1.649   1.00 0.00 ? 280 LEU A O    7 
ATOM   8512 C CB   . LEU A 1 9  ? -1.467  20.610  -0.064  1.00 0.00 ? 280 LEU A CB   7 
ATOM   8513 C CG   . LEU A 1 9  ? -2.415  20.282  -1.217  1.00 0.00 ? 280 LEU A CG   7 
ATOM   8514 C CD1  . LEU A 1 9  ? -2.614  21.527  -2.083  1.00 0.00 ? 280 LEU A CD1  7 
ATOM   8515 C CD2  . LEU A 1 9  ? -1.814  19.162  -2.066  1.00 0.00 ? 280 LEU A CD2  7 
ATOM   8516 H H    . LEU A 1 9  ? -2.504  22.015  1.774   1.00 0.00 ? 280 LEU A H    7 
ATOM   8517 H HA   . LEU A 1 9  ? -2.842  19.358  1.012   1.00 0.00 ? 280 LEU A HA   7 
ATOM   8518 H HB2  . LEU A 1 9  ? -1.377  21.682  0.040   1.00 0.00 ? 280 LEU A HB2  7 
ATOM   8519 H HB3  . LEU A 1 9  ? -0.494  20.186  -0.267  1.00 0.00 ? 280 LEU A HB3  7 
ATOM   8520 H HG   . LEU A 1 9  ? -3.368  19.965  -0.818  1.00 0.00 ? 280 LEU A HG   7 
ATOM   8521 H HD11 . LEU A 1 9  ? -1.683  22.072  -2.150  1.00 0.00 ? 280 LEU A HD11 7 
ATOM   8522 H HD12 . LEU A 1 9  ? -2.930  21.230  -3.072  1.00 0.00 ? 280 LEU A HD12 7 
ATOM   8523 H HD13 . LEU A 1 9  ? -3.369  22.159  -1.639  1.00 0.00 ? 280 LEU A HD13 7 
ATOM   8524 H HD21 . LEU A 1 9  ? -1.061  18.640  -1.495  1.00 0.00 ? 280 LEU A HD21 7 
ATOM   8525 H HD22 . LEU A 1 9  ? -2.595  18.467  -2.350  1.00 0.00 ? 280 LEU A HD22 7 
ATOM   8526 H HD23 . LEU A 1 9  ? -1.366  19.583  -2.953  1.00 0.00 ? 280 LEU A HD23 7 
ATOM   8527 N N    . GLU A 1 10 ? -0.277  19.854  2.913   1.00 0.00 ? 281 GLU A N    7 
ATOM   8528 C CA   . GLU A 1 10 ? 0.782   19.166  3.642   1.00 0.00 ? 281 GLU A CA   7 
ATOM   8529 C C    . GLU A 1 10 ? 0.166   18.043  4.478   1.00 0.00 ? 281 GLU A C    7 
ATOM   8530 O O    . GLU A 1 10 ? 0.566   16.897  4.390   1.00 0.00 ? 281 GLU A O    7 
ATOM   8531 C CB   . GLU A 1 10 ? 1.494   20.158  4.565   1.00 0.00 ? 281 GLU A CB   7 
ATOM   8532 C CG   . GLU A 1 10 ? 2.688   20.770  3.831   1.00 0.00 ? 281 GLU A CG   7 
ATOM   8533 C CD   . GLU A 1 10 ? 3.758   19.699  3.613   1.00 0.00 ? 281 GLU A CD   7 
ATOM   8534 O OE1  . GLU A 1 10 ? 3.443   18.532  3.779   1.00 0.00 ? 281 GLU A OE1  7 
ATOM   8535 O OE2  . GLU A 1 10 ? 4.874   20.062  3.280   1.00 0.00 ? 281 GLU A OE2  7 
ATOM   8536 H H    . GLU A 1 10 ? -0.510  20.777  3.145   1.00 0.00 ? 281 GLU A H    7 
ATOM   8537 H HA   . GLU A 1 10 ? 1.493   18.750  2.944   1.00 0.00 ? 281 GLU A HA   7 
ATOM   8538 H HB2  . GLU A 1 10 ? 0.808   20.940  4.852   1.00 0.00 ? 281 GLU A HB2  7 
ATOM   8539 H HB3  . GLU A 1 10 ? 1.842   19.642  5.448   1.00 0.00 ? 281 GLU A HB3  7 
ATOM   8540 H HG2  . GLU A 1 10 ? 2.364   21.158  2.876   1.00 0.00 ? 281 GLU A HG2  7 
ATOM   8541 H HG3  . GLU A 1 10 ? 3.102   21.573  4.424   1.00 0.00 ? 281 GLU A HG3  7 
ATOM   8542 N N    . GLU A 1 11 ? -0.811  18.357  5.284   1.00 0.00 ? 282 GLU A N    7 
ATOM   8543 C CA   . GLU A 1 11 ? -1.441  17.326  6.099   1.00 0.00 ? 282 GLU A CA   7 
ATOM   8544 C C    . GLU A 1 11 ? -1.962  16.221  5.180   1.00 0.00 ? 282 GLU A C    7 
ATOM   8545 O O    . GLU A 1 11 ? -1.968  15.056  5.529   1.00 0.00 ? 282 GLU A O    7 
ATOM   8546 C CB   . GLU A 1 11 ? -2.604  17.931  6.887   1.00 0.00 ? 282 GLU A CB   7 
ATOM   8547 C CG   . GLU A 1 11 ? -2.217  18.044  8.363   1.00 0.00 ? 282 GLU A CG   7 
ATOM   8548 C CD   . GLU A 1 11 ? -2.892  19.272  8.976   1.00 0.00 ? 282 GLU A CD   7 
ATOM   8549 O OE1  . GLU A 1 11 ? -3.843  19.756  8.388   1.00 0.00 ? 282 GLU A OE1  7 
ATOM   8550 O OE2  . GLU A 1 11 ? -2.445  19.706  10.025  1.00 0.00 ? 282 GLU A OE2  7 
ATOM   8551 H H    . GLU A 1 11 ? -1.124  19.284  5.338   1.00 0.00 ? 282 GLU A H    7 
ATOM   8552 H HA   . GLU A 1 11 ? -0.717  16.914  6.785   1.00 0.00 ? 282 GLU A HA   7 
ATOM   8553 H HB2  . GLU A 1 11 ? -2.829  18.914  6.497   1.00 0.00 ? 282 GLU A HB2  7 
ATOM   8554 H HB3  . GLU A 1 11 ? -3.473  17.298  6.792   1.00 0.00 ? 282 GLU A HB3  7 
ATOM   8555 H HG2  . GLU A 1 11 ? -2.537  17.156  8.888   1.00 0.00 ? 282 GLU A HG2  7 
ATOM   8556 H HG3  . GLU A 1 11 ? -1.146  18.146  8.447   1.00 0.00 ? 282 GLU A HG3  7 
ATOM   8557 N N    . LYS A 1 12 ? -2.392  16.579  4.001   1.00 0.00 ? 283 LYS A N    7 
ATOM   8558 C CA   . LYS A 1 12 ? -2.893  15.575  3.073   1.00 0.00 ? 283 LYS A CA   7 
ATOM   8559 C C    . LYS A 1 12 ? -1.744  14.652  2.671   1.00 0.00 ? 283 LYS A C    7 
ATOM   8560 O O    . LYS A 1 12 ? -1.896  13.448  2.598   1.00 0.00 ? 283 LYS A O    7 
ATOM   8561 C CB   . LYS A 1 12 ? -3.456  16.264  1.829   1.00 0.00 ? 283 LYS A CB   7 
ATOM   8562 C CG   . LYS A 1 12 ? -4.896  15.805  1.597   1.00 0.00 ? 283 LYS A CG   7 
ATOM   8563 C CD   . LYS A 1 12 ? -5.400  16.359  0.263   1.00 0.00 ? 283 LYS A CD   7 
ATOM   8564 C CE   . LYS A 1 12 ? -5.764  17.836  0.425   1.00 0.00 ? 283 LYS A CE   7 
ATOM   8565 N NZ   . LYS A 1 12 ? -7.014  18.127  -0.333  1.00 0.00 ? 283 LYS A NZ   7 
ATOM   8566 H H    . LYS A 1 12 ? -2.372  17.523  3.738   1.00 0.00 ? 283 LYS A H    7 
ATOM   8567 H HA   . LYS A 1 12 ? -3.673  14.997  3.548   1.00 0.00 ? 283 LYS A HA   7 
ATOM   8568 H HB2  . LYS A 1 12 ? -3.437  17.334  1.972   1.00 0.00 ? 283 LYS A HB2  7 
ATOM   8569 H HB3  . LYS A 1 12 ? -2.855  16.004  0.971   1.00 0.00 ? 283 LYS A HB3  7 
ATOM   8570 H HG2  . LYS A 1 12 ? -4.931  14.726  1.577   1.00 0.00 ? 283 LYS A HG2  7 
ATOM   8571 H HG3  . LYS A 1 12 ? -5.524  16.170  2.397   1.00 0.00 ? 283 LYS A HG3  7 
ATOM   8572 H HD2  . LYS A 1 12 ? -4.626  16.258  -0.483  1.00 0.00 ? 283 LYS A HD2  7 
ATOM   8573 H HD3  . LYS A 1 12 ? -6.275  15.807  -0.049  1.00 0.00 ? 283 LYS A HD3  7 
ATOM   8574 H HE2  . LYS A 1 12 ? -5.917  18.056  1.471   1.00 0.00 ? 283 LYS A HE2  7 
ATOM   8575 H HE3  . LYS A 1 12 ? -4.961  18.448  0.044   1.00 0.00 ? 283 LYS A HE3  7 
ATOM   8576 H HZ1  . LYS A 1 12 ? -7.476  17.234  -0.597  1.00 0.00 ? 283 LYS A HZ1  7 
ATOM   8577 H HZ2  . LYS A 1 12 ? -7.657  18.685  0.262   1.00 0.00 ? 283 LYS A HZ2  7 
ATOM   8578 H HZ3  . LYS A 1 12 ? -6.779  18.665  -1.192  1.00 0.00 ? 283 LYS A HZ3  7 
ATOM   8579 N N    . VAL A 1 13 ? -0.591  15.208  2.418   1.00 0.00 ? 284 VAL A N    7 
ATOM   8580 C CA   . VAL A 1 13 ? 0.548   14.380  2.040   1.00 0.00 ? 284 VAL A CA   7 
ATOM   8581 C C    . VAL A 1 13 ? 0.865   13.421  3.186   1.00 0.00 ? 284 VAL A C    7 
ATOM   8582 O O    . VAL A 1 13 ? 1.339   12.321  2.981   1.00 0.00 ? 284 VAL A O    7 
ATOM   8583 C CB   . VAL A 1 13 ? 1.761   15.271  1.771   1.00 0.00 ? 284 VAL A CB   7 
ATOM   8584 C CG1  . VAL A 1 13 ? 3.009   14.398  1.611   1.00 0.00 ? 284 VAL A CG1  7 
ATOM   8585 C CG2  . VAL A 1 13 ? 1.533   16.069  0.487   1.00 0.00 ? 284 VAL A CG2  7 
ATOM   8586 H H    . VAL A 1 13 ? -0.488  16.178  2.489   1.00 0.00 ? 284 VAL A H    7 
ATOM   8587 H HA   . VAL A 1 13 ? 0.309   13.817  1.150   1.00 0.00 ? 284 VAL A HA   7 
ATOM   8588 H HB   . VAL A 1 13 ? 1.901   15.948  2.601   1.00 0.00 ? 284 VAL A HB   7 
ATOM   8589 H HG11 . VAL A 1 13 ? 2.727   13.438  1.205   1.00 0.00 ? 284 VAL A HG11 7 
ATOM   8590 H HG12 . VAL A 1 13 ? 3.705   14.882  0.941   1.00 0.00 ? 284 VAL A HG12 7 
ATOM   8591 H HG13 . VAL A 1 13 ? 3.476   14.257  2.576   1.00 0.00 ? 284 VAL A HG13 7 
ATOM   8592 H HG21 . VAL A 1 13 ? 0.789   15.574  -0.118  1.00 0.00 ? 284 VAL A HG21 7 
ATOM   8593 H HG22 . VAL A 1 13 ? 1.187   17.062  0.738   1.00 0.00 ? 284 VAL A HG22 7 
ATOM   8594 H HG23 . VAL A 1 13 ? 2.459   16.140  -0.065  1.00 0.00 ? 284 VAL A HG23 7 
ATOM   8595 N N    . LYS A 1 14 ? 0.601   13.830  4.398   1.00 0.00 ? 285 LYS A N    7 
ATOM   8596 C CA   . LYS A 1 14 ? 0.875   12.964  5.537   1.00 0.00 ? 285 LYS A CA   7 
ATOM   8597 C C    . LYS A 1 14 ? -0.044  11.743  5.479   1.00 0.00 ? 285 LYS A C    7 
ATOM   8598 O O    . LYS A 1 14 ? 0.403   10.615  5.500   1.00 0.00 ? 285 LYS A O    7 
ATOM   8599 C CB   . LYS A 1 14 ? 0.626   13.733  6.836   1.00 0.00 ? 285 LYS A CB   7 
ATOM   8600 C CG   . LYS A 1 14 ? 1.614   13.263  7.906   1.00 0.00 ? 285 LYS A CG   7 
ATOM   8601 C CD   . LYS A 1 14 ? 3.002   13.833  7.608   1.00 0.00 ? 285 LYS A CD   7 
ATOM   8602 C CE   . LYS A 1 14 ? 3.781   13.987  8.914   1.00 0.00 ? 285 LYS A CE   7 
ATOM   8603 N NZ   . LYS A 1 14 ? 3.888   12.662  9.588   1.00 0.00 ? 285 LYS A NZ   7 
ATOM   8604 H H    . LYS A 1 14 ? 0.217   14.722  4.540   1.00 0.00 ? 285 LYS A H    7 
ATOM   8605 H HA   . LYS A 1 14 ? 1.906   12.641  5.504   1.00 0.00 ? 285 LYS A HA   7 
ATOM   8606 H HB2  . LYS A 1 14 ? 0.761   14.790  6.660   1.00 0.00 ? 285 LYS A HB2  7 
ATOM   8607 H HB3  . LYS A 1 14 ? -0.383  13.550  7.175   1.00 0.00 ? 285 LYS A HB3  7 
ATOM   8608 H HG2  . LYS A 1 14 ? 1.282   13.604  8.875   1.00 0.00 ? 285 LYS A HG2  7 
ATOM   8609 H HG3  . LYS A 1 14 ? 1.662   12.183  7.901   1.00 0.00 ? 285 LYS A HG3  7 
ATOM   8610 H HD2  . LYS A 1 14 ? 3.532   13.162  6.946   1.00 0.00 ? 285 LYS A HD2  7 
ATOM   8611 H HD3  . LYS A 1 14 ? 2.899   14.799  7.135   1.00 0.00 ? 285 LYS A HD3  7 
ATOM   8612 H HE2  . LYS A 1 14 ? 4.772   14.363  8.701   1.00 0.00 ? 285 LYS A HE2  7 
ATOM   8613 H HE3  . LYS A 1 14 ? 3.266   14.681  9.562   1.00 0.00 ? 285 LYS A HE3  7 
ATOM   8614 H HZ1  . LYS A 1 14 ? 3.985   11.915  8.871   1.00 0.00 ? 285 LYS A HZ1  7 
ATOM   8615 H HZ2  . LYS A 1 14 ? 4.719   12.655  10.212  1.00 0.00 ? 285 LYS A HZ2  7 
ATOM   8616 H HZ3  . LYS A 1 14 ? 3.032   12.491  10.154  1.00 0.00 ? 285 LYS A HZ3  7 
ATOM   8617 N N    . THR A 1 15 ? -1.331  11.959  5.401   1.00 0.00 ? 286 THR A N    7 
ATOM   8618 C CA   . THR A 1 15 ? -2.254  10.831  5.338   1.00 0.00 ? 286 THR A CA   7 
ATOM   8619 C C    . THR A 1 15 ? -1.806  9.882   4.225   1.00 0.00 ? 286 THR A C    7 
ATOM   8620 O O    . THR A 1 15 ? -1.735  8.681   4.406   1.00 0.00 ? 286 THR A O    7 
ATOM   8621 C CB   . THR A 1 15 ? -3.667  11.338  5.048   1.00 0.00 ? 286 THR A CB   7 
ATOM   8622 O OG1  . THR A 1 15 ? -3.800  12.667  5.535   1.00 0.00 ? 286 THR A OG1  7 
ATOM   8623 C CG2  . THR A 1 15 ? -4.687  10.434  5.741   1.00 0.00 ? 286 THR A CG2  7 
ATOM   8624 H H    . THR A 1 15 ? -1.676  12.878  5.382   1.00 0.00 ? 286 THR A H    7 
ATOM   8625 H HA   . THR A 1 15 ? -2.246  10.306  6.282   1.00 0.00 ? 286 THR A HA   7 
ATOM   8626 H HB   . THR A 1 15 ? -3.844  11.323  3.983   1.00 0.00 ? 286 THR A HB   7 
ATOM   8627 H HG1  . THR A 1 15 ? -3.964  13.242  4.784   1.00 0.00 ? 286 THR A HG1  7 
ATOM   8628 H HG21 . THR A 1 15 ? -4.178  9.590   6.185   1.00 0.00 ? 286 THR A HG21 7 
ATOM   8629 H HG22 . THR A 1 15 ? -5.197  10.993  6.512   1.00 0.00 ? 286 THR A HG22 7 
ATOM   8630 H HG23 . THR A 1 15 ? -5.407  10.081  5.018   1.00 0.00 ? 286 THR A HG23 7 
ATOM   8631 N N    . LEU A 1 16 ? -1.494  10.413  3.072   1.00 0.00 ? 287 LEU A N    7 
ATOM   8632 C CA   . LEU A 1 16 ? -1.052  9.561   1.976   1.00 0.00 ? 287 LEU A CA   7 
ATOM   8633 C C    . LEU A 1 16 ? 0.091   8.674   2.470   1.00 0.00 ? 287 LEU A C    7 
ATOM   8634 O O    . LEU A 1 16 ? 0.105   7.479   2.248   1.00 0.00 ? 287 LEU A O    7 
ATOM   8635 C CB   . LEU A 1 16 ? -0.560  10.432  0.818   1.00 0.00 ? 287 LEU A CB   7 
ATOM   8636 C CG   . LEU A 1 16 ? -1.556  10.355  -0.341  1.00 0.00 ? 287 LEU A CG   7 
ATOM   8637 C CD1  . LEU A 1 16 ? -1.406  11.593  -1.226  1.00 0.00 ? 287 LEU A CD1  7 
ATOM   8638 C CD2  . LEU A 1 16 ? -1.275  9.100   -1.170  1.00 0.00 ? 287 LEU A CD2  7 
ATOM   8639 H H    . LEU A 1 16 ? -1.551  11.383  2.948   1.00 0.00 ? 287 LEU A H    7 
ATOM   8640 H HA   . LEU A 1 16 ? -1.873  8.944   1.643   1.00 0.00 ? 287 LEU A HA   7 
ATOM   8641 H HB2  . LEU A 1 16 ? -0.474  11.456  1.150   1.00 0.00 ? 287 LEU A HB2  7 
ATOM   8642 H HB3  . LEU A 1 16 ? 0.403   10.079  0.486   1.00 0.00 ? 287 LEU A HB3  7 
ATOM   8643 H HG   . LEU A 1 16 ? -2.562  10.312  0.052   1.00 0.00 ? 287 LEU A HG   7 
ATOM   8644 H HD11 . LEU A 1 16 ? -0.445  12.052  -1.043  1.00 0.00 ? 287 LEU A HD11 7 
ATOM   8645 H HD12 . LEU A 1 16 ? -1.476  11.305  -2.266  1.00 0.00 ? 287 LEU A HD12 7 
ATOM   8646 H HD13 . LEU A 1 16 ? -2.191  12.298  -0.995  1.00 0.00 ? 287 LEU A HD13 7 
ATOM   8647 H HD21 . LEU A 1 16 ? -0.220  9.042   -1.389  1.00 0.00 ? 287 LEU A HD21 7 
ATOM   8648 H HD22 . LEU A 1 16 ? -1.576  8.225   -0.613  1.00 0.00 ? 287 LEU A HD22 7 
ATOM   8649 H HD23 . LEU A 1 16 ? -1.831  9.147   -2.094  1.00 0.00 ? 287 LEU A HD23 7 
ATOM   8650 N N    . LYS A 1 17 ? 1.046   9.251   3.146   1.00 0.00 ? 288 LYS A N    7 
ATOM   8651 C CA   . LYS A 1 17 ? 2.163   8.465   3.652   1.00 0.00 ? 288 LYS A CA   7 
ATOM   8652 C C    . LYS A 1 17 ? 1.619   7.295   4.474   1.00 0.00 ? 288 LYS A C    7 
ATOM   8653 O O    . LYS A 1 17 ? 2.091   6.179   4.378   1.00 0.00 ? 288 LYS A O    7 
ATOM   8654 C CB   . LYS A 1 17 ? 3.044   9.345   4.542   1.00 0.00 ? 288 LYS A CB   7 
ATOM   8655 C CG   . LYS A 1 17 ? 4.321   9.720   3.786   1.00 0.00 ? 288 LYS A CG   7 
ATOM   8656 C CD   . LYS A 1 17 ? 4.176   11.131  3.210   1.00 0.00 ? 288 LYS A CD   7 
ATOM   8657 C CE   . LYS A 1 17 ? 5.385   11.974  3.615   1.00 0.00 ? 288 LYS A CE   7 
ATOM   8658 N NZ   . LYS A 1 17 ? 6.636   11.221  3.321   1.00 0.00 ? 288 LYS A NZ   7 
ATOM   8659 H H    . LYS A 1 17 ? 1.010   10.215  3.317   1.00 0.00 ? 288 LYS A H    7 
ATOM   8660 H HA   . LYS A 1 17 ? 2.746   8.087   2.825   1.00 0.00 ? 288 LYS A HA   7 
ATOM   8661 H HB2  . LYS A 1 17 ? 2.504   10.241  4.806   1.00 0.00 ? 288 LYS A HB2  7 
ATOM   8662 H HB3  . LYS A 1 17 ? 3.305   8.804   5.438   1.00 0.00 ? 288 LYS A HB3  7 
ATOM   8663 H HG2  . LYS A 1 17 ? 5.161   9.693   4.466   1.00 0.00 ? 288 LYS A HG2  7 
ATOM   8664 H HG3  . LYS A 1 17 ? 4.483   9.021   2.982   1.00 0.00 ? 288 LYS A HG3  7 
ATOM   8665 H HD2  . LYS A 1 17 ? 4.118   11.073  2.133   1.00 0.00 ? 288 LYS A HD2  7 
ATOM   8666 H HD3  . LYS A 1 17 ? 3.276   11.586  3.596   1.00 0.00 ? 288 LYS A HD3  7 
ATOM   8667 H HE2  . LYS A 1 17 ? 5.382   12.899  3.057   1.00 0.00 ? 288 LYS A HE2  7 
ATOM   8668 H HE3  . LYS A 1 17 ? 5.336   12.191  4.671   1.00 0.00 ? 288 LYS A HE3  7 
ATOM   8669 H HZ1  . LYS A 1 17 ? 6.451   10.519  2.578   1.00 0.00 ? 288 LYS A HZ1  7 
ATOM   8670 H HZ2  . LYS A 1 17 ? 7.371   11.883  2.997   1.00 0.00 ? 288 LYS A HZ2  7 
ATOM   8671 H HZ3  . LYS A 1 17 ? 6.961   10.736  4.181   1.00 0.00 ? 288 LYS A HZ3  7 
ATOM   8672 N N    . ALA A 1 18 ? 0.626   7.543   5.282   1.00 0.00 ? 289 ALA A N    7 
ATOM   8673 C CA   . ALA A 1 18 ? 0.058   6.476   6.096   1.00 0.00 ? 289 ALA A CA   7 
ATOM   8674 C C    . ALA A 1 18 ? -0.360  5.314   5.198   1.00 0.00 ? 289 ALA A C    7 
ATOM   8675 O O    . ALA A 1 18 ? 0.083   4.195   5.365   1.00 0.00 ? 289 ALA A O    7 
ATOM   8676 C CB   . ALA A 1 18 ? -1.172  6.999   6.836   1.00 0.00 ? 289 ALA A CB   7 
ATOM   8677 H H    . ALA A 1 18 ? 0.260   8.451   5.343   1.00 0.00 ? 289 ALA A H    7 
ATOM   8678 H HA   . ALA A 1 18 ? 0.791   6.136   6.811   1.00 0.00 ? 289 ALA A HA   7 
ATOM   8679 H HB1  . ALA A 1 18 ? -1.257  8.066   6.688   1.00 0.00 ? 289 ALA A HB1  7 
ATOM   8680 H HB2  . ALA A 1 18 ? -2.057  6.509   6.452   1.00 0.00 ? 289 ALA A HB2  7 
