data_1JV5
# 
_entry.id   1JV5 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.292 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1JV5         
RCSB  RCSB014218   
WWPDB D_1000014218 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1JV5 
_pdbx_database_status.recvd_initial_deposition_date   2001-08-28 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Thomas, R.'      1 
'Patenaude, S.I.' 2 
'MacKenzie, C.R.' 3 
'To, R.'          4 
'Hirama, T.'      5 
'Young, N.M.'     6 
'Evans, S.V.'     7 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Structure of an anti-blood group A Fv and improvement of its binding affinity without loss of specificity.' J.Biol.Chem. 
277 2059 2064 2002 JBCHA3 US 0021-9258 0071 ? 11679577 10.1074/jbc.M104364200    
1       
;Production, crystallization and diffraction to atomic resolution of an antibody Fv specific for the blood-group A oligosaccharide antigen
;
'Acta Crystallogr.,Sect.D' 54  1456 1459 1998 ABCRE6 DK 0907-4449 0766 ? ?        10.1107/S0907444998005824 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Thomas, R.'      1  
primary 'Patenaude, S.I.' 2  
primary 'MacKenzie, C.R.' 3  
primary 'To, R.'          4  
primary 'Hirama, T.'      5  
primary 'Young, N.M.'     6  
primary 'Evans, S.V.'     7  
1       'Patenaude, S.I.' 8  
1       'MacKenzie, C.R.' 9  
1       'Bilous, D.'      10 
1       'To, R.J.'        11 
1       'Ryan, S.E.'      12 
1       'Young, N.M.'     13 
1       'Evans, S.V.'     14 
# 
_cell.entry_id           1JV5 
_cell.length_a           51.71 
_cell.length_b           57.96 
_cell.length_c           83.58 
_cell.angle_alpha        90 
_cell.angle_beta         90 
_cell.angle_gamma        90 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1JV5 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Ig kappa chain precursor V region'       11809.013 1  ? ? 'anti-blood group A Fv' ? 
2 polymer man 'Ig chain heavy chain precursor V region' 12877.354 1  ? ? ?                       ? 
3 water   nat water                                     18.015    62 ? ? ?                       ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;DIQMTQTTSSLSASLGDRVTISCRASQDINNYLNWYQQKPDGTVKLLIHYTSRLHSGVPSRFSGSGSGTDYSLTISNLEQ
EDIATYFCQQGNTLPWTFGGGTKLEIK
;
;DIQMTQTTSSLSASLGDRVTISCRASQDINNYLNWYQQKPDGTVKLLIHYTSRLHSGVPSRFSGSGSGTDYSLTISNLEQ
EDIATYFCQQGNTLPWTFGGGTKLEIK
;
A ? 
2 'polypeptide(L)' no no 
;QVQLQQPGAELVKPGTSVKLSCKASGYNFTSYWINWVKLRPGQGLEWIGDIYPGSGITNYNEKFKSKATLTVDTSSSTAY
MQLSSLASEDSALYYCAGQYGNLWFAYWGQGTLVTVS
;
;QVQLQQPGAELVKPGTSVKLSCKASGYNFTSYWINWVKLRPGQGLEWIGDIYPGSGITNYNEKFKSKATLTVDTSSSTAY
MQLSSLASEDSALYYCAGQYGNLWFAYWGQGTLVTVS
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   ILE n 
1 3   GLN n 
1 4   MET n 
1 5   THR n 
1 6   GLN n 
1 7   THR n 
1 8   THR n 
1 9   SER n 
1 10  SER n 
1 11  LEU n 
1 12  SER n 
1 13  ALA n 
1 14  SER n 
1 15  LEU n 
1 16  GLY n 
1 17  ASP n 
1 18  ARG n 
1 19  VAL n 
1 20  THR n 
1 21  ILE n 
1 22  SER n 
1 23  CYS n 
1 24  ARG n 
1 25  ALA n 
1 26  SER n 
1 27  GLN n 
1 28  ASP n 
1 29  ILE n 
1 30  ASN n 
1 31  ASN n 
1 32  TYR n 
1 33  LEU n 
1 34  ASN n 
1 35  TRP n 
1 36  TYR n 
1 37  GLN n 
1 38  GLN n 
1 39  LYS n 
1 40  PRO n 
1 41  ASP n 
1 42  GLY n 
1 43  THR n 
1 44  VAL n 
1 45  LYS n 
1 46  LEU n 
1 47  LEU n 
1 48  ILE n 
1 49  HIS n 
1 50  TYR n 
1 51  THR n 
1 52  SER n 
1 53  ARG n 
1 54  LEU n 
1 55  HIS n 
1 56  SER n 
1 57  GLY n 
1 58  VAL n 
1 59  PRO n 
1 60  SER n 
1 61  ARG n 
1 62  PHE n 
1 63  SER n 
1 64  GLY n 
1 65  SER n 
1 66  GLY n 
1 67  SER n 
1 68  GLY n 
1 69  THR n 
1 70  ASP n 
1 71  TYR n 
1 72  SER n 
1 73  LEU n 
1 74  THR n 
1 75  ILE n 
1 76  SER n 
1 77  ASN n 
1 78  LEU n 
1 79  GLU n 
1 80  GLN n 
1 81  GLU n 
1 82  ASP n 
1 83  ILE n 
1 84  ALA n 
1 85  THR n 
1 86  TYR n 
1 87  PHE n 
1 88  CYS n 
1 89  GLN n 
1 90  GLN n 
1 91  GLY n 
1 92  ASN n 
1 93  THR n 
1 94  LEU n 
1 95  PRO n 
1 96  TRP n 
1 97  THR n 
1 98  PHE n 
1 99  GLY n 
1 100 GLY n 
1 101 GLY n 
1 102 THR n 
1 103 LYS n 
1 104 LEU n 
1 105 GLU n 
1 106 ILE n 
1 107 LYS n 
2 1   GLN n 
2 2   VAL n 
2 3   GLN n 
2 4   LEU n 
2 5   GLN n 
2 6   GLN n 
2 7   PRO n 
2 8   GLY n 
2 9   ALA n 
2 10  GLU n 
2 11  LEU n 
2 12  VAL n 
2 13  LYS n 
2 14  PRO n 
2 15  GLY n 
2 16  THR n 
2 17  SER n 
2 18  VAL n 
2 19  LYS n 
2 20  LEU n 
2 21  SER n 
2 22  CYS n 
2 23  LYS n 
2 24  ALA n 
2 25  SER n 
2 26  GLY n 
2 27  TYR n 
2 28  ASN n 
2 29  PHE n 
2 30  THR n 
2 31  SER n 
2 32  TYR n 
2 33  TRP n 
2 34  ILE n 
2 35  ASN n 
2 36  TRP n 
2 37  VAL n 
2 38  LYS n 
2 39  LEU n 
2 40  ARG n 
2 41  PRO n 
2 42  GLY n 
2 43  GLN n 
2 44  GLY n 
2 45  LEU n 
2 46  GLU n 
2 47  TRP n 
2 48  ILE n 
2 49  GLY n 
2 50  ASP n 
2 51  ILE n 
2 52  TYR n 
2 53  PRO n 
2 54  GLY n 
2 55  SER n 
2 56  GLY n 
2 57  ILE n 
2 58  THR n 
2 59  ASN n 
2 60  TYR n 
2 61  ASN n 
2 62  GLU n 
2 63  LYS n 
2 64  PHE n 
2 65  LYS n 
2 66  SER n 
2 67  LYS n 
2 68  ALA n 
2 69  THR n 
2 70  LEU n 
2 71  THR n 
2 72  VAL n 
2 73  ASP n 
2 74  THR n 
2 75  SER n 
2 76  SER n 
2 77  SER n 
2 78  THR n 
2 79  ALA n 
2 80  TYR n 
2 81  MET n 
2 82  GLN n 
2 83  LEU n 
2 84  SER n 
2 85  SER n 
2 86  LEU n 
2 87  ALA n 
2 88  SER n 
2 89  GLU n 
2 90  ASP n 
2 91  SER n 
2 92  ALA n 
2 93  LEU n 
2 94  TYR n 
2 95  TYR n 
2 96  CYS n 
2 97  ALA n 
2 98  GLY n 
2 99  GLN n 
2 100 TYR n 
2 101 GLY n 
2 102 ASN n 
2 103 LEU n 
2 104 TRP n 
2 105 PHE n 
2 106 ALA n 
2 107 TYR n 
2 108 TRP n 
2 109 GLY n 
2 110 GLN n 
2 111 GLY n 
2 112 THR n 
2 113 LEU n 
2 114 VAL n 
2 115 THR n 
2 116 VAL n 
2 117 SER n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? TG1 ? ? 
? ? ? ? ? ? ? ? ? pUCE8 ? ? 
2 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? TG1 ? ? 
? ? ? ? ? ? ? ? ? pUCE8 ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP KV1B_HUMAN 1 
;DIQMTQTTSSLSASLGDRVTISCRASQDINNYLNWYQQKPDGTVKLLIHYTSRLHSGVPSRFSGSGSGTDYSLTISNLEQ
EDIATYFCQQGNTLPWTFGGGTKLEIK
;
15 P01594 ? 
2 GB  E29380     2 
;QVQLQQPGAELVKPGTSVKLSCKASGYNFTSYWINWVKLRPGQGLEWIGDIYPGSGITNYNEKFKSKATLTVDTSSSTAY
MQLSSLASEDSALYYCAGQYGNLWFAYWGQGTLVTVS
;
20 90683  ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1JV5 A 1 ? 107 ? P01594 15 ? 121 ? 1   107 
2 2 1JV5 B 1 ? 117 ? 90683  20 ? 136 ? 301 417 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1JV5 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.54 
_exptl_crystal.density_percent_sol   51.50 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            300 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_details    'PEG 4000, HEPES, Calcium Chloride, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 300K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           300 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               DIFFRACTOMETER 
_diffrn_detector.type                   'ENRAF-NONIUS FAST' 
_diffrn_detector.pdbx_collection_date   1994-10-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    graphite 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.54 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        ENRAF-NONIUS 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.54 
# 
_reflns.entry_id                     1JV5 
_reflns.observed_criterion_sigma_I   1.5 
_reflns.observed_criterion_sigma_F   3.0 
_reflns.d_resolution_low             20.0 
_reflns.d_resolution_high            2.2 
_reflns.number_obs                   12350 
_reflns.number_all                   12350 
_reflns.percent_possible_obs         93.0 
_reflns.pdbx_Rmerge_I_obs            0.1 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.2 
_reflns_shell.d_res_low              2.31 
_reflns_shell.percent_possible_all   71.8 
_reflns_shell.Rmerge_I_obs           0.073 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    9.3 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      674 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1JV5 
_refine.ls_number_reflns_obs                     9440 
_refine.ls_number_reflns_all                     11626 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          3.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             6.0 
_refine.ls_d_res_high                            2.2 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.183 
_refine.ls_R_factor_all                          0.243 
_refine.ls_R_factor_R_work                       0.183 
_refine.ls_R_factor_R_free                       0.223 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  1266 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2145 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             186 
_refine_hist.number_atoms_total               2331 
_refine_hist.d_res_high                       2.2 
_refine_hist.d_res_low                        6.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d    0.006 ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg 1.412 ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.d_res_high                       2.20 
_refine_ls_shell.d_res_low                        3.21 
_refine_ls_shell.number_reflns_R_work             ? 
_refine_ls_shell.R_factor_R_work                  0.203 
_refine_ls_shell.percent_reflns_obs               71.8 
_refine_ls_shell.R_factor_R_free                  0.256 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             59 
_refine_ls_shell.number_reflns_obs                674 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1JV5 
_struct.title                     'Anti-blood group A Fv' 
_struct.pdbx_descriptor           'Anti-blood group A Fv, PROTEIN (117-MER)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1JV5 
_struct_keywords.pdbx_keywords   'Immune System, Sugar Binding Protein' 
_struct_keywords.text            'immunoglobulin, Immune System, Sugar Binding Protein' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 2 ASN B 28 ? TYR B 32 ? ASN B 328 TYR B 332 5 ? 5 
HELX_P HELX_P2 3 ALA B 87 ? SER B 91 ? ALA B 387 SER B 391 5 ? 5 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 23 SG ? ? ? 1_555 A CYS 88 SG ? ? A CYS 23  A CYS 88  1_555 ? ? ? ? ? ? ? 2.028 ? 
disulf2 disulf ? ? B CYS 22 SG ? ? ? 1_555 B CYS 96 SG ? ? B CYS 322 B CYS 396 1_555 ? ? ? ? ? ? ? 2.028 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          LEU 
_struct_mon_prot_cis.label_seq_id           94 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           LEU 
_struct_mon_prot_cis.auth_seq_id            94 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    95 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     95 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       0.02 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 5 ? 
C ? 6 ? 
D ? 4 ? 
E ? 5 ? 
F ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
C 5 6 ? parallel      
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
E 4 5 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 MET A 4   ? THR A 5   ? MET A 4   THR A 5   
A 2 VAL A 19  ? ALA A 25  ? VAL A 19  ALA A 25  
A 3 ASP A 70  ? ILE A 75  ? ASP A 70  ILE A 75  
A 4 PHE A 62  ? SER A 67  ? PHE A 62  SER A 67  
B 1 ARG A 53  ? LEU A 54  ? ARG A 53  LEU A 54  
B 2 VAL A 44  ? HIS A 49  ? VAL A 44  HIS A 49  
B 3 LEU A 33  ? GLN A 38  ? LEU A 33  GLN A 38  
B 4 THR A 85  ? GLN A 90  ? THR A 85  GLN A 90  
B 5 THR A 97  ? PHE A 98  ? THR A 97  PHE A 98  
C 1 ARG A 53  ? LEU A 54  ? ARG A 53  LEU A 54  
C 2 VAL A 44  ? HIS A 49  ? VAL A 44  HIS A 49  
C 3 LEU A 33  ? GLN A 38  ? LEU A 33  GLN A 38  
C 4 THR A 85  ? GLN A 90  ? THR A 85  GLN A 90  
C 5 THR A 102 ? ILE A 106 ? THR A 102 ILE A 106 
C 6 SER A 10  ? ALA A 13  ? SER A 10  ALA A 13  
D 1 LEU B 4   ? GLN B 5   ? LEU B 304 GLN B 305 
D 2 VAL B 18  ? ALA B 24  ? VAL B 318 ALA B 324 
D 3 THR B 78  ? LEU B 83  ? THR B 378 LEU B 383 
D 4 ALA B 68  ? ASP B 73  ? ALA B 368 ASP B 373 
E 1 LEU B 103 ? TRP B 108 ? LEU B 403 TRP B 408 
E 2 ALA B 92  ? TYR B 100 ? ALA B 392 TYR B 400 
E 3 ILE B 34  ? LEU B 39  ? ILE B 334 LEU B 339 
E 4 LEU B 45  ? ILE B 51  ? LEU B 345 ILE B 351 
E 5 THR B 58  ? TYR B 60  ? THR B 358 TYR B 360 
F 1 LEU B 103 ? TRP B 108 ? LEU B 403 TRP B 408 
F 2 ALA B 92  ? TYR B 100 ? ALA B 392 TYR B 400 
F 3 THR B 112 ? VAL B 116 ? THR B 412 VAL B 416 
F 4 ALA B 9   ? VAL B 12  ? ALA B 309 VAL B 312 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N THR A 5   ? N THR A 5   O ARG A 24  ? O ARG A 24  
A 2 3 N CYS A 23  ? N CYS A 23  O TYR A 71  ? O TYR A 71  
A 3 4 O THR A 74  ? O THR A 74  N SER A 63  ? N SER A 63  
B 1 2 O ARG A 53  ? O ARG A 53  N HIS A 49  ? N HIS A 49  
B 2 3 O LEU A 47  ? O LEU A 47  N TRP A 35  ? N TRP A 35  
B 3 4 N TYR A 36  ? N TYR A 36  O PHE A 87  ? O PHE A 87  
B 4 5 N GLN A 90  ? N GLN A 90  O THR A 97  ? O THR A 97  
C 1 2 O ARG A 53  ? O ARG A 53  N HIS A 49  ? N HIS A 49  
C 2 3 O LEU A 47  ? O LEU A 47  N TRP A 35  ? N TRP A 35  
C 3 4 N TYR A 36  ? N TYR A 36  O PHE A 87  ? O PHE A 87  
C 4 5 N TYR A 86  ? N TYR A 86  O THR A 102 ? O THR A 102 
C 5 6 O LYS A 103 ? O LYS A 103 N LEU A 11  ? N LEU A 11  
D 1 2 N GLN B 5   ? N GLN B 305 O LYS B 23  ? O LYS B 323 
D 2 3 N CYS B 22  ? N CYS B 322 O ALA B 79  ? O ALA B 379 
D 3 4 O TYR B 80  ? O TYR B 380 N THR B 71  ? N THR B 371 
E 1 2 O TYR B 107 ? O TYR B 407 N GLY B 98  ? N GLY B 398 
E 2 3 O ALA B 97  ? O ALA B 397 N ASN B 35  ? N ASN B 335 
E 3 4 N TRP B 36  ? N TRP B 336 O ILE B 48  ? O ILE B 348 
E 4 5 N ASP B 50  ? N ASP B 350 O ASN B 59  ? O ASN B 359 
F 1 2 O TYR B 107 ? O TYR B 407 N GLY B 98  ? N GLY B 398 
F 2 3 N ALA B 92  ? N ALA B 392 O VAL B 114 ? O VAL B 414 
F 3 4 O THR B 115 ? O THR B 415 N VAL B 12  ? N VAL B 312 
# 
_database_PDB_matrix.entry_id          1JV5 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1JV5 
_atom_sites.fract_transf_matrix[1][1]   0.019339 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017253 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011965 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASP A 1 1   ? 3.202   -51.870 42.922 1.00 43.48 ? 1   ASP A N   1 
ATOM   2    C CA  . ASP A 1 1   ? 2.380   -51.132 43.925 1.00 39.94 ? 1   ASP A CA  1 
ATOM   3    C C   . ASP A 1 1   ? 0.902   -51.184 43.571 1.00 36.38 ? 1   ASP A C   1 
ATOM   4    O O   . ASP A 1 1   ? 0.540   -51.234 42.398 1.00 32.54 ? 1   ASP A O   1 
ATOM   5    C CB  . ASP A 1 1   ? 2.800   -49.660 43.988 1.00 45.68 ? 1   ASP A CB  1 
ATOM   6    C CG  . ASP A 1 1   ? 4.247   -49.477 44.383 1.00 50.89 ? 1   ASP A CG  1 
ATOM   7    O OD1 . ASP A 1 1   ? 4.604   -48.354 44.806 1.00 54.56 ? 1   ASP A OD1 1 
ATOM   8    O OD2 . ASP A 1 1   ? 5.024   -50.449 44.268 1.00 50.97 ? 1   ASP A OD2 1 
ATOM   9    N N   . ILE A 1 2   ? 0.057   -51.163 44.598 1.00 31.26 ? 2   ILE A N   1 
ATOM   10   C CA  . ILE A 1 2   ? -1.381  -51.164 44.409 1.00 25.37 ? 2   ILE A CA  1 
ATOM   11   C C   . ILE A 1 2   ? -1.834  -49.707 44.453 1.00 28.84 ? 2   ILE A C   1 
ATOM   12   O O   . ILE A 1 2   ? -1.752  -49.058 45.489 1.00 30.31 ? 2   ILE A O   1 
ATOM   13   C CB  . ILE A 1 2   ? -2.085  -51.955 45.519 1.00 23.10 ? 2   ILE A CB  1 
ATOM   14   C CG1 . ILE A 1 2   ? -1.694  -53.431 45.416 1.00 21.75 ? 2   ILE A CG1 1 
ATOM   15   C CG2 . ILE A 1 2   ? -3.590  -51.803 45.391 1.00 14.35 ? 2   ILE A CG2 1 
ATOM   16   C CD1 . ILE A 1 2   ? -2.464  -54.346 46.346 1.00 28.82 ? 2   ILE A CD1 1 
ATOM   17   N N   . GLN A 1 3   ? -2.299  -49.191 43.320 1.00 31.00 ? 3   GLN A N   1 
ATOM   18   C CA  . GLN A 1 3   ? -2.741  -47.803 43.240 1.00 28.70 ? 3   GLN A CA  1 
ATOM   19   C C   . GLN A 1 3   ? -4.132  -47.605 43.816 1.00 24.67 ? 3   GLN A C   1 
ATOM   20   O O   . GLN A 1 3   ? -5.051  -48.362 43.518 1.00 19.43 ? 3   GLN A O   1 
ATOM   21   C CB  . GLN A 1 3   ? -2.739  -47.327 41.786 1.00 38.13 ? 3   GLN A CB  1 
ATOM   22   C CG  . GLN A 1 3   ? -1.864  -48.141 40.850 1.00 53.74 ? 3   GLN A CG  1 
ATOM   23   C CD  . GLN A 1 3   ? -2.014  -47.706 39.402 1.00 70.43 ? 3   GLN A CD  1 
ATOM   24   O OE1 . GLN A 1 3   ? -2.205  -46.517 39.113 1.00 77.63 ? 3   GLN A OE1 1 
ATOM   25   N NE2 . GLN A 1 3   ? -1.933  -48.666 38.481 1.00 74.71 ? 3   GLN A NE2 1 
ATOM   26   N N   . MET A 1 4   ? -4.283  -46.581 44.645 1.00 22.00 ? 4   MET A N   1 
ATOM   27   C CA  . MET A 1 4   ? -5.575  -46.279 45.241 1.00 19.15 ? 4   MET A CA  1 
ATOM   28   C C   . MET A 1 4   ? -6.085  -45.014 44.582 1.00 21.41 ? 4   MET A C   1 
ATOM   29   O O   . MET A 1 4   ? -5.338  -44.052 44.416 1.00 21.87 ? 4   MET A O   1 
ATOM   30   C CB  . MET A 1 4   ? -5.428  -46.066 46.743 1.00 17.22 ? 4   MET A CB  1 
ATOM   31   C CG  . MET A 1 4   ? -4.804  -47.251 47.449 1.00 9.82  ? 4   MET A CG  1 
ATOM   32   S SD  . MET A 1 4   ? -5.819  -48.727 47.283 1.00 20.79 ? 4   MET A SD  1 
ATOM   33   C CE  . MET A 1 4   ? -7.241  -48.240 48.238 1.00 23.38 ? 4   MET A CE  1 
ATOM   34   N N   . THR A 1 5   ? -7.347  -45.014 44.180 1.00 22.00 ? 5   THR A N   1 
ATOM   35   C CA  . THR A 1 5   ? -7.888  -43.836 43.537 1.00 22.67 ? 5   THR A CA  1 
ATOM   36   C C   . THR A 1 5   ? -9.173  -43.338 44.174 1.00 26.72 ? 5   THR A C   1 
ATOM   37   O O   . THR A 1 5   ? -10.167 -44.057 44.265 1.00 27.38 ? 5   THR A O   1 
ATOM   38   C CB  . THR A 1 5   ? -8.181  -44.054 42.038 1.00 15.84 ? 5   THR A CB  1 
ATOM   39   O OG1 . THR A 1 5   ? -7.112  -44.766 41.415 1.00 14.21 ? 5   THR A OG1 1 
ATOM   40   C CG2 . THR A 1 5   ? -8.326  -42.718 41.352 1.00 23.26 ? 5   THR A CG2 1 
ATOM   41   N N   . GLN A 1 6   ? -9.130  -42.095 44.625 1.00 24.50 ? 6   GLN A N   1 
ATOM   42   C CA  . GLN A 1 6   ? -10.287 -41.458 45.200 1.00 26.68 ? 6   GLN A CA  1 
ATOM   43   C C   . GLN A 1 6   ? -10.674 -40.571 44.023 1.00 32.05 ? 6   GLN A C   1 
ATOM   44   O O   . GLN A 1 6   ? -10.016 -39.568 43.742 1.00 39.34 ? 6   GLN A O   1 
ATOM   45   C CB  . GLN A 1 6   ? -9.884  -40.646 46.435 1.00 19.47 ? 6   GLN A CB  1 
ATOM   46   C CG  . GLN A 1 6   ? -9.522  -41.519 47.638 1.00 17.32 ? 6   GLN A CG  1 
ATOM   47   C CD  . GLN A 1 6   ? -9.215  -40.721 48.893 1.00 19.23 ? 6   GLN A CD  1 
ATOM   48   O OE1 . GLN A 1 6   ? -8.141  -40.860 49.489 1.00 21.21 ? 6   GLN A OE1 1 
ATOM   49   N NE2 . GLN A 1 6   ? -10.157 -39.883 49.305 1.00 20.66 ? 6   GLN A NE2 1 
ATOM   50   N N   . THR A 1 7   ? -11.714 -40.981 43.305 1.00 37.55 ? 7   THR A N   1 
ATOM   51   C CA  . THR A 1 7   ? -12.177 -40.258 42.124 1.00 43.72 ? 7   THR A CA  1 
ATOM   52   C C   . THR A 1 7   ? -12.362 -38.758 42.328 1.00 46.71 ? 7   THR A C   1 
ATOM   53   O O   . THR A 1 7   ? -11.727 -37.949 41.643 1.00 52.29 ? 7   THR A O   1 
ATOM   54   C CB  . THR A 1 7   ? -13.488 -40.854 41.607 1.00 42.56 ? 7   THR A CB  1 
ATOM   55   O OG1 . THR A 1 7   ? -14.254 -41.352 42.708 1.00 43.73 ? 7   THR A OG1 1 
ATOM   56   C CG2 . THR A 1 7   ? -13.195 -41.998 40.655 1.00 50.96 ? 7   THR A CG2 1 
ATOM   57   N N   . THR A 1 8   ? -13.229 -38.385 43.263 1.00 41.26 ? 8   THR A N   1 
ATOM   58   C CA  . THR A 1 8   ? -13.467 -36.977 43.542 1.00 39.81 ? 8   THR A CA  1 
ATOM   59   C C   . THR A 1 8   ? -12.388 -36.393 44.460 1.00 35.75 ? 8   THR A C   1 
ATOM   60   O O   . THR A 1 8   ? -12.101 -36.935 45.526 1.00 36.96 ? 8   THR A O   1 
ATOM   61   C CB  . THR A 1 8   ? -14.835 -36.781 44.192 1.00 40.88 ? 8   THR A CB  1 
ATOM   62   O OG1 . THR A 1 8   ? -15.852 -36.965 43.202 1.00 48.83 ? 8   THR A OG1 1 
ATOM   63   C CG2 . THR A 1 8   ? -14.950 -35.385 44.783 1.00 39.27 ? 8   THR A CG2 1 
ATOM   64   N N   . SER A 1 9   ? -11.798 -35.281 44.040 1.00 30.71 ? 9   SER A N   1 
ATOM   65   C CA  . SER A 1 9   ? -10.752 -34.632 44.819 1.00 35.10 ? 9   SER A CA  1 
ATOM   66   C C   . SER A 1 9   ? -11.340 -33.622 45.793 1.00 31.29 ? 9   SER A C   1 
ATOM   67   O O   . SER A 1 9   ? -10.743 -33.314 46.822 1.00 30.69 ? 9   SER A O   1 
ATOM   68   C CB  . SER A 1 9   ? -9.762  -33.930 43.884 1.00 38.07 ? 9   SER A CB  1 
ATOM   69   O OG  . SER A 1 9   ? -9.232  -34.842 42.936 1.00 48.23 ? 9   SER A OG  1 
ATOM   70   N N   . SER A 1 10  ? -12.513 -33.102 45.452 1.00 32.68 ? 10  SER A N   1 
ATOM   71   C CA  . SER A 1 10  ? -13.192 -32.132 46.293 1.00 33.16 ? 10  SER A CA  1 
ATOM   72   C C   . SER A 1 10  ? -14.692 -32.342 46.183 1.00 31.39 ? 10  SER A C   1 
ATOM   73   O O   . SER A 1 10  ? -15.214 -32.580 45.095 1.00 30.46 ? 10  SER A O   1 
ATOM   74   C CB  . SER A 1 10  ? -12.824 -30.708 45.872 1.00 34.75 ? 10  SER A CB  1 
ATOM   75   O OG  . SER A 1 10  ? -13.750 -30.196 44.934 1.00 46.71 ? 10  SER A OG  1 
ATOM   76   N N   . LEU A 1 11  ? -15.370 -32.253 47.324 1.00 29.68 ? 11  LEU A N   1 
ATOM   77   C CA  . LEU A 1 11  ? -16.810 -32.442 47.406 1.00 27.84 ? 11  LEU A CA  1 
ATOM   78   C C   . LEU A 1 11  ? -17.459 -31.307 48.198 1.00 27.77 ? 11  LEU A C   1 
ATOM   79   O O   . LEU A 1 11  ? -16.953 -30.907 49.237 1.00 31.81 ? 11  LEU A O   1 
ATOM   80   C CB  . LEU A 1 11  ? -17.089 -33.768 48.095 1.00 30.42 ? 11  LEU A CB  1 
ATOM   81   C CG  . LEU A 1 11  ? -18.415 -34.456 47.826 1.00 32.58 ? 11  LEU A CG  1 
ATOM   82   C CD1 . LEU A 1 11  ? -18.347 -35.882 48.358 1.00 35.35 ? 11  LEU A CD1 1 
ATOM   83   C CD2 . LEU A 1 11  ? -19.531 -33.676 48.492 1.00 33.97 ? 11  LEU A CD2 1 
ATOM   84   N N   . SER A 1 12  ? -18.576 -30.787 47.706 1.00 28.99 ? 12  SER A N   1 
ATOM   85   C CA  . SER A 1 12  ? -19.284 -29.707 48.387 1.00 27.98 ? 12  SER A CA  1 
ATOM   86   C C   . SER A 1 12  ? -20.616 -30.217 48.902 1.00 25.01 ? 12  SER A C   1 
ATOM   87   O O   . SER A 1 12  ? -21.260 -31.040 48.268 1.00 29.46 ? 12  SER A O   1 
ATOM   88   C CB  . SER A 1 12  ? -19.519 -28.538 47.435 1.00 32.87 ? 12  SER A CB  1 
ATOM   89   O OG  . SER A 1 12  ? -18.787 -27.399 47.854 1.00 47.62 ? 12  SER A OG  1 
ATOM   90   N N   . ALA A 1 13  ? -21.036 -29.729 50.057 1.00 25.77 ? 13  ALA A N   1 
ATOM   91   C CA  . ALA A 1 13  ? -22.288 -30.185 50.630 1.00 27.69 ? 13  ALA A CA  1 
ATOM   92   C C   . ALA A 1 13  ? -22.803 -29.252 51.719 1.00 27.51 ? 13  ALA A C   1 
ATOM   93   O O   . ALA A 1 13  ? -22.161 -28.270 52.077 1.00 31.16 ? 13  ALA A O   1 
ATOM   94   C CB  . ALA A 1 13  ? -22.113 -31.596 51.186 1.00 31.13 ? 13  ALA A CB  1 
ATOM   95   N N   . SER A 1 14  ? -23.979 -29.566 52.239 1.00 26.76 ? 14  SER A N   1 
ATOM   96   C CA  . SER A 1 14  ? -24.577 -28.753 53.279 1.00 22.90 ? 14  SER A CA  1 
ATOM   97   C C   . SER A 1 14  ? -24.577 -29.584 54.534 1.00 22.57 ? 14  SER A C   1 
ATOM   98   O O   . SER A 1 14  ? -24.662 -30.810 54.466 1.00 19.20 ? 14  SER A O   1 
ATOM   99   C CB  . SER A 1 14  ? -26.011 -28.372 52.904 1.00 23.06 ? 14  SER A CB  1 
ATOM   100  O OG  . SER A 1 14  ? -26.046 -27.587 51.723 1.00 23.83 ? 14  SER A OG  1 
ATOM   101  N N   . LEU A 1 15  ? -24.454 -28.915 55.677 1.00 26.18 ? 15  LEU A N   1 
ATOM   102  C CA  . LEU A 1 15  ? -24.455 -29.593 56.963 1.00 21.66 ? 15  LEU A CA  1 
