data_1JWG
# 
_entry.id   1JWG 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1JWG         
RCSB  RCSB014263   
WWPDB D_1000014263 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1JWF 
_pdbx_database_related.details        '1JWF contains the same protein without M6PR C-terminal peptide' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1JWG 
_pdbx_database_status.recvd_initial_deposition_date   2001-09-04 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Shiba, T.'     1  
'Takatsu, H.'   2  
'Nogi, T.'      3  
'Matsugaki, N.' 4  
'Kawasaki, M.'  5  
'Igarashi, N.'  6  
'Suzuki, M.'    7  
'Kato, R.'      8  
'Earnest, T.'   9  
'Nakayama, K.'  10 
'Wakatsuki, S.' 11 
# 
_citation.id                        primary 
_citation.title                     'Structural basis for recognition of acidic-cluster dileucine sequence by GGA1.' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            415 
_citation.page_first                937 
_citation.page_last                 941 
_citation.year                      2002 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11859376 
_citation.pdbx_database_id_DOI      10.1038/415937a 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Shiba, T.'     1  
primary 'Takatsu, H.'   2  
primary 'Nogi, T.'      3  
primary 'Matsugaki, N.' 4  
primary 'Kawasaki, M.'  5  
primary 'Igarashi, N.'  6  
primary 'Suzuki, M.'    7  
primary 'Kato, R.'      8  
primary 'Earnest, T.'   9  
primary 'Nakayama, K.'  10 
primary 'Wakatsuki, S.' 11 
# 
_cell.entry_id           1JWG 
_cell.length_a           56.146 
_cell.length_b           65.770 
_cell.length_c           101.426 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1JWG 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'ADP-ribosylation factor binding protein GGA1'    16814.436 2   ? ? 'VHS DOMAIN(N-terminal domain)' ? 
2 polymer     syn 'Cation-independent mannose-6-phosphate receptor' 1544.577  2   ? ? 'C-terminal fragment'           ? 
3 non-polymer syn 'IODIDE ION'                                      126.904   6   ? ? ?                               ? 
4 water       nat water                                             18.015    198 ? ? ?                               ? 
# 
_entity_name_com.entity_id   2 
_entity_name_com.name        M6PR 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MEPAMEPETLEARINRATNPLNKELDWASINGFCEQLNEDFEGPPLATRLLAHKIQSPQEWEAIQALTVLETCMKSCGKR
FHDEVGKFRFLNELIKVVSPKYLGSRTSEKVKNKILELLYSWTVGLPEEVKIAEAYQMLKKQGIVKS
;
;MEPAMEPETLEARINRATNPLNKELDWASINGFCEQLNEDFEGPPLATRLLAHKIQSPQEWEAIQALTVLETCMKSCGKR
FHDEVGKFRFLNELIKVVSPKYLGSRTSEKVKNKILELLYSWTVGLPEEVKIAEAYQMLKKQGIVKS
;
A,B ? 
2 'polypeptide(L)' no no SFHDDSDEDLLHI SFHDDSDEDLLHI C,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLU n 
1 3   PRO n 
1 4   ALA n 
1 5   MET n 
1 6   GLU n 
1 7   PRO n 
1 8   GLU n 
1 9   THR n 
1 10  LEU n 
1 11  GLU n 
1 12  ALA n 
1 13  ARG n 
1 14  ILE n 
1 15  ASN n 
1 16  ARG n 
1 17  ALA n 
1 18  THR n 
1 19  ASN n 
1 20  PRO n 
1 21  LEU n 
1 22  ASN n 
1 23  LYS n 
1 24  GLU n 
1 25  LEU n 
1 26  ASP n 
1 27  TRP n 
1 28  ALA n 
1 29  SER n 
1 30  ILE n 
1 31  ASN n 
1 32  GLY n 
1 33  PHE n 
1 34  CYS n 
1 35  GLU n 
1 36  GLN n 
1 37  LEU n 
1 38  ASN n 
1 39  GLU n 
1 40  ASP n 
1 41  PHE n 
1 42  GLU n 
1 43  GLY n 
1 44  PRO n 
1 45  PRO n 
1 46  LEU n 
1 47  ALA n 
1 48  THR n 
1 49  ARG n 
1 50  LEU n 
1 51  LEU n 
1 52  ALA n 
1 53  HIS n 
1 54  LYS n 
1 55  ILE n 
1 56  GLN n 
1 57  SER n 
1 58  PRO n 
1 59  GLN n 
1 60  GLU n 
1 61  TRP n 
1 62  GLU n 
1 63  ALA n 
1 64  ILE n 
1 65  GLN n 
1 66  ALA n 
1 67  LEU n 
1 68  THR n 
1 69  VAL n 
1 70  LEU n 
1 71  GLU n 
1 72  THR n 
1 73  CYS n 
1 74  MET n 
1 75  LYS n 
1 76  SER n 
1 77  CYS n 
1 78  GLY n 
1 79  LYS n 
1 80  ARG n 
1 81  PHE n 
1 82  HIS n 
1 83  ASP n 
1 84  GLU n 
1 85  VAL n 
1 86  GLY n 
1 87  LYS n 
1 88  PHE n 
1 89  ARG n 
1 90  PHE n 
1 91  LEU n 
1 92  ASN n 
1 93  GLU n 
1 94  LEU n 
1 95  ILE n 
1 96  LYS n 
1 97  VAL n 
1 98  VAL n 
1 99  SER n 
1 100 PRO n 
1 101 LYS n 
1 102 TYR n 
1 103 LEU n 
1 104 GLY n 
1 105 SER n 
1 106 ARG n 
1 107 THR n 
1 108 SER n 
1 109 GLU n 
1 110 LYS n 
1 111 VAL n 
1 112 LYS n 
1 113 ASN n 
1 114 LYS n 
1 115 ILE n 
1 116 LEU n 
1 117 GLU n 
1 118 LEU n 
1 119 LEU n 
1 120 TYR n 
1 121 SER n 
1 122 TRP n 
1 123 THR n 
1 124 VAL n 
1 125 GLY n 
1 126 LEU n 
1 127 PRO n 
1 128 GLU n 
1 129 GLU n 
1 130 VAL n 
1 131 LYS n 
1 132 ILE n 
1 133 ALA n 
1 134 GLU n 
1 135 ALA n 
1 136 TYR n 
1 137 GLN n 
1 138 MET n 
1 139 LEU n 
1 140 LYS n 
1 141 LYS n 
1 142 GLN n 
1 143 GLY n 
1 144 ILE n 
1 145 VAL n 
1 146 LYS n 
1 147 SER n 
2 1   SER n 
2 2   PHE n 
2 3   HIS n 
2 4   ASP n 
2 5   ASP n 
2 6   SER n 
2 7   ASP n 
2 8   GLU n 
2 9   ASP n 
2 10  LEU n 
2 11  LEU n 
2 12  HIS n 
2 13  ILE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pgex4t-2 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'This sequence occurs naturally in humans.' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
1 UNP GGA1_HUMAN Q9UJY5 1 1    ? ? 
2 UNP MPRI_HUMAN P11717 2 2479 ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1JWG A 1 ? 147 ? Q9UJY5 1    ? 147  ? 1 147 
2 2 1JWG C 1 ? 13  ? P11717 2479 ? 2491 ? 1 13  
3 1 1JWG B 1 ? 147 ? Q9UJY5 1    ? 147  ? 1 147 
4 2 1JWG D 1 ? 13  ? P11717 2479 ? 2491 ? 1 13  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
IOD non-polymer         . 'IODIDE ION'    ? 'I -1'           126.904 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1JWG 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.55 
_exptl_crystal.density_percent_sol   51.74 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    'PEG 3350, ammonium iodide, Tris, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2001-08-16 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 5.0.2' 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   5.0.2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0 
# 
_reflns.entry_id                     1JWG 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30.0 
_reflns.d_resolution_high            2.0 
_reflns.number_obs                   24632 
_reflns.number_all                   24632 
_reflns.percent_possible_obs         99.6 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.000 
_reflns_shell.d_res_low              2.110 
_reflns_shell.percent_possible_all   99.3 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1JWG 
_refine.ls_number_reflns_obs                     24632 
_refine.ls_number_reflns_all                     24632 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             30.00 
_refine.ls_d_res_high                            2.000 
_refine.ls_percent_reflns_obs                    99.67 
_refine.ls_R_factor_obs                          0.22796 
_refine.ls_R_factor_all                          0.22796 
_refine.ls_R_factor_R_work                       0.2263 
_refine.ls_R_factor_R_free                       0.26115 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  1292 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               39.099 
_refine.aniso_B[1][1]                            -0.89 
_refine.aniso_B[2][2]                            2.78 
_refine.aniso_B[3][3]                            -1.88 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1JWF' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  0.171 
_refine.overall_SU_B                             4.254 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               0.933 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            0.121 
_refine.pdbx_overall_ESU_R                       0.194 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2355 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         6 
_refine_hist.number_atoms_solvent             198 
_refine_hist.number_atoms_total               2559 
_refine_hist.d_res_high                       2.000 
_refine_hist.d_res_low                        30.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.011  0.021  ? 2401 'X-RAY DIFFRACTION' ? 
r_bond_other_d           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.286  1.974  ? 3237 'X-RAY DIFFRACTION' ? 
r_angle_other_deg        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   2.975  3.000  ? 288  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   16.756 15.000 ? 487  'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.093  0.200  ? 364  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.005  0.020  ? 1754 'X-RAY DIFFRACTION' ? 
r_gen_planes_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.245  0.300  ? 1169 'X-RAY DIFFRACTION' ? 
r_nbd_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.183  0.500  ? 163  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other      ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.178  0.300  ? 40   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.173  0.500  ? 13   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it              0.815  1.500  ? 1458 'X-RAY DIFFRACTION' ? 
r_mcangle_it             1.540  2.000  ? 2354 'X-RAY DIFFRACTION' ? 
r_scbond_it              2.326  3.000  ? 943  'X-RAY DIFFRACTION' ? 
r_scangle_it             3.976  4.500  ? 883  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded      ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.000 
_refine_ls_shell.d_res_low                        2.052 
_refine_ls_shell.number_reflns_R_work             1791 
_refine_ls_shell.R_factor_R_work                  0.234 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.272 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            4.634 
_refine_ls_shell.number_reflns_R_free             83 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1JWG 
_struct.title                     'VHS Domain of human GGA1 complexed with cation-independent M6PR C-terminal Peptide' 
_struct.pdbx_descriptor           'ADP-ribosylation factor binding protein GGA1/ Cation-independent mannose-6-phosphate receptor' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1JWG 
_struct_keywords.pdbx_keywords   'PROTEIN TRANSPORT/PROTEIN BINDING' 
_struct_keywords.text            'SUPER HELIX, PROTEIN-PEPTIDE COMPLEX, PROTEIN TRANSPORT-PROTEIN BINDING COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
I N N 3 ? 
J N N 3 ? 
K N N 4 ? 
L N N 4 ? 
M N N 4 ? 
N N N 4 ? 
# 
loop_
_struct_biol.id 
_struct_biol.pdbx_parent_biol_id 
_struct_biol.details 
1 ? ? 
2 ? ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 9   ? THR A 18  ? THR A 9   THR A 18  1 ? 10 
HELX_P HELX_P2  2  ASP A 26  ? ASN A 38  ? ASP A 26  ASN A 38  1 ? 13 
HELX_P HELX_P3  3  GLU A 42  ? GLN A 56  ? GLU A 42  GLN A 56  1 ? 15 
HELX_P HELX_P4  4  GLN A 59  ? LYS A 75  ? GLN A 59  LYS A 75  1 ? 17 
HELX_P HELX_P5  5  GLY A 78  ? GLY A 86  ? GLY A 78  GLY A 86  1 ? 9  
HELX_P HELX_P6  6  LYS A 87  ? SER A 99  ? LYS A 87  SER A 99  1 ? 13 
HELX_P HELX_P7  7  LEU A 103 ? THR A 107 ? LEU A 103 THR A 107 5 ? 5  
HELX_P HELX_P8  8  SER A 108 ? LEU A 126 ? SER A 108 LEU A 126 1 ? 19 
HELX_P HELX_P9  9  GLU A 129 ? GLN A 142 ? GLU A 129 GLN A 142 1 ? 14 
HELX_P HELX_P10 10 THR C 9   ? THR C 18  ? THR B 9   THR B 18  1 ? 10 
HELX_P HELX_P11 11 ASP C 26  ? LEU C 37  ? ASP B 26  LEU B 37  1 ? 12 
HELX_P HELX_P12 12 GLU C 42  ? GLN C 56  ? GLU B 42  GLN B 56  1 ? 15 
HELX_P HELX_P13 13 GLN C 59  ? CYS C 77  ? GLN B 59  CYS B 77  1 ? 19 
HELX_P HELX_P14 14 GLY C 78  ? GLY C 86  ? GLY B 78  GLY B 86  1 ? 9  
HELX_P HELX_P15 15 LYS C 87  ? SER C 99  ? LYS B 87  SER B 99  1 ? 13 
HELX_P HELX_P16 16 LEU C 103 ? THR C 107 ? LEU B 103 THR B 107 5 ? 5  
HELX_P HELX_P17 17 SER C 108 ? LEU C 126 ? SER B 108 LEU B 126 1 ? 19 
HELX_P HELX_P18 18 GLU C 129 ? GLN C 142 ? GLU B 129 GLN B 142 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 34 SG ? ? ? 1_555 A CYS 73 SG ? ? A CYS 34 A CYS 73 1_555 ? ? ? ? ? ? ? 2.058 ? 
disulf2 disulf ? ? A CYS 77 SG ? ? ? 1_555 C CYS 77 SG ? ? A CYS 77 B CYS 77 1_555 ? ? ? ? ? ? ? 2.494 ? 
disulf3 disulf ? ? C CYS 34 SG ? ? ? 1_555 C CYS 73 SG ? ? B CYS 34 B CYS 73 1_555 ? ? ? ? ? ? ? 2.058 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE IOD A 148' 
AC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE IOD A 149' 
AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE IOD B 148' 
AC4 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE IOD B 149' 
AC5 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE IOD B 150' 
AC6 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE IOD B 151' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 1 LYS A 110 ? LYS A 110 . ? 1_555 ? 
2  AC2 3 GLN A 59  ? GLN A 59  . ? 1_555 ? 
3  AC2 3 LEU C 50  ? LEU B 50  . ? 2_655 ? 
4  AC2 3 HIS C 53  ? HIS B 53  . ? 2_655 ? 
5  AC3 4 LYS A 79  ? LYS A 79  . ? 1_555 ? 
6  AC3 4 ARG A 80  ? ARG A 80  . ? 1_555 ? 
7  AC3 4 GLU C 35  ? GLU B 35  . ? 1_555 ? 
8  AC3 4 GLU C 39  ? GLU B 39  . ? 1_555 ? 
9  AC4 2 LYS A 96  ? LYS A 96  . ? 2_654 ? 
10 AC4 2 LYS C 96  ? LYS B 96  . ? 1_555 ? 
11 AC5 3 LEU A 50  ? LEU A 50  . ? 2_654 ? 
12 AC5 3 HIS A 53  ? HIS A 53  . ? 2_654 ? 
13 AC5 3 GLN C 59  ? GLN B 59  . ? 1_555 ? 
14 AC6 2 ARG C 80  ? ARG B 80  . ? 1_555 ? 
15 AC6 2 PHE C 81  ? PHE B 81  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1JWG 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1JWG 
_atom_sites.fract_transf_matrix[1][1]   0.017811 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015204 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009859 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
I 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . PRO A 1 7   ? 36.101 16.169  97.877  1.00 54.02 ? 7   PRO A N   1 
ATOM   2    C CA  . PRO A 1 7   ? 36.929 15.889  96.664  1.00 54.10 ? 7   PRO A CA  1 
ATOM   3    C C   . PRO A 1 7   ? 37.393 14.427  96.673  1.00 53.71 ? 7   PRO A C   1 
ATOM   4    O O   . PRO A 1 7   ? 38.050 13.984  97.631  1.00 53.49 ? 7   PRO A O   1 
ATOM   5    C CB  . PRO A 1 7   ? 38.109 16.866  96.808  1.00 54.26 ? 7   PRO A CB  1 
ATOM   6    C CG  . PRO A 1 7   ? 37.754 17.755  98.022  1.00 54.24 ? 7   PRO A CG  1 
ATOM   7    C CD  . PRO A 1 7   ? 36.868 16.905  98.896  1.00 54.63 ? 7   PRO A CD  1 
ATOM   8    N N   . GLU A 1 8   ? 37.060 13.699  95.606  1.00 52.52 ? 8   GLU A N   1 
ATOM   9    C CA  . GLU A 1 8   ? 37.293 12.257  95.568  1.00 51.53 ? 8   GLU A CA  1 
ATOM   10   C C   . GLU A 1 8   ? 38.575 11.776  94.890  1.00 49.49 ? 8   GLU A C   1 
ATOM   11   O O   . GLU A 1 8   ? 38.593 11.428  93.714  1.00 50.09 ? 8   GLU A O   1 
ATOM   12   C CB  . GLU A 1 8   ? 36.060 11.529  95.002  1.00 52.44 ? 8   GLU A CB  1 
ATOM   13   C CG  . GLU A 1 8   ? 34.736 12.092  95.523  1.00 55.95 ? 8   GLU A CG  1 
ATOM   14   C CD  . GLU A 1 8   ? 33.511 11.323  95.050  1.00 60.06 ? 8   GLU A CD  1 
ATOM   15   O OE1 . GLU A 1 8   ? 32.376 11.786  95.304  1.00 62.75 ? 8   GLU A OE1 1 
ATOM   16   O OE2 . GLU A 1 8   ? 33.672 10.251  94.427  1.00 62.82 ? 8   GLU A OE2 1 
ATOM   17   N N   . THR A 1 9   ? 39.638 11.737  95.676  1.00 46.59 ? 9   THR A N   1 
ATOM   18   C CA  . THR A 1 9   ? 40.907 11.164  95.277  1.00 43.98 ? 9   THR A CA  1 
ATOM   19   C C   . THR A 1 9   ? 40.830 9.667   95.557  1.00 42.14 ? 9   THR A C   1 
ATOM   20   O O   . THR A 1 9   ? 39.830 9.191   96.093  1.00 41.17 ? 9   THR A O   1 
ATOM   21   C CB  . THR A 1 9   ? 41.958 11.698  96.184  1.00 44.03 ? 9   THR A CB  1 
ATOM   22   O OG1 . THR A 1 9   ? 41.572 11.375  97.535  1.00 43.22 ? 9   THR A OG1 1 
ATOM   23   C CG2 . THR A 1 9   ? 41.967 13.231  96.141  1.00 44.64 ? 9   THR A CG2 1 
ATOM   24   N N   . LEU A 1 10  ? 41.897 8.937   95.237  1.00 39.91 ? 10  LEU A N   1 
ATOM   25   C CA  . LEU A 1 10  ? 41.911 7.501   95.474  1.00 38.52 ? 10  LEU A CA  1 
ATOM   26   C C   . LEU A 1 10  ? 41.868 7.212   96.971  1.00 37.74 ? 10  LEU A C   1 
ATOM   27   O O   . LEU A 1 10  ? 41.246 6.244   97.407  1.00 36.47 ? 10  LEU A O   1 
ATOM   28   C CB  . LEU A 1 10  ? 43.114 6.827   94.817  1.00 37.94 ? 10  LEU A CB  1 
ATOM   29   C CG  . LEU A 1 10  ? 43.065 6.684   93.289  1.00 37.67 ? 10  LEU A CG  1 
ATOM   30   C CD1 . LEU A 1 10  ? 44.258 5.873   92.813  1.00 38.52 ? 10  LEU A CD1 1 
ATOM   31   C CD2 . LEU A 1 10  ? 41.770 6.031   92.810  1.00 36.39 ? 10  LEU A CD2 1 
ATOM   32   N N   . GLU A 1 11  ? 42.525 8.068   97.744  1.00 37.07 ? 11  GLU A N   1 
ATOM   33   C CA  . GLU A 1 11  ? 42.527 7.942   99.184  1.00 36.98 ? 11  GLU A CA  1 
ATOM   34   C C   . GLU A 1 11  ? 41.100 8.030   99.724  1.00 36.47 ? 11  GLU A C   1 
ATOM   35   O O   . GLU A 1 11  ? 40.646 7.138   100.439 1.00 36.15 ? 11  GLU A O   1 
ATOM   36   C CB  . GLU A 1 11  ? 43.405 9.011   99.834  1.00 36.98 ? 11  GLU A CB  1 
ATOM   37   C CG  . GLU A 1 11  ? 44.906 8.788   99.678  1.00 38.30 ? 11  GLU A CG  1 
ATOM   38   C CD  . GLU A 1 11  ? 45.485 9.483   98.458  1.00 41.72 ? 11  GLU A CD  1 
ATOM   39   O OE1 . GLU A 1 11  ? 46.707 9.775   98.481  1.00 41.60 ? 11  GLU A OE1 1 
ATOM   40   O OE2 . GLU A 1 11  ? 44.719 9.731   97.483  1.00 42.39 ? 11  GLU A OE2 1 
ATOM   41   N N   . ALA A 1 12  ? 40.392 9.100   99.382  1.00 35.25 ? 12  ALA A N   1 
ATOM   42   C CA  . ALA A 1 12  ? 39.026 9.267   99.871  1.00 34.41 ? 12  ALA A CA  1 
ATOM   43   C C   . ALA A 1 12  ? 38.119 8.144   99.404  1.00 33.26 ? 12  ALA A C   1 
ATOM   44   O O   . ALA A 1 12  ? 37.248 7.682   100.148 1.00 32.08 ? 12  ALA A O   1 
ATOM   45   C CB  . ALA A 1 12  ? 38.447 10.629  99.445  1.00 34.70 ? 12  ALA A CB  1 
ATOM   46   N N   . ARG A 1 13  ? 38.307 7.709   98.163  1.00 32.18 ? 13  ARG A N   1 
ATOM   47   C CA  . ARG A 1 13  ? 37.457 6.671   97.631  1.00 31.45 ? 13  ARG A CA  1 
ATOM   48   C C   . ARG A 1 13  ? 37.687 5.362   98.369  1.00 30.70 ? 13  ARG A C   1 
ATOM   49   O O   . ARG A 1 13  ? 36.748 4.670   98.685  1.00 30.10 ? 13  ARG A O   1 
ATOM   50   C CB  . ARG A 1 13  ? 37.691 6.453   96.139  1.00 31.36 ? 13  ARG A CB  1 
ATOM   51   C CG  . ARG A 1 13  ? 37.131 7.542   95.246  1.00 33.00 ? 13  ARG A CG  1 
ATOM   52   C CD  . ARG A 1 13  ? 37.561 7.381   93.801  1.00 33.33 ? 13  ARG A CD  1 
ATOM   53   N NE  . ARG A 1 13  ? 37.172 8.530   92.999  1.00 34.82 ? 13  ARG A NE  1 
ATOM   54   C CZ  . ARG A 1 13  ? 35.947 8.750   92.533  1.00 36.31 ? 13  ARG A CZ  1 
ATOM   55   N NH1 . ARG A 1 13  ? 34.956 7.887   92.753  1.00 33.19 ? 13  ARG A NH1 1 
ATOM   56   N NH2 . ARG A 1 13  ? 35.719 9.852   91.830  1.00 38.72 ? 13  ARG A NH2 1 
ATOM   57   N N   . ILE A 1 14  ? 38.944 5.014   98.614  1.00 30.55 ? 14  ILE A N   1 
ATOM   58   C CA  . ILE A 1 14  ? 39.198 3.737   99.244  1.00 30.41 ? 14  ILE A CA  1 
ATOM   59   C C   . ILE A 1 14  ? 38.750 3.778   100.707 1.00 30.58 ? 14  ILE A C   1 
ATOM   60   O O   . ILE A 1 14  ? 38.347 2.764   101.274 1.00 29.73 ? 14  ILE A O   1 
ATOM   61   C CB  . ILE A 1 14  ? 40.660 3.306   99.082  1.00 29.60 ? 14  ILE A CB  1 
ATOM   62   C CG1 . ILE A 1 14  ? 40.784 1.802   99.313  1.00 30.35 ? 14  ILE A CG1 1 
ATOM   63   C CG2 . ILE A 1 14  ? 41.567 4.046   100.061 1.00 28.81 ? 14  ILE A CG2 1 
ATOM   64   C CD1 . ILE A 1 14  ? 39.975 0.945   98.368  1.00 32.47 ? 14  ILE A CD1 1 
ATOM   65   N N   . ASN A 1 15  ? 38.794 4.965   101.302 1.00 30.82 ? 15  ASN A N   1 
ATOM   66   C CA  . ASN A 1 15  ? 38.392 5.117   102.689 1.00 31.28 ? 15  ASN A CA  1 
ATOM   67   C C   . ASN A 1 15  ? 36.913 4.857   102.805 1.00 31.51 ? 15  ASN A C   1 
ATOM   68   O O   . ASN A 1 15  ? 36.439 4.289   103.788 1.00 31.72 ? 15  ASN A O   1 
ATOM   69   C CB  . ASN A 1 15  ? 38.747 6.509   103.201 1.00 31.48 ? 15  ASN A CB  1 
ATOM   70   C CG  . ASN A 1 15  ? 40.222 6.678   103.372 1.00 31.86 ? 15  ASN A CG  1 
ATOM   71   O OD1 . ASN A 1 15  ? 40.958 5.694   103.341 1.00 31.41 ? 15  ASN A OD1 1 
ATOM   72   N ND2 . ASN A 1 15  ? 40.685 7.914   103.539 1.00 31.25 ? 15  ASN A ND2 1 
ATOM   73   N N   . ARG A 1 16  ? 36.191 5.253   101.766 1.00 31.04 ? 16  ARG A N   1 
ATOM   74   C CA  . ARG A 1 16  ? 34.747 5.065   101.727 1.00 31.23 ? 16  ARG A CA  1 
ATOM   75   C C   . ARG A 1 16  ? 34.424 3.619   101.378 1.00 29.48 ? 16  ARG A C   1 
ATOM   76   O O   . ARG A 1 16  ? 33.564 3.006   101.996 1.00 29.80 ? 16  ARG A O   1 
ATOM   77   C CB  . ARG A 1 16  ? 34.093 6.022   100.718 1.00 31.83 ? 16  ARG A CB  1 
ATOM   78   C CG  . ARG A 1 16  ? 32.659 6.412   101.060 1.00 36.27 ? 16  ARG A CG  1 
ATOM   79   C CD  . ARG A 1 16  ? 32.063 7.543   100.182 1.00 41.37 ? 16  ARG A CD  1 
ATOM   80   N NE  . ARG A 1 16  ? 33.070 8.531   99.800  1.00 44.61 ? 16  ARG A NE  1 
ATOM   81   C CZ  . ARG A 1 16  ? 33.554 8.653   98.556  1.00 47.18 ? 16  ARG A CZ  1 
ATOM   82   N NH1 . ARG A 1 16  ? 34.480 9.566   98.274  1.00 45.88 ? 16  ARG A NH1 1 
ATOM   83   N NH2 . ARG A 1 16  ? 33.115 7.847   97.591  1.00 48.15 ? 16  ARG A NH2 1 
ATOM   84   N N   . ALA A 1 17  ? 35.151 3.063   100.417 1.00 27.55 ? 17  ALA A N   1 
ATOM   85   C CA  . ALA A 1 17  ? 34.872 1.692   99.963  1.00 27.64 ? 17  ALA A CA  1 
ATOM   86   C C   . ALA A 1 17  ? 35.231 0.592   100.978 1.00 26.39 ? 17  ALA A C   1 
ATOM   87   O O   . ALA A 1 17  ? 34.752 -0.534  100.866 1.00 27.65 ? 17  ALA A O   1 
ATOM   88   C CB  . ALA A 1 17  ? 35.572 1.436   98.642  1.00 27.35 ? 17  ALA A CB  1 
ATOM   89   N N   . THR A 1 18  ? 36.063 0.915   101.964 1.00 25.55 ? 18  THR A N   1 
ATOM   90   C CA  . THR A 1 18  ? 36.525 -0.084  102.930 1.00 25.54 ? 18  THR A CA  1 
ATOM   91   C C   . THR A 1 18  ? 36.227 0.356   104.357 1.00 26.09 ? 18  THR A C   1 
ATOM   92   O O   . THR A 1 18  ? 36.728 -0.208  105.337 1.00 25.62 ? 18  THR A O   1 
ATOM   93   C CB  . THR A 1 18  ? 38.028 -0.396  102.742 1.00 25.50 ? 18  THR A CB  1 
ATOM   94   O OG1 . THR A 1 18  ? 38.821 0.776   102.989 1.00 25.37 ? 18  THR A OG1 1 
ATOM   95   C CG2 . THR A 1 18  ? 38.340 -0.732  101.285 1.00 23.76 ? 18  THR A CG2 1 
ATOM   96   N N   . ASN A 1 19  ? 35.377 1.363   104.468 1.00 25.91 ? 19  ASN A N   1 
ATOM   97   C CA  . ASN A 1 19  ? 35.038 1.871   105.791 1.00 27.09 ? 19  ASN A CA  1 
ATOM   98   C C   . ASN A 1 19  ? 34.447 0.800   106.690 1.00 26.59 ? 19  ASN A C   1 
ATOM   99   O O   . ASN A 1 19  ? 33.467 0.148   106.341 1.00 25.41 ? 19  ASN A O   1 
ATOM   100  C CB  . ASN A 1 19  ? 34.111 3.099   105.684 1.00 27.84 ? 19  ASN A CB  1 
ATOM   101  C CG  . ASN A 1 19  ? 34.131 3.918   106.941 1.00 30.38 ? 19  ASN A CG  1 
ATOM   102  O OD1 . ASN A 1 19  ? 33.794 3.418   107.991 1.00 32.50 ? 19  ASN A OD1 1 
ATOM   103  N ND2 . ASN A 1 19  ? 34.606 5.160   106.849 1.00 34.97 ? 19  ASN A ND2 1 
ATOM   104  N N   . PRO A 1 20  ? 35.089 0.591   107.841 1.00 27.29 ? 20  PRO A N   1 
ATOM   105  C CA  . PRO A 1 20  ? 34.633 -0.364  108.836 1.00 28.22 ? 20  PRO A CA  1 
ATOM   106  C C   . PRO A 1 20  ? 33.188 -0.128  109.271 1.00 28.46 ? 20  PRO A C   1 
ATOM   107  O O   . PRO A 1 20  ? 32.538 -1.045  109.747 1.00 27.88 ? 20  PRO A O   1 
ATOM   108  C CB  . PRO A 1 20  ? 35.581 -0.083  110.019 1.00 27.92 ? 20  PRO A CB  1 
ATOM   109  C CG  . PRO A 1 20  ? 36.809 0.376   109.396 1.00 28.83 ? 20  PRO A CG  1 
ATOM   110  C CD  . PRO A 1 20  ? 36.349 1.226   108.253 1.00 27.80 ? 20  PRO A CD  1 
ATOM   111  N N   . LEU A 1 21  ? 32.695 1.087   109.111 1.00 29.52 ? 21  LEU A N   1 
ATOM   112  C CA  . LEU A 1 21  ? 31.318 1.380   109.523 1.00 30.75 ? 21  LEU A CA  1 
ATOM   113  C C   . LEU A 1 21  ? 30.287 1.002   108.465 1.00 30.78 ? 21  LEU A C   1 
ATOM   114  O O   . LEU A 1 21  ? 29.093 1.007   108.749 1.00 30.46 ? 21  LEU A O   1 
ATOM   115  C CB  . LEU A 1 21  ? 31.192 2.869   109.845 1.00 31.47 ? 21  LEU A CB  1 
ATOM   116  C CG  . LEU A 1 21  ? 31.943 3.329   111.094 1.00 32.84 ? 21  LEU A CG  1 
ATOM   117  C CD1 . LEU A 1 21  ? 32.169 4.842   111.076 1.00 36.21 ? 21  LEU A CD1 1 
ATOM   118  C CD2 . LEU A 1 21  ? 31.165 2.920   112.303 1.00 34.71 ? 21  LEU A CD2 1 
ATOM   119  N N   . ASN A 1 22  ? 30.731 0.693   107.245 1.00 29.91 ? 22  ASN A N   1 
ATOM   120  C CA  . ASN A 1 22  ? 29.782 0.296   106.191 1.00 30.06 ? 22  ASN A CA  1 
ATOM   121  C C   . ASN A 1 22  ? 28.942 -0.887  106.661 1.00 29.96 ? 22  ASN A C   1 
ATOM   122  O O   . ASN A 1 22  ? 29.488 -1.866  107.119 1.00 30.14 ? 22  ASN A O   1 
ATOM   123  C CB  . ASN A 1 22  ? 30.525 -0.116  104.920 1.00 29.49 ? 22  ASN A CB  1 
ATOM   124  C CG  . ASN A 1 22  ? 31.146 1.059   104.201 1.00 30.83 ? 22  ASN A CG  1 
ATOM   125  O OD1 . ASN A 1 22  ? 30.816 2.217   104.473 1.00 30.27 ? 22  ASN A OD1 1 
ATOM   126  N ND2 . ASN A 1 22  ? 32.075 0.772   103.290 1.00 28.66 ? 22  ASN A ND2 1 
ATOM   127  N N   . LYS A 1 23  ? 27.617 -0.820  106.529 1.00 29.86 ? 23  LYS A N   1 
ATOM   128  C CA  . LYS A 1 23  ? 26.768 -1.935  106.966 1.00 30.32 ? 23  LYS A CA  1 
ATOM   129  C C   . LYS A 1 23  ? 26.671 -3.010  105.878 1.00 29.04 ? 23  LYS A C   1 
ATOM   130  O O   . LYS A 1 23  ? 26.261 -4.135  106.133 1.00 28.38 ? 23  LYS A O   1 
ATOM   131  C CB  . LYS A 1 23  ? 25.342 -1.437  107.307 1.00 31.75 ? 23  LYS A CB  1 
ATOM   132  C CG  . LYS A 1 23  ? 25.247 -0.532  108.530 1.00 35.54 ? 23  LYS A CG  1 
ATOM   133  C CD  . LYS A 1 23  ? 23.855 0.110   108.574 1.00 42.88 ? 23  LYS A CD  1 
ATOM   134  C CE  . LYS A 1 23  ? 23.456 0.497   109.982 1.00 47.49 ? 23  LYS A CE  1 
ATOM   135  N NZ  . LYS A 1 23  ? 22.174 1.269   109.972 1.00 51.21 ? 23  LYS A NZ  1 
ATOM   136  N N   . GLU A 1 24  ? 27.047 -2.647  104.663 1.00 28.57 ? 24  GLU A N   1 
ATOM   137  C CA  . GLU A 1 24  ? 27.014 -3.559  103.531 1.00 28.99 ? 24  GLU A CA  1 
ATOM   138  C C   . GLU A 1 24  ? 27.993 -3.057  102.492 1.00 28.48 ? 24  GLU A C   1 
ATOM   139  O O   . GLU A 1 24  ? 28.420 -1.904  102.545 1.00 29.36 ? 24  GLU A O   1 
ATOM   140  C CB  . GLU A 1 24  ? 25.575 -3.634  102.948 1.00 29.96 ? 24  GLU A CB  1 
ATOM   141  C CG  . GLU A 1 24  ? 25.168 -2.440  102.088 1.00 32.20 ? 24  GLU A CG  1 
ATOM   142  C CD  . GLU A 1 24  ? 23.707 -2.495  101.628 1.00 37.47 ? 24  GLU A CD  1 
ATOM   143  O OE1 . GLU A 1 24  ? 23.379 -3.363  100.789 1.00 39.43 ? 24  GLU A OE1 1 
ATOM   144  O OE2 . GLU A 1 24  ? 22.900 -1.674  102.101 1.00 43.83 ? 24  GLU A OE2 1 
ATOM   145  N N   . LEU A 1 25  ? 28.366 -3.919  101.557 1.00 27.63 ? 25  LEU A N   1 
ATOM   146  C CA  . LEU A 1 25  ? 29.305 -3.511  100.530 1.00 28.25 ? 25  LEU A CA  1 
ATOM   147  C C   . LEU A 1 25  ? 28.801 -2.230  99.861  1.00 28.95 ? 25  LEU A C   1 
ATOM   148  O O   . LEU A 1 25  ? 27.645 -2.161  99.476  1.00 28.95 ? 25  LEU A O   1 
ATOM   149  C CB  . LEU A 1 25  ? 29.443 -4.597  99.460  1.00 27.53 ? 25  LEU A CB  1 
ATOM   150  C CG  . LEU A 1 25  ? 30.135 -5.870  99.912  1.00 27.33 ? 25  LEU A CG  1 
ATOM   151  C CD1 . LEU A 1 25  ? 30.081 -6.984  98.809  1.00 25.10 ? 25  LEU A CD1 1 
ATOM   152  C CD2 . LEU A 1 25  ? 31.569 -5.490  100.265 1.00 25.39 ? 25  LEU A CD2 1 
ATOM   153  N N   . ASP A 1 26  ? 29.682 -1.251  99.693  1.00 28.92 ? 26  ASP A N   1 
ATOM   154  C CA  . ASP A 1 26  ? 29.325 0.039   99.088  1.00 29.68 ? 26  ASP A CA  1 
ATOM   155  C C   . ASP A 1 26  ? 29.743 0.018   97.631  1.00 29.46 ? 26  ASP A C   1 
ATOM   156  O O   . ASP A 1 26  ? 30.826 0.515   97.287  1.00 29.10 ? 26  ASP A O   1 
ATOM   157  C CB  . ASP A 1 26  ? 30.075 1.150   99.817  1.00 29.75 ? 26  ASP A CB  1 
ATOM   158  C CG  . ASP A 1 26  ? 29.746 2.547   99.297  1.00 32.79 ? 26  ASP A CG  1 
ATOM   159  O OD1 . ASP A 1 26  ? 29.104 2.682   98.225  1.00 32.85 ? 26  ASP A OD1 1 
ATOM   160  O OD2 . ASP A 1 26  ? 30.137 3.576   99.901  1.00 35.79 ? 26  ASP A OD2 1 
ATOM   161  N N   . TRP A 1 27  ? 28.892 -0.555  96.777  1.00 28.92 ? 27  TRP A N   1 
ATOM   162  C CA  . TRP A 1 27  ? 29.275 -0.766  95.389  1.00 30.03 ? 27  TRP A CA  1 
ATOM   163  C C   . TRP A 1 27  ? 29.596 0.483   94.608  1.00 30.42 ? 27  TRP A C   1 
ATOM   164  O O   . TRP A 1 27  ? 30.490 0.465   93.771  1.00 29.71 ? 27  TRP A O   1 
ATOM   165  C CB  . TRP A 1 27  ? 28.274 -1.642  94.645  1.00 29.80 ? 27  TRP A CB  1 
ATOM   166  C CG  . TRP A 1 27  ? 28.449 -3.082  95.024  1.00 29.22 ? 27  TRP A CG  1 
ATOM   167  C CD1 . TRP A 1 27  ? 27.595 -3.853  95.769  1.00 28.56 ? 27  TRP A CD1 1 
ATOM   168  C CD2 . TRP A 1 27  ? 29.556 -3.923  94.681  1.00 28.73 ? 27  TRP A CD2 1 
ATOM   169  N NE1 . TRP A 1 27  ? 28.114 -5.122  95.910  1.00 29.20 ? 27  TRP A NE1 1 
ATOM   170  C CE2 . TRP A 1 27  ? 29.317 -5.189  95.249  1.00 29.35 ? 27  TRP A CE2 1 
ATOM   171  C CE3 . TRP A 1 27  ? 30.739 -3.728  93.952  1.00 28.29 ? 27  TRP A CE3 1 
ATOM   172  C CZ2 . TRP A 1 27  ? 30.210 -6.257  95.112  1.00 28.40 ? 27  TRP A CZ2 1 
ATOM   173  C CZ3 . TRP A 1 27  ? 31.616 -4.789  93.805  1.00 29.26 ? 27  TRP A CZ3 1 
ATOM   174  C CH2 . TRP A 1 27  ? 31.342 -6.039  94.385  1.00 29.18 ? 27  TRP A CH2 1 
ATOM   175  N N   . ALA A 1 28  ? 28.885 1.565   94.903  1.00 30.75 ? 28  ALA A N   1 
ATOM   176  C CA  . ALA A 1 28  ? 29.127 2.819   94.220  1.00 31.22 ? 28  ALA A CA  1 
ATOM   177  C C   . ALA A 1 28  ? 30.564 3.252   94.456  1.00 30.68 ? 28  ALA A C   1 
ATOM   178  O O   . ALA A 1 28  ? 31.262 3.628   93.511  1.00 30.49 ? 28  ALA A O   1 
ATOM   179  C CB  . ALA A 1 28  ? 28.111 3.923   94.692  1.00 31.31 ? 28  ALA A CB  1 
ATOM   180  N N   . SER A 1 29  ? 31.021 3.173   95.707  1.00 30.36 ? 29  SER A N   1 
ATOM   181  C CA  . SER A 1 29  ? 32.388 3.560   96.028  1.00 29.69 ? 29  SER A CA  1 
ATOM   182  C C   . SER A 1 29  ? 33.421 2.589   95.480  1.00 29.00 ? 29  SER A C   1 
ATOM   183  O O   . SER A 1 29  ? 34.456 3.028   95.017  1.00 28.37 ? 29  SER A O   1 
ATOM   184  C CB  . SER A 1 29  ? 32.621 3.699   97.540  1.00 30.57 ? 29  SER A CB  1 
ATOM   185  O OG  . SER A 1 29  ? 31.899 4.782   98.058  1.00 33.82 ? 29  SER A OG  1 
ATOM   186  N N   . ILE A 1 30  ? 33.156 1.294   95.589  1.00 28.09 ? 30  ILE A N   1 
ATOM   187  C CA  . ILE A 1 30  ? 34.056 0.259   95.070  1.00 28.71 ? 30  ILE A CA  1 
ATOM   188  C C   . ILE A 1 30  ? 34.254 0.427   93.562  1.00 29.89 ? 30  ILE A C   1 
ATOM   189  O O   . ILE A 1 30  ? 35.374 0.452   93.065  1.00 29.20 ? 30  ILE A O   1 
ATOM   190  C CB  . ILE A 1 30  ? 33.460 -1.155  95.352  1.00 28.12 ? 30  ILE A CB  1 
ATOM   191  C CG1 . ILE A 1 30  ? 33.502 -1.476  96.858  1.00 26.21 ? 30  ILE A CG1 1 
ATOM   192  C CG2 . ILE A 1 30  ? 34.222 -2.229  94.579  1.00 28.12 ? 30  ILE A CG2 1 
ATOM   193  C CD1 . ILE A 1 30  ? 32.592 -2.660  97.213  1.00 26.23 ? 30  ILE A CD1 1 
ATOM   194  N N   . ASN A 1 31  ? 33.147 0.565   92.832  1.00 31.21 ? 31  ASN A N   1 
ATOM   195  C CA  . ASN A 1 31  ? 33.265 0.742   91.387  1.00 32.73 ? 31  ASN A CA  1 
ATOM   196  C C   . ASN A 1 31  ? 33.956 2.045   91.015  1.00 32.74 ? 31  ASN A C   1 
ATOM   197  O O   . ASN A 1 31  ? 34.738 2.085   90.063  1.00 33.57 ? 31  ASN A O   1 
ATOM   198  C CB  . ASN A 1 31  ? 31.917 0.637   90.694  1.00 32.16 ? 31  ASN A CB  1 
ATOM   199  C CG  . ASN A 1 31  ? 31.379 -0.753  90.713  1.00 34.58 ? 31  ASN A CG  1 
ATOM   200  O OD1 . ASN A 1 31  ? 32.132 -1.720  90.640  1.00 35.55 ? 31  ASN A OD1 1 
ATOM   201  N ND2 . ASN A 1 31  ? 30.060 -0.875  90.814  1.00 35.65 ? 31  ASN A ND2 1 
ATOM   202  N N   . GLY A 1 32  ? 33.683 3.087   91.779  1.00 32.52 ? 32  GLY A N   1 
ATOM   203  C CA  . GLY A 1 32  ? 34.273 4.396   91.552  1.00 33.22 ? 32  GLY A CA  1 
ATOM   204  C C   . GLY A 1 32  ? 35.775 4.381   91.739  1.00 33.62 ? 32  GLY A C   1 
ATOM   205  O O   . GLY A 1 32  ? 36.505 5.100   91.059  1.00 33.77 ? 32  GLY A O   1 
ATOM   206  N N   . PHE A 1 33  ? 36.248 3.563   92.678  1.00 32.91 ? 33  PHE A N   1 
ATOM   207  C CA  . PHE A 1 33  ? 37.672 3.456   92.902  1.00 32.82 ? 33  PHE A CA  1 
ATOM   208  C C   . PHE A 1 33  ? 38.318 2.801   91.668  1.00 33.42 ? 33  PHE A C   1 
ATOM   209  O O   . PHE A 1 33  ? 39.326 3.292   91.150  1.00 32.45 ? 33  PHE A O   1 
ATOM   210  C CB  . PHE A 1 33  ? 37.934 2.672   94.199  1.00 32.78 ? 33  PHE A CB  1 
ATOM   211  C CG  . PHE A 1 33  ? 39.370 2.410   94.467  1.00 29.92 ? 33  PHE A CG  1 
ATOM   212  C CD1 . PHE A 1 33  ? 39.987 1.306   93.920  1.00 28.53 ? 33  PHE A CD1 1 
ATOM   213  C CD2 . PHE A 1 33  ? 40.102 3.260   95.274  1.00 27.51 ? 33  PHE A CD2 1 
ATOM   214  C CE1 . PHE A 1 33  ? 41.302 1.068   94.158  1.00 27.98 ? 33  PHE A CE1 1 