ATOM   8681 H HB3  . ALA A 1 18 ? -1.076  6.787   7.892   1.00 0.00 ? 289 ALA A HB3  7 
ATOM   8682 N N    . GLN A 1 19 ? -1.222  5.569   4.256   1.00 0.00 ? 290 GLN A N    7 
ATOM   8683 C CA   . GLN A 1 19 ? -1.675  4.500   3.375   1.00 0.00 ? 290 GLN A CA   7 
ATOM   8684 C C    . GLN A 1 19 ? -0.469  3.744   2.813   1.00 0.00 ? 290 GLN A C    7 
ATOM   8685 O O    . GLN A 1 19 ? -0.515  2.545   2.623   1.00 0.00 ? 290 GLN A O    7 
ATOM   8686 C CB   . GLN A 1 19 ? -2.493  5.091   2.226   1.00 0.00 ? 290 GLN A CB   7 
ATOM   8687 C CG   . GLN A 1 19 ? -3.856  5.545   2.754   1.00 0.00 ? 290 GLN A CG   7 
ATOM   8688 C CD   . GLN A 1 19 ? -4.669  6.159   1.614   1.00 0.00 ? 290 GLN A CD   7 
ATOM   8689 O OE1  . GLN A 1 19 ? -5.163  7.262   1.731   1.00 0.00 ? 290 GLN A OE1  7 
ATOM   8690 N NE2  . GLN A 1 19 ? -4.831  5.486   0.508   1.00 0.00 ? 290 GLN A NE2  7 
ATOM   8691 H H    . GLN A 1 19 ? -1.575  6.479   4.145   1.00 0.00 ? 290 GLN A H    7 
ATOM   8692 H HA   . GLN A 1 19 ? -2.294  3.819   3.939   1.00 0.00 ? 290 GLN A HA   7 
ATOM   8693 H HB2  . GLN A 1 19 ? -1.966  5.937   1.807   1.00 0.00 ? 290 GLN A HB2  7 
ATOM   8694 H HB3  . GLN A 1 19 ? -2.634  4.341   1.464   1.00 0.00 ? 290 GLN A HB3  7 
ATOM   8695 H HG2  . GLN A 1 19 ? -4.385  4.696   3.158   1.00 0.00 ? 290 GLN A HG2  7 
ATOM   8696 H HG3  . GLN A 1 19 ? -3.713  6.283   3.531   1.00 0.00 ? 290 GLN A HG3  7 
ATOM   8697 H HE21 . GLN A 1 19 ? -4.432  4.594   0.415   1.00 0.00 ? 290 GLN A HE21 7 
ATOM   8698 H HE22 . GLN A 1 19 ? -5.351  5.869   -0.228  1.00 0.00 ? 290 GLN A HE22 7 
ATOM   8699 N N    . ASN A 1 20 ? 0.608   4.429   2.543   1.00 0.00 ? 291 ASN A N    7 
ATOM   8700 C CA   . ASN A 1 20 ? 1.781   3.747   2.005   1.00 0.00 ? 291 ASN A CA   7 
ATOM   8701 C C    . ASN A 1 20 ? 2.253   2.693   3.008   1.00 0.00 ? 291 ASN A C    7 
ATOM   8702 O O    . ASN A 1 20 ? 2.480   1.550   2.660   1.00 0.00 ? 291 ASN A O    7 
ATOM   8703 C CB   . ASN A 1 20 ? 2.898   4.761   1.758   1.00 0.00 ? 291 ASN A CB   7 
ATOM   8704 C CG   . ASN A 1 20 ? 2.983   5.069   0.263   1.00 0.00 ? 291 ASN A CG   7 
ATOM   8705 O OD1  . ASN A 1 20 ? 2.187   4.581   -0.516  1.00 0.00 ? 291 ASN A OD1  7 
ATOM   8706 N ND2  . ASN A 1 20 ? 3.921   5.864   -0.177  1.00 0.00 ? 291 ASN A ND2  7 
ATOM   8707 H H    . ASN A 1 20 ? 0.629   5.396   2.700   1.00 0.00 ? 291 ASN A H    7 
ATOM   8708 H HA   . ASN A 1 20 ? 1.520   3.267   1.074   1.00 0.00 ? 291 ASN A HA   7 
ATOM   8709 H HB2  . ASN A 1 20 ? 2.688   5.670   2.305   1.00 0.00 ? 291 ASN A HB2  7 
ATOM   8710 H HB3  . ASN A 1 20 ? 3.839   4.348   2.093   1.00 0.00 ? 291 ASN A HB3  7 
ATOM   8711 H HD21 . ASN A 1 20 ? 4.563   6.258   0.449   1.00 0.00 ? 291 ASN A HD21 7 
ATOM   8712 H HD22 . ASN A 1 20 ? 3.983   6.067   -1.135  1.00 0.00 ? 291 ASN A HD22 7 
ATOM   8713 N N    . SER A 1 21 ? 2.401   3.061   4.251   1.00 0.00 ? 292 SER A N    7 
ATOM   8714 C CA   . SER A 1 21 ? 2.845   2.095   5.249   1.00 0.00 ? 292 SER A CA   7 
ATOM   8715 C C    . SER A 1 21 ? 1.823   0.960   5.333   1.00 0.00 ? 292 SER A C    7 
ATOM   8716 O O    . SER A 1 21 ? 2.157   -0.171  5.624   1.00 0.00 ? 292 SER A O    7 
ATOM   8717 C CB   . SER A 1 21 ? 2.962   2.780   6.611   1.00 0.00 ? 292 SER A CB   7 
ATOM   8718 O OG   . SER A 1 21 ? 4.337   2.972   6.922   1.00 0.00 ? 292 SER A OG   7 
ATOM   8719 H H    . SER A 1 21 ? 2.209   3.986   4.515   1.00 0.00 ? 292 SER A H    7 
ATOM   8720 H HA   . SER A 1 21 ? 3.805   1.695   4.963   1.00 0.00 ? 292 SER A HA   7 
ATOM   8721 H HB2  . SER A 1 21 ? 2.470   3.738   6.578   1.00 0.00 ? 292 SER A HB2  7 
ATOM   8722 H HB3  . SER A 1 21 ? 2.495   2.162   7.365   1.00 0.00 ? 292 SER A HB3  7 
ATOM   8723 H HG   . SER A 1 21 ? 4.798   2.147   6.750   1.00 0.00 ? 292 SER A HG   7 
ATOM   8724 N N    . GLU A 1 22 ? 0.577   1.255   5.079   1.00 0.00 ? 293 GLU A N    7 
ATOM   8725 C CA   . GLU A 1 22 ? -0.447  0.219   5.138   1.00 0.00 ? 293 GLU A CA   7 
ATOM   8726 C C    . GLU A 1 22 ? -0.129  -0.864  4.105   1.00 0.00 ? 293 GLU A C    7 
ATOM   8727 O O    . GLU A 1 22 ? 0.081   -2.014  4.436   1.00 0.00 ? 293 GLU A O    7 
ATOM   8728 C CB   . GLU A 1 22 ? -1.814  0.835   4.831   1.00 0.00 ? 293 GLU A CB   7 
ATOM   8729 C CG   . GLU A 1 22 ? -2.507  1.227   6.137   1.00 0.00 ? 293 GLU A CG   7 
ATOM   8730 C CD   . GLU A 1 22 ? -3.850  1.886   5.824   1.00 0.00 ? 293 GLU A CD   7 
ATOM   8731 O OE1  . GLU A 1 22 ? -4.719  1.200   5.312   1.00 0.00 ? 293 GLU A OE1  7 
ATOM   8732 O OE2  . GLU A 1 22 ? -3.989  3.065   6.103   1.00 0.00 ? 293 GLU A OE2  7 
ATOM   8733 H H    . GLU A 1 22 ? 0.329   2.173   4.845   1.00 0.00 ? 293 GLU A H    7 
ATOM   8734 H HA   . GLU A 1 22 ? -0.463  -0.218  6.126   1.00 0.00 ? 293 GLU A HA   7 
ATOM   8735 H HB2  . GLU A 1 22 ? -1.682  1.712   4.213   1.00 0.00 ? 293 GLU A HB2  7 
ATOM   8736 H HB3  . GLU A 1 22 ? -2.423  0.114   4.307   1.00 0.00 ? 293 GLU A HB3  7 
ATOM   8737 H HG2  . GLU A 1 22 ? -2.668  0.344   6.738   1.00 0.00 ? 293 GLU A HG2  7 
ATOM   8738 H HG3  . GLU A 1 22 ? -1.883  1.923   6.679   1.00 0.00 ? 293 GLU A HG3  7 
ATOM   8739 N N    . LEU A 1 23 ? -0.097  -0.502  2.851   1.00 0.00 ? 294 LEU A N    7 
ATOM   8740 C CA   . LEU A 1 23 ? 0.201   -1.484  1.815   1.00 0.00 ? 294 LEU A CA   7 
ATOM   8741 C C    . LEU A 1 23 ? 1.555   -2.135  2.103   1.00 0.00 ? 294 LEU A C    7 
ATOM   8742 O O    . LEU A 1 23 ? 1.802   -3.265  1.732   1.00 0.00 ? 294 LEU A O    7 
ATOM   8743 C CB   . LEU A 1 23 ? 0.248   -0.789  0.454   1.00 0.00 ? 294 LEU A CB   7 
ATOM   8744 C CG   . LEU A 1 23 ? -1.140  -0.249  0.105   1.00 0.00 ? 294 LEU A CG   7 
ATOM   8745 C CD1  . LEU A 1 23 ? -1.053  0.600   -1.164  1.00 0.00 ? 294 LEU A CD1  7 
ATOM   8746 C CD2  . LEU A 1 23 ? -2.096  -1.423  -0.132  1.00 0.00 ? 294 LEU A CD2  7 
ATOM   8747 H H    . LEU A 1 23 ? -0.270  0.431   2.607   1.00 0.00 ? 294 LEU A H    7 
ATOM   8748 H HA   . LEU A 1 23 ? -0.570  -2.241  1.805   1.00 0.00 ? 294 LEU A HA   7 
ATOM   8749 H HB2  . LEU A 1 23 ? 0.954   0.029   0.493   1.00 0.00 ? 294 LEU A HB2  7 
ATOM   8750 H HB3  . LEU A 1 23 ? 0.558   -1.495  -0.301  1.00 0.00 ? 294 LEU A HB3  7 
ATOM   8751 H HG   . LEU A 1 23 ? -1.505  0.359   0.921   1.00 0.00 ? 294 LEU A HG   7 
ATOM   8752 H HD11 . LEU A 1 23 ? -0.081  0.473   -1.616  1.00 0.00 ? 294 LEU A HD11 7 
ATOM   8753 H HD12 . LEU A 1 23 ? -1.819  0.287   -1.859  1.00 0.00 ? 294 LEU A HD12 7 
ATOM   8754 H HD13 . LEU A 1 23 ? -1.201  1.639   -0.912  1.00 0.00 ? 294 LEU A HD13 7 
ATOM   8755 H HD21 . LEU A 1 23 ? -1.577  -2.208  -0.657  1.00 0.00 ? 294 LEU A HD21 7 
ATOM   8756 H HD22 . LEU A 1 23 ? -2.449  -1.796  0.821   1.00 0.00 ? 294 LEU A HD22 7 
ATOM   8757 H HD23 . LEU A 1 23 ? -2.937  -1.088  -0.721  1.00 0.00 ? 294 LEU A HD23 7 
ATOM   8758 N N    . ALA A 1 24 ? 2.435   -1.430  2.761   1.00 0.00 ? 295 ALA A N    7 
ATOM   8759 C CA   . ALA A 1 24 ? 3.743   -1.997  3.064   1.00 0.00 ? 295 ALA A CA   7 
ATOM   8760 C C    . ALA A 1 24 ? 3.572   -3.240  3.940   1.00 0.00 ? 295 ALA A C    7 
ATOM   8761 O O    . ALA A 1 24 ? 4.165   -4.273  3.694   1.00 0.00 ? 295 ALA A O    7 
ATOM   8762 C CB   . ALA A 1 24 ? 4.588   -0.961  3.808   1.00 0.00 ? 295 ALA A CB   7 
ATOM   8763 H H    . ALA A 1 24 ? 2.216   -0.520  3.050   1.00 0.00 ? 295 ALA A H    7 
ATOM   8764 H HA   . ALA A 1 24 ? 4.239   -2.269  2.144   1.00 0.00 ? 295 ALA A HA   7 
ATOM   8765 H HB1  . ALA A 1 24 ? 4.337   0.028   3.452   1.00 0.00 ? 295 ALA A HB1  7 
ATOM   8766 H HB2  . ALA A 1 24 ? 4.387   -1.024  4.866   1.00 0.00 ? 295 ALA A HB2  7 
ATOM   8767 H HB3  . ALA A 1 24 ? 5.635   -1.152  3.627   1.00 0.00 ? 295 ALA A HB3  7 
ATOM   8768 N N    . SER A 1 25 ? 2.767   -3.148  4.962   1.00 0.00 ? 296 SER A N    7 
ATOM   8769 C CA   . SER A 1 25 ? 2.564   -4.297  5.837   1.00 0.00 ? 296 SER A CA   7 
ATOM   8770 C C    . SER A 1 25 ? 1.875   -5.419  5.056   1.00 0.00 ? 296 SER A C    7 
ATOM   8771 O O    . SER A 1 25 ? 2.234   -6.575  5.163   1.00 0.00 ? 296 SER A O    7 
ATOM   8772 C CB   . SER A 1 25 ? 1.692   -3.886  7.024   1.00 0.00 ? 296 SER A CB   7 
ATOM   8773 O OG   . SER A 1 25 ? 0.355   -4.317  6.801   1.00 0.00 ? 296 SER A OG   7 
ATOM   8774 H H    . SER A 1 25 ? 2.302   -2.306  5.144   1.00 0.00 ? 296 SER A H    7 
ATOM   8775 H HA   . SER A 1 25 ? 3.520   -4.646  6.199   1.00 0.00 ? 296 SER A HA   7 
ATOM   8776 H HB2  . SER A 1 25 ? 2.065   -4.347  7.924   1.00 0.00 ? 296 SER A HB2  7 
ATOM   8777 H HB3  . SER A 1 25 ? 1.720   -2.810  7.135   1.00 0.00 ? 296 SER A HB3  7 
ATOM   8778 H HG   . SER A 1 25 ? -0.119  -3.603  6.371   1.00 0.00 ? 296 SER A HG   7 
ATOM   8779 N N    . THR A 1 26 ? 0.886   -5.088  4.270   1.00 0.00 ? 297 THR A N    7 
ATOM   8780 C CA   . THR A 1 26 ? 0.190   -6.115  3.503   1.00 0.00 ? 297 THR A CA   7 
ATOM   8781 C C    . THR A 1 26 ? 1.199   -6.915  2.677   1.00 0.00 ? 297 THR A C    7 
ATOM   8782 O O    . THR A 1 26 ? 1.116   -8.123  2.578   1.00 0.00 ? 297 THR A O    7 
ATOM   8783 C CB   . THR A 1 26 ? -0.825  -5.454  2.567   1.00 0.00 ? 297 THR A CB   7 
ATOM   8784 O OG1  . THR A 1 26 ? -1.811  -4.784  3.339   1.00 0.00 ? 297 THR A OG1  7 
ATOM   8785 C CG2  . THR A 1 26 ? -1.492  -6.524  1.700   1.00 0.00 ? 297 THR A CG2  7 
ATOM   8786 H H    . THR A 1 26 ? 0.610   -4.150  4.199   1.00 0.00 ? 297 THR A H    7 
ATOM   8787 H HA   . THR A 1 26 ? -0.328  -6.779  4.178   1.00 0.00 ? 297 THR A HA   7 
ATOM   8788 H HB   . THR A 1 26 ? -0.319  -4.744  1.930   1.00 0.00 ? 297 THR A HB   7 
ATOM   8789 H HG1  . THR A 1 26 ? -2.596  -4.686  2.795   1.00 0.00 ? 297 THR A HG1  7 
ATOM   8790 H HG21 . THR A 1 26 ? -1.235  -7.503  2.076   1.00 0.00 ? 297 THR A HG21 7 
ATOM   8791 H HG22 . THR A 1 26 ? -2.565  -6.395  1.732   1.00 0.00 ? 297 THR A HG22 7 
ATOM   8792 H HG23 . THR A 1 26 ? -1.147  -6.427  0.681   1.00 0.00 ? 297 THR A HG23 7 
ATOM   8793 N N    . ALA A 1 27 ? 2.148   -6.250  2.079   1.00 0.00 ? 298 ALA A N    7 
ATOM   8794 C CA   . ALA A 1 27 ? 3.138   -6.955  1.273   1.00 0.00 ? 298 ALA A CA   7 
ATOM   8795 C C    . ALA A 1 27 ? 3.942   -7.907  2.161   1.00 0.00 ? 298 ALA A C    7 
ATOM   8796 O O    . ALA A 1 27 ? 4.026   -9.091  1.902   1.00 0.00 ? 298 ALA A O    7 
ATOM   8797 C CB   . ALA A 1 27 ? 4.083   -5.942  0.625   1.00 0.00 ? 298 ALA A CB   7 
ATOM   8798 H H    . ALA A 1 27 ? 2.194   -5.276  2.169   1.00 0.00 ? 298 ALA A H    7 
ATOM   8799 H HA   . ALA A 1 27 ? 2.638   -7.521  0.502   1.00 0.00 ? 298 ALA A HA   7 
ATOM   8800 H HB1  . ALA A 1 27 ? 4.062   -5.020  1.189   1.00 0.00 ? 298 ALA A HB1  7 
ATOM   8801 H HB2  . ALA A 1 27 ? 5.086   -6.337  0.620   1.00 0.00 ? 298 ALA A HB2  7 
ATOM   8802 H HB3  . ALA A 1 27 ? 3.765   -5.751  -0.389  1.00 0.00 ? 298 ALA A HB3  7 
ATOM   8803 N N    . ASN A 1 28 ? 4.539   -7.402  3.206   1.00 0.00 ? 299 ASN A N    7 
ATOM   8804 C CA   . ASN A 1 28 ? 5.323   -8.262  4.085   1.00 0.00 ? 299 ASN A CA   7 
ATOM   8805 C C    . ASN A 1 28 ? 4.439   -9.395  4.614   1.00 0.00 ? 299 ASN A C    7 
ATOM   8806 O O    . ASN A 1 28 ? 4.925   -10.411 5.068   1.00 0.00 ? 299 ASN A O    7 
ATOM   8807 C CB   . ASN A 1 28 ? 5.862   -7.442  5.256   1.00 0.00 ? 299 ASN A CB   7 
ATOM   8808 C CG   . ASN A 1 28 ? 6.638   -6.237  4.721   1.00 0.00 ? 299 ASN A CG   7 
ATOM   8809 O OD1  . ASN A 1 28 ? 7.604   -6.394  3.999   1.00 0.00 ? 299 ASN A OD1  7 
ATOM   8810 N ND2  . ASN A 1 28 ? 6.254   -5.032  5.042   1.00 0.00 ? 299 ASN A ND2  7 
ATOM   8811 H H    . ASN A 1 28 ? 4.464   -6.442  3.398   1.00 0.00 ? 299 ASN A H    7 
ATOM   8812 H HA   . ASN A 1 28 ? 6.150   -8.682  3.531   1.00 0.00 ? 299 ASN A HA   7 
ATOM   8813 H HB2  . ASN A 1 28 ? 5.039   -7.099  5.866   1.00 0.00 ? 299 ASN A HB2  7 
ATOM   8814 H HB3  . ASN A 1 28 ? 6.522   -8.055  5.852   1.00 0.00 ? 299 ASN A HB3  7 
ATOM   8815 H HD21 . ASN A 1 28 ? 5.474   -4.906  5.622   1.00 0.00 ? 299 ASN A HD21 7 
ATOM   8816 H HD22 . ASN A 1 28 ? 6.745   -4.254  4.703   1.00 0.00 ? 299 ASN A HD22 7 
ATOM   8817 N N    . MET A 1 29 ? 3.146   -9.230  4.557   1.00 0.00 ? 300 MET A N    7 
ATOM   8818 C CA   . MET A 1 29 ? 2.256   -10.278 5.045   1.00 0.00 ? 300 MET A CA   7 
ATOM   8819 C C    . MET A 1 29 ? 2.222   -11.424 4.031   1.00 0.00 ? 300 MET A C    7 
ATOM   8820 O O    . MET A 1 29 ? 2.603   -12.539 4.326   1.00 0.00 ? 300 MET A O    7 
ATOM   8821 C CB   . MET A 1 29 ? 0.847   -9.710  5.225   1.00 0.00 ? 300 MET A CB   7 
ATOM   8822 C CG   . MET A 1 29 ? 0.159   -10.412 6.398   1.00 0.00 ? 300 MET A CG   7 
ATOM   8823 S SD   . MET A 1 29 ? -0.970  -11.677 5.766   1.00 0.00 ? 300 MET A SD   7 
ATOM   8824 C CE   . MET A 1 29 ? -1.292  -12.506 7.342   1.00 0.00 ? 300 MET A CE   7 
ATOM   8825 H H    . MET A 1 29 ? 2.773   -8.404  4.185   1.00 0.00 ? 300 MET A H    7 
ATOM   8826 H HA   . MET A 1 29 ? 2.618   -10.645 5.993   1.00 0.00 ? 300 MET A HA   7 
ATOM   8827 H HB2  . MET A 1 29 ? 0.907   -8.649  5.425   1.00 0.00 ? 300 MET A HB2  7 
ATOM   8828 H HB3  . MET A 1 29 ? 0.274   -9.875  4.324   1.00 0.00 ? 300 MET A HB3  7 
ATOM   8829 H HG2  . MET A 1 29 ? 0.904   -10.877 7.026   1.00 0.00 ? 300 MET A HG2  7 
ATOM   8830 H HG3  . MET A 1 29 ? -0.397  -9.688  6.974   1.00 0.00 ? 300 MET A HG3  7 
ATOM   8831 H HE1  . MET A 1 29 ? -0.991  -11.858 8.155   1.00 0.00 ? 300 MET A HE1  7 
ATOM   8832 H HE2  . MET A 1 29 ? -2.345  -12.728 7.424   1.00 0.00 ? 300 MET A HE2  7 
ATOM   8833 H HE3  . MET A 1 29 ? -0.727  -13.422 7.390   1.00 0.00 ? 300 MET A HE3  7 
ATOM   8834 N N    . LEU A 1 30 ? 1.772   -11.157 2.836   1.00 0.00 ? 301 LEU A N    7 
ATOM   8835 C CA   . LEU A 1 30 ? 1.720   -12.209 1.826   1.00 0.00 ? 301 LEU A CA   7 
ATOM   8836 C C    . LEU A 1 30 ? 3.129   -12.754 1.595   1.00 0.00 ? 301 LEU A C    7 
ATOM   8837 O O    . LEU A 1 30 ? 3.312   -13.837 1.075   1.00 0.00 ? 301 LEU A O    7 
ATOM   8838 C CB   . LEU A 1 30 ? 1.176   -11.635 0.517   1.00 0.00 ? 301 LEU A CB   7 
ATOM   8839 C CG   . LEU A 1 30 ? -0.198  -11.009 0.762   1.00 0.00 ? 301 LEU A CG   7 
ATOM   8840 C CD1  . LEU A 1 30 ? -0.372  -9.790  -0.146  1.00 0.00 ? 301 LEU A CD1  7 
ATOM   8841 C CD2  . LEU A 1 30 ? -1.288  -12.036 0.447   1.00 0.00 ? 301 LEU A CD2  7 
ATOM   8842 H H    . LEU A 1 30 ? 1.470   -10.252 2.615   1.00 0.00 ? 301 LEU A H    7 
ATOM   8843 H HA   . LEU A 1 30 ? 1.074   -13.005 2.167   1.00 0.00 ? 301 LEU A HA   7 
ATOM   8844 H HB2  . LEU A 1 30 ? 1.854   -10.880 0.147   1.00 0.00 ? 301 LEU A HB2  7 
ATOM   8845 H HB3  . LEU A 1 30 ? 1.085   -12.426 -0.212  1.00 0.00 ? 301 LEU A HB3  7 
ATOM   8846 H HG   . LEU A 1 30 ? -0.277  -10.703 1.796   1.00 0.00 ? 301 LEU A HG   7 
ATOM   8847 H HD11 . LEU A 1 30 ? 0.579   -9.530  -0.587  1.00 0.00 ? 301 LEU A HD11 7 
ATOM   8848 H HD12 . LEU A 1 30 ? -1.080  -10.020 -0.929  1.00 0.00 ? 301 LEU A HD12 7 
ATOM   8849 H HD13 . LEU A 1 30 ? -0.738  -8.956  0.437   1.00 0.00 ? 301 LEU A HD13 7 