ATOM   103  C C   . LEU A 1 15  ? -25.783 -30.319 57.069 1.00 21.93 ? 15  LEU A C   1 
ATOM   104  O O   . LEU A 1 15  ? -26.837 -29.761 56.751 1.00 22.36 ? 15  LEU A O   1 
ATOM   105  C CB  . LEU A 1 15  ? -24.319 -28.573 58.090 1.00 25.66 ? 15  LEU A CB  1 
ATOM   106  C CG  . LEU A 1 15  ? -23.145 -27.598 57.972 1.00 28.01 ? 15  LEU A CG  1 
ATOM   107  C CD1 . LEU A 1 15  ? -23.262 -26.516 59.028 1.00 25.67 ? 15  LEU A CD1 1 
ATOM   108  C CD2 . LEU A 1 15  ? -21.838 -28.358 58.134 1.00 27.06 ? 15  LEU A CD2 1 
ATOM   109  N N   . GLY A 1 16  ? -25.732 -31.568 57.504 1.00 21.22 ? 16  GLY A N   1 
ATOM   110  C CA  . GLY A 1 16  ? -26.947 -32.351 57.618 1.00 20.79 ? 16  GLY A CA  1 
ATOM   111  C C   . GLY A 1 16  ? -27.021 -33.330 56.467 1.00 21.35 ? 16  GLY A C   1 
ATOM   112  O O   . GLY A 1 16  ? -27.680 -34.362 56.552 1.00 18.89 ? 16  GLY A O   1 
ATOM   113  N N   . ASP A 1 17  ? -26.324 -32.993 55.384 1.00 26.77 ? 17  ASP A N   1 
ATOM   114  C CA  . ASP A 1 17  ? -26.280 -33.818 54.181 1.00 25.27 ? 17  ASP A CA  1 
ATOM   115  C C   . ASP A 1 17  ? -25.664 -35.181 54.485 1.00 25.65 ? 17  ASP A C   1 
ATOM   116  O O   . ASP A 1 17  ? -24.810 -35.306 55.362 1.00 21.30 ? 17  ASP A O   1 
ATOM   117  C CB  . ASP A 1 17  ? -25.432 -33.131 53.109 1.00 25.50 ? 17  ASP A CB  1 
ATOM   118  C CG  . ASP A 1 17  ? -26.258 -32.444 52.037 1.00 21.71 ? 17  ASP A CG  1 
ATOM   119  O OD1 . ASP A 1 17  ? -25.712 -32.210 50.943 1.00 31.96 ? 17  ASP A OD1 1 
ATOM   120  O OD2 . ASP A 1 17  ? -27.436 -32.127 52.271 1.00 23.70 ? 17  ASP A OD2 1 
ATOM   121  N N   . ARG A 1 18  ? -26.119 -36.199 53.763 1.00 27.62 ? 18  ARG A N   1 
ATOM   122  C CA  . ARG A 1 18  ? -25.581 -37.542 53.909 1.00 28.54 ? 18  ARG A CA  1 
ATOM   123  C C   . ARG A 1 18  ? -24.544 -37.605 52.803 1.00 30.62 ? 18  ARG A C   1 
ATOM   124  O O   . ARG A 1 18  ? -24.884 -37.456 51.630 1.00 34.62 ? 18  ARG A O   1 
ATOM   125  C CB  . ARG A 1 18  ? -26.659 -38.596 53.668 1.00 32.25 ? 18  ARG A CB  1 
ATOM   126  C CG  . ARG A 1 18  ? -26.255 -39.993 54.111 1.00 42.40 ? 18  ARG A CG  1 
ATOM   127  C CD  . ARG A 1 18  ? -27.453 -40.928 54.179 1.00 48.51 ? 18  ARG A CD  1 
ATOM   128  N NE  . ARG A 1 18  ? -27.131 -42.248 53.648 1.00 51.91 ? 18  ARG A NE  1 
ATOM   129  C CZ  . ARG A 1 18  ? -26.758 -42.480 52.391 1.00 56.04 ? 18  ARG A CZ  1 
ATOM   130  N NH1 . ARG A 1 18  ? -26.661 -41.475 51.530 1.00 56.20 ? 18  ARG A NH1 1 
ATOM   131  N NH2 . ARG A 1 18  ? -26.480 -43.718 51.993 1.00 52.61 ? 18  ARG A NH2 1 
ATOM   132  N N   . VAL A 1 19  ? -23.285 -37.817 53.171 1.00 26.72 ? 19  VAL A N   1 
ATOM   133  C CA  . VAL A 1 19  ? -22.204 -37.853 52.195 1.00 23.49 ? 19  VAL A CA  1 
ATOM   134  C C   . VAL A 1 19  ? -21.513 -39.200 52.084 1.00 21.16 ? 19  VAL A C   1 
ATOM   135  O O   . VAL A 1 19  ? -21.474 -39.971 53.042 1.00 20.34 ? 19  VAL A O   1 
ATOM   136  C CB  . VAL A 1 19  ? -21.124 -36.799 52.534 1.00 28.05 ? 19  VAL A CB  1 
ATOM   137  C CG1 . VAL A 1 19  ? -20.126 -36.705 51.402 1.00 22.67 ? 19  VAL A CG1 1 
ATOM   138  C CG2 . VAL A 1 19  ? -21.772 -35.442 52.806 1.00 21.76 ? 19  VAL A CG2 1 
ATOM   139  N N   . THR A 1 20  ? -20.969 -39.470 50.900 1.00 20.98 ? 20  THR A N   1 
ATOM   140  C CA  . THR A 1 20  ? -20.237 -40.704 50.635 1.00 21.67 ? 20  THR A CA  1 
ATOM   141  C C   . THR A 1 20  ? -18.978 -40.436 49.803 1.00 23.39 ? 20  THR A C   1 
ATOM   142  O O   . THR A 1 20  ? -19.002 -39.725 48.793 1.00 19.62 ? 20  THR A O   1 
ATOM   143  C CB  . THR A 1 20  ? -21.105 -41.748 49.904 1.00 22.87 ? 20  THR A CB  1 
ATOM   144  O OG1 . THR A 1 20  ? -22.280 -42.012 50.677 1.00 23.62 ? 20  THR A OG1 1 
ATOM   145  C CG2 . THR A 1 20  ? -20.332 -43.053 49.725 1.00 20.21 ? 20  THR A CG2 1 
ATOM   146  N N   . ILE A 1 21  ? -17.875 -41.014 50.262 1.00 25.67 ? 21  ILE A N   1 
ATOM   147  C CA  . ILE A 1 21  ? -16.575 -40.882 49.624 1.00 19.66 ? 21  ILE A CA  1 
ATOM   148  C C   . ILE A 1 21  ? -16.180 -42.263 49.114 1.00 22.08 ? 21  ILE A C   1 
ATOM   149  O O   . ILE A 1 21  ? -16.181 -43.237 49.862 1.00 23.07 ? 21  ILE A O   1 
ATOM   150  C CB  . ILE A 1 21  ? -15.523 -40.391 50.649 1.00 20.93 ? 21  ILE A CB  1 
ATOM   151  C CG1 . ILE A 1 21  ? -15.766 -38.916 50.974 1.00 14.46 ? 21  ILE A CG1 1 
ATOM   152  C CG2 . ILE A 1 21  ? -14.122 -40.606 50.109 1.00 20.51 ? 21  ILE A CG2 1 
ATOM   153  C CD1 . ILE A 1 21  ? -15.413 -38.557 52.364 1.00 12.13 ? 21  ILE A CD1 1 
ATOM   154  N N   . SER A 1 22  ? -15.846 -42.361 47.839 1.00 20.73 ? 22  SER A N   1 
ATOM   155  C CA  . SER A 1 22  ? -15.474 -43.657 47.304 1.00 27.73 ? 22  SER A CA  1 
ATOM   156  C C   . SER A 1 22  ? -13.977 -43.772 47.120 1.00 25.42 ? 22  SER A C   1 
ATOM   157  O O   . SER A 1 22  ? -13.279 -42.770 46.983 1.00 29.17 ? 22  SER A O   1 
ATOM   158  C CB  . SER A 1 22  ? -16.192 -43.899 45.982 1.00 29.46 ? 22  SER A CB  1 
ATOM   159  O OG  . SER A 1 22  ? -17.570 -44.124 46.219 1.00 43.89 ? 22  SER A OG  1 
ATOM   160  N N   . CYS A 1 23  ? -13.493 -45.006 47.112 1.00 22.19 ? 23  CYS A N   1 
ATOM   161  C CA  . CYS A 1 23  ? -12.072 -45.276 46.962 1.00 25.21 ? 23  CYS A CA  1 
ATOM   162  C C   . CYS A 1 23  ? -11.941 -46.594 46.208 1.00 24.24 ? 23  CYS A C   1 
ATOM   163  O O   . CYS A 1 23  ? -12.590 -47.583 46.551 1.00 24.47 ? 23  CYS A O   1 
ATOM   164  C CB  . CYS A 1 23  ? -11.413 -45.362 48.345 1.00 23.15 ? 23  CYS A CB  1 
ATOM   165  S SG  . CYS A 1 23  ? -9.704  -45.978 48.340 1.00 22.78 ? 23  CYS A SG  1 
ATOM   166  N N   . ARG A 1 24  ? -11.119 -46.599 45.165 1.00 21.80 ? 24  ARG A N   1 
ATOM   167  C CA  . ARG A 1 24  ? -10.939 -47.794 44.359 1.00 25.40 ? 24  ARG A CA  1 
ATOM   168  C C   . ARG A 1 24  ? -9.489  -48.253 44.322 1.00 22.47 ? 24  ARG A C   1 
ATOM   169  O O   . ARG A 1 24  ? -8.570  -47.444 44.173 1.00 18.66 ? 24  ARG A O   1 
ATOM   170  C CB  . ARG A 1 24  ? -11.454 -47.541 42.935 1.00 30.03 ? 24  ARG A CB  1 
ATOM   171  C CG  . ARG A 1 24  ? -10.567 -48.085 41.825 1.00 42.68 ? 24  ARG A CG  1 
ATOM   172  C CD  . ARG A 1 24  ? -11.391 -48.558 40.644 1.00 49.28 ? 24  ARG A CD  1 
ATOM   173  N NE  . ARG A 1 24  ? -11.007 -49.898 40.208 1.00 62.81 ? 24  ARG A NE  1 
ATOM   174  C CZ  . ARG A 1 24  ? -11.765 -50.982 40.357 1.00 66.91 ? 24  ARG A CZ  1 
ATOM   175  N NH1 . ARG A 1 24  ? -12.957 -50.889 40.937 1.00 69.21 ? 24  ARG A NH1 1 
ATOM   176  N NH2 . ARG A 1 24  ? -11.333 -52.159 39.923 1.00 65.24 ? 24  ARG A NH2 1 
ATOM   177  N N   . ALA A 1 25  ? -9.299  -49.562 44.467 1.00 18.19 ? 25  ALA A N   1 
ATOM   178  C CA  . ALA A 1 25  ? -7.977  -50.154 44.437 1.00 17.71 ? 25  ALA A CA  1 
ATOM   179  C C   . ALA A 1 25  ? -7.752  -50.712 43.038 1.00 18.36 ? 25  ALA A C   1 
ATOM   180  O O   . ALA A 1 25  ? -8.709  -50.984 42.319 1.00 18.11 ? 25  ALA A O   1 
ATOM   181  C CB  . ALA A 1 25  ? -7.882  -51.255 45.471 1.00 17.91 ? 25  ALA A CB  1 
ATOM   182  N N   . SER A 1 26  ? -6.492  -50.870 42.646 1.00 18.36 ? 26  SER A N   1 
ATOM   183  C CA  . SER A 1 26  ? -6.185  -51.399 41.324 1.00 20.33 ? 26  SER A CA  1 
ATOM   184  C C   . SER A 1 26  ? -6.344  -52.913 41.306 1.00 20.03 ? 26  SER A C   1 
ATOM   185  O O   . SER A 1 26  ? -6.318  -53.531 40.252 1.00 30.40 ? 26  SER A O   1 
ATOM   186  C CB  . SER A 1 26  ? -4.766  -51.000 40.891 1.00 15.12 ? 26  SER A CB  1 
ATOM   187  O OG  . SER A 1 26  ? -3.775  -51.603 41.699 1.00 23.81 ? 26  SER A OG  1 
ATOM   188  N N   . GLN A 1 27  ? -6.506  -53.508 42.480 1.00 22.50 ? 27  GLN A N   1 
ATOM   189  C CA  . GLN A 1 27  ? -6.709  -54.948 42.590 1.00 23.51 ? 27  GLN A CA  1 
ATOM   190  C C   . GLN A 1 27  ? -7.312  -55.276 43.947 1.00 25.03 ? 27  GLN A C   1 
ATOM   191  O O   . GLN A 1 27  ? -7.198  -54.496 44.892 1.00 27.31 ? 27  GLN A O   1 
ATOM   192  C CB  . GLN A 1 27  ? -5.397  -55.709 42.400 1.00 24.94 ? 27  GLN A CB  1 
ATOM   193  C CG  . GLN A 1 27  ? -4.233  -55.184 43.212 1.00 36.38 ? 27  GLN A CG  1 
ATOM   194  C CD  . GLN A 1 27  ? -2.907  -55.782 42.765 1.00 36.61 ? 27  GLN A CD  1 
ATOM   195  O OE1 . GLN A 1 27  ? -2.553  -56.888 43.164 1.00 32.00 ? 27  GLN A OE1 1 
ATOM   196  N NE2 . GLN A 1 27  ? -2.172  -55.051 41.927 1.00 36.01 ? 27  GLN A NE2 1 
ATOM   197  N N   . ASP A 1 28  ? -7.967  -56.425 44.042 1.00 21.05 ? 28  ASP A N   1 
ATOM   198  C CA  . ASP A 1 28  ? -8.591  -56.829 45.292 1.00 22.20 ? 28  ASP A CA  1 
ATOM   199  C C   . ASP A 1 28  ? -7.609  -56.767 46.452 1.00 21.92 ? 28  ASP A C   1 
ATOM   200  O O   . ASP A 1 28  ? -6.534  -57.364 46.397 1.00 25.31 ? 28  ASP A O   1 
ATOM   201  C CB  . ASP A 1 28  ? -9.146  -58.240 45.170 1.00 17.81 ? 28  ASP A CB  1 
ATOM   202  C CG  . ASP A 1 28  ? -9.839  -58.688 46.422 1.00 21.59 ? 28  ASP A CG  1 
ATOM   203  O OD1 . ASP A 1 28  ? -10.137 -59.891 46.528 1.00 31.22 ? 28  ASP A OD1 1 
ATOM   204  O OD2 . ASP A 1 28  ? -10.084 -57.836 47.301 1.00 21.18 ? 28  ASP A OD2 1 
ATOM   205  N N   . ILE A 1 29  ? -7.992  -56.053 47.506 1.00 21.08 ? 29  ILE A N   1 
ATOM   206  C CA  . ILE A 1 29  ? -7.138  -55.896 48.680 1.00 17.95 ? 29  ILE A CA  1 
ATOM   207  C C   . ILE A 1 29  ? -7.752  -56.548 49.916 1.00 18.42 ? 29  ILE A C   1 
ATOM   208  O O   . ILE A 1 29  ? -7.395  -56.238 51.048 1.00 17.99 ? 29  ILE A O   1 
ATOM   209  C CB  . ILE A 1 29  ? -6.872  -54.400 48.955 1.00 17.92 ? 29  ILE A CB  1 
ATOM   210  C CG1 . ILE A 1 29  ? -8.187  -53.613 48.911 1.00 11.98 ? 29  ILE A CG1 1 
ATOM   211  C CG2 . ILE A 1 29  ? -5.903  -53.856 47.904 1.00 8.78  ? 29  ILE A CG2 1 
ATOM   212  C CD1 . ILE A 1 29  ? -8.145  -52.278 49.627 1.00 15.45 ? 29  ILE A CD1 1 
ATOM   213  N N   . ASN A 1 30  ? -8.684  -57.460 49.671 1.00 26.08 ? 30  ASN A N   1 
ATOM   214  C CA  . ASN A 1 30  ? -9.376  -58.206 50.717 1.00 26.61 ? 30  ASN A CA  1 
ATOM   215  C C   . ASN A 1 30  ? -9.824  -57.422 51.928 1.00 23.50 ? 30  ASN A C   1 
ATOM   216  O O   . ASN A 1 30  ? -9.572  -57.842 53.050 1.00 21.93 ? 30  ASN A O   1 
ATOM   217  C CB  . ASN A 1 30  ? -8.519  -59.377 51.200 1.00 32.11 ? 30  ASN A CB  1 
ATOM   218  C CG  . ASN A 1 30  ? -7.522  -59.830 50.166 1.00 35.34 ? 30  ASN A CG  1 
ATOM   219  O OD1 . ASN A 1 30  ? -6.484  -59.199 49.977 1.00 44.01 ? 30  ASN A OD1 1 
ATOM   220  N ND2 . ASN A 1 30  ? -7.828  -60.928 49.487 1.00 32.88 ? 30  ASN A ND2 1 
ATOM   221  N N   . ASN A 1 31  ? -10.484 -56.291 51.706 1.00 21.21 ? 31  ASN A N   1 
ATOM   222  C CA  . ASN A 1 31  ? -11.003 -55.484 52.807 1.00 21.80 ? 31  ASN A CA  1 
ATOM   223  C C   . ASN A 1 31  ? -9.979  -54.839 53.737 1.00 18.35 ? 31  ASN A C   1 
ATOM   224  O O   . ASN A 1 31  ? -10.340 -54.286 54.774 1.00 17.44 ? 31  ASN A O   1 
ATOM   225  C CB  . ASN A 1 31  ? -11.989 -56.313 53.634 1.00 23.60 ? 31  ASN A CB  1 
ATOM   226  C CG  . ASN A 1 31  ? -13.274 -56.594 52.885 1.00 25.84 ? 31  ASN A CG  1 
ATOM   227  O OD1 . ASN A 1 31  ? -13.548 -57.728 52.496 1.00 29.81 ? 31  ASN A OD1 1 
ATOM   228  N ND2 . ASN A 1 31  ? -14.064 -55.557 52.669 1.00 30.84 ? 31  ASN A ND2 1 
ATOM   229  N N   . TYR A 1 32  ? -8.705  -54.913 53.382 1.00 17.34 ? 32  TYR A N   1 
ATOM   230  C CA  . TYR A 1 32  ? -7.678  -54.259 54.185 1.00 18.61 ? 32  TYR A CA  1 
ATOM   231  C C   . TYR A 1 32  ? -7.637  -52.817 53.683 1.00 20.44 ? 32  TYR A C   1 
ATOM   232  O O   . TYR A 1 32  ? -6.721  -52.403 52.960 1.00 20.73 ? 32  TYR A O   1 
ATOM   233  C CB  . TYR A 1 32  ? -6.321  -54.940 53.985 1.00 20.57 ? 32  TYR A CB  1 
ATOM   234  C CG  . TYR A 1 32  ? -6.177  -56.184 54.828 1.00 22.33 ? 32  TYR A CG  1 
ATOM   235  C CD1 . TYR A 1 32  ? -6.109  -57.446 54.240 1.00 24.55 ? 32  TYR A CD1 1 
ATOM   236  C CD2 . TYR A 1 32  ? -6.160  -56.100 56.218 1.00 21.65 ? 32  TYR A CD2 1 
ATOM   237  C CE1 . TYR A 1 32  ? -6.033  -58.594 55.017 1.00 30.94 ? 32  TYR A CE1 1 
ATOM   238  C CE2 . TYR A 1 32  ? -6.082  -57.237 57.004 1.00 28.75 ? 32  TYR A CE2 1 
ATOM   239  C CZ  . TYR A 1 32  ? -6.020  -58.481 56.399 1.00 28.25 ? 32  TYR A CZ  1 
ATOM   240  O OH  . TYR A 1 32  ? -5.941  -59.605 57.182 1.00 23.95 ? 32  TYR A OH  1 
ATOM   241  N N   . LEU A 1 33  ? -8.670  -52.071 54.052 1.00 17.55 ? 33  LEU A N   1 
ATOM   242  C CA  . LEU A 1 33  ? -8.813  -50.681 53.654 1.00 16.86 ? 33  LEU A CA  1 
ATOM   243  C C   . LEU A 1 33  ? -9.043  -49.840 54.909 1.00 17.18 ? 33  LEU A C   1 
ATOM   244  O O   . LEU A 1 33  ? -9.912  -50.151 55.718 1.00 20.07 ? 33  LEU A O   1 
ATOM   245  C CB  . LEU A 1 33  ? -10.007 -50.557 52.703 1.00 13.62 ? 33  LEU A CB  1 
ATOM   246  C CG  . LEU A 1 33  ? -10.228 -49.312 51.828 1.00 20.19 ? 33  LEU A CG  1 
ATOM   247  C CD1 . LEU A 1 33  ? -10.874 -48.204 52.662 1.00 16.57 ? 33  LEU A CD1 1 
ATOM   248  C CD2 . LEU A 1 33  ? -8.921  -48.854 51.228 1.00 15.94 ? 33  LEU A CD2 1 
ATOM   249  N N   . ASN A 1 34  ? -8.261  -48.779 55.071 1.00 17.59 ? 34  ASN A N   1 
ATOM   250  C CA  . ASN A 1 34  ? -8.390  -47.896 56.224 1.00 18.38 ? 34  ASN A CA  1 
ATOM   251  C C   . ASN A 1 34  ? -8.683  -46.467 55.762 1.00 21.10 ? 34  ASN A C   1 
ATOM   252  O O   . ASN A 1 34  ? -8.262  -46.050 54.679 1.00 21.01 ? 34  ASN A O   1 
ATOM   253  C CB  . ASN A 1 34  ? -7.096  -47.912 57.059 1.00 21.15 ? 34  ASN A CB  1 
ATOM   254  C CG  . ASN A 1 34  ? -6.643  -49.324 57.429 1.00 20.08 ? 34  ASN A CG  1 
ATOM   255  O OD1 . ASN A 1 34  ? -7.446  -50.173 57.821 1.00 22.33 ? 34  ASN A OD1 1 
ATOM   256  N ND2 . ASN A 1 34  ? -5.350  -49.574 57.304 1.00 18.32 ? 34  ASN A ND2 1 
ATOM   257  N N   . TRP A 1 35  ? -9.406  -45.719 56.589 1.00 20.99 ? 35  TRP A N   1 
ATOM   258  C CA  . TRP A 1 35  ? -9.750  -44.338 56.272 1.00 19.78 ? 35  TRP A CA  1 
ATOM   259  C C   . TRP A 1 35  ? -9.159  -43.415 57.325 1.00 19.64 ? 35  TRP A C   1 
ATOM   260  O O   . TRP A 1 35  ? -9.265  -43.685 58.521 1.00 18.75 ? 35  TRP A O   1 
ATOM   261  C CB  . TRP A 1 35  ? -11.271 -44.145 56.244 1.00 19.34 ? 35  TRP A CB  1 
ATOM   262  C CG  . TRP A 1 35  ? -11.981 -44.811 55.093 1.00 18.84 ? 35  TRP A CG  1 
ATOM   263  C CD1 . TRP A 1 35  ? -12.589 -46.034 55.103 1.00 12.07 ? 35  TRP A CD1 1 
ATOM   264  C CD2 . TRP A 1 35  ? -12.196 -44.265 53.781 1.00 20.74 ? 35  TRP A CD2 1 
ATOM   265  N NE1 . TRP A 1 35  ? -13.170 -46.281 53.885 1.00 20.82 ? 35  TRP A NE1 1 
ATOM   266  C CE2 . TRP A 1 35  ? -12.947 -45.214 53.055 1.00 18.59 ? 35  TRP A CE2 1 
ATOM   267  C CE3 . TRP A 1 35  ? -11.830 -43.066 53.152 1.00 20.17 ? 35  TRP A CE3 1 
ATOM   268  C CZ2 . TRP A 1 35  ? -13.339 -45.002 51.728 1.00 14.87 ? 35  TRP A CZ2 1 
ATOM   269  C CZ3 . TRP A 1 35  ? -12.222 -42.856 51.834 1.00 17.23 ? 35  TRP A CZ3 1 
ATOM   270  C CH2 . TRP A 1 35  ? -12.970 -43.822 51.138 1.00 15.53 ? 35  TRP A CH2 1 
ATOM   271  N N   . TYR A 1 36  ? -8.536  -42.333 56.866 1.00 19.11 ? 36  TYR A N   1 
ATOM   272  C CA  . TYR A 1 36  ? -7.918  -41.338 57.741 1.00 18.59 ? 36  TYR A CA  1 
ATOM   273  C C   . TYR A 1 36  ? -8.554  -39.982 57.483 1.00 14.71 ? 36  TYR A C   1 
ATOM   274  O O   . TYR A 1 36  ? -8.998  -39.689 56.378 1.00 13.78 ? 36  TYR A O   1 
ATOM   275  C CB  . TYR A 1 36  ? -6.407  -41.217 57.465 1.00 15.15 ? 36  TYR A CB  1 
ATOM   276  C CG  . TYR A 1 36  ? -5.636  -42.482 57.707 1.00 12.92 ? 36  TYR A CG  1 
ATOM   277  C CD1 . TYR A 1 36  ? -5.516  -43.442 56.702 1.00 17.29 ? 36  TYR A CD1 1 
ATOM   278  C CD2 . TYR A 1 36  ? -5.096  -42.764 58.962 1.00 10.62 ? 36  TYR A CD2 1 
ATOM   279  C CE1 . TYR A 1 36  ? -4.886  -44.666 56.943 1.00 20.51 ? 36  TYR A CE1 1 
ATOM   280  C CE2 . TYR A 1 36  ? -4.464  -43.986 59.215 1.00 12.00 ? 36  TYR A CE2 1 
ATOM   281  C CZ  . TYR A 1 36  ? -4.369  -44.933 58.202 1.00 15.17 ? 36  TYR A CZ  1 
ATOM   282  O OH  . TYR A 1 36  ? -3.793  -46.157 58.441 1.00 14.20 ? 36  TYR A OH  1 
ATOM   283  N N   . GLN A 1 37  ? -8.585  -39.151 58.509 1.00 17.56 ? 37  GLN A N   1 
ATOM   284  C CA  . GLN A 1 37  ? -9.136  -37.820 58.365 1.00 18.89 ? 37  GLN A CA  1 
ATOM   285  C C   . GLN A 1 37  ? -8.074  -36.822 58.798 1.00 18.11 ? 37  GLN A C   1 
ATOM   286  O O   . GLN A 1 37  ? -7.426  -37.001 59.822 1.00 19.81 ? 37  GLN A O   1 
ATOM   287  C CB  . GLN A 1 37  ? -10.387 -37.661 59.236 1.00 18.60 ? 37  GLN A CB  1 
ATOM   288  C CG  . GLN A 1 37  ? -10.721 -36.220 59.617 1.00 20.01 ? 37  GLN A CG  1 
ATOM   289  C CD  . GLN A 1 37  ? -11.628 -36.137 60.834 1.00 20.80 ? 37  GLN A CD  1 
ATOM   290  O OE1 . GLN A 1 37  ? -11.176 -36.277 61.970 1.00 26.01 ? 37  GLN A OE1 1 
ATOM   291  N NE2 . GLN A 1 37  ? -12.912 -35.913 60.599 1.00 18.16 ? 37  GLN A NE2 1 
ATOM   292  N N   . GLN A 1 38  ? -7.883  -35.787 57.993 1.00 20.58 ? 38  GLN A N   1 
ATOM   293  C CA  . GLN A 1 38  ? -6.933  -34.734 58.310 1.00 22.40 ? 38  GLN A CA  1 
ATOM   294  C C   . GLN A 1 38  ? -7.763  -33.482 58.566 1.00 22.16 ? 38  GLN A C   1 
ATOM   295  O O   . GLN A 1 38  ? -8.350  -32.921 57.638 1.00 20.57 ? 38  GLN A O   1 
ATOM   296  C CB  . GLN A 1 38  ? -5.987  -34.496 57.138 1.00 20.81 ? 38  GLN A CB  1 
ATOM   297  C CG  . GLN A 1 38  ? -4.984  -33.404 57.404 1.00 15.34 ? 38  GLN A CG  1 
ATOM   298  C CD  . GLN A 1 38  ? -4.230  -33.020 56.165 1.00 23.50 ? 38  GLN A CD  1 
ATOM   299  O OE1 . GLN A 1 38  ? -4.748  -33.130 55.055 1.00 25.98 ? 38  GLN A OE1 1 
ATOM   300  N NE2 . GLN A 1 38  ? -2.994  -32.561 56.341 1.00 25.37 ? 38  GLN A NE2 1 
ATOM   301  N N   . LYS A 1 39  ? -7.824  -33.061 59.827 1.00 24.61 ? 39  LYS A N   1 
ATOM   302  C CA  . LYS A 1 39  ? -8.598  -31.886 60.214 1.00 24.79 ? 39  LYS A CA  1 
ATOM   303  C C   . LYS A 1 39  ? -7.915  -30.599 59.777 1.00 28.28 ? 39  LYS A C   1 
ATOM   304  O O   . LYS A 1 39  ? -6.719  -30.591 59.476 1.00 24.65 ? 39  LYS A O   1 
ATOM   305  C CB  . LYS A 1 39  ? -8.814  -31.871 61.729 1.00 26.08 ? 39  LYS A CB  1 
ATOM   306  C CG  . LYS A 1 39  ? -9.546  -33.098 62.262 1.00 31.73 ? 39  LYS A CG  1 
ATOM   307  C CD  . LYS A 1 39  ? -11.004 -32.792 62.596 1.00 38.50 ? 39  LYS A CD  1 
ATOM   308  C CE  . LYS A 1 39  ? -11.434 -33.488 63.886 1.00 46.08 ? 39  LYS A CE  1 
ATOM   309  N NZ  . LYS A 1 39  ? -12.614 -32.853 64.549 1.00 49.10 ? 39  LYS A NZ  1 
ATOM   310  N N   . PRO A 1 40  ? -8.669  -29.486 59.744 1.00 31.02 ? 40  PRO A N   1 
ATOM   311  C CA  . PRO A 1 40  ? -8.113  -28.192 59.331 1.00 30.01 ? 40  PRO A CA  1 
ATOM   312  C C   . PRO A 1 40  ? -6.900  -27.741 60.142 1.00 25.95 ? 40  PRO A C   1 
ATOM   313  O O   . PRO A 1 40  ? -6.091  -26.944 59.669 1.00 28.22 ? 40  PRO A O   1 
ATOM   314  C CB  . PRO A 1 40  ? -9.290  -27.222 59.469 1.00 29.91 ? 40  PRO A CB  1 
ATOM   315  C CG  . PRO A 1 40  ? -10.512 -28.078 59.514 1.00 34.60 ? 40  PRO A CG  1 
ATOM   316  C CD  . PRO A 1 40  ? -10.094 -29.387 60.109 1.00 32.20 ? 40  PRO A CD  1 
ATOM   317  N N   . ASP A 1 41  ? -6.774  -28.241 61.364 1.00 24.62 ? 41  ASP A N   1 
ATOM   318  C CA  . ASP A 1 41  ? -5.647  -27.849 62.193 1.00 29.23 ? 41  ASP A CA  1 
ATOM   319  C C   . ASP A 1 41  ? -4.437  -28.757 62.000 1.00 29.55 ? 41  ASP A C   1 
ATOM   320  O O   . ASP A 1 41  ? -3.545  -28.801 62.840 1.00 29.13 ? 41  ASP A O   1 
ATOM   321  C CB  . ASP A 1 41  ? -6.059  -27.802 63.666 1.00 31.09 ? 41  ASP A CB  1 
ATOM   322  C CG  . ASP A 1 41  ? -6.355  -29.156 64.228 1.00 32.77 ? 41  ASP A CG  1 
ATOM   323  O OD1 . ASP A 1 41  ? -6.312  -30.132 63.452 1.00 38.10 ? 41  ASP A OD1 1 
ATOM   324  O OD2 . ASP A 1 41  ? -6.631  -29.243 65.444 1.00 41.14 ? 41  ASP A OD2 1 
ATOM   325  N N   . GLY A 1 42  ? -4.425  -29.489 60.891 1.00 30.11 ? 42  GLY A N   1 
ATOM   326  C CA  . GLY A 1 42  ? -3.303  -30.351 60.576 1.00 26.61 ? 42  GLY A CA  1 
ATOM   327  C C   . GLY A 1 42  ? -3.209  -31.711 61.232 1.00 27.49 ? 42  GLY A C   1 
ATOM   328  O O   . GLY A 1 42  ? -2.296  -32.468 60.911 1.00 27.69 ? 42  GLY A O   1 
ATOM   329  N N   . THR A 1 43  ? -4.124  -32.036 62.138 1.00 25.31 ? 43  THR A N   1 
ATOM   330  C CA  . THR A 1 43  ? -4.078  -33.340 62.797 1.00 26.35 ? 43  THR A CA  1 
ATOM   331  C C   . THR A 1 43  ? -4.679  -34.454 61.939 1.00 26.68 ? 43  THR A C   1 
ATOM   332  O O   . THR A 1 43  ? -5.642  -34.242 61.197 1.00 26.24 ? 43  THR A O   1 
ATOM   333  C CB  . THR A 1 43  ? -4.819  -33.317 64.143 1.00 28.83 ? 43  THR A CB  1 
ATOM   334  O OG1 . THR A 1 43  ? -6.014  -32.542 64.014 1.00 42.29 ? 43  THR A OG1 1 
ATOM   335  C CG2 . THR A 1 43  ? -3.948  -32.709 65.222 1.00 26.82 ? 43  THR A CG2 1 
ATOM   336  N N   . VAL A 1 44  ? -4.101  -35.644 62.045 1.00 23.47 ? 44  VAL A N   1 
ATOM   337  C CA  . VAL A 1 44  ? -4.578  -36.792 61.289 1.00 21.70 ? 44  VAL A CA  1 
ATOM   338  C C   . VAL A 1 44  ? -5.056  -37.845 62.287 1.00 23.26 ? 44  VAL A C   1 
ATOM   339  O O   . VAL A 1 44  ? -4.411  -38.080 63.309 1.00 21.82 ? 44  VAL A O   1 
ATOM   340  C CB  . VAL A 1 44  ? -3.459  -37.373 60.395 1.00 19.74 ? 44  VAL A CB  1 
ATOM   341  C CG1 . VAL A 1 44  ? -3.981  -38.551 59.608 1.00 19.49 ? 44  VAL A CG1 1 
ATOM   342  C CG2 . VAL A 1 44  ? -2.946  -36.309 59.446 1.00 11.86 ? 44  VAL A CG2 1 
ATOM   343  N N   . LYS A 1 45  ? -6.194  -38.466 61.985 1.00 26.76 ? 45  LYS A N   1 
ATOM   344  C CA  . LYS A 1 45  ? -6.803  -39.473 62.854 1.00 25.12 ? 45  LYS A CA  1 
ATOM   345  C C   . LYS A 1 45  ? -7.229  -40.708 62.081 1.00 22.01 ? 45  LYS A C   1 
ATOM   346  O O   . LYS A 1 45  ? -7.601  -40.617 60.917 1.00 23.28 ? 45  LYS A O   1 
ATOM   347  C CB  . LYS A 1 45  ? -8.063  -38.901 63.524 1.00 30.30 ? 45  LYS A CB  1 
ATOM   348  C CG  . LYS A 1 45  ? -7.822  -38.061 64.765 1.00 42.42 ? 45  LYS A CG  1 
ATOM   349  C CD  . LYS A 1 45  ? -7.281  -36.679 64.411 1.00 58.40 ? 45  LYS A CD  1 
ATOM   350  C CE  . LYS A 1 45  ? -8.110  -35.996 63.322 1.00 60.95 ? 45  LYS A CE  1 
ATOM   351  N NZ  . LYS A 1 45  ? -9.335  -35.383 63.896 1.00 64.64 ? 45  LYS A NZ  1 
ATOM   352  N N   . LEU A 1 46  ? -7.185  -41.863 62.737 1.00 21.11 ? 46  LEU A N   1 
ATOM   353  C CA  . LEU A 1 46  ? -7.634  -43.099 62.114 1.00 16.77 ? 46  LEU A CA  1 
ATOM   354  C C   . LEU A 1 46  ? -9.122  -43.124 62.407 1.00 19.45 ? 46  LEU A C   1 
ATOM   355  O O   . LEU A 1 46  ? -9.536  -42.995 63.557 1.00 22.16 ? 46  LEU A O   1 
ATOM   356  C CB  . LEU A 1 46  ? -6.982  -44.326 62.756 1.00 18.36 ? 46  LEU A CB  1 
ATOM   357  C CG  . LEU A 1 46  ? -6.823  -45.611 61.930 1.00 16.50 ? 46  LEU A CG  1 
ATOM   358  C CD1 . LEU A 1 46  ? -6.894  -46.807 62.847 1.00 19.26 ? 46  LEU A CD1 1 
ATOM   359  C CD2 . LEU A 1 46  ? -7.882  -45.709 60.872 1.00 17.81 ? 46  LEU A CD2 1 
ATOM   360  N N   . LEU A 1 47  ? -9.923  -43.280 61.365 1.00 22.20 ? 47  LEU A N   1 
ATOM   361  C CA  . LEU A 1 47  ? -11.365 -43.317 61.514 1.00 19.88 ? 47  LEU A CA  1 
ATOM   362  C C   . LEU A 1 47  ? -11.890 -44.751 61.477 1.00 21.24 ? 47  LEU A C   1 
ATOM   363  O O   . LEU A 1 47  ? -12.443 -45.247 62.453 1.00 20.65 ? 47  LEU A O   1 
ATOM   364  C CB  . LEU A 1 47  ? -12.015 -42.486 60.401 1.00 21.12 ? 47  LEU A CB  1 
ATOM   365  C CG  . LEU A 1 47  ? -11.827 -40.968 60.527 1.00 24.68 ? 47  LEU A CG  1 
