data_1JWI
# 
_entry.id   1JWI 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1JWI         
RCSB  RCSB014265   
WWPDB D_1000014265 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1JWI 
_pdbx_database_status.recvd_initial_deposition_date   2001-09-04 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hirotsu, S.' 1 
'Mizuno, H.'  2 
'Fukuda, K.'  3 
'Qi, M.C.'    4 
'Matsui, T.'  5 
'Hamako, J.'  6 
'Morita, T.'  7 
'Titani, K.'  8 
# 
_citation.id                        primary 
_citation.title                     
'Crystal structure of bitiscetin, a von Willebrand factor-dependent platelet aggregation inducer.' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            40 
_citation.page_first                13592 
_citation.page_last                 13597 
_citation.year                      2001 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11695907 
_citation.pdbx_database_id_DOI      10.1021/bi0114933 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Hirotsu, S.' 1 
primary 'Mizuno, H.'  2 
primary 'Fukuda, K.'  3 
primary 'Qi, M.C.'    4 
primary 'Matsui, T.'  5 
primary 'Hamako, J.'  6 
primary 'Morita, T.'  7 
primary 'Titani, K.'  8 
# 
_cell.entry_id           1JWI 
_cell.length_a           35.350 
_cell.length_b           61.740 
_cell.length_c           120.930 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1JWI 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer nat bitiscetin                     14953.644 1   ? ? ? ? 
2 polymer nat 'platelet aggregation inducer' 14822.174 1   ? ? ? ? 
3 water   nat water                          18.015    143 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'bitiscetin alpha chain' 
2 'bitiscetin beta chain'  
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;DPGCLPDWSSYKGHCYKVFKKVGTWEDAEKFCVENSGHLASIDSKEEADFVTKLASQTLTKFVYDAWIGLRDESKTQQCS
PQWTDGSSVVYENVDEPTKCFGLDVHTEYRTWTDLPCGEKNPFICKSRLPH
;
;DPGCLPDWSSYKGHCYKVFKKVGTWEDAEKFCVENSGHLASIDSKEEADFVTKLASQTLTKFVYDAWIGLRDESKTQQCS
PQWTDGSSVVYENVDEPTKCFGLDVHTEYRTWTDLPCGEKNPFICKSRLPH
;
A ? 
2 'polypeptide(L)' no no 
;DEGCLPDWSSYKGHCYKVFKVEKTWADAEKFCKELVNGGHLMSVNSREEGEFISKLALEKMRIVLVWIGLSHFWRICPLR
WTDGARLDYRALSDEPICFVAESFHNKWIQWTCNRKKSFVCKYRV
;
;DEGCLPDWSSYKGHCYKVFKVEKTWADAEKFCKELVNGGHLMSVNSREEGEFISKLALEKMRIVLVWIGLSHFWRICPLR
WTDGARLDYRALSDEPICFVAESFHNKWIQWTCNRKKSFVCKYRV
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   PRO n 
1 3   GLY n 
1 4   CYS n 
1 5   LEU n 
1 6   PRO n 
1 7   ASP n 
1 8   TRP n 
1 9   SER n 
1 10  SER n 
1 11  TYR n 
1 12  LYS n 
1 13  GLY n 
1 14  HIS n 
1 15  CYS n 
1 16  TYR n 
1 17  LYS n 
1 18  VAL n 
1 19  PHE n 
1 20  LYS n 
1 21  LYS n 
1 22  VAL n 
1 23  GLY n 
1 24  THR n 
1 25  TRP n 
1 26  GLU n 
1 27  ASP n 
1 28  ALA n 
1 29  GLU n 
1 30  LYS n 
1 31  PHE n 
1 32  CYS n 
1 33  VAL n 
1 34  GLU n 
1 35  ASN n 
1 36  SER n 
1 37  GLY n 
1 38  HIS n 
1 39  LEU n 
1 40  ALA n 
1 41  SER n 
1 42  ILE n 
1 43  ASP n 
1 44  SER n 
1 45  LYS n 
1 46  GLU n 
1 47  GLU n 
1 48  ALA n 
1 49  ASP n 
1 50  PHE n 
1 51  VAL n 
1 52  THR n 
1 53  LYS n 
1 54  LEU n 
1 55  ALA n 
1 56  SER n 
1 57  GLN n 
1 58  THR n 
1 59  LEU n 
1 60  THR n 
1 61  LYS n 
1 62  PHE n 
1 63  VAL n 
1 64  TYR n 
1 65  ASP n 
1 66  ALA n 
1 67  TRP n 
1 68  ILE n 
1 69  GLY n 
1 70  LEU n 
1 71  ARG n 
1 72  ASP n 
1 73  GLU n 
1 74  SER n 
1 75  LYS n 
1 76  THR n 
1 77  GLN n 
1 78  GLN n 
1 79  CYS n 
1 80  SER n 
1 81  PRO n 
1 82  GLN n 
1 83  TRP n 
1 84  THR n 
1 85  ASP n 
1 86  GLY n 
1 87  SER n 
1 88  SER n 
1 89  VAL n 
1 90  VAL n 
1 91  TYR n 
1 92  GLU n 
1 93  ASN n 
1 94  VAL n 
1 95  ASP n 
1 96  GLU n 
1 97  PRO n 
1 98  THR n 
1 99  LYS n 
1 100 CYS n 
1 101 PHE n 
1 102 GLY n 
1 103 LEU n 
1 104 ASP n 
1 105 VAL n 
1 106 HIS n 
1 107 THR n 
1 108 GLU n 
1 109 TYR n 
1 110 ARG n 
1 111 THR n 
1 112 TRP n 
1 113 THR n 
1 114 ASP n 
1 115 LEU n 
1 116 PRO n 
1 117 CYS n 
1 118 GLY n 
1 119 GLU n 
1 120 LYS n 
1 121 ASN n 
1 122 PRO n 
1 123 PHE n 
1 124 ILE n 
1 125 CYS n 
1 126 LYS n 
1 127 SER n 
1 128 ARG n 
1 129 LEU n 
1 130 PRO n 
1 131 HIS n 
2 1   ASP n 
2 2   GLU n 
2 3   GLY n 
2 4   CYS n 
2 5   LEU n 
2 6   PRO n 
2 7   ASP n 
2 8   TRP n 
2 9   SER n 
2 10  SER n 
2 11  TYR n 
2 12  LYS n 
2 13  GLY n 
2 14  HIS n 
2 15  CYS n 
2 16  TYR n 
2 17  LYS n 
2 18  VAL n 
2 19  PHE n 
2 20  LYS n 
2 21  VAL n 
2 22  GLU n 
2 23  LYS n 
2 24  THR n 
2 25  TRP n 
2 26  ALA n 
2 27  ASP n 
2 28  ALA n 
2 29  GLU n 
2 30  LYS n 
2 31  PHE n 
2 32  CYS n 
2 33  LYS n 
2 34  GLU n 
2 35  LEU n 
2 36  VAL n 
2 37  ASN n 
2 38  GLY n 
2 39  GLY n 
2 40  HIS n 
2 41  LEU n 
2 42  MET n 
2 43  SER n 
2 44  VAL n 
2 45  ASN n 
2 46  SER n 
2 47  ARG n 
2 48  GLU n 
2 49  GLU n 
2 50  GLY n 
2 51  GLU n 
2 52  PHE n 
2 53  ILE n 
2 54  SER n 
2 55  LYS n 
2 56  LEU n 
2 57  ALA n 
2 58  LEU n 
2 59  GLU n 
2 60  LYS n 
2 61  MET n 
2 62  ARG n 
2 63  ILE n 
2 64  VAL n 
2 65  LEU n 
2 66  VAL n 
2 67  TRP n 
2 68  ILE n 
2 69  GLY n 
2 70  LEU n 
2 71  SER n 
2 72  HIS n 
2 73  PHE n 
2 74  TRP n 
2 75  ARG n 
2 76  ILE n 
2 77  CYS n 
2 78  PRO n 
2 79  LEU n 
2 80  ARG n 
2 81  TRP n 
2 82  THR n 
2 83  ASP n 
2 84  GLY n 
2 85  ALA n 
2 86  ARG n 
2 87  LEU n 
2 88  ASP n 
2 89  TYR n 
2 90  ARG n 
2 91  ALA n 
2 92  LEU n 
2 93  SER n 
2 94  ASP n 
2 95  GLU n 
2 96  PRO n 
2 97  ILE n 
2 98  CYS n 
2 99  PHE n 
2 100 VAL n 
2 101 ALA n 
2 102 GLU n 
2 103 SER n 
2 104 PHE n 
2 105 HIS n 
2 106 ASN n 
2 107 LYS n 
2 108 TRP n 
2 109 ILE n 
2 110 GLN n 
2 111 TRP n 
2 112 THR n 
2 113 CYS n 
2 114 ASN n 
2 115 ARG n 
2 116 LYS n 
2 117 LYS n 
2 118 SER n 
2 119 PHE n 
2 120 VAL n 
2 121 CYS n 
2 122 LYS n 
2 123 TYR n 
2 124 ARG n 
2 125 VAL n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1 1 sample ? ? 'puff adder' 'Bitis arietans' 8692 Bitis ? ? ? ? venom ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? 'puff adder' 'Bitis arietans' 8692 Bitis ? ? ? ? venom ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 GB JC5058    1 ? ? 2134244 ? 
2 GB 'JC5059 ' 2 ? ? 2134245 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1JWI A 1 ? 131 ? 2134244 1 ? 131 ? 1 131 
2 2 1JWI B 1 ? 125 ? 2134245 1 ? 125 ? 1 125 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1JWI 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.22 
_exptl_crystal.density_percent_sol   44.47 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_details    'PEG 3350, calcium chloride, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           298.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   2000 
_diffrn_detector.details                'confocal mirrors' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'confocal mirrors' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU ULTRAX 18' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     1JWI 
_reflns.observed_criterion_sigma_I   0.5 
_reflns.observed_criterion_sigma_F   1.0 
_reflns.d_resolution_low             65 
_reflns.d_resolution_high            2.0 
_reflns.number_obs                   566351 
_reflns.number_all                   18662 
_reflns.percent_possible_obs         98.8 
_reflns.pdbx_Rmerge_I_obs            0.093 
_reflns.pdbx_Rsym_value              0.093 
_reflns.pdbx_netI_over_sigmaI        18.9 
_reflns.B_iso_Wilson_estimate        13.5 
_reflns.pdbx_redundancy              30.3 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.0 
_reflns_shell.d_res_low              2.09 
_reflns_shell.percent_possible_all   96.9 
_reflns_shell.Rmerge_I_obs           0.264 
_reflns_shell.pdbx_Rsym_value        0.264 
_reflns_shell.meanI_over_sigI_obs    4.3 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1JWI 
_refine.ls_number_reflns_obs                     18040 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          0.5 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               457829.81 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.ls_d_res_low                             8.00 
_refine.ls_d_res_high                            2.00 
_refine.ls_percent_reflns_obs                    98.8 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.207 
_refine.ls_R_factor_R_free                       0.252 
_refine.ls_R_factor_R_free_error                 0.006 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 9.7 
_refine.ls_number_reflns_R_free                  1750 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               24.9 
_refine.aniso_B[1][1]                            0.17 
_refine.aniso_B[2][2]                            5.63 
_refine.aniso_B[3][3]                            -5.80 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.459023 
_refine.solvent_model_param_bsol                 60.8542 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1BJ3' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1JWI 
_refine_analyze.Luzzati_coordinate_error_obs    0.23 
_refine_analyze.Luzzati_sigma_a_obs             0.16 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.28 
_refine_analyze.Luzzati_sigma_a_free            0.17 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2004 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             143 
_refine_hist.number_atoms_total               2147 
_refine_hist.d_res_high                       2.00 
_refine_hist.d_res_low                        8.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.006 ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.3   ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      23.6  ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.71  ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.00 
_refine_ls_shell.d_res_low                        2.12 
_refine_ls_shell.number_reflns_R_work             2593 
_refine_ls_shell.R_factor_R_work                  0.243 
_refine_ls_shell.percent_reflns_obs               96.8 
_refine_ls_shell.R_factor_R_free                  0.283 
_refine_ls_shell.R_factor_R_free_error            0.017 
_refine_ls_shell.percent_reflns_R_free            10.0 
_refine_ls_shell.number_reflns_R_free             289 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 WATER_REP.PARAM   WATER.TOP   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1JWI 
_struct.title                     'Crystal Structure of Bitiscetin, a von Willeband Factor-dependent Platelet Aggregation Inducer.' 
_struct.pdbx_descriptor           'bitiscetin, platelet aggregation inducer' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1JWI 
_struct_keywords.pdbx_keywords   TOXIN 
_struct_keywords.text            'Domain swapping, C-type lectin, TOXIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 THR A 24  ? ASN A 35  ? THR A 24  ASN A 35  1 ? 12 
HELX_P HELX_P2 2 SER A 44  ? LEU A 59  ? SER A 44  LEU A 59  1 ? 16 
HELX_P HELX_P3 3 VAL A 105 ? GLU A 108 ? VAL A 105 GLU A 108 5 ? 4  
HELX_P HELX_P4 4 THR B 24  ? VAL B 36  ? THR B 24  VAL B 36  1 ? 13 
HELX_P HELX_P5 5 SER B 46  ? LYS B 60  ? SER B 46  LYS B 60  1 ? 15 
HELX_P HELX_P6 6 PHE B 73  ? CYS B 77  ? PHE B 73  CYS B 77  5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 4   SG ? ? ? 1_555 A CYS 15  SG ? ? A CYS 4   A CYS 15  1_555 ? ? ? ? ? ? ? 2.027 ? 
disulf2 disulf ? ? A CYS 32  SG ? ? ? 1_555 A CYS 125 SG ? ? A CYS 32  A CYS 125 1_555 ? ? ? ? ? ? ? 2.025 ? 
disulf3 disulf ? ? A CYS 79  SG ? ? ? 1_555 B CYS 77  SG ? ? A CYS 79  B CYS 77  1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf4 disulf ? ? A CYS 100 SG ? ? ? 1_555 A CYS 117 SG ? ? A CYS 100 A CYS 117 1_555 ? ? ? ? ? ? ? 2.025 ? 
disulf5 disulf ? ? B CYS 4   SG ? ? ? 1_555 B CYS 15  SG ? ? B CYS 4   B CYS 15  1_555 ? ? ? ? ? ? ? 2.024 ? 
disulf6 disulf ? ? B CYS 32  SG ? ? ? 1_555 B CYS 121 SG ? ? B CYS 32  B CYS 121 1_555 ? ? ? ? ? ? ? 2.036 ? 
disulf7 disulf ? ? B CYS 98  SG ? ? ? 1_555 B CYS 113 SG ? ? B CYS 98  B CYS 113 1_555 ? ? ? ? ? ? ? 2.032 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
C ? 4 ? 
D ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? parallel      
D 4 5 ? anti-parallel 
D 5 6 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER A 9   ? TYR A 11  ? SER A 9   TYR A 11  
A 2 HIS A 14  ? GLY A 23  ? HIS A 14  GLY A 23  
A 3 ASN A 121 ? SER A 127 ? ASN A 121 SER A 127 
A 4 HIS A 38  ? LEU A 39  ? HIS A 38  LEU A 39  
B 1 TRP A 112 ? LEU A 115 ? TRP A 112 LEU A 115 
B 2 CYS A 100 ? LEU A 103 ? CYS A 100 LEU A 103 
B 3 ALA A 66  ? ASP A 72  ? ALA A 66  ASP A 72  
B 4 LEU B 79  ? TRP B 81  ? LEU B 79  TRP B 81  
C 1 SER B 9   ? TYR B 11  ? SER B 9   TYR B 11  
C 2 HIS B 14  ? LYS B 23  ? HIS B 14  LYS B 23  
C 3 LYS B 117 ? ARG B 124 ? LYS B 117 ARG B 124 
C 4 HIS B 40  ? LEU B 41  ? HIS B 40  LEU B 41  
D 1 SER B 9   ? TYR B 11  ? SER B 9   TYR B 11  
D 2 HIS B 14  ? LYS B 23  ? HIS B 14  LYS B 23  
D 3 LYS B 117 ? ARG B 124 ? LYS B 117 ARG B 124 
D 4 LEU B 65  ? HIS B 72  ? LEU B 65  HIS B 72  
D 5 ILE B 97  ? GLU B 102 ? ILE B 97  GLU B 102 
D 6 TRP B 108 ? THR B 112 ? TRP B 108 THR B 112 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N SER A 9   ? N SER A 9   O TYR A 16  ? O TYR A 16  
A 2 3 N PHE A 19  ? N PHE A 19  O PHE A 123 ? O PHE A 123 
A 3 4 O LYS A 126 ? O LYS A 126 N HIS A 38  ? N HIS A 38  
B 1 2 O LEU A 115 ? O LEU A 115 N CYS A 100 ? N CYS A 100 
B 2 3 O LEU A 103 ? O LEU A 103 N ALA A 66  ? N ALA A 66  
B 3 4 N ARG A 71  ? N ARG A 71  O ARG B 80  ? O ARG B 80  
C 1 2 N SER B 9   ? N SER B 9   O TYR B 16  ? O TYR B 16  
C 2 3 N PHE B 19  ? N PHE B 19  O PHE B 119 ? O PHE B 119 
C 3 4 O LYS B 122 ? O LYS B 122 N HIS B 40  ? N HIS B 40  
D 1 2 N SER B 9   ? N SER B 9   O TYR B 16  ? O TYR B 16  
D 2 3 N PHE B 19  ? N PHE B 19  O PHE B 119 ? O PHE B 119 
D 3 4 O SER B 118 ? O SER B 118 N TRP B 67  ? N TRP B 67  
D 4 5 N HIS B 72  ? N HIS B 72  O ILE B 97  ? O ILE B 97  
D 5 6 N CYS B 98  ? N CYS B 98  O TRP B 111 ? O TRP B 111 
# 
_database_PDB_matrix.entry_id          1JWI 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1JWI 
_atom_sites.fract_transf_matrix[1][1]   0.028289 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016197 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008269 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . CYS A 1 4   ? -12.718 2.990   -2.938 1.00 35.76 ? 4   CYS A N   1 
ATOM   2    C CA  . CYS A 1 4   ? -11.427 3.641   -2.576 1.00 35.19 ? 4   CYS A CA  1 
ATOM   3    C C   . CYS A 1 4   ? -10.663 4.070   -3.828 1.00 35.45 ? 4   CYS A C   1 
ATOM   4    O O   . CYS A 1 4   ? -10.920 3.566   -4.921 1.00 36.67 ? 4   CYS A O   1 
ATOM   5    C CB  . CYS A 1 4   ? -10.552 2.668   -1.779 1.00 33.34 ? 4   CYS A CB  1 
ATOM   6    S SG  . CYS A 1 4   ? -11.301 1.966   -0.275 1.00 30.21 ? 4   CYS A SG  1 
ATOM   7    N N   . LEU A 1 5   ? -9.731  5.007   -3.673 1.00 35.53 ? 5   LEU A N   1 
ATOM   8    C CA  . LEU A 1 5   ? -8.928  5.433   -4.809 1.00 35.85 ? 5   LEU A CA  1 
ATOM   9    C C   . LEU A 1 5   ? -8.225  4.178   -5.320 1.00 36.66 ? 5   LEU A C   1 
ATOM   10   O O   . LEU A 1 5   ? -7.988  3.236   -4.559 1.00 37.81 ? 5   LEU A O   1 
ATOM   11   C CB  . LEU A 1 5   ? -7.907  6.495   -4.393 1.00 36.28 ? 5   LEU A CB  1 
ATOM   12   C CG  . LEU A 1 5   ? -8.435  7.933   -4.300 1.00 36.67 ? 5   LEU A CG  1 
ATOM   13   C CD1 . LEU A 1 5   ? -9.541  8.032   -3.257 1.00 38.27 ? 5   LEU A CD1 1 
ATOM   14   C CD2 . LEU A 1 5   ? -7.287  8.865   -3.948 1.00 36.95 ? 5   LEU A CD2 1 
ATOM   15   N N   . PRO A 1 6   ? -7.877  4.148   -6.615 1.00 36.48 ? 6   PRO A N   1 
ATOM   16   C CA  . PRO A 1 6   ? -7.210  2.986   -7.209 1.00 36.42 ? 6   PRO A CA  1 
ATOM   17   C C   . PRO A 1 6   ? -5.958  2.457   -6.507 1.00 36.16 ? 6   PRO A C   1 
ATOM   18   O O   . PRO A 1 6   ? -5.639  1.273   -6.623 1.00 36.26 ? 6   PRO A O   1 
ATOM   19   C CB  . PRO A 1 6   ? -6.932  3.445   -8.643 1.00 37.41 ? 6   PRO A CB  1 
ATOM   20   C CG  . PRO A 1 6   ? -6.775  4.937   -8.498 1.00 37.50 ? 6   PRO A CG  1 
ATOM   21   C CD  . PRO A 1 6   ? -7.901  5.282   -7.558 1.00 36.44 ? 6   PRO A CD  1 
ATOM   22   N N   . ASP A 1 7   ? -5.254  3.315   -5.773 1.00 35.75 ? 7   ASP A N   1 
ATOM   23   C CA  . ASP A 1 7   ? -4.034  2.878   -5.098 1.00 34.47 ? 7   ASP A CA  1 
ATOM   24   C C   . ASP A 1 7   ? -4.150  2.655   -3.586 1.00 32.46 ? 7   ASP A C   1 
ATOM   25   O O   . ASP A 1 7   ? -3.142  2.506   -2.891 1.00 32.76 ? 7   ASP A O   1 
ATOM   26   C CB  . ASP A 1 7   ? -2.895  3.853   -5.413 1.00 35.53 ? 7   ASP A CB  1 
ATOM   27   C CG  . ASP A 1 7   ? -3.213  5.283   -5.024 1.00 35.84 ? 7   ASP A CG  1 
ATOM   28   O OD1 . ASP A 1 7   ? -4.365  5.721   -5.223 1.00 36.20 ? 7   ASP A OD1 1 
ATOM   29   O OD2 . ASP A 1 7   ? -2.299  5.980   -4.537 1.00 37.64 ? 7   ASP A OD2 1 
ATOM   30   N N   . TRP A 1 8   ? -5.380  2.626   -3.085 1.00 29.95 ? 8   TRP A N   1 
ATOM   31   C CA  . TRP A 1 8   ? -5.638  2.387   -1.668 1.00 28.04 ? 8   TRP A CA  1 
ATOM   32   C C   . TRP A 1 8   ? -6.275  1.011   -1.572 1.00 27.45 ? 8   TRP A C   1 
ATOM   33   O O   . TRP A 1 8   ? -6.749  0.479   -2.576 1.00 27.15 ? 8   TRP A O   1 
ATOM   34   C CB  . TRP A 1 8   ? -6.613  3.433   -1.106 1.00 26.57 ? 8   TRP A CB  1 
ATOM   35   C CG  . TRP A 1 8   ? -6.017  4.802   -0.928 1.00 24.19 ? 8   TRP A CG  1 
ATOM   36   C CD1 . TRP A 1 8   ? -5.383  5.548   -1.875 1.00 23.73 ? 8   TRP A CD1 1 
ATOM   37   C CD2 . TRP A 1 8   ? -5.995  5.580   0.277  1.00 23.54 ? 8   TRP A CD2 1 
ATOM   38   N NE1 . TRP A 1 8   ? -4.962  6.741   -1.337 1.00 22.60 ? 8   TRP A NE1 1 
ATOM   39   C CE2 . TRP A 1 8   ? -5.325  6.787   -0.018 1.00 22.52 ? 8   TRP A CE2 1 
ATOM   40   C CE3 . TRP A 1 8   ? -6.477  5.374   1.579  1.00 23.94 ? 8   TRP A CE3 1 
ATOM   41   C CZ2 . TRP A 1 8   ? -5.120  7.788   0.942  1.00 22.78 ? 8   TRP A CZ2 1 
ATOM   42   C CZ3 . TRP A 1 8   ? -6.273  6.374   2.539  1.00 22.92 ? 8   TRP A CZ3 1 
ATOM   43   C CH2 . TRP A 1 8   ? -5.600  7.563   2.210  1.00 22.82 ? 8   TRP A CH2 1 
ATOM   44   N N   . SER A 1 9   ? -6.283  0.433   -0.376 1.00 27.03 ? 9   SER A N   1 
ATOM   45   C CA  . SER A 1 9   ? -6.896  -0.875  -0.172 1.00 27.23 ? 9   SER A CA  1 
ATOM   46   C C   . SER A 1 9   ? -8.176  -0.694  0.633  1.00 28.38 ? 9   SER A C   1 
ATOM   47   O O   . SER A 1 9   ? -8.250  0.169   1.511  1.00 28.79 ? 9   SER A O   1 
ATOM   48   C CB  . SER A 1 9   ? -5.942  -1.812  0.581  1.00 26.06 ? 9   SER A CB  1 
ATOM   49   O OG  . SER A 1 9   ? -4.726  -1.976  -0.124 1.00 24.19 ? 9   SER A OG  1 
ATOM   50   N N   . SER A 1 10  ? -9.186  -1.504  0.338  1.00 29.85 ? 10  SER A N   1 
ATOM   51   C CA  . SER A 1 10  ? -10.457 -1.412  1.048  1.00 31.73 ? 10  SER A CA  1 
ATOM   52   C C   . SER A 1 10  ? -10.611 -2.527  2.069  1.00 32.70 ? 10  SER A C   1 
ATOM   53   O O   . SER A 1 10  ? -10.288 -3.683  1.791  1.00 33.99 ? 10  SER A O   1 
ATOM   54   C CB  . SER A 1 10  ? -11.614 -1.458  0.053  1.00 31.62 ? 10  SER A CB  1 
ATOM   55   O OG  . SER A 1 10  ? -11.500 -2.590  -0.785 1.00 34.46 ? 10  SER A OG  1 
ATOM   56   N N   . TYR A 1 11  ? -11.103 -2.173  3.253  1.00 33.94 ? 11  TYR A N   1 
ATOM   57   C CA  . TYR A 1 11  ? -11.301 -3.149  4.317  1.00 34.79 ? 11  TYR A CA  1 
ATOM   58   C C   . TYR A 1 11  ? -12.404 -2.736  5.290  1.00 34.75 ? 11  TYR A C   1 
ATOM   59   O O   . TYR A 1 11  ? -12.349 -1.661  5.886  1.00 34.66 ? 11  TYR A O   1 
ATOM   60   C CB  . TYR A 1 11  ? -9.990  -3.374  5.081  1.00 35.03 ? 11  TYR A CB  1 
ATOM   61   C CG  . TYR A 1 11  ? -10.124 -4.335  6.240  1.00 36.82 ? 11  TYR A CG  1 
ATOM   62   C CD1 . TYR A 1 11  ? -10.541 -3.891  7.498  1.00 38.70 ? 11  TYR A CD1 1 
ATOM   63   C CD2 . TYR A 1 11  ? -9.885  -5.698  6.071  1.00 38.21 ? 11  TYR A CD2 1 
ATOM   64   C CE1 . TYR A 1 11  ? -10.723 -4.784  8.554  1.00 39.26 ? 11  TYR A CE1 1 
ATOM   65   C CE2 . TYR A 1 11  ? -10.067 -6.600  7.122  1.00 38.66 ? 11  TYR A CE2 1 
ATOM   66   C CZ  . TYR A 1 11  ? -10.486 -6.137  8.358  1.00 38.87 ? 11  TYR A CZ  1 
ATOM   67   O OH  . TYR A 1 11  ? -10.691 -7.023  9.393  1.00 39.07 ? 11  TYR A OH  1 
ATOM   68   N N   . LYS A 1 12  ? -13.403 -3.603  5.434  1.00 34.30 ? 12  LYS A N   1 
ATOM   69   C CA  . LYS A 1 12  ? -14.530 -3.378  6.336  1.00 34.66 ? 12  LYS A CA  1 
ATOM   70   C C   . LYS A 1 12  ? -15.033 -1.942  6.435  1.00 34.54 ? 12  LYS A C   1 
ATOM   71   O O   . LYS A 1 12  ? -15.163 -1.401  7.533  1.00 35.09 ? 12  LYS A O   1 
ATOM   72   C CB  . LYS A 1 12  ? -14.187 -3.886  7.742  1.00 35.35 ? 12  LYS A CB  1 
ATOM   73   C CG  . LYS A 1 12  ? -14.414 -5.382  7.949  1.00 37.00 ? 12  LYS A CG  1 
ATOM   74   C CD  . LYS A 1 12  ? -13.719 -5.892  9.211  1.00 38.15 ? 12  LYS A CD  1 
ATOM   75   C CE  . LYS A 1 12  ? -14.071 -5.072  10.443 1.00 39.27 ? 12  LYS A CE  1 
ATOM   76   N NZ  . LYS A 1 12  ? -13.194 -5.423  11.602 1.00 40.10 ? 12  LYS A NZ  1 
ATOM   77   N N   . GLY A 1 13  ? -15.316 -1.326  5.293  1.00 33.51 ? 13  GLY A N   1 
ATOM   78   C CA  . GLY A 1 13  ? -15.837 0.029   5.309  1.00 32.29 ? 13  GLY A CA  1 
ATOM   79   C C   . GLY A 1 13  ? -14.831 1.164   5.335  1.00 31.17 ? 13  GLY A C   1 
ATOM   80   O O   . GLY A 1 13  ? -15.222 2.327   5.388  1.00 31.53 ? 13  GLY A O   1 
ATOM   81   N N   . HIS A 1 14  ? -13.542 0.844   5.308  1.00 30.21 ? 14  HIS A N   1 
ATOM   82   C CA  . HIS A 1 14  ? -12.510 1.879   5.313  1.00 28.54 ? 14  HIS A CA  1 
ATOM   83   C C   . HIS A 1 14  ? -11.506 1.670   4.180  1.00 27.90 ? 14  HIS A C   1 
ATOM   84   O O   . HIS A 1 14  ? -11.399 0.575   3.619  1.00 27.43 ? 14  HIS A O   1 
ATOM   85   C CB  . HIS A 1 14  ? -11.751 1.899   6.651  1.00 28.70 ? 14  HIS A CB  1 
ATOM   86   C CG  . HIS A 1 14  ? -12.545 2.447   7.795  1.00 27.07 ? 14  HIS A CG  1 
ATOM   87   N ND1 . HIS A 1 14  ? -13.267 1.644   8.655  1.00 26.96 ? 14  HIS A ND1 1 
ATOM   88   C CD2 . HIS A 1 14  ? -12.735 3.718   8.220  1.00 28.22 ? 14  HIS A CD2 1 
ATOM   89   C CE1 . HIS A 1 14  ? -13.864 2.398   9.558  1.00 27.46 ? 14  HIS A CE1 1 
ATOM   90   N NE2 . HIS A 1 14  ? -13.560 3.661   9.319  1.00 27.76 ? 14  HIS A NE2 1 
ATOM   91   N N   . CYS A 1 15  ? -10.780 2.736   3.853  1.00 27.16 ? 15  CYS A N   1 
ATOM   92   C CA  . CYS A 1 15  ? -9.753  2.705   2.816  1.00 27.19 ? 15  CYS A CA  1 
ATOM   93   C C   . CYS A 1 15  ? -8.396  2.938   3.483  1.00 26.49 ? 15  CYS A C   1 
ATOM   94   O O   . CYS A 1 15  ? -8.245  3.868   4.281  1.00 27.19 ? 15  CYS A O   1 
ATOM   95   C CB  . CYS A 1 15  ? -10.020 3.793   1.775  1.00 28.08 ? 15  CYS A CB  1 
ATOM   96   S SG  . CYS A 1 15  ? -11.607 3.597   0.889  1.00 31.24 ? 15  CYS A SG  1 
ATOM   97   N N   . TYR A 1 16  ? -7.416  2.096   3.158  1.00 24.35 ? 16  TYR A N   1 
ATOM   98   C CA  . TYR A 1 16  ? -6.078  2.203   3.743  1.00 22.35 ? 16  TYR A CA  1 
ATOM   99   C C   . TYR A 1 16  ? -4.971  2.338   2.711  1.00 21.47 ? 16  TYR A C   1 
ATOM   100  O O   . TYR A 1 16  ? -5.065  1.813   1.598  1.00 21.15 ? 16  TYR A O   1 
ATOM   101  C CB  . TYR A 1 16  ? -5.746  0.975   4.594  1.00 20.35 ? 16  TYR A CB  1 
ATOM   102  C CG  . TYR A 1 16  ? -6.755  0.636   5.660  1.00 21.07 ? 16  TYR A CG  1 
ATOM   103  C CD1 . TYR A 1 16  ? -8.020  0.159   5.322  1.00 20.62 ? 16  TYR A CD1 1 
ATOM   104  C CD2 . TYR A 1 16  ? -6.428  0.743   7.012  1.00 20.19 ? 16  TYR A CD2 1 
ATOM   105  C CE1 . TYR A 1 16  ? -8.934  -0.212  6.302  1.00 22.10 ? 16  TYR A CE1 1 
ATOM   106  C CE2 . TYR A 1 16  ? -7.332  0.374   8.002  1.00 21.02 ? 16  TYR A CE2 1 
ATOM   107  C CZ  . TYR A 1 16  ? -8.582  -0.108  7.638  1.00 22.37 ? 16  TYR A CZ  1 
ATOM   108  O OH  . TYR A 1 16  ? -9.463  -0.519  8.609  1.00 23.32 ? 16  TYR A OH  1 
ATOM   109  N N   . LYS A 1 17  ? -3.903  3.014   3.111  1.00 21.12 ? 17  LYS A N   1 
ATOM   110  C CA  . LYS A 1 17  ? -2.752  3.216   2.246  1.00 22.20 ? 17  LYS A CA  1 
ATOM   111  C C   . LYS A 1 17  ? -1.499  3.448   3.086  1.00 22.23 ? 17  LYS A C   1 
ATOM   112  O O   . LYS A 1 17  ? -1.514  4.222   4.046  1.00 21.51 ? 17  LYS A O   1 
ATOM   113  C CB  . LYS A 1 17  ? -2.994  4.422   1.333  1.00 24.52 ? 17  LYS A CB  1 
ATOM   114  C CG  . LYS A 1 17  ? -1.791  4.867   0.510  1.00 26.52 ? 17  LYS A CG  1 
ATOM   115  C CD  . LYS A 1 17  ? -1.591  3.991   -0.702 1.00 30.43 ? 17  LYS A CD  1 
ATOM   116  C CE  . LYS A 1 17  ? -0.548  4.570   -1.654 1.00 31.09 ? 17  LYS A CE  1 
ATOM   117  N NZ  . LYS A 1 17  ? -0.394  3.689   -2.851 1.00 32.04 ? 17  LYS A NZ  1 
ATOM   118  N N   . VAL A 1 18  ? -0.423  2.758   2.716  1.00 22.96 ? 18  VAL A N   1 
ATOM   119  C CA  . VAL A 1 18  ? 0.868   2.882   3.387  1.00 22.36 ? 18  VAL A CA  1 
ATOM   120  C C   . VAL A 1 18  ? 1.708   3.828   2.533  1.00 23.42 ? 18  VAL A C   1 
ATOM   121  O O   . VAL A 1 18  ? 1.934   3.566   1.351  1.00 24.35 ? 18  VAL A O   1 
ATOM   122  C CB  . VAL A 1 18  ? 1.586   1.505   3.476  1.00 22.45 ? 18  VAL A CB  1 
ATOM   123  C CG1 . VAL A 1 18  ? 2.988   1.673   4.038  1.00 21.49 ? 18  VAL A CG1 1 
ATOM   124  C CG2 . VAL A 1 18  ? 0.772   0.545   4.339  1.00 18.53 ? 18  VAL A CG2 1 
ATOM   125  N N   . PHE A 1 19  ? 2.156   4.933   3.118  1.00 23.51 ? 19  PHE A N   1 
ATOM   126  C CA  . PHE A 1 19  ? 2.968   5.902   2.384  1.00 24.38 ? 19  PHE A CA  1 
ATOM   127  C C   . PHE A 1 19  ? 4.449   5.697   2.677  1.00 25.77 ? 19  PHE A C   1 
ATOM   128  O O   . PHE A 1 19  ? 4.862   5.621   3.839  1.00 25.59 ? 19  PHE A O   1 
ATOM   129  C CB  . PHE A 1 19  ? 2.541   7.323   2.752  1.00 23.40 ? 19  PHE A CB  1 
ATOM   130  C CG  . PHE A 1 19  ? 1.210   7.718   2.178  1.00 23.32 ? 19  PHE A CG  1 
ATOM   131  C CD1 . PHE A 1 19  ? 1.125   8.277   0.908  1.00 22.71 ? 19  PHE A CD1 1 
ATOM   132  C CD2 . PHE A 1 19  ? 0.037   7.509   2.897  1.00 23.43 ? 19  PHE A CD2 1 
ATOM   133  C CE1 . PHE A 1 19  ? -0.109  8.620   0.361  1.00 22.34 ? 19  PHE A CE1 1 
ATOM   134  C CE2 . PHE A 1 19  ? -1.203  7.849   2.356  1.00 23.21 ? 19  PHE A CE2 1 
ATOM   135  C CZ  . PHE A 1 19  ? -1.274  8.406   1.086  1.00 22.15 ? 19  PHE A CZ  1 
ATOM   136  N N   . LYS A 1 20  ? 5.247   5.603   1.615  1.00 27.79 ? 20  LYS A N   1 
ATOM   137  C CA  . LYS A 1 20  ? 6.678   5.390   1.757  1.00 29.23 ? 20  LYS A CA  1 
ATOM   138  C C   . LYS A 1 20  ? 7.461   6.667   2.039  1.00 30.24 ? 20  LYS A C   1 
ATOM   139  O O   . LYS A 1 20  ? 8.582   6.604   2.540  1.00 30.45 ? 20  LYS A O   1 
ATOM   140  C CB  . LYS A 1 20  ? 7.235   4.686   0.515  1.00 30.69 ? 20  LYS A CB  1 
ATOM   141  C CG  . LYS A 1 20  ? 6.891   3.202   0.462  1.00 32.29 ? 20  LYS A CG  1 
ATOM   142  C CD  . LYS A 1 20  ? 7.755   2.452   -0.541 1.00 34.10 ? 20  LYS A CD  1 
ATOM   143  C CE  . LYS A 1 20  ? 7.298   2.702   -1.967 1.00 34.15 ? 20  LYS A CE  1 
ATOM   144  N NZ  . LYS A 1 20  ? 5.890   2.254   -2.170 1.00 35.47 ? 20  LYS A NZ  1 
ATOM   145  N N   . LYS A 1 21  ? 6.873   7.817   1.719  1.00 30.97 ? 21  LYS A N   1 
ATOM   146  C CA  . LYS A 1 21  ? 7.517   9.103   1.975  1.00 31.67 ? 21  LYS A CA  1 
ATOM   147  C C   . LYS A 1 21  ? 7.591   9.259   3.491  1.00 30.91 ? 21  LYS A C   1 
ATOM   148  O O   . LYS A 1 21  ? 6.560   9.329   4.157  1.00 32.08 ? 21  LYS A O   1 
