data_1JWL
# 
_entry.id   1JWL 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1JWL         
NDB   PD0250       
RCSB  RCSB014268   
WWPDB D_1000014268 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1JWL 
_pdbx_database_status.recvd_initial_deposition_date   2001-09-04 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Bell, C.E.' 1 
'Lewis, M.'  2 
# 
_citation.id                        primary 
_citation.title                     'Crystallographic analysis of Lac repressor bound to natural operator O1.' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            312 
_citation.page_first                921 
_citation.page_last                 926 
_citation.year                      2001 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11580238 
_citation.pdbx_database_id_DOI      10.1006/jmbi.2001.5024 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Bell, C.E.' 1 ? 
primary 'Lewis, M.'  2 ? 
# 
_cell.entry_id           1JWL 
_cell.length_a           255.771 
_cell.length_b           255.771 
_cell.length_c           206.795 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              54 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1JWL 
_symmetry.space_group_name_H-M             'H 3 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                155 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn "5'-D(*AP*GP*AP*AP*T*TP*GP*TP*GP*AP*GP*CP*GP*GP*AP*TP*AP*AP*CP*AP*AP*TP*T)-3'"  7152.660  1 ? ? ? 
'O1 top strand'    
2 polymer     syn "5'-D(*TP*AP*AP*TP*TP*GP*TP*TP*AP*TP*CP*CP*GP*CP*TP*CP*AP*CP*AP*AP*TP*TP*C)-3'" 6965.521  1 ? ? ? 
'O1 bottom strand' 
3 polymer     man 'Lactose Operon Repressor'                                                      35756.797 3 ? ? 
'C-terminal deletion mutant' ?                  
4 non-polymer syn '2-nitrophenyl beta-D-fucopyranoside'                                           285.250   3 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no 
;(DA)(DG)(DA)(DA)(DT)(DT)(DG)(DT)(DG)(DA)(DG)(DC)(DG)(DG)(DA)(DT)(DA)(DA)(DC)(DA)
(DA)(DT)(DT)
;
AGAATTGTGAGCGGATAACAATT D     ? 
2 polydeoxyribonucleotide no no 
;(DT)(DA)(DA)(DT)(DT)(DG)(DT)(DT)(DA)(DT)(DC)(DC)(DG)(DC)(DT)(DC)(DA)(DC)(DA)(DA)
(DT)(DT)(DC)
;
TAATTGTTATCCGCTCACAATTC E     ? 
3 'polypeptide(L)'        no no 
;MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIV
AAIKSRADQLGASVVVSMVERSGVEACKTAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSII
FSHEDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSAMSGFQQTMQMLNEGIVPT
AMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSCYIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLP
VSLVKRKTTLAPN
;
;MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIV
AAIKSRADQLGASVVVSMVERSGVEACKTAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSII
FSHEDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSAMSGFQQTMQMLNEGIVPT
AMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSCYIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLP
VSLVKRKTTLAPN
;
A,B,C ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DA  n 
1 2   DG  n 
1 3   DA  n 
1 4   DA  n 
1 5   DT  n 
1 6   DT  n 
1 7   DG  n 
1 8   DT  n 
1 9   DG  n 
1 10  DA  n 
1 11  DG  n 
1 12  DC  n 
1 13  DG  n 
1 14  DG  n 
1 15  DA  n 
1 16  DT  n 
1 17  DA  n 
1 18  DA  n 
1 19  DC  n 
1 20  DA  n 
1 21  DA  n 
1 22  DT  n 
1 23  DT  n 
2 1   DT  n 
2 2   DA  n 
2 3   DA  n 
2 4   DT  n 
2 5   DT  n 
2 6   DG  n 
2 7   DT  n 
2 8   DT  n 
2 9   DA  n 
2 10  DT  n 
2 11  DC  n 
2 12  DC  n 
2 13  DG  n 
2 14  DC  n 
2 15  DT  n 
2 16  DC  n 
2 17  DA  n 
2 18  DC  n 
2 19  DA  n 
2 20  DA  n 
2 21  DT  n 
2 22  DT  n 
2 23  DC  n 
3 1   MET n 
3 2   LYS n 
3 3   PRO n 
3 4   VAL n 
3 5   THR n 
3 6   LEU n 
3 7   TYR n 
3 8   ASP n 
3 9   VAL n 
3 10  ALA n 
3 11  GLU n 
3 12  TYR n 
3 13  ALA n 
3 14  GLY n 
3 15  VAL n 
3 16  SER n 
3 17  TYR n 
3 18  GLN n 
3 19  THR n 
3 20  VAL n 
3 21  SER n 
3 22  ARG n 
3 23  VAL n 
3 24  VAL n 
3 25  ASN n 
3 26  GLN n 
3 27  ALA n 
3 28  SER n 
3 29  HIS n 
3 30  VAL n 
3 31  SER n 
3 32  ALA n 
3 33  LYS n 
3 34  THR n 
3 35  ARG n 
3 36  GLU n 
3 37  LYS n 
3 38  VAL n 
3 39  GLU n 
3 40  ALA n 
3 41  ALA n 
3 42  MET n 
3 43  ALA n 
3 44  GLU n 
3 45  LEU n 
3 46  ASN n 
3 47  TYR n 
3 48  ILE n 
3 49  PRO n 
3 50  ASN n 
3 51  ARG n 
3 52  VAL n 
3 53  ALA n 
3 54  GLN n 
3 55  GLN n 
3 56  LEU n 
3 57  ALA n 
3 58  GLY n 
3 59  LYS n 
3 60  GLN n 
3 61  SER n 
3 62  LEU n 
3 63  LEU n 
3 64  ILE n 
3 65  GLY n 
3 66  VAL n 
3 67  ALA n 
3 68  THR n 
3 69  SER n 
3 70  SER n 
3 71  LEU n 
3 72  ALA n 
3 73  LEU n 
3 74  HIS n 
3 75  ALA n 
3 76  PRO n 
3 77  SER n 
3 78  GLN n 
3 79  ILE n 
3 80  VAL n 
3 81  ALA n 
3 82  ALA n 
3 83  ILE n 
3 84  LYS n 
3 85  SER n 
3 86  ARG n 
3 87  ALA n 
3 88  ASP n 
3 89  GLN n 
3 90  LEU n 
3 91  GLY n 
3 92  ALA n 
3 93  SER n 
3 94  VAL n 
3 95  VAL n 
3 96  VAL n 
3 97  SER n 
3 98  MET n 
3 99  VAL n 
3 100 GLU n 
3 101 ARG n 
3 102 SER n 
3 103 GLY n 
3 104 VAL n 
3 105 GLU n 
3 106 ALA n 
3 107 CYS n 
3 108 LYS n 
3 109 THR n 
3 110 ALA n 
3 111 VAL n 
3 112 HIS n 
3 113 ASN n 
3 114 LEU n 
3 115 LEU n 
3 116 ALA n 
3 117 GLN n 
3 118 ARG n 
3 119 VAL n 
3 120 SER n 
3 121 GLY n 
3 122 LEU n 
3 123 ILE n 
3 124 ILE n 
3 125 ASN n 
3 126 TYR n 
3 127 PRO n 
3 128 LEU n 
3 129 ASP n 
3 130 ASP n 
3 131 GLN n 
3 132 ASP n 
3 133 ALA n 
3 134 ILE n 
3 135 ALA n 
3 136 VAL n 
3 137 GLU n 
3 138 ALA n 
3 139 ALA n 
3 140 CYS n 
3 141 THR n 
3 142 ASN n 
3 143 VAL n 
3 144 PRO n 
3 145 ALA n 
3 146 LEU n 
3 147 PHE n 
3 148 LEU n 
3 149 ASP n 
3 150 VAL n 
3 151 SER n 
3 152 ASP n 
3 153 GLN n 
3 154 THR n 
3 155 PRO n 
3 156 ILE n 
3 157 ASN n 
3 158 SER n 
3 159 ILE n 
3 160 ILE n 
3 161 PHE n 
3 162 SER n 
3 163 HIS n 
3 164 GLU n 
3 165 ASP n 
3 166 GLY n 
3 167 THR n 
3 168 ARG n 
3 169 LEU n 
3 170 GLY n 
3 171 VAL n 
3 172 GLU n 
3 173 HIS n 
3 174 LEU n 
3 175 VAL n 
3 176 ALA n 
3 177 LEU n 
3 178 GLY n 
3 179 HIS n 
3 180 GLN n 
3 181 GLN n 
3 182 ILE n 
3 183 ALA n 
3 184 LEU n 
3 185 LEU n 
3 186 ALA n 
3 187 GLY n 
3 188 PRO n 
3 189 LEU n 
3 190 SER n 
3 191 SER n 
3 192 VAL n 
3 193 SER n 
3 194 ALA n 
3 195 ARG n 
3 196 LEU n 
3 197 ARG n 
3 198 LEU n 
3 199 ALA n 
3 200 GLY n 
3 201 TRP n 
3 202 HIS n 
3 203 LYS n 
3 204 TYR n 
3 205 LEU n 
3 206 THR n 
3 207 ARG n 
3 208 ASN n 
3 209 GLN n 
3 210 ILE n 
3 211 GLN n 
3 212 PRO n 
3 213 ILE n 
3 214 ALA n 
3 215 GLU n 
3 216 ARG n 
3 217 GLU n 
3 218 GLY n 
3 219 ASP n 
3 220 TRP n 
3 221 SER n 
3 222 ALA n 
3 223 MET n 
3 224 SER n 
3 225 GLY n 
3 226 PHE n 
3 227 GLN n 
3 228 GLN n 
3 229 THR n 
3 230 MET n 
3 231 GLN n 
3 232 MET n 
3 233 LEU n 
3 234 ASN n 
3 235 GLU n 
3 236 GLY n 
3 237 ILE n 
3 238 VAL n 
3 239 PRO n 
3 240 THR n 
3 241 ALA n 
3 242 MET n 
3 243 LEU n 
3 244 VAL n 
3 245 ALA n 
3 246 ASN n 
3 247 ASP n 
3 248 GLN n 
3 249 MET n 
3 250 ALA n 
3 251 LEU n 
3 252 GLY n 
3 253 ALA n 
3 254 MET n 
3 255 ARG n 
3 256 ALA n 
3 257 ILE n 
3 258 THR n 
3 259 GLU n 
3 260 SER n 
3 261 GLY n 
3 262 LEU n 
3 263 ARG n 
3 264 VAL n 
3 265 GLY n 
3 266 ALA n 
3 267 ASP n 
3 268 ILE n 
3 269 SER n 
3 270 VAL n 
3 271 VAL n 
3 272 GLY n 
3 273 TYR n 
3 274 ASP n 
3 275 ASP n 
3 276 THR n 
3 277 GLU n 
3 278 ASP n 
3 279 SER n 
3 280 SER n 
3 281 CYS n 
3 282 TYR n 
3 283 ILE n 
3 284 PRO n 
3 285 PRO n 
3 286 LEU n 
3 287 THR n 
3 288 THR n 
3 289 ILE n 
3 290 LYS n 
3 291 GLN n 
3 292 ASP n 
3 293 PHE n 
3 294 ARG n 
3 295 LEU n 
3 296 LEU n 
3 297 GLY n 
3 298 GLN n 
3 299 THR n 
3 300 SER n 
3 301 VAL n 
3 302 ASP n 
3 303 ARG n 
3 304 LEU n 
3 305 LEU n 
3 306 GLN n 
3 307 LEU n 
3 308 SER n 
3 309 GLN n 
3 310 GLY n 
3 311 GLN n 
3 312 ALA n 
3 313 VAL n 
3 314 LYS n 
3 315 GLY n 
3 316 ASN n 
3 317 GLN n 
3 318 LEU n 
3 319 LEU n 
3 320 PRO n 
3 321 VAL n 
3 322 SER n 
3 323 LEU n 
3 324 VAL n 
3 325 LYS n 
3 326 ARG n 
3 327 LYS n 
3 328 THR n 
3 329 THR n 
3 330 LEU n 
3 331 ALA n 
3 332 PRO n 
3 333 ASN n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Escherichia 
_entity_src_gen.pdbx_gene_src_gene                 LacI 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     562 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP LACI_ECOLI 3 
;MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIV
AAIKSRADQLGASVVVSMVERSGVEACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSII
FSHEDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSAMSGFQQTMQMLNEGIVPT
AMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSCYIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLP
VSLVKRKTTLAPN
;
1 P03023 ? 
2 PDB 1JWL       1 ? ? 1JWL   ? 
3 PDB 1JWL       2 ? ? 1JWL   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1JWL A 1 ? 333 ? P03023 1 ? 333 ? 1 333 
2 1 1JWL B 1 ? 333 ? P03023 1 ? 333 ? 1 333 
3 1 1JWL C 1 ? 333 ? P03023 1 ? 333 ? 1 333 
4 2 1JWL D 1 ? 23  ? 1JWL   1 ? 23  ? 1 23  
5 3 1JWL E 1 ? 23  ? 1JWL   1 ? 23  ? 1 23  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1JWL THR A 109 ? UNP P03023 ALA 109 'SEE REMARK 999' 109 1 
2 1JWL THR B 109 ? UNP P03023 ALA 109 'SEE REMARK 999' 109 2 
3 1JWL THR C 109 ? UNP P03023 ALA 109 'SEE REMARK 999' 109 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                               ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                              ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                            ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                       ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                              ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"  ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"   ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"  ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"          ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                             ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                       ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                               ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                             ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                            ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                               ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                            ? 'C5 H11 N O2 S'   149.211 
NPF D-saccharide        n '2-nitrophenyl beta-D-fucopyranoside' ? 'C12 H15 N O7'    285.250 
PHE 'L-peptide linking' y PHENYLALANINE                         ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                               ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                             ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                            ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                              ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1JWL 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      5.36 
_exptl_crystal.density_percent_sol   77.06 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    'ammonium sulfate, PEG400, HEPES, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 295K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 'ammonium sulfate' ? ? ? 
1 2 1 PEG400             ? ? ? 
1 3 1 HEPES              ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           295 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Osmic Mirrors' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.54 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        RIGAKU 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.54 
# 
_reflns.entry_id                     1JWL 
_reflns.observed_criterion_sigma_I   -2.0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             16.0 
_reflns.d_resolution_high            4.0 
_reflns.number_obs                   20847 
_reflns.number_all                   68073 
_reflns.percent_possible_obs         96.1 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.1110000 
_reflns.pdbx_netI_over_sigmaI        7.9 
_reflns.B_iso_Wilson_estimate        45.0 
_reflns.pdbx_redundancy              3.3 
_reflns.R_free_details               ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             4.0 
_reflns_shell.d_res_low              ? 
_reflns_shell.percent_possible_all   93.9 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.2770000 
_reflns_shell.meanI_over_sigI_obs    2.7 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1JWL 
_refine.ls_number_reflns_obs                     19784 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               128004.13 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.ls_d_res_low                             9.99 
_refine.ls_d_res_high                            4.00 
_refine.ls_percent_reflns_obs                    96.1 
_refine.ls_R_factor_obs                          0.2490000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2490000 
_refine.ls_R_factor_R_free                       0.2610000 
_refine.ls_R_factor_R_free_error                 0.006 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 9.9 
_refine.ls_number_reflns_R_free                  1953 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               67.7 
_refine.aniso_B[1][1]                            -0.16 
_refine.aniso_B[2][2]                            -0.16 
_refine.aniso_B[3][3]                            0.32 
_refine.aniso_B[1][2]                            12.83 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.361311 
_refine.solvent_model_param_bsol                 64.8743 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1EFA 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1JWL 
_refine_analyze.Luzzati_coordinate_error_obs    0.44 
_refine_analyze.Luzzati_sigma_a_obs             0.61 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.47 
_refine_analyze.Luzzati_sigma_a_free            0.55 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6641 
_refine_hist.pdbx_number_atoms_nucleic_acid   571 
_refine_hist.pdbx_number_atoms_ligand         60 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               7272 
_refine_hist.d_res_high                       4.00 
_refine_hist.d_res_low                        9.99 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.010 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.6   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      23.5  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      1.54  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.28  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            2.32  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             1.37  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            2.34  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       4.00 
_refine_ls_shell.d_res_low                        4.23 
_refine_ls_shell.number_reflns_R_work             2886 
_refine_ls_shell.R_factor_R_work                  0.2720000 
_refine_ls_shell.percent_reflns_obs               94.2 
_refine_ls_shell.R_factor_R_free                  0.2910000 
_refine_ls_shell.R_factor_R_free_error            0.016 
_refine_ls_shell.percent_reflns_R_free            10.1 
_refine_ls_shell.number_reflns_R_free             325 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 DNA-RNA_REP.PARAM DNA-RNA.TOP 'X-RAY DIFFRACTION' 
3 PARAM.ONPF        TOP.ONPF    'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1JWL 
_struct.title                     'Structure of the Dimeric lac Repressor/Operator O1/ONPF Complex' 
_struct.pdbx_descriptor           'LACTOSE OPERON REPRESSOR/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1JWL 
_struct_keywords.pdbx_keywords   TRANSCRIPTION/DNA 
_struct_keywords.text            'Lac Repressor, Gene Regulation, DNA-Bending, TRANSCRIPTION-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 3 ? 
F N N 4 ? 
G N N 4 ? 
H N N 4 ? 
# 
loop_
_struct_biol.id 
_struct_biol.pdbx_parent_biol_id 
_struct_biol.details 
1 ? ? 
2 ? ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  TYR C 7   ? TYR C 12  ? TYR A 7   TYR A 12  1 ? 6  
HELX_P HELX_P2  2  SER C 16  ? ASN C 25  ? SER A 16  ASN A 25  1 ? 10 
HELX_P HELX_P3  3  ALA C 32  ? ASN C 46  ? ALA A 32  ASN A 46  1 ? 15 
HELX_P HELX_P4  4  ASN C 50  ? ALA C 57  ? ASN A 50  ALA A 57  1 ? 8  
HELX_P HELX_P5  5  LEU C 73  ? LEU C 90  ? LEU A 73  LEU A 90  1 ? 18 
HELX_P HELX_P6  6  GLY C 103 ? GLN C 117 ? GLY A 103 GLN A 117 1 ? 15 
HELX_P HELX_P7  7  ASP C 129 ? CYS C 140 ? ASP A 129 CYS A 140 1 ? 12 
HELX_P HELX_P8  8  SER C 162 ? LEU C 177 ? SER A 162 LEU A 177 1 ? 16 
HELX_P HELX_P9  9  SER C 191 ? ARG C 207 ? SER A 191 ARG A 207 1 ? 17 
HELX_P HELX_P10 10 SER C 221 ? GLU C 235 ? SER A 221 GLU A 235 1 ? 15 
HELX_P HELX_P11 11 ASN C 246 ? GLU C 259 ? ASN A 246 GLU A 259 1 ? 14 
HELX_P HELX_P12 12 GLU C 277 ? TYR C 282 ? GLU A 277 TYR A 282 5 ? 6  
HELX_P HELX_P13 13 ASP C 292 ? GLN C 309 ? ASP A 292 GLN A 309 1 ? 18 
HELX_P HELX_P14 14 TYR D 7   ? TYR D 12  ? TYR B 7   TYR B 12  1 ? 6  
HELX_P HELX_P15 15 SER D 16  ? ASN D 25  ? SER B 16  ASN B 25  1 ? 10 
HELX_P HELX_P16 16 ALA D 32  ? ASN D 46  ? ALA B 32  ASN B 46  1 ? 15 
HELX_P HELX_P17 17 ASN D 50  ? ALA D 57  ? ASN B 50  ALA B 57  1 ? 8  
HELX_P HELX_P18 18 LEU D 73  ? LEU D 90  ? LEU B 73  LEU B 90  1 ? 18 
HELX_P HELX_P19 19 GLY D 103 ? GLN D 117 ? GLY B 103 GLN B 117 1 ? 15 
HELX_P HELX_P20 20 ASP D 129 ? CYS D 140 ? ASP B 129 CYS B 140 1 ? 12 
HELX_P HELX_P21 21 SER D 162 ? LEU D 177 ? SER B 162 LEU B 177 1 ? 16 
HELX_P HELX_P22 22 SER D 191 ? ARG D 207 ? SER B 191 ARG B 207 1 ? 17 
HELX_P HELX_P23 23 SER D 221 ? GLU D 235 ? SER B 221 GLU B 235 1 ? 15 
HELX_P HELX_P24 24 ASN D 246 ? GLU D 259 ? ASN B 246 GLU B 259 1 ? 14 
HELX_P HELX_P25 25 GLU D 277 ? TYR D 282 ? GLU B 277 TYR B 282 5 ? 6  
HELX_P HELX_P26 26 ASP D 292 ? GLN D 309 ? ASP B 292 GLN B 309 1 ? 18 
HELX_P HELX_P27 27 LEU E 73  ? LEU E 90  ? LEU C 73  LEU C 90  1 ? 18 
HELX_P HELX_P28 28 GLY E 103 ? GLN E 117 ? GLY C 103 GLN C 117 1 ? 15 
HELX_P HELX_P29 29 ASP E 129 ? CYS E 140 ? ASP C 129 CYS C 140 1 ? 12 
HELX_P HELX_P30 30 SER E 162 ? LEU E 177 ? SER C 162 LEU C 177 1 ? 16 
HELX_P HELX_P31 31 SER E 191 ? ARG E 207 ? SER C 191 ARG C 207 1 ? 17 
HELX_P HELX_P32 32 SER E 221 ? GLU E 235 ? SER C 221 GLU C 235 1 ? 15 
HELX_P HELX_P33 33 ASN E 246 ? GLU E 259 ? ASN C 246 GLU C 259 1 ? 14 
HELX_P HELX_P34 34 GLU E 277 ? TYR E 282 ? GLU C 277 TYR C 282 5 ? 6  
HELX_P HELX_P35 35 ASP E 292 ? GLN E 309 ? ASP C 292 GLN C 309 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
hydrog1  hydrog ? ? A DT 6  N3 ? ? ? 1_555 B DA 19 N1 ? ? D DT 6  E DA 19 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog2  hydrog ? ? A DT 6  O4 ? ? ? 1_555 B DA 19 N6 ? ? D DT 6  E DA 19 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog3  hydrog ? ? A DG 7  N1 ? ? ? 1_555 B DC 18 N3 ? ? D DG 7  E DC 18 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog4  hydrog ? ? A DG 7  N2 ? ? ? 1_555 B DC 18 O2 ? ? D DG 7  E DC 18 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog5  hydrog ? ? A DG 7  O6 ? ? ? 1_555 B DC 18 N4 ? ? D DG 7  E DC 18 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog6  hydrog ? ? A DT 8  N3 ? ? ? 1_555 B DA 17 N1 ? ? D DT 8  E DA 17 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog7  hydrog ? ? A DT 8  O4 ? ? ? 1_555 B DA 17 N6 ? ? D DT 8  E DA 17 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog8  hydrog ? ? A DG 9  N1 ? ? ? 1_555 B DC 16 N3 ? ? D DG 9  E DC 16 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog9  hydrog ? ? A DG 9  N2 ? ? ? 1_555 B DC 16 O2 ? ? D DG 9  E DC 16 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog10 hydrog ? ? A DG 9  O6 ? ? ? 1_555 B DC 16 N4 ? ? D DG 9  E DC 16 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog11 hydrog ? ? A DA 10 N1 ? ? ? 1_555 B DT 15 N3 ? ? D DA 10 E DT 15 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog12 hydrog ? ? A DA 10 N6 ? ? ? 1_555 B DT 15 O4 ? ? D DA 10 E DT 15 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog13 hydrog ? ? A DG 11 N1 ? ? ? 1_555 B DC 14 N3 ? ? D DG 11 E DC 14 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog14 hydrog ? ? A DG 11 N2 ? ? ? 1_555 B DC 14 O2 ? ? D DG 11 E DC 14 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog15 hydrog ? ? A DG 11 O6 ? ? ? 1_555 B DC 14 N4 ? ? D DG 11 E DC 14 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog16 hydrog ? ? A DC 12 N3 ? ? ? 1_555 B DG 13 N1 ? ? D DC 12 E DG 13 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog17 hydrog ? ? A DC 12 N4 ? ? ? 1_555 B DG 13 O6 ? ? D DC 12 E DG 13 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog18 hydrog ? ? A DC 12 O2 ? ? ? 1_555 B DG 13 N2 ? ? D DC 12 E DG 13 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog19 hydrog ? ? A DG 13 N1 ? ? ? 1_555 B DC 12 N3 ? ? D DG 13 E DC 12 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog20 hydrog ? ? A DG 13 N2 ? ? ? 1_555 B DC 12 O2 ? ? D DG 13 E DC 12 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog21 hydrog ? ? A DG 13 O6 ? ? ? 1_555 B DC 12 N4 ? ? D DG 13 E DC 12 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog22 hydrog ? ? A DG 14 N1 ? ? ? 1_555 B DT 10 O4 ? ? D DG 14 E DT 10 1_555 ? ? ? ? ? ? 'DG-DT MISPAIR' ? ? ? 
hydrog23 hydrog ? ? A DG 14 N1 ? ? ? 1_555 B DC 11 N3 ? ? D DG 14 E DC 11 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog24 hydrog ? ? A DG 14 N2 ? ? ? 1_555 B DC 11 O2 ? ? D DG 14 E DC 11 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog25 hydrog ? ? A DG 14 O6 ? ? ? 1_555 B DC 11 N4 ? ? D DG 14 E DC 11 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog26 hydrog ? ? A DA 15 N1 ? ? ? 1_555 B DA 9  N6 ? ? D DA 15 E DA 9  1_555 ? ? ? ? ? ? 'DA-DA MISPAIR' ? ? ? 
hydrog27 hydrog ? ? A DA 15 N1 ? ? ? 1_555 B DT 10 N3 ? ? D DA 15 E DT 10 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog28 hydrog ? ? A DA 15 N6 ? ? ? 1_555 B DT 10 O4 ? ? D DA 15 E DT 10 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog29 hydrog ? ? A DT 16 N3 ? ? ? 1_555 B DA 9  N1 ? ? D DT 16 E DA 9  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog30 hydrog ? ? A DT 16 O4 ? ? ? 1_555 B DA 9  N6 ? ? D DT 16 E DA 9  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog31 hydrog ? ? A DA 17 N1 ? ? ? 1_555 B DT 8  N3 ? ? D DA 17 E DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog32 hydrog ? ? A DA 17 N6 ? ? ? 1_555 B DT 8  O4 ? ? D DA 17 E DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog33 hydrog ? ? A DA 18 N1 ? ? ? 1_555 B DT 7  N3 ? ? D DA 18 E DT 7  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog34 hydrog ? ? A DA 18 N6 ? ? ? 1_555 B DT 7  O4 ? ? D DA 18 E DT 7  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog35 hydrog ? ? A DC 19 N3 ? ? ? 1_555 B DG 6  N1 ? ? D DC 19 E DG 6  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog36 hydrog ? ? A DC 19 N4 ? ? ? 1_555 B DG 6  O6 ? ? D DC 19 E DG 6  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog37 hydrog ? ? A DC 19 O2 ? ? ? 1_555 B DG 6  N2 ? ? D DC 19 E DG 6  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ILE 283 C . ? ILE 283 A PRO 284 C ? PRO 284 A 1 -0.21 
2 ILE 283 D . ? ILE 283 B PRO 284 D ? PRO 284 B 1 -2.05 
3 ILE 283 E . ? ILE 283 C PRO 284 E ? PRO 284 C 1 -0.89 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 2 ? 
C ? 6 ? 
D ? 4 ? 
E ? 2 ? 
F ? 6 ? 
G ? 4 ? 
H ? 2 ? 
I ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
B 1 2 ? parallel      
C 1 2 ? parallel      
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? parallel      
C 5 6 ? anti-parallel 
D 1 2 ? parallel      
D 2 3 ? parallel      
D 3 4 ? parallel      
E 1 2 ? parallel      
F 1 2 ? parallel      
F 2 3 ? parallel      
F 3 4 ? parallel      
F 4 5 ? parallel      
F 5 6 ? anti-parallel 
G 1 2 ? parallel      
G 2 3 ? parallel      
G 3 4 ? parallel      
H 1 2 ? parallel      
I 1 2 ? parallel      
I 2 3 ? parallel      
I 3 4 ? parallel      
I 4 5 ? parallel      
I 5 6 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER C 93  ? VAL C 99  ? SER A 93  VAL A 99  
A 2 LEU C 63  ? SER C 69  ? LEU A 63  SER A 69  
A 3 GLY C 121 ? ASN C 125 ? GLY A 121 ASN A 125 
A 4 ALA C 145 ? PHE C 147 ? ALA A 145 PHE A 147 
B 1 SER C 158 ? PHE C 161 ? SER A 158 PHE A 161 
B 2 ASN C 316 ? LEU C 319 ? ASN A 316 LEU A 319 
C 1 ALA C 214 ? GLU C 217 ? ALA A 214 GLU A 217 
C 2 ILE C 182 ? ALA C 186 ? ILE A 182 ALA A 186 
C 3 ALA C 241 ? VAL C 244 ? ALA A 241 VAL A 244 
C 4 SER C 269 ? ASP C 274 ? SER A 269 ASP A 274 
C 5 THR C 287 ? LYS C 290 ? THR A 287 LYS A 290 
C 6 SER C 322 ? VAL C 324 ? SER A 322 VAL A 324 
D 1 SER D 93  ? MET D 98  ? SER B 93  MET B 98  
D 2 LEU D 63  ? THR D 68  ? LEU B 63  THR B 68  
D 3 GLY D 121 ? ASN D 125 ? GLY B 121 ASN B 125 
D 4 ALA D 145 ? PHE D 147 ? ALA B 145 PHE B 147 
E 1 SER D 158 ? PHE D 161 ? SER B 158 PHE B 161 
E 2 ASN D 316 ? LEU D 319 ? ASN B 316 LEU B 319 
F 1 ALA D 214 ? GLU D 217 ? ALA B 214 GLU B 217 
F 2 ILE D 182 ? ALA D 186 ? ILE B 182 ALA B 186 
F 3 ALA D 241 ? VAL D 244 ? ALA B 241 VAL B 244 
F 4 SER D 269 ? ASP D 274 ? SER B 269 ASP B 274 
F 5 THR D 287 ? LYS D 290 ? THR B 287 LYS B 290 
F 6 SER D 322 ? VAL D 324 ? SER B 322 VAL B 324 
G 1 SER E 93  ? MET E 98  ? SER C 93  MET C 98  
G 2 LEU E 63  ? THR E 68  ? LEU C 63  THR C 68  
G 3 GLY E 121 ? ASN E 125 ? GLY C 121 ASN C 125 
G 4 ALA E 145 ? PHE E 147 ? ALA C 145 PHE C 147 
H 1 SER E 158 ? PHE E 161 ? SER C 158 PHE C 161 
H 2 ASN E 316 ? LEU E 319 ? ASN C 316 LEU C 319 
I 1 ALA E 214 ? GLU E 217 ? ALA C 214 GLU C 217 
I 2 ILE E 182 ? ALA E 186 ? ILE C 182 ALA C 186 
I 3 ALA E 241 ? VAL E 244 ? ALA C 241 VAL C 244 
I 4 SER E 269 ? ASP E 274 ? SER C 269 ASP C 274 
I 5 THR E 287 ? LYS E 290 ? THR C 287 LYS C 290 
I 6 SER E 322 ? VAL E 324 ? SER C 322 VAL C 324 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O SER C 97  ? O SER A 97  N VAL C 66  ? N VAL A 66  
A 2 3 N ALA C 67  ? N ALA A 67  O ASN C 125 ? O ASN A 125 
A 3 4 N ILE C 124 ? N ILE A 124 O LEU C 146 ? O LEU A 146 
B 1 2 N SER C 158 ? N SER A 158 O GLN C 317 ? O GLN A 317 
C 1 2 O ARG C 216 ? O ARG A 216 N LEU C 184 ? N LEU A 184 
C 2 3 N LEU C 185 ? N LEU A 185 O LEU C 243 ? O LEU A 243 
C 3 4 N MET C 242 ? N MET A 242 O SER C 269 ? O SER A 269 
C 4 5 N ASP C 274 ? N ASP A 274 O ILE C 289 ? O ILE A 289 
C 5 6 N LYS C 290 ? N LYS A 290 O SER C 322 ? O SER A 322 
D 1 2 O SER D 97  ? O SER B 97  N VAL D 66  ? N VAL B 66  
D 2 3 N ALA D 67  ? N ALA B 67  O ASN D 125 ? O ASN B 125 
D 3 4 N ILE D 124 ? N ILE B 124 O LEU D 146 ? O LEU B 146 
E 1 2 N SER D 158 ? N SER B 158 O GLN D 317 ? O GLN B 317 
F 1 2 O ARG D 216 ? O ARG B 216 N LEU D 184 ? N LEU B 184 
F 2 3 N LEU D 185 ? N LEU B 185 O LEU D 243 ? O LEU B 243 
F 3 4 N MET D 242 ? N MET B 242 O SER D 269 ? O SER B 269 
F 4 5 N ASP D 274 ? N ASP B 274 O ILE D 289 ? O ILE B 289 
F 5 6 N LYS D 290 ? N LYS B 290 O SER D 322 ? O SER B 322 
G 1 2 O SER E 97  ? O SER C 97  N VAL E 66  ? N VAL C 66  
G 2 3 N ALA E 67  ? N ALA C 67  O ASN E 125 ? O ASN C 125 
G 3 4 N ILE E 124 ? N ILE C 124 O LEU E 146 ? O LEU C 146 
H 1 2 N SER E 158 ? N SER C 158 O GLN E 317 ? O GLN C 317 
I 1 2 O ARG E 216 ? O ARG C 216 N LEU E 184 ? N LEU C 184 
I 2 3 N LEU E 185 ? N LEU C 185 O LEU E 243 ? O LEU C 243 
I 3 4 N MET E 242 ? N MET C 242 O SER E 269 ? O SER C 269 
I 4 5 N ASP E 274 ? N ASP C 274 O ILE E 289 ? O ILE C 289 
I 5 6 N LYS E 290 ? N LYS C 290 O SER E 322 ? O SER C 322 
# 
_database_PDB_matrix.entry_id          1JWL 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1JWL 
_atom_sites.fract_transf_matrix[1][1]   0.003910 
_atom_sites.fract_transf_matrix[1][2]   0.002257 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004515 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004836 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O "O5'" . DT  A 1 6   ? -6.653  91.601  -21.424 1.00 163.24 ? 6   DT  D "O5'" 1 
ATOM   2    C "C5'" . DT  A 1 6   ? -6.755  92.992  -21.107 1.00 165.64 ? 6   DT  D "C5'" 1 
ATOM   3    C "C4'" . DT  A 1 6   ? -6.906  93.851  -22.343 1.00 169.18 ? 6   DT  D "C4'" 1 
ATOM   4    O "O4'" . DT  A 1 6   ? -8.323  94.019  -22.608 1.00 171.28 ? 6   DT  D "O4'" 1 
ATOM   5    C "C3'" . DT  A 1 6   ? -6.392  95.270  -22.086 1.00 168.96 ? 6   DT  D "C3'" 1 
ATOM   6    O "O3'" . DT  A 1 6   ? -5.967  95.898  -23.307 1.00 171.14 ? 6   DT  D "O3'" 1 
ATOM   7    C "C2'" . DT  A 1 6   ? -7.603  95.988  -21.518 1.00 171.25 ? 6   DT  D "C2'" 1 
ATOM   8    C "C1'" . DT  A 1 6   ? -8.713  95.373  -22.345 1.00 171.64 ? 6   DT  D "C1'" 1 
ATOM   9    N N1    . DT  A 1 6   ? -10.066 95.395  -21.724 1.00 174.07 ? 6   DT  D N1    1 
ATOM   10   C C2    . DT  A 1 6   ? -10.898 96.441  -22.113 1.00 174.70 ? 6   DT  D C2    1 
ATOM   11   O O2    . DT  A 1 6   ? -10.576 97.274  -22.964 1.00 175.19 ? 6   DT  D O2    1 
ATOM   12   N N3    . DT  A 1 6   ? -12.131 96.466  -21.483 1.00 174.72 ? 6   DT  D N3    1 
ATOM   13   C C4    . DT  A 1 6   ? -12.605 95.566  -20.540 1.00 173.99 ? 6   DT  D C4    1 
ATOM   14   O O4    . DT  A 1 6   ? -13.718 95.725  -20.045 1.00 174.29 ? 6   DT  D O4    1 
ATOM   15   C C5    . DT  A 1 6   ? -11.691 94.481  -20.202 1.00 174.36 ? 6   DT  D C5    1 
ATOM   16   C C7    . DT  A 1 6   ? -12.118 93.461  -19.196 1.00 175.69 ? 6   DT  D C7    1 
ATOM   17   C C6    . DT  A 1 6   ? -10.487 94.449  -20.801 1.00 173.89 ? 6   DT  D C6    1 
ATOM   18   P P     . DG  A 1 7   ? -4.542  96.668  -23.347 1.00 170.11 ? 7   DG  D P     1 
ATOM   19   O OP1   . DG  A 1 7   ? -3.586  95.903  -24.205 1.00 171.88 ? 7   DG  D OP1   1 
ATOM   20   O OP2   . DG  A 1 7   ? -4.168  96.959  -21.929 1.00 172.09 ? 7   DG  D OP2   1 
ATOM   21   O "O5'" . DG  A 1 7   ? -4.836  98.065  -24.065 1.00 170.08 ? 7   DG  D "O5'" 1 
ATOM   22   C "C5'" . DG  A 1 7   ? -4.344  99.293  -23.520 1.00 167.35 ? 7   DG  D "C5'" 1 
ATOM   23   C "C4'" . DG  A 1 7   ? -5.022  100.446 -24.210 1.00 165.15 ? 7   DG  D "C4'" 1 
ATOM   24   O "O4'" . DG  A 1 7   ? -6.461  100.248 -24.214 1.00 163.12 ? 7   DG  D "O4'" 1 
ATOM   25   C "C3'" . DG  A 1 7   ? -4.770  101.785 -23.536 1.00 164.22 ? 7   DG  D "C3'" 1 
ATOM   26   O "O3'" . DG  A 1 7   ? -4.896  102.808 -24.512 1.00 163.97 ? 7   DG  D "O3'" 1 
ATOM   27   C "C2'" . DG  A 1 7   ? -5.897  101.855 -22.537 1.00 163.28 ? 7   DG  D "C2'" 1 
ATOM   28   C "C1'" . DG  A 1 7   ? -7.048  101.157 -23.295 1.00 161.79 ? 7   DG  D "C1'" 1 
ATOM   29   N N9    . DG  A 1 7   ? -7.933  100.387 -22.431 1.00 159.91 ? 7   DG  D N9    1 
ATOM   30   C C8    . DG  A 1 7   ? -7.596  99.258  -21.732 1.00 159.27 ? 7   DG  D C8    1 
ATOM   31   N N7    . DG  A 1 7   ? -8.590  98.758  -21.049 1.00 158.22 ? 7   DG  D N7    1 
ATOM   32   C C5    . DG  A 1 7   ? -9.645  99.626  -21.293 1.00 158.17 ? 7   DG  D C5    1 
ATOM   33   C C6    . DG  A 1 7   ? -10.984 99.610  -20.817 1.00 157.47 ? 7   DG  D C6    1 
ATOM   34   O O6    . DG  A 1 7   ? -11.524 98.804  -20.051 1.00 156.55 ? 7   DG  D O6    1 
ATOM   35   N N1    . DG  A 1 7   ? -11.721 100.675 -21.330 1.00 157.28 ? 7   DG  D N1    1 
ATOM   36   C C2    . DG  A 1 7   ? -11.244 101.633 -22.184 1.00 157.41 ? 7   DG  D C2    1 
ATOM   37   N N2    . DG  A 1 7   ? -12.134 102.589 -22.548 1.00 157.07 ? 7   DG  D N2    1 
ATOM   38   N N3    . DG  A 1 7   ? -9.998  101.660 -22.639 1.00 157.73 ? 7   DG  D N3    1 
ATOM   39   C C4    . DG  A 1 7   ? -9.260  100.635 -22.154 1.00 158.60 ? 7   DG  D C4    1 
ATOM   40   P P     . DT  A 1 8   ? -4.560  104.340 -24.108 1.00 164.60 ? 8   DT  D P     1 
ATOM   41   O OP1   . DT  A 1 8   ? -3.592  104.882 -25.100 1.00 163.68 ? 8   DT  D OP1   1 
ATOM   42   O OP2   . DT  A 1 8   ? -4.175  104.354 -22.650 1.00 164.13 ? 8   DT  D OP2   1 
ATOM   43   O "O5'" . DT  A 1 8   ? -5.958  105.111 -24.242 1.00 165.54 ? 8   DT  D "O5'" 1 
ATOM   44   C "C5'" . DT  A 1 8   ? -7.085  104.700 -23.479 1.00 167.24 ? 8   DT  D "C5'" 1 
ATOM   45   C "C4'" . DT  A 1 8   ? -8.072  105.835 -23.339 1.00 168.76 ? 8   DT  D "C4'" 1 
ATOM   46   O "O4'" . DT  A 1 8   ? -9.280  105.309 -22.736 1.00 169.56 ? 8   DT  D "O4'" 1 
ATOM   47   C "C3'" . DT  A 1 8   ? -7.605  106.949 -22.403 1.00 169.60 ? 8   DT  D "C3'" 1 
ATOM   48   O "O3'" . DT  A 1 8   ? -8.170  108.218 -22.763 1.00 170.68 ? 8   DT  D "O3'" 1 
ATOM   49   C "C2'" . DT  A 1 8   ? -8.100  106.484 -21.048 1.00 170.26 ? 8   DT  D "C2'" 1 
ATOM   50   C "C1'" . DT  A 1 8   ? -9.408  105.769 -21.389 1.00 171.10 ? 8   DT  D "C1'" 1 
ATOM   51   N N1    . DT  A 1 8   ? -9.625  104.587 -20.525 1.00 172.84 ? 8   DT  D N1    1 
ATOM   52   C C2    . DT  A 1 8   ? -10.862 104.384 -19.932 1.00 173.52 ? 8   DT  D C2    1 
ATOM   53   O O2    . DT  A 1 8   ? -11.824 105.110 -20.113 1.00 173.13 ? 8   DT  D O2    1 
ATOM   54   N N3    . DT  A 1 8   ? -10.927 103.276 -19.107 1.00 174.37 ? 8   DT  D N3    1 
ATOM   55   C C4    . DT  A 1 8   ? -9.904  102.376 -18.831 1.00 174.87 ? 8   DT  D C4    1 
ATOM   56   O O4    . DT  A 1 8   ? -10.098 101.440 -18.061 1.00 175.22 ? 8   DT  D O4    1 
ATOM   57   C C5    . DT  A 1 8   ? -8.649  102.642 -19.500 1.00 174.69 ? 8   DT  D C5    1 
ATOM   58   C C7    . DT  A 1 8   ? -7.488  101.727 -19.262 1.00 174.86 ? 8   DT  D C7    1 
ATOM   59   C C6    . DT  A 1 8   ? -8.577  103.712 -20.305 1.00 173.94 ? 8   DT  D C6    1 
ATOM   60   P P     . DG  A 1 9   ? -7.790  109.534 -21.904 1.00 171.46 ? 9   DG  D P     1 
ATOM   61   O OP1   . DG  A 1 9   ? -7.728  110.690 -22.840 1.00 171.29 ? 9   DG  D OP1   1 
ATOM   62   O OP2   . DG  A 1 9   ? -6.591  109.191 -21.089 1.00 171.40 ? 9   DG  D OP2   1 
ATOM   63   O "O5'" . DG  A 1 9   ? -9.025  109.742 -20.904 1.00 171.15 ? 9   DG  D "O5'" 1 
ATOM   64   C "C5'" . DG  A 1 9   ? -10.340 109.977 -21.415 1.00 170.07 ? 9   DG  D "C5'" 1 
ATOM   65   C "C4'" . DG  A 1 9   ? -11.327 110.289 -20.307 1.00 169.30 ? 9   DG  D "C4'" 1 
ATOM   66   O "O4'" . DG  A 1 9   ? -11.543 109.117 -19.478 1.00 168.90 ? 9   DG  D "O4'" 1 
ATOM   67   C "C3'" . DG  A 1 9   ? -10.858 111.375 -19.335 1.00 169.19 ? 9   DG  D "C3'" 1 
ATOM   68   O "O3'" . DG  A 1 9   ? -11.994 112.070 -18.789 1.00 169.24 ? 9   DG  D "O3'" 1 
ATOM   69   C "C2'" . DG  A 1 9   ? -10.127 110.578 -18.267 1.00 168.85 ? 9   DG  D "C2'" 1 
ATOM   70   C "C1'" . DG  A 1 9   ? -10.985 109.323 -18.178 1.00 168.36 ? 9   DG  D "C1'" 1 
ATOM   71   N N9    . DG  A 1 9   ? -10.300 108.101 -17.758 1.00 167.53 ? 9   DG  D N9    1 
ATOM   72   C C8    . DG  A 1 9   ? -8.984  107.774 -17.983 1.00 166.99 ? 9   DG  D C8    1 
ATOM   73   N N7    . DG  A 1 9   ? -8.650  106.613 -17.487 1.00 166.87 ? 9   DG  D N7    1 
ATOM   74   C C5    . DG  A 1 9   ? -9.816  106.138 -16.897 1.00 166.75 ? 9   DG  D C5    1 
ATOM   75   C C6    . DG  A 1 9   ? -10.070 104.915 -16.200 1.00 166.34 ? 9   DG  D C6    1 
ATOM   76   O O6    . DG  A 1 9   ? -9.286  103.982 -15.963 1.00 165.59 ? 9   DG  D O6    1 
ATOM   77   N N1    . DG  A 1 9   ? -11.391 104.839 -15.764 1.00 165.84 ? 9   DG  D N1    1 
ATOM   78   C C2    . DG  A 1 9   ? -12.348 105.805 -15.964 1.00 165.73 ? 9   DG  D C2    1 
ATOM   79   N N2    . DG  A 1 9   ? -13.565 105.539 -15.454 1.00 164.81 ? 9   DG  D N2    1 
ATOM   80   N N3    . DG  A 1 9   ? -12.128 106.946 -16.613 1.00 166.11 ? 9   DG  D N3    1 
ATOM   81   C C4    . DG  A 1 9   ? -10.847 107.044 -17.050 1.00 166.89 ? 9   DG  D C4    1 
ATOM   82   P P     . DA  A 1 10  ? -11.781 113.387 -17.880 1.00 169.18 ? 10  DA  D P     1 
ATOM   83   O OP1   . DA  A 1 10  ? -12.505 114.517 -18.523 1.00 168.59 ? 10  DA  D OP1   1 
ATOM   84   O OP2   . DA  A 1 10  ? -10.332 113.526 -17.570 1.00 168.98 ? 10  DA  D OP2   1 
ATOM   85   O "O5'" . DA  A 1 10  ? -12.551 113.026 -16.530 1.00 169.22 ? 10  DA  D "O5'" 1 
ATOM   86   C "C5'" . DA  A 1 10  ? -13.949 112.738 -16.552 1.00 169.33 ? 10  DA  D "C5'" 1 
ATOM   87   C "C4'" . DA  A 1 10  ? -14.476 112.481 -15.157 1.00 169.33 ? 10  DA  D "C4'" 1 
ATOM   88   O "O4'" . DA  A 1 10  ? -14.076 111.158 -14.714 1.00 169.55 ? 10  DA  D "O4'" 1 
ATOM   89   C "C3'" . DA  A 1 10  ? -13.904 113.443 -14.112 1.00 169.12 ? 10  DA  D "C3'" 1 
ATOM   90   O "O3'" . DA  A 1 10  ? -14.859 113.646 -13.062 1.00 168.20 ? 10  DA  D "O3'" 1 
ATOM   91   C "C2'" . DA  A 1 10  ? -12.658 112.715 -13.634 1.00 169.47 ? 10  DA  D "C2'" 1 
ATOM   92   C "C1'" . DA  A 1 10  ? -13.117 111.262 -13.667 1.00 169.88 ? 10  DA  D "C1'" 1 
ATOM   93   N N9    . DA  A 1 10  ? -12.081 110.240 -13.858 1.00 170.28 ? 10  DA  D N9    1 
ATOM   94   C C8    . DA  A 1 10  ? -10.979 110.270 -14.680 1.00 170.20 ? 10  DA  D C8    1 
ATOM   95   N N7    . DA  A 1 10  ? -10.217 109.204 -14.584 1.00 170.16 ? 10  DA  D N7    1 
ATOM   96   C C5    . DA  A 1 10  ? -10.864 108.413 -13.643 1.00 170.47 ? 10  DA  D C5    1 
ATOM   97   C C6    . DA  A 1 10  ? -10.561 107.146 -13.090 1.00 170.65 ? 10  DA  D C6    1 
ATOM   98   N N6    . DA  A 1 10  ? -9.487  106.433 -13.422 1.00 170.70 ? 10  DA  D N6    1 
ATOM   99   N N1    . DA  A 1 10  ? -11.415 106.634 -12.171 1.00 170.74 ? 10  DA  D N1    1 
ATOM   100  C C2    . DA  A 1 10  ? -12.496 107.353 -11.839 1.00 170.79 ? 10  DA  D C2    1 
ATOM   101  N N3    . DA  A 1 10  ? -12.888 108.551 -12.286 1.00 170.90 ? 10  DA  D N3    1 
ATOM   102  C C4    . DA  A 1 10  ? -12.018 109.032 -13.195 1.00 170.57 ? 10  DA  D C4    1 
ATOM   103  P P     . DG  A 1 11  ? -14.501 114.596 -11.811 1.00 167.77 ? 11  DG  D P     1 
ATOM   104  O OP1   . DG  A 1 11  ? -15.448 115.745 -11.813 1.00 167.14 ? 11  DG  D OP1   1 
ATOM   105  O OP2   . DG  A 1 11  ? -13.035 114.859 -11.820 1.00 167.33 ? 11  DG  D OP2   1 
ATOM   106  O "O5'" . DG  A 1 11  ? -14.843 113.661 -10.559 1.00 167.52 ? 11  DG  D "O5'" 1 
ATOM   107  C "C5'" . DG  A 1 11  ? -15.950 112.745 -10.615 1.00 166.09 ? 11  DG  D "C5'" 1 
ATOM   108  C "C4'" . DG  A 1 11  ? -15.969 111.810 -9.421  1.00 165.03 ? 11  DG  D "C4'" 1 
ATOM   109  O "O4'" . DG  A 1 11  ? -14.865 110.871 -9.491  1.00 164.92 ? 11  DG  D "O4'" 1 
ATOM   110  C "C3'" . DG  A 1 11  ? -15.802 112.510 -8.073  1.00 164.45 ? 11  DG  D "C3'" 1 
ATOM   111  O "O3'" . DG  A 1 11  ? -16.472 111.757 -7.056  1.00 163.09 ? 11  DG  D "O3'" 1 
ATOM   112  C "C2'" . DG  A 1 11  ? -14.295 112.505 -7.871  1.00 164.37 ? 11  DG  D "C2'" 1 
ATOM   113  C "C1'" . DG  A 1 11  ? -13.906 111.158 -8.470  1.00 164.42 ? 11  DG  D "C1'" 1 
ATOM   114  N N9    . DG  A 1 11  ? -12.564 111.063 -9.047  1.00 164.06 ? 11  DG  D N9    1 
ATOM   115  C C8    . DG  A 1 11  ? -11.860 112.061 -9.683  1.00 163.55 ? 11  DG  D C8    1 
ATOM   116  N N7    . DG  A 1 11  ? -10.681 111.677 -10.098 1.00 163.39 ? 11  DG  D N7    1 
ATOM   117  C C5    . DG  A 1 11  ? -10.595 110.342 -9.712  1.00 163.72 ? 11  DG  D C5    1 
ATOM   118  C C6    . DG  A 1 11  ? -9.542  109.391 -9.891  1.00 163.77 ? 11  DG  D C6    1 
ATOM   119  O O6    . DG  A 1 11  ? -8.446  109.546 -10.443 1.00 163.72 ? 11  DG  D O6    1 
ATOM   120  N N1    . DG  A 1 11  ? -9.870  108.152 -9.345  1.00 163.63 ? 11  DG  D N1    1 
ATOM   121  C C2    . DG  A 1 11  ? -11.049 107.854 -8.708  1.00 163.43 ? 11  DG  D C2    1 
ATOM   122  N N2    . DG  A 1 11  ? -11.163 106.595 -8.245  1.00 162.84 ? 11  DG  D N2    1 
ATOM   123  N N3    . DG  A 1 11  ? -12.040 108.726 -8.537  1.00 163.68 ? 11  DG  D N3    1 
ATOM   124  C C4    . DG  A 1 11  ? -11.746 109.944 -9.061  1.00 163.90 ? 11  DG  D C4    1 
ATOM   125  P P     . DC  A 1 12  ? -16.603 112.355 -5.570  1.00 162.27 ? 12  DC  D P     1 
ATOM   126  O OP1   . DC  A 1 12  ? -18.025 112.729 -5.350  1.00 161.84 ? 12  DC  D OP1   1 
ATOM   127  O OP2   . DC  A 1 12  ? -15.538 113.382 -5.397  1.00 161.77 ? 12  DC  D OP2   1 
ATOM   128  O "O5'" . DC  A 1 12  ? -16.252 111.107 -4.639  1.00 161.73 ? 12  DC  D "O5'" 1 
ATOM   129  C "C5'" . DC  A 1 12  ? -15.063 110.336 -4.862  1.00 160.58 ? 12  DC  D "C5'" 1 
ATOM   130  C "C4'" . DC  A 1 12  ? -14.704 109.534 -3.630  1.00 159.46 ? 12  DC  D "C4'" 1 
ATOM   131  O "O4'" . DC  A 1 12  ? -13.437 108.874 -3.898  1.00 159.62 ? 12  DC  D "O4'" 1 
ATOM   132  C "C3'" . DC  A 1 12  ? -14.450 110.392 -2.393  1.00 158.58 ? 12  DC  D "C3'" 1 
ATOM   133  O "O3'" . DC  A 1 12  ? -14.821 109.757 -1.168  1.00 156.54 ? 12  DC  D "O3'" 1 
ATOM   134  C "C2'" . DC  A 1 12  ? -12.974 110.716 -2.482  1.00 158.94 ? 12  DC  D "C2'" 1 
ATOM   135  C "C1'" . DC  A 1 12  ? -12.368 109.493 -3.170  1.00 159.59 ? 12  DC  D "C1'" 1 
ATOM   136  N N1    . DC  A 1 12  ? -11.337 109.914 -4.146  1.00 159.79 ? 12  DC  D N1    1 
ATOM   137  C C2    . DC  A 1 12  ? -10.284 109.037 -4.509  1.00 159.59 ? 12  DC  D C2    1 
ATOM   138  O O2    . DC  A 1 12  ? -10.235 107.893 -4.023  1.00 159.12 ? 12  DC  D O2    1 
ATOM   139  N N3    . DC  A 1 12  ? -9.347  109.472 -5.390  1.00 159.60 ? 12  DC  D N3    1 
ATOM   140  C C4    . DC  A 1 12  ? -9.428  110.706 -5.903  1.00 159.77 ? 12  DC  D C4    1 
ATOM   141  N N4    . DC  A 1 12  ? -8.485  111.093 -6.764  1.00 159.65 ? 12  DC  D N4    1 
ATOM   142  C C5    . DC  A 1 12  ? -10.482 111.600 -5.559  1.00 159.92 ? 12  DC  D C5    1 
ATOM   143  C C6    . DC  A 1 12  ? -11.401 111.170 -4.690  1.00 160.01 ? 12  DC  D C6    1 
ATOM   144  P P     . DG  A 1 13  ? -15.370 110.660 0.048   1.00 155.20 ? 13  DG  D P     1 
ATOM   145  O OP1   . DG  A 1 13  ? -16.083 109.783 1.011   1.00 155.33 ? 13  DG  D OP1   1 
ATOM   146  O OP2   . DG  A 1 13  ? -16.085 111.813 -0.552  1.00 155.40 ? 13  DG  D OP2   1 
ATOM   147  O "O5'" . DG  A 1 13  ? -14.051 111.218 0.752   1.00 153.62 ? 13  DG  D "O5'" 1 
ATOM   148  C "C5'" . DG  A 1 13  ? -13.394 110.446 1.751   1.00 151.34 ? 13  DG  D "C5'" 1 
ATOM   149  C "C4'" . DG  A 1 13  ? -12.317 111.248 2.445   1.00 149.98 ? 13  DG  D "C4'" 1 
ATOM   150  O "O4'" . DG  A 1 13  ? -11.220 111.496 1.530   1.00 149.53 ? 13  DG  D "O4'" 1 
ATOM   151  C "C3'" . DG  A 1 13  ? -12.777 112.633 2.891   1.00 149.30 ? 13  DG  D "C3'" 1 
ATOM   152  O "O3'" . DG  A 1 13  ? -12.020 113.018 4.048   1.00 149.60 ? 13  DG  D "O3'" 1 
ATOM   153  C "C2'" . DG  A 1 13  ? -12.464 113.495 1.680   1.00 148.67 ? 13  DG  D "C2'" 1 
ATOM   154  C "C1'" . DG  A 1 13  ? -11.162 112.876 1.196   1.00 148.60 ? 13  DG  D "C1'" 1 
ATOM   155  N N9    . DG  A 1 13  ? -10.846 113.002 -0.224  1.00 148.29 ? 13  DG  D N9    1 
ATOM   156  C C8    . DG  A 1 13  ? -11.714 113.287 -1.249  1.00 148.01 ? 13  DG  D C8    1 
ATOM   157  N N7    . DG  A 1 13  ? -11.129 113.349 -2.415  1.00 147.98 ? 13  DG  D N7    1 
ATOM   158  C C5    . DG  A 1 13  ? -9.792  113.088 -2.145  1.00 148.12 ? 13  DG  D C5    1 
ATOM   159  C C6    . DG  A 1 13  ? -8.672  113.024 -3.019  1.00 148.06 ? 13  DG  D C6    1 
ATOM   160  O O6    . DG  A 1 13  ? -8.637  113.200 -4.240  1.00 147.78 ? 13  DG  D O6    1 
ATOM   161  N N1    . DG  A 1 13  ? -7.500  112.727 -2.330  1.00 148.40 ? 13  DG  D N1    1 
ATOM   162  C C2    . DG  A 1 13  ? -7.408  112.521 -0.975  1.00 148.72 ? 13  DG  D C2    1 
ATOM   163  N N2    . DG  A 1 13  ? -6.173  112.242 -0.502  1.00 148.86 ? 13  DG  D N2    1 
ATOM   164  N N3    . DG  A 1 13  ? -8.445  112.584 -0.146  1.00 148.60 ? 13  DG  D N3    1 
ATOM   165  C C4    . DG  A 1 13  ? -9.598  112.868 -0.798  1.00 148.27 ? 13  DG  D C4    1 
ATOM   166  P P     . DG  A 1 14  ? -12.122 114.516 4.621   1.00 149.82 ? 14  DG  D P     1 
ATOM   167  O OP1   . DG  A 1 14  ? -12.424 114.452 6.075   1.00 149.14 ? 14  DG  D OP1   1 
ATOM   168  O OP2   . DG  A 1 14  ? -13.025 115.273 3.721   1.00 150.12 ? 14  DG  D OP2   1 
ATOM   169  O "O5'" . DG  A 1 14  ? -10.647 115.090 4.431   1.00 150.08 ? 14  DG  D "O5'" 1 
ATOM   170  C "C5'" . DG  A 1 14  ? -9.979  114.984 3.172   1.00 151.35 ? 14  DG  D "C5'" 1 
ATOM   171  C "C4'" . DG  A 1 14  ? -8.485  114.891 3.376   1.00 152.76 ? 14  DG  D "C4'" 1 
ATOM   172  O "O4'" . DG  A 1 14  ? -7.865  114.627 2.092   1.00 152.02 ? 14  DG  D "O4'" 1 
ATOM   173  C "C3'" . DG  A 1 14  ? -7.871  116.202 3.857   1.00 154.47 ? 14  DG  D "C3'" 1 
ATOM   174  O "O3'" . DG  A 1 14  ? -6.713  115.974 4.661   1.00 158.36 ? 14  DG  D "O3'" 1 
ATOM   175  C "C2'" . DG  A 1 14  ? -7.546  116.921 2.563   1.00 153.50 ? 14  DG  D "C2'" 1 
ATOM   176  C "C1'" . DG  A 1 14  ? -7.172  115.782 1.622   1.00 152.13 ? 14  DG  D "C1'" 1 
ATOM   177  N N9    . DG  A 1 14  ? -7.593  116.029 0.245   1.00 151.33 ? 14  DG  D N9    1 
ATOM   178  C C8    . DG  A 1 14  ? -8.795  116.564 -0.155  1.00 150.72 ? 14  DG  D C8    1 
ATOM   179  N N7    . DG  A 1 14  ? -8.898  116.691 -1.450  1.00 150.36 ? 14  DG  D N7    1 
ATOM   180  C C5    . DG  A 1 14  ? -7.694  116.205 -1.941  1.00 150.52 ? 14  DG  D C5    1 
ATOM   181  C C6    . DG  A 1 14  ? -7.230  116.087 -3.281  1.00 150.21 ? 14  DG  D C6    1 
ATOM   182  O O6    . DG  A 1 14  ? -7.812  116.398 -4.331  1.00 149.55 ? 14  DG  D O6    1 
ATOM   183  N N1    . DG  A 1 14  ? -5.950  115.542 -3.333  1.00 150.36 ? 14  DG  D N1    1 
ATOM   184  C C2    . DG  A 1 14  ? -5.206  115.159 -2.239  1.00 150.69 ? 14  DG  D C2    1 
ATOM   185  N N2    . DG  A 1 14  ? -3.984  114.656 -2.505  1.00 150.48 ? 14  DG  D N2    1 
ATOM   186  N N3    . DG  A 1 14  ? -5.629  115.262 -0.982  1.00 150.88 ? 14  DG  D N3    1 
ATOM   187  C C4    . DG  A 1 14  ? -6.874  115.791 -0.909  1.00 150.92 ? 14  DG  D C4    1 
ATOM   188  P P     . DA  A 1 15  ? -5.917  117.226 5.283   1.00 161.44 ? 15  DA  D P     1 
ATOM   189  O OP1   . DA  A 1 15  ? -5.465  116.859 6.653   1.00 161.12 ? 15  DA  D OP1   1 
ATOM   190  O OP2   . DA  A 1 15  ? -6.759  118.437 5.090   1.00 160.96 ? 15  DA  D OP2   1 
ATOM   191  O "O5'" . DA  A 1 15  ? -4.631  117.342 4.342   1.00 164.59 ? 15  DA  D "O5'" 1 
ATOM   192  C "C5'" . DA  A 1 15  ? -3.800  116.197 4.104   1.00 169.36 ? 15  DA  D "C5'" 1 
ATOM   193  C "C4'" . DA  A 1 15  ? -2.528  116.578 3.374   1.00 172.46 ? 15  DA  D "C4'" 1 
ATOM   194  O "O4'" . DA  A 1 15  ? -2.822  116.893 1.989   1.00 173.23 ? 15  DA  D "O4'" 1 
ATOM   195  C "C3'" . DA  A 1 15  ? -1.839  117.826 3.930   1.00 174.31 ? 15  DA  D "C3'" 1 
ATOM   196  O "O3'" . DA  A 1 15  ? -0.415  117.731 3.720   1.00 176.89 ? 15  DA  D "O3'" 1 
ATOM   197  C "C2'" . DA  A 1 15  ? -2.483  118.946 3.124   1.00 174.05 ? 15  DA  D "C2'" 1 
ATOM   198  C "C1'" . DA  A 1 15  ? -2.667  118.292 1.754   1.00 174.15 ? 15  DA  D "C1'" 1 
ATOM   199  N N9    . DA  A 1 15  ? -3.802  118.748 0.940   1.00 174.91 ? 15  DA  D N9    1 
ATOM   200  C C8    . DA  A 1 15  ? -5.136  118.771 1.283   1.00 175.04 ? 15  DA  D C8    1 
ATOM   201  N N7    . DA  A 1 15  ? -5.922  119.213 0.328   1.00 175.33 ? 15  DA  D N7    1 
ATOM   202  C C5    . DA  A 1 15  ? -5.051  119.508 -0.716  1.00 175.50 ? 15  DA  D C5    1 
ATOM   203  C C6    . DA  A 1 15  ? -5.265  120.016 -2.022  1.00 175.50 ? 15  DA  D C6    1 
ATOM   204  N N6    . DA  A 1 15  ? -6.467  120.297 -2.519  1.00 175.29 ? 15  DA  D N6    1 
ATOM   205  N N1    . DA  A 1 15  ? -4.182  120.214 -2.810  1.00 175.48 ? 15  DA  D N1    1 
ATOM   206  C C2    . DA  A 1 15  ? -2.975  119.889 -2.323  1.00 175.21 ? 15  DA  D C2    1 
ATOM   207  N N3    . DA  A 1 15  ? -2.646  119.395 -1.122  1.00 175.22 ? 15  DA  D N3    1 
ATOM   208  C C4    . DA  A 1 15  ? -3.741  119.231 -0.353  1.00 175.35 ? 15  DA  D C4    1 
ATOM   209  P P     . DT  A 1 16  ? 0.612   118.094 4.918   1.00 178.69 ? 16  DT  D P     1 
ATOM   210  O OP1   . DT  A 1 16  ? 1.872   117.320 4.699   1.00 178.13 ? 16  DT  D OP1   1 
ATOM   211  O OP2   . DT  A 1 16  ? -0.120  117.943 6.207   1.00 178.54 ? 16  DT  D OP2   1 
ATOM   212  O "O5'" . DT  A 1 16  ? 0.922   119.645 4.683   1.00 178.54 ? 16  DT  D "O5'" 1 
ATOM   213  C "C5'" . DT  A 1 16  ? 0.362   120.330 3.561   1.00 178.51 ? 16  DT  D "C5'" 1 
ATOM   214  C "C4'" . DT  A 1 16  ? 1.167   120.022 2.321   1.00 178.52 ? 16  DT  D "C4'" 1 
ATOM   215  O "O4'" . DT  A 1 16  ? 0.311   120.117 1.158   1.00 178.68 ? 16  DT  D "O4'" 1 
ATOM   216  C "C3'" . DT  A 1 16  ? 2.307   120.999 2.063   1.00 178.56 ? 16  DT  D "C3'" 1 
ATOM   217  O "O3'" . DT  A 1 16  ? 3.402   120.331 1.416   1.00 178.33 ? 16  DT  D "O3'" 1 
ATOM   218  C "C2'" . DT  A 1 16  ? 1.637   122.072 1.219   1.00 178.70 ? 16  DT  D "C2'" 1 
ATOM   219  C "C1'" . DT  A 1 16  ? 0.622   121.279 0.396   1.00 178.80 ? 16  DT  D "C1'" 1 
ATOM   220  N N1    . DT  A 1 16  ? -0.659  121.975 0.105   1.00 179.22 ? 16  DT  D N1    1 
ATOM   221  C C2    . DT  A 1 16  ? -1.127  121.998 -1.199  1.00 179.34 ? 16  DT  D C2    1 
ATOM   222  O O2    . DT  A 1 16  ? -0.528  121.500 -2.137  1.00 179.05 ? 16  DT  D O2    1 
ATOM   223  N N3    . DT  A 1 16  ? -2.344  122.629 -1.363  1.00 179.75 ? 16  DT  D N3    1 
ATOM   224  C C4    . DT  A 1 16  ? -3.119  123.225 -0.376  1.00 179.58 ? 16  DT  D C4    1 
ATOM   225  O O4    . DT  A 1 16  ? -4.199  123.743 -0.672  1.00 179.75 ? 16  DT  D O4    1 
ATOM   226  C C5    . DT  A 1 16  ? -2.558  123.177 0.962   1.00 179.22 ? 16  DT  D C5    1 
ATOM   227  C C7    . DT  A 1 16  ? -3.316  123.804 2.091   1.00 178.55 ? 16  DT  D C7    1 
ATOM   228  C C6    . DT  A 1 16  ? -1.374  122.567 1.130   1.00 179.26 ? 16  DT  D C6    1 
ATOM   229  P P     . DA  A 1 17  ? 4.810   121.088 1.231   1.00 178.12 ? 17  DA  D P     1 
ATOM   230  O OP1   . DA  A 1 17  ? 5.816   120.084 0.779   1.00 177.47 ? 17  DA  D OP1   1 
ATOM   231  O OP2   . DA  A 1 17  ? 5.081   121.900 2.446   1.00 177.58 ? 17  DA  D OP2   1 
ATOM   232  O "O5'" . DA  A 1 17  ? 4.518   122.085 0.022   1.00 177.94 ? 17  DA  D "O5'" 1 
ATOM   233  C "C5'" . DA  A 1 17  ? 4.209   121.570 -1.276  1.00 177.96 ? 17  DA  D "C5'" 1 
ATOM   234  C "C4'" . DA  A 1 17  ? 4.222   122.676 -2.307  1.00 178.26 ? 17  DA  D "C4'" 1 
ATOM   235  O "O4'" . DA  A 1 17  ? 2.937   123.346 -2.316  1.00 178.02 ? 17  DA  D "O4'" 1 
ATOM   236  C "C3'" . DA  A 1 17  ? 5.252   123.760 -1.971  1.00 178.45 ? 17  DA  D "C3'" 1 
ATOM   237  O "O3'" . DA  A 1 17  ? 5.698   124.409 -3.169  1.00 178.80 ? 17  DA  D "O3'" 1 
ATOM   238  C "C2'" . DA  A 1 17  ? 4.453   124.721 -1.109  1.00 178.29 ? 17  DA  D "C2'" 1 
ATOM   239  C "C1'" . DA  A 1 17  ? 3.083   124.659 -1.785  1.00 178.30 ? 17  DA  D "C1'" 1 
ATOM   240  N N9    . DA  A 1 17  ? 1.896   124.978 -0.982  1.00 178.37 ? 17  DA  D N9    1 
ATOM   241  C C8    . DA  A 1 17  ? 1.773   125.153 0.381   1.00 178.01 ? 17  DA  D C8    1 
ATOM   242  N N7    . DA  A 1 17  ? 0.557   125.478 0.763   1.00 178.13 ? 17  DA  D N7    1 
ATOM   243  C C5    . DA  A 1 17  ? -0.171  125.514 -0.425  1.00 178.68 ? 17  DA  D C5    1 
ATOM   244  C C6    . DA  A 1 17  ? -1.533  125.811 -0.713  1.00 178.93 ? 17  DA  D C6    1 
ATOM   245  N N6    . DA  A 1 17  ? -2.441  126.140 0.214   1.00 179.11 ? 17  DA  D N6    1 
ATOM   246  N N1    . DA  A 1 17  ? -1.932  125.755 -2.010  1.00 178.98 ? 17  DA  D N1    1 
ATOM   247  C C2    . DA  A 1 17  ? -1.027  125.422 -2.945  1.00 178.57 ? 17  DA  D C2    1 
ATOM   248  N N3    . DA  A 1 17  ? 0.269   125.131 -2.802  1.00 178.53 ? 17  DA  D N3    1 
ATOM   249  C C4    . DA  A 1 17  ? 0.639   125.197 -1.504  1.00 178.58 ? 17  DA  D C4    1 
ATOM   250  P P     . DA  A 1 18  ? 7.150   125.115 -3.218  1.00 178.11 ? 18  DA  D P     1 
ATOM   251  O OP1   . DA  A 1 18  ? 8.140   124.117 -3.724  1.00 178.64 ? 18  DA  D OP1   1 
ATOM   252  O OP2   . DA  A 1 18  ? 7.384   125.767 -1.899  1.00 178.47 ? 18  DA  D OP2   1 
ATOM   253  O "O5'" . DA  A 1 18  ? 6.976   126.242 -4.343  1.00 177.73 ? 18  DA  D "O5'" 1 
ATOM   254  C "C5'" . DA  A 1 18  ? 6.097   127.367 -4.164  1.00 174.32 ? 18  DA  D "C5'" 1 
ATOM   255  C "C4'" . DA  A 1 18  ? 4.961   127.324 -5.165  1.00 171.02 ? 18  DA  D "C4'" 1 
ATOM   256  O "O4'" . DA  A 1 18  ? 3.758   126.959 -4.442  1.00 168.36 ? 18  DA  D "O4'" 1 
ATOM   257  C "C3'" . DA  A 1 18  ? 4.667   128.707 -5.764  1.00 172.71 ? 18  DA  D "C3'" 1 
ATOM   258  O "O3'" . DA  A 1 18  ? 4.001   128.628 -7.040  1.00 172.86 ? 18  DA  D "O3'" 1 
ATOM   259  C "C2'" . DA  A 1 18  ? 3.701   129.306 -4.771  1.00 169.54 ? 18  DA  D "C2'" 1 
ATOM   260  C "C1'" . DA  A 1 18  ? 2.894   128.086 -4.365  1.00 168.27 ? 18  DA  D "C1'" 1 