ATOM   366  C CD1 . LEU A 1 47  ? -12.415 -40.262 59.320 1.00 30.00 ? 47  LEU A CD1 1 
ATOM   367  C CD2 . LEU A 1 47  ? -12.502 -40.477 61.800 1.00 24.90 ? 47  LEU A CD2 1 
ATOM   368  N N   . ILE A 1 48  ? -11.690 -45.415 60.347 1.00 21.11 ? 48  ILE A N   1 
ATOM   369  C CA  . ILE A 1 48  ? -12.166 -46.775 60.144 1.00 21.80 ? 48  ILE A CA  1 
ATOM   370  C C   . ILE A 1 48  ? -11.015 -47.654 59.687 1.00 20.82 ? 48  ILE A C   1 
ATOM   371  O O   . ILE A 1 48  ? -10.108 -47.178 59.015 1.00 21.23 ? 48  ILE A O   1 
ATOM   372  C CB  . ILE A 1 48  ? -13.272 -46.782 59.046 1.00 25.36 ? 48  ILE A CB  1 
ATOM   373  C CG1 . ILE A 1 48  ? -14.550 -46.141 59.595 1.00 22.30 ? 48  ILE A CG1 1 
ATOM   374  C CG2 . ILE A 1 48  ? -13.538 -48.194 58.544 1.00 22.49 ? 48  ILE A CG2 1 
ATOM   375  C CD1 . ILE A 1 48  ? -15.598 -45.879 58.535 1.00 32.14 ? 48  ILE A CD1 1 
ATOM   376  N N   . HIS A 1 49  ? -11.043 -48.930 60.058 1.00 21.78 ? 49  HIS A N   1 
ATOM   377  C CA  . HIS A 1 49  ? -10.000 -49.858 59.633 1.00 22.45 ? 49  HIS A CA  1 
ATOM   378  C C   . HIS A 1 49  ? -10.643 -51.169 59.196 1.00 20.61 ? 49  HIS A C   1 
ATOM   379  O O   . HIS A 1 49  ? -11.759 -51.481 59.603 1.00 28.27 ? 49  HIS A O   1 
ATOM   380  C CB  . HIS A 1 49  ? -8.950  -50.061 60.754 1.00 27.28 ? 49  HIS A CB  1 
ATOM   381  C CG  . HIS A 1 49  ? -9.362  -51.016 61.832 1.00 24.06 ? 49  HIS A CG  1 
ATOM   382  N ND1 . HIS A 1 49  ? -9.979  -50.606 62.993 1.00 22.57 ? 49  HIS A ND1 1 
ATOM   383  C CD2 . HIS A 1 49  ? -9.244  -52.363 61.925 1.00 25.14 ? 49  HIS A CD2 1 
ATOM   384  C CE1 . HIS A 1 49  ? -10.229 -51.657 63.752 1.00 20.59 ? 49  HIS A CE1 1 
ATOM   385  N NE2 . HIS A 1 49  ? -9.793  -52.736 63.126 1.00 23.89 ? 49  HIS A NE2 1 
ATOM   386  N N   . TYR A 1 50  ? -9.953  -51.927 58.352 1.00 24.65 ? 50  TYR A N   1 
ATOM   387  C CA  . TYR A 1 50  ? -10.486 -53.189 57.838 1.00 22.11 ? 50  TYR A CA  1 
ATOM   388  C C   . TYR A 1 50  ? -11.884 -52.975 57.244 1.00 24.19 ? 50  TYR A C   1 
ATOM   389  O O   . TYR A 1 50  ? -12.813 -53.751 57.484 1.00 21.65 ? 50  TYR A O   1 
ATOM   390  C CB  . TYR A 1 50  ? -10.541 -54.256 58.936 1.00 22.90 ? 50  TYR A CB  1 
ATOM   391  C CG  . TYR A 1 50  ? -10.586 -55.678 58.394 1.00 26.66 ? 50  TYR A CG  1 
ATOM   392  C CD1 . TYR A 1 50  ? -11.656 -56.532 58.689 1.00 23.24 ? 50  TYR A CD1 1 
ATOM   393  C CD2 . TYR A 1 50  ? -9.565  -56.163 57.567 1.00 23.71 ? 50  TYR A CD2 1 
ATOM   394  C CE1 . TYR A 1 50  ? -11.705 -57.838 58.170 1.00 21.63 ? 50  TYR A CE1 1 
ATOM   395  C CE2 . TYR A 1 50  ? -9.605  -57.464 57.046 1.00 20.30 ? 50  TYR A CE2 1 
ATOM   396  C CZ  . TYR A 1 50  ? -10.674 -58.291 57.353 1.00 23.84 ? 50  TYR A CZ  1 
ATOM   397  O OH  . TYR A 1 50  ? -10.697 -59.573 56.855 1.00 27.05 ? 50  TYR A OH  1 
ATOM   398  N N   . THR A 1 51  ? -12.008 -51.894 56.476 1.00 26.29 ? 51  THR A N   1 
ATOM   399  C CA  . THR A 1 51  ? -13.238 -51.511 55.788 1.00 19.01 ? 51  THR A CA  1 
ATOM   400  C C   . THR A 1 51  ? -14.375 -50.907 56.618 1.00 20.91 ? 51  THR A C   1 
ATOM   401  O O   . THR A 1 51  ? -14.879 -49.833 56.276 1.00 16.16 ? 51  THR A O   1 
ATOM   402  C CB  . THR A 1 51  ? -13.819 -52.691 54.983 1.00 16.08 ? 51  THR A CB  1 
ATOM   403  O OG1 . THR A 1 51  ? -12.823 -53.209 54.091 1.00 21.52 ? 51  THR A OG1 1 
ATOM   404  C CG2 . THR A 1 51  ? -15.005 -52.230 54.161 1.00 18.43 ? 51  THR A CG2 1 
ATOM   405  N N   . SER A 1 52  ? -14.774 -51.568 57.705 1.00 18.96 ? 52  SER A N   1 
ATOM   406  C CA  . SER A 1 52  ? -15.905 -51.067 58.492 1.00 22.11 ? 52  SER A CA  1 
ATOM   407  C C   . SER A 1 52  ? -15.749 -50.917 59.996 1.00 17.41 ? 52  SER A C   1 
ATOM   408  O O   . SER A 1 52  ? -16.658 -50.424 60.657 1.00 15.72 ? 52  SER A O   1 
ATOM   409  C CB  . SER A 1 52  ? -17.139 -51.938 58.228 1.00 23.26 ? 52  SER A CB  1 
ATOM   410  O OG  . SER A 1 52  ? -16.846 -53.309 58.458 1.00 26.00 ? 52  SER A OG  1 
ATOM   411  N N   . ARG A 1 53  ? -14.622 -51.346 60.547 1.00 19.43 ? 53  ARG A N   1 
ATOM   412  C CA  . ARG A 1 53  ? -14.423 -51.225 61.983 1.00 17.09 ? 53  ARG A CA  1 
ATOM   413  C C   . ARG A 1 53  ? -14.138 -49.775 62.381 1.00 21.31 ? 53  ARG A C   1 
ATOM   414  O O   . ARG A 1 53  ? -13.107 -49.206 62.003 1.00 23.94 ? 53  ARG A O   1 
ATOM   415  C CB  . ARG A 1 53  ? -13.268 -52.119 62.438 1.00 15.58 ? 53  ARG A CB  1 
ATOM   416  C CG  . ARG A 1 53  ? -13.340 -53.554 61.952 1.00 19.47 ? 53  ARG A CG  1 
ATOM   417  C CD  . ARG A 1 53  ? -14.619 -54.238 62.410 1.00 28.55 ? 53  ARG A CD  1 
ATOM   418  N NE  . ARG A 1 53  ? -15.113 -55.137 61.376 1.00 38.84 ? 53  ARG A NE  1 
ATOM   419  C CZ  . ARG A 1 53  ? -14.806 -56.427 61.307 1.00 41.74 ? 53  ARG A CZ  1 
ATOM   420  N NH1 . ARG A 1 53  ? -14.009 -56.966 62.216 1.00 50.88 ? 53  ARG A NH1 1 
ATOM   421  N NH2 . ARG A 1 53  ? -15.276 -57.173 60.318 1.00 40.31 ? 53  ARG A NH2 1 
ATOM   422  N N   . LEU A 1 54  ? -15.057 -49.173 63.131 1.00 21.41 ? 54  LEU A N   1 
ATOM   423  C CA  . LEU A 1 54  ? -14.870 -47.801 63.585 1.00 26.21 ? 54  LEU A CA  1 
ATOM   424  C C   . LEU A 1 54  ? -13.811 -47.828 64.680 1.00 29.32 ? 54  LEU A C   1 
ATOM   425  O O   . LEU A 1 54  ? -13.841 -48.687 65.565 1.00 33.48 ? 54  LEU A O   1 
ATOM   426  C CB  . LEU A 1 54  ? -16.173 -47.230 64.143 1.00 27.82 ? 54  LEU A CB  1 
ATOM   427  C CG  . LEU A 1 54  ? -16.926 -46.225 63.267 1.00 34.71 ? 54  LEU A CG  1 
ATOM   428  C CD1 . LEU A 1 54  ? -17.374 -46.894 61.972 1.00 36.75 ? 54  LEU A CD1 1 
ATOM   429  C CD2 . LEU A 1 54  ? -18.130 -45.693 64.028 1.00 36.12 ? 54  LEU A CD2 1 
ATOM   430  N N   . HIS A 1 55  ? -12.871 -46.893 64.612 1.00 27.78 ? 55  HIS A N   1 
ATOM   431  C CA  . HIS A 1 55  ? -11.789 -46.816 65.586 1.00 28.34 ? 55  HIS A CA  1 
ATOM   432  C C   . HIS A 1 55  ? -12.214 -46.121 66.883 1.00 24.07 ? 55  HIS A C   1 
ATOM   433  O O   . HIS A 1 55  ? -13.273 -45.496 66.952 1.00 23.58 ? 55  HIS A O   1 
ATOM   434  C CB  . HIS A 1 55  ? -10.593 -46.090 64.969 1.00 28.58 ? 55  HIS A CB  1 
ATOM   435  C CG  . HIS A 1 55  ? -9.349  -46.174 65.790 1.00 23.79 ? 55  HIS A CG  1 
ATOM   436  N ND1 . HIS A 1 55  ? -8.529  -45.090 66.010 1.00 32.02 ? 55  HIS A ND1 1 
ATOM   437  C CD2 . HIS A 1 55  ? -8.785  -47.212 66.451 1.00 28.50 ? 55  HIS A CD2 1 
ATOM   438  C CE1 . HIS A 1 55  ? -7.512  -45.454 66.771 1.00 27.35 ? 55  HIS A CE1 1 
ATOM   439  N NE2 . HIS A 1 55  ? -7.645  -46.737 67.052 1.00 30.15 ? 55  HIS A NE2 1 
ATOM   440  N N   . SER A 1 56  ? -11.379 -46.238 67.905 1.00 20.62 ? 56  SER A N   1 
ATOM   441  C CA  . SER A 1 56  ? -11.665 -45.647 69.201 1.00 27.46 ? 56  SER A CA  1 
ATOM   442  C C   . SER A 1 56  ? -11.995 -44.159 69.158 1.00 29.94 ? 56  SER A C   1 
ATOM   443  O O   . SER A 1 56  ? -11.258 -43.352 68.586 1.00 29.01 ? 56  SER A O   1 
ATOM   444  C CB  . SER A 1 56  ? -10.492 -45.890 70.151 1.00 25.59 ? 56  SER A CB  1 
ATOM   445  O OG  . SER A 1 56  ? -9.327  -45.214 69.714 1.00 40.69 ? 56  SER A OG  1 
ATOM   446  N N   . GLY A 1 57  ? -13.124 -43.809 69.762 1.00 31.21 ? 57  GLY A N   1 
ATOM   447  C CA  . GLY A 1 57  ? -13.533 -42.419 69.810 1.00 34.94 ? 57  GLY A CA  1 
ATOM   448  C C   . GLY A 1 57  ? -14.010 -41.774 68.524 1.00 35.97 ? 57  GLY A C   1 
ATOM   449  O O   . GLY A 1 57  ? -13.886 -40.559 68.362 1.00 42.58 ? 57  GLY A O   1 
ATOM   450  N N   . VAL A 1 58  ? -14.550 -42.563 67.603 1.00 32.68 ? 58  VAL A N   1 
ATOM   451  C CA  . VAL A 1 58  ? -15.055 -42.005 66.355 1.00 30.47 ? 58  VAL A CA  1 
ATOM   452  C C   . VAL A 1 58  ? -16.581 -42.003 66.417 1.00 31.40 ? 58  VAL A C   1 
ATOM   453  O O   . VAL A 1 58  ? -17.189 -42.990 66.829 1.00 33.54 ? 58  VAL A O   1 
ATOM   454  C CB  . VAL A 1 58  ? -14.595 -42.836 65.137 1.00 30.09 ? 58  VAL A CB  1 
ATOM   455  C CG1 . VAL A 1 58  ? -15.040 -42.162 63.839 1.00 27.86 ? 58  VAL A CG1 1 
ATOM   456  C CG2 . VAL A 1 58  ? -13.086 -42.990 65.160 1.00 28.36 ? 58  VAL A CG2 1 
ATOM   457  N N   . PRO A 1 59  ? -17.217 -40.880 66.041 1.00 27.73 ? 59  PRO A N   1 
ATOM   458  C CA  . PRO A 1 59  ? -18.681 -40.747 66.049 1.00 26.49 ? 59  PRO A CA  1 
ATOM   459  C C   . PRO A 1 59  ? -19.382 -41.837 65.234 1.00 30.94 ? 59  PRO A C   1 
ATOM   460  O O   . PRO A 1 59  ? -18.862 -42.301 64.221 1.00 33.93 ? 59  PRO A O   1 
ATOM   461  C CB  . PRO A 1 59  ? -18.926 -39.358 65.471 1.00 27.94 ? 59  PRO A CB  1 
ATOM   462  C CG  . PRO A 1 59  ? -17.625 -38.946 64.849 1.00 34.20 ? 59  PRO A CG  1 
ATOM   463  C CD  . PRO A 1 59  ? -16.551 -39.644 65.602 1.00 25.59 ? 59  PRO A CD  1 
ATOM   464  N N   . SER A 1 60  ? -20.572 -42.233 65.667 1.00 32.44 ? 60  SER A N   1 
ATOM   465  C CA  . SER A 1 60  ? -21.310 -43.290 64.985 1.00 37.63 ? 60  SER A CA  1 
ATOM   466  C C   . SER A 1 60  ? -21.841 -42.922 63.612 1.00 38.65 ? 60  SER A C   1 
ATOM   467  O O   . SER A 1 60  ? -22.304 -43.800 62.883 1.00 42.04 ? 60  SER A O   1 
ATOM   468  C CB  . SER A 1 60  ? -22.479 -43.752 65.848 1.00 39.40 ? 60  SER A CB  1 
ATOM   469  O OG  . SER A 1 60  ? -22.982 -42.670 66.605 1.00 44.17 ? 60  SER A OG  1 
ATOM   470  N N   . ARG A 1 61  ? -21.789 -41.638 63.259 1.00 37.13 ? 61  ARG A N   1 
ATOM   471  C CA  . ARG A 1 61  ? -22.286 -41.191 61.958 1.00 29.24 ? 61  ARG A CA  1 
ATOM   472  C C   . ARG A 1 61  ? -21.331 -41.578 60.832 1.00 25.82 ? 61  ARG A C   1 
ATOM   473  O O   . ARG A 1 61  ? -21.603 -41.352 59.656 1.00 25.99 ? 61  ARG A O   1 
ATOM   474  C CB  . ARG A 1 61  ? -22.525 -39.674 61.967 1.00 31.08 ? 61  ARG A CB  1 
ATOM   475  C CG  . ARG A 1 61  ? -21.306 -38.816 62.287 1.00 32.58 ? 61  ARG A CG  1 
ATOM   476  C CD  . ARG A 1 61  ? -21.536 -37.361 61.865 1.00 33.69 ? 61  ARG A CD  1 
ATOM   477  N NE  . ARG A 1 61  ? -21.267 -36.424 62.952 1.00 38.28 ? 61  ARG A NE  1 
ATOM   478  C CZ  . ARG A 1 61  ? -20.056 -36.168 63.432 1.00 36.29 ? 61  ARG A CZ  1 
ATOM   479  N NH1 . ARG A 1 61  ? -19.900 -35.305 64.421 1.00 39.15 ? 61  ARG A NH1 1 
ATOM   480  N NH2 . ARG A 1 61  ? -18.998 -36.774 62.917 1.00 44.62 ? 61  ARG A NH2 1 
ATOM   481  N N   . PHE A 1 62  ? -20.209 -42.179 61.203 1.00 24.40 ? 62  PHE A N   1 
ATOM   482  C CA  . PHE A 1 62  ? -19.229 -42.619 60.226 1.00 25.17 ? 62  PHE A CA  1 
ATOM   483  C C   . PHE A 1 62  ? -19.388 -44.117 59.967 1.00 23.32 ? 62  PHE A C   1 
ATOM   484  O O   . PHE A 1 62  ? -19.469 -44.910 60.903 1.00 22.92 ? 62  PHE A O   1 
ATOM   485  C CB  . PHE A 1 62  ? -17.815 -42.349 60.740 1.00 27.97 ? 62  PHE A CB  1 
ATOM   486  C CG  . PHE A 1 62  ? -17.352 -40.941 60.530 1.00 29.67 ? 62  PHE A CG  1 
ATOM   487  C CD1 . PHE A 1 62  ? -17.394 -40.021 61.572 1.00 30.87 ? 62  PHE A CD1 1 
ATOM   488  C CD2 . PHE A 1 62  ? -16.868 -40.535 59.296 1.00 22.82 ? 62  PHE A CD2 1 
ATOM   489  C CE1 . PHE A 1 62  ? -16.961 -38.719 61.386 1.00 27.38 ? 62  PHE A CE1 1 
ATOM   490  C CE2 . PHE A 1 62  ? -16.431 -39.235 59.101 1.00 26.47 ? 62  PHE A CE2 1 
ATOM   491  C CZ  . PHE A 1 62  ? -16.477 -38.326 60.146 1.00 25.54 ? 62  PHE A CZ  1 
ATOM   492  N N   . SER A 1 63  ? -19.435 -44.506 58.699 1.00 21.02 ? 63  SER A N   1 
ATOM   493  C CA  . SER A 1 63  ? -19.557 -45.919 58.369 1.00 24.76 ? 63  SER A CA  1 
ATOM   494  C C   . SER A 1 63  ? -18.838 -46.271 57.077 1.00 23.58 ? 63  SER A C   1 
ATOM   495  O O   . SER A 1 63  ? -18.725 -45.447 56.163 1.00 22.71 ? 63  SER A O   1 
ATOM   496  C CB  . SER A 1 63  ? -21.030 -46.327 58.268 1.00 30.43 ? 63  SER A CB  1 
ATOM   497  O OG  . SER A 1 63  ? -21.696 -45.659 57.211 1.00 30.95 ? 63  SER A OG  1 
ATOM   498  N N   . GLY A 1 64  ? -18.355 -47.506 57.011 1.00 17.95 ? 64  GLY A N   1 
ATOM   499  C CA  . GLY A 1 64  ? -17.652 -47.963 55.829 1.00 20.54 ? 64  GLY A CA  1 
ATOM   500  C C   . GLY A 1 64  ? -18.117 -49.322 55.323 1.00 21.56 ? 64  GLY A C   1 
ATOM   501  O O   . GLY A 1 64  ? -18.563 -50.185 56.085 1.00 19.67 ? 64  GLY A O   1 
ATOM   502  N N   . SER A 1 65  ? -18.012 -49.513 54.016 1.00 18.69 ? 65  SER A N   1 
ATOM   503  C CA  . SER A 1 65  ? -18.409 -50.765 53.409 1.00 15.69 ? 65  SER A CA  1 
ATOM   504  C C   . SER A 1 65  ? -17.549 -50.971 52.187 1.00 12.74 ? 65  SER A C   1 
ATOM   505  O O   . SER A 1 65  ? -16.882 -50.056 51.728 1.00 18.06 ? 65  SER A O   1 
ATOM   506  C CB  . SER A 1 65  ? -19.870 -50.697 52.999 1.00 15.44 ? 65  SER A CB  1 
ATOM   507  O OG  . SER A 1 65  ? -20.109 -49.484 52.324 1.00 30.64 ? 65  SER A OG  1 
ATOM   508  N N   . GLY A 1 66  ? -17.555 -52.184 51.662 1.00 16.98 ? 66  GLY A N   1 
ATOM   509  C CA  . GLY A 1 66  ? -16.770 -52.452 50.479 1.00 13.46 ? 66  GLY A CA  1 
ATOM   510  C C   . GLY A 1 66  ? -16.220 -53.857 50.450 1.00 17.73 ? 66  GLY A C   1 
ATOM   511  O O   . GLY A 1 66  ? -16.259 -54.576 51.449 1.00 19.99 ? 66  GLY A O   1 
ATOM   512  N N   . SER A 1 67  ? -15.711 -54.236 49.285 1.00 17.04 ? 67  SER A N   1 
ATOM   513  C CA  . SER A 1 67  ? -15.124 -55.541 49.067 1.00 17.97 ? 67  SER A CA  1 
ATOM   514  C C   . SER A 1 67  ? -14.431 -55.481 47.723 1.00 17.49 ? 67  SER A C   1 
ATOM   515  O O   . SER A 1 67  ? -14.668 -54.573 46.935 1.00 25.88 ? 67  SER A O   1 
ATOM   516  C CB  . SER A 1 67  ? -16.202 -56.620 49.052 1.00 22.87 ? 67  SER A CB  1 
ATOM   517  O OG  . SER A 1 67  ? -17.179 -56.347 48.063 1.00 36.47 ? 67  SER A OG  1 
ATOM   518  N N   . GLY A 1 68  ? -13.560 -56.446 47.467 1.00 26.94 ? 68  GLY A N   1 
ATOM   519  C CA  . GLY A 1 68  ? -12.843 -56.472 46.212 1.00 23.14 ? 68  GLY A CA  1 
ATOM   520  C C   . GLY A 1 68  ? -11.968 -55.251 46.029 1.00 24.62 ? 68  GLY A C   1 
ATOM   521  O O   . GLY A 1 68  ? -10.916 -55.126 46.664 1.00 24.35 ? 68  GLY A O   1 
ATOM   522  N N   . THR A 1 69  ? -12.408 -54.348 45.157 1.00 22.08 ? 69  THR A N   1 
ATOM   523  C CA  . THR A 1 69  ? -11.657 -53.131 44.863 1.00 22.70 ? 69  THR A CA  1 
ATOM   524  C C   . THR A 1 69  ? -12.517 -51.890 45.039 1.00 20.66 ? 69  THR A C   1 
ATOM   525  O O   . THR A 1 69  ? -12.058 -50.783 44.768 1.00 19.85 ? 69  THR A O   1 
ATOM   526  C CB  . THR A 1 69  ? -11.143 -53.123 43.402 1.00 26.77 ? 69  THR A CB  1 
ATOM   527  O OG1 . THR A 1 69  ? -12.261 -53.203 42.511 1.00 28.71 ? 69  THR A OG1 1 
ATOM   528  C CG2 . THR A 1 69  ? -10.203 -54.297 43.140 1.00 20.49 ? 69  THR A CG2 1 
ATOM   529  N N   . ASP A 1 70  ? -13.750 -52.080 45.506 1.00 20.21 ? 70  ASP A N   1 
ATOM   530  C CA  . ASP A 1 70  ? -14.708 -50.982 45.684 1.00 26.12 ? 70  ASP A CA  1 
ATOM   531  C C   . ASP A 1 70  ? -15.037 -50.664 47.130 1.00 21.57 ? 70  ASP A C   1 
ATOM   532  O O   . ASP A 1 70  ? -15.622 -51.485 47.822 1.00 20.17 ? 70  ASP A O   1 
ATOM   533  C CB  . ASP A 1 70  ? -16.013 -51.325 44.968 1.00 38.89 ? 70  ASP A CB  1 
ATOM   534  C CG  . ASP A 1 70  ? -16.516 -50.200 44.100 1.00 47.95 ? 70  ASP A CG  1 
ATOM   535  O OD1 . ASP A 1 70  ? -17.517 -50.421 43.382 1.00 57.42 ? 70  ASP A OD1 1 
ATOM   536  O OD2 . ASP A 1 70  ? -15.916 -49.101 44.135 1.00 56.17 ? 70  ASP A OD2 1 
ATOM   537  N N   . TYR A 1 71  ? -14.699 -49.458 47.574 1.00 20.14 ? 71  TYR A N   1 
ATOM   538  C CA  . TYR A 1 71  ? -14.958 -49.059 48.952 1.00 13.62 ? 71  TYR A CA  1 
ATOM   539  C C   . TYR A 1 71  ? -15.412 -47.611 49.046 1.00 21.52 ? 71  TYR A C   1 
ATOM   540  O O   . TYR A 1 71  ? -15.045 -46.778 48.218 1.00 15.78 ? 71  TYR A O   1 
ATOM   541  C CB  . TYR A 1 71  ? -13.689 -49.217 49.795 1.00 12.36 ? 71  TYR A CB  1 
ATOM   542  C CG  . TYR A 1 71  ? -13.110 -50.607 49.789 1.00 11.64 ? 71  TYR A CG  1 
ATOM   543  C CD1 . TYR A 1 71  ? -12.255 -51.017 48.773 1.00 8.50  ? 71  TYR A CD1 1 
ATOM   544  C CD2 . TYR A 1 71  ? -13.446 -51.526 50.785 1.00 17.10 ? 71  TYR A CD2 1 
ATOM   545  C CE1 . TYR A 1 71  ? -11.748 -52.308 48.744 1.00 9.06  ? 71  TYR A CE1 1 
ATOM   546  C CE2 . TYR A 1 71  ? -12.946 -52.820 50.768 1.00 11.36 ? 71  TYR A CE2 1 
ATOM   547  C CZ  . TYR A 1 71  ? -12.095 -53.206 49.746 1.00 10.01 ? 71  TYR A CZ  1 
ATOM   548  O OH  . TYR A 1 71  ? -11.563 -54.477 49.740 1.00 12.87 ? 71  TYR A OH  1 
ATOM   549  N N   . SER A 1 72  ? -16.205 -47.312 50.071 1.00 23.26 ? 72  SER A N   1 
ATOM   550  C CA  . SER A 1 72  ? -16.675 -45.955 50.293 1.00 24.58 ? 72  SER A CA  1 
ATOM   551  C C   . SER A 1 72  ? -16.858 -45.668 51.784 1.00 25.17 ? 72  SER A C   1 
ATOM   552  O O   . SER A 1 72  ? -16.983 -46.581 52.601 1.00 24.56 ? 72  SER A O   1 
ATOM   553  C CB  . SER A 1 72  ? -17.990 -45.710 49.546 1.00 29.30 ? 72  SER A CB  1 
ATOM   554  O OG  . SER A 1 72  ? -18.900 -46.771 49.742 1.00 27.12 ? 72  SER A OG  1 
ATOM   555  N N   . LEU A 1 73  ? -16.848 -44.387 52.129 1.00 24.14 ? 73  LEU A N   1 
ATOM   556  C CA  . LEU A 1 73  ? -17.036 -43.948 53.500 1.00 22.07 ? 73  LEU A CA  1 
ATOM   557  C C   . LEU A 1 73  ? -18.340 -43.168 53.480 1.00 19.30 ? 73  LEU A C   1 
ATOM   558  O O   . LEU A 1 73  ? -18.671 -42.551 52.481 1.00 20.16 ? 73  LEU A O   1 
ATOM   559  C CB  . LEU A 1 73  ? -15.876 -43.046 53.933 1.00 22.59 ? 73  LEU A CB  1 
ATOM   560  C CG  . LEU A 1 73  ? -15.968 -42.331 55.286 1.00 22.73 ? 73  LEU A CG  1 
ATOM   561  C CD1 . LEU A 1 73  ? -15.348 -43.195 56.375 1.00 22.93 ? 73  LEU A CD1 1 
ATOM   562  C CD2 . LEU A 1 73  ? -15.249 -40.995 55.201 1.00 22.10 ? 73  LEU A CD2 1 
ATOM   563  N N   . THR A 1 74  ? -19.089 -43.208 54.571 1.00 20.76 ? 74  THR A N   1 
ATOM   564  C CA  . THR A 1 74  ? -20.352 -42.486 54.620 1.00 23.51 ? 74  THR A CA  1 
ATOM   565  C C   . THR A 1 74  ? -20.537 -41.770 55.950 1.00 20.87 ? 74  THR A C   1 
ATOM   566  O O   . THR A 1 74  ? -20.288 -42.339 57.015 1.00 18.68 ? 74  THR A O   1 
ATOM   567  C CB  . THR A 1 74  ? -21.564 -43.443 54.417 1.00 24.18 ? 74  THR A CB  1 
ATOM   568  O OG1 . THR A 1 74  ? -21.527 -44.001 53.100 1.00 28.80 ? 74  THR A OG1 1 
ATOM   569  C CG2 . THR A 1 74  ? -22.874 -42.703 54.602 1.00 23.64 ? 74  THR A CG2 1 
ATOM   570  N N   . ILE A 1 75  ? -20.957 -40.511 55.869 1.00 22.78 ? 75  ILE A N   1 
ATOM   571  C CA  . ILE A 1 75  ? -21.245 -39.703 57.049 1.00 23.56 ? 75  ILE A CA  1 
ATOM   572  C C   . ILE A 1 75  ? -22.750 -39.466 56.924 1.00 20.64 ? 75  ILE A C   1 
ATOM   573  O O   . ILE A 1 75  ? -23.202 -38.819 55.986 1.00 15.60 ? 75  ILE A O   1 
ATOM   574  C CB  . ILE A 1 75  ? -20.490 -38.351 57.026 1.00 23.00 ? 75  ILE A CB  1 
ATOM   575  C CG1 . ILE A 1 75  ? -18.983 -38.599 56.930 1.00 25.26 ? 75  ILE A CG1 1 
ATOM   576  C CG2 . ILE A 1 75  ? -20.796 -37.558 58.292 1.00 17.46 ? 75  ILE A CG2 1 
ATOM   577  C CD1 . ILE A 1 75  ? -18.206 -37.464 56.272 1.00 29.18 ? 75  ILE A CD1 1 
ATOM   578  N N   . SER A 1 76  ? -23.516 -40.026 57.856 1.00 24.80 ? 76  SER A N   1 
ATOM   579  C CA  . SER A 1 76  ? -24.974 -39.918 57.849 1.00 25.77 ? 76  SER A CA  1 
ATOM   580  C C   . SER A 1 76  ? -25.503 -38.485 57.881 1.00 27.81 ? 76  SER A C   1 
ATOM   581  O O   . SER A 1 76  ? -26.381 -38.123 57.095 1.00 25.63 ? 76  SER A O   1 
ATOM   582  C CB  . SER A 1 76  ? -25.548 -40.708 59.025 1.00 21.87 ? 76  SER A CB  1 
ATOM   583  O OG  . SER A 1 76  ? -25.133 -40.148 60.255 1.00 27.56 ? 76  SER A OG  1 
ATOM   584  N N   . ASN A 1 77  ? -24.984 -37.681 58.804 1.00 28.64 ? 77  ASN A N   1 
ATOM   585  C CA  . ASN A 1 77  ? -25.391 -36.284 58.921 1.00 33.12 ? 77  ASN A CA  1 
ATOM   586  C C   . ASN A 1 77  ? -24.129 -35.443 58.995 1.00 27.85 ? 77  ASN A C   1 
ATOM   587  O O   . ASN A 1 77  ? -23.398 -35.512 59.981 1.00 29.81 ? 77  ASN A O   1 
ATOM   588  C CB  . ASN A 1 77  ? -26.222 -36.060 60.188 1.00 40.80 ? 77  ASN A CB  1 
ATOM   589  C CG  . ASN A 1 77  ? -27.396 -37.008 60.290 1.00 48.08 ? 77  ASN A CG  1 
ATOM   590  O OD1 . ASN A 1 77  ? -28.535 -36.644 59.985 1.00 55.33 ? 77  ASN A OD1 1 
ATOM   591  N ND2 . ASN A 1 77  ? -27.127 -38.234 60.724 1.00 50.21 ? 77  ASN A ND2 1 
ATOM   592  N N   . LEU A 1 78  ? -23.883 -34.649 57.957 1.00 23.35 ? 78  LEU A N   1 
ATOM   593  C CA  . LEU A 1 78  ? -22.695 -33.805 57.898 1.00 22.70 ? 78  LEU A CA  1 
ATOM   594  C C   . LEU A 1 78  ? -22.637 -32.740 58.989 1.00 27.70 ? 78  LEU A C   1 
ATOM   595  O O   . LEU A 1 78  ? -23.470 -31.834 59.030 1.00 28.66 ? 78  LEU A O   1 
ATOM   596  C CB  . LEU A 1 78  ? -22.606 -33.129 56.536 1.00 20.24 ? 78  LEU A CB  1 
ATOM   597  C CG  . LEU A 1 78  ? -21.244 -32.965 55.857 1.00 22.74 ? 78  LEU A CG  1 
ATOM   598  C CD1 . LEU A 1 78  ? -21.047 -31.499 55.526 1.00 20.99 ? 78  LEU A CD1 1 
ATOM   599  C CD2 . LEU A 1 78  ? -20.119 -33.475 56.738 1.00 15.64 ? 78  LEU A CD2 1 
ATOM   600  N N   . GLU A 1 79  ? -21.632 -32.861 59.856 1.00 29.78 ? 79  GLU A N   1 
ATOM   601  C CA  . GLU A 1 79  ? -21.401 -31.936 60.962 1.00 25.63 ? 79  GLU A CA  1 
ATOM   602  C C   . GLU A 1 79  ? -20.251 -30.979 60.640 1.00 23.57 ? 79  GLU A C   1 
ATOM   603  O O   . GLU A 1 79  ? -19.349 -31.309 59.873 1.00 22.11 ? 79  GLU A O   1 
ATOM   604  C CB  . GLU A 1 79  ? -21.053 -32.722 62.224 1.00 30.56 ? 79  GLU A CB  1 
ATOM   605  C CG  . GLU A 1 79  ? -22.136 -32.744 63.284 1.00 48.43 ? 79  GLU A CG  1 
ATOM   606  C CD  . GLU A 1 79  ? -23.495 -33.107 62.726 1.00 57.73 ? 79  GLU A CD  1 
ATOM   607  O OE1 . GLU A 1 79  ? -24.094 -32.265 62.018 1.00 62.74 ? 79  GLU A OE1 1 
ATOM   608  O OE2 . GLU A 1 79  ? -23.963 -34.236 63.000 1.00 64.61 ? 79  GLU A OE2 1 
ATOM   609  N N   . GLN A 1 80  ? -20.286 -29.795 61.240 1.00 23.46 ? 80  GLN A N   1 
ATOM   610  C CA  . GLN A 1 80  ? -19.253 -28.781 61.036 1.00 23.65 ? 80  GLN A CA  1 
ATOM   611  C C   . GLN A 1 80  ? -17.847 -29.332 61.261 1.00 23.38 ? 80  GLN A C   1 
ATOM   612  O O   . GLN A 1 80  ? -16.911 -29.016 60.527 1.00 19.94 ? 80  GLN A O   1 
ATOM   613  C CB  . GLN A 1 80  ? -19.487 -27.613 61.991 1.00 25.88 ? 80  GLN A CB  1 
ATOM   614  C CG  . GLN A 1 80  ? -19.374 -26.258 61.354 1.00 35.37 ? 80  GLN A CG  1 
ATOM   615  C CD  . GLN A 1 80  ? -20.066 -25.189 62.165 1.00 43.75 ? 80  GLN A CD  1 
ATOM   616  O OE1 . GLN A 1 80  ? -19.737 -24.968 63.328 1.00 44.73 ? 80  GLN A OE1 1 
ATOM   617  N NE2 . GLN A 1 80  ? -21.038 -24.519 61.554 1.00 53.02 ? 80  GLN A NE2 1 
ATOM   618  N N   . GLU A 1 81  ? -17.704 -30.154 62.289 1.00 23.05 ? 81  GLU A N   1 
ATOM   619  C CA  . GLU A 1 81  ? -16.417 -30.744 62.617 1.00 25.46 ? 81  GLU A CA  1 
ATOM   620  C C   . GLU A 1 81  ? -15.959 -31.755 61.567 1.00 23.20 ? 81  GLU A C   1 
ATOM   621  O O   . GLU A 1 81  ? -14.791 -32.136 61.541 1.00 23.77 ? 81  GLU A O   1 
ATOM   622  C CB  . GLU A 1 81  ? -16.493 -31.421 63.990 1.00 33.66 ? 81  GLU A CB  1 
ATOM   623  C CG  . GLU A 1 81  ? -17.183 -30.579 65.064 1.00 49.26 ? 81  GLU A CG  1 
ATOM   624  C CD  . GLU A 1 81  ? -18.705 -30.569 64.933 1.00 54.01 ? 81  GLU A CD  1 
ATOM   625  O OE1 . GLU A 1 81  ? -19.304 -31.664 64.853 1.00 55.06 ? 81  GLU A OE1 1 
ATOM   626  O OE2 . GLU A 1 81  ? -19.298 -29.465 64.914 1.00 55.35 ? 81  GLU A OE2 1 
ATOM   627  N N   . ASP A 1 82  ? -16.874 -32.184 60.701 1.00 20.99 ? 82  ASP A N   1 
ATOM   628  C CA  . ASP A 1 82  ? -16.550 -33.162 59.660 1.00 23.00 ? 82  ASP A CA  1 