ATOM   149  C CB  . LYS A 1 21  ? 6.684   10.241  1.378  1.00 33.27 ? 21  LYS A CB  1 
ATOM   150  C CG  . LYS A 1 21  ? 5.213   10.202  1.790  1.00 36.55 ? 21  LYS A CG  1 
ATOM   151  C CD  . LYS A 1 21  ? 4.470   11.491  1.450  1.00 37.79 ? 21  LYS A CD  1 
ATOM   152  C CE  . LYS A 1 21  ? 4.937   12.647  2.324  1.00 40.10 ? 21  LYS A CE  1 
ATOM   153  N NZ  . LYS A 1 21  ? 4.221   13.918  2.003  1.00 40.89 ? 21  LYS A NZ  1 
ATOM   154  N N   . VAL A 1 22  ? 8.801   9.309   4.037  1.00 29.85 ? 22  VAL A N   1 
ATOM   155  C CA  . VAL A 1 22  ? 8.971   9.417   5.486  1.00 29.78 ? 22  VAL A CA  1 
ATOM   156  C C   . VAL A 1 22  ? 8.662   10.798  6.048  1.00 29.38 ? 22  VAL A C   1 
ATOM   157  O O   . VAL A 1 22  ? 8.943   11.815  5.422  1.00 30.08 ? 22  VAL A O   1 
ATOM   158  C CB  . VAL A 1 22  ? 10.401  9.025   5.913  1.00 29.65 ? 22  VAL A CB  1 
ATOM   159  C CG1 . VAL A 1 22  ? 10.697  7.595   5.482  1.00 29.76 ? 22  VAL A CG1 1 
ATOM   160  C CG2 . VAL A 1 22  ? 11.412  9.994   5.305  1.00 30.88 ? 22  VAL A CG2 1 
ATOM   161  N N   . GLY A 1 23  ? 8.082   10.822  7.244  1.00 29.48 ? 23  GLY A N   1 
ATOM   162  C CA  . GLY A 1 23  ? 7.753   12.089  7.875  1.00 27.61 ? 23  GLY A CA  1 
ATOM   163  C C   . GLY A 1 23  ? 7.628   11.925  9.372  1.00 26.51 ? 23  GLY A C   1 
ATOM   164  O O   . GLY A 1 23  ? 7.536   10.799  9.867  1.00 25.48 ? 23  GLY A O   1 
ATOM   165  N N   . THR A 1 24  ? 7.634   13.036  10.100 1.00 25.16 ? 24  THR A N   1 
ATOM   166  C CA  . THR A 1 24  ? 7.497   12.974  11.545 1.00 24.87 ? 24  THR A CA  1 
ATOM   167  C C   . THR A 1 24  ? 6.048   12.589  11.808 1.00 24.50 ? 24  THR A C   1 
ATOM   168  O O   . THR A 1 24  ? 5.202   12.727  10.927 1.00 23.16 ? 24  THR A O   1 
ATOM   169  C CB  . THR A 1 24  ? 7.801   14.338  12.209 1.00 25.08 ? 24  THR A CB  1 
ATOM   170  O OG1 . THR A 1 24  ? 6.785   15.285  11.861 1.00 24.64 ? 24  THR A OG1 1 
ATOM   171  C CG2 . THR A 1 24  ? 9.154   14.861  11.747 1.00 25.31 ? 24  THR A CG2 1 
ATOM   172  N N   . TRP A 1 25  ? 5.764   12.102  13.013 1.00 23.92 ? 25  TRP A N   1 
ATOM   173  C CA  . TRP A 1 25  ? 4.410   11.684  13.357 1.00 23.13 ? 25  TRP A CA  1 
ATOM   174  C C   . TRP A 1 25  ? 3.403   12.791  13.062 1.00 24.47 ? 25  TRP A C   1 
ATOM   175  O O   . TRP A 1 25  ? 2.372   12.553  12.431 1.00 23.99 ? 25  TRP A O   1 
ATOM   176  C CB  . TRP A 1 25  ? 4.327   11.300  14.837 1.00 20.45 ? 25  TRP A CB  1 
ATOM   177  C CG  . TRP A 1 25  ? 3.025   10.653  15.220 1.00 19.81 ? 25  TRP A CG  1 
ATOM   178  C CD1 . TRP A 1 25  ? 2.719   9.320   15.165 1.00 19.94 ? 25  TRP A CD1 1 
ATOM   179  C CD2 . TRP A 1 25  ? 1.861   11.310  15.739 1.00 19.29 ? 25  TRP A CD2 1 
ATOM   180  N NE1 . TRP A 1 25  ? 1.437   9.108   15.628 1.00 20.38 ? 25  TRP A NE1 1 
ATOM   181  C CE2 . TRP A 1 25  ? 0.889   10.312  15.986 1.00 19.39 ? 25  TRP A CE2 1 
ATOM   182  C CE3 . TRP A 1 25  ? 1.546   12.648  16.024 1.00 19.18 ? 25  TRP A CE3 1 
ATOM   183  C CZ2 . TRP A 1 25  ? -0.377  10.609  16.505 1.00 19.02 ? 25  TRP A CZ2 1 
ATOM   184  C CZ3 . TRP A 1 25  ? 0.285   12.942  16.541 1.00 20.07 ? 25  TRP A CZ3 1 
ATOM   185  C CH2 . TRP A 1 25  ? -0.660  11.922  16.777 1.00 19.65 ? 25  TRP A CH2 1 
ATOM   186  N N   . GLU A 1 26  ? 3.707   14.003  13.511 1.00 25.96 ? 26  GLU A N   1 
ATOM   187  C CA  . GLU A 1 26  ? 2.805   15.131  13.302 1.00 28.16 ? 26  GLU A CA  1 
ATOM   188  C C   . GLU A 1 26  ? 2.557   15.412  11.816 1.00 27.73 ? 26  GLU A C   1 
ATOM   189  O O   . GLU A 1 26  ? 1.408   15.580  11.402 1.00 28.11 ? 26  GLU A O   1 
ATOM   190  C CB  . GLU A 1 26  ? 3.350   16.384  14.003 1.00 31.16 ? 26  GLU A CB  1 
ATOM   191  C CG  . GLU A 1 26  ? 2.248   17.304  14.523 1.00 38.09 ? 26  GLU A CG  1 
ATOM   192  C CD  . GLU A 1 26  ? 2.770   18.432  15.404 1.00 41.02 ? 26  GLU A CD  1 
ATOM   193  O OE1 . GLU A 1 26  ? 3.494   18.146  16.384 1.00 41.57 ? 26  GLU A OE1 1 
ATOM   194  O OE2 . GLU A 1 26  ? 2.447   19.605  15.120 1.00 43.43 ? 26  GLU A OE2 1 
ATOM   195  N N   . ASP A 1 27  ? 3.620   15.461  11.013 1.00 26.24 ? 27  ASP A N   1 
ATOM   196  C CA  . ASP A 1 27  ? 3.448   15.711  9.583  1.00 26.17 ? 27  ASP A CA  1 
ATOM   197  C C   . ASP A 1 27  ? 2.630   14.586  8.965  1.00 26.51 ? 27  ASP A C   1 
ATOM   198  O O   . ASP A 1 27  ? 1.787   14.810  8.093  1.00 25.49 ? 27  ASP A O   1 
ATOM   199  C CB  . ASP A 1 27  ? 4.800   15.792  8.862  1.00 27.22 ? 27  ASP A CB  1 
ATOM   200  C CG  . ASP A 1 27  ? 5.621   17.006  9.274  1.00 29.84 ? 27  ASP A CG  1 
ATOM   201  O OD1 . ASP A 1 27  ? 5.027   18.058  9.599  1.00 30.08 ? 27  ASP A OD1 1 
ATOM   202  O OD2 . ASP A 1 27  ? 6.865   16.907  9.255  1.00 31.58 ? 27  ASP A OD2 1 
ATOM   203  N N   . ALA A 1 28  ? 2.892   13.366  9.426  1.00 26.31 ? 28  ALA A N   1 
ATOM   204  C CA  . ALA A 1 28  ? 2.188   12.199  8.920  1.00 25.33 ? 28  ALA A CA  1 
ATOM   205  C C   . ALA A 1 28  ? 0.684   12.382  9.100  1.00 24.40 ? 28  ALA A C   1 
ATOM   206  O O   . ALA A 1 28  ? -0.080  12.223  8.149  1.00 23.13 ? 28  ALA A O   1 
ATOM   207  C CB  . ALA A 1 28  ? 2.672   10.941  9.644  1.00 24.58 ? 28  ALA A CB  1 
ATOM   208  N N   . GLU A 1 29  ? 0.261   12.727  10.314 1.00 23.57 ? 29  GLU A N   1 
ATOM   209  C CA  . GLU A 1 29  ? -1.160  12.929  10.591 1.00 23.61 ? 29  GLU A CA  1 
ATOM   210  C C   . GLU A 1 29  ? -1.755  13.999  9.673  1.00 24.84 ? 29  GLU A C   1 
ATOM   211  O O   . GLU A 1 29  ? -2.847  13.823  9.133  1.00 25.42 ? 29  GLU A O   1 
ATOM   212  C CB  . GLU A 1 29  ? -1.362  13.333  12.058 1.00 23.30 ? 29  GLU A CB  1 
ATOM   213  C CG  . GLU A 1 29  ? -2.765  13.837  12.395 1.00 23.57 ? 29  GLU A CG  1 
ATOM   214  C CD  . GLU A 1 29  ? -3.830  12.764  12.300 1.00 24.84 ? 29  GLU A CD  1 
ATOM   215  O OE1 . GLU A 1 29  ? -5.026  13.098  12.481 1.00 24.89 ? 29  GLU A OE1 1 
ATOM   216  O OE2 . GLU A 1 29  ? -3.480  11.587  12.054 1.00 24.78 ? 29  GLU A OE2 1 
ATOM   217  N N   . LYS A 1 30  ? -1.036  15.105  9.501  1.00 25.78 ? 30  LYS A N   1 
ATOM   218  C CA  . LYS A 1 30  ? -1.509  16.191  8.648  1.00 28.04 ? 30  LYS A CA  1 
ATOM   219  C C   . LYS A 1 30  ? -1.676  15.756  7.195  1.00 28.51 ? 30  LYS A C   1 
ATOM   220  O O   . LYS A 1 30  ? -2.597  16.196  6.512  1.00 30.10 ? 30  LYS A O   1 
ATOM   221  C CB  . LYS A 1 30  ? -0.551  17.383  8.717  1.00 29.28 ? 30  LYS A CB  1 
ATOM   222  C CG  . LYS A 1 30  ? -0.636  18.178  10.011 1.00 32.39 ? 30  LYS A CG  1 
ATOM   223  C CD  . LYS A 1 30  ? 0.190   19.460  9.923  1.00 35.48 ? 30  LYS A CD  1 
ATOM   224  C CE  . LYS A 1 30  ? -0.021  20.354  11.134 1.00 37.68 ? 30  LYS A CE  1 
ATOM   225  N NZ  . LYS A 1 30  ? 0.451   19.725  12.406 1.00 40.54 ? 30  LYS A NZ  1 
ATOM   226  N N   . PHE A 1 31  ? -0.779  14.894  6.727  1.00 28.43 ? 31  PHE A N   1 
ATOM   227  C CA  . PHE A 1 31  ? -0.845  14.409  5.357  1.00 26.83 ? 31  PHE A CA  1 
ATOM   228  C C   . PHE A 1 31  ? -2.075  13.519  5.200  1.00 26.88 ? 31  PHE A C   1 
ATOM   229  O O   . PHE A 1 31  ? -2.772  13.592  4.186  1.00 27.60 ? 31  PHE A O   1 
ATOM   230  C CB  . PHE A 1 31  ? 0.440   13.643  5.000  1.00 27.22 ? 31  PHE A CB  1 
ATOM   231  C CG  . PHE A 1 31  ? 0.514   13.208  3.557  1.00 28.10 ? 31  PHE A CG  1 
ATOM   232  C CD1 . PHE A 1 31  ? -0.095  12.030  3.138  1.00 27.23 ? 31  PHE A CD1 1 
ATOM   233  C CD2 . PHE A 1 31  ? 1.181   13.989  2.612  1.00 28.10 ? 31  PHE A CD2 1 
ATOM   234  C CE1 . PHE A 1 31  ? -0.045  11.632  1.801  1.00 25.90 ? 31  PHE A CE1 1 
ATOM   235  C CE2 . PHE A 1 31  ? 1.237   13.601  1.272  1.00 26.11 ? 31  PHE A CE2 1 
ATOM   236  C CZ  . PHE A 1 31  ? 0.623   12.419  0.866  1.00 26.02 ? 31  PHE A CZ  1 
ATOM   237  N N   . CYS A 1 32  ? -2.350  12.685  6.203  1.00 26.36 ? 32  CYS A N   1 
ATOM   238  C CA  . CYS A 1 32  ? -3.515  11.808  6.163  1.00 25.84 ? 32  CYS A CA  1 
ATOM   239  C C   . CYS A 1 32  ? -4.784  12.660  6.178  1.00 27.16 ? 32  CYS A C   1 
ATOM   240  O O   . CYS A 1 32  ? -5.751  12.369  5.461  1.00 27.43 ? 32  CYS A O   1 
ATOM   241  C CB  . CYS A 1 32  ? -3.540  10.863  7.373  1.00 24.38 ? 32  CYS A CB  1 
ATOM   242  S SG  . CYS A 1 32  ? -2.302  9.519   7.407  1.00 21.72 ? 32  CYS A SG  1 
ATOM   243  N N   . VAL A 1 33  ? -4.784  13.695  7.017  1.00 28.16 ? 33  VAL A N   1 
ATOM   244  C CA  . VAL A 1 33  ? -5.927  14.597  7.115  1.00 30.31 ? 33  VAL A CA  1 
ATOM   245  C C   . VAL A 1 33  ? -6.185  15.169  5.719  1.00 32.52 ? 33  VAL A C   1 
ATOM   246  O O   . VAL A 1 33  ? -7.314  15.143  5.221  1.00 33.31 ? 33  VAL A O   1 
ATOM   247  C CB  . VAL A 1 33  ? -5.625  15.749  8.098  1.00 28.92 ? 33  VAL A CB  1 
ATOM   248  C CG1 . VAL A 1 33  ? -6.600  16.900  7.897  1.00 29.62 ? 33  VAL A CG1 1 
ATOM   249  C CG2 . VAL A 1 33  ? -5.723  15.238  9.534  1.00 28.86 ? 33  VAL A CG2 1 
ATOM   250  N N   . GLU A 1 34  ? -5.123  15.678  5.095  1.00 34.50 ? 34  GLU A N   1 
ATOM   251  C CA  . GLU A 1 34  ? -5.207  16.251  3.757  1.00 37.43 ? 34  GLU A CA  1 
ATOM   252  C C   . GLU A 1 34  ? -5.890  15.271  2.804  1.00 37.10 ? 34  GLU A C   1 
ATOM   253  O O   . GLU A 1 34  ? -6.544  15.681  1.843  1.00 38.76 ? 34  GLU A O   1 
ATOM   254  C CB  . GLU A 1 34  ? -3.799  16.602  3.257  1.00 41.18 ? 34  GLU A CB  1 
ATOM   255  C CG  . GLU A 1 34  ? -3.712  16.873  1.767  1.00 47.01 ? 34  GLU A CG  1 
ATOM   256  C CD  . GLU A 1 34  ? -2.301  17.189  1.311  1.00 50.50 ? 34  GLU A CD  1 
ATOM   257  O OE1 . GLU A 1 34  ? -2.088  17.362  0.087  1.00 52.41 ? 34  GLU A OE1 1 
ATOM   258  O OE2 . GLU A 1 34  ? -1.406  17.278  2.180  1.00 52.22 ? 34  GLU A OE2 1 
ATOM   259  N N   . ASN A 1 35  ? -5.737  13.977  3.067  1.00 35.41 ? 35  ASN A N   1 
ATOM   260  C CA  . ASN A 1 35  ? -6.360  12.965  2.225  1.00 34.12 ? 35  ASN A CA  1 
ATOM   261  C C   . ASN A 1 35  ? -7.659  12.442  2.826  1.00 33.62 ? 35  ASN A C   1 
ATOM   262  O O   . ASN A 1 35  ? -8.002  11.260  2.681  1.00 32.64 ? 35  ASN A O   1 
ATOM   263  C CB  . ASN A 1 35  ? -5.398  11.804  1.986  1.00 34.38 ? 35  ASN A CB  1 
ATOM   264  C CG  . ASN A 1 35  ? -4.315  12.147  0.992  1.00 34.22 ? 35  ASN A CG  1 
ATOM   265  O OD1 . ASN A 1 35  ? -3.404  12.922  1.280  1.00 35.17 ? 35  ASN A OD1 1 
ATOM   266  N ND2 . ASN A 1 35  ? -4.421  11.579  -0.201 1.00 35.24 ? 35  ASN A ND2 1 
ATOM   267  N N   . SER A 1 36  ? -8.373  13.333  3.506  1.00 33.35 ? 36  SER A N   1 
ATOM   268  C CA  . SER A 1 36  ? -9.651  13.004  4.124  1.00 33.55 ? 36  SER A CA  1 
ATOM   269  C C   . SER A 1 36  ? -9.592  11.838  5.105  1.00 31.98 ? 36  SER A C   1 
ATOM   270  O O   . SER A 1 36  ? -10.512 11.025  5.154  1.00 33.49 ? 36  SER A O   1 
ATOM   271  C CB  . SER A 1 36  ? -10.684 12.705  3.034  1.00 34.60 ? 36  SER A CB  1 
ATOM   272  O OG  . SER A 1 36  ? -11.965 12.497  3.597  1.00 39.55 ? 36  SER A OG  1 
ATOM   273  N N   . GLY A 1 37  ? -8.522  11.759  5.891  1.00 29.89 ? 37  GLY A N   1 
ATOM   274  C CA  . GLY A 1 37  ? -8.413  10.676  6.850  1.00 28.56 ? 37  GLY A CA  1 
ATOM   275  C C   . GLY A 1 37  ? -7.607  11.029  8.084  1.00 27.95 ? 37  GLY A C   1 
ATOM   276  O O   . GLY A 1 37  ? -7.587  12.179  8.516  1.00 28.57 ? 37  GLY A O   1 
ATOM   277  N N   . HIS A 1 38  ? -6.943  10.024  8.647  1.00 26.62 ? 38  HIS A N   1 
ATOM   278  C CA  . HIS A 1 38  ? -6.109  10.181  9.841  1.00 24.10 ? 38  HIS A CA  1 
ATOM   279  C C   . HIS A 1 38  ? -5.111  9.031   9.831  1.00 21.84 ? 38  HIS A C   1 
ATOM   280  O O   . HIS A 1 38  ? -5.240  8.101   9.034  1.00 19.99 ? 38  HIS A O   1 
ATOM   281  C CB  . HIS A 1 38  ? -6.947  10.034  11.123 1.00 25.34 ? 38  HIS A CB  1 
ATOM   282  C CG  . HIS A 1 38  ? -7.906  11.156  11.373 1.00 26.85 ? 38  HIS A CG  1 
ATOM   283  N ND1 . HIS A 1 38  ? -7.496  12.414  11.757 1.00 26.78 ? 38  HIS A ND1 1 
ATOM   284  C CD2 . HIS A 1 38  ? -9.260  11.196  11.333 1.00 26.99 ? 38  HIS A CD2 1 
ATOM   285  C CE1 . HIS A 1 38  ? -8.558  13.180  11.948 1.00 27.72 ? 38  HIS A CE1 1 
ATOM   286  N NE2 . HIS A 1 38  ? -9.639  12.466  11.698 1.00 27.80 ? 38  HIS A NE2 1 
ATOM   287  N N   . LEU A 1 39  ? -4.120  9.097   10.716 1.00 19.81 ? 39  LEU A N   1 
ATOM   288  C CA  . LEU A 1 39  ? -3.180  8.001   10.838 1.00 18.25 ? 39  LEU A CA  1 
ATOM   289  C C   . LEU A 1 39  ? -4.118  6.897   11.294 1.00 18.52 ? 39  LEU A C   1 
ATOM   290  O O   . LEU A 1 39  ? -5.075  7.159   12.028 1.00 18.22 ? 39  LEU A O   1 
ATOM   291  C CB  . LEU A 1 39  ? -2.130  8.288   11.914 1.00 15.42 ? 39  LEU A CB  1 
ATOM   292  C CG  . LEU A 1 39  ? -0.982  9.171   11.436 1.00 14.70 ? 39  LEU A CG  1 
ATOM   293  C CD1 . LEU A 1 39  ? -0.077  9.542   12.606 1.00 14.17 ? 39  LEU A CD1 1 
ATOM   294  C CD2 . LEU A 1 39  ? -0.201  8.421   10.343 1.00 13.67 ? 39  LEU A CD2 1 
ATOM   295  N N   . ALA A 1 40  ? -3.855  5.677   10.849 1.00 17.81 ? 40  ALA A N   1 
ATOM   296  C CA  . ALA A 1 40  ? -4.695  4.536   11.178 1.00 17.98 ? 40  ALA A CA  1 
ATOM   297  C C   . ALA A 1 40  ? -4.908  4.275   12.662 1.00 19.41 ? 40  ALA A C   1 
ATOM   298  O O   . ALA A 1 40  ? -3.980  4.360   13.470 1.00 18.41 ? 40  ALA A O   1 
ATOM   299  C CB  . ALA A 1 40  ? -4.125  3.271   10.522 1.00 17.39 ? 40  ALA A CB  1 
ATOM   300  N N   . SER A 1 41  ? -6.152  3.968   13.007 1.00 20.71 ? 41  SER A N   1 
ATOM   301  C CA  . SER A 1 41  ? -6.517  3.609   14.366 1.00 21.10 ? 41  SER A CA  1 
ATOM   302  C C   . SER A 1 41  ? -6.858  2.140   14.144 1.00 22.09 ? 41  SER A C   1 
ATOM   303  O O   . SER A 1 41  ? -7.362  1.791   13.076 1.00 21.06 ? 41  SER A O   1 
ATOM   304  C CB  . SER A 1 41  ? -7.757  4.372   14.824 1.00 21.08 ? 41  SER A CB  1 
ATOM   305  O OG  . SER A 1 41  ? -8.908  3.959   14.106 1.00 21.36 ? 41  SER A OG  1 
ATOM   306  N N   . ILE A 1 42  ? -6.570  1.288   15.125 1.00 22.34 ? 42  ILE A N   1 
ATOM   307  C CA  . ILE A 1 42  ? -6.831  -0.149  15.014 1.00 22.90 ? 42  ILE A CA  1 
ATOM   308  C C   . ILE A 1 42  ? -7.786  -0.512  16.147 1.00 23.68 ? 42  ILE A C   1 
ATOM   309  O O   . ILE A 1 42  ? -7.479  -0.279  17.310 1.00 23.76 ? 42  ILE A O   1 
ATOM   310  C CB  . ILE A 1 42  ? -5.494  -0.940  15.122 1.00 22.87 ? 42  ILE A CB  1 
ATOM   311  C CG1 . ILE A 1 42  ? -4.605  -0.580  13.920 1.00 23.32 ? 42  ILE A CG1 1 
ATOM   312  C CG2 . ILE A 1 42  ? -5.753  -2.435  15.171 1.00 22.32 ? 42  ILE A CG2 1 
ATOM   313  C CD1 . ILE A 1 42  ? -3.203  -1.140  13.987 1.00 26.24 ? 42  ILE A CD1 1 
ATOM   314  N N   . ASP A 1 43  ? -8.946  -1.072  15.815 1.00 25.30 ? 43  ASP A N   1 
ATOM   315  C CA  . ASP A 1 43  ? -9.921  -1.372  16.860 1.00 27.80 ? 43  ASP A CA  1 
ATOM   316  C C   . ASP A 1 43  ? -10.135 -2.837  17.199 1.00 26.89 ? 43  ASP A C   1 
ATOM   317  O O   . ASP A 1 43  ? -10.833 -3.145  18.159 1.00 28.01 ? 43  ASP A O   1 
ATOM   318  C CB  . ASP A 1 43  ? -11.265 -0.717  16.509 1.00 32.18 ? 43  ASP A CB  1 
ATOM   319  C CG  . ASP A 1 43  ? -12.055 -0.295  17.747 1.00 38.05 ? 43  ASP A CG  1 
ATOM   320  O OD1 . ASP A 1 43  ? -13.120 0.345   17.586 1.00 41.15 ? 43  ASP A OD1 1 
ATOM   321  O OD2 . ASP A 1 43  ? -11.618 -0.594  18.880 1.00 40.73 ? 43  ASP A OD2 1 
ATOM   322  N N   . SER A 1 44  ? -9.530  -3.736  16.430 1.00 26.58 ? 44  SER A N   1 
ATOM   323  C CA  . SER A 1 44  ? -9.680  -5.166  16.684 1.00 25.27 ? 44  SER A CA  1 
ATOM   324  C C   . SER A 1 44  ? -8.469  -5.954  16.195 1.00 24.11 ? 44  SER A C   1 
ATOM   325  O O   . SER A 1 44  ? -7.684  -5.465  15.377 1.00 22.76 ? 44  SER A O   1 
ATOM   326  C CB  . SER A 1 44  ? -10.934 -5.699  15.986 1.00 25.80 ? 44  SER A CB  1 
ATOM   327  O OG  . SER A 1 44  ? -10.764 -5.690  14.578 1.00 26.41 ? 44  SER A OG  1 
ATOM   328  N N   . LYS A 1 45  ? -8.320  -7.178  16.694 1.00 24.06 ? 45  LYS A N   1 
ATOM   329  C CA  . LYS A 1 45  ? -7.202  -8.021  16.283 1.00 24.54 ? 45  LYS A CA  1 
ATOM   330  C C   . LYS A 1 45  ? -7.288  -8.289  14.787 1.00 24.90 ? 45  LYS A C   1 
ATOM   331  O O   . LYS A 1 45  ? -6.265  -8.354  14.108 1.00 25.61 ? 45  LYS A O   1 
ATOM   332  C CB  . LYS A 1 45  ? -7.210  -9.351  17.041 1.00 24.58 ? 45  LYS A CB  1 
ATOM   333  C CG  . LYS A 1 45  ? -6.075  -10.307 16.658 1.00 25.19 ? 45  LYS A CG  1 
ATOM   334  C CD  . LYS A 1 45  ? -4.699  -9.692  16.923 1.00 25.18 ? 45  LYS A CD  1 
ATOM   335  C CE  . LYS A 1 45  ? -3.598  -10.753 16.971 1.00 25.15 ? 45  LYS A CE  1 
ATOM   336  N NZ  . LYS A 1 45  ? -3.526  -11.559 15.718 1.00 25.03 ? 45  LYS A NZ  1 
ATOM   337  N N   . GLU A 1 46  ? -8.507  -8.440  14.273 1.00 24.62 ? 46  GLU A N   1 
ATOM   338  C CA  . GLU A 1 46  ? -8.682  -8.698  12.851 1.00 24.74 ? 46  GLU A CA  1 
ATOM   339  C C   . GLU A 1 46  ? -8.227  -7.503  12.018 1.00 23.42 ? 46  GLU A C   1 
ATOM   340  O O   . GLU A 1 46  ? -7.549  -7.673  11.001 1.00 21.90 ? 46  GLU A O   1 
ATOM   341  C CB  . GLU A 1 46  ? -10.141 -9.046  12.538 1.00 26.79 ? 46  GLU A CB  1 
ATOM   342  C CG  . GLU A 1 46  ? -10.268 -9.956  11.316 1.00 30.68 ? 46  GLU A CG  1 
ATOM   343  C CD  . GLU A 1 46  ? -11.615 -10.648 11.229 1.00 33.33 ? 46  GLU A CD  1 
ATOM   344  O OE1 . GLU A 1 46  ? -12.569 -10.026 10.718 1.00 34.68 ? 46  GLU A OE1 1 
ATOM   345  O OE2 . GLU A 1 46  ? -11.717 -11.812 11.687 1.00 34.17 ? 46  GLU A OE2 1 
ATOM   346  N N   . GLU A 1 47  ? -8.594  -6.294  12.437 1.00 22.43 ? 47  GLU A N   1 
ATOM   347  C CA  . GLU A 1 47  ? -8.163  -5.105  11.701 1.00 22.53 ? 47  GLU A CA  1 
ATOM   348  C C   . GLU A 1 47  ? -6.638  -5.018  11.808 1.00 21.95 ? 47  GLU A C   1 
ATOM   349  O O   . GLU A 1 47  ? -5.952  -4.684  10.841 1.00 22.03 ? 47  GLU A O   1 
ATOM   350  C CB  . GLU A 1 47  ? -8.790  -3.825  12.273 1.00 21.80 ? 47  GLU A CB  1 
ATOM   351  C CG  . GLU A 1 47  ? -8.321  -2.570  11.542 1.00 22.22 ? 47  GLU A CG  1 
ATOM   352  C CD  . GLU A 1 47  ? -9.044  -1.297  11.957 1.00 22.41 ? 47  GLU A CD  1 
ATOM   353  O OE1 . GLU A 1 47  ? -8.971  -0.310  11.195 1.00 24.57 ? 47  GLU A OE1 1 
ATOM   354  O OE2 . GLU A 1 47  ? -9.674  -1.270  13.032 1.00 21.28 ? 47  GLU A OE2 1 
ATOM   355  N N   . ALA A 1 48  ? -6.115  -5.330  12.992 1.00 21.27 ? 48  ALA A N   1 
ATOM   356  C CA  . ALA A 1 48  ? -4.674  -5.300  13.234 1.00 20.35 ? 48  ALA A CA  1 
ATOM   357  C C   . ALA A 1 48  ? -3.938  -6.196  12.242 1.00 20.71 ? 48  ALA A C   1 
ATOM   358  O O   . ALA A 1 48  ? -2.943  -5.787  11.646 1.00 20.20 ? 48  ALA A O   1 
ATOM   359  C CB  . ALA A 1 48  ? -4.373  -5.748  14.670 1.00 18.73 ? 48  ALA A CB  1 
ATOM   360  N N   . ASP A 1 49  ? -4.427  -7.424  12.080 1.00 21.83 ? 49  ASP A N   1 
ATOM   361  C CA  . ASP A 1 49  ? -3.806  -8.377  11.168 1.00 22.27 ? 49  ASP A CA  1 
ATOM   362  C C   . ASP A 1 49  ? -3.819  -7.865  9.733  1.00 22.10 ? 49  ASP A C   1 
ATOM   363  O O   . ASP A 1 49  ? -2.899  -8.139  8.964  1.00 21.96 ? 49  ASP A O   1 
ATOM   364  C CB  . ASP A 1 49  ? -4.508  -9.736  11.257 1.00 24.69 ? 49  ASP A CB  1 
ATOM   365  C CG  . ASP A 1 49  ? -4.208  -10.463 12.560 1.00 27.39 ? 49  ASP A CG  1 
ATOM   366  O OD1 . ASP A 1 49  ? -3.242  -10.078 13.257 1.00 30.48 ? 49  ASP A OD1 1 
ATOM   367  O OD2 . ASP A 1 49  ? -4.923  -11.435 12.882 1.00 28.86 ? 49  ASP A OD2 1 
ATOM   368  N N   . PHE A 1 50  ? -4.855  -7.112  9.376  1.00 21.53 ? 50  PHE A N   1 
ATOM   369  C CA  . PHE A 1 50  ? -4.944  -6.559  8.031  1.00 21.08 ? 50  PHE A CA  1 
ATOM   370  C C   . PHE A 1 50  ? -3.864  -5.500  7.842  1.00 21.13 ? 50  PHE A C   1 
ATOM   371  O O   . PHE A 1 50  ? -3.118  -5.534  6.864  1.00 20.59 ? 50  PHE A O   1 
ATOM   372  C CB  . PHE A 1 50  ? -6.315  -5.923  7.783  1.00 23.14 ? 50  PHE A CB  1 
ATOM   373  C CG  . PHE A 1 50  ? -6.375  -5.106  6.517  1.00 26.11 ? 50  PHE A CG  1 
ATOM   374  C CD1 . PHE A 1 50  ? -6.254  -5.715  5.271  1.00 26.98 ? 50  PHE A CD1 1 
ATOM   375  C CD2 . PHE A 1 50  ? -6.484  -3.720  6.576  1.00 26.85 ? 50  PHE A CD2 1 
ATOM   376  C CE1 . PHE A 1 50  ? -6.239  -4.954  4.102  1.00 27.63 ? 50  PHE A CE1 1 
ATOM   377  C CE2 . PHE A 1 50  ? -6.469  -2.948  5.413  1.00 28.13 ? 50  PHE A CE2 1 
ATOM   378  C CZ  . PHE A 1 50  ? -6.344  -3.567  4.174  1.00 27.77 ? 50  PHE A CZ  1 
ATOM   379  N N   . VAL A 1 51  ? -3.795  -4.555  8.781  1.00 20.50 ? 51  VAL A N   1 
ATOM   380  C CA  . VAL A 1 51  ? -2.804  -3.481  8.726  1.00 19.67 ? 51  VAL A CA  1 
ATOM   381  C C   . VAL A 1 51  ? -1.381  -4.044  8.723  1.00 19.52 ? 51  VAL A C   1 
ATOM   382  O O   . VAL A 1 51  ? -0.507  -3.537  8.015  1.00 18.64 ? 51  VAL A O   1 
ATOM   383  C CB  . VAL A 1 51  ? -2.984  -2.492  9.915  1.00 19.48 ? 51  VAL A CB  1 
ATOM   384  C CG1 . VAL A 1 51  ? -1.846  -1.475  9.946  1.00 17.81 ? 51  VAL A CG1 1 
ATOM   385  C CG2 . VAL A 1 51  ? -4.309  -1.764  9.777  1.00 18.41 ? 51  VAL A CG2 1 
ATOM   386  N N   . THR A 1 52  ? -1.156  -5.097  9.504  1.00 18.74 ? 52  THR A N   1 
ATOM   387  C CA  . THR A 1 52  ? 0.161   -5.731  9.560  1.00 18.74 ? 52  THR A CA  1 
ATOM   388  C C   . THR A 1 52  ? 0.503   -6.329  8.195  1.00 18.06 ? 52  THR A C   1 
ATOM   389  O O   . THR A 1 52  ? 1.642   -6.264  7.750  1.00 18.09 ? 52  THR A O   1 
ATOM   390  C CB  . THR A 1 52  ? 0.206   -6.860  10.622 1.00 18.97 ? 52  THR A CB  1 
ATOM   391  O OG1 . THR A 1 52  ? 0.176   -6.282  11.933 1.00 17.56 ? 52  THR A OG1 1 
ATOM   392  C CG2 . THR A 1 52  ? 1.471   -7.695  10.472 1.00 18.39 ? 52  THR A CG2 1 
ATOM   393  N N   . LYS A 1 53  ? -0.492  -6.908  7.536  1.00 19.63 ? 53  LYS A N   1 
ATOM   394  C CA  . LYS A 1 53  ? -0.296  -7.520  6.218  1.00 20.52 ? 53  LYS A CA  1 
ATOM   395  C C   . LYS A 1 53  ? -0.019  -6.449  5.160  1.00 20.32 ? 53  LYS A C   1 
ATOM   396  O O   . LYS A 1 53  ? 0.898   -6.579  4.344  1.00 18.28 ? 53  LYS A O   1 
ATOM   397  C CB  . LYS A 1 53  ? -1.542  -8.328  5.833  1.00 21.40 ? 53  LYS A CB  1 
ATOM   398  C CG  . LYS A 1 53  ? -1.456  -9.007  4.478  1.00 24.47 ? 53  LYS A CG  1 
ATOM   399  C CD  . LYS A 1 53  ? -2.742  -9.760  4.163  1.00 27.36 ? 53  LYS A CD  1 
ATOM   400  C CE  . LYS A 1 53  ? -2.648  -10.479 2.825  1.00 28.50 ? 53  LYS A CE  1 
ATOM   401  N NZ  . LYS A 1 53  ? -3.902  -11.221 2.535  1.00 31.40 ? 53  LYS A NZ  1 
ATOM   402  N N   . LEU A 1 54  ? -0.804  -5.377  5.180  1.00 20.06 ? 54  LEU A N   1 
ATOM   403  C CA  . LEU A 1 54  ? -0.612  -4.310  4.207  1.00 20.05 ? 54  LEU A CA  1 
ATOM   404  C C   . LEU A 1 54  ? 0.789   -3.728  4.353  1.00 19.03 ? 54  LEU A C   1 
ATOM   405  O O   . LEU A 1 54  ? 1.491   -3.529  3.364  1.00 18.67 ? 54  LEU A O   1 
ATOM   406  C CB  . LEU A 1 54  ? -1.660  -3.206  4.395  1.00 21.64 ? 54  LEU A CB  1 
ATOM   407  C CG  . LEU A 1 54  ? -1.670  -2.105  3.320  1.00 23.01 ? 54  LEU A CG  1 
ATOM   408  C CD1 . LEU A 1 54  ? -2.065  -2.705  1.976  1.00 21.48 ? 54  LEU A CD1 1 
ATOM   409  C CD2 . LEU A 1 54  ? -2.648  -0.994  3.714  1.00 22.22 ? 54  LEU A CD2 1 
ATOM   410  N N   . ALA A 1 55  ? 1.196   -3.471  5.592  1.00 19.49 ? 55  ALA A N   1 
ATOM   411  C CA  . ALA A 1 55  ? 2.515   -2.912  5.873  1.00 20.62 ? 55  ALA A CA  1 
ATOM   412  C C   . ALA A 1 55  ? 3.641   -3.861  5.448  1.00 20.71 ? 55  ALA A C   1 
ATOM   413  O O   . ALA A 1 55  ? 4.639   -3.430  4.878  1.00 20.69 ? 55  ALA A O   1 
ATOM   414  C CB  . ALA A 1 55  ? 2.633   -2.576  7.359  1.00 20.59 ? 55  ALA A CB  1 
ATOM   415  N N   . SER A 1 56  ? 3.471   -5.150  5.725  1.00 23.00 ? 56  SER A N   1 
ATOM   416  C CA  . SER A 1 56  ? 4.462   -6.166  5.362  1.00 24.49 ? 56  SER A CA  1 
ATOM   417  C C   . SER A 1 56  ? 4.648   -6.320  3.850  1.00 25.26 ? 56  SER A C   1 
ATOM   418  O O   . SER A 1 56  ? 5.730   -6.681  3.386  1.00 24.69 ? 56  SER A O   1 
ATOM   419  C CB  . SER A 1 56  ? 4.065   -7.525  5.941  1.00 24.79 ? 56  SER A CB  1 
ATOM   420  O OG  . SER A 1 56  ? 4.174   -7.521  7.352  1.00 30.27 ? 56  SER A OG  1 
ATOM   421  N N   . GLN A 1 57  ? 3.593   -6.057  3.085  1.00 26.19 ? 57  GLN A N   1 
ATOM   422  C CA  . GLN A 1 57  ? 3.665   -6.195  1.633  1.00 28.19 ? 57  GLN A CA  1 
ATOM   423  C C   . GLN A 1 57  ? 3.969   -4.915  0.862  1.00 28.98 ? 57  GLN A C   1 
ATOM   424  O O   . GLN A 1 57  ? 4.055   -4.934  -0.364 1.00 28.78 ? 57  GLN A O   1 
ATOM   425  C CB  . GLN A 1 57  ? 2.367   -6.805  1.111  1.00 29.80 ? 57  GLN A CB  1 
ATOM   426  C CG  . GLN A 1 57  ? 2.356   -8.316  1.184  1.00 34.54 ? 57  GLN A CG  1 
ATOM   427  C CD  . GLN A 1 57  ? 1.058   -8.908  0.698  1.00 37.68 ? 57  GLN A CD  1 
ATOM   428  O OE1 . GLN A 1 57  ? 0.581   -8.580  -0.392 1.00 39.60 ? 57  GLN A OE1 1 
ATOM   429  N NE2 . GLN A 1 57  ? 0.478   -9.792  1.498  1.00 39.77 ? 57  GLN A NE2 1 
ATOM   430  N N   . THR A 1 58  ? 4.134   -3.807  1.576  1.00 30.64 ? 58  THR A N   1 
ATOM   431  C CA  . THR A 1 58  ? 4.435   -2.526  0.939  1.00 31.15 ? 58  THR A CA  1 
ATOM   432  C C   . THR A 1 58  ? 5.808   -2.029  1.384  1.00 31.35 ? 58  THR A C   1 
ATOM   433  O O   . THR A 1 58  ? 6.477   -1.288  0.663  1.00 32.37 ? 58  THR A O   1 
ATOM   434  C CB  . THR A 1 58  ? 3.392   -1.454  1.314  1.00 31.85 ? 58  THR A CB  1 
ATOM   435  O OG1 . THR A 1 58  ? 2.070   -1.992  1.168  1.00 31.55 ? 58  THR A OG1 1 
ATOM   436  C CG2 . THR A 1 58  ? 3.542   -0.236  0.409  1.00 32.43 ? 58  THR A CG2 1 
ATOM   437  N N   . LEU A 1 59  ? 6.221   -2.443  2.575  1.00 31.41 ? 59  LEU A N   1 
ATOM   438  C CA  . LEU A 1 59  ? 7.507   -2.040  3.125  1.00 31.96 ? 59  LEU A CA  1 
ATOM   439  C C   . LEU A 1 59  ? 8.453   -3.241  3.190  1.00 33.53 ? 59  LEU A C   1 
ATOM   440  O O   . LEU A 1 59  ? 9.543   -3.218  2.620  1.00 34.59 ? 59  LEU A O   1 
ATOM   441  C CB  . LEU A 1 59  ? 7.311   -1.452  4.527  1.00 31.21 ? 59  LEU A CB  1 
ATOM   442  C CG  . LEU A 1 59  ? 6.341   -0.271  4.649  1.00 30.24 ? 59  LEU A CG  1 
ATOM   443  C CD1 . LEU A 1 59  ? 5.993   -0.058  6.114  1.00 29.24 ? 59  LEU A CD1 1 
ATOM   444  C CD2 . LEU A 1 59  ? 6.955   0.990   4.043  1.00 29.20 ? 59  LEU A CD2 1 
ATOM   445  N N   . PHE A 1 62  ? 12.372  -4.886  5.843  1.00 31.39 ? 62  PHE A N   1 
ATOM   446  C CA  . PHE A 1 62  ? 11.921  -4.326  7.114  1.00 32.35 ? 62  PHE A CA  1 
ATOM   447  C C   . PHE A 1 62  ? 13.037  -3.490  7.756  1.00 31.69 ? 62  PHE A C   1 
ATOM   448  O O   . PHE A 1 62  ? 13.816  -4.004  8.557  1.00 31.34 ? 62  PHE A O   1 
ATOM   449  C CB  . PHE A 1 62  ? 11.519  -5.448  8.090  1.00 33.84 ? 62  PHE A CB  1 
ATOM   450  C CG  . PHE A 1 62  ? 10.423  -6.361  7.581  1.00 33.69 ? 62  PHE A CG  1 
ATOM   451  C CD1 . PHE A 1 62  ? 10.648  -7.214  6.500  1.00 32.99 ? 62  PHE A CD1 1 
ATOM   452  C CD2 . PHE A 1 62  ? 9.178   -6.391  8.209  1.00 33.32 ? 62  PHE A CD2 1 
ATOM   453  C CE1 . PHE A 1 62  ? 9.651   -8.086  6.052  1.00 32.41 ? 62  PHE A CE1 1 
ATOM   454  C CE2 . PHE A 1 62  ? 8.172   -7.260  7.769  1.00 34.47 ? 62  PHE A CE2 1 
ATOM   455  C CZ  . PHE A 1 62  ? 8.412   -8.111  6.685  1.00 33.38 ? 62  PHE A CZ  1 
ATOM   456  N N   . VAL A 1 63  ? 13.114  -2.209  7.408  1.00 30.23 ? 63  VAL A N   1 
ATOM   457  C CA  . VAL A 1 63  ? 14.143  -1.340  7.971  1.00 29.54 ? 63  VAL A CA  1 
ATOM   458  C C   . VAL A 1 63  ? 13.580  -0.161  8.759  1.00 28.30 ? 63  VAL A C   1 
ATOM   459  O O   . VAL A 1 63  ? 14.286  0.463   9.540  1.00 28.09 ? 63  VAL A O   1 
ATOM   460  C CB  . VAL A 1 63  ? 15.054  -0.775  6.873  1.00 29.80 ? 63  VAL A CB  1 