ATOM   261  N N9    . DA  A 1 18  ? 2.359   128.198 -3.014  1.00 166.24 ? 18  DA  D N9    1 
ATOM   262  C C8    . DA  A 1 18  ? 3.004   128.302 -1.803  1.00 166.31 ? 18  DA  D C8    1 
ATOM   263  N N7    . DA  A 1 18  ? 2.191   128.499 -0.790  1.00 165.35 ? 18  DA  D N7    1 
ATOM   264  C C5    . DA  A 1 18  ? 0.926   128.499 -1.373  1.00 165.82 ? 18  DA  D C5    1 
ATOM   265  C C6    . DA  A 1 18  ? -0.378  128.664 -0.847  1.00 165.51 ? 18  DA  D C6    1 
ATOM   266  N N6    . DA  A 1 18  ? -0.645  128.870 0.446   1.00 165.76 ? 18  DA  D N6    1 
ATOM   267  N N1    . DA  A 1 18  ? -1.417  128.605 -1.716  1.00 165.81 ? 18  DA  D N1    1 
ATOM   268  C C2    . DA  A 1 18  ? -1.161  128.398 -3.016  1.00 166.16 ? 18  DA  D C2    1 
ATOM   269  N N3    . DA  A 1 18  ? 0.009   128.226 -3.626  1.00 167.26 ? 18  DA  D N3    1 
ATOM   270  C C4    . DA  A 1 18  ? 1.020   128.291 -2.739  1.00 165.95 ? 18  DA  D C4    1 
ATOM   271  P P     . DC  A 1 19  ? 3.635   129.994 -7.846  1.00 176.06 ? 19  DC  D P     1 
ATOM   272  O OP1   . DC  A 1 19  ? 3.920   129.777 -9.299  1.00 173.53 ? 19  DC  D OP1   1 
ATOM   273  O OP2   . DC  A 1 19  ? 4.307   131.114 -7.130  1.00 173.88 ? 19  DC  D OP2   1 
ATOM   274  O "O5'" . DC  A 1 19  ? 2.055   130.204 -7.659  1.00 175.56 ? 19  DC  D "O5'" 1 
ATOM   275  C "C5'" . DC  A 1 19  ? 1.112   129.369 -8.347  1.00 176.90 ? 19  DC  D "C5'" 1 
ATOM   276  C "C4'" . DC  A 1 19  ? -0.295  129.919 -8.221  1.00 176.80 ? 19  DC  D "C4'" 1 
ATOM   277  O "O4'" . DC  A 1 19  ? -0.659  129.981 -6.816  1.00 178.27 ? 19  DC  D "O4'" 1 
ATOM   278  C "C3'" . DC  A 1 19  ? -0.419  131.363 -8.721  1.00 177.77 ? 19  DC  D "C3'" 1 
ATOM   279  O "O3'" . DC  A 1 19  ? -1.743  131.626 -9.221  1.00 177.28 ? 19  DC  D "O3'" 1 
ATOM   280  C "C2'" . DC  A 1 19  ? -0.102  132.191 -7.484  1.00 177.27 ? 19  DC  D "C2'" 1 
ATOM   281  C "C1'" . DC  A 1 19  ? -0.735  131.348 -6.388  1.00 177.57 ? 19  DC  D "C1'" 1 
ATOM   282  N N1    . DC  A 1 19  ? -0.195  131.471 -5.009  1.00 175.89 ? 19  DC  D N1    1 
ATOM   283  C C2    . DC  A 1 19  ? -1.119  131.589 -3.947  1.00 176.60 ? 19  DC  D C2    1 
ATOM   284  O O2    . DC  A 1 19  ? -2.339  131.598 -4.203  1.00 177.17 ? 19  DC  D O2    1 
ATOM   285  N N3    . DC  A 1 19  ? -0.665  131.689 -2.673  1.00 176.43 ? 19  DC  D N3    1 
ATOM   286  C C4    . DC  A 1 19  ? 0.647   131.678 -2.423  1.00 176.40 ? 19  DC  D C4    1 
ATOM   287  N N4    . DC  A 1 19  ? 1.027   131.770 -1.135  1.00 174.73 ? 19  DC  D N4    1 
ATOM   288  C C5    . DC  A 1 19  ? 1.618   131.570 -3.477  1.00 176.50 ? 19  DC  D C5    1 
ATOM   289  C C6    . DC  A 1 19  ? 1.155   131.471 -4.747  1.00 176.46 ? 19  DC  D C6    1 
ATOM   290  P P     . DG  B 2 6   ? -7.863  134.859 6.246   1.00 179.47 ? 6   DG  E P     1 
ATOM   291  O OP1   . DG  B 2 6   ? -7.672  133.490 6.757   1.00 179.73 ? 6   DG  E OP1   1 
ATOM   292  O OP2   . DG  B 2 6   ? -8.211  135.957 7.189   1.00 179.45 ? 6   DG  E OP2   1 
ATOM   293  O "O5'" . DG  B 2 6   ? -9.085  134.760 5.243   1.00 179.01 ? 6   DG  E "O5'" 1 
ATOM   294  C "C5'" . DG  B 2 6   ? -9.315  133.574 4.524   1.00 178.15 ? 6   DG  E "C5'" 1 
ATOM   295  C "C4'" . DG  B 2 6   ? -9.014  133.785 3.055   1.00 178.51 ? 6   DG  E "C4'" 1 
ATOM   296  O "O4'" . DG  B 2 6   ? -7.560  133.851 2.837   1.00 179.11 ? 6   DG  E "O4'" 1 
ATOM   297  C "C3'" . DG  B 2 6   ? -9.403  132.465 2.393   1.00 175.50 ? 6   DG  E "C3'" 1 
ATOM   298  O "O3'" . DG  B 2 6   ? -10.199 132.494 1.202   1.00 178.42 ? 6   DG  E "O3'" 1 
ATOM   299  C "C2'" . DG  B 2 6   ? -8.132  131.625 2.367   1.00 176.93 ? 6   DG  E "C2'" 1 
ATOM   300  C "C1'" . DG  B 2 6   ? -7.117  132.688 2.095   1.00 176.53 ? 6   DG  E "C1'" 1 
ATOM   301  N N9    . DG  B 2 6   ? -5.667  132.421 2.243   1.00 176.30 ? 6   DG  E N9    1 
ATOM   302  C C8    . DG  B 2 6   ? -4.952  132.074 3.377   1.00 174.49 ? 6   DG  E C8    1 
ATOM   303  N N7    . DG  B 2 6   ? -3.676  131.845 3.142   1.00 175.17 ? 6   DG  E N7    1 
ATOM   304  C C5    . DG  B 2 6   ? -3.517  132.065 1.772   1.00 175.72 ? 6   DG  E C5    1 
ATOM   305  C C6    . DG  B 2 6   ? -2.324  131.972 0.908   1.00 176.00 ? 6   DG  E C6    1 
ATOM   306  O O6    . DG  B 2 6   ? -1.143  131.665 1.200   1.00 173.35 ? 6   DG  E O6    1 
ATOM   307  N N1    . DG  B 2 6   ? -2.634  132.284 -0.415  1.00 175.95 ? 6   DG  E N1    1 
ATOM   308  C C2    . DG  B 2 6   ? -3.889  132.638 -0.884  1.00 176.04 ? 6   DG  E C2    1 
ATOM   309  N N2    . DG  B 2 6   ? -3.973  132.890 -2.211  1.00 175.78 ? 6   DG  E N2    1 
ATOM   310  N N3    . DG  B 2 6   ? -4.985  132.734 -0.113  1.00 174.79 ? 6   DG  E N3    1 
ATOM   311  C C4    . DG  B 2 6   ? -4.729  132.433 1.193   1.00 176.12 ? 6   DG  E C4    1 
ATOM   312  P P     . DT  B 2 7   ? -11.316 131.347 1.033   1.00 176.88 ? 7   DT  E P     1 
ATOM   313  O OP1   . DT  B 2 7   ? -12.296 131.675 -0.045  1.00 178.88 ? 7   DT  E OP1   1 
ATOM   314  O OP2   . DT  B 2 7   ? -11.803 131.112 2.430   1.00 178.94 ? 7   DT  E OP2   1 
ATOM   315  O "O5'" . DT  B 2 7   ? -10.425 130.124 0.531   1.00 177.45 ? 7   DT  E "O5'" 1 
ATOM   316  C "C5'" . DT  B 2 7   ? -10.481 129.681 -0.822  1.00 174.89 ? 7   DT  E "C5'" 1 
ATOM   317  C "C4'" . DT  B 2 7   ? -9.825  130.679 -1.751  1.00 171.98 ? 7   DT  E "C4'" 1 
ATOM   318  O "O4'" . DT  B 2 7   ? -8.475  130.989 -1.301  1.00 169.13 ? 7   DT  E "O4'" 1 
ATOM   319  C "C3'" . DT  B 2 7   ? -9.643  129.994 -3.099  1.00 170.69 ? 7   DT  E "C3'" 1 
ATOM   320  O "O3'" . DT  B 2 7   ? -9.850  130.817 -4.234  1.00 170.63 ? 7   DT  E "O3'" 1 
ATOM   321  C "C2'" . DT  B 2 7   ? -8.262  129.384 -3.027  1.00 169.15 ? 7   DT  E "C2'" 1 
ATOM   322  C "C1'" . DT  B 2 7   ? -7.508  130.400 -2.187  1.00 167.09 ? 7   DT  E "C1'" 1 
ATOM   323  N N1    . DT  B 2 7   ? -6.426  129.815 -1.366  1.00 164.58 ? 7   DT  E N1    1 
ATOM   324  C C2    . DT  B 2 7   ? -5.143  129.638 -1.885  1.00 163.23 ? 7   DT  E C2    1 
ATOM   325  O O2    . DT  B 2 7   ? -4.826  129.928 -3.033  1.00 162.30 ? 7   DT  E O2    1 
ATOM   326  N N3    . DT  B 2 7   ? -4.235  129.108 -0.987  1.00 161.25 ? 7   DT  E N3    1 
ATOM   327  C C4    . DT  B 2 7   ? -4.476  128.748 0.329   1.00 160.17 ? 7   DT  E C4    1 
ATOM   328  O O4    . DT  B 2 7   ? -3.563  128.295 1.016   1.00 159.22 ? 7   DT  E O4    1 
ATOM   329  C C5    . DT  B 2 7   ? -5.839  128.950 0.785   1.00 160.84 ? 7   DT  E C5    1 
ATOM   330  C C7    . DT  B 2 7   ? -6.205  128.576 2.186   1.00 160.05 ? 7   DT  E C7    1 
ATOM   331  C C6    . DT  B 2 7   ? -6.723  129.462 -0.074  1.00 162.93 ? 7   DT  E C6    1 
ATOM   332  P P     . DT  B 2 8   ? -10.578 130.166 -5.520  1.00 172.20 ? 8   DT  E P     1 
ATOM   333  O OP1   . DT  B 2 8   ? -11.198 131.219 -6.388  1.00 171.61 ? 8   DT  E OP1   1 
ATOM   334  O OP2   . DT  B 2 8   ? -11.449 129.105 -4.942  1.00 171.69 ? 8   DT  E OP2   1 
ATOM   335  O "O5'" . DT  B 2 8   ? -9.392  129.433 -6.301  1.00 173.55 ? 8   DT  E "O5'" 1 
ATOM   336  C "C5'" . DT  B 2 8   ? -8.157  130.109 -6.509  1.00 175.85 ? 8   DT  E "C5'" 1 
ATOM   337  C "C4'" . DT  B 2 8   ? -7.198  129.240 -7.287  1.00 178.14 ? 8   DT  E "C4'" 1 
ATOM   338  O "O4'" . DT  B 2 8   ? -6.169  128.723 -6.401  1.00 178.94 ? 8   DT  E "O4'" 1 
ATOM   339  C "C3'" . DT  B 2 8   ? -7.899  128.001 -7.843  1.00 179.36 ? 8   DT  E "C3'" 1 
ATOM   340  O "O3'" . DT  B 2 8   ? -7.300  127.581 -9.073  1.00 180.62 ? 8   DT  E "O3'" 1 
ATOM   341  C "C2'" . DT  B 2 8   ? -7.718  126.983 -6.729  1.00 179.96 ? 8   DT  E "C2'" 1 
ATOM   342  C "C1'" . DT  B 2 8   ? -6.328  127.319 -6.217  1.00 180.43 ? 8   DT  E "C1'" 1 
ATOM   343  N N1    . DT  B 2 8   ? -6.064  126.981 -4.796  1.00 181.98 ? 8   DT  E N1    1 
ATOM   344  C C2    . DT  B 2 8   ? -4.782  127.112 -4.284  1.00 182.60 ? 8   DT  E C2    1 
ATOM   345  O O2    . DT  B 2 8   ? -3.836  127.524 -4.940  1.00 182.39 ? 8   DT  E O2    1 
ATOM   346  N N3    . DT  B 2 8   ? -4.650  126.737 -2.963  1.00 183.28 ? 8   DT  E N3    1 
ATOM   347  C C4    . DT  B 2 8   ? -5.647  126.261 -2.127  1.00 183.73 ? 8   DT  E C4    1 
ATOM   348  O O4    . DT  B 2 8   ? -5.380  125.964 -0.961  1.00 184.20 ? 8   DT  E O4    1 
ATOM   349  C C5    . DT  B 2 8   ? -6.960  126.156 -2.736  1.00 183.62 ? 8   DT  E C5    1 
ATOM   350  C C7    . DT  B 2 8   ? -8.103  125.643 -1.929  1.00 184.01 ? 8   DT  E C7    1 
ATOM   351  C C6    . DT  B 2 8   ? -7.096  126.522 -4.012  1.00 182.91 ? 8   DT  E C6    1 
ATOM   352  P P     . DA  B 2 9   ? -8.104  126.599 -10.068 1.00 181.29 ? 9   DA  E P     1 
ATOM   353  O OP1   . DA  B 2 9   ? -8.666  127.416 -11.179 1.00 181.70 ? 9   DA  E OP1   1 
ATOM   354  O OP2   . DA  B 2 9   ? -9.011  125.724 -9.269  1.00 181.21 ? 9   DA  E OP2   1 
ATOM   355  O "O5'" . DA  B 2 9   ? -6.919  125.725 -10.668 1.00 180.25 ? 9   DA  E "O5'" 1 
ATOM   356  C "C5'" . DA  B 2 9   ? -5.698  126.364 -11.038 1.00 178.06 ? 9   DA  E "C5'" 1 
ATOM   357  C "C4'" . DA  B 2 9   ? -4.524  125.420 -10.902 1.00 176.51 ? 9   DA  E "C4'" 1 
ATOM   358  O "O4'" . DA  B 2 9   ? -4.284  125.109 -9.503  1.00 175.87 ? 9   DA  E "O4'" 1 
ATOM   359  C "C3'" . DA  B 2 9   ? -4.808  124.071 -11.549 1.00 175.96 ? 9   DA  E "C3'" 1 
ATOM   360  O "O3'" . DA  B 2 9   ? -3.600  123.513 -12.082 1.00 175.04 ? 9   DA  E "O3'" 1 
ATOM   361  C "C2'" . DA  B 2 9   ? -5.415  123.259 -10.410 1.00 175.61 ? 9   DA  E "C2'" 1 
ATOM   362  C "C1'" . DA  B 2 9   ? -4.610  123.748 -9.225  1.00 175.11 ? 9   DA  E "C1'" 1 
ATOM   363  N N9    . DA  B 2 9   ? -5.211  123.658 -7.883  1.00 174.03 ? 9   DA  E N9    1 
ATOM   364  C C8    . DA  B 2 9   ? -6.532  123.763 -7.509  1.00 173.39 ? 9   DA  E C8    1 
ATOM   365  N N7    . DA  B 2 9   ? -6.730  123.614 -6.215  1.00 173.08 ? 9   DA  E N7    1 
ATOM   366  C C5    . DA  B 2 9   ? -5.455  123.399 -5.701  1.00 173.06 ? 9   DA  E C5    1 
ATOM   367  C C6    . DA  B 2 9   ? -4.972  123.168 -4.381  1.00 172.80 ? 9   DA  E C6    1 
ATOM   368  N N6    . DA  B 2 9   ? -5.749  123.110 -3.295  1.00 172.39 ? 9   DA  E N6    1 
ATOM   369  N N1    . DA  B 2 9   ? -3.639  122.997 -4.220  1.00 172.75 ? 9   DA  E N1    1 
ATOM   370  C C2    . DA  B 2 9   ? -2.853  123.055 -5.304  1.00 172.68 ? 9   DA  E C2    1 
ATOM   371  N N3    . DA  B 2 9   ? -3.181  123.261 -6.581  1.00 173.02 ? 9   DA  E N3    1 
ATOM   372  C C4    . DA  B 2 9   ? -4.510  123.428 -6.716  1.00 173.35 ? 9   DA  E C4    1 
ATOM   373  P P     . DT  B 2 10  ? -3.668  122.166 -12.951 1.00 174.42 ? 10  DT  E P     1 
ATOM   374  O OP1   . DT  B 2 10  ? -2.594  122.191 -13.977 1.00 174.26 ? 10  DT  E OP1   1 
ATOM   375  O OP2   . DT  B 2 10  ? -5.082  121.987 -13.374 1.00 174.36 ? 10  DT  E OP2   1 
ATOM   376  O "O5'" . DT  B 2 10  ? -3.322  121.037 -11.882 1.00 173.61 ? 10  DT  E "O5'" 1 
ATOM   377  C "C5'" . DT  B 2 10  ? -1.964  120.731 -11.538 1.00 171.70 ? 10  DT  E "C5'" 1 
ATOM   378  C "C4'" . DT  B 2 10  ? -1.918  119.504 -10.657 1.00 170.30 ? 10  DT  E "C4'" 1 
ATOM   379  O "O4'" . DT  B 2 10  ? -2.239  119.853 -9.284  1.00 169.90 ? 10  DT  E "O4'" 1 
ATOM   380  C "C3'" . DT  B 2 10  ? -2.922  118.418 -11.061 1.00 169.46 ? 10  DT  E "C3'" 1 
ATOM   381  O "O3'" . DT  B 2 10  ? -2.425  117.123 -10.721 1.00 168.09 ? 10  DT  E "O3'" 1 
ATOM   382  C "C2'" . DT  B 2 10  ? -4.169  118.790 -10.274 1.00 169.29 ? 10  DT  E "C2'" 1 
ATOM   383  C "C1'" . DT  B 2 10  ? -3.559  119.404 -9.022  1.00 169.35 ? 10  DT  E "C1'" 1 
ATOM   384  N N1    . DT  B 2 10  ? -3.776  119.024 -7.616  1.00 169.23 ? 10  DT  E N1    1 
ATOM   385  C C2    . DT  B 2 10  ? -5.041  119.204 -7.099  1.00 169.02 ? 10  DT  E C2    1 
ATOM   386  O O2    . DT  B 2 10  ? -5.953  119.710 -7.741  1.00 168.14 ? 10  DT  E O2    1 
ATOM   387  N N3    . DT  B 2 10  ? -5.200  118.760 -5.798  1.00 169.37 ? 10  DT  E N3    1 
ATOM   388  C C4    . DT  B 2 10  ? -4.249  118.155 -4.997  1.00 169.48 ? 10  DT  E C4    1 
ATOM   389  O O4    . DT  B 2 10  ? -4.566  117.750 -3.878  1.00 169.62 ? 10  DT  E O4    1 
ATOM   390  C C5    . DT  B 2 10  ? -2.927  118.033 -5.592  1.00 169.31 ? 10  DT  E C5    1 
ATOM   391  C C7    . DT  B 2 10  ? -1.819  117.421 -4.787  1.00 168.78 ? 10  DT  E C7    1 
ATOM   392  C C6    . DT  B 2 10  ? -2.760  118.477 -6.853  1.00 169.24 ? 10  DT  E C6    1 
ATOM   393  P P     . DC  B 2 11  ? -1.534  116.303 -11.783 1.00 167.00 ? 11  DC  E P     1 
ATOM   394  O OP1   . DC  B 2 11  ? -0.759  117.275 -12.602 1.00 166.86 ? 11  DC  E OP1   1 
ATOM   395  O OP2   . DC  B 2 11  ? -2.411  115.307 -12.462 1.00 166.17 ? 11  DC  E OP2   1 
ATOM   396  O "O5'" . DC  B 2 11  ? -0.512  115.521 -10.845 1.00 166.14 ? 11  DC  E "O5'" 1 
ATOM   397  C "C5'" . DC  B 2 11  ? 0.219   116.209 -9.826  1.00 164.81 ? 11  DC  E "C5'" 1 
ATOM   398  C "C4'" . DC  B 2 11  ? 0.411   115.316 -8.621  1.00 164.28 ? 11  DC  E "C4'" 1 
ATOM   399  O "O4'" . DC  B 2 11  ? -0.663  115.532 -7.665  1.00 164.36 ? 11  DC  E "O4'" 1 
ATOM   400  C "C3'" . DC  B 2 11  ? 0.309   113.838 -9.007  1.00 163.84 ? 11  DC  E "C3'" 1 
ATOM   401  O "O3'" . DC  B 2 11  ? 1.117   113.022 -8.151  1.00 162.69 ? 11  DC  E "O3'" 1 
ATOM   402  C "C2'" . DC  B 2 11  ? -1.172  113.542 -8.838  1.00 164.05 ? 11  DC  E "C2'" 1 
ATOM   403  C "C1'" . DC  B 2 11  ? -1.510  114.382 -7.618  1.00 164.31 ? 11  DC  E "C1'" 1 
ATOM   404  N N1    . DC  B 2 11  ? -2.919  114.814 -7.498  1.00 164.47 ? 11  DC  E N1    1 
ATOM   405  C C2    . DC  B 2 11  ? -3.522  114.808 -6.222  1.00 164.61 ? 11  DC  E C2    1 
ATOM   406  O O2    . DC  B 2 11  ? -2.844  114.467 -5.232  1.00 164.75 ? 11  DC  E O2    1 
ATOM   407  N N3    . DC  B 2 11  ? -4.824  115.175 -6.103  1.00 164.59 ? 11  DC  E N3    1 
ATOM   408  C C4    . DC  B 2 11  ? -5.518  115.539 -7.188  1.00 164.38 ? 11  DC  E C4    1 
ATOM   409  N N4    . DC  B 2 11  ? -6.800  115.890 -7.023  1.00 164.03 ? 11  DC  E N4    1 
ATOM   410  C C5    . DC  B 2 11  ? -4.928  115.561 -8.490  1.00 164.28 ? 11  DC  E C5    1 
ATOM   411  C C6    . DC  B 2 11  ? -3.639  115.197 -8.597  1.00 164.25 ? 11  DC  E C6    1 
ATOM   412  P P     . DC  B 2 12  ? 0.706   111.487 -7.882  1.00 161.85 ? 12  DC  E P     1 
ATOM   413  O OP1   . DC  B 2 12  ? 1.966   110.725 -7.652  1.00 161.87 ? 12  DC  E OP1   1 
ATOM   414  O OP2   . DC  B 2 12  ? -0.238  111.031 -8.945  1.00 161.09 ? 12  DC  E OP2   1 
ATOM   415  O "O5'" . DC  B 2 12  ? -0.099  111.569 -6.504  1.00 160.67 ? 12  DC  E "O5'" 1 
ATOM   416  C "C5'" . DC  B 2 12  ? 0.513   112.115 -5.325  1.00 157.69 ? 12  DC  E "C5'" 1 
ATOM   417  C "C4'" . DC  B 2 12  ? 0.377   111.152 -4.165  1.00 155.50 ? 12  DC  E "C4'" 1 
ATOM   418  O "O4'" . DC  B 2 12  ? -0.912  111.352 -3.524  1.00 154.85 ? 12  DC  E "O4'" 1 
ATOM   419  C "C3'" . DC  B 2 12  ? 0.375   109.698 -4.629  1.00 154.38 ? 12  DC  E "C3'" 1 
ATOM   420  O "O3'" . DC  B 2 12  ? 1.016   108.795 -3.731  1.00 152.25 ? 12  DC  E "O3'" 1 
ATOM   421  C "C2'" . DC  B 2 12  ? -1.095  109.401 -4.856  1.00 154.23 ? 12  DC  E "C2'" 1 
ATOM   422  C "C1'" . DC  B 2 12  ? -1.796  110.262 -3.805  1.00 153.99 ? 12  DC  E "C1'" 1 
ATOM   423  N N1    . DC  B 2 12  ? -3.058  110.827 -4.322  1.00 153.14 ? 12  DC  E N1    1 
ATOM   424  C C2    . DC  B 2 12  ? -4.059  111.263 -3.427  1.00 152.56 ? 12  DC  E C2    1 
ATOM   425  O O2    . DC  B 2 12  ? -3.875  111.169 -2.199  1.00 151.78 ? 12  DC  E O2    1 
ATOM   426  N N3    . DC  B 2 12  ? -5.206  111.778 -3.933  1.00 152.47 ? 12  DC  E N3    1 
ATOM   427  C C4    . DC  B 2 12  ? -5.376  111.866 -5.257  1.00 152.71 ? 12  DC  E C4    1 
ATOM   428  N N4    . DC  B 2 12  ? -6.518  112.382 -5.712  1.00 152.70 ? 12  DC  E N4    1 
ATOM   429  C C5    . DC  B 2 12  ? -4.380  111.430 -6.177  1.00 152.64 ? 12  DC  E C5    1 
ATOM   430  C C6    . DC  B 2 12  ? -3.252  110.924 -5.673  1.00 152.72 ? 12  DC  E C6    1 
ATOM   431  P P     . DG  B 2 13  ? 1.658   107.441 -4.314  1.00 150.79 ? 13  DG  E P     1 
ATOM   432  O OP1   . DG  B 2 13  ? 2.551   106.894 -3.260  1.00 150.87 ? 13  DG  E OP1   1 
ATOM   433  O OP2   . DG  B 2 13  ? 2.206   107.721 -5.669  1.00 150.63 ? 13  DG  E OP2   1 
ATOM   434  O "O5'" . DG  B 2 13  ? 0.401   106.475 -4.483  1.00 149.14 ? 13  DG  E "O5'" 1 
ATOM   435  C "C5'" . DG  B 2 13  ? -0.261  105.972 -3.330  1.00 146.87 ? 13  DG  E "C5'" 1 
ATOM   436  C "C4'" . DG  B 2 13  ? -1.239  104.879 -3.693  1.00 145.26 ? 13  DG  E "C4'" 1 
ATOM   437  O "O4'" . DG  B 2 13  ? -2.488  105.462 -4.142  1.00 144.67 ? 13  DG  E "O4'" 1 
ATOM   438  C "C3'" . DG  B 2 13  ? -0.773  103.989 -4.844  1.00 144.43 ? 13  DG  E "C3'" 1 
ATOM   439  O "O3'" . DG  B 2 13  ? -1.331  102.679 -4.649  1.00 144.66 ? 13  DG  E "O3'" 1 
ATOM   440  C "C2'" . DG  B 2 13  ? -1.328  104.711 -6.062  1.00 144.00 ? 13  DG  E "C2'" 1 
ATOM   441  C "C1'" . DG  B 2 13  ? -2.665  105.222 -5.532  1.00 143.90 ? 13  DG  E "C1'" 1 
ATOM   442  N N9    . DG  B 2 13  ? -3.259  106.412 -6.146  1.00 143.25 ? 13  DG  E N9    1 
ATOM   443  C C8    . DG  B 2 13  ? -2.626  107.377 -6.895  1.00 142.75 ? 13  DG  E C8    1 
ATOM   444  N N7    . DG  B 2 13  ? -3.433  108.316 -7.313  1.00 142.03 ? 13  DG  E N7    1 
ATOM   445  C C5    . DG  B 2 13  ? -4.677  107.952 -6.812  1.00 142.01 ? 13  DG  E C5    1 
ATOM   446  C C6    . DG  B 2 13  ? -5.940  108.586 -6.939  1.00 141.75 ? 13  DG  E C6    1 
ATOM   447  O O6    . DG  B 2 13  ? -6.220  109.624 -7.537  1.00 141.71 ? 13  DG  E O6    1 
ATOM   448  N N1    . DG  B 2 13  ? -6.940  107.883 -6.275  1.00 141.87 ? 13  DG  E N1    1 
ATOM   449  C C2    . DG  B 2 13  ? -6.757  106.717 -5.577  1.00 142.00 ? 13  DG  E C2    1 
ATOM   450  N N2    . DG  B 2 13  ? -7.865  106.194 -5.005  1.00 141.80 ? 13  DG  E N2    1 
ATOM   451  N N3    . DG  B 2 13  ? -5.582  106.109 -5.450  1.00 142.35 ? 13  DG  E N3    1 
ATOM   452  C C4    . DG  B 2 13  ? -4.591  106.781 -6.089  1.00 142.52 ? 13  DG  E C4    1 
ATOM   453  P P     . DC  B 2 14  ? -1.169  101.541 -5.776  1.00 144.96 ? 14  DC  E P     1 
ATOM   454  O OP1   . DC  B 2 14  ? -0.639  100.308 -5.131  1.00 144.66 ? 14  DC  E OP1   1 
ATOM   455  O OP2   . DC  B 2 14  ? -0.429  102.145 -6.919  1.00 145.02 ? 14  DC  E OP2   1 
ATOM   456  O "O5'" . DC  B 2 14  ? -2.680  101.246 -6.210  1.00 144.99 ? 14  DC  E "O5'" 1 
ATOM   457  C "C5'" . DC  B 2 14  ? -3.608  102.321 -6.417  1.00 145.01 ? 14  DC  E "C5'" 1 
ATOM   458  C "C4'" . DC  B 2 14  ? -5.005  101.920 -5.998  1.00 144.84 ? 14  DC  E "C4'" 1 
ATOM   459  O "O4'" . DC  B 2 14  ? -5.849  103.097 -6.066  1.00 144.19 ? 14  DC  E "O4'" 1 
ATOM   460  C "C3'" . DC  B 2 14  ? -5.659  100.908 -6.934  1.00 145.38 ? 14  DC  E "C3'" 1 
ATOM   461  O "O3'" . DC  B 2 14  ? -6.618  100.105 -6.250  1.00 147.43 ? 14  DC  E "O3'" 1 
ATOM   462  C "C2'" . DC  B 2 14  ? -6.325  101.786 -7.971  1.00 144.53 ? 14  DC  E "C2'" 1 
ATOM   463  C "C1'" . DC  B 2 14  ? -6.744  103.014 -7.174  1.00 143.86 ? 14  DC  E "C1'" 1 
ATOM   464  N N1    . DC  B 2 14  ? -6.608  104.253 -7.964  1.00 143.35 ? 14  DC  E N1    1 
ATOM   465  C C2    . DC  B 2 14  ? -7.724  105.103 -8.133  1.00 143.05 ? 14  DC  E C2    1 
ATOM   466  O O2    . DC  B 2 14  ? -8.794  104.828 -7.560  1.00 142.97 ? 14  DC  E O2    1 
ATOM   467  N N3    . DC  B 2 14  ? -7.599  106.204 -8.916  1.00 142.80 ? 14  DC  E N3    1 
ATOM   468  C C4    . DC  B 2 14  ? -6.430  106.479 -9.505  1.00 142.76 ? 14  DC  E C4    1 
ATOM   469  N N4    . DC  B 2 14  ? -6.357  107.565 -10.278 1.00 142.41 ? 14  DC  E N4    1 
ATOM   470  C C5    . DC  B 2 14  ? -5.282  105.650 -9.329  1.00 142.77 ? 14  DC  E C5    1 
ATOM   471  C C6    . DC  B 2 14  ? -5.414  104.562 -8.556  1.00 143.00 ? 14  DC  E C6    1 
ATOM   472  P P     . DT  B 2 15  ? -7.418  98.969  -7.057  1.00 149.54 ? 15  DT  E P     1 
ATOM   473  O OP1   . DT  B 2 15  ? -7.527  97.781  -6.175  1.00 149.09 ? 15  DT  E OP1   1 
ATOM   474  O OP2   . DT  B 2 15  ? -6.789  98.833  -8.396  1.00 148.89 ? 15  DT  E OP2   1 
ATOM   475  O "O5'" . DT  B 2 15  ? -8.876  99.589  -7.239  1.00 152.59 ? 15  DT  E "O5'" 1 
ATOM   476  C "C5'" . DT  B 2 15  ? -9.688  99.876  -6.096  1.00 157.48 ? 15  DT  E "C5'" 1 
ATOM   477  C "C4'" . DT  B 2 15  ? -11.137 100.085 -6.485  1.00 160.80 ? 15  DT  E "C4'" 1 
ATOM   478  O "O4'" . DT  B 2 15  ? -11.275 101.348 -7.192  1.00 161.40 ? 15  DT  E "O4'" 1 
ATOM   479  C "C3'" . DT  B 2 15  ? -11.683 99.023  -7.446  1.00 162.90 ? 15  DT  E "C3'" 1 
ATOM   480  O "O3'" . DT  B 2 15  ? -13.096 98.806  -7.218  1.00 166.24 ? 15  DT  E "O3'" 1 
ATOM   481  C "C2'" . DT  B 2 15  ? -11.369 99.619  -8.812  1.00 162.43 ? 15  DT  E "C2'" 1 
ATOM   482  C "C1'" . DT  B 2 15  ? -11.570 101.118 -8.572  1.00 161.62 ? 15  DT  E "C1'" 1 
ATOM   483  N N1    . DT  B 2 15  ? -10.748 102.051 -9.400  1.00 161.36 ? 15  DT  E N1    1 
ATOM   484  C C2    . DT  B 2 15  ? -11.314 103.255 -9.808  1.00 161.08 ? 15  DT  E C2    1 
ATOM   485  O O2    . DT  B 2 15  ? -12.454 103.591 -9.535  1.00 160.69 ? 15  DT  E O2    1 
ATOM   486  N N3    . DT  B 2 15  ? -10.479 104.058 -10.559 1.00 160.86 ? 15  DT  E N3    1 
ATOM   487  C C4    . DT  B 2 15  ? -9.173  103.784 -10.931 1.00 160.46 ? 15  DT  E C4    1 
ATOM   488  O O4    . DT  B 2 15  ? -8.540  104.599 -11.592 1.00 160.19 ? 15  DT  E O4    1 
ATOM   489  C C5    . DT  B 2 15  ? -8.653  102.511 -10.481 1.00 160.34 ? 15  DT  E C5    1 
ATOM   490  C C7    . DT  B 2 15  ? -7.255  102.133 -10.854 1.00 159.85 ? 15  DT  E C7    1 
ATOM   491  C C6    . DT  B 2 15  ? -9.453  101.721 -9.749  1.00 160.81 ? 15  DT  E C6    1 
ATOM   492  P P     . DC  B 2 16  ? -13.797 97.420  -7.680  1.00 168.34 ? 16  DC  E P     1 
ATOM   493  O OP1   . DC  B 2 16  ? -14.687 96.946  -6.582  1.00 167.68 ? 16  DC  E OP1   1 
ATOM   494  O OP2   . DC  B 2 16  ? -12.741 96.517  -8.210  1.00 168.10 ? 16  DC  E OP2   1 
ATOM   495  O "O5'" . DC  B 2 16  ? -14.712 97.863  -8.909  1.00 169.88 ? 16  DC  E "O5'" 1 
ATOM   496  C "C5'" . DC  B 2 16  ? -14.222 98.805  -9.864  1.00 172.94 ? 16  DC  E "C5'" 1 
ATOM   497  C "C4'" . DC  B 2 16  ? -15.239 99.897  -10.097 1.00 174.61 ? 16  DC  E "C4'" 1 
ATOM   498  O "O4'" . DC  B 2 16  ? -14.579 101.024 -10.723 1.00 175.80 ? 16  DC  E "O4'" 1 
ATOM   499  C "C3'" . DC  B 2 16  ? -16.347 99.496  -11.061 1.00 175.09 ? 16  DC  E "C3'" 1 
ATOM   500  O "O3'" . DC  B 2 16  ? -17.568 100.164 -10.732 1.00 174.75 ? 16  DC  E "O3'" 1 
ATOM   501  C "C2'" . DC  B 2 16  ? -15.775 99.884  -12.415 1.00 175.77 ? 16  DC  E "C2'" 1 
ATOM   502  C "C1'" . DC  B 2 16  ? -14.936 101.125 -12.101 1.00 176.52 ? 16  DC  E "C1'" 1 
ATOM   503  N N1    . DC  B 2 16  ? -13.678 101.207 -12.876 1.00 177.43 ? 16  DC  E N1    1 
ATOM   504  C C2    . DC  B 2 16  ? -13.271 102.446 -13.436 1.00 177.76 ? 16  DC  E C2    1 
ATOM   505  O O2    . DC  B 2 16  ? -13.982 103.456 -13.277 1.00 177.79 ? 16  DC  E O2    1 
ATOM   506  N N3    . DC  B 2 16  ? -12.110 102.502 -14.138 1.00 178.03 ? 16  DC  E N3    1 
ATOM   507  C C4    . DC  B 2 16  ? -11.370 101.399 -14.296 1.00 178.30 ? 16  DC  E C4    1 
ATOM   508  N N4    . DC  B 2 16  ? -10.234 101.500 -14.996 1.00 178.35 ? 16  DC  E N4    1 
ATOM   509  C C5    . DC  B 2 16  ? -11.759 100.139 -13.745 1.00 178.17 ? 16  DC  E C5    1 
ATOM   510  C C6    . DC  B 2 16  ? -12.905 100.090 -13.050 1.00 177.76 ? 16  DC  E C6    1 
ATOM   511  P P     . DA  B 2 17  ? -18.936 99.732  -11.460 1.00 174.62 ? 17  DA  E P     1 
ATOM   512  O OP1   . DA  B 2 17  ? -20.055 99.871  -10.490 1.00 174.36 ? 17  DA  E OP1   1 
ATOM   513  O OP2   . DA  B 2 17  ? -18.701 98.422  -12.129 1.00 174.16 ? 17  DA  E OP2   1 
ATOM   514  O "O5'" . DA  B 2 17  ? -19.111 100.847 -12.585 1.00 173.99 ? 17  DA  E "O5'" 1 
ATOM   515  C "C5'" . DA  B 2 17  ? -19.052 102.232 -12.244 1.00 172.71 ? 17  DA  E "C5'" 1 
ATOM   516  C "C4'" . DA  B 2 17  ? -19.118 103.095 -13.483 1.00 172.34 ? 17  DA  E "C4'" 1 
ATOM   517  O "O4'" . DA  B 2 17  ? -17.857 103.015 -14.199 1.00 171.11 ? 17  DA  E "O4'" 1 
ATOM   518  C "C3'" . DA  B 2 17  ? -20.176 102.609 -14.477 1.00 172.76 ? 17  DA  E "C3'" 1 
ATOM   519  O "O3'" . DA  B 2 17  ? -20.684 103.731 -15.215 1.00 174.66 ? 17  DA  E "O3'" 1 
ATOM   520  C "C2'" . DA  B 2 17  ? -19.400 101.631 -15.346 1.00 171.59 ? 17  DA  E "C2'" 1 
ATOM   521  C "C1'" . DA  B 2 17  ? -18.046 102.320 -15.427 1.00 170.22 ? 17  DA  E "C1'" 1 
ATOM   522  N N9    . DA  B 2 17  ? -16.857 101.508 -15.721 1.00 168.64 ? 17  DA  E N9    1 
ATOM   523  C C8    . DA  B 2 17  ? -16.606 100.166 -15.514 1.00 167.65 ? 17  DA  E C8    1 
ATOM   524  N N7    . DA  B 2 17  ? -15.432 99.774  -15.962 1.00 167.06 ? 17  DA  E N7    1 
ATOM   525  C C5    . DA  B 2 17  ? -14.870 100.938 -16.489 1.00 167.32 ? 17  DA  E C5    1 
ATOM   526  C C6    . DA  B 2 17  ? -13.633 101.208 -17.134 1.00 166.89 ? 17  DA  E C6    1 
ATOM   527  N N6    . DA  B 2 17  ? -12.701 100.287 -17.376 1.00 166.79 ? 17  DA  E N6    1 
ATOM   528  N N1    . DA  B 2 17  ? -13.394 102.479 -17.536 1.00 166.66 ? 17  DA  E N1    1 
ATOM   529  C C2    . DA  B 2 17  ? -14.327 103.405 -17.308 1.00 166.93 ? 17  DA  E C2    1 
ATOM   530  N N3    . DA  B 2 17  ? -15.518 103.280 -16.724 1.00 167.38 ? 17  DA  E N3    1 
ATOM   531  C C4    . DA  B 2 17  ? -15.732 102.009 -16.335 1.00 167.76 ? 17  DA  E C4    1 
ATOM   532  P P     . DC  B 2 18  ? -21.730 103.508 -16.422 1.00 175.11 ? 18  DC  E P     1 
ATOM   533  O OP1   . DC  B 2 18  ? -22.863 104.457 -16.241 1.00 175.71 ? 18  DC  E OP1   1 
ATOM   534  O OP2   . DC  B 2 18  ? -22.013 102.055 -16.582 1.00 176.04 ? 18  DC  E OP2   1 
ATOM   535  O "O5'" . DC  B 2 18  ? -20.912 103.996 -17.700 1.00 175.36 ? 18  DC  E "O5'" 1 
ATOM   536  C "C5'" . DC  B 2 18  ? -19.490 103.859 -17.772 1.00 173.25 ? 18  DC  E "C5'" 1 
ATOM   537  C "C4'" . DC  B 2 18  ? -18.988 104.496 -19.043 1.00 170.94 ? 18  DC  E "C4'" 1 
ATOM   538  O "O4'" . DC  B 2 18  ? -17.611 104.081 -19.265 1.00 168.74 ? 18  DC  E "O4'" 1 
ATOM   539  C "C3'" . DC  B 2 18  ? -19.767 103.937 -20.231 1.00 173.34 ? 18  DC  E "C3'" 1 
ATOM   540  O "O3'" . DC  B 2 18  ? -19.916 104.900 -21.274 1.00 174.73 ? 18  DC  E "O3'" 1 
ATOM   541  C "C2'" . DC  B 2 18  ? -18.958 102.728 -20.652 1.00 170.21 ? 18  DC  E "C2'" 1 
ATOM   542  C "C1'" . DC  B 2 18  ? -17.533 103.181 -20.374 1.00 169.30 ? 18  DC  E "C1'" 1 
ATOM   543  N N1    . DC  B 2 18  ? -16.632 102.062 -20.031 1.00 167.28 ? 18  DC  E N1    1 
ATOM   544  C C2    . DC  B 2 18  ? -15.266 102.110 -20.412 1.00 166.91 ? 18  DC  E C2    1 
ATOM   545  O O2    . DC  B 2 18  ? -14.821 103.115 -21.004 1.00 167.20 ? 18  DC  E O2    1 
ATOM   546  N N3    . DC  B 2 18  ? -14.472 101.047 -20.126 1.00 166.74 ? 18  DC  E N3    1 
ATOM   547  C C4    . DC  B 2 18  ? -14.979 99.979  -19.495 1.00 166.80 ? 18  DC  E C4    1 
ATOM   548  N N4    . DC  B 2 18  ? -14.165 98.957  -19.234 1.00 166.51 ? 18  DC  E N4    1 
ATOM   549  C C5    . DC  B 2 18  ? -16.344 99.913  -19.097 1.00 166.26 ? 18  DC  E C5    1 
ATOM   550  C C6    . DC  B 2 18  ? -17.123 100.966 -19.374 1.00 167.37 ? 18  DC  E C6    1 
ATOM   551  P P     . DA  B 2 19  ? -20.393 104.422 -22.742 1.00 178.35 ? 19  DA  E P     1 
ATOM   552  O OP1   . DA  B 2 19  ? -21.286 105.484 -23.292 1.00 176.87 ? 19  DA  E OP1   1 
ATOM   553  O OP2   . DA  B 2 19  ? -20.898 103.015 -22.635 1.00 177.25 ? 19  DA  E OP2   1 
ATOM   554  O "O5'" . DA  B 2 19  ? -19.030 104.424 -23.571 1.00 177.02 ? 19  DA  E "O5'" 1 
ATOM   555  C "C5'" . DA  B 2 19  ? -18.024 105.387 -23.257 1.00 176.78 ? 19  DA  E "C5'" 1 
ATOM   556  C "C4'" . DA  B 2 19  ? -16.681 104.988 -23.826 1.00 176.50 ? 19  DA  E "C4'" 1 
ATOM   557  O "O4'" . DA  B 2 19  ? -16.204 103.776 -23.187 1.00 177.26 ? 19  DA  E "O4'" 1 
ATOM   558  C "C3'" . DA  B 2 19  ? -16.770 104.632 -25.313 1.00 177.01 ? 19  DA  E "C3'" 1 
ATOM   559  O "O3'" . DA  B 2 19  ? -15.447 104.725 -25.867 1.00 176.45 ? 19  DA  E "O3'" 1 
ATOM   560  C "C2'" . DA  B 2 19  ? -17.089 103.144 -25.290 1.00 176.43 ? 19  DA  E "C2'" 1 
ATOM   561  C "C1'" . DA  B 2 19  ? -16.216 102.706 -24.133 1.00 176.88 ? 19  DA  E "C1'" 1 
ATOM   562  N N9    . DA  B 2 19  ? -16.499 101.439 -23.449 1.00 176.40 ? 19  DA  E N9    1 
ATOM   563  C C8    . DA  B 2 19  ? -17.647 100.954 -22.856 1.00 176.10 ? 19  DA  E C8    1 
ATOM   564  N N7    . DA  B 2 19  ? -17.501 99.757  -22.322 1.00 176.53 ? 19  DA  E N7    1 
ATOM   565  C C5    . DA  B 2 19  ? -16.170 99.432  -22.584 1.00 176.14 ? 19  DA  E C5    1 
ATOM   566  C C6    . DA  B 2 19  ? -15.370 98.290  -22.275 1.00 175.99 ? 19  DA  E C6    1 
ATOM   567  N N6    . DA  B 2 19  ? -15.815 97.225  -21.601 1.00 175.46 ? 19  DA  E N6    1 
ATOM   568  N N1    . DA  B 2 19  ? -14.079 98.294  -22.692 1.00 175.80 ? 19  DA  E N1    1 
ATOM   569  C C2    . DA  B 2 19  ? -13.625 99.366  -23.370 1.00 175.72 ? 19  DA  E C2    1 
ATOM   570  N N3    . DA  B 2 19  ? -14.269 100.487 -23.714 1.00 175.87 ? 19  DA  E N3    1 
ATOM   571  C C4    . DA  B 2 19  ? -15.547 100.456 -23.284 1.00 176.18 ? 19  DA  E C4    1 
ATOM   572  N N     . LYS C 3 2   ? 9.636   103.602 -1.498  1.00 126.06 ? 2   LYS A N     1 
ATOM   573  C CA    . LYS C 3 2   ? 8.324   103.670 -1.867  1.00 127.78 ? 2   LYS A CA    1 
ATOM   574  C C     . LYS C 3 2   ? 7.997   102.494 -2.714  1.00 128.80 ? 2   LYS A C     1 
ATOM   575  O O     . LYS C 3 2   ? 8.289   102.516 -3.929  1.00 129.82 ? 2   LYS A O     1 
ATOM   576  C CB    . LYS C 3 2   ? 8.361   104.837 -2.601  1.00 127.29 ? 2   LYS A CB    1 
ATOM   577  N N     . PRO C 3 3   ? 7.290   101.505 -2.105  1.00 129.59 ? 3   PRO A N     1 
ATOM   578  C CA    . PRO C 3 3   ? 6.789   100.212 -2.559  1.00 129.53 ? 3   PRO A CA    1 
ATOM   579  C C     . PRO C 3 3   ? 6.469   100.090 -4.104  1.00 129.87 ? 3   PRO A C     1 
ATOM   580  O O     . PRO C 3 3   ? 6.046   101.036 -4.752  1.00 129.02 ? 3   PRO A O     1 
ATOM   581  C CB    . PRO C 3 3   ? 5.610   99.983  -1.614  1.00 129.79 ? 3   PRO A CB    1 
ATOM   582  N N     . VAL C 3 4   ? 6.459   98.855  -4.605  1.00 130.61 ? 4   VAL A N     1 
ATOM   583  C CA    . VAL C 3 4   ? 6.109   98.607  -5.993  1.00 131.90 ? 4   VAL A CA    1 
ATOM   584  C C     . VAL C 3 4   ? 4.671   98.977  -6.357  1.00 132.13 ? 4   VAL A C     1 
ATOM   585  O O     . VAL C 3 4   ? 3.746   98.374  -5.806  1.00 132.41 ? 4   VAL A O     1 
ATOM   586  C CB    . VAL C 3 4   ? 6.348   97.129  -6.416  1.00 131.66 ? 4   VAL A CB    1 
ATOM   587  N N     . THR C 3 5   ? 4.490   99.997  -7.218  1.00 132.13 ? 5   THR A N     1 
ATOM   588  C CA    . THR C 3 5   ? 3.141   100.433 -7.617  1.00 132.02 ? 5   THR A CA    1 
ATOM   589  C C     . THR C 3 5   ? 2.511   99.485  -8.669  1.00 132.03 ? 5   THR A C     1 
ATOM   590  O O     . THR C 3 5   ? 3.153   98.528  -9.123  1.00 132.69 ? 5   THR A O     1 
ATOM   591  C CB    . THR C 3 5   ? 3.161   101.872 -8.191  1.00 131.38 ? 5   THR A CB    1 
ATOM   592  N N     . LEU C 3 6   ? 1.257   99.739  -9.059  1.00 131.91 ? 6   LEU A N     1 
ATOM   593  C CA    . LEU C 3 6   ? 0.588   98.910  -10.090 1.00 131.69 ? 6   LEU A CA    1 
ATOM   594  C C     . LEU C 3 6   ? 1.113   99.397  -11.442 1.00 131.74 ? 6   LEU A C     1 
ATOM   595  O O     . LEU C 3 6   ? 0.976   98.721  -12.476 1.00 131.36 ? 6   LEU A O     1 
ATOM   596  C CB    . LEU C 3 6   ? -0.938  99.074  -10.042 1.00 130.78 ? 6   LEU A CB    1 
ATOM   597  N N     . TYR C 3 7   ? 1.728   100.582 -11.388 1.00 131.89 ? 7   TYR A N     1 
ATOM   598  C CA    . TYR C 3 7   ? 2.339   101.252 -12.532 1.00 131.81 ? 7   TYR A CA    1 
ATOM   599  C C     . TYR C 3 7   ? 3.709   100.629 -12.849 1.00 131.73 ? 7   TYR A C     1 
ATOM   600  O O     . TYR C 3 7   ? 4.082   100.481 -14.015 1.00 131.77 ? 7   TYR A O     1 
ATOM   601  C CB    . TYR C 3 7   ? 2.504   102.743 -12.221 1.00 131.46 ? 7   TYR A CB    1 
ATOM   602  N N     . ASP C 3 8   ? 4.456   100.275 -11.805 1.00 131.53 ? 8   ASP A N     1 
ATOM   603  C CA    . ASP C 3 8   ? 5.764   99.654  -11.975 1.00 131.40 ? 8   ASP A CA    1 
ATOM   604  C C     . ASP C 3 8   ? 5.641   98.293  -12.688 1.00 131.65 ? 8   ASP A C     1 
ATOM   605  O O     . ASP C 3 8   ? 6.552   97.895  -13.425 1.00 131.99 ? 8   ASP A O     1 
ATOM   606  C CB    . ASP C 3 8   ? 6.444   99.471  -10.611 1.00 131.00 ? 8   ASP A CB    1 
ATOM   607  N N     . VAL C 3 9   ? 4.520   97.591  -12.468 1.00 131.64 ? 9   VAL A N     1 
ATOM   608  C CA    . VAL C 3 9   ? 4.259   96.277  -13.086 1.00 131.56 ? 9   VAL A CA    1 
ATOM   609  C C     . VAL C 3 9   ? 3.713   96.432  -14.516 1.00 131.69 ? 9   VAL A C     1 
ATOM   610  O O     . VAL C 3 9   ? 3.658   95.462  -15.293 1.00 131.74 ? 9   VAL A O     1 
ATOM   611  C CB    . VAL C 3 9   ? 3.243   95.445  -12.253 1.00 130.83 ? 9   VAL A CB    1 
ATOM   612  N N     . ALA C 3 10  ? 3.308   97.659  -14.848 1.00 131.74 ? 10  ALA A N     1 
ATOM   613  C CA    . ALA C 3 10  ? 2.783   97.987  -16.170 1.00 131.72 ? 10  ALA A CA    1 
ATOM   614  C C     . ALA C 3 10  ? 3.908   97.964  -17.218 1.00 131.98 ? 10  ALA A C     1 
ATOM   615  O O     . ALA C 3 10  ? 3.758   97.368  -18.289 1.00 131.46 ? 10  ALA A O     1 
ATOM   616  C CB    . ALA C 3 10  ? 2.122   99.370  -16.132 1.00 131.16 ? 10  ALA A CB    1 
ATOM   617  N N     . GLU C 3 11  ? 5.029   98.614  -16.894 1.00 132.58 ? 11  GLU A N     1 
ATOM   618  C CA    . GLU C 3 11  ? 6.195   98.692  -17.781 1.00 133.24 ? 11  GLU A CA    1 
ATOM   619  C C     . GLU C 3 11  ? 7.080   97.429  -17.770 1.00 133.98 ? 11  GLU A C     1 
ATOM   620  O O     . GLU C 3 11  ? 7.614   97.030  -18.811 1.00 134.02 ? 11  GLU A O     1 
ATOM   621  C CB    . GLU C 3 11  ? 7.045   99.921  -17.421 1.00 132.29 ? 11  GLU A CB    1 
ATOM   622  N N     . TYR C 3 12  ? 7.236   96.810  -16.599 1.00 134.75 ? 12  TYR A N     1 
ATOM   623  C CA    . TYR C 3 12  ? 8.044   95.591  -16.459 1.00 135.49 ? 12  TYR A CA    1 
ATOM   624  C C     . TYR C 3 12  ? 7.282   94.350  -16.952 1.00 136.31 ? 12  TYR A C     1 
ATOM   625  O O     . TYR C 3 12  ? 7.669   93.209  -16.670 1.00 135.87 ? 12  TYR A O     1 
ATOM   626  C CB    . TYR C 3 12  ? 8.454   95.399  -14.995 1.00 135.06 ? 12  TYR A CB    1 
ATOM   627  N N     . ALA C 3 13  ? 6.194   94.593  -17.682 1.00 137.71 ? 13  ALA A N     1 
ATOM   628  C CA    . ALA C 3 13  ? 5.352   93.538  -18.244 1.00 139.11 ? 13  ALA A CA    1 
ATOM   629  C C     . ALA C 3 13  ? 4.838   93.977  -19.626 1.00 140.23 ? 13  ALA A C     1 
ATOM   630  O O     . ALA C 3 13  ? 4.288   93.163  -20.381 1.00 140.61 ? 13  ALA A O     1 
ATOM   631  C CB    . ALA C 3 13  ? 4.169   93.235  -17.301 1.00 138.60 ? 13  ALA A CB    1 
ATOM   632  N N     . GLY C 3 14  ? 5.021   95.264  -19.942 1.00 141.24 ? 14  GLY A N     1 
ATOM   633  C CA    . GLY C 3 14  ? 4.597   95.809  -21.228 1.00 142.27 ? 14  GLY A CA    1 
ATOM   634  C C     . GLY C 3 14  ? 3.113   96.106  -21.405 1.00 142.84 ? 14  GLY A C     1 
ATOM   635  O O     . GLY C 3 14  ? 2.617   96.167  -22.538 1.00 142.81 ? 14  GLY A O     1 
ATOM   636  N N     . VAL C 3 15  ? 2.402   96.299  -20.295 1.00 143.36 ? 15  VAL A N     1 
ATOM   637  C CA    . VAL C 3 15  ? 0.965   96.581  -20.334 1.00 143.93 ? 15  VAL A CA    1 
ATOM   638  C C     . VAL C 3 15  ? 0.612   97.914  -19.647 1.00 144.19 ? 15  VAL A C     1 
ATOM   639  O O     . VAL C 3 15  ? 1.484   98.772  -19.447 1.00 144.07 ? 15  VAL A O     1 
ATOM   640  C CB    . VAL C 3 15  ? 0.165   95.439  -19.651 1.00 143.98 ? 15  VAL A CB    1 
ATOM   641  N N     . SER C 3 16  ? -0.671  98.075  -19.301 1.00 144.39 ? 16  SER A N     1 
ATOM   642  C CA    . SER C 3 16  ? -1.181  99.276  -18.622 1.00 144.28 ? 16  SER A CA    1 
ATOM   643  C C     . SER C 3 16  ? -1.556  98.956  -17.164 1.00 144.21 ? 16  SER A C     1 
ATOM   644  O O     . SER C 3 16  ? -1.549  97.789  -16.756 1.00 144.41 ? 16  SER A O     1 
ATOM   645  C CB    . SER C 3 16  ? -2.410  99.829  -19.358 1.00 144.04 ? 16  SER A CB    1 
ATOM   646  N N     . TYR C 3 17  ? -1.880  99.994  -16.387 1.00 143.65 ? 17  TYR A N     1 
ATOM   647  C CA    . TYR C 3 17  ? -2.246  99.837  -14.973 1.00 142.79 ? 17  TYR A CA    1 
ATOM   648  C C     . TYR C 3 17  ? -3.555  99.070  -14.816 1.00 142.08 ? 17  TYR A C     1 
ATOM   649  O O     . TYR C 3 17  ? -3.822  98.474  -13.768 1.00 141.94 ? 17  TYR A O     1 
ATOM   650  C CB    . TYR C 3 17  ? -2.377  101.210 -14.298 1.00 142.36 ? 17  TYR A CB    1 
ATOM   651  N N     . GLN C 3 18  ? -4.360  99.091  -15.874 1.00 141.31 ? 18  GLN A N     1 
ATOM   652  C CA    . GLN C 3 18  ? -5.649  98.408  -15.901 1.00 140.68 ? 18  GLN A CA    1 
ATOM   653  C C     . GLN C 3 18  ? -5.474  96.919  -16.189 1.00 140.23 ? 18  GLN A C     1 
ATOM   654  O O     . GLN C 3 18  ? -6.200  96.083  -15.644 1.00 139.87 ? 18  GLN A O     1 
ATOM   655  C CB    . GLN C 3 18  ? -6.545  99.029  -16.978 1.00 140.88 ? 18  GLN A CB    1 
ATOM   656  N N     . THR C 3 19  ? -4.518  96.604  -17.063 1.00 139.82 ? 19  THR A N     1 
ATOM   657  C CA    . THR C 3 19  ? -4.223  95.225  -17.438 1.00 139.62 ? 19  THR A CA    1 
ATOM   658  C C     . THR C 3 19  ? -3.832  94.441  -16.186 1.00 139.67 ? 19  THR A C     1 
ATOM   659  O O     . THR C 3 19  ? -4.353  93.348  -15.935 1.00 139.83 ? 19  THR A O     1 
ATOM   660  C CB    . THR C 3 19  ? -3.062  95.161  -18.458 1.00 139.07 ? 19  THR A CB    1 
ATOM   661  N N     . VAL C 3 20  ? -2.912  95.013  -15.407 1.00 139.61 ? 20  VAL A N     1 
ATOM   662  C CA    . VAL C 3 20  ? -2.439  94.401  -14.163 1.00 139.32 ? 20  VAL A CA    1 
ATOM   663  C C     . VAL C 3 20  ? -3.585  94.299  -13.148 1.00 139.03 ? 20  VAL A C     1 
ATOM   664  O O     . VAL C 3 20  ? -3.701  93.303  -12.425 1.00 138.84 ? 20  VAL A O     1 
ATOM   665  C CB    . VAL C 3 20  ? -1.290  95.229  -13.533 1.00 139.00 ? 20  VAL A CB    1 
ATOM   666  N N     . SER C 3 21  ? -4.416  95.345  -13.106 1.00 138.86 ? 21  SER A N     1 
ATOM   667  C CA    . SER C 3 21  ? -5.577  95.427  -12.211 1.00 138.53 ? 21  SER A CA    1 
ATOM   668  C C     . SER C 3 21  ? -6.496  94.242  -12.466 1.00 138.57 ? 21  SER A C     1 
ATOM   669  O O     . SER C 3 21  ? -7.006  93.614  -11.531 1.00 138.13 ? 21  SER A O     1 
ATOM   670  C CB    . SER C 3 21  ? -6.352  96.724  -12.470 1.00 137.97 ? 21  SER A CB    1 
ATOM   671  N N     . ARG C 3 22  ? -6.706  93.966  -13.751 1.00 138.91 ? 22  ARG A N     1 
ATOM   672  C CA    . ARG C 3 22  ? -7.538  92.858  -14.200 1.00 139.18 ? 22  ARG A CA    1 
ATOM   673  C C     . ARG C 3 22  ? -6.969  91.558  -13.621 1.00 139.61 ? 22  ARG A C     1 
ATOM   674  O O     . ARG C 3 22  ? -7.649  90.853  -12.871 1.00 139.68 ? 22  ARG A O     1 
ATOM   675  C CB    . ARG C 3 22  ? -7.547  92.803  -15.739 1.00 138.76 ? 22  ARG A CB    1 
ATOM   676  N N     . VAL C 3 23  ? -5.717  91.260  -13.968 1.00 140.14 ? 23  VAL A N     1 
ATOM   677  C CA    . VAL C 3 23  ? -5.021  90.061  -13.493 1.00 140.97 ? 23  VAL A CA    1 
ATOM   678  C C     . VAL C 3 23  ? -5.124  89.883  -11.969 1.00 141.72 ? 23  VAL A C     1 
ATOM   679  O O     . VAL C 3 23  ? -5.451  88.796  -11.478 1.00 140.93 ? 23  VAL A O     1 
ATOM   680  C CB    . VAL C 3 23  ? -3.524  90.109  -13.883 1.00 140.49 ? 23  VAL A CB    1 
ATOM   681  N N     . VAL C 3 24  ? -4.836  90.961  -11.238 1.00 143.03 ? 24  VAL A N     1 
ATOM   682  C CA    . VAL C 3 24  ? -4.882  90.978  -9.773  1.00 143.76 ? 24  VAL A CA    1 
ATOM   683  C C     . VAL C 3 24  ? -6.264  90.651  -9.202  1.00 144.24 ? 24  VAL A C     1 
ATOM   684  O O     . VAL C 3 24  ? -6.386  89.908  -8.217  1.00 144.89 ? 24  VAL A O     1 
ATOM   685  C CB    . VAL C 3 24  ? -4.438  92.358  -9.216  1.00 142.92 ? 24  VAL A CB    1 
ATOM   686  N N     . ASN C 3 25  ? -7.297  91.209  -9.828  1.00 145.81 ? 25  ASN A N     1 
ATOM   687  C CA    . ASN C 3 25  ? -8.689  91.008  -9.420  1.00 147.77 ? 25  ASN A CA    1 
ATOM   688  C C     . ASN C 3 25  ? -9.352  89.749  -10.005 1.00 148.18 ? 25  ASN A C     1 
ATOM   689  O O     . ASN C 3 25  ? -10.592 89.652  -9.969  1.00 148.30 ? 25  ASN A O     1 
ATOM   690  C CB    . ASN C 3 25  ? -9.525  92.252  -9.824  1.00 147.47 ? 25  ASN A CB    1 
ATOM   691  N N     . GLN C 3 26  ? -8.542  88.826  -10.529 1.00 149.35 ? 26  GLN A N     1 
ATOM   692  C CA    . GLN C 3 26  ? -9.044  87.622  -11.137 1.00 150.31 ? 26  GLN A CA    1 
ATOM   693  C C     . GLN C 3 26  ? -9.951  87.922  -12.337 1.00 150.70 ? 26  GLN A C     1 
ATOM   694  O O     . GLN C 3 26  ? -10.910 87.206  -12.589 1.00 151.70 ? 26  GLN A O     1 
ATOM   695  C CB    . GLN C 3 26  ? -9.785  86.724  -10.116 1.00 150.78 ? 26  GLN A CB    1 
ATOM   696  N N     . ALA C 3 27  ? -9.645  89.001  -13.042 1.00 152.63 ? 27  ALA A N     1 
ATOM   697  C CA    . ALA C 3 27  ? -10.350 89.439  -14.226 1.00 154.08 ? 27  ALA A CA    1 
ATOM   698  C C     . ALA C 3 27  ? -11.290 88.665  -15.136 1.00 153.76 ? 27  ALA A C     1 
ATOM   699  O O     . ALA C 3 27  ? -11.151 87.409  -15.256 1.00 154.20 ? 27  ALA A O     1 
ATOM   700  C CB    . ALA C 3 27  ? -9.354  90.217  -15.094 1.00 154.12 ? 27  ALA A CB    1 
ATOM   701  N N     . SER C 3 28  ? -12.172 89.416  -15.843 1.00 154.97 ? 28  SER A N     1 
ATOM   702  C CA    . SER C 3 28  ? -13.123 88.792  -16.779 1.00 156.40 ? 28  SER A CA    1 
ATOM   703  C C     . SER C 3 28  ? -12.491 89.236  -18.157 1.00 157.42 ? 28  SER A C     1 
ATOM   704  O O     . SER C 3 28  ? -12.480 90.432  -18.517 1.00 157.98 ? 28  SER A O     1 
ATOM   705  C CB    . SER C 3 28  ? -14.503 89.414  -16.599 1.00 157.80 ? 28  SER A CB    1 
ATOM   706  N N     . HIS C 3 29  ? -12.029 88.272  -18.938 1.00 157.78 ? 29  HIS A N     1 
ATOM   707  C CA    . HIS C 3 29  ? -11.360 88.527  -20.177 1.00 156.70 ? 29  HIS A CA    1 
ATOM   708  C C     . HIS C 3 29  ? -9.985  89.068  -19.897 1.00 155.96 ? 29  HIS A C     1 
ATOM   709  O O     . HIS C 3 29  ? -9.829  90.182  -19.362 1.00 155.51 ? 29  HIS A O     1 
ATOM   710  C CB    . HIS C 3 29  ? -12.169 89.422  -21.094 1.00 157.13 ? 29  HIS A CB    1 
ATOM   711  N N     . VAL C 3 30  ? -8.994  88.216  -20.193 1.00 154.85 ? 30  VAL A N     1 
ATOM   712  C CA    . VAL C 3 30  ? -7.574  88.509  -19.984 1.00 154.36 ? 30  VAL A CA    1 
ATOM   713  C C     . VAL C 3 30  ? -6.936  87.908  -21.243 1.00 153.36 ? 30  VAL A C     1 
ATOM   714  O O     . VAL C 3 30  ? -7.375  86.861  -21.777 1.00 152.92 ? 30  VAL A O     1 
ATOM   715  C CB    . VAL C 3 30  ? -7.085  87.829  -18.658 1.00 154.20 ? 30  VAL A CB    1 
ATOM   716  N N     . SER C 3 31  ? -5.926  88.610  -21.740 1.00 151.92 ? 31  SER A N     1 
ATOM   717  C CA    . SER C 3 31  ? -5.255  88.218  -22.984 1.00 151.41 ? 31  SER A CA    1 
ATOM   718  C C     . SER C 3 31  ? -4.597  86.833  -22.941 1.00 151.14 ? 31  SER A C     1 
ATOM   719  O O     . SER C 3 31  ? -3.633  86.565  -23.662 1.00 153.06 ? 31  SER A O     1 
ATOM   720  C CB    . SER C 3 31  ? -4.237  89.289  -23.392 1.00 151.31 ? 31  SER A CB    1 
ATOM   721  N N     . ALA C 3 32  ? -5.172  85.940  -22.132 1.00 150.46 ? 32  ALA A N     1 
ATOM   722  C CA    . ALA C 3 32  ? -4.694  84.553  -21.977 1.00 148.95 ? 32  ALA A CA    1 
ATOM   723  C C     . ALA C 3 32  ? -3.237  84.474  -21.526 1.00 147.94 ? 32  ALA A C     1 
ATOM   724  O O     . ALA C 3 32  ? -2.951  84.433  -20.320 1.00 146.44 ? 32  ALA A O     1 
ATOM   725  C CB    . ALA C 3 32  ? -4.882  83.768  -23.301 1.00 148.37 ? 32  ALA A CB    1 
ATOM   726  N N     . LYS C 3 33  ? -2.323  84.412  -22.496 1.00 147.21 ? 33  LYS A N     1 
ATOM   727  C CA    . LYS C 3 33  ? -0.893  84.357  -22.202 1.00 147.73 ? 33  LYS A CA    1 
ATOM   728  C C     . LYS C 3 33  ? -0.409  85.689  -21.603 1.00 146.86 ? 33  LYS A C     1 
ATOM   729  O O     . LYS C 3 33  ? 0.698   85.760  -21.054 1.00 147.71 ? 33  LYS A O     1 
ATOM   730  C CB    . LYS C 3 33  ? -0.106  84.032  -23.484 1.00 146.61 ? 33  LYS A CB    1 
ATOM   731  N N     . THR C 3 34  ? -1.236  86.733  -21.729 1.00 146.60 ? 34  THR A N     1 
ATOM   732  C CA    . THR C 3 34  ? -0.913  88.060  -21.200 1.00 145.37 ? 34  THR A CA    1 
ATOM   733  C C     . THR C 3 34  ? -0.884  88.029  -19.681 1.00 145.11 ? 34  THR A C     1 
ATOM   734  O O     . THR C 3 34  ? -0.003  88.626  -19.053 1.00 145.50 ? 34  THR A O     1 
ATOM   735  C CB    . THR C 3 34  ? -1.948  89.107  -21.612 1.00 147.28 ? 34  THR A CB    1 
ATOM   736  N N     . ARG C 3 35  ? -1.870  87.347  -19.101 1.00 144.25 ? 35  ARG A N     1 
ATOM   737  C CA    . ARG C 3 35  ? -1.990  87.205  -17.650 1.00 142.49 ? 35  ARG A CA    1 
ATOM   738  C C     . ARG C 3 35  ? -0.822  86.387  -17.074 1.00 141.33 ? 35  ARG A C     1 
ATOM   739  O O     . ARG C 3 35  ? -0.391  86.598  -15.933 1.00 139.85 ? 35  ARG A O     1 
ATOM   740  C CB    . ARG C 3 35  ? -3.332  86.536  -17.303 1.00 141.87 ? 35  ARG A CB    1 
ATOM   741  N N     . GLU C 3 36  ? -0.322  85.451  -17.880 1.00 139.21 ? 36  GLU A N     1 
ATOM   742  C CA    . GLU C 3 36  ? 0.800   84.589  -17.502 1.00 138.50 ? 36  GLU A CA    1 
ATOM   743  C C     . GLU C 3 36  ? 2.103   85.406  -17.405 1.00 138.29 ? 36  GLU A C     1 
ATOM   744  O O     . GLU C 3 36  ? 2.983   85.089  -16.595 1.00 138.30 ? 36  GLU A O     1 
ATOM   745  C CB    . GLU C 3 36  ? 0.960   83.445  -18.529 1.00 137.39 ? 36  GLU A CB    1 
ATOM   746  N N     . LYS C 3 37  ? 2.210   86.446  -18.239 1.00 137.01 ? 37  LYS A N     1 
ATOM   747  C CA    . LYS C 3 37  ? 3.379   87.326  -18.281 1.00 136.04 ? 37  LYS A CA    1 
ATOM   748  C C     . LYS C 3 37  ? 3.318   88.413  -17.203 1.00 136.21 ? 37  LYS A C     1 
ATOM   749  O O     . LYS C 3 37  ? 4.351   88.783  -16.629 1.00 137.05 ? 37  LYS A O     1 
ATOM   750  C CB    . LYS C 3 37  ? 3.494   87.983  -19.668 1.00 135.57 ? 37  LYS A CB    1 
ATOM   751  N N     . VAL C 3 38  ? 2.111   88.930  -16.960 1.00 135.64 ? 38  VAL A N     1 
ATOM   752  C CA    . VAL C 3 38  ? 1.872   89.973  -15.961 1.00 134.78 ? 38  VAL A CA    1 
ATOM   753  C C     . VAL C 3 38  ? 2.091   89.434  -14.543 1.00 134.66 ? 38  VAL A C     1 
ATOM   754  O O     . VAL C 3 38  ? 2.698   90.111  -13.705 1.00 132.56 ? 38  VAL A O     1 
ATOM   755  C CB    . VAL C 3 38  ? 0.427   90.520  -16.057 1.00 133.86 ? 38  VAL A CB    1 
ATOM   756  N N     . GLU C 3 39  ? 1.583   88.224  -14.284 1.00 133.86 ? 39  GLU A N     1 
ATOM   757  C CA    . GLU C 3 39  ? 1.712   87.562  -12.978 1.00 133.94 ? 39  GLU A CA    1 
ATOM   758  C C     . GLU C 3 39  ? 3.183   87.281  -12.658 1.00 133.41 ? 39  GLU A C     1 
ATOM   759  O O     . GLU C 3 39  ? 3.602   87.325  -11.497 1.00 133.48 ? 39  GLU A O     1 
ATOM   760  C CB    . GLU C 3 39  ? 0.924   86.242  -12.973 1.00 133.06 ? 39  GLU A CB    1 
ATOM   761  N N     . ALA C 3 40  ? 3.949   86.985  -13.707 1.00 133.40 ? 40  ALA A N     1 
ATOM   762  C CA    . ALA C 3 40  ? 5.379   86.699  -13.600 1.00 132.56 ? 40  ALA A CA    1 
ATOM   763  C C     . ALA C 3 40  ? 6.155   87.993  -13.331 1.00 131.99 ? 40  ALA A C     1 
ATOM   764  O O     . ALA C 3 40  ? 7.211   87.981  -12.684 1.00 132.22 ? 40  ALA A O     1 
ATOM   765  C CB    . ALA C 3 40  ? 5.875   86.047  -14.899 1.00 132.81 ? 40  ALA A CB    1 
ATOM   766  N N     . ALA C 3 41  ? 5.612   89.102  -13.839 1.00 131.98 ? 41  ALA A N     1 
ATOM   767  C CA    . ALA C 3 41  ? 6.198   90.439  -13.692 1.00 131.76 ? 41  ALA A CA    1 
ATOM   768  C C     . ALA C 3 41  ? 6.062   90.980  -12.261 1.00 131.67 ? 41  ALA A C     1 
ATOM   769  O O     . ALA C 3 41  ? 6.987   91.603  -11.724 1.00 130.57 ? 41  ALA A O     1 
ATOM   770  C CB    . ALA C 3 41  ? 5.527   91.410  -14.690 1.00 131.06 ? 41  ALA A CB    1 
ATOM   771  N N     . MET C 3 42  ? 4.897   90.740  -11.659 1.00 131.80 ? 42  MET A N     1 
ATOM   772  C CA    . MET C 3 42  ? 4.613   91.190  -10.299 1.00 132.27 ? 42  MET A CA    1 
ATOM   773  C C     . MET C 3 42  ? 5.237   90.240  -9.279  1.00 133.12 ? 42  MET A C     1 
ATOM   774  O O     . MET C 3 42  ? 5.492   90.616  -8.133  1.00 133.15 ? 42  MET A O     1 
ATOM   775  C CB    . MET C 3 42  ? 3.100   91.276  -10.076 1.00 131.94 ? 42  MET A CB    1 
ATOM   776  N N     . ALA C 3 43  ? 5.485   89.001  -9.707  1.00 133.84 ? 43  ALA A N     1 
ATOM   777  C CA    . ALA C 3 43  ? 6.098   87.978  -8.841  1.00 134.10 ? 43  ALA A CA    1 
ATOM   778  C C     . ALA C 3 43  ? 7.588   88.274  -8.607  1.00 134.42 ? 43  ALA A C     1 
ATOM   779  O O     . ALA C 3 43  ? 8.086   88.145  -7.482  1.00 133.75 ? 43  ALA A O     1 
ATOM   780  C CB    . ALA C 3 43  ? 5.924   86.584  -9.453  1.00 133.56 ? 43  ALA A CB    1 
ATOM   781  N N     . GLU C 3 44  ? 8.291   88.635  -9.687  1.00 135.01 ? 44  GLU A N     1 
ATOM   782  C CA    . GLU C 3 44  ? 9.710   88.994  -9.655  1.00 135.57 ? 44  GLU A CA    1 
ATOM   783  C C     . GLU C 3 44  ? 9.908   90.317  -8.963  1.00 136.14 ? 44  GLU A C     1 
ATOM   784  O O     . GLU C 3 44  ? 11.002  90.623  -8.482  1.00 136.50 ? 44  GLU A O     1 
ATOM   785  C CB    . GLU C 3 44  ? 10.278  89.004  -11.100 1.00 134.81 ? 44  GLU A CB    1 
ATOM   786  N N     . LEU C 3 45  ? 8.869   91.141  -8.978  1.00 136.40 ? 45  LEU A N     1 
ATOM   787  C CA    . LEU C 3 45  ? 9.005   92.422  -8.311  1.00 136.46 ? 45  LEU A CA    1 
ATOM   788  C C     . LEU C 3 45  ? 8.660   92.439  -6.816  1.00 136.81 ? 45  LEU A C     1 
ATOM   789  O O     . LEU C 3 45  ? 9.543   92.788  -5.934  1.00 136.73 ? 45  LEU A O     1 
ATOM   790  C CB    . LEU C 3 45  ? 8.307   93.535  -9.149  1.00 135.80 ? 45  LEU A CB    1 
ATOM   791  N N     . ASN C 3 46  ? 7.408   92.108  -6.488  1.00 136.89 ? 46  ASN A N     1 
ATOM   792  C CA    . ASN C 3 46  ? 7.127   92.153  -5.058  1.00 136.56 ? 46  ASN A CA    1 
ATOM   793  C C     . ASN C 3 46  ? 6.089   93.211  -4.801  1.00 135.97 ? 46  ASN A C     1 
ATOM   794  O O     . ASN C 3 46  ? 6.271   94.284  -4.145  1.00 135.67 ? 46  ASN A O     1 
ATOM   795  C CB    . ASN C 3 46  ? 8.325   92.537  -4.219  1.00 136.66 ? 46  ASN A CB    1 
ATOM   796  N N     . TYR C 3 47  ? 4.970   92.897  -5.398  1.00 135.13 ? 47  TYR A N     1 
ATOM   797  C CA    . TYR C 3 47  ? 3.826   93.743  -5.306  1.00 133.87 ? 47  TYR A CA    1 
ATOM   798  C C     . TYR C 3 47  ? 2.883   93.385  -4.125  1.00 132.68 ? 47  TYR A C     1 
ATOM   799  O O     . TYR C 3 47  ? 2.333   92.275  -3.985  1.00 132.78 ? 47  TYR A O     1 
ATOM   800  C CB    . TYR C 3 47  ? 3.097   93.704  -6.651  1.00 133.94 ? 47  TYR A CB    1 
ATOM   801  N N     . ILE C 3 48  ? 2.701   94.380  -3.275  1.00 130.63 ? 48  ILE A N     1 
ATOM   802  C CA    . ILE C 3 48  ? 1.818   94.257  -2.135  1.00 127.81 ? 48  ILE A CA    1 
ATOM   803  C C     . ILE C 3 48  ? 0.827   95.432  -2.202  1.00 126.07 ? 48  ILE A C     1 
ATOM   804  O O     . ILE C 3 48  ? 1.164   96.571  -1.840  1.00 125.48 ? 48  ILE A O     1 
ATOM   805  C CB    . ILE C 3 48  ? 2.587   94.322  -0.808  1.00 127.60 ? 48  ILE A CB    1 
ATOM   806  N N     . PRO C 3 49  ? -0.397  95.174  -2.705  1.00 123.91 ? 49  PRO A N     1 
ATOM   807  C CA    . PRO C 3 49  ? -1.472  96.164  -2.848  1.00 121.80 ? 49  PRO A CA    1 
ATOM   808  C C     . PRO C 3 49  ? -1.625  97.114  -1.656  1.00 120.34 ? 49  PRO A C     1 
ATOM   809  O O     . PRO C 3 49  ? -1.950  96.674  -0.552  1.00 120.68 ? 49  PRO A O     1 
ATOM   810  C CB    . PRO C 3 49  ? -2.717  95.301  -3.071  1.00 121.66 ? 49  PRO A CB    1 
ATOM   811  N N     . ASN C 3 50  ? -1.395  98.411  -1.883  1.00 118.02 ? 50  ASN A N     1 
ATOM   812  C CA    . ASN C 3 50  ? -1.532  99.410  -0.813  1.00 115.80 ? 50  ASN A CA    1 
ATOM   813  C C     . ASN C 3 50  ? -2.991  99.525  -0.348  1.00 114.52 ? 50  ASN A C     1 
ATOM   814  O O     . ASN C 3 50  ? -3.749  100.370 -0.838  1.00 114.41 ? 50  ASN A O     1 
ATOM   815  C CB    . ASN C 3 50  ? -1.039  100.782 -1.283  1.00 114.90 ? 50  ASN A CB    1 
ATOM   816  N N     . ARG C 3 51  ? -3.368  98.662  0.598   1.00 112.93 ? 51  ARG A N     1 
ATOM   817  C CA    . ARG C 3 51  ? -4.717  98.613  1.163   1.00 110.74 ? 51  ARG A CA    1 
ATOM   818  C C     . ARG C 3 51  ? -5.240  99.991  1.562   1.00 109.56 ? 51  ARG A C     1 
ATOM   819  O O     . ARG C 3 51  ? -6.449  100.199 1.620   1.00 109.08 ? 51  ARG A O     1 