ATOM   8850 H HD21 . LEU A 1 30 ? -0.845  -12.894 -0.037  1.00 0.00 ? 301 LEU A HD21 7 
ATOM   8851 H HD22 . LEU A 1 30 ? -1.766  -12.348 1.364   1.00 0.00 ? 301 LEU A HD22 7 
ATOM   8852 H HD23 . LEU A 1 30 ? -2.021  -11.593 -0.211  1.00 0.00 ? 301 LEU A HD23 7 
ATOM   8853 N N    . ARG A 1 31 ? 4.131   -12.008 1.973   1.00 0.00 ? 302 ARG A N    7 
ATOM   8854 C CA   . ARG A 1 31 ? 5.500   -12.467 1.778   1.00 0.00 ? 302 ARG A CA   7 
ATOM   8855 C C    . ARG A 1 31 ? 5.873   -13.475 2.867   1.00 0.00 ? 302 ARG A C    7 
ATOM   8856 O O    . ARG A 1 31 ? 6.547   -14.453 2.611   1.00 0.00 ? 302 ARG A O    7 
ATOM   8857 C CB   . ARG A 1 31 ? 6.452   -11.271 1.847   1.00 0.00 ? 302 ARG A CB   7 
ATOM   8858 C CG   . ARG A 1 31 ? 7.193   -11.133 0.515   1.00 0.00 ? 302 ARG A CG   7 
ATOM   8859 C CD   . ARG A 1 31 ? 7.983   -9.824  0.502   1.00 0.00 ? 302 ARG A CD   7 
ATOM   8860 N NE   . ARG A 1 31 ? 8.628   -9.661  -0.793  1.00 0.00 ? 302 ARG A NE   7 
ATOM   8861 C CZ   . ARG A 1 31 ? 9.097   -8.496  -1.148  1.00 0.00 ? 302 ARG A CZ   7 
ATOM   8862 N NH1  . ARG A 1 31 ? 9.529   -7.662  -0.241  1.00 0.00 ? 302 ARG A NH1  7 
ATOM   8863 N NH2  . ARG A 1 31 ? 9.130   -8.161  -2.408  1.00 0.00 ? 302 ARG A NH2  7 
ATOM   8864 H H    . ARG A 1 31 ? 3.962   -11.136 2.386   1.00 0.00 ? 302 ARG A H    7 
ATOM   8865 H HA   . ARG A 1 31 ? 5.588   -12.935 0.808   1.00 0.00 ? 302 ARG A HA   7 
ATOM   8866 H HB2  . ARG A 1 31 ? 5.886   -10.372 2.039   1.00 0.00 ? 302 ARG A HB2  7 
ATOM   8867 H HB3  . ARG A 1 31 ? 7.167   -11.425 2.641   1.00 0.00 ? 302 ARG A HB3  7 
ATOM   8868 H HG2  . ARG A 1 31 ? 7.871   -11.966 0.394   1.00 0.00 ? 302 ARG A HG2  7 
ATOM   8869 H HG3  . ARG A 1 31 ? 6.479   -11.128 -0.295  1.00 0.00 ? 302 ARG A HG3  7 
ATOM   8870 H HD2  . ARG A 1 31 ? 7.311   -8.995  0.678   1.00 0.00 ? 302 ARG A HD2  7 
ATOM   8871 H HD3  . ARG A 1 31 ? 8.734   -9.847  1.279   1.00 0.00 ? 302 ARG A HD3  7 
ATOM   8872 H HE   . ARG A 1 31 ? 8.712   -10.427 -1.399  1.00 0.00 ? 302 ARG A HE   7 
ATOM   8873 H HH11 . ARG A 1 31 ? 9.501   -7.918  0.725   1.00 0.00 ? 302 ARG A HH11 7 
ATOM   8874 H HH12 . ARG A 1 31 ? 9.886   -6.769  -0.513  1.00 0.00 ? 302 ARG A HH12 7 
ATOM   8875 H HH21 . ARG A 1 31 ? 8.799   -8.800  -3.104  1.00 0.00 ? 302 ARG A HH21 7 
ATOM   8876 H HH22 . ARG A 1 31 ? 9.489   -7.269  -2.681  1.00 0.00 ? 302 ARG A HH22 7 
ATOM   8877 N N    . GLU A 1 32 ? 5.445   -13.248 4.078   1.00 0.00 ? 303 GLU A N    7 
ATOM   8878 C CA   . GLU A 1 32 ? 5.778   -14.181 5.150   1.00 0.00 ? 303 GLU A CA   7 
ATOM   8879 C C    . GLU A 1 32 ? 5.021   -15.493 4.938   1.00 0.00 ? 303 GLU A C    7 
ATOM   8880 O O    . GLU A 1 32 ? 5.503   -16.560 5.273   1.00 0.00 ? 303 GLU A O    7 
ATOM   8881 C CB   . GLU A 1 32 ? 5.387   -13.575 6.501   1.00 0.00 ? 303 GLU A CB   7 
ATOM   8882 C CG   . GLU A 1 32 ? 3.915   -13.160 6.474   1.00 0.00 ? 303 GLU A CG   7 
ATOM   8883 C CD   . GLU A 1 32 ? 3.382   -13.080 7.905   1.00 0.00 ? 303 GLU A CD   7 
ATOM   8884 O OE1  . GLU A 1 32 ? 4.159   -13.301 8.819   1.00 0.00 ? 303 GLU A OE1  7 
ATOM   8885 O OE2  . GLU A 1 32 ? 2.205   -12.800 8.061   1.00 0.00 ? 303 GLU A OE2  7 
ATOM   8886 H H    . GLU A 1 32 ? 4.905   -12.453 4.268   1.00 0.00 ? 303 GLU A H    7 
ATOM   8887 H HA   . GLU A 1 32 ? 6.840   -14.374 5.140   1.00 0.00 ? 303 GLU A HA   7 
ATOM   8888 H HB2  . GLU A 1 32 ? 5.541   -14.308 7.281   1.00 0.00 ? 303 GLU A HB2  7 
ATOM   8889 H HB3  . GLU A 1 32 ? 6.000   -12.708 6.696   1.00 0.00 ? 303 GLU A HB3  7 
ATOM   8890 H HG2  . GLU A 1 32 ? 3.823   -12.193 5.999   1.00 0.00 ? 303 GLU A HG2  7 
ATOM   8891 H HG3  . GLU A 1 32 ? 3.345   -13.890 5.919   1.00 0.00 ? 303 GLU A HG3  7 
ATOM   8892 N N    . GLN A 1 33 ? 3.842   -15.429 4.382   1.00 0.00 ? 304 GLN A N    7 
ATOM   8893 C CA   . GLN A 1 33 ? 3.078   -16.650 4.155   1.00 0.00 ? 304 GLN A CA   7 
ATOM   8894 C C    . GLN A 1 33 ? 3.660   -17.402 2.955   1.00 0.00 ? 304 GLN A C    7 
ATOM   8895 O O    . GLN A 1 33 ? 3.760   -18.613 2.957   1.00 0.00 ? 304 GLN A O    7 
ATOM   8896 C CB   . GLN A 1 33 ? 1.610   -16.299 3.884   1.00 0.00 ? 304 GLN A CB   7 
ATOM   8897 C CG   . GLN A 1 33 ? 1.459   -15.760 2.459   1.00 0.00 ? 304 GLN A CG   7 
ATOM   8898 C CD   . GLN A 1 33 ? -0.026  -15.557 2.146   1.00 0.00 ? 304 GLN A CD   7 
ATOM   8899 O OE1  . GLN A 1 33 ? -0.515  -14.445 2.161   1.00 0.00 ? 304 GLN A OE1  7 
ATOM   8900 N NE2  . GLN A 1 33 ? -0.766  -16.592 1.859   1.00 0.00 ? 304 GLN A NE2  7 
ATOM   8901 H H    . GLN A 1 33 ? 3.471   -14.560 4.117   1.00 0.00 ? 304 GLN A H    7 
ATOM   8902 H HA   . GLN A 1 33 ? 3.137   -17.277 5.032   1.00 0.00 ? 304 GLN A HA   7 
ATOM   8903 H HB2  . GLN A 1 33 ? 1.002   -17.184 4.000   1.00 0.00 ? 304 GLN A HB2  7 
ATOM   8904 H HB3  . GLN A 1 33 ? 1.285   -15.546 4.587   1.00 0.00 ? 304 GLN A HB3  7 
ATOM   8905 H HG2  . GLN A 1 33 ? 1.978   -14.815 2.374   1.00 0.00 ? 304 GLN A HG2  7 
ATOM   8906 H HG3  . GLN A 1 33 ? 1.878   -16.467 1.760   1.00 0.00 ? 304 GLN A HG3  7 
ATOM   8907 H HE21 . GLN A 1 33 ? -0.371  -17.489 1.845   1.00 0.00 ? 304 GLN A HE21 7 
ATOM   8908 H HE22 . GLN A 1 33 ? -1.717  -16.475 1.656   1.00 0.00 ? 304 GLN A HE22 7 
ATOM   8909 N N    . VAL A 1 34 ? 4.050   -16.693 1.931   1.00 0.00 ? 305 VAL A N    7 
ATOM   8910 C CA   . VAL A 1 34 ? 4.614   -17.354 0.757   1.00 0.00 ? 305 VAL A CA   7 
ATOM   8911 C C    . VAL A 1 34 ? 6.001   -17.900 1.100   1.00 0.00 ? 305 VAL A C    7 
ATOM   8912 O O    . VAL A 1 34 ? 6.464   -18.860 0.518   1.00 0.00 ? 305 VAL A O    7 
ATOM   8913 C CB   . VAL A 1 34 ? 4.725   -16.350 -0.389  1.00 0.00 ? 305 VAL A CB   7 
ATOM   8914 C CG1  . VAL A 1 34 ? 5.531   -16.968 -1.533  1.00 0.00 ? 305 VAL A CG1  7 
ATOM   8915 C CG2  . VAL A 1 34 ? 3.323   -15.994 -0.891  1.00 0.00 ? 305 VAL A CG2  7 
ATOM   8916 H H    . VAL A 1 34 ? 3.963   -15.717 1.947   1.00 0.00 ? 305 VAL A H    7 
ATOM   8917 H HA   . VAL A 1 34 ? 3.970   -18.168 0.461   1.00 0.00 ? 305 VAL A HA   7 
ATOM   8918 H HB   . VAL A 1 34 ? 5.223   -15.458 -0.039  1.00 0.00 ? 305 VAL A HB   7 
ATOM   8919 H HG11 . VAL A 1 34 ? 5.130   -17.941 -1.771  1.00 0.00 ? 305 VAL A HG11 7 
ATOM   8920 H HG12 . VAL A 1 34 ? 5.470   -16.330 -2.402  1.00 0.00 ? 305 VAL A HG12 7 
ATOM   8921 H HG13 . VAL A 1 34 ? 6.565   -17.069 -1.231  1.00 0.00 ? 305 VAL A HG13 7 
ATOM   8922 H HG21 . VAL A 1 34 ? 2.585   -16.431 -0.236  1.00 0.00 ? 305 VAL A HG21 7 
ATOM   8923 H HG22 . VAL A 1 34 ? 3.205   -14.920 -0.897  1.00 0.00 ? 305 VAL A HG22 7 
ATOM   8924 H HG23 . VAL A 1 34 ? 3.190   -16.377 -1.892  1.00 0.00 ? 305 VAL A HG23 7 
ATOM   8925 N N    . ALA A 1 35 ? 6.668   -17.297 2.046   1.00 0.00 ? 306 ALA A N    7 
ATOM   8926 C CA   . ALA A 1 35 ? 7.994   -17.772 2.420   1.00 0.00 ? 306 ALA A CA   7 
ATOM   8927 C C    . ALA A 1 35 ? 7.854   -19.100 3.169   1.00 0.00 ? 306 ALA A C    7 
ATOM   8928 O O    . ALA A 1 35 ? 8.488   -20.081 2.839   1.00 0.00 ? 306 ALA A O    7 
ATOM   8929 C CB   . ALA A 1 35 ? 8.671   -16.742 3.326   1.00 0.00 ? 306 ALA A CB   7 
ATOM   8930 H H    . ALA A 1 35 ? 6.276   -16.526 2.506   1.00 0.00 ? 306 ALA A H    7 
ATOM   8931 H HA   . ALA A 1 35 ? 8.590   -17.919 1.532   1.00 0.00 ? 306 ALA A HA   7 
ATOM   8932 H HB1  . ALA A 1 35 ? 8.340   -15.751 3.055   1.00 0.00 ? 306 ALA A HB1  7 
ATOM   8933 H HB2  . ALA A 1 35 ? 8.412   -16.940 4.355   1.00 0.00 ? 306 ALA A HB2  7 
ATOM   8934 H HB3  . ALA A 1 35 ? 9.743   -16.809 3.206   1.00 0.00 ? 306 ALA A HB3  7 
ATOM   8935 N N    . GLN A 1 36 ? 7.019   -19.136 4.172   1.00 0.00 ? 307 GLN A N    7 
ATOM   8936 C CA   . GLN A 1 36 ? 6.836   -20.375 4.920   1.00 0.00 ? 307 GLN A CA   7 
ATOM   8937 C C    . GLN A 1 36 ? 6.178   -21.413 4.014   1.00 0.00 ? 307 GLN A C    7 
ATOM   8938 O O    . GLN A 1 36 ? 6.277   -22.604 4.237   1.00 0.00 ? 307 GLN A O    7 
ATOM   8939 C CB   . GLN A 1 36 ? 5.940   -20.109 6.132   1.00 0.00 ? 307 GLN A CB   7 
ATOM   8940 C CG   . GLN A 1 36 ? 4.604   -19.533 5.658   1.00 0.00 ? 307 GLN A CG   7 
ATOM   8941 C CD   . GLN A 1 36 ? 3.484   -20.014 6.583   1.00 0.00 ? 307 GLN A CD   7 
ATOM   8942 O OE1  . GLN A 1 36 ? 3.675   -20.130 7.777   1.00 0.00 ? 307 GLN A OE1  7 
ATOM   8943 N NE2  . GLN A 1 36 ? 2.316   -20.298 6.078   1.00 0.00 ? 307 GLN A NE2  7 
ATOM   8944 H H    . GLN A 1 36 ? 6.511   -18.334 4.419   1.00 0.00 ? 307 GLN A H    7 
ATOM   8945 H HA   . GLN A 1 36 ? 7.795   -20.740 5.255   1.00 0.00 ? 307 GLN A HA   7 
ATOM   8946 H HB2  . GLN A 1 36 ? 5.768   -21.035 6.660   1.00 0.00 ? 307 GLN A HB2  7 
ATOM   8947 H HB3  . GLN A 1 36 ? 6.422   -19.402 6.788   1.00 0.00 ? 307 GLN A HB3  7 
ATOM   8948 H HG2  . GLN A 1 36 ? 4.650   -18.455 5.677   1.00 0.00 ? 307 GLN A HG2  7 
ATOM   8949 H HG3  . GLN A 1 36 ? 4.404   -19.867 4.652   1.00 0.00 ? 307 GLN A HG3  7 
ATOM   8950 H HE21 . GLN A 1 36 ? 2.162   -20.203 5.115   1.00 0.00 ? 307 GLN A HE21 7 
ATOM   8951 H HE22 . GLN A 1 36 ? 1.591   -20.605 6.662   1.00 0.00 ? 307 GLN A HE22 7 
ATOM   8952 N N    . LEU A 1 37 ? 5.505   -20.968 2.988   1.00 0.00 ? 308 LEU A N    7 
ATOM   8953 C CA   . LEU A 1 37 ? 4.851   -21.902 2.081   1.00 0.00 ? 308 LEU A CA   7 
ATOM   8954 C C    . LEU A 1 37 ? 5.906   -22.595 1.217   1.00 0.00 ? 308 LEU A C    7 
ATOM   8955 O O    . LEU A 1 37 ? 5.848   -23.785 0.985   1.00 0.00 ? 308 LEU A O    7 
ATOM   8956 C CB   . LEU A 1 37 ? 3.877   -21.138 1.183   1.00 0.00 ? 308 LEU A CB   7 
ATOM   8957 C CG   . LEU A 1 37 ? 2.446   -21.356 1.677   1.00 0.00 ? 308 LEU A CG   7 
ATOM   8958 C CD1  . LEU A 1 37 ? 1.624   -20.086 1.444   1.00 0.00 ? 308 LEU A CD1  7 
ATOM   8959 C CD2  . LEU A 1 37 ? 1.814   -22.520 0.910   1.00 0.00 ? 308 LEU A CD2  7 
ATOM   8960 H H    . LEU A 1 37 ? 5.440   -20.003 2.829   1.00 0.00 ? 308 LEU A H    7 
ATOM   8961 H HA   . LEU A 1 37 ? 4.310   -22.641 2.651   1.00 0.00 ? 308 LEU A HA   7 
ATOM   8962 H HB2  . LEU A 1 37 ? 4.111   -20.082 1.213   1.00 0.00 ? 308 LEU A HB2  7 
ATOM   8963 H HB3  . LEU A 1 37 ? 3.962   -21.496 0.168   1.00 0.00 ? 308 LEU A HB3  7 
ATOM   8964 H HG   . LEU A 1 37 ? 2.460   -21.584 2.733   1.00 0.00 ? 308 LEU A HG   7 
ATOM   8965 H HD11 . LEU A 1 37 ? 2.289   -19.259 1.248   1.00 0.00 ? 308 LEU A HD11 7 
ATOM   8966 H HD12 . LEU A 1 37 ? 0.971   -20.233 0.594   1.00 0.00 ? 308 LEU A HD12 7 
ATOM   8967 H HD13 . LEU A 1 37 ? 1.032   -19.874 2.321   1.00 0.00 ? 308 LEU A HD13 7 
ATOM   8968 H HD21 . LEU A 1 37 ? 2.556   -22.973 0.270   1.00 0.00 ? 308 LEU A HD21 7 
ATOM   8969 H HD22 . LEU A 1 37 ? 1.446   -23.254 1.610   1.00 0.00 ? 308 LEU A HD22 7 
ATOM   8970 H HD23 . LEU A 1 37 ? 0.994   -22.153 0.309   1.00 0.00 ? 308 LEU A HD23 7 
ATOM   8971 N N    . LYS A 1 38 ? 6.873   -21.858 0.739   1.00 0.00 ? 309 LYS A N    7 
ATOM   8972 C CA   . LYS A 1 38 ? 7.908   -22.464 -0.089  1.00 0.00 ? 309 LYS A CA   7 
ATOM   8973 C C    . LYS A 1 38 ? 8.882   -23.237 0.802   1.00 0.00 ? 309 LYS A C    7 
ATOM   8974 O O    . LYS A 1 38 ? 9.608   -24.098 0.344   1.00 0.00 ? 309 LYS A O    7 
ATOM   8975 C CB   . LYS A 1 38 ? 8.665   -21.368 -0.844  1.00 0.00 ? 309 LYS A CB   7 
ATOM   8976 C CG   . LYS A 1 38 ? 7.708   -20.648 -1.797  1.00 0.00 ? 309 LYS A CG   7 
ATOM   8977 C CD   . LYS A 1 38 ? 7.200   -21.634 -2.850  1.00 0.00 ? 309 LYS A CD   7 
ATOM   8978 C CE   . LYS A 1 38 ? 6.397   -20.879 -3.911  1.00 0.00 ? 309 LYS A CE   7 
ATOM   8979 N NZ   . LYS A 1 38 ? 6.547   -21.560 -5.227  1.00 0.00 ? 309 LYS A NZ   7 
ATOM   8980 H H    . LYS A 1 38 ? 6.902   -20.898 0.939   1.00 0.00 ? 309 LYS A H    7 
ATOM   8981 H HA   . LYS A 1 38 ? 7.454   -23.138 -0.800  1.00 0.00 ? 309 LYS A HA   7 
ATOM   8982 H HB2  . LYS A 1 38 ? 9.069   -20.658 -0.136  1.00 0.00 ? 309 LYS A HB2  7 
ATOM   8983 H HB3  . LYS A 1 38 ? 9.470   -21.810 -1.411  1.00 0.00 ? 309 LYS A HB3  7 
ATOM   8984 H HG2  . LYS A 1 38 ? 6.871   -20.254 -1.237  1.00 0.00 ? 309 LYS A HG2  7 
ATOM   8985 H HG3  . LYS A 1 38 ? 8.228   -19.838 -2.286  1.00 0.00 ? 309 LYS A HG3  7 
ATOM   8986 H HD2  . LYS A 1 38 ? 8.042   -22.126 -3.316  1.00 0.00 ? 309 LYS A HD2  7 
ATOM   8987 H HD3  . LYS A 1 38 ? 6.568   -22.370 -2.378  1.00 0.00 ? 309 LYS A HD3  7 
ATOM   8988 H HE2  . LYS A 1 38 ? 5.353   -20.866 -3.629  1.00 0.00 ? 309 LYS A HE2  7 
ATOM   8989 H HE3  . LYS A 1 38 ? 6.763   -19.866 -3.985  1.00 0.00 ? 309 LYS A HE3  7 
ATOM   8990 H HZ1  . LYS A 1 38 ? 6.663   -22.583 -5.077  1.00 0.00 ? 309 LYS A HZ1  7 
ATOM   8991 H HZ2  . LYS A 1 38 ? 5.702   -21.386 -5.807  1.00 0.00 ? 309 LYS A HZ2  7 
ATOM   8992 H HZ3  . LYS A 1 38 ? 7.385   -21.185 -5.717  1.00 0.00 ? 309 LYS A HZ3  7 
ATOM   8993 N N    . GLN A 1 39 ? 8.904   -22.939 2.073   1.00 0.00 ? 310 GLN A N    7 
ATOM   8994 C CA   . GLN A 1 39 ? 9.811   -23.645 2.971   1.00 0.00 ? 310 GLN A CA   7 
ATOM   8995 C C    . GLN A 1 39 ? 9.423   -25.124 3.023   1.00 0.00 ? 310 GLN A C    7 
ATOM   8996 O O    . GLN A 1 39 ? 10.242  -25.981 3.288   1.00 0.00 ? 310 GLN A O    7 
ATOM   8997 C CB   . GLN A 1 39 ? 9.718   -23.039 4.371   1.00 0.00 ? 310 GLN A CB   7 
ATOM   8998 C CG   . GLN A 1 39 ? 10.619  -21.806 4.455   1.00 0.00 ? 310 GLN A CG   7 
ATOM   8999 C CD   . GLN A 1 39 ? 11.333  -21.785 5.807   1.00 0.00 ? 310 GLN A CD   7 
ATOM   9000 O OE1  . GLN A 1 39 ? 11.685  -22.822 6.337   1.00 0.00 ? 310 GLN A OE1  7 
ATOM   9001 N NE2  . GLN A 1 39 ? 11.565  -20.643 6.391   1.00 0.00 ? 310 GLN A NE2  7 
ATOM   9002 H H    . GLN A 1 39 ? 8.312   -22.242 2.423   1.00 0.00 ? 310 GLN A H    7 
ATOM   9003 H HA   . GLN A 1 39 ? 10.824  -23.551 2.607   1.00 0.00 ? 310 GLN A HA   7 
ATOM   9004 H HB2  . GLN A 1 39 ? 8.695   -22.752 4.571   1.00 0.00 ? 310 GLN A HB2  7 
ATOM   9005 H HB3  . GLN A 1 39 ? 10.036  -23.766 5.100   1.00 0.00 ? 310 GLN A HB3  7 
ATOM   9006 H HG2  . GLN A 1 39 ? 11.352  -21.841 3.662   1.00 0.00 ? 310 GLN A HG2  7 
ATOM   9007 H HG3  . GLN A 1 39 ? 10.020  -20.913 4.354   1.00 0.00 ? 310 GLN A HG3  7 
ATOM   9008 H HE21 . GLN A 1 39 ? 11.284  -19.807 5.964   1.00 0.00 ? 310 GLN A HE21 7 
ATOM   9009 H HE22 . GLN A 1 39 ? 12.023  -20.619 7.259   1.00 0.00 ? 310 GLN A HE22 7 
ATOM   9010 N N    . LYS A 1 40 ? 8.180   -25.431 2.770   1.00 0.00 ? 311 LYS A N    7 
ATOM   9011 C CA   . LYS A 1 40 ? 7.752   -26.824 2.803   1.00 0.00 ? 311 LYS A CA   7 
ATOM   9012 C C    . LYS A 1 40 ? 8.158   -27.508 1.497   1.00 0.00 ? 311 LYS A C    7 
ATOM   9013 O O    . LYS A 1 40 ? 8.236   -28.718 1.415   1.00 0.00 ? 311 LYS A O    7 
ATOM   9014 C CB   . LYS A 1 40 ? 6.232   -26.891 2.965   1.00 0.00 ? 311 LYS A CB   7 
ATOM   9015 C CG   . LYS A 1 40 ? 5.806   -28.338 3.213   1.00 0.00 ? 311 LYS A CG   7 
ATOM   9016 C CD   . LYS A 1 40 ? 4.621   -28.365 4.181   1.00 0.00 ? 311 LYS A CD   7 
ATOM   9017 C CE   . LYS A 1 40 ? 3.423   -29.033 3.505   1.00 0.00 ? 311 LYS A CE   7 
ATOM   9018 N NZ   . LYS A 1 40 ? 2.486   -27.988 3.010   1.00 0.00 ? 311 LYS A NZ   7 
ATOM   9019 H H    . LYS A 1 40 ? 7.534   -24.725 2.557   1.00 0.00 ? 311 LYS A H    7 