ATOM   461  C CG1 . VAL A 1 63  ? 15.786  -1.906  6.182  1.00 31.27 ? 63  VAL A CG1 1 
ATOM   462  C CG2 . VAL A 1 63  ? 14.228  0.017   5.874  1.00 31.21 ? 63  VAL A CG2 1 
ATOM   463  N N   . TYR A 1 64  ? 12.308  0.148   8.548  1.00 27.45 ? 64  TYR A N   1 
ATOM   464  C CA  . TYR A 1 64  ? 11.688  1.267   9.248  1.00 26.91 ? 64  TYR A CA  1 
ATOM   465  C C   . TYR A 1 64  ? 10.464  0.827   10.025 1.00 24.33 ? 64  TYR A C   1 
ATOM   466  O O   . TYR A 1 64  ? 9.836   -0.174  9.690  1.00 23.35 ? 64  TYR A O   1 
ATOM   467  C CB  . TYR A 1 64  ? 11.217  2.339   8.262  1.00 30.91 ? 64  TYR A CB  1 
ATOM   468  C CG  . TYR A 1 64  ? 12.284  3.030   7.452  1.00 35.03 ? 64  TYR A CG  1 
ATOM   469  C CD1 . TYR A 1 64  ? 13.202  3.888   8.051  1.00 37.43 ? 64  TYR A CD1 1 
ATOM   470  C CD2 . TYR A 1 64  ? 12.336  2.871   6.066  1.00 36.82 ? 64  TYR A CD2 1 
ATOM   471  C CE1 . TYR A 1 64  ? 14.149  4.576   7.287  1.00 40.32 ? 64  TYR A CE1 1 
ATOM   472  C CE2 . TYR A 1 64  ? 13.275  3.550   5.297  1.00 39.28 ? 64  TYR A CE2 1 
ATOM   473  C CZ  . TYR A 1 64  ? 14.176  4.402   5.913  1.00 40.98 ? 64  TYR A CZ  1 
ATOM   474  O OH  . TYR A 1 64  ? 15.103  5.080   5.153  1.00 44.64 ? 64  TYR A OH  1 
ATOM   475  N N   . ASP A 1 65  ? 10.137  1.581   11.070 1.00 22.10 ? 65  ASP A N   1 
ATOM   476  C CA  . ASP A 1 65  ? 8.925   1.320   11.823 1.00 20.50 ? 65  ASP A CA  1 
ATOM   477  C C   . ASP A 1 65  ? 7.901   2.116   11.006 1.00 19.73 ? 65  ASP A C   1 
ATOM   478  O O   . ASP A 1 65  ? 8.279   2.895   10.126 1.00 19.35 ? 65  ASP A O   1 
ATOM   479  C CB  . ASP A 1 65  ? 9.013   1.889   13.244 1.00 21.65 ? 65  ASP A CB  1 
ATOM   480  C CG  . ASP A 1 65  ? 10.112  1.232   14.077 1.00 23.46 ? 65  ASP A CG  1 
ATOM   481  O OD1 . ASP A 1 65  ? 11.190  1.840   14.229 1.00 25.22 ? 65  ASP A OD1 1 
ATOM   482  O OD2 . ASP A 1 65  ? 9.901   0.112   14.570 1.00 22.64 ? 65  ASP A OD2 1 
ATOM   483  N N   . ALA A 1 66  ? 6.617   1.929   11.277 1.00 18.51 ? 66  ALA A N   1 
ATOM   484  C CA  . ALA A 1 66  ? 5.596   2.670   10.543 1.00 16.23 ? 66  ALA A CA  1 
ATOM   485  C C   . ALA A 1 66  ? 4.619   3.334   11.509 1.00 15.12 ? 66  ALA A C   1 
ATOM   486  O O   . ALA A 1 66  ? 4.052   2.675   12.379 1.00 14.12 ? 66  ALA A O   1 
ATOM   487  C CB  . ALA A 1 66  ? 4.854   1.737   9.594  1.00 17.05 ? 66  ALA A CB  1 
ATOM   488  N N   . TRP A 1 67  ? 4.445   4.645   11.368 1.00 14.10 ? 67  TRP A N   1 
ATOM   489  C CA  . TRP A 1 67  ? 3.539   5.414   12.220 1.00 14.29 ? 67  TRP A CA  1 
ATOM   490  C C   . TRP A 1 67  ? 2.074   5.003   12.148 1.00 14.73 ? 67  TRP A C   1 
ATOM   491  O O   . TRP A 1 67  ? 1.543   4.747   11.060 1.00 14.53 ? 67  TRP A O   1 
ATOM   492  C CB  . TRP A 1 67  ? 3.579   6.908   11.849 1.00 13.99 ? 67  TRP A CB  1 
ATOM   493  C CG  . TRP A 1 67  ? 4.849   7.633   12.163 1.00 15.29 ? 67  TRP A CG  1 
ATOM   494  C CD1 . TRP A 1 67  ? 5.551   8.453   11.324 1.00 16.10 ? 67  TRP A CD1 1 
ATOM   495  C CD2 . TRP A 1 67  ? 5.531   7.668   13.421 1.00 16.90 ? 67  TRP A CD2 1 
ATOM   496  N NE1 . TRP A 1 67  ? 6.626   8.998   11.984 1.00 17.59 ? 67  TRP A NE1 1 
ATOM   497  C CE2 . TRP A 1 67  ? 6.637   8.534   13.273 1.00 17.80 ? 67  TRP A CE2 1 
ATOM   498  C CE3 . TRP A 1 67  ? 5.312   7.055   14.661 1.00 18.68 ? 67  TRP A CE3 1 
ATOM   499  C CZ2 . TRP A 1 67  ? 7.526   8.802   14.320 1.00 18.21 ? 67  TRP A CZ2 1 
ATOM   500  C CZ3 . TRP A 1 67  ? 6.199   7.322   15.704 1.00 19.14 ? 67  TRP A CZ3 1 
ATOM   501  C CH2 . TRP A 1 67  ? 7.289   8.187   15.525 1.00 17.61 ? 67  TRP A CH2 1 
ATOM   502  N N   . ILE A 1 68  ? 1.431   4.943   13.312 1.00 14.08 ? 68  ILE A N   1 
ATOM   503  C CA  . ILE A 1 68  ? -0.004  4.689   13.398 1.00 14.03 ? 68  ILE A CA  1 
ATOM   504  C C   . ILE A 1 68  ? -0.523  5.865   14.238 1.00 13.93 ? 68  ILE A C   1 
ATOM   505  O O   . ILE A 1 68  ? 0.279   6.611   14.810 1.00 14.64 ? 68  ILE A O   1 
ATOM   506  C CB  . ILE A 1 68  ? -0.381  3.330   14.062 1.00 13.29 ? 68  ILE A CB  1 
ATOM   507  C CG1 . ILE A 1 68  ? 0.301   3.163   15.415 1.00 13.07 ? 68  ILE A CG1 1 
ATOM   508  C CG2 . ILE A 1 68  ? -0.050  2.186   13.107 1.00 13.20 ? 68  ILE A CG2 1 
ATOM   509  C CD1 . ILE A 1 68  ? -0.164  1.892   16.137 1.00 13.91 ? 68  ILE A CD1 1 
ATOM   510  N N   . GLY A 1 69  ? -1.837  6.033   14.319 1.00 14.55 ? 69  GLY A N   1 
ATOM   511  C CA  . GLY A 1 69  ? -2.388  7.183   15.026 1.00 15.56 ? 69  GLY A CA  1 
ATOM   512  C C   . GLY A 1 69  ? -2.443  7.272   16.538 1.00 15.19 ? 69  GLY A C   1 
ATOM   513  O O   . GLY A 1 69  ? -3.206  8.074   17.061 1.00 16.59 ? 69  GLY A O   1 
ATOM   514  N N   . LEU A 1 70  ? -1.637  6.493   17.246 1.00 15.64 ? 70  LEU A N   1 
ATOM   515  C CA  . LEU A 1 70  ? -1.665  6.516   18.703 1.00 16.09 ? 70  LEU A CA  1 
ATOM   516  C C   . LEU A 1 70  ? -0.585  7.413   19.311 1.00 16.57 ? 70  LEU A C   1 
ATOM   517  O O   . LEU A 1 70  ? 0.565   7.385   18.868 1.00 16.13 ? 70  LEU A O   1 
ATOM   518  C CB  . LEU A 1 70  ? -1.505  5.091   19.223 1.00 16.53 ? 70  LEU A CB  1 
ATOM   519  C CG  . LEU A 1 70  ? -1.749  4.876   20.710 1.00 17.81 ? 70  LEU A CG  1 
ATOM   520  C CD1 . LEU A 1 70  ? -3.208  5.171   21.042 1.00 17.87 ? 70  LEU A CD1 1 
ATOM   521  C CD2 . LEU A 1 70  ? -1.399  3.432   21.063 1.00 17.24 ? 70  LEU A CD2 1 
ATOM   522  N N   . ARG A 1 71  ? -0.958  8.203   20.321 1.00 16.87 ? 71  ARG A N   1 
ATOM   523  C CA  . ARG A 1 71  ? -0.017  9.098   20.996 1.00 18.78 ? 71  ARG A CA  1 
ATOM   524  C C   . ARG A 1 71  ? -0.283  9.235   22.501 1.00 19.72 ? 71  ARG A C   1 
ATOM   525  O O   . ARG A 1 71  ? -1.435  9.208   22.947 1.00 19.53 ? 71  ARG A O   1 
ATOM   526  C CB  . ARG A 1 71  ? -0.044  10.499  20.369 1.00 19.97 ? 71  ARG A CB  1 
ATOM   527  C CG  . ARG A 1 71  ? 0.999   11.450  20.971 1.00 24.41 ? 71  ARG A CG  1 
ATOM   528  C CD  . ARG A 1 71  ? 1.134   12.773  20.209 1.00 27.86 ? 71  ARG A CD  1 
ATOM   529  N NE  . ARG A 1 71  ? -0.029  13.643  20.358 1.00 33.33 ? 71  ARG A NE  1 
ATOM   530  C CZ  . ARG A 1 71  ? -0.116  14.874  19.856 1.00 35.92 ? 71  ARG A CZ  1 
ATOM   531  N NH1 . ARG A 1 71  ? 0.894   15.389  19.169 1.00 36.86 ? 71  ARG A NH1 1 
ATOM   532  N NH2 . ARG A 1 71  ? -1.215  15.594  20.042 1.00 37.38 ? 71  ARG A NH2 1 
ATOM   533  N N   . ASP A 1 72  ? 0.794   9.370   23.270 1.00 20.28 ? 72  ASP A N   1 
ATOM   534  C CA  . ASP A 1 72  ? 0.697   9.559   24.715 1.00 22.40 ? 72  ASP A CA  1 
ATOM   535  C C   . ASP A 1 72  ? 0.462   11.059  24.894 1.00 22.85 ? 72  ASP A C   1 
ATOM   536  O O   . ASP A 1 72  ? 1.360   11.861  24.663 1.00 21.68 ? 72  ASP A O   1 
ATOM   537  C CB  . ASP A 1 72  ? 2.005   9.137   25.399 1.00 24.41 ? 72  ASP A CB  1 
ATOM   538  C CG  . ASP A 1 72  ? 2.040   9.498   26.888 1.00 25.74 ? 72  ASP A CG  1 
ATOM   539  O OD1 . ASP A 1 72  ? 3.093   9.286   27.525 1.00 26.27 ? 72  ASP A OD1 1 
ATOM   540  O OD2 . ASP A 1 72  ? 1.024   9.991   27.420 1.00 24.84 ? 72  ASP A OD2 1 
ATOM   541  N N   . GLU A 1 73  ? -0.745  11.430  25.301 1.00 24.39 ? 73  GLU A N   1 
ATOM   542  C CA  . GLU A 1 73  ? -1.098  12.837  25.462 1.00 26.82 ? 73  GLU A CA  1 
ATOM   543  C C   . GLU A 1 73  ? -0.701  13.522  26.771 1.00 26.42 ? 73  GLU A C   1 
ATOM   544  O O   . GLU A 1 73  ? -1.052  14.685  26.983 1.00 26.94 ? 73  GLU A O   1 
ATOM   545  C CB  . GLU A 1 73  ? -2.604  13.011  25.249 1.00 31.01 ? 73  GLU A CB  1 
ATOM   546  C CG  . GLU A 1 73  ? -2.961  14.054  24.211 1.00 37.62 ? 73  GLU A CG  1 
ATOM   547  C CD  . GLU A 1 73  ? -2.459  13.686  22.832 1.00 41.72 ? 73  GLU A CD  1 
ATOM   548  O OE1 . GLU A 1 73  ? -2.841  12.606  22.330 1.00 42.69 ? 73  GLU A OE1 1 
ATOM   549  O OE2 . GLU A 1 73  ? -1.683  14.476  22.251 1.00 43.82 ? 73  GLU A OE2 1 
ATOM   550  N N   . SER A 1 74  ? 0.015   12.836  27.656 1.00 26.05 ? 74  SER A N   1 
ATOM   551  C CA  . SER A 1 74  ? 0.409   13.483  28.907 1.00 25.64 ? 74  SER A CA  1 
ATOM   552  C C   . SER A 1 74  ? 1.294   14.693  28.603 1.00 25.36 ? 74  SER A C   1 
ATOM   553  O O   . SER A 1 74  ? 2.027   14.700  27.619 1.00 24.01 ? 74  SER A O   1 
ATOM   554  C CB  . SER A 1 74  ? 1.114   12.488  29.845 1.00 25.90 ? 74  SER A CB  1 
ATOM   555  O OG  . SER A 1 74  ? 2.111   11.737  29.183 1.00 26.43 ? 74  SER A OG  1 
ATOM   556  N N   . LYS A 1 75  ? 1.220   15.725  29.437 1.00 26.39 ? 75  LYS A N   1 
ATOM   557  C CA  . LYS A 1 75  ? 2.008   16.929  29.184 1.00 27.39 ? 75  LYS A CA  1 
ATOM   558  C C   . LYS A 1 75  ? 3.453   16.809  29.649 1.00 24.95 ? 75  LYS A C   1 
ATOM   559  O O   . LYS A 1 75  ? 4.307   17.585  29.224 1.00 25.62 ? 75  LYS A O   1 
ATOM   560  C CB  . LYS A 1 75  ? 1.347   18.150  29.836 1.00 30.77 ? 75  LYS A CB  1 
ATOM   561  C CG  . LYS A 1 75  ? 1.259   18.084  31.352 1.00 37.66 ? 75  LYS A CG  1 
ATOM   562  C CD  . LYS A 1 75  ? 0.698   19.382  31.945 1.00 41.94 ? 75  LYS A CD  1 
ATOM   563  C CE  . LYS A 1 75  ? 1.703   20.536  31.885 1.00 45.12 ? 75  LYS A CE  1 
ATOM   564  N NZ  . LYS A 1 75  ? 2.117   20.909  30.496 1.00 46.86 ? 75  LYS A NZ  1 
ATOM   565  N N   . THR A 1 76  ? 3.723   15.837  30.518 1.00 22.14 ? 76  THR A N   1 
ATOM   566  C CA  . THR A 1 76  ? 5.077   15.608  31.024 1.00 20.14 ? 76  THR A CA  1 
ATOM   567  C C   . THR A 1 76  ? 5.929   14.881  29.973 1.00 18.81 ? 76  THR A C   1 
ATOM   568  O O   . THR A 1 76  ? 5.402   14.395  28.972 1.00 18.01 ? 76  THR A O   1 
ATOM   569  C CB  . THR A 1 76  ? 5.038   14.778  32.333 1.00 19.86 ? 76  THR A CB  1 
ATOM   570  O OG1 . THR A 1 76  ? 4.035   13.762  32.232 1.00 19.40 ? 76  THR A OG1 1 
ATOM   571  C CG2 . THR A 1 76  ? 4.720   15.671  33.520 1.00 19.01 ? 76  THR A CG2 1 
ATOM   572  N N   . GLN A 1 77  ? 7.240   14.823  30.190 1.00 17.64 ? 77  GLN A N   1 
ATOM   573  C CA  . GLN A 1 77  ? 8.139   14.150  29.253 1.00 18.06 ? 77  GLN A CA  1 
ATOM   574  C C   . GLN A 1 77  ? 7.857   12.650  29.212 1.00 18.07 ? 77  GLN A C   1 
ATOM   575  O O   . GLN A 1 77  ? 7.902   12.032  28.152 1.00 18.81 ? 77  GLN A O   1 
ATOM   576  C CB  . GLN A 1 77  ? 9.598   14.416  29.639 1.00 18.26 ? 77  GLN A CB  1 
ATOM   577  C CG  . GLN A 1 77  ? 10.052  15.839  29.323 1.00 19.74 ? 77  GLN A CG  1 
ATOM   578  C CD  . GLN A 1 77  ? 11.428  16.170  29.883 1.00 22.15 ? 77  GLN A CD  1 
ATOM   579  O OE1 . GLN A 1 77  ? 12.289  15.302  30.011 1.00 21.72 ? 77  GLN A OE1 1 
ATOM   580  N NE2 . GLN A 1 77  ? 11.643  17.443  30.203 1.00 24.38 ? 77  GLN A NE2 1 
ATOM   581  N N   . GLN A 1 78  ? 7.585   12.067  30.375 1.00 17.43 ? 78  GLN A N   1 
ATOM   582  C CA  . GLN A 1 78  ? 7.246   10.655  30.453 1.00 17.17 ? 78  GLN A CA  1 
ATOM   583  C C   . GLN A 1 78  ? 5.863   10.587  31.101 1.00 18.43 ? 78  GLN A C   1 
ATOM   584  O O   . GLN A 1 78  ? 5.322   11.611  31.527 1.00 18.27 ? 78  GLN A O   1 
ATOM   585  C CB  . GLN A 1 78  ? 8.309   9.850   31.229 1.00 15.75 ? 78  GLN A CB  1 
ATOM   586  C CG  . GLN A 1 78  ? 8.760   10.428  32.561 1.00 14.45 ? 78  GLN A CG  1 
ATOM   587  C CD  . GLN A 1 78  ? 7.728   10.265  33.654 1.00 13.35 ? 78  GLN A CD  1 
ATOM   588  O OE1 . GLN A 1 78  ? 7.307   11.247  34.273 1.00 13.17 ? 78  GLN A OE1 1 
ATOM   589  N NE2 . GLN A 1 78  ? 7.320   9.023   33.911 1.00 10.49 ? 78  GLN A NE2 1 
ATOM   590  N N   . CYS A 1 79  ? 5.295   9.394   31.183 1.00 17.92 ? 79  CYS A N   1 
ATOM   591  C CA  . CYS A 1 79  ? 3.941   9.244   31.690 1.00 18.82 ? 79  CYS A CA  1 
ATOM   592  C C   . CYS A 1 79  ? 3.618   9.265   33.190 1.00 19.63 ? 79  CYS A C   1 
ATOM   593  O O   . CYS A 1 79  ? 2.495   9.594   33.573 1.00 21.38 ? 79  CYS A O   1 
ATOM   594  C CB  . CYS A 1 79  ? 3.352   7.997   31.042 1.00 19.17 ? 79  CYS A CB  1 
ATOM   595  S SG  . CYS A 1 79  ? 1.911   7.291   31.864 1.00 23.42 ? 79  CYS A SG  1 
ATOM   596  N N   . SER A 1 80  ? 4.573   8.935   34.047 1.00 19.20 ? 80  SER A N   1 
ATOM   597  C CA  . SER A 1 80  ? 4.276   8.929   35.477 1.00 19.44 ? 80  SER A CA  1 
ATOM   598  C C   . SER A 1 80  ? 4.070   10.323  36.075 1.00 18.55 ? 80  SER A C   1 
ATOM   599  O O   . SER A 1 80  ? 4.927   11.194  35.949 1.00 17.71 ? 80  SER A O   1 
ATOM   600  C CB  . SER A 1 80  ? 5.387   8.219   36.243 1.00 19.73 ? 80  SER A CB  1 
ATOM   601  O OG  . SER A 1 80  ? 5.068   8.182   37.619 1.00 25.56 ? 80  SER A OG  1 
ATOM   602  N N   . PRO A 1 81  ? 2.921   10.553  36.729 1.00 19.44 ? 81  PRO A N   1 
ATOM   603  C CA  . PRO A 1 81  ? 2.665   11.864  37.331 1.00 20.35 ? 81  PRO A CA  1 
ATOM   604  C C   . PRO A 1 81  ? 3.317   12.023  38.715 1.00 20.96 ? 81  PRO A C   1 
ATOM   605  O O   . PRO A 1 81  ? 3.392   13.132  39.244 1.00 21.25 ? 81  PRO A O   1 
ATOM   606  C CB  . PRO A 1 81  ? 1.144   11.923  37.380 1.00 19.24 ? 81  PRO A CB  1 
ATOM   607  C CG  . PRO A 1 81  ? 0.779   10.491  37.656 1.00 20.73 ? 81  PRO A CG  1 
ATOM   608  C CD  . PRO A 1 81  ? 1.690   9.739   36.706 1.00 19.78 ? 81  PRO A CD  1 
ATOM   609  N N   . GLN A 1 82  ? 3.798   10.919  39.290 1.00 20.95 ? 82  GLN A N   1 
ATOM   610  C CA  . GLN A 1 82  ? 4.447   10.971  40.600 1.00 21.28 ? 82  GLN A CA  1 
ATOM   611  C C   . GLN A 1 82  ? 5.582   9.954   40.787 1.00 20.54 ? 82  GLN A C   1 
ATOM   612  O O   . GLN A 1 82  ? 5.634   8.924   40.105 1.00 20.64 ? 82  GLN A O   1 
ATOM   613  C CB  . GLN A 1 82  ? 3.409   10.789  41.715 1.00 22.88 ? 82  GLN A CB  1 
ATOM   614  C CG  . GLN A 1 82  ? 2.437   11.948  41.835 1.00 29.10 ? 82  GLN A CG  1 
ATOM   615  C CD  . GLN A 1 82  ? 1.660   11.937  43.139 1.00 32.20 ? 82  GLN A CD  1 
ATOM   616  O OE1 . GLN A 1 82  ? 0.989   12.909  43.480 1.00 35.44 ? 82  GLN A OE1 1 
ATOM   617  N NE2 . GLN A 1 82  ? 1.748   10.837  43.873 1.00 33.88 ? 82  GLN A NE2 1 
ATOM   618  N N   . TRP A 1 83  ? 6.499   10.272  41.700 1.00 18.96 ? 83  TRP A N   1 
ATOM   619  C CA  . TRP A 1 83  ? 7.633   9.403   42.018 1.00 16.14 ? 83  TRP A CA  1 
ATOM   620  C C   . TRP A 1 83  ? 7.138   8.399   43.048 1.00 15.65 ? 83  TRP A C   1 
ATOM   621  O O   . TRP A 1 83  ? 6.044   8.562   43.591 1.00 15.50 ? 83  TRP A O   1 
ATOM   622  C CB  . TRP A 1 83  ? 8.786   10.210  42.631 1.00 14.38 ? 83  TRP A CB  1 
ATOM   623  C CG  . TRP A 1 83  ? 9.370   11.247  41.738 1.00 13.12 ? 83  TRP A CG  1 
ATOM   624  C CD1 . TRP A 1 83  ? 8.942   12.539  41.577 1.00 13.59 ? 83  TRP A CD1 1 
ATOM   625  C CD2 . TRP A 1 83  ? 10.504  11.090  40.878 1.00 11.80 ? 83  TRP A CD2 1 
ATOM   626  N NE1 . TRP A 1 83  ? 9.747   13.195  40.672 1.00 11.78 ? 83  TRP A NE1 1 
ATOM   627  C CE2 . TRP A 1 83  ? 10.711  12.327  40.229 1.00 12.63 ? 83  TRP A CE2 1 
ATOM   628  C CE3 . TRP A 1 83  ? 11.364  10.024  40.595 1.00 11.99 ? 83  TRP A CE3 1 
ATOM   629  C CZ2 . TRP A 1 83  ? 11.748  12.527  39.312 1.00 12.85 ? 83  TRP A CZ2 1 
ATOM   630  C CZ3 . TRP A 1 83  ? 12.395  10.221  39.681 1.00 12.83 ? 83  TRP A CZ3 1 
ATOM   631  C CH2 . TRP A 1 83  ? 12.578  11.467  39.050 1.00 13.01 ? 83  TRP A CH2 1 
ATOM   632  N N   . THR A 1 84  ? 7.938   7.376   43.341 1.00 13.88 ? 84  THR A N   1 
ATOM   633  C CA  . THR A 1 84  ? 7.518   6.381   44.316 1.00 14.28 ? 84  THR A CA  1 
ATOM   634  C C   . THR A 1 84  ? 7.450   6.960   45.734 1.00 15.96 ? 84  THR A C   1 
ATOM   635  O O   . THR A 1 84  ? 6.785   6.389   46.609 1.00 16.03 ? 84  THR A O   1 
ATOM   636  C CB  . THR A 1 84  ? 8.453   5.155   44.315 1.00 13.75 ? 84  THR A CB  1 
ATOM   637  O OG1 . THR A 1 84  ? 9.789   5.571   44.626 1.00 15.22 ? 84  THR A OG1 1 
ATOM   638  C CG2 . THR A 1 84  ? 8.438   4.457   42.944 1.00 14.17 ? 84  THR A CG2 1 
ATOM   639  N N   . ASP A 1 85  ? 8.130   8.081   45.974 1.00 16.05 ? 85  ASP A N   1 
ATOM   640  C CA  . ASP A 1 85  ? 8.089   8.688   47.307 1.00 16.17 ? 85  ASP A CA  1 
ATOM   641  C C   . ASP A 1 85  ? 6.850   9.571   47.446 1.00 17.10 ? 85  ASP A C   1 
ATOM   642  O O   . ASP A 1 85  ? 6.630   10.219  48.477 1.00 18.22 ? 85  ASP A O   1 
ATOM   643  C CB  . ASP A 1 85  ? 9.380   9.479   47.604 1.00 16.06 ? 85  ASP A CB  1 
ATOM   644  C CG  . ASP A 1 85  ? 9.547   10.720  46.737 1.00 16.82 ? 85  ASP A CG  1 
ATOM   645  O OD1 . ASP A 1 85  ? 10.622  11.353  46.822 1.00 18.24 ? 85  ASP A OD1 1 
ATOM   646  O OD2 . ASP A 1 85  ? 8.625   11.073  45.979 1.00 18.83 ? 85  ASP A OD2 1 
ATOM   647  N N   . GLY A 1 86  ? 6.041   9.587   46.390 1.00 18.85 ? 86  GLY A N   1 
ATOM   648  C CA  . GLY A 1 86  ? 4.813   10.354  46.405 1.00 18.77 ? 86  GLY A CA  1 
ATOM   649  C C   . GLY A 1 86  ? 4.884   11.810  45.991 1.00 18.71 ? 86  GLY A C   1 
ATOM   650  O O   . GLY A 1 86  ? 3.855   12.486  45.955 1.00 19.22 ? 86  GLY A O   1 
ATOM   651  N N   . SER A 1 87  ? 6.071   12.323  45.686 1.00 18.75 ? 87  SER A N   1 
ATOM   652  C CA  . SER A 1 87  ? 6.136   13.718  45.277 1.00 18.57 ? 87  SER A CA  1 
ATOM   653  C C   . SER A 1 87  ? 5.738   13.827  43.808 1.00 19.00 ? 87  SER A C   1 
ATOM   654  O O   . SER A 1 87  ? 5.902   12.878  43.030 1.00 19.40 ? 87  SER A O   1 
ATOM   655  C CB  . SER A 1 87  ? 7.538   14.291  45.517 1.00 19.82 ? 87  SER A CB  1 
ATOM   656  O OG  . SER A 1 87  ? 8.519   13.563  44.812 1.00 20.73 ? 87  SER A OG  1 
ATOM   657  N N   . SER A 1 88  ? 5.189   14.975  43.431 1.00 18.00 ? 88  SER A N   1 
ATOM   658  C CA  . SER A 1 88  ? 4.759   15.200  42.059 1.00 18.48 ? 88  SER A CA  1 
ATOM   659  C C   . SER A 1 88  ? 5.945   15.302  41.112 1.00 19.64 ? 88  SER A C   1 
ATOM   660  O O   . SER A 1 88  ? 7.035   15.732  41.499 1.00 20.34 ? 88  SER A O   1 
ATOM   661  C CB  . SER A 1 88  ? 3.948   16.497  41.957 1.00 17.34 ? 88  SER A CB  1 
ATOM   662  O OG  . SER A 1 88  ? 2.846   16.481  42.842 1.00 22.70 ? 88  SER A OG  1 
ATOM   663  N N   . VAL A 1 89  ? 5.730   14.899  39.863 1.00 19.94 ? 89  VAL A N   1 
ATOM   664  C CA  . VAL A 1 89  ? 6.780   14.997  38.871 1.00 18.99 ? 89  VAL A CA  1 
ATOM   665  C C   . VAL A 1 89  ? 6.638   16.380  38.244 1.00 19.97 ? 89  VAL A C   1 
ATOM   666  O O   . VAL A 1 89  ? 5.663   16.654  37.548 1.00 21.16 ? 89  VAL A O   1 
ATOM   667  C CB  . VAL A 1 89  ? 6.633   13.921  37.784 1.00 18.38 ? 89  VAL A CB  1 
ATOM   668  C CG1 . VAL A 1 89  ? 7.625   14.184  36.674 1.00 19.08 ? 89  VAL A CG1 1 
ATOM   669  C CG2 . VAL A 1 89  ? 6.874   12.528  38.379 1.00 16.20 ? 89  VAL A CG2 1 
ATOM   670  N N   . VAL A 1 90  ? 7.582   17.266  38.532 1.00 19.81 ? 90  VAL A N   1 
ATOM   671  C CA  . VAL A 1 90  ? 7.551   18.614  37.973 1.00 20.64 ? 90  VAL A CA  1 
ATOM   672  C C   . VAL A 1 90  ? 8.804   18.762  37.124 1.00 20.10 ? 90  VAL A C   1 
ATOM   673  O O   . VAL A 1 90  ? 8.722   19.004  35.918 1.00 22.29 ? 90  VAL A O   1 
ATOM   674  C CB  . VAL A 1 90  ? 7.539   19.693  39.079 1.00 21.68 ? 90  VAL A CB  1 
ATOM   675  C CG1 . VAL A 1 90  ? 7.551   21.083  38.439 1.00 22.21 ? 90  VAL A CG1 1 
ATOM   676  C CG2 . VAL A 1 90  ? 6.302   19.526  39.953 1.00 21.62 ? 90  VAL A CG2 1 
ATOM   677  N N   . TYR A 1 91  ? 9.962   18.604  37.754 1.00 18.84 ? 91  TYR A N   1 
ATOM   678  C CA  . TYR A 1 91  ? 11.232  18.673  37.031 1.00 17.72 ? 91  TYR A CA  1 
ATOM   679  C C   . TYR A 1 91  ? 11.429  17.328  36.327 1.00 16.19 ? 91  TYR A C   1 
ATOM   680  O O   . TYR A 1 91  ? 11.179  16.280  36.919 1.00 16.73 ? 91  TYR A O   1 
ATOM   681  C CB  . TYR A 1 91  ? 12.393  18.920  38.006 1.00 16.00 ? 91  TYR A CB  1 
ATOM   682  C CG  . TYR A 1 91  ? 13.756  18.828  37.352 1.00 15.07 ? 91  TYR A CG  1 
ATOM   683  C CD1 . TYR A 1 91  ? 14.199  19.819  36.478 1.00 14.88 ? 91  TYR A CD1 1 
ATOM   684  C CD2 . TYR A 1 91  ? 14.572  17.717  37.557 1.00 14.44 ? 91  TYR A CD2 1 
ATOM   685  C CE1 . TYR A 1 91  ? 15.422  19.701  35.809 1.00 16.06 ? 91  TYR A CE1 1 
ATOM   686  C CE2 . TYR A 1 91  ? 15.794  17.586  36.896 1.00 15.04 ? 91  TYR A CE2 1 
ATOM   687  C CZ  . TYR A 1 91  ? 16.213  18.579  36.023 1.00 15.92 ? 91  TYR A CZ  1 
ATOM   688  O OH  . TYR A 1 91  ? 17.411  18.439  35.340 1.00 15.75 ? 91  TYR A OH  1 
ATOM   689  N N   . GLU A 1 92  ? 11.863  17.363  35.071 1.00 16.37 ? 92  GLU A N   1 
ATOM   690  C CA  . GLU A 1 92  ? 12.109  16.145  34.284 1.00 16.49 ? 92  GLU A CA  1 
ATOM   691  C C   . GLU A 1 92  ? 13.339  16.330  33.399 1.00 15.88 ? 92  GLU A C   1 
ATOM   692  O O   . GLU A 1 92  ? 13.587  17.425  32.900 1.00 16.15 ? 92  GLU A O   1 
ATOM   693  C CB  . GLU A 1 92  ? 10.916  15.815  33.376 1.00 16.54 ? 92  GLU A CB  1 
ATOM   694  C CG  . GLU A 1 92  ? 9.694   15.261  34.090 1.00 17.85 ? 92  GLU A CG  1 
ATOM   695  C CD  . GLU A 1 92  ? 8.615   14.842  33.115 1.00 19.34 ? 92  GLU A CD  1 
ATOM   696  O OE1 . GLU A 1 92  ? 8.039   15.732  32.452 1.00 19.82 ? 92  GLU A OE1 1 
ATOM   697  O OE2 . GLU A 1 92  ? 8.355   13.621  33.005 1.00 19.91 ? 92  GLU A OE2 1 
ATOM   698  N N   . ASN A 1 93  ? 14.092  15.255  33.193 1.00 15.63 ? 93  ASN A N   1 
ATOM   699  C CA  . ASN A 1 93  ? 15.292  15.324  32.367 1.00 15.26 ? 93  ASN A CA  1 
ATOM   700  C C   . ASN A 1 93  ? 15.400  14.055  31.523 1.00 15.09 ? 93  ASN A C   1 
ATOM   701  O O   . ASN A 1 93  ? 16.452  13.422  31.471 1.00 13.70 ? 93  ASN A O   1 
ATOM   702  C CB  . ASN A 1 93  ? 16.530  15.465  33.265 1.00 15.42 ? 93  ASN A CB  1 
ATOM   703  C CG  . ASN A 1 93  ? 17.730  16.052  32.538 1.00 15.77 ? 93  ASN A CG  1 
ATOM   704  O OD1 . ASN A 1 93  ? 18.854  16.009  33.047 1.00 20.17 ? 93  ASN A OD1 1 
ATOM   705  N ND2 . ASN A 1 93  ? 17.499  16.618  31.359 1.00 15.24 ? 93  ASN A ND2 1 
ATOM   706  N N   . VAL A 1 94  ? 14.300  13.671  30.876 1.00 16.27 ? 94  VAL A N   1 
ATOM   707  C CA  . VAL A 1 94  ? 14.291  12.476  30.031 1.00 17.70 ? 94  VAL A CA  1 
ATOM   708  C C   . VAL A 1 94  ? 15.173  12.726  28.799 1.00 18.11 ? 94  VAL A C   1 
ATOM   709  O O   . VAL A 1 94  ? 15.023  13.746  28.118 1.00 17.13 ? 94  VAL A O   1 
ATOM   710  C CB  . VAL A 1 94  ? 12.846  12.117  29.584 1.00 17.68 ? 94  VAL A CB  1 
ATOM   711  C CG1 . VAL A 1 94  ? 12.879  10.978  28.573 1.00 14.97 ? 94  VAL A CG1 1 
ATOM   712  C CG2 . VAL A 1 94  ? 12.011  11.685  30.798 1.00 16.02 ? 94  VAL A CG2 1 
ATOM   713  N N   . ASP A 1 95  ? 16.090  11.797  28.533 1.00 19.31 ? 95  ASP A N   1 
ATOM   714  C CA  . ASP A 1 95  ? 17.025  11.914  27.410 1.00 21.53 ? 95  ASP A CA  1 
ATOM   715  C C   . ASP A 1 95  ? 16.299  12.130  26.084 1.00 21.62 ? 95  ASP A C   1 
ATOM   716  O O   . ASP A 1 95  ? 16.514  13.135  25.407 1.00 21.11 ? 95  ASP A O   1 
ATOM   717  C CB  . ASP A 1 95  ? 17.897  10.661  27.315 1.00 24.99 ? 95  ASP A CB  1 
ATOM   718  C CG  . ASP A 1 95  ? 19.047  10.819  26.335 1.00 30.15 ? 95  ASP A CG  1 
ATOM   719  O OD1 . ASP A 1 95  ? 19.528  9.786   25.818 1.00 32.85 ? 95  ASP A OD1 1 
ATOM   720  O OD2 . ASP A 1 95  ? 19.480  11.970  26.090 1.00 32.60 ? 95  ASP A OD2 1 
ATOM   721  N N   . GLU A 1 96  ? 15.434  11.187  25.720 1.00 21.29 ? 96  GLU A N   1 
ATOM   722  C CA  . GLU A 1 96  ? 14.672  11.298  24.481 1.00 20.44 ? 96  GLU A CA  1 
ATOM   723  C C   . GLU A 1 96  ? 13.257  10.758  24.719 1.00 18.65 ? 96  GLU A C   1 
ATOM   724  O O   . GLU A 1 96  ? 13.041  9.546   24.724 1.00 17.80 ? 96  GLU A O   1 
ATOM   725  C CB  . GLU A 1 96  ? 15.359  10.497  23.370 1.00 23.41 ? 96  GLU A CB  1 
ATOM   726  C CG  . GLU A 1 96  ? 14.924  10.885  21.963 1.00 28.11 ? 96  GLU A CG  1 
ATOM   727  C CD  . GLU A 1 96  ? 15.601  10.048  20.894 1.00 31.86 ? 96  GLU A CD  1 
ATOM   728  O OE1 . GLU A 1 96  ? 15.553  10.447  19.710 1.00 34.61 ? 96  GLU A OE1 1 
ATOM   729  O OE2 . GLU A 1 96  ? 16.173  8.986   21.232 1.00 33.47 ? 96  GLU A OE2 1 
ATOM   730  N N   . PRO A 1 97  ? 12.282  11.654  24.947 1.00 17.19 ? 97  PRO A N   1 
ATOM   731  C CA  . PRO A 1 97  ? 10.901  11.224  25.181 1.00 17.29 ? 97  PRO A CA  1 
ATOM   732  C C   . PRO A 1 97  ? 10.358  10.448  23.988 1.00 17.62 ? 97  PRO A C   1 
ATOM   733  O O   . PRO A 1 97  ? 10.628  10.796  22.837 1.00 18.49 ? 97  PRO A O   1 
ATOM   734  C CB  . PRO A 1 97  ? 10.159  12.542  25.390 1.00 16.19 ? 97  PRO A CB  1 
ATOM   735  C CG  . PRO A 1 97  ? 11.221  13.423  26.013 1.00 16.41 ? 97  PRO A CG  1 
ATOM   736  C CD  . PRO A 1 97  ? 12.420  13.107  25.150 1.00 16.32 ? 97  PRO A CD  1 
ATOM   737  N N   . THR A 1 98  ? 9.594   9.398   24.270 1.00 15.64 ? 98  THR A N   1 
ATOM   738  C CA  . THR A 1 98  ? 9.007   8.566   23.223 1.00 16.09 ? 98  THR A CA  1 
ATOM   739  C C   . THR A 1 98  ? 7.496   8.559   23.470 1.00 16.78 ? 98  THR A C   1 
ATOM   740  O O   . THR A 1 98  ? 6.991   7.734   24.233 1.00 18.27 ? 98  THR A O   1 
ATOM   741  C CB  . THR A 1 98  ? 9.568   7.122   23.303 1.00 15.87 ? 98  THR A CB  1 
ATOM   742  O OG1 . THR A 1 98  ? 9.524   6.666   24.668 1.00 14.40 ? 98  THR A OG1 1 
ATOM   743  C CG2 . THR A 1 98  ? 11.010  7.080   22.799 1.00 16.01 ? 98  THR A CG2 1 
ATOM   744  N N   . LYS A 1 99  ? 6.779   9.477   22.826 1.00 16.54 ? 99  LYS A N   1 
ATOM   745  C CA  . LYS A 1 99  ? 5.339   9.588   23.054 1.00 17.14 ? 99  LYS A CA  1 
ATOM   746  C C   . LYS A 1 99  ? 4.434   9.218   21.887 1.00 15.81 ? 99  LYS A C   1 
ATOM   747  O O   . LYS A 1 99  ? 3.212   9.226   22.026 1.00 15.83 ? 99  LYS A O   1 
ATOM   748  C CB  . LYS A 1 99  ? 5.024   11.010  23.542 1.00 17.93 ? 99  LYS A CB  1 
ATOM   749  C CG  . LYS A 1 99  ? 5.885   11.394  24.746 1.00 19.80 ? 99  LYS A CG  1 
ATOM   750  C CD  . LYS A 1 99  ? 5.710   12.830  25.177 1.00 22.34 ? 99  LYS A CD  1 
ATOM   751  C CE  . LYS A 1 99  ? 4.465   13.015  26.016 1.00 24.81 ? 99  LYS A CE  1 
ATOM   752  N NZ  . LYS A 1 99  ? 4.387   14.420  26.488 1.00 30.14 ? 99  LYS A NZ  1 
ATOM   753  N N   . CYS A 1 100 ? 5.035   8.888   20.749 1.00 15.24 ? 100 CYS A N   1 
ATOM   754  C CA  . CYS A 1 100 ? 4.287   8.499   19.557 1.00 14.81 ? 100 CYS A CA  1 
ATOM   755  C C   . CYS A 1 100 ? 4.493   7.003   19.298 1.00 15.78 ? 100 CYS A C   1 
ATOM   756  O O   . CYS A 1 100 ? 5.569   6.462   19.571 1.00 16.31 ? 100 CYS A O   1 
ATOM   757  C CB  . CYS A 1 100 ? 4.752   9.317   18.343 1.00 15.41 ? 100 CYS A CB  1 
ATOM   758  S SG  . CYS A 1 100 ? 4.204   11.056  18.416 1.00 15.89 ? 100 CYS A SG  1 
ATOM   759  N N   . PHE A 1 101 ? 3.472   6.344   18.757 1.00 14.67 ? 101 PHE A N   1 
ATOM   760  C CA  . PHE A 1 101 ? 3.550   4.911   18.492 1.00 13.92 ? 101 PHE A CA  1 
ATOM   761  C C   . PHE A 1 101 ? 3.541   4.499   17.030 1.00 13.55 ? 101 PHE A C   1 
ATOM   762  O O   . PHE A 1 101 ? 2.945   5.160   16.178 1.00 13.96 ? 101 PHE A O   1 
ATOM   763  C CB  . PHE A 1 101 ? 2.425   4.176   19.225 1.00 13.48 ? 101 PHE A CB  1 
ATOM   764  C CG  . PHE A 1 101 ? 2.568   4.200   20.722 1.00 15.46 ? 101 PHE A CG  1 
ATOM   765  C CD1 . PHE A 1 101 ? 2.239   5.348   21.446 1.00 15.68 ? 101 PHE A CD1 1 
ATOM   766  C CD2 . PHE A 1 101 ? 3.058   3.086   21.412 1.00 14.12 ? 101 PHE A CD2 1 
ATOM   767  C CE1 . PHE A 1 101 ? 2.398   5.387   22.839 1.00 14.92 ? 101 PHE A CE1 1 
ATOM   768  C CE2 . PHE A 1 101 ? 3.223   3.113   22.800 1.00 13.84 ? 101 PHE A CE2 1 
ATOM   769  C CZ  . PHE A 1 101 ? 2.894   4.261   23.514 1.00 16.13 ? 101 PHE A CZ  1 
ATOM   770  N N   . GLY A 1 102 ? 4.208   3.379   16.758 1.00 13.49 ? 102 GLY A N   1 
ATOM   771  C CA  . GLY A 1 102 ? 4.278   2.865   15.409 1.00 12.44 ? 102 GLY A CA  1 