ATOM   820  C CB    . ARG C 3 51  ? -4.738  97.682  2.381   1.00 110.33 ? 51  ARG A CB    1 
ATOM   821  N N     . VAL C 3 52  ? -4.329  100.924 1.840   1.00 108.65 ? 52  VAL A N     1 
ATOM   822  C CA    . VAL C 3 52  ? -4.699  102.291 2.219   1.00 107.97 ? 52  VAL A CA    1 
ATOM   823  C C     . VAL C 3 52  ? -5.452  102.940 1.058   1.00 107.52 ? 52  VAL A C     1 
ATOM   824  O O     . VAL C 3 52  ? -6.435  103.668 1.255   1.00 107.49 ? 52  VAL A O     1 
ATOM   825  C CB    . VAL C 3 52  ? -3.452  103.161 2.527   1.00 107.39 ? 52  VAL A CB    1 
ATOM   826  N N     . ALA C 3 53  ? -4.975  102.662 -0.151  1.00 106.84 ? 53  ALA A N     1 
ATOM   827  C CA    . ALA C 3 53  ? -5.571  103.188 -1.369  1.00 106.28 ? 53  ALA A CA    1 
ATOM   828  C C     . ALA C 3 53  ? -6.788  102.367 -1.803  1.00 106.25 ? 53  ALA A C     1 
ATOM   829  O O     . ALA C 3 53  ? -7.755  102.914 -2.335  1.00 106.33 ? 53  ALA A O     1 
ATOM   830  C CB    . ALA C 3 53  ? -4.536  103.201 -2.474  1.00 106.22 ? 53  ALA A CB    1 
ATOM   831  N N     . GLN C 3 54  ? -6.735  101.055 -1.581  1.00 106.21 ? 54  GLN A N     1 
ATOM   832  C CA    . GLN C 3 54  ? -7.838  100.167 -1.948  1.00 106.55 ? 54  GLN A CA    1 
ATOM   833  C C     . GLN C 3 54  ? -9.138  100.581 -1.241  1.00 107.02 ? 54  GLN A C     1 
ATOM   834  O O     . GLN C 3 54  ? -10.215 100.610 -1.848  1.00 106.34 ? 54  GLN A O     1 
ATOM   835  C CB    . GLN C 3 54  ? -7.481  98.715  -1.591  1.00 105.89 ? 54  GLN A CB    1 
ATOM   836  N N     . GLN C 3 55  ? -9.015  100.909 0.043   1.00 108.41 ? 55  GLN A N     1 
ATOM   837  C CA    . GLN C 3 55  ? -10.144 101.325 0.872   1.00 109.52 ? 55  GLN A CA    1 
ATOM   838  C C     . GLN C 3 55  ? -10.715 102.660 0.398   1.00 110.26 ? 55  GLN A C     1 
ATOM   839  O O     . GLN C 3 55  ? -11.927 102.777 0.164   1.00 110.46 ? 55  GLN A O     1 
ATOM   840  C CB    . GLN C 3 55  ? -9.705  101.450 2.341   1.00 109.46 ? 55  GLN A CB    1 
ATOM   841  N N     . LEU C 3 56  ? -9.836  103.657 0.268   1.00 110.79 ? 56  LEU A N     1 
ATOM   842  C CA    . LEU C 3 56  ? -10.226 105.000 -0.173  1.00 111.48 ? 56  LEU A CA    1 
ATOM   843  C C     . LEU C 3 56  ? -10.862 104.965 -1.559  1.00 112.21 ? 56  LEU A C     1 
ATOM   844  O O     . LEU C 3 56  ? -11.768 105.755 -1.854  1.00 112.37 ? 56  LEU A O     1 
ATOM   845  C CB    . LEU C 3 56  ? -9.008  105.931 -0.197  1.00 110.70 ? 56  LEU A CB    1 
ATOM   846  N N     . ALA C 3 57  ? -10.376 104.047 -2.398  1.00 113.02 ? 57  ALA A N     1 
ATOM   847  C CA    . ALA C 3 57  ? -10.876 103.873 -3.763  1.00 113.59 ? 57  ALA A CA    1 
ATOM   848  C C     . ALA C 3 57  ? -12.276 103.242 -3.788  1.00 114.23 ? 57  ALA A C     1 
ATOM   849  O O     . ALA C 3 57  ? -12.925 103.189 -4.839  1.00 113.76 ? 57  ALA A O     1 
ATOM   850  C CB    . ALA C 3 57  ? -9.899  103.017 -4.574  1.00 113.34 ? 57  ALA A CB    1 
ATOM   851  N N     . GLY C 3 58  ? -12.733 102.757 -2.635  1.00 115.28 ? 58  GLY A N     1 
ATOM   852  C CA    . GLY C 3 58  ? -14.062 102.172 -2.562  1.00 116.63 ? 58  GLY A CA    1 
ATOM   853  C C     . GLY C 3 58  ? -14.177 100.669 -2.342  1.00 116.92 ? 58  GLY A C     1 
ATOM   854  O O     . GLY C 3 58  ? -15.295 100.131 -2.327  1.00 117.40 ? 58  GLY A O     1 
ATOM   855  N N     . LYS C 3 59  ? -13.044 99.984  -2.183  1.00 116.43 ? 59  LYS A N     1 
ATOM   856  C CA    . LYS C 3 59  ? -13.059 98.537  -1.952  1.00 115.69 ? 59  LYS A CA    1 
ATOM   857  C C     . LYS C 3 59  ? -13.767 98.204  -0.628  1.00 115.08 ? 59  LYS A C     1 
ATOM   858  O O     . LYS C 3 59  ? -13.261 98.503  0.472   1.00 115.12 ? 59  LYS A O     1 
ATOM   859  C CB    . LYS C 3 59  ? -11.630 97.982  -1.946  1.00 115.73 ? 59  LYS A CB    1 
ATOM   860  N N     . GLN C 3 60  ? -14.949 97.597  -0.748  1.00 113.20 ? 60  GLN A N     1 
ATOM   861  C CA    . GLN C 3 60  ? -15.763 97.226  0.413   1.00 110.43 ? 60  GLN A CA    1 
ATOM   862  C C     . GLN C 3 60  ? -15.127 96.076  1.208   1.00 107.98 ? 60  GLN A C     1 
ATOM   863  O O     . GLN C 3 60  ? -15.274 94.898  0.862   1.00 108.72 ? 60  GLN A O     1 
ATOM   864  C CB    . GLN C 3 60  ? -17.173 96.828  -0.047  1.00 110.83 ? 60  GLN A CB    1 
ATOM   865  N N     . SER C 3 61  ? -14.414 96.421  2.271   1.00 104.46 ? 61  SER A N     1 
ATOM   866  C CA    . SER C 3 61  ? -13.780 95.405  3.090   1.00 100.30 ? 61  SER A CA    1 
ATOM   867  C C     . SER C 3 61  ? -14.404 95.474  4.490   1.00 97.47  ? 61  SER A C     1 
ATOM   868  O O     . SER C 3 61  ? -14.292 96.470  5.205   1.00 97.20  ? 61  SER A O     1 
ATOM   869  C CB    . SER C 3 61  ? -12.275 95.637  3.163   1.00 100.61 ? 61  SER A CB    1 
ATOM   870  N N     . LEU C 3 62  ? -15.153 94.421  4.823   1.00 92.66  ? 62  LEU A N     1 
ATOM   871  C CA    . LEU C 3 62  ? -15.824 94.263  6.121   1.00 86.44  ? 62  LEU A CA    1 
ATOM   872  C C     . LEU C 3 62  ? -14.739 94.376  7.175   1.00 81.48  ? 62  LEU A C     1 
ATOM   873  O O     . LEU C 3 62  ? -14.263 93.398  7.750   1.00 81.05  ? 62  LEU A O     1 
ATOM   874  C CB    . LEU C 3 62  ? -16.581 92.903  6.208   1.00 87.68  ? 62  LEU A CB    1 
ATOM   875  C CG    . LEU C 3 62  ? -15.910 91.603  5.733   1.00 87.69  ? 62  LEU A CG    1 
ATOM   876  C CD1   . LEU C 3 62  ? -16.986 90.526  5.600   1.00 88.37  ? 62  LEU A CD1   1 
ATOM   877  C CD2   . LEU C 3 62  ? -15.240 91.807  4.391   1.00 88.13  ? 62  LEU A CD2   1 
ATOM   878  N N     . LEU C 3 63  ? -14.343 95.619  7.398   1.00 74.90  ? 63  LEU A N     1 
ATOM   879  C CA    . LEU C 3 63  ? -13.332 95.920  8.389   1.00 68.67  ? 63  LEU A CA    1 
ATOM   880  C C     . LEU C 3 63  ? -13.986 96.151  9.764   1.00 65.27  ? 63  LEU A C     1 
ATOM   881  O O     . LEU C 3 63  ? -14.629 97.182  10.013  1.00 64.65  ? 63  LEU A O     1 
ATOM   882  C CB    . LEU C 3 63  ? -12.515 97.142  7.943   1.00 67.45  ? 63  LEU A CB    1 
ATOM   883  C CG    . LEU C 3 63  ? -11.308 97.656  8.748   1.00 66.83  ? 63  LEU A CG    1 
ATOM   884  C CD1   . LEU C 3 63  ? -11.697 98.933  9.477   1.00 66.16  ? 63  LEU A CD1   1 
ATOM   885  C CD2   . LEU C 3 63  ? -10.803 96.590  9.725   1.00 66.82  ? 63  LEU A CD2   1 
ATOM   886  N N     . ILE C 3 64  ? -13.818 95.158  10.637  1.00 60.53  ? 64  ILE A N     1 
ATOM   887  C CA    . ILE C 3 64  ? -14.366 95.159  11.989  1.00 56.37  ? 64  ILE A CA    1 
ATOM   888  C C     . ILE C 3 64  ? -13.510 95.907  13.008  1.00 55.06  ? 64  ILE A C     1 
ATOM   889  O O     . ILE C 3 64  ? -12.339 95.575  13.200  1.00 54.96  ? 64  ILE A O     1 
ATOM   890  C CB    . ILE C 3 64  ? -14.502 93.730  12.513  1.00 54.98  ? 64  ILE A CB    1 
ATOM   891  C CG1   . ILE C 3 64  ? -15.356 92.897  11.565  1.00 53.75  ? 64  ILE A CG1   1 
ATOM   892  C CG2   . ILE C 3 64  ? -15.087 93.751  13.911  1.00 54.52  ? 64  ILE A CG2   1 
ATOM   893  C CD1   . ILE C 3 64  ? -15.546 91.460  12.024  1.00 52.61  ? 64  ILE A CD1   1 
ATOM   894  N N     . GLY C 3 65  ? -14.104 96.897  13.672  1.00 53.63  ? 65  GLY A N     1 
ATOM   895  C CA    . GLY C 3 65  ? -13.396 97.656  14.694  1.00 51.57  ? 65  GLY A CA    1 
ATOM   896  C C     . GLY C 3 65  ? -13.719 97.095  16.076  1.00 50.31  ? 65  GLY A C     1 
ATOM   897  O O     . GLY C 3 65  ? -14.845 96.654  16.324  1.00 51.21  ? 65  GLY A O     1 
ATOM   898  N N     . VAL C 3 66  ? -12.751 97.106  16.988  1.00 48.06  ? 66  VAL A N     1 
ATOM   899  C CA    . VAL C 3 66  ? -12.987 96.566  18.322  1.00 45.31  ? 66  VAL A CA    1 
ATOM   900  C C     . VAL C 3 66  ? -12.425 97.400  19.454  1.00 44.56  ? 66  VAL A C     1 
ATOM   901  O O     . VAL C 3 66  ? -11.215 97.614  19.548  1.00 43.94  ? 66  VAL A O     1 
ATOM   902  C CB    . VAL C 3 66  ? -12.386 95.156  18.472  1.00 44.70  ? 66  VAL A CB    1 
ATOM   903  C CG1   . VAL C 3 66  ? -12.499 94.697  19.913  1.00 43.65  ? 66  VAL A CG1   1 
ATOM   904  C CG2   . VAL C 3 66  ? -13.089 94.182  17.547  1.00 42.89  ? 66  VAL A CG2   1 
ATOM   905  N N     . ALA C 3 67  ? -13.316 97.868  20.317  1.00 43.84  ? 67  ALA A N     1 
ATOM   906  C CA    . ALA C 3 67  ? -12.901 98.634  21.482  1.00 43.18  ? 67  ALA A CA    1 
ATOM   907  C C     . ALA C 3 67  ? -12.957 97.586  22.585  1.00 42.32  ? 67  ALA A C     1 
ATOM   908  O O     . ALA C 3 67  ? -13.984 96.919  22.758  1.00 42.39  ? 67  ALA A O     1 
ATOM   909  C CB    . ALA C 3 67  ? -13.884 99.766  21.766  1.00 43.72  ? 67  ALA A CB    1 
ATOM   910  N N     . THR C 3 68  ? -11.862 97.416  23.317  1.00 40.57  ? 68  THR A N     1 
ATOM   911  C CA    . THR C 3 68  ? -11.846 96.417  24.368  1.00 38.35  ? 68  THR A CA    1 
ATOM   912  C C     . THR C 3 68  ? -11.065 96.908  25.565  1.00 38.70  ? 68  THR A C     1 
ATOM   913  O O     . THR C 3 68  ? -10.268 97.843  25.457  1.00 37.31  ? 68  THR A O     1 
ATOM   914  C CB    . THR C 3 68  ? -11.228 95.120  23.855  1.00 36.95  ? 68  THR A CB    1 
ATOM   915  O OG1   . THR C 3 68  ? -11.151 94.159  24.911  1.00 33.86  ? 68  THR A OG1   1 
ATOM   916  C CG2   . THR C 3 68  ? -9.857  95.396  23.325  1.00 36.56  ? 68  THR A CG2   1 
ATOM   917  N N     . SER C 3 69  ? -11.330 96.277  26.708  1.00 39.54  ? 69  SER A N     1 
ATOM   918  C CA    . SER C 3 69  ? -10.671 96.598  27.978  1.00 40.31  ? 69  SER A CA    1 
ATOM   919  C C     . SER C 3 69  ? -9.250  96.097  27.807  1.00 39.74  ? 69  SER A C     1 
ATOM   920  O O     . SER C 3 69  ? -8.992  95.334  26.871  1.00 39.76  ? 69  SER A O     1 
ATOM   921  C CB    . SER C 3 69  ? -11.350 95.852  29.130  1.00 40.82  ? 69  SER A CB    1 
ATOM   922  O OG    . SER C 3 69  ? -12.764 95.926  29.019  1.00 42.65  ? 69  SER A OG    1 
ATOM   923  N N     . SER C 3 70  ? -8.336  96.487  28.696  1.00 38.92  ? 70  SER A N     1 
ATOM   924  C CA    . SER C 3 70  ? -6.950  96.062  28.535  1.00 38.43  ? 70  SER A CA    1 
ATOM   925  C C     . SER C 3 70  ? -6.803  94.589  28.200  1.00 37.39  ? 70  SER A C     1 
ATOM   926  O O     . SER C 3 70  ? -7.487  93.736  28.770  1.00 37.05  ? 70  SER A O     1 
ATOM   927  C CB    . SER C 3 70  ? -6.114  96.369  29.766  1.00 38.85  ? 70  SER A CB    1 
ATOM   928  O OG    . SER C 3 70  ? -4.785  95.948  29.524  1.00 39.60  ? 70  SER A OG    1 
ATOM   929  N N     . LEU C 3 71  ? -5.900  94.310  27.261  1.00 36.35  ? 71  LEU A N     1 
ATOM   930  C CA    . LEU C 3 71  ? -5.637  92.953  26.806  1.00 35.57  ? 71  LEU A CA    1 
ATOM   931  C C     . LEU C 3 71  ? -4.864  92.198  27.876  1.00 35.25  ? 71  LEU A C     1 
ATOM   932  O O     . LEU C 3 71  ? -4.733  90.979  27.813  1.00 36.08  ? 71  LEU A O     1 
ATOM   933  C CB    . LEU C 3 71  ? -4.861  92.982  25.479  1.00 34.67  ? 71  LEU A CB    1 
ATOM   934  C CG    . LEU C 3 71  ? -5.679  93.370  24.242  1.00 33.42  ? 71  LEU A CG    1 
ATOM   935  C CD1   . LEU C 3 71  ? -4.780  93.721  23.069  1.00 33.04  ? 71  LEU A CD1   1 
ATOM   936  C CD2   . LEU C 3 71  ? -6.600  92.221  23.894  1.00 31.67  ? 71  LEU A CD2   1 
ATOM   937  N N     . ALA C 3 72  ? -4.374  92.934  28.868  1.00 34.45  ? 72  ALA A N     1 
ATOM   938  C CA    . ALA C 3 72  ? -3.623  92.357  29.977  1.00 34.49  ? 72  ALA A CA    1 
ATOM   939  C C     . ALA C 3 72  ? -4.511  91.477  30.831  1.00 34.63  ? 72  ALA A C     1 
ATOM   940  O O     . ALA C 3 72  ? -4.040  90.729  31.679  1.00 33.69  ? 72  ALA A O     1 
ATOM   941  C CB    . ALA C 3 72  ? -3.066  93.451  30.822  1.00 34.89  ? 72  ALA A CB    1 
ATOM   942  N N     . LEU C 3 73  ? -5.809  91.593  30.605  1.00 36.06  ? 73  LEU A N     1 
ATOM   943  C CA    . LEU C 3 73  ? -6.803  90.832  31.348  1.00 36.98  ? 73  LEU A CA    1 
ATOM   944  C C     . LEU C 3 73  ? -7.147  89.568  30.587  1.00 36.93  ? 73  LEU A C     1 
ATOM   945  O O     . LEU C 3 73  ? -7.284  89.586  29.360  1.00 36.39  ? 73  LEU A O     1 
ATOM   946  C CB    . LEU C 3 73  ? -8.056  91.690  31.554  1.00 37.90  ? 73  LEU A CB    1 
ATOM   947  C CG    . LEU C 3 73  ? -7.839  92.976  32.362  1.00 38.22  ? 73  LEU A CG    1 
ATOM   948  C CD1   . LEU C 3 73  ? -8.949  93.956  32.090  1.00 38.37  ? 73  LEU A CD1   1 
ATOM   949  C CD2   . LEU C 3 73  ? -7.767  92.640  33.835  1.00 38.44  ? 73  LEU A CD2   1 
ATOM   950  N N     . HIS C 3 74  ? -7.300  88.475  31.324  1.00 37.41  ? 74  HIS A N     1 
ATOM   951  C CA    . HIS C 3 74  ? -7.598  87.187  30.718  1.00 38.30  ? 74  HIS A CA    1 
ATOM   952  C C     . HIS C 3 74  ? -8.685  87.170  29.651  1.00 38.19  ? 74  HIS A C     1 
ATOM   953  O O     . HIS C 3 74  ? -8.400  87.075  28.460  1.00 38.96  ? 74  HIS A O     1 
ATOM   954  C CB    . HIS C 3 74  ? -7.965  86.165  31.783  1.00 39.01  ? 74  HIS A CB    1 
ATOM   955  C CG    . HIS C 3 74  ? -7.993  84.767  31.260  1.00 39.69  ? 74  HIS A CG    1 
ATOM   956  N ND1   . HIS C 3 74  ? -6.860  84.125  30.811  1.00 40.27  ? 74  HIS A ND1   1 
ATOM   957  C CD2   . HIS C 3 74  ? -9.018  83.906  31.058  1.00 40.79  ? 74  HIS A CD2   1 
ATOM   958  C CE1   . HIS C 3 74  ? -7.186  82.928  30.355  1.00 41.09  ? 74  HIS A CE1   1 
ATOM   959  N NE2   . HIS C 3 74  ? -8.490  82.770  30.492  1.00 41.01  ? 74  HIS A NE2   1 
ATOM   960  N N     . ALA C 3 75  ? -9.935  87.244  30.080  1.00 37.27  ? 75  ALA A N     1 
ATOM   961  C CA    . ALA C 3 75  ? -11.046 87.205  29.146  1.00 36.66  ? 75  ALA A CA    1 
ATOM   962  C C     . ALA C 3 75  ? -10.957 88.151  27.953  1.00 36.26  ? 75  ALA A C     1 
ATOM   963  O O     . ALA C 3 75  ? -11.230 87.754  26.823  1.00 35.74  ? 75  ALA A O     1 
ATOM   964  C CB    . ALA C 3 75  ? -12.326 87.447  29.888  1.00 37.96  ? 75  ALA A CB    1 
ATOM   965  N N     . PRO C 3 76  ? -10.594 89.419  28.183  1.00 36.45  ? 76  PRO A N     1 
ATOM   966  C CA    . PRO C 3 76  ? -10.524 90.291  27.013  1.00 36.80  ? 76  PRO A CA    1 
ATOM   967  C C     . PRO C 3 76  ? -9.673  89.664  25.925  1.00 37.68  ? 76  PRO A C     1 
ATOM   968  O O     . PRO C 3 76  ? -10.149 89.479  24.797  1.00 37.43  ? 76  PRO A O     1 
ATOM   969  C CB    . PRO C 3 76  ? -9.912  91.573  27.570  1.00 37.16  ? 76  PRO A CB    1 
ATOM   970  C CG    . PRO C 3 76  ? -10.432 91.600  28.961  1.00 36.83  ? 76  PRO A CG    1 
ATOM   971  C CD    . PRO C 3 76  ? -10.254 90.159  29.406  1.00 36.35  ? 76  PRO A CD    1 
ATOM   972  N N     . SER C 3 77  ? -8.429  89.320  26.276  1.00 37.70  ? 77  SER A N     1 
ATOM   973  C CA    . SER C 3 77  ? -7.486  88.722  25.325  1.00 37.89  ? 77  SER A CA    1 
ATOM   974  C C     . SER C 3 77  ? -8.075  87.499  24.616  1.00 37.05  ? 77  SER A C     1 
ATOM   975  O O     . SER C 3 77  ? -8.110  87.440  23.389  1.00 37.14  ? 77  SER A O     1 
ATOM   976  C CB    . SER C 3 77  ? -6.172  88.345  26.026  1.00 37.88  ? 77  SER A CB    1 
ATOM   977  O OG    . SER C 3 77  ? -6.302  87.164  26.797  1.00 39.65  ? 77  SER A OG    1 
ATOM   978  N N     . GLN C 3 78  ? -8.541  86.528  25.387  1.00 36.41  ? 78  GLN A N     1 
ATOM   979  C CA    . GLN C 3 78  ? -9.138  85.337  24.808  1.00 36.08  ? 78  GLN A CA    1 
ATOM   980  C C     . GLN C 3 78  ? -10.134 85.728  23.740  1.00 35.73  ? 78  GLN A C     1 
ATOM   981  O O     . GLN C 3 78  ? -10.158 85.147  22.657  1.00 35.62  ? 78  GLN A O     1 
ATOM   982  C CB    . GLN C 3 78  ? -9.871  84.545  25.880  1.00 36.79  ? 78  GLN A CB    1 
ATOM   983  C CG    . GLN C 3 78  ? -8.979  84.089  26.980  1.00 36.65  ? 78  GLN A CG    1 
ATOM   984  C CD    . GLN C 3 78  ? -7.841  83.303  26.435  1.00 36.86  ? 78  GLN A CD    1 
ATOM   985  O OE1   . GLN C 3 78  ? -8.030  82.210  25.915  1.00 36.71  ? 78  GLN A OE1   1 
ATOM   986  N NE2   . GLN C 3 78  ? -6.643  83.861  26.525  1.00 37.19  ? 78  GLN A NE2   1 
ATOM   987  N N     . ILE C 3 79  ? -10.965 86.712  24.063  1.00 35.95  ? 79  ILE A N     1 
ATOM   988  C CA    . ILE C 3 79  ? -11.988 87.182  23.140  1.00 36.49  ? 79  ILE A CA    1 
ATOM   989  C C     . ILE C 3 79  ? -11.423 87.849  21.901  1.00 35.31  ? 79  ILE A C     1 
ATOM   990  O O     . ILE C 3 79  ? -11.817 87.497  20.796  1.00 35.06  ? 79  ILE A O     1 
ATOM   991  C CB    . ILE C 3 79  ? -12.966 88.149  23.829  1.00 36.98  ? 79  ILE A CB    1 
ATOM   992  C CG1   . ILE C 3 79  ? -13.822 87.374  24.841  1.00 36.44  ? 79  ILE A CG1   1 
ATOM   993  C CG2   . ILE C 3 79  ? -13.861 88.816  22.791  1.00 37.03  ? 79  ILE A CG2   1 
ATOM   994  C CD1   . ILE C 3 79  ? -14.571 88.271  25.784  1.00 35.42  ? 79  ILE A CD1   1 
ATOM   995  N N     . VAL C 3 80  ? -10.523 88.814  22.064  1.00 35.20  ? 80  VAL A N     1 
ATOM   996  C CA    . VAL C 3 80  ? -9.938  89.456  20.887  1.00 36.26  ? 80  VAL A CA    1 
ATOM   997  C C     . VAL C 3 80  ? -9.382  88.354  20.006  1.00 36.10  ? 80  VAL A C     1 
ATOM   998  O O     . VAL C 3 80  ? -9.542  88.364  18.788  1.00 35.39  ? 80  VAL A O     1 
ATOM   999  C CB    . VAL C 3 80  ? -8.797  90.432  21.255  1.00 35.58  ? 80  VAL A CB    1 
ATOM   1000 C CG1   . VAL C 3 80  ? -7.927  90.726  20.034  1.00 34.63  ? 80  VAL A CG1   1 
ATOM   1001 C CG2   . VAL C 3 80  ? -9.395  91.723  21.773  1.00 36.14  ? 80  VAL A CG2   1 
ATOM   1002 N N     . ALA C 3 81  ? -8.739  87.391  20.649  1.00 37.68  ? 81  ALA A N     1 
ATOM   1003 C CA    . ALA C 3 81  ? -8.165  86.255  19.955  1.00 39.71  ? 81  ALA A CA    1 
ATOM   1004 C C     . ALA C 3 81  ? -9.207  85.589  19.056  1.00 40.52  ? 81  ALA A C     1 
ATOM   1005 O O     . ALA C 3 81  ? -9.091  85.602  17.832  1.00 39.96  ? 81  ALA A O     1 
ATOM   1006 C CB    . ALA C 3 81  ? -7.638  85.256  20.973  1.00 40.45  ? 81  ALA A CB    1 
ATOM   1007 N N     . ALA C 3 82  ? -10.226 85.004  19.673  1.00 41.90  ? 82  ALA A N     1 
ATOM   1008 C CA    . ALA C 3 82  ? -11.274 84.338  18.922  1.00 43.91  ? 82  ALA A CA    1 
ATOM   1009 C C     . ALA C 3 82  ? -11.880 85.257  17.853  1.00 45.69  ? 82  ALA A C     1 
ATOM   1010 O O     . ALA C 3 82  ? -12.277 84.796  16.784  1.00 45.12  ? 82  ALA A O     1 
ATOM   1011 C CB    . ALA C 3 82  ? -12.354 83.829  19.880  1.00 43.36  ? 82  ALA A CB    1 
ATOM   1012 N N     . ILE C 3 83  ? -11.952 86.555  18.133  1.00 48.66  ? 83  ILE A N     1 
ATOM   1013 C CA    . ILE C 3 83  ? -12.507 87.477  17.150  1.00 51.72  ? 83  ILE A CA    1 
ATOM   1014 C C     . ILE C 3 83  ? -11.610 87.474  15.925  1.00 53.75  ? 83  ILE A C     1 
ATOM   1015 O O     . ILE C 3 83  ? -12.047 87.026  14.865  1.00 53.94  ? 83  ILE A O     1 
ATOM   1016 C CB    . ILE C 3 83  ? -12.624 88.932  17.684  1.00 52.34  ? 83  ILE A CB    1 
ATOM   1017 C CG1   . ILE C 3 83  ? -13.754 89.022  18.718  1.00 52.56  ? 83  ILE A CG1   1 
ATOM   1018 C CG2   . ILE C 3 83  ? -12.900 89.910  16.524  1.00 51.98  ? 83  ILE A CG2   1 
ATOM   1019 C CD1   . ILE C 3 83  ? -13.920 90.423  19.313  1.00 52.64  ? 83  ILE A CD1   1 
ATOM   1020 N N     . LYS C 3 84  ? -10.367 87.957  16.064  1.00 55.79  ? 84  LYS A N     1 
ATOM   1021 C CA    . LYS C 3 84  ? -9.435  87.988  14.925  1.00 57.92  ? 84  LYS A CA    1 
ATOM   1022 C C     . LYS C 3 84  ? -9.484  86.638  14.231  1.00 58.83  ? 84  LYS A C     1 
ATOM   1023 O O     . LYS C 3 84  ? -9.672  86.568  13.017  1.00 59.51  ? 84  LYS A O     1 
ATOM   1024 C CB    . LYS C 3 84  ? -7.986  88.271  15.354  1.00 58.63  ? 84  LYS A CB    1 
ATOM   1025 C CG    . LYS C 3 84  ? -7.776  89.626  16.013  1.00 61.13  ? 84  LYS A CG    1 
ATOM   1026 C CD    . LYS C 3 84  ? -6.289  89.982  16.180  1.00 62.40  ? 84  LYS A CD    1 
ATOM   1027 C CE    . LYS C 3 84  ? -5.800  90.896  15.059  1.00 63.37  ? 84  LYS A CE    1 
ATOM   1028 N NZ    . LYS C 3 84  ? -6.451  92.245  15.080  1.00 64.06  ? 84  LYS A NZ    1 
ATOM   1029 N N     . SER C 3 85  ? -9.327  85.565  15.003  1.00 59.59  ? 85  SER A N     1 
ATOM   1030 C CA    . SER C 3 85  ? -9.379  84.223  14.435  1.00 60.28  ? 85  SER A CA    1 
ATOM   1031 C C     . SER C 3 85  ? -10.523 84.107  13.439  1.00 60.39  ? 85  SER A C     1 
ATOM   1032 O O     . SER C 3 85  ? -10.313 84.010  12.228  1.00 59.72  ? 85  SER A O     1 
ATOM   1033 C CB    . SER C 3 85  ? -9.584  83.183  15.535  1.00 60.83  ? 85  SER A CB    1 
ATOM   1034 O OG    . SER C 3 85  ? -9.894  81.918  14.964  1.00 62.05  ? 85  SER A OG    1 
ATOM   1035 N N     . ARG C 3 86  ? -11.739 84.112  13.973  1.00 60.94  ? 86  ARG A N     1 
ATOM   1036 C CA    . ARG C 3 86  ? -12.934 84.003  13.154  1.00 61.62  ? 86  ARG A CA    1 
ATOM   1037 C C     . ARG C 3 86  ? -12.966 85.037  12.026  1.00 61.53  ? 86  ARG A C     1 
ATOM   1038 O O     . ARG C 3 86  ? -13.469 84.759  10.944  1.00 61.34  ? 86  ARG A O     1 
ATOM   1039 C CB    . ARG C 3 86  ? -14.184 84.123  14.041  1.00 62.09  ? 86  ARG A CB    1 
ATOM   1040 C CG    . ARG C 3 86  ? -15.461 84.484  13.286  1.00 61.84  ? 86  ARG A CG    1 
ATOM   1041 C CD    . ARG C 3 86  ? -15.777 83.488  12.188  1.00 61.09  ? 86  ARG A CD    1 
ATOM   1042 N NE    . ARG C 3 86  ? -16.341 82.241  12.703  1.00 60.51  ? 86  ARG A NE    1 
ATOM   1043 C CZ    . ARG C 3 86  ? -17.167 81.469  11.997  1.00 60.51  ? 86  ARG A CZ    1 
ATOM   1044 N NH1   . ARG C 3 86  ? -17.509 81.830  10.757  1.00 60.78  ? 86  ARG A NH1   1 
ATOM   1045 N NH2   . ARG C 3 86  ? -17.663 80.351  12.524  1.00 58.70  ? 86  ARG A NH2   1 
ATOM   1046 N N     . ALA C 3 87  ? -12.433 86.225  12.273  1.00 61.80  ? 87  ALA A N     1 
ATOM   1047 C CA    . ALA C 3 87  ? -12.425 87.247  11.240  1.00 62.84  ? 87  ALA A CA    1 
ATOM   1048 C C     . ALA C 3 87  ? -11.617 86.765  10.039  1.00 63.77  ? 87  ALA A C     1 
ATOM   1049 O O     . ALA C 3 87  ? -12.118 86.753  8.909   1.00 63.61  ? 87  ALA A O     1 
ATOM   1050 C CB    . ALA C 3 87  ? -11.838 88.548  11.785  1.00 62.78  ? 87  ALA A CB    1 
ATOM   1051 N N     . ASP C 3 88  ? -10.367 86.368  10.288  1.00 65.12  ? 88  ASP A N     1 
ATOM   1052 C CA    . ASP C 3 88  ? -9.476  85.884  9.221   1.00 66.32  ? 88  ASP A CA    1 
ATOM   1053 C C     . ASP C 3 88  ? -10.167 84.787  8.446   1.00 66.13  ? 88  ASP A C     1 
ATOM   1054 O O     . ASP C 3 88  ? -10.114 84.740  7.219   1.00 66.22  ? 88  ASP A O     1 
ATOM   1055 C CB    . ASP C 3 88  ? -8.165  85.296  9.776   1.00 67.55  ? 88  ASP A CB    1 
ATOM   1056 C CG    . ASP C 3 88  ? -7.232  86.349  10.342  1.00 69.35  ? 88  ASP A CG    1 
ATOM   1057 O OD1   . ASP C 3 88  ? -7.088  87.420  9.711   1.00 70.36  ? 88  ASP A OD1   1 
ATOM   1058 O OD2   . ASP C 3 88  ? -6.630  86.098  11.414  1.00 70.68  ? 88  ASP A OD2   1 
ATOM   1059 N N     . GLN C 3 89  ? -10.813 83.898  9.191   1.00 65.78  ? 89  GLN A N     1 
ATOM   1060 C CA    . GLN C 3 89  ? -11.516 82.764  8.619   1.00 65.05  ? 89  GLN A CA    1 
ATOM   1061 C C     . GLN C 3 89  ? -12.641 83.182  7.684   1.00 64.86  ? 89  GLN A C     1 
ATOM   1062 O O     . GLN C 3 89  ? -13.081 82.402  6.842   1.00 64.51  ? 89  GLN A O     1 
ATOM   1063 C CB    . GLN C 3 89  ? -12.070 81.913  9.744   1.00 64.47  ? 89  GLN A CB    1 
ATOM   1064 C CG    . GLN C 3 89  ? -12.664 80.628  9.296   1.00 65.27  ? 89  GLN A CG    1 
ATOM   1065 C CD    . GLN C 3 89  ? -13.092 79.799  10.474  1.00 67.25  ? 89  GLN A CD    1 
ATOM   1066 O OE1   . GLN C 3 89  ? -13.609 78.689  10.312  1.00 68.66  ? 89  GLN A OE1   1 
ATOM   1067 N NE2   . GLN C 3 89  ? -12.880 80.331  11.683  1.00 67.30  ? 89  GLN A NE2   1 
ATOM   1068 N N     . LEU C 3 90  ? -13.108 84.416  7.839   1.00 64.84  ? 90  LEU A N     1 
ATOM   1069 C CA    . LEU C 3 90  ? -14.186 84.927  7.002   1.00 64.08  ? 90  LEU A CA    1 
ATOM   1070 C C     . LEU C 3 90  ? -13.633 85.980  6.057   1.00 63.40  ? 90  LEU A C     1 
ATOM   1071 O O     . LEU C 3 90  ? -14.386 86.679  5.388   1.00 63.51  ? 90  LEU A O     1 
ATOM   1072 C CB    . LEU C 3 90  ? -15.324 85.520  7.866   1.00 64.34  ? 90  LEU A CB    1 
ATOM   1073 C CG    . LEU C 3 90  ? -16.192 84.590  8.751   1.00 63.94  ? 90  LEU A CG    1 
ATOM   1074 C CD1   . LEU C 3 90  ? -17.247 85.406  9.508   1.00 62.89  ? 90  LEU A CD1   1 
ATOM   1075 C CD2   . LEU C 3 90  ? -16.871 83.529  7.888   1.00 62.90  ? 90  LEU A CD2   1 
ATOM   1076 N N     . GLY C 3 91  ? -12.312 86.084  6.002   1.00 62.91  ? 91  GLY A N     1 
ATOM   1077 C CA    . GLY C 3 91  ? -11.698 87.051  5.116   1.00 63.89  ? 91  GLY A CA    1 
ATOM   1078 C C     . GLY C 3 91  ? -12.015 88.473  5.523   1.00 64.74  ? 91  GLY A C     1 
ATOM   1079 O O     . GLY C 3 91  ? -11.994 89.392  4.697   1.00 65.13  ? 91  GLY A O     1 
ATOM   1080 N N     . ALA C 3 92  ? -12.317 88.656  6.804   1.00 65.17  ? 92  ALA A N     1 
ATOM   1081 C CA    . ALA C 3 92  ? -12.623 89.979  7.329   1.00 65.54  ? 92  ALA A CA    1 
ATOM   1082 C C     . ALA C 3 92  ? -11.409 90.546  8.083   1.00 65.57  ? 92  ALA A C     1 
ATOM   1083 O O     . ALA C 3 92  ? -10.694 89.823  8.790   1.00 65.14  ? 92  ALA A O     1 
ATOM   1084 C CB    . ALA C 3 92  ? -13.838 89.902  8.249   1.00 65.54  ? 92  ALA A CB    1 
ATOM   1085 N N     . SER C 3 93  ? -11.166 91.841  7.920   1.00 65.56  ? 93  SER A N     1 
ATOM   1086 C CA    . SER C 3 93  ? -10.043 92.472  8.600   1.00 65.95  ? 93  SER A CA    1 
ATOM   1087 C C     . SER C 3 93  ? -10.519 92.935  9.991   1.00 65.85  ? 93  SER A C     1 
ATOM   1088 O O     . SER C 3 93  ? -11.728 93.055  10.229  1.00 66.27  ? 93  SER A O     1 
ATOM   1089 C CB    . SER C 3 93  ? -9.529  93.656  7.763   1.00 65.71  ? 93  SER A CB    1 
ATOM   1090 O OG    . SER C 3 93  ? -8.250  94.096  8.197   1.00 65.71  ? 93  SER A OG    1 
ATOM   1091 N N     . VAL C 3 94  ? -9.577  93.184  10.904  1.00 65.46  ? 94  VAL A N     1 
ATOM   1092 C CA    . VAL C 3 94  ? -9.924  93.619  12.254  1.00 64.15  ? 94  VAL A CA    1 
ATOM   1093 C C     . VAL C 3 94  ? -8.935  94.577  12.876  1.00 63.20  ? 94  VAL A C     1 
ATOM   1094 O O     . VAL C 3 94  ? -7.786  94.222  13.080  1.00 62.98  ? 94  VAL A O     1 
ATOM   1095 C CB    . VAL C 3 94  ? -10.020 92.429  13.231  1.00 64.08  ? 94  VAL A CB    1 
ATOM   1096 C CG1   . VAL C 3 94  ? -10.309 92.951  14.638  1.00 63.90  ? 94  VAL A CG1   1 
ATOM   1097 C CG2   . VAL C 3 94  ? -11.094 91.450  12.776  1.00 63.29  ? 94  VAL A CG2   1 
ATOM   1098 N N     . VAL C 3 95  ? -9.382  95.784  13.187  1.00 63.06  ? 95  VAL A N     1 
ATOM   1099 C CA    . VAL C 3 95  ? -8.521  96.757  13.852  1.00 63.99  ? 95  VAL A CA    1 
ATOM   1100 C C     . VAL C 3 95  ? -9.062  96.865  15.283  1.00 64.72  ? 95  VAL A C     1 
ATOM   1101 O O     . VAL C 3 95  ? -10.277 96.884  15.473  1.00 65.59  ? 95  VAL A O     1 
ATOM   1102 C CB    . VAL C 3 95  ? -8.561  98.157  13.147  1.00 62.96  ? 95  VAL A CB    1 
ATOM   1103 C CG1   . VAL C 3 95  ? -9.978  98.538  12.805  1.00 62.67  ? 95  VAL A CG1   1 
ATOM   1104 C CG2   . VAL C 3 95  ? -7.949  99.222  14.053  1.00 61.96  ? 95  VAL A CG2   1 
ATOM   1105 N N     . VAL C 3 96  ? -8.192  96.913  16.291  1.00 64.81  ? 96  VAL A N     1 
ATOM   1106 C CA    . VAL C 3 96  ? -8.682  97.010  17.669  1.00 65.05  ? 96  VAL A CA    1 
ATOM   1107 C C     . VAL C 3 96  ? -8.111  98.203  18.436  1.00 65.83  ? 96  VAL A C     1 
ATOM   1108 O O     . VAL C 3 96  ? -6.915  98.477  18.370  1.00 66.14  ? 96  VAL A O     1 
ATOM   1109 C CB    . VAL C 3 96  ? -8.388  95.692  18.472  1.00 64.00  ? 96  VAL A CB    1 
ATOM   1110 C CG1   . VAL C 3 96  ? -8.129  94.536  17.511  1.00 62.54  ? 96  VAL A CG1   1 
ATOM   1111 C CG2   . VAL C 3 96  ? -7.204  95.875  19.412  1.00 63.92  ? 96  VAL A CG2   1 
ATOM   1112 N N     . SER C 3 97  ? -8.964  98.925  19.151  1.00 67.09  ? 97  SER A N     1 
ATOM   1113 C CA    . SER C 3 97  ? -8.479  100.050 19.941  1.00 69.10  ? 97  SER A CA    1 
ATOM   1114 C C     . SER C 3 97  ? -8.611  99.688  21.419  1.00 70.28  ? 97  SER A C     1 
ATOM   1115 O O     . SER C 3 97  ? -9.714  99.426  21.922  1.00 70.57  ? 97  SER A O     1 
ATOM   1116 C CB    . SER C 3 97  ? -9.265  101.327 19.636  1.00 69.41  ? 97  SER A CB    1 
ATOM   1117 O OG    . SER C 3 97  ? -8.638  102.448 20.250  1.00 70.17  ? 97  SER A OG    1 
ATOM   1118 N N     . MET C 3 98  ? -7.480  99.673  22.112  1.00 71.68  ? 98  MET A N     1 
ATOM   1119 C CA    . MET C 3 98  ? -7.469  99.312  23.520  1.00 73.75  ? 98  MET A CA    1 
ATOM   1120 C C     . MET C 3 98  ? -7.714  100.528 24.415  1.00 75.55  ? 98  MET A C     1 
ATOM   1121 O O     . MET C 3 98  ? -7.011  101.538 24.304  1.00 75.15  ? 98  MET A O     1 
ATOM   1122 C CB    . MET C 3 98  ? -6.124  98.648  23.863  1.00 73.17  ? 98  MET A CB    1 
ATOM   1123 C CG    . MET C 3 98  ? -6.102  97.877  25.189  1.00 72.59  ? 98  MET A CG    1 
ATOM   1124 S SD    . MET C 3 98  ? -4.541  96.981  25.518  1.00 71.04  ? 98  MET A SD    1 
ATOM   1125 C CE    . MET C 3 98  ? -3.773  98.063  26.734  1.00 70.51  ? 98  MET A CE    1 
ATOM   1126 N N     . VAL C 3 99  ? -8.719  100.414 25.289  1.00 78.20  ? 99  VAL A N     1 
ATOM   1127 C CA    . VAL C 3 99  ? -9.090  101.473 26.236  1.00 80.87  ? 99  VAL A CA    1 
ATOM   1128 C C     . VAL C 3 99  ? -8.520  101.151 27.608  1.00 83.07  ? 99  VAL A C     1 
ATOM   1129 O O     . VAL C 3 99  ? -8.911  100.156 28.220  1.00 83.10  ? 99  VAL A O     1 
ATOM   1130 C CB    . VAL C 3 99  ? -10.612 101.567 26.426  1.00 80.48  ? 99  VAL A CB    1 
ATOM   1131 C CG1   . VAL C 3 99  ? -10.936 102.734 27.350  1.00 80.09  ? 99  VAL A CG1   1 
ATOM   1132 C CG2   . VAL C 3 99  ? -11.308 101.695 25.078  1.00 80.34  ? 99  VAL A CG2   1 
ATOM   1133 N N     . GLU C 3 100 ? -7.619  101.985 28.108  1.00 86.18  ? 100 GLU A N     1 
ATOM   1134 C CA    . GLU C 3 100 ? -7.042  101.711 29.420  1.00 90.21  ? 100 GLU A CA    1 
ATOM   1135 C C     . GLU C 3 100 ? -7.624  102.590 30.522  1.00 91.78  ? 100 GLU A C     1 
ATOM   1136 O O     . GLU C 3 100 ? -7.961  102.107 31.617  1.00 91.57  ? 100 GLU A O     1 
ATOM   1137 C CB    . GLU C 3 100 ? -5.519  101.866 29.374  1.00 91.66  ? 100 GLU A CB    1 
ATOM   1138 C CG    . GLU C 3 100 ? -4.810  100.770 28.587  1.00 93.39  ? 100 GLU A CG    1 
ATOM   1139 C CD    . GLU C 3 100 ? -3.305  100.967 28.539  1.00 94.23  ? 100 GLU A CD    1 
ATOM   1140 O OE1   . GLU C 3 100 ? -2.866  102.034 28.039  1.00 94.61  ? 100 GLU A OE1   1 
ATOM   1141 O OE2   . GLU C 3 100 ? -2.572  100.055 28.999  1.00 94.18  ? 100 GLU A OE2   1 
ATOM   1142 N N     . ARG C 3 101 ? -7.731  103.883 30.232  1.00 93.86  ? 101 ARG A N     1 
ATOM   1143 C CA    . ARG C 3 101 ? -8.282  104.829 31.194  1.00 95.88  ? 101 ARG A CA    1 
ATOM   1144 C C     . ARG C 3 101 ? -9.715  104.374 31.495  1.00 95.75  ? 101 ARG A C     1 
ATOM   1145 O O     . ARG C 3 101 ? -10.420 103.879 30.607  1.00 95.89  ? 101 ARG A O     1 
ATOM   1146 C CB    . ARG C 3 101 ? -8.280  106.256 30.604  1.00 97.24  ? 101 ARG A CB    1 
ATOM   1147 C CG    . ARG C 3 101 ? -6.891  106.772 30.166  1.00 99.50  ? 101 ARG A CG    1 
ATOM   1148 C CD    . ARG C 3 101 ? -6.967  108.097 29.370  1.00 101.73 ? 101 ARG A CD    1 
ATOM   1149 N NE    . ARG C 3 101 ? -7.747  107.971 28.130  1.00 103.74 ? 101 ARG A NE    1 
ATOM   1150 C CZ    . ARG C 3 101 ? -7.932  108.944 27.233  1.00 104.35 ? 101 ARG A CZ    1 
ATOM   1151 N NH1   . ARG C 3 101 ? -7.394  110.148 27.410  1.00 104.76 ? 101 ARG A NH1   1 
ATOM   1152 N NH2   . ARG C 3 101 ? -8.669  108.713 26.153  1.00 104.24 ? 101 ARG A NH2   1 
ATOM   1153 N N     . SER C 3 102 ? -10.131 104.510 32.749  1.00 95.61  ? 102 SER A N     1 
ATOM   1154 C CA    . SER C 3 102 ? -11.481 104.126 33.132  1.00 95.10  ? 102 SER A CA    1 
ATOM   1155 C C     . SER C 3 102 ? -12.383 105.315 32.828  1.00 94.17  ? 102 SER A C     1 
ATOM   1156 O O     . SER C 3 102 ? -12.016 106.452 33.116  1.00 94.12  ? 102 SER A O     1 
ATOM   1157 C CB    . SER C 3 102 ? -11.535 103.801 34.629  1.00 95.77  ? 102 SER A CB    1 
ATOM   1158 O OG    . SER C 3 102 ? -12.860 103.499 35.042  1.00 96.90  ? 102 SER A OG    1 
ATOM   1159 N N     . GLY C 3 103 ? -13.550 105.063 32.241  1.00 92.93  ? 103 GLY A N     1 
ATOM   1160 C CA    . GLY C 3 103 ? -14.451 106.160 31.940  1.00 91.87  ? 103 GLY A CA    1 
ATOM   1161 C C     . GLY C 3 103 ? -15.131 106.020 30.599  1.00 91.14  ? 103 GLY A C     1 
ATOM   1162 O O     . GLY C 3 103 ? -14.649 105.295 29.731  1.00 91.23  ? 103 GLY A O     1 
ATOM   1163 N N     . VAL C 3 104 ? -16.250 106.722 30.433  1.00 90.72  ? 104 VAL A N     1 
ATOM   1164 C CA    . VAL C 3 104 ? -17.025 106.678 29.192  1.00 90.21  ? 104 VAL A CA    1 
ATOM   1165 C C     . VAL C 3 104 ? -16.315 107.467 28.108  1.00 90.28  ? 104 VAL A C     1 
ATOM   1166 O O     . VAL C 3 104 ? -16.331 107.093 26.931  1.00 90.04  ? 104 VAL A O     1 
ATOM   1167 C CB    . VAL C 3 104 ? -18.434 107.281 29.389  1.00 89.46  ? 104 VAL A CB    1 
ATOM   1168 C CG1   . VAL C 3 104 ? -19.290 107.043 28.149  1.00 88.30  ? 104 VAL A CG1   1 
ATOM   1169 C CG2   . VAL C 3 104 ? -19.080 106.676 30.628  1.00 89.83  ? 104 VAL A CG2   1 
ATOM   1170 N N     . GLU C 3 105 ? -15.688 108.562 28.525  1.00 90.57  ? 105 GLU A N     1 
ATOM   1171 C CA    . GLU C 3 105 ? -14.956 109.431 27.609  1.00 90.94  ? 105 GLU A CA    1 
ATOM   1172 C C     . GLU C 3 105 ? -13.885 108.654 26.856  1.00 89.39  ? 105 GLU A C     1 
ATOM   1173 O O     . GLU C 3 105 ? -13.768 108.756 25.632  1.00 88.71  ? 105 GLU A O     1 
ATOM   1174 C CB    . GLU C 3 105 ? -14.321 110.595 28.390  1.00 93.08  ? 105 GLU A CB    1 
ATOM   1175 C CG    . GLU C 3 105 ? -15.343 111.613 28.908  1.00 96.31  ? 105 GLU A CG    1 
ATOM   1176 C CD    . GLU C 3 105 ? -16.182 112.237 27.774  1.00 98.06  ? 105 GLU A CD    1 
ATOM   1177 O OE1   . GLU C 3 105 ? -15.613 113.021 26.968  1.00 98.62  ? 105 GLU A OE1   1 
ATOM   1178 O OE2   . GLU C 3 105 ? -17.405 111.934 27.687  1.00 98.49  ? 105 GLU A OE2   1 
ATOM   1179 N N     . ALA C 3 106 ? -13.111 107.876 27.607  1.00 88.05  ? 106 ALA A N     1 
ATOM   1180 C CA    . ALA C 3 106 ? -12.046 107.068 27.040  1.00 86.57  ? 106 ALA A CA    1 
ATOM   1181 C C     . ALA C 3 106 ? -12.632 106.080 26.031  1.00 85.39  ? 106 ALA A C     1 
ATOM   1182 O O     . ALA C 3 106 ? -12.070 105.880 24.952  1.00 85.35  ? 106 ALA A O     1 
ATOM   1183 C CB    . ALA C 3 106 ? -11.308 106.317 28.158  1.00 86.87  ? 106 ALA A CB    1 
ATOM   1184 N N     . CYS C 3 107 ? -13.765 105.475 26.387  1.00 83.67  ? 107 CYS A N     1 
ATOM   1185 C CA    . CYS C 3 107 ? -14.417 104.504 25.521  1.00 82.41  ? 107 CYS A CA    1 
ATOM   1186 C C     . CYS C 3 107 ? -15.002 105.164 24.285  1.00 82.66  ? 107 CYS A C     1 
ATOM   1187 O O     . CYS C 3 107 ? -15.225 104.520 23.256  1.00 81.98  ? 107 CYS A O     1 
ATOM   1188 C CB    . CYS C 3 107 ? -15.520 103.775 26.270  1.00 81.18  ? 107 CYS A CB    1 
ATOM   1189 S SG    . CYS C 3 107 ? -16.272 102.493 25.253  1.00 79.91  ? 107 CYS A SG    1 
ATOM   1190 N N     . LYS C 3 108 ? -15.274 106.457 24.398  1.00 83.56  ? 108 LYS A N     1 
ATOM   1191 C CA    . LYS C 3 108 ? -15.799 107.211 23.266  1.00 84.47  ? 108 LYS A CA    1 
ATOM   1192 C C     . LYS C 3 108 ? -14.607 107.527 22.345  1.00 83.55  ? 108 LYS A C     1 
ATOM   1193 O O     . LYS C 3 108 ? -14.673 107.337 21.119  1.00 82.79  ? 108 LYS A O     1 
ATOM   1194 C CB    . LYS C 3 108 ? -16.472 108.512 23.749  1.00 86.20  ? 108 LYS A CB    1 
ATOM   1195 C CG    . LYS C 3 108 ? -17.927 108.346 24.238  1.00 88.27  ? 108 LYS A CG    1 
ATOM   1196 C CD    . LYS C 3 108 ? -18.589 109.715 24.481  1.00 89.93  ? 108 LYS A CD    1 
ATOM   1197 C CE    . LYS C 3 108 ? -20.047 109.594 24.950  1.00 90.75  ? 108 LYS A CE    1 
ATOM   1198 N NZ    . LYS C 3 108 ? -20.670 110.933 25.246  1.00 90.68  ? 108 LYS A NZ    1 
ATOM   1199 N N     . THR C 3 109 ? -13.522 108.003 22.961  1.00 82.62  ? 109 THR A N     1 
ATOM   1200 C CA    . THR C 3 109 ? -12.291 108.331 22.247  1.00 81.32  ? 109 THR A CA    1 
ATOM   1201 C C     . THR C 3 109 ? -11.993 107.142 21.354  1.00 80.51  ? 109 THR A C     1 
ATOM   1202 O O     . THR C 3 109 ? -11.755 107.285 20.160  1.00 79.80  ? 109 THR A O     1 
ATOM   1203 C CB    . THR C 3 109 ? -11.107 108.524 23.233  1.00 81.12  ? 109 THR A CB    1 
ATOM   1204 O OG1   . THR C 3 109 ? -11.380 109.627 24.111  1.00 80.67  ? 109 THR A OG1   1 
ATOM   1205 C CG2   . THR C 3 109 ? -9.816  108.784 22.472  1.00 80.99  ? 109 THR A CG2   1 
ATOM   1206 N N     . ALA C 3 110 ? -12.032 105.962 21.965  1.00 80.91  ? 110 ALA A N     1 
ATOM   1207 C CA    . ALA C 3 110 ? -11.779 104.701 21.277  1.00 81.70  ? 110 ALA A CA    1 
ATOM   1208 C C     . ALA C 3 110 ? -12.711 104.499 20.082  1.00 81.77  ? 110 ALA A C     1 
ATOM   1209 O O     . ALA C 3 110 ? -12.263 104.172 18.974  1.00 81.14  ? 110 ALA A O     1 
ATOM   1210 C CB    . ALA C 3 110 ? -11.933 103.528 22.264  1.00 81.37  ? 110 ALA A CB    1 
ATOM   1211 N N     . VAL C 3 111 ? -14.009 104.686 20.309  1.00 82.08  ? 111 VAL A N     1 
ATOM   1212 C CA    . VAL C 3 111 ? -14.972 104.512 19.238  1.00 82.86  ? 111 VAL A CA    1 
ATOM   1213 C C     . VAL C 3 111 ? -14.725 105.550 18.149  1.00 84.05  ? 111 VAL A C     1 
ATOM   1214 O O     . VAL C 3 111 ? -14.944 105.282 16.964  1.00 84.03  ? 111 VAL A O     1 
ATOM   1215 C CB    . VAL C 3 111 ? -16.407 104.636 19.763  1.00 81.86  ? 111 VAL A CB    1 
ATOM   1216 C CG1   . VAL C 3 111 ? -17.387 104.450 18.621  1.00 81.27  ? 111 VAL A CG1   1 
ATOM   1217 C CG2   . VAL C 3 111 ? -16.655 103.595 20.841  1.00 80.88  ? 111 VAL A CG2   1 
ATOM   1218 N N     . HIS C 3 112 ? -14.252 106.728 18.560  1.00 85.86  ? 112 HIS A N     1 
ATOM   1219 C CA    . HIS C 3 112 ? -13.952 107.824 17.630  1.00 87.50  ? 112 HIS A CA    1 
ATOM   1220 C C     . HIS C 3 112 ? -12.867 107.408 16.607  1.00 86.33  ? 112 HIS A C     1 
ATOM   1221 O O     . HIS C 3 112 ? -13.063 107.532 15.391  1.00 85.50  ? 112 HIS A O     1 
ATOM   1222 C CB    . HIS C 3 112 ? -13.497 109.071 18.426  1.00 90.62  ? 112 HIS A CB    1 
ATOM   1223 C CG    . HIS C 3 112 ? -13.322 110.315 17.593  1.00 93.92  ? 112 HIS A CG    1 
ATOM   1224 N ND1   . HIS C 3 112 ? -12.748 111.468 18.092  1.00 95.22  ? 112 HIS A ND1   1 
ATOM   1225 C CD2   . HIS C 3 112 ? -13.655 110.591 16.307  1.00 95.16  ? 112 HIS A CD2   1 
ATOM   1226 C CE1   . HIS C 3 112 ? -12.736 112.398 17.152  1.00 95.69  ? 112 HIS A CE1   1 
ATOM   1227 N NE2   . HIS C 3 112 ? -13.281 111.892 16.059  1.00 95.81  ? 112 HIS A NE2   1 
ATOM   1228 N N     . ASN C 3 113 ? -11.733 106.911 17.104  1.00 85.19  ? 113 ASN A N     1 
ATOM   1229 C CA    . ASN C 3 113 ? -10.640 106.487 16.233  1.00 83.90  ? 113 ASN A CA    1 
ATOM   1230 C C     . ASN C 3 113 ? -11.049 105.313 15.362  1.00 82.32  ? 113 ASN A C     1 
ATOM   1231 O O     . ASN C 3 113 ? -10.659 105.231 14.197  1.00 81.88  ? 113 ASN A O     1 
ATOM   1232 C CB    . ASN C 3 113 ? -9.408  106.085 17.052  1.00 85.38  ? 113 ASN A CB    1 
ATOM   1233 C CG    . ASN C 3 113 ? -8.911  107.204 17.952  1.00 86.53  ? 113 ASN A CG    1 
ATOM   1234 O OD1   . ASN C 3 113 ? -8.933  108.389 17.574  1.00 86.25  ? 113 ASN A OD1   1 
ATOM   1235 N ND2   . ASN C 3 113 ? -8.441  106.834 19.148  1.00 87.32  ? 113 ASN A ND2   1 
ATOM   1236 N N     . LEU C 3 114 ? -11.820 104.396 15.938  1.00 80.65  ? 114 LEU A N     1 
ATOM   1237 C CA    . LEU C 3 114 ? -12.276 103.231 15.196  1.00 79.49  ? 114 LEU A CA    1 
ATOM   1238 C C     . LEU C 3 114 ? -13.155 103.702 14.047  1.00 78.81  ? 114 LEU A C     1 
ATOM   1239 O O     . LEU C 3 114 ? -13.139 103.143 12.945  1.00 77.80  ? 114 LEU A O     1 
ATOM   1240 C CB    . LEU C 3 114 ? -13.054 102.293 16.123  1.00 79.34  ? 114 LEU A CB    1 
ATOM   1241 C CG    . LEU C 3 114 ? -12.386 100.938 16.395  1.00 78.61  ? 114 LEU A CG    1 
ATOM   1242 C CD1   . LEU C 3 114 ? -10.947 101.132 16.845  1.00 78.69  ? 114 LEU A CD1   1 
ATOM   1243 C CD2   . LEU C 3 114 ? -13.172 100.198 17.452  1.00 78.79  ? 114 LEU A CD2   1 
ATOM   1244 N N     . LEU C 3 115 ? -13.919 104.751 14.318  1.00 78.85  ? 115 LEU A N     1 
ATOM   1245 C CA    . LEU C 3 115 ? -14.800 105.326 13.318  1.00 79.18  ? 115 LEU A CA    1 
ATOM   1246 C C     . LEU C 3 115 ? -13.965 105.977 12.216  1.00 79.54  ? 115 LEU A C     1 
ATOM   1247 O O     . LEU C 3 115 ? -14.222 105.784 11.020  1.00 79.07  ? 115 LEU A O     1 
ATOM   1248 C CB    . LEU C 3 115 ? -15.717 106.355 13.987  1.00 78.67  ? 115 LEU A CB    1 
ATOM   1249 C CG    . LEU C 3 115 ? -17.185 105.936 14.143  1.00 78.18  ? 115 LEU A CG    1 
ATOM   1250 C CD1   . LEU C 3 115 ? -17.288 104.450 14.459  1.00 77.61  ? 115 LEU A CD1   1 
ATOM   1251 C CD2   . LEU C 3 115 ? -17.833 106.777 15.233  1.00 78.21  ? 115 LEU A CD2   1 
ATOM   1252 N N     . ALA C 3 116 ? -12.961 106.741 12.638  1.00 79.87  ? 116 ALA A N     1 
ATOM   1253 C CA    . ALA C 3 116 ? -12.069 107.424 11.713  1.00 79.94  ? 116 ALA A CA    1 
ATOM   1254 C C     . ALA C 3 116 ? -11.500 106.442 10.676  1.00 79.93  ? 116 ALA A C     1 
ATOM   1255 O O     . ALA C 3 116 ? -11.350 106.784 9.503   1.00 80.23  ? 116 ALA A O     1 
ATOM   1256 C CB    . ALA C 3 116 ? -10.929 108.107 12.494  1.00 80.01  ? 116 ALA A CB    1 
ATOM   1257 N N     . GLN C 3 117 ? -11.192 105.221 11.102  1.00 79.41  ? 117 GLN A N     1 
ATOM   1258 C CA    . GLN C 3 117 ? -10.636 104.236 10.186  1.00 78.55  ? 117 GLN A CA    1 
ATOM   1259 C C     . GLN C 3 117 ? -11.727 103.620 9.332   1.00 77.63  ? 117 GLN A C     1 
ATOM   1260 O O     . GLN C 3 117 ? -11.529 102.583 8.708   1.00 77.00  ? 117 GLN A O     1 
ATOM   1261 C CB    . GLN C 3 117 ? -9.893  103.152 10.966  1.00 79.79  ? 117 GLN A CB    1 
ATOM   1262 C CG    . GLN C 3 117 ? -8.711  103.685 11.790  1.00 81.06  ? 117 GLN A CG    1 
ATOM   1263 C CD    . GLN C 3 117 ? -7.969  102.584 12.543  1.00 82.21  ? 117 GLN A CD    1 
ATOM   1264 O OE1   . GLN C 3 117 ? -7.379  101.680 11.934  1.00 82.37  ? 117 GLN A OE1   1 
ATOM   1265 N NE2   . GLN C 3 117 ? -7.999  102.654 13.876  1.00 82.65  ? 117 GLN A NE2   1 
ATOM   1266 N N     . ARG C 3 118 ? -12.876 104.285 9.311   1.00 77.50  ? 118 ARG A N     1 
ATOM   1267 C CA    . ARG C 3 118 ? -14.037 103.854 8.538   1.00 78.45  ? 118 ARG A CA    1 
ATOM   1268 C C     . ARG C 3 118 ? -14.321 102.350 8.603   1.00 76.75  ? 118 ARG A C     1 
ATOM   1269 O O     . ARG C 3 118 ? -14.420 101.678 7.566   1.00 76.56  ? 118 ARG A O     1 
ATOM   1270 C CB    . ARG C 3 118 ? -13.908 104.296 7.063   1.00 81.20  ? 118 ARG A CB    1 
ATOM   1271 C CG    . ARG C 3 118 ? -13.941 105.831 6.830   1.00 85.45  ? 118 ARG A CG    1 
ATOM   1272 C CD    . ARG C 3 118 ? -15.272 106.511 7.262   1.00 88.29  ? 118 ARG A CD    1 
ATOM   1273 N NE    . ARG C 3 118 ? -15.236 107.977 7.137   1.00 90.10  ? 118 ARG A NE    1 
ATOM   1274 C CZ    . ARG C 3 118 ? -14.653 108.804 8.008   1.00 90.88  ? 118 ARG A CZ    1 
ATOM   1275 N NH1   . ARG C 3 118 ? -14.051 108.326 9.092   1.00 91.05  ? 118 ARG A NH1   1 
ATOM   1276 N NH2   . ARG C 3 118 ? -14.656 110.113 7.788   1.00 91.13  ? 118 ARG A NH2   1 
ATOM   1277 N N     . VAL C 3 119 ? -14.456 101.835 9.827   1.00 74.66  ? 119 VAL A N     1 
ATOM   1278 C CA    . VAL C 3 119 ? -14.766 100.418 10.060  1.00 72.03  ? 119 VAL A CA    1 
ATOM   1279 C C     . VAL C 3 119 ? -16.203 100.193 9.616   1.00 69.97  ? 119 VAL A C     1 
ATOM   1280 O O     . VAL C 3 119 ? -17.004 101.124 9.620   1.00 69.58  ? 119 VAL A O     1 
ATOM   1281 C CB    . VAL C 3 119 ? -14.694 100.055 11.558  1.00 71.95  ? 119 VAL A CB    1 
ATOM   1282 C CG1   . VAL C 3 119 ? -13.282 100.221 12.080  1.00 72.35  ? 119 VAL A CG1   1 
ATOM   1283 C CG2   . VAL C 3 119 ? -15.644 100.940 12.337  1.00 71.53  ? 119 VAL A CG2   1 
ATOM   1284 N N     . SER C 3 120 ? -16.545 98.966  9.251   1.00 68.11  ? 120 SER A N     1 
ATOM   1285 C CA    . SER C 3 120 ? -17.914 98.699  8.818   1.00 66.85  ? 120 SER A CA    1 
ATOM   1286 C C     . SER C 3 120 ? -18.852 98.275  9.958   1.00 65.42  ? 120 SER A C     1 
ATOM   1287 O O     . SER C 3 120 ? -20.056 98.093  9.755   1.00 65.32  ? 120 SER A O     1 
ATOM   1288 C CB    . SER C 3 120 ? -17.923 97.638  7.705   1.00 67.37  ? 120 SER A CB    1 
ATOM   1289 O OG    . SER C 3 120 ? -17.459 96.373  8.158   1.00 67.21  ? 120 SER A OG    1 
ATOM   1290 N N     . GLY C 3 121 ? -18.295 98.131  11.156  1.00 63.93  ? 121 GLY A N     1 
ATOM   1291 C CA    . GLY C 3 121 ? -19.085 97.734  12.314  1.00 61.66  ? 121 GLY A CA    1 
ATOM   1292 C C     . GLY C 3 121 ? -18.228 97.766  13.569  1.00 59.36  ? 121 GLY A C     1 
ATOM   1293 O O     . GLY C 3 121 ? -17.011 97.615  13.478  1.00 60.09  ? 121 GLY A O     1 
ATOM   1294 N N     . LEU C 3 122 ? -18.827 97.970  14.736  1.00 56.25  ? 122 LEU A N     1 
ATOM   1295 C CA    . LEU C 3 122 ? -18.024 98.001  15.941  1.00 53.52  ? 122 LEU A CA    1 
ATOM   1296 C C     . LEU C 3 122 ? -18.419 96.909  16.909  1.00 52.61  ? 122 LEU A C     1 
ATOM   1297 O O     . LEU C 3 122 ? -19.572 96.483  16.926  1.00 53.10  ? 122 LEU A O     1 
ATOM   1298 C CB    . LEU C 3 122 ? -18.152 99.356  16.646  1.00 51.73  ? 122 LEU A CB    1 
ATOM   1299 C CG    . LEU C 3 122 ? -17.462 100.588 16.060  1.00 50.45  ? 122 LEU A CG    1 
ATOM   1300 C CD1   . LEU C 3 122 ? -17.377 101.677 17.123  1.00 49.17  ? 122 LEU A CD1   1 
ATOM   1301 C CD2   . LEU C 3 122 ? -16.066 100.225 15.606  1.00 50.10  ? 122 LEU A CD2   1 
ATOM   1302 N N     . ILE C 3 123 ? -17.444 96.432  17.682  1.00 51.00  ? 123 ILE A N     1 
ATOM   1303 C CA    . ILE C 3 123 ? -17.698 95.449  18.729  1.00 48.97  ? 123 ILE A CA    1 
ATOM   1304 C C     . ILE C 3 123 ? -17.100 96.120  19.958  1.00 48.21  ? 123 ILE A C     1 
ATOM   1305 O O     . ILE C 3 123 ? -15.901 96.412  20.000  1.00 46.51  ? 123 ILE A O     1 
ATOM   1306 C CB    . ILE C 3 123 ? -17.014 94.070  18.489  1.00 47.88  ? 123 ILE A CB    1 
ATOM   1307 C CG1   . ILE C 3 123 ? -17.688 93.338  17.326  1.00 46.38  ? 123 ILE A CG1   1 
ATOM   1308 C CG2   . ILE C 3 123 ? -17.150 93.198  19.741  1.00 46.14  ? 123 ILE A CG2   1 
ATOM   1309 C CD1   . ILE C 3 123 ? -17.392 91.844  17.278  1.00 45.37  ? 123 ILE A CD1   1 
ATOM   1310 N N     . ILE C 3 124 ? -17.950 96.404  20.937  1.00 48.39  ? 124 ILE A N     1 
ATOM   1311 C CA    . ILE C 3 124 ? -17.498 97.057  22.157  1.00 48.67  ? 124 ILE A CA    1 
ATOM   1312 C C     . ILE C 3 124 ? -17.436 96.096  23.361  1.00 49.46  ? 124 ILE A C     1 
ATOM   1313 O O     . ILE C 3 124 ? -18.467 95.733  23.957  1.00 49.61  ? 124 ILE A O     1 
ATOM   1314 C CB    . ILE C 3 124 ? -18.418 98.252  22.528  1.00 47.87  ? 124 ILE A CB    1 
ATOM   1315 C CG1   . ILE C 3 124 ? -18.791 99.050  21.278  1.00 46.80  ? 124 ILE A CG1   1 
ATOM   1316 C CG2   . ILE C 3 124 ? -17.694 99.178  23.514  1.00 46.81  ? 124 ILE A CG2   1 
ATOM   1317 C CD1   . ILE C 3 124 ? -17.746 100.048 20.854  1.00 46.80  ? 124 ILE A CD1   1 
ATOM   1318 N N     . ASN C 3 125 ? -16.218 95.685  23.706  1.00 49.29  ? 125 ASN A N     1 
ATOM   1319 C CA    . ASN C 3 125 ? -16.001 94.810  24.844  1.00 49.32  ? 125 ASN A CA    1 
ATOM   1320 C C     . ASN C 3 125 ? -15.396 95.670  25.948  1.00 48.76  ? 125 ASN A C     1 
ATOM   1321 O O     . ASN C 3 125 ? -14.217 95.551  26.281  1.00 48.11  ? 125 ASN A O     1 
ATOM   1322 C CB    . ASN C 3 125 ? -15.052 93.678  24.479  1.00 50.27  ? 125 ASN A CB    1 
ATOM   1323 C CG    . ASN C 3 125 ? -14.758 92.763  25.656  1.00 52.78  ? 125 ASN A CG    1 
ATOM   1324 O OD1   . ASN C 3 125 ? -14.000 91.802  25.523  1.00 53.83  ? 125 ASN A OD1   1 
ATOM   1325 N ND2   . ASN C 3 125 ? -15.351 93.056  26.817  1.00 53.64  ? 125 ASN A ND2   1 
ATOM   1326 N N     . TYR C 3 126 ? -16.233 96.547  26.494  1.00 48.74  ? 126 TYR A N     1 
ATOM   1327 C CA    . TYR C 3 126 ? -15.859 97.471  27.554  1.00 48.27  ? 126 TYR A CA    1 
ATOM   1328 C C     . TYR C 3 126 ? -17.091 97.650  28.456  1.00 48.98  ? 126 TYR A C     1 
ATOM   1329 O O     . TYR C 3 126 ? -18.227 97.745  27.970  1.00 49.56  ? 126 TYR A O     1 
ATOM   1330 C CB    . TYR C 3 126 ? -15.433 98.797  26.926  1.00 46.59  ? 126 TYR A CB    1 
ATOM   1331 C CG    . TYR C 3 126 ? -14.854 99.770  27.896  1.00 46.25  ? 126 TYR A CG    1 
ATOM   1332 C CD1   . TYR C 3 126 ? -15.672 100.556 28.691  1.00 47.29  ? 126 TYR A CD1   1 
ATOM   1333 C CD2   . TYR C 3 126 ? -13.483 99.890  28.041  1.00 46.73  ? 126 TYR A CD2   1 
ATOM   1334 C CE1   . TYR C 3 126 ? -15.138 101.445 29.616  1.00 48.77  ? 126 TYR A CE1   1 
ATOM   1335 C CE2   . TYR C 3 126 ? -12.932 100.769 28.957  1.00 48.31  ? 126 TYR A CE2   1 
ATOM   1336 C CZ    . TYR C 3 126 ? -13.761 101.549 29.748  1.00 49.18  ? 126 TYR A CZ    1 
ATOM   1337 O OH    . TYR C 3 126 ? -13.211 102.428 30.668  1.00 49.69  ? 126 TYR A OH    1 
ATOM   1338 N N     . PRO C 3 127 ? -16.887 97.681  29.784  1.00 49.48  ? 127 PRO A N     1 
ATOM   1339 C CA    . PRO C 3 127 ? -17.984 97.842  30.749  1.00 50.11  ? 127 PRO A CA    1 
ATOM   1340 C C     . PRO C 3 127 ? -18.676 99.191  30.589  1.00 50.82  ? 127 PRO A C     1 
ATOM   1341 O O     . PRO C 3 127 ? -18.068 100.252 30.791  1.00 51.25  ? 127 PRO A O     1 
ATOM   1342 C CB    . PRO C 3 127 ? -17.278 97.709  32.089  1.00 49.96  ? 127 PRO A CB    1 
ATOM   1343 C CG    . PRO C 3 127 ? -15.951 98.362  31.800  1.00 49.75  ? 127 PRO A CG    1 
ATOM   1344 C CD    . PRO C 3 127 ? -15.581 97.760  30.461  1.00 49.29  ? 127 PRO A CD    1 
ATOM   1345 N N     . LEU C 3 128 ? -19.951 99.143  30.233  1.00 50.75  ? 128 LEU A N     1 
ATOM   1346 C CA    . LEU C 3 128 ? -20.706 100.359 30.020  1.00 51.61  ? 128 LEU A CA    1 
ATOM   1347 C C     . LEU C 3 128 ? -22.025 100.354 30.774  1.00 53.40  ? 128 LEU A C     1 
ATOM   1348 O O     . LEU C 3 128 ? -22.738 99.338  30.783  1.00 53.39  ? 128 LEU A O     1 
ATOM   1349 C CB    . LEU C 3 128 ? -20.959 100.521 28.518  1.00 49.54  ? 128 LEU A CB    1 
ATOM   1350 C CG    . LEU C 3 128 ? -20.198 101.610 27.764  1.00 48.34  ? 128 LEU A CG    1 
ATOM   1351 C CD1   . LEU C 3 128 ? -18.856 101.891 28.420  1.00 47.19  ? 128 LEU A CD1   1 
ATOM   1352 C CD2   . LEU C 3 128 ? -20.043 101.170 26.319  1.00 47.34  ? 128 LEU A CD2   1 
ATOM   1353 N N     . ASP C 3 129 ? -22.341 101.480 31.417  1.00 55.54  ? 129 ASP A N     1 
ATOM   1354 C CA    . ASP C 3 129 ? -23.613 101.601 32.125  1.00 58.68  ? 129 ASP A CA    1 
ATOM   1355 C C     . ASP C 3 129 ? -24.691 101.903 31.058  1.00 59.75  ? 129 ASP A C     1 
ATOM   1356 O O     . ASP C 3 129 ? -24.383 102.509 30.018  1.00 60.27  ? 129 ASP A O     1 
ATOM   1357 C CB    . ASP C 3 129 ? -23.539 102.715 33.185  1.00 59.83  ? 129 ASP A CB    1 
ATOM   1358 C CG    . ASP C 3 129 ? -23.128 102.187 34.578  1.00 61.02  ? 129 ASP A CG    1 
ATOM   1359 O OD1   . ASP C 3 129 ? -23.220 102.960 35.577  1.00 60.86  ? 129 ASP A OD1   1 
ATOM   1360 O OD2   . ASP C 3 129 ? -22.718 101.000 34.669  1.00 61.03  ? 129 ASP A OD2   1 
ATOM   1361 N N     . ASP C 3 130 ? -25.934 101.483 31.309  1.00 60.23  ? 130 ASP A N     1 
ATOM   1362 C CA    . ASP C 3 130 ? -27.020 101.658 30.342  1.00 60.59  ? 130 ASP A CA    1 
ATOM   1363 C C     . ASP C 3 130 ? -27.039 102.895 29.460  1.00 60.56  ? 130 ASP A C     1 
ATOM   1364 O O     . ASP C 3 130 ? -26.958 102.778 28.235  1.00 60.07  ? 130 ASP A O     1 
ATOM   1365 C CB    . ASP C 3 130 ? -28.375 101.507 31.031  1.00 62.01  ? 130 ASP A CB    1 
ATOM   1366 C CG    . ASP C 3 130 ? -28.761 100.048 31.221  1.00 63.10  ? 130 ASP A CG    1 
ATOM   1367 O OD1   . ASP C 3 130 ? -29.938 99.743  31.560  1.00 63.93  ? 130 ASP A OD1   1 
ATOM   1368 O OD2   . ASP C 3 130 ? -27.861 99.201  31.024  1.00 64.06  ? 130 ASP A OD2   1 
ATOM   1369 N N     . GLN C 3 131 ? -27.152 104.073 30.057  1.00 61.14  ? 131 GLN A N     1 
ATOM   1370 C CA    . GLN C 3 131 ? -27.192 105.282 29.250  1.00 62.34  ? 131 GLN A CA    1 
ATOM   1371 C C     . GLN C 3 131 ? -25.889 105.507 28.488  1.00 61.89  ? 131 GLN A C     1 
ATOM   1372 O O     . GLN C 3 131 ? -25.895 105.894 27.308  1.00 61.90  ? 131 GLN A O     1 
ATOM   1373 C CB    . GLN C 3 131 ? -27.543 106.476 30.139  1.00 64.03  ? 131 GLN A CB    1 
ATOM   1374 C CG    . GLN C 3 131 ? -28.960 106.337 30.693  1.00 66.60  ? 131 GLN A CG    1 
ATOM   1375 C CD    . GLN C 3 131 ? -29.449 107.556 31.448  1.00 68.14  ? 131 GLN A CD    1 
ATOM   1376 O OE1   . GLN C 3 131 ? -29.492 108.670 30.909  1.00 69.15  ? 131 GLN A OE1   1 
ATOM   1377 N NE2   . GLN C 3 131 ? -29.838 107.348 32.705  1.00 68.88  ? 131 GLN A NE2   1 
ATOM   1378 N N     . ASP C 3 132 ? -24.776 105.248 29.166  1.00 60.63  ? 132 ASP A N     1 
ATOM   1379 C CA    . ASP C 3 132 ? -23.461 105.399 28.564  1.00 59.04  ? 132 ASP A CA    1 