ATOM   215  C CE2 . PHE A 1 33  ? 41.420 3.026   95.530  1.00 29.01 ? 33  PHE A CE2 1 
ATOM   216  C CZ  . PHE A 1 33  ? 42.029 1.919   94.972  1.00 30.50 ? 33  PHE A CZ  1 
ATOM   217  N N   . CYS A 1 34  ? 37.713 1.720   91.188  1.00 33.69 ? 34  CYS A N   1 
ATOM   218  C CA  . CYS A 1 34  ? 38.226 1.012   90.023  1.00 35.85 ? 34  CYS A CA  1 
ATOM   219  C C   . CYS A 1 34  ? 38.208 1.941   88.775  1.00 37.34 ? 34  CYS A C   1 
ATOM   220  O O   . CYS A 1 34  ? 39.207 2.074   88.073  1.00 37.45 ? 34  CYS A O   1 
ATOM   221  C CB  . CYS A 1 34  ? 37.440 -0.282  89.802  1.00 35.67 ? 34  CYS A CB  1 
ATOM   222  S SG  . CYS A 1 34  ? 37.612 -1.514  91.145  1.00 37.77 ? 34  CYS A SG  1 
ATOM   223  N N   . GLU A 1 35  ? 37.088 2.608   88.534  1.00 38.47 ? 35  GLU A N   1 
ATOM   224  C CA  . GLU A 1 35  ? 37.008 3.585   87.449  1.00 40.29 ? 35  GLU A CA  1 
ATOM   225  C C   . GLU A 1 35  ? 38.105 4.655   87.554  1.00 41.02 ? 35  GLU A C   1 
ATOM   226  O O   . GLU A 1 35  ? 38.900 4.827   86.624  1.00 42.01 ? 35  GLU A O   1 
ATOM   227  C CB  . GLU A 1 35  ? 35.622 4.241   87.447  1.00 40.28 ? 35  GLU A CB  1 
ATOM   228  C CG  . GLU A 1 35  ? 34.502 3.300   87.084  1.00 40.59 ? 35  GLU A CG  1 
ATOM   229  C CD  . GLU A 1 35  ? 33.142 3.780   87.575  1.00 45.95 ? 35  GLU A CD  1 
ATOM   230  O OE1 . GLU A 1 35  ? 32.952 5.005   87.792  1.00 46.55 ? 35  GLU A OE1 1 
ATOM   231  O OE2 . GLU A 1 35  ? 32.250 2.922   87.748  1.00 47.03 ? 35  GLU A OE2 1 
ATOM   232  N N   . GLN A 1 36  ? 38.175 5.340   88.697  1.00 41.94 ? 36  GLN A N   1 
ATOM   233  C CA  . GLN A 1 36  ? 39.149 6.423   88.933  1.00 42.46 ? 36  GLN A CA  1 
ATOM   234  C C   . GLN A 1 36  ? 40.642 6.052   88.841  1.00 42.41 ? 36  GLN A C   1 
ATOM   235  O O   . GLN A 1 36  ? 41.472 6.890   88.476  1.00 41.58 ? 36  GLN A O   1 
ATOM   236  C CB  . GLN A 1 36  ? 38.877 7.100   90.290  1.00 43.14 ? 36  GLN A CB  1 
ATOM   237  C CG  . GLN A 1 36  ? 39.993 8.051   90.807  1.00 45.41 ? 36  GLN A CG  1 
ATOM   238  C CD  . GLN A 1 36  ? 39.602 9.530   90.822  1.00 49.76 ? 36  GLN A CD  1 
ATOM   239  O OE1 . GLN A 1 36  ? 39.261 10.103  89.775  1.00 50.21 ? 36  GLN A OE1 1 
ATOM   240  N NE2 . GLN A 1 36  ? 39.652 10.152  92.015  1.00 50.04 ? 36  GLN A NE2 1 
ATOM   241  N N   . LEU A 1 37  ? 40.992 4.811   89.166  1.00 41.81 ? 37  LEU A N   1 
ATOM   242  C CA  . LEU A 1 37  ? 42.402 4.463   89.190  1.00 42.08 ? 37  LEU A CA  1 
ATOM   243  C C   . LEU A 1 37  ? 43.112 4.436   87.823  1.00 42.23 ? 37  LEU A C   1 
ATOM   244  O O   . LEU A 1 37  ? 44.312 4.580   87.777  1.00 41.53 ? 37  LEU A O   1 
ATOM   245  C CB  . LEU A 1 37  ? 42.689 3.221   90.056  1.00 41.46 ? 37  LEU A CB  1 
ATOM   246  C CG  . LEU A 1 37  ? 42.883 1.754   89.633  1.00 41.95 ? 37  LEU A CG  1 
ATOM   247  C CD1 . LEU A 1 37  ? 41.833 0.831   90.253  1.00 39.46 ? 37  LEU A CD1 1 
ATOM   248  C CD2 . LEU A 1 37  ? 43.034 1.529   88.147  1.00 39.73 ? 37  LEU A CD2 1 
ATOM   249  N N   . ASN A 1 38  ? 42.382 4.276   86.724  1.00 43.32 ? 38  ASN A N   1 
ATOM   250  C CA  . ASN A 1 38  ? 43.018 4.321   85.411  1.00 45.39 ? 38  ASN A CA  1 
ATOM   251  C C   . ASN A 1 38  ? 43.040 5.706   84.784  1.00 47.09 ? 38  ASN A C   1 
ATOM   252  O O   . ASN A 1 38  ? 43.670 5.911   83.745  1.00 46.48 ? 38  ASN A O   1 
ATOM   253  C CB  . ASN A 1 38  ? 42.352 3.354   84.445  1.00 45.29 ? 38  ASN A CB  1 
ATOM   254  C CG  . ASN A 1 38  ? 42.803 1.945   84.654  1.00 45.85 ? 38  ASN A CG  1 
ATOM   255  O OD1 . ASN A 1 38  ? 44.002 1.686   84.790  1.00 47.37 ? 38  ASN A OD1 1 
ATOM   256  N ND2 . ASN A 1 38  ? 41.851 1.016   84.704  1.00 45.58 ? 38  ASN A ND2 1 
ATOM   257  N N   . GLU A 1 39  ? 42.348 6.646   85.421  1.00 49.39 ? 39  GLU A N   1 
ATOM   258  C CA  . GLU A 1 39  ? 42.205 8.001   84.904  1.00 52.02 ? 39  GLU A CA  1 
ATOM   259  C C   . GLU A 1 39  ? 43.437 8.829   85.210  1.00 52.96 ? 39  GLU A C   1 
ATOM   260  O O   . GLU A 1 39  ? 43.371 10.056  85.316  1.00 54.13 ? 39  GLU A O   1 
ATOM   261  C CB  . GLU A 1 39  ? 40.945 8.661   85.489  1.00 52.42 ? 39  GLU A CB  1 
ATOM   262  C CG  . GLU A 1 39  ? 39.718 8.641   84.568  1.00 55.21 ? 39  GLU A CG  1 
ATOM   263  C CD  . GLU A 1 39  ? 39.531 7.330   83.805  1.00 58.99 ? 39  GLU A CD  1 
ATOM   264  O OE1 . GLU A 1 39  ? 38.943 6.388   84.376  1.00 60.43 ? 39  GLU A OE1 1 
ATOM   265  O OE2 . GLU A 1 39  ? 39.950 7.239   82.619  1.00 59.74 ? 39  GLU A OE2 1 
ATOM   266  N N   . ASP A 1 40  ? 44.568 8.149   85.335  1.00 53.90 ? 40  ASP A N   1 
ATOM   267  C CA  . ASP A 1 40  ? 45.829 8.790   85.674  1.00 54.33 ? 40  ASP A CA  1 
ATOM   268  C C   . ASP A 1 40  ? 46.957 7.794   85.462  1.00 53.89 ? 40  ASP A C   1 
ATOM   269  O O   . ASP A 1 40  ? 46.791 6.595   85.682  1.00 53.86 ? 40  ASP A O   1 
ATOM   270  C CB  . ASP A 1 40  ? 45.812 9.198   87.142  1.00 54.96 ? 40  ASP A CB  1 
ATOM   271  C CG  . ASP A 1 40  ? 46.307 10.602  87.361  1.00 56.86 ? 40  ASP A CG  1 
ATOM   272  O OD1 . ASP A 1 40  ? 45.457 11.509  87.526  1.00 59.65 ? 40  ASP A OD1 1 
ATOM   273  O OD2 . ASP A 1 40  ? 47.521 10.892  87.396  1.00 59.36 ? 40  ASP A OD2 1 
ATOM   274  N N   . PHE A 1 41  ? 48.107 8.293   85.033  1.00 53.33 ? 41  PHE A N   1 
ATOM   275  C CA  . PHE A 1 41  ? 49.274 7.450   84.803  1.00 52.64 ? 41  PHE A CA  1 
ATOM   276  C C   . PHE A 1 41  ? 49.773 6.829   86.113  1.00 51.37 ? 41  PHE A C   1 
ATOM   277  O O   . PHE A 1 41  ? 50.137 5.656   86.158  1.00 51.03 ? 41  PHE A O   1 
ATOM   278  C CB  . PHE A 1 41  ? 50.373 8.289   84.149  1.00 53.39 ? 41  PHE A CB  1 
ATOM   279  C CG  . PHE A 1 41  ? 51.732 7.670   84.207  1.00 55.03 ? 41  PHE A CG  1 
ATOM   280  C CD1 . PHE A 1 41  ? 52.771 8.319   84.853  1.00 56.81 ? 41  PHE A CD1 1 
ATOM   281  C CD2 . PHE A 1 41  ? 51.985 6.455   83.589  1.00 57.21 ? 41  PHE A CD2 1 
ATOM   282  C CE1 . PHE A 1 41  ? 54.042 7.753   84.897  1.00 59.02 ? 41  PHE A CE1 1 
ATOM   283  C CE2 . PHE A 1 41  ? 53.252 5.880   83.637  1.00 57.76 ? 41  PHE A CE2 1 
ATOM   284  C CZ  . PHE A 1 41  ? 54.279 6.528   84.286  1.00 58.01 ? 41  PHE A CZ  1 
ATOM   285  N N   . GLU A 1 42  ? 49.762 7.628   87.173  1.00 49.78 ? 42  GLU A N   1 
ATOM   286  C CA  . GLU A 1 42  ? 50.235 7.206   88.485  1.00 48.94 ? 42  GLU A CA  1 
ATOM   287  C C   . GLU A 1 42  ? 49.158 6.570   89.355  1.00 46.95 ? 42  GLU A C   1 
ATOM   288  O O   . GLU A 1 42  ? 49.423 6.190   90.492  1.00 46.58 ? 42  GLU A O   1 
ATOM   289  C CB  . GLU A 1 42  ? 50.843 8.395   89.223  1.00 49.39 ? 42  GLU A CB  1 
ATOM   290  C CG  . GLU A 1 42  ? 52.162 8.861   88.626  1.00 53.65 ? 42  GLU A CG  1 
ATOM   291  C CD  . GLU A 1 42  ? 53.263 7.831   88.801  1.00 58.05 ? 42  GLU A CD  1 
ATOM   292  O OE1 . GLU A 1 42  ? 53.324 6.867   87.999  1.00 60.44 ? 42  GLU A OE1 1 
ATOM   293  O OE2 . GLU A 1 42  ? 54.067 7.980   89.750  1.00 61.82 ? 42  GLU A OE2 1 
ATOM   294  N N   . GLY A 1 43  ? 47.950 6.453   88.815  1.00 45.14 ? 43  GLY A N   1 
ATOM   295  C CA  . GLY A 1 43  ? 46.832 5.871   89.528  1.00 42.61 ? 43  GLY A CA  1 
ATOM   296  C C   . GLY A 1 43  ? 47.048 4.448   90.017  1.00 41.26 ? 43  GLY A C   1 
ATOM   297  O O   . GLY A 1 43  ? 46.934 4.162   91.213  1.00 41.47 ? 43  GLY A O   1 
ATOM   298  N N   . PRO A 1 44  ? 47.323 3.540   89.092  1.00 39.78 ? 44  PRO A N   1 
ATOM   299  C CA  . PRO A 1 44  ? 47.498 2.122   89.438  1.00 38.38 ? 44  PRO A CA  1 
ATOM   300  C C   . PRO A 1 44  ? 48.468 1.865   90.602  1.00 37.59 ? 44  PRO A C   1 
ATOM   301  O O   . PRO A 1 44  ? 48.084 1.148   91.518  1.00 37.19 ? 44  PRO A O   1 
ATOM   302  C CB  . PRO A 1 44  ? 47.974 1.487   88.119  1.00 38.75 ? 44  PRO A CB  1 
ATOM   303  C CG  . PRO A 1 44  ? 47.377 2.386   87.051  1.00 38.57 ? 44  PRO A CG  1 
ATOM   304  C CD  . PRO A 1 44  ? 47.412 3.782   87.640  1.00 39.32 ? 44  PRO A CD  1 
ATOM   305  N N   . PRO A 1 45  ? 49.666 2.446   90.610  1.00 36.66 ? 45  PRO A N   1 
ATOM   306  C CA  . PRO A 1 45  ? 50.595 2.208   91.722  1.00 35.94 ? 45  PRO A CA  1 
ATOM   307  C C   . PRO A 1 45  ? 50.075 2.766   93.050  1.00 34.93 ? 45  PRO A C   1 
ATOM   308  O O   . PRO A 1 45  ? 50.318 2.183   94.102  1.00 34.82 ? 45  PRO A O   1 
ATOM   309  C CB  . PRO A 1 45  ? 51.870 2.963   91.294  1.00 35.97 ? 45  PRO A CB  1 
ATOM   310  C CG  . PRO A 1 45  ? 51.694 3.238   89.854  1.00 36.59 ? 45  PRO A CG  1 
ATOM   311  C CD  . PRO A 1 45  ? 50.242 3.349   89.591  1.00 36.42 ? 45  PRO A CD  1 
ATOM   312  N N   . LEU A 1 46  ? 49.418 3.915   93.008  1.00 34.27 ? 46  LEU A N   1 
ATOM   313  C CA  . LEU A 1 46  ? 48.844 4.475   94.218  1.00 33.61 ? 46  LEU A CA  1 
ATOM   314  C C   . LEU A 1 46  ? 47.731 3.534   94.713  1.00 32.25 ? 46  LEU A C   1 
ATOM   315  O O   . LEU A 1 46  ? 47.650 3.236   95.895  1.00 31.29 ? 46  LEU A O   1 
ATOM   316  C CB  . LEU A 1 46  ? 48.230 5.840   93.941  1.00 33.70 ? 46  LEU A CB  1 
ATOM   317  C CG  . LEU A 1 46  ? 48.343 6.954   94.997  1.00 37.57 ? 46  LEU A CG  1 
ATOM   318  C CD1 . LEU A 1 46  ? 47.153 7.926   94.906  1.00 37.21 ? 46  LEU A CD1 1 
ATOM   319  C CD2 . LEU A 1 46  ? 48.581 6.487   96.457  1.00 35.42 ? 46  LEU A CD2 1 
ATOM   320  N N   . ALA A 1 47  ? 46.860 3.123   93.796  1.00 31.53 ? 47  ALA A N   1 
ATOM   321  C CA  . ALA A 1 47  ? 45.753 2.241   94.133  1.00 31.34 ? 47  ALA A CA  1 
ATOM   322  C C   . ALA A 1 47  ? 46.280 1.020   94.881  1.00 31.66 ? 47  ALA A C   1 
ATOM   323  O O   . ALA A 1 47  ? 45.794 0.625   95.924  1.00 30.89 ? 47  ALA A O   1 
ATOM   324  C CB  . ALA A 1 47  ? 45.047 1.787   92.880  1.00 30.31 ? 47  ALA A CB  1 
ATOM   325  N N   . THR A 1 48  ? 47.318 0.448   94.327  1.00 31.62 ? 48  THR A N   1 
ATOM   326  C CA  . THR A 1 48  ? 47.871 -0.774  94.849  1.00 32.55 ? 48  THR A CA  1 
ATOM   327  C C   . THR A 1 48  ? 48.589 -0.564  96.200  1.00 32.58 ? 48  THR A C   1 
ATOM   328  O O   . THR A 1 48  ? 48.585 -1.436  97.075  1.00 31.80 ? 48  THR A O   1 
ATOM   329  C CB  . THR A 1 48  ? 48.732 -1.313  93.707  1.00 34.19 ? 48  THR A CB  1 
ATOM   330  O OG1 . THR A 1 48  ? 48.541 -2.723  93.556  1.00 38.53 ? 48  THR A OG1 1 
ATOM   331  C CG2 . THR A 1 48  ? 50.179 -1.045  93.887  1.00 30.47 ? 48  THR A CG2 1 
ATOM   332  N N   . ARG A 1 49  ? 49.165 0.615   96.413  1.00 31.74 ? 49  ARG A N   1 
ATOM   333  C CA  . ARG A 1 49  ? 49.778 0.856   97.710  1.00 30.91 ? 49  ARG A CA  1 
ATOM   334  C C   . ARG A 1 49  ? 48.686 1.034   98.754  1.00 29.61 ? 49  ARG A C   1 
ATOM   335  O O   . ARG A 1 49  ? 48.813 0.573   99.873  1.00 28.44 ? 49  ARG A O   1 
ATOM   336  C CB  . ARG A 1 49  ? 50.710 2.067   97.670  1.00 31.23 ? 49  ARG A CB  1 
ATOM   337  C CG  . ARG A 1 49  ? 51.232 2.511   99.028  1.00 34.83 ? 49  ARG A CG  1 
ATOM   338  C CD  . ARG A 1 49  ? 52.463 3.409   98.944  1.00 41.73 ? 49  ARG A CD  1 
ATOM   339  N NE  . ARG A 1 49  ? 52.215 4.617   98.138  1.00 49.27 ? 49  ARG A NE  1 
ATOM   340  C CZ  . ARG A 1 49  ? 52.336 4.688   96.807  1.00 50.34 ? 49  ARG A CZ  1 
ATOM   341  N NH1 . ARG A 1 49  ? 52.096 5.826   96.170  1.00 47.98 ? 49  ARG A NH1 1 
ATOM   342  N NH2 . ARG A 1 49  ? 52.705 3.616   96.110  1.00 53.28 ? 49  ARG A NH2 1 
ATOM   343  N N   . LEU A 1 50  ? 47.606 1.702   98.382  1.00 29.34 ? 50  LEU A N   1 
ATOM   344  C CA  . LEU A 1 50  ? 46.511 1.913   99.326  1.00 29.60 ? 50  LEU A CA  1 
ATOM   345  C C   . LEU A 1 50  ? 45.862 0.571   99.655  1.00 28.84 ? 50  LEU A C   1 
ATOM   346  O O   . LEU A 1 50  ? 45.574 0.279   100.805 1.00 28.87 ? 50  LEU A O   1 
ATOM   347  C CB  . LEU A 1 50  ? 45.469 2.863   98.741  1.00 29.07 ? 50  LEU A CB  1 
ATOM   348  C CG  . LEU A 1 50  ? 45.946 4.312   98.486  1.00 30.71 ? 50  LEU A CG  1 
ATOM   349  C CD1 . LEU A 1 50  ? 44.888 5.143   97.758  1.00 30.85 ? 50  LEU A CD1 1 
ATOM   350  C CD2 . LEU A 1 50  ? 46.341 4.987   99.780  1.00 32.09 ? 50  LEU A CD2 1 
ATOM   351  N N   . LEU A 1 51  ? 45.620 -0.229  98.622  1.00 28.03 ? 51  LEU A N   1 
ATOM   352  C CA  . LEU A 1 51  ? 44.971 -1.517  98.798  1.00 27.24 ? 51  LEU A CA  1 
ATOM   353  C C   . LEU A 1 51  ? 45.812 -2.419  99.690  1.00 26.95 ? 51  LEU A C   1 
ATOM   354  O O   . LEU A 1 51  ? 45.284 -3.081  100.581 1.00 25.86 ? 51  LEU A O   1 
ATOM   355  C CB  . LEU A 1 51  ? 44.734 -2.186  97.441  1.00 26.87 ? 51  LEU A CB  1 
ATOM   356  C CG  . LEU A 1 51  ? 43.514 -1.644  96.673  1.00 26.25 ? 51  LEU A CG  1 
ATOM   357  C CD1 . LEU A 1 51  ? 43.512 -2.144  95.209  1.00 23.51 ? 51  LEU A CD1 1 
ATOM   358  C CD2 . LEU A 1 51  ? 42.180 -2.032  97.370  1.00 22.67 ? 51  LEU A CD2 1 
ATOM   359  N N   . ALA A 1 52  ? 47.117 -2.455  99.442  1.00 26.16 ? 52  ALA A N   1 
ATOM   360  C CA  . ALA A 1 52  ? 47.977 -3.305  100.239 1.00 27.28 ? 52  ALA A CA  1 
ATOM   361  C C   . ALA A 1 52  ? 47.852 -2.946  101.717 1.00 27.53 ? 52  ALA A C   1 
ATOM   362  O O   . ALA A 1 52  ? 47.812 -3.833  102.578 1.00 26.59 ? 52  ALA A O   1 
ATOM   363  C CB  . ALA A 1 52  ? 49.421 -3.205  99.801  1.00 27.05 ? 52  ALA A CB  1 
ATOM   364  N N   . HIS A 1 53  ? 47.796 -1.662  102.033 1.00 27.70 ? 53  HIS A N   1 
ATOM   365  C CA  . HIS A 1 53  ? 47.657 -1.320  103.447 1.00 27.83 ? 53  HIS A CA  1 
ATOM   366  C C   . HIS A 1 53  ? 46.265 -1.729  104.012 1.00 27.48 ? 53  HIS A C   1 
ATOM   367  O O   . HIS A 1 53  ? 46.173 -2.267  105.111 1.00 27.90 ? 53  HIS A O   1 
ATOM   368  C CB  . HIS A 1 53  ? 47.891 0.161   103.712 1.00 28.55 ? 53  HIS A CB  1 
ATOM   369  C CG  . HIS A 1 53  ? 47.807 0.525   105.162 1.00 30.25 ? 53  HIS A CG  1 
ATOM   370  N ND1 . HIS A 1 53  ? 46.810 1.329   105.673 1.00 32.74 ? 53  HIS A ND1 1 
ATOM   371  C CD2 . HIS A 1 53  ? 48.579 0.168   106.213 1.00 30.74 ? 53  HIS A CD2 1 
ATOM   372  C CE1 . HIS A 1 53  ? 46.993 1.476   106.971 1.00 30.32 ? 53  HIS A CE1 1 
ATOM   373  N NE2 . HIS A 1 53  ? 48.056 0.779   107.324 1.00 30.56 ? 53  HIS A NE2 1 
ATOM   374  N N   . LYS A 1 54  ? 45.185 -1.485  103.279 1.00 26.94 ? 54  LYS A N   1 
ATOM   375  C CA  . LYS A 1 54  ? 43.867 -1.853  103.816 1.00 25.70 ? 54  LYS A CA  1 
ATOM   376  C C   . LYS A 1 54  ? 43.721 -3.370  104.023 1.00 25.51 ? 54  LYS A C   1 
ATOM   377  O O   . LYS A 1 54  ? 43.078 -3.819  104.978 1.00 26.09 ? 54  LYS A O   1 
ATOM   378  C CB  . LYS A 1 54  ? 42.713 -1.350  102.935 1.00 26.09 ? 54  LYS A CB  1 
ATOM   379  C CG  . LYS A 1 54  ? 42.554 0.167   102.780 1.00 25.96 ? 54  LYS A CG  1 
ATOM   380  C CD  . LYS A 1 54  ? 42.394 0.951   104.086 1.00 23.22 ? 54  LYS A CD  1 
ATOM   381  C CE  . LYS A 1 54  ? 41.966 2.402   103.720 1.00 24.35 ? 54  LYS A CE  1 
ATOM   382  N NZ  . LYS A 1 54  ? 41.629 3.190   104.968 1.00 24.12 ? 54  LYS A NZ  1 
ATOM   383  N N   . ILE A 1 55  ? 44.354 -4.153  103.152 1.00 24.70 ? 55  ILE A N   1 
ATOM   384  C CA  . ILE A 1 55  ? 44.194 -5.609  103.171 1.00 23.55 ? 55  ILE A CA  1 
ATOM   385  C C   . ILE A 1 55  ? 44.869 -6.201  104.418 1.00 23.27 ? 55  ILE A C   1 
ATOM   386  O O   . ILE A 1 55  ? 44.484 -7.265  104.943 1.00 22.78 ? 55  ILE A O   1 
ATOM   387  C CB  . ILE A 1 55  ? 44.760 -6.185  101.836 1.00 24.22 ? 55  ILE A CB  1 
ATOM   388  C CG1 . ILE A 1 55  ? 43.806 -5.751  100.691 1.00 23.70 ? 55  ILE A CG1 1 
ATOM   389  C CG2 . ILE A 1 55  ? 44.836 -7.721  101.857 1.00 22.15 ? 55  ILE A CG2 1 
ATOM   390  C CD1 . ILE A 1 55  ? 44.287 -6.150  99.268  1.00 22.37 ? 55  ILE A CD1 1 
ATOM   391  N N   . GLN A 1 56  ? 45.890 -5.497  104.885 1.00 22.91 ? 56  GLN A N   1 
ATOM   392  C CA  . GLN A 1 56  ? 46.613 -5.877  106.082 1.00 23.28 ? 56  GLN A CA  1 
ATOM   393  C C   . GLN A 1 56  ? 45.963 -5.415  107.388 1.00 23.98 ? 56  GLN A C   1 
ATOM   394  O O   . GLN A 1 56  ? 46.502 -5.642  108.465 1.00 23.14 ? 56  GLN A O   1 
ATOM   395  C CB  . GLN A 1 56  ? 48.081 -5.403  105.992 1.00 23.45 ? 56  GLN A CB  1 
ATOM   396  C CG  . GLN A 1 56  ? 48.817 -6.193  104.908 1.00 26.08 ? 56  GLN A CG  1 
ATOM   397  C CD  . GLN A 1 56  ? 50.252 -5.794  104.693 1.00 31.14 ? 56  GLN A CD  1 
ATOM   398  O OE1 . GLN A 1 56  ? 50.953 -6.443  103.924 1.00 33.26 ? 56  GLN A OE1 1 
ATOM   399  N NE2 . GLN A 1 56  ? 50.685 -4.725  105.328 1.00 32.40 ? 56  GLN A NE2 1 
ATOM   400  N N   . SER A 1 57  ? 44.798 -4.802  107.314 1.00 24.07 ? 57  SER A N   1 
ATOM   401  C CA  . SER A 1 57  ? 44.150 -4.339  108.549 1.00 25.01 ? 57  SER A CA  1 
ATOM   402  C C   . SER A 1 57  ? 43.776 -5.493  109.502 1.00 26.27 ? 57  SER A C   1 
ATOM   403  O O   . SER A 1 57  ? 43.247 -6.512  109.077 1.00 25.90 ? 57  SER A O   1 
ATOM   404  C CB  . SER A 1 57  ? 42.850 -3.608  108.205 1.00 25.03 ? 57  SER A CB  1 
ATOM   405  O OG  . SER A 1 57  ? 42.239 -3.072  109.370 1.00 24.65 ? 57  SER A OG  1 
ATOM   406  N N   . PRO A 1 58  ? 44.020 -5.297  110.790 1.00 26.71 ? 58  PRO A N   1 
ATOM   407  C CA  . PRO A 1 58  ? 43.573 -6.237  111.808 1.00 27.11 ? 58  PRO A CA  1 
ATOM   408  C C   . PRO A 1 58  ? 42.068 -6.200  111.900 1.00 26.58 ? 58  PRO A C   1 
ATOM   409  O O   . PRO A 1 58  ? 41.497 -7.118  112.475 1.00 27.41 ? 58  PRO A O   1 
ATOM   410  C CB  . PRO A 1 58  ? 44.155 -5.669  113.111 1.00 28.21 ? 58  PRO A CB  1 
ATOM   411  C CG  . PRO A 1 58  ? 45.125 -4.669  112.715 1.00 28.95 ? 58  PRO A CG  1 
ATOM   412  C CD  . PRO A 1 58  ? 44.757 -4.158  111.357 1.00 27.49 ? 58  PRO A CD  1 
ATOM   413  N N   . GLN A 1 59  ? 41.424 -5.184  111.334 1.00 24.82 ? 59  GLN A N   1 
ATOM   414  C CA  . GLN A 1 59  ? 39.957 -5.149  111.380 1.00 25.46 ? 59  GLN A CA  1 
ATOM   415  C C   . GLN A 1 59  ? 39.431 -5.890  110.150 1.00 25.29 ? 59  GLN A C   1 
ATOM   416  O O   . GLN A 1 59  ? 39.557 -5.423  109.024 1.00 22.87 ? 59  GLN A O   1 
ATOM   417  C CB  . GLN A 1 59  ? 39.448 -3.715  111.399 1.00 24.95 ? 59  GLN A CB  1 
ATOM   418  C CG  . GLN A 1 59  ? 39.883 -2.970  112.678 1.00 27.06 ? 59  GLN A CG  1 
ATOM   419  C CD  . GLN A 1 59  ? 39.532 -1.487  112.620 1.00 29.09 ? 59  GLN A CD  1 
ATOM   420  O OE1 . GLN A 1 59  ? 38.367 -1.140  112.420 1.00 28.63 ? 59  GLN A OE1 1 
ATOM   421  N NE2 . GLN A 1 59  ? 40.544 -0.614  112.773 1.00 29.08 ? 59  GLN A NE2 1 
ATOM   422  N N   . GLU A 1 60  ? 38.824 -7.035  110.399 1.00 24.57 ? 60  GLU A N   1 
ATOM   423  C CA  . GLU A 1 60  ? 38.454 -7.929  109.324 1.00 26.32 ? 60  GLU A CA  1 
ATOM   424  C C   . GLU A 1 60  ? 37.608 -7.318  108.224 1.00 25.31 ? 60  GLU A C   1 
ATOM   425  O O   . GLU A 1 60  ? 37.898 -7.515  107.043 1.00 25.65 ? 60  GLU A O   1 
ATOM   426  C CB  . GLU A 1 60  ? 37.712 -9.139  109.898 1.00 26.55 ? 60  GLU A CB  1 
ATOM   427  C CG  . GLU A 1 60  ? 37.508 -10.221 108.862 1.00 29.73 ? 60  GLU A CG  1 
ATOM   428  C CD  . GLU A 1 60  ? 36.509 -11.250 109.315 1.00 33.27 ? 60  GLU A CD  1 
ATOM   429  O OE1 . GLU A 1 60  ? 35.314 -10.906 109.411 1.00 34.45 ? 60  GLU A OE1 1 
ATOM   430  O OE2 . GLU A 1 60  ? 36.923 -12.395 109.557 1.00 33.21 ? 60  GLU A OE2 1 
ATOM   431  N N   . TRP A 1 61  ? 36.520 -6.641  108.603 1.00 24.66 ? 61  TRP A N   1 
ATOM   432  C CA  . TRP A 1 61  ? 35.580 -6.093  107.625 1.00 24.70 ? 61  TRP A CA  1 
ATOM   433  C C   . TRP A 1 61  ? 36.267 -5.048  106.739 1.00 24.96 ? 61  TRP A C   1 
ATOM   434  O O   . TRP A 1 61  ? 35.909 -4.872  105.568 1.00 24.11 ? 61  TRP A O   1 
ATOM   435  C CB  . TRP A 1 61  ? 34.361 -5.497  108.358 1.00 25.35 ? 61  TRP A CB  1 
ATOM   436  C CG  . TRP A 1 61  ? 33.310 -4.884  107.535 1.00 23.57 ? 61  TRP A CG  1 
ATOM   437  C CD1 . TRP A 1 61  ? 32.650 -3.708  107.810 1.00 24.72 ? 61  TRP A CD1 1 
ATOM   438  C CD2 . TRP A 1 61  ? 32.717 -5.405  106.344 1.00 24.92 ? 61  TRP A CD2 1 
ATOM   439  N NE1 . TRP A 1 61  ? 31.698 -3.464  106.854 1.00 25.92 ? 61  TRP A NE1 1 
ATOM   440  C CE2 . TRP A 1 61  ? 31.716 -4.490  105.939 1.00 25.17 ? 61  TRP A CE2 1 
ATOM   441  C CE3 . TRP A 1 61  ? 32.937 -6.546  105.560 1.00 25.37 ? 61  TRP A CE3 1 
ATOM   442  C CZ2 . TRP A 1 61  ? 30.951 -4.676  104.796 1.00 24.47 ? 61  TRP A CZ2 1 
ATOM   443  C CZ3 . TRP A 1 61  ? 32.177 -6.729  104.410 1.00 26.14 ? 61  TRP A CZ3 1 
ATOM   444  C CH2 . TRP A 1 61  ? 31.188 -5.798  104.045 1.00 26.83 ? 61  TRP A CH2 1 
ATOM   445  N N   . GLU A 1 62  ? 37.264 -4.370  107.300 1.00 23.91 ? 62  GLU A N   1 
ATOM   446  C CA  . GLU A 1 62  ? 38.037 -3.424  106.517 1.00 24.09 ? 62  GLU A CA  1 
ATOM   447  C C   . GLU A 1 62  ? 38.845 -4.226  105.464 1.00 23.67 ? 62  GLU A C   1 
ATOM   448  O O   . GLU A 1 62  ? 38.804 -3.900  104.268 1.00 23.35 ? 62  GLU A O   1 
ATOM   449  C CB  . GLU A 1 62  ? 38.964 -2.592  107.415 1.00 24.14 ? 62  GLU A CB  1 
ATOM   450  C CG  . GLU A 1 62  ? 39.803 -1.540  106.681 1.00 25.62 ? 62  GLU A CG  1 
ATOM   451  C CD  . GLU A 1 62  ? 40.516 -0.602  107.646 1.00 30.31 ? 62  GLU A CD  1 
ATOM   452  O OE1 . GLU A 1 62  ? 40.471 0.620   107.444 1.00 32.10 ? 62  GLU A OE1 1 
ATOM   453  O OE2 . GLU A 1 62  ? 41.082 -1.088  108.648 1.00 32.75 ? 62  GLU A OE2 1 
ATOM   454  N N   . ALA A 1 63  ? 39.544 -5.260  105.918 1.00 22.57 ? 63  ALA A N   1 
ATOM   455  C CA  . ALA A 1 63  ? 40.345 -6.104  105.025 1.00 23.37 ? 63  ALA A CA  1 
ATOM   456  C C   . ALA A 1 63  ? 39.461 -6.733  103.949 1.00 23.33 ? 63  ALA A C   1 
ATOM   457  O O   . ALA A 1 63  ? 39.763 -6.660  102.756 1.00 23.35 ? 63  ALA A O   1 
ATOM   458  C CB  . ALA A 1 63  ? 41.076 -7.205  105.834 1.00 23.29 ? 63  ALA A CB  1 
ATOM   459  N N   . ILE A 1 64  ? 38.363 -7.344  104.383 1.00 22.40 ? 64  ILE A N   1 
ATOM   460  C CA  . ILE A 1 64  ? 37.433 -7.985  103.481 1.00 22.77 ? 64  ILE A CA  1 
ATOM   461  C C   . ILE A 1 64  ? 36.876 -7.029  102.411 1.00 22.43 ? 64  ILE A C   1 
ATOM   462  O O   . ILE A 1 64  ? 36.853 -7.361  101.241 1.00 22.70 ? 64  ILE A O   1 
ATOM   463  C CB  . ILE A 1 64  ? 36.307 -8.616  104.303 1.00 22.55 ? 64  ILE A CB  1 
ATOM   464  C CG1 . ILE A 1 64  ? 36.816 -9.864  104.994 1.00 23.33 ? 64  ILE A CG1 1 
ATOM   465  C CG2 . ILE A 1 64  ? 35.134 -8.976  103.410 1.00 24.61 ? 64  ILE A CG2 1 
ATOM   466  C CD1 . ILE A 1 64  ? 37.176 -10.997 104.031 1.00 26.32 ? 64  ILE A CD1 1 
ATOM   467  N N   . GLN A 1 65  ? 36.478 -5.828  102.798 1.00 23.29 ? 65  GLN A N   1 
ATOM   468  C CA  . GLN A 1 65  ? 36.050 -4.856  101.807 1.00 23.13 ? 65  GLN A CA  1 
ATOM   469  C C   . GLN A 1 65  ? 37.177 -4.486  100.830 1.00 23.43 ? 65  GLN A C   1 
ATOM   470  O O   . GLN A 1 65  ? 36.942 -4.318  99.637  1.00 22.49 ? 65  GLN A O   1 
ATOM   471  C CB  . GLN A 1 65  ? 35.510 -3.595  102.501 1.00 23.57 ? 65  GLN A CB  1 
ATOM   472  C CG  . GLN A 1 65  ? 34.091 -3.736  103.098 1.00 23.25 ? 65  GLN A CG  1 
ATOM   473  C CD  . GLN A 1 65  ? 33.664 -2.512  103.903 1.00 28.23 ? 65  GLN A CD  1 
ATOM   474  O OE1 . GLN A 1 65  ? 32.911 -1.677  103.408 1.00 28.59 ? 65  GLN A OE1 1 
ATOM   475  N NE2 . GLN A 1 65  ? 34.169 -2.394  105.137 1.00 25.62 ? 65  GLN A NE2 1 
ATOM   476  N N   . ALA A 1 66  ? 38.391 -4.317  101.348 1.00 23.05 ? 66  ALA A N   1 
ATOM   477  C CA  . ALA A 1 66  ? 39.531 -3.995  100.505 1.00 23.24 ? 66  ALA A CA  1 
ATOM   478  C C   . ALA A 1 66  ? 39.799 -5.119  99.508  1.00 23.97 ? 66  ALA A C   1 
ATOM   479  O O   . ALA A 1 66  ? 40.161 -4.857  98.367  1.00 23.25 ? 66  ALA A O   1 
ATOM   480  C CB  . ALA A 1 66  ? 40.775 -3.738  101.368 1.00 23.37 ? 66  ALA A CB  1 
ATOM   481  N N   . LEU A 1 67  ? 39.670 -6.369  99.959  1.00 22.96 ? 67  LEU A N   1 
ATOM   482  C CA  . LEU A 1 67  ? 39.836 -7.492  99.059  1.00 23.44 ? 67  LEU A CA  1 
ATOM   483  C C   . LEU A 1 67  ? 38.741 -7.527  97.962  1.00 24.23 ? 67  LEU A C   1 
ATOM   484  O O   . LEU A 1 67  ? 39.010 -7.959  96.844  1.00 23.93 ? 67  LEU A O   1 
ATOM   485  C CB  . LEU A 1 67  ? 39.911 -8.804  99.841  1.00 23.25 ? 67  LEU A CB  1 
ATOM   486  C CG  . LEU A 1 67  ? 41.281 -9.019  100.523 1.00 21.64 ? 67  LEU A CG  1 
ATOM   487  C CD1 . LEU A 1 67  ? 41.194 -10.170 101.539 1.00 23.19 ? 67  LEU A CD1 1 
ATOM   488  C CD2 . LEU A 1 67  ? 42.426 -9.282  99.505  1.00 18.77 ? 67  LEU A CD2 1 
ATOM   489  N N   . THR A 1 68  ? 37.534 -7.062  98.287  1.00 24.09 ? 68  THR A N   1 
ATOM   490  C CA  . THR A 1 68  ? 36.442 -6.970  97.318  1.00 24.91 ? 68  THR A CA  1 
ATOM   491  C C   . THR A 1 68  ? 36.746 -5.894  96.303  1.00 24.48 ? 68  THR A C   1 
ATOM   492  O O   . THR A 1 68  ? 36.498 -6.074  95.104  1.00 25.28 ? 68  THR A O   1 
ATOM   493  C CB  . THR A 1 68  ? 35.118 -6.637  98.028  1.00 25.53 ? 68  THR A CB  1 
ATOM   494  O OG1 . THR A 1 68  ? 34.807 -7.709  98.920  1.00 27.19 ? 68  THR A OG1 1 
ATOM   495  C CG2 . THR A 1 68  ? 33.940 -6.643  97.013  1.00 25.27 ? 68  THR A CG2 1 
ATOM   496  N N   . VAL A 1 69  ? 37.262 -4.758  96.767  1.00 23.80 ? 69  VAL A N   1 
ATOM   497  C CA  . VAL A 1 69  ? 37.720 -3.747  95.822  1.00 23.69 ? 69  VAL A CA  1 
ATOM   498  C C   . VAL A 1 69  ? 38.767 -4.346  94.857  1.00 25.13 ? 69  VAL A C   1 
ATOM   499  O O   . VAL A 1 69  ? 38.613 -4.276  93.607  1.00 24.86 ? 69  VAL A O   1 
ATOM   500  C CB  . VAL A 1 69  ? 38.318 -2.532  96.532  1.00 24.54 ? 69  VAL A CB  1 
ATOM   501  C CG1 . VAL A 1 69  ? 38.858 -1.512  95.522  1.00 22.66 ? 69  VAL A CG1 1 
ATOM   502  C CG2 . VAL A 1 69  ? 37.298 -1.881  97.482  1.00 22.85 ? 69  VAL A CG2 1 
ATOM   503  N N   . LEU A 1 70  ? 39.813 -4.946  95.423  1.00 24.60 ? 70  LEU A N   1 
ATOM   504  C CA  . LEU A 1 70  ? 40.889 -5.532  94.619  1.00 25.49 ? 70  LEU A CA  1 
ATOM   505  C C   . LEU A 1 70  ? 40.327 -6.554  93.613  1.00 25.75 ? 70  LEU A C   1 
ATOM   506  O O   . LEU A 1 70  ? 40.666 -6.488  92.441  1.00 25.77 ? 70  LEU A O   1 
ATOM   507  C CB  . LEU A 1 70  ? 41.958 -6.180  95.514  1.00 25.04 ? 70  LEU A CB  1 
ATOM   508  C CG  . LEU A 1 70  ? 42.992 -7.076  94.821  1.00 25.01 ? 70  LEU A CG  1 
ATOM   509  C CD1 . LEU A 1 70  ? 43.944 -6.268  93.954  1.00 23.03 ? 70  LEU A CD1 1 
ATOM   510  C CD2 . LEU A 1 70  ? 43.787 -7.868  95.907  1.00 23.51 ? 70  LEU A CD2 1 
ATOM   511  N N   . GLU A 1 71  ? 39.493 -7.492  94.074  1.00 25.96 ? 71  GLU A N   1 
ATOM   512  C CA  . GLU A 1 71  ? 38.868 -8.480  93.184  1.00 27.51 ? 71  GLU A CA  1 
ATOM   513  C C   . GLU A 1 71  ? 38.155 -7.756  92.038  1.00 28.19 ? 71  GLU A C   1 
ATOM   514  O O   . GLU A 1 71  ? 38.347 -8.087  90.854  1.00 27.29 ? 71  GLU A O   1 
ATOM   515  C CB  . GLU A 1 71  ? 37.877 -9.372  93.948  1.00 27.88 ? 71  GLU A CB  1 
ATOM   516  C CG  . GLU A 1 71  ? 37.078 -10.379 93.106  1.00 32.34 ? 71  GLU A CG  1 
ATOM   517  C CD  . GLU A 1 71  ? 36.161 -11.271 93.946  1.00 37.73 ? 71  GLU A CD  1 
ATOM   518  O OE1 . GLU A 1 71  ? 35.605 -10.796 94.964  1.00 41.41 ? 71  GLU A OE1 1 
ATOM   519  O OE2 . GLU A 1 71  ? 35.999 -12.463 93.613  1.00 41.80 ? 71  GLU A OE2 1 
ATOM   520  N N   . THR A 1 72  ? 37.352 -6.761  92.403  1.00 28.58 ? 72  THR A N   1 
ATOM   521  C CA  . THR A 1 72  ? 36.549 -6.008  91.438  1.00 30.25 ? 72  THR A CA  1 
ATOM   522  C C   . THR A 1 72  ? 37.428 -5.301  90.402  1.00 30.58 ? 72  THR A C   1 
ATOM   523  O O   . THR A 1 72  ? 37.187 -5.405  89.201  1.00 30.45 ? 72  THR A O   1 
ATOM   524  C CB  . THR A 1 72  ? 35.606 -5.011  92.180  1.00 29.81 ? 72  THR A CB  1 
ATOM   525  O OG1 . THR A 1 72  ? 34.710 -5.757  93.029  1.00 30.22 ? 72  THR A OG1 1 
ATOM   526  C CG2 . THR A 1 72  ? 34.668 -4.303  91.178  1.00 30.62 ? 72  THR A CG2 1 
ATOM   527  N N   . CYS A 1 73  ? 38.484 -4.636  90.843  1.00 31.69 ? 73  CYS A N   1 
ATOM   528  C CA  . CYS A 1 73  ? 39.327 -3.928  89.892  1.00 32.52 ? 73  CYS A CA  1 
ATOM   529  C C   . CYS A 1 73  ? 40.057 -4.894  88.976  1.00 33.15 ? 73  CYS A C   1 
ATOM   530  O O   . CYS A 1 73  ? 40.273 -4.610  87.781  1.00 33.38 ? 73  CYS A O   1 
ATOM   531  C CB  . CYS A 1 73  ? 40.339 -3.056  90.626  1.00 33.59 ? 73  CYS A CB  1 
ATOM   532  S SG  . CYS A 1 73  ? 39.608 -1.728  91.599  1.00 33.87 ? 73  CYS A SG  1 
ATOM   533  N N   . MET A 1 74  ? 40.449 -6.038  89.529  1.00 32.28 ? 74  MET A N   1 
ATOM   534  C CA  . MET A 1 74  ? 41.187 -7.015  88.758  1.00 31.99 ? 74  MET A CA  1 
ATOM   535  C C   . MET A 1 74  ? 40.313 -7.679  87.689  1.00 32.76 ? 74  MET A C   1 
ATOM   536  O O   . MET A 1 74  ? 40.805 -8.054  86.646  1.00 31.13 ? 74  MET A O   1 
ATOM   537  C CB  . MET A 1 74  ? 41.794 -8.077  89.674  1.00 31.79 ? 74  MET A CB  1 
ATOM   538  C CG  . MET A 1 74  ? 43.010 -7.558  90.471  1.00 30.02 ? 74  MET A CG  1 
ATOM   539  S SD  . MET A 1 74  ? 44.440 -7.285  89.390  1.00 29.74 ? 74  MET A SD  1 
ATOM   540  C CE  . MET A 1 74  ? 44.918 -8.897  89.087  1.00 27.74 ? 74  MET A CE  1 
ATOM   541  N N   . LYS A 1 75  ? 39.031 -7.829  87.970  1.00 33.55 ? 75  LYS A N   1 
ATOM   542  C CA  . LYS A 1 75  ? 38.115 -8.443  87.013  1.00 36.51 ? 75  LYS A CA  1 
ATOM   543  C C   . LYS A 1 75  ? 37.917 -7.594  85.772  1.00 37.13 ? 75  LYS A C   1 
ATOM   544  O O   . LYS A 1 75  ? 37.384 -8.068  84.771  1.00 38.93 ? 75  LYS A O   1 
ATOM   545  C CB  . LYS A 1 75  ? 36.756 -8.711  87.659  1.00 36.53 ? 75  LYS A CB  1 
ATOM   546  C CG  . LYS A 1 75  ? 36.630 -10.109 88.223  1.00 39.44 ? 75  LYS A CG  1 
ATOM   547  C CD  . LYS A 1 75  ? 35.296 -10.293 88.923  1.00 44.24 ? 75  LYS A CD  1 
ATOM   548  C CE  . LYS A 1 75  ? 35.327 -11.557 89.790  1.00 46.63 ? 75  LYS A CE  1 
ATOM   549  N NZ  . LYS A 1 75  ? 34.040 -11.749 90.535  1.00 47.61 ? 75  LYS A NZ  1 
ATOM   550  N N   . SER A 1 76  ? 38.333 -6.342  85.833  1.00 37.61 ? 76  SER A N   1 
ATOM   551  C CA  . SER A 1 76  ? 38.168 -5.449  84.690  1.00 38.55 ? 76  SER A CA  1 
ATOM   552  C C   . SER A 1 76  ? 39.442 -5.229  83.906  1.00 37.70 ? 76  SER A C   1 
ATOM   553  O O   . SER A 1 76  ? 40.540 -5.263  84.458  1.00 37.20 ? 76  SER A O   1 
ATOM   554  C CB  . SER A 1 76  ? 37.636 -4.101  85.137  1.00 38.56 ? 76  SER A CB  1 
ATOM   555  O OG  . SER A 1 76  ? 36.227 -4.108  85.003  1.00 43.83 ? 76  SER A OG  1 
ATOM   556  N N   . CYS A 1 77  ? 39.265 -4.949  82.616  1.00 36.64 ? 77  CYS A N   1 
ATOM   557  C CA  . CYS A 1 77  ? 40.381 -4.768  81.701  1.00 36.05 ? 77  CYS A CA  1 
ATOM   558  C C   . CYS A 1 77  ? 41.258 -3.610  82.125  1.00 35.35 ? 77  CYS A C   1 
ATOM   559  O O   . CYS A 1 77  ? 40.770 -2.579  82.601  1.00 34.52 ? 77  CYS A O   1 
ATOM   560  C CB  . CYS A 1 77  ? 39.863 -4.531  80.274  1.00 36.17 ? 77  CYS A CB  1 
ATOM   561  S SG  . CYS A 1 77  ? 39.136 -2.896  80.082  1.00 38.77 ? 77  CYS A SG  1 
ATOM   562  N N   . GLY A 1 78  ? 42.561 -3.781  81.940  1.00 33.96 ? 78  GLY A N   1 
ATOM   563  C CA  . GLY A 1 78  ? 43.508 -2.734  82.255  1.00 33.40 ? 78  GLY A CA  1 
ATOM   564  C C   . GLY A 1 78  ? 44.891 -3.304  82.469  1.00 32.86 ? 78  GLY A C   1 
ATOM   565  O O   . GLY A 1 78  ? 45.181 -3.843  83.528  1.00 31.98 ? 78  GLY A O   1 
ATOM   566  N N   . LYS A 1 79  ? 45.755 -3.164  81.468  1.00 32.52 ? 79  LYS A N   1 
ATOM   567  C CA  . LYS A 1 79  ? 47.099 -3.729  81.553  1.00 32.58 ? 79  LYS A CA  1 
ATOM   568  C C   . LYS A 1 79  ? 47.891 -3.153  82.721  1.00 32.22 ? 79  LYS A C   1 
ATOM   569  O O   . LYS A 1 79  ? 48.534 -3.890  83.459  1.00 30.62 ? 79  LYS A O   1 
ATOM   570  C CB  . LYS A 1 79  ? 47.869 -3.546  80.230  1.00 33.18 ? 79  LYS A CB  1 
ATOM   571  C CG  . LYS A 1 79  ? 49.349 -3.933  80.309  1.00 35.61 ? 79  LYS A CG  1 
ATOM   572  C CD  . LYS A 1 79  ? 50.063 -3.628  78.986  1.00 38.60 ? 79  LYS A CD  1 
ATOM   573  C CE  . LYS A 1 79  ? 51.504 -4.146  78.974  1.00 41.53 ? 79  LYS A CE  1 
ATOM   574  N NZ  . LYS A 1 79  ? 52.450 -3.250  79.713  1.00 43.88 ? 79  LYS A NZ  1 
ATOM   575  N N   . ARG A 1 80  ? 47.825 -1.841  82.898  1.00 31.45 ? 80  ARG A N   1 
ATOM   576  C CA  . ARG A 1 80  ? 48.633 -1.209  83.925  1.00 32.11 ? 80  ARG A CA  1 
ATOM   577  C C   . ARG A 1 80  ? 48.284 -1.715  85.340  1.00 30.95 ? 80  ARG A C   1 
ATOM   578  O O   . ARG A 1 80  ? 49.174 -2.075  86.121  1.00 29.12 ? 80  ARG A O   1 
ATOM   579  C CB  . ARG A 1 80  ? 48.491 0.311   83.878  1.00 32.52 ? 80  ARG A CB  1 
ATOM   580  C CG  . ARG A 1 80  ? 49.519 1.016   82.984  1.00 37.68 ? 80  ARG A CG  1 
ATOM   581  C CD  . ARG A 1 80  ? 49.296 2.534   82.884  1.00 42.38 ? 80  ARG A CD  1 
ATOM   582  N NE  . ARG A 1 80  ? 47.898 2.799   82.560  1.00 47.14 ? 80  ARG A NE  1 
ATOM   583  C CZ  . ARG A 1 80  ? 47.125 3.655   83.214  1.00 49.29 ? 80  ARG A CZ  1 
ATOM   584  N NH1 . ARG A 1 80  ? 47.606 4.364   84.228  1.00 47.92 ? 80  ARG A NH1 1 