ATOM   9020 H HA   . LYS A 1 40 ? 8.223   -27.326 3.636   1.00 0.00 ? 311 LYS A HA   7 
ATOM   9021 H HB2  . LYS A 1 40 ? 5.933   -26.278 3.803   1.00 0.00 ? 311 LYS A HB2  7 
ATOM   9022 H HB3  . LYS A 1 40 ? 5.759   -26.527 2.067   1.00 0.00 ? 311 LYS A HB3  7 
ATOM   9023 H HG2  . LYS A 1 40 ? 5.517   -28.793 2.277   1.00 0.00 ? 311 LYS A HG2  7 
ATOM   9024 H HG3  . LYS A 1 40 ? 6.630   -28.889 3.642   1.00 0.00 ? 311 LYS A HG3  7 
ATOM   9025 H HD2  . LYS A 1 40 ? 4.893   -28.922 5.067   1.00 0.00 ? 311 LYS A HD2  7 
ATOM   9026 H HD3  . LYS A 1 40 ? 4.359   -27.355 4.457   1.00 0.00 ? 311 LYS A HD3  7 
ATOM   9027 H HE2  . LYS A 1 40 ? 3.766   -29.633 2.676   1.00 0.00 ? 311 LYS A HE2  7 
ATOM   9028 H HE3  . LYS A 1 40 ? 2.915   -29.665 4.219   1.00 0.00 ? 311 LYS A HE3  7 
ATOM   9029 H HZ1  . LYS A 1 40 ? 3.026   -27.161 2.688   1.00 0.00 ? 311 LYS A HZ1  7 
ATOM   9030 H HZ2  . LYS A 1 40 ? 1.931   -28.368 2.217   1.00 0.00 ? 311 LYS A HZ2  7 
ATOM   9031 H HZ3  . LYS A 1 40 ? 1.844   -27.704 3.781   1.00 0.00 ? 311 LYS A HZ3  7 
ATOM   9032 N N    . VAL A 1 41 ? 8.418   -26.741 0.473   1.00 0.00 ? 312 VAL A N    7 
ATOM   9033 C CA   . VAL A 1 41 ? 8.812   -27.329 -0.800  1.00 0.00 ? 312 VAL A CA   7 
ATOM   9034 C C    . VAL A 1 41 ? 10.331  -27.503 -0.830  1.00 0.00 ? 312 VAL A C    7 
ATOM   9035 O O    . VAL A 1 41 ? 10.858  -28.328 -1.551  1.00 0.00 ? 312 VAL A O    7 
ATOM   9036 C CB   . VAL A 1 41 ? 8.380   -26.408 -1.943  1.00 0.00 ? 312 VAL A CB   7 
ATOM   9037 C CG1  . VAL A 1 41 ? 8.866   -26.982 -3.275  1.00 0.00 ? 312 VAL A CG1  7 
ATOM   9038 C CG2  . VAL A 1 41 ? 6.854   -26.302 -1.961  1.00 0.00 ? 312 VAL A CG2  7 
ATOM   9039 H H    . VAL A 1 41 ? 8.350   -25.768 0.563   1.00 0.00 ? 312 VAL A H    7 
ATOM   9040 H HA   . VAL A 1 41 ? 8.336   -28.292 -0.917  1.00 0.00 ? 312 VAL A HA   7 
ATOM   9041 H HB   . VAL A 1 41 ? 8.809   -25.428 -1.796  1.00 0.00 ? 312 VAL A HB   7 
ATOM   9042 H HG11 . VAL A 1 41 ? 8.976   -28.052 -3.186  1.00 0.00 ? 312 VAL A HG11 7 
ATOM   9043 H HG12 . VAL A 1 41 ? 8.147   -26.757 -4.048  1.00 0.00 ? 312 VAL A HG12 7 
ATOM   9044 H HG13 . VAL A 1 41 ? 9.818   -26.542 -3.531  1.00 0.00 ? 312 VAL A HG13 7 
ATOM   9045 H HG21 . VAL A 1 41 ? 6.452   -26.744 -1.061  1.00 0.00 ? 312 VAL A HG21 7 
ATOM   9046 H HG22 . VAL A 1 41 ? 6.566   -25.262 -2.010  1.00 0.00 ? 312 VAL A HG22 7 
ATOM   9047 H HG23 . VAL A 1 41 ? 6.467   -26.824 -2.823  1.00 0.00 ? 312 VAL A HG23 7 
ATOM   9048 N N    . MET A 1 42 ? 11.041  -26.732 -0.051  1.00 0.00 ? 313 MET A N    7 
ATOM   9049 C CA   . MET A 1 42 ? 12.493  -26.849 -0.034  1.00 0.00 ? 313 MET A CA   7 
ATOM   9050 C C    . MET A 1 42 ? 12.904  -27.967 0.928   1.00 0.00 ? 313 MET A C    7 
ATOM   9051 O O    . MET A 1 42 ? 13.937  -28.585 0.771   1.00 0.00 ? 313 MET A O    7 
ATOM   9052 C CB   . MET A 1 42 ? 13.107  -25.525 0.432   1.00 0.00 ? 313 MET A CB   7 
ATOM   9053 C CG   . MET A 1 42 ? 14.089  -25.016 -0.626  1.00 0.00 ? 313 MET A CG   7 
ATOM   9054 S SD   . MET A 1 42 ? 15.754  -24.957 0.079   1.00 0.00 ? 313 MET A SD   7 
ATOM   9055 C CE   . MET A 1 42 ? 15.894  -23.155 0.180   1.00 0.00 ? 313 MET A CE   7 
ATOM   9056 H H    . MET A 1 42 ? 10.595  -26.073 0.522   1.00 0.00 ? 313 MET A H    7 
ATOM   9057 H HA   . MET A 1 42 ? 12.849  -27.078 -1.028  1.00 0.00 ? 313 MET A HA   7 
ATOM   9058 H HB2  . MET A 1 42 ? 12.322  -24.797 0.575   1.00 0.00 ? 313 MET A HB2  7 
ATOM   9059 H HB3  . MET A 1 42 ? 13.632  -25.679 1.363   1.00 0.00 ? 313 MET A HB3  7 
ATOM   9060 H HG2  . MET A 1 42 ? 14.081  -25.684 -1.475  1.00 0.00 ? 313 MET A HG2  7 
ATOM   9061 H HG3  . MET A 1 42 ? 13.795  -24.026 -0.943  1.00 0.00 ? 313 MET A HG3  7 
ATOM   9062 H HE1  . MET A 1 42 ? 15.334  -22.706 -0.629  1.00 0.00 ? 313 MET A HE1  7 
ATOM   9063 H HE2  . MET A 1 42 ? 15.501  -22.816 1.128   1.00 0.00 ? 313 MET A HE2  7 
ATOM   9064 H HE3  . MET A 1 42 ? 16.929  -22.868 0.099   1.00 0.00 ? 313 MET A HE3  7 
ATOM   9065 N N    . ASN A 1 43 ? 12.099  -28.232 1.921   1.00 0.00 ? 314 ASN A N    7 
ATOM   9066 C CA   . ASN A 1 43 ? 12.437  -29.285 2.871   1.00 0.00 ? 314 ASN A CA   7 
ATOM   9067 C C    . ASN A 1 43 ? 11.984  -30.637 2.314   1.00 0.00 ? 314 ASN A C    7 
ATOM   9068 O O    . ASN A 1 43 ? 12.690  -31.621 2.398   1.00 0.00 ? 314 ASN A O    7 
ATOM   9069 C CB   . ASN A 1 43 ? 11.732  -29.016 4.201   1.00 0.00 ? 314 ASN A CB   7 
ATOM   9070 C CG   . ASN A 1 43 ? 12.395  -27.827 4.899   1.00 0.00 ? 314 ASN A CG   7 
ATOM   9071 O OD1  . ASN A 1 43 ? 13.549  -27.533 4.659   1.00 0.00 ? 314 ASN A OD1  7 
ATOM   9072 N ND2  . ASN A 1 43 ? 11.708  -27.122 5.756   1.00 0.00 ? 314 ASN A ND2  7 
ATOM   9073 H H    . ASN A 1 43 ? 11.270  -27.720 2.029   1.00 0.00 ? 314 ASN A H    7 
ATOM   9074 H HA   . ASN A 1 43 ? 13.504  -29.300 3.028   1.00 0.00 ? 314 ASN A HA   7 
ATOM   9075 H HB2  . ASN A 1 43 ? 10.690  -28.793 4.019   1.00 0.00 ? 314 ASN A HB2  7 
ATOM   9076 H HB3  . ASN A 1 43 ? 11.808  -29.888 4.831   1.00 0.00 ? 314 ASN A HB3  7 
ATOM   9077 H HD21 . ASN A 1 43 ? 10.777  -27.356 5.949   1.00 0.00 ? 314 ASN A HD21 7 
ATOM   9078 H HD22 . ASN A 1 43 ? 12.125  -26.358 6.208   1.00 0.00 ? 314 ASN A HD22 7 
ATOM   9079 N N    . TYR A 1 44 ? 10.809  -30.689 1.747   1.00 0.00 ? 315 TYR A N    7 
ATOM   9080 C CA   . TYR A 1 44 ? 10.319  -31.948 1.197   1.00 0.00 ? 315 TYR A CA   7 
ATOM   9081 C C    . TYR A 1 44 ? 9.862   -31.730 -0.247  1.00 0.00 ? 315 TYR A C    7 
ATOM   9082 O O    . TYR A 1 44 ? 9.789   -30.583 -0.658  1.00 0.00 ? 315 TYR A O    7 
ATOM   9083 C CB   . TYR A 1 44 ? 9.142   -32.444 2.039   1.00 0.00 ? 315 TYR A CB   7 
ATOM   9084 C CG   . TYR A 1 44 ? 9.619   -33.516 2.987   1.00 0.00 ? 315 TYR A CG   7 
ATOM   9085 C CD1  . TYR A 1 44 ? 9.666   -34.854 2.566   1.00 0.00 ? 315 TYR A CD1  7 
ATOM   9086 C CD2  . TYR A 1 44 ? 10.018  -33.176 4.290   1.00 0.00 ? 315 TYR A CD2  7 
ATOM   9087 C CE1  . TYR A 1 44 ? 10.112  -35.853 3.446   1.00 0.00 ? 315 TYR A CE1  7 
ATOM   9088 C CE2  . TYR A 1 44 ? 10.463  -34.174 5.171   1.00 0.00 ? 315 TYR A CE2  7 
ATOM   9089 C CZ   . TYR A 1 44 ? 10.510  -35.513 4.749   1.00 0.00 ? 315 TYR A CZ   7 
ATOM   9090 O OH   . TYR A 1 44 ? 10.948  -36.496 5.615   1.00 0.00 ? 315 TYR A OH   7 
ATOM   9091 O OXT  . TYR A 1 44 ? 9.594   -32.713 -0.918  1.00 0.00 ? 315 TYR A OXT  7 
ATOM   9092 H H    . TYR A 1 44 ? 10.256  -29.882 1.691   1.00 0.00 ? 315 TYR A H    7 
ATOM   9093 H HA   . TYR A 1 44 ? 11.109  -32.683 1.217   1.00 0.00 ? 315 TYR A HA   7 
ATOM   9094 H HB2  . TYR A 1 44 ? 8.730   -31.619 2.604   1.00 0.00 ? 315 TYR A HB2  7 
ATOM   9095 H HB3  . TYR A 1 44 ? 8.380   -32.850 1.390   1.00 0.00 ? 315 TYR A HB3  7 
ATOM   9096 H HD1  . TYR A 1 44 ? 9.361   -35.116 1.563   1.00 0.00 ? 315 TYR A HD1  7 
ATOM   9097 H HD2  . TYR A 1 44 ? 9.982   -32.147 4.615   1.00 0.00 ? 315 TYR A HD2  7 
ATOM   9098 H HE1  . TYR A 1 44 ? 10.148  -36.882 3.121   1.00 0.00 ? 315 TYR A HE1  7 
ATOM   9099 H HE2  . TYR A 1 44 ? 10.770  -33.913 6.174   1.00 0.00 ? 315 TYR A HE2  7 
ATOM   9100 H HH   . TYR A 1 44 ? 10.581  -37.334 5.323   1.00 0.00 ? 315 TYR A HH   7 
HETATM 9101 C C    . ACE B 1 1  ? -1.323  32.277  -4.971  1.00 0.00 ? 272 ACE B C    7 
HETATM 9102 O O    . ACE B 1 1  ? -0.657  32.868  -5.797  1.00 0.00 ? 272 ACE B O    7 
HETATM 9103 C CH3  . ACE B 1 1  ? -2.847  32.396  -4.946  1.00 0.00 ? 272 ACE B CH3  7 
HETATM 9104 H H1   . ACE B 1 1  ? -3.138  33.371  -5.309  1.00 0.00 ? 272 ACE B H1   7 
HETATM 9105 H H2   . ACE B 1 1  ? -3.278  31.634  -5.579  1.00 0.00 ? 272 ACE B H2   7 
HETATM 9106 H H3   . ACE B 1 1  ? -3.203  32.268  -3.935  1.00 0.00 ? 272 ACE B H3   7 
ATOM   9107 N N    . CYS B 1 2  ? -0.762  31.516  -4.069  1.00 0.00 ? 273 CYS B N    7 
ATOM   9108 C CA   . CYS B 1 2  ? 0.686   31.362  -4.040  1.00 0.00 ? 273 CYS B CA   7 
ATOM   9109 C C    . CYS B 1 2  ? 1.167   30.809  -5.384  1.00 0.00 ? 273 CYS B C    7 
ATOM   9110 O O    . CYS B 1 2  ? 0.390   30.598  -6.293  1.00 0.00 ? 273 CYS B O    7 
ATOM   9111 C CB   . CYS B 1 2  ? 1.077   30.397  -2.920  1.00 0.00 ? 273 CYS B CB   7 
ATOM   9112 S SG   . CYS B 1 2  ? 2.233   31.216  -1.795  1.00 0.00 ? 273 CYS B SG   7 
ATOM   9113 H H    . CYS B 1 2  ? -1.317  31.047  -3.411  1.00 0.00 ? 273 CYS B H    7 
ATOM   9114 H HA   . CYS B 1 2  ? 1.146   32.323  -3.862  1.00 0.00 ? 273 CYS B HA   7 
ATOM   9115 H HB2  . CYS B 1 2  ? 0.192   30.100  -2.377  1.00 0.00 ? 273 CYS B HB2  7 
ATOM   9116 H HB3  . CYS B 1 2  ? 1.548   29.522  -3.347  1.00 0.00 ? 273 CYS B HB3  7 
ATOM   9117 N N    . GLY B 1 3  ? 2.443   30.574  -5.516  1.00 0.00 ? 274 GLY B N    7 
ATOM   9118 C CA   . GLY B 1 3  ? 2.963   30.047  -6.771  1.00 0.00 ? 274 GLY B CA   7 
ATOM   9119 C C    . GLY B 1 3  ? 4.488   29.953  -6.696  1.00 0.00 ? 274 GLY B C    7 
ATOM   9120 O O    . GLY B 1 3  ? 5.187   30.939  -6.820  1.00 0.00 ? 274 GLY B O    7 
ATOM   9121 H H    . GLY B 1 3  ? 3.054   30.752  -4.769  1.00 0.00 ? 274 GLY B H    7 
ATOM   9122 H HA2  . GLY B 1 3  ? 2.548   29.064  -6.947  1.00 0.00 ? 274 GLY B HA2  7 
ATOM   9123 H HA3  . GLY B 1 3  ? 2.688   30.704  -7.580  1.00 0.00 ? 274 GLY B HA3  7 
ATOM   9124 N N    . GLY B 1 4  ? 5.009   28.774  -6.490  1.00 0.00 ? 275 GLY B N    7 
ATOM   9125 C CA   . GLY B 1 4  ? 6.457   28.622  -6.406  1.00 0.00 ? 275 GLY B CA   7 
ATOM   9126 C C    . GLY B 1 4  ? 6.793   27.374  -5.587  1.00 0.00 ? 275 GLY B C    7 
ATOM   9127 O O    . GLY B 1 4  ? 7.391   26.439  -6.079  1.00 0.00 ? 275 GLY B O    7 
ATOM   9128 H H    . GLY B 1 4  ? 4.427   27.993  -6.392  1.00 0.00 ? 275 GLY B H    7 
ATOM   9129 H HA2  . GLY B 1 4  ? 6.867   28.523  -7.402  1.00 0.00 ? 275 GLY B HA2  7 
ATOM   9130 H HA3  . GLY B 1 4  ? 6.884   29.487  -5.924  1.00 0.00 ? 275 GLY B HA3  7 
ATOM   9131 N N    . ARG B 1 5  ? 6.409   27.354  -4.340  1.00 0.00 ? 276 ARG B N    7 
ATOM   9132 C CA   . ARG B 1 5  ? 6.698   26.193  -3.508  1.00 0.00 ? 276 ARG B CA   7 
ATOM   9133 C C    . ARG B 1 5  ? 5.495   25.248  -3.520  1.00 0.00 ? 276 ARG B C    7 
ATOM   9134 O O    . ARG B 1 5  ? 5.629   24.054  -3.337  1.00 0.00 ? 276 ARG B O    7 
ATOM   9135 C CB   . ARG B 1 5  ? 6.975   26.648  -2.073  1.00 0.00 ? 276 ARG B CB   7 
ATOM   9136 C CG   . ARG B 1 5  ? 8.282   27.440  -2.032  1.00 0.00 ? 276 ARG B CG   7 
ATOM   9137 C CD   . ARG B 1 5  ? 9.442   26.534  -2.447  1.00 0.00 ? 276 ARG B CD   7 
ATOM   9138 N NE   . ARG B 1 5  ? 10.707  27.172  -2.103  1.00 0.00 ? 276 ARG B NE   7 
ATOM   9139 C CZ   . ARG B 1 5  ? 11.803  26.465  -2.066  1.00 0.00 ? 276 ARG B CZ   7 
ATOM   9140 N NH1  . ARG B 1 5  ? 11.887  25.434  -1.271  1.00 0.00 ? 276 ARG B NH1  7 
ATOM   9141 N NH2  . ARG B 1 5  ? 12.816  26.791  -2.823  1.00 0.00 ? 276 ARG B NH2  7 
ATOM   9142 H H    . ARG B 1 5  ? 5.926   28.119  -3.963  1.00 0.00 ? 276 ARG B H    7 
ATOM   9143 H HA   . ARG B 1 5  ? 7.565   25.678  -3.893  1.00 0.00 ? 276 ARG B HA   7 
ATOM   9144 H HB2  . ARG B 1 5  ? 6.163   27.273  -1.731  1.00 0.00 ? 276 ARG B HB2  7 
ATOM   9145 H HB3  . ARG B 1 5  ? 7.059   25.785  -1.431  1.00 0.00 ? 276 ARG B HB3  7 
ATOM   9146 H HG2  . ARG B 1 5  ? 8.216   28.278  -2.710  1.00 0.00 ? 276 ARG B HG2  7 
ATOM   9147 H HG3  . ARG B 1 5  ? 8.453   27.802  -1.029  1.00 0.00 ? 276 ARG B HG3  7 
ATOM   9148 H HD2  . ARG B 1 5  ? 9.362   25.588  -1.931  1.00 0.00 ? 276 ARG B HD2  7 
ATOM   9149 H HD3  . ARG B 1 5  ? 9.404   26.367  -3.513  1.00 0.00 ? 276 ARG B HD3  7 
ATOM   9150 H HE   . ARG B 1 5  ? 10.733  28.129  -1.899  1.00 0.00 ? 276 ARG B HE   7 
ATOM   9151 H HH11 . ARG B 1 5  ? 11.112  25.184  -0.691  1.00 0.00 ? 276 ARG B HH11 7 
ATOM   9152 H HH12 . ARG B 1 5  ? 12.728  24.891  -1.242  1.00 0.00 ? 276 ARG B HH12 7 
ATOM   9153 H HH21 . ARG B 1 5  ? 12.751  27.582  -3.433  1.00 0.00 ? 276 ARG B HH21 7 
ATOM   9154 H HH22 . ARG B 1 5  ? 13.656  26.250  -2.793  1.00 0.00 ? 276 ARG B HH22 7 
ATOM   9155 N N    . ILE B 1 6  ? 4.318   25.773  -3.727  1.00 0.00 ? 277 ILE B N    7 
ATOM   9156 C CA   . ILE B 1 6  ? 3.133   24.930  -3.745  1.00 0.00 ? 277 ILE B CA   7 
ATOM   9157 C C    . ILE B 1 6  ? 3.190   23.969  -4.937  1.00 0.00 ? 277 ILE B C    7 
ATOM   9158 O O    . ILE B 1 6  ? 2.987   22.780  -4.793  1.00 0.00 ? 277 ILE B O    7 
ATOM   9159 C CB   . ILE B 1 6  ? 1.886   25.809  -3.849  1.00 0.00 ? 277 ILE B CB   7 
ATOM   9160 C CG1  . ILE B 1 6  ? 2.031   26.784  -5.022  1.00 0.00 ? 277 ILE B CG1  7 
ATOM   9161 C CG2  . ILE B 1 6  ? 1.710   26.602  -2.553  1.00 0.00 ? 277 ILE B CG2  7 
ATOM   9162 C CD1  . ILE B 1 6  ? 1.278   26.236  -6.236  1.00 0.00 ? 277 ILE B CD1  7 
ATOM   9163 H H    . ILE B 1 6  ? 4.231   26.737  -3.865  1.00 0.00 ? 277 ILE B H    7 
ATOM   9164 H HA   . ILE B 1 6  ? 3.087   24.361  -2.829  1.00 0.00 ? 277 ILE B HA   7 
ATOM   9165 H HB   . ILE B 1 6  ? 1.025   25.185  -4.005  1.00 0.00 ? 277 ILE B HB   7 
ATOM   9166 H HG12 . ILE B 1 6  ? 1.617   27.743  -4.744  1.00 0.00 ? 277 ILE B HG12 7 
ATOM   9167 H HG13 . ILE B 1 6  ? 3.072   26.901  -5.270  1.00 0.00 ? 277 ILE B HG13 7 
ATOM   9168 H HG21 . ILE B 1 6  ? 2.679   26.890  -2.172  1.00 0.00 ? 277 ILE B HG21 7 
ATOM   9169 H HG22 . ILE B 1 6  ? 1.124   27.486  -2.749  1.00 0.00 ? 277 ILE B HG22 7 
ATOM   9170 H HG23 . ILE B 1 6  ? 1.204   25.988  -1.821  1.00 0.00 ? 277 ILE B HG23 7 
ATOM   9171 H HD11 . ILE B 1 6  ? 0.747   25.339  -5.955  1.00 0.00 ? 277 ILE B HD11 7 
ATOM   9172 H HD12 . ILE B 1 6  ? 0.575   26.976  -6.588  1.00 0.00 ? 277 ILE B HD12 7 
ATOM   9173 H HD13 . ILE B 1 6  ? 1.983   26.005  -7.022  1.00 0.00 ? 277 ILE B HD13 7 
ATOM   9174 N N    . ALA B 1 7  ? 3.464   24.468  -6.111  1.00 0.00 ? 278 ALA B N    7 
ATOM   9175 C CA   . ALA B 1 7  ? 3.531   23.592  -7.277  1.00 0.00 ? 278 ALA B CA   7 
ATOM   9176 C C    . ALA B 1 7  ? 4.664   22.585  -7.085  1.00 0.00 ? 278 ALA B C    7 
ATOM   9177 O O    . ALA B 1 7  ? 4.646   21.502  -7.637  1.00 0.00 ? 278 ALA B O    7 
ATOM   9178 C CB   . ALA B 1 7  ? 3.793   24.428  -8.532  1.00 0.00 ? 278 ALA B CB   7 
ATOM   9179 H H    . ALA B 1 7  ? 3.626   25.428  -6.211  1.00 0.00 ? 278 ALA B H    7 
ATOM   9180 H HA   . ALA B 1 7  ? 2.594   23.066  -7.385  1.00 0.00 ? 278 ALA B HA   7 
ATOM   9181 H HB1  . ALA B 1 7  ? 3.893   25.468  -8.259  1.00 0.00 ? 278 ALA B HB1  7 
ATOM   9182 H HB2  . ALA B 1 7  ? 4.702   24.089  -9.004  1.00 0.00 ? 278 ALA B HB2  7 
ATOM   9183 H HB3  . ALA B 1 7  ? 2.966   24.313  -9.219  1.00 0.00 ? 278 ALA B HB3  7 
ATOM   9184 N N    . ARG B 1 8  ? 5.651   22.930  -6.304  1.00 0.00 ? 279 ARG B N    7 
ATOM   9185 C CA   . ARG B 1 8  ? 6.759   22.009  -6.080  1.00 0.00 ? 279 ARG B CA   7 
ATOM   9186 C C    . ARG B 1 8  ? 6.270   20.833  -5.235  1.00 0.00 ? 279 ARG B C    7 
ATOM   9187 O O    . ARG B 1 8  ? 6.224   19.705  -5.687  1.00 0.00 ? 279 ARG B O    7 
ATOM   9188 C CB   . ARG B 1 8  ? 7.885   22.741  -5.350  1.00 0.00 ? 279 ARG B CB   7 