ATOM   1380 C C     . ASP C 3 132 ? -23.423 104.526 27.336  1.00 57.37  ? 132 ASP A C     1 
ATOM   1381 O O     . ASP C 3 132 ? -22.976 104.951 26.275  1.00 57.22  ? 132 ASP A O     1 
ATOM   1382 C CB    . ASP C 3 132 ? -22.391 104.954 29.552  1.00 61.05  ? 132 ASP A CB    1 
ATOM   1383 C CG    . ASP C 3 132 ? -22.179 105.962 30.665  1.00 62.99  ? 132 ASP A CG    1 
ATOM   1384 O OD1   . ASP C 3 132 ? -21.745 105.547 31.772  1.00 63.00  ? 132 ASP A OD1   1 
ATOM   1385 O OD2   . ASP C 3 132 ? -22.438 107.171 30.416  1.00 64.28  ? 132 ASP A OD2   1 
ATOM   1386 N N     . ALA C 3 133 ? -23.907 103.301 27.491  1.00 55.84  ? 133 ALA A N     1 
ATOM   1387 C CA    . ALA C 3 133 ? -23.938 102.358 26.389  1.00 55.52  ? 133 ALA A CA    1 
ATOM   1388 C C     . ALA C 3 133 ? -24.773 102.940 25.264  1.00 55.33  ? 133 ALA A C     1 
ATOM   1389 O O     . ALA C 3 133 ? -24.402 102.859 24.090  1.00 55.07  ? 133 ALA A O     1 
ATOM   1390 C CB    . ALA C 3 133 ? -24.526 101.043 26.847  1.00 55.19  ? 133 ALA A CB    1 
ATOM   1391 N N     . ILE C 3 134 ? -25.905 103.533 25.626  1.00 55.38  ? 134 ILE A N     1 
ATOM   1392 C CA    . ILE C 3 134 ? -26.783 104.129 24.628  1.00 55.47  ? 134 ILE A CA    1 
ATOM   1393 C C     . ILE C 3 134 ? -26.117 105.307 23.926  1.00 55.62  ? 134 ILE A C     1 
ATOM   1394 O O     . ILE C 3 134 ? -26.333 105.517 22.729  1.00 55.69  ? 134 ILE A O     1 
ATOM   1395 C CB    . ILE C 3 134 ? -28.116 104.605 25.247  1.00 54.78  ? 134 ILE A CB    1 
ATOM   1396 C CG1   . ILE C 3 134 ? -28.929 103.398 25.722  1.00 54.12  ? 134 ILE A CG1   1 
ATOM   1397 C CG2   . ILE C 3 134 ? -28.916 105.378 24.214  1.00 54.67  ? 134 ILE A CG2   1 
ATOM   1398 C CD1   . ILE C 3 134 ? -30.289 103.752 26.261  1.00 53.40  ? 134 ILE A CD1   1 
ATOM   1399 N N     . ALA C 3 135 ? -25.315 106.071 24.667  1.00 56.10  ? 135 ALA A N     1 
ATOM   1400 C CA    . ALA C 3 135 ? -24.611 107.220 24.095  1.00 57.40  ? 135 ALA A CA    1 
ATOM   1401 C C     . ALA C 3 135 ? -23.578 106.738 23.068  1.00 58.51  ? 135 ALA A C     1 
ATOM   1402 O O     . ALA C 3 135 ? -23.489 107.275 21.953  1.00 58.72  ? 135 ALA A O     1 
ATOM   1403 C CB    . ALA C 3 135 ? -23.927 108.027 25.201  1.00 56.44  ? 135 ALA A CB    1 
ATOM   1404 N N     . VAL C 3 136 ? -22.794 105.736 23.458  1.00 59.58  ? 136 VAL A N     1 
ATOM   1405 C CA    . VAL C 3 136 ? -21.798 105.152 22.575  1.00 60.84  ? 136 VAL A CA    1 
ATOM   1406 C C     . VAL C 3 136 ? -22.552 104.644 21.343  1.00 62.26  ? 136 VAL A C     1 
ATOM   1407 O O     . VAL C 3 136 ? -22.220 104.992 20.207  1.00 62.22  ? 136 VAL A O     1 
ATOM   1408 C CB    . VAL C 3 136 ? -21.065 103.997 23.289  1.00 60.50  ? 136 VAL A CB    1 
ATOM   1409 C CG1   . VAL C 3 136 ? -20.262 103.169 22.299  1.00 60.94  ? 136 VAL A CG1   1 
ATOM   1410 C CG2   . VAL C 3 136 ? -20.148 104.576 24.352  1.00 60.44  ? 136 VAL A CG2   1 
ATOM   1411 N N     . GLU C 3 137 ? -23.576 103.831 21.577  1.00 63.84  ? 137 GLU A N     1 
ATOM   1412 C CA    . GLU C 3 137 ? -24.392 103.312 20.491  1.00 66.31  ? 137 GLU A CA    1 
ATOM   1413 C C     . GLU C 3 137 ? -24.714 104.440 19.514  1.00 67.75  ? 137 GLU A C     1 
ATOM   1414 O O     . GLU C 3 137 ? -24.602 104.277 18.307  1.00 67.69  ? 137 GLU A O     1 
ATOM   1415 C CB    . GLU C 3 137 ? -25.689 102.725 21.057  1.00 67.19  ? 137 GLU A CB    1 
ATOM   1416 C CG    . GLU C 3 137 ? -26.861 102.679 20.074  1.00 69.45  ? 137 GLU A CG    1 
ATOM   1417 C CD    . GLU C 3 137 ? -26.633 101.737 18.883  1.00 71.40  ? 137 GLU A CD    1 
ATOM   1418 O OE1   . GLU C 3 137 ? -26.656 100.492 19.067  1.00 72.36  ? 137 GLU A OE1   1 
ATOM   1419 O OE2   . GLU C 3 137 ? -26.432 102.248 17.755  1.00 72.49  ? 137 GLU A OE2   1 
ATOM   1420 N N     . ALA C 3 138 ? -25.101 105.591 20.046  1.00 70.12  ? 138 ALA A N     1 
ATOM   1421 C CA    . ALA C 3 138 ? -25.444 106.741 19.222  1.00 73.10  ? 138 ALA A CA    1 
ATOM   1422 C C     . ALA C 3 138 ? -24.279 107.323 18.415  1.00 75.52  ? 138 ALA A C     1 
ATOM   1423 O O     . ALA C 3 138 ? -24.431 107.628 17.225  1.00 75.95  ? 138 ALA A O     1 
ATOM   1424 C CB    . ALA C 3 138 ? -26.049 107.821 20.091  1.00 73.33  ? 138 ALA A CB    1 
ATOM   1425 N N     . ALA C 3 139 ? -23.125 107.493 19.058  1.00 78.14  ? 139 ALA A N     1 
ATOM   1426 C CA    . ALA C 3 139 ? -21.948 108.049 18.381  1.00 80.92  ? 139 ALA A CA    1 
ATOM   1427 C C     . ALA C 3 139 ? -21.512 107.222 17.165  1.00 82.67  ? 139 ALA A C     1 
ATOM   1428 O O     . ALA C 3 139 ? -20.825 107.732 16.280  1.00 82.25  ? 139 ALA A O     1 
ATOM   1429 C CB    . ALA C 3 139 ? -20.787 108.190 19.366  1.00 80.66  ? 139 ALA A CB    1 
ATOM   1430 N N     . CYS C 3 140 ? -21.905 105.949 17.131  1.00 85.07  ? 140 CYS A N     1 
ATOM   1431 C CA    . CYS C 3 140 ? -21.577 105.080 16.005  1.00 87.61  ? 140 CYS A CA    1 
ATOM   1432 C C     . CYS C 3 140 ? -22.406 105.519 14.814  1.00 88.83  ? 140 CYS A C     1 
ATOM   1433 O O     . CYS C 3 140 ? -23.431 104.915 14.466  1.00 88.51  ? 140 CYS A O     1 
ATOM   1434 C CB    . CYS C 3 140 ? -21.878 103.628 16.343  1.00 88.50  ? 140 CYS A CB    1 
ATOM   1435 S SG    . CYS C 3 140 ? -20.881 103.040 17.715  1.00 90.81  ? 140 CYS A SG    1 
ATOM   1436 N N     . THR C 3 141 ? -21.930 106.601 14.212  1.00 90.77  ? 141 THR A N     1 
ATOM   1437 C CA    . THR C 3 141 ? -22.543 107.241 13.055  1.00 92.23  ? 141 THR A CA    1 
ATOM   1438 C C     . THR C 3 141 ? -22.893 106.267 11.917  1.00 91.97  ? 141 THR A C     1 
ATOM   1439 O O     . THR C 3 141 ? -22.034 105.934 11.078  1.00 91.99  ? 141 THR A O     1 
ATOM   1440 C CB    . THR C 3 141 ? -21.596 108.370 12.510  1.00 93.35  ? 141 THR A CB    1 
ATOM   1441 O OG1   . THR C 3 141 ? -21.254 109.265 13.583  1.00 94.07  ? 141 THR A OG1   1 
ATOM   1442 C CG2   . THR C 3 141 ? -22.269 109.168 11.381  1.00 93.81  ? 141 THR A CG2   1 
ATOM   1443 N N     . ASN C 3 142 ? -24.148 105.803 11.908  1.00 90.79  ? 142 ASN A N     1 
ATOM   1444 C CA    . ASN C 3 142 ? -24.631 104.912 10.855  1.00 89.33  ? 142 ASN A CA    1 
ATOM   1445 C C     . ASN C 3 142 ? -24.190 103.437 10.967  1.00 86.87  ? 142 ASN A C     1 
ATOM   1446 O O     . ASN C 3 142 ? -24.943 102.539 10.580  1.00 86.94  ? 142 ASN A O     1 
ATOM   1447 C CB    . ASN C 3 142 ? -24.202 105.501 9.494   1.00 92.10  ? 142 ASN A CB    1 
ATOM   1448 C CG    . ASN C 3 142 ? -24.899 104.849 8.307   1.00 94.28  ? 142 ASN A CG    1 
ATOM   1449 O OD1   . ASN C 3 142 ? -24.669 103.670 7.994   1.00 95.54  ? 142 ASN A OD1   1 
ATOM   1450 N ND2   . ASN C 3 142 ? -25.756 105.625 7.628   1.00 95.48  ? 142 ASN A ND2   1 
ATOM   1451 N N     . VAL C 3 143 ? -22.992 103.184 11.496  1.00 83.41  ? 143 VAL A N     1 
ATOM   1452 C CA    . VAL C 3 143 ? -22.476 101.814 11.612  1.00 79.58  ? 143 VAL A CA    1 
ATOM   1453 C C     . VAL C 3 143 ? -22.986 100.994 12.793  1.00 76.00  ? 143 VAL A C     1 
ATOM   1454 O O     . VAL C 3 143 ? -23.167 101.519 13.903  1.00 75.95  ? 143 VAL A O     1 
ATOM   1455 C CB    . VAL C 3 143 ? -20.931 101.794 11.669  1.00 80.37  ? 143 VAL A CB    1 
ATOM   1456 C CG1   . VAL C 3 143 ? -20.363 102.242 10.329  1.00 81.19  ? 143 VAL A CG1   1 
ATOM   1457 C CG2   . VAL C 3 143 ? -20.430 102.690 12.809  1.00 80.21  ? 143 VAL A CG2   1 
ATOM   1458 N N     . PRO C 3 144 ? -23.210 99.680  12.565  1.00 72.68  ? 144 PRO A N     1 
ATOM   1459 C CA    . PRO C 3 144 ? -23.701 98.781  13.616  1.00 70.05  ? 144 PRO A CA    1 
ATOM   1460 C C     . PRO C 3 144 ? -22.691 98.548  14.743  1.00 67.67  ? 144 PRO A C     1 
ATOM   1461 O O     . PRO C 3 144 ? -21.476 98.481  14.528  1.00 67.14  ? 144 PRO A O     1 
ATOM   1462 C CB    . PRO C 3 144 ? -24.047 97.494  12.850  1.00 69.53  ? 144 PRO A CB    1 
ATOM   1463 C CG    . PRO C 3 144 ? -23.058 97.493  11.747  1.00 69.94  ? 144 PRO A CG    1 
ATOM   1464 C CD    . PRO C 3 144 ? -23.043 98.948  11.293  1.00 70.88  ? 144 PRO A CD    1 
ATOM   1465 N N     . ALA C 3 145 ? -23.214 98.442  15.957  1.00 65.23  ? 145 ALA A N     1 
ATOM   1466 C CA    . ALA C 3 145 ? -22.387 98.203  17.129  1.00 61.61  ? 145 ALA A CA    1 
ATOM   1467 C C     . ALA C 3 145 ? -22.997 97.058  17.946  1.00 59.09  ? 145 ALA A C     1 
ATOM   1468 O O     . ALA C 3 145 ? -24.226 96.965  18.129  1.00 58.89  ? 145 ALA A O     1 
ATOM   1469 C CB    . ALA C 3 145 ? -22.282 99.481  17.982  1.00 61.00  ? 145 ALA A CB    1 
ATOM   1470 N N     . LEU C 3 146 ? -22.122 96.180  18.414  1.00 55.54  ? 146 LEU A N     1 
ATOM   1471 C CA    . LEU C 3 146 ? -22.535 95.048  19.209  1.00 52.42  ? 146 LEU A CA    1 
ATOM   1472 C C     . LEU C 3 146 ? -21.814 95.185  20.555  1.00 51.26  ? 146 LEU A C     1 
ATOM   1473 O O     . LEU C 3 146 ? -20.615 95.470  20.595  1.00 50.37  ? 146 LEU A O     1 
ATOM   1474 C CB    . LEU C 3 146 ? -22.145 93.761  18.477  1.00 50.78  ? 146 LEU A CB    1 
ATOM   1475 C CG    . LEU C 3 146 ? -22.657 92.426  19.018  1.00 49.56  ? 146 LEU A CG    1 
ATOM   1476 C CD1   . LEU C 3 146 ? -24.165 92.437  19.149  1.00 49.16  ? 146 LEU A CD1   1 
ATOM   1477 C CD2   . LEU C 3 146 ? -22.231 91.340  18.072  1.00 49.13  ? 146 LEU A CD2   1 
ATOM   1478 N N     . PHE C 3 147 ? -22.547 95.012  21.652  1.00 49.91  ? 147 PHE A N     1 
ATOM   1479 C CA    . PHE C 3 147 ? -21.950 95.126  22.974  1.00 48.78  ? 147 PHE A CA    1 
ATOM   1480 C C     . PHE C 3 147 ? -21.735 93.767  23.629  1.00 48.67  ? 147 PHE A C     1 
ATOM   1481 O O     . PHE C 3 147 ? -22.534 92.842  23.434  1.00 48.49  ? 147 PHE A O     1 
ATOM   1482 C CB    . PHE C 3 147 ? -22.811 96.029  23.855  1.00 47.90  ? 147 PHE A CB    1 
ATOM   1483 C CG    . PHE C 3 147 ? -22.850 97.450  23.381  1.00 47.71  ? 147 PHE A CG    1 
ATOM   1484 C CD1   . PHE C 3 147 ? -23.584 97.795  22.248  1.00 47.19  ? 147 PHE A CD1   1 
ATOM   1485 C CD2   . PHE C 3 147 ? -22.099 98.439  24.029  1.00 47.66  ? 147 PHE A CD2   1 
ATOM   1486 C CE1   . PHE C 3 147 ? -23.573 99.106  21.758  1.00 47.12  ? 147 PHE A CE1   1 
ATOM   1487 C CE2   . PHE C 3 147 ? -22.076 99.758  23.550  1.00 46.93  ? 147 PHE A CE2   1 
ATOM   1488 C CZ    . PHE C 3 147 ? -22.816 100.092 22.408  1.00 47.00  ? 147 PHE A CZ    1 
ATOM   1489 N N     . LEU C 3 148 ? -20.640 93.650  24.387  1.00 48.49  ? 148 LEU A N     1 
ATOM   1490 C CA    . LEU C 3 148 ? -20.299 92.396  25.065  1.00 47.84  ? 148 LEU A CA    1 
ATOM   1491 C C     . LEU C 3 148 ? -20.178 92.539  26.563  1.00 46.92  ? 148 LEU A C     1 
ATOM   1492 O O     . LEU C 3 148 ? -20.120 91.522  27.266  1.00 46.84  ? 148 LEU A O     1 
ATOM   1493 C CB    . LEU C 3 148 ? -18.985 91.819  24.541  1.00 48.13  ? 148 LEU A CB    1 
ATOM   1494 C CG    . LEU C 3 148 ? -18.879 91.441  23.064  1.00 48.23  ? 148 LEU A CG    1 
ATOM   1495 C CD1   . LEU C 3 148 ? -17.558 90.706  22.862  1.00 48.44  ? 148 LEU A CD1   1 
ATOM   1496 C CD2   . LEU C 3 148 ? -20.070 90.564  22.647  1.00 47.12  ? 148 LEU A CD2   1 
ATOM   1497 N N     . ASP C 3 149 ? -20.104 93.785  27.043  1.00 45.43  ? 149 ASP A N     1 
ATOM   1498 C CA    . ASP C 3 149 ? -20.018 94.042  28.484  1.00 44.88  ? 149 ASP A CA    1 
ATOM   1499 C C     . ASP C 3 149 ? -21.066 95.060  28.919  1.00 43.16  ? 149 ASP A C     1 
ATOM   1500 O O     . ASP C 3 149 ? -20.734 96.180  29.333  1.00 42.92  ? 149 ASP A O     1 
ATOM   1501 C CB    . ASP C 3 149 ? -18.617 94.538  28.898  1.00 46.04  ? 149 ASP A CB    1 
ATOM   1502 C CG    . ASP C 3 149 ? -18.343 94.363  30.409  1.00 47.05  ? 149 ASP A CG    1 
ATOM   1503 O OD1   . ASP C 3 149 ? -19.144 93.688  31.101  1.00 48.26  ? 149 ASP A OD1   1 
ATOM   1504 O OD2   . ASP C 3 149 ? -17.316 94.885  30.902  1.00 45.70  ? 149 ASP A OD2   1 
ATOM   1505 N N     . VAL C 3 150 ? -22.332 94.662  28.804  1.00 40.93  ? 150 VAL A N     1 
ATOM   1506 C CA    . VAL C 3 150 ? -23.454 95.498  29.205  1.00 38.74  ? 150 VAL A CA    1 
ATOM   1507 C C     . VAL C 3 150 ? -24.419 94.537  29.858  1.00 38.13  ? 150 VAL A C     1 
ATOM   1508 O O     . VAL C 3 150 ? -24.160 93.335  29.881  1.00 37.99  ? 150 VAL A O     1 
ATOM   1509 C CB    . VAL C 3 150 ? -24.149 96.180  27.998  1.00 37.81  ? 150 VAL A CB    1 
ATOM   1510 C CG1   . VAL C 3 150 ? -23.196 97.163  27.336  1.00 37.33  ? 150 VAL A CG1   1 
ATOM   1511 C CG2   . VAL C 3 150 ? -24.624 95.133  27.000  1.00 35.57  ? 150 VAL A CG2   1 
ATOM   1512 N N     . SER C 3 151 ? -25.512 95.056  30.400  1.00 37.05  ? 151 SER A N     1 
ATOM   1513 C CA    . SER C 3 151 ? -26.494 94.202  31.034  1.00 35.98  ? 151 SER A CA    1 
ATOM   1514 C C     . SER C 3 151 ? -27.501 93.719  30.007  1.00 35.91  ? 151 SER A C     1 
ATOM   1515 O O     . SER C 3 151 ? -27.697 94.351  28.970  1.00 35.16  ? 151 SER A O     1 
ATOM   1516 C CB    . SER C 3 151 ? -27.220 94.956  32.123  1.00 35.04  ? 151 SER A CB    1 
ATOM   1517 O OG    . SER C 3 151 ? -28.441 94.312  32.379  1.00 35.38  ? 151 SER A OG    1 
ATOM   1518 N N     . ASP C 3 152 ? -28.138 92.590  30.291  1.00 36.89  ? 152 ASP A N     1 
ATOM   1519 C CA    . ASP C 3 152 ? -29.122 92.047  29.364  1.00 38.92  ? 152 ASP A CA    1 
ATOM   1520 C C     . ASP C 3 152 ? -30.310 92.987  29.209  1.00 40.69  ? 152 ASP A C     1 
ATOM   1521 O O     . ASP C 3 152 ? -31.101 92.847  28.281  1.00 41.44  ? 152 ASP A O     1 
ATOM   1522 C CB    . ASP C 3 152 ? -29.621 90.676  29.829  1.00 38.67  ? 152 ASP A CB    1 
ATOM   1523 C CG    . ASP C 3 152 ? -29.999 90.658  31.294  1.00 40.67  ? 152 ASP A CG    1 
ATOM   1524 O OD1   . ASP C 3 152 ? -30.739 89.738  31.710  1.00 41.36  ? 152 ASP A OD1   1 
ATOM   1525 O OD2   . ASP C 3 152 ? -29.543 91.553  32.034  1.00 41.34  ? 152 ASP A OD2   1 
ATOM   1526 N N     . GLN C 3 153 ? -30.430 93.958  30.110  1.00 41.99  ? 153 GLN A N     1 
ATOM   1527 C CA    . GLN C 3 153 ? -31.545 94.899  30.065  1.00 41.85  ? 153 GLN A CA    1 
ATOM   1528 C C     . GLN C 3 153 ? -31.279 96.127  29.250  1.00 42.65  ? 153 GLN A C     1 
ATOM   1529 O O     . GLN C 3 153 ? -32.185 96.904  28.986  1.00 42.95  ? 153 GLN A O     1 
ATOM   1530 C CB    . GLN C 3 153 ? -31.919 95.327  31.461  1.00 41.32  ? 153 GLN A CB    1 
ATOM   1531 C CG    . GLN C 3 153 ? -32.577 94.238  32.234  1.00 40.99  ? 153 GLN A CG    1 
ATOM   1532 C CD    . GLN C 3 153 ? -32.555 94.550  33.683  1.00 42.56  ? 153 GLN A CD    1 
ATOM   1533 O OE1   . GLN C 3 153 ? -33.250 93.914  34.470  1.00 42.92  ? 153 GLN A OE1   1 
ATOM   1534 N NE2   . GLN C 3 153 ? -31.739 95.547  34.063  1.00 43.18  ? 153 GLN A NE2   1 
ATOM   1535 N N     . THR C 3 154 ? -30.033 96.325  28.859  1.00 43.98  ? 154 THR A N     1 
ATOM   1536 C CA    . THR C 3 154 ? -29.740 97.487  28.057  1.00 45.57  ? 154 THR A CA    1 
ATOM   1537 C C     . THR C 3 154 ? -30.372 97.299  26.688  1.00 46.58  ? 154 THR A C     1 
ATOM   1538 O O     . THR C 3 154 ? -30.228 96.250  26.041  1.00 46.19  ? 154 THR A O     1 
ATOM   1539 C CB    . THR C 3 154 ? -28.259 97.699  27.883  1.00 46.38  ? 154 THR A CB    1 
ATOM   1540 O OG1   . THR C 3 154 ? -27.606 97.511  29.145  1.00 47.45  ? 154 THR A OG1   1 
ATOM   1541 C CG2   . THR C 3 154 ? -28.004 99.117  27.384  1.00 46.11  ? 154 THR A CG2   1 
ATOM   1542 N N     . PRO C 3 155 ? -31.096 98.325  26.231  1.00 48.35  ? 155 PRO A N     1 
ATOM   1543 C CA    . PRO C 3 155 ? -31.781 98.317  24.938  1.00 48.00  ? 155 PRO A CA    1 
ATOM   1544 C C     . PRO C 3 155 ? -30.848 98.482  23.746  1.00 47.60  ? 155 PRO A C     1 
ATOM   1545 O O     . PRO C 3 155 ? -30.975 99.435  22.981  1.00 48.08  ? 155 PRO A O     1 
ATOM   1546 C CB    . PRO C 3 155 ? -32.756 99.478  25.071  1.00 48.38  ? 155 PRO A CB    1 
ATOM   1547 C CG    . PRO C 3 155 ? -31.948 100.476 25.891  1.00 48.33  ? 155 PRO A CG    1 
ATOM   1548 C CD    . PRO C 3 155 ? -31.346 99.586  26.962  1.00 48.42  ? 155 PRO A CD    1 
ATOM   1549 N N     . ILE C 3 156 ? -29.903 97.563  23.594  1.00 47.63  ? 156 ILE A N     1 
ATOM   1550 C CA    . ILE C 3 156 ? -28.984 97.626  22.466  1.00 47.64  ? 156 ILE A CA    1 
ATOM   1551 C C     . ILE C 3 156 ? -28.656 96.201  22.015  1.00 47.55  ? 156 ILE A C     1 
ATOM   1552 O O     . ILE C 3 156 ? -29.147 95.231  22.615  1.00 47.34  ? 156 ILE A O     1 
ATOM   1553 C CB    . ILE C 3 156 ? -27.675 98.423  22.825  1.00 47.07  ? 156 ILE A CB    1 
ATOM   1554 C CG1   . ILE C 3 156 ? -27.128 97.998  24.192  1.00 46.08  ? 156 ILE A CG1   1 
ATOM   1555 C CG2   . ILE C 3 156 ? -27.961 99.922  22.832  1.00 46.69  ? 156 ILE A CG2   1 
ATOM   1556 C CD1   . ILE C 3 156 ? -25.778 98.615  24.527  1.00 45.49  ? 156 ILE A CD1   1 
ATOM   1557 N N     . ASN C 3 157 ? -27.872 96.069  20.943  1.00 47.54  ? 157 ASN A N     1 
ATOM   1558 C CA    . ASN C 3 157 ? -27.482 94.742  20.459  1.00 46.76  ? 157 ASN A CA    1 
ATOM   1559 C C     . ASN C 3 157 ? -26.380 94.273  21.370  1.00 46.11  ? 157 ASN A C     1 
ATOM   1560 O O     . ASN C 3 157 ? -25.446 95.028  21.675  1.00 46.38  ? 157 ASN A O     1 
ATOM   1561 C CB    . ASN C 3 157 ? -26.973 94.808  19.035  1.00 47.68  ? 157 ASN A CB    1 
ATOM   1562 C CG    . ASN C 3 157 ? -28.014 95.322  18.095  1.00 48.85  ? 157 ASN A CG    1 
ATOM   1563 O OD1   . ASN C 3 157 ? -29.095 94.725  17.974  1.00 48.90  ? 157 ASN A OD1   1 
ATOM   1564 N ND2   . ASN C 3 157 ? -27.714 96.445  17.421  1.00 49.07  ? 157 ASN A ND2   1 
ATOM   1565 N N     . SER C 3 158 ? -26.474 93.024  21.801  1.00 44.43  ? 158 SER A N     1 
ATOM   1566 C CA    . SER C 3 158 ? -25.488 92.533  22.738  1.00 43.47  ? 158 SER A CA    1 
ATOM   1567 C C     . SER C 3 158 ? -25.462 91.029  22.892  1.00 42.93  ? 158 SER A C     1 
ATOM   1568 O O     . SER C 3 158 ? -26.490 90.357  22.764  1.00 41.83  ? 158 SER A O     1 
ATOM   1569 C CB    . SER C 3 158 ? -25.771 93.145  24.112  1.00 43.48  ? 158 SER A CB    1 
ATOM   1570 O OG    . SER C 3 158 ? -27.085 92.790  24.540  1.00 42.56  ? 158 SER A OG    1 
ATOM   1571 N N     . ILE C 3 159 ? -24.270 90.511  23.178  1.00 42.72  ? 159 ILE A N     1 
ATOM   1572 C CA    . ILE C 3 159 ? -24.098 89.089  23.424  1.00 42.42  ? 159 ILE A CA    1 
ATOM   1573 C C     . ILE C 3 159 ? -23.331 88.945  24.735  1.00 41.53  ? 159 ILE A C     1 
ATOM   1574 O O     . ILE C 3 159 ? -22.256 89.551  24.932  1.00 40.57  ? 159 ILE A O     1 
ATOM   1575 C CB    . ILE C 3 159 ? -23.314 88.376  22.307  1.00 42.40  ? 159 ILE A CB    1 
ATOM   1576 C CG1   . ILE C 3 159 ? -23.911 88.706  20.943  1.00 42.38  ? 159 ILE A CG1   1 
ATOM   1577 C CG2   . ILE C 3 159 ? -23.405 86.862  22.507  1.00 41.05  ? 159 ILE A CG2   1 
ATOM   1578 C CD1   . ILE C 3 159 ? -23.235 87.975  19.820  1.00 42.58  ? 159 ILE A CD1   1 
ATOM   1579 N N     . ILE C 3 160 ? -23.902 88.140  25.625  1.00 41.01  ? 160 ILE A N     1 
ATOM   1580 C CA    . ILE C 3 160 ? -23.312 87.912  26.923  1.00 41.76  ? 160 ILE A CA    1 
ATOM   1581 C C     . ILE C 3 160 ? -23.695 86.547  27.449  1.00 41.94  ? 160 ILE A C     1 
ATOM   1582 O O     . ILE C 3 160 ? -24.745 86.004  27.124  1.00 40.99  ? 160 ILE A O     1 
ATOM   1583 C CB    . ILE C 3 160 ? -23.809 88.930  27.932  1.00 41.06  ? 160 ILE A CB    1 
ATOM   1584 C CG1   . ILE C 3 160 ? -25.293 88.686  28.198  1.00 40.45  ? 160 ILE A CG1   1 
ATOM   1585 C CG2   . ILE C 3 160 ? -23.618 90.342  27.388  1.00 41.02  ? 160 ILE A CG2   1 
ATOM   1586 C CD1   . ILE C 3 160 ? -25.834 89.522  29.301  1.00 40.19  ? 160 ILE A CD1   1 
ATOM   1587 N N     . PHE C 3 161 ? -22.826 85.987  28.276  1.00 43.88  ? 161 PHE A N     1 
ATOM   1588 C CA    . PHE C 3 161 ? -23.106 84.685  28.876  1.00 45.40  ? 161 PHE A CA    1 
ATOM   1589 C C     . PHE C 3 161 ? -24.188 84.887  29.919  1.00 45.24  ? 161 PHE A C     1 
ATOM   1590 O O     . PHE C 3 161 ? -24.250 85.975  30.566  1.00 44.59  ? 161 PHE A O     1 
ATOM   1591 C CB    . PHE C 3 161 ? -21.853 84.101  29.545  1.00 47.32  ? 161 PHE A CB    1 
ATOM   1592 C CG    . PHE C 3 161 ? -20.809 83.631  28.561  1.00 48.52  ? 161 PHE A CG    1 
ATOM   1593 C CD1   . PHE C 3 161 ? -19.755 84.461  28.196  1.00 47.78  ? 161 PHE A CD1   1 
ATOM   1594 C CD2   . PHE C 3 161 ? -20.907 82.367  27.980  1.00 49.40  ? 161 PHE A CD2   1 
ATOM   1595 C CE1   . PHE C 3 161 ? -18.813 84.051  27.275  1.00 48.53  ? 161 PHE A CE1   1 
ATOM   1596 C CE2   . PHE C 3 161 ? -19.975 81.935  27.054  1.00 50.12  ? 161 PHE A CE2   1 
ATOM   1597 C CZ    . PHE C 3 161 ? -18.915 82.779  26.692  1.00 50.03  ? 161 PHE A CZ    1 
ATOM   1598 N N     . SER C 3 162 ? -25.025 83.856  30.085  1.00 45.37  ? 162 SER A N     1 
ATOM   1599 C CA    . SER C 3 162 ? -26.117 83.916  31.058  1.00 45.09  ? 162 SER A CA    1 
ATOM   1600 C C     . SER C 3 162 ? -25.725 83.828  32.528  1.00 44.69  ? 162 SER A C     1 
ATOM   1601 O O     . SER C 3 162 ? -25.638 82.726  33.110  1.00 43.40  ? 162 SER A O     1 
ATOM   1602 C CB    . SER C 3 162 ? -27.129 82.824  30.791  1.00 45.48  ? 162 SER A CB    1 
ATOM   1603 O OG    . SER C 3 162 ? -28.002 82.697  31.897  1.00 44.27  ? 162 SER A OG    1 
ATOM   1604 N N     . HIS C 3 163 ? -25.516 85.002  33.115  1.00 44.95  ? 163 HIS A N     1 
ATOM   1605 C CA    . HIS C 3 163 ? -25.147 85.119  34.511  1.00 45.06  ? 163 HIS A CA    1 
ATOM   1606 C C     . HIS C 3 163 ? -26.273 84.528  35.329  1.00 44.21  ? 163 HIS A C     1 
ATOM   1607 O O     . HIS C 3 163 ? -26.066 84.079  36.457  1.00 43.35  ? 163 HIS A O     1 
ATOM   1608 C CB    . HIS C 3 163 ? -24.953 86.586  34.844  1.00 46.21  ? 163 HIS A CB    1 
ATOM   1609 C CG    . HIS C 3 163 ? -26.114 87.443  34.450  1.00 46.59  ? 163 HIS A CG    1 
ATOM   1610 N ND1   . HIS C 3 163 ? -27.215 87.625  35.260  1.00 47.27  ? 163 HIS A ND1   1 
ATOM   1611 C CD2   . HIS C 3 163 ? -26.350 88.162  33.327  1.00 46.71  ? 163 HIS A CD2   1 
ATOM   1612 C CE1   . HIS C 3 163 ? -28.076 88.424  34.655  1.00 46.55  ? 163 HIS A CE1   1 
ATOM   1613 N NE2   . HIS C 3 163 ? -27.576 88.764  33.481  1.00 46.66  ? 163 HIS A NE2   1 
ATOM   1614 N N     . GLU C 3 164 ? -27.470 84.525  34.754  1.00 43.97  ? 164 GLU A N     1 
ATOM   1615 C CA    . GLU C 3 164 ? -28.589 83.952  35.470  1.00 44.96  ? 164 GLU A CA    1 
ATOM   1616 C C     . GLU C 3 164 ? -28.281 82.453  35.653  1.00 44.30  ? 164 GLU A C     1 
ATOM   1617 O O     . GLU C 3 164 ? -28.338 81.934  36.774  1.00 44.22  ? 164 GLU A O     1 
ATOM   1618 C CB    . GLU C 3 164 ? -29.900 84.145  34.687  1.00 46.99  ? 164 GLU A CB    1 
ATOM   1619 C CG    . GLU C 3 164 ? -31.171 84.206  35.565  1.00 48.65  ? 164 GLU A CG    1 
ATOM   1620 C CD    . GLU C 3 164 ? -31.508 85.623  36.035  1.00 50.19  ? 164 GLU A CD    1 
ATOM   1621 O OE1   . GLU C 3 164 ? -32.300 85.770  36.985  1.00 50.33  ? 164 GLU A OE1   1 
ATOM   1622 O OE2   . GLU C 3 164 ? -30.991 86.598  35.449  1.00 52.22  ? 164 GLU A OE2   1 
ATOM   1623 N N     . ASP C 3 165 ? -27.927 81.765  34.563  1.00 42.95  ? 165 ASP A N     1 
ATOM   1624 C CA    . ASP C 3 165 ? -27.629 80.336  34.637  1.00 41.53  ? 165 ASP A CA    1 
ATOM   1625 C C     . ASP C 3 165 ? -26.375 80.025  35.428  1.00 40.46  ? 165 ASP A C     1 
ATOM   1626 O O     . ASP C 3 165 ? -26.320 79.028  36.146  1.00 40.31  ? 165 ASP A O     1 
ATOM   1627 C CB    . ASP C 3 165 ? -27.476 79.741  33.241  1.00 41.89  ? 165 ASP A CB    1 
ATOM   1628 C CG    . ASP C 3 165 ? -28.796 79.553  32.547  1.00 42.29  ? 165 ASP A CG    1 
ATOM   1629 O OD1   . ASP C 3 165 ? -29.675 78.877  33.124  1.00 42.06  ? 165 ASP A OD1   1 
ATOM   1630 O OD2   . ASP C 3 165 ? -28.952 80.073  31.422  1.00 42.94  ? 165 ASP A OD2   1 
ATOM   1631 N N     . GLY C 3 166 ? -25.364 80.874  35.290  1.00 39.12  ? 166 GLY A N     1 
ATOM   1632 C CA    . GLY C 3 166 ? -24.121 80.642  35.997  1.00 37.48  ? 166 GLY A CA    1 
ATOM   1633 C C     . GLY C 3 166 ? -24.242 80.716  37.504  1.00 36.20  ? 166 GLY A C     1 
ATOM   1634 O O     . GLY C 3 166 ? -23.793 79.827  38.225  1.00 35.19  ? 166 GLY A O     1 
ATOM   1635 N N     . THR C 3 167 ? -24.852 81.784  37.988  1.00 35.88  ? 167 THR A N     1 
ATOM   1636 C CA    . THR C 3 167 ? -24.997 81.963  39.417  1.00 36.92  ? 167 THR A CA    1 
ATOM   1637 C C     . THR C 3 167 ? -25.913 80.931  40.031  1.00 37.06  ? 167 THR A C     1 
ATOM   1638 O O     . THR C 3 167 ? -25.710 80.516  41.168  1.00 36.95  ? 167 THR A O     1 
ATOM   1639 C CB    . THR C 3 167 ? -25.553 83.327  39.729  1.00 37.20  ? 167 THR A CB    1 
ATOM   1640 O OG1   . THR C 3 167 ? -26.700 83.546  38.901  1.00 35.98  ? 167 THR A OG1   1 
ATOM   1641 C CG2   . THR C 3 167 ? -24.499 84.410  39.472  1.00 36.96  ? 167 THR A CG2   1 
ATOM   1642 N N     . ARG C 3 168 ? -26.928 80.520  39.286  1.00 38.03  ? 168 ARG A N     1 
ATOM   1643 C CA    . ARG C 3 168 ? -27.864 79.521  39.796  1.00 39.55  ? 168 ARG A CA    1 
ATOM   1644 C C     . ARG C 3 168 ? -27.105 78.206  39.994  1.00 38.60  ? 168 ARG A C     1 
ATOM   1645 O O     . ARG C 3 168 ? -27.116 77.617  41.077  1.00 36.71  ? 168 ARG A O     1 
ATOM   1646 C CB    . ARG C 3 168 ? -29.016 79.325  38.793  1.00 42.36  ? 168 ARG A CB    1 
ATOM   1647 C CG    . ARG C 3 168 ? -30.235 78.557  39.322  1.00 45.68  ? 168 ARG A CG    1 
ATOM   1648 C CD    . ARG C 3 168 ? -31.126 78.088  38.175  1.00 49.36  ? 168 ARG A CD    1 
ATOM   1649 N NE    . ARG C 3 168 ? -30.427 77.087  37.377  1.00 55.69  ? 168 ARG A NE    1 
ATOM   1650 C CZ    . ARG C 3 168 ? -30.685 76.812  36.102  1.00 58.44  ? 168 ARG A CZ    1 
ATOM   1651 N NH1   . ARG C 3 168 ? -31.644 77.470  35.460  1.00 59.84  ? 168 ARG A NH1   1 
ATOM   1652 N NH2   . ARG C 3 168 ? -29.965 75.889  35.466  1.00 60.51  ? 168 ARG A NH2   1 
ATOM   1653 N N     . LEU C 3 169 ? -26.445 77.778  38.918  1.00 38.49  ? 169 LEU A N     1 
ATOM   1654 C CA    . LEU C 3 169 ? -25.658 76.552  38.872  1.00 38.78  ? 169 LEU A CA    1 
ATOM   1655 C C     . LEU C 3 169 ? -24.735 76.457  40.059  1.00 39.32  ? 169 LEU A C     1 
ATOM   1656 O O     . LEU C 3 169 ? -24.582 75.394  40.666  1.00 39.39  ? 169 LEU A O     1 
ATOM   1657 C CB    . LEU C 3 169 ? -24.827 76.534  37.591  1.00 38.47  ? 169 LEU A CB    1 
ATOM   1658 C CG    . LEU C 3 169 ? -25.137 75.494  36.507  1.00 39.67  ? 169 LEU A CG    1 
ATOM   1659 C CD1   . LEU C 3 169 ? -26.569 74.990  36.615  1.00 40.00  ? 169 LEU A CD1   1 
ATOM   1660 C CD2   . LEU C 3 169 ? -24.887 76.121  35.136  1.00 39.20  ? 169 LEU A CD2   1 
ATOM   1661 N N     . GLY C 3 170 ? -24.111 77.590  40.366  1.00 40.19  ? 170 GLY A N     1 
ATOM   1662 C CA    . GLY C 3 170 ? -23.187 77.666  41.480  1.00 40.46  ? 170 GLY A CA    1 
ATOM   1663 C C     . GLY C 3 170 ? -23.897 77.562  42.811  1.00 40.65  ? 170 GLY A C     1 
ATOM   1664 O O     . GLY C 3 170 ? -23.484 76.782  43.680  1.00 40.21  ? 170 GLY A O     1 
ATOM   1665 N N     . VAL C 3 171 ? -24.971 78.337  42.970  1.00 40.89  ? 171 VAL A N     1 
ATOM   1666 C CA    . VAL C 3 171 ? -25.729 78.318  44.220  1.00 41.24  ? 171 VAL A CA    1 
ATOM   1667 C C     . VAL C 3 171 ? -26.425 76.978  44.455  1.00 41.32  ? 171 VAL A C     1 
ATOM   1668 O O     . VAL C 3 171 ? -26.342 76.407  45.547  1.00 39.91  ? 171 VAL A O     1 
ATOM   1669 C CB    . VAL C 3 171 ? -26.791 79.439  44.276  1.00 40.46  ? 171 VAL A CB    1 
ATOM   1670 C CG1   . VAL C 3 171 ? -27.573 79.330  45.577  1.00 39.56  ? 171 VAL A CG1   1 
ATOM   1671 C CG2   . VAL C 3 171 ? -26.122 80.796  44.209  1.00 38.79  ? 171 VAL A CG2   1 
ATOM   1672 N N     . GLU C 3 172 ? -27.116 76.474  43.442  1.00 42.19  ? 172 GLU A N     1 
ATOM   1673 C CA    . GLU C 3 172 ? -27.794 75.203  43.611  1.00 43.90  ? 172 GLU A CA    1 
ATOM   1674 C C     . GLU C 3 172 ? -26.807 74.069  43.887  1.00 43.63  ? 172 GLU A C     1 
ATOM   1675 O O     . GLU C 3 172 ? -27.162 73.097  44.551  1.00 43.46  ? 172 GLU A O     1 
ATOM   1676 C CB    . GLU C 3 172 ? -28.646 74.887  42.378  1.00 46.31  ? 172 GLU A CB    1 
ATOM   1677 C CG    . GLU C 3 172 ? -29.947 75.696  42.303  1.00 50.19  ? 172 GLU A CG    1 
ATOM   1678 C CD    . GLU C 3 172 ? -30.795 75.370  41.063  1.00 51.83  ? 172 GLU A CD    1 
ATOM   1679 O OE1   . GLU C 3 172 ? -31.897 75.956  40.929  1.00 52.87  ? 172 GLU A OE1   1 
ATOM   1680 O OE2   . GLU C 3 172 ? -30.364 74.536  40.223  1.00 51.65  ? 172 GLU A OE2   1 
ATOM   1681 N N     . HIS C 3 173 ? -25.576 74.192  43.385  1.00 43.75  ? 173 HIS A N     1 
ATOM   1682 C CA    . HIS C 3 173 ? -24.561 73.157  43.605  1.00 43.57  ? 173 HIS A CA    1 
ATOM   1683 C C     . HIS C 3 173 ? -24.159 73.143  45.074  1.00 42.93  ? 173 HIS A C     1 
ATOM   1684 O O     . HIS C 3 173 ? -24.137 72.086  45.710  1.00 42.26  ? 173 HIS A O     1 
ATOM   1685 C CB    . HIS C 3 173 ? -23.310 73.400  42.738  1.00 43.44  ? 173 HIS A CB    1 
ATOM   1686 C CG    . HIS C 3 173 ? -22.221 72.376  42.935  1.00 44.17  ? 173 HIS A CG    1 
ATOM   1687 N ND1   . HIS C 3 173 ? -22.379 71.037  42.626  1.00 44.05  ? 173 HIS A ND1   1 
ATOM   1688 C CD2   . HIS C 3 173 ? -20.949 72.504  43.391  1.00 43.56  ? 173 HIS A CD2   1 
ATOM   1689 C CE1   . HIS C 3 173 ? -21.253 70.390  42.878  1.00 43.07  ? 173 HIS A CE1   1 
ATOM   1690 N NE2   . HIS C 3 173 ? -20.370 71.257  43.342  1.00 43.59  ? 173 HIS A NE2   1 
ATOM   1691 N N     . LEU C 3 174 ? -23.838 74.321  45.598  1.00 42.62  ? 174 LEU A N     1 
ATOM   1692 C CA    . LEU C 3 174 ? -23.436 74.458  46.995  1.00 43.49  ? 174 LEU A CA    1 
ATOM   1693 C C     . LEU C 3 174 ? -24.521 74.013  47.966  1.00 44.77  ? 174 LEU A C     1 
ATOM   1694 O O     . LEU C 3 174 ? -24.242 73.401  49.005  1.00 44.35  ? 174 LEU A O     1 
ATOM   1695 C CB    . LEU C 3 174 ? -23.071 75.907  47.287  1.00 42.20  ? 174 LEU A CB    1 
ATOM   1696 C CG    . LEU C 3 174 ? -21.750 76.350  46.669  1.00 41.38  ? 174 LEU A CG    1 
ATOM   1697 C CD1   . LEU C 3 174 ? -21.525 77.817  46.941  1.00 40.30  ? 174 LEU A CD1   1 
ATOM   1698 C CD2   . LEU C 3 174 ? -20.623 75.527  47.268  1.00 41.65  ? 174 LEU A CD2   1 
ATOM   1699 N N     . VAL C 3 175 ? -25.761 74.339  47.626  1.00 46.86  ? 175 VAL A N     1 
ATOM   1700 C CA    . VAL C 3 175 ? -26.898 73.974  48.462  1.00 48.93  ? 175 VAL A CA    1 
ATOM   1701 C C     . VAL C 3 175 ? -27.138 72.465  48.457  1.00 49.22  ? 175 VAL A C     1 
ATOM   1702 O O     . VAL C 3 175 ? -27.355 71.862  49.513  1.00 48.28  ? 175 VAL A O     1 
ATOM   1703 C CB    . VAL C 3 175 ? -28.176 74.700  47.987  1.00 49.34  ? 175 VAL A CB    1 
ATOM   1704 C CG1   . VAL C 3 175 ? -29.417 74.073  48.637  1.00 49.38  ? 175 VAL A CG1   1 
ATOM   1705 C CG2   . VAL C 3 175 ? -28.073 76.188  48.342  1.00 48.53  ? 175 VAL A CG2   1 
ATOM   1706 N N     . ALA C 3 176 ? -27.109 71.866  47.268  1.00 50.14  ? 176 ALA A N     1 
ATOM   1707 C CA    . ALA C 3 176 ? -27.304 70.425  47.138  1.00 51.84  ? 176 ALA A CA    1 
ATOM   1708 C C     . ALA C 3 176 ? -26.252 69.684  47.980  1.00 53.01  ? 176 ALA A C     1 
ATOM   1709 O O     . ALA C 3 176 ? -26.474 68.557  48.437  1.00 53.04  ? 176 ALA A O     1 
ATOM   1710 C CB    . ALA C 3 176 ? -27.198 70.018  45.673  1.00 51.51  ? 176 ALA A CB    1 
ATOM   1711 N N     . LEU C 3 177 ? -25.102 70.324  48.174  1.00 54.70  ? 177 LEU A N     1 
ATOM   1712 C CA    . LEU C 3 177 ? -24.028 69.751  48.984  1.00 55.87  ? 177 LEU A CA    1 
ATOM   1713 C C     . LEU C 3 177 ? -24.355 70.013  50.445  1.00 56.26  ? 177 LEU A C     1 
ATOM   1714 O O     . LEU C 3 177 ? -23.683 69.516  51.352  1.00 55.58  ? 177 LEU A O     1 
ATOM   1715 C CB    . LEU C 3 177 ? -22.679 70.387  48.619  1.00 56.35  ? 177 LEU A CB    1 
ATOM   1716 C CG    . LEU C 3 177 ? -21.735 69.535  47.756  1.00 56.71  ? 177 LEU A CG    1 
ATOM   1717 C CD1   . LEU C 3 177 ? -22.534 68.457  46.989  1.00 56.14  ? 177 LEU A CD1   1 
ATOM   1718 C CD2   . LEU C 3 177 ? -20.953 70.453  46.811  1.00 56.20  ? 177 LEU A CD2   1 
ATOM   1719 N N     . GLY C 3 178 ? -25.392 70.815  50.655  1.00 57.16  ? 178 GLY A N     1 
ATOM   1720 C CA    . GLY C 3 178 ? -25.831 71.112  51.998  1.00 59.68  ? 178 GLY A CA    1 
ATOM   1721 C C     . GLY C 3 178 ? -25.185 72.300  52.667  1.00 61.40  ? 178 GLY A C     1 
ATOM   1722 O O     . GLY C 3 178 ? -25.200 72.400  53.900  1.00 61.54  ? 178 GLY A O     1 
ATOM   1723 N N     . HIS C 3 179 ? -24.621 73.205  51.876  1.00 63.33  ? 179 HIS A N     1 
ATOM   1724 C CA    . HIS C 3 179 ? -23.984 74.393  52.449  1.00 65.24  ? 179 HIS A CA    1 
ATOM   1725 C C     . HIS C 3 179 ? -25.020 75.476  52.819  1.00 65.35  ? 179 HIS A C     1 
ATOM   1726 O O     . HIS C 3 179 ? -26.026 75.667  52.098  1.00 64.81  ? 179 HIS A O     1 
ATOM   1727 C CB    . HIS C 3 179 ? -22.945 74.943  51.464  1.00 66.13  ? 179 HIS A CB    1 
ATOM   1728 C CG    . HIS C 3 179 ? -21.758 74.050  51.298  1.00 66.89  ? 179 HIS A CG    1 
ATOM   1729 N ND1   . HIS C 3 179 ? -20.779 73.931  52.263  1.00 67.27  ? 179 HIS A ND1   1 
ATOM   1730 C CD2   . HIS C 3 179 ? -21.423 73.187  50.309  1.00 67.13  ? 179 HIS A CD2   1 
ATOM   1731 C CE1   . HIS C 3 179 ? -19.891 73.032  51.875  1.00 67.86  ? 179 HIS A CE1   1 
ATOM   1732 N NE2   . HIS C 3 179 ? -20.259 72.565  50.693  1.00 68.26  ? 179 HIS A NE2   1 
ATOM   1733 N N     . GLN C 3 180 ? -24.783 76.157  53.949  1.00 64.83  ? 180 GLN A N     1 
ATOM   1734 C CA    . GLN C 3 180 ? -25.686 77.212  54.413  1.00 64.50  ? 180 GLN A CA    1 
ATOM   1735 C C     . GLN C 3 180 ? -24.892 78.456  54.778  1.00 62.89  ? 180 GLN A C     1 
ATOM   1736 O O     . GLN C 3 180 ? -25.366 79.584  54.630  1.00 62.95  ? 180 GLN A O     1 
ATOM   1737 C CB    . GLN C 3 180 ? -26.509 76.734  55.624  1.00 67.18  ? 180 GLN A CB    1 
ATOM   1738 C CG    . GLN C 3 180 ? -27.462 75.550  55.312  1.00 70.45  ? 180 GLN A CG    1 
ATOM   1739 C CD    . GLN C 3 180 ? -28.370 75.145  56.484  1.00 71.63  ? 180 GLN A CD    1 
ATOM   1740 O OE1   . GLN C 3 180 ? -27.898 74.810  57.580  1.00 72.32  ? 180 GLN A OE1   1 
ATOM   1741 N NE2   . GLN C 3 180 ? -29.682 75.164  56.243  1.00 70.97  ? 180 GLN A NE2   1 
ATOM   1742 N N     . GLN C 3 181 ? -23.675 78.244  55.260  1.00 61.08  ? 181 GLN A N     1 
ATOM   1743 C CA    . GLN C 3 181 ? -22.798 79.355  55.623  1.00 58.99  ? 181 GLN A CA    1 
ATOM   1744 C C     . GLN C 3 181 ? -21.971 79.758  54.381  1.00 55.97  ? 181 GLN A C     1 
ATOM   1745 O O     . GLN C 3 181 ? -20.798 79.386  54.250  1.00 56.04  ? 181 GLN A O     1 
ATOM   1746 C CB    . GLN C 3 181 ? -21.862 78.917  56.757  1.00 60.67  ? 181 GLN A CB    1 
ATOM   1747 C CG    . GLN C 3 181 ? -22.562 78.475  58.024  1.00 62.62  ? 181 GLN A CG    1 
ATOM   1748 C CD    . GLN C 3 181 ? -23.184 79.639  58.756  1.00 65.16  ? 181 GLN A CD    1 
ATOM   1749 O OE1   . GLN C 3 181 ? -22.480 80.480  59.335  1.00 65.91  ? 181 GLN A OE1   1 
ATOM   1750 N NE2   . GLN C 3 181 ? -24.515 79.709  58.727  1.00 67.01  ? 181 GLN A NE2   1 
ATOM   1751 N N     . ILE C 3 182 ? -22.568 80.512  53.466  1.00 51.66  ? 182 ILE A N     1 
ATOM   1752 C CA    . ILE C 3 182 ? -21.845 80.898  52.263  1.00 47.02  ? 182 ILE A CA    1 
ATOM   1753 C C     . ILE C 3 182 ? -21.393 82.357  52.298  1.00 45.35  ? 182 ILE A C     1 
ATOM   1754 O O     . ILE C 3 182 ? -22.069 83.218  52.854  1.00 45.80  ? 182 ILE A O     1 
ATOM   1755 C CB    . ILE C 3 182 ? -22.715 80.635  51.014  1.00 45.07  ? 182 ILE A CB    1 
ATOM   1756 C CG1   . ILE C 3 182 ? -23.087 79.154  50.960  1.00 43.44  ? 182 ILE A CG1   1 
ATOM   1757 C CG2   . ILE C 3 182 ? -21.966 81.023  49.756  1.00 43.64  ? 182 ILE A CG2   1 
ATOM   1758 C CD1   . ILE C 3 182 ? -24.114 78.818  49.916  1.00 43.06  ? 182 ILE A CD1   1 
ATOM   1759 N N     . ALA C 3 183 ? -20.224 82.614  51.725  1.00 42.96  ? 183 ALA A N     1 
ATOM   1760 C CA    . ALA C 3 183 ? -19.656 83.956  51.653  1.00 40.10  ? 183 ALA A CA    1 
ATOM   1761 C C     . ALA C 3 183 ? -19.541 84.299  50.175  1.00 38.98  ? 183 ALA A C     1 
ATOM   1762 O O     . ALA C 3 183 ? -19.497 83.411  49.323  1.00 38.71  ? 183 ALA A O     1 
ATOM   1763 C CB    . ALA C 3 183 ? -18.280 83.983  52.304  1.00 39.26  ? 183 ALA A CB    1 
ATOM   1764 N N     . LEU C 3 184 ? -19.481 85.581  49.860  1.00 37.65  ? 184 LEU A N     1 
ATOM   1765 C CA    . LEU C 3 184 ? -19.391 85.971  48.463  1.00 36.68  ? 184 LEU A CA    1 
ATOM   1766 C C     . LEU C 3 184 ? -18.210 86.889  48.179  1.00 36.36  ? 184 LEU A C     1 
ATOM   1767 O O     . LEU C 3 184 ? -17.966 87.856  48.908  1.00 35.77  ? 184 LEU A O     1 
ATOM   1768 C CB    . LEU C 3 184 ? -20.690 86.662  48.033  1.00 36.46  ? 184 LEU A CB    1 
ATOM   1769 C CG    . LEU C 3 184 ? -22.026 85.931  48.222  1.00 35.51  ? 184 LEU A CG    1 
ATOM   1770 C CD1   . LEU C 3 184 ? -23.150 86.850  47.762  1.00 35.68  ? 184 LEU A CD1   1 
ATOM   1771 C CD2   . LEU C 3 184 ? -22.049 84.631  47.431  1.00 34.72  ? 184 LEU A CD2   1 
ATOM   1772 N N     . LEU C 3 185 ? -17.482 86.578  47.111  1.00 35.97  ? 185 LEU A N     1 
ATOM   1773 C CA    . LEU C 3 185 ? -16.332 87.375  46.699  1.00 35.71  ? 185 LEU A CA    1 
ATOM   1774 C C     . LEU C 3 185 ? -16.622 87.831  45.283  1.00 35.53  ? 185 LEU A C     1 
ATOM   1775 O O     . LEU C 3 185 ? -16.402 87.089  44.322  1.00 34.97  ? 185 LEU A O     1 
ATOM   1776 C CB    . LEU C 3 185 ? -15.054 86.523  46.739  1.00 36.13  ? 185 LEU A CB    1 
ATOM   1777 C CG    . LEU C 3 185 ? -13.710 87.196  46.435  1.00 35.75  ? 185 LEU A CG    1 
ATOM   1778 C CD1   . LEU C 3 185 ? -13.596 88.524  47.161  1.00 35.55  ? 185 LEU A CD1   1 
ATOM   1779 C CD2   . LEU C 3 185 ? -12.589 86.270  46.857  1.00 35.37  ? 185 LEU A CD2   1 
ATOM   1780 N N     . ALA C 3 186 ? -17.123 89.049  45.148  1.00 35.22  ? 186 ALA A N     1 
ATOM   1781 C CA    . ALA C 3 186 ? -17.462 89.527  43.825  1.00 36.22  ? 186 ALA A CA    1 
ATOM   1782 C C     . ALA C 3 186 ? -16.392 90.382  43.202  1.00 37.18  ? 186 ALA A C     1 
ATOM   1783 O O     . ALA C 3 186 ? -15.571 90.985  43.901  1.00 35.95  ? 186 ALA A O     1 
ATOM   1784 C CB    . ALA C 3 186 ? -18.758 90.286  43.862  1.00 36.74  ? 186 ALA A CB    1 
ATOM   1785 N N     . GLY C 3 187 ? -16.424 90.425  41.870  1.00 38.40  ? 187 GLY A N     1 
ATOM   1786 C CA    . GLY C 3 187 ? -15.467 91.208  41.115  1.00 39.10  ? 187 GLY A CA    1 
ATOM   1787 C C     . GLY C 3 187 ? -15.661 92.674  41.433  1.00 39.99  ? 187 GLY A C     1 
ATOM   1788 O O     . GLY C 3 187 ? -16.527 93.025  42.232  1.00 39.75  ? 187 GLY A O     1 
ATOM   1789 N N     . PRO C 3 188 ? -14.872 93.564  40.821  1.00 40.98  ? 188 PRO A N     1 
ATOM   1790 C CA    . PRO C 3 188 ? -15.008 95.001  41.085  1.00 40.01  ? 188 PRO A CA    1 
ATOM   1791 C C     . PRO C 3 188 ? -16.358 95.517  40.614  1.00 41.37  ? 188 PRO A C     1 
ATOM   1792 O O     . PRO C 3 188 ? -16.790 95.249  39.491  1.00 41.12  ? 188 PRO A O     1 
ATOM   1793 C CB    . PRO C 3 188 ? -13.858 95.599  40.298  1.00 40.58  ? 188 PRO A CB    1 
ATOM   1794 C CG    . PRO C 3 188 ? -13.781 94.676  39.093  1.00 40.49  ? 188 PRO A CG    1 
ATOM   1795 C CD    . PRO C 3 188 ? -13.909 93.310  39.733  1.00 40.49  ? 188 PRO A CD    1 
ATOM   1796 N N     . LEU C 3 189 ? -17.019 96.265  41.484  1.00 41.83  ? 189 LEU A N     1 
ATOM   1797 C CA    . LEU C 3 189 ? -18.340 96.811  41.191  1.00 42.21  ? 189 LEU A CA    1 
ATOM   1798 C C     . LEU C 3 189 ? -18.380 97.799  40.040  1.00 41.74  ? 189 LEU A C     1 
ATOM   1799 O O     . LEU C 3 189 ? -19.452 98.232  39.616  1.00 41.26  ? 189 LEU A O     1 
ATOM   1800 C CB    . LEU C 3 189 ? -18.913 97.469  42.444  1.00 43.46  ? 189 LEU A CB    1 
ATOM   1801 C CG    . LEU C 3 189 ? -19.867 96.656  43.331  1.00 43.93  ? 189 LEU A CG    1 
ATOM   1802 C CD1   . LEU C 3 189 ? -19.649 95.155  43.186  1.00 43.70  ? 189 LEU A CD1   1 
ATOM   1803 C CD2   . LEU C 3 189 ? -19.655 97.108  44.771  1.00 44.50  ? 189 LEU A CD2   1 
ATOM   1804 N N     . SER C 3 190 ? -17.212 98.172  39.542  1.00 41.46  ? 190 SER A N     1 
ATOM   1805 C CA    . SER C 3 190 ? -17.166 99.094  38.421  1.00 41.36  ? 190 SER A CA    1 
ATOM   1806 C C     . SER C 3 190 ? -17.409 98.277  37.158  1.00 40.37  ? 190 SER A C     1 
ATOM   1807 O O     . SER C 3 190 ? -17.576 98.825  36.069  1.00 39.46  ? 190 SER A O     1 
ATOM   1808 C CB    . SER C 3 190 ? -15.805 99.789  38.344  1.00 42.71  ? 190 SER A CB    1 
ATOM   1809 O OG    . SER C 3 190 ? -14.768 98.847  38.153  1.00 44.65  ? 190 SER A OG    1 
ATOM   1810 N N     . SER C 3 191 ? -17.432 96.956  37.311  1.00 39.76  ? 191 SER A N     1 
ATOM   1811 C CA    . SER C 3 191 ? -17.661 96.085  36.174  1.00 39.66  ? 191 SER A CA    1 
ATOM   1812 C C     . SER C 3 191 ? -19.053 95.507  36.124  1.00 38.51  ? 191 SER A C     1 
ATOM   1813 O O     . SER C 3 191 ? -19.453 94.722  36.984  1.00 37.06  ? 191 SER A O     1 
ATOM   1814 C CB    . SER C 3 191 ? -16.667 94.925  36.147  1.00 41.19  ? 191 SER A CB    1 
ATOM   1815 O OG    . SER C 3 191 ? -17.041 93.969  35.153  1.00 41.84  ? 191 SER A OG    1 
ATOM   1816 N N     . VAL C 3 192 ? -19.773 95.896  35.085  1.00 38.41  ? 192 VAL A N     1 
ATOM   1817 C CA    . VAL C 3 192 ? -21.124 95.417  34.847  1.00 38.59  ? 192 VAL A CA    1 
ATOM   1818 C C     . VAL C 3 192 ? -21.232 93.918  35.127  1.00 37.81  ? 192 VAL A C     1 
ATOM   1819 O O     . VAL C 3 192 ? -22.052 93.473  35.926  1.00 36.55  ? 192 VAL A O     1 
ATOM   1820 C CB    . VAL C 3 192 ? -21.525 95.662  33.372  1.00 39.39  ? 192 VAL A CB    1 
ATOM   1821 C CG1   . VAL C 3 192 ? -22.865 94.985  33.062  1.00 38.62  ? 192 VAL A CG1   1 
ATOM   1822 C CG2   . VAL C 3 192 ? -21.569 97.165  33.091  1.00 39.87  ? 192 VAL A CG2   1 
ATOM   1823 N N     . SER C 3 193 ? -20.387 93.142  34.463  1.00 37.70  ? 193 SER A N     1 
ATOM   1824 C CA    . SER C 3 193 ? -20.429 91.707  34.619  1.00 36.99  ? 193 SER A CA    1 
ATOM   1825 C C     . SER C 3 193 ? -20.172 91.253  36.043  1.00 35.68  ? 193 SER A C     1 
ATOM   1826 O O     . SER C 3 193 ? -20.650 90.204  36.458  1.00 34.26  ? 193 SER A O     1 
ATOM   1827 C CB    . SER C 3 193 ? -19.439 91.049  33.660  1.00 37.64  ? 193 SER A CB    1 
ATOM   1828 O OG    . SER C 3 193 ? -19.721 89.664  33.544  1.00 39.51  ? 193 SER A OG    1 
ATOM   1829 N N     . ALA C 3 194 ? -19.421 92.032  36.803  1.00 35.72  ? 194 ALA A N     1 
ATOM   1830 C CA    . ALA C 3 194 ? -19.165 91.634  38.176  1.00 36.62  ? 194 ALA A CA    1 
ATOM   1831 C C     . ALA C 3 194 ? -20.487 91.724  38.902  1.00 36.43  ? 194 ALA A C     1 
ATOM   1832 O O     . ALA C 3 194 ? -20.895 90.803  39.618  1.00 36.76  ? 194 ALA A O     1 
ATOM   1833 C CB    . ALA C 3 194 ? -18.150 92.564  38.825  1.00 36.52  ? 194 ALA A CB    1 
ATOM   1834 N N     . ARG C 3 195 ? -21.159 92.852  38.685  1.00 35.53  ? 195 ARG A N     1 
ATOM   1835 C CA    . ARG C 3 195 ? -22.447 93.138  39.318  1.00 33.57  ? 195 ARG A CA    1 
ATOM   1836 C C     . ARG C 3 195 ? -23.511 92.107  38.982  1.00 31.35  ? 195 ARG A C     1 
ATOM   1837 O O     . ARG C 3 195 ? -24.192 91.592  39.875  1.00 30.03  ? 195 ARG A O     1 
ATOM   1838 C CB    . ARG C 3 195 ? -22.949 94.549  38.931  1.00 32.94  ? 195 ARG A CB    1 
ATOM   1839 C CG    . ARG C 3 195 ? -22.010 95.692  39.342  1.00 31.28  ? 195 ARG A CG    1 
ATOM   1840 C CD    . ARG C 3 195 ? -22.721 97.036  39.305  1.00 29.07  ? 195 ARG A CD    1 
ATOM   1841 N NE    . ARG C 3 195 ? -23.191 97.415  37.970  1.00 28.36  ? 195 ARG A NE    1 
ATOM   1842 C CZ    . ARG C 3 195 ? -22.518 98.195  37.121  1.00 27.72  ? 195 ARG A CZ    1 
ATOM   1843 N NH1   . ARG C 3 195 ? -21.329 98.690  37.455  1.00 27.28  ? 195 ARG A NH1   1 
ATOM   1844 N NH2   . ARG C 3 195 ? -23.046 98.499  35.941  1.00 25.87  ? 195 ARG A NH2   1 
ATOM   1845 N N     . LEU C 3 196 ? -23.649 91.812  37.694  1.00 29.79  ? 196 LEU A N     1 
ATOM   1846 C CA    . LEU C 3 196 ? -24.639 90.849  37.258  1.00 29.96  ? 196 LEU A CA    1 
ATOM   1847 C C     . LEU C 3 196 ? -24.500 89.562  38.049  1.00 30.58  ? 196 LEU A C     1 
ATOM   1848 O O     . LEU C 3 196 ? -25.483 89.000  38.536  1.00 29.45  ? 196 LEU A O     1 
ATOM   1849 C CB    . LEU C 3 196 ? -24.474 90.573  35.767  1.00 29.62  ? 196 LEU A CB    1 
ATOM   1850 C CG    . LEU C 3 196 ? -24.867 91.741  34.864  1.00 29.90  ? 196 LEU A CG    1 
ATOM   1851 C CD1   . LEU C 3 196 ? -24.627 91.414  33.422  1.00 31.10  ? 196 LEU A CD1   1 
ATOM   1852 C CD2   . LEU C 3 196 ? -26.321 92.026  35.049  1.00 29.83  ? 196 LEU A CD2   1 
ATOM   1853 N N     . ARG C 3 197 ? -23.262 89.106  38.186  1.00 32.42  ? 197 ARG A N     1 
ATOM   1854 C CA    . ARG C 3 197 ? -22.979 87.876  38.916  1.00 33.45  ? 197 ARG A CA    1 
ATOM   1855 C C     . ARG C 3 197 ? -23.285 88.014  40.400  1.00 33.89  ? 197 ARG A C     1 
ATOM   1856 O O     . ARG C 3 197 ? -23.747 87.050  41.025  1.00 32.21  ? 197 ARG A O     1 
ATOM   1857 C CB    . ARG C 3 197 ? -21.516 87.471  38.714  1.00 33.70  ? 197 ARG A CB    1 
ATOM   1858 C CG    . ARG C 3 197 ? -21.180 87.172  37.267  1.00 32.97  ? 197 ARG A CG    1 
ATOM   1859 C CD    . ARG C 3 197 ? -19.717 86.911  37.080  1.00 31.74  ? 197 ARG A CD    1 
ATOM   1860 N NE    . ARG C 3 197 ? -19.367 86.833  35.669  1.00 31.99  ? 197 ARG A NE    1 
ATOM   1861 C CZ    . ARG C 3 197 ? -18.119 86.832  35.231  1.00 32.76  ? 197 ARG A CZ    1 
ATOM   1862 N NH1   . ARG C 3 197 ? -17.122 86.906  36.105  1.00 33.47  ? 197 ARG A NH1   1 
ATOM   1863 N NH2   . ARG C 3 197 ? -17.867 86.765  33.930  1.00 32.06  ? 197 ARG A NH2   1 
ATOM   1864 N N     . LEU C 3 198 ? -23.024 89.200  40.961  1.00 34.72  ? 198 LEU A N     1 
ATOM   1865 C CA    . LEU C 3 198 ? -23.304 89.443  42.380  1.00 35.54  ? 198 LEU A CA    1 
ATOM   1866 C C     . LEU C 3 198 ? -24.812 89.306  42.532  1.00 36.60  ? 198 LEU A C     1 
ATOM   1867 O O     . LEU C 3 198 ? -25.313 88.571  43.398  1.00 35.87  ? 198 LEU A O     1 
ATOM   1868 C CB    . LEU C 3 198 ? -22.877 90.855  42.812  1.00 34.41  ? 198 LEU A CB    1 
ATOM   1869 C CG    . LEU C 3 198 ? -22.497 91.023  44.296  1.00 33.42  ? 198 LEU A CG    1 
ATOM   1870 C CD1   . LEU C 3 198 ? -22.496 92.496  44.636  1.00 33.44  ? 198 LEU A CD1   1 
ATOM   1871 C CD2   . LEU C 3 198 ? -23.459 90.285  45.219  1.00 32.23  ? 198 LEU A CD2   1 
ATOM   1872 N N     . ALA C 3 199 ? -25.530 90.020  41.673  1.00 37.89  ? 199 ALA A N     1 
ATOM   1873 C CA    . ALA C 3 199 ? -26.982 89.964  41.690  1.00 39.16  ? 199 ALA A CA    1 
ATOM   1874 C C     . ALA C 3 199 ? -27.409 88.510  41.576  1.00 39.17  ? 199 ALA A C     1 
ATOM   1875 O O     . ALA C 3 199 ? -28.117 87.984  42.444  1.00 37.75  ? 199 ALA A O     1 
ATOM   1876 C CB    . ALA C 3 199 ? -27.553 90.768  40.529  1.00 39.94  ? 199 ALA A CB    1 
ATOM   1877 N N     . GLY C 3 200 ? -26.970 87.869  40.497  1.00 39.32  ? 200 GLY A N     1 
ATOM   1878 C CA    . GLY C 3 200 ? -27.308 86.476  40.298  1.00 41.35  ? 200 GLY A CA    1 
ATOM   1879 C C     . GLY C 3 200 ? -27.246 85.693  41.603  1.00 42.01  ? 200 GLY A C     1 
ATOM   1880 O O     . GLY C 3 200 ? -28.212 85.019  41.996  1.00 41.25  ? 200 GLY A O     1 
ATOM   1881 N N     . TRP C 3 201 ? -26.111 85.787  42.290  1.00 42.90  ? 201 TRP A N     1 
ATOM   1882 C CA    . TRP C 3 201 ? -25.960 85.077  43.551  1.00 44.04  ? 201 TRP A CA    1 
ATOM   1883 C C     . TRP C 3 201 ? -27.034 85.460  44.554  1.00 44.88  ? 201 TRP A C     1 
ATOM   1884 O O     . TRP C 3 201 ? -27.723 84.589  45.107  1.00 45.19  ? 201 TRP A O     1 
ATOM   1885 C CB    . TRP C 3 201 ? -24.593 85.344  44.168  1.00 42.92  ? 201 TRP A CB    1 
ATOM   1886 C CG    . TRP C 3 201 ? -23.491 84.759  43.406  1.00 42.28  ? 201 TRP A CG    1 
ATOM   1887 C CD1   . TRP C 3 201 ? -23.513 83.597  42.680  1.00 42.06  ? 201 TRP A CD1   1 
ATOM   1888 C CD2   . TRP C 3 201 ? -22.168 85.259  43.327  1.00 42.36  ? 201 TRP A CD2   1 
ATOM   1889 N NE1   . TRP C 3 201 ? -22.270 83.336  42.165  1.00 42.58  ? 201 TRP A NE1   1 
ATOM   1890 C CE2   . TRP C 3 201 ? -21.413 84.335  42.565  1.00 42.74  ? 201 TRP A CE2   1 
ATOM   1891 C CE3   . TRP C 3 201 ? -21.525 86.379  43.870  1.00 42.31  ? 201 TRP A CE3   1 
ATOM   1892 C CZ2   . TRP C 3 201 ? -20.048 84.530  42.279  1.00 43.59  ? 201 TRP A CZ2   1 
ATOM   1893 C CZ3   . TRP C 3 201 ? -20.169 86.574  43.592  1.00 42.63  ? 201 TRP A CZ3   1 
ATOM   1894 C CH2   . TRP C 3 201 ? -19.442 85.641  42.821  1.00 43.08  ? 201 TRP A CH2   1 
ATOM   1895 N N     . HIS C 3 202 ? -27.169 86.760  44.803  1.00 45.09  ? 202 HIS A N     1 
ATOM   1896 C CA    . HIS C 3 202 ? -28.174 87.195  45.748  1.00 45.15  ? 202 HIS A CA    1 
ATOM   1897 C C     . HIS C 3 202 ? -29.511 86.611  45.350  1.00 45.06  ? 202 HIS A C     1 
ATOM   1898 O O     . HIS C 3 202 ? -30.184 85.977  46.174  1.00 45.24  ? 202 HIS A O     1 
ATOM   1899 C CB    . HIS C 3 202 ? -28.239 88.715  45.799  1.00 45.63  ? 202 HIS A CB    1 
ATOM   1900 C CG    . HIS C 3 202 ? -27.264 89.312  46.762  1.00 47.11  ? 202 HIS A CG    1 
ATOM   1901 N ND1   . HIS C 3 202 ? -26.452 90.379  46.438  1.00 48.24  ? 202 HIS A ND1   1 
ATOM   1902 C CD2   . HIS C 3 202 ? -26.964 88.987  48.045  1.00 47.38  ? 202 HIS A CD2   1 
ATOM   1903 C CE1   . HIS C 3 202 ? -25.694 90.686  47.478  1.00 47.92  ? 202 HIS A CE1   1 
ATOM   1904 N NE2   . HIS C 3 202 ? -25.985 89.857  48.467  1.00 47.48  ? 202 HIS A NE2   1 
ATOM   1905 N N     . LYS C 3 203 ? -29.879 86.790  44.082  1.00 44.35  ? 203 LYS A N     1 
ATOM   1906 C CA    . LYS C 3 203 ? -31.152 86.273  43.612  1.00 43.89  ? 203 LYS A CA    1 
ATOM   1907 C C     . LYS C 3 203 ? -31.432 84.838  44.041  1.00 43.74  ? 203 LYS A C     1 
ATOM   1908 O O     . LYS C 3 203 ? -32.372 84.588  44.803  1.00 44.02  ? 203 LYS A O     1 
ATOM   1909 C CB    . LYS C 3 203 ? -31.260 86.364  42.093  1.00 43.38  ? 203 LYS A CB    1 
ATOM   1910 C CG    . LYS C 3 203 ? -32.517 85.687  41.587  1.00 43.05  ? 203 LYS A CG    1 
ATOM   1911 C CD    . LYS C 3 203 ? -32.743 85.886  40.121  1.00 42.99  ? 203 LYS A CD    1 
ATOM   1912 C CE    . LYS C 3 203 ? -33.897 85.026  39.691  1.00 44.07  ? 203 LYS A CE    1 
ATOM   1913 N NZ    . LYS C 3 203 ? -34.148 85.109  38.234  1.00 46.16  ? 203 LYS A NZ    1 
ATOM   1914 N N     . TYR C 3 204 ? -30.616 83.900  43.574  1.00 43.14  ? 204 TYR A N     1 
ATOM   1915 C CA    . TYR C 3 204 ? -30.852 82.512  43.913  1.00 43.85  ? 204 TYR A CA    1 
ATOM   1916 C C     . TYR C 3 204 ? -30.525 82.102  45.319  1.00 45.10  ? 204 TYR A C     1 
ATOM   1917 O O     . TYR C 3 204 ? -31.037 81.084  45.790  1.00 45.43  ? 204 TYR A O     1 
ATOM   1918 C CB    . TYR C 3 204 ? -30.133 81.610  42.946  1.00 43.63  ? 204 TYR A CB    1 
ATOM   1919 C CG    . TYR C 3 204 ? -30.667 81.795  41.576  1.00 43.56  ? 204 TYR A CG    1 
ATOM   1920 C CD1   . TYR C 3 204 ? -30.222 82.840  40.781  1.00 44.17  ? 204 TYR A CD1   1 
ATOM   1921 C CD2   . TYR C 3 204 ? -31.649 80.951  41.076  1.00 43.55  ? 204 TYR A CD2   1 
ATOM   1922 C CE1   . TYR C 3 204 ? -30.747 83.042  39.499  1.00 44.89  ? 204 TYR A CE1   1 
ATOM   1923 C CE2   . TYR C 3 204 ? -32.183 81.139  39.802  1.00 43.99  ? 204 TYR A CE2   1 
ATOM   1924 C CZ    . TYR C 3 204 ? -31.728 82.183  39.014  1.00 44.35  ? 204 TYR A CZ    1 
ATOM   1925 O OH    . TYR C 3 204 ? -32.240 82.353  37.744  1.00 44.14  ? 204 TYR A OH    1 
ATOM   1926 N N     . LEU C 3 205 ? -29.663 82.859  45.992  1.00 46.16  ? 205 LEU A N     1 
ATOM   1927 C CA    . LEU C 3 205 ? -29.349 82.523  47.372  1.00 47.82  ? 205 LEU A CA    1 
ATOM   1928 C C     . LEU C 3 205 ? -30.632 82.764  48.149  1.00 49.69  ? 205 LEU A C     1 
ATOM   1929 O O     . LEU C 3 205 ? -31.002 81.990  49.045  1.00 50.34  ? 205 LEU A O     1 
ATOM   1930 C CB    . LEU C 3 205 ? -28.230 83.406  47.917  1.00 46.58  ? 205 LEU A CB    1 
ATOM   1931 C CG    . LEU C 3 205 ? -26.825 82.854  47.659  1.00 46.67  ? 205 LEU A CG    1 
ATOM   1932 C CD1   . LEU C 3 205 ? -25.819 83.733  48.387  1.00 46.08  ? 205 LEU A CD1   1 
ATOM   1933 C CD2   . LEU C 3 205 ? -26.716 81.399  48.144  1.00 45.73  ? 205 LEU A CD2   1 
ATOM   1934 N N     . THR C 3 206 ? -31.315 83.842  47.775  1.00 51.14  ? 206 THR A N     1 
ATOM   1935 C CA    . THR C 3 206 ? -32.574 84.211  48.396  1.00 52.23  ? 206 THR A CA    1 
ATOM   1936 C C     . THR C 3 206 ? -33.632 83.110  48.208  1.00 53.92  ? 206 THR A C     1 
ATOM   1937 O O     . THR C 3 206 ? -34.228 82.663  49.190  1.00 53.87  ? 206 THR A O     1 
ATOM   1938 C CB    . THR C 3 206 ? -33.057 85.562  47.831  1.00 51.56  ? 206 THR A CB    1 
ATOM   1939 O OG1   . THR C 3 206 ? -32.349 86.619  48.493  1.00 50.23  ? 206 THR A OG1   1 