ATOM   585  N NH2 . ARG A 1 80  ? 45.861 3.797   82.851  1.00 51.25 ? 80  ARG A NH2 1 
ATOM   586  N N   . PHE A 1 81  ? 47.002 -1.738  85.661  1.00 29.32 ? 81  PHE A N   1 
ATOM   587  C CA  . PHE A 1 81  ? 46.623 -2.194  86.998  1.00 30.17 ? 81  PHE A CA  1 
ATOM   588  C C   . PHE A 1 81  ? 46.963 -3.657  87.181  1.00 29.84 ? 81  PHE A C   1 
ATOM   589  O O   . PHE A 1 81  ? 47.501 -4.058  88.213  1.00 29.78 ? 81  PHE A O   1 
ATOM   590  C CB  . PHE A 1 81  ? 45.147 -1.944  87.303  1.00 28.91 ? 81  PHE A CB  1 
ATOM   591  C CG  . PHE A 1 81  ? 44.782 -2.283  88.711  1.00 30.40 ? 81  PHE A CG  1 
ATOM   592  C CD1 . PHE A 1 81  ? 45.282 -1.539  89.766  1.00 31.93 ? 81  PHE A CD1 1 
ATOM   593  C CD2 . PHE A 1 81  ? 43.973 -3.353  88.983  1.00 29.43 ? 81  PHE A CD2 1 
ATOM   594  C CE1 . PHE A 1 81  ? 44.960 -1.871  91.075  1.00 34.16 ? 81  PHE A CE1 1 
ATOM   595  C CE2 . PHE A 1 81  ? 43.662 -3.686  90.284  1.00 31.23 ? 81  PHE A CE2 1 
ATOM   596  C CZ  . PHE A 1 81  ? 44.149 -2.944  91.322  1.00 31.32 ? 81  PHE A CZ  1 
ATOM   597  N N   . HIS A 1 82  ? 46.615 -4.458  86.184  1.00 29.41 ? 82  HIS A N   1 
ATOM   598  C CA  . HIS A 1 82  ? 46.924 -5.867  86.209  1.00 29.73 ? 82  HIS A CA  1 
ATOM   599  C C   . HIS A 1 82  ? 48.405 -6.085  86.429  1.00 29.81 ? 82  HIS A C   1 
ATOM   600  O O   . HIS A 1 82  ? 48.793 -6.986  87.175  1.00 29.05 ? 82  HIS A O   1 
ATOM   601  C CB  . HIS A 1 82  ? 46.515 -6.548  84.893  1.00 30.19 ? 82  HIS A CB  1 
ATOM   602  C CG  . HIS A 1 82  ? 45.060 -6.905  84.813  1.00 31.10 ? 82  HIS A CG  1 
ATOM   603  N ND1 . HIS A 1 82  ? 44.367 -6.947  83.618  1.00 30.59 ? 82  HIS A ND1 1 
ATOM   604  C CD2 . HIS A 1 82  ? 44.169 -7.240  85.777  1.00 30.78 ? 82  HIS A CD2 1 
ATOM   605  C CE1 . HIS A 1 82  ? 43.113 -7.293  83.853  1.00 30.71 ? 82  HIS A CE1 1 
ATOM   606  N NE2 . HIS A 1 82  ? 42.969 -7.487  85.152  1.00 29.46 ? 82  HIS A NE2 1 
ATOM   607  N N   . ASP A 1 83  ? 49.240 -5.291  85.756  1.00 29.72 ? 83  ASP A N   1 
ATOM   608  C CA  . ASP A 1 83  ? 50.678 -5.452  85.900  1.00 29.71 ? 83  ASP A CA  1 
ATOM   609  C C   . ASP A 1 83  ? 51.162 -5.005  87.284  1.00 30.04 ? 83  ASP A C   1 
ATOM   610  O O   . ASP A 1 83  ? 52.103 -5.575  87.815  1.00 29.06 ? 83  ASP A O   1 
ATOM   611  C CB  . ASP A 1 83  ? 51.462 -4.702  84.802  1.00 29.41 ? 83  ASP A CB  1 
ATOM   612  C CG  . ASP A 1 83  ? 51.364 -5.383  83.431  1.00 30.80 ? 83  ASP A CG  1 
ATOM   613  O OD1 . ASP A 1 83  ? 51.867 -4.809  82.461  1.00 32.25 ? 83  ASP A OD1 1 
ATOM   614  O OD2 . ASP A 1 83  ? 50.796 -6.480  83.220  1.00 32.86 ? 83  ASP A OD2 1 
ATOM   615  N N   . GLU A 1 84  ? 50.556 -3.964  87.850  1.00 30.33 ? 84  GLU A N   1 
ATOM   616  C CA  . GLU A 1 84  ? 51.006 -3.513  89.167  1.00 31.59 ? 84  GLU A CA  1 
ATOM   617  C C   . GLU A 1 84  ? 50.743 -4.596  90.209  1.00 30.87 ? 84  GLU A C   1 
ATOM   618  O O   . GLU A 1 84  ? 51.595 -4.907  91.051  1.00 31.12 ? 84  GLU A O   1 
ATOM   619  C CB  . GLU A 1 84  ? 50.290 -2.230  89.585  1.00 32.26 ? 84  GLU A CB  1 
ATOM   620  C CG  . GLU A 1 84  ? 50.841 -0.965  88.959  1.00 35.21 ? 84  GLU A CG  1 
ATOM   621  C CD  . GLU A 1 84  ? 52.300 -0.735  89.322  1.00 39.57 ? 84  GLU A CD  1 
ATOM   622  O OE1 . GLU A 1 84  ? 52.707 -0.997  90.484  1.00 40.16 ? 84  GLU A OE1 1 
ATOM   623  O OE2 . GLU A 1 84  ? 53.044 -0.294  88.428  1.00 41.88 ? 84  GLU A OE2 1 
ATOM   624  N N   . VAL A 1 85  ? 49.556 -5.175  90.145  1.00 29.64 ? 85  VAL A N   1 
ATOM   625  C CA  . VAL A 1 85  ? 49.156 -6.188  91.123  1.00 28.79 ? 85  VAL A CA  1 
ATOM   626  C C   . VAL A 1 85  ? 50.023 -7.411  90.888  1.00 28.19 ? 85  VAL A C   1 
ATOM   627  O O   . VAL A 1 85  ? 50.332 -8.159  91.814  1.00 27.38 ? 85  VAL A O   1 
ATOM   628  C CB  . VAL A 1 85  ? 47.656 -6.530  90.968  1.00 28.51 ? 85  VAL A CB  1 
ATOM   629  C CG1 . VAL A 1 85  ? 47.293 -7.845  91.663  1.00 28.90 ? 85  VAL A CG1 1 
ATOM   630  C CG2 . VAL A 1 85  ? 46.791 -5.380  91.478  1.00 27.48 ? 85  VAL A CG2 1 
ATOM   631  N N   . GLY A 1 86  ? 50.428 -7.580  89.631  1.00 27.58 ? 86  GLY A N   1 
ATOM   632  C CA  . GLY A 1 86  ? 51.328 -8.658  89.236  1.00 27.49 ? 86  GLY A CA  1 
ATOM   633  C C   . GLY A 1 86  ? 52.814 -8.473  89.543  1.00 27.87 ? 86  GLY A C   1 
ATOM   634  O O   . GLY A 1 86  ? 53.652 -9.238  89.054  1.00 28.85 ? 86  GLY A O   1 
ATOM   635  N N   . LYS A 1 87  ? 53.167 -7.491  90.356  1.00 27.76 ? 87  LYS A N   1 
ATOM   636  C CA  . LYS A 1 87  ? 54.561 -7.356  90.778  1.00 27.95 ? 87  LYS A CA  1 
ATOM   637  C C   . LYS A 1 87  ? 54.691 -7.883  92.191  1.00 28.26 ? 87  LYS A C   1 
ATOM   638  O O   . LYS A 1 87  ? 53.735 -7.812  92.972  1.00 26.20 ? 87  LYS A O   1 
ATOM   639  C CB  . LYS A 1 87  ? 54.987 -5.905  90.809  1.00 28.23 ? 87  LYS A CB  1 
ATOM   640  C CG  . LYS A 1 87  ? 55.185 -5.296  89.437  1.00 32.15 ? 87  LYS A CG  1 
ATOM   641  C CD  . LYS A 1 87  ? 55.357 -3.814  89.569  1.00 34.50 ? 87  LYS A CD  1 
ATOM   642  C CE  . LYS A 1 87  ? 55.142 -3.118  88.224  1.00 36.18 ? 87  LYS A CE  1 
ATOM   643  N NZ  . LYS A 1 87  ? 55.446 -1.675  88.399  1.00 40.44 ? 87  LYS A NZ  1 
ATOM   644  N N   . PHE A 1 88  ? 55.878 -8.366  92.521  1.00 27.37 ? 88  PHE A N   1 
ATOM   645  C CA  . PHE A 1 88  ? 56.132 -8.873  93.870  1.00 29.05 ? 88  PHE A CA  1 
ATOM   646  C C   . PHE A 1 88  ? 55.949 -7.772  94.891  1.00 28.78 ? 88  PHE A C   1 
ATOM   647  O O   . PHE A 1 88  ? 55.583 -8.032  96.025  1.00 29.54 ? 88  PHE A O   1 
ATOM   648  C CB  . PHE A 1 88  ? 57.523 -9.475  93.964  1.00 28.71 ? 88  PHE A CB  1 
ATOM   649  C CG  . PHE A 1 88  ? 57.694 -10.709 93.122  1.00 30.10 ? 88  PHE A CG  1 
ATOM   650  C CD1 . PHE A 1 88  ? 56.789 -11.751 93.215  1.00 28.92 ? 88  PHE A CD1 1 
ATOM   651  C CD2 . PHE A 1 88  ? 58.749 -10.815 92.231  1.00 30.07 ? 88  PHE A CD2 1 
ATOM   652  C CE1 . PHE A 1 88  ? 56.922 -12.899 92.438  1.00 29.63 ? 88  PHE A CE1 1 
ATOM   653  C CE2 . PHE A 1 88  ? 58.900 -11.961 91.451  1.00 31.11 ? 88  PHE A CE2 1 
ATOM   654  C CZ  . PHE A 1 88  ? 57.984 -13.002 91.551  1.00 29.14 ? 88  PHE A CZ  1 
ATOM   655  N N   . ARG A 1 89  ? 56.165 -6.537  94.451  1.00 29.52 ? 89  ARG A N   1 
ATOM   656  C CA  . ARG A 1 89  ? 55.972 -5.349  95.283  1.00 30.03 ? 89  ARG A CA  1 
ATOM   657  C C   . ARG A 1 89  ? 54.560 -5.323  95.899  1.00 29.38 ? 89  ARG A C   1 
ATOM   658  O O   . ARG A 1 89  ? 54.367 -4.855  97.022  1.00 30.56 ? 89  ARG A O   1 
ATOM   659  C CB  . ARG A 1 89  ? 56.180 -4.100  94.433  1.00 29.56 ? 89  ARG A CB  1 
ATOM   660  C CG  . ARG A 1 89  ? 56.019 -2.808  95.198  1.00 33.41 ? 89  ARG A CG  1 
ATOM   661  C CD  . ARG A 1 89  ? 56.564 -1.599  94.462  1.00 38.38 ? 89  ARG A CD  1 
ATOM   662  N NE  . ARG A 1 89  ? 58.003 -1.742  94.235  1.00 40.76 ? 89  ARG A NE  1 
ATOM   663  C CZ  . ARG A 1 89  ? 58.585 -1.577  93.056  1.00 43.17 ? 89  ARG A CZ  1 
ATOM   664  N NH1 . ARG A 1 89  ? 57.853 -1.264  91.991  1.00 44.01 ? 89  ARG A NH1 1 
ATOM   665  N NH2 . ARG A 1 89  ? 59.897 -1.728  92.939  1.00 43.20 ? 89  ARG A NH2 1 
ATOM   666  N N   . PHE A 1 90  ? 53.576 -5.812  95.158  1.00 28.35 ? 90  PHE A N   1 
ATOM   667  C CA  . PHE A 1 90  ? 52.225 -5.944  95.695  1.00 26.88 ? 90  PHE A CA  1 
ATOM   668  C C   . PHE A 1 90  ? 51.947 -7.324  96.241  1.00 27.19 ? 90  PHE A C   1 
ATOM   669  O O   . PHE A 1 90  ? 51.392 -7.468  97.327  1.00 27.05 ? 90  PHE A O   1 
ATOM   670  C CB  . PHE A 1 90  ? 51.152 -5.626  94.640  1.00 27.38 ? 90  PHE A CB  1 
ATOM   671  C CG  . PHE A 1 90  ? 49.752 -5.671  95.187  1.00 25.87 ? 90  PHE A CG  1 
ATOM   672  C CD1 . PHE A 1 90  ? 49.297 -4.669  96.036  1.00 26.24 ? 90  PHE A CD1 1 
ATOM   673  C CD2 . PHE A 1 90  ? 48.913 -6.715  94.884  1.00 25.58 ? 90  PHE A CD2 1 
ATOM   674  C CE1 . PHE A 1 90  ? 47.996 -4.710  96.559  1.00 25.81 ? 90  PHE A CE1 1 
ATOM   675  C CE2 . PHE A 1 90  ? 47.619 -6.780  95.425  1.00 25.51 ? 90  PHE A CE2 1 
ATOM   676  C CZ  . PHE A 1 90  ? 47.168 -5.769  96.245  1.00 25.21 ? 90  PHE A CZ  1 
ATOM   677  N N   . LEU A 1 91  ? 52.283 -8.349  95.465  1.00 26.30 ? 91  LEU A N   1 
ATOM   678  C CA  . LEU A 1 91  ? 52.055 -9.721  95.901  1.00 25.68 ? 91  LEU A CA  1 
ATOM   679  C C   . LEU A 1 91  ? 52.666 -10.007 97.296  1.00 24.39 ? 91  LEU A C   1 
ATOM   680  O O   . LEU A 1 91  ? 52.064 -10.689 98.127  1.00 22.99 ? 91  LEU A O   1 
ATOM   681  C CB  . LEU A 1 91  ? 52.584 -10.686 94.841  1.00 25.48 ? 91  LEU A CB  1 
ATOM   682  C CG  . LEU A 1 91  ? 51.840 -10.606 93.484  1.00 27.60 ? 91  LEU A CG  1 
ATOM   683  C CD1 . LEU A 1 91  ? 52.673 -11.164 92.314  1.00 26.71 ? 91  LEU A CD1 1 
ATOM   684  C CD2 . LEU A 1 91  ? 50.447 -11.282 93.548  1.00 27.31 ? 91  LEU A CD2 1 
ATOM   685  N N   . ASN A 1 92  ? 53.851 -9.478  97.542  1.00 23.30 ? 92  ASN A N   1 
ATOM   686  C CA  . ASN A 1 92  ? 54.486 -9.677  98.838  1.00 24.23 ? 92  ASN A CA  1 
ATOM   687  C C   . ASN A 1 92  ? 53.576 -9.194  99.976  1.00 24.53 ? 92  ASN A C   1 
ATOM   688  O O   . ASN A 1 92  ? 53.577 -9.778  101.046 1.00 24.38 ? 92  ASN A O   1 
ATOM   689  C CB  . ASN A 1 92  ? 55.868 -8.987  98.922  1.00 23.58 ? 92  ASN A CB  1 
ATOM   690  C CG  . ASN A 1 92  ? 56.920 -9.698  98.105  1.00 25.15 ? 92  ASN A CG  1 
ATOM   691  O OD1 . ASN A 1 92  ? 56.688 -10.797 97.579  1.00 24.08 ? 92  ASN A OD1 1 
ATOM   692  N ND2 . ASN A 1 92  ? 58.080 -9.085  97.995  1.00 24.56 ? 92  ASN A ND2 1 
ATOM   693  N N   . GLU A 1 93  ? 52.825 -8.119  99.746  1.00 26.27 ? 93  GLU A N   1 
ATOM   694  C CA  . GLU A 1 93  ? 51.902 -7.616  100.772 1.00 26.83 ? 93  GLU A CA  1 
ATOM   695  C C   . GLU A 1 93  ? 50.752 -8.597  101.064 1.00 26.50 ? 93  GLU A C   1 
ATOM   696  O O   . GLU A 1 93  ? 50.315 -8.719  102.215 1.00 26.45 ? 93  GLU A O   1 
ATOM   697  C CB  . GLU A 1 93  ? 51.336 -6.247  100.400 1.00 26.87 ? 93  GLU A CB  1 
ATOM   698  C CG  . GLU A 1 93  ? 52.381 -5.173  100.200 1.00 32.10 ? 93  GLU A CG  1 
ATOM   699  C CD  . GLU A 1 93  ? 53.327 -5.070  101.376 1.00 38.54 ? 93  GLU A CD  1 
ATOM   700  O OE1 . GLU A 1 93  ? 53.258 -5.894  102.316 1.00 42.20 ? 93  GLU A OE1 1 
ATOM   701  O OE2 . GLU A 1 93  ? 54.148 -4.152  101.354 1.00 44.33 ? 93  GLU A OE2 1 
ATOM   702  N N   . LEU A 1 94  ? 50.254 -9.275  100.031 1.00 25.45 ? 94  LEU A N   1 
ATOM   703  C CA  . LEU A 1 94  ? 49.244 -10.303 100.217 1.00 24.78 ? 94  LEU A CA  1 
ATOM   704  C C   . LEU A 1 94  ? 49.833 -11.536 100.897 1.00 24.85 ? 94  LEU A C   1 
ATOM   705  O O   . LEU A 1 94  ? 49.162 -12.206 101.685 1.00 24.52 ? 94  LEU A O   1 
ATOM   706  C CB  . LEU A 1 94  ? 48.666 -10.764 98.873  1.00 24.37 ? 94  LEU A CB  1 
ATOM   707  C CG  . LEU A 1 94  ? 48.012 -9.739  97.949  1.00 26.80 ? 94  LEU A CG  1 
ATOM   708  C CD1 . LEU A 1 94  ? 47.514 -10.459 96.658  1.00 25.97 ? 94  LEU A CD1 1 
ATOM   709  C CD2 . LEU A 1 94  ? 46.848 -8.999  98.668  1.00 21.24 ? 94  LEU A CD2 1 
ATOM   710  N N   . ILE A 1 95  ? 51.086 -11.858 100.575 1.00 23.90 ? 95  ILE A N   1 
ATOM   711  C CA  . ILE A 1 95  ? 51.696 -13.058 101.126 1.00 24.08 ? 95  ILE A CA  1 
ATOM   712  C C   . ILE A 1 95  ? 51.922 -12.929 102.639 1.00 24.31 ? 95  ILE A C   1 
ATOM   713  O O   . ILE A 1 95  ? 51.736 -13.892 103.386 1.00 22.72 ? 95  ILE A O   1 
ATOM   714  C CB  . ILE A 1 95  ? 53.019 -13.381 100.388 1.00 24.19 ? 95  ILE A CB  1 
ATOM   715  C CG1 . ILE A 1 95  ? 52.753 -13.888 98.957  1.00 25.73 ? 95  ILE A CG1 1 
ATOM   716  C CG2 . ILE A 1 95  ? 53.864 -14.389 101.174 1.00 25.54 ? 95  ILE A CG2 1 
ATOM   717  C CD1 . ILE A 1 95  ? 53.979 -13.698 97.980  1.00 27.72 ? 95  ILE A CD1 1 
ATOM   718  N N   . LYS A 1 96  ? 52.275 -11.726 103.083 1.00 24.18 ? 96  LYS A N   1 
ATOM   719  C CA  . LYS A 1 96  ? 52.456 -11.420 104.503 1.00 25.77 ? 96  LYS A CA  1 
ATOM   720  C C   . LYS A 1 96  ? 51.195 -11.730 105.303 1.00 25.17 ? 96  LYS A C   1 
ATOM   721  O O   . LYS A 1 96  ? 51.266 -12.175 106.460 1.00 24.70 ? 96  LYS A O   1 
ATOM   722  C CB  . LYS A 1 96  ? 52.769 -9.929  104.661 1.00 25.41 ? 96  LYS A CB  1 
ATOM   723  C CG  . LYS A 1 96  ? 54.242 -9.608  104.412 1.00 28.70 ? 96  LYS A CG  1 
ATOM   724  C CD  . LYS A 1 96  ? 54.469 -8.115  104.483 1.00 30.11 ? 96  LYS A CD  1 
ATOM   725  C CE  . LYS A 1 96  ? 55.911 -7.728  104.073 1.00 36.49 ? 96  LYS A CE  1 
ATOM   726  N NZ  . LYS A 1 96  ? 55.935 -6.277  103.731 1.00 35.77 ? 96  LYS A NZ  1 
ATOM   727  N N   . VAL A 1 97  ? 50.043 -11.492 104.682 1.00 24.57 ? 97  VAL A N   1 
ATOM   728  C CA  . VAL A 1 97  ? 48.747 -11.744 105.328 1.00 24.07 ? 97  VAL A CA  1 
ATOM   729  C C   . VAL A 1 97  ? 48.499 -13.238 105.532 1.00 25.46 ? 97  VAL A C   1 
ATOM   730  O O   . VAL A 1 97  ? 47.940 -13.656 106.561 1.00 24.84 ? 97  VAL A O   1 
ATOM   731  C CB  . VAL A 1 97  ? 47.586 -11.138 104.507 1.00 24.42 ? 97  VAL A CB  1 
ATOM   732  C CG1 . VAL A 1 97  ? 46.208 -11.455 105.143 1.00 25.02 ? 97  VAL A CG1 1 
ATOM   733  C CG2 . VAL A 1 97  ? 47.768 -9.607  104.327 1.00 22.37 ? 97  VAL A CG2 1 
ATOM   734  N N   . VAL A 1 98  ? 48.933 -14.062 104.581 1.00 25.18 ? 98  VAL A N   1 
ATOM   735  C CA  . VAL A 1 98  ? 48.657 -15.479 104.683 1.00 26.57 ? 98  VAL A CA  1 
ATOM   736  C C   . VAL A 1 98  ? 49.778 -16.348 105.281 1.00 28.29 ? 98  VAL A C   1 
ATOM   737  O O   . VAL A 1 98  ? 49.596 -17.549 105.473 1.00 28.73 ? 98  VAL A O   1 
ATOM   738  C CB  . VAL A 1 98  ? 48.311 -16.077 103.307 1.00 26.39 ? 98  VAL A CB  1 
ATOM   739  C CG1 . VAL A 1 98  ? 46.999 -15.498 102.804 1.00 25.98 ? 98  VAL A CG1 1 
ATOM   740  C CG2 . VAL A 1 98  ? 49.445 -15.853 102.301 1.00 26.74 ? 98  VAL A CG2 1 
ATOM   741  N N   . SER A 1 99  ? 50.943 -15.780 105.536 1.00 29.11 ? 99  SER A N   1 
ATOM   742  C CA  . SER A 1 99  ? 52.035 -16.605 106.043 1.00 30.92 ? 99  SER A CA  1 
ATOM   743  C C   . SER A 1 99  ? 52.225 -16.480 107.541 1.00 30.74 ? 99  SER A C   1 
ATOM   744  O O   . SER A 1 99  ? 52.331 -15.378 108.054 1.00 31.56 ? 99  SER A O   1 
ATOM   745  C CB  . SER A 1 99  ? 53.341 -16.243 105.339 1.00 31.23 ? 99  SER A CB  1 
ATOM   746  O OG  . SER A 1 99  ? 53.100 -16.114 103.948 1.00 37.05 ? 99  SER A OG  1 
ATOM   747  N N   . PRO A 1 100 ? 52.281 -17.621 108.220 1.00 32.15 ? 100 PRO A N   1 
ATOM   748  C CA  . PRO A 1 100 ? 52.511 -17.698 109.668 1.00 33.12 ? 100 PRO A CA  1 
ATOM   749  C C   . PRO A 1 100 ? 53.789 -16.967 110.118 1.00 33.63 ? 100 PRO A C   1 
ATOM   750  O O   . PRO A 1 100 ? 53.886 -16.536 111.269 1.00 33.53 ? 100 PRO A O   1 
ATOM   751  C CB  . PRO A 1 100 ? 52.634 -19.212 109.904 1.00 33.81 ? 100 PRO A CB  1 
ATOM   752  C CG  . PRO A 1 100 ? 51.774 -19.796 108.823 1.00 34.31 ? 100 PRO A CG  1 
ATOM   753  C CD  . PRO A 1 100 ? 52.101 -18.954 107.621 1.00 32.17 ? 100 PRO A CD  1 
ATOM   754  N N   . LYS A 1 101 ? 54.736 -16.790 109.204 1.00 33.73 ? 101 LYS A N   1 
ATOM   755  C CA  . LYS A 1 101 ? 55.965 -16.083 109.511 1.00 34.64 ? 101 LYS A CA  1 
ATOM   756  C C   . LYS A 1 101 ? 55.704 -14.584 109.641 1.00 33.94 ? 101 LYS A C   1 
ATOM   757  O O   . LYS A 1 101 ? 56.445 -13.869 110.312 1.00 33.98 ? 101 LYS A O   1 
ATOM   758  C CB  . LYS A 1 101 ? 57.034 -16.376 108.436 1.00 35.36 ? 101 LYS A CB  1 
ATOM   759  C CG  . LYS A 1 101 ? 58.279 -15.476 108.493 1.00 39.32 ? 101 LYS A CG  1 
ATOM   760  C CD  . LYS A 1 101 ? 59.443 -16.042 107.653 1.00 43.53 ? 101 LYS A CD  1 
ATOM   761  C CE  . LYS A 1 101 ? 60.485 -14.947 107.343 1.00 48.03 ? 101 LYS A CE  1 
ATOM   762  N NZ  . LYS A 1 101 ? 61.485 -15.328 106.274 1.00 49.03 ? 101 LYS A NZ  1 
ATOM   763  N N   . TYR A 1 102 ? 54.643 -14.099 109.008 1.00 32.32 ? 102 TYR A N   1 
ATOM   764  C CA  . TYR A 1 102 ? 54.356 -12.668 109.049 1.00 31.79 ? 102 TYR A CA  1 
ATOM   765  C C   . TYR A 1 102 ? 53.064 -12.399 109.815 1.00 31.89 ? 102 TYR A C   1 
ATOM   766  O O   . TYR A 1 102 ? 53.085 -12.406 111.033 1.00 32.02 ? 102 TYR A O   1 
ATOM   767  C CB  . TYR A 1 102 ? 54.346 -12.074 107.632 1.00 31.82 ? 102 TYR A CB  1 
ATOM   768  C CG  . TYR A 1 102 ? 55.722 -12.101 106.994 1.00 32.78 ? 102 TYR A CG  1 
ATOM   769  C CD1 . TYR A 1 102 ? 56.142 -13.187 106.252 1.00 31.64 ? 102 TYR A CD1 1 
ATOM   770  C CD2 . TYR A 1 102 ? 56.614 -11.048 107.174 1.00 32.44 ? 102 TYR A CD2 1 
ATOM   771  C CE1 . TYR A 1 102 ? 57.409 -13.220 105.682 1.00 32.69 ? 102 TYR A CE1 1 
ATOM   772  C CE2 . TYR A 1 102 ? 57.890 -11.076 106.602 1.00 34.28 ? 102 TYR A CE2 1 
ATOM   773  C CZ  . TYR A 1 102 ? 58.267 -12.169 105.858 1.00 34.20 ? 102 TYR A CZ  1 
ATOM   774  O OH  . TYR A 1 102 ? 59.506 -12.210 105.281 1.00 35.68 ? 102 TYR A OH  1 
ATOM   775  N N   . LEU A 1 103 ? 51.933 -12.227 109.129 1.00 31.07 ? 103 LEU A N   1 
ATOM   776  C CA  . LEU A 1 103 ? 50.680 -11.886 109.817 1.00 30.85 ? 103 LEU A CA  1 
ATOM   777  C C   . LEU A 1 103 ? 49.686 -13.010 109.902 1.00 30.35 ? 103 LEU A C   1 
ATOM   778  O O   . LEU A 1 103 ? 48.628 -12.868 110.518 1.00 30.26 ? 103 LEU A O   1 
ATOM   779  C CB  . LEU A 1 103 ? 49.987 -10.727 109.083 1.00 31.09 ? 103 LEU A CB  1 
ATOM   780  C CG  . LEU A 1 103 ? 50.821 -9.480  108.816 1.00 31.40 ? 103 LEU A CG  1 
ATOM   781  C CD1 . LEU A 1 103 ? 50.036 -8.544  107.886 1.00 31.44 ? 103 LEU A CD1 1 
ATOM   782  C CD2 . LEU A 1 103 ? 51.169 -8.783  110.134 1.00 34.52 ? 103 LEU A CD2 1 
ATOM   783  N N   . GLY A 1 104 ? 50.008 -14.122 109.267 1.00 30.97 ? 104 GLY A N   1 
ATOM   784  C CA  . GLY A 1 104 ? 49.090 -15.242 109.150 1.00 31.77 ? 104 GLY A CA  1 
ATOM   785  C C   . GLY A 1 104 ? 48.471 -15.798 110.421 1.00 32.81 ? 104 GLY A C   1 
ATOM   786  O O   . GLY A 1 104 ? 47.286 -16.152 110.443 1.00 32.34 ? 104 GLY A O   1 
ATOM   787  N N   . SER A 1 105 ? 49.260 -15.897 111.482 1.00 33.23 ? 105 SER A N   1 
ATOM   788  C CA  . SER A 1 105 ? 48.749 -16.471 112.718 1.00 34.36 ? 105 SER A CA  1 
ATOM   789  C C   . SER A 1 105 ? 47.729 -15.555 113.393 1.00 34.76 ? 105 SER A C   1 
ATOM   790  O O   . SER A 1 105 ? 47.007 -16.002 114.265 1.00 34.69 ? 105 SER A O   1 
ATOM   791  C CB  . SER A 1 105 ? 49.899 -16.832 113.684 1.00 35.21 ? 105 SER A CB  1 
ATOM   792  O OG  . SER A 1 105 ? 50.420 -15.667 114.297 1.00 37.46 ? 105 SER A OG  1 
ATOM   793  N N   . ARG A 1 106 ? 47.655 -14.287 112.991 1.00 34.21 ? 106 ARG A N   1 
ATOM   794  C CA  . ARG A 1 106 ? 46.671 -13.382 113.577 1.00 35.05 ? 106 ARG A CA  1 
ATOM   795  C C   . ARG A 1 106 ? 45.536 -13.006 112.617 1.00 34.70 ? 106 ARG A C   1 
ATOM   796  O O   . ARG A 1 106 ? 44.667 -12.190 112.961 1.00 35.53 ? 106 ARG A O   1 
ATOM   797  C CB  . ARG A 1 106 ? 47.331 -12.096 114.079 1.00 36.06 ? 106 ARG A CB  1 
ATOM   798  C CG  . ARG A 1 106 ? 48.841 -12.192 114.273 1.00 40.66 ? 106 ARG A CG  1 
ATOM   799  C CD  . ARG A 1 106 ? 49.425 -11.187 115.280 1.00 44.01 ? 106 ARG A CD  1 
ATOM   800  N NE  . ARG A 1 106 ? 49.743 -9.888  114.691 1.00 48.86 ? 106 ARG A NE  1 
ATOM   801  C CZ  . ARG A 1 106 ? 50.920 -9.597  114.146 1.00 51.11 ? 106 ARG A CZ  1 
ATOM   802  N NH1 . ARG A 1 106 ? 51.866 -10.525 114.106 1.00 51.46 ? 106 ARG A NH1 1 
ATOM   803  N NH2 . ARG A 1 106 ? 51.158 -8.387  113.643 1.00 51.12 ? 106 ARG A NH2 1 
ATOM   804  N N   . THR A 1 107 ? 45.527 -13.592 111.425 1.00 32.89 ? 107 THR A N   1 
ATOM   805  C CA  . THR A 1 107 ? 44.537 -13.216 110.419 1.00 31.94 ? 107 THR A CA  1 
ATOM   806  C C   . THR A 1 107 ? 43.472 -14.275 110.342 1.00 30.76 ? 107 THR A C   1 
ATOM   807  O O   . THR A 1 107 ? 43.778 -15.452 110.400 1.00 29.38 ? 107 THR A O   1 
ATOM   808  C CB  . THR A 1 107 ? 45.222 -13.059 109.034 1.00 31.55 ? 107 THR A CB  1 
ATOM   809  O OG1 . THR A 1 107 ? 46.271 -12.093 109.140 1.00 34.64 ? 107 THR A OG1 1 
ATOM   810  C CG2 . THR A 1 107 ? 44.271 -12.423 108.010 1.00 30.24 ? 107 THR A CG2 1 
ATOM   811  N N   . SER A 1 108 ? 42.215 -13.861 110.205 1.00 30.33 ? 108 SER A N   1 
ATOM   812  C CA  . SER A 1 108 ? 41.138 -14.833 110.080 1.00 29.68 ? 108 SER A CA  1 
ATOM   813  C C   . SER A 1 108 ? 41.282 -15.706 108.838 1.00 29.91 ? 108 SER A C   1 
ATOM   814  O O   . SER A 1 108 ? 41.796 -15.290 107.790 1.00 28.55 ? 108 SER A O   1 
ATOM   815  C CB  . SER A 1 108 ? 39.754 -14.152 110.058 1.00 30.31 ? 108 SER A CB  1 
ATOM   816  O OG  . SER A 1 108 ? 39.532 -13.434 108.850 1.00 28.40 ? 108 SER A OG  1 
ATOM   817  N N   . GLU A 1 109 ? 40.781 -16.922 108.963 1.00 29.45 ? 109 GLU A N   1 
ATOM   818  C CA  . GLU A 1 109 ? 40.735 -17.822 107.835 1.00 30.26 ? 109 GLU A CA  1 
ATOM   819  C C   . GLU A 1 109 ? 39.897 -17.222 106.689 1.00 28.59 ? 109 GLU A C   1 
ATOM   820  O O   . GLU A 1 109 ? 40.172 -17.440 105.512 1.00 27.35 ? 109 GLU A O   1 
ATOM   821  C CB  . GLU A 1 109 ? 40.177 -19.160 108.286 1.00 31.60 ? 109 GLU A CB  1 
ATOM   822  C CG  . GLU A 1 109 ? 40.898 -20.353 107.680 1.00 40.01 ? 109 GLU A CG  1 
ATOM   823  C CD  . GLU A 1 109 ? 42.337 -20.485 108.159 1.00 44.68 ? 109 GLU A CD  1 
ATOM   824  O OE1 . GLU A 1 109 ? 43.086 -21.216 107.494 1.00 48.76 ? 109 GLU A OE1 1 
ATOM   825  O OE2 . GLU A 1 109 ? 42.718 -19.876 109.192 1.00 47.27 ? 109 GLU A OE2 1 
ATOM   826  N N   . LYS A 1 110 ? 38.895 -16.427 107.023 1.00 27.56 ? 110 LYS A N   1 
ATOM   827  C CA  . LYS A 1 110 ? 38.063 -15.828 105.976 1.00 26.07 ? 110 LYS A CA  1 
ATOM   828  C C   . LYS A 1 110 ? 38.947 -14.974 105.048 1.00 25.64 ? 110 LYS A C   1 
ATOM   829  O O   . LYS A 1 110 ? 38.934 -15.136 103.828 1.00 24.94 ? 110 LYS A O   1 
ATOM   830  C CB  . LYS A 1 110 ? 36.956 -14.950 106.593 1.00 25.78 ? 110 LYS A CB  1 
ATOM   831  C CG  . LYS A 1 110 ? 35.919 -14.469 105.586 1.00 27.96 ? 110 LYS A CG  1 
ATOM   832  C CD  . LYS A 1 110 ? 35.023 -13.349 106.134 1.00 32.92 ? 110 LYS A CD  1 
ATOM   833  C CE  . LYS A 1 110 ? 34.095 -13.839 107.241 1.00 33.56 ? 110 LYS A CE  1 
ATOM   834  N NZ  . LYS A 1 110 ? 33.615 -12.657 108.018 1.00 40.01 ? 110 LYS A NZ  1 
ATOM   835  N N   . VAL A 1 111 ? 39.716 -14.083 105.651 1.00 24.79 ? 111 VAL A N   1 
ATOM   836  C CA  . VAL A 1 111 ? 40.595 -13.185 104.925 1.00 24.27 ? 111 VAL A CA  1 
ATOM   837  C C   . VAL A 1 111 ? 41.669 -13.955 104.191 1.00 24.10 ? 111 VAL A C   1 
ATOM   838  O O   . VAL A 1 111 ? 41.922 -13.711 103.009 1.00 23.69 ? 111 VAL A O   1 
ATOM   839  C CB  . VAL A 1 111 ? 41.236 -12.193 105.895 1.00 24.16 ? 111 VAL A CB  1 
ATOM   840  C CG1 . VAL A 1 111 ? 42.438 -11.444 105.237 1.00 23.28 ? 111 VAL A CG1 1 
ATOM   841  C CG2 . VAL A 1 111 ? 40.158 -11.207 106.378 1.00 26.27 ? 111 VAL A CG2 1 
ATOM   842  N N   . LYS A 1 112 ? 42.312 -14.884 104.881 1.00 24.08 ? 112 LYS A N   1 
ATOM   843  C CA  . LYS A 1 112 ? 43.363 -15.658 104.254 1.00 24.38 ? 112 LYS A CA  1 
ATOM   844  C C   . LYS A 1 112 ? 42.857 -16.449 103.055 1.00 24.71 ? 112 LYS A C   1 
ATOM   845  O O   . LYS A 1 112 ? 43.461 -16.366 101.989 1.00 24.58 ? 112 LYS A O   1 
ATOM   846  C CB  . LYS A 1 112 ? 44.085 -16.558 105.284 1.00 24.49 ? 112 LYS A CB  1 
ATOM   847  C CG  . LYS A 1 112 ? 44.854 -15.710 106.332 1.00 26.61 ? 112 LYS A CG  1 
ATOM   848  C CD  . LYS A 1 112 ? 45.775 -16.551 107.268 1.00 31.02 ? 112 LYS A CD  1 
ATOM   849  C CE  . LYS A 1 112 ? 44.987 -17.548 108.072 1.00 31.91 ? 112 LYS A CE  1 
ATOM   850  N NZ  . LYS A 1 112 ? 45.831 -18.127 109.146 1.00 35.83 ? 112 LYS A NZ  1 
ATOM   851  N N   . ASN A 1 113 ? 41.770 -17.200 103.216 1.00 24.54 ? 113 ASN A N   1 
ATOM   852  C CA  . ASN A 1 113 ? 41.256 -18.008 102.108 1.00 25.42 ? 113 ASN A CA  1 
ATOM   853  C C   . ASN A 1 113 ? 40.780 -17.178 100.928 1.00 24.52 ? 113 ASN A C   1 
ATOM   854  O O   . ASN A 1 113 ? 40.888 -17.594 99.786  1.00 24.06 ? 113 ASN A O   1 
ATOM   855  C CB  . ASN A 1 113 ? 40.218 -19.035 102.592 1.00 25.85 ? 113 ASN A CB  1 
ATOM   856  C CG  . ASN A 1 113 ? 40.897 -20.244 103.238 1.00 30.95 ? 113 ASN A CG  1 
ATOM   857  O OD1 . ASN A 1 113 ? 40.366 -20.843 104.169 1.00 35.31 ? 113 ASN A OD1 1 
ATOM   858  N ND2 . ASN A 1 113 ? 42.082 -20.594 102.741 1.00 35.79 ? 113 ASN A ND2 1 
ATOM   859  N N   . LYS A 1 114 ? 40.298 -15.972 101.208 1.00 23.88 ? 114 LYS A N   1 
ATOM   860  C CA  . LYS A 1 114 ? 39.857 -15.082 100.137 1.00 23.29 ? 114 LYS A CA  1 
ATOM   861  C C   . LYS A 1 114 ? 41.048 -14.695 99.294  1.00 22.32 ? 114 LYS A C   1 
ATOM   862  O O   . LYS A 1 114 ? 40.972 -14.674 98.081  1.00 20.92 ? 114 LYS A O   1 
ATOM   863  C CB  . LYS A 1 114 ? 39.183 -13.824 100.670 1.00 23.03 ? 114 LYS A CB  1 
ATOM   864  C CG  . LYS A 1 114 ? 38.587 -12.974 99.529  1.00 25.99 ? 114 LYS A CG  1 
ATOM   865  C CD  . LYS A 1 114 ? 37.785 -11.797 100.055 1.00 30.71 ? 114 LYS A CD  1 
ATOM   866  C CE  . LYS A 1 114 ? 37.125 -11.000 98.914  1.00 34.47 ? 114 LYS A CE  1 
ATOM   867  N NZ  . LYS A 1 114 ? 36.013 -11.762 98.282  1.00 36.32 ? 114 LYS A NZ  1 
ATOM   868  N N   . ILE A 1 115 ? 42.155 -14.372 99.953  1.00 22.85 ? 115 ILE A N   1 
ATOM   869  C CA  . ILE A 1 115 ? 43.392 -14.071 99.238  1.00 23.23 ? 115 ILE A CA  1 
ATOM   870  C C   . ILE A 1 115 ? 43.876 -15.259 98.404  1.00 23.22 ? 115 ILE A C   1 
ATOM   871  O O   . ILE A 1 115 ? 44.235 -15.070 97.260  1.00 24.22 ? 115 ILE A O   1 
ATOM   872  C CB  . ILE A 1 115 ? 44.517 -13.599 100.203 1.00 22.89 ? 115 ILE A CB  1 
ATOM   873  C CG1 . ILE A 1 115 ? 44.175 -12.216 100.763 1.00 22.15 ? 115 ILE A CG1 1 
ATOM   874  C CG2 . ILE A 1 115 ? 45.870 -13.552 99.485  1.00 22.45 ? 115 ILE A CG2 1 
ATOM   875  C CD1 . ILE A 1 115 ? 45.147 -11.748 101.882 1.00 20.06 ? 115 ILE A CD1 1 
ATOM   876  N N   . LEU A 1 116 ? 43.888 -16.467 98.963  1.00 23.43 ? 116 LEU A N   1 
ATOM   877  C CA  . LEU A 1 116 ? 44.399 -17.632 98.237  1.00 24.31 ? 116 LEU A CA  1 
ATOM   878  C C   . LEU A 1 116 ? 43.551 -17.961 96.988  1.00 25.13 ? 116 LEU A C   1 
ATOM   879  O O   . LEU A 1 116 ? 44.076 -18.325 95.927  1.00 24.05 ? 116 LEU A O   1 
ATOM   880  C CB  . LEU A 1 116 ? 44.495 -18.855 99.163  1.00 24.67 ? 116 LEU A CB  1 
ATOM   881  C CG  . LEU A 1 116 ? 45.453 -18.680 100.362 1.00 25.26 ? 116 LEU A CG  1 
ATOM   882  C CD1 . LEU A 1 116 ? 45.445 -19.890 101.303 1.00 26.25 ? 116 LEU A CD1 1 
ATOM   883  C CD2 . LEU A 1 116 ? 46.858 -18.457 99.861  1.00 24.01 ? 116 LEU A CD2 1 
ATOM   884  N N   . GLU A 1 117 ? 42.239 -17.828 97.128  1.00 25.72 ? 117 GLU A N   1 
ATOM   885  C CA  . GLU A 1 117 ? 41.318 -18.065 96.009  1.00 27.57 ? 117 GLU A CA  1 
ATOM   886  C C   . GLU A 1 117 ? 41.439 -16.971 94.963  1.00 26.59 ? 117 GLU A C   1 
ATOM   887  O O   . GLU A 1 117 ? 41.327 -17.230 93.773  1.00 26.51 ? 117 GLU A O   1 
ATOM   888  C CB  . GLU A 1 117 ? 39.883 -18.168 96.530  1.00 28.76 ? 117 GLU A CB  1 
ATOM   889  C CG  . GLU A 1 117 ? 39.683 -19.471 97.280  1.00 34.73 ? 117 GLU A CG  1 
ATOM   890  C CD  . GLU A 1 117 ? 39.976 -20.677 96.398  1.00 43.33 ? 117 GLU A CD  1 
ATOM   891  O OE1 . GLU A 1 117 ? 39.408 -20.767 95.285  1.00 48.04 ? 117 GLU A OE1 1 
ATOM   892  O OE2 . GLU A 1 117 ? 40.796 -21.532 96.794  1.00 47.73 ? 117 GLU A OE2 1 
ATOM   893  N N   . LEU A 1 118 ? 41.683 -15.742 95.399  1.00 26.82 ? 118 LEU A N   1 
ATOM   894  C CA  . LEU A 1 118 ? 41.879 -14.650 94.439  1.00 26.91 ? 118 LEU A CA  1 
ATOM   895  C C   . LEU A 1 118 ? 43.135 -14.921 93.621  1.00 25.98 ? 118 LEU A C   1 
ATOM   896  O O   . LEU A 1 118 ? 43.139 -14.855 92.378  1.00 25.57 ? 118 LEU A O   1 
ATOM   897  C CB  . LEU A 1 118 ? 41.976 -13.287 95.131  1.00 26.85 ? 118 LEU A CB  1 
ATOM   898  C CG  . LEU A 1 118 ? 40.657 -12.599 95.490  1.00 28.76 ? 118 LEU A CG  1 
ATOM   899  C CD1 . LEU A 1 118 ? 40.907 -11.260 96.201  1.00 27.78 ? 118 LEU A CD1 1 
ATOM   900  C CD2 . LEU A 1 118 ? 39.869 -12.397 94.203  1.00 27.77 ? 118 LEU A CD2 1 
ATOM   901  N N   . LEU A 1 119 ? 44.213 -15.242 94.321  1.00 25.13 ? 119 LEU A N   1 
ATOM   902  C CA  . LEU A 1 119 ? 45.467 -15.565 93.641  1.00 24.82 ? 119 LEU A CA  1 
ATOM   903  C C   . LEU A 1 119 ? 45.279 -16.701 92.639  1.00 25.16 ? 119 LEU A C   1 
ATOM   904  O O   . LEU A 1 119 ? 45.756 -16.623 91.513  1.00 25.12 ? 119 LEU A O   1 
ATOM   905  C CB  . LEU A 1 119 ? 46.559 -15.953 94.663  1.00 23.97 ? 119 LEU A CB  1 
ATOM   906  C CG  . LEU A 1 119 ? 47.094 -14.823 95.530  1.00 22.64 ? 119 LEU A CG  1 
ATOM   907  C CD1 . LEU A 1 119 ? 48.028 -15.384 96.637  1.00 22.26 ? 119 LEU A CD1 1 
ATOM   908  C CD2 . LEU A 1 119 ? 47.826 -13.778 94.669  1.00 22.05 ? 119 LEU A CD2 1 
ATOM   909  N N   . TYR A 1 120 ? 44.616 -17.768 93.045  1.00 26.22 ? 120 TYR A N   1 
ATOM   910  C CA  . TYR A 1 120 ? 44.402 -18.858 92.112  1.00 27.52 ? 120 TYR A CA  1 
ATOM   911  C C   . TYR A 1 120 ? 43.625 -18.377 90.867  1.00 27.81 ? 120 TYR A C   1 
ATOM   912  O O   . TYR A 1 120 ? 43.995 -18.697 89.745  1.00 26.98 ? 120 TYR A O   1 
ATOM   913  C CB  . TYR A 1 120 ? 43.631 -20.010 92.764  1.00 28.55 ? 120 TYR A CB  1 
ATOM   914  C CG  . TYR A 1 120 ? 43.288 -21.110 91.767  1.00 30.65 ? 120 TYR A CG  1 
ATOM   915  C CD1 . TYR A 1 120 ? 44.265 -22.010 91.358  1.00 32.24 ? 120 TYR A CD1 1 
ATOM   916  C CD2 . TYR A 1 120 ? 42.012 -21.221 91.213  1.00 34.08 ? 120 TYR A CD2 1 
ATOM   917  C CE1 . TYR A 1 120 ? 43.998 -22.989 90.433  1.00 36.27 ? 120 TYR A CE1 1 
ATOM   918  C CE2 . TYR A 1 120 ? 41.727 -22.215 90.267  1.00 35.62 ? 120 TYR A CE2 1 
ATOM   919  C CZ  . TYR A 1 120 ? 42.729 -23.093 89.894  1.00 37.75 ? 120 TYR A CZ  1 
ATOM   920  O OH  . TYR A 1 120 ? 42.493 -24.098 88.990  1.00 41.11 ? 120 TYR A OH  1 
ATOM   921  N N   . SER A 1 121 ? 42.549 -17.617 91.080  1.00 27.66 ? 121 SER A N   1 
ATOM   922  C CA  . SER A 1 121 ? 41.707 -17.144 89.980  1.00 28.55 ? 121 SER A CA  1 
ATOM   923  C C   . SER A 1 121 ? 42.510 -16.312 88.962  1.00 28.68 ? 121 SER A C   1 
ATOM   924  O O   . SER A 1 121 ? 42.298 -16.413 87.742  1.00 27.10 ? 121 SER A O   1 
ATOM   925  C CB  . SER A 1 121 ? 40.524 -16.327 90.509  1.00 28.63 ? 121 SER A CB  1 
ATOM   926  O OG  . SER A 1 121 ? 40.913 -14.991 90.791  1.00 28.90 ? 121 SER A OG  1 
ATOM   927  N N   . TRP A 1 122 ? 43.436 -15.514 89.473  1.00 27.84 ? 122 TRP A N   1 
ATOM   928  C CA  . TRP A 1 122 ? 44.319 -14.751 88.610  1.00 28.46 ? 122 TRP A CA  1 
ATOM   929  C C   . TRP A 1 122 ? 45.327 -15.647 87.858  1.00 28.93 ? 122 TRP A C   1 
ATOM   930  O O   . TRP A 1 122 ? 45.710 -15.311 86.745  1.00 28.45 ? 122 TRP A O   1 
ATOM   931  C CB  . TRP A 1 122 ? 45.058 -13.636 89.354  1.00 27.13 ? 122 TRP A CB  1 
ATOM   932  C CG  . TRP A 1 122 ? 44.171 -12.677 90.070  1.00 29.02 ? 122 TRP A CG  1 
ATOM   933  C CD1 . TRP A 1 122 ? 42.899 -12.322 89.736  1.00 31.00 ? 122 TRP A CD1 1 
ATOM   934  C CD2 . TRP A 1 122 ? 44.490 -11.955 91.265  1.00 28.05 ? 122 TRP A CD2 1 
ATOM   935  N NE1 . TRP A 1 122 ? 42.407 -11.419 90.653  1.00 32.09 ? 122 TRP A NE1 1 
ATOM   936  C CE2 . TRP A 1 122 ? 43.368 -11.177 91.600  1.00 31.31 ? 122 TRP A CE2 1 
ATOM   937  C CE3 . TRP A 1 122 ? 45.620 -11.882 92.085  1.00 28.98 ? 122 TRP A CE3 1 
ATOM   938  C CZ2 . TRP A 1 122 ? 43.335 -10.358 92.730  1.00 30.06 ? 122 TRP A CZ2 1 
ATOM   939  C CZ3 . TRP A 1 122 ? 45.588 -11.058 93.194  1.00 31.36 ? 122 TRP A CZ3 1 
ATOM   940  C CH2 . TRP A 1 122 ? 44.457 -10.309 93.507  1.00 28.46 ? 122 TRP A CH2 1 
ATOM   941  N N   . THR A 1 123 ? 45.759 -16.765 88.440  1.00 29.34 ? 123 THR A N   1 
ATOM   942  C CA  . THR A 1 123 ? 46.660 -17.636 87.670  1.00 30.40 ? 123 THR A CA  1 
ATOM   943  C C   . THR A 1 123 ? 45.932 -18.208 86.454  1.00 31.42 ? 123 THR A C   1 
ATOM   944  O O   . THR A 1 123 ? 46.559 -18.448 85.420  1.00 31.79 ? 123 THR A O   1 
ATOM   945  C CB  . THR A 1 123 ? 47.235 -18.814 88.485  1.00 30.00 ? 123 THR A CB  1 
ATOM   946  O OG1 . THR A 1 123 ? 46.156 -19.633 88.951  1.00 28.74 ? 123 THR A OG1 1 
ATOM   947  C CG2 . THR A 1 123 ? 47.971 -18.331 89.757  1.00 31.07 ? 123 THR A CG2 1 
ATOM   948  N N   . VAL A 1 124 ? 44.633 -18.462 86.605  1.00 31.10 ? 124 VAL A N   1 
ATOM   949  C CA  . VAL A 1 124 ? 43.796 -18.956 85.502  1.00 32.64 ? 124 VAL A CA  1 
ATOM   950  C C   . VAL A 1 124 ? 43.364 -17.853 84.530  1.00 33.00 ? 124 VAL A C   1 
ATOM   951  O O   . VAL A 1 124 ? 43.469 -18.003 83.316  1.00 33.87 ? 124 VAL A O   1 
ATOM   952  C CB  . VAL A 1 124 ? 42.473 -19.569 86.016  1.00 32.65 ? 124 VAL A CB  1 
ATOM   953  C CG1 . VAL A 1 124 ? 41.611 -20.052 84.825  1.00 34.27 ? 124 VAL A CG1 1 
ATOM   954  C CG2 . VAL A 1 124 ? 42.737 -20.714 86.985  1.00 32.44 ? 124 VAL A CG2 1 