ATOM   9189 C CG   . ARG B 1 8  ? 8.796   23.425  -6.370  1.00 0.00 ? 279 ARG B CG   7 
ATOM   9190 C CD   . ARG B 1 8  ? 9.424   22.370  -7.283  1.00 0.00 ? 279 ARG B CD   7 
ATOM   9191 N NE   . ARG B 1 8  ? 10.599  22.929  -7.939  1.00 0.00 ? 279 ARG B NE   7 
ATOM   9192 C CZ   . ARG B 1 8  ? 11.473  22.136  -8.496  1.00 0.00 ? 279 ARG B CZ   7 
ATOM   9193 N NH1  . ARG B 1 8  ? 12.430  21.614  -7.777  1.00 0.00 ? 279 ARG B NH1  7 
ATOM   9194 N NH2  . ARG B 1 8  ? 11.392  21.867  -9.771  1.00 0.00 ? 279 ARG B NH2  7 
ATOM   9195 H H    . ARG B 1 8  ? 5.646   23.806  -5.866  1.00 0.00 ? 279 ARG B H    7 
ATOM   9196 H HA   . ARG B 1 8  ? 7.124   21.645  -7.029  1.00 0.00 ? 279 ARG B HA   7 
ATOM   9197 H HB2  . ARG B 1 8  ? 7.461   23.484  -4.689  1.00 0.00 ? 279 ARG B HB2  7 
ATOM   9198 H HB3  . ARG B 1 8  ? 8.462   22.033  -4.773  1.00 0.00 ? 279 ARG B HB3  7 
ATOM   9199 H HG2  . ARG B 1 8  ? 8.213   24.116  -6.966  1.00 0.00 ? 279 ARG B HG2  7 
ATOM   9200 H HG3  . ARG B 1 8  ? 9.576   23.964  -5.855  1.00 0.00 ? 279 ARG B HG3  7 
ATOM   9201 H HD2  . ARG B 1 8  ? 9.713   21.513  -6.690  1.00 0.00 ? 279 ARG B HD2  7 
ATOM   9202 H HD3  . ARG B 1 8  ? 8.708   22.067  -8.029  1.00 0.00 ? 279 ARG B HD3  7 
ATOM   9203 H HE   . ARG B 1 8  ? 10.733  23.900  -7.963  1.00 0.00 ? 279 ARG B HE   7 
ATOM   9204 H HH11 . ARG B 1 8  ? 12.491  21.819  -6.802  1.00 0.00 ? 279 ARG B HH11 7 
ATOM   9205 H HH12 . ARG B 1 8  ? 13.098  21.005  -8.202  1.00 0.00 ? 279 ARG B HH12 7 
ATOM   9206 H HH21 . ARG B 1 8  ? 10.660  22.268  -10.320 1.00 0.00 ? 279 ARG B HH21 7 
ATOM   9207 H HH22 . ARG B 1 8  ? 12.063  21.261  -10.199 1.00 0.00 ? 279 ARG B HH22 7 
ATOM   9208 N N    . LEU B 1 9  ? 5.896   21.087  -4.011  1.00 0.00 ? 280 LEU B N    7 
ATOM   9209 C CA   . LEU B 1 9  ? 5.412   20.008  -3.162  1.00 0.00 ? 280 LEU B CA   7 
ATOM   9210 C C    . LEU B 1 9  ? 4.308   19.252  -3.902  1.00 0.00 ? 280 LEU B C    7 
ATOM   9211 O O    . LEU B 1 9  ? 4.026   18.106  -3.614  1.00 0.00 ? 280 LEU B O    7 
ATOM   9212 C CB   . LEU B 1 9  ? 4.853   20.588  -1.861  1.00 0.00 ? 280 LEU B CB   7 
ATOM   9213 C CG   . LEU B 1 9  ? 5.785   20.232  -0.701  1.00 0.00 ? 280 LEU B CG   7 
ATOM   9214 C CD1  . LEU B 1 9  ? 5.985   21.462  0.188   1.00 0.00 ? 280 LEU B CD1  7 
ATOM   9215 C CD2  . LEU B 1 9  ? 5.163   19.103  0.123   1.00 0.00 ? 280 LEU B CD2  7 
ATOM   9216 H H    . LEU B 1 9  ? 5.934   22.004  -3.667  1.00 0.00 ? 280 LEU B H    7 
ATOM   9217 H HA   . LEU B 1 9  ? 6.224   19.334  -2.935  1.00 0.00 ? 280 LEU B HA   7 
ATOM   9218 H HB2  . LEU B 1 9  ? 4.779   21.662  -1.949  1.00 0.00 ? 280 LEU B HB2  7 
ATOM   9219 H HB3  . LEU B 1 9  ? 3.875   20.174  -1.674  1.00 0.00 ? 280 LEU B HB3  7 
ATOM   9220 H HG   . LEU B 1 9  ? 6.740   19.913  -1.092  1.00 0.00 ? 280 LEU B HG   7 
ATOM   9221 H HD11 . LEU B 1 9  ? 5.065   22.023  0.237   1.00 0.00 ? 280 LEU B HD11 7 
ATOM   9222 H HD12 . LEU B 1 9  ? 6.268   21.144  1.181   1.00 0.00 ? 280 LEU B HD12 7 
ATOM   9223 H HD13 . LEU B 1 9  ? 6.765   22.082  -0.227  1.00 0.00 ? 280 LEU B HD13 7 
ATOM   9224 H HD21 . LEU B 1 9  ? 4.399   18.611  -0.461  1.00 0.00 ? 280 LEU B HD21 7 
ATOM   9225 H HD22 . LEU B 1 9  ? 5.927   18.390  0.392   1.00 0.00 ? 280 LEU B HD22 7 
ATOM   9226 H HD23 . LEU B 1 9  ? 4.721   19.513  1.020   1.00 0.00 ? 280 LEU B HD23 7 
ATOM   9227 N N    . GLU B 1 10 ? 3.686   19.887  -4.859  1.00 0.00 ? 281 GLU B N    7 
ATOM   9228 C CA   . GLU B 1 10 ? 2.627   19.221  -5.608  1.00 0.00 ? 281 GLU B CA   7 
ATOM   9229 C C    . GLU B 1 10 ? 3.237   18.101  -6.451  1.00 0.00 ? 281 GLU B C    7 
ATOM   9230 O O    . GLU B 1 10 ? 2.827   16.960  -6.379  1.00 0.00 ? 281 GLU B O    7 
ATOM   9231 C CB   . GLU B 1 10 ? 1.936   20.233  -6.525  1.00 0.00 ? 281 GLU B CB   7 
ATOM   9232 C CG   . GLU B 1 10 ? 0.740   20.850  -5.795  1.00 0.00 ? 281 GLU B CG   7 
ATOM   9233 C CD   . GLU B 1 10 ? -0.340  19.786  -5.596  1.00 0.00 ? 281 GLU B CD   7 
ATOM   9234 O OE1  . GLU B 1 10 ? -0.032  18.617  -5.769  1.00 0.00 ? 281 GLU B OE1  7 
ATOM   9235 O OE2  . GLU B 1 10 ? -1.457  20.157  -5.275  1.00 0.00 ? 281 GLU B OE2  7 
ATOM   9236 H H    . GLU B 1 10 ? 3.933   20.810  -5.075  1.00 0.00 ? 281 GLU B H    7 
ATOM   9237 H HA   . GLU B 1 10 ? 1.905   18.806  -4.923  1.00 0.00 ? 281 GLU B HA   7 
ATOM   9238 H HB2  . GLU B 1 10 ? 2.636   21.013  -6.792  1.00 0.00 ? 281 GLU B HB2  7 
ATOM   9239 H HB3  . GLU B 1 10 ? 1.592   19.736  -7.418  1.00 0.00 ? 281 GLU B HB3  7 
ATOM   9240 H HG2  . GLU B 1 10 ? 1.060   21.224  -4.833  1.00 0.00 ? 281 GLU B HG2  7 
ATOM   9241 H HG3  . GLU B 1 10 ? 0.340   21.661  -6.382  1.00 0.00 ? 281 GLU B HG3  7 
ATOM   9242 N N    . GLU B 1 11 ? 4.222   18.417  -7.249  1.00 0.00 ? 282 GLU B N    7 
ATOM   9243 C CA   . GLU B 1 11 ? 4.848   17.389  -8.070  1.00 0.00 ? 282 GLU B CA   7 
ATOM   9244 C C    . GLU B 1 11 ? 5.347   16.266  -7.161  1.00 0.00 ? 282 GLU B C    7 
ATOM   9245 O O    . GLU B 1 11 ? 5.344   15.106  -7.526  1.00 0.00 ? 282 GLU B O    7 
ATOM   9246 C CB   . GLU B 1 11 ? 6.028   17.991  -8.839  1.00 0.00 ? 282 GLU B CB   7 
ATOM   9247 C CG   . GLU B 1 11 ? 5.653   18.135  -10.315 1.00 0.00 ? 282 GLU B CG   7 
ATOM   9248 C CD   . GLU B 1 11 ? 6.345   19.366  -10.901 1.00 0.00 ? 282 GLU B CD   7 
ATOM   9249 O OE1  . GLU B 1 11 ? 7.292   19.834  -10.290 1.00 0.00 ? 282 GLU B OE1  7 
ATOM   9250 O OE2  . GLU B 1 11 ? 5.920   19.819  -11.950 1.00 0.00 ? 282 GLU B OE2  7 
ATOM   9251 H H    . GLU B 1 11 ? 4.546   19.341  -7.289  1.00 0.00 ? 282 GLU B H    7 
ATOM   9252 H HA   . GLU B 1 11 ? 4.126   16.995  -8.768  1.00 0.00 ? 282 GLU B HA   7 
ATOM   9253 H HB2  . GLU B 1 11 ? 6.266   18.962  -8.432  1.00 0.00 ? 282 GLU B HB2  7 
ATOM   9254 H HB3  . GLU B 1 11 ? 6.887   17.342  -8.750  1.00 0.00 ? 282 GLU B HB3  7 
ATOM   9255 H HG2  . GLU B 1 11 ? 5.968   17.252  -10.854 1.00 0.00 ? 282 GLU B HG2  7 
ATOM   9256 H HG3  . GLU B 1 11 ? 4.583   18.250  -10.406 1.00 0.00 ? 282 GLU B HG3  7 
ATOM   9257 N N    . LYS B 1 12 ? 5.768   16.603  -5.972  1.00 0.00 ? 283 LYS B N    7 
ATOM   9258 C CA   . LYS B 1 12 ? 6.248   15.579  -5.054  1.00 0.00 ? 283 LYS B CA   7 
ATOM   9259 C C    . LYS B 1 12 ? 5.082   14.665  -4.677  1.00 0.00 ? 283 LYS B C    7 
ATOM   9260 O O    . LYS B 1 12 ? 5.219   13.460  -4.618  1.00 0.00 ? 283 LYS B O    7 
ATOM   9261 C CB   . LYS B 1 12 ? 6.804   16.245  -3.795  1.00 0.00 ? 283 LYS B CB   7 
ATOM   9262 C CG   . LYS B 1 12 ? 8.238   15.767  -3.554  1.00 0.00 ? 283 LYS B CG   7 
ATOM   9263 C CD   . LYS B 1 12 ? 8.732   16.287  -2.202  1.00 0.00 ? 283 LYS B CD   7 
ATOM   9264 C CE   . LYS B 1 12 ? 9.114   17.763  -2.333  1.00 0.00 ? 283 LYS B CE   7 
ATOM   9265 N NZ   . LYS B 1 12 ? 10.354  18.027  -1.550  1.00 0.00 ? 283 LYS B NZ   7 
ATOM   9266 H H    . LYS B 1 12 ? 5.756   17.544  -5.697  1.00 0.00 ? 283 LYS B H    7 
ATOM   9267 H HA   . LYS B 1 12 ? 7.022   14.999  -5.529  1.00 0.00 ? 283 LYS B HA   7 
ATOM   9268 H HB2  . LYS B 1 12 ? 6.799   17.319  -3.925  1.00 0.00 ? 283 LYS B HB2  7 
ATOM   9269 H HB3  . LYS B 1 12 ? 6.192   15.982  -2.946  1.00 0.00 ? 283 LYS B HB3  7 
ATOM   9270 H HG2  . LYS B 1 12 ? 8.261   14.687  -3.556  1.00 0.00 ? 283 LYS B HG2  7 
ATOM   9271 H HG3  . LYS B 1 12 ? 8.880   16.140  -4.338  1.00 0.00 ? 283 LYS B HG3  7 
ATOM   9272 H HD2  . LYS B 1 12 ? 7.948   16.181  -1.469  1.00 0.00 ? 283 LYS B HD2  7 
ATOM   9273 H HD3  . LYS B 1 12 ? 9.596   15.720  -1.892  1.00 0.00 ? 283 LYS B HD3  7 
ATOM   9274 H HE2  . LYS B 1 12 ? 9.286   18.000  -3.372  1.00 0.00 ? 283 LYS B HE2  7 
ATOM   9275 H HE3  . LYS B 1 12 ? 8.310   18.377  -1.953  1.00 0.00 ? 283 LYS B HE3  7 
ATOM   9276 H HZ1  . LYS B 1 12 ? 10.810  17.123  -1.308  1.00 0.00 ? 283 LYS B HZ1  7 
ATOM   9277 H HZ2  . LYS B 1 12 ? 11.008  18.601  -2.119  1.00 0.00 ? 283 LYS B HZ2  7 
ATOM   9278 H HZ3  . LYS B 1 12 ? 10.110  18.537  -0.677  1.00 0.00 ? 283 LYS B HZ3  7 
ATOM   9279 N N    . VAL B 1 13 ? 3.933   15.230  -4.428  1.00 0.00 ? 284 VAL B N    7 
ATOM   9280 C CA   . VAL B 1 13 ? 2.781   14.413  -4.072  1.00 0.00 ? 284 VAL B CA   7 
ATOM   9281 C C    . VAL B 1 13 ? 2.467   13.472  -5.234  1.00 0.00 ? 284 VAL B C    7 
ATOM   9282 O O    . VAL B 1 13 ? 1.977   12.376  -5.045  1.00 0.00 ? 284 VAL B O    7 
ATOM   9283 C CB   . VAL B 1 13 ? 1.574   15.314  -3.803  1.00 0.00 ? 284 VAL B CB   7 
ATOM   9284 C CG1  . VAL B 1 13 ? 0.315   14.454  -3.677  1.00 0.00 ? 284 VAL B CG1  7 
ATOM   9285 C CG2  . VAL B 1 13 ? 1.796   16.089  -2.502  1.00 0.00 ? 284 VAL B CG2  7 
ATOM   9286 H H    . VAL B 1 13 ? 3.842   16.204  -4.487  1.00 0.00 ? 284 VAL B H    7 
ATOM   9287 H HA   . VAL B 1 13 ? 3.004   13.835  -3.187  1.00 0.00 ? 284 VAL B HA   7 
ATOM   9288 H HB   . VAL B 1 13 ? 1.454   16.009  -4.624  1.00 0.00 ? 284 VAL B HB   7 
ATOM   9289 H HG11 . VAL B 1 13 ? 0.579   13.485  -3.283  1.00 0.00 ? 284 VAL B HG11 7 
ATOM   9290 H HG12 . VAL B 1 13 ? -0.384  14.936  -3.010  1.00 0.00 ? 284 VAL B HG12 7 
ATOM   9291 H HG13 . VAL B 1 13 ? -0.140  14.336  -4.649  1.00 0.00 ? 284 VAL B HG13 7 
ATOM   9292 H HG21 . VAL B 1 13 ? 2.508   15.561  -1.887  1.00 0.00 ? 284 VAL B HG21 7 
ATOM   9293 H HG22 . VAL B 1 13 ? 2.175   17.075  -2.730  1.00 0.00 ? 284 VAL B HG22 7 
ATOM   9294 H HG23 . VAL B 1 13 ? 0.859   16.178  -1.972  1.00 0.00 ? 284 VAL B HG23 7 
ATOM   9295 N N    . LYS B 1 14 ? 2.749   13.894  -6.436  1.00 0.00 ? 285 LYS B N    7 
ATOM   9296 C CA   . LYS B 1 14 ? 2.477   13.045  -7.589  1.00 0.00 ? 285 LYS B CA   7 
ATOM   9297 C C    . LYS B 1 14 ? 3.383   11.813  -7.534  1.00 0.00 ? 285 LYS B C    7 
ATOM   9298 O O    . LYS B 1 14 ? 2.920   10.690  -7.559  1.00 0.00 ? 285 LYS B O    7 
ATOM   9299 C CB   . LYS B 1 14 ? 2.752   13.825  -8.876  1.00 0.00 ? 285 LYS B CB   7 
ATOM   9300 C CG   . LYS B 1 14 ? 1.770   13.381  -9.962  1.00 0.00 ? 285 LYS B CG   7 
ATOM   9301 C CD   . LYS B 1 14 ? 0.387   13.969  -9.672  1.00 0.00 ? 285 LYS B CD   7 
ATOM   9302 C CE   . LYS B 1 14 ? -0.377  14.149  -10.984 1.00 0.00 ? 285 LYS B CE   7 
ATOM   9303 N NZ   . LYS B 1 14 ? -0.487  12.835  -11.679 1.00 0.00 ? 285 LYS B NZ   7 
ATOM   9304 H H    . LYS B 1 14 ? 3.145   14.782  -6.563  1.00 0.00 ? 285 LYS B H    7 
ATOM   9305 H HA   . LYS B 1 14 ? 1.444   12.734  -7.571  1.00 0.00 ? 285 LYS B HA   7 
ATOM   9306 H HB2  . LYS B 1 14 ? 2.628   14.882  -8.688  1.00 0.00 ? 285 LYS B HB2  7 
ATOM   9307 H HB3  . LYS B 1 14 ? 3.761   13.633  -9.205  1.00 0.00 ? 285 LYS B HB3  7 
ATOM   9308 H HG2  . LYS B 1 14 ? 2.116   13.728  -10.924 1.00 0.00 ? 285 LYS B HG2  7 
ATOM   9309 H HG3  . LYS B 1 14 ? 1.706   12.302  -9.969  1.00 0.00 ? 285 LYS B HG3  7 
ATOM   9310 H HD2  . LYS B 1 14 ? -0.159  13.300  -9.023  1.00 0.00 ? 285 LYS B HD2  7 
ATOM   9311 H HD3  . LYS B 1 14 ? 0.498   14.929  -9.188  1.00 0.00 ? 285 LYS B HD3  7 
ATOM   9312 H HE2  . LYS B 1 14 ? -1.364  14.530  -10.777 1.00 0.00 ? 285 LYS B HE2  7 
ATOM   9313 H HE3  . LYS B 1 14 ? 0.153   14.847  -11.616 1.00 0.00 ? 285 LYS B HE3  7 
ATOM   9314 H HZ1  . LYS B 1 14 ? -0.584  12.077  -10.972 1.00 0.00 ? 285 LYS B HZ1  7 
ATOM   9315 H HZ2  . LYS B 1 14 ? -1.320  12.840  -12.301 1.00 0.00 ? 285 LYS B HZ2  7 
ATOM   9316 H HZ3  . LYS B 1 14 ? 0.367   12.671  -12.248 1.00 0.00 ? 285 LYS B HZ3  7 
ATOM   9317 N N    . THR B 1 15 ? 4.671   12.012  -7.454  1.00 0.00 ? 286 THR B N    7 
ATOM   9318 C CA   . THR B 1 15 ? 5.578   10.872  -7.395  1.00 0.00 ? 286 THR B CA   7 
ATOM   9319 C C    . THR B 1 15 ? 5.106   9.915   -6.299  1.00 0.00 ? 286 THR B C    7 
ATOM   9320 O O    . THR B 1 15 ? 5.021   8.718   -6.499  1.00 0.00 ? 286 THR B O    7 
ATOM   9321 C CB   . THR B 1 15 ? 6.995   11.359  -7.079  1.00 0.00 ? 286 THR B CB   7 
ATOM   9322 O OG1  . THR B 1 15 ? 7.153   12.692  -7.548  1.00 0.00 ? 286 THR B OG1  7 
ATOM   9323 C CG2  . THR B 1 15 ? 8.014   10.450  -7.769  1.00 0.00 ? 286 THR B CG2  7 
ATOM   9324 H H    . THR B 1 15 ? 5.028   12.927  -7.431  1.00 0.00 ? 286 THR B H    7 
ATOM   9325 H HA   . THR B 1 15 ? 5.577   10.362  -8.346  1.00 0.00 ? 286 THR B HA   7 
ATOM   9326 H HB   . THR B 1 15 ? 7.157   11.332  -6.013  1.00 0.00 ? 286 THR B HB   7 
ATOM   9327 H HG1  . THR B 1 15 ? 7.328   13.255  -6.791  1.00 0.00 ? 286 THR B HG1  7 
ATOM   9328 H HG21 . THR B 1 15 ? 7.502   9.610   -8.217  1.00 0.00 ? 286 THR B HG21 7 
ATOM   9329 H HG22 . THR B 1 15 ? 8.534   11.005  -8.535  1.00 0.00 ? 286 THR B HG22 7 
ATOM   9330 H HG23 . THR B 1 15 ? 8.727   10.090  -7.041  1.00 0.00 ? 286 THR B HG23 7 
ATOM   9331 N N    . LEU B 1 16 ? 4.789   10.435  -5.145  1.00 0.00 ? 287 LEU B N    7 
ATOM   9332 C CA   . LEU B 1 16 ? 4.323   9.574   -4.064  1.00 0.00 ? 287 LEU B CA   7 
ATOM   9333 C C    . LEU B 1 16 ? 3.175   8.708   -4.585  1.00 0.00 ? 287 LEU B C    7 
ATOM   9334 O O    . LEU B 1 16 ? 3.142   7.511   -4.378  1.00 0.00 ? 287 LEU B O    7 
ATOM   9335 C CB   . LEU B 1 16 ? 3.828   10.436  -2.900  1.00 0.00 ? 287 LEU B CB   7 
ATOM   9336 C CG   . LEU B 1 16 ? 4.807   10.325  -1.730  1.00 0.00 ? 287 LEU B CG   7 
ATOM   9337 C CD1  . LEU B 1 16 ? 4.662   11.552  -0.827  1.00 0.00 ? 287 LEU B CD1  7 
ATOM   9338 C CD2  . LEU B 1 16 ? 4.496   9.063   -0.924  1.00 0.00 ? 287 LEU B CD2  7 
ATOM   9339 H H    . LEU B 1 16 ? 4.858   11.403  -5.006  1.00 0.00 ? 287 LEU B H    7 
ATOM   9340 H HA   . LEU B 1 16 ? 5.132   8.942   -3.730  1.00 0.00 ? 287 LEU B HA   7 
ATOM   9341 H HB2  . LEU B 1 16 ? 3.762   11.466  -3.219  1.00 0.00 ? 287 LEU B HB2  7 
ATOM   9342 H HB3  . LEU B 1 16 ? 2.854   10.092  -2.586  1.00 0.00 ? 287 LEU B HB3  7 
ATOM   9343 H HG   . LEU B 1 16 ? 5.817   10.274  -2.109  1.00 0.00 ? 287 LEU B HG   7 
ATOM   9344 H HD11 . LEU B 1 16 ? 3.709   12.025  -1.013  1.00 0.00 ? 287 LEU B HD11 7 
ATOM   9345 H HD12 . LEU B 1 16 ? 4.716   11.246  0.207   1.00 0.00 ? 287 LEU B HD12 7 
ATOM   9346 H HD13 . LEU B 1 16 ? 5.459   12.250  -1.038  1.00 0.00 ? 287 LEU B HD13 7 
ATOM   9347 H HD21 . LEU B 1 16 ? 3.435   9.014   -0.725  1.00 0.00 ? 287 LEU B HD21 7 
ATOM   9348 H HD22 . LEU B 1 16 ? 4.795   8.192   -1.489  1.00 0.00 ? 287 LEU B HD22 7 
ATOM   9349 H HD23 . LEU B 1 16 ? 5.036   9.088   0.010   1.00 0.00 ? 287 LEU B HD23 7 
ATOM   9350 N N    . LYS B 1 17 ? 2.236   9.305   -5.265  1.00 0.00 ? 288 LYS B N    7 
ATOM   9351 C CA   . LYS B 1 17 ? 1.117   8.538   -5.795  1.00 0.00 ? 288 LYS B CA   7 
ATOM   9352 C C    . LYS B 1 17 ? 1.658   7.377   -6.629  1.00 0.00 ? 288 LYS B C    7 
ATOM   9353 O O    . LYS B 1 17 ? 1.173   6.264   -6.555  1.00 0.00 ? 288 LYS B O    7 
ATOM   9354 C CB   . LYS B 1 17 ? 0.253   9.441   -6.680  1.00 0.00 ? 288 LYS B CB   7 
ATOM   9355 C CG   . LYS B 1 17 ? -1.025  9.821   -5.932  1.00 0.00 ? 288 LYS B CG   7 
ATOM   9356 C CD   . LYS B 1 17 ? -0.866  11.216  -5.325  1.00 0.00 ? 288 LYS B CD   7 
ATOM   9357 C CE   . LYS B 1 17 ? -2.050  12.091  -5.737  1.00 0.00 ? 288 LYS B CE   7 
ATOM   9358 N NZ   . LYS B 1 17 ? -3.323  11.361  -5.473  1.00 0.00 ? 288 LYS B NZ   7 