ATOM   1940 C CG2   . THR C 3 206 ? -34.539 85.745  48.035  1.00 51.56  ? 206 THR A CG2   1 
ATOM   1941 N N     . ARG C 3 207 ? -33.850 82.655  46.972  1.00 55.90  ? 207 ARG A N     1 
ATOM   1942 C CA    . ARG C 3 207 ? -34.836 81.599  46.719  1.00 58.34  ? 207 ARG A CA    1 
ATOM   1943 C C     . ARG C 3 207 ? -34.614 80.321  47.527  1.00 58.49  ? 207 ARG A C     1 
ATOM   1944 O O     . ARG C 3 207 ? -35.465 79.438  47.535  1.00 58.48  ? 207 ARG A O     1 
ATOM   1945 C CB    . ARG C 3 207 ? -34.887 81.225  45.232  1.00 61.21  ? 207 ARG A CB    1 
ATOM   1946 C CG    . ARG C 3 207 ? -35.646 82.207  44.357  1.00 66.61  ? 207 ARG A CG    1 
ATOM   1947 C CD    . ARG C 3 207 ? -35.899 81.618  42.964  1.00 71.32  ? 207 ARG A CD    1 
ATOM   1948 N NE    . ARG C 3 207 ? -36.419 82.622  42.030  1.00 75.92  ? 207 ARG A NE    1 
ATOM   1949 C CZ    . ARG C 3 207 ? -36.638 82.408  40.730  1.00 78.12  ? 207 ARG A CZ    1 
ATOM   1950 N NH1   . ARG C 3 207 ? -36.388 81.213  40.188  1.00 78.78  ? 207 ARG A NH1   1 
ATOM   1951 N NH2   . ARG C 3 207 ? -37.099 83.397  39.964  1.00 79.24  ? 207 ARG A NH2   1 
ATOM   1952 N N     . ASN C 3 208 ? -33.472 80.202  48.192  1.00 59.34  ? 208 ASN A N     1 
ATOM   1953 C CA    . ASN C 3 208 ? -33.209 79.013  48.992  1.00 60.11  ? 208 ASN A CA    1 
ATOM   1954 C C     . ASN C 3 208 ? -33.132 79.405  50.444  1.00 60.87  ? 208 ASN A C     1 
ATOM   1955 O O     . ASN C 3 208 ? -32.682 78.640  51.294  1.00 60.08  ? 208 ASN A O     1 
ATOM   1956 C CB    . ASN C 3 208 ? -31.922 78.319  48.544  1.00 60.49  ? 208 ASN A CB    1 
ATOM   1957 C CG    . ASN C 3 208 ? -32.108 77.538  47.243  1.00 61.19  ? 208 ASN A CG    1 
ATOM   1958 O OD1   . ASN C 3 208 ? -32.167 78.116  46.150  1.00 61.29  ? 208 ASN A OD1   1 
ATOM   1959 N ND2   . ASN C 3 208 ? -32.224 76.218  47.361  1.00 60.95  ? 208 ASN A ND2   1 
ATOM   1960 N N     . GLN C 3 209 ? -33.603 80.617  50.707  1.00 62.71  ? 209 GLN A N     1 
ATOM   1961 C CA    . GLN C 3 209 ? -33.647 81.181  52.047  1.00 65.17  ? 209 GLN A CA    1 
ATOM   1962 C C     . GLN C 3 209 ? -32.286 81.167  52.723  1.00 65.35  ? 209 GLN A C     1 
ATOM   1963 O O     . GLN C 3 209 ? -32.137 80.693  53.853  1.00 65.36  ? 209 GLN A O     1 
ATOM   1964 C CB    . GLN C 3 209 ? -34.664 80.420  52.913  1.00 67.62  ? 209 GLN A CB    1 
ATOM   1965 C CG    . GLN C 3 209 ? -36.068 80.338  52.308  1.00 71.31  ? 209 GLN A CG    1 
ATOM   1966 C CD    . GLN C 3 209 ? -36.585 78.901  52.229  1.00 73.44  ? 209 GLN A CD    1 
ATOM   1967 O OE1   . GLN C 3 209 ? -36.900 78.284  53.254  1.00 74.41  ? 209 GLN A OE1   1 
ATOM   1968 N NE2   . GLN C 3 209 ? -36.661 78.357  51.009  1.00 74.21  ? 209 GLN A NE2   1 
ATOM   1969 N N     . ILE C 3 210 ? -31.290 81.692  52.024  1.00 65.43  ? 210 ILE A N     1 
ATOM   1970 C CA    . ILE C 3 210 ? -29.944 81.754  52.571  1.00 65.70  ? 210 ILE A CA    1 
ATOM   1971 C C     . ILE C 3 210 ? -29.415 83.180  52.479  1.00 65.64  ? 210 ILE A C     1 
ATOM   1972 O O     . ILE C 3 210 ? -29.715 83.905  51.523  1.00 66.32  ? 210 ILE A O     1 
ATOM   1973 C CB    . ILE C 3 210 ? -28.983 80.837  51.800  1.00 66.17  ? 210 ILE A CB    1 
ATOM   1974 C CG1   . ILE C 3 210 ? -29.432 79.378  51.934  1.00 66.37  ? 210 ILE A CG1   1 
ATOM   1975 C CG2   . ILE C 3 210 ? -27.562 81.030  52.322  1.00 66.42  ? 210 ILE A CG2   1 
ATOM   1976 C CD1   . ILE C 3 210 ? -28.548 78.380  51.187  1.00 67.11  ? 210 ILE A CD1   1 
ATOM   1977 N N     . GLN C 3 211 ? -28.639 83.591  53.475  1.00 64.85  ? 211 GLN A N     1 
ATOM   1978 C CA    . GLN C 3 211 ? -28.073 84.926  53.453  1.00 64.09  ? 211 GLN A CA    1 
ATOM   1979 C C     . GLN C 3 211 ? -26.576 84.820  53.565  1.00 62.02  ? 211 GLN A C     1 
ATOM   1980 O O     . GLN C 3 211 ? -26.059 84.162  54.469  1.00 61.22  ? 211 GLN A O     1 
ATOM   1981 C CB    . GLN C 3 211 ? -28.597 85.766  54.609  1.00 66.19  ? 211 GLN A CB    1 
ATOM   1982 C CG    . GLN C 3 211 ? -30.068 86.113  54.511  1.00 70.66  ? 211 GLN A CG    1 
ATOM   1983 C CD    . GLN C 3 211 ? -30.543 86.937  55.707  1.00 73.59  ? 211 GLN A CD    1 
ATOM   1984 O OE1   . GLN C 3 211 ? -29.957 87.987  56.014  1.00 75.20  ? 211 GLN A OE1   1 
ATOM   1985 N NE2   . GLN C 3 211 ? -31.605 86.469  56.391  1.00 74.28  ? 211 GLN A NE2   1 
ATOM   1986 N N     . PRO C 3 212 ? -25.853 85.452  52.631  1.00 60.73  ? 212 PRO A N     1 
ATOM   1987 C CA    . PRO C 3 212 ? -24.395 85.392  52.695  1.00 59.50  ? 212 PRO A CA    1 
ATOM   1988 C C     . PRO C 3 212 ? -23.908 85.920  54.043  1.00 56.89  ? 212 PRO A C     1 
ATOM   1989 O O     . PRO C 3 212 ? -24.269 87.014  54.468  1.00 55.25  ? 212 PRO A O     1 
ATOM   1990 C CB    . PRO C 3 212 ? -23.959 86.268  51.512  1.00 60.19  ? 212 PRO A CB    1 
ATOM   1991 C CG    . PRO C 3 212 ? -25.106 87.226  51.343  1.00 60.36  ? 212 PRO A CG    1 
ATOM   1992 C CD    . PRO C 3 212 ? -26.293 86.309  51.516  1.00 60.82  ? 212 PRO A CD    1 
ATOM   1993 N N     . ILE C 3 213 ? -23.095 85.124  54.716  1.00 55.42  ? 213 ILE A N     1 
ATOM   1994 C CA    . ILE C 3 213 ? -22.590 85.524  56.004  1.00 54.88  ? 213 ILE A CA    1 
ATOM   1995 C C     . ILE C 3 213 ? -21.417 86.469  55.804  1.00 54.41  ? 213 ILE A C     1 
ATOM   1996 O O     . ILE C 3 213 ? -20.773 86.883  56.765  1.00 54.31  ? 213 ILE A O     1 
ATOM   1997 C CB    . ILE C 3 213 ? -22.155 84.292  56.810  1.00 55.19  ? 213 ILE A CB    1 
ATOM   1998 C CG1   . ILE C 3 213 ? -20.820 83.770  56.299  1.00 55.26  ? 213 ILE A CG1   1 
ATOM   1999 C CG2   . ILE C 3 213 ? -23.174 83.167  56.631  1.00 53.97  ? 213 ILE A CG2   1 
ATOM   2000 C CD1   . ILE C 3 213 ? -20.256 82.674  57.175  1.00 56.00  ? 213 ILE A CD1   1 
ATOM   2001 N N     . ALA C 3 214 ? -21.155 86.808  54.545  1.00 54.53  ? 214 ALA A N     1 
ATOM   2002 C CA    . ALA C 3 214 ? -20.057 87.709  54.191  1.00 54.94  ? 214 ALA A CA    1 
ATOM   2003 C C     . ALA C 3 214 ? -20.053 88.046  52.693  1.00 55.02  ? 214 ALA A C     1 
ATOM   2004 O O     . ALA C 3 214 ? -20.364 87.197  51.847  1.00 54.42  ? 214 ALA A O     1 
ATOM   2005 C CB    . ALA C 3 214 ? -18.729 87.081  54.590  1.00 55.74  ? 214 ALA A CB    1 
ATOM   2006 N N     . GLU C 3 215 ? -19.673 89.275  52.362  1.00 54.73  ? 215 GLU A N     1 
ATOM   2007 C CA    . GLU C 3 215 ? -19.669 89.696  50.968  1.00 55.35  ? 215 GLU A CA    1 
ATOM   2008 C C     . GLU C 3 215 ? -18.548 90.701  50.724  1.00 55.65  ? 215 GLU A C     1 
ATOM   2009 O O     . GLU C 3 215 ? -18.619 91.844  51.182  1.00 55.59  ? 215 GLU A O     1 
ATOM   2010 C CB    . GLU C 3 215 ? -21.048 90.291  50.655  1.00 56.67  ? 215 GLU A CB    1 
ATOM   2011 C CG    . GLU C 3 215 ? -21.251 90.935  49.288  1.00 59.02  ? 215 GLU A CG    1 
ATOM   2012 C CD    . GLU C 3 215 ? -22.689 91.450  49.091  1.00 60.45  ? 215 GLU A CD    1 
ATOM   2013 O OE1   . GLU C 3 215 ? -22.913 92.282  48.178  1.00 60.51  ? 215 GLU A OE1   1 
ATOM   2014 O OE2   . GLU C 3 215 ? -23.598 91.017  49.845  1.00 61.46  ? 215 GLU A OE2   1 
ATOM   2015 N N     . ARG C 3 216 ? -17.515 90.266  50.000  1.00 56.20  ? 216 ARG A N     1 
ATOM   2016 C CA    . ARG C 3 216 ? -16.353 91.113  49.704  1.00 56.75  ? 216 ARG A CA    1 
ATOM   2017 C C     . ARG C 3 216 ? -16.123 91.391  48.206  1.00 56.33  ? 216 ARG A C     1 
ATOM   2018 O O     . ARG C 3 216 ? -16.546 90.617  47.328  1.00 55.08  ? 216 ARG A O     1 
ATOM   2019 C CB    . ARG C 3 216 ? -15.094 90.471  50.278  1.00 58.05  ? 216 ARG A CB    1 
ATOM   2020 C CG    . ARG C 3 216 ? -15.352 89.583  51.477  1.00 60.03  ? 216 ARG A CG    1 
ATOM   2021 C CD    . ARG C 3 216 ? -15.555 90.386  52.749  1.00 63.02  ? 216 ARG A CD    1 
ATOM   2022 N NE    . ARG C 3 216 ? -14.318 91.040  53.186  1.00 66.08  ? 216 ARG A NE    1 
ATOM   2023 C CZ    . ARG C 3 216 ? -14.053 91.377  54.449  1.00 67.03  ? 216 ARG A CZ    1 
ATOM   2024 N NH1   . ARG C 3 216 ? -14.945 91.118  55.403  1.00 67.25  ? 216 ARG A NH1   1 
ATOM   2025 N NH2   . ARG C 3 216 ? -12.900 91.967  54.760  1.00 67.39  ? 216 ARG A NH2   1 
ATOM   2026 N N     . GLU C 3 217 ? -15.404 92.481  47.937  1.00 55.81  ? 217 GLU A N     1 
ATOM   2027 C CA    . GLU C 3 217 ? -15.117 92.916  46.576  1.00 55.52  ? 217 GLU A CA    1 
ATOM   2028 C C     . GLU C 3 217 ? -13.635 92.835  46.194  1.00 54.15  ? 217 GLU A C     1 
ATOM   2029 O O     . GLU C 3 217 ? -12.779 93.456  46.838  1.00 53.63  ? 217 GLU A O     1 
ATOM   2030 C CB    . GLU C 3 217 ? -15.605 94.357  46.413  1.00 57.34  ? 217 GLU A CB    1 
ATOM   2031 C CG    . GLU C 3 217 ? -15.578 94.909  44.987  1.00 60.61  ? 217 GLU A CG    1 
ATOM   2032 C CD    . GLU C 3 217 ? -15.769 96.432  44.942  1.00 62.63  ? 217 GLU A CD    1 
ATOM   2033 O OE1   . GLU C 3 217 ? -16.505 96.971  45.809  1.00 63.04  ? 217 GLU A OE1   1 
ATOM   2034 O OE2   . GLU C 3 217 ? -15.191 97.086  44.034  1.00 63.58  ? 217 GLU A OE2   1 
ATOM   2035 N N     . GLY C 3 218 ? -13.352 92.075  45.134  1.00 52.60  ? 218 GLY A N     1 
ATOM   2036 C CA    . GLY C 3 218 ? -11.990 91.931  44.640  1.00 49.90  ? 218 GLY A CA    1 
ATOM   2037 C C     . GLY C 3 218 ? -11.808 92.776  43.392  1.00 47.94  ? 218 GLY A C     1 
ATOM   2038 O O     . GLY C 3 218 ? -12.667 93.600  43.080  1.00 48.02  ? 218 GLY A O     1 
ATOM   2039 N N     . ASP C 3 219 ? -10.704 92.583  42.675  1.00 45.97  ? 219 ASP A N     1 
ATOM   2040 C CA    . ASP C 3 219 ? -10.452 93.355  41.456  1.00 44.14  ? 219 ASP A CA    1 
ATOM   2041 C C     . ASP C 3 219 ? -10.054 92.455  40.290  1.00 42.51  ? 219 ASP A C     1 
ATOM   2042 O O     . ASP C 3 219 ? -9.334  92.880  39.380  1.00 41.99  ? 219 ASP A O     1 
ATOM   2043 C CB    . ASP C 3 219 ? -9.354  94.399  41.703  1.00 44.92  ? 219 ASP A CB    1 
ATOM   2044 C CG    . ASP C 3 219 ? -8.018  93.772  42.042  1.00 45.65  ? 219 ASP A CG    1 
ATOM   2045 O OD1   . ASP C 3 219 ? -7.072  94.521  42.360  1.00 45.44  ? 219 ASP A OD1   1 
ATOM   2046 O OD2   . ASP C 3 219 ? -7.910  92.529  41.986  1.00 46.38  ? 219 ASP A OD2   1 
ATOM   2047 N N     . TRP C 3 220 ? -10.530 91.212  40.339  1.00 40.32  ? 220 TRP A N     1 
ATOM   2048 C CA    . TRP C 3 220 ? -10.253 90.213  39.313  1.00 38.46  ? 220 TRP A CA    1 
ATOM   2049 C C     . TRP C 3 220 ? -8.935  89.493  39.549  1.00 38.12  ? 220 TRP A C     1 
ATOM   2050 O O     . TRP C 3 220 ? -8.771  88.354  39.126  1.00 38.20  ? 220 TRP A O     1 
ATOM   2051 C CB    . TRP C 3 220 ? -10.228 90.856  37.920  1.00 37.49  ? 220 TRP A CB    1 
ATOM   2052 C CG    . TRP C 3 220 ? -11.576 91.329  37.416  1.00 36.13  ? 220 TRP A CG    1 
ATOM   2053 C CD1   . TRP C 3 220 ? -11.853 92.525  36.797  1.00 35.37  ? 220 TRP A CD1   1 
ATOM   2054 C CD2   . TRP C 3 220 ? -12.801 90.594  37.420  1.00 35.49  ? 220 TRP A CD2   1 
ATOM   2055 N NE1   . TRP C 3 220 ? -13.169 92.574  36.421  1.00 34.41  ? 220 TRP A NE1   1 
ATOM   2056 C CE2   . TRP C 3 220 ? -13.781 91.398  36.800  1.00 35.20  ? 220 TRP A CE2   1 
ATOM   2057 C CE3   . TRP C 3 220 ? -13.176 89.327  37.907  1.00 35.60  ? 220 TRP A CE3   1 
ATOM   2058 C CZ2   . TRP C 3 220 ? -15.102 90.979  36.632  1.00 35.74  ? 220 TRP A CZ2   1 
ATOM   2059 C CZ3   . TRP C 3 220 ? -14.492 88.909  37.744  1.00 35.36  ? 220 TRP A CZ3   1 
ATOM   2060 C CH2   . TRP C 3 220 ? -15.440 89.737  37.119  1.00 35.46  ? 220 TRP A CH2   1 
ATOM   2061 N N     . SER C 3 221 ? -8.007  90.153  40.233  1.00 38.12  ? 221 SER A N     1 
ATOM   2062 C CA    . SER C 3 221 ? -6.688  89.583  40.497  1.00 38.81  ? 221 SER A CA    1 
ATOM   2063 C C     . SER C 3 221 ? -6.648  88.520  41.583  1.00 39.13  ? 221 SER A C     1 
ATOM   2064 O O     . SER C 3 221 ? -7.445  88.546  42.515  1.00 38.85  ? 221 SER A O     1 
ATOM   2065 C CB    . SER C 3 221 ? -5.711  90.679  40.898  1.00 38.94  ? 221 SER A CB    1 
ATOM   2066 O OG    . SER C 3 221 ? -5.847  90.964  42.278  1.00 38.44  ? 221 SER A OG    1 
ATOM   2067 N N     . ALA C 3 222 ? -5.688  87.608  41.467  1.00 39.97  ? 222 ALA A N     1 
ATOM   2068 C CA    . ALA C 3 222 ? -5.525  86.549  42.445  1.00 40.84  ? 222 ALA A CA    1 
ATOM   2069 C C     . ALA C 3 222 ? -5.129  87.126  43.788  1.00 41.40  ? 222 ALA A C     1 
ATOM   2070 O O     . ALA C 3 222 ? -5.564  86.626  44.817  1.00 41.89  ? 222 ALA A O     1 
ATOM   2071 C CB    . ALA C 3 222 ? -4.474  85.577  41.984  1.00 41.55  ? 222 ALA A CB    1 
ATOM   2072 N N     . MET C 3 223 ? -4.302  88.170  43.778  1.00 42.31  ? 223 MET A N     1 
ATOM   2073 C CA    . MET C 3 223 ? -3.862  88.800  45.018  1.00 44.41  ? 223 MET A CA    1 
ATOM   2074 C C     . MET C 3 223 ? -5.066  89.293  45.823  1.00 44.89  ? 223 MET A C     1 
ATOM   2075 O O     . MET C 3 223 ? -5.187  89.026  47.017  1.00 45.00  ? 223 MET A O     1 
ATOM   2076 C CB    . MET C 3 223 ? -2.932  89.969  44.710  1.00 45.94  ? 223 MET A CB    1 
ATOM   2077 C CG    . MET C 3 223 ? -2.063  90.384  45.883  1.00 48.78  ? 223 MET A CG    1 
ATOM   2078 S SD    . MET C 3 223 ? -1.192  88.961  46.572  1.00 51.18  ? 223 MET A SD    1 
ATOM   2079 C CE    . MET C 3 223 ? -1.335  89.250  48.313  1.00 51.09  ? 223 MET A CE    1 
ATOM   2080 N N     . SER C 3 224 ? -5.959  90.016  45.162  1.00 45.88  ? 224 SER A N     1 
ATOM   2081 C CA    . SER C 3 224 ? -7.160  90.514  45.818  1.00 46.85  ? 224 SER A CA    1 
ATOM   2082 C C     . SER C 3 224 ? -7.910  89.334  46.440  1.00 47.24  ? 224 SER A C     1 
ATOM   2083 O O     . SER C 3 224 ? -8.230  89.353  47.624  1.00 47.03  ? 224 SER A O     1 
ATOM   2084 C CB    . SER C 3 224 ? -8.061  91.231  44.800  1.00 47.50  ? 224 SER A CB    1 
ATOM   2085 O OG    . SER C 3 224 ? -8.539  90.346  43.794  1.00 47.99  ? 224 SER A OG    1 
ATOM   2086 N N     . GLY C 3 225 ? -8.180  88.311  45.631  1.00 47.84  ? 225 GLY A N     1 
ATOM   2087 C CA    . GLY C 3 225 ? -8.878  87.139  46.118  1.00 48.44  ? 225 GLY A CA    1 
ATOM   2088 C C     . GLY C 3 225 ? -8.241  86.635  47.395  1.00 49.27  ? 225 GLY A C     1 
ATOM   2089 O O     . GLY C 3 225 ? -8.920  86.125  48.283  1.00 49.56  ? 225 GLY A O     1 
ATOM   2090 N N     . PHE C 3 226 ? -6.926  86.787  47.488  1.00 50.12  ? 226 PHE A N     1 
ATOM   2091 C CA    . PHE C 3 226 ? -6.167  86.359  48.661  1.00 50.81  ? 226 PHE A CA    1 
ATOM   2092 C C     . PHE C 3 226 ? -6.439  87.297  49.838  1.00 51.80  ? 226 PHE A C     1 
ATOM   2093 O O     . PHE C 3 226 ? -6.957  86.871  50.874  1.00 52.10  ? 226 PHE A O     1 
ATOM   2094 C CB    . PHE C 3 226 ? -4.665  86.355  48.342  1.00 49.80  ? 226 PHE A CB    1 
ATOM   2095 C CG    . PHE C 3 226 ? -3.804  85.997  49.503  1.00 48.35  ? 226 PHE A CG    1 
ATOM   2096 C CD1   . PHE C 3 226 ? -3.890  84.739  50.076  1.00 47.86  ? 226 PHE A CD1   1 
ATOM   2097 C CD2   . PHE C 3 226 ? -2.932  86.927  50.046  1.00 48.17  ? 226 PHE A CD2   1 
ATOM   2098 C CE1   . PHE C 3 226 ? -3.122  84.409  51.179  1.00 48.01  ? 226 PHE A CE1   1 
ATOM   2099 C CE2   . PHE C 3 226 ? -2.158  86.612  51.150  1.00 48.51  ? 226 PHE A CE2   1 
ATOM   2100 C CZ    . PHE C 3 226 ? -2.252  85.349  51.722  1.00 48.51  ? 226 PHE A CZ    1 
ATOM   2101 N N     . GLN C 3 227 ? -6.090  88.572  49.671  1.00 52.72  ? 227 GLN A N     1 
ATOM   2102 C CA    . GLN C 3 227 ? -6.287  89.574  50.717  1.00 53.34  ? 227 GLN A CA    1 
ATOM   2103 C C     . GLN C 3 227 ? -7.700  89.576  51.275  1.00 52.42  ? 227 GLN A C     1 
ATOM   2104 O O     . GLN C 3 227 ? -7.888  89.456  52.479  1.00 51.46  ? 227 GLN A O     1 
ATOM   2105 C CB    . GLN C 3 227 ? -5.931  90.962  50.187  1.00 56.25  ? 227 GLN A CB    1 
ATOM   2106 C CG    . GLN C 3 227 ? -4.429  91.244  50.212  1.00 60.05  ? 227 GLN A CG    1 
ATOM   2107 C CD    . GLN C 3 227 ? -3.996  92.322  49.215  1.00 63.18  ? 227 GLN A CD    1 
ATOM   2108 O OE1   . GLN C 3 227 ? -2.819  92.706  49.169  1.00 64.15  ? 227 GLN A OE1   1 
ATOM   2109 N NE2   . GLN C 3 227 ? -4.946  92.808  48.406  1.00 64.58  ? 227 GLN A NE2   1 
ATOM   2110 N N     . GLN C 3 228 ? -8.694  89.706  50.405  1.00 52.06  ? 228 GLN A N     1 
ATOM   2111 C CA    . GLN C 3 228 ? -10.081 89.712  50.858  1.00 51.34  ? 228 GLN A CA    1 
ATOM   2112 C C     . GLN C 3 228 ? -10.433 88.466  51.672  1.00 51.29  ? 228 GLN A C     1 
ATOM   2113 O O     . GLN C 3 228 ? -11.026 88.582  52.744  1.00 50.78  ? 228 GLN A O     1 
ATOM   2114 C CB    . GLN C 3 228 ? -11.041 89.841  49.668  1.00 51.25  ? 228 GLN A CB    1 
ATOM   2115 C CG    . GLN C 3 228 ? -11.065 91.219  49.025  1.00 49.94  ? 228 GLN A CG    1 
ATOM   2116 C CD    . GLN C 3 228 ? -11.296 92.333  50.027  1.00 48.95  ? 228 GLN A CD    1 
ATOM   2117 O OE1   . GLN C 3 228 ? -12.232 92.290  50.824  1.00 47.36  ? 228 GLN A OE1   1 
ATOM   2118 N NE2   . GLN C 3 228 ? -10.444 93.347  49.982  1.00 48.88  ? 228 GLN A NE2   1 
ATOM   2119 N N     . THR C 3 229 ? -10.078 87.279  51.175  1.00 51.46  ? 229 THR A N     1 
ATOM   2120 C CA    . THR C 3 229 ? -10.394 86.059  51.905  1.00 51.51  ? 229 THR A CA    1 
ATOM   2121 C C     . THR C 3 229 ? -9.585  85.990  53.189  1.00 53.32  ? 229 THR A C     1 
ATOM   2122 O O     . THR C 3 229 ? -9.973  85.304  54.126  1.00 53.32  ? 229 THR A O     1 
ATOM   2123 C CB    . THR C 3 229 ? -10.162 84.794  51.055  1.00 49.76  ? 229 THR A CB    1 
ATOM   2124 O OG1   . THR C 3 229 ? -11.029 84.826  49.919  1.00 47.41  ? 229 THR A OG1   1 
ATOM   2125 C CG2   . THR C 3 229 ? -10.490 83.547  51.851  1.00 48.47  ? 229 THR A CG2   1 
ATOM   2126 N N     . MET C 3 230 ? -8.465  86.701  53.249  1.00 55.54  ? 230 MET A N     1 
ATOM   2127 C CA    . MET C 3 230 ? -7.681  86.706  54.481  1.00 58.61  ? 230 MET A CA    1 
ATOM   2128 C C     . MET C 3 230 ? -8.408  87.558  55.526  1.00 59.69  ? 230 MET A C     1 
ATOM   2129 O O     . MET C 3 230 ? -8.788  87.046  56.586  1.00 59.63  ? 230 MET A O     1 
ATOM   2130 C CB    . MET C 3 230 ? -6.273  87.265  54.249  1.00 60.40  ? 230 MET A CB    1 
ATOM   2131 C CG    . MET C 3 230 ? -5.184  86.201  54.073  1.00 62.28  ? 230 MET A CG    1 
ATOM   2132 S SD    . MET C 3 230 ? -4.890  85.163  55.540  1.00 65.11  ? 230 MET A SD    1 
ATOM   2133 C CE    . MET C 3 230 ? -3.656  86.151  56.413  1.00 62.88  ? 230 MET A CE    1 
ATOM   2134 N N     . GLN C 3 231 ? -8.604  88.848  55.220  1.00 60.71  ? 231 GLN A N     1 
ATOM   2135 C CA    . GLN C 3 231 ? -9.300  89.780  56.120  1.00 61.46  ? 231 GLN A CA    1 
ATOM   2136 C C     . GLN C 3 231 ? -10.572 89.148  56.652  1.00 60.63  ? 231 GLN A C     1 
ATOM   2137 O O     . GLN C 3 231 ? -10.873 89.275  57.837  1.00 60.45  ? 231 GLN A O     1 
ATOM   2138 C CB    . GLN C 3 231 ? -9.695  91.060  55.393  1.00 64.47  ? 231 GLN A CB    1 
ATOM   2139 C CG    . GLN C 3 231 ? -8.548  91.909  54.894  1.00 69.03  ? 231 GLN A CG    1 
ATOM   2140 C CD    . GLN C 3 231 ? -9.032  93.053  54.000  1.00 72.14  ? 231 GLN A CD    1 
ATOM   2141 O OE1   . GLN C 3 231 ? -8.227  93.862  53.514  1.00 73.58  ? 231 GLN A OE1   1 
ATOM   2142 N NE2   . GLN C 3 231 ? -10.355 93.123  53.777  1.00 73.56  ? 231 GLN A NE2   1 
ATOM   2143 N N     . MET C 3 232 ? -11.319 88.487  55.758  1.00 59.76  ? 232 MET A N     1 
ATOM   2144 C CA    . MET C 3 232 ? -12.568 87.811  56.108  1.00 58.32  ? 232 MET A CA    1 
ATOM   2145 C C     . MET C 3 232 ? -12.322 86.733  57.160  1.00 58.29  ? 232 MET A C     1 
ATOM   2146 O O     . MET C 3 232 ? -13.060 86.629  58.144  1.00 57.92  ? 232 MET A O     1 
ATOM   2147 C CB    . MET C 3 232 ? -13.193 87.166  54.876  1.00 56.68  ? 232 MET A CB    1 
ATOM   2148 C CG    . MET C 3 232 ? -14.434 86.375  55.202  1.00 56.06  ? 232 MET A CG    1 
ATOM   2149 S SD    . MET C 3 232 ? -15.095 85.506  53.789  1.00 56.29  ? 232 MET A SD    1 
ATOM   2150 C CE    . MET C 3 232 ? -14.342 83.920  53.973  1.00 55.36  ? 232 MET A CE    1 
ATOM   2151 N N     . LEU C 3 233 ? -11.285 85.929  56.948  1.00 58.01  ? 233 LEU A N     1 
ATOM   2152 C CA    . LEU C 3 233 ? -10.948 84.878  57.894  1.00 58.01  ? 233 LEU A CA    1 
ATOM   2153 C C     . LEU C 3 233 ? -10.381 85.434  59.195  1.00 58.66  ? 233 LEU A C     1 
ATOM   2154 O O     . LEU C 3 233 ? -10.495 84.799  60.238  1.00 59.35  ? 233 LEU A O     1 
ATOM   2155 C CB    . LEU C 3 233 ? -9.962  83.892  57.266  1.00 57.10  ? 233 LEU A CB    1 
ATOM   2156 C CG    . LEU C 3 233 ? -10.577 82.906  56.258  1.00 56.64  ? 233 LEU A CG    1 
ATOM   2157 C CD1   . LEU C 3 233 ? -9.496  82.013  55.673  1.00 56.81  ? 233 LEU A CD1   1 
ATOM   2158 C CD2   . LEU C 3 233 ? -11.635 82.051  56.939  1.00 56.06  ? 233 LEU A CD2   1 
ATOM   2159 N N     . ASN C 3 234 ? -9.779  86.618  59.145  1.00 59.40  ? 234 ASN A N     1 
ATOM   2160 C CA    . ASN C 3 234 ? -9.232  87.224  60.355  1.00 60.57  ? 234 ASN A CA    1 
ATOM   2161 C C     . ASN C 3 234 ? -10.304 87.866  61.230  1.00 60.77  ? 234 ASN A C     1 
ATOM   2162 O O     . ASN C 3 234 ? -10.097 88.079  62.426  1.00 60.48  ? 234 ASN A O     1 
ATOM   2163 C CB    . ASN C 3 234 ? -8.167  88.257  60.003  1.00 62.06  ? 234 ASN A CB    1 
ATOM   2164 C CG    . ASN C 3 234 ? -6.919  87.618  59.458  1.00 63.55  ? 234 ASN A CG    1 
ATOM   2165 O OD1   . ASN C 3 234 ? -6.472  86.589  59.972  1.00 64.41  ? 234 ASN A OD1   1 
ATOM   2166 N ND2   . ASN C 3 234 ? -6.337  88.220  58.420  1.00 64.42  ? 234 ASN A ND2   1 
ATOM   2167 N N     . GLU C 3 235 ? -11.449 88.174  60.626  1.00 61.05  ? 235 GLU A N     1 
ATOM   2168 C CA    . GLU C 3 235 ? -12.571 88.770  61.350  1.00 60.65  ? 235 GLU A CA    1 
ATOM   2169 C C     . GLU C 3 235 ? -13.402 87.644  61.960  1.00 58.60  ? 235 GLU A C     1 
ATOM   2170 O O     . GLU C 3 235 ? -14.527 87.861  62.390  1.00 58.80  ? 235 GLU A O     1 
ATOM   2171 C CB    . GLU C 3 235 ? -13.464 89.604  60.412  1.00 63.20  ? 235 GLU A CB    1 
ATOM   2172 C CG    . GLU C 3 235 ? -12.832 90.885  59.845  1.00 66.45  ? 235 GLU A CG    1 
ATOM   2173 C CD    . GLU C 3 235 ? -13.765 91.619  58.869  1.00 68.74  ? 235 GLU A CD    1 
ATOM   2174 O OE1   . GLU C 3 235 ? -13.360 92.676  58.324  1.00 69.59  ? 235 GLU A OE1   1 
ATOM   2175 O OE2   . GLU C 3 235 ? -14.904 91.136  58.646  1.00 69.60  ? 235 GLU A OE2   1 
ATOM   2176 N N     . GLY C 3 236 ? -12.845 86.439  61.978  1.00 56.23  ? 236 GLY A N     1 
ATOM   2177 C CA    . GLY C 3 236 ? -13.547 85.303  62.549  1.00 53.72  ? 236 GLY A CA    1 
ATOM   2178 C C     . GLY C 3 236 ? -14.684 84.721  61.725  1.00 51.70  ? 236 GLY A C     1 
ATOM   2179 O O     . GLY C 3 236 ? -15.307 83.736  62.128  1.00 51.38  ? 236 GLY A O     1 
ATOM   2180 N N     . ILE C 3 237 ? -14.965 85.314  60.572  1.00 49.67  ? 237 ILE A N     1 
ATOM   2181 C CA    . ILE C 3 237 ? -16.046 84.815  59.731  1.00 47.79  ? 237 ILE A CA    1 
ATOM   2182 C C     . ILE C 3 237 ? -15.546 83.670  58.882  1.00 45.98  ? 237 ILE A C     1 
ATOM   2183 O O     . ILE C 3 237 ? -14.823 83.878  57.914  1.00 46.21  ? 237 ILE A O     1 
ATOM   2184 C CB    . ILE C 3 237 ? -16.554 85.885  58.780  1.00 48.92  ? 237 ILE A CB    1 
ATOM   2185 C CG1   . ILE C 3 237 ? -16.796 87.184  59.554  1.00 49.15  ? 237 ILE A CG1   1 
ATOM   2186 C CG2   . ILE C 3 237 ? -17.816 85.373  58.068  1.00 48.16  ? 237 ILE A CG2   1 
ATOM   2187 C CD1   . ILE C 3 237 ? -17.092 88.382  58.669  1.00 50.15  ? 237 ILE A CD1   1 
ATOM   2188 N N     . VAL C 3 238 ? -15.945 82.458  59.215  1.00 43.17  ? 238 VAL A N     1 
ATOM   2189 C CA    . VAL C 3 238 ? -15.465 81.338  58.444  1.00 40.30  ? 238 VAL A CA    1 
ATOM   2190 C C     . VAL C 3 238 ? -16.575 80.491  57.876  1.00 37.92  ? 238 VAL A C     1 
ATOM   2191 O O     . VAL C 3 238 ? -17.176 79.679  58.564  1.00 37.54  ? 238 VAL A O     1 
ATOM   2192 C CB    . VAL C 3 238 ? -14.526 80.476  59.290  1.00 41.52  ? 238 VAL A CB    1 
ATOM   2193 C CG1   . VAL C 3 238 ? -15.142 80.220  60.658  1.00 42.22  ? 238 VAL A CG1   1 
ATOM   2194 C CG2   . VAL C 3 238 ? -14.249 79.172  58.580  1.00 41.44  ? 238 VAL A CG2   1 
ATOM   2195 N N     . PRO C 3 239 ? -16.864 80.679  56.593  1.00 37.31  ? 239 PRO A N     1 
ATOM   2196 C CA    . PRO C 3 239 ? -17.914 79.934  55.889  1.00 36.42  ? 239 PRO A CA    1 
ATOM   2197 C C     . PRO C 3 239 ? -17.563 78.471  55.663  1.00 35.54  ? 239 PRO A C     1 
ATOM   2198 O O     . PRO C 3 239 ? -16.580 77.973  56.201  1.00 35.40  ? 239 PRO A O     1 
ATOM   2199 C CB    . PRO C 3 239 ? -18.056 80.699  54.570  1.00 36.91  ? 239 PRO A CB    1 
ATOM   2200 C CG    . PRO C 3 239 ? -16.680 81.286  54.364  1.00 36.95  ? 239 PRO A CG    1 
ATOM   2201 C CD    . PRO C 3 239 ? -16.308 81.751  55.750  1.00 36.62  ? 239 PRO A CD    1 
ATOM   2202 N N     . THR C 3 240 ? -18.386 77.782  54.880  1.00 34.97  ? 240 THR A N     1 
ATOM   2203 C CA    . THR C 3 240 ? -18.128 76.387  54.551  1.00 35.47  ? 240 THR A CA    1 
ATOM   2204 C C     . THR C 3 240 ? -18.074 76.261  53.037  1.00 35.79  ? 240 THR A C     1 
ATOM   2205 O O     . THR C 3 240 ? -17.825 75.182  52.492  1.00 34.95  ? 240 THR A O     1 
ATOM   2206 C CB    . THR C 3 240 ? -19.204 75.434  55.112  1.00 35.51  ? 240 THR A CB    1 
ATOM   2207 O OG1   . THR C 3 240 ? -20.462 75.638  54.452  1.00 35.11  ? 240 THR A OG1   1 
ATOM   2208 C CG2   . THR C 3 240 ? -19.359 75.669  56.593  1.00 35.66  ? 240 THR A CG2   1 
ATOM   2209 N N     . ALA C 3 241 ? -18.296 77.389  52.371  1.00 36.60  ? 241 ALA A N     1 
ATOM   2210 C CA    . ALA C 3 241 ? -18.264 77.457  50.917  1.00 38.13  ? 241 ALA A CA    1 
ATOM   2211 C C     . ALA C 3 241 ? -18.217 78.926  50.508  1.00 38.61  ? 241 ALA A C     1 
ATOM   2212 O O     . ALA C 3 241 ? -18.787 79.784  51.186  1.00 38.79  ? 241 ALA A O     1 
ATOM   2213 C CB    . ALA C 3 241 ? -19.507 76.774  50.311  1.00 36.97  ? 241 ALA A CB    1 
ATOM   2214 N N     . MET C 3 242 ? -17.521 79.207  49.410  1.00 38.69  ? 242 MET A N     1 
ATOM   2215 C CA    . MET C 3 242 ? -17.407 80.559  48.886  1.00 37.95  ? 242 MET A CA    1 
ATOM   2216 C C     . MET C 3 242 ? -17.722 80.542  47.412  1.00 38.21  ? 242 MET A C     1 
ATOM   2217 O O     . MET C 3 242 ? -17.405 79.585  46.705  1.00 38.38  ? 242 MET A O     1 
ATOM   2218 C CB    . MET C 3 242 ? -15.996 81.102  49.064  1.00 38.05  ? 242 MET A CB    1 
ATOM   2219 C CG    . MET C 3 242 ? -15.651 81.504  50.470  1.00 39.74  ? 242 MET A CG    1 
ATOM   2220 S SD    . MET C 3 242 ? -13.931 82.030  50.607  1.00 42.21  ? 242 MET A SD    1 
ATOM   2221 C CE    . MET C 3 242 ? -13.984 83.646  49.896  1.00 43.12  ? 242 MET A CE    1 
ATOM   2222 N N     . LEU C 3 243 ? -18.368 81.600  46.952  1.00 38.75  ? 243 LEU A N     1 
ATOM   2223 C CA    . LEU C 3 243 ? -18.686 81.735  45.535  1.00 38.58  ? 243 LEU A CA    1 
ATOM   2224 C C     . LEU C 3 243 ? -17.811 82.913  45.125  1.00 37.83  ? 243 LEU A C     1 
ATOM   2225 O O     . LEU C 3 243 ? -17.912 84.001  45.716  1.00 37.19  ? 243 LEU A O     1 
ATOM   2226 C CB    . LEU C 3 243 ? -20.176 82.049  45.340  1.00 37.85  ? 243 LEU A CB    1 
ATOM   2227 C CG    . LEU C 3 243 ? -21.112 80.913  45.762  1.00 37.11  ? 243 LEU A CG    1 
ATOM   2228 C CD1   . LEU C 3 243 ? -22.518 81.445  45.929  1.00 37.70  ? 243 LEU A CD1   1 
ATOM   2229 C CD2   . LEU C 3 243 ? -21.073 79.805  44.726  1.00 36.23  ? 243 LEU A CD2   1 
ATOM   2230 N N     . VAL C 3 244 ? -16.925 82.691  44.153  1.00 36.84  ? 244 VAL A N     1 
ATOM   2231 C CA    . VAL C 3 244 ? -16.033 83.759  43.717  1.00 35.96  ? 244 VAL A CA    1 
ATOM   2232 C C     . VAL C 3 244 ? -16.305 84.184  42.277  1.00 35.49  ? 244 VAL A C     1 
ATOM   2233 O O     . VAL C 3 244 ? -16.592 83.343  41.415  1.00 34.80  ? 244 VAL A O     1 
ATOM   2234 C CB    . VAL C 3 244 ? -14.564 83.340  43.870  1.00 35.33  ? 244 VAL A CB    1 
ATOM   2235 C CG1   . VAL C 3 244 ? -13.669 84.574  43.863  1.00 33.49  ? 244 VAL A CG1   1 
ATOM   2236 C CG2   . VAL C 3 244 ? -14.391 82.558  45.156  1.00 34.20  ? 244 VAL A CG2   1 
ATOM   2237 N N     . ALA C 3 245 ? -16.200 85.491  42.035  1.00 34.71  ? 245 ALA A N     1 
ATOM   2238 C CA    . ALA C 3 245 ? -16.469 86.079  40.732  1.00 34.80  ? 245 ALA A CA    1 
ATOM   2239 C C     . ALA C 3 245 ? -15.629 85.593  39.556  1.00 34.95  ? 245 ALA A C     1 
ATOM   2240 O O     . ALA C 3 245 ? -15.955 85.874  38.406  1.00 34.69  ? 245 ALA A O     1 
ATOM   2241 C CB    . ALA C 3 245 ? -16.377 87.575  40.837  1.00 33.69  ? 245 ALA A CB    1 
ATOM   2242 N N     . ASN C 3 246 ? -14.548 84.874  39.825  1.00 35.98  ? 246 ASN A N     1 
ATOM   2243 C CA    . ASN C 3 246 ? -13.717 84.374  38.738  1.00 37.12  ? 246 ASN A CA    1 
ATOM   2244 C C     . ASN C 3 246 ? -12.646 83.421  39.246  1.00 37.45  ? 246 ASN A C     1 
ATOM   2245 O O     . ASN C 3 246 ? -12.265 83.463  40.414  1.00 37.13  ? 246 ASN A O     1 
ATOM   2246 C CB    . ASN C 3 246 ? -13.076 85.546  37.979  1.00 37.68  ? 246 ASN A CB    1 
ATOM   2247 C CG    . ASN C 3 246 ? -11.892 86.166  38.718  1.00 37.61  ? 246 ASN A CG    1 
ATOM   2248 O OD1   . ASN C 3 246 ? -11.831 86.151  39.952  1.00 37.54  ? 246 ASN A OD1   1 
ATOM   2249 N ND2   . ASN C 3 246 ? -10.951 86.734  37.957  1.00 37.15  ? 246 ASN A ND2   1 
ATOM   2250 N N     . ASP C 3 247 ? -12.156 82.565  38.361  1.00 37.86  ? 247 ASP A N     1 
ATOM   2251 C CA    . ASP C 3 247 ? -11.144 81.595  38.745  1.00 37.84  ? 247 ASP A CA    1 
ATOM   2252 C C     . ASP C 3 247 ? -9.932  82.205  39.446  1.00 37.23  ? 247 ASP A C     1 
ATOM   2253 O O     . ASP C 3 247 ? -9.556  81.753  40.527  1.00 36.95  ? 247 ASP A O     1 
ATOM   2254 C CB    . ASP C 3 247 ? -10.716 80.772  37.520  1.00 38.79  ? 247 ASP A CB    1 
ATOM   2255 C CG    . ASP C 3 247 ? -11.834 79.859  37.015  1.00 39.67  ? 247 ASP A CG    1 
ATOM   2256 O OD1   . ASP C 3 247 ? -11.682 79.254  35.931  1.00 39.65  ? 247 ASP A OD1   1 
ATOM   2257 O OD2   . ASP C 3 247 ? -12.872 79.745  37.708  1.00 40.13  ? 247 ASP A OD2   1 
ATOM   2258 N N     . GLN C 3 248 ? -9.326  83.232  38.859  1.00 36.63  ? 248 GLN A N     1 
ATOM   2259 C CA    . GLN C 3 248 ? -8.157  83.834  39.490  1.00 36.60  ? 248 GLN A CA    1 
ATOM   2260 C C     . GLN C 3 248 ? -8.335  84.252  40.943  1.00 35.91  ? 248 GLN A C     1 
ATOM   2261 O O     . GLN C 3 248 ? -7.475  83.970  41.769  1.00 36.36  ? 248 GLN A O     1 
ATOM   2262 C CB    . GLN C 3 248 ? -7.659  85.010  38.671  1.00 38.20  ? 248 GLN A CB    1 
ATOM   2263 C CG    . GLN C 3 248 ? -6.825  84.568  37.496  1.00 42.12  ? 248 GLN A CG    1 
ATOM   2264 C CD    . GLN C 3 248 ? -6.818  85.583  36.375  1.00 44.75  ? 248 GLN A CD    1 
ATOM   2265 O OE1   . GLN C 3 248 ? -7.849  85.821  35.720  1.00 47.16  ? 248 GLN A OE1   1 
ATOM   2266 N NE2   . GLN C 3 248 ? -5.655  86.197  36.142  1.00 45.49  ? 248 GLN A NE2   1 
ATOM   2267 N N     . MET C 3 249 ? -9.428  84.920  41.282  1.00 34.94  ? 249 MET A N     1 
ATOM   2268 C CA    . MET C 3 249 ? -9.612  85.306  42.678  1.00 33.57  ? 249 MET A CA    1 
ATOM   2269 C C     . MET C 3 249 ? -9.861  84.072  43.525  1.00 31.56  ? 249 MET A C     1 
ATOM   2270 O O     . MET C 3 249 ? -9.578  84.062  44.718  1.00 29.64  ? 249 MET A O     1 
ATOM   2271 C CB    . MET C 3 249 ? -10.774 86.281  42.828  1.00 35.55  ? 249 MET A CB    1 
ATOM   2272 C CG    . MET C 3 249 ? -10.491 87.646  42.233  1.00 37.80  ? 249 MET A CG    1 
ATOM   2273 S SD    . MET C 3 249 ? -11.717 88.862  42.704  1.00 40.22  ? 249 MET A SD    1 
ATOM   2274 C CE    . MET C 3 249 ? -13.180 88.123  41.923  1.00 39.70  ? 249 MET A CE    1 
ATOM   2275 N N     . ALA C 3 250 ? -10.394 83.032  42.894  1.00 30.26  ? 250 ALA A N     1 
ATOM   2276 C CA    . ALA C 3 250 ? -10.666 81.775  43.580  1.00 29.31  ? 250 ALA A CA    1 
ATOM   2277 C C     . ALA C 3 250 ? -9.333  81.208  44.023  1.00 28.33  ? 250 ALA A C     1 
ATOM   2278 O O     . ALA C 3 250 ? -9.211  80.632  45.102  1.00 27.19  ? 250 ALA A O     1 
ATOM   2279 C CB    . ALA C 3 250 ? -11.357 80.803  42.636  1.00 29.09  ? 250 ALA A CB    1 
ATOM   2280 N N     . LEU C 3 251 ? -8.337  81.380  43.162  1.00 28.15  ? 251 LEU A N     1 
ATOM   2281 C CA    . LEU C 3 251 ? -6.986  80.915  43.433  1.00 27.69  ? 251 LEU A CA    1 
ATOM   2282 C C     . LEU C 3 251 ? -6.479  81.607  44.696  1.00 27.67  ? 251 LEU A C     1 
ATOM   2283 O O     . LEU C 3 251 ? -6.060  80.947  45.647  1.00 27.38  ? 251 LEU A O     1 
ATOM   2284 C CB    . LEU C 3 251 ? -6.063  81.250  42.261  1.00 26.54  ? 251 LEU A CB    1 
ATOM   2285 C CG    . LEU C 3 251 ? -4.624  80.776  42.433  1.00 26.25  ? 251 LEU A CG    1 
ATOM   2286 C CD1   . LEU C 3 251 ? -4.632  79.270  42.332  1.00 25.88  ? 251 LEU A CD1   1 
ATOM   2287 C CD2   . LEU C 3 251 ? -3.712  81.375  41.375  1.00 25.66  ? 251 LEU A CD2   1 
ATOM   2288 N N     . GLY C 3 252 ? -6.525  82.937  44.699  1.00 26.80  ? 252 GLY A N     1 
ATOM   2289 C CA    . GLY C 3 252 ? -6.082  83.685  45.858  1.00 27.28  ? 252 GLY A CA    1 
ATOM   2290 C C     . GLY C 3 252 ? -6.848  83.261  47.092  1.00 27.36  ? 252 GLY A C     1 
ATOM   2291 O O     . GLY C 3 252 ? -6.295  83.164  48.189  1.00 25.90  ? 252 GLY A O     1 
ATOM   2292 N N     . ALA C 3 253 ? -8.136  83.005  46.901  1.00 29.07  ? 253 ALA A N     1 
ATOM   2293 C CA    . ALA C 3 253 ? -9.002  82.573  47.990  1.00 30.86  ? 253 ALA A CA    1 
ATOM   2294 C C     . ALA C 3 253 ? -8.490  81.247  48.517  1.00 32.12  ? 253 ALA A C     1 
ATOM   2295 O O     . ALA C 3 253 ? -8.291  81.065  49.726  1.00 32.37  ? 253 ALA A O     1 
ATOM   2296 C CB    . ALA C 3 253 ? -10.426 82.411  47.491  1.00 30.01  ? 253 ALA A CB    1 
ATOM   2297 N N     . MET C 3 254 ? -8.282  80.314  47.595  1.00 32.92  ? 254 MET A N     1 
ATOM   2298 C CA    . MET C 3 254 ? -7.791  79.009  47.968  1.00 34.09  ? 254 MET A CA    1 
ATOM   2299 C C     . MET C 3 254 ? -6.475  79.140  48.718  1.00 35.17  ? 254 MET A C     1 
ATOM   2300 O O     . MET C 3 254 ? -6.258  78.444  49.703  1.00 36.08  ? 254 MET A O     1 
ATOM   2301 C CB    . MET C 3 254 ? -7.637  78.162  46.724  1.00 33.22  ? 254 MET A CB    1 
ATOM   2302 C CG    . MET C 3 254 ? -8.954  77.917  46.081  1.00 35.03  ? 254 MET A CG    1 
ATOM   2303 S SD    . MET C 3 254 ? -8.796  77.163  44.494  1.00 38.95  ? 254 MET A SD    1 
ATOM   2304 C CE    . MET C 3 254 ? -8.424  75.495  44.980  1.00 39.98  ? 254 MET A CE    1 
ATOM   2305 N N     . ARG C 3 255 ? -5.609  80.049  48.286  1.00 35.91  ? 255 ARG A N     1 
ATOM   2306 C CA    . ARG C 3 255 ? -4.336  80.198  48.970  1.00 36.87  ? 255 ARG A CA    1 
ATOM   2307 C C     . ARG C 3 255 ? -4.578  80.512  50.426  1.00 36.85  ? 255 ARG A C     1 
ATOM   2308 O O     . ARG C 3 255 ? -4.183  79.755  51.311  1.00 35.69  ? 255 ARG A O     1 
ATOM   2309 C CB    . ARG C 3 255 ? -3.500  81.307  48.338  1.00 38.01  ? 255 ARG A CB    1 
ATOM   2310 C CG    . ARG C 3 255 ? -1.999  81.023  48.389  1.00 39.41  ? 255 ARG A CG    1 
ATOM   2311 C CD    . ARG C 3 255 ? -1.268  81.845  49.423  1.00 39.30  ? 255 ARG A CD    1 
ATOM   2312 N NE    . ARG C 3 255 ? -0.756  83.086  48.853  1.00 40.56  ? 255 ARG A NE    1 
ATOM   2313 C CZ    . ARG C 3 255 ? 0.131   83.872  49.454  1.00 41.46  ? 255 ARG A CZ    1 
ATOM   2314 N NH1   . ARG C 3 255 ? 0.607   83.547  50.646  1.00 41.09  ? 255 ARG A NH1   1 
ATOM   2315 N NH2   . ARG C 3 255 ? 0.549   84.982  48.866  1.00 43.25  ? 255 ARG A NH2   1 
ATOM   2316 N N     . ALA C 3 256 ? -5.250  81.631  50.660  1.00 38.47  ? 256 ALA A N     1 
ATOM   2317 C CA    . ALA C 3 256 ? -5.558  82.087  52.012  1.00 40.29  ? 256 ALA A CA    1 
ATOM   2318 C C     . ALA C 3 256 ? -6.221  81.010  52.866  1.00 40.12  ? 256 ALA A C     1 
ATOM   2319 O O     . ALA C 3 256 ? -5.909  80.863  54.052  1.00 39.69  ? 256 ALA A O     1 
ATOM   2320 C CB    . ALA C 3 256 ? -6.449  83.324  51.946  1.00 41.54  ? 256 ALA A CB    1 
ATOM   2321 N N     . ILE C 3 257 ? -7.148  80.275  52.267  1.00 40.10  ? 257 ILE A N     1 
ATOM   2322 C CA    . ILE C 3 257 ? -7.823  79.213  52.982  1.00 41.46  ? 257 ILE A CA    1 
ATOM   2323 C C     . ILE C 3 257 ? -6.794  78.184  53.468  1.00 42.80  ? 257 ILE A C     1 
ATOM   2324 O O     . ILE C 3 257 ? -6.797  77.790  54.645  1.00 42.83  ? 257 ILE A O     1 
ATOM   2325 C CB    . ILE C 3 257 ? -8.858  78.526  52.070  1.00 40.82  ? 257 ILE A CB    1 
ATOM   2326 C CG1   . ILE C 3 257 ? -10.075 79.435  51.931  1.00 40.10  ? 257 ILE A CG1   1 
ATOM   2327 C CG2   . ILE C 3 257 ? -9.234  77.146  52.612  1.00 39.97  ? 257 ILE A CG2   1 
ATOM   2328 C CD1   . ILE C 3 257 ? -11.183 78.838  51.089  1.00 41.06  ? 257 ILE A CD1   1 
ATOM   2329 N N     . THR C 3 258 ? -5.905  77.775  52.559  1.00 44.21  ? 258 THR A N     1 
ATOM   2330 C CA    . THR C 3 258 ? -4.870  76.776  52.846  1.00 45.31  ? 258 THR A CA    1 
ATOM   2331 C C     . THR C 3 258 ? -3.825  77.231  53.844  1.00 44.89  ? 258 THR A C     1 
ATOM   2332 O O     . THR C 3 258 ? -3.485  76.505  54.768  1.00 44.84  ? 258 THR A O     1 
ATOM   2333 C CB    . THR C 3 258 ? -4.115  76.347  51.570  1.00 45.07  ? 258 THR A CB    1 
ATOM   2334 O OG1   . THR C 3 258 ? -5.025  75.754  50.633  1.00 46.00  ? 258 THR A OG1   1 
ATOM   2335 C CG2   . THR C 3 258 ? -3.058  75.328  51.919  1.00 45.42  ? 258 THR A CG2   1 
ATOM   2336 N N     . GLU C 3 259 ? -3.297  78.424  53.640  1.00 45.74  ? 259 GLU A N     1 
ATOM   2337 C CA    . GLU C 3 259 ? -2.289  78.946  54.537  1.00 48.05  ? 259 GLU A CA    1 
ATOM   2338 C C     . GLU C 3 259 ? -2.890  79.253  55.895  1.00 48.96  ? 259 GLU A C     1 
ATOM   2339 O O     . GLU C 3 259 ? -2.198  79.706  56.808  1.00 49.10  ? 259 GLU A O     1 
ATOM   2340 C CB    . GLU C 3 259 ? -1.676  80.216  53.954  1.00 49.35  ? 259 GLU A CB    1 
ATOM   2341 C CG    . GLU C 3 259 ? -0.875  79.993  52.672  1.00 50.46  ? 259 GLU A CG    1 
ATOM   2342 C CD    . GLU C 3 259 ? 0.012   81.182  52.304  1.00 50.67  ? 259 GLU A CD    1 
ATOM   2343 O OE1   . GLU C 3 259 ? 0.833   81.039  51.372  1.00 49.61  ? 259 GLU A OE1   1 
ATOM   2344 O OE2   . GLU C 3 259 ? -0.111  82.253  52.946  1.00 51.15  ? 259 GLU A OE2   1 
ATOM   2345 N N     . SER C 3 260 ? -4.188  79.010  56.024  1.00 50.56  ? 260 SER A N     1 
ATOM   2346 C CA    . SER C 3 260 ? -4.883  79.266  57.279  1.00 51.77  ? 260 SER A CA    1 
ATOM   2347 C C     . SER C 3 260 ? -5.180  77.959  58.008  1.00 52.03  ? 260 SER A C     1 
ATOM   2348 O O     . SER C 3 260 ? -5.906  77.930  58.998  1.00 51.72  ? 260 SER A O     1 
ATOM   2349 C CB    . SER C 3 260 ? -6.167  80.051  57.006  1.00 51.74  ? 260 SER A CB    1 
ATOM   2350 O OG    . SER C 3 260 ? -5.851  81.348  56.517  1.00 51.65  ? 260 SER A OG    1 
ATOM   2351 N N     . GLY C 3 261 ? -4.602  76.877  57.504  1.00 53.22  ? 261 GLY A N     1 
ATOM   2352 C CA    . GLY C 3 261 ? -4.781  75.582  58.128  1.00 53.92  ? 261 GLY A CA    1 
ATOM   2353 C C     . GLY C 3 261 ? -6.079  74.886  57.791  1.00 54.76  ? 261 GLY A C     1 
ATOM   2354 O O     . GLY C 3 261 ? -6.399  73.858  58.388  1.00 55.22  ? 261 GLY A O     1 
ATOM   2355 N N     . LEU C 3 262 ? -6.840  75.429  56.849  1.00 55.25  ? 262 LEU A N     1 
ATOM   2356 C CA    . LEU C 3 262 ? -8.092  74.790  56.480  1.00 55.89  ? 262 LEU A CA    1 
ATOM   2357 C C     . LEU C 3 262 ? -7.889  74.048  55.159  1.00 56.72  ? 262 LEU A C     1 
ATOM   2358 O O     . LEU C 3 262 ? -6.949  74.342  54.418  1.00 56.47  ? 262 LEU A O     1 
ATOM   2359 C CB    . LEU C 3 262 ? -9.195  75.846  56.394  1.00 55.01  ? 262 LEU A CB    1 
ATOM   2360 C CG    . LEU C 3 262 ? -9.372  76.560  57.739  1.00 54.27  ? 262 LEU A CG    1 
ATOM   2361 C CD1   . LEU C 3 262 ? -10.379 77.671  57.634  1.00 54.79  ? 262 LEU A CD1   1 
ATOM   2362 C CD2   . LEU C 3 262 ? -9.817  75.545  58.771  1.00 54.39  ? 262 LEU A CD2   1 
ATOM   2363 N N     . ARG C 3 263 ? -8.745  73.065  54.883  1.00 58.34  ? 263 ARG A N     1 
ATOM   2364 C CA    . ARG C 3 263 ? -8.639  72.273  53.650  1.00 59.83  ? 263 ARG A CA    1 
ATOM   2365 C C     . ARG C 3 263 ? -9.682  72.635  52.593  1.00 58.62  ? 263 ARG A C     1 
ATOM   2366 O O     . ARG C 3 263 ? -10.857 72.274  52.724  1.00 57.48  ? 263 ARG A O     1 
ATOM   2367 C CB    . ARG C 3 263 ? -8.776  70.772  53.948  1.00 62.81  ? 263 ARG A CB    1 
ATOM   2368 C CG    . ARG C 3 263 ? -7.824  70.217  55.010  1.00 67.53  ? 263 ARG A CG    1 
ATOM   2369 C CD    . ARG C 3 263 ? -7.915  68.684  55.096  1.00 71.70  ? 263 ARG A CD    1 
ATOM   2370 N NE    . ARG C 3 263 ? -9.273  68.184  55.354  1.00 75.96  ? 263 ARG A NE    1 
ATOM   2371 C CZ    . ARG C 3 263 ? -9.997  68.462  56.446  1.00 77.81  ? 263 ARG A CZ    1 
ATOM   2372 N NH1   . ARG C 3 263 ? -9.499  69.252  57.407  1.00 78.85  ? 263 ARG A NH1   1 
ATOM   2373 N NH2   . ARG C 3 263 ? -11.224 67.947  56.587  1.00 78.10  ? 263 ARG A NH2   1 
ATOM   2374 N N     . VAL C 3 264 ? -9.253  73.341  51.549  1.00 58.18  ? 264 VAL A N     1 
ATOM   2375 C CA    . VAL C 3 264 ? -10.166 73.705  50.474  1.00 57.76  ? 264 VAL A CA    1 
ATOM   2376 C C     . VAL C 3 264 ? -10.899 72.417  50.107  1.00 56.55  ? 264 VAL A C     1 
ATOM   2377 O O     . VAL C 3 264 ? -10.279 71.369  49.945  1.00 56.03  ? 264 VAL A O     1 
ATOM   2378 C CB    . VAL C 3 264 ? -9.400  74.268  49.240  1.00 57.92  ? 264 VAL A CB    1 
ATOM   2379 C CG1   . VAL C 3 264 ? -10.352 74.427  48.053  1.00 57.79  ? 264 VAL A CG1   1 
ATOM   2380 C CG2   . VAL C 3 264 ? -8.772  75.618  49.592  1.00 56.97  ? 264 VAL A CG2   1 
ATOM   2381 N N     . GLY C 3 265 ? -12.221 72.500  50.007  1.00 55.73  ? 265 GLY A N     1 
ATOM   2382 C CA    . GLY C 3 265 ? -13.024 71.327  49.704  1.00 55.30  ? 265 GLY A CA    1 
ATOM   2383 C C     . GLY C 3 265 ? -13.626 70.809  51.006  1.00 55.05  ? 265 GLY A C     1 
ATOM   2384 O O     . GLY C 3 265 ? -14.798 71.066  51.315  1.00 55.74  ? 265 GLY A O     1 
ATOM   2385 N N     . ALA C 3 266 ? -12.806 70.100  51.783  1.00 53.76  ? 266 ALA A N     1 
ATOM   2386 C CA    . ALA C 3 266 ? -13.203 69.522  53.071  1.00 51.21  ? 266 ALA A CA    1 
ATOM   2387 C C     . ALA C 3 266 ? -13.674 70.531  54.125  1.00 48.98  ? 266 ALA A C     1 
ATOM   2388 O O     . ALA C 3 266 ? -14.653 70.289  54.830  1.00 48.54  ? 266 ALA A O     1 
ATOM   2389 C CB    . ALA C 3 266 ? -12.048 68.709  53.634  1.00 51.53  ? 266 ALA A CB    1 
ATOM   2390 N N     . ASP C 3 267 ? -12.964 71.644  54.259  1.00 46.94  ? 267 ASP A N     1 
ATOM   2391 C CA    . ASP C 3 267 ? -13.364 72.644  55.237  1.00 46.04  ? 267 ASP A CA    1 
ATOM   2392 C C     . ASP C 3 267 ? -14.151 73.782  54.605  1.00 44.42  ? 267 ASP A C     1 
ATOM   2393 O O     . ASP C 3 267 ? -15.245 74.104  55.066  1.00 46.20  ? 267 ASP A O     1 
ATOM   2394 C CB    . ASP C 3 267 ? -12.151 73.213  55.987  1.00 46.74  ? 267 ASP A CB    1 
ATOM   2395 C CG    . ASP C 3 267 ? -11.473 72.177  56.875  1.00 48.40  ? 267 ASP A CG    1 
ATOM   2396 O OD1   . ASP C 3 267 ? -12.171 71.232  57.320  1.00 48.47  ? 267 ASP A OD1   1 
ATOM   2397 O OD2   . ASP C 3 267 ? -10.250 72.314  57.137  1.00 48.41  ? 267 ASP A OD2   1 
ATOM   2398 N N     . ILE C 3 268 ? -13.607 74.389  53.555  1.00 40.99  ? 268 ILE A N     1 
ATOM   2399 C CA    . ILE C 3 268 ? -14.288 75.491  52.886  1.00 37.19  ? 268 ILE A CA    1 
ATOM   2400 C C     . ILE C 3 268 ? -14.347 75.210  51.400  1.00 36.26  ? 268 ILE A C     1 
ATOM   2401 O O     . ILE C 3 268 ? -13.350 75.386  50.718  1.00 37.21  ? 268 ILE A O     1 
ATOM   2402 C CB    . ILE C 3 268 ? -13.536 76.826  53.096  1.00 34.55  ? 268 ILE A CB    1 
ATOM   2403 C CG1   . ILE C 3 268 ? -13.456 77.161  54.582  1.00 32.87  ? 268 ILE A CG1   1 
ATOM   2404 C CG2   . ILE C 3 268 ? -14.233 77.934  52.341  1.00 32.82  ? 268 ILE A CG2   1 
ATOM   2405 C CD1   . ILE C 3 268 ? -12.836 78.501  54.859  1.00 31.97  ? 268 ILE A CD1   1 
ATOM   2406 N N     . SER C 3 269 ? -15.491 74.767  50.885  1.00 34.94  ? 269 SER A N     1 
ATOM   2407 C CA    . SER C 3 269 ? -15.587 74.504  49.446  1.00 34.62  ? 269 SER A CA    1 
ATOM   2408 C C     . SER C 3 269 ? -15.444 75.801  48.665  1.00 33.66  ? 269 SER A C     1 
ATOM   2409 O O     . SER C 3 269 ? -15.654 76.882  49.212  1.00 34.33  ? 269 SER A O     1 
ATOM   2410 C CB    . SER C 3 269 ? -16.927 73.874  49.084  1.00 34.60  ? 269 SER A CB    1 
ATOM   2411 O OG    . SER C 3 269 ? -16.953 72.502  49.409  1.00 35.01  ? 269 SER A OG    1 
ATOM   2412 N N     . VAL C 3 270 ? -15.082 75.705  47.392  1.00 32.62  ? 270 VAL A N     1 
ATOM   2413 C CA    . VAL C 3 270 ? -14.948 76.908  46.592  1.00 32.25  ? 270 VAL A CA    1 
ATOM   2414 C C     . VAL C 3 270 ? -15.440 76.712  45.169  1.00 32.09  ? 270 VAL A C     1 
ATOM   2415 O O     . VAL C 3 270 ? -15.382 75.608  44.621  1.00 31.75  ? 270 VAL A O     1 
ATOM   2416 C CB    . VAL C 3 270 ? -13.493 77.400  46.553  1.00 31.36  ? 270 VAL A CB    1 
ATOM   2417 C CG1   . VAL C 3 270 ? -13.390 78.624  45.654  1.00 30.31  ? 270 VAL A CG1   1 
ATOM   2418 C CG2   . VAL C 3 270 ? -13.023 77.746  47.953  1.00 29.37  ? 270 VAL A CG2   1 
ATOM   2419 N N     . VAL C 3 271 ? -15.946 77.795  44.585  1.00 32.43  ? 271 VAL A N     1 
ATOM   2420 C CA    . VAL C 3 271 ? -16.430 77.771  43.211  1.00 33.32  ? 271 VAL A CA    1 
ATOM   2421 C C     . VAL C 3 271 ? -16.049 79.041  42.463  1.00 33.85  ? 271 VAL A C     1 
ATOM   2422 O O     . VAL C 3 271 ? -16.329 80.170  42.907  1.00 32.47  ? 271 VAL A O     1 
ATOM   2423 C CB    . VAL C 3 271 ? -17.945 77.619  43.121  1.00 32.61  ? 271 VAL A CB    1 
ATOM   2424 C CG1   . VAL C 3 271 ? -18.359 77.607  41.648  1.00 31.91  ? 271 VAL A CG1   1 
ATOM   2425 C CG2   . VAL C 3 271 ? -18.378 76.341  43.806  1.00 31.68  ? 271 VAL A CG2   1 
ATOM   2426 N N     . GLY C 3 272 ? -15.428 78.828  41.304  1.00 35.13  ? 272 GLY A N     1 
ATOM   2427 C CA    . GLY C 3 272 ? -14.974 79.934  40.488  1.00 34.91  ? 272 GLY A CA    1 
ATOM   2428 C C     . GLY C 3 272 ? -15.861 80.234  39.307  1.00 34.50  ? 272 GLY A C     1 
ATOM   2429 O O     . GLY C 3 272 ? -16.968 79.707  39.181  1.00 33.98  ? 272 GLY A O     1 
ATOM   2430 N N     . TYR C 3 273 ? -15.343 81.066  38.418  1.00 34.25  ? 273 TYR A N     1 
ATOM   2431 C CA    . TYR C 3 273 ? -16.091 81.472  37.256  1.00 34.91  ? 273 TYR A CA    1 
ATOM   2432 C C     . TYR C 3 273 ? -15.111 81.715  36.119  1.00 35.46  ? 273 TYR A C     1 
ATOM   2433 O O     . TYR C 3 273 ? -14.130 82.430  36.306  1.00 34.92  ? 273 TYR A O     1 
ATOM   2434 C CB    . TYR C 3 273 ? -16.854 82.744  37.619  1.00 34.77  ? 273 TYR A CB    1 
ATOM   2435 C CG    . TYR C 3 273 ? -18.218 82.862  36.986  1.00 34.75  ? 273 TYR A CG    1 
ATOM   2436 C CD1   . TYR C 3 273 ? -18.362 83.391  35.710  1.00 34.76  ? 273 TYR A CD1   1 
ATOM   2437 C CD2   . TYR C 3 273 ? -19.364 82.441  37.658  1.00 33.71  ? 273 TYR A CD2   1 
ATOM   2438 C CE1   . TYR C 3 273 ? -19.597 83.504  35.114  1.00 33.81  ? 273 TYR A CE1   1 
ATOM   2439 C CE2   . TYR C 3 273 ? -20.611 82.548  37.065  1.00 33.30  ? 273 TYR A CE2   1 
ATOM   2440 C CZ    . TYR C 3 273 ? -20.713 83.083  35.789  1.00 33.91  ? 273 TYR A CZ    1 
ATOM   2441 O OH    . TYR C 3 273 ? -21.924 83.195  35.158  1.00 34.80  ? 273 TYR A OH    1 
ATOM   2442 N N     . ASP C 3 274 ? -15.388 81.105  34.962  1.00 36.99  ? 274 ASP A N     1 
ATOM   2443 C CA    . ASP C 3 274 ? -14.568 81.202  33.742  1.00 38.92  ? 274 ASP A CA    1 
ATOM   2444 C C     . ASP C 3 274 ? -14.095 79.857  33.229  1.00 40.07  ? 274 ASP A C     1 
ATOM   2445 O O     . ASP C 3 274 ? -14.253 79.541  32.048  1.00 40.66  ? 274 ASP A O     1 
ATOM   2446 C CB    . ASP C 3 274 ? -13.288 82.000  33.950  1.00 39.28  ? 274 ASP A CB    1 
ATOM   2447 C CG    . ASP C 3 274 ? -13.498 83.476  33.886  1.00 39.06  ? 274 ASP A CG    1 
ATOM   2448 O OD1   . ASP C 3 274 ? -14.544 83.902  33.358  1.00 37.12  ? 274 ASP A OD1   1 
ATOM   2449 O OD2   . ASP C 3 274 ? -12.587 84.202  34.354  1.00 40.71  ? 274 ASP A OD2   1 
ATOM   2450 N N     . ASP C 3 275 ? -13.482 79.088  34.127  1.00 40.22  ? 275 ASP A N     1 
ATOM   2451 C CA    . ASP C 3 275 ? -12.915 77.797  33.778  1.00 40.91  ? 275 ASP A CA    1 
ATOM   2452 C C     . ASP C 3 275 ? -11.797 78.141  32.825  1.00 41.24  ? 275 ASP A C     1 
ATOM   2453 O O     . ASP C 3 275 ? -11.824 77.768  31.654  1.00 41.20  ? 275 ASP A O     1 
ATOM   2454 C CB    . ASP C 3 275 ? -13.929 76.894  33.071  1.00 42.45  ? 275 ASP A CB    1 
ATOM   2455 C CG    . ASP C 3 275 ? -13.306 75.590  32.563  1.00 42.81  ? 275 ASP A CG    1 
ATOM   2456 O OD1   . ASP C 3 275 ? -12.563 74.950  33.345  1.00 42.16  ? 275 ASP A OD1   1 
ATOM   2457 O OD2   . ASP C 3 275 ? -13.572 75.205  31.392  1.00 42.68  ? 275 ASP A OD2   1 
ATOM   2458 N N     . THR C 3 276 ? -10.831 78.899  33.326  1.00 41.99  ? 276 THR A N     1 
ATOM   2459 C CA    . THR C 3 276 ? -9.680  79.282  32.526  1.00 43.49  ? 276 THR A CA    1 
ATOM   2460 C C     . THR C 3 276 ? -8.868  78.021  32.346  1.00 44.66  ? 276 THR A C     1 
ATOM   2461 O O     . THR C 3 276 ? -9.089  77.025  33.031  1.00 44.14  ? 276 THR A O     1 
ATOM   2462 C CB    . THR C 3 276 ? -8.789  80.270  33.247  1.00 43.70  ? 276 THR A CB    1 
ATOM   2463 O OG1   . THR C 3 276 ? -8.265  79.639  34.419  1.00 44.40  ? 276 THR A OG1   1 
ATOM   2464 C CG2   . THR C 3 276 ? -9.570  81.510  33.644  1.00 43.78  ? 276 THR A CG2   1 
ATOM   2465 N N     . GLU C 3 277 ? -7.917  78.057  31.431  1.00 46.25  ? 277 GLU A N     1 
ATOM   2466 C CA    . GLU C 3 277 ? -7.110  76.879  31.208  1.00 47.83  ? 277 GLU A CA    1 
ATOM   2467 C C     . GLU C 3 277 ? -6.450  76.406  32.506  1.00 46.56  ? 277 GLU A C     1 
ATOM   2468 O O     . GLU C 3 277 ? -6.568  75.241  32.867  1.00 46.58  ? 277 GLU A O     1 
ATOM   2469 C CB    . GLU C 3 277 ? -6.070  77.161  30.112  1.00 51.68  ? 277 GLU A CB    1 
ATOM   2470 C CG    . GLU C 3 277 ? -6.661  77.151  28.684  1.00 57.07  ? 277 GLU A CG    1 
ATOM   2471 C CD    . GLU C 3 277 ? -6.940  75.729  28.158  1.00 60.63  ? 277 GLU A CD    1 
ATOM   2472 O OE1   . GLU C 3 277 ? -5.958  74.973  27.943  1.00 63.21  ? 277 GLU A OE1   1 
ATOM   2473 O OE2   . GLU C 3 277 ? -8.129  75.365  27.963  1.00 61.47  ? 277 GLU A OE2   1 
ATOM   2474 N N     . ASP C 3 278 ? -5.799  77.317  33.224  1.00 45.25  ? 278 ASP A N     1 
ATOM   2475 C CA    . ASP C 3 278 ? -5.101  76.986  34.475  1.00 44.07  ? 278 ASP A CA    1 
ATOM   2476 C C     . ASP C 3 278 ? -5.941  76.366  35.603  1.00 42.75  ? 278 ASP A C     1 
ATOM   2477 O O     . ASP C 3 278 ? -5.467  75.503  36.358  1.00 41.91  ? 278 ASP A O     1 
ATOM   2478 C CB    . ASP C 3 278 ? -4.397  78.236  35.017  1.00 44.93  ? 278 ASP A CB    1 
ATOM   2479 C CG    . ASP C 3 278 ? -3.383  78.808  34.039  1.00 45.99  ? 278 ASP A CG    1 
ATOM   2480 O OD1   . ASP C 3 278 ? -3.138  78.171  32.984  1.00 46.44  ? 278 ASP A OD1   1 
ATOM   2481 O OD2   . ASP C 3 278 ? -2.831  79.893  34.333  1.00 45.62  ? 278 ASP A OD2   1 
ATOM   2482 N N     . SER C 3 279 ? -7.181  76.820  35.721  1.00 41.49  ? 279 SER A N     1 
ATOM   2483 C CA    . SER C 3 279 ? -8.083  76.342  36.756  1.00 40.45  ? 279 SER A CA    1 
ATOM   2484 C C     . SER C 3 279 ? -8.086  74.830  36.950  1.00 39.45  ? 279 SER A C     1 
ATOM   2485 O O     . SER C 3 279 ? -8.259  74.359  38.069  1.00 39.21  ? 279 SER A O     1 
ATOM   2486 C CB    . SER C 3 279 ? -9.505  76.792  36.440  1.00 41.78  ? 279 SER A CB    1 
ATOM   2487 O OG    . SER C 3 279 ? -9.965  76.178  35.240  1.00 43.19  ? 279 SER A OG    1 
ATOM   2488 N N     . SER C 3 280 ? -7.901  74.071  35.872  1.00 38.10  ? 280 SER A N     1 
ATOM   2489 C CA    . SER C 3 280 ? -7.938  72.615  35.963  1.00 36.51  ? 280 SER A CA    1 
ATOM   2490 C C     . SER C 3 280 ? -6.739  71.969  36.643  1.00 35.61  ? 280 SER A C     1 
ATOM   2491 O O     . SER C 3 280 ? -6.723  70.752  36.841  1.00 35.70  ? 280 SER A O     1 
ATOM   2492 C CB    . SER C 3 280 ? -8.110  72.002  34.572  1.00 35.81  ? 280 SER A CB    1 
ATOM   2493 O OG    . SER C 3 280 ? -6.907  72.069  33.832  1.00 34.65  ? 280 SER A OG    1 
ATOM   2494 N N     . CYS C 3 281 ? -5.740  72.770  36.998  1.00 34.33  ? 281 CYS A N     1 
ATOM   2495 C CA    . CYS C 3 281 ? -4.554  72.233  37.642  1.00 33.20  ? 281 CYS A CA    1 
ATOM   2496 C C     . CYS C 3 281 ? -4.241  72.990  38.916  1.00 32.51  ? 281 CYS A C     1 
ATOM   2497 O O     . CYS C 3 281 ? -3.099  73.043  39.363  1.00 31.65  ? 281 CYS A O     1 
ATOM   2498 C CB    . CYS C 3 281 ? -3.369  72.265  36.664  1.00 33.51  ? 281 CYS A CB    1 