ATOM   955  N N   . GLY A 1 125 ? 42.864 -16.741 85.058  1.00 33.07 ? 125 GLY A N   1 
ATOM   956  C CA  . GLY A 1 125 ? 42.352 -15.682 84.199  1.00 32.98 ? 125 GLY A CA  1 
ATOM   957  C C   . GLY A 1 125 ? 43.394 -14.779 83.572  1.00 32.96 ? 125 GLY A C   1 
ATOM   958  O O   . GLY A 1 125 ? 43.144 -14.183 82.496  1.00 32.26 ? 125 GLY A O   1 
ATOM   959  N N   . LEU A 1 126 ? 44.569 -14.686 84.207  1.00 31.24 ? 126 LEU A N   1 
ATOM   960  C CA  . LEU A 1 126 ? 45.609 -13.768 83.735  1.00 31.22 ? 126 LEU A CA  1 
ATOM   961  C C   . LEU A 1 126 ? 46.982 -14.419 83.636  1.00 32.24 ? 126 LEU A C   1 
ATOM   962  O O   . LEU A 1 126 ? 47.944 -13.979 84.313  1.00 31.64 ? 126 LEU A O   1 
ATOM   963  C CB  . LEU A 1 126 ? 45.684 -12.518 84.630  1.00 31.17 ? 126 LEU A CB  1 
ATOM   964  C CG  . LEU A 1 126 ? 44.399 -11.727 84.838  1.00 30.94 ? 126 LEU A CG  1 
ATOM   965  C CD1 . LEU A 1 126 ? 44.448 -10.903 86.116  1.00 32.82 ? 126 LEU A CD1 1 
ATOM   966  C CD2 . LEU A 1 126 ? 44.095 -10.825 83.625  1.00 29.49 ? 126 LEU A CD2 1 
ATOM   967  N N   . PRO A 1 127 ? 47.081 -15.437 82.774  1.00 32.49 ? 127 PRO A N   1 
ATOM   968  C CA  . PRO A 1 127 ? 48.305 -16.237 82.636  1.00 33.32 ? 127 PRO A CA  1 
ATOM   969  C C   . PRO A 1 127 ? 49.527 -15.403 82.310  1.00 33.46 ? 127 PRO A C   1 
ATOM   970  O O   . PRO A 1 127 ? 50.624 -15.834 82.649  1.00 34.00 ? 127 PRO A O   1 
ATOM   971  C CB  . PRO A 1 127 ? 48.008 -17.185 81.451  1.00 33.87 ? 127 PRO A CB  1 
ATOM   972  C CG  . PRO A 1 127 ? 46.634 -16.922 80.999  1.00 33.37 ? 127 PRO A CG  1 
ATOM   973  C CD  . PRO A 1 127 ? 46.016 -15.872 81.856  1.00 32.67 ? 127 PRO A CD  1 
ATOM   974  N N   . GLU A 1 128 ? 49.372 -14.244 81.676  1.00 33.05 ? 128 GLU A N   1 
ATOM   975  C CA  . GLU A 1 128 ? 50.541 -13.406 81.375  1.00 34.14 ? 128 GLU A CA  1 
ATOM   976  C C   . GLU A 1 128 ? 51.244 -12.838 82.614  1.00 33.51 ? 128 GLU A C   1 
ATOM   977  O O   . GLU A 1 128 ? 52.420 -12.448 82.551  1.00 33.76 ? 128 GLU A O   1 
ATOM   978  C CB  . GLU A 1 128 ? 50.133 -12.234 80.490  1.00 35.06 ? 128 GLU A CB  1 
ATOM   979  C CG  . GLU A 1 128 ? 48.824 -12.467 79.749  1.00 40.16 ? 128 GLU A CG  1 
ATOM   980  C CD  . GLU A 1 128 ? 47.600 -12.258 80.633  1.00 42.65 ? 128 GLU A CD  1 
ATOM   981  O OE1 . GLU A 1 128 ? 46.830 -13.224 80.780  1.00 42.46 ? 128 GLU A OE1 1 
ATOM   982  O OE2 . GLU A 1 128 ? 47.394 -11.122 81.162  1.00 45.41 ? 128 GLU A OE2 1 
ATOM   983  N N   . GLU A 1 129 ? 50.514 -12.740 83.726  1.00 32.49 ? 129 GLU A N   1 
ATOM   984  C CA  . GLU A 1 129 ? 51.098 -12.237 84.961  1.00 31.16 ? 129 GLU A CA  1 
ATOM   985  C C   . GLU A 1 129 ? 51.805 -13.404 85.628  1.00 31.15 ? 129 GLU A C   1 
ATOM   986  O O   . GLU A 1 129 ? 51.326 -14.003 86.590  1.00 30.68 ? 129 GLU A O   1 
ATOM   987  C CB  . GLU A 1 129 ? 50.032 -11.616 85.872  1.00 31.65 ? 129 GLU A CB  1 
ATOM   988  C CG  . GLU A 1 129 ? 49.205 -10.512 85.223  1.00 30.26 ? 129 GLU A CG  1 
ATOM   989  C CD  . GLU A 1 129 ? 49.999 -9.254  84.915  1.00 31.38 ? 129 GLU A CD  1 
ATOM   990  O OE1 . GLU A 1 129 ? 49.487 -8.370  84.177  1.00 30.48 ? 129 GLU A OE1 1 
ATOM   991  O OE2 . GLU A 1 129 ? 51.142 -9.148  85.396  1.00 29.57 ? 129 GLU A OE2 1 
ATOM   992  N N   . VAL A 1 130 ? 52.956 -13.739 85.063  1.00 30.38 ? 130 VAL A N   1 
ATOM   993  C CA  . VAL A 1 130 ? 53.757 -14.862 85.498  1.00 30.50 ? 130 VAL A CA  1 
ATOM   994  C C   . VAL A 1 130 ? 54.228 -14.789 86.965  1.00 29.89 ? 130 VAL A C   1 
ATOM   995  O O   . VAL A 1 130 ? 54.458 -15.816 87.593  1.00 29.93 ? 130 VAL A O   1 
ATOM   996  C CB  . VAL A 1 130 ? 54.981 -14.995 84.564  1.00 31.29 ? 130 VAL A CB  1 
ATOM   997  C CG1 . VAL A 1 130 ? 54.504 -15.173 83.093  1.00 31.87 ? 130 VAL A CG1 1 
ATOM   998  C CG2 . VAL A 1 130 ? 55.857 -13.774 84.664  1.00 32.01 ? 130 VAL A CG2 1 
ATOM   999  N N   . LYS A 1 131 ? 54.382 -13.592 87.522  1.00 28.91 ? 131 LYS A N   1 
ATOM   1000 C CA  . LYS A 1 131 ? 54.829 -13.537 88.920  1.00 28.43 ? 131 LYS A CA  1 
ATOM   1001 C C   . LYS A 1 131 ? 53.689 -13.947 89.881  1.00 28.08 ? 131 LYS A C   1 
ATOM   1002 O O   . LYS A 1 131 ? 53.946 -14.408 91.011  1.00 26.56 ? 131 LYS A O   1 
ATOM   1003 C CB  . LYS A 1 131 ? 55.384 -12.157 89.276  1.00 27.92 ? 131 LYS A CB  1 
ATOM   1004 C CG  . LYS A 1 131 ? 56.665 -11.779 88.549  1.00 28.91 ? 131 LYS A CG  1 
ATOM   1005 C CD  . LYS A 1 131 ? 56.965 -10.282 88.741  1.00 29.05 ? 131 LYS A CD  1 
ATOM   1006 C CE  . LYS A 1 131 ? 58.346 -9.915  88.152  1.00 29.83 ? 131 LYS A CE  1 
ATOM   1007 N NZ  . LYS A 1 131 ? 58.650 -8.469  88.388  1.00 26.66 ? 131 LYS A NZ  1 
ATOM   1008 N N   . ILE A 1 132 ? 52.438 -13.819 89.413  1.00 27.40 ? 132 ILE A N   1 
ATOM   1009 C CA  . ILE A 1 132 ? 51.300 -14.199 90.230  1.00 27.53 ? 132 ILE A CA  1 
ATOM   1010 C C   . ILE A 1 132 ? 51.352 -15.697 90.371  1.00 27.84 ? 132 ILE A C   1 
ATOM   1011 O O   . ILE A 1 132 ? 51.177 -16.235 91.474  1.00 28.29 ? 132 ILE A O   1 
ATOM   1012 C CB  . ILE A 1 132 ? 49.954 -13.740 89.615  1.00 27.91 ? 132 ILE A CB  1 
ATOM   1013 C CG1 . ILE A 1 132 ? 49.874 -12.219 89.535  1.00 27.88 ? 132 ILE A CG1 1 
ATOM   1014 C CG2 . ILE A 1 132 ? 48.776 -14.237 90.466  1.00 27.49 ? 132 ILE A CG2 1 
ATOM   1015 C CD1 . ILE A 1 132 ? 48.457 -11.720 89.130  1.00 27.46 ? 132 ILE A CD1 1 
ATOM   1016 N N   . ALA A 1 133 ? 51.636 -16.377 89.262  1.00 27.79 ? 133 ALA A N   1 
ATOM   1017 C CA  . ALA A 1 133 ? 51.729 -17.829 89.275  1.00 28.40 ? 133 ALA A CA  1 
ATOM   1018 C C   . ALA A 1 133 ? 52.944 -18.280 90.099  1.00 27.67 ? 133 ALA A C   1 
ATOM   1019 O O   . ALA A 1 133 ? 52.899 -19.313 90.734  1.00 27.93 ? 133 ALA A O   1 
ATOM   1020 C CB  . ALA A 1 133 ? 51.827 -18.397 87.832  1.00 28.95 ? 133 ALA A CB  1 
ATOM   1021 N N   . GLU A 1 134 ? 54.034 -17.523 90.039  1.00 27.37 ? 134 GLU A N   1 
ATOM   1022 C CA  . GLU A 1 134 ? 55.231 -17.890 90.800  1.00 27.81 ? 134 GLU A CA  1 
ATOM   1023 C C   . GLU A 1 134 ? 54.946 -17.802 92.308  1.00 26.61 ? 134 GLU A C   1 
ATOM   1024 O O   . GLU A 1 134 ? 55.270 -18.725 93.083  1.00 26.10 ? 134 GLU A O   1 
ATOM   1025 C CB  . GLU A 1 134 ? 56.442 -17.028 90.391  1.00 27.63 ? 134 GLU A CB  1 
ATOM   1026 C CG  . GLU A 1 134 ? 57.677 -17.378 91.219  1.00 30.69 ? 134 GLU A CG  1 
ATOM   1027 C CD  . GLU A 1 134 ? 58.947 -16.662 90.789  1.00 32.46 ? 134 GLU A CD  1 
ATOM   1028 O OE1 . GLU A 1 134 ? 58.941 -15.803 89.853  1.00 31.98 ? 134 GLU A OE1 1 
ATOM   1029 O OE2 . GLU A 1 134 ? 59.964 -16.960 91.423  1.00 35.13 ? 134 GLU A OE2 1 
ATOM   1030 N N   . ALA A 1 135 ? 54.336 -16.688 92.711  1.00 25.61 ? 135 ALA A N   1 
ATOM   1031 C CA  . ALA A 1 135 ? 53.896 -16.488 94.092  1.00 26.38 ? 135 ALA A CA  1 
ATOM   1032 C C   . ALA A 1 135 ? 52.978 -17.627 94.545  1.00 26.29 ? 135 ALA A C   1 
ATOM   1033 O O   . ALA A 1 135 ? 53.166 -18.212 95.596  1.00 26.59 ? 135 ALA A O   1 
ATOM   1034 C CB  . ALA A 1 135 ? 53.202 -15.129 94.245  1.00 25.05 ? 135 ALA A CB  1 
ATOM   1035 N N   . TYR A 1 136 ? 51.991 -17.975 93.729  1.00 26.93 ? 136 TYR A N   1 
ATOM   1036 C CA  . TYR A 1 136 ? 51.072 -19.057 94.091  1.00 26.43 ? 136 TYR A CA  1 
ATOM   1037 C C   . TYR A 1 136 ? 51.793 -20.409 94.170  1.00 26.53 ? 136 TYR A C   1 
ATOM   1038 O O   . TYR A 1 136 ? 51.483 -21.248 95.019  1.00 26.85 ? 136 TYR A O   1 
ATOM   1039 C CB  . TYR A 1 136 ? 49.921 -19.136 93.066  1.00 25.95 ? 136 TYR A CB  1 
ATOM   1040 C CG  . TYR A 1 136 ? 48.745 -19.993 93.512  1.00 27.35 ? 136 TYR A CG  1 
ATOM   1041 C CD1 . TYR A 1 136 ? 47.842 -19.526 94.458  1.00 27.08 ? 136 TYR A CD1 1 
ATOM   1042 C CD2 . TYR A 1 136 ? 48.514 -21.248 92.950  1.00 28.28 ? 136 TYR A CD2 1 
ATOM   1043 C CE1 . TYR A 1 136 ? 46.766 -20.298 94.866  1.00 26.58 ? 136 TYR A CE1 1 
ATOM   1044 C CE2 . TYR A 1 136 ? 47.425 -22.021 93.342  1.00 28.29 ? 136 TYR A CE2 1 
ATOM   1045 C CZ  . TYR A 1 136 ? 46.574 -21.546 94.303  1.00 27.47 ? 136 TYR A CZ  1 
ATOM   1046 O OH  . TYR A 1 136 ? 45.507 -22.299 94.694  1.00 28.62 ? 136 TYR A OH  1 
ATOM   1047 N N   . GLN A 1 137 ? 52.760 -20.638 93.295  1.00 26.70 ? 137 GLN A N   1 
ATOM   1048 C CA  . GLN A 1 137 ? 53.455 -21.919 93.355  1.00 27.89 ? 137 GLN A CA  1 
ATOM   1049 C C   . GLN A 1 137 ? 54.308 -21.998 94.624  1.00 26.99 ? 137 GLN A C   1 
ATOM   1050 O O   . GLN A 1 137 ? 54.447 -23.066 95.226  1.00 27.33 ? 137 GLN A O   1 
ATOM   1051 C CB  . GLN A 1 137 ? 54.277 -22.179 92.089  1.00 28.58 ? 137 GLN A CB  1 
ATOM   1052 C CG  . GLN A 1 137 ? 53.391 -22.278 90.835  1.00 35.10 ? 137 GLN A CG  1 
ATOM   1053 C CD  . GLN A 1 137 ? 52.377 -23.432 90.899  1.00 41.35 ? 137 GLN A CD  1 
ATOM   1054 O OE1 . GLN A 1 137 ? 51.205 -23.270 90.498  1.00 43.63 ? 137 GLN A OE1 1 
ATOM   1055 N NE2 . GLN A 1 137 ? 52.829 -24.603 91.378  1.00 41.93 ? 137 GLN A NE2 1 
ATOM   1056 N N   . MET A 1 138 ? 54.834 -20.860 95.046  1.00 26.56 ? 138 MET A N   1 
ATOM   1057 C CA  . MET A 1 138 ? 55.594 -20.804 96.286  1.00 26.45 ? 138 MET A CA  1 
ATOM   1058 C C   . MET A 1 138 ? 54.681 -21.162 97.426  1.00 25.90 ? 138 MET A C   1 
ATOM   1059 O O   . MET A 1 138 ? 55.026 -21.948 98.295  1.00 25.88 ? 138 MET A O   1 
ATOM   1060 C CB  . MET A 1 138 ? 56.194 -19.412 96.536  1.00 25.86 ? 138 MET A CB  1 
ATOM   1061 C CG  . MET A 1 138 ? 57.071 -19.414 97.815  1.00 31.15 ? 138 MET A CG  1 
ATOM   1062 S SD  . MET A 1 138 ? 57.770 -17.825 98.152  1.00 40.64 ? 138 MET A SD  1 
ATOM   1063 C CE  . MET A 1 138 ? 56.245 -16.920 98.649  1.00 34.88 ? 138 MET A CE  1 
ATOM   1064 N N   . LEU A 1 139 ? 53.495 -20.566 97.426  1.00 26.29 ? 139 LEU A N   1 
ATOM   1065 C CA  . LEU A 1 139 ? 52.529 -20.827 98.475  1.00 26.56 ? 139 LEU A CA  1 
ATOM   1066 C C   . LEU A 1 139 ? 52.141 -22.299 98.579  1.00 26.90 ? 139 LEU A C   1 
ATOM   1067 O O   . LEU A 1 139 ? 51.914 -22.790 99.678  1.00 27.39 ? 139 LEU A O   1 
ATOM   1068 C CB  . LEU A 1 139 ? 51.297 -19.910 98.345  1.00 26.54 ? 139 LEU A CB  1 
ATOM   1069 C CG  . LEU A 1 139 ? 51.556 -18.407 98.502  1.00 24.58 ? 139 LEU A CG  1 
ATOM   1070 C CD1 . LEU A 1 139 ? 50.293 -17.548 98.302  1.00 24.12 ? 139 LEU A CD1 1 
ATOM   1071 C CD2 . LEU A 1 139 ? 52.131 -18.114 99.874  1.00 25.01 ? 139 LEU A CD2 1 
ATOM   1072 N N   . LYS A 1 140 ? 52.070 -23.007 97.452  1.00 27.74 ? 140 LYS A N   1 
ATOM   1073 C CA  . LYS A 1 140 ? 51.774 -24.443 97.481  1.00 28.59 ? 140 LYS A CA  1 
ATOM   1074 C C   . LYS A 1 140 ? 52.969 -25.223 98.012  1.00 27.54 ? 140 LYS A C   1 
ATOM   1075 O O   . LYS A 1 140 ? 52.829 -26.110 98.797  1.00 27.52 ? 140 LYS A O   1 
ATOM   1076 C CB  . LYS A 1 140 ? 51.407 -24.996 96.087  1.00 28.98 ? 140 LYS A CB  1 
ATOM   1077 C CG  . LYS A 1 140 ? 50.079 -24.483 95.564  1.00 34.27 ? 140 LYS A CG  1 
ATOM   1078 C CD  . LYS A 1 140 ? 49.758 -25.017 94.155  1.00 41.65 ? 140 LYS A CD  1 
ATOM   1079 C CE  . LYS A 1 140 ? 49.489 -26.514 94.194  1.00 44.39 ? 140 LYS A CE  1 
ATOM   1080 N NZ  . LYS A 1 140 ? 48.823 -26.995 92.945  1.00 46.77 ? 140 LYS A NZ  1 
ATOM   1081 N N   . LYS A 1 141 ? 54.155 -24.899 97.551  1.00 28.27 ? 141 LYS A N   1 
ATOM   1082 C CA  . LYS A 1 141 ? 55.340 -25.631 98.008  1.00 28.65 ? 141 LYS A CA  1 
ATOM   1083 C C   . LYS A 1 141 ? 55.520 -25.463 99.513  1.00 27.93 ? 141 LYS A C   1 
ATOM   1084 O O   . LYS A 1 141 ? 55.853 -26.407 100.231 1.00 26.79 ? 141 LYS A O   1 
ATOM   1085 C CB  . LYS A 1 141 ? 56.588 -25.128 97.277  1.00 28.95 ? 141 LYS A CB  1 
ATOM   1086 C CG  . LYS A 1 141 ? 56.701 -25.566 95.824  1.00 32.76 ? 141 LYS A CG  1 
ATOM   1087 C CD  . LYS A 1 141 ? 58.115 -25.279 95.322  1.00 38.99 ? 141 LYS A CD  1 
ATOM   1088 C CE  . LYS A 1 141 ? 58.276 -25.508 93.844  1.00 43.35 ? 141 LYS A CE  1 
ATOM   1089 N NZ  . LYS A 1 141 ? 59.569 -24.853 93.420  1.00 45.34 ? 141 LYS A NZ  1 
ATOM   1090 N N   . GLN A 1 142 ? 55.242 -24.253 99.984  1.00 28.08 ? 142 GLN A N   1 
ATOM   1091 C CA  . GLN A 1 142 ? 55.430 -23.930 101.388 1.00 29.13 ? 142 GLN A CA  1 
ATOM   1092 C C   . GLN A 1 142 ? 54.270 -24.437 102.221 1.00 30.63 ? 142 GLN A C   1 
ATOM   1093 O O   . GLN A 1 142 ? 54.214 -24.236 103.434 1.00 30.60 ? 142 GLN A O   1 
ATOM   1094 C CB  . GLN A 1 142 ? 55.614 -22.420 101.552 1.00 28.66 ? 142 GLN A CB  1 
ATOM   1095 C CG  . GLN A 1 142 ? 56.956 -21.956 100.983 1.00 28.26 ? 142 GLN A CG  1 
ATOM   1096 C CD  . GLN A 1 142 ? 58.097 -22.510 101.812 1.00 29.66 ? 142 GLN A CD  1 
ATOM   1097 O OE1 . GLN A 1 142 ? 57.995 -22.516 103.040 1.00 31.74 ? 142 GLN A OE1 1 
ATOM   1098 N NE2 . GLN A 1 142 ? 59.111 -23.049 101.163 1.00 29.04 ? 142 GLN A NE2 1 
ATOM   1099 N N   . GLY A 1 143 ? 53.311 -25.072 101.555 1.00 31.53 ? 143 GLY A N   1 
ATOM   1100 C CA  . GLY A 1 143 ? 52.185 -25.670 102.246 1.00 33.44 ? 143 GLY A CA  1 
ATOM   1101 C C   . GLY A 1 143 ? 51.007 -24.781 102.631 1.00 35.08 ? 143 GLY A C   1 
ATOM   1102 O O   . GLY A 1 143 ? 50.119 -25.230 103.351 1.00 34.85 ? 143 GLY A O   1 
ATOM   1103 N N   . ILE A 1 144 ? 50.997 -23.531 102.173 1.00 36.12 ? 144 ILE A N   1 
ATOM   1104 C CA  . ILE A 1 144 ? 49.884 -22.621 102.459 1.00 37.72 ? 144 ILE A CA  1 
ATOM   1105 C C   . ILE A 1 144 ? 48.651 -23.101 101.698 1.00 38.83 ? 144 ILE A C   1 
ATOM   1106 O O   . ILE A 1 144 ? 47.629 -23.422 102.286 1.00 39.25 ? 144 ILE A O   1 
ATOM   1107 C CB  . ILE A 1 144 ? 50.241 -21.182 102.055 1.00 37.09 ? 144 ILE A CB  1 
ATOM   1108 C CG1 . ILE A 1 144 ? 51.646 -20.833 102.520 1.00 39.48 ? 144 ILE A CG1 1 
ATOM   1109 C CG2 . ILE A 1 144 ? 49.293 -20.197 102.682 1.00 36.61 ? 144 ILE A CG2 1 
ATOM   1110 C CD1 . ILE A 1 144 ? 51.789 -20.693 104.035 1.00 39.56 ? 144 ILE A CD1 1 
ATOM   1111 N N   . VAL A 1 145 ? 48.788 -23.159 100.382 1.00 40.48 ? 145 VAL A N   1 
ATOM   1112 C CA  . VAL A 1 145 ? 47.756 -23.727 99.540  1.00 42.68 ? 145 VAL A CA  1 
ATOM   1113 C C   . VAL A 1 145 ? 47.765 -25.245 99.724  1.00 44.70 ? 145 VAL A C   1 
ATOM   1114 O O   . VAL A 1 145 ? 48.714 -25.940 99.336  1.00 45.33 ? 145 VAL A O   1 
ATOM   1115 C CB  . VAL A 1 145 ? 47.984 -23.386 98.076  1.00 42.53 ? 145 VAL A CB  1 
ATOM   1116 C CG1 . VAL A 1 145 ? 46.926 -24.080 97.212  1.00 42.23 ? 145 VAL A CG1 1 
ATOM   1117 C CG2 . VAL A 1 145 ? 47.942 -21.888 97.894  1.00 41.23 ? 145 VAL A CG2 1 
ATOM   1118 N N   . LYS A 1 146 ? 46.706 -25.734 100.350 1.00 46.74 ? 146 LYS A N   1 
ATOM   1119 C CA  . LYS A 1 146 ? 46.537 -27.137 100.685 1.00 48.69 ? 146 LYS A CA  1 
ATOM   1120 C C   . LYS A 1 146 ? 46.071 -27.924 99.474  1.00 48.71 ? 146 LYS A C   1 
ATOM   1121 O O   . LYS A 1 146 ? 46.856 -28.196 98.561  1.00 48.84 ? 146 LYS A O   1 
ATOM   1122 C CB  . LYS A 1 146 ? 45.515 -27.241 101.813 1.00 49.33 ? 146 LYS A CB  1 
ATOM   1123 C CG  . LYS A 1 146 ? 45.551 -26.019 102.733 1.00 52.31 ? 146 LYS A CG  1 
ATOM   1124 C CD  . LYS A 1 146 ? 44.129 -25.580 103.141 1.00 56.65 ? 146 LYS A CD  1 
ATOM   1125 C CE  . LYS A 1 146 ? 44.031 -24.059 103.247 1.00 58.88 ? 146 LYS A CE  1 
ATOM   1126 N NZ  . LYS A 1 146 ? 45.370 -23.468 103.617 1.00 60.27 ? 146 LYS A NZ  1 
ATOM   1127 N N   . ASP B 2 7   ? 61.276 -3.907  90.567  1.00 36.32 ? 7   ASP C N   1 
ATOM   1128 C CA  . ASP B 2 7   ? 60.412 -4.759  91.457  1.00 36.13 ? 7   ASP C CA  1 
ATOM   1129 C C   . ASP B 2 7   ? 61.227 -5.377  92.573  1.00 36.40 ? 7   ASP C C   1 
ATOM   1130 O O   . ASP B 2 7   ? 62.421 -5.595  92.434  1.00 37.42 ? 7   ASP C O   1 
ATOM   1131 C CB  . ASP B 2 7   ? 59.747 -5.891  90.653  1.00 35.69 ? 7   ASP C CB  1 
ATOM   1132 C CG  . ASP B 2 7   ? 58.561 -6.549  91.402  1.00 34.30 ? 7   ASP C CG  1 
ATOM   1133 O OD1 . ASP B 2 7   ? 58.111 -6.020  92.440  1.00 29.38 ? 7   ASP C OD1 1 
ATOM   1134 O OD2 . ASP B 2 7   ? 58.026 -7.605  91.008  1.00 32.07 ? 7   ASP C OD2 1 
ATOM   1135 N N   . GLU B 2 8   ? 60.569 -5.677  93.680  1.00 36.12 ? 8   GLU C N   1 
ATOM   1136 C CA  . GLU B 2 8   ? 61.201 -6.332  94.813  1.00 35.55 ? 8   GLU C CA  1 
ATOM   1137 C C   . GLU B 2 8   ? 61.375 -7.812  94.501  1.00 34.35 ? 8   GLU C C   1 
ATOM   1138 O O   . GLU B 2 8   ? 60.798 -8.305  93.539  1.00 33.03 ? 8   GLU C O   1 
ATOM   1139 C CB  . GLU B 2 8   ? 60.277 -6.233  96.021  1.00 36.23 ? 8   GLU C CB  1 
ATOM   1140 C CG  . GLU B 2 8   ? 59.663 -4.861  96.202  1.00 40.02 ? 8   GLU C CG  1 
ATOM   1141 C CD  . GLU B 2 8   ? 60.707 -3.849  96.595  1.00 44.67 ? 8   GLU C CD  1 
ATOM   1142 O OE1 . GLU B 2 8   ? 61.724 -4.269  97.179  1.00 44.80 ? 8   GLU C OE1 1 
ATOM   1143 O OE2 . GLU B 2 8   ? 60.509 -2.643  96.323  1.00 48.43 ? 8   GLU C OE2 1 
ATOM   1144 N N   . ASP B 2 9   ? 62.181 -8.497  95.307  1.00 32.79 ? 9   ASP C N   1 
ATOM   1145 C CA  . ASP B 2 9   ? 62.303 -9.948  95.247  1.00 33.45 ? 9   ASP C CA  1 
ATOM   1146 C C   . ASP B 2 9   ? 61.036 -10.564 95.855  1.00 32.27 ? 9   ASP C C   1 
ATOM   1147 O O   . ASP B 2 9   ? 60.461 -9.982  96.792  1.00 30.71 ? 9   ASP C O   1 
ATOM   1148 C CB  . ASP B 2 9   ? 63.471 -10.427 96.130  1.00 33.73 ? 9   ASP C CB  1 
ATOM   1149 C CG  . ASP B 2 9   ? 64.846 -9.935  95.641  1.00 37.35 ? 9   ASP C CG  1 
ATOM   1150 O OD1 . ASP B 2 9   ? 65.740 -9.701  96.482  1.00 41.01 ? 9   ASP C OD1 1 
ATOM   1151 O OD2 . ASP B 2 9   ? 65.109 -9.740  94.449  1.00 38.32 ? 9   ASP C OD2 1 
ATOM   1152 N N   . LEU B 2 10  ? 60.638 -11.743 95.371  1.00 31.10 ? 10  LEU C N   1 
ATOM   1153 C CA  . LEU B 2 10  ? 59.536 -12.480 95.992  1.00 31.04 ? 10  LEU C CA  1 
ATOM   1154 C C   . LEU B 2 10  ? 59.839 -12.716 97.496  1.00 31.63 ? 10  LEU C C   1 
ATOM   1155 O O   . LEU B 2 10  ? 60.972 -13.112 97.886  1.00 30.94 ? 10  LEU C O   1 
ATOM   1156 C CB  . LEU B 2 10  ? 59.311 -13.818 95.285  1.00 30.20 ? 10  LEU C CB  1 
ATOM   1157 C CG  . LEU B 2 10  ? 58.294 -14.815 95.850  1.00 30.15 ? 10  LEU C CG  1 
ATOM   1158 C CD1 . LEU B 2 10  ? 56.885 -14.243 95.780  1.00 27.81 ? 10  LEU C CD1 1 
ATOM   1159 C CD2 . LEU B 2 10  ? 58.341 -16.179 95.115  1.00 29.45 ? 10  LEU C CD2 1 
ATOM   1160 N N   . LEU B 2 11  ? 58.835 -12.488 98.332  1.00 31.48 ? 11  LEU C N   1 
ATOM   1161 C CA  . LEU B 2 11  ? 59.002 -12.623 99.786  1.00 32.64 ? 11  LEU C CA  1 
ATOM   1162 C C   . LEU B 2 11  ? 59.520 -13.984 100.239 1.00 33.15 ? 11  LEU C C   1 
ATOM   1163 O O   . LEU B 2 11  ? 59.174 -15.029 99.654  1.00 32.39 ? 11  LEU C O   1 
ATOM   1164 C CB  . LEU B 2 11  ? 57.663 -12.358 100.506 1.00 32.87 ? 11  LEU C CB  1 
ATOM   1165 C CG  . LEU B 2 11  ? 57.771 -11.700 101.895 1.00 33.96 ? 11  LEU C CG  1 
ATOM   1166 C CD1 . LEU B 2 11  ? 58.268 -10.261 101.777 1.00 33.73 ? 11  LEU C CD1 1 
ATOM   1167 C CD2 . LEU B 2 11  ? 56.448 -11.747 102.647 1.00 35.34 ? 11  LEU C CD2 1 
ATOM   1168 N N   . HIS B 2 12  ? 60.366 -13.976 101.268 1.00 33.73 ? 12  HIS C N   1 
ATOM   1169 C CA  . HIS B 2 12  ? 60.781 -15.224 101.898 1.00 35.08 ? 12  HIS C CA  1 
ATOM   1170 C C   . HIS B 2 12  ? 59.819 -15.568 103.055 1.00 35.53 ? 12  HIS C C   1 
ATOM   1171 O O   . HIS B 2 12  ? 59.675 -14.770 103.980 1.00 35.78 ? 12  HIS C O   1 
ATOM   1172 C CB  . HIS B 2 12  ? 62.189 -15.088 102.457 1.00 35.80 ? 12  HIS C CB  1 
ATOM   1173 C CG  . HIS B 2 12  ? 63.274 -15.360 101.459 1.00 37.53 ? 12  HIS C CG  1 
ATOM   1174 N ND1 . HIS B 2 12  ? 63.643 -14.448 100.493 1.00 40.06 ? 12  HIS C ND1 1 
ATOM   1175 C CD2 . HIS B 2 12  ? 64.085 -16.433 101.294 1.00 38.60 ? 12  HIS C CD2 1 
ATOM   1176 C CE1 . HIS B 2 12  ? 64.625 -14.954 99.765  1.00 39.09 ? 12  HIS C CE1 1 
ATOM   1177 N NE2 . HIS B 2 12  ? 64.915 -16.156 100.237 1.00 38.01 ? 12  HIS C NE2 1 
ATOM   1178 N N   . ILE B 2 13  ? 59.183 -16.743 103.025 1.00 35.50 ? 13  ILE C N   1 
ATOM   1179 C CA  . ILE B 2 13  ? 58.307 -17.157 104.140 1.00 36.49 ? 13  ILE C CA  1 
ATOM   1180 C C   . ILE B 2 13  ? 58.746 -18.447 104.846 1.00 36.92 ? 13  ILE C C   1 
ATOM   1181 O O   . ILE B 2 13  ? 59.738 -19.094 104.538 1.00 37.05 ? 13  ILE C O   1 
ATOM   1182 C CB  . ILE B 2 13  ? 56.779 -17.241 103.743 1.00 36.16 ? 13  ILE C CB  1 
ATOM   1183 C CG1 . ILE B 2 13  ? 56.482 -18.477 102.890 1.00 37.38 ? 13  ILE C CG1 1 
ATOM   1184 C CG2 . ILE B 2 13  ? 56.289 -15.955 103.080 1.00 35.48 ? 13  ILE C CG2 1 
ATOM   1185 C CD1 . ILE B 2 13  ? 54.969 -18.779 102.766 1.00 36.08 ? 13  ILE C CD1 1 
ATOM   1186 O OXT . ILE B 2 13  ? 58.135 -18.933 105.798 1.00 38.26 ? 13  ILE C OXT 1 
ATOM   1187 N N   . PRO C 1 7   ? 53.305 -0.908  68.170  1.00 51.30 ? 7   PRO B N   1 
ATOM   1188 C CA  . PRO C 1 7   ? 53.324 -2.355  68.563  1.00 50.75 ? 7   PRO B CA  1 
ATOM   1189 C C   . PRO C 1 7   ? 52.383 -2.549  69.748  1.00 50.05 ? 7   PRO B C   1 
ATOM   1190 O O   . PRO C 1 7   ? 51.543 -3.453  69.778  1.00 50.19 ? 7   PRO B O   1 
ATOM   1191 C CB  . PRO C 1 7   ? 54.785 -2.593  68.968  1.00 51.33 ? 7   PRO B CB  1 
ATOM   1192 C CG  . PRO C 1 7   ? 55.570 -1.484  68.303  1.00 51.67 ? 7   PRO B CG  1 
ATOM   1193 C CD  . PRO C 1 7   ? 54.640 -0.288  68.256  1.00 51.92 ? 7   PRO B CD  1 
ATOM   1194 N N   . GLU C 1 8   ? 52.509 -1.667  70.726  1.00 48.67 ? 8   GLU B N   1 
ATOM   1195 C CA  . GLU C 1 8   ? 51.601 -1.703  71.849  1.00 47.49 ? 8   GLU B CA  1 
ATOM   1196 C C   . GLU C 1 8   ? 50.380 -0.802  71.608  1.00 45.10 ? 8   GLU B C   1 
ATOM   1197 O O   . GLU C 1 8   ? 49.438 -0.810  72.413  1.00 45.29 ? 8   GLU B O   1 
ATOM   1198 C CB  . GLU C 1 8   ? 52.331 -1.326  73.138  1.00 48.17 ? 8   GLU B CB  1 
ATOM   1199 C CG  . GLU C 1 8   ? 53.665 -2.051  73.324  1.00 51.36 ? 8   GLU B CG  1 
ATOM   1200 C CD  . GLU C 1 8   ? 54.869 -1.256  72.811  1.00 55.79 ? 8   GLU B CD  1 
ATOM   1201 O OE1 . GLU C 1 8   ? 55.968 -1.847  72.671  1.00 55.54 ? 8   GLU B OE1 1 
ATOM   1202 O OE2 . GLU C 1 8   ? 54.726 -0.036  72.550  1.00 58.15 ? 8   GLU B OE2 1 
ATOM   1203 N N   . THR C 1 9   ? 50.374 -0.051  70.498  1.00 41.99 ? 9   THR B N   1 
ATOM   1204 C CA  . THR C 1 9   ? 49.248 0.862   70.226  1.00 39.13 ? 9   THR B CA  1 
ATOM   1205 C C   . THR C 1 9   ? 47.962 0.111   69.923  1.00 36.83 ? 9   THR B C   1 
ATOM   1206 O O   . THR C 1 9   ? 47.987 -1.019  69.466  1.00 36.13 ? 9   THR B O   1 
ATOM   1207 C CB  . THR C 1 9   ? 49.537 1.853   69.057  1.00 39.17 ? 9   THR B CB  1 
ATOM   1208 O OG1 . THR C 1 9   ? 49.558 1.144   67.808  1.00 38.06 ? 9   THR B OG1 1 
ATOM   1209 C CG2 . THR C 1 9   ? 50.943 2.464   69.176  1.00 39.46 ? 9   THR B CG2 1 
ATOM   1210 N N   . LEU C 1 10  ? 46.841 0.756   70.204  1.00 34.66 ? 10  LEU B N   1 
ATOM   1211 C CA  . LEU C 1 10  ? 45.540 0.203   69.880  1.00 32.62 ? 10  LEU B CA  1 
ATOM   1212 C C   . LEU C 1 10  ? 45.470 -0.163  68.398  1.00 30.83 ? 10  LEU B C   1 
ATOM   1213 O O   . LEU C 1 10  ? 44.955 -1.225  68.043  1.00 28.74 ? 10  LEU B O   1 
ATOM   1214 C CB  . LEU C 1 10  ? 44.459 1.229   70.167  1.00 32.65 ? 10  LEU B CB  1 
ATOM   1215 C CG  . LEU C 1 10  ? 43.569 0.983   71.372  1.00 35.46 ? 10  LEU B CG  1 
ATOM   1216 C CD1 . LEU C 1 10  ? 44.102 -0.108  72.280  1.00 33.85 ? 10  LEU B CD1 1 
ATOM   1217 C CD2 . LEU C 1 10  ? 43.310 2.285   72.107  1.00 34.59 ? 10  LEU B CD2 1 
ATOM   1218 N N   . GLU C 1 11  ? 45.939 0.749   67.551  1.00 29.34 ? 11  GLU B N   1 
ATOM   1219 C CA  . GLU C 1 11  ? 45.976 0.529   66.099  1.00 30.09 ? 11  GLU B CA  1 
ATOM   1220 C C   . GLU C 1 11  ? 46.713 -0.751  65.736  1.00 29.38 ? 11  GLU B C   1 
ATOM   1221 O O   . GLU C 1 11  ? 46.174 -1.630  65.047  1.00 29.23 ? 11  GLU B O   1 
ATOM   1222 C CB  . GLU C 1 11  ? 46.641 1.711   65.381  1.00 30.16 ? 11  GLU B CB  1 
ATOM   1223 C CG  . GLU C 1 11  ? 45.821 2.997   65.356  1.00 32.64 ? 11  GLU B CG  1 
ATOM   1224 C CD  . GLU C 1 11  ? 46.019 3.885   66.583  1.00 36.27 ? 11  GLU B CD  1 
ATOM   1225 O OE1 . GLU C 1 11  ? 45.465 5.000   66.574  1.00 38.20 ? 11  GLU B OE1 1 
ATOM   1226 O OE2 . GLU C 1 11  ? 46.729 3.484   67.549  1.00 36.42 ? 11  GLU B OE2 1 
ATOM   1227 N N   . ALA C 1 12  ? 47.952 -0.877  66.195  1.00 28.92 ? 12  ALA B N   1 
ATOM   1228 C CA  . ALA C 1 12  ? 48.702 -2.088  65.881  1.00 29.13 ? 12  ALA B CA  1 
ATOM   1229 C C   . ALA C 1 12  ? 47.983 -3.310  66.425  1.00 29.41 ? 12  ALA B C   1 
ATOM   1230 O O   . ALA C 1 12  ? 47.936 -4.353  65.761  1.00 28.41 ? 12  ALA B O   1 
ATOM   1231 C CB  . ALA C 1 12  ? 50.126 -2.026  66.453  1.00 30.34 ? 12  ALA B CB  1 
ATOM   1232 N N   . ARG C 1 13  ? 47.394 -3.184  67.619  1.00 28.99 ? 13  ARG B N   1 
ATOM   1233 C CA  . ARG C 1 13  ? 46.718 -4.340  68.209  1.00 29.10 ? 13  ARG B CA  1 
ATOM   1234 C C   . ARG C 1 13  ? 45.481 -4.785  67.459  1.00 29.31 ? 13  ARG B C   1 
ATOM   1235 O O   . ARG C 1 13  ? 45.316 -5.987  67.185  1.00 28.80 ? 13  ARG B O   1 
ATOM   1236 C CB  . ARG C 1 13  ? 46.385 -4.126  69.689  1.00 29.77 ? 13  ARG B CB  1 
ATOM   1237 C CG  . ARG C 1 13  ? 47.633 -4.012  70.582  1.00 30.70 ? 13  ARG B CG  1 
ATOM   1238 C CD  . ARG C 1 13  ? 47.292 -3.818  72.059  1.00 35.41 ? 13  ARG B CD  1 
ATOM   1239 N NE  . ARG C 1 13  ? 48.486 -3.628  72.870  1.00 38.08 ? 13  ARG B NE  1 
ATOM   1240 C CZ  . ARG C 1 13  ? 49.173 -4.621  73.419  1.00 40.70 ? 13  ARG B CZ  1 
ATOM   1241 N NH1 . ARG C 1 13  ? 48.776 -5.888  73.254  1.00 38.40 ? 13  ARG B NH1 1 
ATOM   1242 N NH2 . ARG C 1 13  ? 50.251 -4.340  74.141  1.00 40.30 ? 13  ARG B NH2 1 
ATOM   1243 N N   . ILE C 1 14  ? 44.596 -3.843  67.133  1.00 28.25 ? 14  ILE B N   1 
ATOM   1244 C CA  . ILE C 1 14  ? 43.400 -4.224  66.393  1.00 28.26 ? 14  ILE B CA  1 
ATOM   1245 C C   . ILE C 1 14  ? 43.771 -4.765  65.020  1.00 28.59 ? 14  ILE B C   1 
ATOM   1246 O O   . ILE C 1 14  ? 43.090 -5.628  64.485  1.00 28.67 ? 14  ILE B O   1 
ATOM   1247 C CB  . ILE C 1 14  ? 42.387 -3.047  66.274  1.00 27.67 ? 14  ILE B CB  1 
ATOM   1248 C CG1 . ILE C 1 14  ? 41.003 -3.586  65.902  1.00 27.23 ? 14  ILE B CG1 1 
ATOM   1249 C CG2 . ILE C 1 14  ? 42.889 -1.957  65.311  1.00 26.50 ? 14  ILE B CG2 1 
ATOM   1250 C CD1 . ILE C 1 14  ? 40.445 -4.527  66.962  1.00 31.19 ? 14  ILE B CD1 1 
ATOM   1251 N N   . ASN C 1 15  ? 44.865 -4.270  64.449  1.00 28.36 ? 15  ASN B N   1 
ATOM   1252 C CA  . ASN C 1 15  ? 45.269 -4.734  63.122  1.00 29.09 ? 15  ASN B CA  1 
ATOM   1253 C C   . ASN C 1 15  ? 45.624 -6.209  63.124  1.00 30.81 ? 15  ASN B C   1 
ATOM   1254 O O   . ASN C 1 15  ? 45.225 -6.960  62.225  1.00 31.70 ? 15  ASN B O   1 
ATOM   1255 C CB  . ASN C 1 15  ? 46.415 -3.887  62.546  1.00 28.44 ? 15  ASN B CB  1 
ATOM   1256 C CG  . ASN C 1 15  ? 45.947 -2.491  62.104  1.00 27.15 ? 15  ASN B CG  1 
ATOM   1257 O OD1 . ASN C 1 15  ? 46.748 -1.563  61.965  1.00 27.57 ? 15  ASN B OD1 1 
ATOM   1258 N ND2 . ASN C 1 15  ? 44.647 -2.336  61.946  1.00 21.20 ? 15  ASN B ND2 1 
ATOM   1259 N N   . ARG C 1 16  ? 46.328 -6.630  64.167  1.00 31.73 ? 16  ARG B N   1 
ATOM   1260 C CA  . ARG C 1 16  ? 46.701 -8.024  64.330  1.00 32.80 ? 16  ARG B CA  1 
ATOM   1261 C C   . ARG C 1 16  ? 45.445 -8.820  64.705  1.00 32.00 ? 16  ARG B C   1 
ATOM   1262 O O   . ARG C 1 16  ? 45.196 -9.907  64.155  1.00 31.61 ? 16  ARG B O   1 
ATOM   1263 C CB  . ARG C 1 16  ? 47.775 -8.128  65.428  1.00 33.39 ? 16  ARG B CB  1 
ATOM   1264 C CG  . ARG C 1 16  ? 48.975 -9.019  65.131  1.00 38.62 ? 16  ARG B CG  1 
ATOM   1265 C CD  . ARG C 1 16  ? 50.104 -8.970  66.222  1.00 43.84 ? 16  ARG B CD  1 
ATOM   1266 N NE  . ARG C 1 16  ? 50.503 -7.608  66.593  1.00 49.36 ? 16  ARG B NE  1 
ATOM   1267 C CZ  . ARG C 1 16  ? 50.385 -7.080  67.819  1.00 50.73 ? 16  ARG B CZ  1 
ATOM   1268 N NH1 . ARG C 1 16  ? 50.774 -5.833  68.062  1.00 48.90 ? 16  ARG B NH1 1 
ATOM   1269 N NH2 . ARG C 1 16  ? 49.862 -7.798  68.805  1.00 54.01 ? 16  ARG B NH2 1 
ATOM   1270 N N   . ALA C 1 17  ? 44.633 -8.267  65.613  1.00 30.94 ? 17  ALA B N   1 
ATOM   1271 C CA  . ALA C 1 17  ? 43.436 -8.968  66.071  1.00 31.15 ? 17  ALA B CA  1 
ATOM   1272 C C   . ALA C 1 17  ? 42.385 -9.195  64.972  1.00 31.37 ? 17  ALA B C   1 
ATOM   1273 O O   . ALA C 1 17  ? 41.571 -10.124 65.068  1.00 31.25 ? 17  ALA B O   1 
ATOM   1274 C CB  . ALA C 1 17  ? 42.805 -8.274  67.295  1.00 30.89 ? 17  ALA B CB  1 
ATOM   1275 N N   . THR C 1 18  ? 42.389 -8.362  63.931  1.00 30.95 ? 18  THR B N   1 
ATOM   1276 C CA  . THR C 1 18  ? 41.409 -8.526  62.851  1.00 29.95 ? 18  THR B CA  1 
ATOM   1277 C C   . THR C 1 18  ? 42.034 -8.799  61.477  1.00 30.86 ? 18  THR B C   1 
ATOM   1278 O O   . THR C 1 18  ? 41.370 -8.681  60.422  1.00 30.61 ? 18  THR B O   1 
ATOM   1279 C CB  . THR C 1 18  ? 40.505 -7.297  62.768  1.00 30.00 ? 18  THR B CB  1 
ATOM   1280 O OG1 . THR C 1 18  ? 41.311 -6.158  62.455  1.00 26.89 ? 18  THR B OG1 1 
ATOM   1281 C CG2 . THR C 1 18  ? 39.930 -6.954  64.135  1.00 29.45 ? 18  THR B CG2 1 
ATOM   1282 N N   . ASN C 1 19  ? 43.309 -9.134  61.471  1.00 31.72 ? 19  ASN B N   1 
ATOM   1283 C CA  . ASN C 1 19  ? 43.992 -9.383  60.220  1.00 33.16 ? 19  ASN B CA  1 
ATOM   1284 C C   . ASN C 1 19  ? 43.279 -10.413 59.362  1.00 34.52 ? 19  ASN B C   1 
ATOM   1285 O O   . ASN C 1 19  ? 42.991 -11.524 59.807  1.00 33.97 ? 19  ASN B O   1 
ATOM   1286 C CB  . ASN C 1 19  ? 45.433 -9.794  60.471  1.00 34.23 ? 19  ASN B CB  1 
ATOM   1287 C CG  . ASN C 1 19  ? 46.283 -9.630  59.247  1.00 36.20 ? 19  ASN B CG  1 
ATOM   1288 O OD1 . ASN C 1 19  ? 45.898 -10.048 58.150  1.00 38.33 ? 19  ASN B OD1 1 
ATOM   1289 N ND2 . ASN C 1 19  ? 47.410 -8.957  59.403  1.00 40.62 ? 19  ASN B ND2 1 
ATOM   1290 N N   . PRO C 1 20  ? 42.971 -10.036 58.127  1.00 35.66 ? 20  PRO B N   1 
ATOM   1291 C CA  . PRO C 1 20  ? 42.282 -10.929 57.192  1.00 36.86 ? 20  PRO B CA  1 
ATOM   1292 C C   . PRO C 1 20  ? 43.101 -12.186 56.888  1.00 37.81 ? 20  PRO B C   1 
ATOM   1293 O O   . PRO C 1 20  ? 42.560 -13.155 56.375  1.00 37.89 ? 20  PRO B O   1 
ATOM   1294 C CB  . PRO C 1 20  ? 42.188 -10.081 55.907  1.00 37.01 ? 20  PRO B CB  1 
ATOM   1295 C CG  . PRO C 1 20  ? 42.318 -8.683  56.364  1.00 36.56 ? 20  PRO B CG  1 
ATOM   1296 C CD  . PRO C 1 20  ? 43.249 -8.715  57.545  1.00 35.53 ? 20  PRO B CD  1 
ATOM   1297 N N   . LEU C 1 21  ? 44.393 -12.147 57.178  1.00 38.75 ? 21  LEU B N   1 
ATOM   1298 C CA  . LEU C 1 21  ? 45.268 -13.280 56.907  1.00 40.51 ? 21  LEU B CA  1 
ATOM   1299 C C   . LEU C 1 21  ? 45.298 -14.289 58.059  1.00 41.07 ? 21  LEU B C   1 
ATOM   1300 O O   . LEU C 1 21  ? 45.961 -15.323 57.956  1.00 41.33 ? 21  LEU B O   1 
ATOM   1301 C CB  . LEU C 1 21  ? 46.689 -12.782 56.625  1.00 40.34 ? 21  LEU B CB  1 
ATOM   1302 C CG  . LEU C 1 21  ? 46.862 -12.052 55.290  1.00 41.70 ? 21  LEU B CG  1 
ATOM   1303 C CD1 . LEU C 1 21  ? 48.232 -11.389 55.188  1.00 41.75 ? 21  LEU B CD1 1 
ATOM   1304 C CD2 . LEU C 1 21  ? 46.623 -13.019 54.129  1.00 41.83 ? 21  LEU B CD2 1 
ATOM   1305 N N   . ASN C 1 22  ? 44.606 -13.980 59.160  1.00 41.55 ? 22  ASN B N   1 
ATOM   1306 C CA  . ASN C 1 22  ? 44.556 -14.885 60.313  1.00 42.10 ? 22  ASN B CA  1 
ATOM   1307 C C   . ASN C 1 22  ? 43.878 -16.230 59.990  1.00 43.00 ? 22  ASN B C   1 
ATOM   1308 O O   . ASN C 1 22  ? 42.744 -16.274 59.513  1.00 42.79 ? 22  ASN B O   1 
ATOM   1309 C CB  . ASN C 1 22  ? 43.843 -14.223 61.494  1.00 41.63 ? 22  ASN B CB  1 
ATOM   1310 C CG  . ASN C 1 22  ? 44.705 -13.167 62.192  1.00 41.68 ? 22  ASN B CG  1 
ATOM   1311 O OD1 . ASN C 1 22  ? 45.926 -13.098 62.000  1.00 39.41 ? 22  ASN B OD1 1 
ATOM   1312 N ND2 . ASN C 1 22  ? 44.064 -12.342 63.003  1.00 38.42 ? 22  ASN B ND2 1 
ATOM   1313 N N   . LYS C 1 23  ? 44.579 -17.323 60.251  1.00 44.25 ? 23  LYS B N   1 
ATOM   1314 C CA  . LYS C 1 23  ? 44.016 -18.644 60.011  1.00 45.88 ? 23  LYS B CA  1 
ATOM   1315 C C   . LYS C 1 23  ? 42.946 -18.918 61.049  1.00 45.90 ? 23  LYS B C   1 
ATOM   1316 O O   . LYS C 1 23  ? 41.910 -19.508 60.750  1.00 46.10 ? 23  LYS B O   1 
ATOM   1317 C CB  . LYS C 1 23  ? 45.107 -19.722 60.060  1.00 45.97 ? 23  LYS B CB  1 
ATOM   1318 C CG  . LYS C 1 23  ? 46.314 -19.415 59.177  1.00 48.10 ? 23  LYS B CG  1 
ATOM   1319 C CD  . LYS C 1 23  ? 46.268 -20.109 57.819  1.00 52.51 ? 23  LYS B CD  1 
ATOM   1320 C CE  . LYS C 1 23  ? 45.270 -19.445 56.862  1.00 53.81 ? 23  LYS B CE  1 
ATOM   1321 N NZ  . LYS C 1 23  ? 45.253 -20.104 55.513  1.00 54.02 ? 23  LYS B NZ  1 
ATOM   1322 N N   . GLU C 1 24  ? 43.196 -18.458 62.268  1.00 46.34 ? 24  GLU B N   1 
ATOM   1323 C CA  . GLU C 1 24  ? 42.264 -18.644 63.365  1.00 46.80 ? 24  GLU B CA  1 
ATOM   1324 C C   . GLU C 1 24  ? 42.241 -17.382 64.228  1.00 45.86 ? 24  GLU B C   1 