ATOM   629  C C   . ASP A 1 82  ? -15.881 -32.540 58.433 1.00 23.54 ? 82  ASP A C   1 
ATOM   630  O O   . ASP A 1 82  ? -15.427 -33.249 57.523 1.00 16.02 ? 82  ASP A O   1 
ATOM   631  C CB  . ASP A 1 82  ? -17.814 -33.915 59.239 1.00 19.68 ? 82  ASP A CB  1 
ATOM   632  C CG  . ASP A 1 82  ? -18.495 -34.595 60.407 1.00 22.09 ? 82  ASP A CG  1 
ATOM   633  O OD1 . ASP A 1 82  ? -17.782 -34.971 61.364 1.00 20.73 ? 82  ASP A OD1 1 
ATOM   634  O OD2 . ASP A 1 82  ? -19.738 -34.747 60.374 1.00 21.19 ? 82  ASP A OD2 1 
ATOM   635  N N   . ILE A 1 83  ? -15.829 -31.211 58.414 1.00 22.36 ? 83  ILE A N   1 
ATOM   636  C CA  . ILE A 1 83  ? -15.201 -30.490 57.323 1.00 17.84 ? 83  ILE A CA  1 
ATOM   637  C C   . ILE A 1 83  ? -13.692 -30.748 57.394 1.00 23.49 ? 83  ILE A C   1 
ATOM   638  O O   . ILE A 1 83  ? -12.994 -30.224 58.266 1.00 20.80 ? 83  ILE A O   1 
ATOM   639  C CB  . ILE A 1 83  ? -15.500 -28.978 57.431 1.00 19.08 ? 83  ILE A CB  1 
ATOM   640  C CG1 . ILE A 1 83  ? -17.011 -28.740 57.328 1.00 18.07 ? 83  ILE A CG1 1 
ATOM   641  C CG2 . ILE A 1 83  ? -14.777 -28.215 56.338 1.00 20.01 ? 83  ILE A CG2 1 
ATOM   642  C CD1 . ILE A 1 83  ? -17.715 -29.550 56.234 1.00 16.44 ? 83  ILE A CD1 1 
ATOM   643  N N   . ALA A 1 84  ? -13.201 -31.572 56.471 1.00 26.19 ? 84  ALA A N   1 
ATOM   644  C CA  . ALA A 1 84  ? -11.787 -31.938 56.424 1.00 22.09 ? 84  ALA A CA  1 
ATOM   645  C C   . ALA A 1 84  ? -11.479 -32.714 55.141 1.00 18.92 ? 84  ALA A C   1 
ATOM   646  O O   . ALA A 1 84  ? -12.295 -32.756 54.221 1.00 21.90 ? 84  ALA A O   1 
ATOM   647  C CB  . ALA A 1 84  ? -11.438 -32.793 57.651 1.00 19.03 ? 84  ALA A CB  1 
ATOM   648  N N   . THR A 1 85  ? -10.300 -33.328 55.092 1.00 20.70 ? 85  THR A N   1 
ATOM   649  C CA  . THR A 1 85  ? -9.865  -34.119 53.941 1.00 16.47 ? 85  THR A CA  1 
ATOM   650  C C   . THR A 1 85  ? -9.692  -35.573 54.365 1.00 17.94 ? 85  THR A C   1 
ATOM   651  O O   . THR A 1 85  ? -9.025  -35.858 55.364 1.00 16.18 ? 85  THR A O   1 
ATOM   652  C CB  . THR A 1 85  ? -8.529  -33.614 53.402 1.00 17.70 ? 85  THR A CB  1 
ATOM   653  O OG1 . THR A 1 85  ? -8.676  -32.250 52.999 1.00 18.72 ? 85  THR A OG1 1 
ATOM   654  C CG2 . THR A 1 85  ? -8.075  -34.449 52.207 1.00 18.49 ? 85  THR A CG2 1 
ATOM   655  N N   . TYR A 1 86  ? -10.282 -36.489 53.599 1.00 13.10 ? 86  TYR A N   1 
ATOM   656  C CA  . TYR A 1 86  ? -10.205 -37.915 53.909 1.00 17.94 ? 86  TYR A CA  1 
ATOM   657  C C   . TYR A 1 86  ? -9.354  -38.690 52.912 1.00 16.83 ? 86  TYR A C   1 
ATOM   658  O O   . TYR A 1 86  ? -9.407  -38.444 51.703 1.00 20.61 ? 86  TYR A O   1 
ATOM   659  C CB  . TYR A 1 86  ? -11.620 -38.507 53.972 1.00 13.34 ? 86  TYR A CB  1 
ATOM   660  C CG  . TYR A 1 86  ? -12.520 -37.771 54.946 1.00 13.50 ? 86  TYR A CG  1 
ATOM   661  C CD1 . TYR A 1 86  ? -12.847 -38.325 56.183 1.00 16.09 ? 86  TYR A CD1 1 
ATOM   662  C CD2 . TYR A 1 86  ? -13.002 -36.494 54.652 1.00 12.68 ? 86  TYR A CD2 1 
ATOM   663  C CE1 . TYR A 1 86  ? -13.627 -37.621 57.113 1.00 14.33 ? 86  TYR A CE1 1 
ATOM   664  C CE2 . TYR A 1 86  ? -13.777 -35.781 55.569 1.00 10.78 ? 86  TYR A CE2 1 
ATOM   665  C CZ  . TYR A 1 86  ? -14.079 -36.346 56.797 1.00 17.01 ? 86  TYR A CZ  1 
ATOM   666  O OH  . TYR A 1 86  ? -14.774 -35.610 57.729 1.00 13.87 ? 86  TYR A OH  1 
ATOM   667  N N   . PHE A 1 87  ? -8.559  -39.618 53.438 1.00 18.35 ? 87  PHE A N   1 
ATOM   668  C CA  . PHE A 1 87  ? -7.677  -40.459 52.626 1.00 23.76 ? 87  PHE A CA  1 
ATOM   669  C C   . PHE A 1 87  ? -7.934  -41.935 52.912 1.00 22.87 ? 87  PHE A C   1 
ATOM   670  O O   . PHE A 1 87  ? -8.166  -42.318 54.057 1.00 23.17 ? 87  PHE A O   1 
ATOM   671  C CB  . PHE A 1 87  ? -6.198  -40.169 52.939 1.00 18.57 ? 87  PHE A CB  1 
ATOM   672  C CG  . PHE A 1 87  ? -5.797  -38.735 52.743 1.00 21.80 ? 87  PHE A CG  1 
ATOM   673  C CD1 . PHE A 1 87  ? -5.978  -37.800 53.759 1.00 20.77 ? 87  PHE A CD1 1 
ATOM   674  C CD2 . PHE A 1 87  ? -5.211  -38.321 51.552 1.00 18.89 ? 87  PHE A CD2 1 
ATOM   675  C CE1 . PHE A 1 87  ? -5.576  -36.471 53.593 1.00 15.68 ? 87  PHE A CE1 1 
ATOM   676  C CE2 . PHE A 1 87  ? -4.808  -36.994 51.381 1.00 23.39 ? 87  PHE A CE2 1 
ATOM   677  C CZ  . PHE A 1 87  ? -4.992  -36.071 52.404 1.00 18.17 ? 87  PHE A CZ  1 
ATOM   678  N N   . CYS A 1 88  ? -7.889  -42.764 51.874 1.00 27.09 ? 88  CYS A N   1 
ATOM   679  C CA  . CYS A 1 88  ? -8.077  -44.197 52.059 1.00 23.69 ? 88  CYS A CA  1 
ATOM   680  C C   . CYS A 1 88  ? -6.704  -44.841 51.876 1.00 20.23 ? 88  CYS A C   1 
ATOM   681  O O   . CYS A 1 88  ? -5.883  -44.338 51.110 1.00 19.93 ? 88  CYS A O   1 
ATOM   682  C CB  . CYS A 1 88  ? -9.088  -44.746 51.042 1.00 23.83 ? 88  CYS A CB  1 
ATOM   683  S SG  . CYS A 1 88  ? -8.643  -44.534 49.290 1.00 23.50 ? 88  CYS A SG  1 
ATOM   684  N N   . GLN A 1 89  ? -6.446  -45.933 52.590 1.00 18.99 ? 89  GLN A N   1 
ATOM   685  C CA  . GLN A 1 89  ? -5.155  -46.618 52.498 1.00 17.37 ? 89  GLN A CA  1 
ATOM   686  C C   . GLN A 1 89  ? -5.335  -48.127 52.465 1.00 19.05 ? 89  GLN A C   1 
ATOM   687  O O   . GLN A 1 89  ? -6.176  -48.662 53.175 1.00 14.50 ? 89  GLN A O   1 
ATOM   688  C CB  . GLN A 1 89  ? -4.276  -46.262 53.705 1.00 18.19 ? 89  GLN A CB  1 
ATOM   689  C CG  . GLN A 1 89  ? -2.902  -46.957 53.729 1.00 21.12 ? 89  GLN A CG  1 
ATOM   690  C CD  . GLN A 1 89  ? -2.689  -47.867 54.944 1.00 21.12 ? 89  GLN A CD  1 
ATOM   691  O OE1 . GLN A 1 89  ? -2.003  -48.888 54.850 1.00 25.02 ? 89  GLN A OE1 1 
ATOM   692  N NE2 . GLN A 1 89  ? -3.273  -47.500 56.084 1.00 15.21 ? 89  GLN A NE2 1 
ATOM   693  N N   . GLN A 1 90  ? -4.548  -48.816 51.642 1.00 21.62 ? 90  GLN A N   1 
ATOM   694  C CA  . GLN A 1 90  ? -4.637  -50.268 51.589 1.00 19.44 ? 90  GLN A CA  1 
ATOM   695  C C   . GLN A 1 90  ? -3.514  -50.879 52.421 1.00 16.55 ? 90  GLN A C   1 
ATOM   696  O O   . GLN A 1 90  ? -2.350  -50.474 52.336 1.00 12.92 ? 90  GLN A O   1 
ATOM   697  C CB  . GLN A 1 90  ? -4.585  -50.786 50.138 1.00 17.49 ? 90  GLN A CB  1 
ATOM   698  C CG  . GLN A 1 90  ? -3.262  -50.602 49.401 1.00 26.59 ? 90  GLN A CG  1 
ATOM   699  C CD  . GLN A 1 90  ? -2.197  -51.618 49.797 1.00 27.79 ? 90  GLN A CD  1 
ATOM   700  O OE1 . GLN A 1 90  ? -2.502  -52.701 50.301 1.00 24.77 ? 90  GLN A OE1 1 
ATOM   701  N NE2 . GLN A 1 90  ? -0.936  -51.265 49.567 1.00 21.93 ? 90  GLN A NE2 1 
ATOM   702  N N   . GLY A 1 91  ? -3.880  -51.845 53.251 1.00 17.25 ? 91  GLY A N   1 
ATOM   703  C CA  . GLY A 1 91  ? -2.897  -52.500 54.088 1.00 22.33 ? 91  GLY A CA  1 
ATOM   704  C C   . GLY A 1 91  ? -2.764  -53.964 53.736 1.00 20.60 ? 91  GLY A C   1 
ATOM   705  O O   . GLY A 1 91  ? -2.413  -54.785 54.577 1.00 23.28 ? 91  GLY A O   1 
ATOM   706  N N   . ASN A 1 92  ? -3.044  -54.285 52.481 1.00 25.30 ? 92  ASN A N   1 
ATOM   707  C CA  . ASN A 1 92  ? -2.963  -55.655 51.998 1.00 24.55 ? 92  ASN A CA  1 
ATOM   708  C C   . ASN A 1 92  ? -1.529  -56.103 51.697 1.00 29.34 ? 92  ASN A C   1 
ATOM   709  O O   . ASN A 1 92  ? -1.137  -57.200 52.079 1.00 35.68 ? 92  ASN A O   1 
ATOM   710  C CB  . ASN A 1 92  ? -3.834  -55.807 50.755 1.00 21.10 ? 92  ASN A CB  1 
ATOM   711  C CG  . ASN A 1 92  ? -4.022  -57.242 50.351 1.00 17.74 ? 92  ASN A CG  1 
ATOM   712  O OD1 . ASN A 1 92  ? -4.074  -58.137 51.190 1.00 20.93 ? 92  ASN A OD1 1 
ATOM   713  N ND2 . ASN A 1 92  ? -4.122  -57.473 49.055 1.00 30.19 ? 92  ASN A ND2 1 
ATOM   714  N N   . THR A 1 93  ? -0.750  -55.257 51.026 1.00 31.70 ? 93  THR A N   1 
ATOM   715  C CA  . THR A 1 93  ? 0.639   -55.585 50.682 1.00 32.55 ? 93  THR A CA  1 
ATOM   716  C C   . THR A 1 93  ? 1.525   -54.347 50.746 1.00 34.50 ? 93  THR A C   1 
ATOM   717  O O   . THR A 1 93  ? 1.037   -53.234 50.576 1.00 41.10 ? 93  THR A O   1 
ATOM   718  C CB  . THR A 1 93  ? 0.750   -56.113 49.240 1.00 34.49 ? 93  THR A CB  1 
ATOM   719  O OG1 . THR A 1 93  ? -0.559  -56.335 48.709 1.00 45.73 ? 93  THR A OG1 1 
ATOM   720  C CG2 . THR A 1 93  ? 1.538   -57.400 49.198 1.00 42.04 ? 93  THR A CG2 1 
ATOM   721  N N   . LEU A 1 94  ? 2.822   -54.531 50.984 1.00 29.56 ? 94  LEU A N   1 
ATOM   722  C CA  . LEU A 1 94  ? 3.738   -53.391 51.002 1.00 29.43 ? 94  LEU A CA  1 
ATOM   723  C C   . LEU A 1 94  ? 4.183   -53.182 49.562 1.00 26.35 ? 94  LEU A C   1 
ATOM   724  O O   . LEU A 1 94  ? 4.229   -54.131 48.785 1.00 31.21 ? 94  LEU A O   1 
ATOM   725  C CB  . LEU A 1 94  ? 4.978   -53.666 51.853 1.00 32.50 ? 94  LEU A CB  1 
ATOM   726  C CG  . LEU A 1 94  ? 4.817   -54.132 53.292 1.00 33.45 ? 94  LEU A CG  1 
ATOM   727  C CD1 . LEU A 1 94  ? 4.513   -55.614 53.296 1.00 41.22 ? 94  LEU A CD1 1 
ATOM   728  C CD2 . LEU A 1 94  ? 6.096   -53.844 54.064 1.00 37.40 ? 94  LEU A CD2 1 
ATOM   729  N N   . PRO A 1 95  ? 4.515   -51.938 49.183 1.00 23.59 ? 95  PRO A N   1 
ATOM   730  C CA  . PRO A 1 95  ? 4.488   -50.749 50.040 1.00 20.29 ? 95  PRO A CA  1 
ATOM   731  C C   . PRO A 1 95  ? 3.073   -50.259 50.302 1.00 18.20 ? 95  PRO A C   1 
ATOM   732  O O   . PRO A 1 95  ? 2.208   -50.336 49.428 1.00 21.79 ? 95  PRO A O   1 
ATOM   733  C CB  . PRO A 1 95  ? 5.276   -49.724 49.242 1.00 12.03 ? 95  PRO A CB  1 
ATOM   734  C CG  . PRO A 1 95  ? 4.999   -50.108 47.831 1.00 14.19 ? 95  PRO A CG  1 
ATOM   735  C CD  . PRO A 1 95  ? 4.971   -51.608 47.822 1.00 8.69  ? 95  PRO A CD  1 
ATOM   736  N N   . TRP A 1 96  ? 2.838   -49.755 51.505 1.00 21.68 ? 96  TRP A N   1 
ATOM   737  C CA  . TRP A 1 96  ? 1.527   -49.213 51.833 1.00 22.34 ? 96  TRP A CA  1 
ATOM   738  C C   . TRP A 1 96  ? 1.276   -48.085 50.820 1.00 22.31 ? 96  TRP A C   1 
ATOM   739  O O   . TRP A 1 96  ? 2.208   -47.359 50.456 1.00 19.47 ? 96  TRP A O   1 
ATOM   740  C CB  . TRP A 1 96  ? 1.534   -48.646 53.254 1.00 27.92 ? 96  TRP A CB  1 
ATOM   741  C CG  . TRP A 1 96  ? 1.936   -49.626 54.335 1.00 36.65 ? 96  TRP A CG  1 
ATOM   742  C CD1 . TRP A 1 96  ? 2.695   -49.360 55.450 1.00 36.90 ? 96  TRP A CD1 1 
ATOM   743  C CD2 . TRP A 1 96  ? 1.553   -51.004 54.435 1.00 38.16 ? 96  TRP A CD2 1 
ATOM   744  N NE1 . TRP A 1 96  ? 2.800   -50.485 56.233 1.00 32.51 ? 96  TRP A NE1 1 
ATOM   745  C CE2 . TRP A 1 96  ? 2.110   -51.508 55.636 1.00 35.53 ? 96  TRP A CE2 1 
ATOM   746  C CE3 . TRP A 1 96  ? 0.793   -51.862 53.629 1.00 39.22 ? 96  TRP A CE3 1 
ATOM   747  C CZ2 . TRP A 1 96  ? 1.929   -52.831 56.047 1.00 38.29 ? 96  TRP A CZ2 1 
ATOM   748  C CZ3 . TRP A 1 96  ? 0.614   -53.177 54.039 1.00 43.57 ? 96  TRP A CZ3 1 
ATOM   749  C CH2 . TRP A 1 96  ? 1.180   -53.649 55.240 1.00 43.17 ? 96  TRP A CH2 1 
ATOM   750  N N   . THR A 1 97  ? 0.038   -47.955 50.343 1.00 16.38 ? 97  THR A N   1 
ATOM   751  C CA  . THR A 1 97  ? -0.298  -46.909 49.379 1.00 14.01 ? 97  THR A CA  1 
ATOM   752  C C   . THR A 1 97  ? -1.597  -46.253 49.771 1.00 12.19 ? 97  THR A C   1 
ATOM   753  O O   . THR A 1 97  ? -2.513  -46.904 50.263 1.00 11.26 ? 97  THR A O   1 
ATOM   754  C CB  . THR A 1 97  ? -0.453  -47.449 47.956 1.00 15.89 ? 97  THR A CB  1 
ATOM   755  O OG1 . THR A 1 97  ? -1.349  -48.563 47.970 1.00 20.86 ? 97  THR A OG1 1 
ATOM   756  C CG2 . THR A 1 97  ? 0.898   -47.883 47.402 1.00 15.38 ? 97  THR A CG2 1 
ATOM   757  N N   . PHE A 1 98  ? -1.673  -44.952 49.539 1.00 12.10 ? 98  PHE A N   1 
ATOM   758  C CA  . PHE A 1 98  ? -2.846  -44.197 49.910 1.00 14.23 ? 98  PHE A CA  1 
ATOM   759  C C   . PHE A 1 98  ? -3.525  -43.603 48.688 1.00 18.33 ? 98  PHE A C   1 
ATOM   760  O O   . PHE A 1 98  ? -2.941  -43.528 47.611 1.00 13.69 ? 98  PHE A O   1 
ATOM   761  C CB  . PHE A 1 98  ? -2.442  -43.058 50.856 1.00 23.07 ? 98  PHE A CB  1 
ATOM   762  C CG  . PHE A 1 98  ? -1.789  -43.514 52.134 1.00 23.72 ? 98  PHE A CG  1 
ATOM   763  C CD1 . PHE A 1 98  ? -0.529  -44.102 52.122 1.00 26.32 ? 98  PHE A CD1 1 
ATOM   764  C CD2 . PHE A 1 98  ? -2.427  -43.327 53.358 1.00 25.34 ? 98  PHE A CD2 1 
ATOM   765  C CE1 . PHE A 1 98  ? 0.084   -44.496 53.306 1.00 26.90 ? 98  PHE A CE1 1 
ATOM   766  C CE2 . PHE A 1 98  ? -1.819  -43.718 54.553 1.00 22.83 ? 98  PHE A CE2 1 
ATOM   767  C CZ  . PHE A 1 98  ? -0.564  -44.302 54.525 1.00 26.72 ? 98  PHE A CZ  1 
ATOM   768  N N   . GLY A 1 99  ? -4.771  -43.184 48.869 1.00 17.87 ? 99  GLY A N   1 
ATOM   769  C CA  . GLY A 1 99  ? -5.493  -42.557 47.787 1.00 12.89 ? 99  GLY A CA  1 
ATOM   770  C C   . GLY A 1 99  ? -5.086  -41.102 47.838 1.00 16.33 ? 99  GLY A C   1 
ATOM   771  O O   . GLY A 1 99  ? -4.424  -40.683 48.791 1.00 17.49 ? 99  GLY A O   1 
ATOM   772  N N   . GLY A 1 100 ? -5.493  -40.329 46.837 1.00 15.40 ? 100 GLY A N   1 
ATOM   773  C CA  . GLY A 1 100 ? -5.123  -38.925 46.773 1.00 15.86 ? 100 GLY A CA  1 
ATOM   774  C C   . GLY A 1 100 ? -5.811  -37.980 47.729 1.00 15.80 ? 100 GLY A C   1 
ATOM   775  O O   . GLY A 1 100 ? -5.363  -36.847 47.907 1.00 16.67 ? 100 GLY A O   1 
ATOM   776  N N   . GLY A 1 101 ? -6.902  -38.436 48.332 1.00 22.62 ? 101 GLY A N   1 
ATOM   777  C CA  . GLY A 1 101 ? -7.639  -37.613 49.274 1.00 19.25 ? 101 GLY A CA  1 
ATOM   778  C C   . GLY A 1 101 ? -8.882  -36.968 48.692 1.00 20.88 ? 101 GLY A C   1 
ATOM   779  O O   . GLY A 1 101 ? -8.996  -36.778 47.480 1.00 17.12 ? 101 GLY A O   1 
ATOM   780  N N   . THR A 1 102 ? -9.821  -36.629 49.568 1.00 17.46 ? 102 THR A N   1 
ATOM   781  C CA  . THR A 1 102 ? -11.058 -35.981 49.158 1.00 18.02 ? 102 THR A CA  1 
ATOM   782  C C   . THR A 1 102 ? -11.336 -34.831 50.123 1.00 17.79 ? 102 THR A C   1 
ATOM   783  O O   . THR A 1 102 ? -11.555 -35.054 51.315 1.00 20.05 ? 102 THR A O   1 
ATOM   784  C CB  . THR A 1 102 ? -12.255 -36.979 49.183 1.00 16.56 ? 102 THR A CB  1 
ATOM   785  O OG1 . THR A 1 102 ? -12.126 -37.914 48.101 1.00 14.07 ? 102 THR A OG1 1 
ATOM   786  C CG2 . THR A 1 102 ? -13.585 -36.236 49.041 1.00 16.12 ? 102 THR A CG2 1 
ATOM   787  N N   . LYS A 1 103 ? -11.326 -33.606 49.608 1.00 14.08 ? 103 LYS A N   1 
ATOM   788  C CA  . LYS A 1 103 ? -11.581 -32.429 50.436 1.00 20.71 ? 103 LYS A CA  1 
ATOM   789  C C   . LYS A 1 103 ? -13.080 -32.134 50.591 1.00 23.64 ? 103 LYS A C   1 
ATOM   790  O O   . LYS A 1 103 ? -13.778 -31.945 49.600 1.00 23.46 ? 103 LYS A O   1 
ATOM   791  C CB  . LYS A 1 103 ? -10.883 -31.215 49.827 1.00 23.43 ? 103 LYS A CB  1 
ATOM   792  C CG  . LYS A 1 103 ? -10.925 -29.984 50.702 1.00 30.45 ? 103 LYS A CG  1 
ATOM   793  C CD  . LYS A 1 103 ? -10.294 -28.796 50.000 1.00 38.87 ? 103 LYS A CD  1 
ATOM   794  C CE  . LYS A 1 103 ? -10.450 -27.520 50.814 1.00 45.95 ? 103 LYS A CE  1 
ATOM   795  N NZ  . LYS A 1 103 ? -9.129  -26.997 51.287 1.00 54.90 ? 103 LYS A NZ  1 
ATOM   796  N N   . LEU A 1 104 ? -13.561 -32.099 51.836 1.00 24.96 ? 104 LEU A N   1 
ATOM   797  C CA  . LEU A 1 104 ? -14.969 -31.822 52.128 1.00 27.88 ? 104 LEU A CA  1 
ATOM   798  C C   . LEU A 1 104 ? -15.149 -30.348 52.445 1.00 33.07 ? 104 LEU A C   1 
ATOM   799  O O   . LEU A 1 104 ? -14.429 -29.796 53.277 1.00 35.98 ? 104 LEU A O   1 
ATOM   800  C CB  . LEU A 1 104 ? -15.450 -32.647 53.323 1.00 30.08 ? 104 LEU A CB  1 
ATOM   801  C CG  . LEU A 1 104 ? -16.722 -33.467 53.113 1.00 27.10 ? 104 LEU A CG  1 
ATOM   802  C CD1 . LEU A 1 104 ? -16.485 -34.459 51.995 1.00 31.01 ? 104 LEU A CD1 1 
ATOM   803  C CD2 . LEU A 1 104 ? -17.098 -34.200 54.382 1.00 30.98 ? 104 LEU A CD2 1 
ATOM   804  N N   . GLU A 1 105 ? -16.117 -29.715 51.790 1.00 34.75 ? 105 GLU A N   1 
ATOM   805  C CA  . GLU A 1 105 ? -16.372 -28.295 51.989 1.00 36.58 ? 105 GLU A CA  1 
ATOM   806  C C   . GLU A 1 105 ? -17.862 -28.007 52.042 1.00 35.42 ? 105 GLU A C   1 
ATOM   807  O O   . GLU A 1 105 ? -18.658 -28.797 51.560 1.00 36.95 ? 105 GLU A O   1 
ATOM   808  C CB  . GLU A 1 105 ? -15.744 -27.498 50.850 1.00 44.02 ? 105 GLU A CB  1 
ATOM   809  C CG  . GLU A 1 105 ? -14.807 -28.301 49.968 1.00 44.91 ? 105 GLU A CG  1 
ATOM   810  C CD  . GLU A 1 105 ? -13.991 -27.417 49.052 1.00 53.16 ? 105 GLU A CD  1 
ATOM   811  O OE1 . GLU A 1 105 ? -13.600 -27.889 47.961 1.00 62.72 ? 105 GLU A OE1 1 
ATOM   812  O OE2 . GLU A 1 105 ? -13.743 -26.249 49.424 1.00 43.88 ? 105 GLU A OE2 1 
ATOM   813  N N   . ILE A 1 106 ? -18.233 -26.865 52.610 1.00 34.86 ? 106 ILE A N   1 
ATOM   814  C CA  . ILE A 1 106 ? -19.641 -26.493 52.722 1.00 39.83 ? 106 ILE A CA  1 
ATOM   815  C C   . ILE A 1 106 ? -20.234 -25.860 51.460 1.00 45.49 ? 106 ILE A C   1 
ATOM   816  O O   . ILE A 1 106 ? -19.512 -25.319 50.625 1.00 47.40 ? 106 ILE A O   1 
ATOM   817  C CB  . ILE A 1 106 ? -19.860 -25.518 53.889 1.00 32.67 ? 106 ILE A CB  1 
ATOM   818  C CG1 . ILE A 1 106 ? -19.029 -25.961 55.094 1.00 39.80 ? 106 ILE A CG1 1 
ATOM   819  C CG2 . ILE A 1 106 ? -21.341 -25.442 54.230 1.00 32.54 ? 106 ILE A CG2 1 
ATOM   820  C CD1 . ILE A 1 106 ? -19.807 -26.729 56.160 1.00 41.56 ? 106 ILE A CD1 1 
ATOM   821  N N   . LYS A 1 107 ? -21.562 -25.936 51.354 1.00 52.28 ? 107 LYS A N   1 
ATOM   822  C CA  . LYS A 1 107 ? -22.345 -25.392 50.245 1.00 54.42 ? 107 LYS A CA  1 
ATOM   823  C C   . LYS A 1 107 ? -22.698 -26.454 49.217 1.00 57.32 ? 107 LYS A C   1 
ATOM   824  O O   . LYS A 1 107 ? -23.787 -27.050 49.341 1.00 57.77 ? 107 LYS A O   1 
ATOM   825  C CB  . LYS A 1 107 ? -21.607 -24.240 49.560 1.00 54.92 ? 107 LYS A CB  1 
ATOM   826  C CG  . LYS A 1 107 ? -21.635 -22.940 50.342 1.00 61.16 ? 107 LYS A CG  1 
ATOM   827  C CD  . LYS A 1 107 ? -22.320 -21.836 49.555 1.00 65.65 ? 107 LYS A CD  1 
ATOM   828  C CE  . LYS A 1 107 ? -21.548 -21.507 48.290 1.00 66.20 ? 107 LYS A CE  1 
ATOM   829  N NZ  . LYS A 1 107 ? -22.353 -20.662 47.370 1.00 73.43 ? 107 LYS A NZ  1 
ATOM   830  O OXT . LYS A 1 107 ? -21.887 -26.675 48.297 1.00 65.33 ? 107 LYS A OXT 1 
ATOM   831  N N   . GLN B 2 1   ? -1.321  -38.469 76.730 1.00 56.41 ? 301 GLN B N   1 
ATOM   832  C CA  . GLN B 2 1   ? -0.645  -39.801 76.786 1.00 59.55 ? 301 GLN B CA  1 
ATOM   833  C C   . GLN B 2 1   ? 0.330   -39.984 75.621 1.00 55.04 ? 301 GLN B C   1 
ATOM   834  O O   . GLN B 2 1   ? 1.273   -39.206 75.464 1.00 53.77 ? 301 GLN B O   1 
ATOM   835  C CB  . GLN B 2 1   ? -1.689  -40.925 76.773 1.00 62.55 ? 301 GLN B CB  1 
ATOM   836  C CG  . GLN B 2 1   ? -3.083  -40.490 76.338 1.00 73.14 ? 301 GLN B CG  1 
ATOM   837  C CD  . GLN B 2 1   ? -3.153  -40.098 74.873 1.00 76.60 ? 301 GLN B CD  1 
ATOM   838  O OE1 . GLN B 2 1   ? -3.040  -40.943 73.983 1.00 80.01 ? 301 GLN B OE1 1 
ATOM   839  N NE2 . GLN B 2 1   ? -3.344  -38.808 74.616 1.00 81.17 ? 301 GLN B NE2 1 
ATOM   840  N N   . VAL B 2 2   ? 0.104   -41.021 74.819 1.00 50.86 ? 302 VAL B N   1 
ATOM   841  C CA  . VAL B 2 2   ? 0.949   -41.303 73.668 1.00 48.51 ? 302 VAL B CA  1 
ATOM   842  C C   . VAL B 2 2   ? 0.871   -40.130 72.702 1.00 47.08 ? 302 VAL B C   1 
ATOM   843  O O   . VAL B 2 2   ? -0.218  -39.664 72.367 1.00 49.25 ? 302 VAL B O   1 
ATOM   844  C CB  . VAL B 2 2   ? 0.479   -42.583 72.937 1.00 49.07 ? 302 VAL B CB  1 
ATOM   845  C CG1 . VAL B 2 2   ? 0.719   -42.459 71.440 1.00 49.05 ? 302 VAL B CG1 1 
ATOM   846  C CG2 . VAL B 2 2   ? 1.216   -43.791 73.481 1.00 52.79 ? 302 VAL B CG2 1 
ATOM   847  N N   . GLN B 2 3   ? 2.025   -39.649 72.257 1.00 42.38 ? 303 GLN B N   1 
ATOM   848  C CA  . GLN B 2 3   ? 2.045   -38.538 71.322 1.00 37.93 ? 303 GLN B CA  1 
ATOM   849  C C   . GLN B 2 3   ? 3.399   -38.335 70.646 1.00 35.23 ? 303 GLN B C   1 
ATOM   850  O O   . GLN B 2 3   ? 4.464   -38.559 71.237 1.00 27.86 ? 303 GLN B O   1 
ATOM   851  C CB  . GLN B 2 3   ? 1.589   -37.249 72.018 1.00 34.74 ? 303 GLN B CB  1 
ATOM   852  C CG  . GLN B 2 3   ? 2.692   -36.447 72.652 1.00 43.78 ? 303 GLN B CG  1 
ATOM   853  C CD  . GLN B 2 3   ? 2.200   -35.118 73.176 1.00 52.75 ? 303 GLN B CD  1 
ATOM   854  O OE1 . GLN B 2 3   ? 1.859   -34.223 72.400 1.00 55.57 ? 303 GLN B OE1 1 
ATOM   855  N NE2 . GLN B 2 3   ? 2.155   -34.980 74.500 1.00 51.77 ? 303 GLN B NE2 1 
ATOM   856  N N   . LEU B 2 4   ? 3.331   -37.923 69.384 1.00 30.79 ? 304 LEU B N   1 
ATOM   857  C CA  . LEU B 2 4   ? 4.509   -37.684 68.572 1.00 24.52 ? 304 LEU B CA  1 
ATOM   858  C C   . LEU B 2 4   ? 4.616   -36.187 68.303 1.00 25.03 ? 304 LEU B C   1 
ATOM   859  O O   . LEU B 2 4   ? 3.648   -35.534 67.906 1.00 24.06 ? 304 LEU B O   1 
ATOM   860  C CB  . LEU B 2 4   ? 4.388   -38.469 67.265 1.00 17.88 ? 304 LEU B CB  1 
ATOM   861  C CG  . LEU B 2 4   ? 4.153   -39.974 67.430 1.00 16.43 ? 304 LEU B CG  1 
ATOM   862  C CD1 . LEU B 2 4   ? 3.884   -40.593 66.070 1.00 11.74 ? 304 LEU B CD1 1 
ATOM   863  C CD2 . LEU B 2 4   ? 5.379   -40.625 68.071 1.00 13.56 ? 304 LEU B CD2 1 
ATOM   864  N N   . GLN B 2 5   ? 5.801   -35.642 68.521 1.00 22.38 ? 305 GLN B N   1 
ATOM   865  C CA  . GLN B 2 5   ? 6.004   -34.223 68.327 1.00 20.86 ? 305 GLN B CA  1 
ATOM   866  C C   . GLN B 2 5   ? 7.077   -33.920 67.301 1.00 22.85 ? 305 GLN B C   1 
ATOM   867  O O   . GLN B 2 5   ? 8.227   -34.343 67.449 1.00 18.59 ? 305 GLN B O   1 
ATOM   868  C CB  . GLN B 2 5   ? 6.374   -33.575 69.662 1.00 23.10 ? 305 GLN B CB  1 
ATOM   869  C CG  . GLN B 2 5   ? 5.398   -33.892 70.778 1.00 31.98 ? 305 GLN B CG  1 
ATOM   870  C CD  . GLN B 2 5   ? 6.037   -33.861 72.149 1.00 36.41 ? 305 GLN B CD  1 
ATOM   871  O OE1 . GLN B 2 5   ? 6.789   -34.765 72.515 1.00 45.50 ? 305 GLN B OE1 1 
ATOM   872  N NE2 . GLN B 2 5   ? 5.737   -32.821 72.920 1.00 35.66 ? 305 GLN B NE2 1 
ATOM   873  N N   . GLN B 2 6   ? 6.691   -33.186 66.260 1.00 20.59 ? 306 GLN B N   1 
ATOM   874  C CA  . GLN B 2 6   ? 7.622   -32.786 65.218 1.00 20.37 ? 306 GLN B CA  1 
ATOM   875  C C   . GLN B 2 6   ? 7.594   -31.268 65.105 1.00 20.80 ? 306 GLN B C   1 
ATOM   876  O O   . GLN B 2 6   ? 6.609   -30.633 65.476 1.00 22.52 ? 306 GLN B O   1 
ATOM   877  C CB  . GLN B 2 6   ? 7.225   -33.366 63.847 1.00 16.14 ? 306 GLN B CB  1 
ATOM   878  C CG  . GLN B 2 6   ? 6.497   -34.687 63.856 1.00 20.09 ? 306 GLN B CG  1 
ATOM   879  C CD  . GLN B 2 6   ? 5.925   -35.038 62.492 1.00 20.52 ? 306 GLN B CD  1 
ATOM   880  O OE1 . GLN B 2 6   ? 6.662   -35.149 61.505 1.00 20.21 ? 306 GLN B OE1 1 
ATOM   881  N NE2 . GLN B 2 6   ? 4.604   -35.213 62.427 1.00 3.53  ? 306 GLN B NE2 1 
ATOM   882  N N   . PRO B 2 7   ? 8.697   -30.661 64.636 1.00 21.56 ? 307 PRO B N   1 
ATOM   883  C CA  . PRO B 2 7   ? 8.704   -29.201 64.485 1.00 20.64 ? 307 PRO B CA  1 
ATOM   884  C C   . PRO B 2 7   ? 7.724   -28.896 63.340 1.00 19.30 ? 307 PRO B C   1 
ATOM   885  O O   . PRO B 2 7   ? 7.592   -29.693 62.417 1.00 24.06 ? 307 PRO B O   1 
ATOM   886  C CB  . PRO B 2 7   ? 10.151  -28.882 64.121 1.00 17.06 ? 307 PRO B CB  1 
ATOM   887  C CG  . PRO B 2 7   ? 10.697  -30.149 63.566 1.00 22.60 ? 307 PRO B CG  1 
ATOM   888  C CD  . PRO B 2 7   ? 9.992   -31.263 64.278 1.00 21.86 ? 307 PRO B CD  1 
ATOM   889  N N   . GLY B 2 8   ? 7.046   -27.755 63.391 1.00 20.70 ? 308 GLY B N   1 
ATOM   890  C CA  . GLY B 2 8   ? 6.063   -27.432 62.368 1.00 17.07 ? 308 GLY B CA  1 