ATOM   2499 S SG    . CYS C 3 281 ? -3.549  71.164  35.198  1.00 34.09  ? 281 CYS A SG    1 
ATOM   2500 N N     . TYR C 3 282 ? -5.279  73.587  39.488  1.00 32.71  ? 282 TYR A N     1 
ATOM   2501 C CA    . TYR C 3 282 ? -5.163  74.322  40.742  1.00 32.88  ? 282 TYR A CA    1 
ATOM   2502 C C     . TYR C 3 282 ? -5.107  73.275  41.856  1.00 32.74  ? 282 TYR A C     1 
ATOM   2503 O O     . TYR C 3 282 ? -5.556  72.150  41.674  1.00 32.69  ? 282 TYR A O     1 
ATOM   2504 C CB    . TYR C 3 282 ? -6.388  75.215  40.954  1.00 32.71  ? 282 TYR A CB    1 
ATOM   2505 C CG    . TYR C 3 282 ? -6.375  76.521  40.198  1.00 32.45  ? 282 TYR A CG    1 
ATOM   2506 C CD1   . TYR C 3 282 ? -5.295  76.886  39.413  1.00 32.76  ? 282 TYR A CD1   1 
ATOM   2507 C CD2   . TYR C 3 282 ? -7.430  77.418  40.319  1.00 32.63  ? 282 TYR A CD2   1 
ATOM   2508 C CE1   . TYR C 3 282 ? -5.269  78.117  38.777  1.00 33.25  ? 282 TYR A CE1   1 
ATOM   2509 C CE2   . TYR C 3 282 ? -7.411  78.645  39.689  1.00 32.38  ? 282 TYR A CE2   1 
ATOM   2510 C CZ    . TYR C 3 282 ? -6.331  78.990  38.924  1.00 32.72  ? 282 TYR A CZ    1 
ATOM   2511 O OH    . TYR C 3 282 ? -6.287  80.216  38.314  1.00 33.21  ? 282 TYR A OH    1 
ATOM   2512 N N     . ILE C 3 283 ? -4.574  73.647  43.012  1.00 32.57  ? 283 ILE A N     1 
ATOM   2513 C CA    . ILE C 3 283 ? -4.465  72.699  44.113  1.00 32.34  ? 283 ILE A CA    1 
ATOM   2514 C C     . ILE C 3 283 ? -5.493  72.937  45.212  1.00 30.90  ? 283 ILE A C     1 
ATOM   2515 O O     . ILE C 3 283 ? -5.311  73.786  46.099  1.00 29.62  ? 283 ILE A O     1 
ATOM   2516 C CB    . ILE C 3 283 ? -3.066  72.751  44.767  1.00 34.13  ? 283 ILE A CB    1 
ATOM   2517 C CG1   . ILE C 3 283 ? -1.981  73.088  43.722  1.00 34.10  ? 283 ILE A CG1   1 
ATOM   2518 C CG2   . ILE C 3 283 ? -2.770  71.410  45.442  1.00 34.42  ? 283 ILE A CG2   1 
ATOM   2519 C CD1   . ILE C 3 283 ? -1.701  71.960  42.731  1.00 33.59  ? 283 ILE A CD1   1 
ATOM   2520 N N     . PRO C 3 284 ? -6.576  72.155  45.193  1.00 31.17  ? 284 PRO A N     1 
ATOM   2521 C CA    . PRO C 3 284 ? -6.842  71.105  44.203  1.00 30.45  ? 284 PRO A CA    1 
ATOM   2522 C C     . PRO C 3 284 ? -7.579  71.712  43.026  1.00 30.29  ? 284 PRO A C     1 
ATOM   2523 O O     . PRO C 3 284 ? -7.893  72.902  43.040  1.00 30.00  ? 284 PRO A O     1 
ATOM   2524 C CB    . PRO C 3 284 ? -7.729  70.135  44.976  1.00 30.56  ? 284 PRO A CB    1 
ATOM   2525 C CG    . PRO C 3 284 ? -8.574  71.092  45.761  1.00 31.27  ? 284 PRO A CG    1 
ATOM   2526 C CD    . PRO C 3 284 ? -7.571  72.117  46.276  1.00 31.21  ? 284 PRO A CD    1 
ATOM   2527 N N     . PRO C 3 285 ? -7.889  70.902  41.998  1.00 31.50  ? 285 PRO A N     1 
ATOM   2528 C CA    . PRO C 3 285 ? -8.605  71.366  40.804  1.00 31.71  ? 285 PRO A CA    1 
ATOM   2529 C C     . PRO C 3 285 ? -9.893  72.138  41.163  1.00 32.13  ? 285 PRO A C     1 
ATOM   2530 O O     . PRO C 3 285 ? -10.742 71.660  41.926  1.00 32.74  ? 285 PRO A O     1 
ATOM   2531 C CB    . PRO C 3 285 ? -8.863  70.071  40.052  1.00 31.43  ? 285 PRO A CB    1 
ATOM   2532 C CG    . PRO C 3 285 ? -7.633  69.291  40.343  1.00 31.02  ? 285 PRO A CG    1 
ATOM   2533 C CD    . PRO C 3 285 ? -7.478  69.497  41.837  1.00 31.47  ? 285 PRO A CD    1 
ATOM   2534 N N     . LEU C 3 286 ? -10.028 73.332  40.591  1.00 31.53  ? 286 LEU A N     1 
ATOM   2535 C CA    . LEU C 3 286 ? -11.151 74.216  40.861  1.00 29.75  ? 286 LEU A CA    1 
ATOM   2536 C C     . LEU C 3 286 ? -12.444 73.921  40.135  1.00 29.68  ? 286 LEU A C     1 
ATOM   2537 O O     . LEU C 3 286 ? -12.461 73.735  38.917  1.00 28.32  ? 286 LEU A O     1 
ATOM   2538 C CB    . LEU C 3 286 ? -10.741 75.660  40.558  1.00 28.46  ? 286 LEU A CB    1 
ATOM   2539 C CG    . LEU C 3 286 ? -11.838 76.711  40.693  1.00 26.95  ? 286 LEU A CG    1 
ATOM   2540 C CD1   . LEU C 3 286 ? -12.273 76.796  42.136  1.00 26.36  ? 286 LEU A CD1   1 
ATOM   2541 C CD2   . LEU C 3 286 ? -11.323 78.043  40.212  1.00 25.91  ? 286 LEU A CD2   1 
ATOM   2542 N N     . THR C 3 287 ? -13.527 73.892  40.912  1.00 30.76  ? 287 THR A N     1 
ATOM   2543 C CA    . THR C 3 287 ? -14.878 73.691  40.390  1.00 32.22  ? 287 THR A CA    1 
ATOM   2544 C C     . THR C 3 287 ? -15.293 75.085  39.939  1.00 31.30  ? 287 THR A C     1 
ATOM   2545 O O     . THR C 3 287 ? -15.166 76.040  40.700  1.00 28.75  ? 287 THR A O     1 
ATOM   2546 C CB    . THR C 3 287 ? -15.873 73.247  41.485  1.00 33.55  ? 287 THR A CB    1 
ATOM   2547 O OG1   . THR C 3 287 ? -15.507 71.956  42.005  1.00 33.73  ? 287 THR A OG1   1 
ATOM   2548 C CG2   . THR C 3 287 ? -17.281 73.194  40.903  1.00 34.10  ? 287 THR A CG2   1 
ATOM   2549 N N     . THR C 3 288 ? -15.797 75.214  38.720  1.00 32.71  ? 288 THR A N     1 
ATOM   2550 C CA    . THR C 3 288 ? -16.150 76.540  38.247  1.00 34.59  ? 288 THR A CA    1 
ATOM   2551 C C     . THR C 3 288 ? -17.235 76.575  37.185  1.00 34.79  ? 288 THR A C     1 
ATOM   2552 O O     . THR C 3 288 ? -17.781 75.549  36.791  1.00 34.20  ? 288 THR A O     1 
ATOM   2553 C CB    . THR C 3 288 ? -14.884 77.268  37.702  1.00 34.71  ? 288 THR A CB    1 
ATOM   2554 O OG1   . THR C 3 288 ? -15.227 78.597  37.289  1.00 34.24  ? 288 THR A OG1   1 
ATOM   2555 C CG2   . THR C 3 288 ? -14.287 76.505  36.513  1.00 34.65  ? 288 THR A CG2   1 
ATOM   2556 N N     . ILE C 3 289 ? -17.533 77.786  36.733  1.00 36.01  ? 289 ILE A N     1 
ATOM   2557 C CA    . ILE C 3 289 ? -18.548 78.032  35.728  1.00 37.58  ? 289 ILE A CA    1 
ATOM   2558 C C     . ILE C 3 289 ? -17.867 78.301  34.400  1.00 38.16  ? 289 ILE A C     1 
ATOM   2559 O O     . ILE C 3 289 ? -17.141 79.280  34.252  1.00 37.03  ? 289 ILE A O     1 
ATOM   2560 C CB    . ILE C 3 289 ? -19.412 79.245  36.130  1.00 37.85  ? 289 ILE A CB    1 
ATOM   2561 C CG1   . ILE C 3 289 ? -20.002 79.015  37.528  1.00 37.55  ? 289 ILE A CG1   1 
ATOM   2562 C CG2   . ILE C 3 289 ? -20.531 79.444  35.128  1.00 37.87  ? 289 ILE A CG2   1 
ATOM   2563 C CD1   . ILE C 3 289 ? -20.844 77.756  37.629  1.00 38.79  ? 289 ILE A CD1   1 
ATOM   2564 N N     . LYS C 3 290 ? -18.124 77.436  33.428  1.00 40.25  ? 290 LYS A N     1 
ATOM   2565 C CA    . LYS C 3 290 ? -17.502 77.552  32.113  1.00 42.60  ? 290 LYS A CA    1 
ATOM   2566 C C     . LYS C 3 290 ? -18.085 78.594  31.165  1.00 42.86  ? 290 LYS A C     1 
ATOM   2567 O O     . LYS C 3 290 ? -19.283 78.590  30.887  1.00 43.18  ? 290 LYS A O     1 
ATOM   2568 C CB    . LYS C 3 290 ? -17.513 76.187  31.415  1.00 45.05  ? 290 LYS A CB    1 
ATOM   2569 C CG    . LYS C 3 290 ? -16.742 76.161  30.089  1.00 49.35  ? 290 LYS A CG    1 
ATOM   2570 C CD    . LYS C 3 290 ? -16.801 74.793  29.401  1.00 53.62  ? 290 LYS A CD    1 
ATOM   2571 C CE    . LYS C 3 290 ? -16.125 74.815  28.011  1.00 55.88  ? 290 LYS A CE    1 
ATOM   2572 N NZ    . LYS C 3 290 ? -16.398 73.582  27.186  1.00 56.60  ? 290 LYS A NZ    1 
ATOM   2573 N N     . GLN C 3 291 ? -17.227 79.481  30.668  1.00 43.13  ? 291 GLN A N     1 
ATOM   2574 C CA    . GLN C 3 291 ? -17.635 80.509  29.724  1.00 43.10  ? 291 GLN A CA    1 
ATOM   2575 C C     . GLN C 3 291 ? -16.769 80.352  28.487  1.00 42.61  ? 291 GLN A C     1 
ATOM   2576 O O     . GLN C 3 291 ? -15.616 80.776  28.470  1.00 42.32  ? 291 GLN A O     1 
ATOM   2577 C CB    . GLN C 3 291 ? -17.421 81.889  30.317  1.00 44.57  ? 291 GLN A CB    1 
ATOM   2578 C CG    . GLN C 3 291 ? -18.124 82.108  31.641  1.00 47.46  ? 291 GLN A CG    1 
ATOM   2579 C CD    . GLN C 3 291 ? -18.191 83.579  32.024  1.00 49.84  ? 291 GLN A CD    1 
ATOM   2580 O OE1   . GLN C 3 291 ? -19.226 84.250  31.839  1.00 50.18  ? 291 GLN A OE1   1 
ATOM   2581 N NE2   . GLN C 3 291 ? -17.077 84.099  32.553  1.00 50.86  ? 291 GLN A NE2   1 
ATOM   2582 N N     . ASP C 3 292 ? -17.329 79.741  27.451  1.00 42.62  ? 292 ASP A N     1 
ATOM   2583 C CA    . ASP C 3 292 ? -16.595 79.493  26.212  1.00 43.59  ? 292 ASP A CA    1 
ATOM   2584 C C     . ASP C 3 292 ? -16.182 80.736  25.402  1.00 42.66  ? 292 ASP A C     1 
ATOM   2585 O O     . ASP C 3 292 ? -16.802 81.066  24.389  1.00 41.17  ? 292 ASP A O     1 
ATOM   2586 C CB    . ASP C 3 292 ? -17.419 78.544  25.335  1.00 46.16  ? 292 ASP A CB    1 
ATOM   2587 C CG    . ASP C 3 292 ? -16.632 78.011  24.142  1.00 48.73  ? 292 ASP A CG    1 
ATOM   2588 O OD1   . ASP C 3 292 ? -17.048 76.970  23.571  1.00 50.16  ? 292 ASP A OD1   1 
ATOM   2589 O OD2   . ASP C 3 292 ? -15.602 78.633  23.777  1.00 49.43  ? 292 ASP A OD2   1 
ATOM   2590 N N     . PHE C 3 293 ? -15.117 81.404  25.834  1.00 42.91  ? 293 PHE A N     1 
ATOM   2591 C CA    . PHE C 3 293 ? -14.649 82.598  25.147  1.00 44.71  ? 293 PHE A CA    1 
ATOM   2592 C C     . PHE C 3 293 ? -14.559 82.446  23.641  1.00 47.31  ? 293 PHE A C     1 
ATOM   2593 O O     . PHE C 3 293 ? -14.822 83.405  22.918  1.00 48.18  ? 293 PHE A O     1 
ATOM   2594 C CB    . PHE C 3 293 ? -13.286 83.024  25.663  1.00 42.62  ? 293 PHE A CB    1 
ATOM   2595 C CG    . PHE C 3 293 ? -13.257 83.310  27.125  1.00 41.86  ? 293 PHE A CG    1 
ATOM   2596 C CD1   . PHE C 3 293 ? -12.591 82.452  28.001  1.00 41.96  ? 293 PHE A CD1   1 
ATOM   2597 C CD2   . PHE C 3 293 ? -13.881 84.432  27.639  1.00 41.31  ? 293 PHE A CD2   1 
ATOM   2598 C CE1   . PHE C 3 293 ? -12.545 82.708  29.375  1.00 41.88  ? 293 PHE A CE1   1 
ATOM   2599 C CE2   . PHE C 3 293 ? -13.838 84.695  29.015  1.00 41.90  ? 293 PHE A CE2   1 
ATOM   2600 C CZ    . PHE C 3 293 ? -13.173 83.836  29.880  1.00 41.40  ? 293 PHE A CZ    1 
ATOM   2601 N N     . ARG C 3 294 ? -14.169 81.265  23.160  1.00 50.28  ? 294 ARG A N     1 
ATOM   2602 C CA    . ARG C 3 294 ? -14.058 81.036  21.709  1.00 52.94  ? 294 ARG A CA    1 
ATOM   2603 C C     . ARG C 3 294 ? -15.416 81.297  21.033  1.00 51.18  ? 294 ARG A C     1 
ATOM   2604 O O     . ARG C 3 294 ? -15.511 81.986  20.001  1.00 50.35  ? 294 ARG A O     1 
ATOM   2605 C CB    . ARG C 3 294 ? -13.624 79.584  21.410  1.00 58.13  ? 294 ARG A CB    1 
ATOM   2606 C CG    . ARG C 3 294 ? -12.149 79.237  21.654  1.00 65.71  ? 294 ARG A CG    1 
ATOM   2607 C CD    . ARG C 3 294 ? -11.372 79.193  20.329  1.00 73.77  ? 294 ARG A CD    1 
ATOM   2608 N NE    . ARG C 3 294 ? -10.650 80.392  19.957  1.00 80.99  ? 294 ARG A NE    1 
ATOM   2609 C CZ    . ARG C 3 294 ? -10.268 80.817  18.747  1.00 83.79  ? 294 ARG A CZ    1 
ATOM   2610 N NH1   . ARG C 3 294 ? -10.529 80.170  17.601  1.00 85.06  ? 294 ARG A NH1   1 
ATOM   2611 N NH2   . ARG C 3 294 ? -9.533  81.925  18.727  1.00 84.79  ? 294 ARG A NH2   1 
ATOM   2612 N N     . LEU C 3 295 ? -16.460 80.734  21.640  1.00 48.91  ? 295 LEU A N     1 
ATOM   2613 C CA    . LEU C 3 295 ? -17.818 80.858  21.138  1.00 46.68  ? 295 LEU A CA    1 
ATOM   2614 C C     . LEU C 3 295 ? -18.235 82.317  21.097  1.00 45.35  ? 295 LEU A C     1 
ATOM   2615 O O     . LEU C 3 295 ? -18.737 82.807  20.080  1.00 44.18  ? 295 LEU A O     1 
ATOM   2616 C CB    . LEU C 3 295 ? -18.766 80.052  22.032  1.00 46.39  ? 295 LEU A CB    1 
ATOM   2617 C CG    . LEU C 3 295 ? -20.257 80.021  21.673  1.00 46.30  ? 295 LEU A CG    1 
ATOM   2618 C CD1   . LEU C 3 295 ? -20.443 79.608  20.216  1.00 46.24  ? 295 LEU A CD1   1 
ATOM   2619 C CD2   . LEU C 3 295 ? -20.980 79.054  22.605  1.00 45.65  ? 295 LEU A CD2   1 
ATOM   2620 N N     . LEU C 3 296 ? -18.032 83.003  22.214  1.00 44.30  ? 296 LEU A N     1 
ATOM   2621 C CA    . LEU C 3 296 ? -18.377 84.408  22.288  1.00 44.21  ? 296 LEU A CA    1 
ATOM   2622 C C     . LEU C 3 296 ? -17.717 85.144  21.117  1.00 45.29  ? 296 LEU A C     1 
ATOM   2623 O O     . LEU C 3 296 ? -18.403 85.721  20.270  1.00 45.43  ? 296 LEU A O     1 
ATOM   2624 C CB    . LEU C 3 296 ? -17.904 85.009  23.615  1.00 42.24  ? 296 LEU A CB    1 
ATOM   2625 C CG    . LEU C 3 296 ? -18.057 86.528  23.657  1.00 40.37  ? 296 LEU A CG    1 
ATOM   2626 C CD1   . LEU C 3 296 ? -19.516 86.872  23.542  1.00 39.92  ? 296 LEU A CD1   1 
ATOM   2627 C CD2   . LEU C 3 296 ? -17.475 87.077  24.922  1.00 39.79  ? 296 LEU A CD2   1 
ATOM   2628 N N     . GLY C 3 297 ? -16.387 85.105  21.073  1.00 45.97  ? 297 GLY A N     1 
ATOM   2629 C CA    . GLY C 3 297 ? -15.650 85.777  20.022  1.00 46.45  ? 297 GLY A CA    1 
ATOM   2630 C C     . GLY C 3 297 ? -16.115 85.395  18.632  1.00 47.79  ? 297 GLY A C     1 
ATOM   2631 O O     . GLY C 3 297 ? -16.260 86.273  17.777  1.00 48.06  ? 297 GLY A O     1 
ATOM   2632 N N     . GLN C 3 298 ? -16.345 84.099  18.400  1.00 48.75  ? 298 GLN A N     1 
ATOM   2633 C CA    . GLN C 3 298 ? -16.791 83.617  17.085  1.00 49.97  ? 298 GLN A CA    1 
ATOM   2634 C C     . GLN C 3 298 ? -18.173 84.189  16.768  1.00 48.41  ? 298 GLN A C     1 
ATOM   2635 O O     . GLN C 3 298 ? -18.404 84.790  15.706  1.00 46.27  ? 298 GLN A O     1 
ATOM   2636 C CB    . GLN C 3 298 ? -16.824 82.073  17.066  1.00 52.63  ? 298 GLN A CB    1 
ATOM   2637 C CG    . GLN C 3 298 ? -17.300 81.436  15.737  1.00 57.20  ? 298 GLN A CG    1 
ATOM   2638 C CD    . GLN C 3 298 ? -18.798 81.051  15.738  1.00 60.80  ? 298 GLN A CD    1 
ATOM   2639 O OE1   . GLN C 3 298 ? -19.220 80.123  16.451  1.00 62.73  ? 298 GLN A OE1   1 
ATOM   2640 N NE2   . GLN C 3 298 ? -19.602 81.765  14.938  1.00 61.70  ? 298 GLN A NE2   1 
ATOM   2641 N N     . THR C 3 299 ? -19.085 84.013  17.715  1.00 47.43  ? 299 THR A N     1 
ATOM   2642 C CA    . THR C 3 299 ? -20.431 84.500  17.543  1.00 46.76  ? 299 THR A CA    1 
ATOM   2643 C C     . THR C 3 299 ? -20.414 86.004  17.293  1.00 46.53  ? 299 THR A C     1 
ATOM   2644 O O     . THR C 3 299 ? -21.051 86.484  16.370  1.00 45.97  ? 299 THR A O     1 
ATOM   2645 C CB    . THR C 3 299 ? -21.293 84.151  18.776  1.00 46.16  ? 299 THR A CB    1 
ATOM   2646 O OG1   . THR C 3 299 ? -21.351 82.725  18.925  1.00 44.38  ? 299 THR A OG1   1 
ATOM   2647 C CG2   . THR C 3 299 ? -22.701 84.676  18.609  1.00 46.35  ? 299 THR A CG2   1 
ATOM   2648 N N     . SER C 3 300 ? -19.663 86.746  18.095  1.00 47.61  ? 300 SER A N     1 
ATOM   2649 C CA    . SER C 3 300 ? -19.597 88.194  17.930  1.00 49.18  ? 300 SER A CA    1 
ATOM   2650 C C     . SER C 3 300 ? -19.304 88.660  16.512  1.00 49.79  ? 300 SER A C     1 
ATOM   2651 O O     . SER C 3 300 ? -19.930 89.599  16.030  1.00 50.18  ? 300 SER A O     1 
ATOM   2652 C CB    . SER C 3 300 ? -18.556 88.801  18.874  1.00 49.12  ? 300 SER A CB    1 
ATOM   2653 O OG    . SER C 3 300 ? -18.976 88.692  20.224  1.00 50.17  ? 300 SER A OG    1 
ATOM   2654 N N     . VAL C 3 301 ? -18.353 88.026  15.837  1.00 51.36  ? 301 VAL A N     1 
ATOM   2655 C CA    . VAL C 3 301 ? -18.041 88.452  14.477  1.00 52.92  ? 301 VAL A CA    1 
ATOM   2656 C C     . VAL C 3 301 ? -19.195 88.083  13.548  1.00 53.63  ? 301 VAL A C     1 
ATOM   2657 O O     . VAL C 3 301 ? -19.695 88.941  12.809  1.00 53.48  ? 301 VAL A O     1 
ATOM   2658 C CB    . VAL C 3 301 ? -16.702 87.840  13.959  1.00 52.51  ? 301 VAL A CB    1 
ATOM   2659 C CG1   . VAL C 3 301 ? -16.504 88.173  12.482  1.00 51.24  ? 301 VAL A CG1   1 
ATOM   2660 C CG2   . VAL C 3 301 ? -15.529 88.412  14.757  1.00 51.02  ? 301 VAL A CG2   1 
ATOM   2661 N N     . ASP C 3 302 ? -19.631 86.826  13.597  1.00 54.41  ? 302 ASP A N     1 
ATOM   2662 C CA    . ASP C 3 302 ? -20.743 86.394  12.753  1.00 55.99  ? 302 ASP A CA    1 
ATOM   2663 C C     . ASP C 3 302 ? -21.901 87.375  12.834  1.00 55.70  ? 302 ASP A C     1 
ATOM   2664 O O     . ASP C 3 302 ? -22.434 87.817  11.816  1.00 55.04  ? 302 ASP A O     1 
ATOM   2665 C CB    . ASP C 3 302 ? -21.232 85.017  13.190  1.00 57.41  ? 302 ASP A CB    1 
ATOM   2666 C CG    . ASP C 3 302 ? -20.279 83.920  12.798  1.00 58.46  ? 302 ASP A CG    1 
ATOM   2667 O OD1   . ASP C 3 302 ? -19.088 84.253  12.574  1.00 59.19  ? 302 ASP A OD1   1 
ATOM   2668 O OD2   . ASP C 3 302 ? -20.716 82.742  12.725  1.00 58.27  ? 302 ASP A OD2   1 
ATOM   2669 N N     . ARG C 3 303 ? -22.282 87.706  14.061  1.00 56.30  ? 303 ARG A N     1 
ATOM   2670 C CA    . ARG C 3 303 ? -23.378 88.622  14.288  1.00 57.21  ? 303 ARG A CA    1 
ATOM   2671 C C     . ARG C 3 303 ? -23.104 90.031  13.776  1.00 57.44  ? 303 ARG A C     1 
ATOM   2672 O O     . ARG C 3 303 ? -23.968 90.624  13.140  1.00 57.26  ? 303 ARG A O     1 
ATOM   2673 C CB    . ARG C 3 303 ? -23.727 88.674  15.772  1.00 57.65  ? 303 ARG A CB    1 
ATOM   2674 C CG    . ARG C 3 303 ? -24.691 89.796  16.108  1.00 59.17  ? 303 ARG A CG    1 
ATOM   2675 C CD    . ARG C 3 303 ? -26.145 89.366  16.203  1.00 60.95  ? 303 ARG A CD    1 
ATOM   2676 N NE    . ARG C 3 303 ? -26.488 88.959  17.547  1.00 63.18  ? 303 ARG A NE    1 
ATOM   2677 C CZ    . ARG C 3 303 ? -27.096 89.623  18.534  1.00 63.97  ? 303 ARG A CZ    1 
ATOM   2678 N NH1   . ARG C 3 303 ? -27.548 90.879  18.449  1.00 63.69  ? 303 ARG A NH1   1 
ATOM   2679 N NH2   . ARG C 3 303 ? -27.203 88.964  19.678  1.00 63.13  ? 303 ARG A NH2   1 
ATOM   2680 N N     . LEU C 3 304 ? -21.919 90.578  14.037  1.00 58.34  ? 304 LEU A N     1 
ATOM   2681 C CA    . LEU C 3 304 ? -21.640 91.939  13.572  1.00 60.05  ? 304 LEU A CA    1 
ATOM   2682 C C     . LEU C 3 304 ? -21.764 92.027  12.066  1.00 61.47  ? 304 LEU A C     1 
ATOM   2683 O O     . LEU C 3 304 ? -22.102 93.084  11.527  1.00 61.67  ? 304 LEU A O     1 
ATOM   2684 C CB    . LEU C 3 304 ? -20.240 92.437  13.986  1.00 59.68  ? 304 LEU A CB    1 
ATOM   2685 C CG    . LEU C 3 304 ? -19.956 93.919  13.618  1.00 58.98  ? 304 LEU A CG    1 
ATOM   2686 C CD1   . LEU C 3 304 ? -20.889 94.844  14.397  1.00 58.83  ? 304 LEU A CD1   1 
ATOM   2687 C CD2   . LEU C 3 304 ? -18.519 94.294  13.931  1.00 58.19  ? 304 LEU A CD2   1 
ATOM   2688 N N     . LEU C 3 305 ? -21.488 90.919  11.386  1.00 63.46  ? 305 LEU A N     1 
ATOM   2689 C CA    . LEU C 3 305 ? -21.586 90.904  9.930   1.00 66.01  ? 305 LEU A CA    1 
ATOM   2690 C C     . LEU C 3 305 ? -23.049 90.870  9.506   1.00 67.60  ? 305 LEU A C     1 
ATOM   2691 O O     . LEU C 3 305 ? -23.450 91.554  8.557   1.00 67.29  ? 305 LEU A O     1 
ATOM   2692 C CB    . LEU C 3 305 ? -20.835 89.701  9.341   1.00 65.84  ? 305 LEU A CB    1 
ATOM   2693 C CG    . LEU C 3 305 ? -19.310 89.716  9.501   1.00 65.88  ? 305 LEU A CG    1 
ATOM   2694 C CD1   . LEU C 3 305 ? -18.742 88.485  8.827   1.00 65.78  ? 305 LEU A CD1   1 
ATOM   2695 C CD2   . LEU C 3 305 ? -18.708 90.980  8.891   1.00 65.46  ? 305 LEU A CD2   1 
ATOM   2696 N N     . GLN C 3 306 ? -23.840 90.074  10.218  1.00 69.38  ? 306 GLN A N     1 
ATOM   2697 C CA    . GLN C 3 306 ? -25.260 89.962  9.924   1.00 71.63  ? 306 GLN A CA    1 
ATOM   2698 C C     . GLN C 3 306 ? -25.906 91.330  10.052  1.00 73.26  ? 306 GLN A C     1 
ATOM   2699 O O     . GLN C 3 306 ? -26.656 91.752  9.175   1.00 73.02  ? 306 GLN A O     1 
ATOM   2700 C CB    . GLN C 3 306 ? -25.925 88.984  10.889  1.00 72.28  ? 306 GLN A CB    1 
ATOM   2701 C CG    . GLN C 3 306 ? -25.436 87.548  10.743  1.00 73.88  ? 306 GLN A CG    1 
ATOM   2702 C CD    . GLN C 3 306 ? -26.043 86.614  11.781  1.00 74.69  ? 306 GLN A CD    1 
ATOM   2703 O OE1   . GLN C 3 306 ? -25.783 85.409  11.773  1.00 75.47  ? 306 GLN A OE1   1 
ATOM   2704 N NE2   . GLN C 3 306 ? -26.852 87.168  12.684  1.00 74.58  ? 306 GLN A NE2   1 
ATOM   2705 N N     . LEU C 3 307 ? -25.608 92.023  11.148  1.00 76.03  ? 307 LEU A N     1 
ATOM   2706 C CA    . LEU C 3 307 ? -26.160 93.358  11.370  1.00 79.19  ? 307 LEU A CA    1 
ATOM   2707 C C     . LEU C 3 307 ? -25.716 94.318  10.265  1.00 81.25  ? 307 LEU A C     1 
ATOM   2708 O O     . LEU C 3 307 ? -26.516 95.130  9.787   1.00 81.82  ? 307 LEU A O     1 
ATOM   2709 C CB    . LEU C 3 307 ? -25.730 93.919  12.736  1.00 78.81  ? 307 LEU A CB    1 
ATOM   2710 C CG    . LEU C 3 307 ? -26.274 93.252  14.012  1.00 78.84  ? 307 LEU A CG    1 
ATOM   2711 C CD1   . LEU C 3 307 ? -25.628 93.915  15.214  1.00 79.27  ? 307 LEU A CD1   1 
ATOM   2712 C CD2   . LEU C 3 307 ? -27.794 93.372  14.102  1.00 78.44  ? 307 LEU A CD2   1 
ATOM   2713 N N     . SER C 3 308 ? -24.449 94.220  9.858   1.00 83.73  ? 308 SER A N     1 
ATOM   2714 C CA    . SER C 3 308 ? -23.917 95.084  8.801   1.00 86.33  ? 308 SER A CA    1 
ATOM   2715 C C     . SER C 3 308 ? -24.684 94.880  7.491   1.00 88.31  ? 308 SER A C     1 
ATOM   2716 O O     . SER C 3 308 ? -24.730 95.773  6.633   1.00 88.40  ? 308 SER A O     1 
ATOM   2717 C CB    . SER C 3 308 ? -22.433 94.799  8.569   1.00 85.91  ? 308 SER A CB    1 
ATOM   2718 O OG    . SER C 3 308 ? -21.867 95.780  7.716   1.00 86.10  ? 308 SER A OG    1 
ATOM   2719 N N     . GLN C 3 309 ? -25.278 93.695  7.352   1.00 90.95  ? 309 GLN A N     1 
ATOM   2720 C CA    . GLN C 3 309 ? -26.075 93.339  6.179   1.00 93.57  ? 309 GLN A CA    1 
ATOM   2721 C C     . GLN C 3 309 ? -27.573 93.537  6.454   1.00 94.63  ? 309 GLN A C     1 
ATOM   2722 O O     . GLN C 3 309 ? -28.416 92.837  5.886   1.00 94.80  ? 309 GLN A O     1 
ATOM   2723 C CB    . GLN C 3 309 ? -25.829 91.881  5.794   1.00 94.62  ? 309 GLN A CB    1 
ATOM   2724 C CG    . GLN C 3 309 ? -24.546 91.623  5.019   1.00 96.49  ? 309 GLN A CG    1 
ATOM   2725 C CD    . GLN C 3 309 ? -24.311 90.131  4.791   1.00 97.98  ? 309 GLN A CD    1 
ATOM   2726 O OE1   . GLN C 3 309 ? -25.261 89.336  4.773   1.00 98.84  ? 309 GLN A OE1   1 
ATOM   2727 N NE2   . GLN C 3 309 ? -23.047 89.746  4.605   1.00 98.14  ? 309 GLN A NE2   1 
ATOM   2728 N N     . GLY C 3 310 ? -27.890 94.481  7.337   1.00 95.90  ? 310 GLY A N     1 
ATOM   2729 C CA    . GLY C 3 310 ? -29.274 94.763  7.668   1.00 97.27  ? 310 GLY A CA    1 
ATOM   2730 C C     . GLY C 3 310 ? -30.123 93.543  7.960   1.00 98.62  ? 310 GLY A C     1 
ATOM   2731 O O     . GLY C 3 310 ? -31.330 93.562  7.709   1.00 98.85  ? 310 GLY A O     1 
ATOM   2732 N N     . GLN C 3 311 ? -29.507 92.483  8.480   1.00 99.89  ? 311 GLN A N     1 
ATOM   2733 C CA    . GLN C 3 311 ? -30.240 91.264  8.818   1.00 101.50 ? 311 GLN A CA    1 
ATOM   2734 C C     . GLN C 3 311 ? -30.971 91.534  10.147  1.00 101.15 ? 311 GLN A C     1 
ATOM   2735 O O     . GLN C 3 311 ? -30.409 92.167  11.052  1.00 101.20 ? 311 GLN A O     1 
ATOM   2736 C CB    . GLN C 3 311 ? -29.262 90.087  8.956   1.00 103.79 ? 311 GLN A CB    1 
ATOM   2737 C CG    . GLN C 3 311 ? -29.889 88.681  8.829   1.00 106.83 ? 311 GLN A CG    1 
ATOM   2738 C CD    . GLN C 3 311 ? -28.840 87.552  8.829   1.00 108.54 ? 311 GLN A CD    1 
ATOM   2739 O OE1   . GLN C 3 311 ? -27.957 87.500  7.950   1.00 109.40 ? 311 GLN A OE1   1 
ATOM   2740 N NE2   . GLN C 3 311 ? -28.936 86.645  9.815   1.00 108.97 ? 311 GLN A NE2   1 
ATOM   2741 N N     . ALA C 3 312 ? -32.220 91.070  10.251  1.00 100.28 ? 312 ALA A N     1 
ATOM   2742 C CA    . ALA C 3 312 ? -33.047 91.279  11.448  1.00 98.79  ? 312 ALA A CA    1 
ATOM   2743 C C     . ALA C 3 312 ? -32.691 90.374  12.639  1.00 97.41  ? 312 ALA A C     1 
ATOM   2744 O O     . ALA C 3 312 ? -33.371 89.375  12.921  1.00 97.23  ? 312 ALA A O     1 
ATOM   2745 C CB    . ALA C 3 312 ? -34.524 91.114  11.083  1.00 99.05  ? 312 ALA A CB    1 
ATOM   2746 N N     . VAL C 3 313 ? -31.630 90.754  13.343  1.00 95.46  ? 313 VAL A N     1 
ATOM   2747 C CA    . VAL C 3 313 ? -31.148 90.008  14.499  1.00 93.24  ? 313 VAL A CA    1 
ATOM   2748 C C     . VAL C 3 313 ? -30.812 91.012  15.617  1.00 91.45  ? 313 VAL A C     1 
ATOM   2749 O O     . VAL C 3 313 ? -29.836 90.839  16.362  1.00 91.76  ? 313 VAL A O     1 
ATOM   2750 C CB    . VAL C 3 313 ? -29.877 89.163  14.117  1.00 93.32  ? 313 VAL A CB    1 
ATOM   2751 C CG1   . VAL C 3 313 ? -30.261 88.034  13.159  1.00 92.99  ? 313 VAL A CG1   1 
ATOM   2752 C CG2   . VAL C 3 313 ? -28.820 90.056  13.450  1.00 92.82  ? 313 VAL A CG2   1 
ATOM   2753 N N     . LYS C 3 314 ? -31.629 92.066  15.717  1.00 88.87  ? 314 LYS A N     1 
ATOM   2754 C CA    . LYS C 3 314 ? -31.438 93.118  16.725  1.00 85.70  ? 314 LYS A CA    1 
ATOM   2755 C C     . LYS C 3 314 ? -31.754 92.637  18.148  1.00 82.38  ? 314 LYS A C     1 
ATOM   2756 O O     . LYS C 3 314 ? -32.556 91.712  18.347  1.00 81.87  ? 314 LYS A O     1 
ATOM   2757 C CB    . LYS C 3 314 ? -32.317 94.347  16.397  1.00 86.87  ? 314 LYS A CB    1 
ATOM   2758 C CG    . LYS C 3 314 ? -31.861 95.220  15.207  1.00 88.01  ? 314 LYS A CG    1 
ATOM   2759 C CD    . LYS C 3 314 ? -30.643 96.101  15.544  1.00 89.56  ? 314 LYS A CD    1 
ATOM   2760 C CE    . LYS C 3 314 ? -30.235 97.011  14.369  1.00 90.12  ? 314 LYS A CE    1 
ATOM   2761 N NZ    . LYS C 3 314 ? -28.951 97.766  14.596  1.00 90.86  ? 314 LYS A NZ    1 
ATOM   2762 N N     . GLY C 3 315 ? -31.109 93.261  19.131  1.00 78.65  ? 315 GLY A N     1 
ATOM   2763 C CA    . GLY C 3 315 ? -31.365 92.899  20.513  1.00 74.51  ? 315 GLY A CA    1 
ATOM   2764 C C     . GLY C 3 315 ? -30.218 92.298  21.300  1.00 71.27  ? 315 GLY A C     1 
ATOM   2765 O O     . GLY C 3 315 ? -29.042 92.475  20.960  1.00 70.41  ? 315 GLY A O     1 
ATOM   2766 N N     . ASN C 3 316 ? -30.579 91.592  22.368  1.00 68.22  ? 316 ASN A N     1 
ATOM   2767 C CA    . ASN C 3 316 ? -29.609 90.944  23.235  1.00 65.49  ? 316 ASN A CA    1 
ATOM   2768 C C     . ASN C 3 316 ? -29.683 89.436  23.127  1.00 64.10  ? 316 ASN A C     1 
ATOM   2769 O O     . ASN C 3 316 ? -30.778 88.854  23.100  1.00 63.34  ? 316 ASN A O     1 
ATOM   2770 C CB    . ASN C 3 316 ? -29.832 91.344  24.691  1.00 65.88  ? 316 ASN A CB    1 
ATOM   2771 C CG    . ASN C 3 316 ? -29.288 90.303  25.675  1.00 65.73  ? 316 ASN A CG    1 
ATOM   2772 O OD1   . ASN C 3 316 ? -29.960 89.318  26.000  1.00 66.00  ? 316 ASN A OD1   1 
ATOM   2773 N ND2   . ASN C 3 316 ? -28.065 90.513  26.138  1.00 65.48  ? 316 ASN A ND2   1 
ATOM   2774 N N     . GLN C 3 317 ? -28.504 88.815  23.094  1.00 62.34  ? 317 GLN A N     1 
ATOM   2775 C CA    . GLN C 3 317 ? -28.390 87.368  22.980  1.00 60.44  ? 317 GLN A CA    1 
ATOM   2776 C C     . GLN C 3 317 ? -27.698 86.792  24.195  1.00 57.93  ? 317 GLN A C     1 
ATOM   2777 O O     . GLN C 3 317 ? -26.784 87.409  24.762  1.00 55.97  ? 317 GLN A O     1 
ATOM   2778 C CB    . GLN C 3 317 ? -27.589 86.995  21.724  1.00 63.04  ? 317 GLN A CB    1 
ATOM   2779 C CG    . GLN C 3 317 ? -27.864 85.589  21.166  1.00 66.19  ? 317 GLN A CG    1 
ATOM   2780 C CD    . GLN C 3 317 ? -26.968 85.236  19.973  1.00 68.07  ? 317 GLN A CD    1 
ATOM   2781 O OE1   . GLN C 3 317 ? -26.716 86.077  19.097  1.00 68.42  ? 317 GLN A OE1   1 
ATOM   2782 N NE2   . GLN C 3 317 ? -26.494 83.983  19.929  1.00 68.59  ? 317 GLN A NE2   1 
ATOM   2783 N N     . LEU C 3 318 ? -28.141 85.600  24.582  1.00 55.43  ? 318 LEU A N     1 
ATOM   2784 C CA    . LEU C 3 318 ? -27.558 84.911  25.722  1.00 53.49  ? 318 LEU A CA    1 
ATOM   2785 C C     . LEU C 3 318 ? -26.816 83.616  25.311  1.00 52.03  ? 318 LEU A C     1 
ATOM   2786 O O     . LEU C 3 318 ? -27.373 82.745  24.608  1.00 52.03  ? 318 LEU A O     1 
ATOM   2787 C CB    . LEU C 3 318 ? -28.647 84.618  26.773  1.00 52.25  ? 318 LEU A CB    1 
ATOM   2788 C CG    . LEU C 3 318 ? -28.683 85.573  27.977  1.00 50.88  ? 318 LEU A CG    1 
ATOM   2789 C CD1   . LEU C 3 318 ? -28.482 87.025  27.529  1.00 50.88  ? 318 LEU A CD1   1 
ATOM   2790 C CD2   . LEU C 3 318 ? -30.006 85.400  28.702  1.00 50.41  ? 318 LEU A CD2   1 
ATOM   2791 N N     . LEU C 3 319 ? -25.548 83.528  25.730  1.00 48.73  ? 319 LEU A N     1 
ATOM   2792 C CA    . LEU C 3 319 ? -24.708 82.376  25.454  1.00 44.25  ? 319 LEU A CA    1 
ATOM   2793 C C     . LEU C 3 319 ? -24.732 81.497  26.670  1.00 42.07  ? 319 LEU A C     1 
ATOM   2794 O O     . LEU C 3 319 ? -24.575 81.969  27.791  1.00 40.97  ? 319 LEU A O     1 
ATOM   2795 C CB    . LEU C 3 319 ? -23.275 82.808  25.182  1.00 43.32  ? 319 LEU A CB    1 
ATOM   2796 C CG    . LEU C 3 319 ? -22.890 82.970  23.713  1.00 43.27  ? 319 LEU A CG    1 
ATOM   2797 C CD1   . LEU C 3 319 ? -24.048 83.574  22.916  1.00 42.97  ? 319 LEU A CD1   1 
ATOM   2798 C CD2   . LEU C 3 319 ? -21.638 83.842  23.637  1.00 43.36  ? 319 LEU A CD2   1 
ATOM   2799 N N     . PRO C 3 320 ? -24.929 80.197  26.462  1.00 41.63  ? 320 PRO A N     1 
ATOM   2800 C CA    . PRO C 3 320 ? -24.976 79.223  27.556  1.00 39.95  ? 320 PRO A CA    1 
ATOM   2801 C C     . PRO C 3 320 ? -23.664 79.122  28.330  1.00 38.18  ? 320 PRO A C     1 
ATOM   2802 O O     . PRO C 3 320 ? -22.596 79.476  27.858  1.00 37.73  ? 320 PRO A O     1 
ATOM   2803 C CB    . PRO C 3 320 ? -25.311 77.914  26.838  1.00 40.57  ? 320 PRO A CB    1 
ATOM   2804 C CG    . PRO C 3 320 ? -24.573 78.097  25.515  1.00 41.47  ? 320 PRO A CG    1 
ATOM   2805 C CD    . PRO C 3 320 ? -24.949 79.527  25.148  1.00 40.89  ? 320 PRO A CD    1 
ATOM   2806 N N     . VAL C 3 321 ? -23.772 78.618  29.543  1.00 37.11  ? 321 VAL A N     1 
ATOM   2807 C CA    . VAL C 3 321 ? -22.624 78.410  30.416  1.00 37.26  ? 321 VAL A CA    1 
ATOM   2808 C C     . VAL C 3 321 ? -22.884 77.078  31.075  1.00 38.05  ? 321 VAL A C     1 
ATOM   2809 O O     . VAL C 3 321 ? -23.955 76.502  30.883  1.00 39.10  ? 321 VAL A O     1 
ATOM   2810 C CB    . VAL C 3 321 ? -22.524 79.467  31.514  1.00 36.45  ? 321 VAL A CB    1 
ATOM   2811 C CG1   . VAL C 3 321 ? -22.541 80.846  30.887  1.00 36.40  ? 321 VAL A CG1   1 
ATOM   2812 C CG2   . VAL C 3 321 ? -23.658 79.312  32.504  1.00 35.08  ? 321 VAL A CG2   1 
ATOM   2813 N N     . SER C 3 322 ? -21.929 76.585  31.856  1.00 38.75  ? 322 SER A N     1 
ATOM   2814 C CA    . SER C 3 322 ? -22.112 75.285  32.487  1.00 39.83  ? 322 SER A CA    1 
ATOM   2815 C C     . SER C 3 322 ? -21.254 75.064  33.713  1.00 39.87  ? 322 SER A C     1 
ATOM   2816 O O     . SER C 3 322 ? -20.247 75.743  33.918  1.00 39.22  ? 322 SER A O     1 
ATOM   2817 C CB    . SER C 3 322 ? -21.819 74.172  31.472  1.00 39.98  ? 322 SER A CB    1 
ATOM   2818 O OG    . SER C 3 322 ? -20.490 74.275  30.983  1.00 40.35  ? 322 SER A OG    1 
ATOM   2819 N N     . LEU C 3 323 ? -21.657 74.089  34.518  1.00 41.00  ? 323 LEU A N     1 
ATOM   2820 C CA    . LEU C 3 323 ? -20.924 73.767  35.724  1.00 43.47  ? 323 LEU A CA    1 
ATOM   2821 C C     . LEU C 3 323 ? -19.911 72.664  35.455  1.00 45.19  ? 323 LEU A C     1 
ATOM   2822 O O     . LEU C 3 323 ? -20.245 71.630  34.865  1.00 45.72  ? 323 LEU A O     1 
ATOM   2823 C CB    . LEU C 3 323 ? -21.875 73.319  36.834  1.00 43.18  ? 323 LEU A CB    1 
ATOM   2824 C CG    . LEU C 3 323 ? -21.193 72.882  38.137  1.00 44.00  ? 323 LEU A CG    1 
ATOM   2825 C CD1   . LEU C 3 323 ? -20.362 74.019  38.683  1.00 43.78  ? 323 LEU A CD1   1 
ATOM   2826 C CD2   . LEU C 3 323 ? -22.237 72.460  39.148  1.00 44.09  ? 323 LEU A CD2   1 
ATOM   2827 N N     . VAL C 3 324 ? -18.676 72.906  35.898  1.00 47.16  ? 324 VAL A N     1 
ATOM   2828 C CA    . VAL C 3 324 ? -17.569 71.968  35.748  1.00 48.26  ? 324 VAL A CA    1 
ATOM   2829 C C     . VAL C 3 324 ? -17.149 71.534  37.137  1.00 48.69  ? 324 VAL A C     1 
ATOM   2830 O O     . VAL C 3 324 ? -16.433 72.250  37.831  1.00 46.91  ? 324 VAL A O     1 
ATOM   2831 C CB    . VAL C 3 324 ? -16.368 72.625  35.078  1.00 48.05  ? 324 VAL A CB    1 
ATOM   2832 C CG1   . VAL C 3 324 ? -15.291 71.589  34.854  1.00 48.44  ? 324 VAL A CG1   1 
ATOM   2833 C CG2   . VAL C 3 324 ? -16.784 73.262  33.765  1.00 47.61  ? 324 VAL A CG2   1 
ATOM   2834 N N     . LYS C 3 325 ? -17.604 70.353  37.531  1.00 51.23  ? 325 LYS A N     1 
ATOM   2835 C CA    . LYS C 3 325 ? -17.306 69.817  38.851  1.00 53.87  ? 325 LYS A CA    1 
ATOM   2836 C C     . LYS C 3 325 ? -15.898 69.286  38.965  1.00 53.20  ? 325 LYS A C     1 
ATOM   2837 O O     . LYS C 3 325 ? -15.540 68.309  38.307  1.00 53.12  ? 325 LYS A O     1 
ATOM   2838 C CB    . LYS C 3 325 ? -18.266 68.684  39.195  1.00 57.83  ? 325 LYS A CB    1 
ATOM   2839 C CG    . LYS C 3 325 ? -19.744 69.068  39.140  1.00 62.08  ? 325 LYS A CG    1 
ATOM   2840 C CD    . LYS C 3 325 ? -20.634 67.938  39.687  1.00 65.23  ? 325 LYS A CD    1 
ATOM   2841 C CE    . LYS C 3 325 ? -20.591 66.682  38.804  1.00 66.87  ? 325 LYS A CE    1 
ATOM   2842 N NZ    . LYS C 3 325 ? -21.323 65.529  39.431  1.00 67.08  ? 325 LYS A NZ    1 
ATOM   2843 N N     . ARG C 3 326 ? -15.106 69.923  39.817  1.00 53.06  ? 326 ARG A N     1 
ATOM   2844 C CA    . ARG C 3 326 ? -13.728 69.500  40.027  1.00 52.92  ? 326 ARG A CA    1 
ATOM   2845 C C     . ARG C 3 326 ? -13.600 69.014  41.476  1.00 53.48  ? 326 ARG A C     1 
ATOM   2846 O O     . ARG C 3 326 ? -14.447 68.253  41.938  1.00 53.48  ? 326 ARG A O     1 
ATOM   2847 C CB    . ARG C 3 326 ? -12.758 70.661  39.720  1.00 51.18  ? 326 ARG A CB    1 
ATOM   2848 C CG    . ARG C 3 326 ? -11.727 70.347  38.620  1.00 49.83  ? 326 ARG A CG    1 
ATOM   2849 C CD    . ARG C 3 326 ? -12.171 70.705  37.198  1.00 48.84  ? 326 ARG A CD    1 
ATOM   2850 N NE    . ARG C 3 326 ? -11.811 72.076  36.833  1.00 48.72  ? 326 ARG A NE    1 
ATOM   2851 C CZ    . ARG C 3 326 ? -11.751 72.532  35.578  1.00 48.61  ? 326 ARG A CZ    1 
ATOM   2852 N NH1   . ARG C 3 326 ? -12.025 71.723  34.551  1.00 47.70  ? 326 ARG A NH1   1 
ATOM   2853 N NH2   . ARG C 3 326 ? -11.417 73.801  35.343  1.00 47.72  ? 326 ARG A NH2   1 
ATOM   2854 N N     . LYS C 3 327 ? -12.581 69.467  42.201  1.00 53.88  ? 327 LYS A N     1 
ATOM   2855 C CA    . LYS C 3 327 ? -12.387 69.014  43.575  1.00 54.11  ? 327 LYS A CA    1 
ATOM   2856 C C     . LYS C 3 327 ? -12.511 70.060  44.670  1.00 54.64  ? 327 LYS A C     1 
ATOM   2857 O O     . LYS C 3 327 ? -12.223 69.753  45.824  1.00 55.10  ? 327 LYS A O     1 
ATOM   2858 C CB    . LYS C 3 327 ? -11.014 68.361  43.729  1.00 55.54  ? 327 LYS A CB    1 
ATOM   2859 C CG    . LYS C 3 327 ? -10.736 67.220  42.769  1.00 58.48  ? 327 LYS A CG    1 
ATOM   2860 C CD    . LYS C 3 327 ? -11.631 66.012  43.041  1.00 60.72  ? 327 LYS A CD    1 
ATOM   2861 C CE    . LYS C 3 327 ? -11.273 64.847  42.097  1.00 62.26  ? 327 LYS A CE    1 
ATOM   2862 N NZ    . LYS C 3 327 ? -12.148 63.633  42.281  1.00 62.34  ? 327 LYS A NZ    1 
ATOM   2863 N N     . THR C 3 328 ? -12.923 71.282  44.346  1.00 55.76  ? 328 THR A N     1 
ATOM   2864 C CA    . THR C 3 328 ? -13.024 72.310  45.391  1.00 57.43  ? 328 THR A CA    1 
ATOM   2865 C C     . THR C 3 328 ? -14.370 72.365  46.153  1.00 59.69  ? 328 THR A C     1 
ATOM   2866 O O     . THR C 3 328 ? -14.489 73.078  47.149  1.00 56.50  ? 328 THR A O     1 
ATOM   2867 C CB    . THR C 3 328 ? -12.664 73.743  44.829  1.00 55.35  ? 328 THR A CB    1 
ATOM   2868 O OG1   . THR C 3 328 ? -13.340 73.976  43.586  1.00 54.15  ? 328 THR A OG1   1 
ATOM   2869 C CG2   . THR C 3 328 ? -11.163 73.882  44.626  1.00 53.93  ? 328 THR A CG2   1 
ATOM   2870 N N     . THR C 3 329 ? -15.356 71.595  45.689  1.00 59.46  ? 329 THR A N     1 
ATOM   2871 C CA    . THR C 3 329 ? -16.688 71.536  46.282  1.00 62.75  ? 329 THR A CA    1 
ATOM   2872 C C     . THR C 3 329 ? -16.901 70.118  46.826  1.00 63.54  ? 329 THR A C     1 
ATOM   2873 O O     . THR C 3 329 ? -17.104 69.145  46.079  1.00 65.14  ? 329 THR A O     1 
ATOM   2874 C CB    . THR C 3 329 ? -17.769 71.879  45.201  1.00 63.80  ? 329 THR A CB    1 
ATOM   2875 O OG1   . THR C 3 329 ? -17.651 70.969  44.093  1.00 63.55  ? 329 THR A OG1   1 
ATOM   2876 C CG2   . THR C 3 329 ? -17.582 73.311  44.676  1.00 64.39  ? 329 THR A CG2   1 
ATOM   2877 N N     . LEU C 3 330 ? -16.790 69.988  48.143  1.00 67.53  ? 330 LEU A N     1 
ATOM   2878 C CA    . LEU C 3 330 ? -16.967 68.659  48.819  1.00 68.83  ? 330 LEU A CA    1 
ATOM   2879 C C     . LEU C 3 330 ? -17.760 68.840  50.135  1.00 68.26  ? 330 LEU A C     1 
ATOM   2880 O O     . LEU C 3 330 ? -18.954 69.259  50.102  1.00 67.72  ? 330 LEU A O     1 
ATOM   2881 C CB    . LEU C 3 330 ? -15.603 67.935  49.146  1.00 70.04  ? 330 LEU A CB    1 
ATOM   2882 C CG    . LEU C 3 330 ? -14.634 67.803  47.945  1.00 73.99  ? 330 LEU A CG    1 
ATOM   2883 C CD1   . LEU C 3 330 ? -13.247 67.211  48.395  1.00 70.85  ? 330 LEU A CD1   1 
ATOM   2884 C CD2   . LEU C 3 330 ? -15.308 66.904  46.833  1.00 70.73  ? 330 LEU A CD2   1 
ATOM   2885 N N     . LYS D 3 2   ? -22.787 107.604 3.439   1.00 126.89 ? 2   LYS B N     1 
ATOM   2886 C CA    . LYS D 3 2   ? -21.492 107.575 3.892   1.00 128.49 ? 2   LYS B CA    1 
ATOM   2887 C C     . LYS D 3 2   ? -21.077 108.862 4.538   1.00 129.00 ? 2   LYS B C     1 
ATOM   2888 O O     . LYS D 3 2   ? -21.394 109.933 4.034   1.00 129.54 ? 2   LYS B O     1 
ATOM   2889 C CB    . LYS D 3 2   ? -20.762 107.367 2.640   1.00 128.34 ? 2   LYS B CB    1 
ATOM   2890 N N     . PRO D 3 3   ? -20.262 108.767 5.598   1.00 129.60 ? 3   PRO B N     1 
ATOM   2891 C CA    . PRO D 3 3   ? -19.670 109.826 6.436   1.00 129.34 ? 3   PRO B CA    1 
ATOM   2892 C C     . PRO D 3 3   ? -19.604 111.316 5.913   1.00 129.57 ? 3   PRO B C     1 
ATOM   2893 O O     . PRO D 3 3   ? -19.445 111.593 4.706   1.00 128.91 ? 3   PRO B O     1 
ATOM   2894 C CB    . PRO D 3 3   ? -18.277 109.247 6.790   1.00 129.58 ? 3   PRO B CB    1 
ATOM   2895 N N     . VAL D 3 4   ? -19.696 112.262 6.852   1.00 130.08 ? 4   VAL B N     1 
ATOM   2896 C CA    . VAL D 3 4   ? -19.628 113.672 6.501   1.00 131.28 ? 4   VAL B CA    1 
ATOM   2897 C C     . VAL D 3 4   ? -18.296 114.063 5.865   1.00 131.54 ? 4   VAL B C     1 
ATOM   2898 O O     . VAL D 3 4   ? -17.261 113.987 6.530   1.00 131.66 ? 4   VAL B O     1 
ATOM   2899 C CB    . VAL D 3 4   ? -19.871 114.590 7.735   1.00 130.85 ? 4   VAL B CB    1 
ATOM   2900 N N     . THR D 3 5   ? -18.328 114.491 4.594   1.00 131.37 ? 5   THR B N     1 
ATOM   2901 C CA    . THR D 3 5   ? -17.104 114.909 3.892   1.00 131.00 ? 5   THR B CA    1 
ATOM   2902 C C     . THR D 3 5   ? -16.655 116.345 4.281   1.00 130.95 ? 5   THR B C     1 
ATOM   2903 O O     . THR D 3 5   ? -17.343 117.034 5.039   1.00 131.20 ? 5   THR B O     1 
ATOM   2904 C CB    . THR D 3 5   ? -17.292 114.837 2.353   1.00 130.54 ? 5   THR B CB    1 
ATOM   2905 N N     . LEU D 3 6   ? -15.499 116.793 3.782   1.00 131.02 ? 6   LEU B N     1 
ATOM   2906 C CA    . LEU D 3 6   ? -15.019 118.154 4.077   1.00 130.82 ? 6   LEU B CA    1 
ATOM   2907 C C     . LEU D 3 6   ? -15.808 119.086 3.171   1.00 131.22 ? 6   LEU B C     1 
ATOM   2908 O O     . LEU D 3 6   ? -15.837 120.306 3.379   1.00 131.12 ? 6   LEU B O     1 
ATOM   2909 C CB    . LEU D 3 6   ? -13.522 118.306 3.780   1.00 130.22 ? 6   LEU B CB    1 
ATOM   2910 N N     . TYR D 3 7   ? -16.442 118.469 2.168   1.00 131.51 ? 7   TYR B N     1 
ATOM   2911 C CA    . TYR D 3 7   ? -17.280 119.140 1.174   1.00 131.55 ? 7   TYR B CA    1 
ATOM   2912 C C     . TYR D 3 7   ? -18.657 119.447 1.770   1.00 131.64 ? 7   TYR B C     1 
ATOM   2913 O O     . TYR D 3 7   ? -19.247 120.493 1.483   1.00 131.79 ? 7   TYR B O     1 
ATOM   2914 C CB    . TYR D 3 7   ? -17.444 118.248 -0.065  1.00 131.02 ? 7   TYR B CB    1 
ATOM   2915 N N     . ASP D 3 8   ? -19.165 118.530 2.594   1.00 131.55 ? 8   ASP B N     1 
ATOM   2916 C CA    . ASP D 3 8   ? -20.463 118.713 3.244   1.00 131.44 ? 8   ASP B CA    1 
ATOM   2917 C C     . ASP D 3 8   ? -20.431 119.913 4.207   1.00 131.46 ? 8   ASP B C     1 
ATOM   2918 O O     . ASP D 3 8   ? -21.451 120.586 4.400   1.00 131.77 ? 8   ASP B O     1 
ATOM   2919 C CB    . ASP D 3 8   ? -20.865 117.444 4.007   1.00 131.23 ? 8   ASP B CB    1 
ATOM   2920 N N     . VAL D 3 9   ? -19.262 120.173 4.803   1.00 131.18 ? 9   VAL B N     1 
ATOM   2921 C CA    . VAL D 3 9   ? -19.078 121.297 5.735   1.00 131.03 ? 9   VAL B CA    1 
ATOM   2922 C C     . VAL D 3 9   ? -18.824 122.616 4.981   1.00 131.09 ? 9   VAL B C     1 
ATOM   2923 O O     . VAL D 3 9   ? -18.878 123.709 5.565   1.00 130.96 ? 9   VAL B O     1 
ATOM   2924 C CB    . VAL D 3 9   ? -17.890 121.047 6.697   1.00 130.57 ? 9   VAL B CB    1 
ATOM   2925 N N     . ALA D 3 10  ? -18.542 122.496 3.684   1.00 130.97 ? 10  ALA B N     1 
ATOM   2926 C CA    . ALA D 3 10  ? -18.293 123.645 2.820   1.00 130.87 ? 10  ALA B CA    1 
ATOM   2927 C C     . ALA D 3 10  ? -19.596 124.413 2.566   1.00 131.21 ? 10  ALA B C     1 
ATOM   2928 O O     . ALA D 3 10  ? -19.630 125.636 2.686   1.00 131.22 ? 10  ALA B O     1 
ATOM   2929 C CB    . ALA D 3 10  ? -17.691 123.177 1.492   1.00 130.20 ? 10  ALA B CB    1 
ATOM   2930 N N     . GLU D 3 11  ? -20.661 123.685 2.222   1.00 131.69 ? 11  GLU B N     1 
ATOM   2931 C CA    . GLU D 3 11  ? -21.977 124.276 1.938   1.00 132.16 ? 11  GLU B CA    1 
ATOM   2932 C C     . GLU D 3 11  ? -22.793 124.626 3.192   1.00 132.65 ? 11  GLU B C     1 
ATOM   2933 O O     . GLU D 3 11  ? -23.501 125.638 3.217   1.00 132.44 ? 11  GLU B O     1 
ATOM   2934 C CB    . GLU D 3 11  ? -22.794 123.329 1.046   1.00 131.43 ? 11  GLU B CB    1 
ATOM   2935 N N     . TYR D 3 12  ? -22.695 123.787 4.223   1.00 133.44 ? 12  TYR B N     1 
ATOM   2936 C CA    . TYR D 3 12  ? -23.415 124.008 5.479   1.00 134.42 ? 12  TYR B CA    1 
ATOM   2937 C C     . TYR D 3 12  ? -22.719 125.071 6.342   1.00 135.44 ? 12  TYR B C     1 
ATOM   2938 O O     . TYR D 3 12  ? -23.006 125.210 7.537   1.00 135.52 ? 12  TYR B O     1 
ATOM   2939 C CB    . TYR D 3 12  ? -23.530 122.692 6.259   1.00 133.74 ? 12  TYR B CB    1 
ATOM   2940 N N     . ALA D 3 13  ? -21.801 125.811 5.721   1.00 136.74 ? 13  ALA B N     1 
ATOM   2941 C CA    . ALA D 3 13  ? -21.050 126.877 6.385   1.00 138.04 ? 13  ALA B CA    1 
ATOM   2942 C C     . ALA D 3 13  ? -20.831 128.035 5.401   1.00 139.17 ? 13  ALA B C     1 
ATOM   2943 O O     . ALA D 3 13  ? -20.402 129.123 5.802   1.00 139.50 ? 13  ALA B O     1 
ATOM   2944 C CB    . ALA D 3 13  ? -19.694 126.345 6.898   1.00 137.54 ? 13  ALA B CB    1 
ATOM   2945 N N     . GLY D 3 14  ? -21.126 127.789 4.120   1.00 140.27 ? 14  GLY B N     1 
ATOM   2946 C CA    . GLY D 3 14  ? -20.969 128.807 3.083   1.00 141.48 ? 14  GLY B CA    1 
ATOM   2947 C C     . GLY D 3 14  ? -19.551 129.092 2.577   1.00 142.26 ? 14  GLY B C     1 
ATOM   2948 O O     . GLY D 3 14  ? -19.283 130.176 2.036   1.00 142.26 ? 14  GLY B O     1 
ATOM   2949 N N     . VAL D 3 15  ? -18.642 128.129 2.741   1.00 142.98 ? 15  VAL B N     1 
ATOM   2950 C CA    . VAL D 3 15  ? -17.249 128.280 2.306   1.00 143.42 ? 15  VAL B CA    1 
ATOM   2951 C C     . VAL D 3 15  ? -16.824 127.183 1.310   1.00 143.78 ? 15  VAL B C     1 
ATOM   2952 O O     . VAL D 3 15  ? -17.675 126.516 0.695   1.00 143.96 ? 15  VAL B O     1 
ATOM   2953 C CB    . VAL D 3 15  ? -16.288 128.244 3.524   1.00 143.28 ? 15  VAL B CB    1 
ATOM   2954 N N     . SER D 3 16  ? -15.507 127.013 1.152   1.00 143.93 ? 16  SER B N     1 
ATOM   2955 C CA    . SER D 3 16  ? -14.932 125.999 0.255   1.00 143.85 ? 16  SER B CA    1 
ATOM   2956 C C     . SER D 3 16  ? -14.280 124.860 1.066   1.00 143.76 ? 16  SER B C     1 
ATOM   2957 O O     . SER D 3 16  ? -14.171 124.951 2.298   1.00 143.92 ? 16  SER B O     1 
ATOM   2958 C CB    . SER D 3 16  ? -13.888 126.639 -0.672  1.00 143.45 ? 16  SER B CB    1 
ATOM   2959 N N     . TYR D 3 17  ? -13.856 123.796 0.373   1.00 143.38 ? 17  TYR B N     1 
ATOM   2960 C CA    . TYR D 3 17  ? -13.217 122.639 1.019   1.00 142.66 ? 17  TYR B CA    1 
ATOM   2961 C C     . TYR D 3 17  ? -11.862 123.015 1.639   1.00 142.17 ? 17  TYR B C     1 
ATOM   2962 O O     . TYR D 3 17  ? -11.371 122.336 2.555   1.00 141.98 ? 17  TYR B O     1 
ATOM   2963 C CB    . TYR D 3 17  ? -13.020 121.501 0.006   1.00 142.02 ? 17  TYR B CB    1 
ATOM   2964 N N     . GLN D 3 18  ? -11.276 124.100 1.129   1.00 141.55 ? 18  GLN B N     1 
ATOM   2965 C CA    . GLN D 3 18  ? -9.988  124.612 1.598   1.00 140.75 ? 18  GLN B CA    1 
ATOM   2966 C C     . GLN D 3 18  ? -10.148 125.429 2.875   1.00 140.37 ? 18  GLN B C     1 
ATOM   2967 O O     . GLN D 3 18  ? -9.286  125.384 3.765   1.00 140.25 ? 18  GLN B O     1 
ATOM   2968 C CB    . GLN D 3 18  ? -9.369  125.503 0.538   1.00 140.25 ? 18  GLN B CB    1 
ATOM   2969 N N     . THR D 3 19  ? -11.242 126.193 2.938   1.00 139.95 ? 19  THR B N     1 
ATOM   2970 C CA    . THR D 3 19  ? -11.562 127.028 4.098   1.00 139.37 ? 19  THR B CA    1 
ATOM   2971 C C     . THR D 3 19  ? -11.679 126.142 5.346   1.00 139.01 ? 19  THR B C     1 
ATOM   2972 O O     . THR D 3 19  ? -11.082 126.427 6.393   1.00 138.70 ? 19  THR B O     1 
ATOM   2973 C CB    . THR D 3 19  ? -12.897 127.787 3.889   1.00 138.81 ? 19  THR B CB    1 
ATOM   2974 N N     . VAL D 3 20  ? -12.452 125.064 5.219   1.00 138.73 ? 20  VAL B N     1 
ATOM   2975 C CA    . VAL D 3 20  ? -12.651 124.106 6.305   1.00 138.32 ? 20  VAL B CA    1 
ATOM   2976 C C     . VAL D 3 20  ? -11.322 123.418 6.654   1.00 138.09 ? 20  VAL B C     1 
ATOM   2977 O O     . VAL D 3 20  ? -11.025 123.185 7.831   1.00 137.81 ? 20  VAL B O     1 
ATOM   2978 C CB    . VAL D 3 20  ? -13.693 123.023 5.907   1.00 138.00 ? 20  VAL B CB    1 
ATOM   2979 N N     . SER D 3 21  ? -10.541 123.097 5.617   1.00 137.77 ? 21  SER B N     1 
ATOM   2980 C CA    . SER D 3 21  ? -9.234  122.444 5.750   1.00 137.15 ? 21  SER B CA    1 
ATOM   2981 C C     . SER D 3 21  ? -8.336  123.297 6.634   1.00 137.20 ? 21  SER B C     1 
ATOM   2982 O O     . SER D 3 21  ? -7.630  122.785 7.512   1.00 136.87 ? 21  SER B O     1 
ATOM   2983 C CB    . SER D 3 21  ? -8.576  122.282 4.371   1.00 136.69 ? 21  SER B CB    1 
ATOM   2984 N N     . ARG D 3 22  ? -8.372  124.602 6.375   1.00 137.49 ? 22  ARG B N     1 
ATOM   2985 C CA    . ARG D 3 22  ? -7.596  125.577 7.125   1.00 138.18 ? 22  ARG B CA    1 
ATOM   2986 C C     . ARG D 3 22  ? -7.990  125.479 8.599   1.00 138.49 ? 22  ARG B C     1 
ATOM   2987 O O     . ARG D 3 22  ? -7.154  125.203 9.462   1.00 138.47 ? 22  ARG B O     1 
ATOM   2988 C CB    . ARG D 3 22  ? -7.874  126.992 6.593   1.00 136.89 ? 22  ARG B CB    1 
ATOM   2989 N N     . VAL D 3 23  ? -9.274  125.693 8.870   1.00 139.46 ? 23  VAL B N     1 
ATOM   2990 C CA    . VAL D 3 23  ? -9.812  125.630 10.229  1.00 141.07 ? 23  VAL B CA    1 
ATOM   2991 C C     . VAL D 3 23  ? -9.414  124.338 10.965  1.00 142.54 ? 23  VAL B C     1 
ATOM   2992 O O     . VAL D 3 23  ? -8.960  124.372 12.118  1.00 142.32 ? 23  VAL B O     1 
ATOM   2993 C CB    . VAL D 3 23  ? -11.360 125.723 10.209  1.00 141.16 ? 23  VAL B CB    1 
ATOM   2994 N N     . VAL D 3 24  ? -9.595  123.205 10.287  1.00 143.63 ? 24  VAL B N     1 
ATOM   2995 C CA    . VAL D 3 24  ? -9.278  121.890 10.838  1.00 143.99 ? 24  VAL B CA    1 
ATOM   2996 C C     . VAL D 3 24  ? -7.794  121.737 11.206  1.00 145.48 ? 24  VAL B C     1 
ATOM   2997 O O     . VAL D 3 24  ? -7.458  121.176 12.261  1.00 144.30 ? 24  VAL B O     1 
ATOM   2998 C CB    . VAL D 3 24  ? -9.652  120.771 9.832   1.00 143.36 ? 24  VAL B CB    1 
ATOM   2999 N N     . ASN D 3 25  ? -6.918  122.245 10.337  1.00 146.36 ? 25  ASN B N     1 
ATOM   3000 C CA    . ASN D 3 25  ? -5.468  122.168 10.523  1.00 147.66 ? 25  ASN B CA    1 
ATOM   3001 C C     . ASN D 3 25  ? -4.907  123.310 11.380  1.00 149.26 ? 25  ASN B C     1 
ATOM   3002 O O     . ASN D 3 25  ? -3.686  123.521 11.375  1.00 148.39 ? 25  ASN B O     1 
ATOM   3003 C CB    . ASN D 3 25  ? -4.773  122.209 9.157   1.00 146.38 ? 25  ASN B CB    1 
ATOM   3004 N N     . GLN D 3 26  ? -5.774  124.026 12.101  1.00 149.76 ? 26  GLN B N     1 
ATOM   3005 C CA    . GLN D 3 26  ? -5.348  125.140 12.937  1.00 151.26 ? 26  GLN B CA    1 
ATOM   3006 C C     . GLN D 3 26  ? -4.644  126.216 12.072  1.00 153.56 ? 26  GLN B C     1 
ATOM   3007 O O     . GLN D 3 26  ? -3.704  126.920 12.525  1.00 154.01 ? 26  GLN B O     1 
ATOM   3008 C CB    . GLN D 3 26  ? -4.423  124.651 14.076  1.00 150.11 ? 26  GLN B CB    1 
ATOM   3009 N N     . ALA D 3 27  ? -5.129  126.359 10.842  1.00 153.76 ? 27  ALA B N     1 
ATOM   3010 C CA    . ALA D 3 27  ? -4.649  127.332 9.862   1.00 153.56 ? 27  ALA B CA    1 
ATOM   3011 C C     . ALA D 3 27  ? -3.957  128.699 10.211  1.00 155.08 ? 27  ALA B C     1 
ATOM   3012 O O     . ALA D 3 27  ? -4.182  129.284 11.324  1.00 153.42 ? 27  ALA B O     1 
ATOM   3013 C CB    . ALA D 3 27  ? -5.827  127.578 8.918   1.00 152.19 ? 27  ALA B CB    1 
ATOM   3014 N N     . SER D 3 28  ? -3.191  129.194 9.205   1.00 155.03 ? 28  SER B N     1 
ATOM   3015 C CA    . SER D 3 28  ? -2.480  130.472 9.236   1.00 156.51 ? 28  SER B CA    1 
ATOM   3016 C C     . SER D 3 28  ? -3.373  131.402 8.374   1.00 157.81 ? 28  SER B C     1 
ATOM   3017 O O     . SER D 3 28  ? -3.506  131.220 7.165   1.00 156.78 ? 28  SER B O     1 
ATOM   3018 C CB    . SER D 3 28  ? -1.024  130.319 8.681   1.00 154.76 ? 28  SER B CB    1 
ATOM   3019 N N     . HIS D 3 29  ? -3.971  132.396 9.036   1.00 157.70 ? 29  HIS B N     1 
ATOM   3020 C CA    . HIS D 3 29  ? -4.847  133.380 8.404   1.00 157.26 ? 29  HIS B CA    1 
ATOM   3021 C C     . HIS D 3 29  ? -6.182  132.646 8.166   1.00 157.11 ? 29  HIS B C     1 
ATOM   3022 O O     . HIS D 3 29  ? -6.337  131.794 7.230   1.00 158.10 ? 29  HIS B O     1 
ATOM   3023 C CB    . HIS D 3 29  ? -4.307  133.804 7.049   1.00 156.80 ? 29  HIS B CB    1 
ATOM   3024 N N     . VAL D 3 30  ? -7.154  133.003 9.001   1.00 156.41 ? 30  VAL B N     1 
ATOM   3025 C CA    . VAL D 3 30  ? -8.515  132.468 8.963   1.00 156.05 ? 30  VAL B CA    1 
ATOM   3026 C C     . VAL D 3 30  ? -9.376  133.764 9.064   1.00 155.63 ? 30  VAL B C     1 
ATOM   3027 O O     . VAL D 3 30  ? -8.968  134.741 9.775   1.00 154.29 ? 30  VAL B O     1 
ATOM   3028 C CB    . VAL D 3 30  ? -8.778  131.550 10.152  1.00 154.87 ? 30  VAL B CB    1 
ATOM   3029 N N     . SER D 3 31  ? -10.512 133.806 8.345   1.00 153.81 ? 31  SER B N     1 
ATOM   3030 C CA    . SER D 3 31  ? -11.342 135.017 8.271   1.00 151.99 ? 31  SER B CA    1 
ATOM   3031 C C     . SER D 3 31  ? -11.918 135.430 9.632   1.00 151.57 ? 31  SER B C     1 
ATOM   3032 O O     . SER D 3 31  ? -13.003 136.014 9.696   1.00 151.59 ? 31  SER B O     1 
ATOM   3033 C CB    . SER D 3 31  ? -12.463 134.788 7.248   1.00 151.23 ? 31  SER B CB    1 
ATOM   3034 N N     . ALA D 3 32  ? -11.178 135.132 10.708  1.00 151.08 ? 32  ALA B N     1 
ATOM   3035 C CA    . ALA D 3 32  ? -11.556 135.446 12.097  1.00 150.42 ? 32  ALA B CA    1 
ATOM   3036 C C     . ALA D 3 32  ? -12.893 134.826 12.509  1.00 150.40 ? 32  ALA B C     1 
ATOM   3037 O O     . ALA D 3 32  ? -12.931 133.711 13.043  1.00 149.57 ? 32  ALA B O     1 
ATOM   3038 C CB    . ALA D 3 32  ? -11.570 136.980 12.298  1.00 149.74 ? 32  ALA B CB    1 
ATOM   3039 N N     . LYS D 3 33  ? -13.978 135.562 12.280  1.00 148.66 ? 33  LYS B N     1 
ATOM   3040 C CA    . LYS D 3 33  ? -15.320 135.088 12.610  1.00 147.37 ? 33  LYS B CA    1 
ATOM   3041 C C     . LYS D 3 33  ? -15.741 133.952 11.665  1.00 147.42 ? 33  LYS B C     1 
ATOM   3042 O O     . LYS D 3 33  ? -16.719 133.242 11.915  1.00 146.51 ? 33  LYS B O     1 
ATOM   3043 C CB    . LYS D 3 33  ? -16.325 136.239 12.512  1.00 145.73 ? 33  LYS B CB    1 
ATOM   3044 N N     . THR D 3 34  ? -14.993 133.788 10.576  1.00 146.28 ? 34  THR B N     1 
ATOM   3045 C CA    . THR D 3 34  ? -15.261 132.736 9.591   1.00 145.25 ? 34  THR B CA    1 
ATOM   3046 C C     . THR D 3 34  ? -14.986 131.364 10.197  1.00 145.29 ? 34  THR B C     1 
ATOM   3047 O O     . THR D 3 34  ? -15.753 130.420 9.987   1.00 144.84 ? 34  THR B O     1 
ATOM   3048 C CB    . THR D 3 34  ? -14.364 132.868 8.357   1.00 144.02 ? 34  THR B CB    1 
ATOM   3049 N N     . ARG D 3 35  ? -13.883 131.268 10.941  1.00 144.01 ? 35  ARG B N     1 
ATOM   3050 C CA    . ARG D 3 35  ? -13.482 130.029 11.601  1.00 142.58 ? 35  ARG B CA    1 
ATOM   3051 C C     . ARG D 3 35  ? -14.480 129.653 12.705  1.00 141.56 ? 35  ARG B C     1 
ATOM   3052 O O     . ARG D 3 35  ? -14.692 128.462 12.993  1.00 141.88 ? 35  ARG B O     1 
ATOM   3053 C CB    . ARG D 3 35  ? -12.073 130.187 12.190  1.00 141.20 ? 35  ARG B CB    1 
ATOM   3054 N N     . GLU D 3 36  ? -15.094 130.676 13.309  1.00 140.26 ? 36  GLU B N     1 
ATOM   3055 C CA    . GLU D 3 36  ? -16.083 130.494 14.378  1.00 139.50 ? 36  GLU B CA    1 
ATOM   3056 C C     . GLU D 3 36  ? -17.380 129.885 13.815  1.00 138.62 ? 36  GLU B C     1 
ATOM   3057 O O     . GLU D 3 36  ? -18.077 129.128 14.503  1.00 138.01 ? 36  GLU B O     1 
ATOM   3058 C CB    . GLU D 3 36  ? -16.397 131.839 15.038  1.00 138.57 ? 36  GLU B CB    1 