ATOM   1325 O O   . GLU C 1 24  ? 43.102 -16.517 64.082  1.00 45.51 ? 24  GLU B O   1 
ATOM   1326 C CB  . GLU C 1 24  ? 42.693 -19.851 64.207  1.00 47.45 ? 24  GLU B CB  1 
ATOM   1327 C CG  . GLU C 1 24  ? 44.200 -20.085 64.215  1.00 51.96 ? 24  GLU B CG  1 
ATOM   1328 C CD  . GLU C 1 24  ? 44.641 -21.195 65.166  1.00 57.07 ? 24  GLU B CD  1 
ATOM   1329 O OE1 . GLU C 1 24  ? 44.349 -22.382 64.893  1.00 59.54 ? 24  GLU B OE1 1 
ATOM   1330 O OE2 . GLU C 1 24  ? 45.288 -20.879 66.192  1.00 59.90 ? 24  GLU B OE2 1 
ATOM   1331 N N   . LEU C 1 25  ? 41.252 -17.287 65.114  1.00 44.72 ? 25  LEU B N   1 
ATOM   1332 C CA  . LEU C 1 25  ? 41.150 -16.172 66.043  1.00 43.96 ? 25  LEU B CA  1 
ATOM   1333 C C   . LEU C 1 25  ? 42.455 -15.997 66.807  1.00 43.51 ? 25  LEU B C   1 
ATOM   1334 O O   . LEU C 1 25  ? 42.973 -16.955 67.382  1.00 43.08 ? 25  LEU B O   1 
ATOM   1335 C CB  . LEU C 1 25  ? 40.021 -16.413 67.036  1.00 43.66 ? 25  LEU B CB  1 
ATOM   1336 C CG  . LEU C 1 25  ? 38.609 -16.239 66.490  1.00 44.18 ? 25  LEU B CG  1 
ATOM   1337 C CD1 . LEU C 1 25  ? 37.570 -16.740 67.500  1.00 43.73 ? 25  LEU B CD1 1 
ATOM   1338 C CD2 . LEU C 1 25  ? 38.359 -14.771 66.098  1.00 43.00 ? 25  LEU B CD2 1 
ATOM   1339 N N   . ASP C 1 26  ? 42.994 -14.777 66.797  1.00 42.61 ? 26  ASP B N   1 
ATOM   1340 C CA  . ASP C 1 26  ? 44.206 -14.464 67.549  1.00 41.68 ? 26  ASP B CA  1 
ATOM   1341 C C   . ASP C 1 26  ? 43.822 -13.923 68.930  1.00 40.68 ? 26  ASP B C   1 
ATOM   1342 O O   . ASP C 1 26  ? 43.785 -12.706 69.145  1.00 40.68 ? 26  ASP B O   1 
ATOM   1343 C CB  . ASP C 1 26  ? 45.058 -13.455 66.777  1.00 41.81 ? 26  ASP B CB  1 
ATOM   1344 C CG  . ASP C 1 26  ? 46.345 -13.101 67.492  1.00 42.56 ? 26  ASP B CG  1 
ATOM   1345 O OD1 . ASP C 1 26  ? 47.152 -12.343 66.912  1.00 42.11 ? 26  ASP B OD1 1 
ATOM   1346 O OD2 . ASP C 1 26  ? 46.643 -13.517 68.631  1.00 43.08 ? 26  ASP B OD2 1 
ATOM   1347 N N   . TRP C 1 27  ? 43.551 -14.826 69.870  1.00 39.56 ? 27  TRP B N   1 
ATOM   1348 C CA  . TRP C 1 27  ? 43.094 -14.419 71.207  1.00 38.30 ? 27  TRP B CA  1 
ATOM   1349 C C   . TRP C 1 27  ? 44.045 -13.542 71.999  1.00 37.44 ? 27  TRP B C   1 
ATOM   1350 O O   . TRP C 1 27  ? 43.604 -12.634 72.706  1.00 37.08 ? 27  TRP B O   1 
ATOM   1351 C CB  . TRP C 1 27  ? 42.657 -15.619 72.034  1.00 38.16 ? 27  TRP B CB  1 
ATOM   1352 C CG  . TRP C 1 27  ? 41.400 -16.157 71.537  1.00 38.04 ? 27  TRP B CG  1 
ATOM   1353 C CD1 . TRP C 1 27  ? 41.224 -17.273 70.777  1.00 36.17 ? 27  TRP B CD1 1 
ATOM   1354 C CD2 . TRP C 1 27  ? 40.114 -15.589 71.727  1.00 37.27 ? 27  TRP B CD2 1 
ATOM   1355 N NE1 . TRP C 1 27  ? 39.892 -17.431 70.487  1.00 34.88 ? 27  TRP B NE1 1 
ATOM   1356 C CE2 . TRP C 1 27  ? 39.192 -16.405 71.058  1.00 35.91 ? 27  TRP B CE2 1 
ATOM   1357 C CE3 . TRP C 1 27  ? 39.642 -14.457 72.401  1.00 37.08 ? 27  TRP B CE3 1 
ATOM   1358 C CZ2 . TRP C 1 27  ? 37.830 -16.142 71.054  1.00 37.55 ? 27  TRP B CZ2 1 
ATOM   1359 C CZ3 . TRP C 1 27  ? 38.307 -14.194 72.382  1.00 37.28 ? 27  TRP B CZ3 1 
ATOM   1360 C CH2 . TRP C 1 27  ? 37.409 -15.033 71.714  1.00 36.95 ? 27  TRP B CH2 1 
ATOM   1361 N N   . ALA C 1 28  ? 45.339 -13.802 71.869  1.00 36.31 ? 28  ALA B N   1 
ATOM   1362 C CA  . ALA C 1 28  ? 46.346 -13.015 72.562  1.00 36.17 ? 28  ALA B CA  1 
ATOM   1363 C C   . ALA C 1 28  ? 46.286 -11.558 72.101  1.00 35.56 ? 28  ALA B C   1 
ATOM   1364 O O   . ALA C 1 28  ? 46.455 -10.627 72.908  1.00 34.82 ? 28  ALA B O   1 
ATOM   1365 C CB  . ALA C 1 28  ? 47.736 -13.595 72.316  1.00 36.06 ? 28  ALA B CB  1 
ATOM   1366 N N   . SER C 1 29  ? 46.053 -11.371 70.798  1.00 34.34 ? 29  SER B N   1 
ATOM   1367 C CA  . SER C 1 29  ? 45.915 -10.032 70.234  1.00 34.09 ? 29  SER B CA  1 
ATOM   1368 C C   . SER C 1 29  ? 44.569 -9.438  70.596  1.00 32.47 ? 29  SER B C   1 
ATOM   1369 O O   . SER C 1 29  ? 44.465 -8.257  70.905  1.00 32.76 ? 29  SER B O   1 
ATOM   1370 C CB  . SER C 1 29  ? 46.087 -10.043 68.711  1.00 33.76 ? 29  SER B CB  1 
ATOM   1371 O OG  . SER C 1 29  ? 47.439 -10.302 68.394  1.00 36.82 ? 29  SER B OG  1 
ATOM   1372 N N   . ILE C 1 30  ? 43.534 -10.259 70.545  1.00 32.63 ? 30  ILE B N   1 
ATOM   1373 C CA  . ILE C 1 30  ? 42.206 -9.805  70.935  1.00 32.75 ? 30  ILE B CA  1 
ATOM   1374 C C   . ILE C 1 30  ? 42.268 -9.292  72.354  1.00 33.38 ? 30  ILE B C   1 
ATOM   1375 O O   . ILE C 1 30  ? 41.849 -8.164  72.648  1.00 33.42 ? 30  ILE B O   1 
ATOM   1376 C CB  . ILE C 1 30  ? 41.186 -10.921 70.804  1.00 32.32 ? 30  ILE B CB  1 
ATOM   1377 C CG1 . ILE C 1 30  ? 40.921 -11.210 69.328  1.00 32.14 ? 30  ILE B CG1 1 
ATOM   1378 C CG2 . ILE C 1 30  ? 39.870 -10.528 71.472  1.00 32.58 ? 30  ILE B CG2 1 
ATOM   1379 C CD1 . ILE C 1 30  ? 40.200 -12.526 69.091  1.00 32.22 ? 30  ILE B CD1 1 
ATOM   1380 N N   . ASN C 1 31  ? 42.848 -10.103 73.236  1.00 33.99 ? 31  ASN B N   1 
ATOM   1381 C CA  . ASN C 1 31  ? 42.922 -9.734  74.650  1.00 33.70 ? 31  ASN B CA  1 
ATOM   1382 C C   . ASN C 1 31  ? 43.816 -8.538  74.924  1.00 32.77 ? 31  ASN B C   1 
ATOM   1383 O O   . ASN C 1 31  ? 43.498 -7.720  75.773  1.00 32.17 ? 31  ASN B O   1 
ATOM   1384 C CB  . ASN C 1 31  ? 43.349 -10.968 75.496  1.00 34.12 ? 31  ASN B CB  1 
ATOM   1385 C CG  . ASN C 1 31  ? 42.244 -11.983 75.657  1.00 35.04 ? 31  ASN B CG  1 
ATOM   1386 O OD1 . ASN C 1 31  ? 42.514 -13.173 75.759  1.00 37.65 ? 31  ASN B OD1 1 
ATOM   1387 N ND2 . ASN C 1 31  ? 41.000 -11.527 75.695  1.00 34.75 ? 31  ASN B ND2 1 
ATOM   1388 N N   . GLY C 1 32  ? 44.922 -8.436  74.196  1.00 31.99 ? 32  GLY B N   1 
ATOM   1389 C CA  . GLY C 1 32  ? 45.847 -7.336  74.370  1.00 30.77 ? 32  GLY B CA  1 
ATOM   1390 C C   . GLY C 1 32  ? 45.175 -6.027  73.999  1.00 30.21 ? 32  GLY B C   1 
ATOM   1391 O O   . GLY C 1 32  ? 45.506 -4.947  74.524  1.00 30.81 ? 32  GLY B O   1 
ATOM   1392 N N   . PHE C 1 33  ? 44.219 -6.106  73.080  1.00 29.96 ? 33  PHE B N   1 
ATOM   1393 C CA  . PHE C 1 33  ? 43.478 -4.921  72.637  1.00 29.14 ? 33  PHE B CA  1 
ATOM   1394 C C   . PHE C 1 33  ? 42.560 -4.462  73.769  1.00 29.60 ? 33  PHE B C   1 
ATOM   1395 O O   . PHE C 1 33  ? 42.543 -3.288  74.137  1.00 29.02 ? 33  PHE B O   1 
ATOM   1396 C CB  . PHE C 1 33  ? 42.698 -5.179  71.330  1.00 27.93 ? 33  PHE B CB  1 
ATOM   1397 C CG  . PHE C 1 33  ? 41.864 -3.989  70.875  1.00 28.88 ? 33  PHE B CG  1 
ATOM   1398 C CD1 . PHE C 1 33  ? 40.553 -3.841  71.297  1.00 29.11 ? 33  PHE B CD1 1 
ATOM   1399 C CD2 . PHE C 1 33  ? 42.416 -2.998  70.058  1.00 28.26 ? 33  PHE B CD2 1 
ATOM   1400 C CE1 . PHE C 1 33  ? 39.791 -2.725  70.906  1.00 30.60 ? 33  PHE B CE1 1 
ATOM   1401 C CE2 . PHE C 1 33  ? 41.662 -1.898  69.656  1.00 26.08 ? 33  PHE B CE2 1 
ATOM   1402 C CZ  . PHE C 1 33  ? 40.358 -1.757  70.080  1.00 26.71 ? 33  PHE B CZ  1 
ATOM   1403 N N   . CYS C 1 34  ? 41.799 -5.407  74.308  1.00 30.42 ? 34  CYS B N   1 
ATOM   1404 C CA  . CYS C 1 34  ? 40.916 -5.147  75.432  1.00 32.58 ? 34  CYS B CA  1 
ATOM   1405 C C   . CYS C 1 34  ? 41.752 -4.585  76.593  1.00 32.03 ? 34  CYS B C   1 
ATOM   1406 O O   . CYS C 1 34  ? 41.370 -3.587  77.213  1.00 31.11 ? 34  CYS B O   1 
ATOM   1407 C CB  . CYS C 1 34  ? 40.126 -6.432  75.790  1.00 33.03 ? 34  CYS B CB  1 
ATOM   1408 S SG  . CYS C 1 34  ? 38.909 -6.908  74.507  1.00 38.10 ? 34  CYS B SG  1 
ATOM   1409 N N   . GLU C 1 35  ? 42.946 -5.131  76.805  1.00 31.65 ? 35  GLU B N   1 
ATOM   1410 C CA  . GLU C 1 35  ? 43.802 -4.704  77.920  1.00 31.75 ? 35  GLU B CA  1 
ATOM   1411 C C   . GLU C 1 35  ? 44.401 -3.311  77.800  1.00 32.77 ? 35  GLU B C   1 
ATOM   1412 O O   . GLU C 1 35  ? 44.765 -2.665  78.812  1.00 32.14 ? 35  GLU B O   1 
ATOM   1413 C CB  . GLU C 1 35  ? 44.930 -5.727  78.129  1.00 31.54 ? 35  GLU B CB  1 
ATOM   1414 C CG  . GLU C 1 35  ? 44.472 -6.984  78.869  1.00 30.42 ? 35  GLU B CG  1 
ATOM   1415 C CD  . GLU C 1 35  ? 44.281 -6.693  80.349  1.00 32.30 ? 35  GLU B CD  1 
ATOM   1416 O OE1 . GLU C 1 35  ? 45.291 -6.596  81.080  1.00 32.63 ? 35  GLU B OE1 1 
ATOM   1417 O OE2 . GLU C 1 35  ? 43.124 -6.531  80.773  1.00 32.32 ? 35  GLU B OE2 1 
ATOM   1418 N N   . GLN C 1 36  ? 44.490 -2.834  76.566  1.00 32.35 ? 36  GLN B N   1 
ATOM   1419 C CA  . GLN C 1 36  ? 45.154 -1.590  76.300  1.00 34.05 ? 36  GLN B CA  1 
ATOM   1420 C C   . GLN C 1 36  ? 44.224 -0.396  76.188  1.00 34.61 ? 36  GLN B C   1 
ATOM   1421 O O   . GLN C 1 36  ? 44.659 0.740   76.331  1.00 34.99 ? 36  GLN B O   1 
ATOM   1422 C CB  . GLN C 1 36  ? 45.915 -1.699  74.983  1.00 34.46 ? 36  GLN B CB  1 
ATOM   1423 C CG  . GLN C 1 36  ? 46.901 -0.586  74.765  1.00 36.76 ? 36  GLN B CG  1 
ATOM   1424 C CD  . GLN C 1 36  ? 48.034 -0.671  75.745  1.00 41.64 ? 36  GLN B CD  1 
ATOM   1425 O OE1 . GLN C 1 36  ? 48.448 -1.789  76.134  1.00 44.03 ? 36  GLN B OE1 1 
ATOM   1426 N NE2 . GLN C 1 36  ? 48.544 0.486   76.166  1.00 43.11 ? 36  GLN B NE2 1 
ATOM   1427 N N   . LEU C 1 37  ? 42.947 -0.639  75.927  1.00 35.68 ? 37  LEU B N   1 
ATOM   1428 C CA  . LEU C 1 37  ? 42.038 0.461   75.630  1.00 37.44 ? 37  LEU B CA  1 
ATOM   1429 C C   . LEU C 1 37  ? 41.810 1.502   76.725  1.00 39.69 ? 37  LEU B C   1 
ATOM   1430 O O   . LEU C 1 37  ? 41.500 2.651   76.403  1.00 39.57 ? 37  LEU B O   1 
ATOM   1431 C CB  . LEU C 1 37  ? 40.705 -0.047  75.066  1.00 36.58 ? 37  LEU B CB  1 
ATOM   1432 C CG  . LEU C 1 37  ? 39.780 -0.882  75.950  1.00 34.96 ? 37  LEU B CG  1 
ATOM   1433 C CD1 . LEU C 1 37  ? 38.984 0.032   76.867  1.00 33.22 ? 37  LEU B CD1 1 
ATOM   1434 C CD2 . LEU C 1 37  ? 38.847 -1.693  75.075  1.00 34.43 ? 37  LEU B CD2 1 
ATOM   1435 N N   . ASN C 1 38  ? 41.949 1.125   77.998  1.00 42.08 ? 38  ASN B N   1 
ATOM   1436 C CA  . ASN C 1 38  ? 41.750 2.088   79.077  1.00 45.45 ? 38  ASN B CA  1 
ATOM   1437 C C   . ASN C 1 38  ? 43.043 2.748   79.550  1.00 47.02 ? 38  ASN B C   1 
ATOM   1438 O O   . ASN C 1 38  ? 43.093 3.375   80.599  1.00 47.35 ? 38  ASN B O   1 
ATOM   1439 C CB  . ASN C 1 38  ? 40.980 1.468   80.257  1.00 45.95 ? 38  ASN B CB  1 
ATOM   1440 C CG  . ASN C 1 38  ? 41.131 -0.047  80.348  1.00 49.52 ? 38  ASN B CG  1 
ATOM   1441 O OD1 . ASN C 1 38  ? 41.790 -0.715  79.505  1.00 51.94 ? 38  ASN B OD1 1 
ATOM   1442 N ND2 . ASN C 1 38  ? 40.488 -0.614  81.364  1.00 50.25 ? 38  ASN B ND2 1 
ATOM   1443 N N   . GLU C 1 39  ? 44.094 2.620   78.758  1.00 48.90 ? 39  GLU B N   1 
ATOM   1444 C CA  . GLU C 1 39  ? 45.375 3.185   79.136  1.00 51.43 ? 39  GLU B CA  1 
ATOM   1445 C C   . GLU C 1 39  ? 45.382 4.712   79.027  1.00 52.49 ? 39  GLU B C   1 
ATOM   1446 O O   . GLU C 1 39  ? 46.211 5.391   79.646  1.00 52.50 ? 39  GLU B O   1 
ATOM   1447 C CB  . GLU C 1 39  ? 46.465 2.536   78.286  1.00 51.92 ? 39  GLU B CB  1 
ATOM   1448 C CG  . GLU C 1 39  ? 47.613 3.432   77.873  1.00 55.17 ? 39  GLU B CG  1 
ATOM   1449 C CD  . GLU C 1 39  ? 47.385 4.095   76.526  1.00 59.66 ? 39  GLU B CD  1 
ATOM   1450 O OE1 . GLU C 1 39  ? 47.310 5.351   76.502  1.00 61.85 ? 39  GLU B OE1 1 
ATOM   1451 O OE2 . GLU C 1 39  ? 47.301 3.372   75.494  1.00 59.57 ? 39  GLU B OE2 1 
ATOM   1452 N N   . ASP C 1 40  ? 44.419 5.239   78.273  1.00 53.65 ? 40  ASP B N   1 
ATOM   1453 C CA  . ASP C 1 40  ? 44.323 6.665   77.968  1.00 54.94 ? 40  ASP B CA  1 
ATOM   1454 C C   . ASP C 1 40  ? 42.951 7.239   78.237  1.00 55.06 ? 40  ASP B C   1 
ATOM   1455 O O   . ASP C 1 40  ? 41.950 6.512   78.300  1.00 54.54 ? 40  ASP B O   1 
ATOM   1456 C CB  . ASP C 1 40  ? 44.572 6.886   76.473  1.00 55.29 ? 40  ASP B CB  1 
ATOM   1457 C CG  . ASP C 1 40  ? 45.809 7.705   76.195  1.00 57.31 ? 40  ASP B CG  1 
ATOM   1458 O OD1 . ASP C 1 40  ? 45.796 8.911   76.512  1.00 58.92 ? 40  ASP B OD1 1 
ATOM   1459 O OD2 . ASP C 1 40  ? 46.832 7.231   75.642  1.00 58.60 ? 40  ASP B OD2 1 
ATOM   1460 N N   . PHE C 1 41  ? 42.921 8.565   78.356  1.00 55.12 ? 41  PHE B N   1 
ATOM   1461 C CA  . PHE C 1 41  ? 41.675 9.296   78.470  1.00 54.96 ? 41  PHE B CA  1 
ATOM   1462 C C   . PHE C 1 41  ? 40.894 9.067   77.180  1.00 53.78 ? 41  PHE B C   1 
ATOM   1463 O O   . PHE C 1 41  ? 39.733 8.700   77.214  1.00 54.50 ? 41  PHE B O   1 
ATOM   1464 C CB  . PHE C 1 41  ? 41.957 10.784  78.679  1.00 55.79 ? 41  PHE B CB  1 
ATOM   1465 C CG  . PHE C 1 41  ? 40.859 11.680  78.199  1.00 57.71 ? 41  PHE B CG  1 
ATOM   1466 C CD1 . PHE C 1 41  ? 39.853 12.090  79.060  1.00 59.80 ? 41  PHE B CD1 1 
ATOM   1467 C CD2 . PHE C 1 41  ? 40.837 12.119  76.887  1.00 59.78 ? 41  PHE B CD2 1 
ATOM   1468 C CE1 . PHE C 1 41  ? 38.832 12.914  78.616  1.00 61.78 ? 41  PHE B CE1 1 
ATOM   1469 C CE2 . PHE C 1 41  ? 39.829 12.941  76.435  1.00 60.70 ? 41  PHE B CE2 1 
ATOM   1470 C CZ  . PHE C 1 41  ? 38.822 13.346  77.299  1.00 61.63 ? 41  PHE B CZ  1 
ATOM   1471 N N   . GLU C 1 42  ? 41.559 9.251   76.045  1.00 52.31 ? 42  GLU B N   1 
ATOM   1472 C CA  . GLU C 1 42  ? 40.955 9.053   74.729  1.00 51.22 ? 42  GLU B CA  1 
ATOM   1473 C C   . GLU C 1 42  ? 41.025 7.604   74.196  1.00 49.28 ? 42  GLU B C   1 
ATOM   1474 O O   . GLU C 1 42  ? 40.788 7.376   73.007  1.00 48.67 ? 42  GLU B O   1 
ATOM   1475 C CB  . GLU C 1 42  ? 41.633 9.972   73.717  1.00 51.89 ? 42  GLU B CB  1 
ATOM   1476 C CG  . GLU C 1 42  ? 43.149 9.955   73.818  1.00 54.74 ? 42  GLU B CG  1 
ATOM   1477 C CD  . GLU C 1 42  ? 43.678 11.041  74.744  1.00 58.90 ? 42  GLU B CD  1 
ATOM   1478 O OE1 . GLU C 1 42  ? 44.669 10.770  75.452  1.00 60.43 ? 42  GLU B OE1 1 
ATOM   1479 O OE2 . GLU C 1 42  ? 43.105 12.162  74.769  1.00 58.04 ? 42  GLU B OE2 1 
ATOM   1480 N N   . GLY C 1 43  ? 41.341 6.638   75.058  1.00 47.14 ? 43  GLY B N   1 
ATOM   1481 C CA  . GLY C 1 43  ? 41.467 5.256   74.638  1.00 44.69 ? 43  GLY B CA  1 
ATOM   1482 C C   . GLY C 1 43  ? 40.166 4.581   74.243  1.00 42.84 ? 43  GLY B C   1 
ATOM   1483 O O   . GLY C 1 43  ? 40.026 4.108   73.115  1.00 42.42 ? 43  GLY B O   1 
ATOM   1484 N N   . PRO C 1 44  ? 39.226 4.496   75.179  1.00 41.87 ? 44  PRO B N   1 
ATOM   1485 C CA  . PRO C 1 44  ? 37.919 3.880   74.911  1.00 40.75 ? 44  PRO B CA  1 
ATOM   1486 C C   . PRO C 1 44  ? 37.202 4.425   73.663  1.00 39.83 ? 44  PRO B C   1 
ATOM   1487 O O   . PRO C 1 44  ? 36.678 3.610   72.916  1.00 40.06 ? 44  PRO B O   1 
ATOM   1488 C CB  . PRO C 1 44  ? 37.131 4.147   76.200  1.00 41.09 ? 44  PRO B CB  1 
ATOM   1489 C CG  . PRO C 1 44  ? 38.189 4.264   77.238  1.00 41.53 ? 44  PRO B CG  1 
ATOM   1490 C CD  . PRO C 1 44  ? 39.351 4.951   76.577  1.00 41.59 ? 44  PRO B CD  1 
ATOM   1491 N N   . PRO C 1 45  ? 37.146 5.729   73.426  1.00 39.03 ? 45  PRO B N   1 
ATOM   1492 C CA  . PRO C 1 45  ? 36.523 6.227   72.191  1.00 38.54 ? 45  PRO B CA  1 
ATOM   1493 C C   . PRO C 1 45  ? 37.404 5.950   70.976  1.00 37.58 ? 45  PRO B C   1 
ATOM   1494 O O   . PRO C 1 45  ? 36.855 5.785   69.896  1.00 37.81 ? 45  PRO B O   1 
ATOM   1495 C CB  . PRO C 1 45  ? 36.403 7.740   72.416  1.00 38.62 ? 45  PRO B CB  1 
ATOM   1496 C CG  . PRO C 1 45  ? 36.695 7.960   73.872  1.00 38.94 ? 45  PRO B CG  1 
ATOM   1497 C CD  . PRO C 1 45  ? 37.607 6.837   74.284  1.00 39.41 ? 45  PRO B CD  1 
ATOM   1498 N N   . LEU C 1 46  ? 38.728 5.910   71.120  1.00 36.01 ? 46  LEU B N   1 
ATOM   1499 C CA  . LEU C 1 46  ? 39.557 5.550   69.968  1.00 35.17 ? 46  LEU B CA  1 
ATOM   1500 C C   . LEU C 1 46  ? 39.240 4.100   69.608  1.00 33.54 ? 46  LEU B C   1 
ATOM   1501 O O   . LEU C 1 46  ? 39.104 3.741   68.433  1.00 32.67 ? 46  LEU B O   1 
ATOM   1502 C CB  . LEU C 1 46  ? 41.068 5.709   70.253  1.00 34.77 ? 46  LEU B CB  1 
ATOM   1503 C CG  . LEU C 1 46  ? 42.041 5.213   69.170  1.00 36.17 ? 46  LEU B CG  1 
ATOM   1504 C CD1 . LEU C 1 46  ? 41.738 5.897   67.803  1.00 34.02 ? 46  LEU B CD1 1 
ATOM   1505 C CD2 . LEU C 1 46  ? 43.501 5.448   69.568  1.00 34.97 ? 46  LEU B CD2 1 
ATOM   1506 N N   . ALA C 1 47  ? 39.150 3.272   70.642  1.00 32.33 ? 47  ALA B N   1 
ATOM   1507 C CA  . ALA C 1 47  ? 38.854 1.847   70.495  1.00 30.61 ? 47  ALA B CA  1 
ATOM   1508 C C   . ALA C 1 47  ? 37.547 1.607   69.732  1.00 30.01 ? 47  ALA B C   1 
ATOM   1509 O O   . ALA C 1 47  ? 37.498 0.758   68.817  1.00 27.47 ? 47  ALA B O   1 
ATOM   1510 C CB  . ALA C 1 47  ? 38.831 1.150   71.872  1.00 31.02 ? 47  ALA B CB  1 
ATOM   1511 N N   . THR C 1 48  ? 36.508 2.372   70.068  1.00 29.87 ? 48  THR B N   1 
ATOM   1512 C CA  . THR C 1 48  ? 35.226 2.223   69.372  1.00 30.86 ? 48  THR B CA  1 
ATOM   1513 C C   . THR C 1 48  ? 35.326 2.709   67.937  1.00 30.56 ? 48  THR B C   1 
ATOM   1514 O O   . THR C 1 48  ? 34.698 2.136   67.064  1.00 30.23 ? 48  THR B O   1 
ATOM   1515 C CB  . THR C 1 48  ? 34.010 2.913   70.085  1.00 30.71 ? 48  THR B CB  1 
ATOM   1516 O OG1 . THR C 1 48  ? 34.276 4.301   70.342  1.00 32.29 ? 48  THR B OG1 1 
ATOM   1517 C CG2 . THR C 1 48  ? 33.788 2.333   71.456  1.00 32.68 ? 48  THR B CG2 1 
ATOM   1518 N N   . ARG C 1 49  ? 36.120 3.751   67.694  1.00 31.06 ? 49  ARG B N   1 
ATOM   1519 C CA  . ARG C 1 49  ? 36.293 4.257   66.335  1.00 31.40 ? 49  ARG B CA  1 
ATOM   1520 C C   . ARG C 1 49  ? 36.965 3.210   65.476  1.00 30.47 ? 49  ARG B C   1 
ATOM   1521 O O   . ARG C 1 49  ? 36.549 2.953   64.326  1.00 28.55 ? 49  ARG B O   1 
ATOM   1522 C CB  . ARG C 1 49  ? 37.155 5.511   66.288  1.00 32.78 ? 49  ARG B CB  1 
ATOM   1523 C CG  . ARG C 1 49  ? 36.429 6.801   66.592  1.00 37.59 ? 49  ARG B CG  1 
ATOM   1524 C CD  . ARG C 1 49  ? 37.331 8.014   66.437  1.00 42.53 ? 49  ARG B CD  1 
ATOM   1525 N NE  . ARG C 1 49  ? 37.569 8.274   65.020  1.00 47.11 ? 49  ARG B NE  1 
ATOM   1526 C CZ  . ARG C 1 49  ? 38.756 8.497   64.481  1.00 47.75 ? 49  ARG B CZ  1 
ATOM   1527 N NH1 . ARG C 1 49  ? 39.846 8.470   65.242  1.00 48.02 ? 49  ARG B NH1 1 
ATOM   1528 N NH2 . ARG C 1 49  ? 38.844 8.740   63.177  1.00 47.91 ? 49  ARG B NH2 1 
ATOM   1529 N N   . LEU C 1 50  ? 38.016 2.617   66.031  1.00 28.64 ? 50  LEU B N   1 
ATOM   1530 C CA  . LEU C 1 50  ? 38.762 1.592   65.311  1.00 28.65 ? 50  LEU B CA  1 
ATOM   1531 C C   . LEU C 1 50  ? 37.897 0.380   64.990  1.00 28.88 ? 50  LEU B C   1 
ATOM   1532 O O   . LEU C 1 50  ? 37.931 -0.148  63.876  1.00 29.22 ? 50  LEU B O   1 
ATOM   1533 C CB  . LEU C 1 50  ? 39.990 1.171   66.105  1.00 28.59 ? 50  LEU B CB  1 
ATOM   1534 C CG  . LEU C 1 50  ? 41.085 2.231   66.281  1.00 28.70 ? 50  LEU B CG  1 
ATOM   1535 C CD1 . LEU C 1 50  ? 42.132 1.718   67.233  1.00 26.99 ? 50  LEU B CD1 1 
ATOM   1536 C CD2 . LEU C 1 50  ? 41.736 2.627   64.945  1.00 29.38 ? 50  LEU B CD2 1 
ATOM   1537 N N   . LEU C 1 51  ? 37.120 -0.050  65.973  1.00 28.23 ? 51  LEU B N   1 
ATOM   1538 C CA  . LEU C 1 51  ? 36.264 -1.222  65.837  1.00 28.38 ? 51  LEU B CA  1 
ATOM   1539 C C   . LEU C 1 51  ? 35.146 -1.008  64.814  1.00 28.14 ? 51  LEU B C   1 
ATOM   1540 O O   . LEU C 1 51  ? 34.833 -1.880  64.021  1.00 28.37 ? 51  LEU B O   1 
ATOM   1541 C CB  . LEU C 1 51  ? 35.656 -1.557  67.194  1.00 27.69 ? 51  LEU B CB  1 
ATOM   1542 C CG  . LEU C 1 51  ? 36.539 -2.376  68.122  1.00 28.57 ? 51  LEU B CG  1 
ATOM   1543 C CD1 . LEU C 1 51  ? 36.043 -2.248  69.561  1.00 28.12 ? 51  LEU B CD1 1 
ATOM   1544 C CD2 . LEU C 1 51  ? 36.565 -3.837  67.675  1.00 27.55 ? 51  LEU B CD2 1 
ATOM   1545 N N   . ALA C 1 52  ? 34.545 0.168   64.847  1.00 28.12 ? 52  ALA B N   1 
ATOM   1546 C CA  . ALA C 1 52  ? 33.472 0.490   63.908  1.00 27.85 ? 52  ALA B CA  1 
ATOM   1547 C C   . ALA C 1 52  ? 33.939 0.338   62.468  1.00 27.50 ? 52  ALA B C   1 
ATOM   1548 O O   . ALA C 1 52  ? 33.217 -0.195  61.623  1.00 27.28 ? 52  ALA B O   1 
ATOM   1549 C CB  . ALA C 1 52  ? 32.984 1.913   64.151  1.00 27.81 ? 52  ALA B CB  1 
ATOM   1550 N N   . HIS C 1 53  ? 35.154 0.799   62.187  1.00 27.10 ? 53  HIS B N   1 
ATOM   1551 C CA  . HIS C 1 53  ? 35.680 0.718   60.844  1.00 27.19 ? 53  HIS B CA  1 
ATOM   1552 C C   . HIS C 1 53  ? 35.894 -0.726  60.404  1.00 26.70 ? 53  HIS B C   1 
ATOM   1553 O O   . HIS C 1 53  ? 35.491 -1.104  59.297  1.00 26.67 ? 53  HIS B O   1 
ATOM   1554 C CB  . HIS C 1 53  ? 36.980 1.503   60.701  1.00 27.44 ? 53  HIS B CB  1 
ATOM   1555 C CG  . HIS C 1 53  ? 37.556 1.446   59.315  1.00 27.82 ? 53  HIS B CG  1 
ATOM   1556 N ND1 . HIS C 1 53  ? 38.784 0.879   59.041  1.00 27.93 ? 53  HIS B ND1 1 
ATOM   1557 C CD2 . HIS C 1 53  ? 37.084 1.903   58.132  1.00 27.43 ? 53  HIS B CD2 1 
ATOM   1558 C CE1 . HIS C 1 53  ? 39.037 0.976   57.745  1.00 27.17 ? 53  HIS B CE1 1 
ATOM   1559 N NE2 . HIS C 1 53  ? 38.021 1.594   57.170  1.00 26.11 ? 53  HIS B NE2 1 
ATOM   1560 N N   . LYS C 1 54  ? 36.514 -1.528  61.267  1.00 26.68 ? 54  LYS B N   1 
ATOM   1561 C CA  . LYS C 1 54  ? 36.791 -2.947  60.969  1.00 26.63 ? 54  LYS B CA  1 
ATOM   1562 C C   . LYS C 1 54  ? 35.481 -3.730  60.783  1.00 26.46 ? 54  LYS B C   1 
ATOM   1563 O O   . LYS C 1 54  ? 35.387 -4.612  59.935  1.00 26.20 ? 54  LYS B O   1 
ATOM   1564 C CB  . LYS C 1 54  ? 37.598 -3.590  62.119  1.00 26.53 ? 54  LYS B CB  1 
ATOM   1565 C CG  . LYS C 1 54  ? 39.025 -3.006  62.368  1.00 27.40 ? 54  LYS B CG  1 
ATOM   1566 C CD  . LYS C 1 54  ? 39.973 -3.262  61.175  1.00 26.22 ? 54  LYS B CD  1 
ATOM   1567 C CE  . LYS C 1 54  ? 41.393 -2.755  61.494  1.00 29.91 ? 54  LYS B CE  1 
ATOM   1568 N NZ  . LYS C 1 54  ? 42.407 -3.008  60.382  1.00 29.54 ? 54  LYS B NZ  1 
ATOM   1569 N N   . ILE C 1 55  ? 34.480 -3.415  61.602  1.00 27.27 ? 55  ILE B N   1 
ATOM   1570 C CA  . ILE C 1 55  ? 33.184 -4.092  61.540  1.00 27.76 ? 55  ILE B CA  1 
ATOM   1571 C C   . ILE C 1 55  ? 32.465 -3.819  60.195  1.00 28.47 ? 55  ILE B C   1 
ATOM   1572 O O   . ILE C 1 55  ? 31.728 -4.649  59.677  1.00 28.48 ? 55  ILE B O   1 
ATOM   1573 C CB  . ILE C 1 55  ? 32.329 -3.690  62.778  1.00 28.38 ? 55  ILE B CB  1 
ATOM   1574 C CG1 . ILE C 1 55  ? 32.968 -4.273  64.048  1.00 27.32 ? 55  ILE B CG1 1 
ATOM   1575 C CG2 . ILE C 1 55  ? 30.896 -4.173  62.625  1.00 28.77 ? 55  ILE B CG2 1 
ATOM   1576 C CD1 . ILE C 1 55  ? 32.342 -3.818  65.370  1.00 26.58 ? 55  ILE B CD1 1 
ATOM   1577 N N   . GLN C 1 56  ? 32.734 -2.663  59.614  1.00 28.68 ? 56  GLN B N   1 
ATOM   1578 C CA  . GLN C 1 56  ? 32.148 -2.299  58.334  1.00 29.66 ? 56  GLN B CA  1 
ATOM   1579 C C   . GLN C 1 56  ? 33.000 -2.716  57.145  1.00 29.62 ? 56  GLN B C   1 
ATOM   1580 O O   . GLN C 1 56  ? 32.762 -2.276  56.016  1.00 30.50 ? 56  GLN B O   1 
ATOM   1581 C CB  . GLN C 1 56  ? 31.898 -0.791  58.287  1.00 29.49 ? 56  GLN B CB  1 
ATOM   1582 C CG  . GLN C 1 56  ? 30.816 -0.377  59.284  1.00 30.01 ? 56  GLN B CG  1 
ATOM   1583 C CD  . GLN C 1 56  ? 30.564 1.108   59.268  1.00 34.31 ? 56  GLN B CD  1 
ATOM   1584 O OE1 . GLN C 1 56  ? 31.361 1.865   58.726  1.00 34.87 ? 56  GLN B OE1 1 
ATOM   1585 N NE2 . GLN C 1 56  ? 29.451 1.532   59.853  1.00 33.93 ? 56  GLN B NE2 1 
ATOM   1586 N N   . SER C 1 57  ? 33.997 -3.550  57.388  1.00 29.27 ? 57  SER B N   1 
ATOM   1587 C CA  . SER C 1 57  ? 34.841 -4.013  56.309  1.00 29.47 ? 57  SER B CA  1 
ATOM   1588 C C   . SER C 1 57  ? 34.103 -4.892  55.292  1.00 29.94 ? 57  SER B C   1 
ATOM   1589 O O   . SER C 1 57  ? 33.356 -5.799  55.645  1.00 28.60 ? 57  SER B O   1 
ATOM   1590 C CB  . SER C 1 57  ? 36.022 -4.812  56.848  1.00 29.59 ? 57  SER B CB  1 
ATOM   1591 O OG  . SER C 1 57  ? 36.793 -5.323  55.758  1.00 30.19 ? 57  SER B OG  1 
ATOM   1592 N N   . PRO C 1 58  ? 34.325 -4.610  54.021  1.00 30.96 ? 58  PRO B N   1 
ATOM   1593 C CA  . PRO C 1 58  ? 33.820 -5.470  52.948  1.00 31.30 ? 58  PRO B CA  1 
ATOM   1594 C C   . PRO C 1 58  ? 34.419 -6.883  53.050  1.00 32.06 ? 58  PRO B C   1 
ATOM   1595 O O   . PRO C 1 58  ? 33.810 -7.823  52.538  1.00 32.23 ? 58  PRO B O   1 
ATOM   1596 C CB  . PRO C 1 58  ? 34.280 -4.748  51.687  1.00 31.92 ? 58  PRO B CB  1 
ATOM   1597 C CG  . PRO C 1 58  ? 34.422 -3.321  52.131  1.00 34.10 ? 58  PRO B CG  1 
ATOM   1598 C CD  . PRO C 1 58  ? 35.026 -3.414  53.513  1.00 30.60 ? 58  PRO B CD  1 
ATOM   1599 N N   . GLN C 1 59  ? 35.573 -7.034  53.701  1.00 31.04 ? 59  GLN B N   1 
ATOM   1600 C CA  . GLN C 1 59  ? 36.187 -8.348  53.843  1.00 31.99 ? 59  GLN B CA  1 
ATOM   1601 C C   . GLN C 1 59  ? 35.596 -9.001  55.071  1.00 32.32 ? 59  GLN B C   1 
ATOM   1602 O O   . GLN C 1 59  ? 35.906 -8.628  56.205  1.00 31.86 ? 59  GLN B O   1 
ATOM   1603 C CB  . GLN C 1 59  ? 37.712 -8.257  53.924  1.00 31.37 ? 59  GLN B CB  1 
ATOM   1604 C CG  . GLN C 1 59  ? 38.305 -7.428  52.774  1.00 33.98 ? 59  GLN B CG  1 
ATOM   1605 C CD  . GLN C 1 59  ? 39.807 -7.345  52.795  1.00 32.72 ? 59  GLN B CD  1 
ATOM   1606 O OE1 . GLN C 1 59  ? 40.477 -8.352  52.961  1.00 32.84 ? 59  GLN B OE1 1 
ATOM   1607 N NE2 . GLN C 1 59  ? 40.341 -6.145  52.608  1.00 32.86 ? 59  GLN B NE2 1 
ATOM   1608 N N   . GLU C 1 60  ? 34.721 -9.972  54.828  1.00 33.32 ? 60  GLU B N   1 
ATOM   1609 C CA  . GLU C 1 60  ? 33.942 -10.613 55.881  1.00 33.99 ? 60  GLU B CA  1 
ATOM   1610 C C   . GLU C 1 60  ? 34.733 -11.089 57.096  1.00 33.70 ? 60  GLU B C   1 
ATOM   1611 O O   . GLU C 1 60  ? 34.291 -10.920 58.228  1.00 33.17 ? 60  GLU B O   1 
ATOM   1612 C CB  . GLU C 1 60  ? 33.111 -11.796 55.321  1.00 35.04 ? 60  GLU B CB  1 
ATOM   1613 C CG  . GLU C 1 60  ? 32.039 -12.263 56.294  1.00 36.71 ? 60  GLU B CG  1 
ATOM   1614 C CD  . GLU C 1 60  ? 31.349 -13.572 55.888  1.00 40.66 ? 60  GLU B CD  1 
ATOM   1615 O OE1 . GLU C 1 60  ? 30.112 -13.624 55.979  1.00 42.95 ? 60  GLU B OE1 1 
ATOM   1616 O OE2 . GLU C 1 60  ? 32.034 -14.531 55.489  1.00 40.69 ? 60  GLU B OE2 1 
ATOM   1617 N N   . TRP C 1 61  ? 35.888 -11.692 56.872  1.00 34.00 ? 61  TRP B N   1 
ATOM   1618 C CA  . TRP C 1 61  ? 36.613 -12.296 57.986  1.00 34.55 ? 61  TRP B CA  1 
ATOM   1619 C C   . TRP C 1 61  ? 37.174 -11.210 58.904  1.00 34.10 ? 61  TRP B C   1 
ATOM   1620 O O   . TRP C 1 61  ? 37.307 -11.407 60.110  1.00 33.16 ? 61  TRP B O   1 
ATOM   1621 C CB  . TRP C 1 61  ? 37.718 -13.230 57.460  1.00 34.65 ? 61  TRP B CB  1 
ATOM   1622 C CG  . TRP C 1 61  ? 38.628 -13.910 58.511  1.00 34.75 ? 61  TRP B CG  1 
ATOM   1623 C CD1 . TRP C 1 61  ? 39.982 -14.059 58.418  1.00 34.17 ? 61  TRP B CD1 1 
ATOM   1624 C CD2 . TRP C 1 61  ? 38.245 -14.578 59.737  1.00 34.71 ? 61  TRP B CD2 1 
ATOM   1625 N NE1 . TRP C 1 61  ? 40.471 -14.731 59.510  1.00 32.91 ? 61  TRP B NE1 1 
ATOM   1626 C CE2 . TRP C 1 61  ? 39.428 -15.073 60.331  1.00 34.16 ? 61  TRP B CE2 1 
ATOM   1627 C CE3 . TRP C 1 61  ? 37.024 -14.796 60.397  1.00 35.67 ? 61  TRP B CE3 1 
ATOM   1628 C CZ2 . TRP C 1 61  ? 39.436 -15.757 61.551  1.00 33.46 ? 61  TRP B CZ2 1 
ATOM   1629 C CZ3 . TRP C 1 61  ? 37.034 -15.488 61.627  1.00 35.97 ? 61  TRP B CZ3 1 
ATOM   1630 C CH2 . TRP C 1 61  ? 38.234 -15.953 62.183  1.00 35.29 ? 61  TRP B CH2 1 
ATOM   1631 N N   . GLU C 1 62  ? 37.502 -10.062 58.316  1.00 33.37 ? 62  GLU B N   1 
ATOM   1632 C CA  . GLU C 1 62  ? 38.038 -8.942  59.092  1.00 32.72 ? 62  GLU B CA  1 
ATOM   1633 C C   . GLU C 1 62  ? 36.914 -8.446  59.978  1.00 32.72 ? 62  GLU B C   1 
ATOM   1634 O O   . GLU C 1 62  ? 37.104 -8.150  61.160  1.00 32.73 ? 62  GLU B O   1 
ATOM   1635 C CB  . GLU C 1 62  ? 38.523 -7.860  58.136  1.00 32.55 ? 62  GLU B CB  1 
ATOM   1636 C CG  . GLU C 1 62  ? 38.984 -6.551  58.761  1.00 32.74 ? 62  GLU B CG  1 
ATOM   1637 C CD  . GLU C 1 62  ? 39.734 -5.714  57.745  1.00 32.86 ? 62  GLU B CD  1 
ATOM   1638 O OE1 . GLU C 1 62  ? 39.089 -5.177  56.817  1.00 32.76 ? 62  GLU B OE1 1 
ATOM   1639 O OE2 . GLU C 1 62  ? 40.973 -5.671  57.823  1.00 32.64 ? 62  GLU B OE2 1 
ATOM   1640 N N   . ALA C 1 63  ? 35.730 -8.378  59.388  1.00 32.67 ? 63  ALA B N   1 
ATOM   1641 C CA  . ALA C 1 63  ? 34.535 -7.945  60.089  1.00 32.65 ? 63  ALA B CA  1 
ATOM   1642 C C   . ALA C 1 63  ? 34.193 -8.878  61.237  1.00 32.63 ? 63  ALA B C   1 
ATOM   1643 O O   . ALA C 1 63  ? 33.934 -8.427  62.355  1.00 31.40 ? 63  ALA B O   1 
ATOM   1644 C CB  . ALA C 1 63  ? 33.359 -7.872  59.115  1.00 32.17 ? 63  ALA B CB  1 
ATOM   1645 N N   . ILE C 1 64  ? 34.161 -10.178 60.942  1.00 32.71 ? 64  ILE B N   1 
ATOM   1646 C CA  . ILE C 1 64  ? 33.795 -11.159 61.953  1.00 33.24 ? 64  ILE B CA  1 
ATOM   1647 C C   . ILE C 1 64  ? 34.750 -11.123 63.145  1.00 32.18 ? 64  ILE B C   1 
ATOM   1648 O O   . ILE C 1 64  ? 34.308 -11.180 64.273  1.00 31.92 ? 64  ILE B O   1 
ATOM   1649 C CB  . ILE C 1 64  ? 33.693 -12.574 61.350  1.00 33.99 ? 64  ILE B CB  1 
ATOM   1650 C CG1 . ILE C 1 64  ? 32.439 -12.677 60.499  1.00 35.87 ? 64  ILE B CG1 1 
ATOM   1651 C CG2 . ILE C 1 64  ? 33.570 -13.646 62.467  1.00 35.22 ? 64  ILE B CG2 1 
ATOM   1652 C CD1 . ILE C 1 64  ? 31.164 -12.581 61.354  1.00 40.96 ? 64  ILE B CD1 1 
ATOM   1653 N N   . GLN C 1 65  ? 36.047 -11.007 62.884  1.00 31.22 ? 65  GLN B N   1 
ATOM   1654 C CA  . GLN C 1 65  ? 37.026 -10.938 63.962  1.00 31.23 ? 65  GLN B CA  1 
ATOM   1655 C C   . GLN C 1 65  ? 36.858 -9.673  64.792  1.00 30.70 ? 65  GLN B C   1 
ATOM   1656 O O   . GLN C 1 65  ? 37.010 -9.715  66.009  1.00 29.50 ? 65  GLN B O   1 
ATOM   1657 C CB  . GLN C 1 65  ? 38.434 -10.994 63.429  1.00 31.08 ? 65  GLN B CB  1 
ATOM   1658 C CG  . GLN C 1 65  ? 38.787 -12.318 62.797  1.00 33.22 ? 65  GLN B CG  1 
ATOM   1659 C CD  . GLN C 1 65  ? 40.150 -12.272 62.137  1.00 34.21 ? 65  GLN B CD  1 
ATOM   1660 O OE1 . GLN C 1 65  ? 40.301 -11.819 60.982  1.00 38.06 ? 65  GLN B OE1 1 
ATOM   1661 N NE2 . GLN C 1 65  ? 41.139 -12.737 62.847  1.00 33.05 ? 65  GLN B NE2 1 
ATOM   1662 N N   . ALA C 1 66  ? 36.549 -8.554  64.130  1.00 29.79 ? 66  ALA B N   1 
ATOM   1663 C CA  . ALA C 1 66  ? 36.305 -7.308  64.845  1.00 29.92 ? 66  ALA B CA  1 
ATOM   1664 C C   . ALA C 1 66  ? 35.109 -7.436  65.783  1.00 29.39 ? 66  ALA B C   1 
ATOM   1665 O O   . ALA C 1 66  ? 35.120 -6.923  66.925  1.00 29.15 ? 66  ALA B O   1 
ATOM   1666 C CB  . ALA C 1 66  ? 36.088 -6.146  63.856  1.00 29.64 ? 66  ALA B CB  1 
ATOM   1667 N N   . LEU C 1 67  ? 34.056 -8.088  65.302  1.00 29.14 ? 67  LEU B N   1 
ATOM   1668 C CA  . LEU C 1 67  ? 32.883 -8.256  66.142  1.00 30.06 ? 67  LEU B CA  1 
ATOM   1669 C C   . LEU C 1 67  ? 33.250 -9.121  67.349  1.00 30.98 ? 67  LEU B C   1 
ATOM   1670 O O   . LEU C 1 67  ? 32.718 -8.927  68.426  1.00 31.05 ? 67  LEU B O   1 
ATOM   1671 C CB  . LEU C 1 67  ? 31.726 -8.887  65.371  1.00 29.73 ? 67  LEU B CB  1 
ATOM   1672 C CG  . LEU C 1 67  ? 31.061 -7.866  64.445  1.00 30.87 ? 67  LEU B CG  1 
ATOM   1673 C CD1 . LEU C 1 67  ? 30.246 -8.573  63.382  1.00 32.74 ? 67  LEU B CD1 1 
ATOM   1674 C CD2 . LEU C 1 67  ? 30.195 -6.906  65.254  1.00 28.92 ? 67  LEU B CD2 1 
ATOM   1675 N N   . THR C 1 68  ? 34.153 -10.071 67.149  1.00 31.22 ? 68  THR B N   1 
ATOM   1676 C CA  . THR C 1 68  ? 34.594 -10.911 68.255  1.00 32.91 ? 68  THR B CA  1 
ATOM   1677 C C   . THR C 1 68  ? 35.391 -10.053 69.201  1.00 32.42 ? 68  THR B C   1 
ATOM   1678 O O   . THR C 1 68  ? 35.271 -10.182 70.418  1.00 32.64 ? 68  THR B O   1 
ATOM   1679 C CB  . THR C 1 68  ? 35.456 -12.071 67.745  1.00 32.89 ? 68  THR B CB  1 
ATOM   1680 O OG1 . THR C 1 68  ? 34.609 -13.019 67.113  1.00 34.68 ? 68  THR B OG1 1 
ATOM   1681 C CG2 . THR C 1 68  ? 36.010 -12.892 68.901  1.00 34.44 ? 68  THR B CG2 1 
ATOM   1682 N N   . VAL C 1 69  ? 36.213 -9.162  68.656  1.00 31.16 ? 69  VAL B N   1 
ATOM   1683 C CA  . VAL C 1 69  ? 36.933 -8.266  69.534  1.00 30.96 ? 69  VAL B CA  1 
ATOM   1684 C C   . VAL C 1 69  ? 35.934 -7.432  70.330  1.00 30.76 ? 69  VAL B C   1 
ATOM   1685 O O   . VAL C 1 69  ? 36.025 -7.342  71.554  1.00 30.61 ? 69  VAL B O   1 
ATOM   1686 C CB  . VAL C 1 69  ? 37.921 -7.353  68.780  1.00 30.83 ? 69  VAL B CB  1 
ATOM   1687 C CG1 . VAL C 1 69  ? 38.472 -6.310  69.734  1.00 30.27 ? 69  VAL B CG1 1 
ATOM   1688 C CG2 . VAL C 1 69  ? 39.087 -8.176  68.202  1.00 29.62 ? 69  VAL B CG2 1 
ATOM   1689 N N   . LEU C 1 70  ? 34.965 -6.854  69.634  1.00 30.90 ? 70  LEU B N   1 
ATOM   1690 C CA  . LEU C 1 70  ? 33.938 -6.033  70.274  1.00 31.62 ? 70  LEU B CA  1 
ATOM   1691 C C   . LEU C 1 70  ? 33.252 -6.822  71.396  1.00 32.71 ? 70  LEU B C   1 
ATOM   1692 O O   . LEU C 1 70  ? 33.097 -6.328  72.512  1.00 32.28 ? 70  LEU B O   1 
ATOM   1693 C CB  . LEU C 1 70  ? 32.899 -5.555  69.237  1.00 30.82 ? 70  LEU B CB  1 
ATOM   1694 C CG  . LEU C 1 70  ? 31.642 -4.874  69.781  1.00 30.92 ? 70  LEU B CG  1 