ATOM   891  C C   . GLY B 2 8   ? 6.531   -27.071 60.976 1.00 19.31 ? 308 GLY B C   1 
ATOM   892  O O   . GLY B 2 8   ? 5.780   -27.237 60.009 1.00 15.94 ? 308 GLY B O   1 
ATOM   893  N N   . ALA B 2 9   ? 7.758   -26.576 60.850 1.00 18.77 ? 309 ALA B N   1 
ATOM   894  C CA  . ALA B 2 9   ? 8.262   -26.188 59.537 1.00 19.00 ? 309 ALA B CA  1 
ATOM   895  C C   . ALA B 2 9   ? 9.776   -26.218 59.444 1.00 17.67 ? 309 ALA B C   1 
ATOM   896  O O   . ALA B 2 9   ? 10.472  -26.157 60.459 1.00 22.23 ? 309 ALA B O   1 
ATOM   897  C CB  . ALA B 2 9   ? 7.755   -24.798 59.182 1.00 14.48 ? 309 ALA B CB  1 
ATOM   898  N N   . GLU B 2 10  ? 10.269  -26.307 58.211 1.00 17.06 ? 310 GLU B N   1 
ATOM   899  C CA  . GLU B 2 10  ? 11.698  -26.330 57.926 1.00 16.28 ? 310 GLU B CA  1 
ATOM   900  C C   . GLU B 2 10  ? 11.982  -25.621 56.612 1.00 17.99 ? 310 GLU B C   1 
ATOM   901  O O   . GLU B 2 10  ? 11.462  -26.011 55.580 1.00 26.55 ? 310 GLU B O   1 
ATOM   902  C CB  . GLU B 2 10  ? 12.186  -27.767 57.833 1.00 19.20 ? 310 GLU B CB  1 
ATOM   903  C CG  . GLU B 2 10  ? 13.602  -27.960 58.336 1.00 37.10 ? 310 GLU B CG  1 
ATOM   904  C CD  . GLU B 2 10  ? 13.765  -27.656 59.823 1.00 35.64 ? 310 GLU B CD  1 
ATOM   905  O OE1 . GLU B 2 10  ? 13.309  -28.465 60.662 1.00 32.99 ? 310 GLU B OE1 1 
ATOM   906  O OE2 . GLU B 2 10  ? 14.360  -26.608 60.150 1.00 44.08 ? 310 GLU B OE2 1 
ATOM   907  N N   . LEU B 2 11  ? 12.799  -24.575 56.645 1.00 21.74 ? 311 LEU B N   1 
ATOM   908  C CA  . LEU B 2 11  ? 13.143  -23.842 55.428 1.00 23.96 ? 311 LEU B CA  1 
ATOM   909  C C   . LEU B 2 11  ? 14.509  -24.312 54.946 1.00 26.83 ? 311 LEU B C   1 
ATOM   910  O O   . LEU B 2 11  ? 15.519  -24.019 55.581 1.00 30.01 ? 311 LEU B O   1 
ATOM   911  C CB  . LEU B 2 11  ? 13.196  -22.342 55.707 1.00 27.42 ? 311 LEU B CB  1 
ATOM   912  C CG  . LEU B 2 11  ? 12.115  -21.472 55.067 1.00 31.07 ? 311 LEU B CG  1 
ATOM   913  C CD1 . LEU B 2 11  ? 12.149  -20.077 55.678 1.00 30.24 ? 311 LEU B CD1 1 
ATOM   914  C CD2 . LEU B 2 11  ? 12.342  -21.402 53.566 1.00 35.84 ? 311 LEU B CD2 1 
ATOM   915  N N   . VAL B 2 12  ? 14.546  -25.028 53.822 1.00 29.38 ? 312 VAL B N   1 
ATOM   916  C CA  . VAL B 2 12  ? 15.806  -25.559 53.294 1.00 28.17 ? 312 VAL B CA  1 
ATOM   917  C C   . VAL B 2 12  ? 16.212  -25.057 51.906 1.00 27.63 ? 312 VAL B C   1 
ATOM   918  O O   . VAL B 2 12  ? 15.375  -24.639 51.115 1.00 31.60 ? 312 VAL B O   1 
ATOM   919  C CB  . VAL B 2 12  ? 15.759  -27.098 53.250 1.00 26.92 ? 312 VAL B CB  1 
ATOM   920  C CG1 . VAL B 2 12  ? 15.780  -27.665 54.670 1.00 23.64 ? 312 VAL B CG1 1 
ATOM   921  C CG2 . VAL B 2 12  ? 14.513  -27.545 52.519 1.00 22.43 ? 312 VAL B CG2 1 
ATOM   922  N N   . LYS B 2 13  ? 17.510  -25.106 51.622 1.00 27.03 ? 313 LYS B N   1 
ATOM   923  C CA  . LYS B 2 13  ? 18.044  -24.668 50.333 1.00 24.93 ? 313 LYS B CA  1 
ATOM   924  C C   . LYS B 2 13  ? 18.246  -25.887 49.443 1.00 22.79 ? 313 LYS B C   1 
ATOM   925  O O   . LYS B 2 13  ? 18.646  -26.948 49.921 1.00 17.05 ? 313 LYS B O   1 
ATOM   926  C CB  . LYS B 2 13  ? 19.388  -23.965 50.530 1.00 28.87 ? 313 LYS B CB  1 
ATOM   927  C CG  . LYS B 2 13  ? 19.291  -22.572 51.111 1.00 36.98 ? 313 LYS B CG  1 
ATOM   928  C CD  . LYS B 2 13  ? 20.511  -21.748 50.756 1.00 43.91 ? 313 LYS B CD  1 
ATOM   929  C CE  . LYS B 2 13  ? 20.369  -20.321 51.249 1.00 50.13 ? 313 LYS B CE  1 
ATOM   930  N NZ  . LYS B 2 13  ? 20.702  -20.213 52.698 1.00 63.78 ? 313 LYS B NZ  1 
ATOM   931  N N   . PRO B 2 14  ? 17.969  -25.760 48.136 1.00 19.02 ? 314 PRO B N   1 
ATOM   932  C CA  . PRO B 2 14  ? 18.168  -26.940 47.286 1.00 18.65 ? 314 PRO B CA  1 
ATOM   933  C C   . PRO B 2 14  ? 19.610  -27.468 47.289 1.00 21.52 ? 314 PRO B C   1 
ATOM   934  O O   . PRO B 2 14  ? 20.565  -26.704 47.449 1.00 19.87 ? 314 PRO B O   1 
ATOM   935  C CB  . PRO B 2 14  ? 17.716  -26.479 45.903 1.00 16.88 ? 314 PRO B CB  1 
ATOM   936  C CG  . PRO B 2 14  ? 17.651  -24.986 45.971 1.00 13.04 ? 314 PRO B CG  1 
ATOM   937  C CD  . PRO B 2 14  ? 17.456  -24.600 47.390 1.00 13.35 ? 314 PRO B CD  1 
ATOM   938  N N   . GLY B 2 15  ? 19.747  -28.785 47.128 1.00 21.07 ? 315 GLY B N   1 
ATOM   939  C CA  . GLY B 2 15  ? 21.049  -29.420 47.096 1.00 9.29  ? 315 GLY B CA  1 
ATOM   940  C C   . GLY B 2 15  ? 21.569  -29.781 48.468 1.00 17.89 ? 315 GLY B C   1 
ATOM   941  O O   . GLY B 2 15  ? 22.432  -30.638 48.609 1.00 19.74 ? 315 GLY B O   1 
ATOM   942  N N   . THR B 2 16  ? 21.057  -29.129 49.499 1.00 20.45 ? 316 THR B N   1 
ATOM   943  C CA  . THR B 2 16  ? 21.530  -29.437 50.837 1.00 20.14 ? 316 THR B CA  1 
ATOM   944  C C   . THR B 2 16  ? 20.739  -30.591 51.427 1.00 20.49 ? 316 THR B C   1 
ATOM   945  O O   . THR B 2 16  ? 19.946  -31.225 50.735 1.00 17.59 ? 316 THR B O   1 
ATOM   946  C CB  . THR B 2 16  ? 21.452  -28.204 51.764 1.00 20.19 ? 316 THR B CB  1 
ATOM   947  O OG1 . THR B 2 16  ? 20.087  -27.937 52.121 1.00 29.15 ? 316 THR B OG1 1 
ATOM   948  C CG2 . THR B 2 16  ? 22.037  -26.998 51.058 1.00 24.50 ? 316 THR B CG2 1 
ATOM   949  N N   . SER B 2 17  ? 20.965  -30.869 52.705 1.00 19.42 ? 317 SER B N   1 
ATOM   950  C CA  . SER B 2 17  ? 20.277  -31.960 53.371 1.00 23.35 ? 317 SER B CA  1 
ATOM   951  C C   . SER B 2 17  ? 19.502  -31.480 54.602 1.00 19.70 ? 317 SER B C   1 
ATOM   952  O O   . SER B 2 17  ? 19.727  -30.376 55.092 1.00 19.49 ? 317 SER B O   1 
ATOM   953  C CB  . SER B 2 17  ? 21.296  -33.024 53.780 1.00 20.17 ? 317 SER B CB  1 
ATOM   954  O OG  . SER B 2 17  ? 20.826  -33.752 54.899 1.00 37.63 ? 317 SER B OG  1 
ATOM   955  N N   . VAL B 2 18  ? 18.578  -32.298 55.089 1.00 16.66 ? 318 VAL B N   1 
ATOM   956  C CA  . VAL B 2 18  ? 17.821  -31.930 56.279 1.00 18.74 ? 318 VAL B CA  1 
ATOM   957  C C   . VAL B 2 18  ? 17.404  -33.168 57.063 1.00 20.84 ? 318 VAL B C   1 
ATOM   958  O O   . VAL B 2 18  ? 17.114  -34.213 56.487 1.00 20.50 ? 318 VAL B O   1 
ATOM   959  C CB  . VAL B 2 18  ? 16.571  -31.084 55.931 1.00 18.00 ? 318 VAL B CB  1 
ATOM   960  C CG1 . VAL B 2 18  ? 15.528  -31.936 55.251 1.00 14.02 ? 318 VAL B CG1 1 
ATOM   961  C CG2 . VAL B 2 18  ? 16.000  -30.458 57.202 1.00 20.84 ? 318 VAL B CG2 1 
ATOM   962  N N   . LYS B 2 19  ? 17.402  -33.048 58.386 1.00 23.22 ? 319 LYS B N   1 
ATOM   963  C CA  . LYS B 2 19  ? 17.020  -34.157 59.253 1.00 24.02 ? 319 LYS B CA  1 
ATOM   964  C C   . LYS B 2 19  ? 15.794  -33.767 60.071 1.00 24.34 ? 319 LYS B C   1 
ATOM   965  O O   . LYS B 2 19  ? 15.849  -32.875 60.925 1.00 26.67 ? 319 LYS B O   1 
ATOM   966  C CB  . LYS B 2 19  ? 18.177  -34.522 60.186 1.00 26.23 ? 319 LYS B CB  1 
ATOM   967  C CG  . LYS B 2 19  ? 18.022  -35.855 60.897 1.00 24.92 ? 319 LYS B CG  1 
ATOM   968  C CD  . LYS B 2 19  ? 18.868  -35.888 62.152 1.00 30.69 ? 319 LYS B CD  1 
ATOM   969  C CE  . LYS B 2 19  ? 20.293  -36.323 61.848 1.00 35.78 ? 319 LYS B CE  1 
ATOM   970  N NZ  . LYS B 2 19  ? 20.745  -37.436 62.740 1.00 37.85 ? 319 LYS B NZ  1 
ATOM   971  N N   . LEU B 2 20  ? 14.683  -34.435 59.789 1.00 18.77 ? 320 LEU B N   1 
ATOM   972  C CA  . LEU B 2 20  ? 13.432  -34.178 60.480 1.00 16.68 ? 320 LEU B CA  1 
ATOM   973  C C   . LEU B 2 20  ? 13.375  -35.004 61.762 1.00 19.10 ? 320 LEU B C   1 
ATOM   974  O O   . LEU B 2 20  ? 13.838  -36.141 61.793 1.00 22.28 ? 320 LEU B O   1 
ATOM   975  C CB  . LEU B 2 20  ? 12.263  -34.520 59.546 1.00 15.75 ? 320 LEU B CB  1 
ATOM   976  C CG  . LEU B 2 20  ? 12.304  -33.766 58.203 1.00 18.71 ? 320 LEU B CG  1 
ATOM   977  C CD1 . LEU B 2 20  ? 11.206  -34.244 57.278 1.00 17.69 ? 320 LEU B CD1 1 
ATOM   978  C CD2 . LEU B 2 20  ? 12.159  -32.271 58.455 1.00 18.60 ? 320 LEU B CD2 1 
ATOM   979  N N   . SER B 2 21  ? 12.825  -34.435 62.828 1.00 17.93 ? 321 SER B N   1 
ATOM   980  C CA  . SER B 2 21  ? 12.737  -35.167 64.088 1.00 21.77 ? 321 SER B CA  1 
ATOM   981  C C   . SER B 2 21  ? 11.301  -35.514 64.456 1.00 17.39 ? 321 SER B C   1 
ATOM   982  O O   . SER B 2 21  ? 10.360  -34.836 64.043 1.00 17.51 ? 321 SER B O   1 
ATOM   983  C CB  . SER B 2 21  ? 13.392  -34.363 65.223 1.00 29.34 ? 321 SER B CB  1 
ATOM   984  O OG  . SER B 2 21  ? 12.457  -33.543 65.909 1.00 40.97 ? 321 SER B OG  1 
ATOM   985  N N   . CYS B 2 22  ? 11.151  -36.585 65.230 1.00 13.39 ? 322 CYS B N   1 
ATOM   986  C CA  . CYS B 2 22  ? 9.854   -37.066 65.687 1.00 13.74 ? 322 CYS B CA  1 
ATOM   987  C C   . CYS B 2 22  ? 10.079  -37.630 67.089 1.00 13.53 ? 322 CYS B C   1 
ATOM   988  O O   . CYS B 2 22  ? 10.640  -38.712 67.245 1.00 7.94  ? 322 CYS B O   1 
ATOM   989  C CB  . CYS B 2 22  ? 9.332   -38.156 64.726 1.00 19.01 ? 322 CYS B CB  1 
ATOM   990  S SG  . CYS B 2 22  ? 7.797   -39.046 65.195 1.00 18.15 ? 322 CYS B SG  1 
ATOM   991  N N   . LYS B 2 23  ? 9.661   -36.873 68.102 1.00 15.51 ? 323 LYS B N   1 
ATOM   992  C CA  . LYS B 2 23  ? 9.822   -37.269 69.500 1.00 23.22 ? 323 LYS B CA  1 
ATOM   993  C C   . LYS B 2 23  ? 8.579   -37.951 70.075 1.00 27.40 ? 323 LYS B C   1 
ATOM   994  O O   . LYS B 2 23  ? 7.508   -37.344 70.157 1.00 20.45 ? 323 LYS B O   1 
ATOM   995  C CB  . LYS B 2 23  ? 10.153  -36.044 70.352 1.00 31.44 ? 323 LYS B CB  1 
ATOM   996  C CG  . LYS B 2 23  ? 11.492  -36.116 71.062 1.00 41.41 ? 323 LYS B CG  1 
ATOM   997  C CD  . LYS B 2 23  ? 11.390  -36.905 72.356 1.00 45.86 ? 323 LYS B CD  1 
ATOM   998  C CE  . LYS B 2 23  ? 11.977  -36.122 73.522 1.00 49.44 ? 323 LYS B CE  1 
ATOM   999  N NZ  . LYS B 2 23  ? 13.140  -35.288 73.104 1.00 53.07 ? 323 LYS B NZ  1 
ATOM   1000 N N   . ALA B 2 24  ? 8.742   -39.210 70.483 1.00 32.42 ? 324 ALA B N   1 
ATOM   1001 C CA  . ALA B 2 24  ? 7.657   -40.014 71.046 1.00 32.79 ? 324 ALA B CA  1 
ATOM   1002 C C   . ALA B 2 24  ? 7.477   -39.717 72.531 1.00 33.93 ? 324 ALA B C   1 
ATOM   1003 O O   . ALA B 2 24  ? 8.456   -39.551 73.252 1.00 33.60 ? 324 ALA B O   1 
ATOM   1004 C CB  . ALA B 2 24  ? 7.956   -41.495 70.834 1.00 33.31 ? 324 ALA B CB  1 
ATOM   1005 N N   . SER B 2 25  ? 6.233   -39.685 72.998 1.00 38.48 ? 325 SER B N   1 
ATOM   1006 C CA  . SER B 2 25  ? 5.984   -39.361 74.397 1.00 44.76 ? 325 SER B CA  1 
ATOM   1007 C C   . SER B 2 25  ? 5.590   -40.456 75.386 1.00 45.38 ? 325 SER B C   1 
ATOM   1008 O O   . SER B 2 25  ? 6.451   -41.139 75.928 1.00 52.60 ? 325 SER B O   1 
ATOM   1009 C CB  . SER B 2 25  ? 4.957   -38.234 74.483 1.00 52.56 ? 325 SER B CB  1 
ATOM   1010 O OG  . SER B 2 25  ? 5.456   -37.152 75.249 1.00 57.29 ? 325 SER B OG  1 
ATOM   1011 N N   . GLY B 2 26  ? 4.291   -40.617 75.623 1.00 44.58 ? 326 GLY B N   1 
ATOM   1012 C CA  . GLY B 2 26  ? 3.823   -41.580 76.613 1.00 41.08 ? 326 GLY B CA  1 
ATOM   1013 C C   . GLY B 2 26  ? 3.709   -43.080 76.377 1.00 39.75 ? 326 GLY B C   1 
ATOM   1014 O O   . GLY B 2 26  ? 2.665   -43.664 76.670 1.00 42.29 ? 326 GLY B O   1 
ATOM   1015 N N   . TYR B 2 27  ? 4.764   -43.719 75.884 1.00 32.32 ? 327 TYR B N   1 
ATOM   1016 C CA  . TYR B 2 27  ? 4.722   -45.156 75.659 1.00 29.02 ? 327 TYR B CA  1 
ATOM   1017 C C   . TYR B 2 27  ? 6.124   -45.696 75.434 1.00 34.45 ? 327 TYR B C   1 
ATOM   1018 O O   . TYR B 2 27  ? 7.081   -44.928 75.341 1.00 37.86 ? 327 TYR B O   1 
ATOM   1019 C CB  . TYR B 2 27  ? 3.845   -45.483 74.454 1.00 26.38 ? 327 TYR B CB  1 
ATOM   1020 C CG  . TYR B 2 27  ? 4.503   -45.165 73.141 1.00 32.33 ? 327 TYR B CG  1 
ATOM   1021 C CD1 . TYR B 2 27  ? 4.969   -46.181 72.311 1.00 34.54 ? 327 TYR B CD1 1 
ATOM   1022 C CD2 . TYR B 2 27  ? 4.691   -43.847 72.739 1.00 29.96 ? 327 TYR B CD2 1 
ATOM   1023 C CE1 . TYR B 2 27  ? 5.612   -45.888 71.110 1.00 40.95 ? 327 TYR B CE1 1 
ATOM   1024 C CE2 . TYR B 2 27  ? 5.329   -43.542 71.547 1.00 34.14 ? 327 TYR B CE2 1 
ATOM   1025 C CZ  . TYR B 2 27  ? 5.791   -44.564 70.736 1.00 36.45 ? 327 TYR B CZ  1 
ATOM   1026 O OH  . TYR B 2 27  ? 6.457   -44.262 69.569 1.00 39.11 ? 327 TYR B OH  1 
ATOM   1027 N N   . ASN B 2 28  ? 6.238   -47.019 75.348 1.00 38.41 ? 328 ASN B N   1 
ATOM   1028 C CA  . ASN B 2 28  ? 7.526   -47.673 75.145 1.00 35.01 ? 328 ASN B CA  1 
ATOM   1029 C C   . ASN B 2 28  ? 7.992   -47.532 73.714 1.00 32.60 ? 328 ASN B C   1 
ATOM   1030 O O   . ASN B 2 28  ? 7.647   -48.345 72.861 1.00 34.10 ? 328 ASN B O   1 
ATOM   1031 C CB  . ASN B 2 28  ? 7.441   -49.157 75.500 1.00 41.68 ? 328 ASN B CB  1 
ATOM   1032 C CG  . ASN B 2 28  ? 8.812   -49.794 75.666 1.00 51.35 ? 328 ASN B CG  1 
ATOM   1033 O OD1 . ASN B 2 28  ? 9.846   -49.145 75.474 1.00 53.85 ? 328 ASN B OD1 1 
ATOM   1034 N ND2 . ASN B 2 28  ? 8.828   -51.072 76.026 1.00 57.79 ? 328 ASN B ND2 1 
ATOM   1035 N N   . PHE B 2 29  ? 8.784   -46.492 73.473 1.00 32.41 ? 329 PHE B N   1 
ATOM   1036 C CA  . PHE B 2 29  ? 9.337   -46.180 72.157 1.00 31.34 ? 329 PHE B CA  1 
ATOM   1037 C C   . PHE B 2 29  ? 9.948   -47.414 71.489 1.00 30.80 ? 329 PHE B C   1 
ATOM   1038 O O   . PHE B 2 29  ? 9.759   -47.660 70.298 1.00 33.25 ? 329 PHE B O   1 
ATOM   1039 C CB  . PHE B 2 29  ? 10.393  -45.088 72.328 1.00 29.78 ? 329 PHE B CB  1 
ATOM   1040 C CG  . PHE B 2 29  ? 10.963  -44.569 71.043 1.00 24.82 ? 329 PHE B CG  1 
ATOM   1041 C CD1 . PHE B 2 29  ? 10.145  -43.981 70.090 1.00 26.71 ? 329 PHE B CD1 1 
ATOM   1042 C CD2 . PHE B 2 29  ? 12.335  -44.633 70.806 1.00 25.94 ? 329 PHE B CD2 1 
ATOM   1043 C CE1 . PHE B 2 29  ? 10.688  -43.461 68.920 1.00 31.82 ? 329 PHE B CE1 1 
ATOM   1044 C CE2 . PHE B 2 29  ? 12.890  -44.118 69.641 1.00 21.73 ? 329 PHE B CE2 1 
ATOM   1045 C CZ  . PHE B 2 29  ? 12.068  -43.530 68.697 1.00 27.45 ? 329 PHE B CZ  1 
ATOM   1046 N N   . THR B 2 30  ? 10.669  -48.189 72.284 1.00 30.08 ? 330 THR B N   1 
ATOM   1047 C CA  . THR B 2 30  ? 11.340  -49.399 71.832 1.00 30.45 ? 330 THR B CA  1 
ATOM   1048 C C   . THR B 2 30  ? 10.393  -50.495 71.325 1.00 26.84 ? 330 THR B C   1 
ATOM   1049 O O   . THR B 2 30  ? 10.788  -51.348 70.538 1.00 26.13 ? 330 THR B O   1 
ATOM   1050 C CB  . THR B 2 30  ? 12.206  -49.970 73.003 1.00 31.61 ? 330 THR B CB  1 
ATOM   1051 O OG1 . THR B 2 30  ? 13.565  -49.545 72.846 1.00 42.58 ? 330 THR B OG1 1 
ATOM   1052 C CG2 . THR B 2 30  ? 12.156  -51.494 73.049 1.00 38.70 ? 330 THR B CG2 1 
ATOM   1053 N N   . SER B 2 31  ? 9.141   -50.453 71.759 1.00 26.68 ? 331 SER B N   1 
ATOM   1054 C CA  . SER B 2 31  ? 8.178   -51.487 71.409 1.00 27.90 ? 331 SER B CA  1 
ATOM   1055 C C   . SER B 2 31  ? 7.339   -51.350 70.143 1.00 29.80 ? 331 SER B C   1 
ATOM   1056 O O   . SER B 2 31  ? 6.631   -52.291 69.774 1.00 29.82 ? 331 SER B O   1 
ATOM   1057 C CB  . SER B 2 31  ? 7.236   -51.701 72.597 1.00 35.03 ? 331 SER B CB  1 
ATOM   1058 O OG  . SER B 2 31  ? 7.936   -52.198 73.726 1.00 40.88 ? 331 SER B OG  1 
ATOM   1059 N N   . TYR B 2 32  ? 7.398   -50.206 69.471 1.00 29.97 ? 332 TYR B N   1 
ATOM   1060 C CA  . TYR B 2 32  ? 6.579   -50.033 68.269 1.00 27.54 ? 332 TYR B CA  1 
ATOM   1061 C C   . TYR B 2 32  ? 7.269   -49.398 67.058 1.00 26.52 ? 332 TYR B C   1 
ATOM   1062 O O   . TYR B 2 32  ? 8.250   -48.662 67.178 1.00 25.80 ? 332 TYR B O   1 
ATOM   1063 C CB  . TYR B 2 32  ? 5.325   -49.216 68.601 1.00 25.74 ? 332 TYR B CB  1 
ATOM   1064 C CG  . TYR B 2 32  ? 4.570   -49.698 69.808 1.00 19.83 ? 332 TYR B CG  1 
ATOM   1065 C CD1 . TYR B 2 32  ? 4.921   -49.268 71.079 1.00 20.14 ? 332 TYR B CD1 1 
ATOM   1066 C CD2 . TYR B 2 32  ? 3.509   -50.591 69.680 1.00 20.87 ? 332 TYR B CD2 1 
ATOM   1067 C CE1 . TYR B 2 32  ? 4.241   -49.716 72.203 1.00 29.26 ? 332 TYR B CE1 1 
ATOM   1068 C CE2 . TYR B 2 32  ? 2.817   -51.048 70.795 1.00 24.50 ? 332 TYR B CE2 1 
ATOM   1069 C CZ  . TYR B 2 32  ? 3.191   -50.605 72.057 1.00 31.02 ? 332 TYR B CZ  1 
ATOM   1070 O OH  . TYR B 2 32  ? 2.521   -51.046 73.176 1.00 35.62 ? 332 TYR B OH  1 
ATOM   1071 N N   . TRP B 2 33  ? 6.710   -49.682 65.889 1.00 24.70 ? 333 TRP B N   1 
ATOM   1072 C CA  . TRP B 2 33  ? 7.222   -49.172 64.634 1.00 22.92 ? 333 TRP B CA  1 
ATOM   1073 C C   . TRP B 2 33  ? 6.876   -47.711 64.405 1.00 23.75 ? 333 TRP B C   1 
ATOM   1074 O O   . TRP B 2 33  ? 5.832   -47.222 64.848 1.00 23.06 ? 333 TRP B O   1 
ATOM   1075 C CB  . TRP B 2 33  ? 6.660   -49.987 63.480 1.00 24.40 ? 333 TRP B CB  1 
ATOM   1076 C CG  . TRP B 2 33  ? 7.668   -50.810 62.794 1.00 23.63 ? 333 TRP B CG  1 
ATOM   1077 C CD1 . TRP B 2 33  ? 8.573   -50.403 61.844 1.00 29.83 ? 333 TRP B CD1 1 
ATOM   1078 C CD2 . TRP B 2 33  ? 7.851   -52.204 62.951 1.00 17.27 ? 333 TRP B CD2 1 
ATOM   1079 N NE1 . TRP B 2 33  ? 9.311   -51.479 61.397 1.00 23.25 ? 333 TRP B NE1 1 
ATOM   1080 C CE2 . TRP B 2 33  ? 8.886   -52.598 62.061 1.00 21.98 ? 333 TRP B CE2 1 
ATOM   1081 C CE3 . TRP B 2 33  ? 7.244   -53.162 63.752 1.00 10.43 ? 333 TRP B CE3 1 
ATOM   1082 C CZ2 . TRP B 2 33  ? 9.319   -53.909 61.957 1.00 16.80 ? 333 TRP B CZ2 1 
ATOM   1083 C CZ3 . TRP B 2 33  ? 7.672   -54.458 63.648 1.00 29.27 ? 333 TRP B CZ3 1 
ATOM   1084 C CH2 . TRP B 2 33  ? 8.703   -54.828 62.755 1.00 25.84 ? 333 TRP B CH2 1 
ATOM   1085 N N   . ILE B 2 34  ? 7.761   -47.030 63.688 1.00 18.61 ? 334 ILE B N   1 
ATOM   1086 C CA  . ILE B 2 34  ? 7.577   -45.628 63.372 1.00 22.00 ? 334 ILE B CA  1 
ATOM   1087 C C   . ILE B 2 34  ? 7.469   -45.537 61.865 1.00 22.14 ? 334 ILE B C   1 
ATOM   1088 O O   . ILE B 2 34  ? 8.301   -46.089 61.149 1.00 21.21 ? 334 ILE B O   1 
ATOM   1089 C CB  . ILE B 2 34  ? 8.784   -44.764 63.846 1.00 26.02 ? 334 ILE B CB  1 
ATOM   1090 C CG1 . ILE B 2 34  ? 8.798   -44.663 65.379 1.00 20.18 ? 334 ILE B CG1 1 
ATOM   1091 C CG2 . ILE B 2 34  ? 8.712   -43.371 63.218 1.00 20.92 ? 334 ILE B CG2 1 
ATOM   1092 C CD1 . ILE B 2 34  ? 7.667   -43.814 65.974 1.00 15.22 ? 334 ILE B CD1 1 
ATOM   1093 N N   . ASN B 2 35  ? 6.432   -44.840 61.403 1.00 20.97 ? 335 ASN B N   1 
ATOM   1094 C CA  . ASN B 2 35  ? 6.160   -44.642 59.985 1.00 22.00 ? 335 ASN B CA  1 
ATOM   1095 C C   . ASN B 2 35  ? 6.404   -43.199 59.564 1.00 22.21 ? 335 ASN B C   1 
ATOM   1096 O O   . ASN B 2 35  ? 6.165   -42.273 60.337 1.00 24.53 ? 335 ASN B O   1 
ATOM   1097 C CB  . ASN B 2 35  ? 4.704   -44.972 59.681 1.00 17.54 ? 335 ASN B CB  1 
ATOM   1098 C CG  . ASN B 2 35  ? 4.437   -46.442 59.674 1.00 17.73 ? 335 ASN B CG  1 
ATOM   1099 O OD1 . ASN B 2 35  ? 4.657   -47.113 58.671 1.00 18.63 ? 335 ASN B OD1 1 
ATOM   1100 N ND2 . ASN B 2 35  ? 3.950   -46.961 60.794 1.00 20.53 ? 335 ASN B ND2 1 
ATOM   1101 N N   . TRP B 2 36  ? 6.872   -43.019 58.334 1.00 17.98 ? 336 TRP B N   1 
ATOM   1102 C CA  . TRP B 2 36  ? 7.105   -41.691 57.790 1.00 19.30 ? 336 TRP B CA  1 
ATOM   1103 C C   . TRP B 2 36  ? 6.375   -41.623 56.441 1.00 22.86 ? 336 TRP B C   1 
ATOM   1104 O O   . TRP B 2 36  ? 6.602   -42.463 55.562 1.00 20.48 ? 336 TRP B O   1 
ATOM   1105 C CB  . TRP B 2 36  ? 8.600   -41.448 57.584 1.00 16.47 ? 336 TRP B CB  1 
ATOM   1106 C CG  . TRP B 2 36  ? 9.374   -41.148 58.840 1.00 17.55 ? 336 TRP B CG  1 
ATOM   1107 C CD1 . TRP B 2 36  ? 10.096  -42.034 59.593 1.00 12.95 ? 336 TRP B CD1 1 
ATOM   1108 C CD2 . TRP B 2 36  ? 9.542   -39.866 59.459 1.00 17.94 ? 336 TRP B CD2 1 
ATOM   1109 N NE1 . TRP B 2 36  ? 10.703  -41.383 60.640 1.00 9.39  ? 336 TRP B NE1 1 
ATOM   1110 C CE2 . TRP B 2 36  ? 10.381  -40.052 60.584 1.00 14.63 ? 336 TRP B CE2 1 
ATOM   1111 C CE3 . TRP B 2 36  ? 9.067   -38.575 59.172 1.00 16.81 ? 336 TRP B CE3 1 
ATOM   1112 C CZ2 . TRP B 2 36  ? 10.754  -38.996 61.424 1.00 11.88 ? 336 TRP B CZ2 1 
ATOM   1113 C CZ3 . TRP B 2 36  ? 9.441   -37.524 60.007 1.00 10.27 ? 336 TRP B CZ3 1 
ATOM   1114 C CH2 . TRP B 2 36  ? 10.275  -37.742 61.119 1.00 16.62 ? 336 TRP B CH2 1 
ATOM   1115 N N   . VAL B 2 37  ? 5.485   -40.639 56.298 1.00 21.83 ? 337 VAL B N   1 
ATOM   1116 C CA  . VAL B 2 37  ? 4.717   -40.447 55.070 1.00 17.76 ? 337 VAL B CA  1 
ATOM   1117 C C   . VAL B 2 37  ? 4.909   -39.019 54.571 1.00 19.63 ? 337 VAL B C   1 
ATOM   1118 O O   . VAL B 2 37  ? 5.164   -38.105 55.357 1.00 19.79 ? 337 VAL B O   1 
ATOM   1119 C CB  . VAL B 2 37  ? 3.184   -40.691 55.278 1.00 17.46 ? 337 VAL B CB  1 
ATOM   1120 C CG1 . VAL B 2 37  ? 2.951   -41.909 56.152 1.00 24.18 ? 337 VAL B CG1 1 
ATOM   1121 C CG2 . VAL B 2 37  ? 2.537   -39.468 55.905 1.00 25.59 ? 337 VAL B CG2 1 
ATOM   1122 N N   . LYS B 2 38  ? 4.770   -38.840 53.262 1.00 15.46 ? 338 LYS B N   1 
ATOM   1123 C CA  . LYS B 2 38  ? 4.929   -37.541 52.629 1.00 13.28 ? 338 LYS B CA  1 
ATOM   1124 C C   . LYS B 2 38  ? 3.609   -37.115 51.979 1.00 20.48 ? 338 LYS B C   1 
ATOM   1125 O O   . LYS B 2 38  ? 2.952   -37.907 51.293 1.00 15.01 ? 338 LYS B O   1 
ATOM   1126 C CB  . LYS B 2 38  ? 6.049   -37.629 51.583 1.00 15.99 ? 338 LYS B CB  1 
ATOM   1127 C CG  . LYS B 2 38  ? 6.163   -36.447 50.634 1.00 10.39 ? 338 LYS B CG  1 
ATOM   1128 C CD  . LYS B 2 38  ? 6.992   -36.828 49.414 1.00 15.35 ? 338 LYS B CD  1 
ATOM   1129 C CE  . LYS B 2 38  ? 7.211   -35.638 48.490 1.00 16.41 ? 338 LYS B CE  1 
ATOM   1130 N NZ  . LYS B 2 38  ? 8.501   -35.760 47.780 1.00 15.67 ? 338 LYS B NZ  1 
ATOM   1131 N N   . LEU B 2 39  ? 3.214   -35.865 52.215 1.00 22.37 ? 339 LEU B N   1 
ATOM   1132 C CA  . LEU B 2 39  ? 1.984   -35.338 51.643 1.00 22.01 ? 339 LEU B CA  1 
ATOM   1133 C C   . LEU B 2 39  ? 2.198   -34.067 50.819 1.00 25.45 ? 339 LEU B C   1 
ATOM   1134 O O   . LEU B 2 39  ? 2.452   -32.997 51.367 1.00 25.96 ? 339 LEU B O   1 
ATOM   1135 C CB  . LEU B 2 39  ? 0.964   -35.057 52.747 1.00 14.33 ? 339 LEU B CB  1 
ATOM   1136 C CG  . LEU B 2 39  ? -0.372  -34.402 52.364 1.00 14.31 ? 339 LEU B CG  1 
ATOM   1137 C CD1 . LEU B 2 39  ? -0.934  -35.011 51.075 1.00 17.70 ? 339 LEU B CD1 1 
ATOM   1138 C CD2 . LEU B 2 39  ? -1.361  -34.588 53.507 1.00 12.37 ? 339 LEU B CD2 1 
ATOM   1139 N N   . ARG B 2 40  ? 2.120   -34.207 49.498 1.00 30.83 ? 340 ARG B N   1 
ATOM   1140 C CA  . ARG B 2 40  ? 2.239   -33.073 48.591 1.00 37.19 ? 340 ARG B CA  1 
ATOM   1141 C C   . ARG B 2 40  ? 0.780   -32.807 48.259 1.00 43.16 ? 340 ARG B C   1 
ATOM   1142 O O   . ARG B 2 40  ? 0.114   -33.672 47.701 1.00 39.79 ? 340 ARG B O   1 
ATOM   1143 C CB  . ARG B 2 40  ? 2.973   -33.453 47.299 1.00 43.08 ? 340 ARG B CB  1 
ATOM   1144 C CG  . ARG B 2 40  ? 4.451   -33.792 47.432 1.00 51.88 ? 340 ARG B CG  1 
ATOM   1145 C CD  . ARG B 2 40  ? 5.351   -32.633 47.001 1.00 58.59 ? 340 ARG B CD  1 
ATOM   1146 N NE  . ARG B 2 40  ? 5.453   -32.468 45.551 1.00 58.12 ? 340 ARG B NE  1 
ATOM   1147 C CZ  . ARG B 2 40  ? 5.995   -31.405 44.957 1.00 59.07 ? 340 ARG B CZ  1 
ATOM   1148 N NH1 . ARG B 2 40  ? 6.487   -30.409 45.684 1.00 55.17 ? 340 ARG B NH1 1 
ATOM   1149 N NH2 . ARG B 2 40  ? 6.041   -31.332 43.635 1.00 58.28 ? 340 ARG B NH2 1 
ATOM   1150 N N   . PRO B 2 41  ? 0.254   -31.623 48.615 1.00 54.35 ? 341 PRO B N   1 
ATOM   1151 C CA  . PRO B 2 41  ? -1.156  -31.321 48.319 1.00 57.43 ? 341 PRO B CA  1 
ATOM   1152 C C   . PRO B 2 41  ? -1.481  -31.422 46.827 1.00 59.73 ? 341 PRO B C   1 
ATOM   1153 O O   . PRO B 2 41  ? -0.852  -30.764 45.994 1.00 58.03 ? 341 PRO B O   1 