ATOM   772  C C   . GLY A 1 102 ? 4.374   1.352   15.411 1.00 12.95 ? 102 GLY A C   1 
ATOM   773  O O   . GLY A 1 102 ? 4.567   0.731   16.463 1.00 11.26 ? 102 GLY A O   1 
ATOM   774  N N   . LEU A 1 103 ? 4.212   0.757   14.232 1.00 13.27 ? 103 LEU A N   1 
ATOM   775  C CA  . LEU A 1 103 ? 4.314   -0.689  14.098 1.00 14.63 ? 103 LEU A CA  1 
ATOM   776  C C   . LEU A 1 103 ? 5.801   -1.042  14.224 1.00 15.32 ? 103 LEU A C   1 
ATOM   777  O O   . LEU A 1 103 ? 6.636   -0.513  13.494 1.00 15.80 ? 103 LEU A O   1 
ATOM   778  C CB  . LEU A 1 103 ? 3.762   -1.127  12.737 1.00 14.29 ? 103 LEU A CB  1 
ATOM   779  C CG  . LEU A 1 103 ? 2.292   -0.768  12.480 1.00 14.02 ? 103 LEU A CG  1 
ATOM   780  C CD1 . LEU A 1 103 ? 1.855   -1.286  11.120 1.00 14.05 ? 103 LEU A CD1 1 
ATOM   781  C CD2 . LEU A 1 103 ? 1.430   -1.368  13.583 1.00 13.63 ? 103 LEU A CD2 1 
ATOM   782  N N   . ASP A 1 104 ? 6.117   -1.938  15.153 1.00 16.07 ? 104 ASP A N   1 
ATOM   783  C CA  . ASP A 1 104 ? 7.492   -2.358  15.431 1.00 17.40 ? 104 ASP A CA  1 
ATOM   784  C C   . ASP A 1 104 ? 8.094   -3.252  14.342 1.00 17.62 ? 104 ASP A C   1 
ATOM   785  O O   . ASP A 1 104 ? 7.642   -4.376  14.124 1.00 17.57 ? 104 ASP A O   1 
ATOM   786  C CB  . ASP A 1 104 ? 7.504   -3.104  16.764 1.00 18.99 ? 104 ASP A CB  1 
ATOM   787  C CG  . ASP A 1 104 ? 8.898   -3.341  17.305 1.00 21.18 ? 104 ASP A CG  1 
ATOM   788  O OD1 . ASP A 1 104 ? 9.899   -3.156  16.577 1.00 20.71 ? 104 ASP A OD1 1 
ATOM   789  O OD2 . ASP A 1 104 ? 8.979   -3.731  18.487 1.00 24.05 ? 104 ASP A OD2 1 
ATOM   790  N N   . VAL A 1 105 ? 9.131   -2.759  13.680 1.00 18.25 ? 105 VAL A N   1 
ATOM   791  C CA  . VAL A 1 105 ? 9.792   -3.517  12.622 1.00 20.54 ? 105 VAL A CA  1 
ATOM   792  C C   . VAL A 1 105 ? 10.346  -4.854  13.125 1.00 21.46 ? 105 VAL A C   1 
ATOM   793  O O   . VAL A 1 105 ? 10.378  -5.842  12.387 1.00 22.31 ? 105 VAL A O   1 
ATOM   794  C CB  . VAL A 1 105 ? 10.960  -2.713  12.013 1.00 21.49 ? 105 VAL A CB  1 
ATOM   795  C CG1 . VAL A 1 105 ? 12.130  -2.656  12.995 1.00 20.32 ? 105 VAL A CG1 1 
ATOM   796  C CG2 . VAL A 1 105 ? 11.388  -3.331  10.688 1.00 21.81 ? 105 VAL A CG2 1 
ATOM   797  N N   . HIS A 1 106 ? 10.761  -4.883  14.388 1.00 21.11 ? 106 HIS A N   1 
ATOM   798  C CA  . HIS A 1 106 ? 11.344  -6.081  14.976 1.00 21.79 ? 106 HIS A CA  1 
ATOM   799  C C   . HIS A 1 106 ? 10.387  -7.249  15.185 1.00 21.07 ? 106 HIS A C   1 
ATOM   800  O O   . HIS A 1 106 ? 10.823  -8.379  15.410 1.00 21.31 ? 106 HIS A O   1 
ATOM   801  C CB  . HIS A 1 106 ? 12.035  -5.707  16.288 1.00 22.98 ? 106 HIS A CB  1 
ATOM   802  C CG  . HIS A 1 106 ? 13.166  -4.743  16.100 1.00 25.78 ? 106 HIS A CG  1 
ATOM   803  N ND1 . HIS A 1 106 ? 13.379  -3.669  16.937 1.00 27.00 ? 106 HIS A ND1 1 
ATOM   804  C CD2 . HIS A 1 106 ? 14.139  -4.686  15.161 1.00 26.02 ? 106 HIS A CD2 1 
ATOM   805  C CE1 . HIS A 1 106 ? 14.433  -2.990  16.519 1.00 27.08 ? 106 HIS A CE1 1 
ATOM   806  N NE2 . HIS A 1 106 ? 14.914  -3.586  15.442 1.00 26.86 ? 106 HIS A NE2 1 
ATOM   807  N N   . THR A 1 107 ? 9.089   -6.990  15.112 1.00 20.28 ? 107 THR A N   1 
ATOM   808  C CA  . THR A 1 107 ? 8.105   -8.058  15.271 1.00 20.96 ? 107 THR A CA  1 
ATOM   809  C C   . THR A 1 107 ? 7.363   -8.186  13.936 1.00 21.90 ? 107 THR A C   1 
ATOM   810  O O   . THR A 1 107 ? 6.288   -8.774  13.851 1.00 22.65 ? 107 THR A O   1 
ATOM   811  C CB  . THR A 1 107 ? 7.102   -7.751  16.429 1.00 20.59 ? 107 THR A CB  1 
ATOM   812  O OG1 . THR A 1 107 ? 6.422   -6.515  16.175 1.00 20.74 ? 107 THR A OG1 1 
ATOM   813  C CG2 . THR A 1 107 ? 7.836   -7.650  17.770 1.00 18.64 ? 107 THR A CG2 1 
ATOM   814  N N   . GLU A 1 108 ? 7.979   -7.633  12.896 1.00 22.49 ? 108 GLU A N   1 
ATOM   815  C CA  . GLU A 1 108 ? 7.426   -7.632  11.545 1.00 25.33 ? 108 GLU A CA  1 
ATOM   816  C C   . GLU A 1 108 ? 6.068   -6.938  11.539 1.00 24.85 ? 108 GLU A C   1 
ATOM   817  O O   . GLU A 1 108 ? 5.096   -7.427  10.960 1.00 24.51 ? 108 GLU A O   1 
ATOM   818  C CB  . GLU A 1 108 ? 7.321   -9.066  10.995 1.00 27.82 ? 108 GLU A CB  1 
ATOM   819  C CG  . GLU A 1 108 ? 8.643   -9.821  11.056 1.00 29.55 ? 108 GLU A CG  1 
ATOM   820  C CD  . GLU A 1 108 ? 8.777   -10.901 9.992  1.00 32.08 ? 108 GLU A CD  1 
ATOM   821  O OE1 . GLU A 1 108 ? 7.818   -11.682 9.803  1.00 33.82 ? 108 GLU A OE1 1 
ATOM   822  O OE2 . GLU A 1 108 ? 9.854   -10.968 9.358  1.00 32.75 ? 108 GLU A OE2 1 
ATOM   823  N N   . TYR A 1 109 ? 6.022   -5.792  12.213 1.00 24.02 ? 109 TYR A N   1 
ATOM   824  C CA  . TYR A 1 109 ? 4.819   -4.981  12.304 1.00 22.71 ? 109 TYR A CA  1 
ATOM   825  C C   . TYR A 1 109 ? 3.652   -5.671  13.001 1.00 22.64 ? 109 TYR A C   1 
ATOM   826  O O   . TYR A 1 109 ? 2.489   -5.336  12.758 1.00 23.76 ? 109 TYR A O   1 
ATOM   827  C CB  . TYR A 1 109 ? 4.405   -4.523  10.902 1.00 20.52 ? 109 TYR A CB  1 
ATOM   828  C CG  . TYR A 1 109 ? 5.530   -3.870  10.136 1.00 19.34 ? 109 TYR A CG  1 
ATOM   829  C CD1 . TYR A 1 109 ? 6.352   -2.920  10.743 1.00 19.28 ? 109 TYR A CD1 1 
ATOM   830  C CD2 . TYR A 1 109 ? 5.761   -4.184  8.799  1.00 20.06 ? 109 TYR A CD2 1 
ATOM   831  C CE1 . TYR A 1 109 ? 7.382   -2.297  10.039 1.00 20.16 ? 109 TYR A CE1 1 
ATOM   832  C CE2 . TYR A 1 109 ? 6.790   -3.567  8.081  1.00 21.50 ? 109 TYR A CE2 1 
ATOM   833  C CZ  . TYR A 1 109 ? 7.593   -2.624  8.709  1.00 21.34 ? 109 TYR A CZ  1 
ATOM   834  O OH  . TYR A 1 109 ? 8.603   -1.999  8.011  1.00 21.61 ? 109 TYR A OH  1 
ATOM   835  N N   . ARG A 1 110 ? 3.960   -6.623  13.875 1.00 22.93 ? 110 ARG A N   1 
ATOM   836  C CA  . ARG A 1 110 ? 2.926   -7.344  14.609 1.00 24.83 ? 110 ARG A CA  1 
ATOM   837  C C   . ARG A 1 110 ? 2.534   -6.636  15.911 1.00 23.28 ? 110 ARG A C   1 
ATOM   838  O O   . ARG A 1 110 ? 1.402   -6.765  16.377 1.00 22.03 ? 110 ARG A O   1 
ATOM   839  C CB  . ARG A 1 110 ? 3.405   -8.764  14.930 1.00 28.07 ? 110 ARG A CB  1 
ATOM   840  C CG  . ARG A 1 110 ? 2.341   -9.649  15.551 1.00 35.14 ? 110 ARG A CG  1 
ATOM   841  C CD  . ARG A 1 110 ? 1.164   -9.863  14.594 1.00 42.49 ? 110 ARG A CD  1 
ATOM   842  N NE  . ARG A 1 110 ? 1.560   -10.507 13.340 1.00 47.18 ? 110 ARG A NE  1 
ATOM   843  C CZ  . ARG A 1 110 ? 0.719   -10.810 12.353 1.00 48.60 ? 110 ARG A CZ  1 
ATOM   844  N NH1 . ARG A 1 110 ? -0.573  -10.530 12.466 1.00 49.23 ? 110 ARG A NH1 1 
ATOM   845  N NH2 . ARG A 1 110 ? 1.169   -11.397 11.251 1.00 49.48 ? 110 ARG A NH2 1 
ATOM   846  N N   . THR A 1 111 ? 3.462   -5.882  16.496 1.00 21.36 ? 111 THR A N   1 
ATOM   847  C CA  . THR A 1 111 ? 3.179   -5.186  17.753 1.00 19.80 ? 111 THR A CA  1 
ATOM   848  C C   . THR A 1 111 ? 3.437   -3.686  17.669 1.00 19.39 ? 111 THR A C   1 
ATOM   849  O O   . THR A 1 111 ? 3.954   -3.191  16.665 1.00 18.99 ? 111 THR A O   1 
ATOM   850  C CB  . THR A 1 111 ? 4.031   -5.768  18.898 1.00 18.00 ? 111 THR A CB  1 
ATOM   851  O OG1 . THR A 1 111 ? 5.416   -5.698  18.536 1.00 17.01 ? 111 THR A OG1 1 
ATOM   852  C CG2 . THR A 1 111 ? 3.660   -7.211  19.143 1.00 17.24 ? 111 THR A CG2 1 
ATOM   853  N N   . TRP A 1 112 ? 3.073   -2.964  18.726 1.00 19.10 ? 112 TRP A N   1 
ATOM   854  C CA  . TRP A 1 112 ? 3.269   -1.517  18.743 1.00 18.10 ? 112 TRP A CA  1 
ATOM   855  C C   . TRP A 1 112 ? 4.414   -1.114  19.672 1.00 17.99 ? 112 TRP A C   1 
ATOM   856  O O   . TRP A 1 112 ? 4.620   -1.730  20.716 1.00 17.73 ? 112 TRP A O   1 
ATOM   857  C CB  . TRP A 1 112 ? 1.979   -0.814  19.171 1.00 16.57 ? 112 TRP A CB  1 
ATOM   858  C CG  . TRP A 1 112 ? 0.772   -1.214  18.357 1.00 16.47 ? 112 TRP A CG  1 
ATOM   859  C CD1 . TRP A 1 112 ? 0.770   -1.800  17.118 1.00 15.57 ? 112 TRP A CD1 1 
ATOM   860  C CD2 . TRP A 1 112 ? -0.605  -1.010  18.705 1.00 16.24 ? 112 TRP A CD2 1 
ATOM   861  N NE1 . TRP A 1 112 ? -0.525  -1.972  16.678 1.00 17.18 ? 112 TRP A NE1 1 
ATOM   862  C CE2 . TRP A 1 112 ? -1.387  -1.498  17.632 1.00 15.31 ? 112 TRP A CE2 1 
ATOM   863  C CE3 . TRP A 1 112 ? -1.254  -0.462  19.820 1.00 17.39 ? 112 TRP A CE3 1 
ATOM   864  C CZ2 . TRP A 1 112 ? -2.787  -1.455  17.641 1.00 15.74 ? 112 TRP A CZ2 1 
ATOM   865  C CZ3 . TRP A 1 112 ? -2.653  -0.416  19.830 1.00 16.10 ? 112 TRP A CZ3 1 
ATOM   866  C CH2 . TRP A 1 112 ? -3.400  -0.912  18.746 1.00 16.41 ? 112 TRP A CH2 1 
ATOM   867  N N   . THR A 1 113 ? 5.153   -0.075  19.291 1.00 17.89 ? 113 THR A N   1 
ATOM   868  C CA  . THR A 1 113 ? 6.283   0.393   20.089 1.00 17.75 ? 113 THR A CA  1 
ATOM   869  C C   . THR A 1 113 ? 6.299   1.922   20.199 1.00 16.37 ? 113 THR A C   1 
ATOM   870  O O   . THR A 1 113 ? 5.849   2.618   19.288 1.00 15.47 ? 113 THR A O   1 
ATOM   871  C CB  . THR A 1 113 ? 7.623   -0.104  19.469 1.00 18.49 ? 113 THR A CB  1 
ATOM   872  O OG1 . THR A 1 113 ? 8.712   0.194   20.355 1.00 19.52 ? 113 THR A OG1 1 
ATOM   873  C CG2 . THR A 1 113 ? 7.868   0.551   18.123 1.00 17.99 ? 113 THR A CG2 1 
ATOM   874  N N   . ASP A 1 114 ? 6.803   2.434   21.321 1.00 15.49 ? 114 ASP A N   1 
ATOM   875  C CA  . ASP A 1 114 ? 6.886   3.877   21.546 1.00 16.46 ? 114 ASP A CA  1 
ATOM   876  C C   . ASP A 1 114 ? 8.153   4.416   20.897 1.00 17.83 ? 114 ASP A C   1 
ATOM   877  O O   . ASP A 1 114 ? 9.232   3.860   21.078 1.00 18.52 ? 114 ASP A O   1 
ATOM   878  C CB  . ASP A 1 114 ? 6.895   4.192   23.045 1.00 15.55 ? 114 ASP A CB  1 
ATOM   879  C CG  . ASP A 1 114 ? 8.017   3.494   23.778 1.00 16.11 ? 114 ASP A CG  1 
ATOM   880  O OD1 . ASP A 1 114 ? 8.839   4.194   24.413 1.00 17.17 ? 114 ASP A OD1 1 
ATOM   881  O OD2 . ASP A 1 114 ? 8.080   2.251   23.715 1.00 15.24 ? 114 ASP A OD2 1 
ATOM   882  N N   . LEU A 1 115 ? 8.016   5.512   20.157 1.00 17.68 ? 115 LEU A N   1 
ATOM   883  C CA  . LEU A 1 115 ? 9.137   6.111   19.436 1.00 17.66 ? 115 LEU A CA  1 
ATOM   884  C C   . LEU A 1 115 ? 9.180   7.630   19.548 1.00 17.88 ? 115 LEU A C   1 
ATOM   885  O O   . LEU A 1 115 ? 8.198   8.262   19.929 1.00 17.01 ? 115 LEU A O   1 
ATOM   886  C CB  . LEU A 1 115 ? 9.031   5.749   17.951 1.00 16.11 ? 115 LEU A CB  1 
ATOM   887  C CG  . LEU A 1 115 ? 8.991   4.265   17.583 1.00 15.26 ? 115 LEU A CG  1 
ATOM   888  C CD1 . LEU A 1 115 ? 8.426   4.086   16.176 1.00 16.12 ? 115 LEU A CD1 1 
ATOM   889  C CD2 . LEU A 1 115 ? 10.397  3.702   17.687 1.00 15.00 ? 115 LEU A CD2 1 
ATOM   890  N N   . PRO A 1 116 ? 10.331  8.237   19.208 1.00 19.21 ? 116 PRO A N   1 
ATOM   891  C CA  . PRO A 1 116 ? 10.459  9.697   19.270 1.00 19.61 ? 116 PRO A CA  1 
ATOM   892  C C   . PRO A 1 116 ? 9.535   10.258  18.193 1.00 19.09 ? 116 PRO A C   1 
ATOM   893  O O   . PRO A 1 116 ? 9.644   9.880   17.031 1.00 18.23 ? 116 PRO A O   1 
ATOM   894  C CB  . PRO A 1 116 ? 11.933  9.936   18.932 1.00 19.84 ? 116 PRO A CB  1 
ATOM   895  C CG  . PRO A 1 116 ? 12.601  8.658   19.365 1.00 19.83 ? 116 PRO A CG  1 
ATOM   896  C CD  . PRO A 1 116 ? 11.625  7.613   18.887 1.00 19.45 ? 116 PRO A CD  1 
ATOM   897  N N   . CYS A 1 117 ? 8.629   11.148  18.575 1.00 19.90 ? 117 CYS A N   1 
ATOM   898  C CA  . CYS A 1 117 ? 7.688   11.727  17.626 1.00 19.34 ? 117 CYS A CA  1 
ATOM   899  C C   . CYS A 1 117 ? 8.368   12.465  16.474 1.00 21.30 ? 117 CYS A C   1 
ATOM   900  O O   . CYS A 1 117 ? 7.779   12.629  15.407 1.00 20.59 ? 117 CYS A O   1 
ATOM   901  C CB  . CYS A 1 117 ? 6.752   12.693  18.341 1.00 17.51 ? 117 CYS A CB  1 
ATOM   902  S SG  . CYS A 1 117 ? 5.616   11.953  19.557 1.00 16.62 ? 117 CYS A SG  1 
ATOM   903  N N   . GLY A 1 118 ? 9.604   12.907  16.689 1.00 23.65 ? 118 GLY A N   1 
ATOM   904  C CA  . GLY A 1 118 ? 10.323  13.633  15.655 1.00 26.18 ? 118 GLY A CA  1 
ATOM   905  C C   . GLY A 1 118 ? 11.087  12.773  14.662 1.00 27.70 ? 118 GLY A C   1 
ATOM   906  O O   . GLY A 1 118 ? 11.740  13.295  13.754 1.00 28.25 ? 118 GLY A O   1 
ATOM   907  N N   . GLU A 1 119 ? 11.008  11.457  14.832 1.00 28.73 ? 119 GLU A N   1 
ATOM   908  C CA  . GLU A 1 119 ? 11.684  10.509  13.947 1.00 30.89 ? 119 GLU A CA  1 
ATOM   909  C C   . GLU A 1 119 ? 10.933  10.421  12.616 1.00 30.38 ? 119 GLU A C   1 
ATOM   910  O O   . GLU A 1 119 ? 9.705   10.482  12.591 1.00 30.33 ? 119 GLU A O   1 
ATOM   911  C CB  . GLU A 1 119 ? 11.711  9.132   14.616 1.00 34.02 ? 119 GLU A CB  1 
ATOM   912  C CG  . GLU A 1 119 ? 12.611  8.100   13.964 1.00 37.43 ? 119 GLU A CG  1 
ATOM   913  C CD  . GLU A 1 119 ? 12.540  6.749   14.664 1.00 40.13 ? 119 GLU A CD  1 
ATOM   914  O OE1 . GLU A 1 119 ? 11.575  5.993   14.419 1.00 40.23 ? 119 GLU A OE1 1 
ATOM   915  O OE2 . GLU A 1 119 ? 13.448  6.446   15.468 1.00 41.40 ? 119 GLU A OE2 1 
ATOM   916  N N   . LYS A 1 120 ? 11.660  10.272  11.513 1.00 29.28 ? 120 LYS A N   1 
ATOM   917  C CA  . LYS A 1 120 ? 11.013  10.176  10.204 1.00 28.67 ? 120 LYS A CA  1 
ATOM   918  C C   . LYS A 1 120 ? 10.789  8.721   9.786  1.00 27.62 ? 120 LYS A C   1 
ATOM   919  O O   . LYS A 1 120 ? 11.739  7.961   9.595  1.00 28.00 ? 120 LYS A O   1 
ATOM   920  C CB  . LYS A 1 120 ? 11.841  10.908  9.142  1.00 29.39 ? 120 LYS A CB  1 
ATOM   921  C CG  . LYS A 1 120 ? 11.901  12.416  9.352  1.00 30.77 ? 120 LYS A CG  1 
ATOM   922  C CD  . LYS A 1 120 ? 12.670  13.119  8.245  1.00 31.11 ? 120 LYS A CD  1 
ATOM   923  C CE  . LYS A 1 120 ? 12.905  14.581  8.595  1.00 31.90 ? 120 LYS A CE  1 
ATOM   924  N NZ  . LYS A 1 120 ? 11.638  15.303  8.914  1.00 31.74 ? 120 LYS A NZ  1 
ATOM   925  N N   . ASN A 1 121 ? 9.522   8.343   9.645  1.00 25.06 ? 121 ASN A N   1 
ATOM   926  C CA  . ASN A 1 121 ? 9.166   6.979   9.268  1.00 22.83 ? 121 ASN A CA  1 
ATOM   927  C C   . ASN A 1 121 ? 8.029   6.961   8.269  1.00 21.85 ? 121 ASN A C   1 
ATOM   928  O O   . ASN A 1 121 ? 7.311   7.949   8.112  1.00 21.98 ? 121 ASN A O   1 
ATOM   929  C CB  . ASN A 1 121 ? 8.683   6.187   10.489 1.00 21.96 ? 121 ASN A CB  1 
ATOM   930  C CG  . ASN A 1 121 ? 9.764   5.957   11.513 1.00 21.35 ? 121 ASN A CG  1 
ATOM   931  O OD1 . ASN A 1 121 ? 10.825  5.423   11.198 1.00 23.41 ? 121 ASN A OD1 1 
ATOM   932  N ND2 . ASN A 1 121 ? 9.494   6.345   12.758 1.00 19.46 ? 121 ASN A ND2 1 
ATOM   933  N N   . PRO A 1 122 ? 7.860   5.835   7.562  1.00 20.82 ? 122 PRO A N   1 
ATOM   934  C CA  . PRO A 1 122 ? 6.749   5.792   6.615  1.00 20.22 ? 122 PRO A CA  1 
ATOM   935  C C   . PRO A 1 122 ? 5.510   5.733   7.511  1.00 19.48 ? 122 PRO A C   1 
ATOM   936  O O   . PRO A 1 122 ? 5.631   5.579   8.736  1.00 17.66 ? 122 PRO A O   1 
ATOM   937  C CB  . PRO A 1 122 ? 6.999   4.493   5.841  1.00 20.69 ? 122 PRO A CB  1 
ATOM   938  C CG  . PRO A 1 122 ? 7.744   3.643   6.810  1.00 20.11 ? 122 PRO A CG  1 
ATOM   939  C CD  . PRO A 1 122 ? 8.697   4.630   7.448  1.00 20.42 ? 122 PRO A CD  1 
ATOM   940  N N   . PHE A 1 123 ? 4.326   5.851   6.930  1.00 20.13 ? 123 PHE A N   1 
ATOM   941  C CA  . PHE A 1 123 ? 3.120   5.837   7.744  1.00 19.88 ? 123 PHE A CA  1 
ATOM   942  C C   . PHE A 1 123 ? 1.913   5.268   7.025  1.00 19.56 ? 123 PHE A C   1 
ATOM   943  O O   . PHE A 1 123 ? 1.945   5.020   5.819  1.00 19.48 ? 123 PHE A O   1 
ATOM   944  C CB  . PHE A 1 123 ? 2.803   7.247   8.244  1.00 19.75 ? 123 PHE A CB  1 
ATOM   945  C CG  . PHE A 1 123 ? 2.708   8.269   7.153  1.00 20.40 ? 123 PHE A CG  1 
ATOM   946  C CD1 . PHE A 1 123 ? 3.856   8.813   6.588  1.00 18.74 ? 123 PHE A CD1 1 
ATOM   947  C CD2 . PHE A 1 123 ? 1.467   8.686   6.686  1.00 19.82 ? 123 PHE A CD2 1 
ATOM   948  C CE1 . PHE A 1 123 ? 3.769   9.764   5.573  1.00 19.52 ? 123 PHE A CE1 1 
ATOM   949  C CE2 . PHE A 1 123 ? 1.369   9.638   5.671  1.00 19.87 ? 123 PHE A CE2 1 
ATOM   950  C CZ  . PHE A 1 123 ? 2.527   10.177  5.112  1.00 19.79 ? 123 PHE A CZ  1 
ATOM   951  N N   . ILE A 1 124 ? 0.846   5.069   7.783  1.00 19.40 ? 124 ILE A N   1 
ATOM   952  C CA  . ILE A 1 124 ? -0.367  4.492   7.241  1.00 20.81 ? 124 ILE A CA  1 
ATOM   953  C C   . ILE A 1 124 ? -1.596  5.331   7.543  1.00 20.43 ? 124 ILE A C   1 
ATOM   954  O O   . ILE A 1 124 ? -1.896  5.622   8.703  1.00 20.28 ? 124 ILE A O   1 
ATOM   955  C CB  . ILE A 1 124 ? -0.582  3.076   7.807  1.00 22.12 ? 124 ILE A CB  1 
ATOM   956  C CG1 . ILE A 1 124 ? -1.934  2.531   7.348  1.00 22.73 ? 124 ILE A CG1 1 
ATOM   957  C CG2 . ILE A 1 124 ? -0.507  3.112   9.327  1.00 25.18 ? 124 ILE A CG2 1 
ATOM   958  C CD1 . ILE A 1 124 ? -2.304  1.219   7.983  1.00 25.32 ? 124 ILE A CD1 1 
ATOM   959  N N   . CYS A 1 125 ? -2.300  5.710   6.479  1.00 20.52 ? 125 CYS A N   1 
ATOM   960  C CA  . CYS A 1 125 ? -3.517  6.500   6.591  1.00 20.39 ? 125 CYS A CA  1 
ATOM   961  C C   . CYS A 1 125 ? -4.754  5.606   6.501  1.00 20.73 ? 125 CYS A C   1 
ATOM   962  O O   . CYS A 1 125 ? -4.719  4.513   5.924  1.00 20.68 ? 125 CYS A O   1 
ATOM   963  C CB  . CYS A 1 125 ? -3.577  7.551   5.482  1.00 18.35 ? 125 CYS A CB  1 
ATOM   964  S SG  . CYS A 1 125 ? -2.248  8.791   5.518  1.00 18.77 ? 125 CYS A SG  1 
ATOM   965  N N   . LYS A 1 126 ? -5.839  6.085   7.091  1.00 21.01 ? 126 LYS A N   1 
ATOM   966  C CA  . LYS A 1 126 ? -7.109  5.379   7.095  1.00 22.40 ? 126 LYS A CA  1 
ATOM   967  C C   . LYS A 1 126 ? -8.218  6.421   6.947  1.00 24.73 ? 126 LYS A C   1 
ATOM   968  O O   . LYS A 1 126 ? -8.213  7.447   7.635  1.00 25.00 ? 126 LYS A O   1 
ATOM   969  C CB  . LYS A 1 126 ? -7.264  4.613   8.409  1.00 21.61 ? 126 LYS A CB  1 
ATOM   970  C CG  . LYS A 1 126 ? -8.637  4.024   8.662  1.00 19.44 ? 126 LYS A CG  1 
ATOM   971  C CD  . LYS A 1 126 ? -8.648  3.334   10.015 1.00 19.19 ? 126 LYS A CD  1 
ATOM   972  C CE  . LYS A 1 126 ? -10.036 2.858   10.401 1.00 20.47 ? 126 LYS A CE  1 
ATOM   973  N NZ  . LYS A 1 126 ? -10.041 2.289   11.782 1.00 23.01 ? 126 LYS A NZ  1 
ATOM   974  N N   . SER A 1 127 ? -9.152  6.173   6.034  1.00 26.79 ? 127 SER A N   1 
ATOM   975  C CA  . SER A 1 127 ? -10.259 7.097   5.822  1.00 28.98 ? 127 SER A CA  1 
ATOM   976  C C   . SER A 1 127 ? -11.527 6.319   5.482  1.00 31.02 ? 127 SER A C   1 
ATOM   977  O O   . SER A 1 127 ? -11.393 5.148   5.062  1.00 32.99 ? 127 SER A O   1 
ATOM   978  C CB  . SER A 1 127 ? -9.925  8.082   4.698  1.00 27.44 ? 127 SER A CB  1 
ATOM   979  O OG  . SER A 1 127 ? -9.819  7.428   3.446  1.00 27.55 ? 127 SER A OG  1 
ATOM   980  N N   . GLY B 2 3   ? 22.010  15.630  59.747 1.00 32.42 ? 3   GLY B N   1 
ATOM   981  C CA  . GLY B 2 3   ? 21.201  14.847  60.731 1.00 30.10 ? 3   GLY B CA  1 
ATOM   982  C C   . GLY B 2 3   ? 20.818  13.482  60.195 1.00 28.60 ? 3   GLY B C   1 
ATOM   983  O O   . GLY B 2 3   ? 19.857  12.870  60.661 1.00 29.22 ? 3   GLY B O   1 
ATOM   984  N N   . CYS B 2 4   ? 21.575  13.010  59.210 1.00 26.87 ? 4   CYS B N   1 
ATOM   985  C CA  . CYS B 2 4   ? 21.328  11.714  58.587 1.00 25.14 ? 4   CYS B CA  1 
ATOM   986  C C   . CYS B 2 4   ? 21.991  10.589  59.380 1.00 25.51 ? 4   CYS B C   1 
ATOM   987  O O   . CYS B 2 4   ? 22.779  10.842  60.296 1.00 26.72 ? 4   CYS B O   1 
ATOM   988  C CB  . CYS B 2 4   ? 21.889  11.709  57.167 1.00 24.25 ? 4   CYS B CB  1 
ATOM   989  S SG  . CYS B 2 4   ? 21.223  12.992  56.054 1.00 21.97 ? 4   CYS B SG  1 
ATOM   990  N N   . LEU B 2 5   ? 21.665  9.350   59.027 1.00 24.94 ? 5   LEU B N   1 
ATOM   991  C CA  . LEU B 2 5   ? 22.260  8.190   59.675 1.00 24.49 ? 5   LEU B CA  1 
ATOM   992  C C   . LEU B 2 5   ? 23.673  8.066   59.094 1.00 25.55 ? 5   LEU B C   1 
ATOM   993  O O   . LEU B 2 5   ? 23.947  8.578   58.005 1.00 25.09 ? 5   LEU B O   1 
ATOM   994  C CB  . LEU B 2 5   ? 21.466  6.926   59.351 1.00 23.25 ? 5   LEU B CB  1 
ATOM   995  C CG  . LEU B 2 5   ? 20.029  6.795   59.860 1.00 24.13 ? 5   LEU B CG  1 
ATOM   996  C CD1 . LEU B 2 5   ? 19.407  5.522   59.303 1.00 23.90 ? 5   LEU B CD1 1 
ATOM   997  C CD2 . LEU B 2 5   ? 20.015  6.766   61.374 1.00 22.85 ? 5   LEU B CD2 1 
ATOM   998  N N   . PRO B 2 6   ? 24.579  7.371   59.806 1.00 26.15 ? 6   PRO B N   1 
ATOM   999  C CA  . PRO B 2 6   ? 25.970  7.168   59.386 1.00 27.04 ? 6   PRO B CA  1 
ATOM   1000 C C   . PRO B 2 6   ? 26.124  6.632   57.960 1.00 28.19 ? 6   PRO B C   1 
ATOM   1001 O O   . PRO B 2 6   ? 25.411  5.719   57.539 1.00 28.13 ? 6   PRO B O   1 
ATOM   1002 C CB  . PRO B 2 6   ? 26.506  6.192   60.435 1.00 27.13 ? 6   PRO B CB  1 
ATOM   1003 C CG  . PRO B 2 6   ? 25.715  6.560   61.661 1.00 25.98 ? 6   PRO B CG  1 
ATOM   1004 C CD  . PRO B 2 6   ? 24.323  6.691   61.090 1.00 26.19 ? 6   PRO B CD  1 
ATOM   1005 N N   . ASP B 2 7   ? 27.069  7.216   57.233 1.00 28.74 ? 7   ASP B N   1 
ATOM   1006 C CA  . ASP B 2 7   ? 27.367  6.847   55.852 1.00 29.29 ? 7   ASP B CA  1 
ATOM   1007 C C   . ASP B 2 7   ? 26.313  7.254   54.829 1.00 28.19 ? 7   ASP B C   1 
ATOM   1008 O O   . ASP B 2 7   ? 26.328  6.799   53.689 1.00 28.55 ? 7   ASP B O   1 
ATOM   1009 C CB  . ASP B 2 7   ? 27.672  5.352   55.746 1.00 31.23 ? 7   ASP B CB  1 
ATOM   1010 C CG  . ASP B 2 7   ? 28.959  4.976   56.457 1.00 34.16 ? 7   ASP B CG  1 
ATOM   1011 O OD1 . ASP B 2 7   ? 29.942  5.750   56.357 1.00 34.42 ? 7   ASP B OD1 1 
ATOM   1012 O OD2 . ASP B 2 7   ? 28.990  3.911   57.108 1.00 35.70 ? 7   ASP B OD2 1 
ATOM   1013 N N   . TRP B 2 8   ? 25.381  8.102   55.245 1.00 27.03 ? 8   TRP B N   1 
ATOM   1014 C CA  . TRP B 2 8   ? 24.383  8.624   54.321 1.00 25.05 ? 8   TRP B CA  1 
ATOM   1015 C C   . TRP B 2 8   ? 24.873  10.046  54.049 1.00 24.73 ? 8   TRP B C   1 
ATOM   1016 O O   . TRP B 2 8   ? 25.402  10.707  54.944 1.00 23.79 ? 8   TRP B O   1 
ATOM   1017 C CB  . TRP B 2 8   ? 22.981  8.668   54.949 1.00 23.92 ? 8   TRP B CB  1 
ATOM   1018 C CG  . TRP B 2 8   ? 22.275  7.335   55.026 1.00 22.44 ? 8   TRP B CG  1 
ATOM   1019 C CD1 . TRP B 2 8   ? 22.583  6.286   55.849 1.00 20.20 ? 8   TRP B CD1 1 
ATOM   1020 C CD2 . TRP B 2 8   ? 21.131  6.924   54.265 1.00 22.58 ? 8   TRP B CD2 1 
ATOM   1021 N NE1 . TRP B 2 8   ? 21.700  5.252   55.649 1.00 19.67 ? 8   TRP B NE1 1 
ATOM   1022 C CE2 . TRP B 2 8   ? 20.799  5.616   54.683 1.00 21.62 ? 8   TRP B CE2 1 
ATOM   1023 C CE3 . TRP B 2 8   ? 20.354  7.535   53.267 1.00 21.94 ? 8   TRP B CE3 1 
ATOM   1024 C CZ2 . TRP B 2 8   ? 19.720  4.906   54.142 1.00 21.04 ? 8   TRP B CZ2 1 
ATOM   1025 C CZ3 . TRP B 2 8   ? 19.283  6.831   52.728 1.00 21.96 ? 8   TRP B CZ3 1 
ATOM   1026 C CH2 . TRP B 2 8   ? 18.975  5.528   53.168 1.00 21.52 ? 8   TRP B CH2 1 
ATOM   1027 N N   . SER B 2 9   ? 24.722  10.507  52.817 1.00 24.75 ? 9   SER B N   1 
ATOM   1028 C CA  . SER B 2 9   ? 25.149  11.851  52.455 1.00 24.28 ? 9   SER B CA  1 
ATOM   1029 C C   . SER B 2 9   ? 23.974  12.818  52.577 1.00 24.20 ? 9   SER B C   1 
ATOM   1030 O O   . SER B 2 9   ? 22.836  12.470  52.256 1.00 24.25 ? 9   SER B O   1 
ATOM   1031 C CB  . SER B 2 9   ? 25.685  11.851  51.023 1.00 25.62 ? 9   SER B CB  1 
ATOM   1032 O OG  . SER B 2 9   ? 25.806  13.174  50.529 1.00 31.48 ? 9   SER B OG  1 
ATOM   1033 N N   . SER B 2 10  ? 24.234  14.030  53.049 1.00 23.92 ? 10  SER B N   1 
ATOM   1034 C CA  . SER B 2 10  ? 23.155  14.997  53.189 1.00 24.93 ? 10  SER B CA  1 
ATOM   1035 C C   . SER B 2 10  ? 23.201  16.068  52.106 1.00 23.85 ? 10  SER B C   1 
ATOM   1036 O O   . SER B 2 10  ? 24.274  16.453  51.633 1.00 24.04 ? 10  SER B O   1 
ATOM   1037 C CB  . SER B 2 10  ? 23.208  15.668  54.566 1.00 26.20 ? 10  SER B CB  1 
ATOM   1038 O OG  . SER B 2 10  ? 24.382  16.450  54.694 1.00 27.85 ? 10  SER B OG  1 
ATOM   1039 N N   . TYR B 2 11  ? 22.022  16.538  51.711 1.00 22.66 ? 11  TYR B N   1 
ATOM   1040 C CA  . TYR B 2 11  ? 21.908  17.588  50.710 1.00 22.35 ? 11  TYR B CA  1 
ATOM   1041 C C   . TYR B 2 11  ? 20.527  18.234  50.791 1.00 23.46 ? 11  TYR B C   1 
ATOM   1042 O O   . TYR B 2 11  ? 19.506  17.567  50.617 1.00 22.80 ? 11  TYR B O   1 
ATOM   1043 C CB  . TYR B 2 11  ? 22.145  17.035  49.298 1.00 20.59 ? 11  TYR B CB  1 
ATOM   1044 C CG  . TYR B 2 11  ? 22.181  18.112  48.239 1.00 18.72 ? 11  TYR B CG  1 
ATOM   1045 C CD1 . TYR B 2 11  ? 21.137  18.258  47.329 1.00 19.89 ? 11  TYR B CD1 1 
ATOM   1046 C CD2 . TYR B 2 11  ? 23.258  18.994  48.153 1.00 19.87 ? 11  TYR B CD2 1 
ATOM   1047 C CE1 . TYR B 2 11  ? 21.163  19.257  46.359 1.00 21.79 ? 11  TYR B CE1 1 
ATOM   1048 C CE2 . TYR B 2 11  ? 23.296  19.994  47.192 1.00 21.23 ? 11  TYR B CE2 1 
ATOM   1049 C CZ  . TYR B 2 11  ? 22.248  20.119  46.296 1.00 21.40 ? 11  TYR B CZ  1 
ATOM   1050 O OH  . TYR B 2 11  ? 22.287  21.097  45.333 1.00 22.40 ? 11  TYR B OH  1 
ATOM   1051 N N   . LYS B 2 12  ? 20.509  19.532  51.080 1.00 23.35 ? 12  LYS B N   1 
ATOM   1052 C CA  . LYS B 2 12  ? 19.270  20.293  51.182 1.00 22.86 ? 12  LYS B CA  1 
ATOM   1053 C C   . LYS B 2 12  ? 18.126  19.607  51.938 1.00 21.13 ? 12  LYS B C   1 
ATOM   1054 O O   . LYS B 2 12  ? 17.033  19.446  51.402 1.00 22.38 ? 12  LYS B O   1 
ATOM   1055 C CB  . LYS B 2 12  ? 18.793  20.693  49.782 1.00 22.88 ? 12  LYS B CB  1 
ATOM   1056 C CG  . LYS B 2 12  ? 19.686  21.726  49.107 1.00 24.96 ? 12  LYS B CG  1 
ATOM   1057 C CD  . LYS B 2 12  ? 19.130  22.175  47.765 1.00 27.67 ? 12  LYS B CD  1 
ATOM   1058 C CE  . LYS B 2 12  ? 20.046  23.205  47.130 1.00 28.23 ? 12  LYS B CE  1 
ATOM   1059 N NZ  . LYS B 2 12  ? 19.542  23.644  45.810 1.00 31.80 ? 12  LYS B NZ  1 
ATOM   1060 N N   . GLY B 2 13  ? 18.378  19.211  53.182 1.00 19.07 ? 13  GLY B N   1 
ATOM   1061 C CA  . GLY B 2 13  ? 17.340  18.583  53.982 1.00 19.12 ? 13  GLY B CA  1 
ATOM   1062 C C   . GLY B 2 13  ? 16.972  17.130  53.696 1.00 19.81 ? 13  GLY B C   1 
ATOM   1063 O O   . GLY B 2 13  ? 16.024  16.601  54.276 1.00 22.63 ? 13  GLY B O   1 
ATOM   1064 N N   . HIS B 2 14  ? 17.696  16.474  52.806 1.00 17.89 ? 14  HIS B N   1 
ATOM   1065 C CA  . HIS B 2 14  ? 17.394  15.080  52.496 1.00 16.40 ? 14  HIS B CA  1 
ATOM   1066 C C   . HIS B 2 14  ? 18.653  14.237  52.695 1.00 17.09 ? 14  HIS B C   1 
ATOM   1067 O O   . HIS B 2 14  ? 19.760  14.777  52.752 1.00 17.03 ? 14  HIS B O   1 
ATOM   1068 C CB  . HIS B 2 14  ? 16.887  14.970  51.055 1.00 15.82 ? 14  HIS B CB  1 
ATOM   1069 C CG  . HIS B 2 14  ? 15.495  15.494  50.864 1.00 15.91 ? 14  HIS B CG  1 
ATOM   1070 N ND1 . HIS B 2 14  ? 14.385  14.674  50.860 1.00 15.94 ? 14  HIS B ND1 1 
ATOM   1071 C CD2 . HIS B 2 14  ? 15.028  16.755  50.707 1.00 15.87 ? 14  HIS B CD2 1 
ATOM   1072 C CE1 . HIS B 2 14  ? 13.296  15.404  50.709 1.00 14.89 ? 14  HIS B CE1 1 
ATOM   1073 N NE2 . HIS B 2 14  ? 13.658  16.674  50.614 1.00 17.28 ? 14  HIS B NE2 1 
ATOM   1074 N N   . CYS B 2 15  ? 18.481  12.923  52.809 1.00 16.93 ? 15  CYS B N   1 
ATOM   1075 C CA  . CYS B 2 15  ? 19.607  12.020  52.996 1.00 17.01 ? 15  CYS B CA  1 
ATOM   1076 C C   . CYS B 2 15  ? 19.687  11.048  51.821 1.00 17.32 ? 15  CYS B C   1 
ATOM   1077 O O   . CYS B 2 15  ? 18.659  10.577  51.329 1.00 18.25 ? 15  CYS B O   1 
ATOM   1078 C CB  . CYS B 2 15  ? 19.443  11.268  54.314 1.00 17.54 ? 15  CYS B CB  1 
ATOM   1079 S SG  . CYS B 2 15  ? 19.315  12.389  55.749 1.00 21.51 ? 15  CYS B SG  1 
ATOM   1080 N N   . TYR B 2 16  ? 20.908  10.762  51.372 1.00 16.57 ? 16  TYR B N   1 
ATOM   1081 C CA  . TYR B 2 16  ? 21.140  9.881   50.227 1.00 16.00 ? 16  TYR B CA  1 
ATOM   1082 C C   . TYR B 2 16  ? 22.215  8.830   50.478 1.00 15.11 ? 16  TYR B C   1 