ATOM   9359 H H    . LYS B 1 17 ? 2.285   10.272  -5.424  1.00 0.00 ? 288 LYS B H    7 
ATOM   9360 H HA   . LYS B 1 17 ? 0.521   8.154   -4.980  1.00 0.00 ? 288 LYS B HA   7 
ATOM   9361 H HB2  . LYS B 1 17 ? 0.807   10.337  -6.927  1.00 0.00 ? 288 LYS B HB2  7 
ATOM   9362 H HB3  . LYS B 1 17 ? -0.004  8.915   -7.587  1.00 0.00 ? 288 LYS B HB3  7 
ATOM   9363 H HG2  . LYS B 1 17 ? -1.858  9.820   -6.620  1.00 0.00 ? 288 LYS B HG2  7 
ATOM   9364 H HG3  . LYS B 1 17 ? -1.208  9.106   -5.144  1.00 0.00 ? 288 LYS B HG3  7 
ATOM   9365 H HD2  . LYS B 1 17 ? -0.833  11.138  -4.247  1.00 0.00 ? 288 LYS B HD2  7 
ATOM   9366 H HD3  . LYS B 1 17 ? 0.049   11.662  -5.682  1.00 0.00 ? 288 LYS B HD3  7 
ATOM   9367 H HE2  . LYS B 1 17 ? -2.037  13.008  -5.169  1.00 0.00 ? 288 LYS B HE2  7 
ATOM   9368 H HE3  . LYS B 1 17 ? -1.980  12.320  -6.790  1.00 0.00 ? 288 LYS B HE3  7 
ATOM   9369 H HZ1  . LYS B 1 17 ? -3.160  10.631  -4.749  1.00 0.00 ? 288 LYS B HZ1  7 
ATOM   9370 H HZ2  . LYS B 1 17 ? -4.043  12.032  -5.134  1.00 0.00 ? 288 LYS B HZ2  7 
ATOM   9371 H HZ3  . LYS B 1 17 ? -3.653  10.909  -6.349  1.00 0.00 ? 288 LYS B HZ3  7 
ATOM   9372 N N    . ALA B 1 18 ? 2.662   7.629   -7.423  1.00 0.00 ? 289 ALA B N    7 
ATOM   9373 C CA   . ALA B 1 18 ? 3.229   6.568   -8.245  1.00 0.00 ? 289 ALA B CA   7 
ATOM   9374 C C    . ALA B 1 18 ? 3.616   5.385   -7.358  1.00 0.00 ? 289 ALA B C    7 
ATOM   9375 O O    . ALA B 1 18 ? 3.158   4.277   -7.548  1.00 0.00 ? 289 ALA B O    7 
ATOM   9376 C CB   . ALA B 1 18 ? 4.480   7.084   -8.956  1.00 0.00 ? 289 ALA B CB   7 
ATOM   9377 H H    . ALA B 1 18 ? 3.038   8.533   -7.464  1.00 0.00 ? 289 ALA B H    7 
ATOM   9378 H HA   . ALA B 1 18 ? 2.505   6.249   -8.978  1.00 0.00 ? 289 ALA B HA   7 
ATOM   9379 H HB1  . ALA B 1 18 ? 4.575   8.147   -8.791  1.00 0.00 ? 289 ALA B HB1  7 
ATOM   9380 H HB2  . ALA B 1 18 ? 5.351   6.579   -8.558  1.00 0.00 ? 289 ALA B HB2  7 
ATOM   9381 H HB3  . ALA B 1 18 ? 4.401   6.887   -10.014 1.00 0.00 ? 289 ALA B HB3  7 
ATOM   9382 N N    . GLN B 1 19 ? 4.465   5.614   -6.396  1.00 0.00 ? 290 GLN B N    7 
ATOM   9383 C CA   . GLN B 1 19 ? 4.883   4.525   -5.524  1.00 0.00 ? 290 GLN B CA   7 
ATOM   9384 C C    . GLN B 1 19 ? 3.650   3.797   -4.978  1.00 0.00 ? 290 GLN B C    7 
ATOM   9385 O O    . GLN B 1 19 ? 3.672   2.600   -4.765  1.00 0.00 ? 290 GLN B O    7 
ATOM   9386 C CB   . GLN B 1 19 ? 5.704   5.084   -4.361  1.00 0.00 ? 290 GLN B CB   7 
ATOM   9387 C CG   . GLN B 1 19 ? 7.079   5.518   -4.871  1.00 0.00 ? 290 GLN B CG   7 
ATOM   9388 C CD   . GLN B 1 19 ? 7.891   6.112   -3.718  1.00 0.00 ? 290 GLN B CD   7 
ATOM   9389 O OE1  . GLN B 1 19 ? 8.398   7.212   -3.822  1.00 0.00 ? 290 GLN B OE1  7 
ATOM   9390 N NE2  . GLN B 1 19 ? 8.035   5.428   -2.616  1.00 0.00 ? 290 GLN B NE2  7 
ATOM   9391 H H    . GLN B 1 19 ? 4.830   6.516   -6.265  1.00 0.00 ? 290 GLN B H    7 
ATOM   9392 H HA   . GLN B 1 19 ? 5.489   3.834   -6.087  1.00 0.00 ? 290 GLN B HA   7 
ATOM   9393 H HB2  . GLN B 1 19 ? 5.192   5.933   -3.934  1.00 0.00 ? 290 GLN B HB2  7 
ATOM   9394 H HB3  . GLN B 1 19 ? 5.826   4.321   -3.607  1.00 0.00 ? 290 GLN B HB3  7 
ATOM   9395 H HG2  . GLN B 1 19 ? 7.600   4.660   -5.274  1.00 0.00 ? 290 GLN B HG2  7 
ATOM   9396 H HG3  . GLN B 1 19 ? 6.958   6.262   -5.644  1.00 0.00 ? 290 GLN B HG3  7 
ATOM   9397 H HE21 . GLN B 1 19 ? 7.624   4.542   -2.534  1.00 0.00 ? 290 GLN B HE21 7 
ATOM   9398 H HE22 . GLN B 1 19 ? 8.552   5.801   -1.872  1.00 0.00 ? 290 GLN B HE22 7 
ATOM   9399 N N    . ASN B 1 20 ? 2.575   4.505   -4.755  1.00 0.00 ? 291 ASN B N    7 
ATOM   9400 C CA   . ASN B 1 20 ? 1.374   3.857   -4.237  1.00 0.00 ? 291 ASN B CA   7 
ATOM   9401 C C    . ASN B 1 20 ? 0.894   2.807   -5.241  1.00 0.00 ? 291 ASN B C    7 
ATOM   9402 O O    . ASN B 1 20 ? 0.601   1.682   -4.886  1.00 0.00 ? 291 ASN B O    7 
ATOM   9403 C CB   . ASN B 1 20 ? 0.274   4.900   -4.024  1.00 0.00 ? 291 ASN B CB   7 
ATOM   9404 C CG   . ASN B 1 20 ? -0.681  4.417   -2.929  1.00 0.00 ? 291 ASN B CG   7 
ATOM   9405 O OD1  . ASN B 1 20 ? -0.381  3.478   -2.219  1.00 0.00 ? 291 ASN B OD1  7 
ATOM   9406 N ND2  . ASN B 1 20 ? -1.825  5.022   -2.766  1.00 0.00 ? 291 ASN B ND2  7 
ATOM   9407 H H    . ASN B 1 20 ? 2.575   5.468   -4.934  1.00 0.00 ? 291 ASN B H    7 
ATOM   9408 H HA   . ASN B 1 20 ? 1.601   3.378   -3.295  1.00 0.00 ? 291 ASN B HA   7 
ATOM   9409 H HB2  . ASN B 1 20 ? 0.720   5.838   -3.724  1.00 0.00 ? 291 ASN B HB2  7 
ATOM   9410 H HB3  . ASN B 1 20 ? -0.276  5.039   -4.943  1.00 0.00 ? 291 ASN B HB3  7 
ATOM   9411 H HD21 . ASN B 1 20 ? -2.065  5.778   -3.339  1.00 0.00 ? 291 ASN B HD21 7 
ATOM   9412 H HD22 . ASN B 1 20 ? -2.442  4.719   -2.067  1.00 0.00 ? 291 ASN B HD22 7 
ATOM   9413 N N    . SER B 1 21 ? 0.816   3.164   -6.493  1.00 0.00 ? 292 SER B N    7 
ATOM   9414 C CA   . SER B 1 21 ? 0.372   2.205   -7.497  1.00 0.00 ? 292 SER B CA   7 
ATOM   9415 C C    . SER B 1 21 ? 1.379   1.057   -7.580  1.00 0.00 ? 292 SER B C    7 
ATOM   9416 O O    . SER B 1 21 ? 1.032   -0.068  -7.881  1.00 0.00 ? 292 SER B O    7 
ATOM   9417 C CB   . SER B 1 21 ? 0.274   2.899   -8.858  1.00 0.00 ? 292 SER B CB   7 
ATOM   9418 O OG   . SER B 1 21 ? -1.095  3.109   -9.178  1.00 0.00 ? 292 SER B OG   7 
ATOM   9419 H H    . SER B 1 21 ? 1.060   4.075   -6.759  1.00 0.00 ? 292 SER B H    7 
ATOM   9420 H HA   . SER B 1 21 ? -0.597  1.817   -7.222  1.00 0.00 ? 292 SER B HA   7 
ATOM   9421 H HB2  . SER B 1 21 ? 0.778   3.850   -8.814  1.00 0.00 ? 292 SER B HB2  7 
ATOM   9422 H HB3  . SER B 1 21 ? 0.740   2.280   -9.611  1.00 0.00 ? 292 SER B HB3  7 
ATOM   9423 H HG   . SER B 1 21 ? -1.569  2.291   -9.006  1.00 0.00 ? 292 SER B HG   7 
ATOM   9424 N N    . GLU B 1 22 ? 2.627   1.333   -7.313  1.00 0.00 ? 293 GLU B N    7 
ATOM   9425 C CA   . GLU B 1 22 ? 3.638   0.284   -7.371  1.00 0.00 ? 293 GLU B CA   7 
ATOM   9426 C C    . GLU B 1 22 ? 3.294   -0.807  -6.354  1.00 0.00 ? 293 GLU B C    7 
ATOM   9427 O O    . GLU B 1 22 ? 3.066   -1.949  -6.705  1.00 0.00 ? 293 GLU B O    7 
ATOM   9428 C CB   . GLU B 1 22 ? 5.008   0.879   -7.036  1.00 0.00 ? 293 GLU B CB   7 
ATOM   9429 C CG   . GLU B 1 22 ? 5.723   1.278   -8.329  1.00 0.00 ? 293 GLU B CG   7 
ATOM   9430 C CD   . GLU B 1 22 ? 7.071   1.914   -7.992  1.00 0.00 ? 293 GLU B CD   7 
ATOM   9431 O OE1  . GLU B 1 22 ? 7.923   1.209   -7.474  1.00 0.00 ? 293 GLU B OE1  7 
ATOM   9432 O OE2  . GLU B 1 22 ? 7.231   3.094   -8.254  1.00 0.00 ? 293 GLU B OE2  7 
ATOM   9433 H H    . GLU B 1 22 ? 2.883   2.248   -7.070  1.00 0.00 ? 293 GLU B H    7 
ATOM   9434 H HA   . GLU B 1 22 ? 3.663   -0.139  -8.363  1.00 0.00 ? 293 GLU B HA   7 
ATOM   9435 H HB2  . GLU B 1 22 ? 4.879   1.751   -6.412  1.00 0.00 ? 293 GLU B HB2  7 
ATOM   9436 H HB3  . GLU B 1 22 ? 5.600   0.147   -6.511  1.00 0.00 ? 293 GLU B HB3  7 
ATOM   9437 H HG2  . GLU B 1 22 ? 5.878   0.401   -8.939  1.00 0.00 ? 293 GLU B HG2  7 
ATOM   9438 H HG3  . GLU B 1 22 ? 5.117   1.990   -8.869  1.00 0.00 ? 293 GLU B HG3  7 
ATOM   9439 N N    . LEU B 1 23 ? 3.259   -0.464  -5.096  1.00 0.00 ? 294 LEU B N    7 
ATOM   9440 C CA   . LEU B 1 23 ? 2.938   -1.456  -4.077  1.00 0.00 ? 294 LEU B CA   7 
ATOM   9441 C C    . LEU B 1 23 ? 1.578   -2.086  -4.388  1.00 0.00 ? 294 LEU B C    7 
ATOM   9442 O O    . LEU B 1 23 ? 1.315   -3.218  -4.037  1.00 0.00 ? 294 LEU B O    7 
ATOM   9443 C CB   . LEU B 1 23 ? 2.883   -0.780  -2.706  1.00 0.00 ? 294 LEU B CB   7 
ATOM   9444 C CG   . LEU B 1 23 ? 4.277   -0.274  -2.330  1.00 0.00 ? 294 LEU B CG   7 
ATOM   9445 C CD1  . LEU B 1 23 ? 4.189   0.561   -1.050  1.00 0.00 ? 294 LEU B CD1  7 
ATOM   9446 C CD2  . LEU B 1 23 ? 5.207   -1.466  -2.098  1.00 0.00 ? 294 LEU B CD2  7 
ATOM   9447 H H    . LEU B 1 23 ? 3.446   0.462   -4.835  1.00 0.00 ? 294 LEU B H    7 
ATOM   9448 H HA   . LEU B 1 23 ? 3.697   -2.224  -4.069  1.00 0.00 ? 294 LEU B HA   7 
ATOM   9449 H HB2  . LEU B 1 23 ? 2.196   0.052   -2.744  1.00 0.00 ? 294 LEU B HB2  7 
ATOM   9450 H HB3  . LEU B 1 23 ? 2.552   -1.491  -1.966  1.00 0.00 ? 294 LEU B HB3  7 
ATOM   9451 H HG   . LEU B 1 23 ? 4.666   0.337   -3.132  1.00 0.00 ? 294 LEU B HG   7 
ATOM   9452 H HD11 . LEU B 1 23 ? 3.211   0.443   -0.612  1.00 0.00 ? 294 LEU B HD11 7 
ATOM   9453 H HD12 . LEU B 1 23 ? 4.942   0.227   -0.352  1.00 0.00 ? 294 LEU B HD12 7 
ATOM   9454 H HD13 . LEU B 1 23 ? 4.355   1.602   -1.289  1.00 0.00 ? 294 LEU B HD13 7 
ATOM   9455 H HD21 . LEU B 1 23 ? 4.666   -2.249  -1.588  1.00 0.00 ? 294 LEU B HD21 7 
ATOM   9456 H HD22 . LEU B 1 23 ? 5.564   -1.835  -3.048  1.00 0.00 ? 294 LEU B HD22 7 
ATOM   9457 H HD23 . LEU B 1 23 ? 6.045   -1.156  -1.493  1.00 0.00 ? 294 LEU B HD23 7 
ATOM   9458 N N    . ALA B 1 24 ? 0.713   -1.360  -5.041  1.00 0.00 ? 295 ALA B N    7 
ATOM   9459 C CA   . ALA B 1 24 ? -0.600  -1.907  -5.364  1.00 0.00 ? 295 ALA B CA   7 
ATOM   9460 C C    . ALA B 1 24 ? -0.435  -3.142  -6.254  1.00 0.00 ? 295 ALA B C    7 
ATOM   9461 O O    . ALA B 1 24 ? -1.038  -4.172  -6.023  1.00 0.00 ? 295 ALA B O    7 
ATOM   9462 C CB   . ALA B 1 24 ? -1.423  -0.850  -6.104  1.00 0.00 ? 295 ALA B CB   7 
ATOM   9463 H H    . ALA B 1 24 ? 0.946   -0.448  -5.314  1.00 0.00 ? 295 ALA B H    7 
ATOM   9464 H HA   . ALA B 1 24 ? -1.110  -2.183  -4.453  1.00 0.00 ? 295 ALA B HA   7 
ATOM   9465 H HB1  . ALA B 1 24 ? -1.171  0.131   -5.728  1.00 0.00 ? 295 ALA B HB1  7 
ATOM   9466 H HB2  . ALA B 1 24 ? -1.203  -0.896  -7.161  1.00 0.00 ? 295 ALA B HB2  7 
ATOM   9467 H HB3  . ALA B 1 24 ? -2.475  -1.039  -5.948  1.00 0.00 ? 295 ALA B HB3  7 
ATOM   9468 N N    . SER B 1 25 ? 0.377   -3.047  -7.271  1.00 0.00 ? 296 SER B N    7 
ATOM   9469 C CA   . SER B 1 25 ? 0.574   -4.189  -8.157  1.00 0.00 ? 296 SER B CA   7 
ATOM   9470 C C    . SER B 1 25 ? 1.243   -5.327  -7.383  1.00 0.00 ? 296 SER B C    7 
ATOM   9471 O O    . SER B 1 25 ? 0.862   -6.476  -7.499  1.00 0.00 ? 296 SER B O    7 
ATOM   9472 C CB   . SER B 1 25 ? 1.463   -3.774  -9.332  1.00 0.00 ? 296 SER B CB   7 
ATOM   9473 O OG   . SER B 1 25 ? 2.791   -4.227  -9.102  1.00 0.00 ? 296 SER B OG   7 
ATOM   9474 H H    . SER B 1 25 ? 0.852   -2.206  -7.440  1.00 0.00 ? 296 SER B H    7 
ATOM   9475 H HA   . SER B 1 25 ? -0.382  -4.520  -8.532  1.00 0.00 ? 296 SER B HA   7 
ATOM   9476 H HB2  . SER B 1 25 ? 1.089   -4.216  -10.239 1.00 0.00 ? 296 SER B HB2  7 
ATOM   9477 H HB3  . SER B 1 25 ? 1.449   -2.698  -9.428  1.00 0.00 ? 296 SER B HB3  7 
ATOM   9478 H HG   . SER B 1 25 ? 3.279   -3.515  -8.684  1.00 0.00 ? 296 SER B HG   7 
ATOM   9479 N N    . THR B 1 26 ? 2.237   -5.019  -6.595  1.00 0.00 ? 297 THR B N    7 
ATOM   9480 C CA   . THR B 1 26 ? 2.914   -6.064  -5.834  1.00 0.00 ? 297 THR B CA   7 
ATOM   9481 C C    . THR B 1 26 ? 1.887   -6.862  -5.029  1.00 0.00 ? 297 THR B C    7 
ATOM   9482 O O    . THR B 1 26 ? 1.953   -8.074  -4.947  1.00 0.00 ? 297 THR B O    7 
ATOM   9483 C CB   . THR B 1 26 ? 3.925   -5.426  -4.878  1.00 0.00 ? 297 THR B CB   7 
ATOM   9484 O OG1  . THR B 1 26 ? 4.928   -4.757  -5.628  1.00 0.00 ? 297 THR B OG1  7 
ATOM   9485 C CG2  . THR B 1 26 ? 4.568   -6.511  -4.014  1.00 0.00 ? 297 THR B CG2  7 
ATOM   9486 H H    . THR B 1 26 ? 2.529   -4.086  -6.516  1.00 0.00 ? 297 THR B H    7 
ATOM   9487 H HA   . THR B 1 26 ? 3.432   -6.725  -6.511  1.00 0.00 ? 297 THR B HA   7 
ATOM   9488 H HB   . THR B 1 26 ? 3.419   -4.717  -4.239  1.00 0.00 ? 297 THR B HB   7 
ATOM   9489 H HG1  . THR B 1 26 ? 5.722   -4.715  -5.092  1.00 0.00 ? 297 THR B HG1  7 
ATOM   9490 H HG21 . THR B 1 26 ? 4.295   -7.484  -4.395  1.00 0.00 ? 297 THR B HG21 7 
ATOM   9491 H HG22 . THR B 1 26 ? 5.643   -6.402  -4.038  1.00 0.00 ? 297 THR B HG22 7 
ATOM   9492 H HG23 . THR B 1 26 ? 4.221   -6.414  -2.996  1.00 0.00 ? 297 THR B HG23 7 
ATOM   9493 N N    . ALA B 1 27 ? 0.939   -6.196  -4.431  1.00 0.00 ? 298 ALA B N    7 
ATOM   9494 C CA   . ALA B 1 27 ? -0.066  -6.900  -3.643  1.00 0.00 ? 298 ALA B CA   7 
ATOM   9495 C C    . ALA B 1 27 ? -0.872  -7.831  -4.553  1.00 0.00 ? 298 ALA B C    7 
ATOM   9496 O O    . ALA B 1 27 ? -0.966  -9.017  -4.314  1.00 0.00 ? 298 ALA B O    7 
ATOM   9497 C CB   . ALA B 1 27 ? -1.005  -5.885  -2.991  1.00 0.00 ? 298 ALA B CB   7 
ATOM   9498 H H    . ALA B 1 27 ? 0.906   -5.220  -4.506  1.00 0.00 ? 298 ALA B H    7 
ATOM   9499 H HA   . ALA B 1 27 ? 0.422   -7.481  -2.875  1.00 0.00 ? 298 ALA B HA   7 
ATOM   9500 H HB1  . ALA B 1 27 ? -0.966  -4.955  -3.539  1.00 0.00 ? 298 ALA B HB1  7 
ATOM   9501 H HB2  . ALA B 1 27 ? -2.016  -6.269  -3.006  1.00 0.00 ? 298 ALA B HB2  7 
ATOM   9502 H HB3  . ALA B 1 27 ? -0.699  -5.715  -1.970  1.00 0.00 ? 298 ALA B HB3  7 
ATOM   9503 N N    . ASN B 1 28 ? -1.458  -7.301  -5.592  1.00 0.00 ? 299 ASN B N    7 
ATOM   9504 C CA   . ASN B 1 28 ? -2.242  -8.142  -6.491  1.00 0.00 ? 299 ASN B CA   7 
ATOM   9505 C C    . ASN B 1 28 ? -1.366  -9.276  -7.028  1.00 0.00 ? 299 ASN B C    7 
ATOM   9506 O O    . ASN B 1 28 ? -1.858  -10.280 -7.504  1.00 0.00 ? 299 ASN B O    7 
ATOM   9507 C CB   . ASN B 1 28 ? -2.761  -7.298  -7.657  1.00 0.00 ? 299 ASN B CB   7 
ATOM   9508 C CG   . ASN B 1 28 ? -3.520  -6.088  -7.111  1.00 0.00 ? 299 ASN B CG   7 
ATOM   9509 O OD1  . ASN B 1 28 ? -4.493  -6.237  -6.397  1.00 0.00 ? 299 ASN B OD1  7 
ATOM   9510 N ND2  . ASN B 1 28 ? -3.113  -4.886  -7.418  1.00 0.00 ? 299 ASN B ND2  7 
ATOM   9511 H H    . ASN B 1 28 ? -1.374  -6.340  -5.766  1.00 0.00 ? 299 ASN B H    7 
ATOM   9512 H HA   . ASN B 1 28 ? -3.079  -8.559  -5.952  1.00 0.00 ? 299 ASN B HA   7 
ATOM   9513 H HB2  . ASN B 1 28 ? -1.927  -6.962  -8.256  1.00 0.00 ? 299 ASN B HB2  7 
ATOM   9514 H HB3  . ASN B 1 28 ? -3.426  -7.893  -8.264  1.00 0.00 ? 299 ASN B HB3  7 
ATOM   9515 H HD21 . ASN B 1 28 ? -2.330  -4.765  -7.991  1.00 0.00 ? 299 ASN B HD21 7 
ATOM   9516 H HD22 . ASN B 1 28 ? -3.593  -4.104  -7.071  1.00 0.00 ? 299 ASN B HD22 7 
ATOM   9517 N N    . MET B 1 29 ? -0.070  -9.128  -6.954  1.00 0.00 ? 300 MET B N    7 
ATOM   9518 C CA   . MET B 1 29 ? 0.812   -10.179 -7.447  1.00 0.00 ? 300 MET B CA   7 
ATOM   9519 C C    . MET B 1 29 ? 0.820   -11.341 -6.452  1.00 0.00 ? 300 MET B C    7 
ATOM   9520 O O    . MET B 1 29 ? 0.428   -12.448 -6.769  1.00 0.00 ? 300 MET B O    7 
ATOM   9521 C CB   . MET B 1 29 ? 2.230   -9.627  -7.602  1.00 0.00 ? 300 MET B CB   7 
ATOM   9522 C CG   . MET B 1 29 ? 2.921   -10.317 -8.780  1.00 0.00 ? 300 MET B CG   7 
ATOM   9523 S SD   . MET B 1 29 ? 4.034   -11.602 -8.158  1.00 0.00 ? 300 MET B SD   7 
ATOM   9524 C CE   . MET B 1 29 ? 4.347   -12.418 -9.742  1.00 0.00 ? 300 MET B CE   7 
ATOM   9525 H H    . MET B 1 29 ? 0.308   -8.312  -6.565  1.00 0.00 ? 300 MET B H    7 
ATOM   9526 H HA   . MET B 1 29 ? 0.456   -10.529 -8.405  1.00 0.00 ? 300 MET B HA   7 
ATOM   9527 H HB2  . MET B 1 29 ? 2.182   -8.563  -7.785  1.00 0.00 ? 300 MET B HB2  7 