ATOM   1154 C CB  . PRO B 2 41  ? -1.348  -29.903 48.864 1.00 61.03 ? 341 PRO B CB  1 
ATOM   1155 C CG  . PRO B 2 41  ? -0.229  -29.721 49.859 1.00 62.23 ? 341 PRO B CG  1 
ATOM   1156 C CD  . PRO B 2 41  ? 0.925   -30.509 49.307 1.00 58.21 ? 341 PRO B CD  1 
ATOM   1157 N N   . GLY B 2 42  ? -2.464  -32.254 46.499 1.00 59.35 ? 342 GLY B N   1 
ATOM   1158 C CA  . GLY B 2 42  ? -2.837  -32.438 45.111 1.00 61.21 ? 342 GLY B CA  1 
ATOM   1159 C C   . GLY B 2 42  ? -1.968  -33.495 44.452 1.00 63.76 ? 342 GLY B C   1 
ATOM   1160 O O   . GLY B 2 42  ? -2.166  -33.853 43.292 1.00 65.53 ? 342 GLY B O   1 
ATOM   1161 N N   . GLN B 2 43  ? -0.994  -33.999 45.197 1.00 64.60 ? 343 GLN B N   1 
ATOM   1162 C CA  . GLN B 2 43  ? -0.096  -35.019 44.678 1.00 63.77 ? 343 GLN B CA  1 
ATOM   1163 C C   . GLN B 2 43  ? -0.044  -36.238 45.599 1.00 61.58 ? 343 GLN B C   1 
ATOM   1164 O O   . GLN B 2 43  ? 0.960   -36.951 45.645 1.00 67.13 ? 343 GLN B O   1 
ATOM   1165 C CB  . GLN B 2 43  ? 1.306   -34.435 44.490 1.00 68.26 ? 343 GLN B CB  1 
ATOM   1166 C CG  . GLN B 2 43  ? 1.364   -32.918 44.642 1.00 73.91 ? 343 GLN B CG  1 
ATOM   1167 C CD  . GLN B 2 43  ? 1.425   -32.197 43.315 1.00 78.16 ? 343 GLN B CD  1 
ATOM   1168 O OE1 . GLN B 2 43  ? 1.141   -32.775 42.266 1.00 81.41 ? 343 GLN B OE1 1 
ATOM   1169 N NE2 . GLN B 2 43  ? 1.797   -30.922 43.352 1.00 81.49 ? 343 GLN B NE2 1 
ATOM   1170 N N   . GLY B 2 44  ? -1.130  -36.450 46.340 1.00 55.14 ? 344 GLY B N   1 
ATOM   1171 C CA  . GLY B 2 44  ? -1.252  -37.595 47.235 1.00 47.46 ? 344 GLY B CA  1 
ATOM   1172 C C   . GLY B 2 44  ? -0.301  -37.859 48.400 1.00 42.91 ? 344 GLY B C   1 
ATOM   1173 O O   . GLY B 2 44  ? 0.763   -37.242 48.543 1.00 41.90 ? 344 GLY B O   1 
ATOM   1174 N N   . LEU B 2 45  ? -0.723  -38.809 49.236 1.00 34.95 ? 345 LEU B N   1 
ATOM   1175 C CA  . LEU B 2 45  ? 0.010   -39.259 50.419 1.00 27.45 ? 345 LEU B CA  1 
ATOM   1176 C C   . LEU B 2 45  ? 0.937   -40.408 50.021 1.00 24.53 ? 345 LEU B C   1 
ATOM   1177 O O   . LEU B 2 45  ? 0.528   -41.323 49.310 1.00 19.65 ? 345 LEU B O   1 
ATOM   1178 C CB  . LEU B 2 45  ? -0.979  -39.744 51.479 1.00 24.64 ? 345 LEU B CB  1 
ATOM   1179 C CG  . LEU B 2 45  ? -1.036  -38.980 52.800 1.00 23.79 ? 345 LEU B CG  1 
ATOM   1180 C CD1 . LEU B 2 45  ? -2.078  -39.611 53.705 1.00 10.25 ? 345 LEU B CD1 1 
ATOM   1181 C CD2 . LEU B 2 45  ? 0.336   -38.996 53.452 1.00 24.21 ? 345 LEU B CD2 1 
ATOM   1182 N N   . GLU B 2 46  ? 2.178   -40.383 50.492 1.00 23.09 ? 346 GLU B N   1 
ATOM   1183 C CA  . GLU B 2 46  ? 3.119   -41.427 50.112 1.00 21.71 ? 346 GLU B CA  1 
ATOM   1184 C C   . GLU B 2 46  ? 3.896   -41.996 51.276 1.00 21.95 ? 346 GLU B C   1 
ATOM   1185 O O   . GLU B 2 46  ? 4.529   -41.256 52.021 1.00 17.10 ? 346 GLU B O   1 
ATOM   1186 C CB  . GLU B 2 46  ? 4.117   -40.884 49.097 1.00 24.25 ? 346 GLU B CB  1 
ATOM   1187 C CG  . GLU B 2 46  ? 3.723   -41.041 47.647 1.00 21.85 ? 346 GLU B CG  1 
ATOM   1188 C CD  . GLU B 2 46  ? 4.745   -40.403 46.732 1.00 24.32 ? 346 GLU B CD  1 
ATOM   1189 O OE1 . GLU B 2 46  ? 5.300   -41.106 45.856 1.00 23.67 ? 346 GLU B OE1 1 
ATOM   1190 O OE2 . GLU B 2 46  ? 5.003   -39.193 46.904 1.00 24.53 ? 346 GLU B OE2 1 
ATOM   1191 N N   . TRP B 2 47  ? 3.863   -43.322 51.404 1.00 20.95 ? 347 TRP B N   1 
ATOM   1192 C CA  . TRP B 2 47  ? 4.575   -44.013 52.467 1.00 17.49 ? 347 TRP B CA  1 
ATOM   1193 C C   . TRP B 2 47  ? 6.055   -44.033 52.125 1.00 19.77 ? 347 TRP B C   1 
ATOM   1194 O O   . TRP B 2 47  ? 6.428   -44.469 51.042 1.00 20.64 ? 347 TRP B O   1 
ATOM   1195 C CB  . TRP B 2 47  ? 4.067   -45.450 52.603 1.00 14.42 ? 347 TRP B CB  1 
ATOM   1196 C CG  . TRP B 2 47  ? 4.807   -46.238 53.641 1.00 18.61 ? 347 TRP B CG  1 
ATOM   1197 C CD1 . TRP B 2 47  ? 4.794   -46.025 54.990 1.00 17.22 ? 347 TRP B CD1 1 
ATOM   1198 C CD2 . TRP B 2 47  ? 5.658   -47.370 53.424 1.00 17.12 ? 347 TRP B CD2 1 
ATOM   1199 N NE1 . TRP B 2 47  ? 5.580   -46.952 55.624 1.00 20.01 ? 347 TRP B NE1 1 
ATOM   1200 C CE2 . TRP B 2 47  ? 6.122   -47.793 54.689 1.00 18.13 ? 347 TRP B CE2 1 
ATOM   1201 C CE3 . TRP B 2 47  ? 6.073   -48.071 52.286 1.00 23.38 ? 347 TRP B CE3 1 
ATOM   1202 C CZ2 . TRP B 2 47  ? 6.982   -48.889 54.849 1.00 19.54 ? 347 TRP B CZ2 1 
ATOM   1203 C CZ3 . TRP B 2 47  ? 6.933   -49.165 52.447 1.00 23.04 ? 347 TRP B CZ3 1 
ATOM   1204 C CH2 . TRP B 2 47  ? 7.376   -49.560 53.720 1.00 16.42 ? 347 TRP B CH2 1 
ATOM   1205 N N   . ILE B 2 48  ? 6.898   -43.561 53.040 1.00 18.97 ? 348 ILE B N   1 
ATOM   1206 C CA  . ILE B 2 48  ? 8.337   -43.551 52.789 1.00 17.01 ? 348 ILE B CA  1 
ATOM   1207 C C   . ILE B 2 48  ? 9.005   -44.810 53.333 1.00 16.49 ? 348 ILE B C   1 
ATOM   1208 O O   . ILE B 2 48  ? 9.764   -45.472 52.623 1.00 15.78 ? 348 ILE B O   1 
ATOM   1209 C CB  . ILE B 2 48  ? 9.001   -42.289 53.406 1.00 19.93 ? 348 ILE B CB  1 
ATOM   1210 C CG1 . ILE B 2 48  ? 8.670   -41.063 52.546 1.00 14.90 ? 348 ILE B CG1 1 
ATOM   1211 C CG2 . ILE B 2 48  ? 10.512  -42.453 53.459 1.00 15.55 ? 348 ILE B CG2 1 
ATOM   1212 C CD1 . ILE B 2 48  ? 8.368   -39.835 53.334 1.00 13.70 ? 348 ILE B CD1 1 
ATOM   1213 N N   . GLY B 2 49  ? 8.710   -45.143 54.587 1.00 19.30 ? 349 GLY B N   1 
ATOM   1214 C CA  . GLY B 2 49  ? 9.293   -46.322 55.200 1.00 19.90 ? 349 GLY B CA  1 
ATOM   1215 C C   . GLY B 2 49  ? 8.953   -46.489 56.674 1.00 22.34 ? 349 GLY B C   1 
ATOM   1216 O O   . GLY B 2 49  ? 8.225   -45.679 57.245 1.00 20.83 ? 349 GLY B O   1 
ATOM   1217 N N   . ASP B 2 50  ? 9.495   -47.546 57.280 1.00 27.08 ? 350 ASP B N   1 
ATOM   1218 C CA  . ASP B 2 50  ? 9.286   -47.887 58.693 1.00 25.89 ? 350 ASP B CA  1 
ATOM   1219 C C   . ASP B 2 50  ? 10.629  -48.107 59.365 1.00 22.08 ? 350 ASP B C   1 
ATOM   1220 O O   . ASP B 2 50  ? 11.650  -48.236 58.695 1.00 26.94 ? 350 ASP B O   1 
ATOM   1221 C CB  . ASP B 2 50  ? 8.549   -49.216 58.833 1.00 34.29 ? 350 ASP B CB  1 
ATOM   1222 C CG  . ASP B 2 50  ? 7.147   -49.164 58.335 1.00 44.23 ? 350 ASP B CG  1 
ATOM   1223 O OD1 . ASP B 2 50  ? 6.722   -48.076 57.894 1.00 56.82 ? 350 ASP B OD1 1 
ATOM   1224 O OD2 . ASP B 2 50  ? 6.473   -50.217 58.387 1.00 48.95 ? 350 ASP B OD2 1 
ATOM   1225 N N   . ILE B 2 51  ? 10.605  -48.172 60.692 1.00 19.76 ? 351 ILE B N   1 
ATOM   1226 C CA  . ILE B 2 51  ? 11.790  -48.466 61.487 1.00 17.16 ? 351 ILE B CA  1 
ATOM   1227 C C   . ILE B 2 51  ? 11.345  -48.947 62.857 1.00 22.44 ? 351 ILE B C   1 
ATOM   1228 O O   . ILE B 2 51  ? 10.492  -48.323 63.498 1.00 19.65 ? 351 ILE B O   1 
ATOM   1229 C CB  . ILE B 2 51  ? 12.751  -47.250 61.653 1.00 20.48 ? 351 ILE B CB  1 
ATOM   1230 C CG1 . ILE B 2 51  ? 13.979  -47.688 62.460 1.00 16.52 ? 351 ILE B CG1 1 
ATOM   1231 C CG2 . ILE B 2 51  ? 12.058  -46.086 62.350 1.00 11.76 ? 351 ILE B CG2 1 
ATOM   1232 C CD1 . ILE B 2 51  ? 15.233  -46.905 62.172 1.00 7.83  ? 351 ILE B CD1 1 
ATOM   1233 N N   . TYR B 2 52  ? 11.887  -50.088 63.282 1.00 24.96 ? 352 TYR B N   1 
ATOM   1234 C CA  . TYR B 2 52  ? 11.568  -50.641 64.595 1.00 22.65 ? 352 TYR B CA  1 
ATOM   1235 C C   . TYR B 2 52  ? 12.715  -50.215 65.489 1.00 22.55 ? 352 TYR B C   1 
ATOM   1236 O O   . TYR B 2 52  ? 13.818  -50.739 65.385 1.00 26.38 ? 352 TYR B O   1 
ATOM   1237 C CB  . TYR B 2 52  ? 11.490  -52.165 64.554 1.00 23.14 ? 352 TYR B CB  1 
ATOM   1238 C CG  . TYR B 2 52  ? 11.050  -52.758 65.871 1.00 21.13 ? 352 TYR B CG  1 
ATOM   1239 C CD1 . TYR B 2 52  ? 9.823   -52.422 66.427 1.00 23.89 ? 352 TYR B CD1 1 
ATOM   1240 C CD2 . TYR B 2 52  ? 11.871  -53.636 66.573 1.00 27.15 ? 352 TYR B CD2 1 
ATOM   1241 C CE1 . TYR B 2 52  ? 9.421   -52.942 67.649 1.00 30.05 ? 352 TYR B CE1 1 
ATOM   1242 C CE2 . TYR B 2 52  ? 11.482  -54.164 67.796 1.00 26.54 ? 352 TYR B CE2 1 
ATOM   1243 C CZ  . TYR B 2 52  ? 10.255  -53.812 68.328 1.00 31.91 ? 352 TYR B CZ  1 
ATOM   1244 O OH  . TYR B 2 52  ? 9.857   -54.326 69.537 1.00 37.29 ? 352 TYR B OH  1 
ATOM   1245 N N   . PRO B 2 53  ? 12.463  -49.261 66.389 1.00 20.33 ? 353 PRO B N   1 
ATOM   1246 C CA  . PRO B 2 53  ? 13.469  -48.726 67.320 1.00 22.56 ? 353 PRO B CA  1 
ATOM   1247 C C   . PRO B 2 53  ? 14.190  -49.728 68.226 1.00 29.69 ? 353 PRO B C   1 
ATOM   1248 O O   . PRO B 2 53  ? 15.322  -49.488 68.643 1.00 32.17 ? 353 PRO B O   1 
ATOM   1249 C CB  . PRO B 2 53  ? 12.699  -47.674 68.124 1.00 24.88 ? 353 PRO B CB  1 
ATOM   1250 C CG  . PRO B 2 53  ? 11.463  -47.371 67.292 1.00 22.10 ? 353 PRO B CG  1 
ATOM   1251 C CD  . PRO B 2 53  ? 11.138  -48.646 66.574 1.00 16.14 ? 353 PRO B CD  1 
ATOM   1252 N N   . GLY B 2 54  ? 13.544  -50.847 68.531 1.00 29.52 ? 354 GLY B N   1 
ATOM   1253 C CA  . GLY B 2 54  ? 14.172  -51.833 69.389 1.00 31.07 ? 354 GLY B CA  1 
ATOM   1254 C C   . GLY B 2 54  ? 15.180  -52.735 68.700 1.00 32.37 ? 354 GLY B C   1 
ATOM   1255 O O   . GLY B 2 54  ? 15.930  -53.437 69.371 1.00 35.94 ? 354 GLY B O   1 
ATOM   1256 N N   . SER B 2 55  ? 15.203  -52.724 67.369 1.00 33.79 ? 355 SER B N   1 
ATOM   1257 C CA  . SER B 2 55  ? 16.126  -53.566 66.607 1.00 36.41 ? 355 SER B CA  1 
ATOM   1258 C C   . SER B 2 55  ? 16.898  -52.762 65.566 1.00 36.47 ? 355 SER B C   1 
ATOM   1259 O O   . SER B 2 55  ? 18.008  -53.127 65.168 1.00 31.04 ? 355 SER B O   1 
ATOM   1260 C CB  . SER B 2 55  ? 15.356  -54.684 65.909 1.00 42.00 ? 355 SER B CB  1 
ATOM   1261 O OG  . SER B 2 55  ? 14.976  -54.290 64.601 1.00 41.73 ? 355 SER B OG  1 
ATOM   1262 N N   . GLY B 2 56  ? 16.292  -51.666 65.123 1.00 35.91 ? 356 GLY B N   1 
ATOM   1263 C CA  . GLY B 2 56  ? 16.930  -50.811 64.142 1.00 32.19 ? 356 GLY B CA  1 
ATOM   1264 C C   . GLY B 2 56  ? 16.602  -51.183 62.716 1.00 29.90 ? 356 GLY B C   1 
ATOM   1265 O O   . GLY B 2 56  ? 16.950  -50.448 61.801 1.00 31.69 ? 356 GLY B O   1 
ATOM   1266 N N   . ILE B 2 57  ? 15.943  -52.322 62.520 1.00 28.76 ? 357 ILE B N   1 
ATOM   1267 C CA  . ILE B 2 57  ? 15.584  -52.758 61.176 1.00 27.52 ? 357 ILE B CA  1 
ATOM   1268 C C   . ILE B 2 57  ? 14.607  -51.761 60.560 1.00 29.28 ? 357 ILE B C   1 
ATOM   1269 O O   . ILE B 2 57  ? 13.736  -51.220 61.246 1.00 27.99 ? 357 ILE B O   1 
ATOM   1270 C CB  . ILE B 2 57  ? 14.937  -54.180 61.169 1.00 28.53 ? 357 ILE B CB  1 
ATOM   1271 C CG1 . ILE B 2 57  ? 13.580  -54.151 61.863 1.00 33.10 ? 357 ILE B CG1 1 
ATOM   1272 C CG2 . ILE B 2 57  ? 15.842  -55.181 61.854 1.00 22.19 ? 357 ILE B CG2 1 
ATOM   1273 C CD1 . ILE B 2 57  ? 12.469  -54.738 61.024 1.00 40.70 ? 357 ILE B CD1 1 
ATOM   1274 N N   . THR B 2 58  ? 14.760  -51.523 59.261 1.00 30.77 ? 358 THR B N   1 
ATOM   1275 C CA  . THR B 2 58  ? 13.911  -50.578 58.549 1.00 31.66 ? 358 THR B CA  1 
ATOM   1276 C C   . THR B 2 58  ? 13.317  -51.191 57.295 1.00 32.79 ? 358 THR B C   1 
ATOM   1277 O O   . THR B 2 58  ? 13.822  -52.186 56.774 1.00 36.98 ? 358 THR B O   1 
ATOM   1278 C CB  . THR B 2 58  ? 14.703  -49.336 58.090 1.00 30.93 ? 358 THR B CB  1 
ATOM   1279 O OG1 . THR B 2 58  ? 15.831  -49.760 57.318 1.00 35.05 ? 358 THR B OG1 1 
ATOM   1280 C CG2 . THR B 2 58  ? 15.187  -48.519 59.277 1.00 32.80 ? 358 THR B CG2 1 
ATOM   1281 N N   . ASN B 2 59  ? 12.238  -50.582 56.819 1.00 27.72 ? 359 ASN B N   1 
ATOM   1282 C CA  . ASN B 2 59  ? 11.590  -51.012 55.590 1.00 28.60 ? 359 ASN B CA  1 
ATOM   1283 C C   . ASN B 2 59  ? 11.421  -49.737 54.775 1.00 26.67 ? 359 ASN B C   1 
ATOM   1284 O O   . ASN B 2 59  ? 10.973  -48.719 55.299 1.00 23.73 ? 359 ASN B O   1 
ATOM   1285 C CB  . ASN B 2 59  ? 10.238  -51.650 55.885 1.00 35.64 ? 359 ASN B CB  1 
ATOM   1286 C CG  . ASN B 2 59  ? 10.365  -53.067 56.393 1.00 35.69 ? 359 ASN B CG  1 
ATOM   1287 O OD1 . ASN B 2 59  ? 9.379   -53.799 56.470 1.00 47.05 ? 359 ASN B OD1 1 
ATOM   1288 N ND2 . ASN B 2 59  ? 11.581  -53.464 56.747 1.00 44.01 ? 359 ASN B ND2 1 
ATOM   1289 N N   . TYR B 2 60  ? 11.798  -49.789 53.502 1.00 23.74 ? 360 TYR B N   1 
ATOM   1290 C CA  . TYR B 2 60  ? 11.719  -48.617 52.638 1.00 25.63 ? 360 TYR B CA  1 
ATOM   1291 C C   . TYR B 2 60  ? 10.859  -48.793 51.408 1.00 25.62 ? 360 TYR B C   1 
ATOM   1292 O O   . TYR B 2 60  ? 10.760  -49.884 50.849 1.00 30.16 ? 360 TYR B O   1 
ATOM   1293 C CB  . TYR B 2 60  ? 13.112  -48.221 52.121 1.00 24.24 ? 360 TYR B CB  1 
ATOM   1294 C CG  . TYR B 2 60  ? 14.035  -47.579 53.119 1.00 20.68 ? 360 TYR B CG  1 
ATOM   1295 C CD1 . TYR B 2 60  ? 14.983  -48.338 53.792 1.00 25.25 ? 360 TYR B CD1 1 
ATOM   1296 C CD2 . TYR B 2 60  ? 13.978  -46.212 53.377 1.00 20.68 ? 360 TYR B CD2 1 
ATOM   1297 C CE1 . TYR B 2 60  ? 15.860  -47.759 54.702 1.00 33.35 ? 360 TYR B CE1 1 
ATOM   1298 C CE2 . TYR B 2 60  ? 14.852  -45.616 54.288 1.00 26.03 ? 360 TYR B CE2 1 
ATOM   1299 C CZ  . TYR B 2 60  ? 15.792  -46.401 54.946 1.00 31.77 ? 360 TYR B CZ  1 
ATOM   1300 O OH  . TYR B 2 60  ? 16.674  -45.847 55.838 1.00 25.86 ? 360 TYR B OH  1 
ATOM   1301 N N   . ASN B 2 61  ? 10.246  -47.697 50.982 1.00 26.30 ? 361 ASN B N   1 
ATOM   1302 C CA  . ASN B 2 61  ? 9.491   -47.704 49.746 1.00 22.04 ? 361 ASN B CA  1 
ATOM   1303 C C   . ASN B 2 61  ? 10.685  -47.548 48.812 1.00 23.42 ? 361 ASN B C   1 
ATOM   1304 O O   . ASN B 2 61  ? 11.401  -46.553 48.906 1.00 22.29 ? 361 ASN B O   1 
ATOM   1305 C CB  . ASN B 2 61  ? 8.597   -46.471 49.655 1.00 21.01 ? 361 ASN B CB  1 
ATOM   1306 C CG  . ASN B 2 61  ? 7.770   -46.450 48.393 1.00 22.32 ? 361 ASN B CG  1 
ATOM   1307 O OD1 . ASN B 2 61  ? 8.150   -47.043 47.385 1.00 18.91 ? 361 ASN B OD1 1 
ATOM   1308 N ND2 . ASN B 2 61  ? 6.632   -45.766 48.438 1.00 21.77 ? 361 ASN B ND2 1 
ATOM   1309 N N   . GLU B 2 62  ? 10.932  -48.523 47.943 1.00 25.43 ? 362 GLU B N   1 
ATOM   1310 C CA  . GLU B 2 62  ? 12.086  -48.439 47.051 1.00 31.16 ? 362 GLU B CA  1 
ATOM   1311 C C   . GLU B 2 62  ? 12.109  -47.155 46.230 1.00 33.56 ? 362 GLU B C   1 
ATOM   1312 O O   . GLU B 2 62  ? 13.084  -46.868 45.525 1.00 35.57 ? 362 GLU B O   1 
ATOM   1313 C CB  . GLU B 2 62  ? 12.159  -49.674 46.142 1.00 33.76 ? 362 GLU B CB  1 
ATOM   1314 C CG  . GLU B 2 62  ? 11.376  -49.605 44.846 1.00 42.81 ? 362 GLU B CG  1 
ATOM   1315 C CD  . GLU B 2 62  ? 11.618  -50.833 43.971 1.00 54.10 ? 362 GLU B CD  1 
ATOM   1316 O OE1 . GLU B 2 62  ? 12.788  -51.074 43.592 1.00 60.09 ? 362 GLU B OE1 1 
ATOM   1317 O OE2 . GLU B 2 62  ? 10.645  -51.560 43.666 1.00 52.59 ? 362 GLU B OE2 1 
ATOM   1318 N N   . LYS B 2 63  ? 11.033  -46.382 46.345 1.00 33.71 ? 363 LYS B N   1 
ATOM   1319 C CA  . LYS B 2 63  ? 10.900  -45.107 45.650 1.00 30.93 ? 363 LYS B CA  1 
ATOM   1320 C C   . LYS B 2 63  ? 11.623  -44.000 46.423 1.00 28.79 ? 363 LYS B C   1 
ATOM   1321 O O   . LYS B 2 63  ? 11.947  -42.957 45.866 1.00 27.96 ? 363 LYS B O   1 
ATOM   1322 C CB  . LYS B 2 63  ? 9.418   -44.758 45.506 1.00 28.62 ? 363 LYS B CB  1 
ATOM   1323 C CG  . LYS B 2 63  ? 9.148   -43.421 44.859 1.00 31.13 ? 363 LYS B CG  1 
ATOM   1324 C CD  . LYS B 2 63  ? 7.653   -43.173 44.708 1.00 44.31 ? 363 LYS B CD  1 
ATOM   1325 C CE  . LYS B 2 63  ? 6.961   -44.325 43.983 1.00 48.58 ? 363 LYS B CE  1 
ATOM   1326 N NZ  . LYS B 2 63  ? 5.597   -43.952 43.494 1.00 55.18 ? 363 LYS B NZ  1 
ATOM   1327 N N   . PHE B 2 64  ? 11.873  -44.240 47.708 1.00 26.17 ? 364 PHE B N   1 
ATOM   1328 C CA  . PHE B 2 64  ? 12.555  -43.274 48.567 1.00 33.87 ? 364 PHE B CA  1 
ATOM   1329 C C   . PHE B 2 64  ? 13.837  -43.846 49.180 1.00 37.78 ? 364 PHE B C   1 
ATOM   1330 O O   . PHE B 2 64  ? 14.329  -43.335 50.188 1.00 38.28 ? 364 PHE B O   1 
ATOM   1331 C CB  . PHE B 2 64  ? 11.629  -42.834 49.705 1.00 25.70 ? 364 PHE B CB  1 
ATOM   1332 C CG  . PHE B 2 64  ? 10.447  -42.033 49.253 1.00 24.89 ? 364 PHE B CG  1 
ATOM   1333 C CD1 . PHE B 2 64  ? 10.547  -40.653 49.094 1.00 24.04 ? 364 PHE B CD1 1 
ATOM   1334 C CD2 . PHE B 2 64  ? 9.232   -42.660 48.972 1.00 21.56 ? 364 PHE B CD2 1 
ATOM   1335 C CE1 . PHE B 2 64  ? 9.450   -39.906 48.658 1.00 27.13 ? 364 PHE B CE1 1 
ATOM   1336 C CE2 . PHE B 2 64  ? 8.132   -41.926 48.536 1.00 22.74 ? 364 PHE B CE2 1 
ATOM   1337 C CZ  . PHE B 2 64  ? 8.237   -40.547 48.378 1.00 22.36 ? 364 PHE B CZ  1 
ATOM   1338 N N   . LYS B 2 65  ? 14.379  -44.895 48.574 1.00 42.94 ? 365 LYS B N   1 
ATOM   1339 C CA  . LYS B 2 65  ? 15.582  -45.535 49.100 1.00 49.10 ? 365 LYS B CA  1 
ATOM   1340 C C   . LYS B 2 65  ? 16.825  -44.653 49.075 1.00 50.24 ? 365 LYS B C   1 
ATOM   1341 O O   . LYS B 2 65  ? 17.548  -44.557 50.070 1.00 54.31 ? 365 LYS B O   1 
ATOM   1342 C CB  . LYS B 2 65  ? 15.867  -46.831 48.336 1.00 55.15 ? 365 LYS B CB  1 
ATOM   1343 C CG  . LYS B 2 65  ? 16.082  -48.048 49.230 1.00 62.37 ? 365 LYS B CG  1 
ATOM   1344 C CD  . LYS B 2 65  ? 14.947  -49.060 49.074 1.00 68.08 ? 365 LYS B CD  1 
ATOM   1345 C CE  . LYS B 2 65  ? 15.471  -50.441 48.688 1.00 67.38 ? 365 LYS B CE  1 
ATOM   1346 N NZ  . LYS B 2 65  ? 14.619  -51.099 47.654 1.00 68.94 ? 365 LYS B NZ  1 
ATOM   1347 N N   . SER B 2 66  ? 17.071  -44.006 47.942 1.00 46.90 ? 366 SER B N   1 
ATOM   1348 C CA  . SER B 2 66  ? 18.242  -43.153 47.796 1.00 44.20 ? 366 SER B CA  1 
ATOM   1349 C C   . SER B 2 66  ? 18.001  -41.714 48.240 1.00 40.93 ? 366 SER B C   1 
ATOM   1350 O O   . SER B 2 66  ? 18.865  -40.855 48.084 1.00 45.64 ? 366 SER B O   1 
ATOM   1351 C CB  . SER B 2 66  ? 18.689  -43.175 46.340 1.00 46.03 ? 366 SER B CB  1 
ATOM   1352 O OG  . SER B 2 66  ? 18.028  -44.218 45.646 1.00 50.56 ? 366 SER B OG  1 
ATOM   1353 N N   . LYS B 2 67  ? 16.834  -41.454 48.813 1.00 37.46 ? 367 LYS B N   1 
ATOM   1354 C CA  . LYS B 2 67  ? 16.496  -40.106 49.249 1.00 31.54 ? 367 LYS B CA  1 
ATOM   1355 C C   . LYS B 2 67  ? 16.389  -39.948 50.765 1.00 27.42 ? 367 LYS B C   1 
ATOM   1356 O O   . LYS B 2 67  ? 16.922  -38.996 51.340 1.00 20.40 ? 367 LYS B O   1 
ATOM   1357 C CB  . LYS B 2 67  ? 15.173  -39.679 48.598 1.00 25.97 ? 367 LYS B CB  1 
ATOM   1358 C CG  . LYS B 2 67  ? 14.750  -38.263 48.914 1.00 23.27 ? 367 LYS B CG  1 
ATOM   1359 C CD  . LYS B 2 67  ? 14.643  -37.451 47.648 1.00 24.97 ? 367 LYS B CD  1 
ATOM   1360 C CE  . LYS B 2 67  ? 15.676  -36.339 47.622 1.00 27.79 ? 367 LYS B CE  1 
ATOM   1361 N NZ  . LYS B 2 67  ? 15.457  -35.411 46.475 1.00 22.94 ? 367 LYS B NZ  1 
ATOM   1362 N N   . ALA B 2 68  ? 15.695  -40.882 51.407 1.00 25.91 ? 368 ALA B N   1 
ATOM   1363 C CA  . ALA B 2 68  ? 15.489  -40.809 52.843 1.00 23.64 ? 368 ALA B CA  1 
ATOM   1364 C C   . ALA B 2 68  ? 16.256  -41.863 53.607 1.00 23.74 ? 368 ALA B C   1 
ATOM   1365 O O   . ALA B 2 68  ? 16.376  -42.999 53.151 1.00 29.74 ? 368 ALA B O   1 
ATOM   1366 C CB  . ALA B 2 68  ? 14.014  -40.937 53.148 1.00 19.33 ? 368 ALA B CB  1 
ATOM   1367 N N   . THR B 2 69  ? 16.777  -41.468 54.768 1.00 23.72 ? 369 THR B N   1 
ATOM   1368 C CA  . THR B 2 69  ? 17.517  -42.364 55.653 1.00 22.17 ? 369 THR B CA  1 
ATOM   1369 C C   . THR B 2 69  ? 16.854  -42.288 57.021 1.00 20.98 ? 369 THR B C   1 
ATOM   1370 O O   . THR B 2 69  ? 16.893  -41.253 57.685 1.00 24.15 ? 369 THR B O   1 
ATOM   1371 C CB  . THR B 2 69  ? 18.988  -41.944 55.812 1.00 23.34 ? 369 THR B CB  1 
ATOM   1372 O OG1 . THR B 2 69  ? 19.594  -41.816 54.524 1.00 22.87 ? 369 THR B OG1 1 
ATOM   1373 C CG2 . THR B 2 69  ? 19.755  -42.982 56.623 1.00 23.54 ? 369 THR B CG2 1 
ATOM   1374 N N   . LEU B 2 70  ? 16.238  -43.387 57.433 1.00 19.03 ? 370 LEU B N   1 
ATOM   1375 C CA  . LEU B 2 70  ? 15.557  -43.441 58.715 1.00 21.18 ? 370 LEU B CA  1 
ATOM   1376 C C   . LEU B 2 70  ? 16.523  -43.903 59.805 1.00 23.02 ? 370 LEU B C   1 
ATOM   1377 O O   . LEU B 2 70  ? 17.256  -44.868 59.616 1.00 22.52 ? 370 LEU B O   1 
ATOM   1378 C CB  . LEU B 2 70  ? 14.380  -44.418 58.634 1.00 19.85 ? 370 LEU B CB  1 
ATOM   1379 C CG  . LEU B 2 70  ? 12.977  -44.007 58.152 1.00 25.60 ? 370 LEU B CG  1 
ATOM   1380 C CD1 . LEU B 2 70  ? 13.023  -42.762 57.280 1.00 19.09 ? 370 LEU B CD1 1 
ATOM   1381 C CD2 . LEU B 2 70  ? 12.369  -45.179 57.381 1.00 16.99 ? 370 LEU B CD2 1 
ATOM   1382 N N   . THR B 2 71  ? 16.536  -43.200 60.934 1.00 22.24 ? 371 THR B N   1 
ATOM   1383 C CA  . THR B 2 71  ? 17.386  -43.567 62.064 1.00 25.74 ? 371 THR B CA  1 
ATOM   1384 C C   . THR B 2 71  ? 16.633  -43.201 63.337 1.00 26.44 ? 371 THR B C   1 
ATOM   1385 O O   . THR B 2 71  ? 15.600  -42.539 63.277 1.00 24.53 ? 371 THR B O   1 
ATOM   1386 C CB  . THR B 2 71  ? 18.753  -42.821 62.051 1.00 19.79 ? 371 THR B CB  1 
ATOM   1387 O OG1 . THR B 2 71  ? 18.566  -41.461 62.455 1.00 31.09 ? 371 THR B OG1 1 
ATOM   1388 C CG2 . THR B 2 71  ? 19.363  -42.839 60.668 1.00 27.38 ? 371 THR B CG2 1 
ATOM   1389 N N   . VAL B 2 72  ? 17.135  -43.646 64.483 1.00 27.72 ? 372 VAL B N   1 
ATOM   1390 C CA  . VAL B 2 72  ? 16.495  -43.326 65.755 1.00 32.71 ? 372 VAL B CA  1 
ATOM   1391 C C   . VAL B 2 72  ? 17.521  -43.091 66.868 1.00 30.53 ? 372 VAL B C   1 
ATOM   1392 O O   . VAL B 2 72  ? 18.683  -43.468 66.744 1.00 31.09 ? 372 VAL B O   1 
ATOM   1393 C CB  . VAL B 2 72  ? 15.530  -44.457 66.210 1.00 28.78 ? 372 VAL B CB  1 
ATOM   1394 C CG1 . VAL B 2 72  ? 14.520  -44.752 65.123 1.00 30.63 ? 372 VAL B CG1 1 
ATOM   1395 C CG2 . VAL B 2 72  ? 16.311  -45.706 66.553 1.00 33.61 ? 372 VAL B CG2 1 
ATOM   1396 N N   . ASP B 2 73  ? 17.092  -42.444 67.945 1.00 32.34 ? 373 ASP B N   1 
ATOM   1397 C CA  . ASP B 2 73  ? 17.967  -42.213 69.085 1.00 28.01 ? 373 ASP B CA  1 
ATOM   1398 C C   . ASP B 2 73  ? 17.255  -42.843 70.258 1.00 26.78 ? 373 ASP B C   1 
ATOM   1399 O O   . ASP B 2 73  ? 16.398  -42.228 70.890 1.00 22.88 ? 373 ASP B O   1 
ATOM   1400 C CB  . ASP B 2 73  ? 18.177  -40.727 69.349 1.00 35.97 ? 373 ASP B CB  1 
ATOM   1401 C CG  . ASP B 2 73  ? 19.099  -40.475 70.529 1.00 39.09 ? 373 ASP B CG  1 
ATOM   1402 O OD1 . ASP B 2 73  ? 19.791  -41.423 70.949 1.00 34.83 ? 373 ASP B OD1 1 
ATOM   1403 O OD2 . ASP B 2 73  ? 19.132  -39.336 71.040 1.00 45.65 ? 373 ASP B OD2 1 
ATOM   1404 N N   . THR B 2 74  ? 17.606  -44.092 70.531 1.00 32.81 ? 374 THR B N   1 
ATOM   1405 C CA  . THR B 2 74  ? 17.000  -44.842 71.616 1.00 38.15 ? 374 THR B CA  1 
ATOM   1406 C C   . THR B 2 74  ? 17.073  -44.106 72.955 1.00 37.83 ? 374 THR B C   1 
ATOM   1407 O O   . THR B 2 74  ? 16.191  -44.265 73.803 1.00 40.28 ? 374 THR B O   1 
ATOM   1408 C CB  . THR B 2 74  ? 17.669  -46.231 71.740 1.00 38.47 ? 374 THR B CB  1 
ATOM   1409 O OG1 . THR B 2 74  ? 16.702  -47.248 71.451 1.00 42.27 ? 374 THR B OG1 1 
ATOM   1410 C CG2 . THR B 2 74  ? 18.228  -46.443 73.137 1.00 40.43 ? 374 THR B CG2 1 
ATOM   1411 N N   . SER B 2 75  ? 18.114  -43.297 73.136 1.00 36.28 ? 375 SER B N   1 
ATOM   1412 C CA  . SER B 2 75  ? 18.299  -42.555 74.381 1.00 36.54 ? 375 SER B CA  1 
ATOM   1413 C C   . SER B 2 75  ? 17.312  -41.419 74.563 1.00 30.47 ? 375 SER B C   1 
ATOM   1414 O O   . SER B 2 75  ? 16.804  -41.207 75.659 1.00 34.90 ? 375 SER B O   1 
ATOM   1415 C CB  . SER B 2 75  ? 19.716  -41.987 74.466 1.00 40.79 ? 375 SER B CB  1 
ATOM   1416 O OG  . SER B 2 75  ? 20.310  -41.905 73.185 1.00 55.87 ? 375 SER B OG  1 