ATOM   1083 O O   . TYR B 2 16  ? 23.173  9.063   51.216 1.00 15.25 ? 16  TYR B O   1 
ATOM   1084 C CB  . TYR B 2 16  ? 21.590  10.693  49.005 1.00 14.76 ? 16  TYR B CB  1 
ATOM   1085 C CG  . TYR B 2 16  ? 20.701  11.852  48.639 1.00 15.04 ? 16  TYR B CG  1 
ATOM   1086 C CD1 . TYR B 2 16  ? 19.874  11.793  47.515 1.00 15.81 ? 16  TYR B CD1 1 
ATOM   1087 C CD2 . TYR B 2 16  ? 20.674  13.008  49.419 1.00 14.95 ? 16  TYR B CD2 1 
ATOM   1088 C CE1 . TYR B 2 16  ? 19.036  12.865  47.182 1.00 17.32 ? 16  TYR B CE1 1 
ATOM   1089 C CE2 . TYR B 2 16  ? 19.841  14.078  49.096 1.00 16.85 ? 16  TYR B CE2 1 
ATOM   1090 C CZ  . TYR B 2 16  ? 19.027  13.999  47.977 1.00 16.10 ? 16  TYR B CZ  1 
ATOM   1091 O OH  . TYR B 2 16  ? 18.182  15.040  47.667 1.00 15.74 ? 16  TYR B OH  1 
ATOM   1092 N N   . LYS B 2 17  ? 22.057  7.681   49.835 1.00 15.87 ? 17  LYS B N   1 
ATOM   1093 C CA  . LYS B 2 17  ? 23.038  6.610   49.940 1.00 17.31 ? 17  LYS B CA  1 
ATOM   1094 C C   . LYS B 2 17  ? 23.006  5.788   48.664 1.00 17.41 ? 17  LYS B C   1 
ATOM   1095 O O   . LYS B 2 17  ? 21.971  5.236   48.293 1.00 16.64 ? 17  LYS B O   1 
ATOM   1096 C CB  . LYS B 2 17  ? 22.764  5.710   51.147 1.00 17.03 ? 17  LYS B CB  1 
ATOM   1097 C CG  . LYS B 2 17  ? 23.875  4.678   51.406 1.00 19.20 ? 17  LYS B CG  1 
ATOM   1098 C CD  . LYS B 2 17  ? 23.744  4.058   52.805 1.00 21.79 ? 17  LYS B CD  1 
ATOM   1099 C CE  . LYS B 2 17  ? 24.713  2.886   53.013 1.00 21.63 ? 17  LYS B CE  1 
ATOM   1100 N NZ  . LYS B 2 17  ? 26.152  3.263   52.836 1.00 22.20 ? 17  LYS B NZ  1 
ATOM   1101 N N   . VAL B 2 18  ? 24.150  5.731   47.992 1.00 18.41 ? 18  VAL B N   1 
ATOM   1102 C CA  . VAL B 2 18  ? 24.289  4.982   46.750 1.00 19.73 ? 18  VAL B CA  1 
ATOM   1103 C C   . VAL B 2 18  ? 24.678  3.532   47.047 1.00 20.79 ? 18  VAL B C   1 
ATOM   1104 O O   . VAL B 2 18  ? 25.615  3.283   47.806 1.00 20.09 ? 18  VAL B O   1 
ATOM   1105 C CB  . VAL B 2 18  ? 25.386  5.609   45.854 1.00 19.26 ? 18  VAL B CB  1 
ATOM   1106 C CG1 . VAL B 2 18  ? 25.456  4.877   44.530 1.00 18.78 ? 18  VAL B CG1 1 
ATOM   1107 C CG2 . VAL B 2 18  ? 25.107  7.085   45.638 1.00 18.52 ? 18  VAL B CG2 1 
ATOM   1108 N N   . PHE B 2 19  ? 23.957  2.581   46.458 1.00 20.82 ? 19  PHE B N   1 
ATOM   1109 C CA  . PHE B 2 19  ? 24.271  1.169   46.664 1.00 21.55 ? 19  PHE B CA  1 
ATOM   1110 C C   . PHE B 2 19  ? 24.817  0.535   45.393 1.00 22.72 ? 19  PHE B C   1 
ATOM   1111 O O   . PHE B 2 19  ? 24.173  0.562   44.345 1.00 22.14 ? 19  PHE B O   1 
ATOM   1112 C CB  . PHE B 2 19  ? 23.035  0.395   47.135 1.00 19.27 ? 19  PHE B CB  1 
ATOM   1113 C CG  . PHE B 2 19  ? 22.643  0.692   48.554 1.00 19.54 ? 19  PHE B CG  1 
ATOM   1114 C CD1 . PHE B 2 19  ? 21.777  1.742   48.853 1.00 18.62 ? 19  PHE B CD1 1 
ATOM   1115 C CD2 . PHE B 2 19  ? 23.165  -0.065  49.599 1.00 19.16 ? 19  PHE B CD2 1 
ATOM   1116 C CE1 . PHE B 2 19  ? 21.436  2.033   50.182 1.00 17.59 ? 19  PHE B CE1 1 
ATOM   1117 C CE2 . PHE B 2 19  ? 22.838  0.212   50.924 1.00 17.69 ? 19  PHE B CE2 1 
ATOM   1118 C CZ  . PHE B 2 19  ? 21.970  1.263   51.222 1.00 17.44 ? 19  PHE B CZ  1 
ATOM   1119 N N   . LYS B 2 20  ? 26.015  -0.029  45.482 1.00 24.63 ? 20  LYS B N   1 
ATOM   1120 C CA  . LYS B 2 20  ? 26.624  -0.666  44.325 1.00 27.64 ? 20  LYS B CA  1 
ATOM   1121 C C   . LYS B 2 20  ? 25.948  -1.999  43.992 1.00 28.71 ? 20  LYS B C   1 
ATOM   1122 O O   . LYS B 2 20  ? 25.794  -2.345  42.821 1.00 29.42 ? 20  LYS B O   1 
ATOM   1123 C CB  . LYS B 2 20  ? 28.122  -0.871  44.572 1.00 29.30 ? 20  LYS B CB  1 
ATOM   1124 C CG  . LYS B 2 20  ? 28.876  -1.481  43.399 1.00 31.95 ? 20  LYS B CG  1 
ATOM   1125 C CD  . LYS B 2 20  ? 30.346  -1.061  43.402 1.00 34.50 ? 20  LYS B CD  1 
ATOM   1126 C CE  . LYS B 2 20  ? 30.948  -1.140  44.798 1.00 36.45 ? 20  LYS B CE  1 
ATOM   1127 N NZ  . LYS B 2 20  ? 30.719  -2.467  45.433 1.00 37.19 ? 20  LYS B NZ  1 
ATOM   1128 N N   . VAL B 2 21  ? 25.532  -2.739  45.015 1.00 29.48 ? 21  VAL B N   1 
ATOM   1129 C CA  . VAL B 2 21  ? 24.868  -4.021  44.799 1.00 30.72 ? 21  VAL B CA  1 
ATOM   1130 C C   . VAL B 2 21  ? 23.729  -3.843  43.794 1.00 31.13 ? 21  VAL B C   1 
ATOM   1131 O O   . VAL B 2 21  ? 22.875  -2.967  43.954 1.00 31.53 ? 21  VAL B O   1 
ATOM   1132 C CB  . VAL B 2 21  ? 24.312  -4.592  46.124 1.00 30.79 ? 21  VAL B CB  1 
ATOM   1133 C CG1 . VAL B 2 21  ? 23.381  -3.582  46.777 1.00 31.83 ? 21  VAL B CG1 1 
ATOM   1134 C CG2 . VAL B 2 21  ? 23.588  -5.903  45.861 1.00 30.75 ? 21  VAL B CG2 1 
ATOM   1135 N N   . GLU B 2 22  ? 23.724  -4.679  42.758 1.00 30.78 ? 22  GLU B N   1 
ATOM   1136 C CA  . GLU B 2 22  ? 22.721  -4.598  41.698 1.00 29.79 ? 22  GLU B CA  1 
ATOM   1137 C C   . GLU B 2 22  ? 21.448  -5.411  41.921 1.00 28.33 ? 22  GLU B C   1 
ATOM   1138 O O   . GLU B 2 22  ? 21.496  -6.600  42.231 1.00 27.73 ? 22  GLU B O   1 
ATOM   1139 C CB  . GLU B 2 22  ? 23.367  -4.992  40.370 1.00 31.57 ? 22  GLU B CB  1 
ATOM   1140 C CG  . GLU B 2 22  ? 24.477  -4.040  39.948 1.00 35.83 ? 22  GLU B CG  1 
ATOM   1141 C CD  . GLU B 2 22  ? 25.223  -4.513  38.722 1.00 37.73 ? 22  GLU B CD  1 
ATOM   1142 O OE1 . GLU B 2 22  ? 24.566  -4.851  37.717 1.00 40.01 ? 22  GLU B OE1 1 
ATOM   1143 O OE2 . GLU B 2 22  ? 26.471  -4.539  38.759 1.00 39.44 ? 22  GLU B OE2 1 
ATOM   1144 N N   . LYS B 2 23  ? 20.305  -4.747  41.753 1.00 26.22 ? 23  LYS B N   1 
ATOM   1145 C CA  . LYS B 2 23  ? 18.996  -5.372  41.931 1.00 24.74 ? 23  LYS B CA  1 
ATOM   1146 C C   . LYS B 2 23  ? 18.052  -4.870  40.844 1.00 23.15 ? 23  LYS B C   1 
ATOM   1147 O O   . LYS B 2 23  ? 18.347  -3.892  40.166 1.00 24.65 ? 23  LYS B O   1 
ATOM   1148 C CB  . LYS B 2 23  ? 18.389  -4.987  43.285 1.00 25.05 ? 23  LYS B CB  1 
ATOM   1149 C CG  . LYS B 2 23  ? 19.212  -5.356  44.513 1.00 26.65 ? 23  LYS B CG  1 
ATOM   1150 C CD  . LYS B 2 23  ? 18.512  -4.863  45.778 1.00 27.92 ? 23  LYS B CD  1 
ATOM   1151 C CE  . LYS B 2 23  ? 19.318  -5.168  47.034 1.00 30.06 ? 23  LYS B CE  1 
ATOM   1152 N NZ  . LYS B 2 23  ? 19.386  -6.621  47.345 1.00 31.61 ? 23  LYS B NZ  1 
ATOM   1153 N N   . THR B 2 24  ? 16.916  -5.539  40.688 1.00 21.95 ? 24  THR B N   1 
ATOM   1154 C CA  . THR B 2 24  ? 15.908  -5.121  39.724 1.00 19.56 ? 24  THR B CA  1 
ATOM   1155 C C   . THR B 2 24  ? 15.279  -3.848  40.306 1.00 19.68 ? 24  THR B C   1 
ATOM   1156 O O   . THR B 2 24  ? 15.453  -3.554  41.494 1.00 18.93 ? 24  THR B O   1 
ATOM   1157 C CB  . THR B 2 24  ? 14.804  -6.167  39.592 1.00 18.15 ? 24  THR B CB  1 
ATOM   1158 O OG1 . THR B 2 24  ? 14.203  -6.354  40.874 1.00 17.00 ? 24  THR B OG1 1 
ATOM   1159 C CG2 . THR B 2 24  ? 15.366  -7.504  39.086 1.00 17.03 ? 24  THR B CG2 1 
ATOM   1160 N N   . TRP B 2 25  ? 14.542  -3.108  39.483 1.00 18.17 ? 25  TRP B N   1 
ATOM   1161 C CA  . TRP B 2 25  ? 13.914  -1.877  39.950 1.00 17.44 ? 25  TRP B CA  1 
ATOM   1162 C C   . TRP B 2 25  ? 13.041  -2.157  41.167 1.00 18.68 ? 25  TRP B C   1 
ATOM   1163 O O   . TRP B 2 25  ? 13.214  -1.535  42.215 1.00 18.86 ? 25  TRP B O   1 
ATOM   1164 C CB  . TRP B 2 25  ? 13.062  -1.256  38.845 1.00 15.34 ? 25  TRP B CB  1 
ATOM   1165 C CG  . TRP B 2 25  ? 12.518  0.103   39.192 1.00 14.46 ? 25  TRP B CG  1 
ATOM   1166 C CD1 . TRP B 2 25  ? 13.131  1.310   39.008 1.00 14.20 ? 25  TRP B CD1 1 
ATOM   1167 C CD2 . TRP B 2 25  ? 11.249  0.385   39.785 1.00 14.40 ? 25  TRP B CD2 1 
ATOM   1168 N NE1 . TRP B 2 25  ? 12.318  2.334   39.450 1.00 12.61 ? 25  TRP B NE1 1 
ATOM   1169 C CE2 . TRP B 2 25  ? 11.156  1.790   39.933 1.00 14.12 ? 25  TRP B CE2 1 
ATOM   1170 C CE3 . TRP B 2 25  ? 10.178  -0.413  40.207 1.00 14.85 ? 25  TRP B CE3 1 
ATOM   1171 C CZ2 . TRP B 2 25  ? 10.032  2.409   40.484 1.00 12.68 ? 25  TRP B CZ2 1 
ATOM   1172 C CZ3 . TRP B 2 25  ? 9.061   0.204   40.755 1.00 13.75 ? 25  TRP B CZ3 1 
ATOM   1173 C CH2 . TRP B 2 25  ? 8.999   1.605   40.888 1.00 12.79 ? 25  TRP B CH2 1 
ATOM   1174 N N   . ALA B 2 26  ? 12.120  -3.111  41.036 1.00 18.72 ? 26  ALA B N   1 
ATOM   1175 C CA  . ALA B 2 26  ? 11.219  -3.447  42.138 1.00 18.97 ? 26  ALA B CA  1 
ATOM   1176 C C   . ALA B 2 26  ? 11.959  -3.836  43.424 1.00 18.86 ? 26  ALA B C   1 
ATOM   1177 O O   . ALA B 2 26  ? 11.601  -3.381  44.509 1.00 18.01 ? 26  ALA B O   1 
ATOM   1178 C CB  . ALA B 2 26  ? 10.265  -4.570  41.715 1.00 17.75 ? 26  ALA B CB  1 
ATOM   1179 N N   . ASP B 2 27  ? 12.987  -4.671  43.307 1.00 19.95 ? 27  ASP B N   1 
ATOM   1180 C CA  . ASP B 2 27  ? 13.756  -5.089  44.486 1.00 20.28 ? 27  ASP B CA  1 
ATOM   1181 C C   . ASP B 2 27  ? 14.473  -3.904  45.139 1.00 19.82 ? 27  ASP B C   1 
ATOM   1182 O O   . ASP B 2 27  ? 14.564  -3.823  46.363 1.00 21.22 ? 27  ASP B O   1 
ATOM   1183 C CB  . ASP B 2 27  ? 14.796  -6.145  44.108 1.00 22.26 ? 27  ASP B CB  1 
ATOM   1184 C CG  . ASP B 2 27  ? 14.205  -7.542  43.984 1.00 24.84 ? 27  ASP B CG  1 
ATOM   1185 O OD1 . ASP B 2 27  ? 14.903  -8.428  43.451 1.00 26.78 ? 27  ASP B OD1 1 
ATOM   1186 O OD2 . ASP B 2 27  ? 13.058  -7.764  44.422 1.00 26.96 ? 27  ASP B OD2 1 
ATOM   1187 N N   . ALA B 2 28  ? 14.979  -2.991  44.318 1.00 19.08 ? 28  ALA B N   1 
ATOM   1188 C CA  . ALA B 2 28  ? 15.683  -1.820  44.831 1.00 17.14 ? 28  ALA B CA  1 
ATOM   1189 C C   . ALA B 2 28  ? 14.734  -0.913  45.609 1.00 15.94 ? 28  ALA B C   1 
ATOM   1190 O O   . ALA B 2 28  ? 15.068  -0.466  46.705 1.00 15.66 ? 28  ALA B O   1 
ATOM   1191 C CB  . ALA B 2 28  ? 16.345  -1.050  43.682 1.00 15.73 ? 28  ALA B CB  1 
ATOM   1192 N N   . GLU B 2 29  ? 13.554  -0.643  45.053 1.00 15.75 ? 29  GLU B N   1 
ATOM   1193 C CA  . GLU B 2 29  ? 12.572  0.207   45.733 1.00 15.46 ? 29  GLU B CA  1 
ATOM   1194 C C   . GLU B 2 29  ? 12.188  -0.410  47.080 1.00 15.98 ? 29  GLU B C   1 
ATOM   1195 O O   . GLU B 2 29  ? 12.130  0.281   48.100 1.00 14.95 ? 29  GLU B O   1 
ATOM   1196 C CB  . GLU B 2 29  ? 11.316  0.396   44.862 1.00 15.83 ? 29  GLU B CB  1 
ATOM   1197 C CG  . GLU B 2 29  ? 10.104  0.984   45.605 1.00 14.15 ? 29  GLU B CG  1 
ATOM   1198 C CD  . GLU B 2 29  ? 10.244  2.451   45.990 1.00 14.24 ? 29  GLU B CD  1 
ATOM   1199 O OE1 . GLU B 2 29  ? 9.428   2.914   46.808 1.00 15.50 ? 29  GLU B OE1 1 
ATOM   1200 O OE2 . GLU B 2 29  ? 11.152  3.151   45.478 1.00 15.54 ? 29  GLU B OE2 1 
ATOM   1201 N N   . LYS B 2 30  ? 11.938  -1.715  47.091 1.00 17.89 ? 30  LYS B N   1 
ATOM   1202 C CA  . LYS B 2 30  ? 11.568  -2.392  48.329 1.00 19.54 ? 30  LYS B CA  1 
ATOM   1203 C C   . LYS B 2 30  ? 12.718  -2.307  49.326 1.00 20.12 ? 30  LYS B C   1 
ATOM   1204 O O   . LYS B 2 30  ? 12.498  -2.053  50.505 1.00 20.57 ? 30  LYS B O   1 
ATOM   1205 C CB  . LYS B 2 30  ? 11.232  -3.859  48.055 1.00 22.66 ? 30  LYS B CB  1 
ATOM   1206 C CG  . LYS B 2 30  ? 10.316  -4.509  49.098 1.00 27.34 ? 30  LYS B CG  1 
ATOM   1207 C CD  . LYS B 2 30  ? 10.863  -4.401  50.513 1.00 29.95 ? 30  LYS B CD  1 
ATOM   1208 C CE  . LYS B 2 30  ? 10.089  -5.286  51.479 1.00 32.19 ? 30  LYS B CE  1 
ATOM   1209 N NZ  . LYS B 2 30  ? 10.249  -6.735  51.144 1.00 33.70 ? 30  LYS B NZ  1 
ATOM   1210 N N   . PHE B 2 31  ? 13.944  -2.527  48.854 1.00 19.56 ? 31  PHE B N   1 
ATOM   1211 C CA  . PHE B 2 31  ? 15.113  -2.454  49.726 1.00 19.96 ? 31  PHE B CA  1 
ATOM   1212 C C   . PHE B 2 31  ? 15.197  -1.092  50.415 1.00 20.28 ? 31  PHE B C   1 
ATOM   1213 O O   . PHE B 2 31  ? 15.462  -1.016  51.615 1.00 20.35 ? 31  PHE B O   1 
ATOM   1214 C CB  . PHE B 2 31  ? 16.393  -2.721  48.921 1.00 21.06 ? 31  PHE B CB  1 
ATOM   1215 C CG  . PHE B 2 31  ? 17.671  -2.621  49.732 1.00 22.26 ? 31  PHE B CG  1 
ATOM   1216 C CD1 . PHE B 2 31  ? 18.322  -1.400  49.888 1.00 23.53 ? 31  PHE B CD1 1 
ATOM   1217 C CD2 . PHE B 2 31  ? 18.224  -3.751  50.330 1.00 23.80 ? 31  PHE B CD2 1 
ATOM   1218 C CE1 . PHE B 2 31  ? 19.506  -1.302  50.623 1.00 24.89 ? 31  PHE B CE1 1 
ATOM   1219 C CE2 . PHE B 2 31  ? 19.411  -3.664  51.069 1.00 25.49 ? 31  PHE B CE2 1 
ATOM   1220 C CZ  . PHE B 2 31  ? 20.051  -2.438  51.215 1.00 25.76 ? 31  PHE B CZ  1 
ATOM   1221 N N   . CYS B 2 32  ? 14.968  -0.017  49.662 1.00 20.07 ? 32  CYS B N   1 
ATOM   1222 C CA  . CYS B 2 32  ? 15.042  1.322   50.248 1.00 19.26 ? 32  CYS B CA  1 
ATOM   1223 C C   . CYS B 2 32  ? 13.958  1.515   51.296 1.00 19.53 ? 32  CYS B C   1 
ATOM   1224 O O   . CYS B 2 32  ? 14.200  2.093   52.360 1.00 18.74 ? 32  CYS B O   1 
ATOM   1225 C CB  . CYS B 2 32  ? 14.895  2.407   49.175 1.00 17.22 ? 32  CYS B CB  1 
ATOM   1226 S SG  . CYS B 2 32  ? 16.232  2.537   47.953 1.00 17.76 ? 32  CYS B SG  1 
ATOM   1227 N N   . LYS B 2 33  ? 12.763  1.028   50.984 1.00 20.40 ? 33  LYS B N   1 
ATOM   1228 C CA  . LYS B 2 33  ? 11.622  1.137   51.883 1.00 24.10 ? 33  LYS B CA  1 
ATOM   1229 C C   . LYS B 2 33  ? 11.811  0.418   53.221 1.00 25.25 ? 33  LYS B C   1 
ATOM   1230 O O   . LYS B 2 33  ? 11.360  0.911   54.256 1.00 25.62 ? 33  LYS B O   1 
ATOM   1231 C CB  . LYS B 2 33  ? 10.357  0.608   51.188 1.00 25.66 ? 33  LYS B CB  1 
ATOM   1232 C CG  . LYS B 2 33  ? 9.687   1.624   50.276 1.00 28.30 ? 33  LYS B CG  1 
ATOM   1233 C CD  . LYS B 2 33  ? 8.691   0.979   49.317 1.00 32.41 ? 33  LYS B CD  1 
ATOM   1234 C CE  . LYS B 2 33  ? 7.517   0.336   50.033 1.00 33.24 ? 33  LYS B CE  1 
ATOM   1235 N NZ  . LYS B 2 33  ? 6.596   -0.284  49.042 1.00 35.99 ? 33  LYS B NZ  1 
ATOM   1236 N N   . GLU B 2 34  ? 12.475  -0.736  53.207 1.00 25.44 ? 34  GLU B N   1 
ATOM   1237 C CA  . GLU B 2 34  ? 12.679  -1.500  54.438 1.00 26.54 ? 34  GLU B CA  1 
ATOM   1238 C C   . GLU B 2 34  ? 13.895  -1.023  55.224 1.00 25.10 ? 34  GLU B C   1 
ATOM   1239 O O   . GLU B 2 34  ? 14.049  -1.326  56.407 1.00 23.53 ? 34  GLU B O   1 
ATOM   1240 C CB  . GLU B 2 34  ? 12.821  -2.997  54.114 1.00 30.32 ? 34  GLU B CB  1 
ATOM   1241 C CG  . GLU B 2 34  ? 14.262  -3.506  53.997 1.00 39.20 ? 34  GLU B CG  1 
ATOM   1242 C CD  . GLU B 2 34  ? 14.928  -3.777  55.357 1.00 44.80 ? 34  GLU B CD  1 
ATOM   1243 O OE1 . GLU B 2 34  ? 16.170  -3.971  55.399 1.00 46.34 ? 34  GLU B OE1 1 
ATOM   1244 O OE2 . GLU B 2 34  ? 14.210  -3.803  56.384 1.00 45.88 ? 34  GLU B OE2 1 
ATOM   1245 N N   . LEU B 2 35  ? 14.755  -0.261  54.565 1.00 24.37 ? 35  LEU B N   1 
ATOM   1246 C CA  . LEU B 2 35  ? 15.968  0.235   55.194 1.00 23.83 ? 35  LEU B CA  1 
ATOM   1247 C C   . LEU B 2 35  ? 15.721  1.330   56.236 1.00 24.93 ? 35  LEU B C   1 
ATOM   1248 O O   . LEU B 2 35  ? 16.312  1.313   57.321 1.00 25.55 ? 35  LEU B O   1 
ATOM   1249 C CB  . LEU B 2 35  ? 16.910  0.746   54.111 1.00 22.71 ? 35  LEU B CB  1 
ATOM   1250 C CG  . LEU B 2 35  ? 18.363  1.059   54.453 1.00 22.46 ? 35  LEU B CG  1 
ATOM   1251 C CD1 . LEU B 2 35  ? 19.023  -0.141  55.098 1.00 22.68 ? 35  LEU B CD1 1 
ATOM   1252 C CD2 . LEU B 2 35  ? 19.091  1.429   53.172 1.00 23.95 ? 35  LEU B CD2 1 
ATOM   1253 N N   . VAL B 2 36  ? 14.847  2.277   55.904 1.00 24.67 ? 36  VAL B N   1 
ATOM   1254 C CA  . VAL B 2 36  ? 14.544  3.390   56.798 1.00 25.06 ? 36  VAL B CA  1 
ATOM   1255 C C   . VAL B 2 36  ? 13.120  3.881   56.547 1.00 25.80 ? 36  VAL B C   1 
ATOM   1256 O O   . VAL B 2 36  ? 12.582  3.715   55.454 1.00 25.54 ? 36  VAL B O   1 
ATOM   1257 C CB  . VAL B 2 36  ? 15.546  4.558   56.578 1.00 25.77 ? 36  VAL B CB  1 
ATOM   1258 C CG1 . VAL B 2 36  ? 15.375  5.145   55.182 1.00 25.81 ? 36  VAL B CG1 1 
ATOM   1259 C CG2 . VAL B 2 36  ? 15.356  5.626   57.632 1.00 27.84 ? 36  VAL B CG2 1 
ATOM   1260 N N   . ASN B 2 37  ? 12.511  4.477   57.567 1.00 26.37 ? 37  ASN B N   1 
ATOM   1261 C CA  . ASN B 2 37  ? 11.149  4.984   57.457 1.00 27.21 ? 37  ASN B CA  1 
ATOM   1262 C C   . ASN B 2 37  ? 11.090  6.162   56.495 1.00 26.12 ? 37  ASN B C   1 
ATOM   1263 O O   . ASN B 2 37  ? 11.739  7.175   56.716 1.00 27.54 ? 37  ASN B O   1 
ATOM   1264 C CB  . ASN B 2 37  ? 10.642  5.428   58.829 1.00 30.75 ? 37  ASN B CB  1 
ATOM   1265 C CG  . ASN B 2 37  ? 9.187   5.828   58.801 1.00 35.38 ? 37  ASN B CG  1 
ATOM   1266 O OD1 . ASN B 2 37  ? 8.329   5.047   58.380 1.00 38.35 ? 37  ASN B OD1 1 
ATOM   1267 N ND2 . ASN B 2 37  ? 8.895   7.049   59.244 1.00 36.43 ? 37  ASN B ND2 1 
ATOM   1268 N N   . GLY B 2 38  ? 10.298  6.031   55.438 1.00 25.12 ? 38  GLY B N   1 
ATOM   1269 C CA  . GLY B 2 38  ? 10.189  7.100   54.459 1.00 23.80 ? 38  GLY B CA  1 
ATOM   1270 C C   . GLY B 2 38  ? 11.229  6.936   53.364 1.00 22.26 ? 38  GLY B C   1 
ATOM   1271 O O   . GLY B 2 38  ? 11.435  7.830   52.538 1.00 21.48 ? 38  GLY B O   1 
ATOM   1272 N N   . GLY B 2 39  ? 11.890  5.784   53.360 1.00 20.10 ? 39  GLY B N   1 
ATOM   1273 C CA  . GLY B 2 39  ? 12.914  5.520   52.366 1.00 18.55 ? 39  GLY B CA  1 
ATOM   1274 C C   . GLY B 2 39  ? 12.349  5.081   51.032 1.00 17.05 ? 39  GLY B C   1 
ATOM   1275 O O   . GLY B 2 39  ? 11.364  4.354   50.978 1.00 17.28 ? 39  GLY B O   1 
ATOM   1276 N N   . HIS B 2 40  ? 12.969  5.529   49.948 1.00 16.75 ? 40  HIS B N   1 
ATOM   1277 C CA  . HIS B 2 40  ? 12.514  5.172   48.608 1.00 16.67 ? 40  HIS B CA  1 
ATOM   1278 C C   . HIS B 2 40  ? 13.648  5.324   47.624 1.00 15.92 ? 40  HIS B C   1 
ATOM   1279 O O   . HIS B 2 40  ? 14.695  5.888   47.936 1.00 15.43 ? 40  HIS B O   1 
ATOM   1280 C CB  . HIS B 2 40  ? 11.399  6.112   48.122 1.00 15.99 ? 40  HIS B CB  1 
ATOM   1281 C CG  . HIS B 2 40  ? 10.106  5.989   48.869 1.00 16.84 ? 40  HIS B CG  1 
ATOM   1282 N ND1 . HIS B 2 40  ? 9.167   5.020   48.581 1.00 17.24 ? 40  HIS B ND1 1 
ATOM   1283 C CD2 . HIS B 2 40  ? 9.590   6.723   49.882 1.00 16.61 ? 40  HIS B CD2 1 
ATOM   1284 C CE1 . HIS B 2 40  ? 8.131   5.162   49.388 1.00 16.27 ? 40  HIS B CE1 1 
ATOM   1285 N NE2 . HIS B 2 40  ? 8.362   6.188   50.189 1.00 15.95 ? 40  HIS B NE2 1 
ATOM   1286 N N   . LEU B 2 41  ? 13.414  4.816   46.421 1.00 16.04 ? 41  LEU B N   1 
ATOM   1287 C CA  . LEU B 2 41  ? 14.363  4.963   45.336 1.00 15.27 ? 41  LEU B CA  1 
ATOM   1288 C C   . LEU B 2 41  ? 14.376  6.486   45.197 1.00 15.85 ? 41  LEU B C   1 
ATOM   1289 O O   . LEU B 2 41  ? 13.354  7.152   45.410 1.00 15.33 ? 41  LEU B O   1 
ATOM   1290 C CB  . LEU B 2 41  ? 13.799  4.304   44.073 1.00 15.31 ? 41  LEU B CB  1 
ATOM   1291 C CG  . LEU B 2 41  ? 14.616  3.295   43.253 1.00 17.25 ? 41  LEU B CG  1 
ATOM   1292 C CD1 . LEU B 2 41  ? 15.665  2.605   44.079 1.00 15.13 ? 41  LEU B CD1 1 
ATOM   1293 C CD2 . LEU B 2 41  ? 13.654  2.301   42.630 1.00 14.71 ? 41  LEU B CD2 1 
ATOM   1294 N N   . MET B 2 42  ? 15.522  7.046   44.856 1.00 15.94 ? 42  MET B N   1 
ATOM   1295 C CA  . MET B 2 42  ? 15.617  8.490   44.728 1.00 17.36 ? 42  MET B CA  1 
ATOM   1296 C C   . MET B 2 42  ? 14.690  9.179   43.723 1.00 16.24 ? 42  MET B C   1 
ATOM   1297 O O   . MET B 2 42  ? 14.427  8.674   42.629 1.00 14.50 ? 42  MET B O   1 
ATOM   1298 C CB  . MET B 2 42  ? 17.059  8.877   44.409 1.00 20.21 ? 42  MET B CB  1 
ATOM   1299 C CG  . MET B 2 42  ? 17.220  10.323  44.007 1.00 24.71 ? 42  MET B CG  1 
ATOM   1300 S SD  . MET B 2 42  ? 18.906  10.689  43.562 1.00 29.90 ? 42  MET B SD  1 
ATOM   1301 C CE  . MET B 2 42  ? 19.153  9.510   42.188 1.00 24.33 ? 42  MET B CE  1 
ATOM   1302 N N   . SER B 2 43  ? 14.190  10.341  44.128 1.00 14.58 ? 43  SER B N   1 
ATOM   1303 C CA  . SER B 2 43  ? 13.377  11.181  43.264 1.00 15.00 ? 43  SER B CA  1 
ATOM   1304 C C   . SER B 2 43  ? 14.294  12.365  42.929 1.00 14.93 ? 43  SER B C   1 
ATOM   1305 O O   . SER B 2 43  ? 15.092  12.794  43.769 1.00 14.23 ? 43  SER B O   1 
ATOM   1306 C CB  . SER B 2 43  ? 12.129  11.674  44.001 1.00 15.74 ? 43  SER B CB  1 
ATOM   1307 O OG  . SER B 2 43  ? 12.471  12.320  45.214 1.00 17.86 ? 43  SER B OG  1 
ATOM   1308 N N   . VAL B 2 44  ? 14.212  12.868  41.700 1.00 14.19 ? 44  VAL B N   1 
ATOM   1309 C CA  . VAL B 2 44  ? 15.031  14.003  41.289 1.00 14.53 ? 44  VAL B CA  1 
ATOM   1310 C C   . VAL B 2 44  ? 14.081  15.162  41.048 1.00 15.68 ? 44  VAL B C   1 
ATOM   1311 O O   . VAL B 2 44  ? 13.330  15.170  40.069 1.00 16.23 ? 44  VAL B O   1 
ATOM   1312 C CB  . VAL B 2 44  ? 15.814  13.692  40.006 1.00 15.59 ? 44  VAL B CB  1 
ATOM   1313 C CG1 . VAL B 2 44  ? 16.746  14.850  39.661 1.00 15.29 ? 44  VAL B CG1 1 
ATOM   1314 C CG2 . VAL B 2 44  ? 16.610  12.419  40.205 1.00 14.88 ? 44  VAL B CG2 1 
ATOM   1315 N N   . ASN B 2 45  ? 14.123  16.141  41.950 1.00 17.01 ? 45  ASN B N   1 
ATOM   1316 C CA  . ASN B 2 45  ? 13.224  17.284  41.890 1.00 17.77 ? 45  ASN B CA  1 
ATOM   1317 C C   . ASN B 2 45  ? 13.820  18.623  41.447 1.00 18.29 ? 45  ASN B C   1 
ATOM   1318 O O   . ASN B 2 45  ? 13.130  19.644  41.443 1.00 17.06 ? 45  ASN B O   1 
ATOM   1319 C CB  . ASN B 2 45  ? 12.510  17.405  43.246 1.00 19.20 ? 45  ASN B CB  1 
ATOM   1320 C CG  . ASN B 2 45  ? 11.530  16.250  43.487 1.00 21.64 ? 45  ASN B CG  1 
ATOM   1321 O OD1 . ASN B 2 45  ? 11.249  15.863  44.622 1.00 23.87 ? 45  ASN B OD1 1 
ATOM   1322 N ND2 . ASN B 2 45  ? 11.005  15.701  42.403 1.00 24.05 ? 45  ASN B ND2 1 
ATOM   1323 N N   . SER B 2 46  ? 15.089  18.616  41.053 1.00 18.54 ? 46  SER B N   1 
ATOM   1324 C CA  . SER B 2 46  ? 15.736  19.830  40.569 1.00 19.82 ? 46  SER B CA  1 
ATOM   1325 C C   . SER B 2 46  ? 17.050  19.462  39.896 1.00 19.62 ? 46  SER B C   1 
ATOM   1326 O O   . SER B 2 46  ? 17.631  18.425  40.184 1.00 19.07 ? 46  SER B O   1 
ATOM   1327 C CB  . SER B 2 46  ? 16.008  20.810  41.719 1.00 21.73 ? 46  SER B CB  1 
ATOM   1328 O OG  . SER B 2 46  ? 17.084  20.365  42.525 1.00 21.45 ? 46  SER B OG  1 
ATOM   1329 N N   . ARG B 2 47  ? 17.507  20.318  38.990 1.00 20.80 ? 47  ARG B N   1 
ATOM   1330 C CA  . ARG B 2 47  ? 18.760  20.086  38.282 1.00 21.57 ? 47  ARG B CA  1 
ATOM   1331 C C   . ARG B 2 47  ? 19.935  19.997  39.257 1.00 21.31 ? 47  ARG B C   1 
ATOM   1332 O O   . ARG B 2 47  ? 20.846  19.190  39.070 1.00 19.82 ? 47  ARG B O   1 
ATOM   1333 C CB  . ARG B 2 47  ? 19.002  21.215  37.269 1.00 23.34 ? 47  ARG B CB  1 
ATOM   1334 C CG  . ARG B 2 47  ? 20.412  21.279  36.708 1.00 26.78 ? 47  ARG B CG  1 
ATOM   1335 C CD  . ARG B 2 47  ? 20.570  22.459  35.749 1.00 31.04 ? 47  ARG B CD  1 
ATOM   1336 N NE  . ARG B 2 47  ? 21.968  22.869  35.595 1.00 36.04 ? 47  ARG B NE  1 
ATOM   1337 C CZ  . ARG B 2 47  ? 22.644  23.595  36.486 1.00 39.32 ? 47  ARG B CZ  1 
ATOM   1338 N NH1 . ARG B 2 47  ? 22.055  24.005  37.605 1.00 39.60 ? 47  ARG B NH1 1 
ATOM   1339 N NH2 . ARG B 2 47  ? 23.914  23.911  36.263 1.00 41.13 ? 47  ARG B NH2 1 
ATOM   1340 N N   . GLU B 2 48  ? 19.911  20.830  40.295 1.00 21.73 ? 48  GLU B N   1 
ATOM   1341 C CA  . GLU B 2 48  ? 20.985  20.846  41.283 1.00 21.52 ? 48  GLU B CA  1 
ATOM   1342 C C   . GLU B 2 48  ? 21.074  19.528  42.056 1.00 21.29 ? 48  GLU B C   1 
ATOM   1343 O O   . GLU B 2 48  ? 22.169  19.033  42.341 1.00 20.56 ? 48  GLU B O   1 
ATOM   1344 C CB  . GLU B 2 48  ? 20.789  22.018  42.256 1.00 22.58 ? 48  GLU B CB  1 
ATOM   1345 C CG  . GLU B 2 48  ? 20.931  23.394  41.606 1.00 23.08 ? 48  GLU B CG  1 
ATOM   1346 C CD  . GLU B 2 48  ? 19.672  23.856  40.885 1.00 23.18 ? 48  GLU B CD  1 
ATOM   1347 O OE1 . GLU B 2 48  ? 19.730  24.921  40.237 1.00 26.33 ? 48  GLU B OE1 1 
ATOM   1348 O OE2 . GLU B 2 48  ? 18.631  23.176  40.965 1.00 22.81 ? 48  GLU B OE2 1 
ATOM   1349 N N   . GLU B 2 49  ? 19.924  18.958  42.399 1.00 19.75 ? 49  GLU B N   1 
ATOM   1350 C CA  . GLU B 2 49  ? 19.925  17.688  43.113 1.00 19.35 ? 49  GLU B CA  1 
ATOM   1351 C C   . GLU B 2 49  ? 20.494  16.609  42.182 1.00 18.86 ? 49  GLU B C   1 
ATOM   1352 O O   . GLU B 2 49  ? 21.290  15.765  42.596 1.00 19.25 ? 49  GLU B O   1 
ATOM   1353 C CB  . GLU B 2 49  ? 18.506  17.316  43.536 1.00 18.80 ? 49  GLU B CB  1 
ATOM   1354 C CG  . GLU B 2 49  ? 18.441  16.093  44.423 1.00 19.12 ? 49  GLU B CG  1 
ATOM   1355 C CD  . GLU B 2 49  ? 17.021  15.703  44.785 1.00 19.64 ? 49  GLU B CD  1 
ATOM   1356 O OE1 . GLU B 2 49  ? 16.856  14.825  45.658 1.00 18.41 ? 49  GLU B OE1 1 
ATOM   1357 O OE2 . GLU B 2 49  ? 16.075  16.266  44.192 1.00 19.22 ? 49  GLU B OE2 1 
ATOM   1358 N N   . GLY B 2 50  ? 20.085  16.655  40.917 1.00 18.54 ? 50  GLY B N   1 
ATOM   1359 C CA  . GLY B 2 50  ? 20.566  15.684  39.950 1.00 19.75 ? 50  GLY B CA  1 
ATOM   1360 C C   . GLY B 2 50  ? 22.082  15.696  39.829 1.00 20.91 ? 50  GLY B C   1 
ATOM   1361 O O   . GLY B 2 50  ? 22.722  14.642  39.829 1.00 19.15 ? 50  GLY B O   1 
ATOM   1362 N N   . GLU B 2 51  ? 22.662  16.890  39.730 1.00 21.97 ? 51  GLU B N   1 
ATOM   1363 C CA  . GLU B 2 51  ? 24.111  17.017  39.620 1.00 23.39 ? 51  GLU B CA  1 
ATOM   1364 C C   . GLU B 2 51  ? 24.797  16.502  40.870 1.00 22.62 ? 51  GLU B C   1 
ATOM   1365 O O   . GLU B 2 51  ? 25.839  15.864  40.793 1.00 23.32 ? 51  GLU B O   1 
ATOM   1366 C CB  . GLU B 2 51  ? 24.520  18.471  39.401 1.00 26.62 ? 51  GLU B CB  1 
ATOM   1367 C CG  . GLU B 2 51  ? 23.987  19.086  38.129 1.00 33.37 ? 51  GLU B CG  1 
ATOM   1368 C CD  . GLU B 2 51  ? 24.693  20.378  37.793 1.00 36.94 ? 51  GLU B CD  1 
ATOM   1369 O OE1 . GLU B 2 51  ? 25.845  20.317  37.310 1.00 37.43 ? 51  GLU B OE1 1 
ATOM   1370 O OE2 . GLU B 2 51  ? 24.100  21.454  38.029 1.00 40.08 ? 51  GLU B OE2 1 
ATOM   1371 N N   . PHE B 2 52  ? 24.214  16.784  42.027 1.00 22.23 ? 52  PHE B N   1 
ATOM   1372 C CA  . PHE B 2 52  ? 24.794  16.330  43.287 1.00 22.69 ? 52  PHE B CA  1 
ATOM   1373 C C   . PHE B 2 52  ? 24.944  14.807  43.347 1.00 22.74 ? 52  PHE B C   1 
ATOM   1374 O O   . PHE B 2 52  ? 26.010  14.293  43.692 1.00 23.03 ? 52  PHE B O   1 
ATOM   1375 C CB  . PHE B 2 52  ? 23.933  16.781  44.467 1.00 23.42 ? 52  PHE B CB  1 
ATOM   1376 C CG  . PHE B 2 52  ? 24.372  16.203  45.784 1.00 25.85 ? 52  PHE B CG  1 
ATOM   1377 C CD1 . PHE B 2 52  ? 25.496  16.697  46.431 1.00 25.35 ? 52  PHE B CD1 1 
ATOM   1378 C CD2 . PHE B 2 52  ? 23.686  15.130  46.353 1.00 26.57 ? 52  PHE B CD2 1 
ATOM   1379 C CE1 . PHE B 2 52  ? 25.939  16.132  47.627 1.00 24.51 ? 52  PHE B CE1 1 
ATOM   1380 C CE2 . PHE B 2 52  ? 24.125  14.555  47.553 1.00 26.64 ? 52  PHE B CE2 1 
ATOM   1381 C CZ  . PHE B 2 52  ? 25.255  15.060  48.186 1.00 24.70 ? 52  PHE B CZ  1 
ATOM   1382 N N   . ILE B 2 53  ? 23.874  14.090  43.020 1.00 22.77 ? 53  ILE B N   1 
ATOM   1383 C CA  . ILE B 2 53  ? 23.892  12.630  43.052 1.00 22.77 ? 53  ILE B CA  1 
ATOM   1384 C C   . ILE B 2 53  ? 24.803  12.007  41.987 1.00 22.14 ? 53  ILE B C   1 
ATOM   1385 O O   . ILE B 2 53  ? 25.449  10.990  42.238 1.00 20.88 ? 53  ILE B O   1 
ATOM   1386 C CB  . ILE B 2 53  ? 22.472  12.048  42.871 1.00 24.43 ? 53  ILE B CB  1 
ATOM   1387 C CG1 . ILE B 2 53  ? 22.472  10.567  43.241 1.00 24.94 ? 53  ILE B CG1 1 
ATOM   1388 C CG2 . ILE B 2 53  ? 22.018  12.190  41.421 1.00 25.29 ? 53  ILE B CG2 1 
ATOM   1389 C CD1 . ILE B 2 53  ? 22.852  10.310  44.685 1.00 26.78 ? 53  ILE B CD1 1 
ATOM   1390 N N   . SER B 2 54  ? 24.831  12.597  40.795 1.00 21.71 ? 54  SER B N   1 
ATOM   1391 C CA  . SER B 2 54  ? 25.677  12.075  39.730 1.00 23.17 ? 54  SER B CA  1 
ATOM   1392 C C   . SER B 2 54  ? 27.141  12.128  40.135 1.00 24.38 ? 54  SER B C   1 
ATOM   1393 O O   . SER B 2 54  ? 27.885  11.180  39.907 1.00 24.25 ? 54  SER B O   1 