ATOM   9528 H HB3  . MET B 1 29 ? 2.790   -9.813  -6.699  1.00 0.00 ? 300 MET B HB3  7 
ATOM   9529 H HG2  . MET B 1 29 ? 2.177   -10.765 -9.422  1.00 0.00 ? 300 MET B HG2  7 
ATOM   9530 H HG3  . MET B 1 29 ? 3.488   -9.589  -9.342  1.00 0.00 ? 300 MET B HG3  7 
ATOM   9531 H HE1  . MET B 1 29 ? 4.062   -11.758 -10.549 1.00 0.00 ? 300 MET B HE1  7 
ATOM   9532 H HE2  . MET B 1 29 ? 5.399   -12.658 -9.821  1.00 0.00 ? 300 MET B HE2  7 
ATOM   9533 H HE3  . MET B 1 29 ? 3.769   -13.325 -9.802  1.00 0.00 ? 300 MET B HE3  7 
ATOM   9534 N N    . LEU B 1 30 ? 1.260   -11.099 -5.248  1.00 0.00 ? 301 LEU B N    7 
ATOM   9535 C CA   . LEU B 1 30 ? 1.288   -12.167 -4.255  1.00 0.00 ? 301 LEU B CA   7 
ATOM   9536 C C    . LEU B 1 30 ? -0.132  -12.696 -4.047  1.00 0.00 ? 301 LEU B C    7 
ATOM   9537 O O    . LEU B 1 30 ? -0.334  -13.784 -3.543  1.00 0.00 ? 301 LEU B O    7 
ATOM   9538 C CB   . LEU B 1 30 ? 1.827   -11.621 -2.931  1.00 0.00 ? 301 LEU B CB   7 
ATOM   9539 C CG   . LEU B 1 30 ? 3.210   -11.008 -3.154  1.00 0.00 ? 301 LEU B CG   7 
ATOM   9540 C CD1  . LEU B 1 30 ? 3.387   -9.800  -2.231  1.00 0.00 ? 301 LEU B CD1  7 
ATOM   9541 C CD2  . LEU B 1 30 ? 4.285   -12.051 -2.836  1.00 0.00 ? 301 LEU B CD2  7 
ATOM   9542 H H    . LEU B 1 30 ? 1.570   -10.200 -5.010  1.00 0.00 ? 301 LEU B H    7 
ATOM   9543 H HA   . LEU B 1 30 ? 1.926   -12.966 -4.602  1.00 0.00 ? 301 LEU B HA   7 
ATOM   9544 H HB2  . LEU B 1 30 ? 1.153   -10.865 -2.554  1.00 0.00 ? 301 LEU B HB2  7 
ATOM   9545 H HB3  . LEU B 1 30 ? 1.903   -12.424 -2.215  1.00 0.00 ? 301 LEU B HB3  7 
ATOM   9546 H HG   . LEU B 1 30 ? 3.303   -10.693 -4.183  1.00 0.00 ? 301 LEU B HG   7 
ATOM   9547 H HD11 . LEU B 1 30 ? 2.434   -9.538  -1.797  1.00 0.00 ? 301 LEU B HD11 7 
ATOM   9548 H HD12 . LEU B 1 30 ? 4.086   -10.047 -1.445  1.00 0.00 ? 301 LEU B HD12 7 
ATOM   9549 H HD13 . LEU B 1 30 ? 3.765   -8.964  -2.801  1.00 0.00 ? 301 LEU B HD13 7 
ATOM   9550 H HD21 . LEU B 1 30 ? 3.828   -12.906 -2.364  1.00 0.00 ? 301 LEU B HD21 7 
ATOM   9551 H HD22 . LEU B 1 30 ? 4.767   -12.360 -3.753  1.00 0.00 ? 301 LEU B HD22 7 
ATOM   9552 H HD23 . LEU B 1 30 ? 5.018   -11.620 -2.172  1.00 0.00 ? 301 LEU B HD23 7 
ATOM   9553 N N    . ARG B 1 31 ? -1.119  -11.932 -4.426  1.00 0.00 ? 302 ARG B N    7 
ATOM   9554 C CA   . ARG B 1 31 ? -2.497  -12.374 -4.252  1.00 0.00 ? 302 ARG B CA   7 
ATOM   9555 C C    . ARG B 1 31 ? -2.869  -13.362 -5.360  1.00 0.00 ? 302 ARG B C    7 
ATOM   9556 O O    . ARG B 1 31 ? -3.561  -14.333 -5.128  1.00 0.00 ? 302 ARG B O    7 
ATOM   9557 C CB   . ARG B 1 31 ? -3.431  -11.165 -4.314  1.00 0.00 ? 302 ARG B CB   7 
ATOM   9558 C CG   . ARG B 1 31 ? -4.191  -11.042 -2.994  1.00 0.00 ? 302 ARG B CG   7 
ATOM   9559 C CD   . ARG B 1 31 ? -4.971  -9.726  -2.972  1.00 0.00 ? 302 ARG B CD   7 
ATOM   9560 N NE   . ARG B 1 31 ? -5.618  -9.566  -1.677  1.00 0.00 ? 302 ARG B NE   7 
ATOM   9561 C CZ   . ARG B 1 31 ? -6.075  -8.400  -1.315  1.00 0.00 ? 302 ARG B CZ   7 
ATOM   9562 N NH1  . ARG B 1 31 ? -6.493  -7.554  -2.218  1.00 0.00 ? 302 ARG B NH1  7 
ATOM   9563 N NH2  . ARG B 1 31 ? -6.116  -8.079  -0.051  1.00 0.00 ? 302 ARG B NH2  7 
ATOM   9564 H H    . ARG B 1 31 ? -0.932  -11.057 -4.827  1.00 0.00 ? 302 ARG B H    7 
ATOM   9565 H HA   . ARG B 1 31 ? -2.601  -12.856 -3.291  1.00 0.00 ? 302 ARG B HA   7 
ATOM   9566 H HB2  . ARG B 1 31 ? -2.849  -10.270 -4.483  1.00 0.00 ? 302 ARG B HB2  7 
ATOM   9567 H HB3  . ARG B 1 31 ? -4.135  -11.295 -5.122  1.00 0.00 ? 302 ARG B HB3  7 
ATOM   9568 H HG2  . ARG B 1 31 ? -4.877  -11.870 -2.896  1.00 0.00 ? 302 ARG B HG2  7 
ATOM   9569 H HG3  . ARG B 1 31 ? -3.490  -11.056 -2.173  1.00 0.00 ? 302 ARG B HG3  7 
ATOM   9570 H HD2  . ARG B 1 31 ? -4.292  -8.903  -3.140  1.00 0.00 ? 302 ARG B HD2  7 
ATOM   9571 H HD3  . ARG B 1 31 ? -5.721  -9.740  -3.749  1.00 0.00 ? 302 ARG B HD3  7 
ATOM   9572 H HE   . ARG B 1 31 ? -5.709  -10.336 -1.076  1.00 0.00 ? 302 ARG B HE   7 
ATOM   9573 H HH11 . ARG B 1 31 ? -6.462  -7.800  -3.186  1.00 0.00 ? 302 ARG B HH11 7 
ATOM   9574 H HH12 . ARG B 1 31 ? -6.844  -6.660  -1.940  1.00 0.00 ? 302 ARG B HH12 7 
ATOM   9575 H HH21 . ARG B 1 31 ? -5.796  -8.727  0.639   1.00 0.00 ? 302 ARG B HH21 7 
ATOM   9576 H HH22 . ARG B 1 31 ? -6.467  -7.184  0.226   1.00 0.00 ? 302 ARG B HH22 7 
ATOM   9577 N N    . GLU B 1 32 ? -2.422  -13.125 -6.564  1.00 0.00 ? 303 GLU B N    7 
ATOM   9578 C CA   . GLU B 1 32 ? -2.755  -14.037 -7.652  1.00 0.00 ? 303 GLU B CA   7 
ATOM   9579 C C    . GLU B 1 32 ? -2.019  -15.363 -7.451  1.00 0.00 ? 303 GLU B C    7 
ATOM   9580 O O    . GLU B 1 32 ? -2.510  -16.417 -7.805  1.00 0.00 ? 303 GLU B O    7 
ATOM   9581 C CB   . GLU B 1 32 ? -2.343  -13.417 -8.990  1.00 0.00 ? 303 GLU B CB   7 
ATOM   9582 C CG   . GLU B 1 32 ? -0.866  -13.020 -8.942  1.00 0.00 ? 303 GLU B CG   7 
ATOM   9583 C CD   . GLU B 1 32 ? -0.318  -12.919 -10.366 1.00 0.00 ? 303 GLU B CD   7 
ATOM   9584 O OE1  . GLU B 1 32 ? -1.086  -13.121 -11.292 1.00 0.00 ? 303 GLU B OE1  7 
ATOM   9585 O OE2  . GLU B 1 32 ? 0.862   -12.641 -10.508 1.00 0.00 ? 303 GLU B OE2  7 
ATOM   9586 H H    . GLU B 1 32 ? -1.869  -12.335 -6.735  1.00 0.00 ? 303 GLU B H    7 
ATOM   9587 H HA   . GLU B 1 32 ? -3.820  -14.215 -7.655  1.00 0.00 ? 303 GLU B HA   7 
ATOM   9588 H HB2  . GLU B 1 32 ? -2.498  -14.137 -9.781  1.00 0.00 ? 303 GLU B HB2  7 
ATOM   9589 H HB3  . GLU B 1 32 ? -2.943  -12.539 -9.179  1.00 0.00 ? 303 GLU B HB3  7 
ATOM   9590 H HG2  . GLU B 1 32 ? -0.767  -12.062 -8.449  1.00 0.00 ? 303 GLU B HG2  7 
ATOM   9591 H HG3  . GLU B 1 32 ? -0.310  -13.766 -8.395  1.00 0.00 ? 303 GLU B HG3  7 
ATOM   9592 N N    . GLN B 1 33 ? -0.845  -15.320 -6.880  1.00 0.00 ? 304 GLN B N    7 
ATOM   9593 C CA   . GLN B 1 33 ? -0.100  -16.556 -6.663  1.00 0.00 ? 304 GLN B CA   7 
ATOM   9594 C C    . GLN B 1 33 ? -0.708  -17.315 -5.479  1.00 0.00 ? 304 GLN B C    7 
ATOM   9595 O O    . GLN B 1 33 ? -0.824  -18.524 -5.500  1.00 0.00 ? 304 GLN B O    7 
ATOM   9596 C CB   . GLN B 1 33 ? 1.368   -16.228 -6.370  1.00 0.00 ? 304 GLN B CB   7 
ATOM   9597 C CG   . GLN B 1 33 ? 1.512   -15.712 -4.936  1.00 0.00 ? 304 GLN B CG   7 
ATOM   9598 C CD   . GLN B 1 33 ? 2.993   -15.529 -4.604  1.00 0.00 ? 304 GLN B CD   7 
ATOM   9599 O OE1  . GLN B 1 33 ? 3.496   -14.424 -4.603  1.00 0.00 ? 304 GLN B OE1  7 
ATOM   9600 N NE2  . GLN B 1 33 ? 3.722   -16.576 -4.322  1.00 0.00 ? 304 GLN B NE2  7 
ATOM   9601 H H    . GLN B 1 33 ? -0.465  -14.461 -6.600  1.00 0.00 ? 304 GLN B H    7 
ATOM   9602 H HA   . GLN B 1 33 ? -0.158  -17.170 -7.550  1.00 0.00 ? 304 GLN B HA   7 
ATOM   9603 H HB2  . GLN B 1 33 ? 1.967   -17.119 -6.493  1.00 0.00 ? 304 GLN B HB2  7 
ATOM   9604 H HB3  . GLN B 1 33 ? 1.711   -15.469 -7.058  1.00 0.00 ? 304 GLN B HB3  7 
ATOM   9605 H HG2  . GLN B 1 33 ? 1.001   -14.766 -4.841  1.00 0.00 ? 304 GLN B HG2  7 
ATOM   9606 H HG3  . GLN B 1 33 ? 1.079   -16.426 -4.253  1.00 0.00 ? 304 GLN B HG3  7 
ATOM   9607 H HE21 . GLN B 1 33 ? 3.317   -17.469 -4.324  1.00 0.00 ? 304 GLN B HE21 7 
ATOM   9608 H HE22 . GLN B 1 33 ? 4.671   -16.469 -4.107  1.00 0.00 ? 304 GLN B HE22 7 
ATOM   9609 N N    . VAL B 1 34 ? -1.096  -16.614 -4.451  1.00 0.00 ? 305 VAL B N    7 
ATOM   9610 C CA   . VAL B 1 34 ? -1.683  -17.282 -3.292  1.00 0.00 ? 305 VAL B CA   7 
ATOM   9611 C C    . VAL B 1 34 ? -3.073  -17.806 -3.659  1.00 0.00 ? 305 VAL B C    7 
ATOM   9612 O O    . VAL B 1 34 ? -3.552  -18.769 -3.095  1.00 0.00 ? 305 VAL B O    7 
ATOM   9613 C CB   . VAL B 1 34 ? -1.798  -16.289 -2.135  1.00 0.00 ? 305 VAL B CB   7 
ATOM   9614 C CG1  . VAL B 1 34 ? -2.624  -16.911 -1.008  1.00 0.00 ? 305 VAL B CG1  7 
ATOM   9615 C CG2  . VAL B 1 34 ? -0.400  -15.949 -1.616  1.00 0.00 ? 305 VAL B CG2  7 
ATOM   9616 H H    . VAL B 1 34 ? -0.994  -15.639 -4.453  1.00 0.00 ? 305 VAL B H    7 
ATOM   9617 H HA   . VAL B 1 34 ? -1.054  -18.106 -2.995  1.00 0.00 ? 305 VAL B HA   7 
ATOM   9618 H HB   . VAL B 1 34 ? -2.285  -15.388 -2.482  1.00 0.00 ? 305 VAL B HB   7 
ATOM   9619 H HG11 . VAL B 1 34 ? -2.235  -17.893 -0.777  1.00 0.00 ? 305 VAL B HG11 7 
ATOM   9620 H HG12 . VAL B 1 34 ? -2.566  -16.285 -0.132  1.00 0.00 ? 305 VAL B HG12 7 
ATOM   9621 H HG13 . VAL B 1 34 ? -3.653  -16.997 -1.321  1.00 0.00 ? 305 VAL B HG13 7 
ATOM   9622 H HG21 . VAL B 1 34 ? 0.342   -16.394 -2.263  1.00 0.00 ? 305 VAL B HG21 7 
ATOM   9623 H HG22 . VAL B 1 34 ? -0.270  -14.877 -1.602  1.00 0.00 ? 305 VAL B HG22 7 
ATOM   9624 H HG23 . VAL B 1 34 ? -0.283  -16.340 -0.615  1.00 0.00 ? 305 VAL B HG23 7 
ATOM   9625 N N    . ALA B 1 35 ? -3.721  -17.183 -4.604  1.00 0.00 ? 306 ALA B N    7 
ATOM   9626 C CA   . ALA B 1 35 ? -5.047  -17.639 -5.001  1.00 0.00 ? 306 ALA B CA   7 
ATOM   9627 C C    . ALA B 1 35 ? -4.915  -18.955 -5.765  1.00 0.00 ? 306 ALA B C    7 
ATOM   9628 O O    . ALA B 1 35 ? -5.567  -19.934 -5.458  1.00 0.00 ? 306 ALA B O    7 
ATOM   9629 C CB   . ALA B 1 35 ? -5.702  -16.588 -5.900  1.00 0.00 ? 306 ALA B CB   7 
ATOM   9630 H H    . ALA B 1 35 ? -3.315  -16.410 -5.049  1.00 0.00 ? 306 ALA B H    7 
ATOM   9631 H HA   . ALA B 1 35 ? -5.656  -17.789 -4.122  1.00 0.00 ? 306 ALA B HA   7 
ATOM   9632 H HB1  . ALA B 1 35 ? -5.373  -15.604 -5.603  1.00 0.00 ? 306 ALA B HB1  7 
ATOM   9633 H HB2  . ALA B 1 35 ? -5.422  -16.767 -6.928  1.00 0.00 ? 306 ALA B HB2  7 
ATOM   9634 H HB3  . ALA B 1 35 ? -6.777  -16.652 -5.805  1.00 0.00 ? 306 ALA B HB3  7 
ATOM   9635 N N    . GLN B 1 36 ? -4.069  -18.991 -6.760  1.00 0.00 ? 307 GLN B N    7 
ATOM   9636 C CA   . GLN B 1 36 ? -3.892  -20.220 -7.521  1.00 0.00 ? 307 GLN B CA   7 
ATOM   9637 C C    . GLN B 1 36 ? -3.256  -21.279 -6.621  1.00 0.00 ? 307 GLN B C    7 
ATOM   9638 O O    . GLN B 1 36 ? -3.368  -22.465 -6.864  1.00 0.00 ? 307 GLN B O    7 
ATOM   9639 C CB   . GLN B 1 36 ? -2.978  -19.951 -8.718  1.00 0.00 ? 307 GLN B CB   7 
ATOM   9640 C CG   . GLN B 1 36 ? -1.640  -19.400 -8.221  1.00 0.00 ? 307 GLN B CG   7 
ATOM   9641 C CD   . GLN B 1 36 ? -0.516  -19.880 -9.141  1.00 0.00 ? 307 GLN B CD   7 
ATOM   9642 O OE1  . GLN B 1 36 ? -0.698  -19.983 -10.338 1.00 0.00 ? 307 GLN B OE1  7 
ATOM   9643 N NE2  . GLN B 1 36 ? 0.647   -20.178 -8.629  1.00 0.00 ? 307 GLN B NE2  7 
ATOM   9644 H H    . GLN B 1 36 ? -3.548  -18.192 -6.987  1.00 0.00 ? 307 GLN B H    7 
ATOM   9645 H HA   . GLN B 1 36 ? -4.852  -20.570 -7.873  1.00 0.00 ? 307 GLN B HA   7 
ATOM   9646 H HB2  . GLN B 1 36 ? -2.812  -20.872 -9.258  1.00 0.00 ? 307 GLN B HB2  7 
ATOM   9647 H HB3  . GLN B 1 36 ? -3.443  -19.228 -9.371  1.00 0.00 ? 307 GLN B HB3  7 
ATOM   9648 H HG2  . GLN B 1 36 ? -1.673  -18.319 -8.224  1.00 0.00 ? 307 GLN B HG2  7 
ATOM   9649 H HG3  . GLN B 1 36 ? -1.457  -19.751 -7.218  1.00 0.00 ? 307 GLN B HG3  7 
ATOM   9650 H HE21 . GLN B 1 36 ? 0.794   -20.093 -7.663  1.00 0.00 ? 307 GLN B HE21 7 
ATOM   9651 H HE22 . GLN B 1 36 ? 1.374   -20.487 -9.209  1.00 0.00 ? 307 GLN B HE22 7 
ATOM   9652 N N    . LEU B 1 37 ? -2.591  -20.858 -5.581  1.00 0.00 ? 308 LEU B N    7 
ATOM   9653 C CA   . LEU B 1 37 ? -1.960  -21.815 -4.679  1.00 0.00 ? 308 LEU B CA   7 
ATOM   9654 C C    . LEU B 1 37 ? -3.034  -22.505 -3.837  1.00 0.00 ? 308 LEU B C    7 
ATOM   9655 O O    . LEU B 1 37 ? -2.993  -23.699 -3.621  1.00 0.00 ? 308 LEU B O    7 
ATOM   9656 C CB   . LEU B 1 37 ? -0.985  -21.074 -3.760  1.00 0.00 ? 308 LEU B CB   7 
ATOM   9657 C CG   . LEU B 1 37 ? 0.448   -21.303 -4.245  1.00 0.00 ? 308 LEU B CG   7 
ATOM   9658 C CD1  . LEU B 1 37 ? 1.281   -20.049 -3.979  1.00 0.00 ? 308 LEU B CD1  7 
ATOM   9659 C CD2  . LEU B 1 37 ? 1.057   -22.487 -3.491  1.00 0.00 ? 308 LEU B CD2  7 
ATOM   9660 H H    . LEU B 1 37 ? -2.514  -19.897 -5.407  1.00 0.00 ? 308 LEU B H    7 
ATOM   9661 H HA   . LEU B 1 37 ? -1.421  -22.552 -5.254  1.00 0.00 ? 308 LEU B HA   7 
ATOM   9662 H HB2  . LEU B 1 37 ? -1.208  -20.017 -3.778  1.00 0.00 ? 308 LEU B HB2  7 
ATOM   9663 H HB3  . LEU B 1 37 ? -1.087  -21.448 -2.754  1.00 0.00 ? 308 LEU B HB3  7 
ATOM   9664 H HG   . LEU B 1 37 ? 0.440   -21.512 -5.305  1.00 0.00 ? 308 LEU B HG   7 
ATOM   9665 H HD11 . LEU B 1 37 ? 0.626   -19.212 -3.789  1.00 0.00 ? 308 LEU B HD11 7 
ATOM   9666 H HD12 . LEU B 1 37 ? 1.916   -20.211 -3.122  1.00 0.00 ? 308 LEU B HD12 7 
ATOM   9667 H HD13 . LEU B 1 37 ? 1.895   -19.834 -4.844  1.00 0.00 ? 308 LEU B HD13 7 
ATOM   9668 H HD21 . LEU B 1 37 ? 0.303   -22.943 -2.869  1.00 0.00 ? 308 LEU B HD21 7 
ATOM   9669 H HD22 . LEU B 1 37 ? 1.426   -23.213 -4.201  1.00 0.00 ? 308 LEU B HD22 7 
ATOM   9670 H HD23 . LEU B 1 37 ? 1.873   -22.140 -2.875  1.00 0.00 ? 308 LEU B HD23 7 
ATOM   9671 N N    . LYS B 1 38 ? -3.996  -21.762 -3.363  1.00 0.00 ? 309 LYS B N    7 
ATOM   9672 C CA   . LYS B 1 38 ? -5.049  -22.364 -2.554  1.00 0.00 ? 309 LYS B CA   7 
ATOM   9673 C C    . LYS B 1 38 ? -6.023  -23.114 -3.467  1.00 0.00 ? 309 LYS B C    7 
ATOM   9674 O O    . LYS B 1 38 ? -6.764  -23.972 -3.031  1.00 0.00 ? 309 LYS B O    7 
ATOM   9675 C CB   . LYS B 1 38 ? -5.801  -21.270 -1.794  1.00 0.00 ? 309 LYS B CB   7 
ATOM   9676 C CG   . LYS B 1 38 ? -4.845  -20.577 -0.821  1.00 0.00 ? 309 LYS B CG   7 
ATOM   9677 C CD   . LYS B 1 38 ? -4.368  -21.583 0.230   1.00 0.00 ? 309 LYS B CD   7 
ATOM   9678 C CE   . LYS B 1 38 ? -3.563  -20.852 1.307   1.00 0.00 ? 309 LYS B CE   7 
ATOM   9679 N NZ   . LYS B 1 38 ? -3.732  -21.553 2.611   1.00 0.00 ? 309 LYS B NZ   7 
ATOM   9680 H H    . LYS B 1 38 ? -4.012  -20.801 -3.549  1.00 0.00 ? 309 LYS B H    7 
ATOM   9681 H HA   . LYS B 1 38 ? -4.613  -23.056 -1.849  1.00 0.00 ? 309 LYS B HA   7 
ATOM   9682 H HB2  . LYS B 1 38 ? -6.190  -20.547 -2.497  1.00 0.00 ? 309 LYS B HB2  7 
ATOM   9683 H HB3  . LYS B 1 38 ? -6.617  -21.712 -1.243  1.00 0.00 ? 309 LYS B HB3  7 
ATOM   9684 H HG2  . LYS B 1 38 ? -3.995  -20.191 -1.365  1.00 0.00 ? 309 LYS B HG2  7 
ATOM   9685 H HG3  . LYS B 1 38 ? -5.360  -19.764 -0.330  1.00 0.00 ? 309 LYS B HG3  7 
ATOM   9686 H HD2  . LYS B 1 38 ? -5.222  -22.063 0.682   1.00 0.00 ? 309 LYS B HD2  7 
ATOM   9687 H HD3  . LYS B 1 38 ? -3.743  -22.327 -0.242  1.00 0.00 ? 309 LYS B HD3  7 
ATOM   9688 H HE2  . LYS B 1 38 ? -2.519  -20.846 1.032   1.00 0.00 ? 309 LYS B HE2  7 
ATOM   9689 H HE3  . LYS B 1 38 ? -3.918  -19.836 1.393   1.00 0.00 ? 309 LYS B HE3  7 
ATOM   9690 H HZ1  . LYS B 1 38 ? -3.855  -22.572 2.444   1.00 0.00 ? 309 LYS B HZ1  7 
ATOM   9691 H HZ2  . LYS B 1 38 ? -2.889  -21.396 3.200   1.00 0.00 ? 309 LYS B HZ2  7 
ATOM   9692 H HZ3  . LYS B 1 38 ? -4.567  -21.176 3.101   1.00 0.00 ? 309 LYS B HZ3  7 
ATOM   9693 N N    . GLN B 1 39 ? -6.026  -22.796 -4.735  1.00 0.00 ? 310 GLN B N    7 
ATOM   9694 C CA   . GLN B 1 39 ? -6.930  -23.477 -5.653  1.00 0.00 ? 310 GLN B CA   7 
ATOM   9695 C C    . GLN B 1 39 ? -6.558  -24.961 -5.724  1.00 0.00 ? 310 GLN B C    7 
ATOM   9696 O O    . GLN B 1 39 ? -7.383  -25.805 -6.012  1.00 0.00 ? 310 GLN B O    7 
ATOM   9697 C CB   . GLN B 1 39 ? -6.813  -22.852 -7.044  1.00 0.00 ? 310 GLN B CB   7 