ATOM   1417 N N   . SER B 2 76  ? 17.043  -40.681 73.495 1.00 25.91 ? 376 SER B N   1 
ATOM   1418 C CA  . SER B 2 76  ? 16.119  -39.566 73.592 1.00 24.35 ? 376 SER B CA  1 
ATOM   1419 C C   . SER B 2 76  ? 14.728  -39.888 73.064 1.00 24.97 ? 376 SER B C   1 
ATOM   1420 O O   . SER B 2 76  ? 13.866  -39.015 73.024 1.00 31.31 ? 376 SER B O   1 
ATOM   1421 C CB  . SER B 2 76  ? 16.680  -38.359 72.854 1.00 18.15 ? 376 SER B CB  1 
ATOM   1422 O OG  . SER B 2 76  ? 16.865  -38.656 71.488 1.00 30.84 ? 376 SER B OG  1 
ATOM   1423 N N   . SER B 2 77  ? 14.509  -41.136 72.663 1.00 22.47 ? 377 SER B N   1 
ATOM   1424 C CA  . SER B 2 77  ? 13.208  -41.558 72.145 1.00 21.99 ? 377 SER B CA  1 
ATOM   1425 C C   . SER B 2 77  ? 12.746  -40.705 70.970 1.00 21.56 ? 377 SER B C   1 
ATOM   1426 O O   . SER B 2 77  ? 11.570  -40.345 70.867 1.00 17.98 ? 377 SER B O   1 
ATOM   1427 C CB  . SER B 2 77  ? 12.153  -41.505 73.247 1.00 20.43 ? 377 SER B CB  1 
ATOM   1428 O OG  . SER B 2 77  ? 12.146  -42.710 73.990 1.00 35.90 ? 377 SER B OG  1 
ATOM   1429 N N   . THR B 2 78  ? 13.683  -40.388 70.086 1.00 19.36 ? 378 THR B N   1 
ATOM   1430 C CA  . THR B 2 78  ? 13.389  -39.584 68.912 1.00 22.04 ? 378 THR B CA  1 
ATOM   1431 C C   . THR B 2 78  ? 13.675  -40.381 67.642 1.00 18.64 ? 378 THR B C   1 
ATOM   1432 O O   . THR B 2 78  ? 14.679  -41.086 67.550 1.00 17.95 ? 378 THR B O   1 
ATOM   1433 C CB  . THR B 2 78  ? 14.241  -38.279 68.895 1.00 16.47 ? 378 THR B CB  1 
ATOM   1434 O OG1 . THR B 2 78  ? 13.924  -37.487 70.041 1.00 20.06 ? 378 THR B OG1 1 
ATOM   1435 C CG2 . THR B 2 78  ? 13.948  -37.455 67.654 1.00 19.76 ? 378 THR B CG2 1 
ATOM   1436 N N   . ALA B 2 79  ? 12.764  -40.280 66.680 1.00 21.26 ? 379 ALA B N   1 
ATOM   1437 C CA  . ALA B 2 79  ? 12.912  -40.941 65.391 1.00 18.61 ? 379 ALA B CA  1 
ATOM   1438 C C   . ALA B 2 79  ? 13.366  -39.848 64.418 1.00 19.76 ? 379 ALA B C   1 
ATOM   1439 O O   . ALA B 2 79  ? 12.907  -38.704 64.501 1.00 19.40 ? 379 ALA B O   1 
ATOM   1440 C CB  . ALA B 2 79  ? 11.587  -41.531 64.948 1.00 9.40  ? 379 ALA B CB  1 
ATOM   1441 N N   . TYR B 2 80  ? 14.275  -40.198 63.512 1.00 14.63 ? 380 TYR B N   1 
ATOM   1442 C CA  . TYR B 2 80  ? 14.804  -39.242 62.551 1.00 15.80 ? 380 TYR B CA  1 
ATOM   1443 C C   . TYR B 2 80  ? 14.663  -39.673 61.102 1.00 18.40 ? 380 TYR B C   1 
ATOM   1444 O O   . TYR B 2 80  ? 14.693  -40.863 60.786 1.00 18.93 ? 380 TYR B O   1 
ATOM   1445 C CB  . TYR B 2 80  ? 16.303  -39.010 62.795 1.00 11.50 ? 380 TYR B CB  1 
ATOM   1446 C CG  . TYR B 2 80  ? 16.631  -38.358 64.103 1.00 21.67 ? 380 TYR B CG  1 
ATOM   1447 C CD1 . TYR B 2 80  ? 16.452  -36.984 64.283 1.00 16.37 ? 380 TYR B CD1 1 
ATOM   1448 C CD2 . TYR B 2 80  ? 17.107  -39.114 65.178 1.00 24.43 ? 380 TYR B CD2 1 
ATOM   1449 C CE1 . TYR B 2 80  ? 16.736  -36.378 65.505 1.00 19.75 ? 380 TYR B CE1 1 
ATOM   1450 C CE2 . TYR B 2 80  ? 17.395  -38.519 66.405 1.00 24.22 ? 380 TYR B CE2 1 
ATOM   1451 C CZ  . TYR B 2 80  ? 17.207  -37.152 66.561 1.00 24.47 ? 380 TYR B CZ  1 
ATOM   1452 O OH  . TYR B 2 80  ? 17.490  -36.564 67.772 1.00 28.00 ? 380 TYR B OH  1 
ATOM   1453 N N   . MET B 2 81  ? 14.510  -38.684 60.228 1.00 17.32 ? 381 MET B N   1 
ATOM   1454 C CA  . MET B 2 81  ? 14.478  -38.925 58.800 1.00 18.40 ? 381 MET B CA  1 
ATOM   1455 C C   . MET B 2 81  ? 15.321  -37.849 58.121 1.00 19.33 ? 381 MET B C   1 
ATOM   1456 O O   . MET B 2 81  ? 15.027  -36.660 58.224 1.00 17.04 ? 381 MET B O   1 
ATOM   1457 C CB  . MET B 2 81  ? 13.075  -38.874 58.214 1.00 15.31 ? 381 MET B CB  1 
ATOM   1458 C CG  . MET B 2 81  ? 13.140  -39.129 56.723 1.00 9.24  ? 381 MET B CG  1 
ATOM   1459 S SD  . MET B 2 81  ? 11.586  -39.373 55.912 1.00 16.56 ? 381 MET B SD  1 
ATOM   1460 C CE  . MET B 2 81  ? 11.044  -37.670 55.836 1.00 9.02  ? 381 MET B CE  1 
ATOM   1461 N N   . GLN B 2 82  ? 16.380  -38.268 57.439 1.00 20.44 ? 382 GLN B N   1 
ATOM   1462 C CA  . GLN B 2 82  ? 17.237  -37.324 56.736 1.00 21.05 ? 382 GLN B CA  1 
ATOM   1463 C C   . GLN B 2 82  ? 16.930  -37.347 55.245 1.00 20.97 ? 382 GLN B C   1 
ATOM   1464 O O   . GLN B 2 82  ? 16.925  -38.412 54.627 1.00 22.72 ? 382 GLN B O   1 
ATOM   1465 C CB  . GLN B 2 82  ? 18.704  -37.681 56.951 1.00 22.66 ? 382 GLN B CB  1 
ATOM   1466 C CG  . GLN B 2 82  ? 19.662  -36.540 56.672 1.00 32.26 ? 382 GLN B CG  1 
ATOM   1467 C CD  . GLN B 2 82  ? 20.997  -37.033 56.174 1.00 40.59 ? 382 GLN B CD  1 
ATOM   1468 O OE1 . GLN B 2 82  ? 21.087  -38.108 55.581 1.00 54.13 ? 382 GLN B OE1 1 
ATOM   1469 N NE2 . GLN B 2 82  ? 22.046  -36.255 56.410 1.00 44.10 ? 382 GLN B NE2 1 
ATOM   1470 N N   . LEU B 2 83  ? 16.659  -36.175 54.678 1.00 18.89 ? 383 LEU B N   1 
ATOM   1471 C CA  . LEU B 2 83  ? 16.378  -36.054 53.251 1.00 18.81 ? 383 LEU B CA  1 
ATOM   1472 C C   . LEU B 2 83  ? 17.616  -35.458 52.579 1.00 18.07 ? 383 LEU B C   1 
ATOM   1473 O O   . LEU B 2 83  ? 18.078  -34.385 52.961 1.00 21.14 ? 383 LEU B O   1 
ATOM   1474 C CB  . LEU B 2 83  ? 15.163  -35.145 53.018 1.00 15.00 ? 383 LEU B CB  1 
ATOM   1475 C CG  . LEU B 2 83  ? 13.771  -35.681 53.386 1.00 16.83 ? 383 LEU B CG  1 
ATOM   1476 C CD1 . LEU B 2 83  ? 12.747  -34.543 53.370 1.00 8.83  ? 383 LEU B CD1 1 
ATOM   1477 C CD2 . LEU B 2 83  ? 13.359  -36.765 52.403 1.00 19.39 ? 383 LEU B CD2 1 
ATOM   1478 N N   . SER B 2 84  ? 18.156  -36.154 51.585 1.00 17.78 ? 384 SER B N   1 
ATOM   1479 C CA  . SER B 2 84  ? 19.352  -35.684 50.886 1.00 16.58 ? 384 SER B CA  1 
ATOM   1480 C C   . SER B 2 84  ? 19.074  -35.021 49.542 1.00 15.23 ? 384 SER B C   1 
ATOM   1481 O O   . SER B 2 84  ? 18.020  -35.218 48.946 1.00 12.75 ? 384 SER B O   1 
ATOM   1482 C CB  . SER B 2 84  ? 20.317  -36.847 50.668 1.00 19.18 ? 384 SER B CB  1 
ATOM   1483 O OG  . SER B 2 84  ? 20.128  -37.848 51.650 1.00 35.45 ? 384 SER B OG  1 
ATOM   1484 N N   . SER B 2 85  ? 20.038  -34.237 49.075 1.00 13.74 ? 385 SER B N   1 
ATOM   1485 C CA  . SER B 2 85  ? 19.929  -33.546 47.800 1.00 19.80 ? 385 SER B CA  1 
ATOM   1486 C C   . SER B 2 85  ? 18.533  -32.973 47.572 1.00 21.68 ? 385 SER B C   1 
ATOM   1487 O O   . SER B 2 85  ? 17.873  -33.278 46.572 1.00 19.11 ? 385 SER B O   1 
ATOM   1488 C CB  . SER B 2 85  ? 20.285  -34.504 46.660 1.00 24.93 ? 385 SER B CB  1 
ATOM   1489 O OG  . SER B 2 85  ? 21.673  -34.484 46.388 1.00 34.88 ? 385 SER B OG  1 
ATOM   1490 N N   . LEU B 2 86  ? 18.097  -32.130 48.500 1.00 19.91 ? 386 LEU B N   1 
ATOM   1491 C CA  . LEU B 2 86  ? 16.784  -31.510 48.416 1.00 18.60 ? 386 LEU B CA  1 
ATOM   1492 C C   . LEU B 2 86  ? 16.521  -30.795 47.094 1.00 19.46 ? 386 LEU B C   1 
ATOM   1493 O O   . LEU B 2 86  ? 17.300  -29.954 46.652 1.00 20.96 ? 386 LEU B O   1 
ATOM   1494 C CB  . LEU B 2 86  ? 16.593  -30.522 49.569 1.00 20.92 ? 386 LEU B CB  1 
ATOM   1495 C CG  . LEU B 2 86  ? 16.007  -31.011 50.901 1.00 23.43 ? 386 LEU B CG  1 
ATOM   1496 C CD1 . LEU B 2 86  ? 15.426  -32.402 50.766 1.00 26.06 ? 386 LEU B CD1 1 
ATOM   1497 C CD2 . LEU B 2 86  ? 17.089  -30.986 51.954 1.00 22.61 ? 386 LEU B CD2 1 
ATOM   1498 N N   . ALA B 2 87  ? 15.403  -31.152 46.472 1.00 25.67 ? 387 ALA B N   1 
ATOM   1499 C CA  . ALA B 2 87  ? 14.958  -30.565 45.216 1.00 19.58 ? 387 ALA B CA  1 
ATOM   1500 C C   . ALA B 2 87  ? 13.578  -29.989 45.498 1.00 18.89 ? 387 ALA B C   1 
ATOM   1501 O O   . ALA B 2 87  ? 12.960  -30.318 46.511 1.00 22.29 ? 387 ALA B O   1 
ATOM   1502 C CB  . ALA B 2 87  ? 14.869  -31.635 44.145 1.00 21.59 ? 387 ALA B CB  1 
ATOM   1503 N N   . SER B 2 88  ? 13.088  -29.131 44.616 1.00 15.74 ? 388 SER B N   1 
ATOM   1504 C CA  . SER B 2 88  ? 11.778  -28.534 44.818 1.00 17.66 ? 388 SER B CA  1 
ATOM   1505 C C   . SER B 2 88  ? 10.677  -29.582 44.928 1.00 17.44 ? 388 SER B C   1 
ATOM   1506 O O   . SER B 2 88  ? 9.647   -29.353 45.558 1.00 18.89 ? 388 SER B O   1 
ATOM   1507 C CB  . SER B 2 88  ? 11.452  -27.586 43.671 1.00 23.55 ? 388 SER B CB  1 
ATOM   1508 O OG  . SER B 2 88  ? 10.846  -28.294 42.606 1.00 34.64 ? 388 SER B OG  1 
ATOM   1509 N N   . GLU B 2 89  ? 10.886  -30.739 44.320 1.00 18.20 ? 389 GLU B N   1 
ATOM   1510 C CA  . GLU B 2 89  ? 9.868   -31.774 44.375 1.00 18.56 ? 389 GLU B CA  1 
ATOM   1511 C C   . GLU B 2 89  ? 9.759   -32.343 45.790 1.00 16.29 ? 389 GLU B C   1 
ATOM   1512 O O   . GLU B 2 89  ? 8.780   -33.007 46.133 1.00 18.00 ? 389 GLU B O   1 
ATOM   1513 C CB  . GLU B 2 89  ? 10.183  -32.867 43.350 1.00 14.31 ? 389 GLU B CB  1 
ATOM   1514 C CG  . GLU B 2 89  ? 9.760   -32.514 41.924 1.00 11.74 ? 389 GLU B CG  1 
ATOM   1515 C CD  . GLU B 2 89  ? 10.891  -31.930 41.060 1.00 17.39 ? 389 GLU B CD  1 
ATOM   1516 O OE1 . GLU B 2 89  ? 12.014  -31.699 41.556 1.00 11.60 ? 389 GLU B OE1 1 
ATOM   1517 O OE2 . GLU B 2 89  ? 10.649  -31.694 39.859 1.00 26.89 ? 389 GLU B OE2 1 
ATOM   1518 N N   . ASP B 2 90  ? 10.758  -32.056 46.616 1.00 17.93 ? 390 ASP B N   1 
ATOM   1519 C CA  . ASP B 2 90  ? 10.778  -32.531 48.000 1.00 19.66 ? 390 ASP B CA  1 
ATOM   1520 C C   . ASP B 2 90  ? 9.918   -31.681 48.926 1.00 17.16 ? 390 ASP B C   1 
ATOM   1521 O O   . ASP B 2 90  ? 9.683   -32.051 50.072 1.00 14.69 ? 390 ASP B O   1 
ATOM   1522 C CB  . ASP B 2 90  ? 12.213  -32.564 48.527 1.00 15.91 ? 390 ASP B CB  1 
ATOM   1523 C CG  . ASP B 2 90  ? 13.021  -33.677 47.911 1.00 18.02 ? 390 ASP B CG  1 
ATOM   1524 O OD1 . ASP B 2 90  ? 14.189  -33.456 47.545 1.00 17.28 ? 390 ASP B OD1 1 
ATOM   1525 O OD2 . ASP B 2 90  ? 12.477  -34.785 47.782 1.00 24.23 ? 390 ASP B OD2 1 
ATOM   1526 N N   . SER B 2 91  ? 9.462   -30.538 48.432 1.00 17.70 ? 391 SER B N   1 
ATOM   1527 C CA  . SER B 2 91  ? 8.622   -29.661 49.231 1.00 21.20 ? 391 SER B CA  1 
ATOM   1528 C C   . SER B 2 91  ? 7.284   -30.350 49.448 1.00 20.50 ? 391 SER B C   1 
ATOM   1529 O O   . SER B 2 91  ? 6.520   -30.537 48.508 1.00 23.43 ? 391 SER B O   1 
ATOM   1530 C CB  . SER B 2 91  ? 8.409   -28.330 48.512 1.00 22.70 ? 391 SER B CB  1 
ATOM   1531 O OG  . SER B 2 91  ? 9.557   -27.513 48.629 1.00 24.14 ? 391 SER B OG  1 
ATOM   1532 N N   . ALA B 2 92  ? 7.016   -30.728 50.694 1.00 20.13 ? 392 ALA B N   1 
ATOM   1533 C CA  . ALA B 2 92  ? 5.781   -31.411 51.056 1.00 16.93 ? 392 ALA B CA  1 
ATOM   1534 C C   . ALA B 2 92  ? 5.621   -31.387 52.567 1.00 14.44 ? 392 ALA B C   1 
ATOM   1535 O O   . ALA B 2 92  ? 6.455   -30.836 53.283 1.00 12.27 ? 392 ALA B O   1 
ATOM   1536 C CB  . ALA B 2 92  ? 5.821   -32.867 50.568 1.00 16.90 ? 392 ALA B CB  1 
ATOM   1537 N N   . LEU B 2 93  ? 4.537   -31.988 53.041 1.00 13.49 ? 393 LEU B N   1 
ATOM   1538 C CA  . LEU B 2 93  ? 4.274   -32.083 54.471 1.00 17.29 ? 393 LEU B CA  1 
ATOM   1539 C C   . LEU B 2 93  ? 4.731   -33.485 54.877 1.00 20.20 ? 393 LEU B C   1 
ATOM   1540 O O   . LEU B 2 93  ? 4.407   -34.475 54.217 1.00 20.82 ? 393 LEU B O   1 
ATOM   1541 C CB  . LEU B 2 93  ? 2.777   -31.897 54.754 1.00 16.33 ? 393 LEU B CB  1 
ATOM   1542 C CG  . LEU B 2 93  ? 2.371   -31.627 56.207 1.00 23.65 ? 393 LEU B CG  1 
ATOM   1543 C CD1 . LEU B 2 93  ? 2.973   -30.317 56.686 1.00 27.23 ? 393 LEU B CD1 1 
ATOM   1544 C CD2 . LEU B 2 93  ? 0.863   -31.577 56.313 1.00 24.32 ? 393 LEU B CD2 1 
ATOM   1545 N N   . TYR B 2 94  ? 5.501   -33.574 55.951 1.00 18.45 ? 394 TYR B N   1 
ATOM   1546 C CA  . TYR B 2 94  ? 5.986   -34.865 56.387 1.00 17.32 ? 394 TYR B CA  1 
ATOM   1547 C C   . TYR B 2 94  ? 5.509   -35.240 57.776 1.00 18.21 ? 394 TYR B C   1 
ATOM   1548 O O   . TYR B 2 94  ? 5.765   -34.528 58.745 1.00 22.46 ? 394 TYR B O   1 
ATOM   1549 C CB  . TYR B 2 94  ? 7.512   -34.881 56.362 1.00 16.38 ? 394 TYR B CB  1 
ATOM   1550 C CG  . TYR B 2 94  ? 8.108   -34.800 54.979 1.00 15.31 ? 394 TYR B CG  1 
ATOM   1551 C CD1 . TYR B 2 94  ? 8.372   -33.565 54.385 1.00 16.64 ? 394 TYR B CD1 1 
ATOM   1552 C CD2 . TYR B 2 94  ? 8.431   -35.957 54.272 1.00 13.81 ? 394 TYR B CD2 1 
ATOM   1553 C CE1 . TYR B 2 94  ? 8.946   -33.484 53.122 1.00 18.96 ? 394 TYR B CE1 1 
ATOM   1554 C CE2 . TYR B 2 94  ? 9.005   -35.889 53.011 1.00 12.35 ? 394 TYR B CE2 1 
ATOM   1555 C CZ  . TYR B 2 94  ? 9.261   -34.651 52.441 1.00 17.47 ? 394 TYR B CZ  1 
ATOM   1556 O OH  . TYR B 2 94  ? 9.839   -34.581 51.194 1.00 19.68 ? 394 TYR B OH  1 
ATOM   1557 N N   . TYR B 2 95  ? 4.819   -36.370 57.867 1.00 17.75 ? 395 TYR B N   1 
ATOM   1558 C CA  . TYR B 2 95  ? 4.333   -36.863 59.147 1.00 18.88 ? 395 TYR B CA  1 
ATOM   1559 C C   . TYR B 2 95  ? 5.039   -38.155 59.509 1.00 21.78 ? 395 TYR B C   1 
ATOM   1560 O O   . TYR B 2 95  ? 5.506   -38.901 58.637 1.00 13.45 ? 395 TYR B O   1 
ATOM   1561 C CB  . TYR B 2 95  ? 2.846   -37.218 59.107 1.00 18.65 ? 395 TYR B CB  1 
ATOM   1562 C CG  . TYR B 2 95  ? 1.867   -36.105 58.863 1.00 16.82 ? 395 TYR B CG  1 
ATOM   1563 C CD1 . TYR B 2 95  ? 1.537   -35.720 57.564 1.00 17.43 ? 395 TYR B CD1 1 
ATOM   1564 C CD2 . TYR B 2 95  ? 1.185   -35.511 59.921 1.00 16.60 ? 395 TYR B CD2 1 
ATOM   1565 C CE1 . TYR B 2 95  ? 0.549   -34.776 57.321 1.00 17.56 ? 395 TYR B CE1 1 
ATOM   1566 C CE2 . TYR B 2 95  ? 0.191   -34.560 59.688 1.00 19.00 ? 395 TYR B CE2 1 
ATOM   1567 C CZ  . TYR B 2 95  ? -0.119  -34.203 58.383 1.00 18.73 ? 395 TYR B CZ  1 
ATOM   1568 O OH  . TYR B 2 95  ? -1.093  -33.269 58.135 1.00 20.36 ? 395 TYR B OH  1 
ATOM   1569 N N   . CYS B 2 96  ? 5.114   -38.400 60.812 1.00 22.65 ? 396 CYS B N   1 
ATOM   1570 C CA  . CYS B 2 96  ? 5.652   -39.644 61.328 1.00 18.99 ? 396 CYS B CA  1 
ATOM   1571 C C   . CYS B 2 96  ? 4.393   -40.133 62.014 1.00 18.67 ? 396 CYS B C   1 
ATOM   1572 O O   . CYS B 2 96  ? 3.597   -39.326 62.499 1.00 12.68 ? 396 CYS B O   1 
ATOM   1573 C CB  . CYS B 2 96  ? 6.796   -39.432 62.341 1.00 17.99 ? 396 CYS B CB  1 
ATOM   1574 S SG  . CYS B 2 96  ? 6.409   -38.473 63.832 1.00 18.10 ? 396 CYS B SG  1 
ATOM   1575 N N   . ALA B 2 97  ? 4.180   -41.437 62.001 1.00 17.65 ? 397 ALA B N   1 
ATOM   1576 C CA  . ALA B 2 97  ? 3.008   -42.014 62.627 1.00 19.87 ? 397 ALA B CA  1 
ATOM   1577 C C   . ALA B 2 97  ? 3.494   -43.280 63.303 1.00 22.79 ? 397 ALA B C   1 
ATOM   1578 O O   . ALA B 2 97  ? 4.400   -43.939 62.803 1.00 25.25 ? 397 ALA B O   1 
ATOM   1579 C CB  . ALA B 2 97  ? 1.950   -42.336 61.576 1.00 11.92 ? 397 ALA B CB  1 
ATOM   1580 N N   . GLY B 2 98  ? 2.906   -43.618 64.443 1.00 27.02 ? 398 GLY B N   1 
ATOM   1581 C CA  . GLY B 2 98  ? 3.336   -44.810 65.142 1.00 23.89 ? 398 GLY B CA  1 
ATOM   1582 C C   . GLY B 2 98  ? 2.300   -45.909 65.129 1.00 22.72 ? 398 GLY B C   1 
ATOM   1583 O O   . GLY B 2 98  ? 1.106   -45.667 64.960 1.00 20.30 ? 398 GLY B O   1 
ATOM   1584 N N   . GLN B 2 99  ? 2.776   -47.133 65.296 1.00 25.11 ? 399 GLN B N   1 
ATOM   1585 C CA  . GLN B 2 99  ? 1.905   -48.283 65.338 1.00 26.90 ? 399 GLN B CA  1 
ATOM   1586 C C   . GLN B 2 99  ? 1.501   -48.463 66.796 1.00 30.19 ? 399 GLN B C   1 
ATOM   1587 O O   . GLN B 2 99  ? 2.281   -48.163 67.704 1.00 25.95 ? 399 GLN B O   1 
ATOM   1588 C CB  . GLN B 2 99  ? 2.646   -49.514 64.829 1.00 29.27 ? 399 GLN B CB  1 
ATOM   1589 C CG  . GLN B 2 99  ? 1.984   -50.821 65.191 1.00 35.38 ? 399 GLN B CG  1 
ATOM   1590 C CD  . GLN B 2 99  ? 2.999   -51.897 65.463 1.00 34.93 ? 399 GLN B CD  1 
ATOM   1591 O OE1 . GLN B 2 99  ? 4.028   -51.646 66.093 1.00 33.11 ? 399 GLN B OE1 1 
ATOM   1592 N NE2 . GLN B 2 99  ? 2.726   -53.103 64.981 1.00 42.30 ? 399 GLN B NE2 1 
ATOM   1593 N N   . TYR B 2 100 ? 0.280   -48.939 67.015 1.00 33.03 ? 400 TYR B N   1 
ATOM   1594 C CA  . TYR B 2 100 ? -0.235  -49.141 68.364 1.00 38.42 ? 400 TYR B CA  1 
ATOM   1595 C C   . TYR B 2 100 ? -1.574  -49.855 68.314 1.00 39.88 ? 400 TYR B C   1 
ATOM   1596 O O   . TYR B 2 100 ? -2.428  -49.532 67.490 1.00 42.57 ? 400 TYR B O   1 
ATOM   1597 C CB  . TYR B 2 100 ? -0.412  -47.797 69.074 1.00 42.53 ? 400 TYR B CB  1 
ATOM   1598 C CG  . TYR B 2 100 ? -0.429  -47.914 70.579 1.00 45.87 ? 400 TYR B CG  1 
ATOM   1599 C CD1 . TYR B 2 100 ? -1.630  -47.927 71.283 1.00 43.43 ? 400 TYR B CD1 1 
ATOM   1600 C CD2 . TYR B 2 100 ? 0.759   -48.056 71.298 1.00 45.62 ? 400 TYR B CD2 1 
ATOM   1601 C CE1 . TYR B 2 100 ? -1.647  -48.086 72.666 1.00 45.73 ? 400 TYR B CE1 1 
ATOM   1602 C CE2 . TYR B 2 100 ? 0.753   -48.215 72.676 1.00 44.67 ? 400 TYR B CE2 1 
ATOM   1603 C CZ  . TYR B 2 100 ? -0.452  -48.232 73.353 1.00 46.77 ? 400 TYR B CZ  1 
ATOM   1604 O OH  . TYR B 2 100 ? -0.459  -48.417 74.715 1.00 54.37 ? 400 TYR B OH  1 
ATOM   1605 N N   . GLY B 2 101 ? -1.756  -50.823 69.201 1.00 37.80 ? 401 GLY B N   1 
ATOM   1606 C CA  . GLY B 2 101 ? -3.004  -51.557 69.226 1.00 38.74 ? 401 GLY B CA  1 
ATOM   1607 C C   . GLY B 2 101 ? -3.200  -52.424 67.998 1.00 40.00 ? 401 GLY B C   1 
ATOM   1608 O O   . GLY B 2 101 ? -4.332  -52.639 67.563 1.00 40.92 ? 401 GLY B O   1 
ATOM   1609 N N   . ASN B 2 102 ? -2.097  -52.915 67.437 1.00 40.47 ? 402 ASN B N   1 
ATOM   1610 C CA  . ASN B 2 102 ? -2.130  -53.779 66.255 1.00 39.68 ? 402 ASN B CA  1 
ATOM   1611 C C   . ASN B 2 102 ? -2.421  -53.035 64.942 1.00 36.12 ? 402 ASN B C   1 
ATOM   1612 O O   . ASN B 2 102 ? -2.648  -53.662 63.903 1.00 37.93 ? 402 ASN B O   1 
ATOM   1613 C CB  . ASN B 2 102 ? -3.153  -54.909 66.458 1.00 41.14 ? 402 ASN B CB  1 
ATOM   1614 C CG  . ASN B 2 102 ? -2.691  -56.232 65.864 1.00 47.14 ? 402 ASN B CG  1 
ATOM   1615 O OD1 . ASN B 2 102 ? -3.455  -56.932 65.198 1.00 52.07 ? 402 ASN B OD1 1 
ATOM   1616 N ND2 . ASN B 2 102 ? -1.435  -56.578 66.102 1.00 49.49 ? 402 ASN B ND2 1 
ATOM   1617 N N   . LEU B 2 103 ? -2.406  -51.704 64.992 1.00 32.45 ? 403 LEU B N   1 
ATOM   1618 C CA  . LEU B 2 103 ? -2.656  -50.873 63.811 1.00 26.27 ? 403 LEU B CA  1 
ATOM   1619 C C   . LEU B 2 103 ? -1.412  -50.031 63.504 1.00 26.20 ? 403 LEU B C   1 
ATOM   1620 O O   . LEU B 2 103 ? -0.901  -49.323 64.372 1.00 21.67 ? 403 LEU B O   1 
ATOM   1621 C CB  . LEU B 2 103 ? -3.860  -49.971 64.061 1.00 20.85 ? 403 LEU B CB  1 
ATOM   1622 C CG  . LEU B 2 103 ? -5.279  -50.503 63.815 1.00 22.57 ? 403 LEU B CG  1 
ATOM   1623 C CD1 . LEU B 2 103 ? -5.313  -52.012 63.669 1.00 22.07 ? 403 LEU B CD1 1 
ATOM   1624 C CD2 . LEU B 2 103 ? -6.143  -50.069 64.976 1.00 22.92 ? 403 LEU B CD2 1 
ATOM   1625 N N   . TRP B 2 104 ? -0.946  -50.108 62.259 1.00 26.87 ? 404 TRP B N   1 
ATOM   1626 C CA  . TRP B 2 104 ? 0.266   -49.419 61.801 1.00 26.35 ? 404 TRP B CA  1 
ATOM   1627 C C   . TRP B 2 104 ? 0.322   -47.890 61.760 1.00 24.27 ? 404 TRP B C   1 
ATOM   1628 O O   . TRP B 2 104 ? 1.393   -47.307 61.914 1.00 23.34 ? 404 TRP B O   1 
ATOM   1629 C CB  . TRP B 2 104 ? 0.664   -49.981 60.436 1.00 30.18 ? 404 TRP B CB  1 
ATOM   1630 C CG  . TRP B 2 104 ? 1.125   -51.388 60.544 1.00 36.12 ? 404 TRP B CG  1 
ATOM   1631 C CD1 . TRP B 2 104 ? 0.348   -52.508 60.493 1.00 38.32 ? 404 TRP B CD1 1 
ATOM   1632 C CD2 . TRP B 2 104 ? 2.463   -51.835 60.805 1.00 37.79 ? 404 TRP B CD2 1 
ATOM   1633 N NE1 . TRP B 2 104 ? 1.119   -53.628 60.711 1.00 43.02 ? 404 TRP B NE1 1 
ATOM   1634 C CE2 . TRP B 2 104 ? 2.419   -53.245 60.906 1.00 37.57 ? 404 TRP B CE2 1 
ATOM   1635 C CE3 . TRP B 2 104 ? 3.693   -51.183 60.966 1.00 33.79 ? 404 TRP B CE3 1 
ATOM   1636 C CZ2 . TRP B 2 104 ? 3.557   -54.012 61.160 1.00 29.47 ? 404 TRP B CZ2 1 
ATOM   1637 C CZ3 . TRP B 2 104 ? 4.824   -51.948 61.219 1.00 26.96 ? 404 TRP B CZ3 1 
ATOM   1638 C CH2 . TRP B 2 104 ? 4.747   -53.348 61.313 1.00 27.98 ? 404 TRP B CH2 1 
ATOM   1639 N N   . PHE B 2 105 ? -0.801  -47.232 61.523 1.00 22.08 ? 405 PHE B N   1 
ATOM   1640 C CA  . PHE B 2 105 ? -0.799  -45.773 61.510 1.00 21.73 ? 405 PHE B CA  1 
ATOM   1641 C C   . PHE B 2 105 ? -1.820  -45.375 62.569 1.00 23.09 ? 405 PHE B C   1 
ATOM   1642 O O   . PHE B 2 105 ? -2.834  -44.737 62.277 1.00 25.09 ? 405 PHE B O   1 
ATOM   1643 C CB  . PHE B 2 105 ? -1.210  -45.234 60.132 1.00 15.78 ? 405 PHE B CB  1 
ATOM   1644 C CG  . PHE B 2 105 ? -0.204  -45.502 59.039 1.00 13.85 ? 405 PHE B CG  1 
ATOM   1645 C CD1 . PHE B 2 105 ? -0.226  -46.695 58.334 1.00 11.00 ? 405 PHE B CD1 1 
ATOM   1646 C CD2 . PHE B 2 105 ? 0.761   -44.557 58.714 1.00 19.71 ? 405 PHE B CD2 1 
ATOM   1647 C CE1 . PHE B 2 105 ? 0.694   -46.946 57.328 1.00 10.13 ? 405 PHE B CE1 1 
ATOM   1648 C CE2 . PHE B 2 105 ? 1.690   -44.797 57.705 1.00 15.62 ? 405 PHE B CE2 1 
ATOM   1649 C CZ  . PHE B 2 105 ? 1.655   -45.997 57.011 1.00 19.22 ? 405 PHE B CZ  1 
ATOM   1650 N N   . ALA B 2 106 ? -1.550  -45.766 63.809 1.00 20.50 ? 406 ALA B N   1 
ATOM   1651 C CA  . ALA B 2 106 ? -2.472  -45.483 64.895 1.00 23.29 ? 406 ALA B CA  1 
ATOM   1652 C C   . ALA B 2 106 ? -2.365  -44.059 65.450 1.00 29.28 ? 406 ALA B C   1 
ATOM   1653 O O   . ALA B 2 106 ? -3.387  -43.434 65.758 1.00 31.12 ? 406 ALA B O   1 
ATOM   1654 C CB  . ALA B 2 106 ? -2.282  -46.517 66.011 1.00 12.81 ? 406 ALA B CB  1 
ATOM   1655 N N   . TYR B 2 107 ? -1.142  -43.545 65.575 1.00 29.75 ? 407 TYR B N   1 
ATOM   1656 C CA  . TYR B 2 107 ? -0.935  -42.195 66.095 1.00 25.16 ? 407 TYR B CA  1 
ATOM   1657 C C   . TYR B 2 107 ? -0.098  -41.384 65.126 1.00 25.21 ? 407 TYR B C   1 
ATOM   1658 O O   . TYR B 2 107 ? 0.867   -41.888 64.566 1.00 26.96 ? 407 TYR B O   1 
ATOM   1659 C CB  . TYR B 2 107 ? -0.270  -42.259 67.469 1.00 27.76 ? 407 TYR B CB  1 
ATOM   1660 C CG  . TYR B 2 107 ? -1.157  -42.956 68.458 1.00 40.54 ? 407 TYR B CG  1 
ATOM   1661 C CD1 . TYR B 2 107 ? -0.926  -44.285 68.819 1.00 43.64 ? 407 TYR B CD1 1 
ATOM   1662 C CD2 . TYR B 2 107 ? -2.303  -42.325 68.950 1.00 46.25 ? 407 TYR B CD2 1 
ATOM   1663 C CE1 . TYR B 2 107 ? -1.820  -44.970 69.635 1.00 49.45 ? 407 TYR B CE1 1 
ATOM   1664 C CE2 . TYR B 2 107 ? -3.203  -43.002 69.766 1.00 53.16 ? 407 TYR B CE2 1 
ATOM   1665 C CZ  . TYR B 2 107 ? -2.957  -44.325 70.099 1.00 54.65 ? 407 TYR B CZ  1 
ATOM   1666 O OH  . TYR B 2 107 ? -3.861  -45.006 70.873 1.00 63.49 ? 407 TYR B OH  1 
ATOM   1667 N N   . TRP B 2 108 ? -0.483  -40.127 64.930 1.00 23.06 ? 408 TRP B N   1 
ATOM   1668 C CA  . TRP B 2 108 ? 0.203   -39.250 63.997 1.00 16.95 ? 408 TRP B CA  1 
ATOM   1669 C C   . TRP B 2 108 ? 0.756   -38.009 64.653 1.00 19.61 ? 408 TRP B C   1 
ATOM   1670 O O   . TRP B 2 108 ? 0.242   -37.548 65.668 1.00 19.93 ? 408 TRP B O   1 
ATOM   1671 C CB  . TRP B 2 108 ? -0.757  -38.799 62.893 1.00 14.91 ? 408 TRP B CB  1 
ATOM   1672 C CG  . TRP B 2 108 ? -1.196  -39.881 61.970 1.00 18.36 ? 408 TRP B CG  1 
ATOM   1673 C CD1 . TRP B 2 108 ? -2.004  -40.945 62.267 1.00 18.68 ? 408 TRP B CD1 1 
ATOM   1674 C CD2 . TRP B 2 108 ? -0.854  -40.008 60.585 1.00 24.68 ? 408 TRP B CD2 1 
ATOM   1675 N NE1 . TRP B 2 108 ? -2.185  -41.727 61.149 1.00 18.44 ? 408 TRP B NE1 1 
ATOM   1676 C CE2 . TRP B 2 108 ? -1.491  -41.178 60.103 1.00 19.38 ? 408 TRP B CE2 1 
ATOM   1677 C CE3 . TRP B 2 108 ? -0.070  -39.245 59.700 1.00 17.34 ? 408 TRP B CE3 1 
ATOM   1678 C CZ2 . TRP B 2 108 ? -1.366  -41.604 58.778 1.00 17.49 ? 408 TRP B CZ2 1 