ATOM   1394 C CB  . SER B 2 54  ? 25.479  12.873  38.439 1.00 23.28 ? 54  SER B CB  1 
ATOM   1395 O OG  . SER B 2 54  ? 24.208  12.599  37.873 1.00 27.00 ? 54  SER B OG  1 
ATOM   1396 N N   . LYS B 2 55  ? 27.549  13.241  40.738 1.00 26.71 ? 55  LYS B N   1 
ATOM   1397 C CA  . LYS B 2 55  ? 28.933  13.413  41.172 1.00 27.97 ? 55  LYS B CA  1 
ATOM   1398 C C   . LYS B 2 55  ? 29.310  12.396  42.245 1.00 28.31 ? 55  LYS B C   1 
ATOM   1399 O O   . LYS B 2 55  ? 30.423  11.867  42.253 1.00 28.90 ? 55  LYS B O   1 
ATOM   1400 C CB  . LYS B 2 55  ? 29.145  14.835  41.704 1.00 29.87 ? 55  LYS B CB  1 
ATOM   1401 C CG  . LYS B 2 55  ? 29.594  15.869  40.657 1.00 32.91 ? 55  LYS B CG  1 
ATOM   1402 C CD  . LYS B 2 55  ? 28.498  16.255  39.654 1.00 35.50 ? 55  LYS B CD  1 
ATOM   1403 C CE  . LYS B 2 55  ? 28.298  15.199  38.570 1.00 35.77 ? 55  LYS B CE  1 
ATOM   1404 N NZ  . LYS B 2 55  ? 27.270  15.597  37.569 1.00 34.12 ? 55  LYS B NZ  1 
ATOM   1405 N N   . LEU B 2 56  ? 28.370  12.120  43.143 1.00 27.35 ? 56  LEU B N   1 
ATOM   1406 C CA  . LEU B 2 56  ? 28.586  11.164  44.221 1.00 27.04 ? 56  LEU B CA  1 
ATOM   1407 C C   . LEU B 2 56  ? 28.751  9.743   43.669 1.00 26.65 ? 56  LEU B C   1 
ATOM   1408 O O   . LEU B 2 56  ? 29.696  9.031   44.014 1.00 26.22 ? 56  LEU B O   1 
ATOM   1409 C CB  . LEU B 2 56  ? 27.398  11.216  45.191 1.00 27.85 ? 56  LEU B CB  1 
ATOM   1410 C CG  . LEU B 2 56  ? 27.511  10.532  46.557 1.00 29.76 ? 56  LEU B CG  1 
ATOM   1411 C CD1 . LEU B 2 56  ? 28.608  11.201  47.383 1.00 31.26 ? 56  LEU B CD1 1 
ATOM   1412 C CD2 . LEU B 2 56  ? 26.171  10.628  47.284 1.00 28.84 ? 56  LEU B CD2 1 
ATOM   1413 N N   . ALA B 2 57  ? 27.830  9.338   42.805 1.00 26.00 ? 57  ALA B N   1 
ATOM   1414 C CA  . ALA B 2 57  ? 27.872  8.003   42.221 1.00 26.61 ? 57  ALA B CA  1 
ATOM   1415 C C   . ALA B 2 57  ? 29.062  7.769   41.285 1.00 26.96 ? 57  ALA B C   1 
ATOM   1416 O O   . ALA B 2 57  ? 29.697  6.715   41.337 1.00 27.16 ? 57  ALA B O   1 
ATOM   1417 C CB  . ALA B 2 57  ? 26.566  7.726   41.483 1.00 27.30 ? 57  ALA B CB  1 
ATOM   1418 N N   . LEU B 2 58  ? 29.365  8.745   40.433 1.00 27.29 ? 58  LEU B N   1 
ATOM   1419 C CA  . LEU B 2 58  ? 30.478  8.608   39.486 1.00 27.74 ? 58  LEU B CA  1 
ATOM   1420 C C   . LEU B 2 58  ? 31.875  8.775   40.090 1.00 28.88 ? 58  LEU B C   1 
ATOM   1421 O O   . LEU B 2 58  ? 32.678  7.844   40.089 1.00 29.12 ? 58  LEU B O   1 
ATOM   1422 C CB  . LEU B 2 58  ? 30.325  9.606   38.331 1.00 25.54 ? 58  LEU B CB  1 
ATOM   1423 C CG  . LEU B 2 58  ? 31.446  9.557   37.279 1.00 23.60 ? 58  LEU B CG  1 
ATOM   1424 C CD1 . LEU B 2 58  ? 31.482  8.183   36.621 1.00 21.80 ? 58  LEU B CD1 1 
ATOM   1425 C CD2 . LEU B 2 58  ? 31.225  10.633  36.237 1.00 21.94 ? 58  LEU B CD2 1 
ATOM   1426 N N   . GLU B 2 59  ? 32.159  9.966   40.600 1.00 31.06 ? 59  GLU B N   1 
ATOM   1427 C CA  . GLU B 2 59  ? 33.470  10.257  41.166 1.00 34.13 ? 59  GLU B CA  1 
ATOM   1428 C C   . GLU B 2 59  ? 33.824  9.482   42.430 1.00 34.94 ? 59  GLU B C   1 
ATOM   1429 O O   . GLU B 2 59  ? 34.966  9.054   42.592 1.00 35.87 ? 59  GLU B O   1 
ATOM   1430 C CB  . GLU B 2 59  ? 33.594  11.753  41.451 1.00 35.19 ? 59  GLU B CB  1 
ATOM   1431 C CG  . GLU B 2 59  ? 33.176  12.632  40.286 1.00 39.07 ? 59  GLU B CG  1 
ATOM   1432 C CD  . GLU B 2 59  ? 33.608  14.074  40.462 1.00 42.66 ? 59  GLU B CD  1 
ATOM   1433 O OE1 . GLU B 2 59  ? 33.668  14.540  41.623 1.00 43.35 ? 59  GLU B OE1 1 
ATOM   1434 O OE2 . GLU B 2 59  ? 33.874  14.744  39.441 1.00 43.71 ? 59  GLU B OE2 1 
ATOM   1435 N N   . LYS B 2 60  ? 32.854  9.297   43.322 1.00 35.61 ? 60  LYS B N   1 
ATOM   1436 C CA  . LYS B 2 60  ? 33.111  8.600   44.575 1.00 35.77 ? 60  LYS B CA  1 
ATOM   1437 C C   . LYS B 2 60  ? 32.947  7.086   44.513 1.00 35.25 ? 60  LYS B C   1 
ATOM   1438 O O   . LYS B 2 60  ? 33.605  6.363   45.260 1.00 36.68 ? 60  LYS B O   1 
ATOM   1439 C CB  . LYS B 2 60  ? 32.214  9.160   45.683 1.00 37.05 ? 60  LYS B CB  1 
ATOM   1440 C CG  . LYS B 2 60  ? 32.174  10.686  45.739 1.00 38.59 ? 60  LYS B CG  1 
ATOM   1441 C CD  . LYS B 2 60  ? 33.548  11.296  45.991 1.00 39.85 ? 60  LYS B CD  1 
ATOM   1442 C CE  . LYS B 2 60  ? 33.483  12.818  45.937 1.00 40.33 ? 60  LYS B CE  1 
ATOM   1443 N NZ  . LYS B 2 60  ? 34.800  13.458  46.214 1.00 40.22 ? 60  LYS B NZ  1 
ATOM   1444 N N   . MET B 2 61  ? 32.081  6.594   43.630 1.00 33.91 ? 61  MET B N   1 
ATOM   1445 C CA  . MET B 2 61  ? 31.879  5.149   43.542 1.00 31.34 ? 61  MET B CA  1 
ATOM   1446 C C   . MET B 2 61  ? 32.013  4.541   42.146 1.00 28.82 ? 61  MET B C   1 
ATOM   1447 O O   . MET B 2 61  ? 31.875  3.331   41.970 1.00 28.06 ? 61  MET B O   1 
ATOM   1448 C CB  . MET B 2 61  ? 30.527  4.781   44.154 1.00 32.03 ? 61  MET B CB  1 
ATOM   1449 C CG  . MET B 2 61  ? 30.473  5.033   45.656 1.00 33.97 ? 61  MET B CG  1 
ATOM   1450 S SD  . MET B 2 61  ? 28.978  4.393   46.410 1.00 39.39 ? 61  MET B SD  1 
ATOM   1451 C CE  . MET B 2 61  ? 29.391  2.635   46.557 1.00 37.04 ? 61  MET B CE  1 
ATOM   1452 N N   . ARG B 2 62  ? 32.298  5.377   41.157 1.00 26.10 ? 62  ARG B N   1 
ATOM   1453 C CA  . ARG B 2 62  ? 32.464  4.897   39.794 1.00 26.23 ? 62  ARG B CA  1 
ATOM   1454 C C   . ARG B 2 62  ? 31.258  4.112   39.282 1.00 24.98 ? 62  ARG B C   1 
ATOM   1455 O O   . ARG B 2 62  ? 31.396  3.018   38.731 1.00 22.24 ? 62  ARG B O   1 
ATOM   1456 C CB  . ARG B 2 62  ? 33.731  4.042   39.693 1.00 29.02 ? 62  ARG B CB  1 
ATOM   1457 C CG  . ARG B 2 62  ? 34.969  4.747   40.223 1.00 31.44 ? 62  ARG B CG  1 
ATOM   1458 C CD  . ARG B 2 62  ? 36.245  4.056   39.781 1.00 34.31 ? 62  ARG B CD  1 
ATOM   1459 N NE  . ARG B 2 62  ? 37.134  4.995   39.103 1.00 38.18 ? 62  ARG B NE  1 
ATOM   1460 C CZ  . ARG B 2 62  ? 38.253  4.653   38.472 1.00 39.86 ? 62  ARG B CZ  1 
ATOM   1461 N NH1 . ARG B 2 62  ? 38.989  5.585   37.885 1.00 40.17 ? 62  ARG B NH1 1 
ATOM   1462 N NH2 . ARG B 2 62  ? 38.635  3.383   38.426 1.00 39.80 ? 62  ARG B NH2 1 
ATOM   1463 N N   . ILE B 2 63  ? 30.075  4.690   39.469 1.00 23.63 ? 63  ILE B N   1 
ATOM   1464 C CA  . ILE B 2 63  ? 28.826  4.091   39.012 1.00 23.14 ? 63  ILE B CA  1 
ATOM   1465 C C   . ILE B 2 63  ? 28.248  5.038   37.953 1.00 21.39 ? 63  ILE B C   1 
ATOM   1466 O O   . ILE B 2 63  ? 28.130  6.234   38.197 1.00 20.38 ? 63  ILE B O   1 
ATOM   1467 C CB  . ILE B 2 63  ? 27.830  3.932   40.191 1.00 23.25 ? 63  ILE B CB  1 
ATOM   1468 C CG1 . ILE B 2 63  ? 28.393  2.926   41.202 1.00 21.23 ? 63  ILE B CG1 1 
ATOM   1469 C CG2 . ILE B 2 63  ? 26.468  3.477   39.674 1.00 24.62 ? 63  ILE B CG2 1 
ATOM   1470 C CD1 . ILE B 2 63  ? 27.539  2.741   42.433 1.00 21.20 ? 63  ILE B CD1 1 
ATOM   1471 N N   . VAL B 2 64  ? 27.910  4.511   36.780 1.00 21.40 ? 64  VAL B N   1 
ATOM   1472 C CA  . VAL B 2 64  ? 27.372  5.352   35.707 1.00 21.00 ? 64  VAL B CA  1 
ATOM   1473 C C   . VAL B 2 64  ? 25.851  5.345   35.585 1.00 19.08 ? 64  VAL B C   1 
ATOM   1474 O O   . VAL B 2 64  ? 25.258  6.333   35.149 1.00 19.16 ? 64  VAL B O   1 
ATOM   1475 C CB  . VAL B 2 64  ? 27.958  4.959   34.330 1.00 22.04 ? 64  VAL B CB  1 
ATOM   1476 C CG1 . VAL B 2 64  ? 29.480  5.000   34.385 1.00 22.58 ? 64  VAL B CG1 1 
ATOM   1477 C CG2 . VAL B 2 64  ? 27.487  3.574   33.939 1.00 23.59 ? 64  VAL B CG2 1 
ATOM   1478 N N   . LEU B 2 65  ? 25.220  4.237   35.969 1.00 17.38 ? 65  LEU B N   1 
ATOM   1479 C CA  . LEU B 2 65  ? 23.762  4.128   35.879 1.00 17.04 ? 65  LEU B CA  1 
ATOM   1480 C C   . LEU B 2 65  ? 23.129  3.709   37.209 1.00 16.47 ? 65  LEU B C   1 
ATOM   1481 O O   . LEU B 2 65  ? 23.582  2.765   37.857 1.00 17.03 ? 65  LEU B O   1 
ATOM   1482 C CB  . LEU B 2 65  ? 23.370  3.101   34.806 1.00 16.57 ? 65  LEU B CB  1 
ATOM   1483 C CG  . LEU B 2 65  ? 23.862  3.284   33.362 1.00 16.30 ? 65  LEU B CG  1 
ATOM   1484 C CD1 . LEU B 2 65  ? 23.442  2.075   32.535 1.00 15.07 ? 65  LEU B CD1 1 
ATOM   1485 C CD2 . LEU B 2 65  ? 23.286  4.556   32.767 1.00 14.77 ? 65  LEU B CD2 1 
ATOM   1486 N N   . VAL B 2 66  ? 22.080  4.414   37.612 1.00 15.76 ? 66  VAL B N   1 
ATOM   1487 C CA  . VAL B 2 66  ? 21.379  4.079   38.844 1.00 14.16 ? 66  VAL B CA  1 
ATOM   1488 C C   . VAL B 2 66  ? 19.869  4.139   38.611 1.00 14.17 ? 66  VAL B C   1 
ATOM   1489 O O   . VAL B 2 66  ? 19.390  4.932   37.798 1.00 12.87 ? 66  VAL B O   1 
ATOM   1490 C CB  . VAL B 2 66  ? 21.732  5.053   39.997 1.00 13.41 ? 66  VAL B CB  1 
ATOM   1491 C CG1 . VAL B 2 66  ? 23.193  4.871   40.416 1.00 13.82 ? 66  VAL B CG1 1 
ATOM   1492 C CG2 . VAL B 2 66  ? 21.465  6.504   39.566 1.00 11.73 ? 66  VAL B CG2 1 
ATOM   1493 N N   . TRP B 2 67  ? 19.133  3.286   39.314 1.00 14.36 ? 67  TRP B N   1 
ATOM   1494 C CA  . TRP B 2 67  ? 17.670  3.262   39.240 1.00 13.86 ? 67  TRP B CA  1 
ATOM   1495 C C   . TRP B 2 67  ? 17.165  4.511   39.952 1.00 13.22 ? 67  TRP B C   1 
ATOM   1496 O O   . TRP B 2 67  ? 17.740  4.914   40.959 1.00 12.70 ? 67  TRP B O   1 
ATOM   1497 C CB  . TRP B 2 67  ? 17.095  2.068   40.013 1.00 13.23 ? 67  TRP B CB  1 
ATOM   1498 C CG  . TRP B 2 67  ? 17.209  0.721   39.356 1.00 12.99 ? 67  TRP B CG  1 
ATOM   1499 C CD1 . TRP B 2 67  ? 17.739  -0.411  39.905 1.00 10.57 ? 67  TRP B CD1 1 
ATOM   1500 C CD2 . TRP B 2 67  ? 16.703  0.347   38.070 1.00 12.66 ? 67  TRP B CD2 1 
ATOM   1501 N NE1 . TRP B 2 67  ? 17.592  -1.472  39.040 1.00 12.18 ? 67  TRP B NE1 1 
ATOM   1502 C CE2 . TRP B 2 67  ? 16.960  -1.032  37.905 1.00 13.09 ? 67  TRP B CE2 1 
ATOM   1503 C CE3 . TRP B 2 67  ? 16.054  1.043   37.040 1.00 12.67 ? 67  TRP B CE3 1 
ATOM   1504 C CZ2 . TRP B 2 67  ? 16.589  -1.729  36.753 1.00 13.46 ? 67  TRP B CZ2 1 
ATOM   1505 C CZ3 . TRP B 2 67  ? 15.684  0.349   35.890 1.00 13.01 ? 67  TRP B CZ3 1 
ATOM   1506 C CH2 . TRP B 2 67  ? 15.955  -1.024  35.758 1.00 12.99 ? 67  TRP B CH2 1 
ATOM   1507 N N   . ILE B 2 68  ? 16.108  5.124   39.427 1.00 12.90 ? 68  ILE B N   1 
ATOM   1508 C CA  . ILE B 2 68  ? 15.493  6.276   40.079 1.00 12.33 ? 68  ILE B CA  1 
ATOM   1509 C C   . ILE B 2 68  ? 14.023  5.886   40.247 1.00 11.50 ? 68  ILE B C   1 
ATOM   1510 O O   . ILE B 2 68  ? 13.532  4.997   39.549 1.00 11.87 ? 68  ILE B O   1 
ATOM   1511 C CB  . ILE B 2 68  ? 15.630  7.581   39.255 1.00 13.58 ? 68  ILE B CB  1 
ATOM   1512 C CG1 . ILE B 2 68  ? 14.935  7.447   37.901 1.00 12.98 ? 68  ILE B CG1 1 
ATOM   1513 C CG2 . ILE B 2 68  ? 17.110  7.946   39.119 1.00 13.29 ? 68  ILE B CG2 1 
ATOM   1514 C CD1 . ILE B 2 68  ? 14.948  8.735   37.121 1.00 13.25 ? 68  ILE B CD1 1 
ATOM   1515 N N   . GLY B 2 69  ? 13.332  6.543   41.169 1.00 10.83 ? 69  GLY B N   1 
ATOM   1516 C CA  . GLY B 2 69  ? 11.951  6.185   41.467 1.00 10.96 ? 69  GLY B CA  1 
ATOM   1517 C C   . GLY B 2 69  ? 10.848  6.484   40.477 1.00 11.51 ? 69  GLY B C   1 
ATOM   1518 O O   . GLY B 2 69  ? 9.775   6.941   40.875 1.00 11.47 ? 69  GLY B O   1 
ATOM   1519 N N   . LEU B 2 70  ? 11.081  6.188   39.205 1.00 11.65 ? 70  LEU B N   1 
ATOM   1520 C CA  . LEU B 2 70  ? 10.088  6.467   38.175 1.00 12.76 ? 70  LEU B CA  1 
ATOM   1521 C C   . LEU B 2 70  ? 9.791   5.194   37.377 1.00 13.87 ? 70  LEU B C   1 
ATOM   1522 O O   . LEU B 2 70  ? 10.709  4.549   36.857 1.00 13.48 ? 70  LEU B O   1 
ATOM   1523 C CB  . LEU B 2 70  ? 10.640  7.552   37.249 1.00 12.72 ? 70  LEU B CB  1 
ATOM   1524 C CG  . LEU B 2 70  ? 9.743   8.606   36.618 1.00 12.33 ? 70  LEU B CG  1 
ATOM   1525 C CD1 . LEU B 2 70  ? 8.939   9.354   37.697 1.00 9.89  ? 70  LEU B CD1 1 
ATOM   1526 C CD2 . LEU B 2 70  ? 10.638  9.566   35.825 1.00 11.39 ? 70  LEU B CD2 1 
ATOM   1527 N N   . SER B 2 71  ? 8.512   4.848   37.272 1.00 14.70 ? 71  SER B N   1 
ATOM   1528 C CA  . SER B 2 71  ? 8.087   3.654   36.549 1.00 16.85 ? 71  SER B CA  1 
ATOM   1529 C C   . SER B 2 71  ? 6.594   3.741   36.237 1.00 16.48 ? 71  SER B C   1 
ATOM   1530 O O   . SER B 2 71  ? 5.843   4.362   36.980 1.00 15.35 ? 71  SER B O   1 
ATOM   1531 C CB  . SER B 2 71  ? 8.349   2.406   37.402 1.00 18.49 ? 71  SER B CB  1 
ATOM   1532 O OG  . SER B 2 71  ? 7.859   1.240   36.767 1.00 21.98 ? 71  SER B OG  1 
ATOM   1533 N N   . HIS B 2 72  ? 6.165   3.116   35.145 1.00 16.63 ? 72  HIS B N   1 
ATOM   1534 C CA  . HIS B 2 72  ? 4.752   3.147   34.785 1.00 18.08 ? 72  HIS B CA  1 
ATOM   1535 C C   . HIS B 2 72  ? 4.409   2.049   33.786 1.00 18.32 ? 72  HIS B C   1 
ATOM   1536 O O   . HIS B 2 72  ? 5.300   1.462   33.172 1.00 16.58 ? 72  HIS B O   1 
ATOM   1537 C CB  . HIS B 2 72  ? 4.401   4.510   34.183 1.00 18.94 ? 72  HIS B CB  1 
ATOM   1538 C CG  . HIS B 2 72  ? 5.023   4.758   32.841 1.00 18.59 ? 72  HIS B CG  1 
ATOM   1539 N ND1 . HIS B 2 72  ? 4.491   4.266   31.670 1.00 20.53 ? 72  HIS B ND1 1 
ATOM   1540 C CD2 . HIS B 2 72  ? 6.142   5.437   32.490 1.00 19.15 ? 72  HIS B CD2 1 
ATOM   1541 C CE1 . HIS B 2 72  ? 5.253   4.631   30.651 1.00 20.04 ? 72  HIS B CE1 1 
ATOM   1542 N NE2 . HIS B 2 72  ? 6.261   5.343   31.123 1.00 21.35 ? 72  HIS B NE2 1 
ATOM   1543 N N   . PHE B 2 73  ? 3.116   1.752   33.662 1.00 19.23 ? 73  PHE B N   1 
ATOM   1544 C CA  . PHE B 2 73  ? 2.619   0.767   32.698 1.00 19.56 ? 73  PHE B CA  1 
ATOM   1545 C C   . PHE B 2 73  ? 1.834   1.613   31.696 1.00 19.38 ? 73  PHE B C   1 
ATOM   1546 O O   . PHE B 2 73  ? 1.288   2.647   32.068 1.00 18.50 ? 73  PHE B O   1 
ATOM   1547 C CB  . PHE B 2 73  ? 1.643   -0.232  33.335 1.00 20.23 ? 73  PHE B CB  1 
ATOM   1548 C CG  . PHE B 2 73  ? 2.260   -1.154  34.336 1.00 22.13 ? 73  PHE B CG  1 
ATOM   1549 C CD1 . PHE B 2 73  ? 2.553   -0.715  35.622 1.00 23.38 ? 73  PHE B CD1 1 
ATOM   1550 C CD2 . PHE B 2 73  ? 2.502   -2.485  34.008 1.00 23.73 ? 73  PHE B CD2 1 
ATOM   1551 C CE1 . PHE B 2 73  ? 3.075   -1.591  36.573 1.00 25.75 ? 73  PHE B CE1 1 
ATOM   1552 C CE2 . PHE B 2 73  ? 3.023   -3.373  34.951 1.00 25.61 ? 73  PHE B CE2 1 
ATOM   1553 C CZ  . PHE B 2 73  ? 3.309   -2.927  36.236 1.00 25.69 ? 73  PHE B CZ  1 
ATOM   1554 N N   . TRP B 2 74  ? 1.764   1.183   30.440 1.00 18.88 ? 74  TRP B N   1 
ATOM   1555 C CA  . TRP B 2 74  ? 1.027   1.946   29.435 1.00 19.60 ? 74  TRP B CA  1 
ATOM   1556 C C   . TRP B 2 74  ? -0.444  2.058   29.827 1.00 20.65 ? 74  TRP B C   1 
ATOM   1557 O O   . TRP B 2 74  ? -1.101  3.050   29.535 1.00 20.03 ? 74  TRP B O   1 
ATOM   1558 C CB  . TRP B 2 74  ? 1.162   1.285   28.054 1.00 17.94 ? 74  TRP B CB  1 
ATOM   1559 C CG  . TRP B 2 74  ? 2.540   1.427   27.492 1.00 16.66 ? 74  TRP B CG  1 
ATOM   1560 C CD1 . TRP B 2 74  ? 3.373   0.427   27.088 1.00 17.63 ? 74  TRP B CD1 1 
ATOM   1561 C CD2 . TRP B 2 74  ? 3.253   2.652   27.289 1.00 16.22 ? 74  TRP B CD2 1 
ATOM   1562 N NE1 . TRP B 2 74  ? 4.570   0.952   26.645 1.00 17.92 ? 74  TRP B NE1 1 
ATOM   1563 C CE2 . TRP B 2 74  ? 4.522   2.317   26.759 1.00 16.78 ? 74  TRP B CE2 1 
ATOM   1564 C CE3 . TRP B 2 74  ? 2.943   4.002   27.504 1.00 15.92 ? 74  TRP B CE3 1 
ATOM   1565 C CZ2 . TRP B 2 74  ? 5.481   3.281   26.442 1.00 16.13 ? 74  TRP B CZ2 1 
ATOM   1566 C CZ3 . TRP B 2 74  ? 3.896   4.965   27.187 1.00 17.54 ? 74  TRP B CZ3 1 
ATOM   1567 C CH2 . TRP B 2 74  ? 5.154   4.598   26.661 1.00 17.23 ? 74  TRP B CH2 1 
ATOM   1568 N N   . ARG B 2 75  ? -0.939  1.027   30.498 1.00 22.74 ? 75  ARG B N   1 
ATOM   1569 C CA  . ARG B 2 75  ? -2.321  0.967   30.958 1.00 26.00 ? 75  ARG B CA  1 
ATOM   1570 C C   . ARG B 2 75  ? -2.731  2.223   31.715 1.00 26.46 ? 75  ARG B C   1 
ATOM   1571 O O   . ARG B 2 75  ? -3.904  2.576   31.734 1.00 26.12 ? 75  ARG B O   1 
ATOM   1572 C CB  . ARG B 2 75  ? -2.504  -0.247  31.872 1.00 29.48 ? 75  ARG B CB  1 
ATOM   1573 C CG  . ARG B 2 75  ? -3.852  -0.337  32.573 1.00 35.49 ? 75  ARG B CG  1 
ATOM   1574 C CD  . ARG B 2 75  ? -3.670  -0.823  34.008 1.00 40.16 ? 75  ARG B CD  1 
ATOM   1575 N NE  . ARG B 2 75  ? -2.795  -1.993  34.093 1.00 44.80 ? 75  ARG B NE  1 
ATOM   1576 C CZ  . ARG B 2 75  ? -1.591  -2.001  34.660 1.00 45.96 ? 75  ARG B CZ  1 
ATOM   1577 N NH1 . ARG B 2 75  ? -1.103  -0.897  35.201 1.00 45.83 ? 75  ARG B NH1 1 
ATOM   1578 N NH2 . ARG B 2 75  ? -0.876  -3.118  34.681 1.00 47.16 ? 75  ARG B NH2 1 
ATOM   1579 N N   . ILE B 2 76  ? -1.769  2.900   32.338 1.00 26.65 ? 76  ILE B N   1 
ATOM   1580 C CA  . ILE B 2 76  ? -2.079  4.099   33.106 1.00 26.60 ? 76  ILE B CA  1 
ATOM   1581 C C   . ILE B 2 76  ? -1.726  5.419   32.424 1.00 24.78 ? 76  ILE B C   1 
ATOM   1582 O O   . ILE B 2 76  ? -1.723  6.466   33.069 1.00 24.51 ? 76  ILE B O   1 
ATOM   1583 C CB  . ILE B 2 76  ? -1.402  4.050   34.510 1.00 29.61 ? 76  ILE B CB  1 
ATOM   1584 C CG1 . ILE B 2 76  ? 0.109   3.855   34.368 1.00 30.63 ? 76  ILE B CG1 1 
ATOM   1585 C CG2 . ILE B 2 76  ? -2.000  2.920   35.336 1.00 31.76 ? 76  ILE B CG2 1 
ATOM   1586 C CD1 . ILE B 2 76  ? 0.843   3.655   35.695 1.00 29.35 ? 76  ILE B CD1 1 
ATOM   1587 N N   . CYS B 2 77  ? -1.448  5.377   31.123 1.00 23.23 ? 77  CYS B N   1 
ATOM   1588 C CA  . CYS B 2 77  ? -1.116  6.591   30.379 1.00 21.21 ? 77  CYS B CA  1 
ATOM   1589 C C   . CYS B 2 77  ? -2.269  7.002   29.465 1.00 19.70 ? 77  CYS B C   1 
ATOM   1590 O O   . CYS B 2 77  ? -3.002  6.164   28.954 1.00 18.57 ? 77  CYS B O   1 
ATOM   1591 C CB  . CYS B 2 77  ? 0.165   6.381   29.568 1.00 21.21 ? 77  CYS B CB  1 
ATOM   1592 S SG  . CYS B 2 77  ? 1.463   5.722   30.652 1.00 23.56 ? 77  CYS B SG  1 
ATOM   1593 N N   . PRO B 2 78  ? -2.444  8.313   29.264 1.00 19.13 ? 78  PRO B N   1 
ATOM   1594 C CA  . PRO B 2 78  ? -3.519  8.818   28.408 1.00 18.76 ? 78  PRO B CA  1 
ATOM   1595 C C   . PRO B 2 78  ? -3.245  8.588   26.919 1.00 17.35 ? 78  PRO B C   1 
ATOM   1596 O O   . PRO B 2 78  ? -2.941  9.524   26.189 1.00 17.65 ? 78  PRO B O   1 
ATOM   1597 C CB  . PRO B 2 78  ? -3.577  10.303  28.777 1.00 17.99 ? 78  PRO B CB  1 
ATOM   1598 C CG  . PRO B 2 78  ? -2.132  10.613  29.076 1.00 19.31 ? 78  PRO B CG  1 
ATOM   1599 C CD  . PRO B 2 78  ? -1.705  9.419   29.900 1.00 19.27 ? 78  PRO B CD  1 
ATOM   1600 N N   . LEU B 2 79  ? -3.341  7.346   26.470 1.00 18.09 ? 79  LEU B N   1 
ATOM   1601 C CA  . LEU B 2 79  ? -3.102  7.058   25.055 1.00 18.75 ? 79  LEU B CA  1 
ATOM   1602 C C   . LEU B 2 79  ? -4.386  7.314   24.278 1.00 18.29 ? 79  LEU B C   1 
ATOM   1603 O O   . LEU B 2 79  ? -5.439  6.784   24.628 1.00 19.35 ? 79  LEU B O   1 
ATOM   1604 C CB  . LEU B 2 79  ? -2.666  5.608   24.870 1.00 18.05 ? 79  LEU B CB  1 
ATOM   1605 C CG  . LEU B 2 79  ? -1.476  5.147   25.711 1.00 17.87 ? 79  LEU B CG  1 
ATOM   1606 C CD1 . LEU B 2 79  ? -1.175  3.698   25.358 1.00 18.91 ? 79  LEU B CD1 1 
ATOM   1607 C CD2 . LEU B 2 79  ? -0.262  6.031   25.465 1.00 18.36 ? 79  LEU B CD2 1 
ATOM   1608 N N   . ARG B 2 80  ? -4.298  8.116   23.223 1.00 18.99 ? 80  ARG B N   1 
ATOM   1609 C CA  . ARG B 2 80  ? -5.476  8.450   22.429 1.00 20.75 ? 80  ARG B CA  1 
ATOM   1610 C C   . ARG B 2 80  ? -5.257  8.249   20.934 1.00 19.84 ? 80  ARG B C   1 
ATOM   1611 O O   . ARG B 2 80  ? -4.152  8.455   20.430 1.00 19.32 ? 80  ARG B O   1 
ATOM   1612 C CB  . ARG B 2 80  ? -5.845  9.919   22.647 1.00 23.93 ? 80  ARG B CB  1 
ATOM   1613 C CG  . ARG B 2 80  ? -5.691  10.412  24.069 1.00 29.07 ? 80  ARG B CG  1 
ATOM   1614 C CD  . ARG B 2 80  ? -6.916  10.116  24.908 1.00 35.37 ? 80  ARG B CD  1 
ATOM   1615 N NE  . ARG B 2 80  ? -6.806  10.690  26.249 1.00 42.24 ? 80  ARG B NE  1 
ATOM   1616 C CZ  . ARG B 2 80  ? -6.546  11.972  26.501 1.00 45.04 ? 80  ARG B CZ  1 
ATOM   1617 N NH1 . ARG B 2 80  ? -6.365  12.831  25.504 1.00 46.21 ? 80  ARG B NH1 1 
ATOM   1618 N NH2 . ARG B 2 80  ? -6.457  12.399  27.755 1.00 45.64 ? 80  ARG B NH2 1 
ATOM   1619 N N   . TRP B 2 81  ? -6.315  7.847   20.231 1.00 19.64 ? 81  TRP B N   1 
ATOM   1620 C CA  . TRP B 2 81  ? -6.244  7.683   18.785 1.00 19.35 ? 81  TRP B CA  1 
ATOM   1621 C C   . TRP B 2 81  ? -6.510  9.059   18.193 1.00 20.18 ? 81  TRP B C   1 
ATOM   1622 O O   . TRP B 2 81  ? -7.365  9.807   18.673 1.00 19.59 ? 81  TRP B O   1 
ATOM   1623 C CB  . TRP B 2 81  ? -7.302  6.710   18.268 1.00 17.92 ? 81  TRP B CB  1 
ATOM   1624 C CG  . TRP B 2 81  ? -6.994  5.278   18.526 1.00 15.96 ? 81  TRP B CG  1 
ATOM   1625 C CD1 . TRP B 2 81  ? -7.721  4.413   19.289 1.00 13.82 ? 81  TRP B CD1 1 
ATOM   1626 C CD2 . TRP B 2 81  ? -5.890  4.529   18.000 1.00 15.41 ? 81  TRP B CD2 1 
ATOM   1627 N NE1 . TRP B 2 81  ? -7.139  3.168   19.272 1.00 16.87 ? 81  TRP B NE1 1 
ATOM   1628 C CE2 . TRP B 2 81  ? -6.014  3.209   18.490 1.00 16.09 ? 81  TRP B CE2 1 
ATOM   1629 C CE3 . TRP B 2 81  ? -4.808  4.843   17.166 1.00 13.71 ? 81  TRP B CE3 1 
ATOM   1630 C CZ2 . TRP B 2 81  ? -5.094  2.196   18.171 1.00 14.35 ? 81  TRP B CZ2 1 
ATOM   1631 C CZ3 . TRP B 2 81  ? -3.891  3.838   16.847 1.00 11.58 ? 81  TRP B CZ3 1 
ATOM   1632 C CH2 . TRP B 2 81  ? -4.043  2.530   17.352 1.00 13.24 ? 81  TRP B CH2 1 
ATOM   1633 N N   . THR B 2 82  ? -5.786  9.377   17.136 1.00 20.31 ? 82  THR B N   1 
ATOM   1634 C CA  . THR B 2 82  ? -5.911  10.660  16.487 1.00 21.69 ? 82  THR B CA  1 
ATOM   1635 C C   . THR B 2 82  ? -7.314  10.881  15.898 1.00 23.14 ? 82  THR B C   1 
ATOM   1636 O O   . THR B 2 82  ? -7.725  12.021  15.654 1.00 22.27 ? 82  THR B O   1 
ATOM   1637 C CB  . THR B 2 82  ? -4.823  10.762  15.400 1.00 22.07 ? 82  THR B CB  1 
ATOM   1638 O OG1 . THR B 2 82  ? -4.349  12.109  15.315 1.00 23.35 ? 82  THR B OG1 1 
ATOM   1639 C CG2 . THR B 2 82  ? -5.352  10.295  14.062 1.00 22.09 ? 82  THR B CG2 1 
ATOM   1640 N N   . ASP B 2 83  ? -8.057  9.795   15.685 1.00 23.83 ? 83  ASP B N   1 
ATOM   1641 C CA  . ASP B 2 83  ? -9.396  9.904   15.118 1.00 25.49 ? 83  ASP B CA  1 
ATOM   1642 C C   . ASP B 2 83  ? -10.519 9.871   16.160 1.00 26.56 ? 83  ASP B C   1 
ATOM   1643 O O   . ASP B 2 83  ? -11.690 9.803   15.809 1.00 26.57 ? 83  ASP B O   1 
ATOM   1644 C CB  . ASP B 2 83  ? -9.623  8.803   14.066 1.00 26.20 ? 83  ASP B CB  1 
ATOM   1645 C CG  . ASP B 2 83  ? -9.534  7.404   14.645 1.00 27.71 ? 83  ASP B CG  1 
ATOM   1646 O OD1 . ASP B 2 83  ? -9.638  6.426   13.865 1.00 25.40 ? 83  ASP B OD1 1 
ATOM   1647 O OD2 . ASP B 2 83  ? -9.364  7.279   15.876 1.00 29.31 ? 83  ASP B OD2 1 
ATOM   1648 N N   . GLY B 2 84  ? -10.160 9.919   17.438 1.00 27.30 ? 84  GLY B N   1 
ATOM   1649 C CA  . GLY B 2 84  ? -11.164 9.910   18.486 1.00 29.68 ? 84  GLY B CA  1 
ATOM   1650 C C   . GLY B 2 84  ? -11.647 8.540   18.926 1.00 31.37 ? 84  GLY B C   1 
ATOM   1651 O O   . GLY B 2 84  ? -12.281 8.408   19.972 1.00 31.66 ? 84  GLY B O   1 
ATOM   1652 N N   . ALA B 2 85  ? -11.362 7.515   18.130 1.00 32.50 ? 85  ALA B N   1 
ATOM   1653 C CA  . ALA B 2 85  ? -11.787 6.166   18.475 1.00 33.79 ? 85  ALA B CA  1 
ATOM   1654 C C   . ALA B 2 85  ? -11.319 5.812   19.883 1.00 34.81 ? 85  ALA B C   1 
ATOM   1655 O O   . ALA B 2 85  ? -10.358 6.386   20.396 1.00 34.35 ? 85  ALA B O   1 
ATOM   1656 C CB  . ALA B 2 85  ? -11.228 5.165   17.467 1.00 34.11 ? 85  ALA B CB  1 
ATOM   1657 N N   . ARG B 2 86  ? -12.014 4.871   20.508 1.00 37.01 ? 86  ARG B N   1 
ATOM   1658 C CA  . ARG B 2 86  ? -11.662 4.428   21.848 1.00 38.65 ? 86  ARG B CA  1 
ATOM   1659 C C   . ARG B 2 86  ? -10.562 3.387   21.745 1.00 37.44 ? 86  ARG B C   1 
ATOM   1660 O O   . ARG B 2 86  ? -10.498 2.639   20.766 1.00 37.14 ? 86  ARG B O   1 
ATOM   1661 C CB  . ARG B 2 86  ? -12.887 3.821   22.543 1.00 41.92 ? 86  ARG B CB  1 
ATOM   1662 C CG  . ARG B 2 86  ? -13.767 4.839   23.260 1.00 45.93 ? 86  ARG B CG  1 
ATOM   1663 C CD  . ARG B 2 86  ? -13.347 4.992   24.717 1.00 49.51 ? 86  ARG B CD  1 
ATOM   1664 N NE  . ARG B 2 86  ? -13.641 3.786   25.489 1.00 52.95 ? 86  ARG B NE  1 
ATOM   1665 C CZ  . ARG B 2 86  ? -13.265 3.588   26.749 1.00 54.26 ? 86  ARG B CZ  1 
ATOM   1666 N NH1 . ARG B 2 86  ? -12.570 4.517   27.395 1.00 55.01 ? 86  ARG B NH1 1 
ATOM   1667 N NH2 . ARG B 2 86  ? -13.583 2.457   27.365 1.00 54.41 ? 86  ARG B NH2 1 
ATOM   1668 N N   . LEU B 2 87  ? -9.691  3.350   22.746 1.00 35.87 ? 87  LEU B N   1 
ATOM   1669 C CA  . LEU B 2 87  ? -8.604  2.385   22.762 1.00 35.04 ? 87  LEU B CA  1 
ATOM   1670 C C   . LEU B 2 87  ? -9.099  1.061   23.339 1.00 35.65 ? 87  LEU B C   1 
ATOM   1671 O O   . LEU B 2 87  ? -9.053  0.836   24.548 1.00 36.67 ? 87  LEU B O   1 
ATOM   1672 C CB  . LEU B 2 87  ? -7.422  2.913   23.587 1.00 33.85 ? 87  LEU B CB  1 
ATOM   1673 C CG  . LEU B 2 87  ? -6.188  2.000   23.649 1.00 32.66 ? 87  LEU B CG  1 
ATOM   1674 C CD1 . LEU B 2 87  ? -5.675  1.728   22.241 1.00 32.21 ? 87  LEU B CD1 1 
ATOM   1675 C CD2 . LEU B 2 87  ? -5.099  2.645   24.495 1.00 30.47 ? 87  LEU B CD2 1 
ATOM   1676 N N   . ASP B 2 88  ? -9.592  0.197   22.460 1.00 36.21 ? 88  ASP B N   1 
ATOM   1677 C CA  . ASP B 2 88  ? -10.089 -1.116  22.852 1.00 36.78 ? 88  ASP B CA  1 
ATOM   1678 C C   . ASP B 2 88  ? -8.939  -2.105  22.716 1.00 34.73 ? 88  ASP B C   1 
ATOM   1679 O O   . ASP B 2 88  ? -8.299  -2.486  23.700 1.00 35.46 ? 88  ASP B O   1 
ATOM   1680 C CB  . ASP B 2 88  ? -11.242 -1.536  21.934 1.00 40.05 ? 88  ASP B CB  1 
ATOM   1681 C CG  . ASP B 2 88  ? -12.567 -1.634  22.666 1.00 43.74 ? 88  ASP B CG  1 
ATOM   1682 O OD1 . ASP B 2 88  ? -13.622 -1.689  21.990 1.00 45.63 ? 88  ASP B OD1 1 
ATOM   1683 O OD2 . ASP B 2 88  ? -12.552 -1.665  23.917 1.00 44.16 ? 88  ASP B OD2 1 
ATOM   1684 N N   . TYR B 2 89  ? -8.680  -2.513  21.482 1.00 31.89 ? 89  TYR B N   1 
ATOM   1685 C CA  . TYR B 2 89  ? -7.602  -3.444  21.195 1.00 31.19 ? 89  TYR B CA  1 
ATOM   1686 C C   . TYR B 2 89  ? -6.251  -2.734  21.312 1.00 30.67 ? 89  TYR B C   1 
ATOM   1687 O O   . TYR B 2 89  ? -6.104  -1.585  20.895 1.00 29.59 ? 89  TYR B O   1 
ATOM   1688 C CB  . TYR B 2 89  ? -7.767  -4.003  19.780 1.00 30.66 ? 89  TYR B CB  1 
ATOM   1689 C CG  . TYR B 2 89  ? -6.625  -4.884  19.337 1.00 30.68 ? 89  TYR B CG  1 
ATOM   1690 C CD1 . TYR B 2 89  ? -6.561  -6.224  19.714 1.00 31.13 ? 89  TYR B CD1 1 
ATOM   1691 C CD2 . TYR B 2 89  ? -5.584  -4.365  18.566 1.00 30.42 ? 89  TYR B CD2 1 
ATOM   1692 C CE1 . TYR B 2 89  ? -5.487  -7.026  19.335 1.00 31.12 ? 89  TYR B CE1 1 
ATOM   1693 C CE2 . TYR B 2 89  ? -4.507  -5.159  18.185 1.00 30.50 ? 89  TYR B CE2 1 
ATOM   1694 C CZ  . TYR B 2 89  ? -4.464  -6.485  18.571 1.00 30.79 ? 89  TYR B CZ  1 
ATOM   1695 O OH  . TYR B 2 89  ? -3.395  -7.265  18.198 1.00 32.61 ? 89  TYR B OH  1 
ATOM   1696 N N   . ARG B 2 90  ? -5.270  -3.420  21.885 1.00 30.03 ? 90  ARG B N   1 
ATOM   1697 C CA  . ARG B 2 90  ? -3.938  -2.848  22.025 1.00 29.87 ? 90  ARG B CA  1 
ATOM   1698 C C   . ARG B 2 90  ? -2.891  -3.916  21.788 1.00 28.10 ? 90  ARG B C   1 
ATOM   1699 O O   . ARG B 2 90  ? -3.065  -5.066  22.177 1.00 28.01 ? 90  ARG B O   1 
ATOM   1700 C CB  . ARG B 2 90  ? -3.748  -2.239  23.419 1.00 32.00 ? 90  ARG B CB  1 
ATOM   1701 C CG  . ARG B 2 90  ? -3.918  -3.213  24.561 1.00 34.35 ? 90  ARG B CG  1 
ATOM   1702 C CD  . ARG B 2 90  ? -4.983  -2.704  25.525 1.00 36.71 ? 90  ARG B CD  1 
ATOM   1703 N NE  . ARG B 2 90  ? -4.625  -1.418  26.116 1.00 36.43 ? 90  ARG B NE  1 
ATOM   1704 C CZ  . ARG B 2 90  ? -5.512  -0.519  26.533 1.00 37.65 ? 90  ARG B CZ  1 