ATOM   9698 C CG   . GLN B 1 39 ? -7.701  -21.608 -7.119  1.00 0.00 ? 310 GLN B CG   7 
ATOM   9699 C CD   . GLN B 1 39 ? -8.405  -21.564 -8.476  1.00 0.00 ? 310 GLN B CD   7 
ATOM   9700 O OE1  . GLN B 1 39 ? -8.751  -22.590 -9.028  1.00 0.00 ? 310 GLN B OE1  7 
ATOM   9701 N NE2  . GLN B 1 39 ? -8.633  -20.410 -9.042  1.00 0.00 ? 310 GLN B NE2  7 
ATOM   9702 H H    . GLN B 1 39 ? -5.421  -22.101 -5.068  1.00 0.00 ? 310 GLN B H    7 
ATOM   9703 H HA   . GLN B 1 39 ? -7.945  -23.378 -5.300  1.00 0.00 ? 310 GLN B HA   7 
ATOM   9704 H HB2  . GLN B 1 39 ? -5.785  -22.574 -7.228  1.00 0.00 ? 310 GLN B HB2  7 
ATOM   9705 H HB3  . GLN B 1 39 ? -7.133  -23.565 -7.789  1.00 0.00 ? 310 GLN B HB3  7 
ATOM   9706 H HG2  . GLN B 1 39 ? -8.438  -21.644 -6.331  1.00 0.00 ? 310 GLN B HG2  7 
ATOM   9707 H HG3  . GLN B 1 39 ? -7.092  -20.724 -7.003  1.00 0.00 ? 310 GLN B HG3  7 
ATOM   9708 H HE21 . GLN B 1 39 ? -8.356  -19.583 -8.597  1.00 0.00 ? 310 GLN B HE21 7 
ATOM   9709 H HE22 . GLN B 1 39 ? -9.085  -20.372 -9.912  1.00 0.00 ? 310 GLN B HE22 7 
ATOM   9710 N N    . LYS B 1 40 ? -5.321  -25.285 -5.463  1.00 0.00 ? 311 LYS B N    7 
ATOM   9711 C CA   . LYS B 1 40 ? -4.911  -26.684 -5.514  1.00 0.00 ? 311 LYS B CA   7 
ATOM   9712 C C    . LYS B 1 40 ? -5.337  -27.384 -4.223  1.00 0.00 ? 311 LYS B C    7 
ATOM   9713 O O    . LYS B 1 40 ? -5.430  -28.593 -4.161  1.00 0.00 ? 311 LYS B O    7 
ATOM   9714 C CB   . LYS B 1 40 ? -3.389  -26.764 -5.660  1.00 0.00 ? 311 LYS B CB   7 
ATOM   9715 C CG   . LYS B 1 40 ? -2.976  -28.216 -5.920  1.00 0.00 ? 311 LYS B CG   7 
ATOM   9716 C CD   . LYS B 1 40 ? -1.784  -28.243 -6.879  1.00 0.00 ? 311 LYS B CD   7 
ATOM   9717 C CE   . LYS B 1 40 ? -0.599  -28.935 -6.199  1.00 0.00 ? 311 LYS B CE   7 
ATOM   9718 N NZ   . LYS B 1 40 ? 0.350   -27.907 -5.688  1.00 0.00 ? 311 LYS B NZ   7 
ATOM   9719 H H    . LYS B 1 40 ? -4.671  -24.591 -5.233  1.00 0.00 ? 311 LYS B H    7 
ATOM   9720 H HA   . LYS B 1 40 ? -5.378  -27.168 -6.359  1.00 0.00 ? 311 LYS B HA   7 
ATOM   9721 H HB2  . LYS B 1 40 ? -3.074  -26.146 -6.486  1.00 0.00 ? 311 LYS B HB2  7 
ATOM   9722 H HB3  . LYS B 1 40 ? -2.922  -26.417 -4.751  1.00 0.00 ? 311 LYS B HB3  7 
ATOM   9723 H HG2  . LYS B 1 40 ? -2.701  -28.684 -4.986  1.00 0.00 ? 311 LYS B HG2  7 
ATOM   9724 H HG3  . LYS B 1 40 ? -3.802  -28.751 -6.363  1.00 0.00 ? 311 LYS B HG3  7 
ATOM   9725 H HD2  . LYS B 1 40 ? -2.054  -28.786 -7.773  1.00 0.00 ? 311 LYS B HD2  7 
ATOM   9726 H HD3  . LYS B 1 40 ? -1.507  -27.233 -7.138  1.00 0.00 ? 311 LYS B HD3  7 
ATOM   9727 H HE2  . LYS B 1 40 ? -0.957  -29.535 -5.377  1.00 0.00 ? 311 LYS B HE2  7 
ATOM   9728 H HE3  . LYS B 1 40 ? -0.094  -29.567 -6.914  1.00 0.00 ? 311 LYS B HE3  7 
ATOM   9729 H HZ1  . LYS B 1 40 ? -0.180  -27.067 -5.379  1.00 0.00 ? 311 LYS B HZ1  7 
ATOM   9730 H HZ2  . LYS B 1 40 ? 0.880   -28.294 -4.882  1.00 0.00 ? 311 LYS B HZ2  7 
ATOM   9731 H HZ3  . LYS B 1 40 ? 1.014   -27.640 -6.444  1.00 0.00 ? 311 LYS B HZ3  7 
ATOM   9732 N N    . VAL B 1 41 ? -5.603  -26.630 -3.191  1.00 0.00 ? 312 VAL B N    7 
ATOM   9733 C CA   . VAL B 1 41 ? -6.018  -27.233 -1.931  1.00 0.00 ? 312 VAL B CA   7 
ATOM   9734 C C    . VAL B 1 41 ? -7.540  -27.389 -1.921  1.00 0.00 ? 312 VAL B C    7 
ATOM   9735 O O    . VAL B 1 41 ? -8.085  -28.223 -1.225  1.00 0.00 ? 312 VAL B O    7 
ATOM   9736 C CB   . VAL B 1 41 ? -5.589  -26.336 -0.769  1.00 0.00 ? 312 VAL B CB   7 
ATOM   9737 C CG1  . VAL B 1 41 ? -6.095  -26.927 0.549   1.00 0.00 ? 312 VAL B CG1  7 
ATOM   9738 C CG2  . VAL B 1 41 ? -4.061  -26.247 -0.734  1.00 0.00 ? 312 VAL B CG2  7 
ATOM   9739 H H    . VAL B 1 41 ? -5.523  -25.656 -3.264  1.00 0.00 ? 312 VAL B H    7 
ATOM   9740 H HA   . VAL B 1 41 ? -5.556  -28.202 -1.826  1.00 0.00 ? 312 VAL B HA   7 
ATOM   9741 H HB   . VAL B 1 41 ? -6.007  -25.348 -0.904  1.00 0.00 ? 312 VAL B HB   7 
ATOM   9742 H HG11 . VAL B 1 41 ? -6.223  -27.994 0.438   1.00 0.00 ? 312 VAL B HG11 7 
ATOM   9743 H HG12 . VAL B 1 41 ? -5.378  -26.728 1.330   1.00 0.00 ? 312 VAL B HG12 7 
ATOM   9744 H HG13 . VAL B 1 41 ? -7.042  -26.475 0.806   1.00 0.00 ? 312 VAL B HG13 7 
ATOM   9745 H HG21 . VAL B 1 41 ? -3.654  -26.689 -1.631  1.00 0.00 ? 312 VAL B HG21 7 
ATOM   9746 H HG22 . VAL B 1 41 ? -3.764  -25.210 -0.676  1.00 0.00 ? 312 VAL B HG22 7 
ATOM   9747 H HG23 . VAL B 1 41 ? -3.690  -26.777 0.132   1.00 0.00 ? 312 VAL B HG23 7 
ATOM   9748 N N    . MET B 1 42 ? -8.231  -26.592 -2.690  1.00 0.00 ? 313 MET B N    7 
ATOM   9749 C CA   . MET B 1 42 ? -9.685  -26.691 -2.726  1.00 0.00 ? 313 MET B CA   7 
ATOM   9750 C C    . MET B 1 42 ? -10.096 -27.793 -3.705  1.00 0.00 ? 313 MET B C    7 
ATOM   9751 O O    . MET B 1 42 ? -11.138 -28.403 -3.567  1.00 0.00 ? 313 MET B O    7 
ATOM   9752 C CB   . MET B 1 42 ? -10.277 -25.355 -3.183  1.00 0.00 ? 313 MET B CB   7 
ATOM   9753 C CG   . MET B 1 42 ? -11.265 -24.847 -2.131  1.00 0.00 ? 313 MET B CG   7 
ATOM   9754 S SD   . MET B 1 42 ? -12.923 -24.764 -2.852  1.00 0.00 ? 313 MET B SD   7 
ATOM   9755 C CE   . MET B 1 42 ? -13.046 -22.960 -2.927  1.00 0.00 ? 313 MET B CE   7 
ATOM   9756 H H    . MET B 1 42 ? -7.771  -25.927 -3.242  1.00 0.00 ? 313 MET B H    7 
ATOM   9757 H HA   . MET B 1 42 ? -10.056 -26.929 -1.740  1.00 0.00 ? 313 MET B HA   7 
ATOM   9758 H HB2  . MET B 1 42 ? -9.482  -24.635 -3.310  1.00 0.00 ? 313 MET B HB2  7 
ATOM   9759 H HB3  . MET B 1 42 ? -10.792 -25.492 -4.122  1.00 0.00 ? 313 MET B HB3  7 
ATOM   9760 H HG2  . MET B 1 42 ? -11.273 -25.523 -1.289  1.00 0.00 ? 313 MET B HG2  7 
ATOM   9761 H HG3  . MET B 1 42 ? -10.966 -23.863 -1.802  1.00 0.00 ? 313 MET B HG3  7 
ATOM   9762 H HE1  . MET B 1 42 ? -12.506 -22.528 -2.096  1.00 0.00 ? 313 MET B HE1  7 
ATOM   9763 H HE2  . MET B 1 42 ? -12.626 -22.610 -3.858  1.00 0.00 ? 313 MET B HE2  7 
ATOM   9764 H HE3  . MET B 1 42 ? -14.083 -22.666 -2.870  1.00 0.00 ? 313 MET B HE3  7 
ATOM   9765 N N    . ASN B 1 43 ? -9.286  -28.051 -4.695  1.00 0.00 ? 314 ASN B N    7 
ATOM   9766 C CA   . ASN B 1 43 ? -9.624  -29.089 -5.663  1.00 0.00 ? 314 ASN B CA   7 
ATOM   9767 C C    . ASN B 1 43 ? -9.193  -30.452 -5.118  1.00 0.00 ? 314 ASN B C    7 
ATOM   9768 O O    . ASN B 1 43 ? -9.913  -31.427 -5.218  1.00 0.00 ? 314 ASN B O    7 
ATOM   9769 C CB   . ASN B 1 43 ? -8.899  -28.812 -6.982  1.00 0.00 ? 314 ASN B CB   7 
ATOM   9770 C CG   . ASN B 1 43 ? -9.544  -27.608 -7.673  1.00 0.00 ? 314 ASN B CG   7 
ATOM   9771 O OD1  . ASN B 1 43 ? -10.694 -27.301 -7.436  1.00 0.00 ? 314 ASN B OD1  7 
ATOM   9772 N ND2  . ASN B 1 43 ? -8.843  -26.910 -8.524  1.00 0.00 ? 314 ASN B ND2  7 
ATOM   9773 H H    . ASN B 1 43 ? -8.451  -27.547 -4.789  1.00 0.00 ? 314 ASN B H    7 
ATOM   9774 H HA   . ASN B 1 43 ? -10.689 -29.090 -5.833  1.00 0.00 ? 314 ASN B HA   7 
ATOM   9775 H HB2  . ASN B 1 43 ? -7.859  -28.602 -6.784  1.00 0.00 ? 314 ASN B HB2  7 
ATOM   9776 H HB3  . ASN B 1 43 ? -8.977  -29.678 -7.624  1.00 0.00 ? 314 ASN B HB3  7 
ATOM   9777 H HD21 . ASN B 1 43 ? -7.914  -27.159 -8.716  1.00 0.00 ? 314 ASN B HD21 7 
ATOM   9778 H HD22 . ASN B 1 43 ? -9.246  -26.136 -8.972  1.00 0.00 ? 314 ASN B HD22 7 
ATOM   9779 N N    . TYR B 1 44 ? -8.023  -30.526 -4.542  1.00 0.00 ? 315 TYR B N    7 
ATOM   9780 C CA   . TYR B 1 44 ? -7.553  -31.797 -4.005  1.00 0.00 ? 315 TYR B CA   7 
ATOM   9781 C C    . TYR B 1 44 ? -7.108  -31.603 -2.553  1.00 0.00 ? 315 TYR B C    7 
ATOM   9782 O O    . TYR B 1 44 ? -7.028  -30.463 -2.126  1.00 0.00 ? 315 TYR B O    7 
ATOM   9783 C CB   . TYR B 1 44 ? -6.374  -32.296 -4.842  1.00 0.00 ? 315 TYR B CB   7 
ATOM   9784 C CG   . TYR B 1 44 ? -6.857  -33.346 -5.813  1.00 0.00 ? 315 TYR B CG   7 
ATOM   9785 C CD1  . TYR B 1 44 ? -6.933  -34.690 -5.412  1.00 0.00 ? 315 TYR B CD1  7 
ATOM   9786 C CD2  . TYR B 1 44 ? -7.231  -32.980 -7.116  1.00 0.00 ? 315 TYR B CD2  7 
ATOM   9787 C CE1  . TYR B 1 44 ? -7.381  -35.667 -6.315  1.00 0.00 ? 315 TYR B CE1  7 
ATOM   9788 C CE2  . TYR B 1 44 ? -7.680  -33.957 -8.019  1.00 0.00 ? 315 TYR B CE2  7 
ATOM   9789 C CZ   . TYR B 1 44 ? -7.755  -35.302 -7.618  1.00 0.00 ? 315 TYR B CZ   7 
ATOM   9790 O OH   . TYR B 1 44 ? -8.196  -36.263 -8.505  1.00 0.00 ? 315 TYR B OH   7 
ATOM   9791 O OXT  . TYR B 1 44 ? -6.857  -32.597 -1.895  1.00 0.00 ? 315 TYR B OXT  7 
ATOM   9792 H H    . TYR B 1 44 ? -7.460  -29.727 -4.475  1.00 0.00 ? 315 TYR B H    7 
ATOM   9793 H HA   . TYR B 1 44 ? -8.353  -32.522 -4.042  1.00 0.00 ? 315 TYR B HA   7 
ATOM   9794 H HB2  . TYR B 1 44 ? -5.944  -31.469 -5.387  1.00 0.00 ? 315 TYR B HB2  7 
ATOM   9795 H HB3  . TYR B 1 44 ? -5.626  -32.726 -4.190  1.00 0.00 ? 315 TYR B HB3  7 
ATOM   9796 H HD1  . TYR B 1 44 ? -6.646  -34.972 -4.411  1.00 0.00 ? 315 TYR B HD1  7 
ATOM   9797 H HD2  . TYR B 1 44 ? -7.172  -31.946 -7.424  1.00 0.00 ? 315 TYR B HD2  7 
ATOM   9798 H HE1  . TYR B 1 44 ? -7.439  -36.700 -6.007  1.00 0.00 ? 315 TYR B HE1  7 
ATOM   9799 H HE2  . TYR B 1 44 ? -7.967  -33.675 -9.022  1.00 0.00 ? 315 TYR B HE2  7 
ATOM   9800 H HH   . TYR B 1 44 ? -7.829  -37.109 -8.234  1.00 0.00 ? 315 TYR B HH   7 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  ACE 1  272 272 ACE ACE A . n 
A 1 2  CYS 2  273 273 CYS CYS A . n 
A 1 3  GLY 3  274 274 GLY GLY A . n 
A 1 4  GLY 4  275 275 GLY GLY A . n 
A 1 5  ARG 5  276 276 ARG ARG A . n 
A 1 6  ILE 6  277 277 ILE ILE A . n 
A 1 7  ALA 7  278 278 ALA ALA A . n 
A 1 8  ARG 8  279 279 ARG ARG A . n 
A 1 9  LEU 9  280 280 LEU LEU A . n 
A 1 10 GLU 10 281 281 GLU GLU A . n 
A 1 11 GLU 11 282 282 GLU GLU A . n 
A 1 12 LYS 12 283 283 LYS LYS A . n 
A 1 13 VAL 13 284 284 VAL VAL A . n 
A 1 14 LYS 14 285 285 LYS LYS A . n 
A 1 15 THR 15 286 286 THR THR A . n 
A 1 16 LEU 16 287 287 LEU LEU A . n 
A 1 17 LYS 17 288 288 LYS LYS A . n 
A 1 18 ALA 18 289 289 ALA ALA A . n 
A 1 19 GLN 19 290 290 GLN GLN A . n 
A 1 20 ASN 20 291 291 ASN ASN A . n 
A 1 21 SER 21 292 292 SER SER A . n 
A 1 22 GLU 22 293 293 GLU GLU A . n 
A 1 23 LEU 23 294 294 LEU LEU A . n 
A 1 24 ALA 24 295 295 ALA ALA A . n 
A 1 25 SER 25 296 296 SER SER A . n 
A 1 26 THR 26 297 297 THR THR A . n 
A 1 27 ALA 27 298 298 ALA ALA A . n 
A 1 28 ASN 28 299 299 ASN ASN A . n 
A 1 29 MET 29 300 300 MET MET A . n 
A 1 30 LEU 30 301 301 LEU LEU A . n 
A 1 31 ARG 31 302 302 ARG ARG A . n 
A 1 32 GLU 32 303 303 GLU GLU A . n 
A 1 33 GLN 33 304 304 GLN GLN A . n 
A 1 34 VAL 34 305 305 VAL VAL A . n 
A 1 35 ALA 35 306 306 ALA ALA A . n 
A 1 36 GLN 36 307 307 GLN GLN A . n 
A 1 37 LEU 37 308 308 LEU LEU A . n 
A 1 38 LYS 38 309 309 LYS LYS A . n 
A 1 39 GLN 39 310 310 GLN GLN A . n 
A 1 40 LYS 40 311 311 LYS LYS A . n 
A 1 41 VAL 41 312 312 VAL VAL A . n 
A 1 42 MET 42 313 313 MET MET A . n 
A 1 43 ASN 43 314 314 ASN ASN A . n 
A 1 44 TYR 44 315 315 TYR TYR A . n 
B 1 1  ACE 1  272 272 ACE ACE B . n 
B 1 2  CYS 2  273 273 CYS CYS B . n 
B 1 3  GLY 3  274 274 GLY GLY B . n 
B 1 4  GLY 4  275 275 GLY GLY B . n 
B 1 5  ARG 5  276 276 ARG ARG B . n 
B 1 6  ILE 6  277 277 ILE ILE B . n 
B 1 7  ALA 7  278 278 ALA ALA B . n 
B 1 8  ARG 8  279 279 ARG ARG B . n 
B 1 9  LEU 9  280 280 LEU LEU B . n 
B 1 10 GLU 10 281 281 GLU GLU B . n 
B 1 11 GLU 11 282 282 GLU GLU B . n 
B 1 12 LYS 12 283 283 LYS LYS B . n 
B 1 13 VAL 13 284 284 VAL VAL B . n 
B 1 14 LYS 14 285 285 LYS LYS B . n 
B 1 15 THR 15 286 286 THR THR B . n 
B 1 16 LEU 16 287 287 LEU LEU B . n 
B 1 17 LYS 17 288 288 LYS LYS B . n 
B 1 18 ALA 18 289 289 ALA ALA B . n 
B 1 19 GLN 19 290 290 GLN GLN B . n 
B 1 20 ASN 20 291 291 ASN ASN B . n 
B 1 21 SER 21 292 292 SER SER B . n 
B 1 22 GLU 22 293 293 GLU GLU B . n 
B 1 23 LEU 23 294 294 LEU LEU B . n 
B 1 24 ALA 24 295 295 ALA ALA B . n 
B 1 25 SER 25 296 296 SER SER B . n 
B 1 26 THR 26 297 297 THR THR B . n 
B 1 27 ALA 27 298 298 ALA ALA B . n 
B 1 28 ASN 28 299 299 ASN ASN B . n 
B 1 29 MET 29 300 300 MET MET B . n 
B 1 30 LEU 30 301 301 LEU LEU B . n 
B 1 31 ARG 31 302 302 ARG ARG B . n 
B 1 32 GLU 32 303 303 GLU GLU B . n 
B 1 33 GLN 33 304 304 GLN GLN B . n 
B 1 34 VAL 34 305 305 VAL VAL B . n 
B 1 35 ALA 35 306 306 ALA ALA B . n 
B 1 36 GLN 36 307 307 GLN GLN B . n 
B 1 37 LEU 37 308 308 LEU LEU B . n 
B 1 38 LYS 38 309 309 LYS LYS B . n 
B 1 39 GLN 39 310 310 GLN GLN B . n 
B 1 40 LYS 40 311 311 LYS LYS B . n 
B 1 41 VAL 41 312 312 VAL VAL B . n 
B 1 42 MET 42 313 313 MET MET B . n 
B 1 43 ASN 43 314 314 ASN ASN B . n 
B 1 44 TYR 44 315 315 TYR TYR B . n 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1996-06-20 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR 'model building' 3.1 ? 1 
X-PLOR refinement       3.1 ? 2 
X-PLOR phasing          3.1 ? 3 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 MET A 313 ? ? -67.75  92.69  
2  1 ASN A 314 ? ? -176.46 51.21  
3  1 MET B 313 ? ? -67.42  92.28  
4  1 ASN B 314 ? ? -176.10 51.46  
5  2 GLU A 293 ? ? -70.32  -75.92 
6  2 ASN A 314 ? ? 56.36   165.18 
7  2 GLU B 293 ? ? -70.16  -75.43 
8  2 ASN B 314 ? ? 56.43   165.25 
9  3 GLU A 293 ? ? -72.43  -70.61 
10 3 GLU B 293 ? ? -72.23  -70.59 
11 4 ASN A 314 ? ? -138.72 -84.02 
12 4 ASN B 314 ? ? -138.75 -83.11 
13 5 ASN A 314 ? ? -162.00 82.11  
14 5 ASN B 314 ? ? -161.76 81.77  
15 6 MET A 313 ? ? -68.31  71.50  
16 6 MET B 313 ? ? -68.03  71.59  
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1  1 ARG A 276 ? ? 0.208 'SIDE CHAIN' 
2  1 ARG A 279 ? ? 0.309 'SIDE CHAIN' 
3  1 ARG A 302 ? ? 0.309 'SIDE CHAIN' 
4  1 ARG B 276 ? ? 0.209 'SIDE CHAIN' 
5  1 ARG B 279 ? ? 0.310 'SIDE CHAIN' 
6  1 ARG B 302 ? ? 0.308 'SIDE CHAIN' 
7  2 ARG A 276 ? ? 0.309 'SIDE CHAIN' 
8  2 ARG A 279 ? ? 0.214 'SIDE CHAIN' 
9  2 ARG A 302 ? ? 0.247 'SIDE CHAIN' 
10 2 ARG B 276 ? ? 0.309 'SIDE CHAIN' 
11 2 ARG B 279 ? ? 0.215 'SIDE CHAIN' 
12 2 ARG B 302 ? ? 0.246 'SIDE CHAIN' 
13 3 ARG A 276 ? ? 0.271 'SIDE CHAIN' 
14 3 ARG A 279 ? ? 0.303 'SIDE CHAIN' 
15 3 ARG A 302 ? ? 0.200 'SIDE CHAIN' 
16 3 ARG B 276 ? ? 0.271 'SIDE CHAIN' 
17 3 ARG B 279 ? ? 0.303 'SIDE CHAIN' 
18 3 ARG B 302 ? ? 0.201 'SIDE CHAIN' 
19 4 ARG A 276 ? ? 0.273 'SIDE CHAIN' 
20 4 ARG A 279 ? ? 0.124 'SIDE CHAIN' 
21 4 ARG A 302 ? ? 0.308 'SIDE CHAIN' 
22 4 ARG B 276 ? ? 0.274 'SIDE CHAIN' 
23 4 ARG B 279 ? ? 0.126 'SIDE CHAIN' 
24 4 ARG B 302 ? ? 0.308 'SIDE CHAIN' 
25 5 ARG A 276 ? ? 0.205 'SIDE CHAIN' 
26 5 ARG A 279 ? ? 0.124 'SIDE CHAIN' 
27 5 ARG A 302 ? ? 0.252 'SIDE CHAIN' 
28 5 ARG B 276 ? ? 0.206 'SIDE CHAIN' 
29 5 ARG B 279 ? ? 0.127 'SIDE CHAIN' 
30 5 ARG B 302 ? ? 0.252 'SIDE CHAIN' 
31 6 ARG A 276 ? ? 0.299 'SIDE CHAIN' 
32 6 ARG A 279 ? ? 0.287 'SIDE CHAIN' 
33 6 ARG A 302 ? ? 0.265 'SIDE CHAIN' 
34 6 ARG B 276 ? ? 0.300 'SIDE CHAIN' 
35 6 ARG B 279 ? ? 0.287 'SIDE CHAIN' 
36 6 ARG B 302 ? ? 0.265 'SIDE CHAIN' 
37 7 ARG A 276 ? ? 0.266 'SIDE CHAIN' 
38 7 ARG A 279 ? ? 0.312 'SIDE CHAIN' 
39 7 ARG A 302 ? ? 0.152 'SIDE CHAIN' 
40 7 ARG B 276 ? ? 0.263 'SIDE CHAIN' 
41 7 ARG B 279 ? ? 0.312 'SIDE CHAIN' 
42 7 ARG B 302 ? ? 0.150 'SIDE CHAIN' 
#