ATOM   3059 N N     . LYS D 3 37  ? -17.678 130.202 12.552  1.00 137.87 ? 37  LYS B N     1 
ATOM   3060 C CA    . LYS D 3 37  ? -18.872 129.699 11.850  1.00 136.73 ? 37  LYS B CA    1 
ATOM   3061 C C     . LYS D 3 37  ? -18.653 128.294 11.249  1.00 136.15 ? 37  LYS B C     1 
ATOM   3062 O O     . LYS D 3 37  ? -19.564 127.452 11.251  1.00 136.81 ? 37  LYS B O     1 
ATOM   3063 C CB    . LYS D 3 37  ? -19.265 130.670 10.731  1.00 136.61 ? 37  LYS B CB    1 
ATOM   3064 N N     . VAL D 3 38  ? -17.438 128.059 10.746  1.00 136.05 ? 38  VAL B N     1 
ATOM   3065 C CA    . VAL D 3 38  ? -17.045 126.781 10.148  1.00 135.53 ? 38  VAL B CA    1 
ATOM   3066 C C     . VAL D 3 38  ? -16.961 125.677 11.210  1.00 134.88 ? 38  VAL B C     1 
ATOM   3067 O O     . VAL D 3 38  ? -17.426 124.551 10.975  1.00 134.17 ? 38  VAL B O     1 
ATOM   3068 C CB    . VAL D 3 38  ? -15.672 126.893 9.443   1.00 135.27 ? 38  VAL B CB    1 
ATOM   3069 N N     . GLU D 3 39  ? -16.368 126.006 12.364  1.00 133.75 ? 39  GLU B N     1 
ATOM   3070 C CA    . GLU D 3 39  ? -16.219 125.069 13.486  1.00 132.89 ? 39  GLU B CA    1 
ATOM   3071 C C     . GLU D 3 39  ? -17.591 124.658 14.028  1.00 132.44 ? 39  GLU B C     1 
ATOM   3072 O O     . GLU D 3 39  ? -17.781 123.523 14.478  1.00 132.24 ? 39  GLU B O     1 
ATOM   3073 C CB    . GLU D 3 39  ? -15.393 125.708 14.612  1.00 131.83 ? 39  GLU B CB    1 
ATOM   3074 N N     . ALA D 3 40  ? -18.537 125.598 13.979  1.00 132.17 ? 40  ALA B N     1 
ATOM   3075 C CA    . ALA D 3 40  ? -19.909 125.385 14.441  1.00 131.18 ? 40  ALA B CA    1 
ATOM   3076 C C     . ALA D 3 40  ? -20.663 124.508 13.441  1.00 130.77 ? 40  ALA B C     1 
ATOM   3077 O O     . ALA D 3 40  ? -21.570 123.757 13.817  1.00 130.70 ? 40  ALA B O     1 
ATOM   3078 C CB    . ALA D 3 40  ? -20.621 126.732 14.596  1.00 130.88 ? 40  ALA B CB    1 
ATOM   3079 N N     . ALA D 3 41  ? -20.271 124.620 12.171  1.00 130.35 ? 41  ALA B N     1 
ATOM   3080 C CA    . ALA D 3 41  ? -20.866 123.865 11.067  1.00 130.37 ? 41  ALA B CA    1 
ATOM   3081 C C     . ALA D 3 41  ? -20.478 122.383 11.105  1.00 130.70 ? 41  ALA B C     1 
ATOM   3082 O O     . ALA D 3 41  ? -21.313 121.500 10.848  1.00 130.48 ? 41  ALA B O     1 
ATOM   3083 C CB    . ALA D 3 41  ? -20.436 124.483 9.732   1.00 129.63 ? 41  ALA B CB    1 
ATOM   3084 N N     . MET D 3 42  ? -19.209 122.120 11.417  1.00 131.17 ? 42  MET B N     1 
ATOM   3085 C CA    . MET D 3 42  ? -18.693 120.754 11.498  1.00 131.71 ? 42  MET B CA    1 
ATOM   3086 C C     . MET D 3 42  ? -19.073 120.105 12.847  1.00 132.16 ? 42  MET B C     1 
ATOM   3087 O O     . MET D 3 42  ? -19.113 118.876 12.964  1.00 132.36 ? 42  MET B O     1 
ATOM   3088 C CB    . MET D 3 42  ? -17.163 120.768 11.338  1.00 131.25 ? 42  MET B CB    1 
ATOM   3089 N N     . ALA D 3 43  ? -19.370 120.939 13.849  1.00 132.86 ? 43  ALA B N     1 
ATOM   3090 C CA    . ALA D 3 43  ? -19.730 120.458 15.187  1.00 133.44 ? 43  ALA B CA    1 
ATOM   3091 C C     . ALA D 3 43  ? -21.177 119.906 15.168  1.00 133.90 ? 43  ALA B C     1 
ATOM   3092 O O     . ALA D 3 43  ? -21.437 118.850 15.748  1.00 133.76 ? 43  ALA B O     1 
ATOM   3093 C CB    . ALA D 3 43  ? -19.617 121.594 16.195  1.00 133.21 ? 43  ALA B CB    1 
ATOM   3094 N N     . GLU D 3 44  ? -22.083 120.637 14.506  1.00 134.56 ? 44  GLU B N     1 
ATOM   3095 C CA    . GLU D 3 44  ? -23.473 120.263 14.405  1.00 135.00 ? 44  GLU B CA    1 
ATOM   3096 C C     . GLU D 3 44  ? -23.609 119.050 13.444  1.00 135.41 ? 44  GLU B C     1 
ATOM   3097 O O     . GLU D 3 44  ? -24.615 118.291 13.494  1.00 135.64 ? 44  GLU B O     1 
ATOM   3098 C CB    . GLU D 3 44  ? -24.307 121.437 13.873  1.00 134.82 ? 44  GLU B CB    1 
ATOM   3099 N N     . LEU D 3 45  ? -22.592 118.879 12.584  1.00 135.76 ? 45  LEU B N     1 
ATOM   3100 C CA    . LEU D 3 45  ? -22.639 117.782 11.639  1.00 136.18 ? 45  LEU B CA    1 
ATOM   3101 C C     . LEU D 3 45  ? -21.947 116.433 11.959  1.00 136.64 ? 45  LEU B C     1 
ATOM   3102 O O     . LEU D 3 45  ? -22.497 115.217 11.686  1.00 137.08 ? 45  LEU B O     1 
ATOM   3103 C CB    . LEU D 3 45  ? -22.260 118.210 10.306  1.00 135.95 ? 45  LEU B CB    1 
ATOM   3104 N N     . ASN D 3 46  ? -20.793 116.563 12.654  1.00 136.72 ? 46  ASN B N     1 
ATOM   3105 C CA    . ASN D 3 46  ? -20.146 115.280 13.159  1.00 136.27 ? 46  ASN B CA    1 
ATOM   3106 C C     . ASN D 3 46  ? -19.104 114.845 12.132  1.00 135.87 ? 46  ASN B C     1 
ATOM   3107 O O     . ASN D 3 46  ? -19.264 113.783 11.374  1.00 135.94 ? 46  ASN B O     1 
ATOM   3108 C CB    . ASN D 3 46  ? -21.179 114.087 13.289  1.00 136.15 ? 46  ASN B CB    1 
ATOM   3109 N N     . TYR D 3 47  ? -18.073 115.680 12.064  1.00 134.89 ? 47  TYR B N     1 
ATOM   3110 C CA    . TYR D 3 47  ? -17.017 115.455 11.114  1.00 133.43 ? 47  TYR B CA    1 
ATOM   3111 C C     . TYR D 3 47  ? -15.813 114.676 11.769  1.00 132.23 ? 47  TYR B C     1 
ATOM   3112 O O     . TYR D 3 47  ? -15.222 115.095 12.817  1.00 131.95 ? 47  TYR B O     1 
ATOM   3113 C CB    . TYR D 3 47  ? -16.488 116.787 10.567  1.00 133.24 ? 47  TYR B CB    1 
ATOM   3114 N N     . ILE D 3 48  ? -15.524 113.500 11.209  1.00 130.25 ? 48  ILE B N     1 
ATOM   3115 C CA    . ILE D 3 48  ? -14.446 112.662 11.660  1.00 127.84 ? 48  ILE B CA    1 
ATOM   3116 C C     . ILE D 3 48  ? -13.552 112.414 10.439  1.00 126.67 ? 48  ILE B C     1 
ATOM   3117 O O     . ILE D 3 48  ? -13.851 111.566 9.585   1.00 126.49 ? 48  ILE B O     1 
ATOM   3118 C CB    . ILE D 3 48  ? -14.983 111.323 12.183  1.00 127.56 ? 48  ILE B CB    1 
ATOM   3119 N N     . PRO D 3 49  ? -12.430 113.151 10.344  1.00 124.80 ? 49  PRO B N     1 
ATOM   3120 C CA    . PRO D 3 49  ? -11.442 113.063 9.253   1.00 122.67 ? 49  PRO B CA    1 
ATOM   3121 C C     . PRO D 3 49  ? -11.100 111.628 8.816   1.00 121.00 ? 49  PRO B C     1 
ATOM   3122 O O     . PRO D 3 49  ? -10.560 110.853 9.605   1.00 121.01 ? 49  PRO B O     1 
ATOM   3123 C CB    . PRO D 3 49  ? -10.216 113.799 9.815   1.00 122.49 ? 49  PRO B CB    1 
ATOM   3124 N N     . ASN D 3 50  ? -11.414 111.288 7.562   1.00 118.72 ? 50  ASN B N     1 
ATOM   3125 C CA    . ASN D 3 50  ? -11.128 109.952 7.035   1.00 116.53 ? 50  ASN B CA    1 
ATOM   3126 C C     . ASN D 3 50  ? -9.614  109.721 6.942   1.00 115.09 ? 50  ASN B C     1 
ATOM   3127 O O     . ASN D 3 50  ? -8.996  109.956 5.899   1.00 114.78 ? 50  ASN B O     1 
ATOM   3128 C CB    . ASN D 3 50  ? -11.773 109.752 5.655   1.00 115.83 ? 50  ASN B CB    1 
ATOM   3129 N N     . ARG D 3 51  ? -9.034  109.267 8.054   1.00 113.20 ? 51  ARG B N     1 
ATOM   3130 C CA    . ARG D 3 51  ? -7.607  108.985 8.165   1.00 110.81 ? 51  ARG B CA    1 
ATOM   3131 C C     . ARG D 3 51  ? -7.084  108.155 6.986   1.00 109.60 ? 51  ARG B C     1 
ATOM   3132 O O     . ARG D 3 51  ? -5.895  108.223 6.664   1.00 109.39 ? 51  ARG B O     1 
ATOM   3133 C CB    . ARG D 3 51  ? -7.329  108.252 9.484   1.00 110.30 ? 51  ARG B CB    1 
ATOM   3134 N N     . VAL D 3 52  ? -7.966  107.374 6.352   1.00 108.13 ? 52  VAL B N     1 
ATOM   3135 C CA    . VAL D 3 52  ? -7.587  106.540 5.206   1.00 106.85 ? 52  VAL B CA    1 
ATOM   3136 C C     . VAL D 3 52  ? -7.090  107.440 4.091   1.00 106.40 ? 52  VAL B C     1 
ATOM   3137 O O     . VAL D 3 52  ? -6.120  107.121 3.397   1.00 106.37 ? 52  VAL B O     1 
ATOM   3138 C CB    . VAL D 3 52  ? -8.783  105.727 4.668   1.00 105.56 ? 52  VAL B CB    1 
ATOM   3139 N N     . ALA D 3 53  ? -7.770  108.573 3.939   1.00 106.24 ? 53  ALA B N     1 
ATOM   3140 C CA    . ALA D 3 53  ? -7.440  109.565 2.924   1.00 106.44 ? 53  ALA B CA    1 
ATOM   3141 C C     . ALA D 3 53  ? -6.295  110.480 3.364   1.00 106.61 ? 53  ALA B C     1 
ATOM   3142 O O     . ALA D 3 53  ? -5.479  110.907 2.537   1.00 106.92 ? 53  ALA B O     1 
ATOM   3143 C CB    . ALA D 3 53  ? -8.671  110.395 2.603   1.00 106.32 ? 53  ALA B CB    1 
ATOM   3144 N N     . GLN D 3 54  ? -6.245  110.786 4.660   1.00 106.60 ? 54  GLN B N     1 
ATOM   3145 C CA    . GLN D 3 54  ? -5.201  111.649 5.211   1.00 106.94 ? 54  GLN B CA    1 
ATOM   3146 C C     . GLN D 3 54  ? -3.811  111.054 4.959   1.00 107.50 ? 54  GLN B C     1 
ATOM   3147 O O     . GLN D 3 54  ? -2.870  111.765 4.588   1.00 107.34 ? 54  GLN B O     1 
ATOM   3148 C CB    . GLN D 3 54  ? -5.425  111.844 6.715   1.00 105.90 ? 54  GLN B CB    1 
ATOM   3149 N N     . GLN D 3 55  ? -3.701  109.742 5.160   1.00 108.65 ? 55  GLN B N     1 
ATOM   3150 C CA    . GLN D 3 55  ? -2.451  109.002 4.961   1.00 109.63 ? 55  GLN B CA    1 
ATOM   3151 C C     . GLN D 3 55  ? -2.026  108.985 3.481   1.00 110.19 ? 55  GLN B C     1 
ATOM   3152 O O     . GLN D 3 55  ? -0.885  109.345 3.142   1.00 109.75 ? 55  GLN B O     1 
ATOM   3153 C CB    . GLN D 3 55  ? -2.617  107.559 5.466   1.00 109.74 ? 55  GLN B CB    1 
ATOM   3154 N N     . LEU D 3 56  ? -2.952  108.559 2.615   1.00 110.78 ? 56  LEU B N     1 
ATOM   3155 C CA    . LEU D 3 56  ? -2.715  108.482 1.170   1.00 111.16 ? 56  LEU B CA    1 
ATOM   3156 C C     . LEU D 3 56  ? -2.363  109.855 0.607   1.00 111.83 ? 56  LEU B C     1 
ATOM   3157 O O     . LEU D 3 56  ? -1.562  109.958 -0.324  1.00 112.29 ? 56  LEU B O     1 
ATOM   3158 C CB    . LEU D 3 56  ? -3.954  107.938 0.446   1.00 110.24 ? 56  LEU B CB    1 
ATOM   3159 N N     . ALA D 3 57  ? -2.970  110.899 1.175   1.00 112.71 ? 57  ALA B N     1 
ATOM   3160 C CA    . ALA D 3 57  ? -2.727  112.279 0.757   1.00 113.69 ? 57  ALA B CA    1 
ATOM   3161 C C     . ALA D 3 57  ? -1.327  112.769 1.172   1.00 114.58 ? 57  ALA B C     1 
ATOM   3162 O O     . ALA D 3 57  ? -0.887  113.849 0.747   1.00 114.53 ? 57  ALA B O     1 
ATOM   3163 C CB    . ALA D 3 57  ? -3.802  113.200 1.339   1.00 113.03 ? 57  ALA B CB    1 
ATOM   3164 N N     . GLY D 3 58  ? -0.637  111.987 2.007   1.00 115.53 ? 58  GLY B N     1 
ATOM   3165 C CA    . GLY D 3 58  ? 0.707   112.360 2.420   1.00 116.49 ? 58  GLY B CA    1 
ATOM   3166 C C     . GLY D 3 58  ? 0.925   112.788 3.862   1.00 116.97 ? 58  GLY B C     1 
ATOM   3167 O O     . GLY D 3 58  ? 2.049   113.166 4.225   1.00 117.72 ? 58  GLY B O     1 
ATOM   3168 N N     . LYS D 3 59  ? -0.128  112.749 4.683   1.00 116.68 ? 59  LYS B N     1 
ATOM   3169 C CA    . LYS D 3 59  ? -0.009  113.127 6.097   1.00 116.10 ? 59  LYS B CA    1 
ATOM   3170 C C     . LYS D 3 59  ? 0.948   112.170 6.831   1.00 115.46 ? 59  LYS B C     1 
ATOM   3171 O O     . LYS D 3 59  ? 0.639   110.979 7.042   1.00 115.32 ? 59  LYS B O     1 
ATOM   3172 C CB    . LYS D 3 59  ? -1.385  113.121 6.775   1.00 115.86 ? 59  LYS B CB    1 
ATOM   3173 N N     . GLN D 3 60  ? 2.119   112.698 7.198   1.00 113.58 ? 60  GLN B N     1 
ATOM   3174 C CA    . GLN D 3 60  ? 3.148   111.921 7.897   1.00 110.64 ? 60  GLN B CA    1 
ATOM   3175 C C     . GLN D 3 60  ? 2.713   111.582 9.339   1.00 108.58 ? 60  GLN B C     1 
ATOM   3176 O O     . GLN D 3 60  ? 2.878   112.396 10.262  1.00 109.48 ? 60  GLN B O     1 
ATOM   3177 C CB    . GLN D 3 60  ? 4.465   112.713 7.920   1.00 110.89 ? 60  GLN B CB    1 
ATOM   3178 N N     . SER D 3 61  ? 2.154   110.385 9.524   1.00 105.15 ? 61  SER B N     1 
ATOM   3179 C CA    . SER D 3 61  ? 1.701   109.925 10.840  1.00 100.58 ? 61  SER B CA    1 
ATOM   3180 C C     . SER D 3 61  ? 2.510   108.668 11.228  1.00 97.53  ? 61  SER B C     1 
ATOM   3181 O O     . SER D 3 61  ? 2.589   107.716 10.472  1.00 97.82  ? 61  SER B O     1 
ATOM   3182 C CB    . SER D 3 61  ? 0.217   109.560 10.794  1.00 99.90  ? 61  SER B CB    1 
ATOM   3183 N N     . LEU D 3 62  ? 3.087   108.613 12.419  1.00 92.54  ? 62  LEU B N     1 
ATOM   3184 C CA    . LEU D 3 62  ? 3.876   107.422 12.790  1.00 86.09  ? 62  LEU B CA    1 
ATOM   3185 C C     . LEU D 3 62  ? 3.003   106.258 13.279  1.00 80.72  ? 62  LEU B C     1 
ATOM   3186 O O     . LEU D 3 62  ? 2.414   106.298 14.345  1.00 79.61  ? 62  LEU B O     1 
ATOM   3187 C CB    . LEU D 3 62  ? 4.957   107.811 13.811  1.00 87.68  ? 62  LEU B CB    1 
ATOM   3188 C CG    . LEU D 3 62  ? 4.604   108.043 15.276  1.00 87.87  ? 62  LEU B CG    1 
ATOM   3189 C CD1   . LEU D 3 62  ? 5.904   108.440 15.971  1.00 87.74  ? 62  LEU B CD1   1 
ATOM   3190 C CD2   . LEU D 3 62  ? 3.543   109.117 15.462  1.00 89.34  ? 62  LEU B CD2   1 
ATOM   3191 N N     . LEU D 3 63  ? 2.956   105.214 12.452  1.00 74.56  ? 63  LEU B N     1 
ATOM   3192 C CA    . LEU D 3 63  ? 2.132   104.015 12.661  1.00 68.73  ? 63  LEU B CA    1 
ATOM   3193 C C     . LEU D 3 63  ? 2.913   102.684 12.765  1.00 65.58  ? 63  LEU B C     1 
ATOM   3194 O O     . LEU D 3 63  ? 3.455   102.176 11.767  1.00 65.63  ? 63  LEU B O     1 
ATOM   3195 C CB    . LEU D 3 63  ? 1.096   103.944 11.520  1.00 67.24  ? 63  LEU B CB    1 
ATOM   3196 C CG    . LEU D 3 63  ? -0.015  102.887 11.415  1.00 65.97  ? 63  LEU B CG    1 
ATOM   3197 C CD1   . LEU D 3 63  ? 0.352   101.840 10.374  1.00 65.60  ? 63  LEU B CD1   1 
ATOM   3198 C CD2   . LEU D 3 63  ? -0.272  102.264 12.771  1.00 65.08  ? 63  LEU B CD2   1 
ATOM   3199 N N     . ILE D 3 64  ? 2.950   102.137 13.984  1.00 60.61  ? 64  ILE B N     1 
ATOM   3200 C CA    . ILE D 3 64  ? 3.652   100.896 14.310  1.00 55.79  ? 64  ILE B CA    1 
ATOM   3201 C C     . ILE D 3 64  ? 2.863   99.617  14.024  1.00 54.28  ? 64  ILE B C     1 
ATOM   3202 O O     . ILE D 3 64  ? 1.768   99.423  14.554  1.00 53.75  ? 64  ILE B O     1 
ATOM   3203 C CB    . ILE D 3 64  ? 4.002   100.864 15.792  1.00 53.88  ? 64  ILE B CB    1 
ATOM   3204 C CG1   . ILE D 3 64  ? 4.813   102.094 16.173  1.00 52.58  ? 64  ILE B CG1   1 
ATOM   3205 C CG2   . ILE D 3 64  ? 4.754   99.608  16.104  1.00 53.17  ? 64  ILE B CG2   1 
ATOM   3206 C CD1   . ILE D 3 64  ? 5.188   102.126 17.633  1.00 51.75  ? 64  ILE B CD1   1 
ATOM   3207 N N     . GLY D 3 65  ? 3.437   98.737  13.206  1.00 52.71  ? 65  GLY B N     1 
ATOM   3208 C CA    . GLY D 3 65  ? 2.787   97.477  12.882  1.00 50.41  ? 65  GLY B CA    1 
ATOM   3209 C C     . GLY D 3 65  ? 3.349   96.373  13.761  1.00 48.72  ? 65  GLY B C     1 
ATOM   3210 O O     . GLY D 3 65  ? 4.542   96.376  14.064  1.00 48.90  ? 65  GLY B O     1 
ATOM   3211 N N     . VAL D 3 66  ? 2.509   95.424  14.168  1.00 46.93  ? 66  VAL B N     1 
ATOM   3212 C CA    . VAL D 3 66  ? 2.955   94.337  15.039  1.00 44.50  ? 66  VAL B CA    1 
ATOM   3213 C C     . VAL D 3 66  ? 2.472   92.946  14.656  1.00 43.64  ? 66  VAL B C     1 
ATOM   3214 O O     . VAL D 3 66  ? 1.279   92.675  14.647  1.00 43.64  ? 66  VAL B O     1 
ATOM   3215 C CB    . VAL D 3 66  ? 2.514   94.568  16.505  1.00 43.64  ? 66  VAL B CB    1 
ATOM   3216 C CG1   . VAL D 3 66  ? 2.863   93.361  17.353  1.00 42.12  ? 66  VAL B CG1   1 
ATOM   3217 C CG2   . VAL D 3 66  ? 3.179   95.796  17.062  1.00 42.81  ? 66  VAL B CG2   1 
ATOM   3218 N N     . ALA D 3 67  ? 3.410   92.062  14.347  1.00 42.72  ? 67  ALA B N     1 
ATOM   3219 C CA    . ALA D 3 67  ? 3.077   90.685  14.024  1.00 41.71  ? 67  ALA B CA    1 
ATOM   3220 C C     . ALA D 3 67  ? 3.373   89.972  15.325  1.00 40.84  ? 67  ALA B C     1 
ATOM   3221 O O     . ALA D 3 67  ? 4.468   90.098  15.861  1.00 41.59  ? 67  ALA B O     1 
ATOM   3222 C CB    . ALA D 3 67  ? 3.973   90.158  12.927  1.00 41.97  ? 67  ALA B CB    1 
ATOM   3223 N N     . THR D 3 68  ? 2.408   89.234  15.845  1.00 39.18  ? 68  THR B N     1 
ATOM   3224 C CA    . THR D 3 68  ? 2.624   88.551  17.102  1.00 38.04  ? 68  THR B CA    1 
ATOM   3225 C C     . THR D 3 68  ? 1.965   87.185  17.105  1.00 36.99  ? 68  THR B C     1 
ATOM   3226 O O     . THR D 3 68  ? 1.078   86.918  16.300  1.00 34.85  ? 68  THR B O     1 
ATOM   3227 C CB    . THR D 3 68  ? 2.082   89.412  18.267  1.00 38.32  ? 68  THR B CB    1 
ATOM   3228 O OG1   . THR D 3 68  ? 2.237   88.724  19.515  1.00 38.75  ? 68  THR B OG1   1 
ATOM   3229 C CG2   . THR D 3 68  ? 0.632   89.719  18.047  1.00 38.77  ? 68  THR B CG2   1 
ATOM   3230 N N     . SER D 3 69  ? 2.441   86.321  17.999  1.00 37.51  ? 69  SER B N     1 
ATOM   3231 C CA    . SER D 3 69  ? 1.922   84.964  18.167  1.00 38.15  ? 69  SER B CA    1 
ATOM   3232 C C     . SER D 3 69  ? 0.549   85.149  18.781  1.00 38.83  ? 69  SER B C     1 
ATOM   3233 O O     . SER D 3 69  ? 0.242   86.253  19.243  1.00 39.87  ? 69  SER B O     1 
ATOM   3234 C CB    . SER D 3 69  ? 2.815   84.183  19.127  1.00 38.38  ? 69  SER B CB    1 
ATOM   3235 O OG    . SER D 3 69  ? 4.187   84.426  18.859  1.00 38.47  ? 69  SER B OG    1 
ATOM   3236 N N     . SER D 3 70  ? -0.270  84.097  18.824  1.00 38.38  ? 70  SER B N     1 
ATOM   3237 C CA    . SER D 3 70  ? -1.622  84.258  19.375  1.00 38.06  ? 70  SER B CA    1 
ATOM   3238 C C     . SER D 3 70  ? -1.680  85.025  20.690  1.00 37.53  ? 70  SER B C     1 
ATOM   3239 O O     . SER D 3 70  ? -0.870  84.801  21.591  1.00 37.11  ? 70  SER B O     1 
ATOM   3240 C CB    . SER D 3 70  ? -2.324  82.921  19.569  1.00 37.70  ? 70  SER B CB    1 
ATOM   3241 O OG    . SER D 3 70  ? -3.607  83.145  20.129  1.00 37.09  ? 70  SER B OG    1 
ATOM   3242 N N     . LEU D 3 71  ? -2.652  85.932  20.779  1.00 36.86  ? 71  LEU B N     1 
ATOM   3243 C CA    . LEU D 3 71  ? -2.841  86.761  21.957  1.00 36.08  ? 71  LEU B CA    1 
ATOM   3244 C C     . LEU D 3 71  ? -3.399  85.922  23.100  1.00 36.15  ? 71  LEU B C     1 
ATOM   3245 O O     . LEU D 3 71  ? -3.444  86.371  24.258  1.00 36.14  ? 71  LEU B O     1 
ATOM   3246 C CB    . LEU D 3 71  ? -3.777  87.929  21.618  1.00 36.35  ? 71  LEU B CB    1 
ATOM   3247 C CG    . LEU D 3 71  ? -3.155  89.038  20.755  1.00 35.27  ? 71  LEU B CG    1 
ATOM   3248 C CD1   . LEU D 3 71  ? -4.237  89.969  20.221  1.00 36.42  ? 71  LEU B CD1   1 
ATOM   3249 C CD2   . LEU D 3 71  ? -2.136  89.811  21.584  1.00 34.87  ? 71  LEU B CD2   1 
ATOM   3250 N N     . ALA D 3 72  ? -3.801  84.698  22.758  1.00 34.96  ? 72  ALA B N     1 
ATOM   3251 C CA    . ALA D 3 72  ? -4.356  83.751  23.718  1.00 34.94  ? 72  ALA B CA    1 
ATOM   3252 C C     . ALA D 3 72  ? -3.291  83.304  24.697  1.00 35.06  ? 72  ALA B C     1 
ATOM   3253 O O     . ALA D 3 72  ? -3.579  82.711  25.737  1.00 34.59  ? 72  ALA B O     1 
ATOM   3254 C CB    . ALA D 3 72  ? -4.892  82.558  22.995  1.00 34.31  ? 72  ALA B CB    1 
ATOM   3255 N N     . LEU D 3 73  ? -2.049  83.591  24.340  1.00 36.01  ? 73  LEU B N     1 
ATOM   3256 C CA    . LEU D 3 73  ? -0.907  83.225  25.159  1.00 36.59  ? 73  LEU B CA    1 
ATOM   3257 C C     . LEU D 3 73  ? -0.545  84.373  26.093  1.00 36.27  ? 73  LEU B C     1 
ATOM   3258 O O     . LEU D 3 73  ? -0.574  85.540  25.700  1.00 36.12  ? 73  LEU B O     1 
ATOM   3259 C CB    . LEU D 3 73  ? 0.270   82.883  24.245  1.00 36.32  ? 73  LEU B CB    1 
ATOM   3260 C CG    . LEU D 3 73  ? 0.046   81.692  23.315  1.00 35.65  ? 73  LEU B CG    1 
ATOM   3261 C CD1   . LEU D 3 73  ? 1.008   81.746  22.164  1.00 36.48  ? 73  LEU B CD1   1 
ATOM   3262 C CD2   . LEU D 3 73  ? 0.209   80.410  24.093  1.00 33.82  ? 73  LEU B CD2   1 
ATOM   3263 N N     . HIS D 3 74  ? -0.196  84.035  27.328  1.00 36.87  ? 74  HIS B N     1 
ATOM   3264 C CA    . HIS D 3 74  ? 0.150   85.040  28.318  1.00 37.53  ? 74  HIS B CA    1 
ATOM   3265 C C     . HIS D 3 74  ? 1.092   86.146  27.875  1.00 37.25  ? 74  HIS B C     1 
ATOM   3266 O O     . HIS D 3 74  ? 0.667   87.271  27.664  1.00 38.54  ? 74  HIS B O     1 
ATOM   3267 C CB    . HIS D 3 74  ? 0.746   84.396  29.553  1.00 37.74  ? 74  HIS B CB    1 
ATOM   3268 C CG    . HIS D 3 74  ? 0.847   85.334  30.708  1.00 37.48  ? 74  HIS B CG    1 
ATOM   3269 N ND1   . HIS D 3 74  ? -0.263  85.845  31.341  1.00 37.24  ? 74  HIS B ND1   1 
ATOM   3270 C CD2   . HIS D 3 74  ? 1.918   85.893  31.317  1.00 38.51  ? 74  HIS B CD2   1 
ATOM   3271 C CE1   . HIS D 3 74  ? 0.119   86.679  32.291  1.00 37.55  ? 74  HIS B CE1   1 
ATOM   3272 N NE2   . HIS D 3 74  ? 1.438   86.726  32.297  1.00 37.91  ? 74  HIS B NE2   1 
ATOM   3273 N N     . ALA D 3 75  ? 2.373   85.836  27.751  1.00 36.96  ? 75  ALA B N     1 
ATOM   3274 C CA    . ALA D 3 75  ? 3.358   86.836  27.365  1.00 37.71  ? 75  ALA B CA    1 
ATOM   3275 C C     . ALA D 3 75  ? 3.036   87.658  26.120  1.00 37.28  ? 75  ALA B C     1 
ATOM   3276 O O     . ALA D 3 75  ? 3.220   88.875  26.110  1.00 37.99  ? 75  ALA B O     1 
ATOM   3277 C CB    . ALA D 3 75  ? 4.688   86.184  27.199  1.00 38.63  ? 75  ALA B CB    1 
ATOM   3278 N N     . PRO D 3 76  ? 2.578   87.014  25.042  1.00 36.37  ? 76  PRO B N     1 
ATOM   3279 C CA    . PRO D 3 76  ? 2.282   87.846  23.876  1.00 37.29  ? 76  PRO B CA    1 
ATOM   3280 C C     . PRO D 3 76  ? 1.354   89.007  24.256  1.00 37.29  ? 76  PRO B C     1 
ATOM   3281 O O     . PRO D 3 76  ? 1.685   90.180  24.032  1.00 37.23  ? 76  PRO B O     1 
ATOM   3282 C CB    . PRO D 3 76  ? 1.620   86.866  22.919  1.00 36.12  ? 76  PRO B CB    1 
ATOM   3283 C CG    . PRO D 3 76  ? 2.293   85.596  23.252  1.00 35.95  ? 76  PRO B CG    1 
ATOM   3284 C CD    . PRO D 3 76  ? 2.322   85.599  24.755  1.00 35.86  ? 76  PRO B CD    1 
ATOM   3285 N N     . SER D 3 77  ? 0.206   88.664  24.850  1.00 37.27  ? 77  SER B N     1 
ATOM   3286 C CA    . SER D 3 77  ? -0.793  89.649  25.262  1.00 36.98  ? 77  SER B CA    1 
ATOM   3287 C C     . SER D 3 77  ? -0.169  90.746  26.121  1.00 36.02  ? 77  SER B C     1 
ATOM   3288 O O     . SER D 3 77  ? -0.258  91.920  25.784  1.00 35.91  ? 77  SER B O     1 
ATOM   3289 C CB    . SER D 3 77  ? -1.958  88.961  26.002  1.00 37.34  ? 77  SER B CB    1 
ATOM   3290 O OG    . SER D 3 77  ? -1.621  88.618  27.332  1.00 38.75  ? 77  SER B OG    1 
ATOM   3291 N N     . GLN D 3 78  ? 0.471   90.367  27.219  1.00 35.23  ? 78  GLN B N     1 
ATOM   3292 C CA    . GLN D 3 78  ? 1.114   91.340  28.086  1.00 34.93  ? 78  GLN B CA    1 
ATOM   3293 C C     . GLN D 3 78  ? 1.932   92.308  27.261  1.00 34.49  ? 78  GLN B C     1 
ATOM   3294 O O     . GLN D 3 78  ? 1.884   93.515  27.474  1.00 34.41  ? 78  GLN B O     1 
ATOM   3295 C CB    . GLN D 3 78  ? 2.043   90.642  29.061  1.00 35.64  ? 78  GLN B CB    1 
ATOM   3296 C CG    . GLN D 3 78  ? 1.341   89.665  29.933  1.00 36.62  ? 78  GLN B CG    1 
ATOM   3297 C CD    . GLN D 3 78  ? 0.227   90.325  30.661  1.00 37.16  ? 78  GLN B CD    1 
ATOM   3298 O OE1   . GLN D 3 78  ? 0.452   91.182  31.518  1.00 37.42  ? 78  GLN B OE1   1 
ATOM   3299 N NE2   . GLN D 3 78  ? -0.997  89.954  30.315  1.00 37.05  ? 78  GLN B NE2   1 
ATOM   3300 N N     . ILE D 3 79  ? 2.692   91.769  26.320  1.00 33.76  ? 79  ILE B N     1 
ATOM   3301 C CA    . ILE D 3 79  ? 3.531   92.593  25.474  1.00 34.00  ? 79  ILE B CA    1 
ATOM   3302 C C     . ILE D 3 79  ? 2.740   93.512  24.565  1.00 35.40  ? 79  ILE B C     1 
ATOM   3303 O O     . ILE D 3 79  ? 3.011   94.712  24.525  1.00 35.68  ? 79  ILE B O     1 
ATOM   3304 C CB    . ILE D 3 79  ? 4.470   91.736  24.629  1.00 33.72  ? 79  ILE B CB    1 
ATOM   3305 C CG1   . ILE D 3 79  ? 5.510   91.099  25.542  1.00 34.60  ? 79  ILE B CG1   1 
ATOM   3306 C CG2   . ILE D 3 79  ? 5.173   92.581  23.590  1.00 33.12  ? 79  ILE B CG2   1 
ATOM   3307 C CD1   . ILE D 3 79  ? 6.272   89.986  24.891  1.00 34.59  ? 79  ILE B CD1   1 
ATOM   3308 N N     . VAL D 3 80  ? 1.772   92.974  23.826  1.00 35.89  ? 80  VAL B N     1 
ATOM   3309 C CA    . VAL D 3 80  ? 0.980   93.833  22.945  1.00 35.68  ? 80  VAL B CA    1 
ATOM   3310 C C     . VAL D 3 80  ? 0.432   94.959  23.783  1.00 36.29  ? 80  VAL B C     1 
ATOM   3311 O O     . VAL D 3 80  ? 0.435   96.113  23.375  1.00 35.46  ? 80  VAL B O     1 
ATOM   3312 C CB    . VAL D 3 80  ? -0.193  93.077  22.295  1.00 35.75  ? 80  VAL B CB    1 
ATOM   3313 C CG1   . VAL D 3 80  ? -1.233  94.066  21.776  1.00 34.98  ? 80  VAL B CG1   1 
ATOM   3314 C CG2   . VAL D 3 80  ? 0.332   92.223  21.145  1.00 36.16  ? 80  VAL B CG2   1 
ATOM   3315 N N     . ALA D 3 81  ? -0.022  94.601  24.975  1.00 37.91  ? 81  ALA B N     1 
ATOM   3316 C CA    . ALA D 3 81  ? -0.572  95.563  25.916  1.00 40.10  ? 81  ALA B CA    1 
ATOM   3317 C C     . ALA D 3 81  ? 0.406   96.707  26.143  1.00 41.18  ? 81  ALA B C     1 
ATOM   3318 O O     . ALA D 3 81  ? 0.123   97.859  25.798  1.00 41.47  ? 81  ALA B O     1 
ATOM   3319 C CB    . ALA D 3 81  ? -0.884  94.879  27.241  1.00 40.77  ? 81  ALA B CB    1 
ATOM   3320 N N     . ALA D 3 82  ? 1.558   96.387  26.722  1.00 42.13  ? 82  ALA B N     1 
ATOM   3321 C CA    . ALA D 3 82  ? 2.564   97.401  26.986  1.00 44.52  ? 82  ALA B CA    1 
ATOM   3322 C C     . ALA D 3 82  ? 2.935   98.172  25.719  1.00 46.56  ? 82  ALA B C     1 
ATOM   3323 O O     . ALA D 3 82  ? 3.244   99.360  25.786  1.00 47.77  ? 82  ALA B O     1 
ATOM   3324 C CB    . ALA D 3 82  ? 3.805   96.771  27.606  1.00 44.13  ? 82  ALA B CB    1 
ATOM   3325 N N     . ILE D 3 83  ? 2.910   97.515  24.563  1.00 48.11  ? 83  ILE B N     1 
ATOM   3326 C CA    . ILE D 3 83  ? 3.235   98.222  23.331  1.00 49.94  ? 83  ILE B CA    1 
ATOM   3327 C C     . ILE D 3 83  ? 2.197   99.315  23.103  1.00 52.38  ? 83  ILE B C     1 
ATOM   3328 O O     . ILE D 3 83  ? 2.531   100.503 23.157  1.00 52.22  ? 83  ILE B O     1 
ATOM   3329 C CB    . ILE D 3 83  ? 3.262   97.287  22.107  1.00 49.63  ? 83  ILE B CB    1 
ATOM   3330 C CG1   . ILE D 3 83  ? 4.489   96.385  22.177  1.00 50.19  ? 83  ILE B CG1   1 
ATOM   3331 C CG2   . ILE D 3 83  ? 3.317   98.101  20.823  1.00 49.31  ? 83  ILE B CG2   1 
ATOM   3332 C CD1   . ILE D 3 83  ? 4.596   95.429  20.998  1.00 50.84  ? 83  ILE B CD1   1 
ATOM   3333 N N     . LYS D 3 84  ? 0.942   98.920  22.868  1.00 54.72  ? 84  LYS B N     1 
ATOM   3334 C CA    . LYS D 3 84  ? -0.130  99.896  22.636  1.00 56.57  ? 84  LYS B CA    1 
ATOM   3335 C C     . LYS D 3 84  ? -0.029  100.973 23.691  1.00 56.53  ? 84  LYS B C     1 
ATOM   3336 O O     . LYS D 3 84  ? 0.027   102.156 23.378  1.00 56.97  ? 84  LYS B O     1 
ATOM   3337 C CB    . LYS D 3 84  ? -1.530  99.256  22.701  1.00 58.23  ? 84  LYS B CB    1 
ATOM   3338 C CG    . LYS D 3 84  ? -1.795  98.200  21.628  1.00 61.11  ? 84  LYS B CG    1 
ATOM   3339 C CD    . LYS D 3 84  ? -3.280  97.807  21.535  1.00 63.01  ? 84  LYS B CD    1 
ATOM   3340 C CE    . LYS D 3 84  ? -3.991  98.549  20.395  1.00 64.09  ? 84  LYS B CE    1 
ATOM   3341 N NZ    . LYS D 3 84  ? -3.473  98.165  19.038  1.00 64.59  ? 84  LYS B NZ    1 
ATOM   3342 N N     . SER D 3 85  ? 0.004   100.558 24.946  1.00 56.86  ? 85  SER B N     1 
ATOM   3343 C CA    . SER D 3 85  ? 0.114   101.515 26.024  1.00 58.33  ? 85  SER B CA    1 
ATOM   3344 C C     . SER D 3 85  ? 1.136   102.592 25.679  1.00 59.02  ? 85  SER B C     1 
ATOM   3345 O O     . SER D 3 85  ? 0.789   103.747 25.435  1.00 59.36  ? 85  SER B O     1 
ATOM   3346 C CB    . SER D 3 85  ? 0.540   100.818 27.315  1.00 59.07  ? 85  SER B CB    1 
ATOM   3347 O OG    . SER D 3 85  ? 0.892   101.771 28.311  1.00 60.50  ? 85  SER B OG    1 
ATOM   3348 N N     . ARG D 3 86  ? 2.403   102.201 25.660  1.00 59.73  ? 86  ARG B N     1 
ATOM   3349 C CA    . ARG D 3 86  ? 3.482   103.127 25.369  1.00 60.50  ? 86  ARG B CA    1 
ATOM   3350 C C     . ARG D 3 86  ? 3.271   103.863 24.061  1.00 60.84  ? 86  ARG B C     1 
ATOM   3351 O O     . ARG D 3 86  ? 3.653   105.016 23.934  1.00 61.73  ? 86  ARG B O     1 
ATOM   3352 C CB    . ARG D 3 86  ? 4.816   102.384 25.351  1.00 60.26  ? 86  ARG B CB    1 
ATOM   3353 C CG    . ARG D 3 86  ? 5.925   103.114 24.625  1.00 59.60  ? 86  ARG B CG    1 
ATOM   3354 C CD    . ARG D 3 86  ? 6.198   104.491 25.207  1.00 58.30  ? 86  ARG B CD    1 
ATOM   3355 N NE    . ARG D 3 86  ? 6.947   104.452 26.457  1.00 57.30  ? 86  ARG B NE    1 
ATOM   3356 C CZ    . ARG D 3 86  ? 7.748   105.432 26.858  1.00 57.02  ? 86  ARG B CZ    1 
ATOM   3357 N NH1   . ARG D 3 86  ? 7.891   106.509 26.104  1.00 56.94  ? 86  ARG B NH1   1 
ATOM   3358 N NH2   . ARG D 3 86  ? 8.415   105.337 28.000  1.00 57.17  ? 86  ARG B NH2   1 
ATOM   3359 N N     . ALA D 3 87  ? 2.661   103.212 23.085  1.00 61.35  ? 87  ALA B N     1 
ATOM   3360 C CA    . ALA D 3 87  ? 2.426   103.884 21.818  1.00 62.50  ? 87  ALA B CA    1 
ATOM   3361 C C     . ALA D 3 87  ? 1.520   105.100 22.025  1.00 63.17  ? 87  ALA B C     1 
ATOM   3362 O O     . ALA D 3 87  ? 1.877   106.220 21.647  1.00 62.64  ? 87  ALA B O     1 
ATOM   3363 C CB    . ALA D 3 87  ? 1.797   102.923 20.827  1.00 63.13  ? 87  ALA B CB    1 
ATOM   3364 N N     . ASP D 3 88  ? 0.352   104.873 22.630  1.00 64.36  ? 88  ASP B N     1 
ATOM   3365 C CA    . ASP D 3 88  ? -0.614  105.948 22.895  1.00 65.13  ? 88  ASP B CA    1 
ATOM   3366 C C     . ASP D 3 88  ? 0.075   107.085 23.613  1.00 65.05  ? 88  ASP B C     1 
ATOM   3367 O O     . ASP D 3 88  ? -0.136  108.254 23.308  1.00 65.46  ? 88  ASP B O     1 
ATOM   3368 C CB    . ASP D 3 88  ? -1.772  105.482 23.794  1.00 66.51  ? 88  ASP B CB    1 
ATOM   3369 C CG    . ASP D 3 88  ? -2.717  104.536 23.099  1.00 68.14  ? 88  ASP B CG    1 
ATOM   3370 O OD1   . ASP D 3 88  ? -3.037  104.774 21.913  1.00 69.27  ? 88  ASP B OD1   1 
ATOM   3371 O OD2   . ASP D 3 88  ? -3.151  103.561 23.753  1.00 69.41  ? 88  ASP B OD2   1 
ATOM   3372 N N     . GLN D 3 89  ? 0.890   106.718 24.589  1.00 64.39  ? 89  GLN B N     1 
ATOM   3373 C CA    . GLN D 3 89  ? 1.613   107.675 25.394  1.00 63.91  ? 89  GLN B CA    1 
ATOM   3374 C C     . GLN D 3 89  ? 2.570   108.522 24.558  1.00 63.26  ? 89  GLN B C     1 
ATOM   3375 O O     . GLN D 3 89  ? 2.967   109.607 24.971  1.00 63.17  ? 89  GLN B O     1 
ATOM   3376 C CB    . GLN D 3 89  ? 2.370   106.921 26.473  1.00 64.48  ? 89  GLN B CB    1 
ATOM   3377 C CG    . GLN D 3 89  ? 3.034   107.791 27.495  1.00 66.61  ? 89  GLN B CG    1 
ATOM   3378 C CD    . GLN D 3 89  ? 3.714   106.962 28.566  1.00 67.60  ? 89  GLN B CD    1 
ATOM   3379 O OE1   . GLN D 3 89  ? 4.326   107.498 29.497  1.00 68.04  ? 89  GLN B OE1   1 
ATOM   3380 N NE2   . GLN D 3 89  ? 3.609   105.640 28.440  1.00 67.00  ? 89  GLN B NE2   1 
ATOM   3381 N N     . LEU D 3 90  ? 2.939   108.028 23.382  1.00 62.52  ? 90  LEU B N     1 
ATOM   3382 C CA    . LEU D 3 90  ? 3.843   108.766 22.516  1.00 62.31  ? 90  LEU B CA    1 
ATOM   3383 C C     . LEU D 3 90  ? 3.083   109.293 21.311  1.00 61.96  ? 90  LEU B C     1 
ATOM   3384 O O     . LEU D 3 90  ? 3.668   109.792 20.355  1.00 61.69  ? 90  LEU B O     1 
ATOM   3385 C CB    . LEU D 3 90  ? 5.007   107.876 22.060  1.00 62.79  ? 90  LEU B CB    1 
ATOM   3386 C CG    . LEU D 3 90  ? 6.067   107.422 23.082  1.00 63.07  ? 90  LEU B CG    1 
ATOM   3387 C CD1   . LEU D 3 90  ? 7.126   106.563 22.383  1.00 62.40  ? 90  LEU B CD1   1 
ATOM   3388 C CD2   . LEU D 3 90  ? 6.721   108.631 23.737  1.00 61.91  ? 90  LEU B CD2   1 
ATOM   3389 N N     . GLY D 3 91  ? 1.766   109.178 21.359  1.00 62.26  ? 91  GLY B N     1 
ATOM   3390 C CA    . GLY D 3 91  ? 0.960   109.672 20.262  1.00 63.25  ? 91  GLY B CA    1 
ATOM   3391 C C     . GLY D 3 91  ? 1.168   108.881 18.997  1.00 63.55  ? 91  GLY B C     1 
ATOM   3392 O O     . GLY D 3 91  ? 0.954   109.375 17.893  1.00 63.50  ? 91  GLY B O     1 
ATOM   3393 N N     . ALA D 3 92  ? 1.589   107.637 19.168  1.00 64.43  ? 92  ALA B N     1 
ATOM   3394 C CA    . ALA D 3 92  ? 1.822   106.755 18.037  1.00 65.12  ? 92  ALA B CA    1 
ATOM   3395 C C     . ALA D 3 92  ? 0.665   105.761 17.890  1.00 65.03  ? 92  ALA B C     1 
ATOM   3396 O O     . ALA D 3 92  ? 0.117   105.266 18.878  1.00 64.62  ? 92  ALA B O     1 
ATOM   3397 C CB    . ALA D 3 92  ? 3.149   106.011 18.224  1.00 66.18  ? 92  ALA B CB    1 
ATOM   3398 N N     . SER D 3 93  ? 0.286   105.477 16.654  1.00 64.78  ? 93  SER B N     1 
ATOM   3399 C CA    . SER D 3 93  ? -0.796  104.538 16.418  1.00 65.25  ? 93  SER B CA    1 
ATOM   3400 C C     . SER D 3 93  ? -0.208  103.127 16.321  1.00 65.37  ? 93  SER B C     1 
ATOM   3401 O O     . SER D 3 93  ? 0.991   102.976 16.082  1.00 66.18  ? 93  SER B O     1 
ATOM   3402 C CB    . SER D 3 93  ? -1.509  104.910 15.125  1.00 66.18  ? 93  SER B CB    1 
ATOM   3403 O OG    . SER D 3 93  ? -2.736  104.219 15.014  1.00 68.11  ? 93  SER B OG    1 
ATOM   3404 N N     . VAL D 3 94  ? -1.037  102.098 16.502  1.00 64.65  ? 94  VAL B N     1 
ATOM   3405 C CA    . VAL D 3 94  ? -0.553  100.717 16.435  1.00 63.46  ? 94  VAL B CA    1 
ATOM   3406 C C     . VAL D 3 94  ? -1.541  99.739  15.839  1.00 63.37  ? 94  VAL B C     1 
ATOM   3407 O O     . VAL D 3 94  ? -2.622  99.556  16.378  1.00 63.16  ? 94  VAL B O     1 
ATOM   3408 C CB    . VAL D 3 94  ? -0.213  100.164 17.831  1.00 63.16  ? 94  VAL B CB    1 
ATOM   3409 C CG1   . VAL D 3 94  ? 0.198   98.706  17.713  1.00 62.79  ? 94  VAL B CG1   1 
ATOM   3410 C CG2   . VAL D 3 94  ? 0.886   100.980 18.471  1.00 62.70  ? 94  VAL B CG2   1 
ATOM   3411 N N     . VAL D 3 95  ? -1.176  99.102  14.735  1.00 63.47  ? 95  VAL B N     1 
ATOM   3412 C CA    . VAL D 3 95  ? -2.049  98.092  14.127  1.00 63.87  ? 95  VAL B CA    1 
ATOM   3413 C C     . VAL D 3 95  ? -1.340  96.761  14.371  1.00 64.47  ? 95  VAL B C     1 
ATOM   3414 O O     . VAL D 3 95  ? -0.111  96.702  14.244  1.00 65.29  ? 95  VAL B O     1 
ATOM   3415 C CB    . VAL D 3 95  ? -2.231  98.315  12.599  1.00 63.60  ? 95  VAL B CB    1 
ATOM   3416 C CG1   . VAL D 3 95  ? -0.893  98.643  11.950  1.00 63.59  ? 95  VAL B CG1   1 
ATOM   3417 C CG2   . VAL D 3 95  ? -2.835  97.069  11.955  1.00 62.33  ? 95  VAL B CG2   1 
ATOM   3418 N N     . VAL D 3 96  ? -2.078  95.707  14.737  1.00 63.94  ? 96  VAL B N     1 
ATOM   3419 C CA    . VAL D 3 96  ? -1.430  94.416  14.997  1.00 63.29  ? 96  VAL B CA    1 
ATOM   3420 C C     . VAL D 3 96  ? -2.017  93.270  14.186  1.00 63.45  ? 96  VAL B C     1 
ATOM   3421 O O     . VAL D 3 96  ? -3.227  93.140  14.088  1.00 62.47  ? 96  VAL B O     1 
ATOM   3422 C CB    . VAL D 3 96  ? -1.476  94.033  16.520  1.00 62.49  ? 96  VAL B CB    1 
ATOM   3423 C CG1   . VAL D 3 96  ? -1.710  95.269  17.367  1.00 62.10  ? 96  VAL B CG1   1 
ATOM   3424 C CG2   . VAL D 3 96  ? -2.544  92.994  16.780  1.00 61.90  ? 96  VAL B CG2   1 
ATOM   3425 N N     . SER D 3 97  ? -1.154  92.447  13.596  1.00 64.77  ? 97  SER B N     1 
ATOM   3426 C CA    . SER D 3 97  ? -1.620  91.301  12.825  1.00 66.42  ? 97  SER B CA    1 
ATOM   3427 C C     . SER D 3 97  ? -1.261  90.035  13.579  1.00 68.00  ? 97  SER B C     1 
ATOM   3428 O O     . SER D 3 97  ? -0.088  89.743  13.803  1.00 68.86  ? 97  SER B O     1 
ATOM   3429 C CB    . SER D 3 97  ? -0.987  91.259  11.439  1.00 66.36  ? 97  SER B CB    1 
ATOM   3430 O OG    . SER D 3 97  ? -1.625  90.265  10.650  1.00 66.35  ? 97  SER B OG    1 
ATOM   3431 N N     . MET D 3 98  ? -2.280  89.281  13.965  1.00 69.77  ? 98  MET B N     1 
ATOM   3432 C CA    . MET D 3 98  ? -2.077  88.059  14.724  1.00 71.83  ? 98  MET B CA    1 
ATOM   3433 C C     . MET D 3 98  ? -1.838  86.860  13.814  1.00 73.69  ? 98  MET B C     1 
ATOM   3434 O O     . MET D 3 98  ? -2.646  86.581  12.928  1.00 73.19  ? 98  MET B O     1 
ATOM   3435 C CB    . MET D 3 98  ? -3.295  87.815  15.629  1.00 71.31  ? 98  MET B CB    1 
ATOM   3436 C CG    . MET D 3 98  ? -3.069  86.796  16.739  1.00 70.97  ? 98  MET B CG    1 
ATOM   3437 S SD    . MET D 3 98  ? -4.457  86.619  17.889  1.00 70.53  ? 98  MET B SD    1 
ATOM   3438 C CE    . MET D 3 98  ? -5.174  85.069  17.314  1.00 69.97  ? 98  MET B CE    1 
ATOM   3439 N N     . VAL D 3 99  ? -0.719  86.168  14.042  1.00 76.70  ? 99  VAL B N     1 
ATOM   3440 C CA    . VAL D 3 99  ? -0.338  84.976  13.276  1.00 79.96  ? 99  VAL B CA    1 
ATOM   3441 C C     . VAL D 3 99  ? -0.697  83.717  14.059  1.00 82.87  ? 99  VAL B C     1 
ATOM   3442 O O     . VAL D 3 99  ? -0.135  83.479  15.129  1.00 83.62  ? 99  VAL B O     1 
ATOM   3443 C CB    . VAL D 3 99  ? 1.171   84.906  13.046  1.00 79.28  ? 99  VAL B CB    1 
ATOM   3444 C CG1   . VAL D 3 99  ? 1.488   83.707  12.176  1.00 79.18  ? 99  VAL B CG1   1 
ATOM   3445 C CG2   . VAL D 3 99  ? 1.677   86.197  12.442  1.00 79.15  ? 99  VAL B CG2   1 
ATOM   3446 N N     . GLU D 3 100 ? -1.606  82.901  13.540  1.00 86.15  ? 100 GLU B N     1 
ATOM   3447 C CA    . GLU D 3 100 ? -1.984  81.691  14.268  1.00 89.72  ? 100 GLU B CA    1 
ATOM   3448 C C     . GLU D 3 100 ? -1.360  80.436  13.687  1.00 91.02  ? 100 GLU B C     1 
ATOM   3449 O O     . GLU D 3 100 ? -0.834  79.594  14.420  1.00 90.76  ? 100 GLU B O     1 
ATOM   3450 C CB    . GLU D 3 100 ? -3.507  81.542  14.310  1.00 91.21  ? 100 GLU B CB    1 
ATOM   3451 C CG    . GLU D 3 100 ? -4.194  82.571  15.199  1.00 93.32  ? 100 GLU B CG    1 
ATOM   3452 C CD    . GLU D 3 100 ? -5.703  82.421  15.196  1.00 94.61  ? 100 GLU B CD    1 
ATOM   3453 O OE1   . GLU D 3 100 ? -6.303  82.508  14.096  1.00 94.86  ? 100 GLU B OE1   1 
ATOM   3454 O OE2   . GLU D 3 100 ? -6.279  82.214  16.293  1.00 95.19  ? 100 GLU B OE2   1 
ATOM   3455 N N     . ARG D 3 101 ? -1.427  80.310  12.367  1.00 92.94  ? 101 ARG B N     1 
ATOM   3456 C CA    . ARG D 3 101 ? -0.854  79.152  11.692  1.00 94.95  ? 101 ARG B CA    1 
ATOM   3457 C C     . ARG D 3 101 ? 0.641   79.144  12.021  1.00 95.18  ? 101 ARG B C     1 
ATOM   3458 O O     . ARG D 3 101 ? 1.258   80.209  12.144  1.00 95.48  ? 101 ARG B O     1 
ATOM   3459 C CB    . ARG D 3 101 ? -1.067  79.261  10.169  1.00 96.42  ? 101 ARG B CB    1 
ATOM   3460 C CG    . ARG D 3 101 ? -2.537  79.393  9.725   1.00 98.57  ? 101 ARG B CG    1 
ATOM   3461 C CD    . ARG D 3 101 ? -2.685  79.735  8.222   1.00 100.90 ? 101 ARG B CD    1 
ATOM   3462 N NE    . ARG D 3 101 ? -2.074  81.028  7.872   1.00 103.27 ? 101 ARG B NE    1 
ATOM   3463 C CZ    . ARG D 3 101 ? -2.090  81.590  6.658   1.00 103.94 ? 101 ARG B CZ    1 
ATOM   3464 N NH1   . ARG D 3 101 ? -2.691  80.990  5.637   1.00 104.15 ? 101 ARG B NH1   1 
ATOM   3465 N NH2   . ARG D 3 101 ? -1.491  82.762  6.462   1.00 103.99 ? 101 ARG B NH2   1 
ATOM   3466 N N     . SER D 3 102 ? 1.213   77.954  12.194  1.00 95.10  ? 102 SER B N     1 
ATOM   3467 C CA    . SER D 3 102 ? 2.643   77.837  12.492  1.00 94.43  ? 102 SER B CA    1 
ATOM   3468 C C     . SER D 3 102 ? 3.380   77.838  11.160  1.00 93.54  ? 102 SER B C     1 
ATOM   3469 O O     . SER D 3 102 ? 2.939   77.186  10.212  1.00 93.61  ? 102 SER B O     1 
ATOM   3470 C CB    . SER D 3 102 ? 2.940   76.531  13.241  1.00 94.69  ? 102 SER B CB    1 
ATOM   3471 O OG    . SER D 3 102 ? 4.331   76.376  13.485  1.00 94.36  ? 102 SER B OG    1 
ATOM   3472 N N     . GLY D 3 103 ? 4.483   78.574  11.078  1.00 92.13  ? 103 GLY B N     1 
ATOM   3473 C CA    . GLY D 3 103 ? 5.228   78.607  9.835   1.00 90.94  ? 103 GLY B CA    1 
ATOM   3474 C C     . GLY D 3 103 ? 5.730   79.983  9.477   1.00 90.25  ? 103 GLY B C     1 
ATOM   3475 O O     . GLY D 3 103 ? 5.203   80.983  9.959   1.00 89.89  ? 103 GLY B O     1 
ATOM   3476 N N     . VAL D 3 104 ? 6.751   80.028  8.624   1.00 90.18  ? 104 VAL B N     1 
ATOM   3477 C CA    . VAL D 3 104 ? 7.353   81.289  8.185   1.00 90.24  ? 104 VAL B CA    1 
ATOM   3478 C C     . VAL D 3 104 ? 6.441   82.002  7.196   1.00 90.61  ? 104 VAL B C     1 
ATOM   3479 O O     . VAL D 3 104 ? 6.356   83.238  7.175   1.00 90.69  ? 104 VAL B O     1 
ATOM   3480 C CB    . VAL D 3 104 ? 8.710   81.046  7.498   1.00 89.58  ? 104 VAL B CB    1 
ATOM   3481 C CG1   . VAL D 3 104 ? 9.414   82.375  7.238   1.00 88.85  ? 104 VAL B CG1   1 
ATOM   3482 C CG2   . VAL D 3 104 ? 9.560   80.125  8.362   1.00 89.49  ? 104 VAL B CG2   1 
ATOM   3483 N N     . GLU D 3 105 ? 5.764   81.208  6.374   1.00 90.69  ? 105 GLU B N     1 
ATOM   3484 C CA    . GLU D 3 105 ? 4.841   81.737  5.381   1.00 90.81  ? 105 GLU B CA    1 
ATOM   3485 C C     . GLU D 3 105 ? 3.760   82.593  6.043   1.00 89.20  ? 105 GLU B C     1 
ATOM   3486 O O     . GLU D 3 105 ? 3.479   83.717  5.614   1.00 88.57  ? 105 GLU B O     1 
ATOM   3487 C CB    . GLU D 3 105 ? 4.206   80.576  4.604   1.00 92.69  ? 105 GLU B CB    1 
ATOM   3488 C CG    . GLU D 3 105 ? 5.181   79.870  3.669   1.00 95.48  ? 105 GLU B CG    1 
ATOM   3489 C CD    . GLU D 3 105 ? 5.792   80.826  2.633   1.00 97.53  ? 105 GLU B CD    1 
ATOM   3490 O OE1   . GLU D 3 105 ? 5.058   81.280  1.715   1.00 98.18  ? 105 GLU B OE1   1 
ATOM   3491 O OE2   . GLU D 3 105 ? 7.006   81.133  2.743   1.00 98.35  ? 105 GLU B OE2   1 
ATOM   3492 N N     . ALA D 3 106 ? 3.165   82.047  7.094   1.00 87.65  ? 106 ALA B N     1 
ATOM   3493 C CA    . ALA D 3 106 ? 2.125   82.740  7.824   1.00 86.11  ? 106 ALA B CA    1 
ATOM   3494 C C     . ALA D 3 106 ? 2.666   84.053  8.369   1.00 85.07  ? 106 ALA B C     1 
ATOM   3495 O O     . ALA D 3 106 ? 1.993   85.083  8.295   1.00 84.85  ? 106 ALA B O     1 
ATOM   3496 C CB    . ALA D 3 106 ? 1.628   81.861  8.963   1.00 86.91  ? 106 ALA B CB    1 
ATOM   3497 N N     . CYS D 3 107 ? 3.884   84.009  8.910   1.00 83.85  ? 107 CYS B N     1 
ATOM   3498 C CA    . CYS D 3 107 ? 4.515   85.188  9.488   1.00 82.94  ? 107 CYS B CA    1 
ATOM   3499 C C     . CYS D 3 107 ? 4.868   86.201  8.413   1.00 83.37  ? 107 CYS B C     1 
ATOM   3500 O O     . CYS D 3 107 ? 5.009   87.400  8.688   1.00 83.55  ? 107 CYS B O     1 
ATOM   3501 C CB    . CYS D 3 107 ? 5.770   84.801  10.261  1.00 81.52  ? 107 CYS B CB    1 
ATOM   3502 S SG    . CYS D 3 107 ? 6.515   86.212  11.076  1.00 79.88  ? 107 CYS B SG    1 
ATOM   3503 N N     . LYS D 3 108 ? 5.028   85.711  7.188   1.00 83.77  ? 108 LYS B N     1 
ATOM   3504 C CA    . LYS D 3 108 ? 5.324   86.590  6.064   1.00 84.20  ? 108 LYS B CA    1 
ATOM   3505 C C     . LYS D 3 108 ? 3.994   87.250  5.656   1.00 83.78  ? 108 LYS B C     1 
ATOM   3506 O O     . LYS D 3 108 ? 3.907   88.475  5.468   1.00 83.63  ? 108 LYS B O     1 
ATOM   3507 C CB    . LYS D 3 108 ? 5.924   85.792  4.893   1.00 84.82  ? 108 LYS B CB    1 
ATOM   3508 C CG    . LYS D 3 108 ? 7.428   85.507  5.009   1.00 86.08  ? 108 LYS B CG    1 
ATOM   3509 C CD    . LYS D 3 108 ? 7.974   84.930  3.697   1.00 87.38  ? 108 LYS B CD    1 
ATOM   3510 C CE    . LYS D 3 108 ? 9.483   84.660  3.747   1.00 88.64  ? 108 LYS B CE    1 
ATOM   3511 N NZ    . LYS D 3 108 ? 10.018  84.035  2.484   1.00 88.53  ? 108 LYS B NZ    1 
ATOM   3512 N N     . THR D 3 109 ? 2.958   86.422  5.533   1.00 82.79  ? 109 THR B N     1 
ATOM   3513 C CA    . THR D 3 109 ? 1.625   86.900  5.188   1.00 81.33  ? 109 THR B CA    1 
ATOM   3514 C C     . THR D 3 109 ? 1.347   88.094  6.091   1.00 80.51  ? 109 THR B C     1 
ATOM   3515 O O     . THR D 3 109 ? 0.969   89.170  5.636   1.00 80.02  ? 109 THR B O     1 
ATOM   3516 C CB    . THR D 3 109 ? 0.568   85.806  5.464   1.00 81.59  ? 109 THR B CB    1 
ATOM   3517 O OG1   . THR D 3 109 ? 0.854   84.656  4.655   1.00 81.81  ? 109 THR B OG1   1 
ATOM   3518 C CG2   . THR D 3 109 ? -0.840  86.320  5.159   1.00 81.47  ? 109 THR B CG2   1 
ATOM   3519 N N     . ALA D 3 110 ? 1.567   87.881  7.381   1.00 79.91  ? 110 ALA B N     1 
ATOM   3520 C CA    . ALA D 3 110 ? 1.361   88.900  8.392   1.00 80.05  ? 110 ALA B CA    1 
ATOM   3521 C C     . ALA D 3 110 ? 2.147   90.167  8.094   1.00 80.35  ? 110 ALA B C     1 
ATOM   3522 O O     . ALA D 3 110 ? 1.597   91.268  8.116   1.00 80.40  ? 110 ALA B O     1 
ATOM   3523 C CB    . ALA D 3 110 ? 1.758   88.355  9.754   1.00 79.97  ? 110 ALA B CB    1 
ATOM   3524 N N     . VAL D 3 111 ? 3.438   90.019  7.831   1.00 80.59  ? 111 VAL B N     1 
ATOM   3525 C CA    . VAL D 3 111 ? 4.260   91.181  7.542   1.00 81.50  ? 111 VAL B CA    1 
ATOM   3526 C C     . VAL D 3 111 ? 3.773   91.866  6.261   1.00 83.64  ? 111 VAL B C     1 
ATOM   3527 O O     . VAL D 3 111 ? 3.868   93.093  6.124   1.00 84.09  ? 111 VAL B O     1 
ATOM   3528 C CB    . VAL D 3 111 ? 5.736   90.785  7.395   1.00 80.42  ? 111 VAL B CB    1 
ATOM   3529 C CG1   . VAL D 3 111 ? 6.574   92.005  7.080   1.00 79.63  ? 111 VAL B CG1   1 
ATOM   3530 C CG2   . VAL D 3 111 ? 6.217   90.133  8.671   1.00 79.37  ? 111 VAL B CG2   1 
ATOM   3531 N N     . HIS D 3 112 ? 3.234   91.069  5.336   1.00 85.42  ? 112 HIS B N     1 
ATOM   3532 C CA    . HIS D 3 112 ? 2.718   91.583  4.065   1.00 86.68  ? 112 HIS B CA    1 
ATOM   3533 C C     . HIS D 3 112 ? 1.564   92.575  4.311   1.00 85.60  ? 112 HIS B C     1 
ATOM   3534 O O     . HIS D 3 112 ? 1.596   93.709  3.826   1.00 85.60  ? 112 HIS B O     1 
ATOM   3535 C CB    . HIS D 3 112 ? 2.246   90.406  3.185   1.00 90.03  ? 112 HIS B CB    1 
ATOM   3536 C CG    . HIS D 3 112 ? 1.849   90.793  1.785   1.00 94.08  ? 112 HIS B CG    1 
ATOM   3537 N ND1   . HIS D 3 112 ? 1.219   89.916  0.922   1.00 95.70  ? 112 HIS B ND1   1 
ATOM   3538 C CD2   . HIS D 3 112 ? 1.998   91.952  1.094   1.00 95.46  ? 112 HIS B CD2   1 
ATOM   3539 C CE1   . HIS D 3 112 ? 0.997   90.518  -0.235  1.00 96.23  ? 112 HIS B CE1   1 
ATOM   3540 N NE2   . HIS D 3 112 ? 1.460   91.754  -0.158  1.00 96.17  ? 112 HIS B NE2   1 
ATOM   3541 N N     . ASN D 3 113 ? 0.557   92.151  5.071   1.00 84.02  ? 113 ASN B N     1 
ATOM   3542 C CA    . ASN D 3 113 ? -0.586  93.013  5.359   1.00 82.75  ? 113 ASN B CA    1 
ATOM   3543 C C     . ASN D 3 113 ? -0.173  94.241  6.152   1.00 81.08  ? 113 ASN B C     1 
ATOM   3544 O O     . ASN D 3 113 ? -0.693  95.333  5.939   1.00 80.90  ? 113 ASN B O     1 
ATOM   3545 C CB    . ASN D 3 113 ? -1.660  92.259  6.151   1.00 83.99  ? 113 ASN B CB    1 
ATOM   3546 C CG    . ASN D 3 113 ? -2.161  91.020  5.433   1.00 85.27  ? 113 ASN B CG    1 
ATOM   3547 O OD1   . ASN D 3 113 ? -2.301  91.009  4.203   1.00 85.37  ? 113 ASN B OD1   1 
ATOM   3548 N ND2   . ASN D 3 113 ? -2.451  89.969  6.202   1.00 85.86  ? 113 ASN B ND2   1 
ATOM   3549 N N     . LEU D 3 114 ? 0.750   94.052  7.082   1.00 79.46  ? 114 LEU B N     1 
ATOM   3550 C CA    . LEU D 3 114 ? 1.214   95.156  7.899   1.00 78.46  ? 114 LEU B CA    1 
ATOM   3551 C C     . LEU D 3 114 ? 1.887   96.161  6.993   1.00 77.97  ? 114 LEU B C     1 
ATOM   3552 O O     . LEU D 3 114 ? 1.793   97.370  7.195   1.00 77.93  ? 114 LEU B O     1 
ATOM   3553 C CB    . LEU D 3 114 ? 2.191   94.652  8.964   1.00 78.26  ? 114 LEU B CB    1 
ATOM   3554 C CG    . LEU D 3 114 ? 1.706   94.747  10.418  1.00 77.90  ? 114 LEU B CG    1 
ATOM   3555 C CD1   . LEU D 3 114 ? 0.332   94.130  10.552  1.00 78.17  ? 114 LEU B CD1   1 
ATOM   3556 C CD2   . LEU D 3 114 ? 2.683   94.042  11.333  1.00 77.60  ? 114 LEU B CD2   1 
ATOM   3557 N N     . LEU D 3 115 ? 2.567   95.647  5.983   1.00 77.60  ? 115 LEU B N     1 
ATOM   3558 C CA    . LEU D 3 115 ? 3.248   96.502  5.033   1.00 78.30  ? 115 LEU B CA    1 
ATOM   3559 C C     . LEU D 3 115 ? 2.218   97.268  4.203   1.00 78.76  ? 115 LEU B C     1 
ATOM   3560 O O     . LEU D 3 115 ? 2.340   98.484  3.995   1.00 78.84  ? 115 LEU B O     1 
ATOM   3561 C CB    . LEU D 3 115 ? 4.143   95.647  4.133   1.00 77.99  ? 115 LEU B CB    1 
ATOM   3562 C CG    . LEU D 3 115 ? 5.651   95.771  4.372   1.00 77.64  ? 115 LEU B CG    1 
ATOM   3563 C CD1   . LEU D 3 115 ? 5.941   95.954  5.850   1.00 77.40  ? 115 LEU B CD1   1 
ATOM   3564 C CD2   . LEU D 3 115 ? 6.339   94.537  3.826   1.00 77.01  ? 115 LEU B CD2   1 
ATOM   3565 N N     . ALA D 3 116 ? 1.201   96.545  3.741   1.00 78.77  ? 116 ALA B N     1 
ATOM   3566 C CA    . ALA D 3 116 ? 0.138   97.133  2.936   1.00 78.57  ? 116 ALA B CA    1 
ATOM   3567 C C     . ALA D 3 116 ? -0.460  98.360  3.629   1.00 78.18  ? 116 ALA B C     1 
ATOM   3568 O O     . ALA D 3 116 ? -0.796  99.342  2.971   1.00 78.48  ? 116 ALA B O     1 
ATOM   3569 C CB    . ALA D 3 116 ? -0.956  96.089  2.667   1.00 79.05  ? 116 ALA B CB    1 
ATOM   3570 N N     . GLN D 3 117 ? -0.586  98.311  4.952   1.00 77.67  ? 117 GLN B N     1 
ATOM   3571 C CA    . GLN D 3 117 ? -1.152  99.435  5.685   1.00 77.46  ? 117 GLN B CA    1 
ATOM   3572 C C     . GLN D 3 117 ? -0.129  100.540 5.862   1.00 77.03  ? 117 GLN B C     1 
ATOM   3573 O O     . GLN D 3 117 ? -0.316  101.440 6.679   1.00 76.43  ? 117 GLN B O     1 
ATOM   3574 C CB    . GLN D 3 117 ? -1.673  98.974  7.045   1.00 78.26  ? 117 GLN B CB    1 
ATOM   3575 C CG    . GLN D 3 117 ? -2.771  97.918  6.944   1.00 79.77  ? 117 GLN B CG    1 
ATOM   3576 C CD    . GLN D 3 117 ? -3.302  97.488  8.302   1.00 80.62  ? 117 GLN B CD    1 
ATOM   3577 O OE1   . GLN D 3 117 ? -3.875  98.294  9.045   1.00 80.79  ? 117 GLN B OE1   1 
ATOM   3578 N NE2   . GLN D 3 117 ? -3.113  96.210  8.636   1.00 80.92  ? 117 GLN B NE2   1 
ATOM   3579 N N     . ARG D 3 118 ? 0.940   100.462 5.073   1.00 77.16  ? 118 ARG B N     1 
ATOM   3580 C CA    . ARG D 3 118 ? 2.035   101.431 5.095   1.00 77.86  ? 118 ARG B CA    1 
ATOM   3581 C C     . ARG D 3 118 ? 2.461   101.864 6.504   1.00 76.65  ? 118 ARG B C     1 
ATOM   3582 O O     . ARG D 3 118 ? 2.469   103.066 6.821   1.00 76.73  ? 118 ARG B O     1 
ATOM   3583 C CB    . ARG D 3 118 ? 1.682   102.673 4.257   1.00 80.57  ? 118 ARG B CB    1 
ATOM   3584 C CG    . ARG D 3 118 ? 1.540   102.416 2.745   1.00 85.27  ? 118 ARG B CG    1 
ATOM   3585 C CD    . ARG D 3 118 ? 2.844   101.919 2.052   1.00 88.71  ? 118 ARG B CD    1 
ATOM   3586 N NE    . ARG D 3 118 ? 2.650   101.582 0.624   1.00 92.29  ? 118 ARG B NE    1 
ATOM   3587 C CZ    . ARG D 3 118 ? 2.102   100.444 0.164   1.00 93.78  ? 118 ARG B CZ    1 
ATOM   3588 N NH1   . ARG D 3 118 ? 1.689   99.501  1.012   1.00 95.17  ? 118 ARG B NH1   1 
ATOM   3589 N NH2   . ARG D 3 118 ? 1.943   100.242 -1.150  1.00 93.41  ? 118 ARG B NH2   1 
ATOM   3590 N N     . VAL D 3 119 ? 2.815   100.881 7.339   1.00 74.10  ? 119 VAL B N     1 
ATOM   3591 C CA    . VAL D 3 119 ? 3.279   101.134 8.708   1.00 70.51  ? 119 VAL B CA    1 
ATOM   3592 C C     . VAL D 3 119 ? 4.665   101.752 8.594   1.00 68.56  ? 119 VAL B C     1 
ATOM   3593 O O     . VAL D 3 119 ? 5.368   101.517 7.609   1.00 68.27  ? 119 VAL B O     1 
ATOM   3594 C CB    . VAL D 3 119 ? 3.427   99.829  9.506   1.00 70.49  ? 119 VAL B CB    1 
ATOM   3595 C CG1   . VAL D 3 119 ? 2.078   99.163  9.696   1.00 70.33  ? 119 VAL B CG1   1 
ATOM   3596 C CG2   . VAL D 3 119 ? 4.373   98.899  8.773   1.00 70.79  ? 119 VAL B CG2   1 
ATOM   3597 N N     . SER D 3 120 ? 5.074   102.528 9.590   1.00 66.49  ? 120 SER B N     1 
ATOM   3598 C CA    . SER D 3 120 ? 6.397   103.143 9.530   1.00 65.22  ? 120 SER B CA    1 
ATOM   3599 C C     . SER D 3 120 ? 7.507   102.281 10.153  1.00 64.46  ? 120 SER B C     1 
ATOM   3600 O O     . SER D 3 120 ? 8.685   102.659 10.130  1.00 64.49  ? 120 SER B O     1 
ATOM   3601 C CB    . SER D 3 120 ? 6.372   104.535 10.185  1.00 65.17  ? 120 SER B CB    1 
ATOM   3602 O OG    . SER D 3 120 ? 6.080   104.482 11.570  1.00 65.08  ? 120 SER B OG    1 
ATOM   3603 N N     . GLY D 3 121 ? 7.127   101.120 10.689  1.00 63.07  ? 121 GLY B N     1 
ATOM   3604 C CA    . GLY D 3 121 ? 8.085   100.211 11.309  1.00 60.60  ? 121 GLY B CA    1 
ATOM   3605 C C     . GLY D 3 121 ? 7.385   98.945  11.780  1.00 58.45  ? 121 GLY B C     1 
ATOM   3606 O O     . GLY D 3 121 ? 6.190   98.970  12.065  1.00 58.81  ? 121 GLY B O     1 
ATOM   3607 N N     . LEU D 3 122 ? 8.101   97.831  11.857  1.00 56.06  ? 122 LEU B N     1 
ATOM   3608 C CA    . LEU D 3 122 ? 7.471   96.597  12.307  1.00 53.30  ? 122 LEU B CA    1 
ATOM   3609 C C     . LEU D 3 122 ? 8.102   96.054  13.581  1.00 52.53  ? 122 LEU B C     1 
ATOM   3610 O O     . LEU D 3 122 ? 9.292   96.266  13.837  1.00 53.74  ? 122 LEU B O     1 
ATOM   3611 C CB    . LEU D 3 122 ? 7.558   95.517  11.224  1.00 51.16  ? 122 LEU B CB    1 
ATOM   3612 C CG    . LEU D 3 122 ? 6.701   95.643  9.976   1.00 49.17  ? 122 LEU B CG    1 
ATOM   3613 C CD1   . LEU D 3 122 ? 6.655   94.305  9.274   1.00 48.96  ? 122 LEU B CD1   1 
ATOM   3614 C CD2   . LEU D 3 122 ? 5.308   96.049  10.366  1.00 49.30  ? 122 LEU B CD2   1 
ATOM   3615 N N     . ILE D 3 123 ? 7.290   95.381  14.391  1.00 50.53  ? 123 ILE B N     1 
ATOM   3616 C CA    . ILE D 3 123 ? 7.777   94.735  15.602  1.00 48.45  ? 123 ILE B CA    1 
ATOM   3617 C C     . ILE D 3 123 ? 7.298   93.310  15.423  1.00 47.38  ? 123 ILE B C     1 
ATOM   3618 O O     . ILE D 3 123 ? 6.102   93.066  15.347  1.00 47.39  ? 123 ILE B O     1 