ATOM   1695 C CD1 . LEU C 1 70  ? 32.005 -3.770  70.777  1.00 27.24 ? 70  LEU B CD1 1 
ATOM   1696 C CD2 . LEU C 1 70  ? 30.762 -4.337  68.648  1.00 29.56 ? 70  LEU B CD2 1 
ATOM   1697 N N   . GLU C 1 71  ? 32.854 -8.053  71.094  1.00 34.17 ? 71  GLU B N   1 
ATOM   1698 C CA  . GLU C 1 71  ? 32.164 -8.882  72.084  1.00 36.21 ? 71  GLU B CA  1 
ATOM   1699 C C   . GLU C 1 71  ? 33.033 -9.111  73.312  1.00 35.97 ? 71  GLU B C   1 
ATOM   1700 O O   . GLU C 1 71  ? 32.578 -8.971  74.449  1.00 36.52 ? 71  GLU B O   1 
ATOM   1701 C CB  . GLU C 1 71  ? 31.757 -10.221 71.469  1.00 36.29 ? 71  GLU B CB  1 
ATOM   1702 C CG  . GLU C 1 71  ? 31.359 -11.266 72.503  1.00 40.11 ? 71  GLU B CG  1 
ATOM   1703 C CD  . GLU C 1 71  ? 30.779 -12.522 71.877  1.00 44.30 ? 71  GLU B CD  1 
ATOM   1704 O OE1 . GLU C 1 71  ? 31.175 -12.862 70.742  1.00 46.22 ? 71  GLU B OE1 1 
ATOM   1705 O OE2 . GLU C 1 71  ? 29.929 -13.171 72.527  1.00 48.21 ? 71  GLU B OE2 1 
ATOM   1706 N N   . THR C 1 72  ? 34.294 -9.438  73.067  1.00 36.27 ? 72  THR B N   1 
ATOM   1707 C CA  . THR C 1 72  ? 35.250 -9.702  74.124  1.00 36.47 ? 72  THR B CA  1 
ATOM   1708 C C   . THR C 1 72  ? 35.469 -8.522  75.046  1.00 36.66 ? 72  THR B C   1 
ATOM   1709 O O   . THR C 1 72  ? 35.410 -8.668  76.265  1.00 36.80 ? 72  THR B O   1 
ATOM   1710 C CB  . THR C 1 72  ? 36.574 -10.183 73.512  1.00 36.49 ? 72  THR B CB  1 
ATOM   1711 O OG1 . THR C 1 72  ? 36.316 -11.342 72.702  1.00 36.54 ? 72  THR B OG1 1 
ATOM   1712 C CG2 . THR C 1 72  ? 37.506 -10.712 74.591  1.00 37.07 ? 72  THR B CG2 1 
ATOM   1713 N N   . CYS C 1 73  ? 35.689 -7.338  74.467  1.00 36.45 ? 73  CYS B N   1 
ATOM   1714 C CA  . CYS C 1 73  ? 35.951 -6.151  75.255  1.00 36.44 ? 73  CYS B CA  1 
ATOM   1715 C C   . CYS C 1 73  ? 34.746 -5.710  76.076  1.00 36.32 ? 73  CYS B C   1 
ATOM   1716 O O   . CYS C 1 73  ? 34.902 -5.109  77.129  1.00 35.58 ? 73  CYS B O   1 
ATOM   1717 C CB  . CYS C 1 73  ? 36.419 -4.995  74.357  1.00 36.88 ? 73  CYS B CB  1 
ATOM   1718 S SG  . CYS C 1 73  ? 38.043 -5.270  73.612  1.00 36.57 ? 73  CYS B SG  1 
ATOM   1719 N N   . MET C 1 74  ? 33.541 -5.993  75.590  1.00 37.03 ? 74  MET B N   1 
ATOM   1720 C CA  . MET C 1 74  ? 32.337 -5.626  76.336  1.00 38.22 ? 74  MET B CA  1 
ATOM   1721 C C   . MET C 1 74  ? 32.216 -6.512  77.585  1.00 38.98 ? 74  MET B C   1 
ATOM   1722 O O   . MET C 1 74  ? 31.765 -6.082  78.644  1.00 39.83 ? 74  MET B O   1 
ATOM   1723 C CB  . MET C 1 74  ? 31.095 -5.715  75.445  1.00 38.34 ? 74  MET B CB  1 
ATOM   1724 C CG  . MET C 1 74  ? 30.939 -4.488  74.497  1.00 38.16 ? 74  MET B CG  1 
ATOM   1725 S SD  . MET C 1 74  ? 30.487 -2.903  75.277  1.00 38.59 ? 74  MET B SD  1 
ATOM   1726 C CE  . MET C 1 74  ? 28.877 -3.291  75.849  1.00 38.45 ? 74  MET B CE  1 
ATOM   1727 N N   . LYS C 1 75  ? 32.636 -7.752  77.472  1.00 39.86 ? 75  LYS B N   1 
ATOM   1728 C CA  . LYS C 1 75  ? 32.633 -8.625  78.640  1.00 41.26 ? 75  LYS B CA  1 
ATOM   1729 C C   . LYS C 1 75  ? 33.818 -8.400  79.600  1.00 41.36 ? 75  LYS B C   1 
ATOM   1730 O O   . LYS C 1 75  ? 33.657 -8.560  80.805  1.00 41.43 ? 75  LYS B O   1 
ATOM   1731 C CB  . LYS C 1 75  ? 32.523 -10.082 78.204  1.00 42.17 ? 75  LYS B CB  1 
ATOM   1732 C CG  . LYS C 1 75  ? 31.076 -10.499 78.028  1.00 43.98 ? 75  LYS B CG  1 
ATOM   1733 C CD  . LYS C 1 75  ? 30.887 -11.496 76.909  1.00 49.67 ? 75  LYS B CD  1 
ATOM   1734 C CE  . LYS C 1 75  ? 31.575 -12.805 77.179  1.00 51.98 ? 75  LYS B CE  1 
ATOM   1735 N NZ  . LYS C 1 75  ? 31.091 -13.775 76.171  1.00 53.53 ? 75  LYS B NZ  1 
ATOM   1736 N N   . SER C 1 76  ? 34.974 -7.968  79.090  1.00 40.49 ? 76  SER B N   1 
ATOM   1737 C CA  . SER C 1 76  ? 36.165 -7.767  79.930  1.00 40.41 ? 76  SER B CA  1 
ATOM   1738 C C   . SER C 1 76  ? 36.315 -6.372  80.503  1.00 40.22 ? 76  SER B C   1 
ATOM   1739 O O   . SER C 1 76  ? 36.943 -6.185  81.542  1.00 40.14 ? 76  SER B O   1 
ATOM   1740 C CB  . SER C 1 76  ? 37.449 -8.042  79.137  1.00 40.36 ? 76  SER B CB  1 
ATOM   1741 O OG  . SER C 1 76  ? 37.290 -9.135  78.266  1.00 42.62 ? 76  SER B OG  1 
ATOM   1742 N N   . CYS C 1 77  ? 35.763 -5.384  79.821  1.00 39.85 ? 77  CYS B N   1 
ATOM   1743 C CA  . CYS C 1 77  ? 35.955 -4.000  80.218  1.00 39.68 ? 77  CYS B CA  1 
ATOM   1744 C C   . CYS C 1 77  ? 34.843 -3.391  81.085  1.00 40.39 ? 77  CYS B C   1 
ATOM   1745 O O   . CYS C 1 77  ? 33.785 -3.987  81.268  1.00 40.15 ? 77  CYS B O   1 
ATOM   1746 C CB  . CYS C 1 77  ? 36.234 -3.158  78.967  1.00 39.97 ? 77  CYS B CB  1 
ATOM   1747 S SG  . CYS C 1 77  ? 37.776 -3.671  78.141  1.00 39.49 ? 77  CYS B SG  1 
ATOM   1748 N N   . GLY C 1 78  ? 35.113 -2.205  81.623  1.00 41.03 ? 78  GLY B N   1 
ATOM   1749 C CA  . GLY C 1 78  ? 34.196 -1.536  82.523  1.00 42.80 ? 78  GLY B CA  1 
ATOM   1750 C C   . GLY C 1 78  ? 33.364 -0.439  81.902  1.00 43.77 ? 78  GLY B C   1 
ATOM   1751 O O   . GLY C 1 78  ? 33.160 -0.394  80.675  1.00 43.05 ? 78  GLY B O   1 
ATOM   1752 N N   . LYS C 1 79  ? 32.907 0.472   82.754  1.00 45.10 ? 79  LYS B N   1 
ATOM   1753 C CA  . LYS C 1 79  ? 31.990 1.531   82.329  1.00 46.22 ? 79  LYS B CA  1 
ATOM   1754 C C   . LYS C 1 79  ? 32.487 2.468   81.241  1.00 46.04 ? 79  LYS B C   1 
ATOM   1755 O O   . LYS C 1 79  ? 31.719 2.875   80.393  1.00 46.40 ? 79  LYS B O   1 
ATOM   1756 C CB  . LYS C 1 79  ? 31.533 2.376   83.519  1.00 46.84 ? 79  LYS B CB  1 
ATOM   1757 C CG  . LYS C 1 79  ? 30.261 3.172   83.208  1.00 47.83 ? 79  LYS B CG  1 
ATOM   1758 C CD  . LYS C 1 79  ? 29.874 4.109   84.344  1.00 51.22 ? 79  LYS B CD  1 
ATOM   1759 C CE  . LYS C 1 79  ? 28.380 4.441   84.320  1.00 51.77 ? 79  LYS B CE  1 
ATOM   1760 N NZ  . LYS C 1 79  ? 27.924 5.238   83.139  1.00 54.19 ? 79  LYS B NZ  1 
ATOM   1761 N N   . ARG C 1 80  ? 33.745 2.867   81.293  1.00 46.30 ? 80  ARG B N   1 
ATOM   1762 C CA  . ARG C 1 80  ? 34.247 3.784   80.278  1.00 46.73 ? 80  ARG B CA  1 
ATOM   1763 C C   . ARG C 1 80  ? 33.955 3.221   78.880  1.00 45.88 ? 80  ARG B C   1 
ATOM   1764 O O   . ARG C 1 80  ? 33.449 3.939   78.025  1.00 46.12 ? 80  ARG B O   1 
ATOM   1765 C CB  . ARG C 1 80  ? 35.736 4.031   80.465  1.00 47.36 ? 80  ARG B CB  1 
ATOM   1766 C CG  . ARG C 1 80  ? 36.105 5.316   81.197  1.00 50.59 ? 80  ARG B CG  1 
ATOM   1767 C CD  . ARG C 1 80  ? 36.545 6.422   80.262  1.00 56.01 ? 80  ARG B CD  1 
ATOM   1768 N NE  . ARG C 1 80  ? 37.434 7.392   80.897  1.00 59.92 ? 80  ARG B NE  1 
ATOM   1769 C CZ  . ARG C 1 80  ? 37.031 8.361   81.717  1.00 61.72 ? 80  ARG B CZ  1 
ATOM   1770 N NH1 . ARG C 1 80  ? 35.743 8.483   82.027  1.00 61.57 ? 80  ARG B NH1 1 
ATOM   1771 N NH2 . ARG C 1 80  ? 37.918 9.209   82.231  1.00 62.50 ? 80  ARG B NH2 1 
ATOM   1772 N N   . PHE C 1 81  ? 34.257 1.937   78.670  1.00 44.63 ? 81  PHE B N   1 
ATOM   1773 C CA  . PHE C 1 81  ? 34.030 1.272   77.370  1.00 43.36 ? 81  PHE B CA  1 
ATOM   1774 C C   . PHE C 1 81  ? 32.551 0.956   77.093  1.00 43.21 ? 81  PHE B C   1 
ATOM   1775 O O   . PHE C 1 81  ? 32.102 1.037   75.951  1.00 42.26 ? 81  PHE B O   1 
ATOM   1776 C CB  . PHE C 1 81  ? 34.860 -0.021  77.250  1.00 42.64 ? 81  PHE B CB  1 
ATOM   1777 C CG  . PHE C 1 81  ? 34.760 -0.686  75.899  1.00 41.98 ? 81  PHE B CG  1 
ATOM   1778 C CD1 . PHE C 1 81  ? 33.963 -1.797  75.708  1.00 41.26 ? 81  PHE B CD1 1 
ATOM   1779 C CD2 . PHE C 1 81  ? 35.439 -0.156  74.811  1.00 41.87 ? 81  PHE B CD2 1 
ATOM   1780 C CE1 . PHE C 1 81  ? 33.872 -2.393  74.460  1.00 43.00 ? 81  PHE B CE1 1 
ATOM   1781 C CE2 . PHE C 1 81  ? 35.350 -0.743  73.563  1.00 42.16 ? 81  PHE B CE2 1 
ATOM   1782 C CZ  . PHE C 1 81  ? 34.562 -1.860  73.384  1.00 40.67 ? 81  PHE B CZ  1 
ATOM   1783 N N   . HIS C 1 82  ? 31.804 0.550   78.115  1.00 42.83 ? 82  HIS B N   1 
ATOM   1784 C CA  . HIS C 1 82  ? 30.378 0.308   77.904  1.00 43.48 ? 82  HIS B CA  1 
ATOM   1785 C C   . HIS C 1 82  ? 29.724 1.628   77.492  1.00 43.14 ? 82  HIS B C   1 
ATOM   1786 O O   . HIS C 1 82  ? 28.892 1.665   76.584  1.00 43.07 ? 82  HIS B O   1 
ATOM   1787 C CB  . HIS C 1 82  ? 29.705 -0.232  79.162  1.00 43.79 ? 82  HIS B CB  1 
ATOM   1788 C CG  . HIS C 1 82  ? 30.198 -1.582  79.579  1.00 45.25 ? 82  HIS B CG  1 
ATOM   1789 N ND1 . HIS C 1 82  ? 30.859 -2.432  78.719  1.00 47.86 ? 82  HIS B ND1 1 
ATOM   1790 C CD2 . HIS C 1 82  ? 30.130 -2.226  80.766  1.00 46.12 ? 82  HIS B CD2 1 
ATOM   1791 C CE1 . HIS C 1 82  ? 31.171 -3.545  79.357  1.00 47.04 ? 82  HIS B CE1 1 
ATOM   1792 N NE2 . HIS C 1 82  ? 30.739 -3.444  80.602  1.00 48.03 ? 82  HIS B NE2 1 
ATOM   1793 N N   . ASP C 1 83  ? 30.123 2.711   78.160  1.00 42.71 ? 83  ASP B N   1 
ATOM   1794 C CA  . ASP C 1 83  ? 29.586 4.046   77.882  1.00 42.82 ? 83  ASP B CA  1 
ATOM   1795 C C   . ASP C 1 83  ? 29.853 4.516   76.431  1.00 42.52 ? 83  ASP B C   1 
ATOM   1796 O O   . ASP C 1 83  ? 29.026 5.210   75.824  1.00 41.53 ? 83  ASP B O   1 
ATOM   1797 C CB  . ASP C 1 83  ? 30.192 5.071   78.837  1.00 42.64 ? 83  ASP B CB  1 
ATOM   1798 C CG  . ASP C 1 83  ? 29.592 5.027   80.247  1.00 43.83 ? 83  ASP B CG  1 
ATOM   1799 O OD1 . ASP C 1 83  ? 28.682 4.205   80.559  1.00 42.76 ? 83  ASP B OD1 1 
ATOM   1800 O OD2 . ASP C 1 83  ? 30.013 5.814   81.117  1.00 44.68 ? 83  ASP B OD2 1 
ATOM   1801 N N   . GLU C 1 84  ? 31.030 4.186   75.899  1.00 42.20 ? 84  GLU B N   1 
ATOM   1802 C CA  . GLU C 1 84  ? 31.373 4.599   74.544  1.00 42.20 ? 84  GLU B CA  1 
ATOM   1803 C C   . GLU C 1 84  ? 30.600 3.751   73.545  1.00 41.55 ? 84  GLU B C   1 
ATOM   1804 O O   . GLU C 1 84  ? 30.125 4.256   72.548  1.00 41.22 ? 84  GLU B O   1 
ATOM   1805 C CB  . GLU C 1 84  ? 32.873 4.472   74.271  1.00 42.40 ? 84  GLU B CB  1 
ATOM   1806 C CG  . GLU C 1 84  ? 33.745 5.524   74.925  1.00 44.06 ? 84  GLU B CG  1 
ATOM   1807 C CD  . GLU C 1 84  ? 33.242 6.935   74.699  1.00 46.91 ? 84  GLU B CD  1 
ATOM   1808 O OE1 . GLU C 1 84  ? 32.897 7.305   73.554  1.00 48.54 ? 84  GLU B OE1 1 
ATOM   1809 O OE2 . GLU C 1 84  ? 33.194 7.689   75.687  1.00 49.20 ? 84  GLU B OE2 1 
ATOM   1810 N N   . VAL C 1 85  ? 30.470 2.463   73.813  1.00 41.37 ? 85  VAL B N   1 
ATOM   1811 C CA  . VAL C 1 85  ? 29.726 1.596   72.911  1.00 40.90 ? 85  VAL B CA  1 
ATOM   1812 C C   . VAL C 1 85  ? 28.226 1.865   73.037  1.00 41.64 ? 85  VAL B C   1 
ATOM   1813 O O   . VAL C 1 85  ? 27.440 1.625   72.104  1.00 40.82 ? 85  VAL B O   1 
ATOM   1814 C CB  . VAL C 1 85  ? 30.009 0.119   73.216  1.00 40.70 ? 85  VAL B CB  1 
ATOM   1815 C CG1 . VAL C 1 85  ? 28.972 -0.788  72.560  1.00 40.24 ? 85  VAL B CG1 1 
ATOM   1816 C CG2 . VAL C 1 85  ? 31.408 -0.264  72.762  1.00 39.23 ? 85  VAL B CG2 1 
ATOM   1817 N N   . GLY C 1 86  ? 27.834 2.396   74.194  1.00 41.63 ? 86  GLY B N   1 
ATOM   1818 C CA  . GLY C 1 86  ? 26.432 2.597   74.504  1.00 42.64 ? 86  GLY B CA  1 
ATOM   1819 C C   . GLY C 1 86  ? 25.920 3.912   73.963  1.00 43.83 ? 86  GLY B C   1 
ATOM   1820 O O   . GLY C 1 86  ? 24.772 4.286   74.195  1.00 45.04 ? 86  GLY B O   1 
ATOM   1821 N N   . LYS C 1 87  ? 26.793 4.617   73.253  1.00 44.18 ? 87  LYS B N   1 
ATOM   1822 C CA  . LYS C 1 87  ? 26.455 5.877   72.608  1.00 44.64 ? 87  LYS B CA  1 
ATOM   1823 C C   . LYS C 1 87  ? 26.010 5.651   71.164  1.00 44.60 ? 87  LYS B C   1 
ATOM   1824 O O   . LYS C 1 87  ? 26.545 4.765   70.474  1.00 43.62 ? 87  LYS B O   1 
ATOM   1825 C CB  . LYS C 1 87  ? 27.676 6.787   72.573  1.00 44.99 ? 87  LYS B CB  1 
ATOM   1826 C CG  . LYS C 1 87  ? 28.045 7.394   73.901  1.00 46.72 ? 87  LYS B CG  1 
ATOM   1827 C CD  . LYS C 1 87  ? 28.505 8.829   73.695  1.00 49.98 ? 87  LYS B CD  1 
ATOM   1828 C CE  . LYS C 1 87  ? 30.008 8.937   73.536  1.00 50.78 ? 87  LYS B CE  1 
ATOM   1829 N NZ  . LYS C 1 87  ? 30.641 9.290   74.830  1.00 51.32 ? 87  LYS B NZ  1 
ATOM   1830 N N   . PHE C 1 88  ? 25.071 6.486   70.698  1.00 44.19 ? 88  PHE B N   1 
ATOM   1831 C CA  . PHE C 1 88  ? 24.588 6.407   69.318  1.00 43.59 ? 88  PHE B CA  1 
ATOM   1832 C C   . PHE C 1 88  ? 25.730 6.585   68.330  1.00 43.01 ? 88  PHE B C   1 
ATOM   1833 O O   . PHE C 1 88  ? 25.727 5.982   67.260  1.00 43.55 ? 88  PHE B O   1 
ATOM   1834 C CB  . PHE C 1 88  ? 23.430 7.401   69.053  1.00 43.38 ? 88  PHE B CB  1 
ATOM   1835 C CG  . PHE C 1 88  ? 22.146 7.035   69.762  1.00 43.79 ? 88  PHE B CG  1 
ATOM   1836 C CD1 . PHE C 1 88  ? 21.689 5.735   69.760  1.00 43.95 ? 88  PHE B CD1 1 
ATOM   1837 C CD2 . PHE C 1 88  ? 21.414 7.987   70.447  1.00 44.63 ? 88  PHE B CD2 1 
ATOM   1838 C CE1 . PHE C 1 88  ? 20.530 5.388   70.411  1.00 45.24 ? 88  PHE B CE1 1 
ATOM   1839 C CE2 . PHE C 1 88  ? 20.247 7.652   71.101  1.00 45.06 ? 88  PHE B CE2 1 
ATOM   1840 C CZ  . PHE C 1 88  ? 19.802 6.349   71.092  1.00 45.40 ? 88  PHE B CZ  1 
ATOM   1841 N N   . ARG C 1 89  ? 26.719 7.396   68.696  1.00 42.59 ? 89  ARG B N   1 
ATOM   1842 C CA  . ARG C 1 89  ? 27.892 7.603   67.850  1.00 42.40 ? 89  ARG B CA  1 
ATOM   1843 C C   . ARG C 1 89  ? 28.515 6.270   67.428  1.00 40.65 ? 89  ARG B C   1 
ATOM   1844 O O   . ARG C 1 89  ? 29.086 6.164   66.355  1.00 41.45 ? 89  ARG B O   1 
ATOM   1845 C CB  . ARG C 1 89  ? 28.933 8.467   68.576  1.00 43.20 ? 89  ARG B CB  1 
ATOM   1846 C CG  . ARG C 1 89  ? 30.071 8.984   67.707  1.00 46.55 ? 89  ARG B CG  1 
ATOM   1847 C CD  . ARG C 1 89  ? 30.736 10.278  68.234  1.00 51.98 ? 89  ARG B CD  1 
ATOM   1848 N NE  . ARG C 1 89  ? 30.233 10.664  69.553  1.00 56.91 ? 89  ARG B NE  1 
ATOM   1849 C CZ  . ARG C 1 89  ? 29.799 11.883  69.878  1.00 58.68 ? 89  ARG B CZ  1 
ATOM   1850 N NH1 . ARG C 1 89  ? 29.359 12.117  71.107  1.00 60.00 ? 89  ARG B NH1 1 
ATOM   1851 N NH2 . ARG C 1 89  ? 29.799 12.866  68.987  1.00 58.36 ? 89  ARG B NH2 1 
ATOM   1852 N N   . PHE C 1 90  ? 28.431 5.256   68.276  1.00 38.99 ? 90  PHE B N   1 
ATOM   1853 C CA  . PHE C 1 90  ? 28.967 3.945   67.903  1.00 37.54 ? 90  PHE B CA  1 
ATOM   1854 C C   . PHE C 1 90  ? 27.867 3.024   67.398  1.00 36.96 ? 90  PHE B C   1 
ATOM   1855 O O   . PHE C 1 90  ? 28.015 2.328   66.388  1.00 35.95 ? 90  PHE B O   1 
ATOM   1856 C CB  . PHE C 1 90  ? 29.683 3.261   69.078  1.00 36.94 ? 90  PHE B CB  1 
ATOM   1857 C CG  . PHE C 1 90  ? 30.198 1.885   68.738  1.00 34.24 ? 90  PHE B CG  1 
ATOM   1858 C CD1 . PHE C 1 90  ? 31.358 1.733   67.984  1.00 32.86 ? 90  PHE B CD1 1 
ATOM   1859 C CD2 . PHE C 1 90  ? 29.510 0.749   69.136  1.00 32.46 ? 90  PHE B CD2 1 
ATOM   1860 C CE1 . PHE C 1 90  ? 31.829 0.454   67.637  1.00 31.78 ? 90  PHE B CE1 1 
ATOM   1861 C CE2 . PHE C 1 90  ? 29.980 -0.527  68.810  1.00 33.07 ? 90  PHE B CE2 1 
ATOM   1862 C CZ  . PHE C 1 90  ? 31.145 -0.668  68.055  1.00 31.82 ? 90  PHE B CZ  1 
ATOM   1863 N N   . LEU C 1 91  ? 26.770 3.009   68.137  1.00 36.36 ? 91  LEU B N   1 
ATOM   1864 C CA  . LEU C 1 91  ? 25.613 2.177   67.805  1.00 36.55 ? 91  LEU B CA  1 
ATOM   1865 C C   . LEU C 1 91  ? 25.134 2.378   66.376  1.00 35.88 ? 91  LEU B C   1 
ATOM   1866 O O   . LEU C 1 91  ? 24.811 1.413   65.708  1.00 36.18 ? 91  LEU B O   1 
ATOM   1867 C CB  . LEU C 1 91  ? 24.452 2.475   68.755  1.00 36.37 ? 91  LEU B CB  1 
ATOM   1868 C CG  . LEU C 1 91  ? 24.661 1.922   70.160  1.00 37.87 ? 91  LEU B CG  1 
ATOM   1869 C CD1 . LEU C 1 91  ? 23.502 2.316   71.068  1.00 39.27 ? 91  LEU B CD1 1 
ATOM   1870 C CD2 . LEU C 1 91  ? 24.805 0.402   70.077  1.00 38.24 ? 91  LEU B CD2 1 
ATOM   1871 N N   . ASN C 1 92  ? 25.072 3.633   65.931  1.00 35.39 ? 92  ASN B N   1 
ATOM   1872 C CA  . ASN C 1 92  ? 24.668 3.951   64.561  1.00 35.21 ? 92  ASN B CA  1 
ATOM   1873 C C   . ASN C 1 92  ? 25.513 3.203   63.546  1.00 34.82 ? 92  ASN B C   1 
ATOM   1874 O O   . ASN C 1 92  ? 25.007 2.689   62.544  1.00 34.35 ? 92  ASN B O   1 
ATOM   1875 C CB  . ASN C 1 92  ? 24.798 5.460   64.300  1.00 35.14 ? 92  ASN B CB  1 
ATOM   1876 C CG  . ASN C 1 92  ? 23.678 6.276   64.954  1.00 36.59 ? 92  ASN B CG  1 
ATOM   1877 O OD1 . ASN C 1 92  ? 23.726 7.514   64.985  1.00 38.73 ? 92  ASN B OD1 1 
ATOM   1878 N ND2 . ASN C 1 92  ? 22.687 5.592   65.486  1.00 36.38 ? 92  ASN B ND2 1 
ATOM   1879 N N   . GLU C 1 93  ? 26.821 3.171   63.797  1.00 34.38 ? 93  GLU B N   1 
ATOM   1880 C CA  . GLU C 1 93  ? 27.755 2.479   62.909  1.00 34.45 ? 93  GLU B CA  1 
ATOM   1881 C C   . GLU C 1 93  ? 27.418 0.986   62.806  1.00 33.93 ? 93  GLU B C   1 
ATOM   1882 O O   . GLU C 1 93  ? 27.632 0.362   61.770  1.00 34.76 ? 93  GLU B O   1 
ATOM   1883 C CB  . GLU C 1 93  ? 29.217 2.704   63.355  1.00 34.72 ? 93  GLU B CB  1 
ATOM   1884 C CG  . GLU C 1 93  ? 29.693 4.164   63.319  1.00 35.59 ? 93  GLU B CG  1 
ATOM   1885 C CD  . GLU C 1 93  ? 29.291 4.895   62.042  1.00 39.90 ? 93  GLU B CD  1 
ATOM   1886 O OE1 . GLU C 1 93  ? 29.441 4.328   60.950  1.00 38.24 ? 93  GLU B OE1 1 
ATOM   1887 O OE2 . GLU C 1 93  ? 28.786 6.037   62.124  1.00 45.16 ? 93  GLU B OE2 1 
ATOM   1888 N N   . LEU C 1 94  ? 26.838 0.414   63.849  1.00 33.73 ? 94  LEU B N   1 
ATOM   1889 C CA  . LEU C 1 94  ? 26.446 -0.998  63.779  1.00 33.58 ? 94  LEU B CA  1 
ATOM   1890 C C   . LEU C 1 94  ? 25.136 -1.109  62.989  1.00 33.65 ? 94  LEU B C   1 
ATOM   1891 O O   . LEU C 1 94  ? 24.940 -2.023  62.193  1.00 32.15 ? 94  LEU B O   1 
ATOM   1892 C CB  . LEU C 1 94  ? 26.224 -1.580  65.182  1.00 34.30 ? 94  LEU B CB  1 
ATOM   1893 C CG  . LEU C 1 94  ? 27.395 -1.730  66.165  1.00 34.88 ? 94  LEU B CG  1 
ATOM   1894 C CD1 . LEU C 1 94  ? 26.942 -2.318  67.511  1.00 33.27 ? 94  LEU B CD1 1 
ATOM   1895 C CD2 . LEU C 1 94  ? 28.497 -2.592  65.558  1.00 33.95 ? 94  LEU B CD2 1 
ATOM   1896 N N   . ILE C 1 95  ? 24.231 -0.180  63.271  1.00 33.39 ? 95  ILE B N   1 
ATOM   1897 C CA  . ILE C 1 95  ? 22.947 -0.097  62.595  1.00 34.99 ? 95  ILE B CA  1 
ATOM   1898 C C   . ILE C 1 95  ? 23.122 -0.007  61.079  1.00 34.75 ? 95  ILE B C   1 
ATOM   1899 O O   . ILE C 1 95  ? 22.389 -0.643  60.333  1.00 34.86 ? 95  ILE B O   1 
ATOM   1900 C CB  . ILE C 1 95  ? 22.174 1.115   63.159  1.00 34.99 ? 95  ILE B CB  1 
ATOM   1901 C CG1 . ILE C 1 95  ? 21.812 0.850   64.630  1.00 35.91 ? 95  ILE B CG1 1 
ATOM   1902 C CG2 . ILE C 1 95  ? 20.945 1.429   62.344  1.00 36.33 ? 95  ILE B CG2 1 
ATOM   1903 C CD1 . ILE C 1 95  ? 21.249 2.058   65.339  1.00 36.19 ? 95  ILE B CD1 1 
ATOM   1904 N N   . LYS C 1 96  ? 24.127 0.739   60.632  1.00 35.22 ? 96  LYS B N   1 
ATOM   1905 C CA  . LYS C 1 96  ? 24.394 0.877   59.206  1.00 35.15 ? 96  LYS B CA  1 
ATOM   1906 C C   . LYS C 1 96  ? 24.661 -0.467  58.565  1.00 35.57 ? 96  LYS B C   1 
ATOM   1907 O O   . LYS C 1 96  ? 24.242 -0.701  57.428  1.00 35.36 ? 96  LYS B O   1 
ATOM   1908 C CB  . LYS C 1 96  ? 25.562 1.835   58.931  1.00 35.01 ? 96  LYS B CB  1 
ATOM   1909 C CG  . LYS C 1 96  ? 25.276 3.300   59.244  1.00 36.15 ? 96  LYS B CG  1 
ATOM   1910 C CD  . LYS C 1 96  ? 26.501 4.202   58.997  1.00 38.09 ? 96  LYS B CD  1 
ATOM   1911 C CE  . LYS C 1 96  ? 26.278 5.578   59.646  1.00 40.76 ? 96  LYS B CE  1 
ATOM   1912 N NZ  . LYS C 1 96  ? 27.434 6.501   59.499  1.00 40.24 ? 96  LYS B NZ  1 
ATOM   1913 N N   . VAL C 1 97  ? 25.331 -1.361  59.296  1.00 35.71 ? 97  VAL B N   1 
ATOM   1914 C CA  . VAL C 1 97  ? 25.668 -2.679  58.766  1.00 36.00 ? 97  VAL B CA  1 
ATOM   1915 C C   . VAL C 1 97  ? 24.404 -3.541  58.610  1.00 37.47 ? 97  VAL B C   1 
ATOM   1916 O O   . VAL C 1 97  ? 24.268 -4.301  57.649  1.00 37.14 ? 97  VAL B O   1 
ATOM   1917 C CB  . VAL C 1 97  ? 26.746 -3.382  59.640  1.00 36.55 ? 97  VAL B CB  1 
ATOM   1918 C CG1 . VAL C 1 97  ? 27.118 -4.779  59.088  1.00 35.43 ? 97  VAL B CG1 1 
ATOM   1919 C CG2 . VAL C 1 97  ? 28.029 -2.492  59.742  1.00 35.50 ? 97  VAL B CG2 1 
ATOM   1920 N N   . VAL C 1 98  ? 23.458 -3.405  59.528  1.00 37.96 ? 98  VAL B N   1 
ATOM   1921 C CA  . VAL C 1 98  ? 22.253 -4.228  59.429  1.00 39.31 ? 98  VAL B CA  1 
ATOM   1922 C C   . VAL C 1 98  ? 21.108 -3.633  58.593  1.00 40.14 ? 98  VAL B C   1 
ATOM   1923 O O   . VAL C 1 98  ? 20.226 -4.365  58.173  1.00 41.10 ? 98  VAL B O   1 
ATOM   1924 C CB  . VAL C 1 98  ? 21.690 -4.615  60.812  1.00 38.88 ? 98  VAL B CB  1 
ATOM   1925 C CG1 . VAL C 1 98  ? 22.664 -5.513  61.577  1.00 38.13 ? 98  VAL B CG1 1 
ATOM   1926 C CG2 . VAL C 1 98  ? 21.341 -3.385  61.617  1.00 39.30 ? 98  VAL B CG2 1 
ATOM   1927 N N   . SER C 1 99  ? 21.118 -2.326  58.344  1.00 41.08 ? 99  SER B N   1 
ATOM   1928 C CA  . SER C 1 99  ? 20.026 -1.697  57.608  1.00 42.13 ? 99  SER B CA  1 
ATOM   1929 C C   . SER C 1 99  ? 20.175 -1.762  56.097  1.00 42.80 ? 99  SER B C   1 
ATOM   1930 O O   . SER C 1 99  ? 21.216 -1.408  55.542  1.00 42.14 ? 99  SER B O   1 
ATOM   1931 C CB  . SER C 1 99  ? 19.843 -0.242  58.035  1.00 42.56 ? 99  SER B CB  1 
ATOM   1932 O OG  . SER C 1 99  ? 19.028 0.441   57.101  1.00 42.71 ? 99  SER B OG  1 
ATOM   1933 N N   . PRO C 1 100 ? 19.119 -2.235  55.439  1.00 43.75 ? 100 PRO B N   1 
ATOM   1934 C CA  . PRO C 1 100 ? 19.065 -2.306  53.975  1.00 43.92 ? 100 PRO B CA  1 
ATOM   1935 C C   . PRO C 1 100 ? 19.288 -0.950  53.308  1.00 44.16 ? 100 PRO B C   1 
ATOM   1936 O O   . PRO C 1 100 ? 19.826 -0.886  52.205  1.00 44.28 ? 100 PRO B O   1 
ATOM   1937 C CB  . PRO C 1 100 ? 17.636 -2.789  53.709  1.00 44.18 ? 100 PRO B CB  1 
ATOM   1938 C CG  . PRO C 1 100 ? 17.267 -3.564  54.946  1.00 44.66 ? 100 PRO B CG  1 
ATOM   1939 C CD  . PRO C 1 100 ? 17.908 -2.794  56.071  1.00 44.14 ? 100 PRO B CD  1 
ATOM   1940 N N   . LYS C 1 101 ? 18.864 0.118   53.975  1.00 44.50 ? 101 LYS B N   1 
ATOM   1941 C CA  . LYS C 1 101 ? 19.009 1.483   53.459  1.00 45.03 ? 101 LYS B CA  1 
ATOM   1942 C C   . LYS C 1 101 ? 20.462 1.937   53.413  1.00 44.14 ? 101 LYS B C   1 
ATOM   1943 O O   . LYS C 1 101 ? 20.812 2.898   52.724  1.00 44.19 ? 101 LYS B O   1 
ATOM   1944 C CB  . LYS C 1 101 ? 18.208 2.460   54.328  1.00 45.51 ? 101 LYS B CB  1 
ATOM   1945 C CG  . LYS C 1 101 ? 17.966 3.845   53.712  1.00 48.88 ? 101 LYS B CG  1 
ATOM   1946 C CD  . LYS C 1 101 ? 16.597 3.908   53.014  1.00 53.06 ? 101 LYS B CD  1 
ATOM   1947 C CE  . LYS C 1 101 ? 16.112 5.344   52.795  1.00 55.07 ? 101 LYS B CE  1 
ATOM   1948 N NZ  . LYS C 1 101 ? 14.612 5.421   52.577  1.00 55.50 ? 101 LYS B NZ  1 
ATOM   1949 N N   . TYR C 1 102 ? 21.319 1.241   54.149  1.00 43.07 ? 102 TYR B N   1 
ATOM   1950 C CA  . TYR C 1 102 ? 22.718 1.616   54.217  1.00 41.97 ? 102 TYR B CA  1 
ATOM   1951 C C   . TYR C 1 102 ? 23.641 0.507   53.654  1.00 41.13 ? 102 TYR B C   1 
ATOM   1952 O O   . TYR C 1 102 ? 23.794 0.393   52.437  1.00 40.76 ? 102 TYR B O   1 
ATOM   1953 C CB  . TYR C 1 102 ? 23.068 2.024   55.659  1.00 42.35 ? 102 TYR B CB  1 
ATOM   1954 C CG  . TYR C 1 102 ? 22.370 3.292   56.129  1.00 43.06 ? 102 TYR B CG  1 
ATOM   1955 C CD1 . TYR C 1 102 ? 22.996 4.535   56.017  1.00 44.51 ? 102 TYR B CD1 1 
ATOM   1956 C CD2 . TYR C 1 102 ? 21.091 3.252   56.681  1.00 43.00 ? 102 TYR B CD2 1 
ATOM   1957 C CE1 . TYR C 1 102 ? 22.374 5.703   56.454  1.00 43.72 ? 102 TYR B CE1 1 
ATOM   1958 C CE2 . TYR C 1 102 ? 20.457 4.415   57.116  1.00 43.88 ? 102 TYR B CE2 1 
ATOM   1959 C CZ  . TYR C 1 102 ? 21.109 5.637   56.996  1.00 43.67 ? 102 TYR B CZ  1 
ATOM   1960 O OH  . TYR C 1 102 ? 20.502 6.799   57.419  1.00 44.09 ? 102 TYR B OH  1 
ATOM   1961 N N   . LEU C 1 103 ? 24.245 -0.301  54.526  1.00 40.21 ? 103 LEU B N   1 
ATOM   1962 C CA  . LEU C 1 103 ? 25.128 -1.382  54.088  1.00 39.76 ? 103 LEU B CA  1 
ATOM   1963 C C   . LEU C 1 103 ? 24.508 -2.774  54.142  1.00 39.67 ? 103 LEU B C   1 
ATOM   1964 O O   . LEU C 1 103 ? 25.107 -3.728  53.657  1.00 38.66 ? 103 LEU B O   1 
ATOM   1965 C CB  . LEU C 1 103 ? 26.430 -1.391  54.901  1.00 39.41 ? 103 LEU B CB  1 
ATOM   1966 C CG  . LEU C 1 103 ? 27.164 -0.054  54.965  1.00 39.60 ? 103 LEU B CG  1 
ATOM   1967 C CD1 . LEU C 1 103 ? 28.073 0.015   56.197  1.00 40.13 ? 103 LEU B CD1 1 
ATOM   1968 C CD2 . LEU C 1 103 ? 27.934 0.176   53.671  1.00 39.44 ? 103 LEU B CD2 1 
ATOM   1969 N N   . GLY C 1 104 ? 23.324 -2.898  54.734  1.00 40.42 ? 104 GLY B N   1 
ATOM   1970 C CA  . GLY C 1 104 ? 22.689 -4.197  54.896  1.00 41.54 ? 104 GLY B CA  1 
ATOM   1971 C C   . GLY C 1 104 ? 22.646 -5.064  53.647  1.00 42.85 ? 104 GLY B C   1 
ATOM   1972 O O   . GLY C 1 104 ? 22.929 -6.265  53.672  1.00 42.15 ? 104 GLY B O   1 
ATOM   1973 N N   . SER C 1 105 ? 22.346 -4.422  52.530  1.00 44.10 ? 105 SER B N   1 
ATOM   1974 C CA  . SER C 1 105 ? 22.156 -5.130  51.276  1.00 45.72 ? 105 SER B CA  1 
ATOM   1975 C C   . SER C 1 105 ? 23.436 -5.644  50.624  1.00 46.01 ? 105 SER B C   1 
ATOM   1976 O O   . SER C 1 105 ? 23.384 -6.302  49.590  1.00 46.32 ? 105 SER B O   1 
ATOM   1977 C CB  . SER C 1 105 ? 21.345 -4.263  50.309  1.00 45.76 ? 105 SER B CB  1 
ATOM   1978 O OG  . SER C 1 105 ? 22.089 -4.075  49.125  1.00 48.25 ? 105 SER B OG  1 
ATOM   1979 N N   . ARG C 1 106 ? 24.577 -5.359  51.248  1.00 46.00 ? 106 ARG B N   1 
ATOM   1980 C CA  . ARG C 1 106 ? 25.874 -5.761  50.726  1.00 45.90 ? 106 ARG B CA  1 
ATOM   1981 C C   . ARG C 1 106 ? 26.687 -6.519  51.770  1.00 45.13 ? 106 ARG B C   1 
ATOM   1982 O O   . ARG C 1 106 ? 27.819 -6.914  51.521  1.00 44.55 ? 106 ARG B O   1 
ATOM   1983 C CB  . ARG C 1 106 ? 26.662 -4.521  50.315  1.00 46.92 ? 106 ARG B CB  1 
ATOM   1984 C CG  . ARG C 1 106 ? 26.622 -4.192  48.842  1.00 49.63 ? 106 ARG B CG  1 
ATOM   1985 C CD  . ARG C 1 106 ? 26.621 -2.680  48.556  1.00 55.24 ? 106 ARG B CD  1 
ATOM   1986 N NE  . ARG C 1 106 ? 27.653 -1.942  49.292  1.00 57.63 ? 106 ARG B NE  1 
ATOM   1987 C CZ  . ARG C 1 106 ? 27.472 -0.734  49.829  1.00 58.36 ? 106 ARG B CZ  1 
ATOM   1988 N NH1 . ARG C 1 106 ? 28.465 -0.128  50.472  1.00 57.57 ? 106 ARG B NH1 1 
ATOM   1989 N NH2 . ARG C 1 106 ? 26.288 -0.135  49.731  1.00 58.58 ? 106 ARG B NH2 1 
ATOM   1990 N N   . THR C 1 107 ? 26.090 -6.708  52.942  1.00 44.27 ? 107 THR B N   1 
ATOM   1991 C CA  . THR C 1 107 ? 26.729 -7.390  54.058  1.00 43.22 ? 107 THR B CA  1 
ATOM   1992 C C   . THR C 1 107 ? 26.175 -8.799  54.215  1.00 43.84 ? 107 THR B C   1 
ATOM   1993 O O   . THR C 1 107 ? 24.957 -9.002  54.079  1.00 42.60 ? 107 THR B O   1 
ATOM   1994 C CB  . THR C 1 107 ? 26.450 -6.620  55.345  1.00 43.42 ? 107 THR B CB  1 
ATOM   1995 O OG1 . THR C 1 107 ? 26.873 -5.259  55.192  1.00 40.05 ? 107 THR B OG1 1 
ATOM   1996 C CG2 . THR C 1 107 ? 27.303 -7.180  56.496  1.00 43.42 ? 107 THR B CG2 1 
ATOM   1997 N N   . SER C 1 108 ? 27.056 -9.765  54.504  1.00 44.08 ? 108 SER B N   1 
ATOM   1998 C CA  . SER C 1 108 ? 26.631 -11.161 54.684  1.00 44.60 ? 108 SER B CA  1 
ATOM   1999 C C   . SER C 1 108 ? 25.682 -11.354 55.872  1.00 44.92 ? 108 SER B C   1 
ATOM   2000 O O   . SER C 1 108 ? 25.618 -10.523 56.801  1.00 44.53 ? 108 SER B O   1 
ATOM   2001 C CB  . SER C 1 108 ? 27.827 -12.124 54.757  1.00 44.56 ? 108 SER B CB  1 
ATOM   2002 O OG  . SER C 1 108 ? 28.432 -12.166 56.044  1.00 44.92 ? 108 SER B OG  1 
ATOM   2003 N N   . GLU C 1 109 ? 24.919 -12.443 55.812  1.00 45.30 ? 109 GLU B N   1 
ATOM   2004 C CA  . GLU C 1 109 ? 23.927 -12.765 56.826  1.00 45.64 ? 109 GLU B CA  1 
ATOM   2005 C C   . GLU C 1 109 ? 24.596 -13.044 58.154  1.00 44.67 ? 109 GLU B C   1 
ATOM   2006 O O   . GLU C 1 109 ? 24.111 -12.646 59.216  1.00 44.89 ? 109 GLU B O   1 
ATOM   2007 C CB  . GLU C 1 109 ? 23.126 -13.997 56.390  1.00 46.42 ? 109 GLU B CB  1 
ATOM   2008 C CG  . GLU C 1 109 ? 21.965 -14.324 57.308  1.00 49.46 ? 109 GLU B CG  1 
ATOM   2009 C CD  . GLU C 1 109 ? 20.903 -13.246 57.281  1.00 53.57 ? 109 GLU B CD  1 
ATOM   2010 O OE1 . GLU C 1 109 ? 19.985 -13.283 58.133  1.00 56.00 ? 109 GLU B OE1 1 
ATOM   2011 O OE2 . GLU C 1 109 ? 20.987 -12.362 56.398  1.00 56.60 ? 109 GLU B OE2 1 
ATOM   2012 N N   . LYS C 1 110 ? 25.708 -13.756 58.070  1.00 43.61 ? 110 LYS B N   1 
ATOM   2013 C CA  . LYS C 1 110 ? 26.530 -14.102 59.207  1.00 42.84 ? 110 LYS B CA  1 
ATOM   2014 C C   . LYS C 1 110 ? 26.879 -12.852 60.032  1.00 41.44 ? 110 LYS B C   1 
ATOM   2015 O O   . LYS C 1 110 ? 26.648 -12.794 61.248  1.00 40.77 ? 110 LYS B O   1 
ATOM   2016 C CB  . LYS C 1 110 ? 27.804 -14.755 58.666  1.00 43.25 ? 110 LYS B CB  1 
ATOM   2017 C CG  . LYS C 1 110 ? 28.624 -15.543 59.648  1.00 45.67 ? 110 LYS B CG  1 
ATOM   2018 C CD  . LYS C 1 110 ? 29.870 -16.098 58.949  1.00 50.14 ? 110 LYS B CD  1 
ATOM   2019 C CE  . LYS C 1 110 ? 30.694 -17.018 59.852  1.00 53.67 ? 110 LYS B CE  1 
ATOM   2020 N NZ  . LYS C 1 110 ? 30.148 -18.419 59.951  1.00 56.92 ? 110 LYS B NZ  1 
ATOM   2021 N N   . VAL C 1 111 ? 27.446 -11.855 59.359  1.00 39.98 ? 111 VAL B N   1 
ATOM   2022 C CA  . VAL C 1 111 ? 27.871 -10.630 60.020  1.00 38.57 ? 111 VAL B CA  1 
ATOM   2023 C C   . VAL C 1 111 ? 26.699 -9.870  60.646  1.00 38.07 ? 111 VAL B C   1 
ATOM   2024 O O   . VAL C 1 111 ? 26.798 -9.401  61.765  1.00 36.67 ? 111 VAL B O   1 
ATOM   2025 C CB  . VAL C 1 111 ? 28.646 -9.708  59.040  1.00 38.27 ? 111 VAL B CB  1 
ATOM   2026 C CG1 . VAL C 1 111 ? 28.782 -8.315  59.590  1.00 37.72 ? 111 VAL B CG1 1 
ATOM   2027 C CG2 . VAL C 1 111 ? 30.003 -10.271 58.770  1.00 37.59 ? 111 VAL B CG2 1 
ATOM   2028 N N   . LYS C 1 112 ? 25.586 -9.763  59.925  1.00 37.83 ? 112 LYS B N   1 
ATOM   2029 C CA  . LYS C 1 112 ? 24.447 -9.024  60.449  1.00 39.06 ? 112 LYS B CA  1 
ATOM   2030 C C   . LYS C 1 112 ? 23.799 -9.653  61.689  1.00 39.48 ? 112 LYS B C   1 
ATOM   2031 O O   . LYS C 1 112 ? 23.418 -8.946  62.613  1.00 39.13 ? 112 LYS B O   1 
ATOM   2032 C CB  . LYS C 1 112 ? 23.400 -8.786  59.358  1.00 39.42 ? 112 LYS B CB  1 
ATOM   2033 C CG  . LYS C 1 112 ? 23.877 -7.830  58.267  1.00 40.94 ? 112 LYS B CG  1 
ATOM   2034 C CD  . LYS C 1 112 ? 22.779 -7.494  57.263  1.00 42.86 ? 112 LYS B CD  1 
ATOM   2035 C CE  . LYS C 1 112 ? 22.437 -8.671  56.370  1.00 42.95 ? 112 LYS B CE  1 
ATOM   2036 N NZ  . LYS C 1 112 ? 21.626 -8.187  55.192  1.00 44.23 ? 112 LYS B NZ  1 
ATOM   2037 N N   . ASN C 1 113 ? 23.692 -10.977 61.712  1.00 40.56 ? 113 ASN B N   1 
ATOM   2038 C CA  . ASN C 1 113 ? 23.032 -11.664 62.825  1.00 41.52 ? 113 ASN B CA  1 
ATOM   2039 C C   . ASN C 1 113 ? 23.895 -11.565 64.043  1.00 41.35 ? 113 ASN B C   1 
ATOM   2040 O O   . ASN C 1 113 ? 23.419 -11.467 65.171  1.00 41.37 ? 113 ASN B O   1 
ATOM   2041 C CB  . ASN C 1 113 ? 22.789 -13.134 62.475  1.00 41.98 ? 113 ASN B CB  1 
ATOM   2042 C CG  . ASN C 1 113 ? 21.839 -13.300 61.302  1.00 43.95 ? 113 ASN B CG  1 
ATOM   2043 O OD1 . ASN C 1 113 ? 20.999 -12.438 61.056  1.00 46.58 ? 113 ASN B OD1 1 
ATOM   2044 N ND2 . ASN C 1 113 ? 21.964 -14.419 60.574  1.00 45.88 ? 113 ASN B ND2 1 
ATOM   2045 N N   . LYS C 1 114 ? 25.190 -11.585 63.797  1.00 41.70 ? 114 LYS B N   1 
ATOM   2046 C CA  . LYS C 1 114 ? 26.154 -11.463 64.870  1.00 42.00 ? 114 LYS B CA  1 
ATOM   2047 C C   . LYS C 1 114 ? 25.874 -10.136 65.586  1.00 41.16 ? 114 LYS B C   1 
ATOM   2048 O O   . LYS C 1 114 ? 25.661 -10.106 66.790  1.00 40.89 ? 114 LYS B O   1 
ATOM   2049 C CB  . LYS C 1 114 ? 27.560 -11.513 64.277  1.00 42.12 ? 114 LYS B CB  1 
ATOM   2050 C CG  . LYS C 1 114 ? 28.506 -12.470 64.949  1.00 45.50 ? 114 LYS B CG  1 
ATOM   2051 C CD  . LYS C 1 114 ? 28.666 -12.174 66.429  1.00 49.87 ? 114 LYS B CD  1 
ATOM   2052 C CE  . LYS C 1 114 ? 29.301 -13.358 67.152  1.00 52.51 ? 114 LYS B CE  1 
ATOM   2053 N NZ  . LYS C 1 114 ? 29.142 -13.292 68.641  1.00 53.45 ? 114 LYS B NZ  1 
ATOM   2054 N N   . ILE C 1 115 ? 25.829 -9.042  64.829  1.00 40.72 ? 115 ILE B N   1 
ATOM   2055 C CA  . ILE C 1 115 ? 25.549 -7.729  65.416  1.00 40.57 ? 115 ILE B CA  1 
ATOM   2056 C C   . ILE C 1 115 ? 24.227 -7.726  66.185  1.00 41.04 ? 115 ILE B C   1 
ATOM   2057 O O   . ILE C 1 115 ? 24.145 -7.205  67.290  1.00 41.80 ? 115 ILE B O   1 
ATOM   2058 C CB  . ILE C 1 115 ? 25.558 -6.629  64.318  1.00 39.93 ? 115 ILE B CB  1 
ATOM   2059 C CG1 . ILE C 1 115 ? 26.999 -6.298  63.919  1.00 38.42 ? 115 ILE B CG1 1 
ATOM   2060 C CG2 . ILE C 1 115 ? 24.856 -5.370  64.789  1.00 38.69 ? 115 ILE B CG2 1 
ATOM   2061 C CD1 . ILE C 1 115 ? 27.096 -5.635  62.573  1.00 35.67 ? 115 ILE B CD1 1 
ATOM   2062 N N   . LEU C 1 116 ? 23.194 -8.308  65.597  1.00 41.86 ? 116 LEU B N   1 
ATOM   2063 C CA  . LEU C 1 116 ? 21.889 -8.350  66.247  1.00 43.09 ? 116 LEU B CA  1 
ATOM   2064 C C   . LEU C 1 116 ? 21.954 -9.129  67.570  1.00 43.86 ? 116 LEU B C   1 