ATOM   1705 N NH1 . ARG B 2 90  ? -6.813  -0.766  26.418 1.00 37.41 ? 90  ARG B NH1 1 
ATOM   1706 N NH2 . ARG B 2 90  ? -5.101  0.625   27.068 1.00 37.19 ? 90  ARG B NH2 1 
ATOM   1707 N N   . ALA B 2 91  ? -1.807  -3.530  21.128 1.00 26.69 ? 91  ALA B N   1 
ATOM   1708 C CA  . ALA B 2 91  ? -0.724  -4.453  20.852 1.00 25.28 ? 91  ALA B CA  1 
ATOM   1709 C C   . ALA B 2 91  ? 0.541   -3.891  21.481 1.00 24.73 ? 91  ALA B C   1 
ATOM   1710 O O   . ALA B 2 91  ? 1.621   -3.936  20.896 1.00 25.11 ? 91  ALA B O   1 
ATOM   1711 C CB  . ALA B 2 91  ? -0.546  -4.625  19.349 1.00 24.34 ? 91  ALA B CB  1 
ATOM   1712 N N   . LEU B 2 92  ? 0.388   -3.361  22.689 1.00 25.25 ? 92  LEU B N   1 
ATOM   1713 C CA  . LEU B 2 92  ? 1.504   -2.792  23.430 1.00 26.45 ? 92  LEU B CA  1 
ATOM   1714 C C   . LEU B 2 92  ? 1.990   -3.760  24.499 1.00 27.61 ? 92  LEU B C   1 
ATOM   1715 O O   . LEU B 2 92  ? 1.256   -4.650  24.938 1.00 27.14 ? 92  LEU B O   1 
ATOM   1716 C CB  . LEU B 2 92  ? 1.076   -1.498  24.118 1.00 26.57 ? 92  LEU B CB  1 
ATOM   1717 C CG  . LEU B 2 92  ? 0.521   -0.380  23.243 1.00 26.89 ? 92  LEU B CG  1 
ATOM   1718 C CD1 . LEU B 2 92  ? -0.070  0.703   24.116 1.00 26.64 ? 92  LEU B CD1 1 
ATOM   1719 C CD2 . LEU B 2 92  ? 1.624   0.169   22.371 1.00 28.19 ? 92  LEU B CD2 1 
ATOM   1720 N N   . SER B 2 93  ? 3.234   -3.578  24.920 1.00 27.87 ? 93  SER B N   1 
ATOM   1721 C CA  . SER B 2 93  ? 3.800   -4.401  25.971 1.00 27.60 ? 93  SER B CA  1 
ATOM   1722 C C   . SER B 2 93  ? 3.020   -4.106  27.254 1.00 27.12 ? 93  SER B C   1 
ATOM   1723 O O   . SER B 2 93  ? 2.682   -2.954  27.528 1.00 24.50 ? 93  SER B O   1 
ATOM   1724 C CB  . SER B 2 93  ? 5.276   -4.041  26.168 1.00 28.06 ? 93  SER B CB  1 
ATOM   1725 O OG  . SER B 2 93  ? 5.727   -4.426  27.452 1.00 28.81 ? 93  SER B OG  1 
ATOM   1726 N N   . ASP B 2 94  ? 2.710   -5.140  28.028 1.00 28.37 ? 94  ASP B N   1 
ATOM   1727 C CA  . ASP B 2 94  ? 1.998   -4.935  29.285 1.00 31.08 ? 94  ASP B CA  1 
ATOM   1728 C C   . ASP B 2 94  ? 2.996   -4.980  30.436 1.00 30.61 ? 94  ASP B C   1 
ATOM   1729 O O   . ASP B 2 94  ? 2.628   -5.132  31.601 1.00 30.75 ? 94  ASP B O   1 
ATOM   1730 C CB  . ASP B 2 94  ? 0.904   -5.993  29.476 1.00 33.84 ? 94  ASP B CB  1 
ATOM   1731 C CG  . ASP B 2 94  ? 1.377   -7.391  29.143 1.00 38.17 ? 94  ASP B CG  1 
ATOM   1732 O OD1 . ASP B 2 94  ? 2.408   -7.818  29.700 1.00 40.14 ? 94  ASP B OD1 1 
ATOM   1733 O OD2 . ASP B 2 94  ? 0.713   -8.064  28.323 1.00 40.42 ? 94  ASP B OD2 1 
ATOM   1734 N N   . GLU B 2 95  ? 4.270   -4.841  30.087 1.00 30.05 ? 95  GLU B N   1 
ATOM   1735 C CA  . GLU B 2 95  ? 5.351   -4.842  31.066 1.00 29.79 ? 95  GLU B CA  1 
ATOM   1736 C C   . GLU B 2 95  ? 5.621   -3.383  31.457 1.00 27.49 ? 95  GLU B C   1 
ATOM   1737 O O   . GLU B 2 95  ? 5.471   -2.476  30.641 1.00 26.80 ? 95  GLU B O   1 
ATOM   1738 C CB  . GLU B 2 95  ? 6.602   -5.464  30.441 1.00 33.22 ? 95  GLU B CB  1 
ATOM   1739 C CG  . GLU B 2 95  ? 7.424   -6.347  31.369 1.00 40.63 ? 95  GLU B CG  1 
ATOM   1740 C CD  . GLU B 2 95  ? 6.669   -7.585  31.835 1.00 44.22 ? 95  GLU B CD  1 
ATOM   1741 O OE1 . GLU B 2 95  ? 7.331   -8.562  32.245 1.00 47.23 ? 95  GLU B OE1 1 
ATOM   1742 O OE2 . GLU B 2 95  ? 5.419   -7.581  31.804 1.00 47.53 ? 95  GLU B OE2 1 
ATOM   1743 N N   . PRO B 2 96  ? 6.021   -3.139  32.712 1.00 25.54 ? 96  PRO B N   1 
ATOM   1744 C CA  . PRO B 2 96  ? 6.290   -1.762  33.132 1.00 25.03 ? 96  PRO B CA  1 
ATOM   1745 C C   . PRO B 2 96  ? 7.538   -1.178  32.479 1.00 24.62 ? 96  PRO B C   1 
ATOM   1746 O O   . PRO B 2 96  ? 8.373   -1.907  31.942 1.00 25.25 ? 96  PRO B O   1 
ATOM   1747 C CB  . PRO B 2 96  ? 6.444   -1.891  34.643 1.00 24.80 ? 96  PRO B CB  1 
ATOM   1748 C CG  . PRO B 2 96  ? 7.088   -3.233  34.782 1.00 25.09 ? 96  PRO B CG  1 
ATOM   1749 C CD  . PRO B 2 96  ? 6.291   -4.085  33.808 1.00 25.18 ? 96  PRO B CD  1 
ATOM   1750 N N   . ILE B 2 97  ? 7.643   0.145   32.528 1.00 23.63 ? 97  ILE B N   1 
ATOM   1751 C CA  . ILE B 2 97  ? 8.785   0.874   31.986 1.00 21.37 ? 97  ILE B CA  1 
ATOM   1752 C C   . ILE B 2 97  ? 9.487   1.462   33.208 1.00 19.39 ? 97  ILE B C   1 
ATOM   1753 O O   . ILE B 2 97  ? 8.830   2.017   34.077 1.00 18.46 ? 97  ILE B O   1 
ATOM   1754 C CB  . ILE B 2 97  ? 8.331   2.041   31.079 1.00 22.82 ? 97  ILE B CB  1 
ATOM   1755 C CG1 . ILE B 2 97  ? 7.474   1.520   29.921 1.00 22.98 ? 97  ILE B CG1 1 
ATOM   1756 C CG2 . ILE B 2 97  ? 9.545   2.799   30.559 1.00 22.73 ? 97  ILE B CG2 1 
ATOM   1757 C CD1 . ILE B 2 97  ? 8.200   0.583   28.995 1.00 24.82 ? 97  ILE B CD1 1 
ATOM   1758 N N   . CYS B 2 98  ? 10.805  1.318   33.290 1.00 18.82 ? 98  CYS B N   1 
ATOM   1759 C CA  . CYS B 2 98  ? 11.559  1.862   34.419 1.00 18.15 ? 98  CYS B CA  1 
ATOM   1760 C C   . CYS B 2 98  ? 12.640  2.813   33.902 1.00 18.25 ? 98  CYS B C   1 
ATOM   1761 O O   . CYS B 2 98  ? 13.030  2.738   32.737 1.00 17.53 ? 98  CYS B O   1 
ATOM   1762 C CB  . CYS B 2 98  ? 12.184  0.732   35.255 1.00 17.35 ? 98  CYS B CB  1 
ATOM   1763 S SG  . CYS B 2 98  ? 10.906  -0.239  36.109 1.00 16.56 ? 98  CYS B SG  1 
ATOM   1764 N N   . PHE B 2 99  ? 13.103  3.717   34.762 1.00 17.08 ? 99  PHE B N   1 
ATOM   1765 C CA  . PHE B 2 99  ? 14.121  4.677   34.362 1.00 16.87 ? 99  PHE B CA  1 
ATOM   1766 C C   . PHE B 2 99  ? 15.368  4.646   35.237 1.00 16.27 ? 99  PHE B C   1 
ATOM   1767 O O   . PHE B 2 99  ? 15.293  4.421   36.447 1.00 15.30 ? 99  PHE B O   1 
ATOM   1768 C CB  . PHE B 2 99  ? 13.569  6.110   34.396 1.00 15.27 ? 99  PHE B CB  1 
ATOM   1769 C CG  . PHE B 2 99  ? 12.545  6.408   33.336 1.00 15.14 ? 99  PHE B CG  1 
ATOM   1770 C CD1 . PHE B 2 99  ? 11.210  6.042   33.504 1.00 14.81 ? 99  PHE B CD1 1 
ATOM   1771 C CD2 . PHE B 2 99  ? 12.923  7.045   32.156 1.00 15.80 ? 99  PHE B CD2 1 
ATOM   1772 C CE1 . PHE B 2 99  ? 10.260  6.307   32.505 1.00 15.79 ? 99  PHE B CE1 1 
ATOM   1773 C CE2 . PHE B 2 99  ? 11.987  7.313   31.155 1.00 16.29 ? 99  PHE B CE2 1 
ATOM   1774 C CZ  . PHE B 2 99  ? 10.654  6.944   31.329 1.00 16.77 ? 99  PHE B CZ  1 
ATOM   1775 N N   . VAL B 2 100 ? 16.509  4.873   34.593 1.00 16.87 ? 100 VAL B N   1 
ATOM   1776 C CA  . VAL B 2 100 ? 17.803  4.955   35.256 1.00 16.39 ? 100 VAL B CA  1 
ATOM   1777 C C   . VAL B 2 100 ? 18.332  6.336   34.912 1.00 15.60 ? 100 VAL B C   1 
ATOM   1778 O O   . VAL B 2 100 ? 17.922  6.930   33.911 1.00 15.67 ? 100 VAL B O   1 
ATOM   1779 C CB  . VAL B 2 100 ? 18.826  3.930   34.710 1.00 17.76 ? 100 VAL B CB  1 
ATOM   1780 C CG1 . VAL B 2 100 ? 18.446  2.524   35.126 1.00 16.83 ? 100 VAL B CG1 1 
ATOM   1781 C CG2 . VAL B 2 100 ? 18.915  4.051   33.196 1.00 16.84 ? 100 VAL B CG2 1 
ATOM   1782 N N   . ALA B 2 101 ? 19.219  6.862   35.747 1.00 14.28 ? 101 ALA B N   1 
ATOM   1783 C CA  . ALA B 2 101 ? 19.813  8.156   35.472 1.00 14.55 ? 101 ALA B CA  1 
ATOM   1784 C C   . ALA B 2 101 ? 21.284  7.849   35.188 1.00 15.60 ? 101 ALA B C   1 
ATOM   1785 O O   . ALA B 2 101 ? 21.882  7.014   35.870 1.00 13.94 ? 101 ALA B O   1 
ATOM   1786 C CB  . ALA B 2 101 ? 19.683  9.078   36.681 1.00 13.09 ? 101 ALA B CB  1 
ATOM   1787 N N   . GLU B 2 102 ? 21.852  8.505   34.178 1.00 16.45 ? 102 GLU B N   1 
ATOM   1788 C CA  . GLU B 2 102 ? 23.254  8.294   33.807 1.00 18.31 ? 102 GLU B CA  1 
ATOM   1789 C C   . GLU B 2 102 ? 24.120  9.408   34.395 1.00 17.76 ? 102 GLU B C   1 
ATOM   1790 O O   . GLU B 2 102 ? 23.805  10.593  34.288 1.00 18.88 ? 102 GLU B O   1 
ATOM   1791 C CB  . GLU B 2 102 ? 23.396  8.199   32.271 1.00 19.91 ? 102 GLU B CB  1 
ATOM   1792 C CG  . GLU B 2 102 ? 22.843  9.371   31.486 1.00 22.40 ? 102 GLU B CG  1 
ATOM   1793 C CD  . GLU B 2 102 ? 23.821  10.522  31.397 1.00 25.42 ? 102 GLU B CD  1 
ATOM   1794 O OE1 . GLU B 2 102 ? 23.365  11.679  31.269 1.00 26.65 ? 102 GLU B OE1 1 
ATOM   1795 O OE2 . GLU B 2 102 ? 25.045  10.268  31.440 1.00 26.26 ? 102 GLU B OE2 1 
ATOM   1796 N N   . SER B 2 103 ? 25.215  9.005   35.028 1.00 17.87 ? 103 SER B N   1 
ATOM   1797 C CA  . SER B 2 103 ? 26.109  9.936   35.716 1.00 18.84 ? 103 SER B CA  1 
ATOM   1798 C C   . SER B 2 103 ? 26.810  11.054  34.956 1.00 20.04 ? 103 SER B C   1 
ATOM   1799 O O   . SER B 2 103 ? 27.187  12.050  35.569 1.00 20.53 ? 103 SER B O   1 
ATOM   1800 C CB  . SER B 2 103 ? 27.154  9.144   36.498 1.00 19.57 ? 103 SER B CB  1 
ATOM   1801 O OG  . SER B 2 103 ? 26.535  8.337   37.486 1.00 21.32 ? 103 SER B OG  1 
ATOM   1802 N N   . PHE B 2 104 ? 26.985  10.914  33.644 1.00 20.75 ? 104 PHE B N   1 
ATOM   1803 C CA  . PHE B 2 104 ? 27.680  11.943  32.869 1.00 22.30 ? 104 PHE B CA  1 
ATOM   1804 C C   . PHE B 2 104 ? 26.879  13.224  32.623 1.00 23.19 ? 104 PHE B C   1 
ATOM   1805 O O   . PHE B 2 104 ? 27.371  14.325  32.876 1.00 22.19 ? 104 PHE B O   1 
ATOM   1806 C CB  . PHE B 2 104 ? 28.151  11.363  31.526 1.00 23.02 ? 104 PHE B CB  1 
ATOM   1807 C CG  . PHE B 2 104 ? 29.048  10.161  31.669 1.00 24.24 ? 104 PHE B CG  1 
ATOM   1808 C CD1 . PHE B 2 104 ? 28.725  8.955   31.053 1.00 24.87 ? 104 PHE B CD1 1 
ATOM   1809 C CD2 . PHE B 2 104 ? 30.202  10.228  32.437 1.00 24.77 ? 104 PHE B CD2 1 
ATOM   1810 C CE1 . PHE B 2 104 ? 29.540  7.833   31.207 1.00 26.22 ? 104 PHE B CE1 1 
ATOM   1811 C CE2 . PHE B 2 104 ? 31.023  9.111   32.597 1.00 25.88 ? 104 PHE B CE2 1 
ATOM   1812 C CZ  . PHE B 2 104 ? 30.692  7.913   31.983 1.00 25.14 ? 104 PHE B CZ  1 
ATOM   1813 N N   . HIS B 2 105 ? 25.647  13.083  32.137 1.00 25.66 ? 105 HIS B N   1 
ATOM   1814 C CA  . HIS B 2 105 ? 24.805  14.244  31.854 1.00 28.03 ? 105 HIS B CA  1 
ATOM   1815 C C   . HIS B 2 105 ? 23.514  14.335  32.670 1.00 28.26 ? 105 HIS B C   1 
ATOM   1816 O O   . HIS B 2 105 ? 22.683  15.213  32.435 1.00 27.81 ? 105 HIS B O   1 
ATOM   1817 C CB  . HIS B 2 105 ? 24.480  14.289  30.362 1.00 30.89 ? 105 HIS B CB  1 
ATOM   1818 C CG  . HIS B 2 105 ? 25.664  14.613  29.506 1.00 33.75 ? 105 HIS B CG  1 
ATOM   1819 N ND1 . HIS B 2 105 ? 26.303  15.832  29.560 1.00 35.25 ? 105 HIS B ND1 1 
ATOM   1820 C CD2 . HIS B 2 105 ? 26.351  13.861  28.616 1.00 34.91 ? 105 HIS B CD2 1 
ATOM   1821 C CE1 . HIS B 2 105 ? 27.338  15.817  28.736 1.00 36.67 ? 105 HIS B CE1 1 
ATOM   1822 N NE2 . HIS B 2 105 ? 27.390  14.635  28.154 1.00 36.50 ? 105 HIS B NE2 1 
ATOM   1823 N N   . ASN B 2 106 ? 23.354  13.425  33.624 1.00 27.59 ? 106 ASN B N   1 
ATOM   1824 C CA  . ASN B 2 106 ? 22.189  13.407  34.502 1.00 26.36 ? 106 ASN B CA  1 
ATOM   1825 C C   . ASN B 2 106 ? 20.856  13.195  33.778 1.00 25.40 ? 106 ASN B C   1 
ATOM   1826 O O   . ASN B 2 106 ? 19.795  13.507  34.321 1.00 26.12 ? 106 ASN B O   1 
ATOM   1827 C CB  . ASN B 2 106 ? 22.122  14.710  35.306 1.00 26.60 ? 106 ASN B CB  1 
ATOM   1828 C CG  . ASN B 2 106 ? 23.496  15.260  35.651 1.00 27.95 ? 106 ASN B CG  1 
ATOM   1829 O OD1 . ASN B 2 106 ? 24.371  14.533  36.125 1.00 28.85 ? 106 ASN B OD1 1 
ATOM   1830 N ND2 . ASN B 2 106 ? 23.687  16.556  35.422 1.00 27.97 ? 106 ASN B ND2 1 
ATOM   1831 N N   . LYS B 2 107 ? 20.910  12.671  32.559 1.00 23.79 ? 107 LYS B N   1 
ATOM   1832 C CA  . LYS B 2 107 ? 19.695  12.419  31.788 1.00 23.42 ? 107 LYS B CA  1 
ATOM   1833 C C   . LYS B 2 107 ? 19.074  11.091  32.216 1.00 21.68 ? 107 LYS B C   1 
ATOM   1834 O O   . LYS B 2 107 ? 19.771  10.210  32.713 1.00 21.66 ? 107 LYS B O   1 
ATOM   1835 C CB  . LYS B 2 107 ? 20.023  12.373  30.295 1.00 26.96 ? 107 LYS B CB  1 
ATOM   1836 C CG  . LYS B 2 107 ? 20.571  13.675  29.725 1.00 29.52 ? 107 LYS B CG  1 
ATOM   1837 C CD  . LYS B 2 107 ? 19.520  14.771  29.722 1.00 33.88 ? 107 LYS B CD  1 
ATOM   1838 C CE  . LYS B 2 107 ? 20.035  16.011  29.010 1.00 36.06 ? 107 LYS B CE  1 
ATOM   1839 N NZ  . LYS B 2 107 ? 20.603  15.642  27.676 1.00 39.39 ? 107 LYS B NZ  1 
ATOM   1840 N N   . TRP B 2 108 ? 17.768  10.947  32.011 1.00 19.80 ? 108 TRP B N   1 
ATOM   1841 C CA  . TRP B 2 108 ? 17.062  9.720   32.383 1.00 18.79 ? 108 TRP B CA  1 
ATOM   1842 C C   . TRP B 2 108 ? 16.750  8.868   31.140 1.00 18.49 ? 108 TRP B C   1 
ATOM   1843 O O   . TRP B 2 108 ? 16.227  9.372   30.144 1.00 17.83 ? 108 TRP B O   1 
ATOM   1844 C CB  . TRP B 2 108 ? 15.763  10.064  33.128 1.00 17.99 ? 108 TRP B CB  1 
ATOM   1845 C CG  . TRP B 2 108 ? 15.916  11.092  34.223 1.00 16.30 ? 108 TRP B CG  1 
ATOM   1846 C CD1 . TRP B 2 108 ? 17.077  11.484  34.840 1.00 16.43 ? 108 TRP B CD1 1 
ATOM   1847 C CD2 . TRP B 2 108 ? 14.867  11.853  34.832 1.00 16.56 ? 108 TRP B CD2 1 
ATOM   1848 N NE1 . TRP B 2 108 ? 16.810  12.445  35.789 1.00 15.49 ? 108 TRP B NE1 1 
ATOM   1849 C CE2 . TRP B 2 108 ? 15.462  12.689  35.805 1.00 15.91 ? 108 TRP B CE2 1 
ATOM   1850 C CE3 . TRP B 2 108 ? 13.477  11.910  34.650 1.00 16.35 ? 108 TRP B CE3 1 
ATOM   1851 C CZ2 . TRP B 2 108 ? 14.716  13.574  36.592 1.00 15.83 ? 108 TRP B CZ2 1 
ATOM   1852 C CZ3 . TRP B 2 108 ? 12.733  12.791  35.437 1.00 14.57 ? 108 TRP B CZ3 1 
ATOM   1853 C CH2 . TRP B 2 108 ? 13.358  13.611  36.395 1.00 15.69 ? 108 TRP B CH2 1 
ATOM   1854 N N   . ILE B 2 109 ? 17.062  7.576   31.214 1.00 19.01 ? 109 ILE B N   1 
ATOM   1855 C CA  . ILE B 2 109 ? 16.854  6.659   30.092 1.00 18.91 ? 109 ILE B CA  1 
ATOM   1856 C C   . ILE B 2 109 ? 15.928  5.494   30.437 1.00 19.54 ? 109 ILE B C   1 
ATOM   1857 O O   . ILE B 2 109 ? 16.040  4.907   31.510 1.00 18.28 ? 109 ILE B O   1 
ATOM   1858 C CB  . ILE B 2 109 ? 18.209  6.046   29.625 1.00 19.73 ? 109 ILE B CB  1 
ATOM   1859 C CG1 . ILE B 2 109 ? 19.222  7.156   29.330 1.00 19.88 ? 109 ILE B CG1 1 
ATOM   1860 C CG2 . ILE B 2 109 ? 17.998  5.207   28.371 1.00 18.07 ? 109 ILE B CG2 1 
ATOM   1861 C CD1 . ILE B 2 109 ? 20.650  6.643   29.076 1.00 22.21 ? 109 ILE B CD1 1 
ATOM   1862 N N   . GLN B 2 110 ? 15.024  5.163   29.517 1.00 21.26 ? 110 GLN B N   1 
ATOM   1863 C CA  . GLN B 2 110 ? 14.104  4.042   29.706 1.00 23.74 ? 110 GLN B CA  1 
ATOM   1864 C C   . GLN B 2 110 ? 14.938  2.768   29.793 1.00 24.54 ? 110 GLN B C   1 
ATOM   1865 O O   . GLN B 2 110 ? 15.896  2.601   29.038 1.00 26.34 ? 110 GLN B O   1 
ATOM   1866 C CB  . GLN B 2 110 ? 13.143  3.922   28.520 1.00 25.47 ? 110 GLN B CB  1 
ATOM   1867 C CG  . GLN B 2 110 ? 11.796  4.592   28.703 1.00 29.82 ? 110 GLN B CG  1 
ATOM   1868 C CD  . GLN B 2 110 ? 10.876  4.365   27.510 1.00 33.85 ? 110 GLN B CD  1 
ATOM   1869 O OE1 . GLN B 2 110 ? 10.926  3.317   26.863 1.00 35.53 ? 110 GLN B OE1 1 
ATOM   1870 N NE2 . GLN B 2 110 ? 10.021  5.340   27.225 1.00 35.23 ? 110 GLN B NE2 1 
ATOM   1871 N N   . TRP B 2 111 ? 14.565  1.862   30.688 1.00 23.69 ? 111 TRP B N   1 
ATOM   1872 C CA  . TRP B 2 111 ? 15.323  0.629   30.843 1.00 22.76 ? 111 TRP B CA  1 
ATOM   1873 C C   . TRP B 2 111 ? 14.400  -0.512  31.253 1.00 23.26 ? 111 TRP B C   1 
ATOM   1874 O O   . TRP B 2 111 ? 13.395  -0.291  31.934 1.00 24.03 ? 111 TRP B O   1 
ATOM   1875 C CB  . TRP B 2 111 ? 16.407  0.847   31.897 1.00 23.29 ? 111 TRP B CB  1 
ATOM   1876 C CG  . TRP B 2 111 ? 17.600  -0.031  31.747 1.00 24.09 ? 111 TRP B CG  1 
ATOM   1877 C CD1 . TRP B 2 111 ? 17.740  -1.309  32.198 1.00 24.78 ? 111 TRP B CD1 1 
ATOM   1878 C CD2 . TRP B 2 111 ? 18.824  0.298   31.084 1.00 23.57 ? 111 TRP B CD2 1 
ATOM   1879 N NE1 . TRP B 2 111 ? 18.979  -1.796  31.861 1.00 26.21 ? 111 TRP B NE1 1 
ATOM   1880 C CE2 . TRP B 2 111 ? 19.664  -0.830  31.174 1.00 24.44 ? 111 TRP B CE2 1 
ATOM   1881 C CE3 . TRP B 2 111 ? 19.293  1.438   30.423 1.00 24.40 ? 111 TRP B CE3 1 
ATOM   1882 C CZ2 . TRP B 2 111 ? 20.953  -0.855  30.624 1.00 23.61 ? 111 TRP B CZ2 1 
ATOM   1883 C CZ3 . TRP B 2 111 ? 20.579  1.414   29.876 1.00 23.87 ? 111 TRP B CZ3 1 
ATOM   1884 C CH2 . TRP B 2 111 ? 21.391  0.273   29.983 1.00 23.85 ? 111 TRP B CH2 1 
ATOM   1885 N N   . THR B 2 112 ? 14.732  -1.731  30.837 1.00 22.78 ? 112 THR B N   1 
ATOM   1886 C CA  . THR B 2 112 ? 13.911  -2.885  31.189 1.00 23.40 ? 112 THR B CA  1 
ATOM   1887 C C   . THR B 2 112 ? 13.983  -3.072  32.696 1.00 23.05 ? 112 THR B C   1 
ATOM   1888 O O   . THR B 2 112 ? 15.067  -3.160  33.270 1.00 23.93 ? 112 THR B O   1 
ATOM   1889 C CB  . THR B 2 112 ? 14.395  -4.154  30.467 1.00 23.89 ? 112 THR B CB  1 
ATOM   1890 O OG1 . THR B 2 112 ? 14.270  -3.957  29.055 1.00 24.09 ? 112 THR B OG1 1 
ATOM   1891 C CG2 . THR B 2 112 ? 13.558  -5.358  30.876 1.00 22.00 ? 112 THR B CG2 1 
ATOM   1892 N N   . CYS B 2 113 ? 12.818  -3.144  33.326 1.00 21.90 ? 113 CYS B N   1 
ATOM   1893 C CA  . CYS B 2 113 ? 12.736  -3.253  34.774 1.00 22.17 ? 113 CYS B CA  1 
ATOM   1894 C C   . CYS B 2 113 ? 13.338  -4.492  35.441 1.00 24.00 ? 113 CYS B C   1 
ATOM   1895 O O   . CYS B 2 113 ? 13.793  -4.410  36.583 1.00 23.52 ? 113 CYS B O   1 
ATOM   1896 C CB  . CYS B 2 113 ? 11.284  -3.131  35.214 1.00 20.21 ? 113 CYS B CB  1 
ATOM   1897 S SG  . CYS B 2 113 ? 10.387  -1.624  34.716 1.00 17.53 ? 113 CYS B SG  1 
ATOM   1898 N N   . ASN B 2 114 ? 13.348  -5.629  34.746 1.00 26.13 ? 114 ASN B N   1 
ATOM   1899 C CA  . ASN B 2 114 ? 13.871  -6.854  35.338 1.00 28.15 ? 114 ASN B CA  1 
ATOM   1900 C C   . ASN B 2 114 ? 15.391  -7.018  35.272 1.00 28.64 ? 114 ASN B C   1 
ATOM   1901 O O   . ASN B 2 114 ? 15.919  -8.063  35.639 1.00 29.47 ? 114 ASN B O   1 
ATOM   1902 C CB  . ASN B 2 114 ? 13.181  -8.084  34.722 1.00 30.44 ? 114 ASN B CB  1 
ATOM   1903 C CG  . ASN B 2 114 ? 13.620  -8.364  33.292 1.00 32.37 ? 114 ASN B CG  1 
ATOM   1904 O OD1 . ASN B 2 114 ? 13.247  -9.384  32.712 1.00 35.38 ? 114 ASN B OD1 1 
ATOM   1905 N ND2 . ASN B 2 114 ? 14.410  -7.467  32.718 1.00 34.09 ? 114 ASN B ND2 1 
ATOM   1906 N N   . ARG B 2 115 ? 16.091  -5.989  34.809 1.00 29.60 ? 115 ARG B N   1 
ATOM   1907 C CA  . ARG B 2 115 ? 17.547  -6.033  34.729 1.00 30.10 ? 115 ARG B CA  1 
ATOM   1908 C C   . ARG B 2 115 ? 18.079  -5.628  36.103 1.00 29.45 ? 115 ARG B C   1 
ATOM   1909 O O   . ARG B 2 115 ? 17.331  -5.106  36.931 1.00 28.96 ? 115 ARG B O   1 
ATOM   1910 C CB  . ARG B 2 115 ? 18.058  -5.032  33.698 1.00 33.53 ? 115 ARG B CB  1 
ATOM   1911 C CG  . ARG B 2 115 ? 17.397  -5.111  32.338 1.00 38.87 ? 115 ARG B CG  1 
ATOM   1912 C CD  . ARG B 2 115 ? 18.004  -6.191  31.463 1.00 43.00 ? 115 ARG B CD  1 
ATOM   1913 N NE  . ARG B 2 115 ? 18.267  -5.666  30.126 1.00 47.76 ? 115 ARG B NE  1 
ATOM   1914 C CZ  . ARG B 2 115 ? 18.627  -6.406  29.083 1.00 50.41 ? 115 ARG B CZ  1 
ATOM   1915 N NH1 . ARG B 2 115 ? 18.769  -7.719  29.212 1.00 51.28 ? 115 ARG B NH1 1 
ATOM   1916 N NH2 . ARG B 2 115 ? 18.844  -5.829  27.908 1.00 51.62 ? 115 ARG B NH2 1 
ATOM   1917 N N   . LYS B 2 116 ? 19.367  -5.864  36.338 1.00 27.67 ? 116 LYS B N   1 
ATOM   1918 C CA  . LYS B 2 116 ? 19.991  -5.506  37.605 1.00 25.95 ? 116 LYS B CA  1 
ATOM   1919 C C   . LYS B 2 116 ? 20.847  -4.262  37.441 1.00 24.16 ? 116 LYS B C   1 
ATOM   1920 O O   . LYS B 2 116 ? 21.683  -4.192  36.543 1.00 23.65 ? 116 LYS B O   1 
ATOM   1921 C CB  . LYS B 2 116 ? 20.871  -6.646  38.121 1.00 27.51 ? 116 LYS B CB  1 
ATOM   1922 C CG  . LYS B 2 116 ? 20.184  -7.579  39.092 1.00 29.50 ? 116 LYS B CG  1 
ATOM   1923 C CD  . LYS B 2 116 ? 19.914  -8.930  38.469 1.00 32.17 ? 116 LYS B CD  1 
ATOM   1924 C CE  . LYS B 2 116 ? 19.398  -9.907  39.509 1.00 34.49 ? 116 LYS B CE  1 
ATOM   1925 N NZ  . LYS B 2 116 ? 19.251  -11.285 38.956 1.00 37.26 ? 116 LYS B NZ  1 
ATOM   1926 N N   . LYS B 2 117 ? 20.650  -3.288  38.320 1.00 22.93 ? 117 LYS B N   1 
ATOM   1927 C CA  . LYS B 2 117 ? 21.406  -2.049  38.248 1.00 22.08 ? 117 LYS B CA  1 
ATOM   1928 C C   . LYS B 2 117 ? 21.656  -1.536  39.653 1.00 20.73 ? 117 LYS B C   1 
ATOM   1929 O O   . LYS B 2 117 ? 20.957  -1.912  40.589 1.00 20.85 ? 117 LYS B O   1 
ATOM   1930 C CB  . LYS B 2 117 ? 20.614  -0.994  37.467 1.00 24.68 ? 117 LYS B CB  1 
ATOM   1931 C CG  . LYS B 2 117 ? 21.168  -0.640  36.096 1.00 28.19 ? 117 LYS B CG  1 
ATOM   1932 C CD  . LYS B 2 117 ? 21.010  -1.776  35.112 1.00 30.28 ? 117 LYS B CD  1 
ATOM   1933 C CE  . LYS B 2 117 ? 21.703  -1.462  33.810 1.00 31.65 ? 117 LYS B CE  1 
ATOM   1934 N NZ  . LYS B 2 117 ? 23.137  -1.136  34.050 1.00 33.76 ? 117 LYS B NZ  1 
ATOM   1935 N N   . SER B 2 118 ? 22.656  -0.680  39.801 1.00 19.67 ? 118 SER B N   1 
ATOM   1936 C CA  . SER B 2 118 ? 22.935  -0.100  41.099 1.00 20.98 ? 118 SER B CA  1 
ATOM   1937 C C   . SER B 2 118 ? 21.807  0.894   41.356 1.00 20.93 ? 118 SER B C   1 
ATOM   1938 O O   . SER B 2 118 ? 21.019  1.184   40.454 1.00 21.13 ? 118 SER B O   1 
ATOM   1939 C CB  . SER B 2 118 ? 24.292  0.600   41.076 1.00 21.81 ? 118 SER B CB  1 
ATOM   1940 O OG  . SER B 2 118 ? 25.323  -0.346  40.835 1.00 23.94 ? 118 SER B OG  1 
ATOM   1941 N N   . PHE B 2 119 ? 21.713  1.415   42.575 1.00 19.55 ? 119 PHE B N   1 
ATOM   1942 C CA  . PHE B 2 119 ? 20.644  2.355   42.879 1.00 18.54 ? 119 PHE B CA  1 
ATOM   1943 C C   . PHE B 2 119 ? 20.961  3.325   44.016 1.00 17.92 ? 119 PHE B C   1 
ATOM   1944 O O   . PHE B 2 119 ? 21.978  3.194   44.698 1.00 18.33 ? 119 PHE B O   1 
ATOM   1945 C CB  . PHE B 2 119 ? 19.362  1.588   43.203 1.00 17.69 ? 119 PHE B CB  1 
ATOM   1946 C CG  . PHE B 2 119 ? 19.504  0.618   44.345 1.00 17.46 ? 119 PHE B CG  1 
ATOM   1947 C CD1 . PHE B 2 119 ? 20.026  -0.655  44.136 1.00 15.45 ? 119 PHE B CD1 1 
ATOM   1948 C CD2 . PHE B 2 119 ? 19.107  0.978   45.631 1.00 16.40 ? 119 PHE B CD2 1 
ATOM   1949 C CE1 . PHE B 2 119 ? 20.147  -1.561  45.189 1.00 16.04 ? 119 PHE B CE1 1 
ATOM   1950 C CE2 . PHE B 2 119 ? 19.224  0.080   46.697 1.00 16.88 ? 119 PHE B CE2 1 
ATOM   1951 C CZ  . PHE B 2 119 ? 19.745  -1.195  46.474 1.00 15.69 ? 119 PHE B CZ  1 
ATOM   1952 N N   . VAL B 2 120 ? 20.075  4.296   44.207 1.00 17.34 ? 120 VAL B N   1 
ATOM   1953 C CA  . VAL B 2 120 ? 20.233  5.303   45.252 1.00 15.32 ? 120 VAL B CA  1 
ATOM   1954 C C   . VAL B 2 120 ? 18.982  5.425   46.107 1.00 14.47 ? 120 VAL B C   1 
ATOM   1955 O O   . VAL B 2 120 ? 17.891  5.618   45.574 1.00 13.91 ? 120 VAL B O   1 
ATOM   1956 C CB  . VAL B 2 120 ? 20.508  6.688   44.642 1.00 15.96 ? 120 VAL B CB  1 
ATOM   1957 C CG1 . VAL B 2 120 ? 20.688  7.719   45.754 1.00 14.58 ? 120 VAL B CG1 1 
ATOM   1958 C CG2 . VAL B 2 120 ? 21.733  6.635   43.748 1.00 17.01 ? 120 VAL B CG2 1 
ATOM   1959 N N   . CYS B 2 121 ? 19.129  5.317   47.429 1.00 15.37 ? 121 CYS B N   1 
ATOM   1960 C CA  . CYS B 2 121 ? 17.975  5.476   48.309 1.00 14.94 ? 121 CYS B CA  1 
ATOM   1961 C C   . CYS B 2 121 ? 18.009  6.902   48.857 1.00 15.19 ? 121 CYS B C   1 
ATOM   1962 O O   . CYS B 2 121 ? 19.082  7.488   49.024 1.00 15.72 ? 121 CYS B O   1 
ATOM   1963 C CB  . CYS B 2 121 ? 18.009  4.493   49.474 1.00 14.19 ? 121 CYS B CB  1 
ATOM   1964 S SG  . CYS B 2 121 ? 17.935  2.723   49.053 1.00 15.37 ? 121 CYS B SG  1 
ATOM   1965 N N   . LYS B 2 122 ? 16.830  7.443   49.143 1.00 14.91 ? 122 LYS B N   1 
ATOM   1966 C CA  . LYS B 2 122 ? 16.689  8.801   49.642 1.00 15.22 ? 122 LYS B CA  1 
ATOM   1967 C C   . LYS B 2 122 ? 15.567  8.879   50.678 1.00 16.63 ? 122 LYS B C   1 
ATOM   1968 O O   . LYS B 2 122 ? 14.566  8.177   50.561 1.00 16.56 ? 122 LYS B O   1 
ATOM   1969 C CB  . LYS B 2 122 ? 16.363  9.720   48.452 1.00 15.95 ? 122 LYS B CB  1 
ATOM   1970 C CG  . LYS B 2 122 ? 15.827  11.111  48.799 1.00 14.52 ? 122 LYS B CG  1 
ATOM   1971 C CD  . LYS B 2 122 ? 15.289  11.808  47.541 1.00 13.29 ? 122 LYS B CD  1 
ATOM   1972 C CE  . LYS B 2 122 ? 14.794  13.220  47.850 1.00 11.14 ? 122 LYS B CE  1 
ATOM   1973 N NZ  . LYS B 2 122 ? 14.329  13.921  46.612 1.00 10.18 ? 122 LYS B NZ  1 
ATOM   1974 N N   . TYR B 2 123 ? 15.747  9.708   51.703 1.00 17.59 ? 123 TYR B N   1 
ATOM   1975 C CA  . TYR B 2 123 ? 14.711  9.907   52.716 1.00 18.60 ? 123 TYR B CA  1 
ATOM   1976 C C   . TYR B 2 123 ? 14.828  11.333  53.251 1.00 20.52 ? 123 TYR B C   1 
ATOM   1977 O O   . TYR B 2 123 ? 15.907  11.923  53.221 1.00 19.92 ? 123 TYR B O   1 
ATOM   1978 C CB  . TYR B 2 123 ? 14.811  8.861   53.844 1.00 18.34 ? 123 TYR B CB  1 
ATOM   1979 C CG  . TYR B 2 123 ? 15.900  9.052   54.886 1.00 18.64 ? 123 TYR B CG  1 
ATOM   1980 C CD1 . TYR B 2 123 ? 15.720  9.913   55.973 1.00 18.65 ? 123 TYR B CD1 1 
ATOM   1981 C CD2 . TYR B 2 123 ? 17.076  8.307   54.828 1.00 15.64 ? 123 TYR B CD2 1 
ATOM   1982 C CE1 . TYR B 2 123 ? 16.690  10.010  56.987 1.00 19.02 ? 123 TYR B CE1 1 
ATOM   1983 C CE2 . TYR B 2 123 ? 18.043  8.398   55.823 1.00 16.02 ? 123 TYR B CE2 1 
ATOM   1984 C CZ  . TYR B 2 123 ? 17.848  9.246   56.902 1.00 18.03 ? 123 TYR B CZ  1 
ATOM   1985 O OH  . TYR B 2 123 ? 18.803  9.298   57.902 1.00 15.19 ? 123 TYR B OH  1 
ATOM   1986 N N   . ARG B 2 124 ? 13.712  11.889  53.711 1.00 22.85 ? 124 ARG B N   1 
ATOM   1987 C CA  . ARG B 2 124 ? 13.694  13.257  54.216 1.00 27.39 ? 124 ARG B CA  1 
ATOM   1988 C C   . ARG B 2 124 ? 14.046  13.358  55.698 1.00 28.54 ? 124 ARG B C   1 
ATOM   1989 O O   . ARG B 2 124 ? 13.524  12.607  56.523 1.00 28.59 ? 124 ARG B O   1 
ATOM   1990 C CB  . ARG B 2 124 ? 12.319  13.888  53.976 1.00 30.48 ? 124 ARG B CB  1 
ATOM   1991 C CG  . ARG B 2 124 ? 12.222  15.332  54.447 1.00 37.26 ? 124 ARG B CG  1 
ATOM   1992 C CD  . ARG B 2 124 ? 10.894  15.971  54.060 1.00 42.32 ? 124 ARG B CD  1 
ATOM   1993 N NE  . ARG B 2 124 ? 9.754   15.176  54.507 1.00 45.78 ? 124 ARG B NE  1 
ATOM   1994 C CZ  . ARG B 2 124 ? 8.496   15.604  54.500 1.00 47.94 ? 124 ARG B CZ  1 
ATOM   1995 N NH1 . ARG B 2 124 ? 8.214   16.829  54.070 1.00 49.19 ? 124 ARG B NH1 1 
ATOM   1996 N NH2 . ARG B 2 124 ? 7.521   14.810  54.925 1.00 48.65 ? 124 ARG B NH2 1 
ATOM   1997 N N   . VAL B 2 125 ? 14.932  14.294  56.031 1.00 30.08 ? 125 VAL B N   1 
ATOM   1998 C CA  . VAL B 2 125 ? 15.341  14.480  57.416 1.00 32.14 ? 125 VAL B CA  1 
ATOM   1999 C C   . VAL B 2 125 ? 14.151  14.988  58.222 1.00 33.33 ? 125 VAL B C   1 
ATOM   2000 O O   . VAL B 2 125 ? 13.840  14.368  59.263 1.00 35.33 ? 125 VAL B O   1 
ATOM   2001 C CB  . VAL B 2 125 ? 16.525  15.490  57.541 1.00 31.88 ? 125 VAL B CB  1 
ATOM   2002 C CG1 . VAL B 2 125 ? 17.706  15.007  56.722 1.00 31.85 ? 125 VAL B CG1 1 
ATOM   2003 C CG2 . VAL B 2 125 ? 16.102  16.879  57.083 1.00 32.63 ? 125 VAL B CG2 1 
ATOM   2004 O OXT . VAL B 2 125 ? 13.539  15.995  57.800 1.00 33.59 ? 125 VAL B OXT 1 
HETATM 2005 O O   . HOH C 3 .   ? 10.214  15.962  39.465 1.00 12.43 ? 132 HOH A O   1 
HETATM 2006 O O   . HOH C 3 .   ? 10.774  8.199   44.445 1.00 12.56 ? 133 HOH A O   1 
HETATM 2007 O O   . HOH C 3 .   ? 8.434   11.837  21.491 1.00 15.13 ? 134 HOH A O   1 
HETATM 2008 O O   . HOH C 3 .   ? -0.513  0.821   0.686  1.00 19.20 ? 135 HOH A O   1 
HETATM 2009 O O   . HOH C 3 .   ? 6.711   -3.977  20.024 1.00 31.75 ? 136 HOH A O   1 
HETATM 2010 O O   . HOH C 3 .   ? 19.016  16.253  36.334 1.00 22.25 ? 137 HOH A O   1 
HETATM 2011 O O   . HOH C 3 .   ? 8.508   9.518   27.073 1.00 20.28 ? 138 HOH A O   1 
HETATM 2012 O O   . HOH C 3 .   ? 5.713   14.698  15.422 1.00 24.16 ? 139 HOH A O   1 
HETATM 2013 O O   . HOH C 3 .   ? 11.316  -0.948  16.598 1.00 21.96 ? 140 HOH A O   1 
HETATM 2014 O O   . HOH C 3 .   ? 12.624  3.706   14.333 1.00 16.16 ? 141 HOH A O   1 
HETATM 2015 O O   . HOH C 3 .   ? 6.929   6.448   39.795 1.00 22.84 ? 142 HOH A O   1 