ATOM   1679 C CZ3 . TRP B 2 108 ? 0.053   -39.667 58.386 1.00 14.85 ? 408 TRP B CZ3 1 
ATOM   1680 C CH2 . TRP B 2 108 ? -0.593  -40.840 57.937 1.00 21.09 ? 408 TRP B CH2 1 
ATOM   1681 N N   . GLY B 2 109 ? 1.816   -37.472 64.062 1.00 20.10 ? 409 GLY B N   1 
ATOM   1682 C CA  . GLY B 2 109 ? 2.388   -36.247 64.566 1.00 19.18 ? 409 GLY B CA  1 
ATOM   1683 C C   . GLY B 2 109 ? 1.591   -35.168 63.862 1.00 26.29 ? 409 GLY B C   1 
ATOM   1684 O O   . GLY B 2 109 ? 0.700   -35.471 63.067 1.00 28.20 ? 409 GLY B O   1 
ATOM   1685 N N   . GLN B 2 110 ? 1.895   -33.908 64.133 1.00 30.73 ? 410 GLN B N   1 
ATOM   1686 C CA  . GLN B 2 110 ? 1.164   -32.830 63.492 1.00 31.13 ? 410 GLN B CA  1 
ATOM   1687 C C   . GLN B 2 110 ? 1.787   -32.446 62.153 1.00 28.68 ? 410 GLN B C   1 
ATOM   1688 O O   . GLN B 2 110 ? 1.246   -31.619 61.425 1.00 26.19 ? 410 GLN B O   1 
ATOM   1689 C CB  . GLN B 2 110 ? 1.104   -31.632 64.429 1.00 36.19 ? 410 GLN B CB  1 
ATOM   1690 C CG  . GLN B 2 110 ? 0.140   -31.843 65.582 1.00 44.08 ? 410 GLN B CG  1 
ATOM   1691 C CD  . GLN B 2 110 ? -1.134  -31.038 65.436 1.00 46.93 ? 410 GLN B CD  1 
ATOM   1692 O OE1 . GLN B 2 110 ? -2.000  -31.073 66.306 1.00 52.70 ? 410 GLN B OE1 1 
ATOM   1693 N NE2 . GLN B 2 110 ? -1.253  -30.301 64.335 1.00 50.00 ? 410 GLN B NE2 1 
ATOM   1694 N N   . GLY B 2 111 ? 2.930   -33.055 61.841 1.00 25.27 ? 411 GLY B N   1 
ATOM   1695 C CA  . GLY B 2 111 ? 3.601   -32.795 60.581 1.00 20.48 ? 411 GLY B CA  1 
ATOM   1696 C C   . GLY B 2 111 ? 4.595   -31.653 60.550 1.00 17.27 ? 411 GLY B C   1 
ATOM   1697 O O   . GLY B 2 111 ? 4.485   -30.704 61.316 1.00 23.20 ? 411 GLY B O   1 
ATOM   1698 N N   . THR B 2 112 ? 5.571   -31.764 59.652 1.00 16.91 ? 412 THR B N   1 
ATOM   1699 C CA  . THR B 2 112 ? 6.600   -30.750 59.463 1.00 12.61 ? 412 THR B CA  1 
ATOM   1700 C C   . THR B 2 112 ? 6.567   -30.366 57.995 1.00 16.99 ? 412 THR B C   1 
ATOM   1701 O O   . THR B 2 112 ? 6.892   -31.183 57.133 1.00 18.30 ? 412 THR B O   1 
ATOM   1702 C CB  . THR B 2 112 ? 8.034   -31.279 59.768 1.00 11.89 ? 412 THR B CB  1 
ATOM   1703 O OG1 . THR B 2 112 ? 8.123   -31.725 61.124 1.00 13.62 ? 412 THR B OG1 1 
ATOM   1704 C CG2 . THR B 2 112 ? 9.062   -30.186 59.565 1.00 12.95 ? 412 THR B CG2 1 
ATOM   1705 N N   . LEU B 2 113 ? 6.162   -29.135 57.704 1.00 14.69 ? 413 LEU B N   1 
ATOM   1706 C CA  . LEU B 2 113 ? 6.131   -28.671 56.327 1.00 12.16 ? 413 LEU B CA  1 
ATOM   1707 C C   . LEU B 2 113 ? 7.541   -28.296 55.912 1.00 12.17 ? 413 LEU B C   1 
ATOM   1708 O O   . LEU B 2 113 ? 8.164   -27.439 56.525 1.00 18.81 ? 413 LEU B O   1 
ATOM   1709 C CB  . LEU B 2 113 ? 5.231   -27.452 56.174 1.00 11.49 ? 413 LEU B CB  1 
ATOM   1710 C CG  . LEU B 2 113 ? 5.365   -26.802 54.797 1.00 12.20 ? 413 LEU B CG  1 
ATOM   1711 C CD1 . LEU B 2 113 ? 4.531   -27.559 53.778 1.00 12.05 ? 413 LEU B CD1 1 
ATOM   1712 C CD2 . LEU B 2 113 ? 4.935   -25.360 54.890 1.00 16.92 ? 413 LEU B CD2 1 
ATOM   1713 N N   . VAL B 2 114 ? 8.038   -28.943 54.867 1.00 19.08 ? 414 VAL B N   1 
ATOM   1714 C CA  . VAL B 2 114 ? 9.382   -28.691 54.367 1.00 18.21 ? 414 VAL B CA  1 
ATOM   1715 C C   . VAL B 2 114 ? 9.321   -27.874 53.088 1.00 20.45 ? 414 VAL B C   1 
ATOM   1716 O O   . VAL B 2 114 ? 8.738   -28.310 52.102 1.00 24.64 ? 414 VAL B O   1 
ATOM   1717 C CB  . VAL B 2 114 ? 10.114  -30.017 54.051 1.00 19.86 ? 414 VAL B CB  1 
ATOM   1718 C CG1 . VAL B 2 114 ? 11.396  -29.735 53.283 1.00 17.21 ? 414 VAL B CG1 1 
ATOM   1719 C CG2 . VAL B 2 114 ? 10.411  -30.767 55.336 1.00 9.44  ? 414 VAL B CG2 1 
ATOM   1720 N N   . THR B 2 115 ? 9.913   -26.690 53.108 1.00 18.03 ? 415 THR B N   1 
ATOM   1721 C CA  . THR B 2 115 ? 9.931   -25.847 51.927 1.00 17.45 ? 415 THR B CA  1 
ATOM   1722 C C   . THR B 2 115 ? 11.367  -25.645 51.497 1.00 20.21 ? 415 THR B C   1 
ATOM   1723 O O   . THR B 2 115 ? 12.161  -25.072 52.240 1.00 19.40 ? 415 THR B O   1 
ATOM   1724 C CB  . THR B 2 115 ? 9.345   -24.460 52.191 1.00 17.84 ? 415 THR B CB  1 
ATOM   1725 O OG1 . THR B 2 115 ? 8.008   -24.589 52.680 1.00 23.69 ? 415 THR B OG1 1 
ATOM   1726 C CG2 . THR B 2 115 ? 9.344   -23.639 50.899 1.00 15.40 ? 415 THR B CG2 1 
ATOM   1727 N N   . VAL B 2 116 ? 11.707  -26.118 50.305 1.00 19.09 ? 416 VAL B N   1 
ATOM   1728 C CA  . VAL B 2 116 ? 13.058  -25.937 49.812 1.00 23.90 ? 416 VAL B CA  1 
ATOM   1729 C C   . VAL B 2 116 ? 13.022  -24.762 48.843 1.00 23.15 ? 416 VAL B C   1 
ATOM   1730 O O   . VAL B 2 116 ? 12.290  -24.774 47.867 1.00 24.76 ? 416 VAL B O   1 
ATOM   1731 C CB  . VAL B 2 116 ? 13.592  -27.233 49.144 1.00 24.71 ? 416 VAL B CB  1 
ATOM   1732 C CG1 . VAL B 2 116 ? 12.477  -28.264 49.042 1.00 18.65 ? 416 VAL B CG1 1 
ATOM   1733 C CG2 . VAL B 2 116 ? 14.210  -26.922 47.797 1.00 17.70 ? 416 VAL B CG2 1 
ATOM   1734 N N   . SER B 2 117 ? 13.797  -23.732 49.151 1.00 30.28 ? 417 SER B N   1 
ATOM   1735 C CA  . SER B 2 117 ? 13.856  -22.515 48.351 1.00 41.84 ? 417 SER B CA  1 
ATOM   1736 C C   . SER B 2 117 ? 14.421  -22.716 46.951 1.00 48.45 ? 417 SER B C   1 
ATOM   1737 O O   . SER B 2 117 ? 13.962  -23.644 46.246 1.00 54.88 ? 417 SER B O   1 
ATOM   1738 C CB  . SER B 2 117 ? 14.702  -21.481 49.079 1.00 45.05 ? 417 SER B CB  1 
ATOM   1739 O OG  . SER B 2 117 ? 16.013  -21.985 49.271 1.00 44.03 ? 417 SER B OG  1 
ATOM   1740 O OXT . SER B 2 117 ? 15.322  -21.927 46.577 1.00 52.83 ? 417 SER B OXT 1 
HETATM 1741 O O   . HOH C 3 .   ? -0.765  -51.110 39.837 1.00 46.68 ? 802 HOH A O   1 
HETATM 1742 O O   . HOH C 3 .   ? -1.939  -44.967 45.374 1.00 14.94 ? 803 HOH A O   1 
HETATM 1743 O O   . HOH C 3 .   ? -8.478  -30.146 55.767 1.00 42.63 ? 805 HOH A O   1 
HETATM 1744 O O   . HOH C 3 .   ? -14.608 -49.106 53.533 1.00 25.02 ? 806 HOH A O   1 
HETATM 1745 O O   . HOH C 3 .   ? -11.035 -46.185 38.894 1.00 35.94 ? 807 HOH A O   1 
HETATM 1746 O O   . HOH C 3 .   ? -26.165 -29.970 49.643 1.00 50.25 ? 808 HOH A O   1 
HETATM 1747 O O   . HOH C 3 .   ? -12.514 -58.399 49.125 1.00 32.54 ? 809 HOH A O   1 
HETATM 1748 O O   . HOH C 3 .   ? -20.980 -46.599 62.147 1.00 36.77 ? 811 HOH A O   1 
HETATM 1749 O O   . HOH C 3 .   ? -14.430 -37.399 64.200 1.00 50.19 ? 812 HOH A O   1 
HETATM 1750 O O   . HOH C 3 .   ? -18.702 -48.958 59.679 1.00 20.93 ? 813 HOH A O   1 
HETATM 1751 O O   . HOH C 3 .   ? -8.380  -37.407 45.208 1.00 23.48 ? 814 HOH A O   1 
HETATM 1752 O O   . HOH C 3 .   ? -11.992 -51.113 66.104 1.00 32.85 ? 816 HOH A O   1 
HETATM 1753 O O   . HOH C 3 .   ? -14.041 -53.033 66.111 1.00 17.16 ? 817 HOH A O   1 
HETATM 1754 O O   . HOH C 3 .   ? -7.372  -33.737 47.136 1.00 66.93 ? 818 HOH A O   1 
HETATM 1755 O O   . HOH C 3 .   ? 2.900   -45.222 49.106 1.00 20.35 ? 819 HOH A O   1 
HETATM 1756 O O   . HOH C 3 .   ? -12.840 -30.446 61.767 1.00 51.54 ? 823 HOH A O   1 
HETATM 1757 O O   . HOH C 3 .   ? -7.443  -52.812 57.506 1.00 22.26 ? 827 HOH A O   1 
HETATM 1758 O O   . HOH C 3 .   ? -3.354  -57.897 39.672 1.00 47.56 ? 828 HOH A O   1 
HETATM 1759 O O   . HOH C 3 .   ? -7.028  -47.434 41.331 1.00 34.33 ? 838 HOH A O   1 
HETATM 1760 O O   . HOH C 3 .   ? 8.013   -47.685 43.739 1.00 73.40 ? 840 HOH A O   1 
HETATM 1761 O O   . HOH C 3 .   ? -11.237 -28.258 47.168 1.00 49.76 ? 841 HOH A O   1 
HETATM 1762 O O   . HOH C 3 .   ? -13.968 -20.382 47.341 1.00 68.68 ? 842 HOH A O   1 
HETATM 1763 O O   . HOH C 3 .   ? -25.280 -25.128 51.765 1.00 78.47 ? 843 HOH A O   1 
HETATM 1764 O O   . HOH C 3 .   ? -24.762 -25.705 54.815 1.00 36.18 ? 844 HOH A O   1 
HETATM 1765 O O   . HOH C 3 .   ? -22.886 -23.253 57.544 1.00 47.78 ? 845 HOH A O   1 
HETATM 1766 O O   . HOH C 3 .   ? -30.311 -33.891 58.123 1.00 25.79 ? 846 HOH A O   1 
HETATM 1767 O O   . HOH C 3 .   ? -6.972  -56.106 39.221 1.00 24.93 ? 847 HOH A O   1 
HETATM 1768 O O   . HOH C 3 .   ? -7.760  -58.172 41.160 1.00 19.89 ? 848 HOH A O   1 
HETATM 1769 O O   . HOH C 3 .   ? -3.351  -39.664 65.294 1.00 23.25 ? 851 HOH A O   1 
HETATM 1770 O O   . HOH C 3 .   ? -8.738  -51.772 39.269 1.00 24.74 ? 852 HOH A O   1 
HETATM 1771 O O   . HOH C 3 .   ? -1.573  -50.927 57.483 1.00 22.92 ? 853 HOH A O   1 
HETATM 1772 O O   . HOH C 3 .   ? -3.817  -48.138 60.801 1.00 25.85 ? 854 HOH A O   1 
HETATM 1773 O O   . HOH C 3 .   ? -7.311  -53.982 60.589 1.00 26.91 ? 855 HOH A O   1 
HETATM 1774 O O   . HOH C 3 .   ? -20.427 -46.611 53.430 1.00 44.67 ? 856 HOH A O   1 
HETATM 1775 O O   . HOH C 3 .   ? -11.825 -28.603 53.996 1.00 42.94 ? 857 HOH A O   1 
HETATM 1776 O O   . HOH C 3 .   ? -7.052  -26.492 56.370 1.00 57.36 ? 858 HOH A O   1 
HETATM 1777 O O   . HOH C 3 .   ? -18.705 -49.156 48.427 1.00 32.06 ? 859 HOH A O   1 
HETATM 1778 O O   . HOH D 3 .   ? -0.509  -51.717 71.800 1.00 57.26 ? 801 HOH B O   1 
HETATM 1779 O O   . HOH D 3 .   ? 10.694  -36.485 49.001 1.00 20.03 ? 804 HOH B O   1 
HETATM 1780 O O   . HOH D 3 .   ? 14.149  -30.850 62.105 1.00 33.94 ? 810 HOH B O   1 
HETATM 1781 O O   . HOH D 3 .   ? 4.329   -29.478 64.487 1.00 29.55 ? 815 HOH B O   1 
HETATM 1782 O O   . HOH D 3 .   ? 13.484  -56.601 64.616 1.00 35.30 ? 820 HOH B O   1 
HETATM 1783 O O   . HOH D 3 .   ? 0.809   -43.773 48.146 1.00 12.68 ? 821 HOH B O   1 
HETATM 1784 O O   . HOH D 3 .   ? 3.474   -32.700 66.158 1.00 19.43 ? 822 HOH B O   1 
HETATM 1785 O O   . HOH D 3 .   ? 16.590  -46.572 44.512 1.00 47.32 ? 824 HOH B O   1 
HETATM 1786 O O   . HOH D 3 .   ? -5.368  -42.095 65.056 1.00 22.33 ? 825 HOH B O   1 
HETATM 1787 O O   . HOH D 3 .   ? 16.205  -50.739 73.532 1.00 51.11 ? 826 HOH B O   1 
HETATM 1788 O O   . HOH D 3 .   ? -4.258  -33.146 50.218 1.00 59.27 ? 829 HOH B O   1 
HETATM 1789 O O   . HOH D 3 .   ? 15.740  -53.867 72.170 1.00 40.44 ? 830 HOH B O   1 
HETATM 1790 O O   . HOH D 3 .   ? 18.206  -49.485 68.165 1.00 64.69 ? 831 HOH B O   1 
HETATM 1791 O O   . HOH D 3 .   ? -1.727  -35.138 63.829 1.00 24.35 ? 832 HOH B O   1 
HETATM 1792 O O   . HOH D 3 .   ? 22.798  -33.168 50.139 1.00 32.78 ? 833 HOH B O   1 
HETATM 1793 O O   . HOH D 3 .   ? 4.031   -48.925 76.173 1.00 42.83 ? 834 HOH B O   1 
HETATM 1794 O O   . HOH D 3 .   ? 12.848  -42.805 61.891 1.00 14.89 ? 835 HOH B O   1 
HETATM 1795 O O   . HOH D 3 .   ? 16.918  -51.238 54.751 1.00 66.37 ? 836 HOH B O   1 
HETATM 1796 O O   . HOH D 3 .   ? 18.291  -50.488 71.452 1.00 43.54 ? 837 HOH B O   1 
HETATM 1797 O O   . HOH D 3 .   ? 18.038  -37.914 46.705 1.00 61.29 ? 839 HOH B O   1 
HETATM 1798 O O   . HOH D 3 .   ? 20.358  -40.004 64.122 1.00 35.29 ? 849 HOH B O   1 
HETATM 1799 O O   . HOH D 3 .   ? 18.303  -40.275 59.873 1.00 12.44 ? 850 HOH B O   1 
HETATM 1800 O O   . HOH D 3 .   ? 9.533   -34.089 61.545 1.00 14.60 ? 860 HOH B O   1 
HETATM 1801 O O   . HOH D 3 .   ? 4.509   -44.816 46.730 1.00 33.50 ? 861 HOH B O   1 
HETATM 1802 O O   . HOH D 3 .   ? 13.489  -29.578 41.088 1.00 28.91 ? 862 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   1   1   ASP ASP A . n 
A 1 2   ILE 2   2   2   ILE ILE A . n 
A 1 3   GLN 3   3   3   GLN GLN A . n 
A 1 4   MET 4   4   4   MET MET A . n 
A 1 5   THR 5   5   5   THR THR A . n 
A 1 6   GLN 6   6   6   GLN GLN A . n 
A 1 7   THR 7   7   7   THR THR A . n 
A 1 8   THR 8   8   8   THR THR A . n 
A 1 9   SER 9   9   9   SER SER A . n 
A 1 10  SER 10  10  10  SER SER A . n 
A 1 11  LEU 11  11  11  LEU LEU A . n 
A 1 12  SER 12  12  12  SER SER A . n 
A 1 13  ALA 13  13  13  ALA ALA A . n 
A 1 14  SER 14  14  14  SER SER A . n 
A 1 15  LEU 15  15  15  LEU LEU A . n 
A 1 16  GLY 16  16  16  GLY GLY A . n 
A 1 17  ASP 17  17  17  ASP ASP A . n 
A 1 18  ARG 18  18  18  ARG ARG A . n 
A 1 19  VAL 19  19  19  VAL VAL A . n 
A 1 20  THR 20  20  20  THR THR A . n 
A 1 21  ILE 21  21  21  ILE ILE A . n 
A 1 22  SER 22  22  22  SER SER A . n 
A 1 23  CYS 23  23  23  CYS CYS A . n 
A 1 24  ARG 24  24  24  ARG ARG A . n 
A 1 25  ALA 25  25  25  ALA ALA A . n 
A 1 26  SER 26  26  26  SER SER A . n 
A 1 27  GLN 27  27  27  GLN GLN A . n 
A 1 28  ASP 28  28  28  ASP ASP A . n 
A 1 29  ILE 29  29  29  ILE ILE A . n 
A 1 30  ASN 30  30  30  ASN ASN A . n 
A 1 31  ASN 31  31  31  ASN ASN A . n 
A 1 32  TYR 32  32  32  TYR TYR A . n 
A 1 33  LEU 33  33  33  LEU LEU A . n 
A 1 34  ASN 34  34  34  ASN ASN A . n 
A 1 35  TRP 35  35  35  TRP TRP A . n 
A 1 36  TYR 36  36  36  TYR TYR A . n 
A 1 37  GLN 37  37  37  GLN GLN A . n 
A 1 38  GLN 38  38  38  GLN GLN A . n 
A 1 39  LYS 39  39  39  LYS LYS A . n 
A 1 40  PRO 40  40  40  PRO PRO A . n 
A 1 41  ASP 41  41  41  ASP ASP A . n 
A 1 42  GLY 42  42  42  GLY GLY A . n 
A 1 43  THR 43  43  43  THR THR A . n 
A 1 44  VAL 44  44  44  VAL VAL A . n 
A 1 45  LYS 45  45  45  LYS LYS A . n 
A 1 46  LEU 46  46  46  LEU LEU A . n 
A 1 47  LEU 47  47  47  LEU LEU A . n 
A 1 48  ILE 48  48  48  ILE ILE A . n 
A 1 49  HIS 49  49  49  HIS HIS A . n 
A 1 50  TYR 50  50  50  TYR TYR A . n 
A 1 51  THR 51  51  51  THR THR A . n 
A 1 52  SER 52  52  52  SER SER A . n 
A 1 53  ARG 53  53  53  ARG ARG A . n 
A 1 54  LEU 54  54  54  LEU LEU A . n 
A 1 55  HIS 55  55  55  HIS HIS A . n 
A 1 56  SER 56  56  56  SER SER A . n 
A 1 57  GLY 57  57  57  GLY GLY A . n 
A 1 58  VAL 58  58  58  VAL VAL A . n 
A 1 59  PRO 59  59  59  PRO PRO A . n 
A 1 60  SER 60  60  60  SER SER A . n 
A 1 61  ARG 61  61  61  ARG ARG A . n 
A 1 62  PHE 62  62  62  PHE PHE A . n 
A 1 63  SER 63  63  63  SER SER A . n 
A 1 64  GLY 64  64  64  GLY GLY A . n 
A 1 65  SER 65  65  65  SER SER A . n 
A 1 66  GLY 66  66  66  GLY GLY A . n 
A 1 67  SER 67  67  67  SER SER A . n 
A 1 68  GLY 68  68  68  GLY GLY A . n 
A 1 69  THR 69  69  69  THR THR A . n 
A 1 70  ASP 70  70  70  ASP ASP A . n 
A 1 71  TYR 71  71  71  TYR TYR A . n 
A 1 72  SER 72  72  72  SER SER A . n 
A 1 73  LEU 73  73  73  LEU LEU A . n 
A 1 74  THR 74  74  74  THR THR A . n 
A 1 75  ILE 75  75  75  ILE ILE A . n 
A 1 76  SER 76  76  76  SER SER A . n 
A 1 77  ASN 77  77  77  ASN ASN A . n 
A 1 78  LEU 78  78  78  LEU LEU A . n 
A 1 79  GLU 79  79  79  GLU GLU A . n 
A 1 80  GLN 80  80  80  GLN GLN A . n 
A 1 81  GLU 81  81  81  GLU GLU A . n 
A 1 82  ASP 82  82  82  ASP ASP A . n 
A 1 83  ILE 83  83  83  ILE ILE A . n 
A 1 84  ALA 84  84  84  ALA ALA A . n 
A 1 85  THR 85  85  85  THR THR A . n 
A 1 86  TYR 86  86  86  TYR TYR A . n 
A 1 87  PHE 87  87  87  PHE PHE A . n 
A 1 88  CYS 88  88  88  CYS CYS A . n 
A 1 89  GLN 89  89  89  GLN GLN A . n 
A 1 90  GLN 90  90  90  GLN GLN A . n 
A 1 91  GLY 91  91  91  GLY GLY A . n 
A 1 92  ASN 92  92  92  ASN ASN A . n 
A 1 93  THR 93  93  93  THR THR A . n 
A 1 94  LEU 94  94  94  LEU LEU A . n 
A 1 95  PRO 95  95  95  PRO PRO A . n 
A 1 96  TRP 96  96  96  TRP TRP A . n 
A 1 97  THR 97  97  97  THR THR A . n 
A 1 98  PHE 98  98  98  PHE PHE A . n 
A 1 99  GLY 99  99  99  GLY GLY A . n 
A 1 100 GLY 100 100 100 GLY GLY A . n 
A 1 101 GLY 101 101 101 GLY GLY A . n 
A 1 102 THR 102 102 102 THR THR A . n 
A 1 103 LYS 103 103 103 LYS LYS A . n 
A 1 104 LEU 104 104 104 LEU LEU A . n 
A 1 105 GLU 105 105 105 GLU GLU A . n 
A 1 106 ILE 106 106 106 ILE ILE A . n 
A 1 107 LYS 107 107 107 LYS LYS A . n 
B 2 1   GLN 1   301 301 GLN GLN B . n 
B 2 2   VAL 2   302 302 VAL VAL B . n 
B 2 3   GLN 3   303 303 GLN GLN B . n 
B 2 4   LEU 4   304 304 LEU LEU B . n 
B 2 5   GLN 5   305 305 GLN GLN B . n 
B 2 6   GLN 6   306 306 GLN GLN B . n 
B 2 7   PRO 7   307 307 PRO PRO B . n 
B 2 8   GLY 8   308 308 GLY GLY B . n 
B 2 9   ALA 9   309 309 ALA ALA B . n 
B 2 10  GLU 10  310 310 GLU GLU B . n 
B 2 11  LEU 11  311 311 LEU LEU B . n 
B 2 12  VAL 12  312 312 VAL VAL B . n 
B 2 13  LYS 13  313 313 LYS LYS B . n 
B 2 14  PRO 14  314 314 PRO PRO B . n 
B 2 15  GLY 15  315 315 GLY GLY B . n 
B 2 16  THR 16  316 316 THR THR B . n 
B 2 17  SER 17  317 317 SER SER B . n 
B 2 18  VAL 18  318 318 VAL VAL B . n 
B 2 19  LYS 19  319 319 LYS LYS B . n 
B 2 20  LEU 20  320 320 LEU LEU B . n 
B 2 21  SER 21  321 321 SER SER B . n 
B 2 22  CYS 22  322 322 CYS CYS B . n 
B 2 23  LYS 23  323 323 LYS LYS B . n 
B 2 24  ALA 24  324 324 ALA ALA B . n 
B 2 25  SER 25  325 325 SER SER B . n 
B 2 26  GLY 26  326 326 GLY GLY B . n 
B 2 27  TYR 27  327 327 TYR TYR B . n 
B 2 28  ASN 28  328 328 ASN ASN B . n 
B 2 29  PHE 29  329 329 PHE PHE B . n 
B 2 30  THR 30  330 330 THR THR B . n 
B 2 31  SER 31  331 331 SER SER B . n 
B 2 32  TYR 32  332 332 TYR TYR B . n 
B 2 33  TRP 33  333 333 TRP TRP B . n 
B 2 34  ILE 34  334 334 ILE ILE B . n 
B 2 35  ASN 35  335 335 ASN ASN B . n 
B 2 36  TRP 36  336 336 TRP TRP B . n 
B 2 37  VAL 37  337 337 VAL VAL B . n 
B 2 38  LYS 38  338 338 LYS LYS B . n 
B 2 39  LEU 39  339 339 LEU LEU B . n 
B 2 40  ARG 40  340 340 ARG ARG B . n 
B 2 41  PRO 41  341 341 PRO PRO B . n 
B 2 42  GLY 42  342 342 GLY GLY B . n 
B 2 43  GLN 43  343 343 GLN GLN B . n 
B 2 44  GLY 44  344 344 GLY GLY B . n 
B 2 45  LEU 45  345 345 LEU LEU B . n 
B 2 46  GLU 46  346 346 GLU GLU B . n 
B 2 47  TRP 47  347 347 TRP TRP B . n 
B 2 48  ILE 48  348 348 ILE ILE B . n 
B 2 49  GLY 49  349 349 GLY GLY B . n 
B 2 50  ASP 50  350 350 ASP ASP B . n 
B 2 51  ILE 51  351 351 ILE ILE B . n 
B 2 52  TYR 52  352 352 TYR TYR B . n 
B 2 53  PRO 53  353 353 PRO PRO B . n 
B 2 54  GLY 54  354 354 GLY GLY B . n 
B 2 55  SER 55  355 355 SER SER B . n 
B 2 56  GLY 56  356 356 GLY GLY B . n 
B 2 57  ILE 57  357 357 ILE ILE B . n 
B 2 58  THR 58  358 358 THR THR B . n 
B 2 59  ASN 59  359 359 ASN ASN B . n 
B 2 60  TYR 60  360 360 TYR TYR B . n 
B 2 61  ASN 61  361 361 ASN ASN B . n 
B 2 62  GLU 62  362 362 GLU GLU B . n 
B 2 63  LYS 63  363 363 LYS LYS B . n 
B 2 64  PHE 64  364 364 PHE PHE B . n 
B 2 65  LYS 65  365 365 LYS LYS B . n 
B 2 66  SER 66  366 366 SER SER B . n 
B 2 67  LYS 67  367 367 LYS LYS B . n 
B 2 68  ALA 68  368 368 ALA ALA B . n 
B 2 69  THR 69  369 369 THR THR B . n 
B 2 70  LEU 70  370 370 LEU LEU B . n 
B 2 71  THR 71  371 371 THR THR B . n 
B 2 72  VAL 72  372 372 VAL VAL B . n 
B 2 73  ASP 73  373 373 ASP ASP B . n 
B 2 74  THR 74  374 374 THR THR B . n 
B 2 75  SER 75  375 375 SER SER B . n 
B 2 76  SER 76  376 376 SER SER B . n 
B 2 77  SER 77  377 377 SER SER B . n 
B 2 78  THR 78  378 378 THR THR B . n 
B 2 79  ALA 79  379 379 ALA ALA B . n 
B 2 80  TYR 80  380 380 TYR TYR B . n 
B 2 81  MET 81  381 381 MET MET B . n 
B 2 82  GLN 82  382 382 GLN GLN B . n 
B 2 83  LEU 83  383 383 LEU LEU B . n 
B 2 84  SER 84  384 384 SER SER B . n 
B 2 85  SER 85  385 385 SER SER B . n 
B 2 86  LEU 86  386 386 LEU LEU B . n 
B 2 87  ALA 87  387 387 ALA ALA B . n 
B 2 88  SER 88  388 388 SER SER B . n 
B 2 89  GLU 89  389 389 GLU GLU B . n 
B 2 90  ASP 90  390 390 ASP ASP B . n 
B 2 91  SER 91  391 391 SER SER B . n 
B 2 92  ALA 92  392 392 ALA ALA B . n 
B 2 93  LEU 93  393 393 LEU LEU B . n 
B 2 94  TYR 94  394 394 TYR TYR B . n 
B 2 95  TYR 95  395 395 TYR TYR B . n 
B 2 96  CYS 96  396 396 CYS CYS B . n 
B 2 97  ALA 97  397 397 ALA ALA B . n 
B 2 98  GLY 98  398 398 GLY GLY B . n 
B 2 99  GLN 99  399 399 GLN GLN B . n 
B 2 100 TYR 100 400 400 TYR TYR B . n 
B 2 101 GLY 101 401 401 GLY GLY B . n 
B 2 102 ASN 102 402 402 ASN ASN B . n 
B 2 103 LEU 103 403 403 LEU LEU B . n 
B 2 104 TRP 104 404 404 TRP TRP B . n 
B 2 105 PHE 105 405 405 PHE PHE B . n 
B 2 106 ALA 106 406 406 ALA ALA B . n 
B 2 107 TYR 107 407 407 TYR TYR B . n 
B 2 108 TRP 108 408 408 TRP TRP B . n 
B 2 109 GLY 109 409 409 GLY GLY B . n 
B 2 110 GLN 110 410 410 GLN GLN B . n 
B 2 111 GLY 111 411 411 GLY GLY B . n 
B 2 112 THR 112 412 412 THR THR B . n 
B 2 113 LEU 113 413 413 LEU LEU B . n 
B 2 114 VAL 114 414 414 VAL VAL B . n 
B 2 115 THR 115 415 415 THR THR B . n 
B 2 116 VAL 116 416 416 VAL VAL B . n 
B 2 117 SER 117 417 417 SER SER B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 HOH 1  802 802 HOH TIP A . 
C 3 HOH 2  803 803 HOH TIP A . 
C 3 HOH 3  805 805 HOH TIP A . 
C 3 HOH 4  806 806 HOH TIP A . 
C 3 HOH 5  807 807 HOH TIP A . 
C 3 HOH 6  808 808 HOH TIP A . 
C 3 HOH 7  809 809 HOH TIP A . 
C 3 HOH 8  811 811 HOH TIP A . 
C 3 HOH 9  812 812 HOH TIP A . 
C 3 HOH 10 813 813 HOH TIP A . 
C 3 HOH 11 814 814 HOH TIP A . 
C 3 HOH 12 816 816 HOH TIP A . 
C 3 HOH 13 817 817 HOH TIP A . 
C 3 HOH 14 818 818 HOH TIP A . 
C 3 HOH 15 819 819 HOH TIP A . 
C 3 HOH 16 823 823 HOH TIP A . 
C 3 HOH 17 827 827 HOH TIP A . 
C 3 HOH 18 828 828 HOH TIP A . 
C 3 HOH 19 838 838 HOH TIP A . 
C 3 HOH 20 840 840 HOH TIP A . 
C 3 HOH 21 841 841 HOH TIP A . 
C 3 HOH 22 842 842 HOH TIP A . 
C 3 HOH 23 843 843 HOH TIP A . 
C 3 HOH 24 844 844 HOH TIP A . 
C 3 HOH 25 845 845 HOH TIP A . 
C 3 HOH 26 846 846 HOH TIP A . 
C 3 HOH 27 847 847 HOH TIP A . 
C 3 HOH 28 848 848 HOH TIP A . 
C 3 HOH 29 851 851 HOH TIP A . 
C 3 HOH 30 852 852 HOH TIP A . 
C 3 HOH 31 853 853 HOH TIP A . 
C 3 HOH 32 854 854 HOH TIP A . 
C 3 HOH 33 855 855 HOH TIP A . 
C 3 HOH 34 856 856 HOH TIP A . 
C 3 HOH 35 857 857 HOH TIP A . 
C 3 HOH 36 858 858 HOH TIP A . 
C 3 HOH 37 859 859 HOH TIP A . 
D 3 HOH 1  801 801 HOH TIP B . 
D 3 HOH 2  804 804 HOH TIP B . 
D 3 HOH 3  810 810 HOH TIP B . 
D 3 HOH 4  815 815 HOH TIP B . 
D 3 HOH 5  820 820 HOH TIP B . 
D 3 HOH 6  821 821 HOH TIP B . 
D 3 HOH 7  822 822 HOH TIP B . 
D 3 HOH 8  824 824 HOH TIP B . 
D 3 HOH 9  825 825 HOH TIP B . 
D 3 HOH 10 826 826 HOH TIP B . 
D 3 HOH 11 829 829 HOH TIP B . 
D 3 HOH 12 830 830 HOH TIP B . 
D 3 HOH 13 831 831 HOH TIP B . 
D 3 HOH 14 832 832 HOH TIP B . 
D 3 HOH 15 833 833 HOH TIP B . 
D 3 HOH 16 834 834 HOH TIP B . 
D 3 HOH 17 835 835 HOH TIP B . 
D 3 HOH 18 836 836 HOH TIP B . 
D 3 HOH 19 837 837 HOH TIP B . 
D 3 HOH 20 839 839 HOH TIP B . 
D 3 HOH 21 849 849 HOH TIP B . 
D 3 HOH 22 850 850 HOH TIP B . 
D 3 HOH 23 860 860 HOH TIP B . 
D 3 HOH 24 861 861 HOH TIP B . 
D 3 HOH 25 862 862 HOH TIP B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1450  ? 
1 MORE         -10   ? 
1 'SSA (A^2)'  10340 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-01-09 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-04 
5 'Structure model' 1 4 2018-04-18 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Refinement description'    
4 5 'Structure model' 'Data collection'           
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' software        
2 5 'Structure model' diffrn_detector 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_software.name'            
2 5 'Structure model' '_diffrn_detector.detector' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CAD4     'data collection' .           ? 1 
ROTAVATA 'data reduction'  .           ? 2 
MERLOT   phasing           .           ? 3 
X-PLOR   refinement        3.1         ? 4 
CAD4     'data reduction'  .           ? 5 
CCP4     'data scaling'    '(AGROVATA' ? 6 
ROTAVATA 'data scaling'    .           ? 7 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LEU A 47  ? ? -100.71 -62.68  
2 1 THR A 51  ? ? 74.90   -51.57  
3 1 ALA A 84  ? ? -171.18 -167.38 
4 1 SER B 325 ? ? -105.35 -96.06  
5 1 GLU B 362 ? ? -54.77  -6.33   
6 1 TYR B 400 ? ? -172.77 137.03  
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#