ATOM   2065 O O   . LEU C 1 116 ? 21.423 -8.681  68.592  1.00 43.65 ? 116 LEU B O   1 
ATOM   2066 C CB  . LEU C 1 116 ? 20.851 -8.945  65.298  1.00 43.14 ? 116 LEU B CB  1 
ATOM   2067 C CG  . LEU C 1 116 ? 20.619 -8.099  64.045  1.00 42.82 ? 116 LEU B CG  1 
ATOM   2068 C CD1 . LEU C 1 116 ? 19.622 -8.772  63.104  1.00 43.00 ? 116 LEU B CD1 1 
ATOM   2069 C CD2 . LEU C 1 116 ? 20.146 -6.681  64.419  1.00 42.28 ? 116 LEU B CD2 1 
ATOM   2070 N N   . GLU C 1 117 ? 22.620 -10.281 67.545  1.00 44.70 ? 117 GLU B N   1 
ATOM   2071 C CA  . GLU C 1 117 ? 22.806 -11.079 68.748  1.00 45.92 ? 117 GLU B CA  1 
ATOM   2072 C C   . GLU C 1 117 ? 23.505 -10.237 69.810  1.00 46.11 ? 117 GLU B C   1 
ATOM   2073 O O   . GLU C 1 117 ? 23.057 -10.165 70.957  1.00 46.13 ? 117 GLU B O   1 
ATOM   2074 C CB  . GLU C 1 117 ? 23.662 -12.316 68.458  1.00 46.08 ? 117 GLU B CB  1 
ATOM   2075 C CG  . GLU C 1 117 ? 22.972 -13.423 67.676  1.00 48.51 ? 117 GLU B CG  1 
ATOM   2076 C CD  . GLU C 1 117 ? 23.912 -14.559 67.327  1.00 51.23 ? 117 GLU B CD  1 
ATOM   2077 O OE1 . GLU C 1 117 ? 24.951 -14.720 68.007  1.00 53.81 ? 117 GLU B OE1 1 
ATOM   2078 O OE2 . GLU C 1 117 ? 23.620 -15.295 66.367  1.00 54.47 ? 117 GLU B OE2 1 
ATOM   2079 N N   . LEU C 1 118 ? 24.608 -9.602  69.422  1.00 45.92 ? 118 LEU B N   1 
ATOM   2080 C CA  . LEU C 1 118 ? 25.371 -8.800  70.363  1.00 46.44 ? 118 LEU B CA  1 
ATOM   2081 C C   . LEU C 1 118 ? 24.502 -7.725  70.974  1.00 46.38 ? 118 LEU B C   1 
ATOM   2082 O O   . LEU C 1 118 ? 24.525 -7.505  72.181  1.00 45.79 ? 118 LEU B O   1 
ATOM   2083 C CB  . LEU C 1 118 ? 26.578 -8.135  69.678  1.00 46.18 ? 118 LEU B CB  1 
ATOM   2084 C CG  . LEU C 1 118 ? 27.766 -9.024  69.344  1.00 46.84 ? 118 LEU B CG  1 
ATOM   2085 C CD1 . LEU C 1 118 ? 28.947 -8.178  68.842  1.00 46.44 ? 118 LEU B CD1 1 
ATOM   2086 C CD2 . LEU C 1 118 ? 28.183 -9.830  70.557  1.00 46.58 ? 118 LEU B CD2 1 
ATOM   2087 N N   . LEU C 1 119 ? 23.739 -7.050  70.123  1.00 47.01 ? 119 LEU B N   1 
ATOM   2088 C CA  . LEU C 1 119 ? 22.904 -5.952  70.572  1.00 47.54 ? 119 LEU B CA  1 
ATOM   2089 C C   . LEU C 1 119 ? 21.923 -6.434  71.622  1.00 48.42 ? 119 LEU B C   1 
ATOM   2090 O O   . LEU C 1 119 ? 21.791 -5.834  72.668  1.00 47.69 ? 119 LEU B O   1 
ATOM   2091 C CB  . LEU C 1 119 ? 22.172 -5.308  69.388  1.00 47.61 ? 119 LEU B CB  1 
ATOM   2092 C CG  . LEU C 1 119 ? 23.083 -4.469  68.476  1.00 47.17 ? 119 LEU B CG  1 
ATOM   2093 C CD1 . LEU C 1 119 ? 22.343 -3.981  67.220  1.00 45.60 ? 119 LEU B CD1 1 
ATOM   2094 C CD2 . LEU C 1 119 ? 23.669 -3.294  69.248  1.00 45.94 ? 119 LEU B CD2 1 
ATOM   2095 N N   . TYR C 1 120 ? 21.247 -7.534  71.351  1.00 50.01 ? 120 TYR B N   1 
ATOM   2096 C CA  . TYR C 1 120 ? 20.274 -8.023  72.312  1.00 51.98 ? 120 TYR B CA  1 
ATOM   2097 C C   . TYR C 1 120 ? 20.947 -8.373  73.633  1.00 52.45 ? 120 TYR B C   1 
ATOM   2098 O O   . TYR C 1 120 ? 20.491 -7.961  74.701  1.00 52.35 ? 120 TYR B O   1 
ATOM   2099 C CB  . TYR C 1 120 ? 19.542 -9.236  71.764  1.00 52.39 ? 120 TYR B CB  1 
ATOM   2100 C CG  . TYR C 1 120 ? 18.691 -9.927  72.797  1.00 55.08 ? 120 TYR B CG  1 
ATOM   2101 C CD1 . TYR C 1 120 ? 17.638 -9.264  73.425  1.00 57.05 ? 120 TYR B CD1 1 
ATOM   2102 C CD2 . TYR C 1 120 ? 18.955 -11.244 73.160  1.00 57.67 ? 120 TYR B CD2 1 
ATOM   2103 C CE1 . TYR C 1 120 ? 16.859 -9.914  74.379  1.00 59.00 ? 120 TYR B CE1 1 
ATOM   2104 C CE2 . TYR C 1 120 ? 18.188 -11.896 74.107  1.00 59.24 ? 120 TYR B CE2 1 
ATOM   2105 C CZ  . TYR C 1 120 ? 17.145 -11.230 74.716  1.00 59.32 ? 120 TYR B CZ  1 
ATOM   2106 O OH  . TYR C 1 120 ? 16.395 -11.906 75.658  1.00 59.28 ? 120 TYR B OH  1 
ATOM   2107 N N   . SER C 1 121 ? 22.042 -9.123  73.548  1.00 53.48 ? 121 SER B N   1 
ATOM   2108 C CA  . SER C 1 121 ? 22.762 -9.571  74.735  1.00 53.99 ? 121 SER B CA  1 
ATOM   2109 C C   . SER C 1 121 ? 23.104 -8.408  75.658  1.00 54.42 ? 121 SER B C   1 
ATOM   2110 O O   . SER C 1 121 ? 23.048 -8.540  76.878  1.00 54.87 ? 121 SER B O   1 
ATOM   2111 C CB  . SER C 1 121 ? 24.028 -10.351 74.351  1.00 54.36 ? 121 SER B CB  1 
ATOM   2112 O OG  . SER C 1 121 ? 25.070 -9.460  73.983  1.00 54.78 ? 121 SER B OG  1 
ATOM   2113 N N   . TRP C 1 122 ? 23.445 -7.265  75.073  1.00 54.40 ? 122 TRP B N   1 
ATOM   2114 C CA  . TRP C 1 122 ? 23.778 -6.080  75.857  1.00 54.73 ? 122 TRP B CA  1 
ATOM   2115 C C   . TRP C 1 122 ? 22.545 -5.461  76.482  1.00 55.49 ? 122 TRP B C   1 
ATOM   2116 O O   . TRP C 1 122 ? 22.642 -4.788  77.500  1.00 55.35 ? 122 TRP B O   1 
ATOM   2117 C CB  . TRP C 1 122 ? 24.475 -5.024  75.000  1.00 54.13 ? 122 TRP B CB  1 
ATOM   2118 C CG  . TRP C 1 122 ? 25.738 -5.510  74.409  1.00 52.58 ? 122 TRP B CG  1 
ATOM   2119 C CD1 . TRP C 1 122 ? 26.529 -6.518  74.882  1.00 51.32 ? 122 TRP B CD1 1 
ATOM   2120 C CD2 . TRP C 1 122 ? 26.362 -5.035  73.218  1.00 50.04 ? 122 TRP B CD2 1 
ATOM   2121 N NE1 . TRP C 1 122 ? 27.618 -6.685  74.062  1.00 49.78 ? 122 TRP B NE1 1 
ATOM   2122 C CE2 . TRP C 1 122 ? 27.538 -5.791  73.029  1.00 49.83 ? 122 TRP B CE2 1 
ATOM   2123 C CE3 . TRP C 1 122 ? 26.053 -4.037  72.290  1.00 49.02 ? 122 TRP B CE3 1 
ATOM   2124 C CZ2 . TRP C 1 122 ? 28.393 -5.587  71.946  1.00 48.43 ? 122 TRP B CZ2 1 
ATOM   2125 C CZ3 . TRP C 1 122 ? 26.905 -3.833  71.222  1.00 48.07 ? 122 TRP B CZ3 1 
ATOM   2126 C CH2 . TRP C 1 122 ? 28.065 -4.599  71.063  1.00 47.57 ? 122 TRP B CH2 1 
ATOM   2127 N N   . THR C 1 123 ? 21.392 -5.663  75.850  1.00 56.37 ? 123 THR B N   1 
ATOM   2128 C CA  . THR C 1 123 ? 20.140 -5.146  76.397  1.00 57.49 ? 123 THR B CA  1 
ATOM   2129 C C   . THR C 1 123 ? 19.780 -5.919  77.672  1.00 58.64 ? 123 THR B C   1 
ATOM   2130 O O   . THR C 1 123 ? 19.292 -5.332  78.642  1.00 58.88 ? 123 THR B O   1 
ATOM   2131 C CB  . THR C 1 123 ? 18.992 -5.205  75.356  1.00 57.27 ? 123 THR B CB  1 
ATOM   2132 O OG1 . THR C 1 123 ? 18.712 -6.563  75.010  1.00 56.18 ? 123 THR B OG1 1 
ATOM   2133 C CG2 . THR C 1 123 ? 19.429 -4.598  74.037  1.00 57.71 ? 123 THR B CG2 1 
ATOM   2134 N N   . VAL C 1 124 ? 20.038 -7.230  77.666  1.00 59.72 ? 124 VAL B N   1 
ATOM   2135 C CA  . VAL C 1 124 ? 19.794 -8.072  78.839  1.00 61.15 ? 124 VAL B CA  1 
ATOM   2136 C C   . VAL C 1 124 ? 20.931 -7.978  79.861  1.00 61.77 ? 124 VAL B C   1 
ATOM   2137 O O   . VAL C 1 124 ? 20.698 -8.018  81.066  1.00 62.08 ? 124 VAL B O   1 
ATOM   2138 C CB  . VAL C 1 124 ? 19.567 -9.565  78.466  1.00 61.05 ? 124 VAL B CB  1 
ATOM   2139 C CG1 . VAL C 1 124 ? 18.636 -9.691  77.288  1.00 60.94 ? 124 VAL B CG1 1 
ATOM   2140 C CG2 . VAL C 1 124 ? 20.883 -10.256 78.162  1.00 62.28 ? 124 VAL B CG2 1 
ATOM   2141 N N   . GLY C 1 125 ? 22.157 -7.831  79.373  1.00 62.47 ? 125 GLY B N   1 
ATOM   2142 C CA  . GLY C 1 125 ? 23.322 -7.784  80.236  1.00 63.12 ? 125 GLY B CA  1 
ATOM   2143 C C   . GLY C 1 125 ? 23.687 -6.404  80.737  1.00 63.60 ? 125 GLY B C   1 
ATOM   2144 O O   . GLY C 1 125 ? 24.312 -6.268  81.794  1.00 63.58 ? 125 GLY B O   1 
ATOM   2145 N N   . LEU C 1 126 ? 23.305 -5.375  79.986  1.00 64.02 ? 126 LEU B N   1 
ATOM   2146 C CA  . LEU C 1 126 ? 23.633 -4.008  80.376  1.00 64.54 ? 126 LEU B CA  1 
ATOM   2147 C C   . LEU C 1 126 ? 22.450 -3.050  80.318  1.00 65.07 ? 126 LEU B C   1 
ATOM   2148 O O   . LEU C 1 126 ? 22.550 -1.972  79.735  1.00 65.11 ? 126 LEU B O   1 
ATOM   2149 C CB  . LEU C 1 126 ? 24.786 -3.468  79.532  1.00 64.31 ? 126 LEU B CB  1 
ATOM   2150 C CG  . LEU C 1 126 ? 26.106 -4.223  79.685  1.00 64.57 ? 126 LEU B CG  1 
ATOM   2151 C CD1 . LEU C 1 126 ? 26.992 -4.017  78.468  1.00 64.54 ? 126 LEU B CD1 1 
ATOM   2152 C CD2 . LEU C 1 126 ? 26.820 -3.816  80.972  1.00 64.22 ? 126 LEU B CD2 1 
ATOM   2153 N N   . PRO C 1 127 ? 21.336 -3.429  80.936  1.00 65.71 ? 127 PRO B N   1 
ATOM   2154 C CA  . PRO C 1 127 ? 20.157 -2.561  80.982  1.00 65.98 ? 127 PRO B CA  1 
ATOM   2155 C C   . PRO C 1 127 ? 20.534 -1.152  81.436  1.00 66.21 ? 127 PRO B C   1 
ATOM   2156 O O   . PRO C 1 127 ? 19.740 -0.225  81.306  1.00 66.15 ? 127 PRO B O   1 
ATOM   2157 C CB  . PRO C 1 127 ? 19.263 -3.258  82.011  1.00 65.96 ? 127 PRO B CB  1 
ATOM   2158 C CG  . PRO C 1 127 ? 20.188 -4.243  82.695  1.00 66.09 ? 127 PRO B CG  1 
ATOM   2159 C CD  . PRO C 1 127 ? 21.090 -4.715  81.614  1.00 65.64 ? 127 PRO B CD  1 
ATOM   2160 N N   . GLU C 1 128 ? 21.749 -1.004  81.955  1.00 66.75 ? 128 GLU B N   1 
ATOM   2161 C CA  . GLU C 1 128 ? 22.278 0.296   82.360  1.00 67.06 ? 128 GLU B CA  1 
ATOM   2162 C C   . GLU C 1 128 ? 22.287 1.226   81.155  1.00 66.75 ? 128 GLU B C   1 
ATOM   2163 O O   . GLU C 1 128 ? 21.885 2.383   81.242  1.00 66.79 ? 128 GLU B O   1 
ATOM   2164 C CB  . GLU C 1 128 ? 23.713 0.157   82.888  1.00 67.50 ? 128 GLU B CB  1 
ATOM   2165 C CG  . GLU C 1 128 ? 23.877 -0.751  84.099  1.00 69.39 ? 128 GLU B CG  1 
ATOM   2166 C CD  . GLU C 1 128 ? 23.686 -2.218  83.765  1.00 71.22 ? 128 GLU B CD  1 
ATOM   2167 O OE1 . GLU C 1 128 ? 23.828 -3.073  84.670  1.00 72.36 ? 128 GLU B OE1 1 
ATOM   2168 O OE2 . GLU C 1 128 ? 23.397 -2.519  82.593  1.00 71.42 ? 128 GLU B OE2 1 
ATOM   2169 N N   . GLU C 1 129 ? 22.759 0.707   80.024  1.00 66.19 ? 129 GLU B N   1 
ATOM   2170 C CA  . GLU C 1 129 ? 22.824 1.492   78.802  1.00 65.31 ? 129 GLU B CA  1 
ATOM   2171 C C   . GLU C 1 129 ? 21.452 1.557   78.131  1.00 64.94 ? 129 GLU B C   1 
ATOM   2172 O O   . GLU C 1 129 ? 21.018 0.605   77.477  1.00 65.02 ? 129 GLU B O   1 
ATOM   2173 C CB  . GLU C 1 129 ? 23.871 0.912   77.850  1.00 65.35 ? 129 GLU B CB  1 
ATOM   2174 C CG  . GLU C 1 129 ? 25.264 0.767   78.449  1.00 64.52 ? 129 GLU B CG  1 
ATOM   2175 C CD  . GLU C 1 129 ? 25.910 2.093   78.824  1.00 63.98 ? 129 GLU B CD  1 
ATOM   2176 O OE1 . GLU C 1 129 ? 25.596 3.141   78.220  1.00 63.23 ? 129 GLU B OE1 1 
ATOM   2177 O OE2 . GLU C 1 129 ? 26.760 2.086   79.730  1.00 65.21 ? 129 GLU B OE2 1 
ATOM   2178 N N   . VAL C 1 130 ? 20.776 2.691   78.297  1.00 64.02 ? 130 VAL B N   1 
ATOM   2179 C CA  . VAL C 1 130 ? 19.432 2.871   77.756  1.00 63.29 ? 130 VAL B CA  1 
ATOM   2180 C C   . VAL C 1 130 ? 19.412 2.858   76.223  1.00 62.39 ? 130 VAL B C   1 
ATOM   2181 O O   . VAL C 1 130 ? 18.585 2.184   75.612  1.00 62.48 ? 130 VAL B O   1 
ATOM   2182 C CB  . VAL C 1 130 ? 18.753 4.162   78.312  1.00 63.30 ? 130 VAL B CB  1 
ATOM   2183 C CG1 . VAL C 1 130 ? 19.722 5.341   78.306  1.00 63.93 ? 130 VAL B CG1 1 
ATOM   2184 C CG2 . VAL C 1 130 ? 17.466 4.492   77.542  1.00 63.56 ? 130 VAL B CG2 1 
ATOM   2185 N N   . LYS C 1 131 ? 20.334 3.581   75.605  1.00 60.98 ? 131 LYS B N   1 
ATOM   2186 C CA  . LYS C 1 131 ? 20.375 3.666   74.148  1.00 59.92 ? 131 LYS B CA  1 
ATOM   2187 C C   . LYS C 1 131 ? 20.478 2.321   73.433  1.00 59.22 ? 131 LYS B C   1 
ATOM   2188 O O   . LYS C 1 131 ? 19.867 2.121   72.381  1.00 59.26 ? 131 LYS B O   1 
ATOM   2189 C CB  . LYS C 1 131 ? 21.491 4.613   73.713  1.00 59.95 ? 131 LYS B CB  1 
ATOM   2190 C CG  . LYS C 1 131 ? 21.380 5.965   74.380  1.00 59.25 ? 131 LYS B CG  1 
ATOM   2191 C CD  . LYS C 1 131 ? 22.439 6.934   73.911  1.00 58.45 ? 131 LYS B CD  1 
ATOM   2192 C CE  . LYS C 1 131 ? 22.359 8.202   74.727  1.00 58.02 ? 131 LYS B CE  1 
ATOM   2193 N NZ  . LYS C 1 131 ? 23.264 9.273   74.224  1.00 58.27 ? 131 LYS B NZ  1 
ATOM   2194 N N   . ILE C 1 132 ? 21.247 1.396   73.993  1.00 58.11 ? 132 ILE B N   1 
ATOM   2195 C CA  . ILE C 1 132 ? 21.342 0.075   73.381  1.00 57.34 ? 132 ILE B CA  1 
ATOM   2196 C C   . ILE C 1 132 ? 19.934 -0.495  73.234  1.00 57.19 ? 132 ILE B C   1 
ATOM   2197 O O   . ILE C 1 132 ? 19.584 -1.075  72.199  1.00 56.74 ? 132 ILE B O   1 
ATOM   2198 C CB  . ILE C 1 132 ? 22.245 -0.866  74.197  1.00 57.14 ? 132 ILE B CB  1 
ATOM   2199 C CG1 . ILE C 1 132 ? 23.643 -0.260  74.335  1.00 56.91 ? 132 ILE B CG1 1 
ATOM   2200 C CG2 . ILE C 1 132 ? 22.329 -2.223  73.529  1.00 56.56 ? 132 ILE B CG2 1 
ATOM   2201 C CD1 . ILE C 1 132 ? 24.706 -1.281  74.702  1.00 56.93 ? 132 ILE B CD1 1 
ATOM   2202 N N   . ALA C 1 133 ? 19.117 -0.318  74.266  1.00 57.01 ? 133 ALA B N   1 
ATOM   2203 C CA  . ALA C 1 133 ? 17.735 -0.764  74.198  1.00 57.23 ? 133 ALA B CA  1 
ATOM   2204 C C   . ALA C 1 133 ? 16.991 0.149   73.226  1.00 57.06 ? 133 ALA B C   1 
ATOM   2205 O O   . ALA C 1 133 ? 16.202 -0.323  72.423  1.00 57.03 ? 133 ALA B O   1 
ATOM   2206 C CB  . ALA C 1 133 ? 17.089 -0.733  75.567  1.00 57.28 ? 133 ALA B CB  1 
ATOM   2207 N N   . GLU C 1 134 ? 17.253 1.453   73.294  1.00 57.27 ? 134 GLU B N   1 
ATOM   2208 C CA  . GLU C 1 134 ? 16.604 2.393   72.380  1.00 57.85 ? 134 GLU B CA  1 
ATOM   2209 C C   . GLU C 1 134 ? 16.879 1.968   70.936  1.00 57.88 ? 134 GLU B C   1 
ATOM   2210 O O   . GLU C 1 134 ? 15.955 1.678   70.181  1.00 58.10 ? 134 GLU B O   1 
ATOM   2211 C CB  . GLU C 1 134 ? 17.048 3.842   72.631  1.00 57.96 ? 134 GLU B CB  1 
ATOM   2212 C CG  . GLU C 1 134 ? 15.955 4.862   72.322  1.00 59.10 ? 134 GLU B CG  1 
ATOM   2213 C CD  . GLU C 1 134 ? 16.416 6.309   72.387  1.00 60.74 ? 134 GLU B CD  1 
ATOM   2214 O OE1 . GLU C 1 134 ? 15.994 7.103   71.510  1.00 60.44 ? 134 GLU B OE1 1 
ATOM   2215 O OE2 . GLU C 1 134 ? 17.180 6.666   73.318  1.00 61.03 ? 134 GLU B OE2 1 
ATOM   2216 N N   . ALA C 1 135 ? 18.152 1.897   70.564  1.00 57.76 ? 135 ALA B N   1 
ATOM   2217 C CA  . ALA C 1 135 ? 18.524 1.459   69.223  1.00 57.69 ? 135 ALA B CA  1 
ATOM   2218 C C   . ALA C 1 135 ? 17.960 0.082   68.871  1.00 57.89 ? 135 ALA B C   1 
ATOM   2219 O O   . ALA C 1 135 ? 17.484 -0.133  67.755  1.00 57.74 ? 135 ALA B O   1 
ATOM   2220 C CB  . ALA C 1 135 ? 20.029 1.474   69.058  1.00 57.55 ? 135 ALA B CB  1 
ATOM   2221 N N   . TYR C 1 136 ? 18.006 -0.856  69.810  1.00 58.36 ? 136 TYR B N   1 
ATOM   2222 C CA  . TYR C 1 136 ? 17.485 -2.197  69.545  1.00 58.77 ? 136 TYR B CA  1 
ATOM   2223 C C   . TYR C 1 136 ? 15.974 -2.137  69.347  1.00 59.96 ? 136 TYR B C   1 
ATOM   2224 O O   . TYR C 1 136 ? 15.407 -2.864  68.531  1.00 59.63 ? 136 TYR B O   1 
ATOM   2225 C CB  . TYR C 1 136 ? 17.827 -3.136  70.695  1.00 58.43 ? 136 TYR B CB  1 
ATOM   2226 C CG  . TYR C 1 136 ? 17.542 -4.599  70.431  1.00 56.73 ? 136 TYR B CG  1 
ATOM   2227 C CD1 . TYR C 1 136 ? 18.362 -5.349  69.603  1.00 55.93 ? 136 TYR B CD1 1 
ATOM   2228 C CD2 . TYR C 1 136 ? 16.471 -5.235  71.036  1.00 56.27 ? 136 TYR B CD2 1 
ATOM   2229 C CE1 . TYR C 1 136 ? 18.115 -6.697  69.367  1.00 55.27 ? 136 TYR B CE1 1 
ATOM   2230 C CE2 . TYR C 1 136 ? 16.209 -6.587  70.808  1.00 55.77 ? 136 TYR B CE2 1 
ATOM   2231 C CZ  . TYR C 1 136 ? 17.036 -7.312  69.973  1.00 55.17 ? 136 TYR B CZ  1 
ATOM   2232 O OH  . TYR C 1 136 ? 16.784 -8.648  69.743  1.00 52.99 ? 136 TYR B OH  1 
ATOM   2233 N N   . GLN C 1 137 ? 15.341 -1.257  70.115  1.00 61.32 ? 137 GLN B N   1 
ATOM   2234 C CA  . GLN C 1 137 ? 13.907 -1.024  70.045  1.00 62.87 ? 137 GLN B CA  1 
ATOM   2235 C C   . GLN C 1 137 ? 13.567 -0.640  68.619  1.00 63.55 ? 137 GLN B C   1 
ATOM   2236 O O   . GLN C 1 137 ? 12.818 -1.339  67.941  1.00 63.75 ? 137 GLN B O   1 
ATOM   2237 C CB  . GLN C 1 137 ? 13.542 0.120   70.998  1.00 63.03 ? 137 GLN B CB  1 
ATOM   2238 C CG  . GLN C 1 137 ? 12.070 0.307   71.311  1.00 64.89 ? 137 GLN B CG  1 
ATOM   2239 C CD  . GLN C 1 137 ? 11.855 1.387   72.359  1.00 66.57 ? 137 GLN B CD  1 
ATOM   2240 O OE1 . GLN C 1 137 ? 12.439 1.335   73.442  1.00 68.05 ? 137 GLN B OE1 1 
ATOM   2241 N NE2 . GLN C 1 137 ? 11.036 2.376   72.033  1.00 68.29 ? 137 GLN B NE2 1 
ATOM   2242 N N   . MET C 1 138 ? 14.153 0.462   68.163  1.00 64.37 ? 138 MET B N   1 
ATOM   2243 C CA  . MET C 1 138 ? 13.912 0.958   66.814  1.00 65.41 ? 138 MET B CA  1 
ATOM   2244 C C   . MET C 1 138 ? 14.100 -0.124  65.761  1.00 65.67 ? 138 MET B C   1 
ATOM   2245 O O   . MET C 1 138 ? 13.381 -0.146  64.764  1.00 65.50 ? 138 MET B O   1 
ATOM   2246 C CB  . MET C 1 138 ? 14.801 2.161   66.501  1.00 65.33 ? 138 MET B CB  1 
ATOM   2247 C CG  . MET C 1 138 ? 14.794 2.547   65.035  1.00 67.13 ? 138 MET B CG  1 
ATOM   2248 S SD  . MET C 1 138 ? 15.562 4.143   64.715  1.00 71.58 ? 138 MET B SD  1 
ATOM   2249 C CE  . MET C 1 138 ? 14.264 5.272   65.347  1.00 71.28 ? 138 MET B CE  1 
ATOM   2250 N N   . LEU C 1 139 ? 15.060 -1.020  65.983  1.00 66.28 ? 139 LEU B N   1 
ATOM   2251 C CA  . LEU C 1 139 ? 15.317 -2.106  65.040  1.00 66.93 ? 139 LEU B CA  1 
ATOM   2252 C C   . LEU C 1 139 ? 14.144 -3.070  65.018  1.00 67.67 ? 139 LEU B C   1 
ATOM   2253 O O   . LEU C 1 139 ? 13.803 -3.640  63.983  1.00 67.56 ? 139 LEU B O   1 
ATOM   2254 C CB  . LEU C 1 139 ? 16.593 -2.862  65.406  1.00 66.84 ? 139 LEU B CB  1 
ATOM   2255 C CG  . LEU C 1 139 ? 17.925 -2.236  64.982  1.00 66.62 ? 139 LEU B CG  1 
ATOM   2256 C CD1 . LEU C 1 139 ? 19.060 -2.923  65.701  1.00 66.24 ? 139 LEU B CD1 1 
ATOM   2257 C CD2 . LEU C 1 139 ? 18.122 -2.309  63.476  1.00 65.29 ? 139 LEU B CD2 1 
ATOM   2258 N N   . LYS C 1 140 ? 13.527 -3.253  66.174  1.00 68.77 ? 140 LYS B N   1 
ATOM   2259 C CA  . LYS C 1 140 ? 12.386 -4.142  66.271  1.00 69.98 ? 140 LYS B CA  1 
ATOM   2260 C C   . LYS C 1 140 ? 11.195 -3.537  65.527  1.00 70.17 ? 140 LYS B C   1 
ATOM   2261 O O   . LYS C 1 140 ? 10.508 -4.225  64.775  1.00 70.21 ? 140 LYS B O   1 
ATOM   2262 C CB  . LYS C 1 140 ? 12.044 -4.401  67.737  1.00 70.24 ? 140 LYS B CB  1 
ATOM   2263 C CG  . LYS C 1 140 ? 11.036 -5.521  67.955  1.00 71.96 ? 140 LYS B CG  1 
ATOM   2264 C CD  . LYS C 1 140 ? 10.583 -5.570  69.412  1.00 74.30 ? 140 LYS B CD  1 
ATOM   2265 C CE  . LYS C 1 140 ? 9.193  -6.189  69.553  1.00 75.14 ? 140 LYS B CE  1 
ATOM   2266 N NZ  . LYS C 1 140 ? 8.580  -5.812  70.859  1.00 75.38 ? 140 LYS B NZ  1 
ATOM   2267 N N   . LYS C 1 141 ? 10.978 -2.241  65.728  1.00 70.70 ? 141 LYS B N   1 
ATOM   2268 C CA  . LYS C 1 141 ? 9.872  -1.519  65.097  1.00 71.19 ? 141 LYS B CA  1 
ATOM   2269 C C   . LYS C 1 141 ? 10.019 -1.457  63.574  1.00 71.30 ? 141 LYS B C   1 
ATOM   2270 O O   . LYS C 1 141 ? 9.076  -1.748  62.838  1.00 71.24 ? 141 LYS B O   1 
ATOM   2271 C CB  . LYS C 1 141 ? 9.782  -0.101  65.675  1.00 71.32 ? 141 LYS B CB  1 
ATOM   2272 C CG  . LYS C 1 141 ? 8.525  0.669   65.288  1.00 72.12 ? 141 LYS B CG  1 
ATOM   2273 C CD  . LYS C 1 141 ? 8.507  2.074   65.897  1.00 72.53 ? 141 LYS B CD  1 
ATOM   2274 C CE  . LYS C 1 141 ? 8.164  2.066   67.387  1.00 72.39 ? 141 LYS B CE  1 
ATOM   2275 N NZ  . LYS C 1 141 ? 9.332  1.731   68.251  1.00 71.69 ? 141 LYS B NZ  1 
ATOM   2276 N N   . GLN C 1 142 ? 11.214 -1.083  63.113  1.00 71.41 ? 142 GLN B N   1 
ATOM   2277 C CA  . GLN C 1 142 ? 11.512 -0.975  61.686  1.00 71.17 ? 142 GLN B CA  1 
ATOM   2278 C C   . GLN C 1 142 ? 11.473 -2.335  60.999  1.00 71.10 ? 142 GLN B C   1 
ATOM   2279 O O   . GLN C 1 142 ? 11.445 -2.417  59.773  1.00 71.07 ? 142 GLN B O   1 
ATOM   2280 C CB  . GLN C 1 142 ? 12.867 -0.290  61.467  1.00 71.11 ? 142 GLN B CB  1 
ATOM   2281 C CG  . GLN C 1 142 ? 13.342 -0.269  60.020  1.00 70.87 ? 142 GLN B CG  1 
ATOM   2282 C CD  . GLN C 1 142 ? 12.541 0.690   59.156  1.00 70.65 ? 142 GLN B CD  1 
ATOM   2283 O OE1 . GLN C 1 142 ? 11.934 1.632   59.666  1.00 70.39 ? 142 GLN B OE1 1 
ATOM   2284 N NE2 . GLN C 1 142 ? 12.543 0.456   57.847  1.00 69.66 ? 142 GLN B NE2 1 
ATOM   2285 N N   . GLY C 1 143 ? 11.488 -3.401  61.793  1.00 71.12 ? 143 GLY B N   1 
ATOM   2286 C CA  . GLY C 1 143 ? 11.361 -4.749  61.263  1.00 71.23 ? 143 GLY B CA  1 
ATOM   2287 C C   . GLY C 1 143 ? 12.623 -5.536  60.949  1.00 71.54 ? 143 GLY B C   1 
ATOM   2288 O O   . GLY C 1 143 ? 12.554 -6.561  60.276  1.00 71.27 ? 143 GLY B O   1 
ATOM   2289 N N   . ILE C 1 144 ? 13.775 -5.087  61.437  1.00 71.87 ? 144 ILE B N   1 
ATOM   2290 C CA  . ILE C 1 144 ? 15.018 -5.799  61.148  1.00 72.20 ? 144 ILE B CA  1 
ATOM   2291 C C   . ILE C 1 144 ? 15.256 -6.963  62.107  1.00 72.85 ? 144 ILE B C   1 
ATOM   2292 O O   . ILE C 1 144 ? 15.693 -8.038  61.692  1.00 72.60 ? 144 ILE B O   1 
ATOM   2293 C CB  . ILE C 1 144 ? 16.204 -4.827  61.140  1.00 72.06 ? 144 ILE B CB  1 
ATOM   2294 C CG1 . ILE C 1 144 ? 16.124 -3.929  59.903  1.00 71.65 ? 144 ILE B CG1 1 
ATOM   2295 C CG2 . ILE C 1 144 ? 17.511 -5.590  61.139  1.00 71.75 ? 144 ILE B CG2 1 
ATOM   2296 C CD1 . ILE C 1 144 ? 16.836 -2.603  60.049  1.00 71.12 ? 144 ILE B CD1 1 
ATOM   2297 N N   . VAL C 1 145 ? 14.947 -6.753  63.383  1.00 73.88 ? 145 VAL B N   1 
ATOM   2298 C CA  . VAL C 1 145 ? 15.127 -7.794  64.399  1.00 75.05 ? 145 VAL B CA  1 
ATOM   2299 C C   . VAL C 1 145 ? 14.153 -8.973  64.243  1.00 75.83 ? 145 VAL B C   1 
ATOM   2300 O O   . VAL C 1 145 ? 14.566 -10.135 64.288  1.00 75.94 ? 145 VAL B O   1 
ATOM   2301 C CB  . VAL C 1 145 ? 15.051 -7.214  65.835  1.00 75.02 ? 145 VAL B CB  1 
ATOM   2302 C CG1 . VAL C 1 145 ? 14.699 -8.299  66.848  1.00 75.06 ? 145 VAL B CG1 1 
ATOM   2303 C CG2 . VAL C 1 145 ? 16.366 -6.544  66.207  1.00 75.16 ? 145 VAL B CG2 1 
ATOM   2304 N N   . LYS C 1 146 ? 12.872 -8.667  64.050  1.00 76.84 ? 146 LYS B N   1 
ATOM   2305 C CA  . LYS C 1 146 ? 11.836 -9.690  63.889  1.00 77.77 ? 146 LYS B CA  1 
ATOM   2306 C C   . LYS C 1 146 ? 11.728 -10.597 65.111  1.00 77.89 ? 146 LYS B C   1 
ATOM   2307 O O   . LYS C 1 146 ? 12.234 -11.721 65.103  1.00 78.27 ? 146 LYS B O   1 
ATOM   2308 C CB  . LYS C 1 146 ? 12.084 -10.537 62.634  1.00 78.17 ? 146 LYS B CB  1 
ATOM   2309 C CG  . LYS C 1 146 ? 12.100 -9.754  61.328  1.00 79.67 ? 146 LYS B CG  1 
ATOM   2310 C CD  . LYS C 1 146 ? 12.131 -10.691 60.120  1.00 81.90 ? 146 LYS B CD  1 
ATOM   2311 C CE  . LYS C 1 146 ? 13.270 -11.714 60.213  1.00 82.85 ? 146 LYS B CE  1 
ATOM   2312 N NZ  . LYS C 1 146 ? 14.620 -11.101 60.040  1.00 83.72 ? 146 LYS B NZ  1 
ATOM   2313 N N   . ASP D 2 9   ? 20.250 12.066  66.973  1.00 49.86 ? 9   ASP D N   1 
ATOM   2314 C CA  . ASP D 2 9   ? 21.538 11.329  67.047  1.00 49.27 ? 9   ASP D CA  1 
ATOM   2315 C C   . ASP D 2 9   ? 21.312 9.957   66.468  1.00 48.63 ? 9   ASP D C   1 
ATOM   2316 O O   . ASP D 2 9   ? 21.957 9.573   65.495  1.00 48.10 ? 9   ASP D O   1 
ATOM   2317 C CB  . ASP D 2 9   ? 21.991 11.184  68.493  1.00 50.02 ? 9   ASP D CB  1 
ATOM   2318 C CG  . ASP D 2 9   ? 23.469 11.381  68.659  1.00 50.84 ? 9   ASP D CG  1 
ATOM   2319 O OD1 . ASP D 2 9   ? 24.178 11.421  67.639  1.00 53.44 ? 9   ASP D OD1 1 
ATOM   2320 O OD2 . ASP D 2 9   ? 24.015 11.533  69.775  1.00 53.75 ? 9   ASP D OD2 1 
ATOM   2321 N N   . LEU D 2 10  ? 20.383 9.220   67.064  1.00 47.82 ? 10  LEU D N   1 
ATOM   2322 C CA  . LEU D 2 10  ? 20.089 7.878   66.591  1.00 47.63 ? 10  LEU D CA  1 
ATOM   2323 C C   . LEU D 2 10  ? 19.793 7.907   65.097  1.00 47.80 ? 10  LEU D C   1 
ATOM   2324 O O   . LEU D 2 10  ? 19.114 8.819   64.604  1.00 47.07 ? 10  LEU D O   1 
ATOM   2325 C CB  . LEU D 2 10  ? 18.942 7.239   67.368  1.00 47.29 ? 10  LEU D CB  1 
ATOM   2326 C CG  . LEU D 2 10  ? 18.559 5.840   66.872  1.00 46.92 ? 10  LEU D CG  1 
ATOM   2327 C CD1 . LEU D 2 10  ? 19.678 4.826   67.101  1.00 46.83 ? 10  LEU D CD1 1 
ATOM   2328 C CD2 . LEU D 2 10  ? 17.310 5.355   67.529  1.00 45.50 ? 10  LEU D CD2 1 
ATOM   2329 N N   . LEU D 2 11  ? 20.315 6.905   64.388  1.00 47.51 ? 11  LEU D N   1 
ATOM   2330 C CA  . LEU D 2 11  ? 20.216 6.828   62.938  1.00 47.89 ? 11  LEU D CA  1 
ATOM   2331 C C   . LEU D 2 11  ? 18.784 6.706   62.434  1.00 48.14 ? 11  LEU D C   1 
ATOM   2332 O O   . LEU D 2 11  ? 18.005 5.908   62.938  1.00 47.13 ? 11  LEU D O   1 
ATOM   2333 C CB  . LEU D 2 11  ? 20.990 5.613   62.439  1.00 47.69 ? 11  LEU D CB  1 
ATOM   2334 C CG  . LEU D 2 11  ? 21.945 5.770   61.249  1.00 48.05 ? 11  LEU D CG  1 
ATOM   2335 C CD1 . LEU D 2 11  ? 21.890 4.531   60.367  1.00 46.53 ? 11  LEU D CD1 1 
ATOM   2336 C CD2 . LEU D 2 11  ? 21.674 7.018   60.443  1.00 50.43 ? 11  LEU D CD2 1 
ATOM   2337 N N   . HIS D 2 12  ? 18.456 7.479   61.405  1.00 49.28 ? 12  HIS D N   1 
ATOM   2338 C CA  . HIS D 2 12  ? 17.128 7.398   60.806  1.00 50.49 ? 12  HIS D CA  1 
ATOM   2339 C C   . HIS D 2 12  ? 17.002 6.201   59.866  1.00 51.38 ? 12  HIS D C   1 
ATOM   2340 O O   . HIS D 2 12  ? 17.702 6.100   58.869  1.00 51.57 ? 12  HIS D O   1 
ATOM   2341 C CB  . HIS D 2 12  ? 16.774 8.689   60.065  1.00 50.55 ? 12  HIS D CB  1 
ATOM   2342 C CG  . HIS D 2 12  ? 15.429 8.660   59.411  1.00 49.61 ? 12  HIS D CG  1 
ATOM   2343 N ND1 . HIS D 2 12  ? 15.041 9.589   58.470  1.00 49.92 ? 12  HIS D ND1 1 
ATOM   2344 C CD2 . HIS D 2 12  ? 14.373 7.829   59.576  1.00 48.49 ? 12  HIS D CD2 1 
ATOM   2345 C CE1 . HIS D 2 12  ? 13.808 9.327   58.078  1.00 49.12 ? 12  HIS D CE1 1 
ATOM   2346 N NE2 . HIS D 2 12  ? 13.385 8.257   58.725  1.00 48.62 ? 12  HIS D NE2 1 
ATOM   2347 N N   . ILE D 2 13  ? 16.083 5.318   60.221  1.00 53.16 ? 13  ILE D N   1 
ATOM   2348 C CA  . ILE D 2 13  ? 15.707 4.097   59.489  1.00 55.12 ? 13  ILE D CA  1 
ATOM   2349 C C   . ILE D 2 13  ? 16.766 3.013   59.267  1.00 55.63 ? 13  ILE D C   1 
ATOM   2350 O O   . ILE D 2 13  ? 17.638 3.139   58.404  1.00 56.94 ? 13  ILE D O   1 
ATOM   2351 C CB  . ILE D 2 13  ? 14.841 4.369   58.206  1.00 55.01 ? 13  ILE D CB  1 
ATOM   2352 C CG1 . ILE D 2 13  ? 14.648 3.070   57.417  1.00 55.50 ? 13  ILE D CG1 1 
ATOM   2353 C CG2 . ILE D 2 13  ? 15.435 5.470   57.308  1.00 56.15 ? 13  ILE D CG2 1 
ATOM   2354 C CD1 . ILE D 2 13  ? 14.028 3.265   56.007  1.00 55.45 ? 13  ILE D CD1 1 
ATOM   2355 O OXT . ILE D 2 13  ? 16.702 1.992   59.966  1.00 55.86 ? 13  ILE D OXT 1 
HETATM 2356 I I   . IOD E 3 .   ? 31.795 -10.816 105.461 1.00 32.83 ? 148 IOD A I   1 
HETATM 2357 I I   . IOD F 3 .   ? 43.537 -0.928  112.851 1.00 64.79 ? 149 IOD A I   1 
HETATM 2358 I I   . IOD G 3 .   ? 45.740 0.261   80.776  1.00 63.56 ? 148 IOD B I   1 
HETATM 2359 I I   . IOD H 3 .   ? 26.502 7.019   56.191  1.00 58.56 ? 149 IOD B I   1 
HETATM 2360 I I   . IOD I 3 .   ? 38.575 -3.357  52.272  1.00 50.42 ? 150 IOD B I   1 
HETATM 2361 I I   . IOD J 3 .   ? 37.093 0.810   80.573  1.00 57.86 ? 151 IOD B I   1 
HETATM 2362 O O   . HOH K 4 .   ? 34.703 7.664   104.224 1.00 44.13 ? 150 HOH A O   1 
HETATM 2363 O O   . HOH K 4 .   ? 39.214 2.095   105.705 1.00 29.37 ? 151 HOH A O   1 
HETATM 2364 O O   . HOH K 4 .   ? 43.952 3.360   105.960 1.00 44.15 ? 152 HOH A O   1 
HETATM 2365 O O   . HOH K 4 .   ? 36.317 9.124   102.321 1.00 35.58 ? 153 HOH A O   1 
HETATM 2366 O O   . HOH K 4 .   ? 34.702 5.809   94.720  1.00 33.91 ? 154 HOH A O   1 
HETATM 2367 O O   . HOH K 4 .   ? 30.357 4.469   102.357 1.00 42.71 ? 155 HOH A O   1 
HETATM 2368 O O   . HOH K 4 .   ? 32.282 -1.810  100.556 1.00 25.96 ? 156 HOH A O   1 
HETATM 2369 O O   . HOH K 4 .   ? 35.352 4.069   110.488 1.00 37.68 ? 157 HOH A O   1 
HETATM 2370 O O   . HOH K 4 .   ? 27.428 0.995   102.051 1.00 48.76 ? 158 HOH A O   1 
HETATM 2371 O O   . HOH K 4 .   ? 25.747 -4.449  99.229  1.00 31.60 ? 159 HOH A O   1 
HETATM 2372 O O   . HOH K 4 .   ? 30.134 5.112   91.486  1.00 43.34 ? 160 HOH A O   1 
HETATM 2373 O O   . HOH K 4 .   ? 43.488 9.634   88.764  1.00 61.21 ? 161 HOH A O   1 
HETATM 2374 O O   . HOH K 4 .   ? 53.014 0.782   94.613  1.00 36.60 ? 162 HOH A O   1 
HETATM 2375 O O   . HOH K 4 .   ? 52.330 -1.661  94.761  1.00 29.43 ? 163 HOH A O   1 
HETATM 2376 O O   . HOH K 4 .   ? 44.201 -8.497  107.156 1.00 22.40 ? 164 HOH A O   1 
HETATM 2377 O O   . HOH K 4 .   ? 38.000 -7.752  113.267 1.00 36.71 ? 165 HOH A O   1 
HETATM 2378 O O   . HOH K 4 .   ? 35.651 -6.180  111.458 1.00 29.10 ? 166 HOH A O   1 
HETATM 2379 O O   . HOH K 4 .   ? 33.831 -9.207  107.862 1.00 29.14 ? 167 HOH A O   1 
HETATM 2380 O O   . HOH K 4 .   ? 34.344 -10.311 96.769  1.00 37.45 ? 168 HOH A O   1 
HETATM 2381 O O   . HOH K 4 .   ? 39.709 -10.716 90.229  1.00 29.09 ? 169 HOH A O   1 
HETATM 2382 O O   . HOH K 4 .   ? 42.629 -4.031  85.402  1.00 34.42 ? 170 HOH A O   1 
HETATM 2383 O O   . HOH K 4 .   ? 41.885 -1.455  85.935  1.00 48.82 ? 171 HOH A O   1 
HETATM 2384 O O   . HOH K 4 .   ? 34.240 -6.591  84.246  1.00 60.43 ? 172 HOH A O   1 
HETATM 2385 O O   . HOH K 4 .   ? 52.377 -2.133  82.518  1.00 37.09 ? 173 HOH A O   1 
HETATM 2386 O O   . HOH K 4 .   ? 53.431 -10.825 86.864  1.00 29.77 ? 174 HOH A O   1 
HETATM 2387 O O   . HOH K 4 .   ? 40.016 -11.083 112.648 1.00 40.93 ? 175 HOH A O   1 
HETATM 2388 O O   . HOH K 4 .   ? 58.253 -6.432  99.283  1.00 38.89 ? 176 HOH A O   1 
HETATM 2389 O O   . HOH K 4 .   ? 48.293 -19.725 106.772 1.00 37.07 ? 177 HOH A O   1 
HETATM 2390 O O   . HOH K 4 .   ? 49.106 -19.592 110.852 1.00 42.78 ? 178 HOH A O   1 
HETATM 2391 O O   . HOH K 4 .   ? 51.800 -14.530 112.160 1.00 34.38 ? 179 HOH A O   1 
HETATM 2392 O O   . HOH K 4 .   ? 39.688 -17.836 111.664 1.00 37.23 ? 180 HOH A O   1 
HETATM 2393 O O   . HOH K 4 .   ? 37.505 -19.352 106.010 1.00 37.72 ? 181 HOH A O   1 
HETATM 2394 O O   . HOH K 4 .   ? 37.125 -16.607 109.507 1.00 31.20 ? 182 HOH A O   1 
HETATM 2395 O O   . HOH K 4 .   ? 43.717 -21.613 96.661  1.00 34.08 ? 183 HOH A O   1 
HETATM 2396 O O   . HOH K 4 .   ? 47.120 -22.272 88.868  1.00 47.15 ? 184 HOH A O   1 
HETATM 2397 O O   . HOH K 4 .   ? 49.039 -15.643 86.608  1.00 34.53 ? 185 HOH A O   1 
HETATM 2398 O O   . HOH K 4 .   ? 38.893 -16.930 84.333  1.00 48.50 ? 186 HOH A O   1 
HETATM 2399 O O   . HOH K 4 .   ? 49.187 -19.106 85.240  1.00 40.36 ? 187 HOH A O   1 
HETATM 2400 O O   . HOH K 4 .   ? 58.106 -17.006 85.867  1.00 44.97 ? 188 HOH A O   1 
HETATM 2401 O O   . HOH K 4 .   ? 57.502 -20.266 93.005  1.00 38.45 ? 189 HOH A O   1 
HETATM 2402 O O   . HOH K 4 .   ? 59.704 -18.792 93.335  1.00 38.83 ? 190 HOH A O   1 
HETATM 2403 O O   . HOH K 4 .   ? 45.463 -24.651 94.151  1.00 37.16 ? 191 HOH A O   1 
HETATM 2404 O O   . HOH K 4 .   ? 50.683 -27.420 98.872  1.00 47.97 ? 192 HOH A O   1 
HETATM 2405 O O   . HOH K 4 .   ? 34.782 -18.349 106.044 1.00 30.63 ? 193 HOH A O   1 
HETATM 2406 O O   . HOH K 4 .   ? 39.999 2.829   108.816 1.00 34.23 ? 194 HOH A O   1 
HETATM 2407 O O   . HOH K 4 .   ? 25.950 -0.718  97.463  1.00 36.95 ? 195 HOH A O   1 
HETATM 2408 O O   . HOH K 4 .   ? 24.895 -7.194  95.061  1.00 58.84 ? 196 HOH A O   1 
HETATM 2409 O O   . HOH K 4 .   ? 21.992 -0.544  97.680  1.00 55.73 ? 197 HOH A O   1 
HETATM 2410 O O   . HOH K 4 .   ? 28.369 -3.296  90.374  1.00 50.92 ? 198 HOH A O   1 
HETATM 2411 O O   . HOH K 4 .   ? 28.699 -5.362  91.365  1.00 60.29 ? 199 HOH A O   1 
HETATM 2412 O O   . HOH K 4 .   ? 52.467 -2.588  97.103  1.00 38.51 ? 200 HOH A O   1 
HETATM 2413 O O   . HOH K 4 .   ? 53.039 -2.905  92.425  1.00 32.63 ? 201 HOH A O   1 
HETATM 2414 O O   . HOH K 4 .   ? 36.274 -2.816  112.811 1.00 36.47 ? 202 HOH A O   1 
HETATM 2415 O O   . HOH K 4 .   ? 38.638 -13.167 90.489  1.00 44.20 ? 203 HOH A O   1 
HETATM 2416 O O   . HOH K 4 .   ? 39.684 -8.615  82.310  1.00 40.67 ? 204 HOH A O   1 
HETATM 2417 O O   . HOH K 4 .   ? 54.205 -6.929  86.257  1.00 42.48 ? 205 HOH A O   1 
HETATM 2418 O O   . HOH K 4 .   ? 35.966 -14.632 110.408 1.00 36.33 ? 206 HOH A O   1 
HETATM 2419 O O   . HOH K 4 .   ? 56.020 -4.700  99.046  1.00 37.35 ? 207 HOH A O   1 
HETATM 2420 O O   . HOH K 4 .   ? 49.437 -22.052 107.226 1.00 45.91 ? 208 HOH A O   1 
HETATM 2421 O O   . HOH K 4 .   ? 45.514 11.323  95.620  1.00 42.99 ? 209 HOH A O   1 
HETATM 2422 O O   . HOH K 4 .   ? 45.199 9.117   91.219  1.00 52.75 ? 210 HOH A O   1 
HETATM 2423 O O   . HOH K 4 .   ? 37.626 4.162   106.189 1.00 29.32 ? 211 HOH A O   1 
HETATM 2424 O O   . HOH K 4 .   ? 39.192 6.328   106.860 1.00 37.94 ? 212 HOH A O   1 
HETATM 2425 O O   . HOH K 4 .   ? 48.490 9.105   100.070 1.00 47.67 ? 213 HOH A O   1 
HETATM 2426 O O   . HOH K 4 .   ? 29.126 -1.106  113.104 1.00 57.98 ? 214 HOH A O   1 
HETATM 2427 O O   . HOH K 4 .   ? 25.559 -4.980  108.529 1.00 49.71 ? 215 HOH A O   1 
HETATM 2428 O O   . HOH K 4 .   ? 30.719 7.116   96.279  1.00 50.72 ? 216 HOH A O   1 
HETATM 2429 O O   . HOH K 4 .   ? 33.758 -8.205  92.338  1.00 50.87 ? 217 HOH A O   1 
HETATM 2430 O O   . HOH K 4 .   ? 58.460 -5.764  102.095 1.00 46.15 ? 218 HOH A O   1 
HETATM 2431 O O   . HOH K 4 .   ? 64.599 -16.163 105.087 1.00 38.20 ? 219 HOH A O   1 
HETATM 2432 O O   . HOH K 4 .   ? 59.214 -13.394 86.256  1.00 41.46 ? 220 HOH A O   1 
HETATM 2433 O O   . HOH K 4 .   ? 48.172 -23.922 90.397  1.00 51.38 ? 221 HOH A O   1 
HETATM 2434 O O   . HOH K 4 .   ? 61.392 -11.969 103.312 1.00 71.89 ? 222 HOH A O   1 