HETATM 2016 O O   . HOH C 3 .   ? -3.658  11.681  19.655 1.00 23.16 ? 143 HOH A O   1 
HETATM 2017 O O   . HOH C 3 .   ? 6.675   0.135   24.897 1.00 37.50 ? 144 HOH A O   1 
HETATM 2018 O O   . HOH C 3 .   ? 12.411  -9.676  9.333  1.00 25.38 ? 145 HOH A O   1 
HETATM 2019 O O   . HOH C 3 .   ? 5.522   17.354  45.196 1.00 25.31 ? 146 HOH A O   1 
HETATM 2020 O O   . HOH C 3 .   ? -9.826  14.117  8.517  1.00 36.83 ? 147 HOH A O   1 
HETATM 2021 O O   . HOH C 3 .   ? 11.876  7.670   26.770 1.00 42.21 ? 148 HOH A O   1 
HETATM 2022 O O   . HOH C 3 .   ? -0.647  9.778   33.325 1.00 30.42 ? 149 HOH A O   1 
HETATM 2023 O O   . HOH C 3 .   ? -2.831  0.193   -0.773 1.00 38.75 ? 150 HOH A O   1 
HETATM 2024 O O   . HOH C 3 .   ? -6.126  7.611   14.509 1.00 19.56 ? 151 HOH A O   1 
HETATM 2025 O O   . HOH C 3 .   ? 0.115   14.869  31.969 1.00 28.61 ? 152 HOH A O   1 
HETATM 2026 O O   . HOH C 3 .   ? 11.203  13.459  18.975 1.00 23.66 ? 153 HOH A O   1 
HETATM 2027 O O   . HOH C 3 .   ? 4.019   -9.390  9.309  1.00 29.23 ? 154 HOH A O   1 
HETATM 2028 O O   . HOH C 3 .   ? 1.958   8.588   44.624 1.00 29.10 ? 155 HOH A O   1 
HETATM 2029 O O   . HOH C 3 .   ? -5.546  15.755  13.111 1.00 37.25 ? 156 HOH A O   1 
HETATM 2030 O O   . HOH C 3 .   ? -9.665  -8.674  19.076 1.00 33.53 ? 157 HOH A O   1 
HETATM 2031 O O   . HOH C 3 .   ? -9.636  7.772   9.972  1.00 34.16 ? 158 HOH A O   1 
HETATM 2032 O O   . HOH C 3 .   ? 12.206  -7.618  11.362 1.00 44.22 ? 159 HOH A O   1 
HETATM 2033 O O   . HOH C 3 .   ? -11.395 15.173  11.432 1.00 51.55 ? 160 HOH A O   1 
HETATM 2034 O O   . HOH C 3 .   ? -7.797  -9.749  9.251  1.00 35.02 ? 161 HOH A O   1 
HETATM 2035 O O   . HOH C 3 .   ? 10.427  4.653   3.078  1.00 39.09 ? 162 HOH A O   1 
HETATM 2036 O O   . HOH C 3 .   ? 10.172  19.196  40.550 1.00 36.05 ? 163 HOH A O   1 
HETATM 2037 O O   . HOH C 3 .   ? 1.604   13.301  33.490 1.00 33.28 ? 164 HOH A O   1 
HETATM 2038 O O   . HOH C 3 .   ? 13.346  16.171  27.335 1.00 48.59 ? 165 HOH A O   1 
HETATM 2039 O O   . HOH C 3 .   ? 4.961   7.064   48.644 1.00 32.30 ? 166 HOH A O   1 
HETATM 2040 O O   . HOH C 3 .   ? 4.919   7.297   -0.639 1.00 37.65 ? 167 HOH A O   1 
HETATM 2041 O O   . HOH C 3 .   ? 4.563   -1.180  23.533 1.00 32.28 ? 168 HOH A O   1 
HETATM 2042 O O   . HOH C 3 .   ? -12.141 -1.752  12.022 1.00 37.40 ? 169 HOH A O   1 
HETATM 2043 O O   . HOH C 3 .   ? 5.340   4.072   46.102 1.00 29.84 ? 170 HOH A O   1 
HETATM 2044 O O   . HOH C 3 .   ? 8.520   17.780  42.745 1.00 31.14 ? 171 HOH A O   1 
HETATM 2045 O O   . HOH C 3 .   ? 11.843  11.830  49.965 1.00 37.74 ? 172 HOH A O   1 
HETATM 2046 O O   . HOH C 3 .   ? 9.912   0.832   24.870 1.00 34.69 ? 173 HOH A O   1 
HETATM 2047 O O   . HOH C 3 .   ? 9.032   18.636  31.366 1.00 41.09 ? 174 HOH A O   1 
HETATM 2048 O O   . HOH C 3 .   ? 16.652  14.161  22.650 1.00 45.66 ? 175 HOH A O   1 
HETATM 2049 O O   . HOH C 3 .   ? 5.385   8.284   26.898 1.00 39.71 ? 176 HOH A O   1 
HETATM 2050 O O   . HOH C 3 .   ? 3.700   6.963   43.524 1.00 41.84 ? 177 HOH A O   1 
HETATM 2051 O O   . HOH C 3 .   ? 12.939  20.077  29.161 1.00 37.72 ? 178 HOH A O   1 
HETATM 2052 O O   . HOH C 3 .   ? -0.820  -10.836 -0.518 1.00 35.22 ? 179 HOH A O   1 
HETATM 2053 O O   . HOH C 3 .   ? -0.958  -4.023  12.743 1.00 48.25 ? 180 HOH A O   1 
HETATM 2054 O O   . HOH C 3 .   ? 12.067  3.993   21.224 1.00 46.96 ? 181 HOH A O   1 
HETATM 2055 O O   . HOH C 3 .   ? 11.087  19.886  33.412 1.00 29.87 ? 182 HOH A O   1 
HETATM 2056 O O   . HOH C 3 .   ? -3.395  17.943  20.497 1.00 40.21 ? 183 HOH A O   1 
HETATM 2057 O O   . HOH C 3 .   ? -5.446  -1.131  -4.917 1.00 35.38 ? 184 HOH A O   1 
HETATM 2058 O O   . HOH C 3 .   ? 7.807   18.128  33.503 1.00 31.91 ? 185 HOH A O   1 
HETATM 2059 O O   . HOH C 3 .   ? -12.186 9.030   7.202  1.00 33.06 ? 186 HOH A O   1 
HETATM 2060 O O   . HOH C 3 .   ? -4.741  -13.192 4.414  1.00 31.79 ? 187 HOH A O   1 
HETATM 2061 O O   . HOH C 3 .   ? 6.619   12.758  4.823  1.00 41.58 ? 188 HOH A O   1 
HETATM 2062 O O   . HOH C 3 .   ? -1.657  -7.969  13.816 1.00 32.35 ? 189 HOH A O   1 
HETATM 2063 O O   . HOH C 3 .   ? 17.992  7.692   25.519 1.00 34.11 ? 190 HOH A O   1 
HETATM 2064 O O   . HOH C 3 .   ? 20.444  7.325   25.327 1.00 63.73 ? 191 HOH A O   1 
HETATM 2065 O O   . HOH C 3 .   ? 13.166  6.380   11.366 1.00 35.70 ? 192 HOH A O   1 
HETATM 2066 O O   . HOH C 3 .   ? 15.366  8.412   16.041 1.00 41.54 ? 193 HOH A O   1 
HETATM 2067 O O   . HOH C 3 .   ? 7.847   7.021   26.829 1.00 44.22 ? 194 HOH A O   1 
HETATM 2068 O O   . HOH C 3 .   ? 1.242   1.518   -1.646 1.00 47.12 ? 195 HOH A O   1 
HETATM 2069 O O   . HOH C 3 .   ? -2.850  14.540  18.378 1.00 59.74 ? 196 HOH A O   1 
HETATM 2070 O O   . HOH C 3 .   ? -3.509  18.724  6.734  1.00 49.86 ? 197 HOH A O   1 
HETATM 2071 O O   . HOH C 3 .   ? -1.518  19.671  15.721 1.00 55.08 ? 198 HOH A O   1 
HETATM 2072 O O   . HOH C 3 .   ? -9.378  5.816   -0.864 1.00 45.59 ? 199 HOH A O   1 
HETATM 2073 O O   . HOH C 3 .   ? 13.916  17.394  8.375  1.00 49.72 ? 200 HOH A O   1 
HETATM 2074 O O   . HOH C 3 .   ? 7.402   14.373  21.973 1.00 28.93 ? 201 HOH A O   1 
HETATM 2075 O O   . HOH C 3 .   ? 11.987  12.813  21.475 1.00 30.36 ? 202 HOH A O   1 
HETATM 2076 O O   . HOH C 3 .   ? 15.214  8.797   26.913 1.00 44.84 ? 203 HOH A O   1 
HETATM 2077 O O   . HOH C 3 .   ? 12.347  3.516   11.656 1.00 49.14 ? 204 HOH A O   1 
HETATM 2078 O O   . HOH C 3 .   ? -14.345 0.245   19.846 1.00 34.61 ? 205 HOH A O   1 
HETATM 2079 O O   . HOH D 3 .   ? 19.198  13.598  36.959 1.00 11.86 ? 126 HOH B O   1 
HETATM 2080 O O   . HOH D 3 .   ? 12.078  9.250   49.771 1.00 19.29 ? 127 HOH B O   1 
HETATM 2081 O O   . HOH D 3 .   ? 12.880  9.361   47.353 1.00 20.28 ? 128 HOH B O   1 
HETATM 2082 O O   . HOH D 3 .   ? 11.644  -4.675  38.588 1.00 19.26 ? 129 HOH B O   1 
HETATM 2083 O O   . HOH D 3 .   ? 27.631  1.639   36.409 1.00 27.54 ? 130 HOH B O   1 
HETATM 2084 O O   . HOH D 3 .   ? 8.984   4.682   52.662 1.00 57.79 ? 131 HOH B O   1 
HETATM 2085 O O   . HOH D 3 .   ? 17.789  17.520  48.622 1.00 29.52 ? 132 HOH B O   1 
HETATM 2086 O O   . HOH D 3 .   ? 2.912   -1.531  29.955 1.00 17.30 ? 133 HOH B O   1 
HETATM 2087 O O   . HOH D 3 .   ? 24.417  0.235   37.585 1.00 34.01 ? 134 HOH B O   1 
HETATM 2088 O O   . HOH D 3 .   ? 26.636  6.795   49.106 1.00 21.67 ? 135 HOH B O   1 
HETATM 2089 O O   . HOH D 3 .   ? -1.395  -6.934  16.616 1.00 39.16 ? 136 HOH B O   1 
HETATM 2090 O O   . HOH D 3 .   ? 11.284  10.395  53.468 1.00 27.99 ? 137 HOH B O   1 
HETATM 2091 O O   . HOH D 3 .   ? 10.501  -3.739  31.820 1.00 24.14 ? 138 HOH B O   1 
HETATM 2092 O O   . HOH D 3 .   ? 24.557  20.349  42.806 1.00 43.04 ? 139 HOH B O   1 
HETATM 2093 O O   . HOH D 3 .   ? 14.251  6.415   27.227 1.00 37.95 ? 140 HOH B O   1 
HETATM 2094 O O   . HOH D 3 .   ? 24.691  22.385  40.571 1.00 31.23 ? 141 HOH B O   1 
HETATM 2095 O O   . HOH D 3 .   ? 6.855   7.456   29.416 1.00 23.27 ? 142 HOH B O   1 
HETATM 2096 O O   . HOH D 3 .   ? -7.935  6.416   11.492 1.00 23.53 ? 143 HOH B O   1 
HETATM 2097 O O   . HOH D 3 .   ? -8.741  7.814   21.799 1.00 22.84 ? 144 HOH B O   1 
HETATM 2098 O O   . HOH D 3 .   ? 8.748   -2.692  44.904 1.00 28.48 ? 145 HOH B O   1 
HETATM 2099 O O   . HOH D 3 .   ? 7.576   -1.760  46.993 1.00 30.04 ? 146 HOH B O   1 
HETATM 2100 O O   . HOH D 3 .   ? 21.452  17.488  31.768 1.00 41.64 ? 147 HOH B O   1 
HETATM 2101 O O   . HOH D 3 .   ? 11.969  -8.114  40.862 1.00 35.74 ? 148 HOH B O   1 
HETATM 2102 O O   . HOH D 3 .   ? 18.984  1.991   58.154 1.00 34.27 ? 149 HOH B O   1 
HETATM 2103 O O   . HOH D 3 .   ? 20.419  -8.125  27.091 1.00 42.59 ? 150 HOH B O   1 
HETATM 2104 O O   . HOH D 3 .   ? -7.903  0.085   19.907 1.00 25.73 ? 151 HOH B O   1 
HETATM 2105 O O   . HOH D 3 .   ? 27.115  7.816   51.490 1.00 22.83 ? 152 HOH B O   1 
HETATM 2106 O O   . HOH D 3 .   ? 16.266  -6.349  47.936 1.00 45.09 ? 153 HOH B O   1 
HETATM 2107 O O   . HOH D 3 .   ? 21.021  19.339  54.052 1.00 46.78 ? 154 HOH B O   1 
HETATM 2108 O O   . HOH D 3 .   ? 22.616  10.413  38.391 1.00 37.46 ? 155 HOH B O   1 
HETATM 2109 O O   . HOH D 3 .   ? 13.462  16.584  46.593 1.00 30.13 ? 156 HOH B O   1 
HETATM 2110 O O   . HOH D 3 .   ? 26.612  22.848  37.411 1.00 34.15 ? 157 HOH B O   1 
HETATM 2111 O O   . HOH D 3 .   ? 26.713  -0.824  38.575 1.00 25.18 ? 158 HOH B O   1 
HETATM 2112 O O   . HOH D 3 .   ? -3.755  3.307   27.998 1.00 27.30 ? 159 HOH B O   1 
HETATM 2113 O O   . HOH D 3 .   ? 41.426  3.909   40.012 1.00 43.22 ? 160 HOH B O   1 
HETATM 2114 O O   . HOH D 3 .   ? 25.520  8.500   29.560 1.00 40.12 ? 161 HOH B O   1 
HETATM 2115 O O   . HOH D 3 .   ? -2.736  -8.910  20.318 1.00 43.85 ? 162 HOH B O   1 
HETATM 2116 O O   . HOH D 3 .   ? 15.821  22.503  38.181 1.00 24.83 ? 163 HOH B O   1 
HETATM 2117 O O   . HOH D 3 .   ? 6.582   7.574   52.094 1.00 29.84 ? 164 HOH B O   1 
HETATM 2118 O O   . HOH D 3 .   ? 7.108   -2.129  28.241 1.00 51.69 ? 165 HOH B O   1 
HETATM 2119 O O   . HOH D 3 .   ? 28.091  15.195  45.307 1.00 27.41 ? 166 HOH B O   1 
HETATM 2120 O O   . HOH D 3 .   ? -5.878  -6.157  23.637 1.00 31.34 ? 167 HOH B O   1 
HETATM 2121 O O   . HOH D 3 .   ? 23.617  8.191   37.586 1.00 36.32 ? 168 HOH B O   1 
HETATM 2122 O O   . HOH D 3 .   ? 21.696  18.399  34.377 1.00 44.25 ? 169 HOH B O   1 
HETATM 2123 O O   . HOH D 3 .   ? 38.188  7.932   39.199 1.00 39.66 ? 170 HOH B O   1 
HETATM 2124 O O   . HOH D 3 .   ? -8.275  6.647   24.791 1.00 45.46 ? 171 HOH B O   1 
HETATM 2125 O O   . HOH D 3 .   ? -0.132  -1.875  30.657 1.00 20.22 ? 172 HOH B O   1 
HETATM 2126 O O   . HOH D 3 .   ? 27.136  -6.701  36.438 1.00 44.94 ? 173 HOH B O   1 
HETATM 2127 O O   . HOH D 3 .   ? 9.214   18.633  45.143 1.00 34.93 ? 174 HOH B O   1 
HETATM 2128 O O   . HOH D 3 .   ? -13.542 7.924   22.250 1.00 34.90 ? 175 HOH B O   1 
HETATM 2129 O O   . HOH D 3 .   ? -10.326 4.839   24.952 1.00 38.89 ? 176 HOH B O   1 
HETATM 2130 O O   . HOH D 3 .   ? 17.565  23.518  43.664 1.00 39.37 ? 177 HOH B O   1 
HETATM 2131 O O   . HOH D 3 .   ? 15.433  -8.126  28.441 1.00 57.43 ? 178 HOH B O   1 
HETATM 2132 O O   . HOH D 3 .   ? 14.226  -10.811 43.674 1.00 44.22 ? 179 HOH B O   1 
HETATM 2133 O O   . HOH D 3 .   ? -13.416 7.376   15.264 1.00 37.58 ? 180 HOH B O   1 
HETATM 2134 O O   . HOH D 3 .   ? 35.684  6.967   46.827 1.00 40.25 ? 181 HOH B O   1 
HETATM 2135 O O   . HOH D 3 .   ? 14.061  -5.164  59.446 1.00 60.91 ? 182 HOH B O   1 
HETATM 2136 O O   . HOH D 3 .   ? 33.174  0.807   38.957 1.00 66.39 ? 183 HOH B O   1 
HETATM 2137 O O   . HOH D 3 .   ? 9.503   -8.538  30.635 1.00 32.06 ? 184 HOH B O   1 
HETATM 2138 O O   . HOH D 3 .   ? 12.628  -9.172  50.265 1.00 57.43 ? 185 HOH B O   1 
HETATM 2139 O O   . HOH D 3 .   ? 4.908   -5.892  23.059 1.00 31.04 ? 186 HOH B O   1 
HETATM 2140 O O   . HOH D 3 .   ? 16.793  -2.858  53.110 1.00 32.50 ? 187 HOH B O   1 
HETATM 2141 O O   . HOH D 3 .   ? -11.238 1.225   26.570 1.00 54.43 ? 188 HOH B O   1 
HETATM 2142 O O   . HOH D 3 .   ? -16.022 2.198   26.034 1.00 44.94 ? 189 HOH B O   1 
HETATM 2143 O O   . HOH D 3 .   ? 29.557  9.170   56.823 1.00 44.04 ? 190 HOH B O   1 
HETATM 2144 O O   . HOH D 3 .   ? 10.337  15.361  50.705 1.00 45.14 ? 191 HOH B O   1 
HETATM 2145 O O   . HOH D 3 .   ? 23.942  14.442  58.369 1.00 30.83 ? 192 HOH B O   1 
HETATM 2146 O O   . HOH D 3 .   ? -5.795  4.922   27.382 1.00 51.96 ? 193 HOH B O   1 
HETATM 2147 O O   . HOH D 3 .   ? 15.273  19.075  44.601 1.00 38.49 ? 194 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   1   ?   ?   ?   A . n 
A 1 2   PRO 2   2   ?   ?   ?   A . n 
A 1 3   GLY 3   3   ?   ?   ?   A . n 
A 1 4   CYS 4   4   4   CYS CYS A . n 
A 1 5   LEU 5   5   5   LEU LEU A . n 
A 1 6   PRO 6   6   6   PRO PRO A . n 
A 1 7   ASP 7   7   7   ASP ASP A . n 
A 1 8   TRP 8   8   8   TRP TRP A . n 
A 1 9   SER 9   9   9   SER SER A . n 
A 1 10  SER 10  10  10  SER SER A . n 
A 1 11  TYR 11  11  11  TYR TYR A . n 
A 1 12  LYS 12  12  12  LYS LYS A . n 
A 1 13  GLY 13  13  13  GLY GLY A . n 
A 1 14  HIS 14  14  14  HIS HIS A . n 
A 1 15  CYS 15  15  15  CYS CYS A . n 
A 1 16  TYR 16  16  16  TYR TYR A . n 
A 1 17  LYS 17  17  17  LYS LYS A . n 
A 1 18  VAL 18  18  18  VAL VAL A . n 
A 1 19  PHE 19  19  19  PHE PHE A . n 
A 1 20  LYS 20  20  20  LYS LYS A . n 
A 1 21  LYS 21  21  21  LYS LYS A . n 
A 1 22  VAL 22  22  22  VAL VAL A . n 
A 1 23  GLY 23  23  23  GLY GLY A . n 
A 1 24  THR 24  24  24  THR THR A . n 
A 1 25  TRP 25  25  25  TRP TRP A . n 
A 1 26  GLU 26  26  26  GLU GLU A . n 
A 1 27  ASP 27  27  27  ASP ASP A . n 
A 1 28  ALA 28  28  28  ALA ALA A . n 
A 1 29  GLU 29  29  29  GLU GLU A . n 
A 1 30  LYS 30  30  30  LYS LYS A . n 
A 1 31  PHE 31  31  31  PHE PHE A . n 
A 1 32  CYS 32  32  32  CYS CYS A . n 
A 1 33  VAL 33  33  33  VAL VAL A . n 
A 1 34  GLU 34  34  34  GLU GLU A . n 
A 1 35  ASN 35  35  35  ASN ASN A . n 
A 1 36  SER 36  36  36  SER SER A . n 
A 1 37  GLY 37  37  37  GLY GLY A . n 
A 1 38  HIS 38  38  38  HIS HIS A . n 
A 1 39  LEU 39  39  39  LEU LEU A . n 
A 1 40  ALA 40  40  40  ALA ALA A . n 
A 1 41  SER 41  41  41  SER SER A . n 
A 1 42  ILE 42  42  42  ILE ILE A . n 
A 1 43  ASP 43  43  43  ASP ASP A . n 
A 1 44  SER 44  44  44  SER SER A . n 
A 1 45  LYS 45  45  45  LYS LYS A . n 
A 1 46  GLU 46  46  46  GLU GLU A . n 
A 1 47  GLU 47  47  47  GLU GLU A . n 
A 1 48  ALA 48  48  48  ALA ALA A . n 
A 1 49  ASP 49  49  49  ASP ASP A . n 
A 1 50  PHE 50  50  50  PHE PHE A . n 
A 1 51  VAL 51  51  51  VAL VAL A . n 
A 1 52  THR 52  52  52  THR THR A . n 
A 1 53  LYS 53  53  53  LYS LYS A . n 
A 1 54  LEU 54  54  54  LEU LEU A . n 
A 1 55  ALA 55  55  55  ALA ALA A . n 
A 1 56  SER 56  56  56  SER SER A . n 
A 1 57  GLN 57  57  57  GLN GLN A . n 
A 1 58  THR 58  58  58  THR THR A . n 
A 1 59  LEU 59  59  59  LEU LEU A . n 
A 1 60  THR 60  60  ?   ?   ?   A . n 
A 1 61  LYS 61  61  ?   ?   ?   A . n 
A 1 62  PHE 62  62  62  PHE PHE A . n 
A 1 63  VAL 63  63  63  VAL VAL A . n 
A 1 64  TYR 64  64  64  TYR TYR A . n 
A 1 65  ASP 65  65  65  ASP ASP A . n 
A 1 66  ALA 66  66  66  ALA ALA A . n 
A 1 67  TRP 67  67  67  TRP TRP A . n 
A 1 68  ILE 68  68  68  ILE ILE A . n 
A 1 69  GLY 69  69  69  GLY GLY A . n 
A 1 70  LEU 70  70  70  LEU LEU A . n 
A 1 71  ARG 71  71  71  ARG ARG A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  GLU 73  73  73  GLU GLU A . n 
A 1 74  SER 74  74  74  SER SER A . n 
A 1 75  LYS 75  75  75  LYS LYS A . n 
A 1 76  THR 76  76  76  THR THR A . n 
A 1 77  GLN 77  77  77  GLN GLN A . n 
A 1 78  GLN 78  78  78  GLN GLN A . n 
A 1 79  CYS 79  79  79  CYS CYS A . n 
A 1 80  SER 80  80  80  SER SER A . n 
A 1 81  PRO 81  81  81  PRO PRO A . n 
A 1 82  GLN 82  82  82  GLN GLN A . n 
A 1 83  TRP 83  83  83  TRP TRP A . n 
A 1 84  THR 84  84  84  THR THR A . n 
A 1 85  ASP 85  85  85  ASP ASP A . n 
A 1 86  GLY 86  86  86  GLY GLY A . n 
A 1 87  SER 87  87  87  SER SER A . n 
A 1 88  SER 88  88  88  SER SER A . n 
A 1 89  VAL 89  89  89  VAL VAL A . n 
A 1 90  VAL 90  90  90  VAL VAL A . n 
A 1 91  TYR 91  91  91  TYR TYR A . n 
A 1 92  GLU 92  92  92  GLU GLU A . n 
A 1 93  ASN 93  93  93  ASN ASN A . n 
A 1 94  VAL 94  94  94  VAL VAL A . n 
A 1 95  ASP 95  95  95  ASP ASP A . n 
A 1 96  GLU 96  96  96  GLU GLU A . n 
A 1 97  PRO 97  97  97  PRO PRO A . n 
A 1 98  THR 98  98  98  THR THR A . n 
A 1 99  LYS 99  99  99  LYS LYS A . n 
A 1 100 CYS 100 100 100 CYS CYS A . n 
A 1 101 PHE 101 101 101 PHE PHE A . n 
A 1 102 GLY 102 102 102 GLY GLY A . n 
A 1 103 LEU 103 103 103 LEU LEU A . n 
A 1 104 ASP 104 104 104 ASP ASP A . n 
A 1 105 VAL 105 105 105 VAL VAL A . n 
A 1 106 HIS 106 106 106 HIS HIS A . n 
A 1 107 THR 107 107 107 THR THR A . n 
A 1 108 GLU 108 108 108 GLU GLU A . n 
A 1 109 TYR 109 109 109 TYR TYR A . n 
A 1 110 ARG 110 110 110 ARG ARG A . n 
A 1 111 THR 111 111 111 THR THR A . n 
A 1 112 TRP 112 112 112 TRP TRP A . n 
A 1 113 THR 113 113 113 THR THR A . n 
A 1 114 ASP 114 114 114 ASP ASP A . n 
A 1 115 LEU 115 115 115 LEU LEU A . n 
A 1 116 PRO 116 116 116 PRO PRO A . n 
A 1 117 CYS 117 117 117 CYS CYS A . n 
A 1 118 GLY 118 118 118 GLY GLY A . n 
A 1 119 GLU 119 119 119 GLU GLU A . n 
A 1 120 LYS 120 120 120 LYS LYS A . n 
A 1 121 ASN 121 121 121 ASN ASN A . n 
A 1 122 PRO 122 122 122 PRO PRO A . n 
A 1 123 PHE 123 123 123 PHE PHE A . n 
A 1 124 ILE 124 124 124 ILE ILE A . n 
A 1 125 CYS 125 125 125 CYS CYS A . n 
A 1 126 LYS 126 126 126 LYS LYS A . n 
A 1 127 SER 127 127 127 SER SER A . n 
A 1 128 ARG 128 128 ?   ?   ?   A . n 
A 1 129 LEU 129 129 ?   ?   ?   A . n 
A 1 130 PRO 130 130 ?   ?   ?   A . n 
A 1 131 HIS 131 131 ?   ?   ?   A . n 
B 2 1   ASP 1   1   ?   ?   ?   B . n 
B 2 2   GLU 2   2   ?   ?   ?   B . n 
B 2 3   GLY 3   3   3   GLY GLY B . n 
B 2 4   CYS 4   4   4   CYS CYS B . n 
B 2 5   LEU 5   5   5   LEU LEU B . n 
B 2 6   PRO 6   6   6   PRO PRO B . n 
B 2 7   ASP 7   7   7   ASP ASP B . n 
B 2 8   TRP 8   8   8   TRP TRP B . n 
B 2 9   SER 9   9   9   SER SER B . n 
B 2 10  SER 10  10  10  SER SER B . n 
B 2 11  TYR 11  11  11  TYR TYR B . n 
B 2 12  LYS 12  12  12  LYS LYS B . n 
B 2 13  GLY 13  13  13  GLY GLY B . n 
B 2 14  HIS 14  14  14  HIS HIS B . n 
B 2 15  CYS 15  15  15  CYS CYS B . n 
B 2 16  TYR 16  16  16  TYR TYR B . n 
B 2 17  LYS 17  17  17  LYS LYS B . n 
B 2 18  VAL 18  18  18  VAL VAL B . n 
B 2 19  PHE 19  19  19  PHE PHE B . n 
B 2 20  LYS 20  20  20  LYS LYS B . n 
B 2 21  VAL 21  21  21  VAL VAL B . n 
B 2 22  GLU 22  22  22  GLU GLU B . n 
B 2 23  LYS 23  23  23  LYS LYS B . n 
B 2 24  THR 24  24  24  THR THR B . n 
B 2 25  TRP 25  25  25  TRP TRP B . n 
B 2 26  ALA 26  26  26  ALA ALA B . n 
B 2 27  ASP 27  27  27  ASP ASP B . n 
B 2 28  ALA 28  28  28  ALA ALA B . n 
B 2 29  GLU 29  29  29  GLU GLU B . n 
B 2 30  LYS 30  30  30  LYS LYS B . n 
B 2 31  PHE 31  31  31  PHE PHE B . n 
B 2 32  CYS 32  32  32  CYS CYS B . n 
B 2 33  LYS 33  33  33  LYS LYS B . n 
B 2 34  GLU 34  34  34  GLU GLU B . n 
B 2 35  LEU 35  35  35  LEU LEU B . n 
B 2 36  VAL 36  36  36  VAL VAL B . n 
B 2 37  ASN 37  37  37  ASN ASN B . n 
B 2 38  GLY 38  38  38  GLY GLY B . n 
B 2 39  GLY 39  39  39  GLY GLY B . n 
B 2 40  HIS 40  40  40  HIS HIS B . n 
B 2 41  LEU 41  41  41  LEU LEU B . n 
B 2 42  MET 42  42  42  MET MET B . n 
B 2 43  SER 43  43  43  SER SER B . n 
B 2 44  VAL 44  44  44  VAL VAL B . n 
B 2 45  ASN 45  45  45  ASN ASN B . n 
B 2 46  SER 46  46  46  SER SER B . n 
B 2 47  ARG 47  47  47  ARG ARG B . n 
B 2 48  GLU 48  48  48  GLU GLU B . n 
B 2 49  GLU 49  49  49  GLU GLU B . n 
B 2 50  GLY 50  50  50  GLY GLY B . n 
B 2 51  GLU 51  51  51  GLU GLU B . n 
B 2 52  PHE 52  52  52  PHE PHE B . n 
B 2 53  ILE 53  53  53  ILE ILE B . n 
B 2 54  SER 54  54  54  SER SER B . n 
B 2 55  LYS 55  55  55  LYS LYS B . n 
B 2 56  LEU 56  56  56  LEU LEU B . n 
B 2 57  ALA 57  57  57  ALA ALA B . n 
B 2 58  LEU 58  58  58  LEU LEU B . n 
B 2 59  GLU 59  59  59  GLU GLU B . n 
B 2 60  LYS 60  60  60  LYS LYS B . n 
B 2 61  MET 61  61  61  MET MET B . n 
B 2 62  ARG 62  62  62  ARG ARG B . n 
B 2 63  ILE 63  63  63  ILE ILE B . n 
B 2 64  VAL 64  64  64  VAL VAL B . n 
B 2 65  LEU 65  65  65  LEU LEU B . n 
B 2 66  VAL 66  66  66  VAL VAL B . n 
B 2 67  TRP 67  67  67  TRP TRP B . n 
B 2 68  ILE 68  68  68  ILE ILE B . n 
B 2 69  GLY 69  69  69  GLY GLY B . n 
B 2 70  LEU 70  70  70  LEU LEU B . n 
B 2 71  SER 71  71  71  SER SER B . n 
B 2 72  HIS 72  72  72  HIS HIS B . n 
B 2 73  PHE 73  73  73  PHE PHE B . n 
B 2 74  TRP 74  74  74  TRP TRP B . n 
B 2 75  ARG 75  75  75  ARG ARG B . n 
B 2 76  ILE 76  76  76  ILE ILE B . n 
B 2 77  CYS 77  77  77  CYS CYS B . n 
B 2 78  PRO 78  78  78  PRO PRO B . n 
B 2 79  LEU 79  79  79  LEU LEU B . n 
B 2 80  ARG 80  80  80  ARG ARG B . n 
B 2 81  TRP 81  81  81  TRP TRP B . n 
B 2 82  THR 82  82  82  THR THR B . n 
B 2 83  ASP 83  83  83  ASP ASP B . n 
B 2 84  GLY 84  84  84  GLY GLY B . n 
B 2 85  ALA 85  85  85  ALA ALA B . n 
B 2 86  ARG 86  86  86  ARG ARG B . n 
B 2 87  LEU 87  87  87  LEU LEU B . n 
B 2 88  ASP 88  88  88  ASP ASP B . n 
B 2 89  TYR 89  89  89  TYR TYR B . n 
B 2 90  ARG 90  90  90  ARG ARG B . n 
B 2 91  ALA 91  91  91  ALA ALA B . n 
B 2 92  LEU 92  92  92  LEU LEU B . n 
B 2 93  SER 93  93  93  SER SER B . n 
B 2 94  ASP 94  94  94  ASP ASP B . n 
B 2 95  GLU 95  95  95  GLU GLU B . n 
B 2 96  PRO 96  96  96  PRO PRO B . n 
B 2 97  ILE 97  97  97  ILE ILE B . n 
B 2 98  CYS 98  98  98  CYS CYS B . n 
B 2 99  PHE 99  99  99  PHE PHE B . n 
B 2 100 VAL 100 100 100 VAL VAL B . n 
B 2 101 ALA 101 101 101 ALA ALA B . n 
B 2 102 GLU 102 102 102 GLU GLU B . n 
B 2 103 SER 103 103 103 SER SER B . n 
B 2 104 PHE 104 104 104 PHE PHE B . n 
B 2 105 HIS 105 105 105 HIS HIS B . n 
B 2 106 ASN 106 106 106 ASN ASN B . n 
B 2 107 LYS 107 107 107 LYS LYS B . n 
B 2 108 TRP 108 108 108 TRP TRP B . n 
B 2 109 ILE 109 109 109 ILE ILE B . n 
B 2 110 GLN 110 110 110 GLN GLN B . n 
B 2 111 TRP 111 111 111 TRP TRP B . n 
B 2 112 THR 112 112 112 THR THR B . n 
B 2 113 CYS 113 113 113 CYS CYS B . n 
B 2 114 ASN 114 114 114 ASN ASN B . n 
B 2 115 ARG 115 115 115 ARG ARG B . n 
B 2 116 LYS 116 116 116 LYS LYS B . n 
B 2 117 LYS 117 117 117 LYS LYS B . n 
B 2 118 SER 118 118 118 SER SER B . n 
B 2 119 PHE 119 119 119 PHE PHE B . n 
B 2 120 VAL 120 120 120 VAL VAL B . n 
B 2 121 CYS 121 121 121 CYS CYS B . n 
B 2 122 LYS 122 122 122 LYS LYS B . n 
B 2 123 TYR 123 123 123 TYR TYR B . n 
B 2 124 ARG 124 124 124 ARG ARG B . n 
B 2 125 VAL 125 125 125 VAL VAL B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3220  ? 
1 MORE         -25   ? 
1 'SSA (A^2)'  12670 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2001-11-28 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' .   ? 1 
SCALEPACK 'data scaling'   .   ? 2 
AMoRE     phasing          .   ? 3 
CNS       refinement       1.0 ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LYS A 12 ? ? 37.29   52.00  
2 1 ASN A 35 ? ? -98.79  34.11  
3 1 ASN A 93 ? ? -140.84 47.74  
4 1 TYR B 11 ? ? -161.39 118.79 
5 1 ASP B 88 ? ? -92.78  -78.57 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ASP 1   ? A ASP 1   
2  1 Y 1 A PRO 2   ? A PRO 2   
3  1 Y 1 A GLY 3   ? A GLY 3   
4  1 Y 1 A THR 60  ? A THR 60  
5  1 Y 1 A LYS 61  ? A LYS 61  
6  1 Y 1 A ARG 128 ? A ARG 128 
7  1 Y 1 A LEU 129 ? A LEU 129 
8  1 Y 1 A PRO 130 ? A PRO 130 
9  1 Y 1 A HIS 131 ? A HIS 131 
10 1 Y 1 B ASP 1   ? B ASP 1   
11 1 Y 1 B GLU 2   ? B GLU 2   
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 HOH 1  132 1   HOH HOH A . 
C 3 HOH 2  133 3   HOH HOH A . 
C 3 HOH 3  134 4   HOH HOH A . 
C 3 HOH 4  135 5   HOH HOH A . 
C 3 HOH 5  136 6   HOH HOH A . 
C 3 HOH 6  137 7   HOH HOH A . 
C 3 HOH 7  138 8   HOH HOH A . 
C 3 HOH 8  139 9   HOH HOH A . 
C 3 HOH 9  140 11  HOH HOH A . 
C 3 HOH 10 141 14  HOH HOH A . 
C 3 HOH 11 142 16  HOH HOH A . 
C 3 HOH 12 143 17  HOH HOH A . 
C 3 HOH 13 144 18  HOH HOH A . 
C 3 HOH 14 145 22  HOH HOH A . 
C 3 HOH 15 146 27  HOH HOH A . 
C 3 HOH 16 147 29  HOH HOH A . 
C 3 HOH 17 148 34  HOH HOH A . 
C 3 HOH 18 149 36  HOH HOH A . 
C 3 HOH 19 150 39  HOH HOH A . 
C 3 HOH 20 151 40  HOH HOH A . 
C 3 HOH 21 152 42  HOH HOH A . 
C 3 HOH 22 153 44  HOH HOH A . 
C 3 HOH 23 154 47  HOH HOH A . 
C 3 HOH 24 155 48  HOH HOH A . 
C 3 HOH 25 156 51  HOH HOH A . 
C 3 HOH 26 157 53  HOH HOH A . 
C 3 HOH 27 158 55  HOH HOH A . 
C 3 HOH 28 159 57  HOH HOH A . 
C 3 HOH 29 160 59  HOH HOH A . 
C 3 HOH 30 161 60  HOH HOH A . 
C 3 HOH 31 162 61  HOH HOH A . 
C 3 HOH 32 163 63  HOH HOH A . 
C 3 HOH 33 164 67  HOH HOH A . 
C 3 HOH 34 165 68  HOH HOH A . 
C 3 HOH 35 166 69  HOH HOH A . 
C 3 HOH 36 167 71  HOH HOH A . 
C 3 HOH 37 168 73  HOH HOH A . 
C 3 HOH 38 169 75  HOH HOH A . 
C 3 HOH 39 170 77  HOH HOH A . 
C 3 HOH 40 171 78  HOH HOH A . 
C 3 HOH 41 172 79  HOH HOH A . 
C 3 HOH 42 173 81  HOH HOH A . 
C 3 HOH 43 174 83  HOH HOH A . 
C 3 HOH 44 175 85  HOH HOH A . 
C 3 HOH 45 176 86  HOH HOH A . 
C 3 HOH 46 177 90  HOH HOH A . 
C 3 HOH 47 178 94  HOH HOH A . 
C 3 HOH 48 179 96  HOH HOH A . 
C 3 HOH 49 180 98  HOH HOH A . 
C 3 HOH 50 181 100 HOH HOH A . 
C 3 HOH 51 182 101 HOH HOH A . 
C 3 HOH 52 183 103 HOH HOH A . 
C 3 HOH 53 184 104 HOH HOH A . 
C 3 HOH 54 185 110 HOH HOH A . 
C 3 HOH 55 186 112 HOH HOH A . 
C 3 HOH 56 187 114 HOH HOH A . 
C 3 HOH 57 188 116 HOH HOH A . 
C 3 HOH 58 189 118 HOH HOH A . 
C 3 HOH 59 190 119 HOH HOH A . 
C 3 HOH 60 191 121 HOH HOH A . 
C 3 HOH 61 192 122 HOH HOH A . 
C 3 HOH 62 193 123 HOH HOH A . 
C 3 HOH 63 194 124 HOH HOH A . 
C 3 HOH 64 195 126 HOH HOH A . 
C 3 HOH 65 196 128 HOH HOH A . 
C 3 HOH 66 197 129 HOH HOH A . 
C 3 HOH 67 198 130 HOH HOH A . 
C 3 HOH 68 199 133 HOH HOH A . 
C 3 HOH 69 200 134 HOH HOH A . 
C 3 HOH 70 201 136 HOH HOH A . 
C 3 HOH 71 202 137 HOH HOH A . 
C 3 HOH 72 203 138 HOH HOH A . 
C 3 HOH 73 204 140 HOH HOH A . 
C 3 HOH 74 205 143 HOH HOH A . 
D 3 HOH 1  126 2   HOH HOH B . 
D 3 HOH 2  127 10  HOH HOH B . 
D 3 HOH 3  128 12  HOH HOH B . 
D 3 HOH 4  129 13  HOH HOH B . 
D 3 HOH 5  130 15  HOH HOH B . 
D 3 HOH 6  131 19  HOH HOH B . 
D 3 HOH 7  132 20  HOH HOH B . 
D 3 HOH 8  133 21  HOH HOH B . 
D 3 HOH 9  134 23  HOH HOH B . 
D 3 HOH 10 135 24  HOH HOH B . 
D 3 HOH 11 136 25  HOH HOH B . 
D 3 HOH 12 137 26  HOH HOH B . 
D 3 HOH 13 138 28  HOH HOH B . 
D 3 HOH 14 139 30  HOH HOH B . 
D 3 HOH 15 140 31  HOH HOH B . 
D 3 HOH 16 141 32  HOH HOH B . 
D 3 HOH 17 142 33  HOH HOH B . 
D 3 HOH 18 143 35  HOH HOH B . 
D 3 HOH 19 144 37  HOH HOH B . 
D 3 HOH 20 145 38  HOH HOH B . 
D 3 HOH 21 146 41  HOH HOH B . 
D 3 HOH 22 147 43  HOH HOH B . 
D 3 HOH 23 148 45  HOH HOH B . 
D 3 HOH 24 149 46  HOH HOH B . 
D 3 HOH 25 150 49  HOH HOH B . 
D 3 HOH 26 151 50  HOH HOH B . 
D 3 HOH 27 152 52  HOH HOH B . 
D 3 HOH 28 153 54  HOH HOH B . 
D 3 HOH 29 154 56  HOH HOH B . 
D 3 HOH 30 155 58  HOH HOH B . 
D 3 HOH 31 156 62  HOH HOH B . 
D 3 HOH 32 157 64  HOH HOH B . 
D 3 HOH 33 158 65  HOH HOH B . 
D 3 HOH 34 159 66  HOH HOH B . 
D 3 HOH 35 160 70  HOH HOH B . 
D 3 HOH 36 161 72  HOH HOH B . 
D 3 HOH 37 162 74  HOH HOH B . 
D 3 HOH 38 163 76  HOH HOH B . 
D 3 HOH 39 164 80  HOH HOH B . 
D 3 HOH 40 165 82  HOH HOH B . 
D 3 HOH 41 166 84  HOH HOH B . 
D 3 HOH 42 167 87  HOH HOH B . 
D 3 HOH 43 168 88  HOH HOH B . 
D 3 HOH 44 169 89  HOH HOH B . 
D 3 HOH 45 170 91  HOH HOH B . 
D 3 HOH 46 171 92  HOH HOH B . 
D 3 HOH 47 172 93  HOH HOH B . 
D 3 HOH 48 173 95  HOH HOH B . 
D 3 HOH 49 174 97  HOH HOH B . 
D 3 HOH 50 175 99  HOH HOH B . 
D 3 HOH 51 176 102 HOH HOH B . 
D 3 HOH 52 177 105 HOH HOH B . 
D 3 HOH 53 178 106 HOH HOH B . 
D 3 HOH 54 179 107 HOH HOH B . 
D 3 HOH 55 180 108 HOH HOH B . 
D 3 HOH 56 181 109 HOH HOH B . 
D 3 HOH 57 182 111 HOH HOH B . 
D 3 HOH 58 183 113 HOH HOH B . 
D 3 HOH 59 184 115 HOH HOH B . 
D 3 HOH 60 185 117 HOH HOH B . 
D 3 HOH 61 186 120 HOH HOH B . 
D 3 HOH 62 187 125 HOH HOH B . 
D 3 HOH 63 188 127 HOH HOH B . 
D 3 HOH 64 189 131 HOH HOH B . 
D 3 HOH 65 190 132 HOH HOH B . 
D 3 HOH 66 191 135 HOH HOH B . 
D 3 HOH 67 192 139 HOH HOH B . 
D 3 HOH 68 193 141 HOH HOH B . 
D 3 HOH 69 194 142 HOH HOH B . 
#