HETATM 2435 O O   . HOH K 4 .   ? 26.220 -6.596  97.346  1.00 42.65 ? 223 HOH A O   1 
HETATM 2436 O O   . HOH K 4 .   ? 51.074 -0.298  101.378 1.00 34.95 ? 224 HOH A O   1 
HETATM 2437 O O   . HOH K 4 .   ? 41.933 -9.040  108.836 1.00 39.35 ? 225 HOH A O   1 
HETATM 2438 O O   . HOH K 4 .   ? 32.728 8.211   90.813  1.00 47.23 ? 226 HOH A O   1 
HETATM 2439 O O   . HOH K 4 .   ? 39.764 12.487  102.324 1.00 48.04 ? 227 HOH A O   1 
HETATM 2440 O O   . HOH K 4 .   ? 37.066 -13.877 92.177  1.00 45.08 ? 228 HOH A O   1 
HETATM 2441 O O   . HOH K 4 .   ? 61.447 -14.803 89.051  1.00 54.59 ? 229 HOH A O   1 
HETATM 2442 O O   . HOH K 4 .   ? 43.910 10.173  93.783  1.00 53.67 ? 230 HOH A O   1 
HETATM 2443 O O   . HOH K 4 .   ? 29.824 0.411   87.188  1.00 69.25 ? 231 HOH A O   1 
HETATM 2444 O O   . HOH K 4 .   ? 50.551 -2.411  107.138 1.00 54.01 ? 232 HOH A O   1 
HETATM 2445 O O   . HOH K 4 .   ? 35.201 -9.733  113.594 1.00 54.53 ? 233 HOH A O   1 
HETATM 2446 O O   . HOH K 4 .   ? 37.904 -15.813 93.649  1.00 51.60 ? 234 HOH A O   1 
HETATM 2447 O O   . HOH K 4 .   ? 24.312 0.759   100.415 1.00 58.12 ? 235 HOH A O   1 
HETATM 2448 O O   . HOH K 4 .   ? 40.727 -12.708 86.549  1.00 33.05 ? 236 HOH A O   1 
HETATM 2449 O O   . HOH K 4 .   ? 43.796 -22.923 99.109  1.00 51.84 ? 237 HOH A O   1 
HETATM 2450 O O   . HOH K 4 .   ? 56.220 -22.964 105.160 1.00 58.46 ? 238 HOH A O   1 
HETATM 2451 O O   . HOH K 4 .   ? 28.010 -3.254  111.618 1.00 58.37 ? 239 HOH A O   1 
HETATM 2452 O O   . HOH K 4 .   ? 29.677 -5.049  113.233 1.00 61.44 ? 240 HOH A O   1 
HETATM 2453 O O   . HOH K 4 .   ? 62.096 -18.264 90.504  1.00 55.39 ? 241 HOH A O   1 
HETATM 2454 O O   . HOH K 4 .   ? 56.855 -0.268  86.127  1.00 74.43 ? 242 HOH A O   1 
HETATM 2455 O O   . HOH K 4 .   ? 59.040 1.876   87.532  1.00 73.07 ? 243 HOH A O   1 
HETATM 2456 O O   . HOH K 4 .   ? 48.093 -30.529 91.412  1.00 60.30 ? 244 HOH A O   1 
HETATM 2457 O O   . HOH K 4 .   ? 46.059 -26.921 95.071  1.00 52.56 ? 245 HOH A O   1 
HETATM 2458 O O   . HOH K 4 .   ? 30.661 9.302   102.570 1.00 65.34 ? 246 HOH A O   1 
HETATM 2459 O O   . HOH K 4 .   ? 34.337 7.626   108.367 1.00 58.75 ? 247 HOH A O   1 
HETATM 2460 O O   . HOH K 4 .   ? 36.840 -10.216 83.734  1.00 67.76 ? 248 HOH A O   1 
HETATM 2461 O O   . HOH K 4 .   ? 39.801 -24.892 103.017 1.00 79.19 ? 249 HOH A O   1 
HETATM 2462 O O   . HOH K 4 .   ? 48.378 11.505  97.425  1.00 45.99 ? 250 HOH A O   1 
HETATM 2463 O O   . HOH K 4 .   ? 39.567 -1.806  86.547  1.00 68.01 ? 251 HOH A O   1 
HETATM 2464 O O   . HOH K 4 .   ? 43.309 1.607   107.825 1.00 50.86 ? 252 HOH A O   1 
HETATM 2465 O O   . HOH K 4 .   ? 61.771 -25.481 91.309  1.00 48.65 ? 253 HOH A O   1 
HETATM 2466 O O   . HOH K 4 .   ? 32.675 -10.079 93.174  1.00 69.02 ? 254 HOH A O   1 
HETATM 2467 O O   . HOH K 4 .   ? 30.392 -14.833 90.675  1.00 57.20 ? 255 HOH A O   1 
HETATM 2468 O O   . HOH K 4 .   ? 54.361 -3.811  105.670 1.00 68.77 ? 256 HOH A O   1 
HETATM 2469 O O   . HOH K 4 .   ? 36.379 -13.502 96.857  1.00 46.49 ? 257 HOH A O   1 
HETATM 2470 O O   . HOH K 4 .   ? 51.684 -0.810  104.452 1.00 57.17 ? 258 HOH A O   1 
HETATM 2471 O O   . HOH K 4 .   ? 58.494 -3.443  103.652 1.00 46.35 ? 259 HOH A O   1 
HETATM 2472 O O   . HOH L 4 .   ? 61.650 -1.340  89.190  1.00 68.34 ? 34  HOH C O   1 
HETATM 2473 O O   . HOH L 4 .   ? 61.426 -8.712  99.247  1.00 50.78 ? 53  HOH C O   1 
HETATM 2474 O O   . HOH L 4 .   ? 62.022 -12.688 93.131  1.00 29.25 ? 72  HOH C O   1 
HETATM 2475 O O   . HOH L 4 .   ? 58.794 -4.325  87.093  1.00 46.53 ? 82  HOH C O   1 
HETATM 2476 O O   . HOH L 4 .   ? 59.129 -20.199 107.658 1.00 51.68 ? 91  HOH C O   1 
HETATM 2477 O O   . HOH L 4 .   ? 55.383 -18.821 106.456 1.00 35.59 ? 92  HOH C O   1 
HETATM 2478 O O   . HOH L 4 .   ? 59.768 -18.634 100.699 1.00 40.04 ? 97  HOH C O   1 
HETATM 2479 O O   . HOH L 4 .   ? 61.925 -9.220  91.237  1.00 48.16 ? 98  HOH C O   1 
HETATM 2480 O O   . HOH L 4 .   ? 61.754 -19.947 101.958 1.00 76.45 ? 113 HOH C O   1 
HETATM 2481 O O   . HOH M 4 .   ? 36.707 8.722   87.250  1.00 70.70 ? 152 HOH B O   1 
HETATM 2482 O O   . HOH M 4 .   ? 46.544 -9.555  77.657  1.00 50.51 ? 153 HOH B O   1 
HETATM 2483 O O   . HOH M 4 .   ? 50.554 0.097   62.761  1.00 39.57 ? 154 HOH B O   1 
HETATM 2484 O O   . HOH M 4 .   ? 24.376 11.472  59.404  1.00 58.16 ? 155 HOH B O   1 
HETATM 2485 O O   . HOH M 4 .   ? 40.215 -12.327 80.104  1.00 46.16 ? 156 HOH B O   1 
HETATM 2486 O O   . HOH M 4 .   ? 49.548 -2.418  62.054  1.00 36.34 ? 157 HOH B O   1 
HETATM 2487 O O   . HOH M 4 .   ? 35.032 7.206   84.936  1.00 52.93 ? 158 HOH B O   1 
HETATM 2488 O O   . HOH M 4 .   ? 48.385 -6.823  77.516  1.00 36.09 ? 159 HOH B O   1 
HETATM 2489 O O   . HOH M 4 .   ? 47.400 -4.489  76.149  1.00 32.81 ? 160 HOH B O   1 
HETATM 2490 O O   . HOH M 4 .   ? 26.075 9.239   59.766  1.00 64.11 ? 161 HOH B O   1 
HETATM 2491 O O   . HOH M 4 .   ? 49.739 -4.870  63.553  1.00 30.91 ? 162 HOH B O   1 
HETATM 2492 O O   . HOH M 4 .   ? 42.363 -5.428  59.974  1.00 31.33 ? 163 HOH B O   1 
HETATM 2493 O O   . HOH M 4 .   ? 42.539 -16.910 55.497  1.00 64.74 ? 164 HOH B O   1 
HETATM 2494 O O   . HOH M 4 .   ? 41.376 -12.795 65.763  1.00 30.19 ? 165 HOH B O   1 
HETATM 2495 O O   . HOH M 4 .   ? 49.685 -10.380 70.600  1.00 52.57 ? 166 HOH B O   1 
HETATM 2496 O O   . HOH M 4 .   ? 50.428 -12.247 74.295  1.00 53.90 ? 167 HOH B O   1 
HETATM 2497 O O   . HOH M 4 .   ? 47.666 -7.236  80.167  1.00 34.11 ? 168 HOH B O   1 
HETATM 2498 O O   . HOH M 4 .   ? 38.823 9.075   69.018  1.00 43.51 ? 169 HOH B O   1 
HETATM 2499 O O   . HOH M 4 .   ? 31.957 5.600   66.250  1.00 43.41 ? 170 HOH B O   1 
HETATM 2500 O O   . HOH M 4 .   ? 35.181 -11.194 51.935  1.00 46.61 ? 171 HOH B O   1 
HETATM 2501 O O   . HOH M 4 .   ? 34.489 -15.484 57.710  1.00 30.62 ? 172 HOH B O   1 
HETATM 2502 O O   . HOH M 4 .   ? 38.674 -13.271 77.118  1.00 54.07 ? 173 HOH B O   1 
HETATM 2503 O O   . HOH M 4 .   ? 30.794 -5.527  57.388  1.00 29.73 ? 174 HOH B O   1 
HETATM 2504 O O   . HOH M 4 .   ? 30.908 6.062   70.973  1.00 49.25 ? 175 HOH B O   1 
HETATM 2505 O O   . HOH M 4 .   ? 23.573 -13.352 51.892  1.00 58.94 ? 176 HOH B O   1 
HETATM 2506 O O   . HOH M 4 .   ? 28.436 -7.906  78.091  1.00 36.21 ? 177 HOH B O   1 
HETATM 2507 O O   . HOH M 4 .   ? 13.135 8.525   72.577  1.00 66.69 ? 178 HOH B O   1 
HETATM 2508 O O   . HOH M 4 .   ? 12.925 -2.570  73.323  1.00 80.23 ? 179 HOH B O   1 
HETATM 2509 O O   . HOH M 4 .   ? 35.961 11.742  86.242  1.00 72.95 ? 180 HOH B O   1 
HETATM 2510 O O   . HOH M 4 .   ? 46.223 -8.624  55.788  1.00 37.84 ? 181 HOH B O   1 
HETATM 2511 O O   . HOH M 4 .   ? 43.029 -4.744  56.455  1.00 30.87 ? 182 HOH B O   1 
HETATM 2512 O O   . HOH M 4 .   ? 44.516 6.157   64.233  1.00 43.67 ? 183 HOH B O   1 
HETATM 2513 O O   . HOH M 4 .   ? 49.046 0.470   79.030  1.00 50.22 ? 184 HOH B O   1 
HETATM 2514 O O   . HOH M 4 .   ? 30.066 5.496   58.510  1.00 56.35 ? 185 HOH B O   1 
HETATM 2515 O O   . HOH M 4 .   ? 52.312 -5.361  64.820  1.00 54.48 ? 186 HOH B O   1 
HETATM 2516 O O   . HOH M 4 .   ? 53.026 -7.652  63.234  1.00 53.99 ? 187 HOH B O   1 
HETATM 2517 O O   . HOH M 4 .   ? 50.590 -11.170 67.412  1.00 57.49 ? 188 HOH B O   1 
HETATM 2518 O O   . HOH M 4 .   ? 37.201 -12.055 54.190  1.00 36.04 ? 189 HOH B O   1 
HETATM 2519 O O   . HOH M 4 .   ? 38.422 -18.980 58.683  1.00 52.24 ? 190 HOH B O   1 
HETATM 2520 O O   . HOH M 4 .   ? 33.223 -17.593 62.334  1.00 56.69 ? 191 HOH B O   1 
HETATM 2521 O O   . HOH M 4 .   ? 29.312 -4.261  55.785  1.00 36.74 ? 192 HOH B O   1 
HETATM 2522 O O   . HOH M 4 .   ? 30.046 -9.328  54.453  1.00 38.80 ? 193 HOH B O   1 
HETATM 2523 O O   . HOH M 4 .   ? 23.542 -9.817  51.567  1.00 45.24 ? 194 HOH B O   1 
HETATM 2524 O O   . HOH M 4 .   ? 18.181 8.446   75.502  1.00 55.07 ? 195 HOH B O   1 
HETATM 2525 O O   . HOH M 4 .   ? 45.068 -6.387  59.579  1.00 34.88 ? 196 HOH B O   1 
HETATM 2526 O O   . HOH M 4 .   ? 29.861 7.926   57.484  1.00 44.16 ? 197 HOH B O   1 
HETATM 2527 O O   . HOH M 4 .   ? 41.026 -8.100  79.699  1.00 41.42 ? 198 HOH B O   1 
HETATM 2528 O O   . HOH M 4 .   ? 36.362 1.630   83.566  1.00 32.52 ? 199 HOH B O   1 
HETATM 2529 O O   . HOH M 4 .   ? 24.981 9.359   71.747  1.00 41.54 ? 200 HOH B O   1 
HETATM 2530 O O   . HOH M 4 .   ? 18.925 -6.234  52.583  1.00 45.37 ? 201 HOH B O   1 
HETATM 2531 O O   . HOH M 4 .   ? 46.333 -4.046  58.784  1.00 35.41 ? 202 HOH B O   1 
HETATM 2532 O O   . HOH M 4 .   ? 31.281 1.229   48.921  1.00 44.51 ? 203 HOH B O   1 
HETATM 2533 O O   . HOH M 4 .   ? 42.149 7.469   64.863  1.00 50.89 ? 204 HOH B O   1 
HETATM 2534 O O   . HOH M 4 .   ? 50.525 2.390   65.467  1.00 42.07 ? 205 HOH B O   1 
HETATM 2535 O O   . HOH M 4 .   ? 39.961 -9.457  77.313  1.00 41.53 ? 206 HOH B O   1 
HETATM 2536 O O   . HOH M 4 .   ? 32.803 4.943   59.274  1.00 48.92 ? 207 HOH B O   1 
HETATM 2537 O O   . HOH M 4 .   ? 49.473 5.473   64.994  1.00 61.24 ? 208 HOH B O   1 
HETATM 2538 O O   . HOH M 4 .   ? 42.888 9.309   81.556  1.00 63.32 ? 209 HOH B O   1 
HETATM 2539 O O   . HOH M 4 .   ? 31.001 -3.167  53.748  1.00 54.44 ? 210 HOH B O   1 
HETATM 2540 O O   . HOH M 4 .   ? 23.112 2.318   49.973  1.00 50.19 ? 211 HOH B O   1 
HETATM 2541 O O   . HOH M 4 .   ? 49.085 -6.509  61.645  1.00 49.93 ? 212 HOH B O   1 
HETATM 2542 O O   . HOH M 4 .   ? 35.072 4.607   62.698  1.00 34.67 ? 213 HOH B O   1 
HETATM 2543 O O   . HOH M 4 .   ? 50.516 -8.003  74.022  1.00 57.21 ? 214 HOH B O   1 
HETATM 2544 O O   . HOH M 4 .   ? 39.310 -20.037 68.551  1.00 54.59 ? 215 HOH B O   1 
HETATM 2545 O O   . HOH M 4 .   ? 34.940 -16.101 74.935  1.00 56.55 ? 216 HOH B O   1 
HETATM 2546 O O   . HOH M 4 .   ? 48.081 -19.841 53.218  1.00 61.48 ? 217 HOH B O   1 
HETATM 2547 O O   . HOH M 4 .   ? 40.468 -18.254 74.553  1.00 62.29 ? 218 HOH B O   1 
HETATM 2548 O O   . HOH M 4 .   ? 36.625 -14.889 54.284  1.00 54.18 ? 219 HOH B O   1 
HETATM 2549 O O   . HOH M 4 .   ? 29.553 -8.701  74.945  1.00 40.94 ? 220 HOH B O   1 
HETATM 2550 O O   . HOH M 4 .   ? 18.741 6.439   55.092  1.00 93.54 ? 221 HOH B O   1 
HETATM 2551 O O   . HOH M 4 .   ? 30.843 -22.094 58.972  1.00 72.15 ? 222 HOH B O   1 
HETATM 2552 O O   . HOH M 4 .   ? 29.501 -9.526  81.369  1.00 69.21 ? 223 HOH B O   1 
HETATM 2553 O O   . HOH M 4 .   ? 23.604 12.539  75.705  1.00 53.52 ? 224 HOH B O   1 
HETATM 2554 O O   . HOH M 4 .   ? 47.171 3.365   71.612  1.00 44.57 ? 225 HOH B O   1 
HETATM 2555 O O   . HOH M 4 .   ? 42.319 -10.341 79.182  1.00 47.86 ? 226 HOH B O   1 
HETATM 2556 O O   . HOH N 4 .   ? 16.988 10.571  65.373  1.00 39.37 ? 55  HOH D O   1 
HETATM 2557 O O   . HOH N 4 .   ? 14.464 5.180   61.917  1.00 43.87 ? 177 HOH D O   1 
HETATM 2558 O O   . HOH N 4 .   ? 23.373 14.059  65.040  1.00 56.70 ? 185 HOH D O   1 
HETATM 2559 O O   . HOH N 4 .   ? 21.726 12.067  72.214  1.00 66.87 ? 202 HOH D O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   GLU 2   2   ?   ?   ?   A . n 
A 1 3   PRO 3   3   ?   ?   ?   A . n 
A 1 4   ALA 4   4   ?   ?   ?   A . n 
A 1 5   MET 5   5   ?   ?   ?   A . n 
A 1 6   GLU 6   6   ?   ?   ?   A . n 
A 1 7   PRO 7   7   7   PRO PRO A . n 
A 1 8   GLU 8   8   8   GLU GLU A . n 
A 1 9   THR 9   9   9   THR THR A . n 
A 1 10  LEU 10  10  10  LEU LEU A . n 
A 1 11  GLU 11  11  11  GLU GLU A . n 
A 1 12  ALA 12  12  12  ALA ALA A . n 
A 1 13  ARG 13  13  13  ARG ARG A . n 
A 1 14  ILE 14  14  14  ILE ILE A . n 
A 1 15  ASN 15  15  15  ASN ASN A . n 
A 1 16  ARG 16  16  16  ARG ARG A . n 
A 1 17  ALA 17  17  17  ALA ALA A . n 
A 1 18  THR 18  18  18  THR THR A . n 
A 1 19  ASN 19  19  19  ASN ASN A . n 
A 1 20  PRO 20  20  20  PRO PRO A . n 
A 1 21  LEU 21  21  21  LEU LEU A . n 
A 1 22  ASN 22  22  22  ASN ASN A . n 
A 1 23  LYS 23  23  23  LYS LYS A . n 
A 1 24  GLU 24  24  24  GLU GLU A . n 
A 1 25  LEU 25  25  25  LEU LEU A . n 
A 1 26  ASP 26  26  26  ASP ASP A . n 
A 1 27  TRP 27  27  27  TRP TRP A . n 
A 1 28  ALA 28  28  28  ALA ALA A . n 
A 1 29  SER 29  29  29  SER SER A . n 
A 1 30  ILE 30  30  30  ILE ILE A . n 
A 1 31  ASN 31  31  31  ASN ASN A . n 
A 1 32  GLY 32  32  32  GLY GLY A . n 
A 1 33  PHE 33  33  33  PHE PHE A . n 
A 1 34  CYS 34  34  34  CYS CYS A . n 
A 1 35  GLU 35  35  35  GLU GLU A . n 
A 1 36  GLN 36  36  36  GLN GLN A . n 
A 1 37  LEU 37  37  37  LEU LEU A . n 
A 1 38  ASN 38  38  38  ASN ASN A . n 
A 1 39  GLU 39  39  39  GLU GLU A . n 
A 1 40  ASP 40  40  40  ASP ASP A . n 
A 1 41  PHE 41  41  41  PHE PHE A . n 
A 1 42  GLU 42  42  42  GLU GLU A . n 
A 1 43  GLY 43  43  43  GLY GLY A . n 
A 1 44  PRO 44  44  44  PRO PRO A . n 
A 1 45  PRO 45  45  45  PRO PRO A . n 
A 1 46  LEU 46  46  46  LEU LEU A . n 
A 1 47  ALA 47  47  47  ALA ALA A . n 
A 1 48  THR 48  48  48  THR THR A . n 
A 1 49  ARG 49  49  49  ARG ARG A . n 
A 1 50  LEU 50  50  50  LEU LEU A . n 
A 1 51  LEU 51  51  51  LEU LEU A . n 
A 1 52  ALA 52  52  52  ALA ALA A . n 
A 1 53  HIS 53  53  53  HIS HIS A . n 
A 1 54  LYS 54  54  54  LYS LYS A . n 
A 1 55  ILE 55  55  55  ILE ILE A . n 
A 1 56  GLN 56  56  56  GLN GLN A . n 
A 1 57  SER 57  57  57  SER SER A . n 
A 1 58  PRO 58  58  58  PRO PRO A . n 
A 1 59  GLN 59  59  59  GLN GLN A . n 
A 1 60  GLU 60  60  60  GLU GLU A . n 
A 1 61  TRP 61  61  61  TRP TRP A . n 
A 1 62  GLU 62  62  62  GLU GLU A . n 
A 1 63  ALA 63  63  63  ALA ALA A . n 
A 1 64  ILE 64  64  64  ILE ILE A . n 
A 1 65  GLN 65  65  65  GLN GLN A . n 
A 1 66  ALA 66  66  66  ALA ALA A . n 
A 1 67  LEU 67  67  67  LEU LEU A . n 
A 1 68  THR 68  68  68  THR THR A . n 
A 1 69  VAL 69  69  69  VAL VAL A . n 
A 1 70  LEU 70  70  70  LEU LEU A . n 
A 1 71  GLU 71  71  71  GLU GLU A . n 
A 1 72  THR 72  72  72  THR THR A . n 
A 1 73  CYS 73  73  73  CYS CYS A . n 
A 1 74  MET 74  74  74  MET MET A . n 
A 1 75  LYS 75  75  75  LYS LYS A . n 
A 1 76  SER 76  76  76  SER SER A . n 
A 1 77  CYS 77  77  77  CYS CYS A . n 
A 1 78  GLY 78  78  78  GLY GLY A . n 
A 1 79  LYS 79  79  79  LYS LYS A . n 
A 1 80  ARG 80  80  80  ARG ARG A . n 
A 1 81  PHE 81  81  81  PHE PHE A . n 
A 1 82  HIS 82  82  82  HIS HIS A . n 
A 1 83  ASP 83  83  83  ASP ASP A . n 
A 1 84  GLU 84  84  84  GLU GLU A . n 
A 1 85  VAL 85  85  85  VAL VAL A . n 
A 1 86  GLY 86  86  86  GLY GLY A . n 
A 1 87  LYS 87  87  87  LYS LYS A . n 
A 1 88  PHE 88  88  88  PHE PHE A . n 
A 1 89  ARG 89  89  89  ARG ARG A . n 
A 1 90  PHE 90  90  90  PHE PHE A . n 
A 1 91  LEU 91  91  91  LEU LEU A . n 
A 1 92  ASN 92  92  92  ASN ASN A . n 
A 1 93  GLU 93  93  93  GLU GLU A . n 
A 1 94  LEU 94  94  94  LEU LEU A . n 
A 1 95  ILE 95  95  95  ILE ILE A . n 
A 1 96  LYS 96  96  96  LYS LYS A . n 
A 1 97  VAL 97  97  97  VAL VAL A . n 
A 1 98  VAL 98  98  98  VAL VAL A . n 
A 1 99  SER 99  99  99  SER SER A . n 
A 1 100 PRO 100 100 100 PRO PRO A . n 
A 1 101 LYS 101 101 101 LYS LYS A . n 
A 1 102 TYR 102 102 102 TYR TYR A . n 
A 1 103 LEU 103 103 103 LEU LEU A . n 
A 1 104 GLY 104 104 104 GLY GLY A . n 
A 1 105 SER 105 105 105 SER SER A . n 
A 1 106 ARG 106 106 106 ARG ARG A . n 
A 1 107 THR 107 107 107 THR THR A . n 
A 1 108 SER 108 108 108 SER SER A . n 
A 1 109 GLU 109 109 109 GLU GLU A . n 
A 1 110 LYS 110 110 110 LYS LYS A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 LYS 112 112 112 LYS LYS A . n 
A 1 113 ASN 113 113 113 ASN ASN A . n 
A 1 114 LYS 114 114 114 LYS LYS A . n 
A 1 115 ILE 115 115 115 ILE ILE A . n 
A 1 116 LEU 116 116 116 LEU LEU A . n 
A 1 117 GLU 117 117 117 GLU GLU A . n 
A 1 118 LEU 118 118 118 LEU LEU A . n 
A 1 119 LEU 119 119 119 LEU LEU A . n 
A 1 120 TYR 120 120 120 TYR TYR A . n 
A 1 121 SER 121 121 121 SER SER A . n 
A 1 122 TRP 122 122 122 TRP TRP A . n 
A 1 123 THR 123 123 123 THR THR A . n 
A 1 124 VAL 124 124 124 VAL VAL A . n 
A 1 125 GLY 125 125 125 GLY GLY A . n 
A 1 126 LEU 126 126 126 LEU LEU A . n 
A 1 127 PRO 127 127 127 PRO PRO A . n 
A 1 128 GLU 128 128 128 GLU GLU A . n 
A 1 129 GLU 129 129 129 GLU GLU A . n 
A 1 130 VAL 130 130 130 VAL VAL A . n 
A 1 131 LYS 131 131 131 LYS LYS A . n 
A 1 132 ILE 132 132 132 ILE ILE A . n 
A 1 133 ALA 133 133 133 ALA ALA A . n 
A 1 134 GLU 134 134 134 GLU GLU A . n 
A 1 135 ALA 135 135 135 ALA ALA A . n 
A 1 136 TYR 136 136 136 TYR TYR A . n 
A 1 137 GLN 137 137 137 GLN GLN A . n 
A 1 138 MET 138 138 138 MET MET A . n 
A 1 139 LEU 139 139 139 LEU LEU A . n 
A 1 140 LYS 140 140 140 LYS LYS A . n 
A 1 141 LYS 141 141 141 LYS LYS A . n 
A 1 142 GLN 142 142 142 GLN GLN A . n 
A 1 143 GLY 143 143 143 GLY GLY A . n 
A 1 144 ILE 144 144 144 ILE ILE A . n 
A 1 145 VAL 145 145 145 VAL VAL A . n 
A 1 146 LYS 146 146 146 LYS LYS A . n 
A 1 147 SER 147 147 ?   ?   ?   A . n 
B 2 1   SER 1   1   ?   ?   ?   C . n 
B 2 2   PHE 2   2   ?   ?   ?   C . n 
B 2 3   HIS 3   3   ?   ?   ?   C . n 
B 2 4   ASP 4   4   ?   ?   ?   C . n 
B 2 5   ASP 5   5   ?   ?   ?   C . n 
B 2 6   SER 6   6   ?   ?   ?   C . n 
B 2 7   ASP 7   7   7   ASP ASP C . n 
B 2 8   GLU 8   8   8   GLU GLU C . n 
B 2 9   ASP 9   9   9   ASP ASP C . n 
B 2 10  LEU 10  10  10  LEU LEU C . n 
B 2 11  LEU 11  11  11  LEU LEU C . n 
B 2 12  HIS 12  12  12  HIS HIS C . n 
B 2 13  ILE 13  13  13  ILE ILE C . n 
C 1 1   MET 1   1   ?   ?   ?   B . n 
C 1 2   GLU 2   2   ?   ?   ?   B . n 
C 1 3   PRO 3   3   ?   ?   ?   B . n 
C 1 4   ALA 4   4   ?   ?   ?   B . n 
C 1 5   MET 5   5   ?   ?   ?   B . n 
C 1 6   GLU 6   6   ?   ?   ?   B . n 
C 1 7   PRO 7   7   7   PRO PRO B . n 
C 1 8   GLU 8   8   8   GLU GLU B . n 
C 1 9   THR 9   9   9   THR THR B . n 
C 1 10  LEU 10  10  10  LEU LEU B . n 
C 1 11  GLU 11  11  11  GLU GLU B . n 
C 1 12  ALA 12  12  12  ALA ALA B . n 
C 1 13  ARG 13  13  13  ARG ARG B . n 
C 1 14  ILE 14  14  14  ILE ILE B . n 
C 1 15  ASN 15  15  15  ASN ASN B . n 
C 1 16  ARG 16  16  16  ARG ARG B . n 
C 1 17  ALA 17  17  17  ALA ALA B . n 
C 1 18  THR 18  18  18  THR THR B . n 
C 1 19  ASN 19  19  19  ASN ASN B . n 
C 1 20  PRO 20  20  20  PRO PRO B . n 
C 1 21  LEU 21  21  21  LEU LEU B . n 
C 1 22  ASN 22  22  22  ASN ASN B . n 
C 1 23  LYS 23  23  23  LYS LYS B . n 
C 1 24  GLU 24  24  24  GLU GLU B . n 
C 1 25  LEU 25  25  25  LEU LEU B . n 
C 1 26  ASP 26  26  26  ASP ASP B . n 
C 1 27  TRP 27  27  27  TRP TRP B . n 
C 1 28  ALA 28  28  28  ALA ALA B . n 
C 1 29  SER 29  29  29  SER SER B . n 
C 1 30  ILE 30  30  30  ILE ILE B . n 
C 1 31  ASN 31  31  31  ASN ASN B . n 
C 1 32  GLY 32  32  32  GLY GLY B . n 
C 1 33  PHE 33  33  33  PHE PHE B . n 
C 1 34  CYS 34  34  34  CYS CYS B . n 
C 1 35  GLU 35  35  35  GLU GLU B . n 
C 1 36  GLN 36  36  36  GLN GLN B . n 
C 1 37  LEU 37  37  37  LEU LEU B . n 
C 1 38  ASN 38  38  38  ASN ASN B . n 
C 1 39  GLU 39  39  39  GLU GLU B . n 
C 1 40  ASP 40  40  40  ASP ASP B . n 
C 1 41  PHE 41  41  41  PHE PHE B . n 
C 1 42  GLU 42  42  42  GLU GLU B . n 
C 1 43  GLY 43  43  43  GLY GLY B . n 
C 1 44  PRO 44  44  44  PRO PRO B . n 
C 1 45  PRO 45  45  45  PRO PRO B . n 
C 1 46  LEU 46  46  46  LEU LEU B . n 
C 1 47  ALA 47  47  47  ALA ALA B . n 
C 1 48  THR 48  48  48  THR THR B . n 
C 1 49  ARG 49  49  49  ARG ARG B . n 
C 1 50  LEU 50  50  50  LEU LEU B . n 
C 1 51  LEU 51  51  51  LEU LEU B . n 
C 1 52  ALA 52  52  52  ALA ALA B . n 
C 1 53  HIS 53  53  53  HIS HIS B . n 
C 1 54  LYS 54  54  54  LYS LYS B . n 
C 1 55  ILE 55  55  55  ILE ILE B . n 
C 1 56  GLN 56  56  56  GLN GLN B . n 
C 1 57  SER 57  57  57  SER SER B . n 
C 1 58  PRO 58  58  58  PRO PRO B . n 
C 1 59  GLN 59  59  59  GLN GLN B . n 
C 1 60  GLU 60  60  60  GLU GLU B . n 
C 1 61  TRP 61  61  61  TRP TRP B . n 
C 1 62  GLU 62  62  62  GLU GLU B . n 
C 1 63  ALA 63  63  63  ALA ALA B . n 
C 1 64  ILE 64  64  64  ILE ILE B . n 
C 1 65  GLN 65  65  65  GLN GLN B . n 
C 1 66  ALA 66  66  66  ALA ALA B . n 
C 1 67  LEU 67  67  67  LEU LEU B . n 
C 1 68  THR 68  68  68  THR THR B . n 
C 1 69  VAL 69  69  69  VAL VAL B . n 
C 1 70  LEU 70  70  70  LEU LEU B . n 
C 1 71  GLU 71  71  71  GLU GLU B . n 
C 1 72  THR 72  72  72  THR THR B . n 
C 1 73  CYS 73  73  73  CYS CYS B . n 
C 1 74  MET 74  74  74  MET MET B . n 
C 1 75  LYS 75  75  75  LYS LYS B . n 
C 1 76  SER 76  76  76  SER SER B . n 
C 1 77  CYS 77  77  77  CYS CYS B . n 
C 1 78  GLY 78  78  78  GLY GLY B . n 
C 1 79  LYS 79  79  79  LYS LYS B . n 
C 1 80  ARG 80  80  80  ARG ARG B . n 
C 1 81  PHE 81  81  81  PHE PHE B . n 
C 1 82  HIS 82  82  82  HIS HIS B . n 
C 1 83  ASP 83  83  83  ASP ASP B . n 
C 1 84  GLU 84  84  84  GLU GLU B . n 
C 1 85  VAL 85  85  85  VAL VAL B . n 
C 1 86  GLY 86  86  86  GLY GLY B . n 
C 1 87  LYS 87  87  87  LYS LYS B . n 
C 1 88  PHE 88  88  88  PHE PHE B . n 
C 1 89  ARG 89  89  89  ARG ARG B . n 
C 1 90  PHE 90  90  90  PHE PHE B . n 
C 1 91  LEU 91  91  91  LEU LEU B . n 
C 1 92  ASN 92  92  92  ASN ASN B . n 
C 1 93  GLU 93  93  93  GLU GLU B . n 
C 1 94  LEU 94  94  94  LEU LEU B . n 
C 1 95  ILE 95  95  95  ILE ILE B . n 
C 1 96  LYS 96  96  96  LYS LYS B . n 
C 1 97  VAL 97  97  97  VAL VAL B . n 
C 1 98  VAL 98  98  98  VAL VAL B . n 
C 1 99  SER 99  99  99  SER SER B . n 
C 1 100 PRO 100 100 100 PRO PRO B . n 
C 1 101 LYS 101 101 101 LYS LYS B . n 
C 1 102 TYR 102 102 102 TYR TYR B . n 
C 1 103 LEU 103 103 103 LEU LEU B . n 
C 1 104 GLY 104 104 104 GLY GLY B . n 
C 1 105 SER 105 105 105 SER SER B . n 
C 1 106 ARG 106 106 106 ARG ARG B . n 
C 1 107 THR 107 107 107 THR THR B . n 
C 1 108 SER 108 108 108 SER SER B . n 
C 1 109 GLU 109 109 109 GLU GLU B . n 
C 1 110 LYS 110 110 110 LYS LYS B . n 
C 1 111 VAL 111 111 111 VAL VAL B . n 
C 1 112 LYS 112 112 112 LYS LYS B . n 
C 1 113 ASN 113 113 113 ASN ASN B . n 
C 1 114 LYS 114 114 114 LYS LYS B . n 
C 1 115 ILE 115 115 115 ILE ILE B . n 
C 1 116 LEU 116 116 116 LEU LEU B . n 
C 1 117 GLU 117 117 117 GLU GLU B . n 
C 1 118 LEU 118 118 118 LEU LEU B . n 
C 1 119 LEU 119 119 119 LEU LEU B . n 
C 1 120 TYR 120 120 120 TYR TYR B . n 
C 1 121 SER 121 121 121 SER SER B . n 
C 1 122 TRP 122 122 122 TRP TRP B . n 
C 1 123 THR 123 123 123 THR THR B . n 
C 1 124 VAL 124 124 124 VAL VAL B . n 
C 1 125 GLY 125 125 125 GLY GLY B . n 
C 1 126 LEU 126 126 126 LEU LEU B . n 
C 1 127 PRO 127 127 127 PRO PRO B . n 
C 1 128 GLU 128 128 128 GLU GLU B . n 
C 1 129 GLU 129 129 129 GLU GLU B . n 
C 1 130 VAL 130 130 130 VAL VAL B . n 
C 1 131 LYS 131 131 131 LYS LYS B . n 
C 1 132 ILE 132 132 132 ILE ILE B . n 
C 1 133 ALA 133 133 133 ALA ALA B . n 
C 1 134 GLU 134 134 134 GLU GLU B . n 
C 1 135 ALA 135 135 135 ALA ALA B . n 
C 1 136 TYR 136 136 136 TYR TYR B . n 
C 1 137 GLN 137 137 137 GLN GLN B . n 
C 1 138 MET 138 138 138 MET MET B . n 
C 1 139 LEU 139 139 139 LEU LEU B . n 
C 1 140 LYS 140 140 140 LYS LYS B . n 
C 1 141 LYS 141 141 141 LYS LYS B . n 
C 1 142 GLN 142 142 142 GLN GLN B . n 
C 1 143 GLY 143 143 143 GLY GLY B . n 
C 1 144 ILE 144 144 144 ILE ILE B . n 
C 1 145 VAL 145 145 145 VAL VAL B . n 
C 1 146 LYS 146 146 146 LYS LYS B . n 
C 1 147 SER 147 147 ?   ?   ?   B . n 
D 2 1   SER 1   1   ?   ?   ?   D . n 
D 2 2   PHE 2   2   ?   ?   ?   D . n 
D 2 3   HIS 3   3   ?   ?   ?   D . n 
D 2 4   ASP 4   4   ?   ?   ?   D . n 
D 2 5   ASP 5   5   ?   ?   ?   D . n 
D 2 6   SER 6   6   ?   ?   ?   D . n 
D 2 7   ASP 7   7   ?   ?   ?   D . n 
D 2 8   GLU 8   8   ?   ?   ?   D . n 
D 2 9   ASP 9   9   9   ASP ASP D . n 
D 2 10  LEU 10  10  10  LEU LEU D . n 
D 2 11  LEU 11  11  11  LEU LEU D . n 
D 2 12  HIS 12  12  12  HIS HIS D . n 
D 2 13  ILE 13  13  13  ILE ILE D . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly              ?    dimeric 2 
2 author_and_software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,E,F,K,L     
2 1 C,D,G,H,I,J,M,N 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
2 'ABSA (A^2)' 1090 ? 
2 MORE         -7   ? 
2 'SSA (A^2)'  8060 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-03-06 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MOSFLM 'data reduction' .         ? 1 
SCALA  'data scaling'   .         ? 2 
AMoRE  phasing          .         ? 3 
REFMAC refinement       5.0       ? 4 
CCP4   'data scaling'   '(SCALA)' ? 5 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CA A LEU 37 ? ? CB A LEU 37 ? ? CG  A LEU 37 ? ? 129.59 115.30 14.29 2.30 N 
2 1 CB A ASP 83 ? ? CG A ASP 83 ? ? OD2 A ASP 83 ? ? 124.61 118.30 6.31  0.90 N 
3 1 CB B ASP 26 ? ? CG B ASP 26 ? ? OD2 B ASP 26 ? ? 123.76 118.30 5.46  0.90 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 TYR A 102 ? ? -113.65 -97.58 
2 1 TYR B 102 ? ? -117.48 -99.62 
3 1 PRO B 127 ? ? -49.55  -12.77 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A GLU 2   ? A GLU 2   
3  1 Y 1 A PRO 3   ? A PRO 3   
4  1 Y 1 A ALA 4   ? A ALA 4   
5  1 Y 1 A MET 5   ? A MET 5   
6  1 Y 1 A GLU 6   ? A GLU 6   
7  1 Y 1 A SER 147 ? A SER 147 
8  1 Y 1 C SER 1   ? B SER 1   
9  1 Y 1 C PHE 2   ? B PHE 2   
10 1 Y 1 C HIS 3   ? B HIS 3   
11 1 Y 1 C ASP 4   ? B ASP 4   
12 1 Y 1 C ASP 5   ? B ASP 5   
13 1 Y 1 C SER 6   ? B SER 6   
14 1 Y 1 B MET 1   ? C MET 1   
15 1 Y 1 B GLU 2   ? C GLU 2   
16 1 Y 1 B PRO 3   ? C PRO 3   
17 1 Y 1 B ALA 4   ? C ALA 4   
18 1 Y 1 B MET 5   ? C MET 5   
19 1 Y 1 B GLU 6   ? C GLU 6   
20 1 Y 1 B SER 147 ? C SER 147 
21 1 Y 1 D SER 1   ? D SER 1   
22 1 Y 1 D PHE 2   ? D PHE 2   
23 1 Y 1 D HIS 3   ? D HIS 3   
24 1 Y 1 D ASP 4   ? D ASP 4   
25 1 Y 1 D ASP 5   ? D ASP 5   
26 1 Y 1 D SER 6   ? D SER 6   
27 1 Y 1 D ASP 7   ? D ASP 7   
28 1 Y 1 D GLU 8   ? D GLU 8   
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'IODIDE ION' IOD 
4 water        HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 IOD 1   148 1   IOD IOD A . 
F 3 IOD 1   149 2   IOD IOD A . 
G 3 IOD 1   148 3   IOD IOD B . 
H 3 IOD 1   149 4   IOD IOD B . 
I 3 IOD 1   150 5   IOD IOD B . 
J 3 IOD 1   151 6   IOD IOD B . 
K 4 HOH 1   150 8   HOH HOH A . 
K 4 HOH 2   151 9   HOH HOH A . 
K 4 HOH 3   152 10  HOH HOH A . 
K 4 HOH 4   153 11  HOH HOH A . 
K 4 HOH 5   154 12  HOH HOH A . 
K 4 HOH 6   155 13  HOH HOH A . 
K 4 HOH 7   156 14  HOH HOH A . 
K 4 HOH 8   157 15  HOH HOH A . 
K 4 HOH 9   158 16  HOH HOH A . 
K 4 HOH 10  159 17  HOH HOH A . 
K 4 HOH 11  160 18  HOH HOH A . 
K 4 HOH 12  161 19  HOH HOH A . 
K 4 HOH 13  162 20  HOH HOH A . 
K 4 HOH 14  163 21  HOH HOH A . 
K 4 HOH 15  164 22  HOH HOH A . 
K 4 HOH 16  165 23  HOH HOH A . 
K 4 HOH 17  166 24  HOH HOH A . 
K 4 HOH 18  167 25  HOH HOH A . 
K 4 HOH 19  168 26  HOH HOH A . 
K 4 HOH 20  169 27  HOH HOH A . 
K 4 HOH 21  170 28  HOH HOH A . 
K 4 HOH 22  171 29  HOH HOH A . 
K 4 HOH 23  172 30  HOH HOH A . 
K 4 HOH 24  173 31  HOH HOH A . 
K 4 HOH 25  174 32  HOH HOH A . 
K 4 HOH 26  175 33  HOH HOH A . 
K 4 HOH 27  176 35  HOH HOH A . 
K 4 HOH 28  177 36  HOH HOH A . 
K 4 HOH 29  178 37  HOH HOH A . 
K 4 HOH 30  179 38  HOH HOH A . 
K 4 HOH 31  180 39  HOH HOH A . 
K 4 HOH 32  181 40  HOH HOH A . 
K 4 HOH 33  182 41  HOH HOH A . 
K 4 HOH 34  183 42  HOH HOH A . 
K 4 HOH 35  184 43  HOH HOH A . 
K 4 HOH 36  185 44  HOH HOH A . 
K 4 HOH 37  186 45  HOH HOH A . 
K 4 HOH 38  187 46  HOH HOH A . 
K 4 HOH 39  188 48  HOH HOH A . 
K 4 HOH 40  189 49  HOH HOH A . 
K 4 HOH 41  190 50  HOH HOH A . 
K 4 HOH 42  191 51  HOH HOH A . 
K 4 HOH 43  192 52  HOH HOH A . 
K 4 HOH 44  193 54  HOH HOH A . 
K 4 HOH 45  194 56  HOH HOH A . 
K 4 HOH 46  195 58  HOH HOH A . 
K 4 HOH 47  196 59  HOH HOH A . 
K 4 HOH 48  197 60  HOH HOH A . 
K 4 HOH 49  198 61  HOH HOH A . 
K 4 HOH 50  199 62  HOH HOH A . 
K 4 HOH 51  200 63  HOH HOH A . 
K 4 HOH 52  201 64  HOH HOH A . 
K 4 HOH 53  202 65  HOH HOH A . 
K 4 HOH 54  203 66  HOH HOH A . 
K 4 HOH 55  204 67  HOH HOH A . 
K 4 HOH 56  205 68  HOH HOH A . 
K 4 HOH 57  206 69  HOH HOH A . 
K 4 HOH 58  207 70  HOH HOH A . 
K 4 HOH 59  208 71  HOH HOH A . 
K 4 HOH 60  209 73  HOH HOH A . 
K 4 HOH 61  210 74  HOH HOH A . 
K 4 HOH 62  211 75  HOH HOH A . 
K 4 HOH 63  212 76  HOH HOH A . 
K 4 HOH 64  213 77  HOH HOH A . 
K 4 HOH 65  214 78  HOH HOH A . 
K 4 HOH 66  215 79  HOH HOH A . 
K 4 HOH 67  216 80  HOH HOH A . 
K 4 HOH 68  217 81  HOH HOH A . 
K 4 HOH 69  218 83  HOH HOH A . 
K 4 HOH 70  219 84  HOH HOH A . 
K 4 HOH 71  220 85  HOH HOH A . 
K 4 HOH 72  221 86  HOH HOH A . 
K 4 HOH 73  222 87  HOH HOH A . 
K 4 HOH 74  223 88  HOH HOH A . 
K 4 HOH 75  224 89  HOH HOH A . 
K 4 HOH 76  225 90  HOH HOH A . 
K 4 HOH 77  226 93  HOH HOH A . 
K 4 HOH 78  227 94  HOH HOH A . 
K 4 HOH 79  228 95  HOH HOH A . 
K 4 HOH 80  229 96  HOH HOH A . 
K 4 HOH 81  230 99  HOH HOH A . 
K 4 HOH 82  231 100 HOH HOH A . 
K 4 HOH 83  232 101 HOH HOH A . 
K 4 HOH 84  233 102 HOH HOH A . 
K 4 HOH 85  234 105 HOH HOH A . 
K 4 HOH 86  235 106 HOH HOH A . 
K 4 HOH 87  236 107 HOH HOH A . 
K 4 HOH 88  237 108 HOH HOH A . 
K 4 HOH 89  238 109 HOH HOH A . 
K 4 HOH 90  239 110 HOH HOH A . 
K 4 HOH 91  240 111 HOH HOH A . 
K 4 HOH 92  241 112 HOH HOH A . 
K 4 HOH 93  242 114 HOH HOH A . 
K 4 HOH 94  243 115 HOH HOH A . 
K 4 HOH 95  244 116 HOH HOH A . 
K 4 HOH 96  245 117 HOH HOH A . 
K 4 HOH 97  246 118 HOH HOH A . 
K 4 HOH 98  247 119 HOH HOH A . 
K 4 HOH 99  248 120 HOH HOH A . 
K 4 HOH 100 249 121 HOH HOH A . 
K 4 HOH 101 250 122 HOH HOH A . 
K 4 HOH 102 251 123 HOH HOH A . 
K 4 HOH 103 252 124 HOH HOH A . 
K 4 HOH 104 253 125 HOH HOH A . 
K 4 HOH 105 254 126 HOH HOH A . 
K 4 HOH 106 255 127 HOH HOH A . 
K 4 HOH 107 256 128 HOH HOH A . 
K 4 HOH 108 257 129 HOH HOH A . 
K 4 HOH 109 258 132 HOH HOH A . 
K 4 HOH 110 259 176 HOH HOH A . 
L 4 HOH 1   34  34  HOH HOH C . 
L 4 HOH 2   53  53  HOH HOH C . 
L 4 HOH 3   72  72  HOH HOH C . 
L 4 HOH 4   82  82  HOH HOH C . 
L 4 HOH 5   91  91  HOH HOH C . 
L 4 HOH 6   92  92  HOH HOH C . 
L 4 HOH 7   97  97  HOH HOH C . 
L 4 HOH 8   98  98  HOH HOH C . 
L 4 HOH 9   113 113 HOH HOH C . 
M 4 HOH 1   152 7   HOH HOH B . 
M 4 HOH 2   153 47  HOH HOH B . 
M 4 HOH 3   154 57  HOH HOH B . 
M 4 HOH 4   155 103 HOH HOH B . 
M 4 HOH 5   156 104 HOH HOH B . 
M 4 HOH 6   157 130 HOH HOH B . 
M 4 HOH 7   158 131 HOH HOH B . 
M 4 HOH 8   159 133 HOH HOH B . 
M 4 HOH 9   160 134 HOH HOH B . 
M 4 HOH 10  161 135 HOH HOH B . 
M 4 HOH 11  162 136 HOH HOH B . 
M 4 HOH 12  163 137 HOH HOH B . 
M 4 HOH 13  164 138 HOH HOH B . 
M 4 HOH 14  165 139 HOH HOH B . 
M 4 HOH 15  166 140 HOH HOH B . 
M 4 HOH 16  167 141 HOH HOH B . 
M 4 HOH 17  168 142 HOH HOH B . 
M 4 HOH 18  169 143 HOH HOH B . 
M 4 HOH 19  170 144 HOH HOH B . 
M 4 HOH 20  171 145 HOH HOH B . 
M 4 HOH 21  172 146 HOH HOH B . 
M 4 HOH 22  173 147 HOH HOH B . 
M 4 HOH 23  174 148 HOH HOH B . 
M 4 HOH 24  175 149 HOH HOH B . 
M 4 HOH 25  176 150 HOH HOH B . 
M 4 HOH 26  177 151 HOH HOH B . 
M 4 HOH 27  178 152 HOH HOH B . 
M 4 HOH 28  179 153 HOH HOH B . 
M 4 HOH 29  180 154 HOH HOH B . 
M 4 HOH 30  181 155 HOH HOH B . 
M 4 HOH 31  182 156 HOH HOH B . 
M 4 HOH 32  183 157 HOH HOH B . 
M 4 HOH 33  184 158 HOH HOH B . 
M 4 HOH 34  185 159 HOH HOH B . 
M 4 HOH 35  186 160 HOH HOH B . 
M 4 HOH 36  187 161 HOH HOH B . 
M 4 HOH 37  188 162 HOH HOH B . 
M 4 HOH 38  189 163 HOH HOH B . 
M 4 HOH 39  190 164 HOH HOH B . 
M 4 HOH 40  191 165 HOH HOH B . 
M 4 HOH 41  192 166 HOH HOH B . 
M 4 HOH 42  193 167 HOH HOH B . 
M 4 HOH 43  194 168 HOH HOH B . 
M 4 HOH 44  195 169 HOH HOH B . 
M 4 HOH 45  196 170 HOH HOH B . 
M 4 HOH 46  197 171 HOH HOH B . 
M 4 HOH 47  198 172 HOH HOH B . 
M 4 HOH 48  199 173 HOH HOH B . 
M 4 HOH 49  200 174 HOH HOH B . 
M 4 HOH 50  201 175 HOH HOH B . 
M 4 HOH 51  202 178 HOH HOH B . 
M 4 HOH 52  203 179 HOH HOH B . 
M 4 HOH 53  204 180 HOH HOH B . 
M 4 HOH 54  205 181 HOH HOH B . 
M 4 HOH 55  206 182 HOH HOH B . 
M 4 HOH 56  207 183 HOH HOH B . 
M 4 HOH 57  208 184 HOH HOH B . 
M 4 HOH 58  209 186 HOH HOH B . 
M 4 HOH 59  210 187 HOH HOH B . 
M 4 HOH 60  211 188 HOH HOH B . 
M 4 HOH 61  212 189 HOH HOH B . 
M 4 HOH 62  213 190 HOH HOH B . 
M 4 HOH 63  214 191 HOH HOH B . 
M 4 HOH 64  215 192 HOH HOH B . 
M 4 HOH 65  216 193 HOH HOH B . 
M 4 HOH 66  217 194 HOH HOH B . 
M 4 HOH 67  218 195 HOH HOH B . 
M 4 HOH 68  219 196 HOH HOH B . 
M 4 HOH 69  220 197 HOH HOH B . 
M 4 HOH 70  221 198 HOH HOH B . 
M 4 HOH 71  222 199 HOH HOH B . 
M 4 HOH 72  223 200 HOH HOH B . 
M 4 HOH 73  224 201 HOH HOH B . 
M 4 HOH 74  225 203 HOH HOH B . 
M 4 HOH 75  226 204 HOH HOH B . 
N 4 HOH 1   55  55  HOH HOH D . 
N 4 HOH 2   177 177 HOH HOH D . 
N 4 HOH 3   185 185 HOH HOH D . 
N 4 HOH 4   202 202 HOH HOH D . 
#