ATOM   3619 C CB    . ILE D 3 123 ? 7.182   95.330  16.911  1.00 46.58  ? 123 ILE B CB    1 
ATOM   3620 C CG1   . ILE D 3 123 ? 7.777   96.711  17.179  1.00 45.66  ? 123 ILE B CG1   1 
ATOM   3621 C CG2   . ILE D 3 123 ? 7.519   94.437  18.087  1.00 45.19  ? 123 ILE B CG2   1 
ATOM   3622 C CD1   . ILE D 3 123 ? 7.616   97.177  18.611  1.00 44.41  ? 123 ILE B CD1   1 
ATOM   3623 N N     . ILE D 3 124 ? 8.232   92.375  15.320  1.00 47.00  ? 124 ILE B N     1 
ATOM   3624 C CA    . ILE D 3 124 ? 7.870   90.982  15.122  1.00 47.64  ? 124 ILE B CA    1 
ATOM   3625 C C     . ILE D 3 124 ? 8.050   90.136  16.385  1.00 47.87  ? 124 ILE B C     1 
ATOM   3626 O O     . ILE D 3 124 ? 9.173   89.792  16.766  1.00 48.41  ? 124 ILE B O     1 
ATOM   3627 C CB    . ILE D 3 124 ? 8.712   90.341  13.992  1.00 47.84  ? 124 ILE B CB    1 
ATOM   3628 C CG1   . ILE D 3 124 ? 8.860   91.306  12.809  1.00 47.66  ? 124 ILE B CG1   1 
ATOM   3629 C CG2   . ILE D 3 124 ? 8.037   89.046  13.522  1.00 47.79  ? 124 ILE B CG2   1 
ATOM   3630 C CD1   . ILE D 3 124 ? 7.684   91.311  11.859  1.00 48.13  ? 124 ILE B CD1   1 
ATOM   3631 N N     . ASN D 3 125 ? 6.938   89.801  17.031  1.00 47.55  ? 125 ASN B N     1 
ATOM   3632 C CA    . ASN D 3 125 ? 6.966   88.974  18.230  1.00 47.21  ? 125 ASN B CA    1 
ATOM   3633 C C     . ASN D 3 125 ? 6.427   87.615  17.830  1.00 46.44  ? 125 ASN B C     1 
ATOM   3634 O O     . ASN D 3 125 ? 5.330   87.216  18.215  1.00 45.41  ? 125 ASN B O     1 
ATOM   3635 C CB    . ASN D 3 125 ? 6.099   89.583  19.329  1.00 49.11  ? 125 ASN B CB    1 
ATOM   3636 C CG    . ASN D 3 125 ? 6.037   88.720  20.578  1.00 50.76  ? 125 ASN B CG    1 
ATOM   3637 O OD1   . ASN D 3 125 ? 5.359   89.070  21.550  1.00 51.98  ? 125 ASN B OD1   1 
ATOM   3638 N ND2   . ASN D 3 125 ? 6.735   87.588  20.562  1.00 50.52  ? 125 ASN B ND2   1 
ATOM   3639 N N     . TYR D 3 126 ? 7.225   86.921  17.032  1.00 46.12  ? 126 TYR B N     1 
ATOM   3640 C CA    . TYR D 3 126 ? 6.899   85.598  16.531  1.00 45.58  ? 126 TYR B CA    1 
ATOM   3641 C C     . TYR D 3 126 ? 8.211   84.796  16.465  1.00 45.80  ? 126 TYR B C     1 
ATOM   3642 O O     . TYR D 3 126 ? 9.251   85.334  16.086  1.00 45.58  ? 126 TYR B O     1 
ATOM   3643 C CB    . TYR D 3 126 ? 6.265   85.741  15.152  1.00 45.27  ? 126 TYR B CB    1 
ATOM   3644 C CG    . TYR D 3 126 ? 5.715   84.466  14.595  1.00 45.24  ? 126 TYR B CG    1 
ATOM   3645 C CD1   . TYR D 3 126 ? 6.538   83.547  13.982  1.00 46.18  ? 126 TYR B CD1   1 
ATOM   3646 C CD2   . TYR D 3 126 ? 4.374   84.161  14.717  1.00 46.11  ? 126 TYR B CD2   1 
ATOM   3647 C CE1   . TYR D 3 126 ? 6.042   82.348  13.503  1.00 47.75  ? 126 TYR B CE1   1 
ATOM   3648 C CE2   . TYR D 3 126 ? 3.865   82.965  14.245  1.00 47.60  ? 126 TYR B CE2   1 
ATOM   3649 C CZ    . TYR D 3 126 ? 4.702   82.057  13.638  1.00 47.79  ? 126 TYR B CZ    1 
ATOM   3650 O OH    . TYR D 3 126 ? 4.203   80.850  13.186  1.00 48.62  ? 126 TYR B OH    1 
ATOM   3651 N N     . PRO D 3 127 ? 8.182   83.506  16.853  1.00 46.67  ? 127 PRO B N     1 
ATOM   3652 C CA    . PRO D 3 127 ? 9.364   82.640  16.841  1.00 45.78  ? 127 PRO B CA    1 
ATOM   3653 C C     . PRO D 3 127 ? 9.885   82.417  15.435  1.00 46.58  ? 127 PRO B C     1 
ATOM   3654 O O     . PRO D 3 127 ? 9.224   81.810  14.603  1.00 46.01  ? 127 PRO B O     1 
ATOM   3655 C CB    . PRO D 3 127 ? 8.850   81.361  17.467  1.00 46.17  ? 127 PRO B CB    1 
ATOM   3656 C CG    . PRO D 3 127 ? 7.467   81.305  16.936  1.00 46.17  ? 127 PRO B CG    1 
ATOM   3657 C CD    . PRO D 3 127 ? 6.982   82.717  17.165  1.00 46.52  ? 127 PRO B CD    1 
ATOM   3658 N N     . LEU D 3 128 ? 11.091  82.903  15.187  1.00 48.05  ? 128 LEU B N     1 
ATOM   3659 C CA    . LEU D 3 128 ? 11.720  82.797  13.881  1.00 49.19  ? 128 LEU B CA    1 
ATOM   3660 C C     . LEU D 3 128 ? 13.125  82.226  13.943  1.00 51.00  ? 128 LEU B C     1 
ATOM   3661 O O     . LEU D 3 128 ? 13.929  82.614  14.791  1.00 51.11  ? 128 LEU B O     1 
ATOM   3662 C CB    . LEU D 3 128 ? 11.776  84.181  13.240  1.00 48.52  ? 128 LEU B CB    1 
ATOM   3663 C CG    . LEU D 3 128 ? 10.823  84.490  12.086  1.00 48.42  ? 128 LEU B CG    1 
ATOM   3664 C CD1   . LEU D 3 128 ? 9.564   83.649  12.196  1.00 48.52  ? 128 LEU B CD1   1 
ATOM   3665 C CD2   . LEU D 3 128 ? 10.508  85.981  12.081  1.00 48.24  ? 128 LEU B CD2   1 
ATOM   3666 N N     . ASP D 3 129 ? 13.420  81.292  13.045  1.00 53.20  ? 129 ASP B N     1 
ATOM   3667 C CA    . ASP D 3 129 ? 14.755  80.705  12.990  1.00 55.53  ? 129 ASP B CA    1 
ATOM   3668 C C     . ASP D 3 129 ? 15.630  81.713  12.254  1.00 57.11  ? 129 ASP B C     1 
ATOM   3669 O O     . ASP D 3 129 ? 15.113  82.496  11.450  1.00 57.97  ? 129 ASP B O     1 
ATOM   3670 C CB    . ASP D 3 129 ? 14.733  79.358  12.262  1.00 56.86  ? 129 ASP B CB    1 
ATOM   3671 C CG    . ASP D 3 129 ? 14.534  78.179  13.213  1.00 58.63  ? 129 ASP B CG    1 
ATOM   3672 O OD1   . ASP D 3 129 ? 14.663  77.015  12.767  1.00 59.36  ? 129 ASP B OD1   1 
ATOM   3673 O OD2   . ASP D 3 129 ? 14.249  78.413  14.410  1.00 59.47  ? 129 ASP B OD2   1 
ATOM   3674 N N     . ASP D 3 130 ? 16.937  81.700  12.523  1.00 57.92  ? 130 ASP B N     1 
ATOM   3675 C CA    . ASP D 3 130 ? 17.869  82.664  11.924  1.00 58.67  ? 130 ASP B CA    1 
ATOM   3676 C C     . ASP D 3 130 ? 17.666  83.122  10.485  1.00 59.31  ? 130 ASP B C     1 
ATOM   3677 O O     . ASP D 3 130 ? 17.456  84.310  10.238  1.00 59.66  ? 130 ASP B O     1 
ATOM   3678 C CB    . ASP D 3 130 ? 19.306  82.189  12.101  1.00 59.53  ? 130 ASP B CB    1 
ATOM   3679 C CG    . ASP D 3 130 ? 19.838  82.487  13.487  1.00 60.11  ? 130 ASP B CG    1 
ATOM   3680 O OD1   . ASP D 3 130 ? 21.058  82.324  13.731  1.00 60.77  ? 130 ASP B OD1   1 
ATOM   3681 O OD2   . ASP D 3 130 ? 19.018  82.887  14.339  1.00 60.83  ? 130 ASP B OD2   1 
ATOM   3682 N N     . GLN D 3 131 ? 17.736  82.210  9.528   1.00 59.89  ? 131 GLN B N     1 
ATOM   3683 C CA    . GLN D 3 131 ? 17.543  82.613  8.142   1.00 60.67  ? 131 GLN B CA    1 
ATOM   3684 C C     . GLN D 3 131 ? 16.128  83.130  7.890   1.00 60.05  ? 131 GLN B C     1 
ATOM   3685 O O     . GLN D 3 131 ? 15.936  84.129  7.194   1.00 60.32  ? 131 GLN B O     1 
ATOM   3686 C CB    . GLN D 3 131 ? 17.885  81.451  7.219   1.00 62.60  ? 131 GLN B CB    1 
ATOM   3687 C CG    . GLN D 3 131 ? 19.357  81.097  7.339   1.00 66.24  ? 131 GLN B CG    1 
ATOM   3688 C CD    . GLN D 3 131 ? 19.830  80.050  6.349   1.00 68.22  ? 131 GLN B CD    1 
ATOM   3689 O OE1   . GLN D 3 131 ? 19.711  80.224  5.131   1.00 68.74  ? 131 GLN B OE1   1 
ATOM   3690 N NE2   . GLN D 3 131 ? 20.391  78.955  6.871   1.00 69.44  ? 131 GLN B NE2   1 
ATOM   3691 N N     . ASP D 3 132 ? 15.140  82.456  8.466   1.00 58.90  ? 132 ASP B N     1 
ATOM   3692 C CA    . ASP D 3 132 ? 13.755  82.869  8.327   1.00 57.40  ? 132 ASP B CA    1 
ATOM   3693 C C     . ASP D 3 132 ? 13.652  84.297  8.808   1.00 55.82  ? 132 ASP B C     1 
ATOM   3694 O O     . ASP D 3 132 ? 13.041  85.126  8.156   1.00 55.82  ? 132 ASP B O     1 
ATOM   3695 C CB    . ASP D 3 132 ? 12.863  81.975  9.174   1.00 58.97  ? 132 ASP B CB    1 
ATOM   3696 C CG    . ASP D 3 132 ? 12.699  80.604  8.579   1.00 59.85  ? 132 ASP B CG    1 
ATOM   3697 O OD1   . ASP D 3 132 ? 12.430  79.647  9.338   1.00 60.56  ? 132 ASP B OD1   1 
ATOM   3698 O OD2   . ASP D 3 132 ? 12.829  80.494  7.341   1.00 60.22  ? 132 ASP B OD2   1 
ATOM   3699 N N     . ALA D 3 133 ? 14.257  84.576  9.955   1.00 54.31  ? 133 ALA B N     1 
ATOM   3700 C CA    . ALA D 3 133 ? 14.231  85.911  10.509  1.00 53.53  ? 133 ALA B CA    1 
ATOM   3701 C C     . ALA D 3 133 ? 14.872  86.857  9.523   1.00 53.33  ? 133 ALA B C     1 
ATOM   3702 O O     . ALA D 3 133 ? 14.374  87.953  9.311   1.00 53.98  ? 133 ALA B O     1 
ATOM   3703 C CB    . ALA D 3 133 ? 14.969  85.948  11.807  1.00 53.33  ? 133 ALA B CB    1 
ATOM   3704 N N     . ILE D 3 134 ? 15.971  86.438  8.910   1.00 52.80  ? 134 ILE B N     1 
ATOM   3705 C CA    . ILE D 3 134 ? 16.645  87.291  7.941   1.00 53.05  ? 134 ILE B CA    1 
ATOM   3706 C C     . ILE D 3 134 ? 15.792  87.524  6.697   1.00 53.87  ? 134 ILE B C     1 
ATOM   3707 O O     . ILE D 3 134 ? 15.844  88.592  6.094   1.00 54.43  ? 134 ILE B O     1 
ATOM   3708 C CB    . ILE D 3 134 ? 17.986  86.703  7.501   1.00 52.53  ? 134 ILE B CB    1 
ATOM   3709 C CG1   . ILE D 3 134 ? 18.961  86.687  8.674   1.00 51.82  ? 134 ILE B CG1   1 
ATOM   3710 C CG2   . ILE D 3 134 ? 18.558  87.532  6.370   1.00 52.87  ? 134 ILE B CG2   1 
ATOM   3711 C CD1   . ILE D 3 134 ? 20.340  86.172  8.322   1.00 51.17  ? 134 ILE B CD1   1 
ATOM   3712 N N     . ALA D 3 135 ? 15.011  86.526  6.306   1.00 54.58  ? 135 ALA B N     1 
ATOM   3713 C CA    . ALA D 3 135 ? 14.148  86.665  5.136   1.00 55.74  ? 135 ALA B CA    1 
ATOM   3714 C C     . ALA D 3 135 ? 13.046  87.685  5.424   1.00 56.71  ? 135 ALA B C     1 
ATOM   3715 O O     . ALA D 3 135 ? 12.772  88.560  4.609   1.00 56.73  ? 135 ALA B O     1 
ATOM   3716 C CB    . ALA D 3 135 ? 13.537  85.322  4.774   1.00 56.40  ? 135 ALA B CB    1 
ATOM   3717 N N     . VAL D 3 136 ? 12.409  87.553  6.583   1.00 57.93  ? 136 VAL B N     1 
ATOM   3718 C CA    . VAL D 3 136 ? 11.360  88.472  7.001   1.00 59.03  ? 136 VAL B CA    1 
ATOM   3719 C C     . VAL D 3 136 ? 11.995  89.858  7.017   1.00 59.92  ? 136 VAL B C     1 
ATOM   3720 O O     . VAL D 3 136 ? 11.493  90.784  6.398   1.00 59.63  ? 136 VAL B O     1 
ATOM   3721 C CB    . VAL D 3 136 ? 10.823  88.088  8.414   1.00 59.48  ? 136 VAL B CB    1 
ATOM   3722 C CG1   . VAL D 3 136 ? 9.980   89.213  9.004   1.00 59.55  ? 136 VAL B CG1   1 
ATOM   3723 C CG2   . VAL D 3 136 ? 9.995   86.809  8.316   1.00 59.43  ? 136 VAL B CG2   1 
ATOM   3724 N N     . GLU D 3 137 ? 13.115  89.988  7.713   1.00 61.77  ? 137 GLU B N     1 
ATOM   3725 C CA    . GLU D 3 137 ? 13.825  91.254  7.778   1.00 64.62  ? 137 GLU B CA    1 
ATOM   3726 C C     . GLU D 3 137 ? 13.912  91.847  6.385   1.00 66.42  ? 137 GLU B C     1 
ATOM   3727 O O     . GLU D 3 137 ? 13.664  93.025  6.195   1.00 66.82  ? 137 GLU B O     1 
ATOM   3728 C CB    . GLU D 3 137 ? 15.233  91.035  8.335   1.00 65.65  ? 137 GLU B CB    1 
ATOM   3729 C CG    . GLU D 3 137 ? 16.277  92.075  7.925   1.00 67.17  ? 137 GLU B CG    1 
ATOM   3730 C CD    . GLU D 3 137 ? 16.008  93.456  8.497   1.00 68.70  ? 137 GLU B CD    1 
ATOM   3731 O OE1   . GLU D 3 137 ? 16.162  93.658  9.725   1.00 69.51  ? 137 GLU B OE1   1 
ATOM   3732 O OE2   . GLU D 3 137 ? 15.639  94.348  7.706   1.00 70.03  ? 137 GLU B OE2   1 
ATOM   3733 N N     . ALA D 3 138 ? 14.249  91.021  5.407   1.00 69.45  ? 138 ALA B N     1 
ATOM   3734 C CA    . ALA D 3 138 ? 14.377  91.484  4.026   1.00 72.74  ? 138 ALA B CA    1 
ATOM   3735 C C     . ALA D 3 138 ? 13.067  91.963  3.394   1.00 74.85  ? 138 ALA B C     1 
ATOM   3736 O O     . ALA D 3 138 ? 13.025  93.017  2.751   1.00 74.75  ? 138 ALA B O     1 
ATOM   3737 C CB    . ALA D 3 138 ? 14.981  90.383  3.172   1.00 73.07  ? 138 ALA B CB    1 
ATOM   3738 N N     . ALA D 3 139 ? 12.002  91.186  3.569   1.00 77.90  ? 139 ALA B N     1 
ATOM   3739 C CA    . ALA D 3 139 ? 10.703  91.545  3.005   1.00 80.97  ? 139 ALA B CA    1 
ATOM   3740 C C     . ALA D 3 139 ? 10.221  92.920  3.487   1.00 83.04  ? 139 ALA B C     1 
ATOM   3741 O O     . ALA D 3 139 ? 9.401   93.556  2.824   1.00 83.58  ? 139 ALA B O     1 
ATOM   3742 C CB    . ALA D 3 139 ? 9.655   90.460  3.332   1.00 80.47  ? 139 ALA B CB    1 
ATOM   3743 N N     . CYS D 3 140 ? 10.722  93.378  4.634   1.00 85.33  ? 140 CYS B N     1 
ATOM   3744 C CA    . CYS D 3 140 ? 10.334  94.686  5.155   1.00 87.45  ? 140 CYS B CA    1 
ATOM   3745 C C     . CYS D 3 140 ? 10.950  95.739  4.267   1.00 88.50  ? 140 CYS B C     1 
ATOM   3746 O O     . CYS D 3 140 ? 11.981  96.338  4.576   1.00 88.54  ? 140 CYS B O     1 
ATOM   3747 C CB    . CYS D 3 140 ? 10.809  94.865  6.587   1.00 87.80  ? 140 CYS B CB    1 
ATOM   3748 S SG    . CYS D 3 140 ? 10.010  93.718  7.694   1.00 90.08  ? 140 CYS B SG    1 
ATOM   3749 N N     . THR D 3 141 ? 10.287  95.933  3.140   1.00 90.11  ? 141 THR B N     1 
ATOM   3750 C CA    . THR D 3 141 ? 10.682  96.881  2.114   1.00 91.83  ? 141 THR B CA    1 
ATOM   3751 C C     . THR D 3 141 ? 10.988  98.293  2.649   1.00 91.11  ? 141 THR B C     1 
ATOM   3752 O O     . THR D 3 141 ? 10.075  99.116  2.823   1.00 91.20  ? 141 THR B O     1 
ATOM   3753 C CB    . THR D 3 141 ? 9.556   96.957  1.017   1.00 93.51  ? 141 THR B CB    1 
ATOM   3754 O OG1   . THR D 3 141 ? 9.277   95.630  0.530   1.00 94.30  ? 141 THR B OG1   1 
ATOM   3755 C CG2   . THR D 3 141 ? 9.977   97.870  -0.163  1.00 94.52  ? 141 THR B CG2   1 
ATOM   3756 N N     . ASN D 3 142 ? 12.268  98.561  2.922   1.00 89.63  ? 142 ASN B N     1 
ATOM   3757 C CA    . ASN D 3 142 ? 12.683  99.884  3.385   1.00 88.40  ? 142 ASN B CA    1 
ATOM   3758 C C     . ASN D 3 142 ? 12.410  100.200 4.874   1.00 85.97  ? 142 ASN B C     1 
ATOM   3759 O O     . ASN D 3 142 ? 13.197  100.903 5.513   1.00 85.96  ? 142 ASN B O     1 
ATOM   3760 C CB    . ASN D 3 142 ? 12.015  100.946 2.474   1.00 91.17  ? 142 ASN B CB    1 
ATOM   3761 C CG    . ASN D 3 142 ? 12.610  102.353 2.633   1.00 93.50  ? 142 ASN B CG    1 
ATOM   3762 O OD1   . ASN D 3 142 ? 12.461  102.993 3.681   1.00 94.94  ? 142 ASN B OD1   1 
ATOM   3763 N ND2   . ASN D 3 142 ? 13.281  102.842 1.579   1.00 94.53  ? 142 ASN B ND2   1 
ATOM   3764 N N     . VAL D 3 143 ? 11.313  99.684  5.430   1.00 82.56  ? 143 VAL B N     1 
ATOM   3765 C CA    . VAL D 3 143 ? 10.953  99.953  6.832   1.00 78.44  ? 143 VAL B CA    1 
ATOM   3766 C C     . VAL D 3 143 ? 11.680  99.128  7.889   1.00 75.09  ? 143 VAL B C     1 
ATOM   3767 O O     . VAL D 3 143 ? 11.919  97.926  7.710   1.00 75.45  ? 143 VAL B O     1 
ATOM   3768 C CB    . VAL D 3 143 ? 9.442   99.761  7.072   1.00 79.43  ? 143 VAL B CB    1 
ATOM   3769 C CG1   . VAL D 3 143 ? 8.657   100.830 6.317   1.00 80.20  ? 143 VAL B CG1   1 
ATOM   3770 C CG2   . VAL D 3 143 ? 9.012   98.348  6.636   1.00 80.06  ? 143 VAL B CG2   1 
ATOM   3771 N N     . PRO D 3 144 ? 12.018  99.764  9.028   1.00 71.31  ? 144 PRO B N     1 
ATOM   3772 C CA    . PRO D 3 144 ? 12.722  99.093  10.130  1.00 68.10  ? 144 PRO B CA    1 
ATOM   3773 C C     . PRO D 3 144 ? 11.908  98.007  10.825  1.00 65.19  ? 144 PRO B C     1 
ATOM   3774 O O     . PRO D 3 144 ? 10.700  98.126  10.995  1.00 64.98  ? 144 PRO B O     1 
ATOM   3775 C CB    . PRO D 3 144 ? 13.081  100.246 11.071  1.00 67.93  ? 144 PRO B CB    1 
ATOM   3776 C CG    . PRO D 3 144 ? 11.959  101.194 10.868  1.00 68.70  ? 144 PRO B CG    1 
ATOM   3777 C CD    . PRO D 3 144 ? 11.758  101.176 9.360   1.00 69.82  ? 144 PRO B CD    1 
ATOM   3778 N N     . ALA D 3 145 ? 12.584  96.939  11.214  1.00 61.89  ? 145 ALA B N     1 
ATOM   3779 C CA    . ALA D 3 145 ? 11.923  95.850  11.894  1.00 58.65  ? 145 ALA B CA    1 
ATOM   3780 C C     . ALA D 3 145 ? 12.732  95.481  13.123  1.00 56.50  ? 145 ALA B C     1 
ATOM   3781 O O     . ALA D 3 145 ? 13.965  95.432  13.091  1.00 56.71  ? 145 ALA B O     1 
ATOM   3782 C CB    . ALA D 3 145 ? 11.790  94.655  10.968  1.00 58.85  ? 145 ALA B CB    1 
ATOM   3783 N N     . LEU D 3 146 ? 12.024  95.225  14.211  1.00 53.41  ? 146 LEU B N     1 
ATOM   3784 C CA    . LEU D 3 146 ? 12.651  94.853  15.461  1.00 50.71  ? 146 LEU B CA    1 
ATOM   3785 C C     . LEU D 3 146 ? 12.106  93.470  15.834  1.00 49.24  ? 146 LEU B C     1 
ATOM   3786 O O     . LEU D 3 146 ? 10.901  93.234  15.738  1.00 49.02  ? 146 LEU B O     1 
ATOM   3787 C CB    . LEU D 3 146 ? 12.299  95.903  16.517  1.00 49.76  ? 146 LEU B CB    1 
ATOM   3788 C CG    . LEU D 3 146 ? 12.991  95.869  17.876  1.00 49.62  ? 146 LEU B CG    1 
ATOM   3789 C CD1   . LEU D 3 146 ? 14.497  95.904  17.710  1.00 49.94  ? 146 LEU B CD1   1 
ATOM   3790 C CD2   . LEU D 3 146 ? 12.535  97.058  18.678  1.00 48.82  ? 146 LEU B CD2   1 
ATOM   3791 N N     . PHE D 3 147 ? 12.985  92.548  16.227  1.00 47.67  ? 147 PHE B N     1 
ATOM   3792 C CA    . PHE D 3 147 ? 12.546  91.205  16.598  1.00 45.79  ? 147 PHE B CA    1 
ATOM   3793 C C     . PHE D 3 147 ? 12.560  90.981  18.106  1.00 45.27  ? 147 PHE B C     1 
ATOM   3794 O O     . PHE D 3 147 ? 13.437  91.495  18.814  1.00 45.17  ? 147 PHE B O     1 
ATOM   3795 C CB    . PHE D 3 147 ? 13.403  90.161  15.891  1.00 44.99  ? 147 PHE B CB    1 
ATOM   3796 C CG    . PHE D 3 147 ? 13.249  90.181  14.405  1.00 45.01  ? 147 PHE B CG    1 
ATOM   3797 C CD1   . PHE D 3 147 ? 13.823  91.199  13.645  1.00 45.48  ? 147 PHE B CD1   1 
ATOM   3798 C CD2   . PHE D 3 147 ? 12.480  89.213  13.760  1.00 44.51  ? 147 PHE B CD2   1 
ATOM   3799 C CE1   . PHE D 3 147 ? 13.623  91.252  12.257  1.00 45.30  ? 147 PHE B CE1   1 
ATOM   3800 C CE2   . PHE D 3 147 ? 12.274  89.255  12.377  1.00 44.14  ? 147 PHE B CE2   1 
ATOM   3801 C CZ    . PHE D 3 147 ? 12.844  90.274  11.625  1.00 44.50  ? 147 PHE B CZ    1 
ATOM   3802 N N     . LEU D 3 148 ? 11.575  90.222  18.590  1.00 44.64  ? 148 LEU B N     1 
ATOM   3803 C CA    . LEU D 3 148 ? 11.442  89.937  20.016  1.00 43.98  ? 148 LEU B CA    1 
ATOM   3804 C C     . LEU D 3 148 ? 11.509  88.468  20.349  1.00 43.51  ? 148 LEU B C     1 
ATOM   3805 O O     . LEU D 3 148 ? 11.631  88.123  21.528  1.00 43.41  ? 148 LEU B O     1 
ATOM   3806 C CB    . LEU D 3 148 ? 10.129  90.478  20.567  1.00 43.83  ? 148 LEU B CB    1 
ATOM   3807 C CG    . LEU D 3 148 ? 9.871   91.980  20.500  1.00 43.93  ? 148 LEU B CG    1 
ATOM   3808 C CD1   . LEU D 3 148 ? 8.635   92.272  21.327  1.00 43.63  ? 148 LEU B CD1   1 
ATOM   3809 C CD2   . LEU D 3 148 ? 11.071  92.772  21.022  1.00 43.90  ? 148 LEU B CD2   1 
ATOM   3810 N N     . ASP D 3 149 ? 11.401  87.609  19.331  1.00 42.49  ? 149 ASP B N     1 
ATOM   3811 C CA    . ASP D 3 149 ? 11.480  86.160  19.540  1.00 41.43  ? 149 ASP B CA    1 
ATOM   3812 C C     . ASP D 3 149 ? 12.454  85.537  18.572  1.00 39.83  ? 149 ASP B C     1 
ATOM   3813 O O     . ASP D 3 149 ? 12.066  84.786  17.695  1.00 39.65  ? 149 ASP B O     1 
ATOM   3814 C CB    . ASP D 3 149 ? 10.110  85.480  19.377  1.00 43.32  ? 149 ASP B CB    1 
ATOM   3815 C CG    . ASP D 3 149 ? 10.054  84.079  20.019  1.00 43.63  ? 149 ASP B CG    1 
ATOM   3816 O OD1   . ASP D 3 149 ? 11.013  83.710  20.730  1.00 43.82  ? 149 ASP B OD1   1 
ATOM   3817 O OD2   . ASP D 3 149 ? 9.046   83.355  19.825  1.00 42.96  ? 149 ASP B OD2   1 
ATOM   3818 N N     . VAL D 3 150 ? 13.723  85.883  18.725  1.00 38.35  ? 150 VAL B N     1 
ATOM   3819 C CA    . VAL D 3 150 ? 14.793  85.339  17.897  1.00 37.24  ? 150 VAL B CA    1 
ATOM   3820 C C     . VAL D 3 150 ? 15.937  85.107  18.860  1.00 37.47  ? 150 VAL B C     1 
ATOM   3821 O O     . VAL D 3 150 ? 15.826  85.440  20.042  1.00 37.82  ? 150 VAL B O     1 
ATOM   3822 C CB    . VAL D 3 150 ? 15.259  86.322  16.792  1.00 36.48  ? 150 VAL B CB    1 
ATOM   3823 C CG1   . VAL D 3 150 ? 14.130  86.583  15.824  1.00 36.93  ? 150 VAL B CG1   1 
ATOM   3824 C CG2   . VAL D 3 150 ? 15.731  87.624  17.402  1.00 36.09  ? 150 VAL B CG2   1 
ATOM   3825 N N     . SER D 3 151 ? 17.028  84.531  18.380  1.00 36.43  ? 151 SER B N     1 
ATOM   3826 C CA    . SER D 3 151 ? 18.150  84.300  19.259  1.00 35.92  ? 151 SER B CA    1 
ATOM   3827 C C     . SER D 3 151 ? 19.064  85.508  19.281  1.00 35.95  ? 151 SER B C     1 
ATOM   3828 O O     . SER D 3 151 ? 19.060  86.322  18.358  1.00 35.22  ? 151 SER B O     1 
ATOM   3829 C CB    . SER D 3 151 ? 18.938  83.103  18.802  1.00 36.09  ? 151 SER B CB    1 
ATOM   3830 O OG    . SER D 3 151 ? 20.224  83.183  19.371  1.00 37.54  ? 151 SER B OG    1 
ATOM   3831 N N     . ASP D 3 152 ? 19.857  85.623  20.336  1.00 36.31  ? 152 ASP B N     1 
ATOM   3832 C CA    . ASP D 3 152 ? 20.766  86.750  20.445  1.00 37.44  ? 152 ASP B CA    1 
ATOM   3833 C C     . ASP D 3 152 ? 21.817  86.724  19.354  1.00 37.51  ? 152 ASP B C     1 
ATOM   3834 O O     . ASP D 3 152 ? 22.480  87.714  19.097  1.00 38.56  ? 152 ASP B O     1 
ATOM   3835 C CB    . ASP D 3 152 ? 21.455  86.772  21.814  1.00 36.94  ? 152 ASP B CB    1 
ATOM   3836 C CG    . ASP D 3 152 ? 22.014  85.426  22.211  1.00 36.40  ? 152 ASP B CG    1 
ATOM   3837 O OD1   . ASP D 3 152 ? 22.880  85.372  23.104  1.00 36.02  ? 152 ASP B OD1   1 
ATOM   3838 O OD2   . ASP D 3 152 ? 21.575  84.417  21.644  1.00 35.37  ? 152 ASP B OD2   1 
ATOM   3839 N N     . GLN D 3 153 ? 21.963  85.588  18.696  1.00 38.13  ? 153 GLN B N     1 
ATOM   3840 C CA    . GLN D 3 153 ? 22.964  85.458  17.649  1.00 39.37  ? 153 GLN B CA    1 
ATOM   3841 C C     . GLN D 3 153 ? 22.483  85.834  16.280  1.00 40.76  ? 153 GLN B C     1 
ATOM   3842 O O     . GLN D 3 153 ? 23.281  85.941  15.352  1.00 41.59  ? 153 GLN B O     1 
ATOM   3843 C CB    . GLN D 3 153 ? 23.468  84.035  17.588  1.00 38.79  ? 153 GLN B CB    1 
ATOM   3844 C CG    . GLN D 3 153 ? 24.293  83.666  18.772  1.00 39.21  ? 153 GLN B CG    1 
ATOM   3845 C CD    . GLN D 3 153 ? 24.418  82.180  18.914  1.00 38.39  ? 153 GLN B CD    1 
ATOM   3846 O OE1   . GLN D 3 153 ? 25.249  81.686  19.681  1.00 37.84  ? 153 GLN B OE1   1 
ATOM   3847 N NE2   . GLN D 3 153 ? 23.582  81.447  18.182  1.00 36.89  ? 153 GLN B NE2   1 
ATOM   3848 N N     . THR D 3 154 ? 21.180  86.023  16.135  1.00 42.49  ? 154 THR B N     1 
ATOM   3849 C CA    . THR D 3 154 ? 20.658  86.386  14.834  1.00 44.16  ? 154 THR B CA    1 
ATOM   3850 C C     . THR D 3 154 ? 21.123  87.787  14.512  1.00 45.07  ? 154 THR B C     1 
ATOM   3851 O O     . THR D 3 154 ? 20.998  88.705  15.325  1.00 45.86  ? 154 THR B O     1 
ATOM   3852 C CB    . THR D 3 154 ? 19.143  86.362  14.789  1.00 44.67  ? 154 THR B CB    1 
ATOM   3853 O OG1   . THR D 3 154 ? 18.657  85.170  15.420  1.00 45.89  ? 154 THR B OG1   1 
ATOM   3854 C CG2   . THR D 3 154 ? 18.694  86.383  13.349  1.00 44.87  ? 154 THR B CG2   1 
ATOM   3855 N N     . PRO D 3 155 ? 21.681  87.967  13.319  1.00 44.70  ? 155 PRO B N     1 
ATOM   3856 C CA    . PRO D 3 155 ? 22.186  89.253  12.853  1.00 45.04  ? 155 PRO B CA    1 
ATOM   3857 C C     . PRO D 3 155 ? 21.089  90.251  12.460  1.00 45.95  ? 155 PRO B C     1 
ATOM   3858 O O     . PRO D 3 155 ? 21.024  90.700  11.316  1.00 46.19  ? 155 PRO B O     1 
ATOM   3859 C CB    . PRO D 3 155 ? 23.062  88.851  11.679  1.00 45.69  ? 155 PRO B CB    1 
ATOM   3860 C CG    . PRO D 3 155 ? 22.296  87.706  11.103  1.00 45.86  ? 155 PRO B CG    1 
ATOM   3861 C CD    . PRO D 3 155 ? 21.920  86.912  12.323  1.00 45.19  ? 155 PRO B CD    1 
ATOM   3862 N N     . ILE D 3 156 ? 20.221  90.592  13.404  1.00 45.70  ? 156 ILE B N     1 
ATOM   3863 C CA    . ILE D 3 156 ? 19.164  91.556  13.135  1.00 45.12  ? 156 ILE B CA    1 
ATOM   3864 C C     . ILE D 3 156 ? 18.920  92.403  14.378  1.00 45.37  ? 156 ILE B C     1 
ATOM   3865 O O     . ILE D 3 156 ? 19.583  92.210  15.399  1.00 46.36  ? 156 ILE B O     1 
ATOM   3866 C CB    . ILE D 3 156 ? 17.854  90.856  12.676  1.00 44.84  ? 156 ILE B CB    1 
ATOM   3867 C CG1   . ILE D 3 156 ? 17.539  89.651  13.557  1.00 44.15  ? 156 ILE B CG1   1 
ATOM   3868 C CG2   . ILE D 3 156 ? 18.001  90.403  11.238  1.00 45.04  ? 156 ILE B CG2   1 
ATOM   3869 C CD1   . ILE D 3 156 ? 16.204  89.019  13.250  1.00 44.55  ? 156 ILE B CD1   1 
ATOM   3870 N N     . ASN D 3 157 ? 18.012  93.369  14.292  1.00 44.68  ? 157 ASN B N     1 
ATOM   3871 C CA    . ASN D 3 157 ? 17.720  94.198  15.453  1.00 43.92  ? 157 ASN B CA    1 
ATOM   3872 C C     . ASN D 3 157 ? 16.790  93.365  16.313  1.00 42.76  ? 157 ASN B C     1 
ATOM   3873 O O     . ASN D 3 157 ? 15.852  92.744  15.796  1.00 42.23  ? 157 ASN B O     1 
ATOM   3874 C CB    . ASN D 3 157 ? 17.046  95.498  15.033  1.00 44.88  ? 157 ASN B CB    1 
ATOM   3875 C CG    . ASN D 3 157 ? 17.920  96.333  14.136  1.00 44.51  ? 157 ASN B CG    1 
ATOM   3876 O OD1   . ASN D 3 157 ? 19.019  96.734  14.525  1.00 44.51  ? 157 ASN B OD1   1 
ATOM   3877 N ND2   . ASN D 3 157 ? 17.443  96.597  12.921  1.00 44.23  ? 157 ASN B ND2   1 
ATOM   3878 N N     . SER D 3 158 ? 17.040  93.353  17.619  1.00 41.37  ? 158 SER B N     1 
ATOM   3879 C CA    . SER D 3 158 ? 16.230  92.537  18.502  1.00 40.04  ? 158 SER B CA    1 
ATOM   3880 C C     . SER D 3 158 ? 16.376  92.864  19.965  1.00 39.86  ? 158 SER B C     1 
ATOM   3881 O O     . SER D 3 158 ? 17.433  93.293  20.412  1.00 40.23  ? 158 SER B O     1 
ATOM   3882 C CB    . SER D 3 158 ? 16.623  91.089  18.319  1.00 39.92  ? 158 SER B CB    1 
ATOM   3883 O OG    . SER D 3 158 ? 18.004  90.939  18.614  1.00 39.84  ? 158 SER B OG    1 
ATOM   3884 N N     . ILE D 3 159 ? 15.304  92.638  20.713  1.00 39.33  ? 159 ILE B N     1 
ATOM   3885 C CA    . ILE D 3 159 ? 15.323  92.858  22.152  1.00 39.47  ? 159 ILE B CA    1 
ATOM   3886 C C     . ILE D 3 159 ? 14.747  91.609  22.780  1.00 39.48  ? 159 ILE B C     1 
ATOM   3887 O O     . ILE D 3 159 ? 13.660  91.141  22.406  1.00 39.25  ? 159 ILE B O     1 
ATOM   3888 C CB    . ILE D 3 159 ? 14.477  94.051  22.598  1.00 39.58  ? 159 ILE B CB    1 
ATOM   3889 C CG1   . ILE D 3 159 ? 14.874  95.297  21.816  1.00 40.85  ? 159 ILE B CG1   1 
ATOM   3890 C CG2   . ILE D 3 159 ? 14.707  94.311  24.073  1.00 38.51  ? 159 ILE B CG2   1 
ATOM   3891 C CD1   . ILE D 3 159 ? 14.128  96.532  22.252  1.00 42.24  ? 159 ILE B CD1   1 
ATOM   3892 N N     . ILE D 3 160 ? 15.497  91.065  23.732  1.00 40.11  ? 160 ILE B N     1 
ATOM   3893 C CA    . ILE D 3 160 ? 15.102  89.842  24.420  1.00 40.36  ? 160 ILE B CA    1 
ATOM   3894 C C     . ILE D 3 160 ? 15.681  89.797  25.824  1.00 40.25  ? 160 ILE B C     1 
ATOM   3895 O O     . ILE D 3 160 ? 16.743  90.355  26.091  1.00 39.24  ? 160 ILE B O     1 
ATOM   3896 C CB    . ILE D 3 160 ? 15.623  88.603  23.683  1.00 40.39  ? 160 ILE B CB    1 
ATOM   3897 C CG1   . ILE D 3 160 ? 17.147  88.572  23.773  1.00 40.05  ? 160 ILE B CG1   1 
ATOM   3898 C CG2   . ILE D 3 160 ? 15.232  88.655  22.221  1.00 41.34  ? 160 ILE B CG2   1 
ATOM   3899 C CD1   . ILE D 3 160 ? 17.738  87.341  23.199  1.00 39.22  ? 160 ILE B CD1   1 
ATOM   3900 N N     . PHE D 3 161 ? 14.982  89.117  26.718  1.00 41.04  ? 161 PHE B N     1 
ATOM   3901 C CA    . PHE D 3 161 ? 15.455  88.997  28.079  1.00 42.60  ? 161 PHE B CA    1 
ATOM   3902 C C     . PHE D 3 161 ? 16.628  88.046  28.064  1.00 43.17  ? 161 PHE B C     1 
ATOM   3903 O O     . PHE D 3 161 ? 16.658  87.109  27.252  1.00 43.76  ? 161 PHE B O     1 
ATOM   3904 C CB    . PHE D 3 161 ? 14.368  88.441  28.980  1.00 43.77  ? 161 PHE B CB    1 
ATOM   3905 C CG    . PHE D 3 161 ? 13.273  89.422  29.278  1.00 44.42  ? 161 PHE B CG    1 
ATOM   3906 C CD1   . PHE D 3 161 ? 12.099  89.398  28.562  1.00 44.79  ? 161 PHE B CD1   1 
ATOM   3907 C CD2   . PHE D 3 161 ? 13.425  90.379  30.267  1.00 45.17  ? 161 PHE B CD2   1 
ATOM   3908 C CE1   . PHE D 3 161 ? 11.089  90.306  28.819  1.00 45.18  ? 161 PHE B CE1   1 
ATOM   3909 C CE2   . PHE D 3 161 ? 12.421  91.291  30.534  1.00 45.44  ? 161 PHE B CE2   1 
ATOM   3910 C CZ    . PHE D 3 161 ? 11.249  91.256  29.808  1.00 45.48  ? 161 PHE B CZ    1 
ATOM   3911 N N     . SER D 3 162 ? 17.580  88.274  28.970  1.00 43.44  ? 162 SER B N     1 
ATOM   3912 C CA    . SER D 3 162 ? 18.787  87.455  29.064  1.00 43.24  ? 162 SER B CA    1 
ATOM   3913 C C     . SER D 3 162 ? 18.603  86.059  29.620  1.00 42.84  ? 162 SER B C     1 
ATOM   3914 O O     . SER D 3 162 ? 18.711  85.836  30.834  1.00 42.44  ? 162 SER B O     1 
ATOM   3915 C CB    . SER D 3 162 ? 19.844  88.153  29.902  1.00 42.79  ? 162 SER B CB    1 
ATOM   3916 O OG    . SER D 3 162 ? 20.874  87.240  30.211  1.00 42.29  ? 162 SER B OG    1 
ATOM   3917 N N     . HIS D 3 163 ? 18.363  85.123  28.711  1.00 42.67  ? 163 HIS B N     1 
ATOM   3918 C CA    . HIS D 3 163 ? 18.174  83.742  29.069  1.00 42.45  ? 163 HIS B CA    1 
ATOM   3919 C C     . HIS D 3 163 ? 19.447  83.259  29.726  1.00 41.15  ? 163 HIS B C     1 
ATOM   3920 O O     . HIS D 3 163 ? 19.428  82.330  30.530  1.00 40.45  ? 163 HIS B O     1 
ATOM   3921 C CB    . HIS D 3 163 ? 17.862  82.953  27.810  1.00 43.46  ? 163 HIS B CB    1 
ATOM   3922 C CG    . HIS D 3 163 ? 18.860  83.151  26.724  1.00 43.94  ? 163 HIS B CG    1 
ATOM   3923 N ND1   . HIS D 3 163 ? 20.028  82.425  26.649  1.00 45.73  ? 163 HIS B ND1   1 
ATOM   3924 C CD2   . HIS D 3 163 ? 18.877  84.004  25.679  1.00 44.53  ? 163 HIS B CD2   1 
ATOM   3925 C CE1   . HIS D 3 163 ? 20.721  82.819  25.598  1.00 45.95  ? 163 HIS B CE1   1 
ATOM   3926 N NE2   . HIS D 3 163 ? 20.044  83.778  24.993  1.00 46.07  ? 163 HIS B NE2   1 
ATOM   3927 N N     . GLU D 3 164 ? 20.556  83.904  29.396  1.00 40.36  ? 164 GLU B N     1 
ATOM   3928 C CA    . GLU D 3 164 ? 21.803  83.508  30.003  1.00 41.15  ? 164 GLU B CA    1 
ATOM   3929 C C     . GLU D 3 164 ? 21.676  83.780  31.506  1.00 40.76  ? 164 GLU B C     1 
ATOM   3930 O O     . GLU D 3 164 ? 21.946  82.912  32.321  1.00 41.84  ? 164 GLU B O     1 
ATOM   3931 C CB    . GLU D 3 164 ? 22.969  84.298  29.410  1.00 42.90  ? 164 GLU B CB    1 
ATOM   3932 C CG    . GLU D 3 164 ? 24.317  83.575  29.458  1.00 45.70  ? 164 GLU B CG    1 
ATOM   3933 C CD    . GLU D 3 164 ? 24.588  82.741  28.214  1.00 48.07  ? 164 GLU B CD    1 
ATOM   3934 O OE1   . GLU D 3 164 ? 25.500  81.893  28.247  1.00 49.09  ? 164 GLU B OE1   1 
ATOM   3935 O OE2   . GLU D 3 164 ? 23.898  82.934  27.191  1.00 50.61  ? 164 GLU B OE2   1 
ATOM   3936 N N     . ASP D 3 165 ? 21.234  84.974  31.879  1.00 39.52  ? 165 ASP B N     1 
ATOM   3937 C CA    . ASP D 3 165 ? 21.098  85.313  33.294  1.00 37.75  ? 165 ASP B CA    1 
ATOM   3938 C C     . ASP D 3 165 ? 19.992  84.557  33.996  1.00 36.68  ? 165 ASP B C     1 
ATOM   3939 O O     . ASP D 3 165 ? 20.118  84.206  35.158  1.00 36.62  ? 165 ASP B O     1 
ATOM   3940 C CB    . ASP D 3 165 ? 20.839  86.806  33.471  1.00 38.78  ? 165 ASP B CB    1 
ATOM   3941 C CG    . ASP D 3 165 ? 22.075  87.641  33.242  1.00 39.61  ? 165 ASP B CG    1 
ATOM   3942 O OD1   . ASP D 3 165 ? 23.094  87.383  33.914  1.00 40.10  ? 165 ASP B OD1   1 
ATOM   3943 O OD2   . ASP D 3 165 ? 22.034  88.559  32.395  1.00 39.54  ? 165 ASP B OD2   1 
ATOM   3944 N N     . GLY D 3 166 ? 18.900  84.316  33.290  1.00 36.13  ? 166 GLY B N     1 
ATOM   3945 C CA    . GLY D 3 166 ? 17.782  83.614  33.892  1.00 35.58  ? 166 GLY B CA    1 
ATOM   3946 C C     . GLY D 3 166 ? 18.074  82.169  34.235  1.00 35.16  ? 166 GLY B C     1 
ATOM   3947 O O     . GLY D 3 166 ? 17.796  81.717  35.342  1.00 35.39  ? 166 GLY B O     1 
ATOM   3948 N N     . THR D 3 167 ? 18.631  81.433  33.288  1.00 34.38  ? 167 THR B N     1 
ATOM   3949 C CA    . THR D 3 167 ? 18.934  80.042  33.535  1.00 34.50  ? 167 THR B CA    1 
ATOM   3950 C C     . THR D 3 167 ? 20.032  79.881  34.568  1.00 35.61  ? 167 THR B C     1 
ATOM   3951 O O     . THR D 3 167 ? 20.025  78.918  35.317  1.00 36.58  ? 167 THR B O     1 
ATOM   3952 C CB    . THR D 3 167 ? 19.373  79.368  32.278  1.00 34.38  ? 167 THR B CB    1 
ATOM   3953 O OG1   . THR D 3 167 ? 20.382  80.168  31.670  1.00 35.30  ? 167 THR B OG1   1 
ATOM   3954 C CG2   . THR D 3 167 ? 18.211  79.215  31.327  1.00 33.91  ? 167 THR B CG2   1 
ATOM   3955 N N     . ARG D 3 168 ? 20.979  80.811  34.610  1.00 36.30  ? 168 ARG B N     1 
ATOM   3956 C CA    . ARG D 3 168 ? 22.066  80.731  35.585  1.00 37.40  ? 168 ARG B CA    1 
ATOM   3957 C C     . ARG D 3 168 ? 21.476  80.895  36.984  1.00 36.23  ? 168 ARG B C     1 
ATOM   3958 O O     . ARG D 3 168 ? 21.670  80.068  37.871  1.00 35.75  ? 168 ARG B O     1 
ATOM   3959 C CB    . ARG D 3 168 ? 23.092  81.837  35.318  1.00 40.08  ? 168 ARG B CB    1 
ATOM   3960 C CG    . ARG D 3 168 ? 24.436  81.679  36.038  1.00 44.62  ? 168 ARG B CG    1 
ATOM   3961 C CD    . ARG D 3 168 ? 25.211  82.982  36.022  1.00 49.32  ? 168 ARG B CD    1 
ATOM   3962 N NE    . ARG D 3 168 ? 24.520  83.986  36.830  1.00 55.61  ? 168 ARG B NE    1 
ATOM   3963 C CZ    . ARG D 3 168 ? 24.646  85.305  36.683  1.00 58.38  ? 168 ARG B CZ    1 
ATOM   3964 N NH1   . ARG D 3 168 ? 25.453  85.798  35.742  1.00 60.49  ? 168 ARG B NH1   1 
ATOM   3965 N NH2   . ARG D 3 168 ? 23.948  86.135  37.466  1.00 59.34  ? 168 ARG B NH2   1 
ATOM   3966 N N     . LEU D 3 169 ? 20.740  81.979  37.155  1.00 35.75  ? 169 LEU B N     1 
ATOM   3967 C CA    . LEU D 3 169 ? 20.078  82.314  38.407  1.00 35.57  ? 169 LEU B CA    1 
ATOM   3968 C C     . LEU D 3 169 ? 19.323  81.131  38.957  1.00 35.89  ? 169 LEU B C     1 
ATOM   3969 O O     . LEU D 3 169 ? 19.344  80.871  40.152  1.00 36.19  ? 169 LEU B O     1 
ATOM   3970 C CB    . LEU D 3 169 ? 19.094  83.456  38.170  1.00 35.12  ? 169 LEU B CB    1 
ATOM   3971 C CG    . LEU D 3 169 ? 19.353  84.826  38.792  1.00 34.60  ? 169 LEU B CG    1 
ATOM   3972 C CD1   . LEU D 3 169 ? 20.817  85.015  39.094  1.00 35.63  ? 169 LEU B CD1   1 
ATOM   3973 C CD2   . LEU D 3 169 ? 18.871  85.884  37.835  1.00 34.88  ? 169 LEU B CD2   1 
ATOM   3974 N N     . GLY D 3 170 ? 18.634  80.434  38.065  1.00 36.58  ? 170 GLY B N     1 
ATOM   3975 C CA    . GLY D 3 170 ? 17.869  79.270  38.458  1.00 37.42  ? 170 GLY B CA    1 
ATOM   3976 C C     . GLY D 3 170 ? 18.766  78.098  38.832  1.00 38.36  ? 170 GLY B C     1 
ATOM   3977 O O     . GLY D 3 170 ? 18.548  77.455  39.864  1.00 40.11  ? 170 GLY B O     1 
ATOM   3978 N N     . VAL D 3 171 ? 19.773  77.807  38.007  1.00 37.29  ? 171 VAL B N     1 
ATOM   3979 C CA    . VAL D 3 171 ? 20.675  76.703  38.293  1.00 35.52  ? 171 VAL B CA    1 
ATOM   3980 C C     . VAL D 3 171 ? 21.516  76.972  39.527  1.00 36.13  ? 171 VAL B C     1 
ATOM   3981 O O     . VAL D 3 171 ? 21.633  76.117  40.391  1.00 36.43  ? 171 VAL B O     1 
ATOM   3982 C CB    . VAL D 3 171 ? 21.605  76.415  37.125  1.00 34.46  ? 171 VAL B CB    1 
ATOM   3983 C CG1   . VAL D 3 171 ? 22.563  75.329  37.494  1.00 34.51  ? 171 VAL B CG1   1 
ATOM   3984 C CG2   . VAL D 3 171 ? 20.808  75.978  35.942  1.00 34.53  ? 171 VAL B CG2   1 
ATOM   3985 N N     . GLU D 3 172 ? 22.099  78.154  39.629  1.00 36.99  ? 172 GLU B N     1 
ATOM   3986 C CA    . GLU D 3 172 ? 22.904  78.444  40.801  1.00 39.44  ? 172 GLU B CA    1 
ATOM   3987 C C     . GLU D 3 172 ? 22.084  78.470  42.091  1.00 39.23  ? 172 GLU B C     1 
ATOM   3988 O O     . GLU D 3 172 ? 22.614  78.225  43.166  1.00 39.18  ? 172 GLU B O     1 
ATOM   3989 C CB    . GLU D 3 172 ? 23.647  79.762  40.621  1.00 43.06  ? 172 GLU B CB    1 
ATOM   3990 C CG    . GLU D 3 172 ? 24.838  79.673  39.671  1.00 47.77  ? 172 GLU B CG    1 
ATOM   3991 C CD    . GLU D 3 172 ? 25.544  81.012  39.475  1.00 51.00  ? 172 GLU B CD    1 
ATOM   3992 O OE1   . GLU D 3 172 ? 26.542  81.041  38.718  1.00 52.50  ? 172 GLU B OE1   1 
ATOM   3993 O OE2   . GLU D 3 172 ? 25.104  82.031  40.073  1.00 52.37  ? 172 GLU B OE2   1 
ATOM   3994 N N     . HIS D 3 173 ? 20.792  78.762  41.994  1.00 39.20  ? 173 HIS B N     1 
ATOM   3995 C CA    . HIS D 3 173 ? 19.933  78.788  43.179  1.00 38.48  ? 173 HIS B CA    1 
ATOM   3996 C C     . HIS D 3 173 ? 19.726  77.362  43.672  1.00 38.60  ? 173 HIS B C     1 
ATOM   3997 O O     . HIS D 3 173 ? 19.905  77.077  44.850  1.00 38.55  ? 173 HIS B O     1 
ATOM   3998 C CB    . HIS D 3 173 ? 18.573  79.419  42.856  1.00 37.36  ? 173 HIS B CB    1 
ATOM   3999 C CG    . HIS D 3 173 ? 17.624  79.451  44.014  1.00 36.00  ? 173 HIS B CG    1 
ATOM   4000 N ND1   . HIS D 3 173 ? 17.867  80.180  45.158  1.00 34.61  ? 173 HIS B ND1   1 
ATOM   4001 C CD2   . HIS D 3 173 ? 16.426  78.850  44.199  1.00 35.16  ? 173 HIS B CD2   1 
ATOM   4002 C CE1   . HIS D 3 173 ? 16.860  80.026  45.996  1.00 33.92  ? 173 HIS B CE1   1 
ATOM   4003 N NE2   . HIS D 3 173 ? 15.972  79.223  45.439  1.00 34.08  ? 173 HIS B NE2   1 
ATOM   4004 N N     . LEU D 3 174 ? 19.350  76.470  42.762  1.00 38.41  ? 174 LEU B N     1 
ATOM   4005 C CA    . LEU D 3 174 ? 19.129  75.073  43.096  1.00 39.50  ? 174 LEU B CA    1 
ATOM   4006 C C     . LEU D 3 174 ? 20.379  74.409  43.654  1.00 41.65  ? 174 LEU B C     1 
ATOM   4007 O O     . LEU D 3 174 ? 20.302  73.624  44.598  1.00 43.64  ? 174 LEU B O     1 
ATOM   4008 C CB    . LEU D 3 174 ? 18.672  74.311  41.863  1.00 37.76  ? 174 LEU B CB    1 
ATOM   4009 C CG    . LEU D 3 174 ? 17.256  74.640  41.432  1.00 37.57  ? 174 LEU B CG    1 
ATOM   4010 C CD1   . LEU D 3 174 ? 16.922  73.917  40.154  1.00 36.49  ? 174 LEU B CD1   1 
ATOM   4011 C CD2   . LEU D 3 174 ? 16.313  74.231  42.542  1.00 38.06  ? 174 LEU B CD2   1 
ATOM   4012 N N     . VAL D 3 175 ? 21.531  74.714  43.064  1.00 42.73  ? 175 VAL B N     1 
ATOM   4013 C CA    . VAL D 3 175 ? 22.792  74.139  43.514  1.00 42.85  ? 175 VAL B CA    1 
ATOM   4014 C C     . VAL D 3 175 ? 23.180  74.640  44.899  1.00 44.26  ? 175 VAL B C     1 
ATOM   4015 O O     . VAL D 3 175 ? 23.601  73.867  45.748  1.00 43.46  ? 175 VAL B O     1 
ATOM   4016 C CB    . VAL D 3 175 ? 23.913  74.457  42.525  1.00 42.30  ? 175 VAL B CB    1 
ATOM   4017 C CG1   . VAL D 3 175 ? 25.259  74.150  43.145  1.00 42.95  ? 175 VAL B CG1   1 
ATOM   4018 C CG2   . VAL D 3 175 ? 23.714  73.655  41.260  1.00 40.51  ? 175 VAL B CG2   1 
ATOM   4019 N N     . ALA D 3 176 ? 23.033  75.937  45.122  1.00 45.96  ? 176 ALA B N     1 
ATOM   4020 C CA    . ALA D 3 176 ? 23.353  76.522  46.414  1.00 48.64  ? 176 ALA B CA    1 
ATOM   4021 C C     . ALA D 3 176 ? 22.494  75.853  47.492  1.00 50.29  ? 176 ALA B C     1 
ATOM   4022 O O     . ALA D 3 176 ? 22.883  75.769  48.659  1.00 51.01  ? 176 ALA B O     1 
ATOM   4023 C CB    . ALA D 3 176 ? 23.097  78.024  46.380  1.00 49.20  ? 176 ALA B CB    1 
ATOM   4024 N N     . LEU D 3 177 ? 21.319  75.379  47.097  1.00 51.65  ? 177 LEU B N     1 
ATOM   4025 C CA    . LEU D 3 177 ? 20.436  74.698  48.030  1.00 52.76  ? 177 LEU B CA    1 
ATOM   4026 C C     . LEU D 3 177 ? 20.923  73.270  48.177  1.00 53.59  ? 177 LEU B C     1 
ATOM   4027 O O     . LEU D 3 177 ? 20.427  72.515  49.002  1.00 54.52  ? 177 LEU B O     1 
ATOM   4028 C CB    . LEU D 3 177 ? 19.000  74.716  47.519  1.00 52.87  ? 177 LEU B CB    1 
ATOM   4029 C CG    . LEU D 3 177 ? 18.050  75.690  48.217  1.00 53.66  ? 177 LEU B CG    1 
ATOM   4030 C CD1   . LEU D 3 177 ? 18.820  76.808  48.917  1.00 53.32  ? 177 LEU B CD1   1 
ATOM   4031 C CD2   . LEU D 3 177 ? 17.083  76.245  47.175  1.00 55.17  ? 177 LEU B CD2   1 
ATOM   4032 N N     . GLY D 3 178 ? 21.897  72.905  47.354  1.00 54.01  ? 178 GLY B N     1 
ATOM   4033 C CA    . GLY D 3 178 ? 22.462  71.575  47.427  1.00 55.82  ? 178 GLY B CA    1 
ATOM   4034 C C     . GLY D 3 178 ? 21.817  70.504  46.578  1.00 56.81  ? 178 GLY B C     1 
ATOM   4035 O O     . GLY D 3 178 ? 22.029  69.321  46.808  1.00 56.42  ? 178 GLY B O     1 
ATOM   4036 N N     . HIS D 3 179 ? 21.035  70.905  45.592  1.00 58.78  ? 179 HIS B N     1 
ATOM   4037 C CA    . HIS D 3 179 ? 20.379  69.939  44.723  1.00 60.89  ? 179 HIS B CA    1 
ATOM   4038 C C     . HIS D 3 179 ? 21.335  69.362  43.668  1.00 61.47  ? 179 HIS B C     1 
ATOM   4039 O O     . HIS D 3 179 ? 22.202  70.067  43.149  1.00 61.85  ? 179 HIS B O     1 
ATOM   4040 C CB    . HIS D 3 179 ? 19.179  70.605  44.056  1.00 62.70  ? 179 HIS B CB    1 
ATOM   4041 C CG    . HIS D 3 179 ? 18.076  70.937  45.011  1.00 64.19  ? 179 HIS B CG    1 
ATOM   4042 N ND1   . HIS D 3 179 ? 17.233  69.979  45.532  1.00 64.85  ? 179 HIS B ND1   1 
ATOM   4043 C CD2   . HIS D 3 179 ? 17.705  72.112  45.576  1.00 65.33  ? 179 HIS B CD2   1 
ATOM   4044 C CE1   . HIS D 3 179 ? 16.390  70.547  46.377  1.00 65.62  ? 179 HIS B CE1   1 
ATOM   4045 N NE2   . HIS D 3 179 ? 16.655  71.841  46.423  1.00 65.93  ? 179 HIS B NE2   1 
ATOM   4046 N N     . GLN D 3 180 ? 21.183  68.074  43.364  1.00 61.44  ? 180 GLN B N     1 
ATOM   4047 C CA    . GLN D 3 180 ? 22.034  67.413  42.370  1.00 61.10  ? 180 GLN B CA    1 
ATOM   4048 C C     . GLN D 3 180 ? 21.181  66.609  41.409  1.00 58.84  ? 180 GLN B C     1 
ATOM   4049 O O     . GLN D 3 180 ? 21.521  66.441  40.249  1.00 57.39  ? 180 GLN B O     1 
ATOM   4050 C CB    . GLN D 3 180 ? 23.056  66.491  43.052  1.00 64.89  ? 180 GLN B CB    1 
ATOM   4051 C CG    . GLN D 3 180 ? 24.051  67.221  43.975  1.00 70.17  ? 180 GLN B CG    1 
ATOM   4052 C CD    . GLN D 3 180 ? 25.137  66.304  44.564  1.00 72.90  ? 180 GLN B CD    1 
ATOM   4053 O OE1   . GLN D 3 180 ? 24.845  65.317  45.254  1.00 74.28  ? 180 GLN B OE1   1 
ATOM   4054 N NE2   . GLN D 3 180 ? 26.399  66.639  44.295  1.00 74.06  ? 180 GLN B NE2   1 
ATOM   4055 N N     . GLN D 3 181 ? 20.063  66.108  41.906  1.00 57.44  ? 181 GLN B N     1 
ATOM   4056 C CA    . GLN D 3 181 ? 19.143  65.330  41.086  1.00 56.16  ? 181 GLN B CA    1 
ATOM   4057 C C     . GLN D 3 181 ? 18.128  66.294  40.459  1.00 53.44  ? 181 GLN B C     1 
ATOM   4058 O O     . GLN D 3 181 ? 16.993  66.413  40.936  1.00 53.65  ? 181 GLN B O     1 
ATOM   4059 C CB    . GLN D 3 181 ? 18.408  64.302  41.963  1.00 59.32  ? 181 GLN B CB    1 
ATOM   4060 C CG    . GLN D 3 181 ? 19.300  63.274  42.665  1.00 61.99  ? 181 GLN B CG    1 
ATOM   4061 C CD    . GLN D 3 181 ? 19.886  62.262  41.691  1.00 63.94  ? 181 GLN B CD    1 
ATOM   4062 O OE1   . GLN D 3 181 ? 19.178  61.397  41.173  1.00 63.91  ? 181 GLN B OE1   1 
ATOM   4063 N NE2   . GLN D 3 181 ? 21.185  62.376  41.427  1.00 65.57  ? 181 GLN B NE2   1 
ATOM   4064 N N     . ILE D 3 182 ? 18.519  66.984  39.395  1.00 48.96  ? 182 ILE B N     1 
ATOM   4065 C CA    . ILE D 3 182 ? 17.610  67.941  38.773  1.00 44.23  ? 182 ILE B CA    1 
ATOM   4066 C C     . ILE D 3 182 ? 17.039  67.433  37.463  1.00 42.66  ? 182 ILE B C     1 
ATOM   4067 O O     . ILE D 3 182 ? 17.716  66.727  36.713  1.00 42.76  ? 182 ILE B O     1 
ATOM   4068 C CB    . ILE D 3 182 ? 18.313  69.275  38.533  1.00 42.55  ? 182 ILE B CB    1 
ATOM   4069 C CG1   . ILE D 3 182 ? 18.813  69.827  39.861  1.00 41.91  ? 182 ILE B CG1   1 
ATOM   4070 C CG2   . ILE D 3 182 ? 17.366  70.253  37.909  1.00 41.51  ? 182 ILE B CG2   1 
ATOM   4071 C CD1   . ILE D 3 182 ? 19.743  70.998  39.730  1.00 41.58  ? 182 ILE B CD1   1 
ATOM   4072 N N     . ALA D 3 183 ? 15.779  67.781  37.213  1.00 40.12  ? 183 ALA B N     1 
ATOM   4073 C CA    . ALA D 3 183 ? 15.067  67.382  35.999  1.00 37.51  ? 183 ALA B CA    1 
ATOM   4074 C C     . ALA D 3 183 ? 14.735  68.653  35.254  1.00 36.25  ? 183 ALA B C     1 
ATOM   4075 O O     . ALA D 3 183 ? 14.689  69.718  35.845  1.00 36.72  ? 183 ALA B O     1 
ATOM   4076 C CB    . ALA D 3 183 ? 13.784  66.638  36.349  1.00 37.12  ? 183 ALA B CB    1 
ATOM   4077 N N     . LEU D 3 184 ? 14.490  68.555  33.960  1.00 34.65  ? 184 LEU B N     1 
ATOM   4078 C CA    . LEU D 3 184 ? 14.187  69.750  33.197  1.00 33.11  ? 184 LEU B CA    1 
ATOM   4079 C C     . LEU D 3 184 ? 12.885  69.621  32.426  1.00 32.58  ? 184 LEU B C     1 
ATOM   4080 O O     . LEU D 3 184 ? 12.626  68.605  31.796  1.00 32.93  ? 184 LEU B O     1 
ATOM   4081 C CB    . LEU D 3 184 ? 15.328  70.047  32.220  1.00 32.24  ? 184 LEU B CB    1 
ATOM   4082 C CG    . LEU D 3 184 ? 16.734  70.189  32.788  1.00 31.88  ? 184 LEU B CG    1 
ATOM   4083 C CD1   . LEU D 3 184 ? 17.686  70.422  31.649  1.00 32.65  ? 184 LEU B CD1   1 
ATOM   4084 C CD2   . LEU D 3 184 ? 16.795  71.334  33.773  1.00 32.14  ? 184 LEU B CD2   1 
ATOM   4085 N N     . LEU D 3 185 ? 12.064  70.657  32.479  1.00 32.10  ? 185 LEU B N     1 
ATOM   4086 C CA    . LEU D 3 185 ? 10.806  70.664  31.754  1.00 32.29  ? 185 LEU B CA    1 
ATOM   4087 C C     . LEU D 3 185 ? 10.864  71.894  30.865  1.00 32.08  ? 185 LEU B C     1 
ATOM   4088 O O     . LEU D 3 185 ? 10.616  73.004  31.320  1.00 31.94  ? 185 LEU B O     1 
ATOM   4089 C CB    . LEU D 3 185 ? 9.642   70.753  32.739  1.00 32.74  ? 185 LEU B CB    1 
ATOM   4090 C CG    . LEU D 3 185 ? 8.218   70.730  32.187  1.00 33.89  ? 185 LEU B CG    1 
ATOM   4091 C CD1   . LEU D 3 185 ? 8.071   69.641  31.151  1.00 34.77  ? 185 LEU B CD1   1 
ATOM   4092 C CD2   . LEU D 3 185 ? 7.248   70.506  33.327  1.00 33.51  ? 185 LEU B CD2   1 
ATOM   4093 N N     . ALA D 3 186 ? 11.207  71.706  29.598  1.00 32.53  ? 186 ALA B N     1 
ATOM   4094 C CA    . ALA D 3 186 ? 11.332  72.842  28.702  1.00 33.41  ? 186 ALA B CA    1 
ATOM   4095 C C     . ALA D 3 186 ? 10.119  73.084  27.858  1.00 34.08  ? 186 ALA B C     1 
ATOM   4096 O O     . ALA D 3 186 ? 9.334   72.171  27.608  1.00 34.14  ? 186 ALA B O     1 
ATOM   4097 C CB    . ALA D 3 186 ? 12.521  72.669  27.812  1.00 34.43  ? 186 ALA B CB    1 
ATOM   4098 N N     . GLY D 3 187 ? 9.988   74.328  27.410  1.00 34.66  ? 187 GLY B N     1 
ATOM   4099 C CA    . GLY D 3 187 ? 8.866   74.709  26.580  1.00 35.86  ? 187 GLY B CA    1 
ATOM   4100 C C     . GLY D 3 187 ? 8.947   73.981  25.267  1.00 36.69  ? 187 GLY B C     1 
ATOM   4101 O O     . GLY D 3 187 ? 9.877   73.220  25.064  1.00 37.71  ? 187 GLY B O     1 
ATOM   4102 N N     . PRO D 3 188 ? 8.000   74.188  24.353  1.00 37.43  ? 188 PRO B N     1 
ATOM   4103 C CA    . PRO D 3 188 ? 8.027   73.506  23.057  1.00 38.83  ? 188 PRO B CA    1 
ATOM   4104 C C     . PRO D 3 188 ? 9.252   73.918  22.245  1.00 39.57  ? 188 PRO B C     1 
ATOM   4105 O O     . PRO D 3 188 ? 9.561   75.093  22.127  1.00 39.50  ? 188 PRO B O     1 
ATOM   4106 C CB    . PRO D 3 188 ? 6.725   73.943  22.415  1.00 38.53  ? 188 PRO B CB    1 
ATOM   4107 C CG    . PRO D 3 188 ? 6.580   75.332  22.940  1.00 38.75  ? 188 PRO B CG    1 
ATOM   4108 C CD    . PRO D 3 188 ? 6.924   75.185  24.397  1.00 37.89  ? 188 PRO B CD    1 
ATOM   4109 N N     . LEU D 3 189 ? 9.946   72.930  21.694  1.00 40.91  ? 189 LEU B N     1 
ATOM   4110 C CA    . LEU D 3 189 ? 11.157  73.149  20.915  1.00 41.03  ? 189 LEU B CA    1 
ATOM   4111 C C     . LEU D 3 189 ? 10.934  73.925  19.641  1.00 41.08  ? 189 LEU B C     1 
ATOM   4112 O O     . LEU D 3 189 ? 11.891  74.286  18.960  1.00 41.58  ? 189 LEU B O     1 
ATOM   4113 C CB    . LEU D 3 189 ? 11.809  71.811  20.582  1.00 41.88  ? 189 LEU B CB    1 
ATOM   4114 C CG    . LEU D 3 189 ? 12.940  71.314  21.484  1.00 42.39  ? 189 LEU B CG    1 
ATOM   4115 C CD1   . LEU D 3 189 ? 12.847  71.882  22.892  1.00 42.07  ? 189 LEU B CD1   1 
ATOM   4116 C CD2   . LEU D 3 189 ? 12.874  69.799  21.495  1.00 43.46  ? 189 LEU B CD2   1 
ATOM   4117 N N     . SER D 3 190 ? 9.676   74.174  19.304  1.00 40.46  ? 190 SER B N     1 
ATOM   4118 C CA    . SER D 3 190 ? 9.387   74.943  18.104  1.00 40.04  ? 190 SER B CA    1 
ATOM   4119 C C     . SER D 3 190 ? 9.550   76.418  18.444  1.00 39.41  ? 190 SER B C     1 
ATOM   4120 O O     . SER D 3 190 ? 9.528   77.276  17.570  1.00 38.66  ? 190 SER B O     1 
ATOM   4121 C CB    . SER D 3 190 ? 7.966   74.676  17.626  1.00 41.04  ? 190 SER B CB    1 
ATOM   4122 O OG    . SER D 3 190 ? 7.030   75.021  18.626  1.00 41.54  ? 190 SER B OG    1 
ATOM   4123 N N     . SER D 3 191 ? 9.718   76.706  19.729  1.00 39.44  ? 191 SER B N     1 
ATOM   4124 C CA    . SER D 3 191 ? 9.899   78.082  20.188  1.00 39.06  ? 191 SER B CA    1 
ATOM   4125 C C     . SER D 3 191 ? 11.334  78.445  20.537  1.00 38.25  ? 191 SER B C     1 
ATOM   4126 O O     . SER D 3 191 ? 11.929  77.919  21.482  1.00 37.79  ? 191 SER B O     1 
ATOM   4127 C CB    . SER D 3 191 ? 9.034   78.375  21.411  1.00 40.01  ? 191 SER B CB    1 
ATOM   4128 O OG    . SER D 3 191 ? 9.395   79.623  21.992  1.00 39.34  ? 191 SER B OG    1 
ATOM   4129 N N     . VAL D 3 192 ? 11.872  79.371  19.763  1.00 36.94  ? 192 VAL B N     1 
ATOM   4130 C CA    . VAL D 3 192 ? 13.218  79.853  19.965  1.00 36.12  ? 192 VAL B CA    1 
ATOM   4131 C C     . VAL D 3 192 ? 13.501  80.062  21.436  1.00 36.05  ? 192 VAL B C     1 
ATOM   4132 O O     . VAL D 3 192 ? 14.452  79.516  21.983  1.00 35.73  ? 192 VAL B O     1 
ATOM   4133 C CB    . VAL D 3 192 ? 13.406  81.184  19.254  1.00 36.07  ? 192 VAL B CB    1 
ATOM   4134 C CG1   . VAL D 3 192 ? 14.735  81.800  19.627  1.00 35.70  ? 192 VAL B CG1   1 
ATOM   4135 C CG2   . VAL D 3 192 ? 13.305  80.971  17.763  1.00 37.11  ? 192 VAL B CG2   1 
ATOM   4136 N N     . SER D 3 193 ? 12.660  80.849  22.085  1.00 36.28  ? 193 SER B N     1 
ATOM   4137 C CA    . SER D 3 193 ? 12.869  81.138  23.492  1.00 36.33  ? 193 SER B CA    1 
ATOM   4138 C C     . SER D 3 193 ? 12.833  79.908  24.391  1.00 36.02  ? 193 SER B C     1 
ATOM   4139 O O     . SER D 3 193 ? 13.449  79.895  25.457  1.00 35.66  ? 193 SER B O     1 
ATOM   4140 C CB    . SER D 3 193 ? 11.863  82.177  23.980  1.00 36.49  ? 193 SER B CB    1 
ATOM   4141 O OG    . SER D 3 193 ? 12.275  82.707  25.228  1.00 35.94  ? 193 SER B OG    1 
ATOM   4142 N N     . ALA D 3 194 ? 12.124  78.868  23.981  1.00 35.70  ? 194 ALA B N     1 
ATOM   4143 C CA    . ALA D 3 194 ? 12.096  77.672  24.811  1.00 35.18  ? 194 ALA B CA    1 
ATOM   4144 C C     . ALA D 3 194 ? 13.490  77.077  24.758  1.00 33.75  ? 194 ALA B C     1 
ATOM   4145 O O     . ALA D 3 194 ? 14.091  76.743  25.783  1.00 32.57  ? 194 ALA B O     1 
ATOM   4146 C CB    . ALA D 3 194 ? 11.076  76.672  24.273  1.00 36.30  ? 194 ALA B CB    1 
ATOM   4147 N N     . ARG D 3 195 ? 13.994  76.975  23.535  1.00 32.03  ? 195 ARG B N     1 
ATOM   4148 C CA    . ARG D 3 195 ? 15.305  76.415  23.283  1.00 30.70  ? 195 ARG B CA    1 
ATOM   4149 C C     . ARG D 3 195 ? 16.408  77.166  24.016  1.00 30.30  ? 195 ARG B C     1 
ATOM   4150 O O     . ARG D 3 195 ? 17.239  76.545  24.687  1.00 30.85  ? 195 ARG B O     1 
ATOM   4151 C CB    . ARG D 3 195 ? 15.596  76.395  21.774  1.00 29.43  ? 195 ARG B CB    1 
ATOM   4152 C CG    . ARG D 3 195 ? 14.596  75.595  20.949  1.00 27.63  ? 195 ARG B CG    1 
ATOM   4153 C CD    . ARG D 3 195 ? 15.154  75.271  19.570  1.00 27.21  ? 195 ARG B CD    1 
ATOM   4154 N NE    . ARG D 3 195 ? 15.424  76.444  18.732  1.00 26.21  ? 195 ARG B NE    1 
ATOM   4155 C CZ    . ARG D 3 195 ? 14.584  76.948  17.828  1.00 24.71  ? 195 ARG B CZ    1 
ATOM   4156 N NH1   . ARG D 3 195 ? 13.397  76.396  17.624  1.00 23.12  ? 195 ARG B NH1   1 
ATOM   4157 N NH2   . ARG D 3 195 ? 14.942  78.002  17.112  1.00 24.08  ? 195 ARG B NH2   1 
ATOM   4158 N N     . LEU D 3 196 ? 16.417  78.494  23.892  1.00 29.08  ? 196 LEU B N     1 
ATOM   4159 C CA    . LEU D 3 196 ? 17.437  79.301  24.544  1.00 28.49  ? 196 LEU B CA    1 
ATOM   4160 C C     . LEU D 3 196 ? 17.509  78.944  26.013  1.00 29.13  ? 196 LEU B C     1 
ATOM   4161 O O     . LEU D 3 196 ? 18.593  78.741  26.563  1.00 29.22  ? 196 LEU B O     1 
ATOM   4162 C CB    . LEU D 3 196 ? 17.135  80.785  24.384  1.00 27.05  ? 196 LEU B CB    1 
ATOM   4163 C CG    . LEU D 3 196 ? 17.286  81.295  22.961  1.00 26.97  ? 196 LEU B CG    1 
ATOM   4164 C CD1   . LEU D 3 196 ? 16.914  82.730  22.873  1.00 28.38  ? 196 LEU B CD1   1 
ATOM   4165 C CD2   . LEU D 3 196 ? 18.697  81.149  22.547  1.00 27.65  ? 196 LEU B CD2   1 
ATOM   4166 N N     . ARG D 3 197 ? 16.349  78.843  26.645  1.00 29.97  ? 197 ARG B N     1 
ATOM   4167 C CA    . ARG D 3 197 ? 16.299  78.504  28.052  1.00 31.45  ? 197 ARG B CA    1 
ATOM   4168 C C     . ARG D 3 197 ? 16.775  77.079  28.312  1.00 32.44  ? 197 ARG B C     1 
ATOM   4169 O O     . ARG D 3 197 ? 17.408  76.817  29.340  1.00 33.06  ? 197 ARG B O     1 
ATOM   4170 C CB    . ARG D 3 197 ? 14.885  78.689  28.569  1.00 31.34  ? 197 ARG B CB    1 
ATOM   4171 C CG    . ARG D 3 197 ? 14.411  80.113  28.471  1.00 31.11  ? 197 ARG B CG    1 
ATOM   4172 C CD    . ARG D 3 197 ? 12.970  80.237  28.879  1.00 30.78  ? 197 ARG B CD    1 
ATOM   4173 N NE    . ARG D 3 197 ? 12.433  81.554  28.574  1.00 31.55  ? 197 ARG B NE    1 
ATOM   4174 C CZ    . ARG D 3 197 ? 11.139  81.834  28.597  1.00 32.15  ? 197 ARG B CZ    1 
ATOM   4175 N NH1   . ARG D 3 197 ? 10.268  80.886  28.908  1.00 32.17  ? 197 ARG B NH1   1 
ATOM   4176 N NH2   . ARG D 3 197 ? 10.716  83.053  28.310  1.00 31.93  ? 197 ARG B NH2   1 
ATOM   4177 N N     . LEU D 3 198 ? 16.473  76.154  27.397  1.00 33.00  ? 198 LEU B N     1 
ATOM   4178 C CA    . LEU D 3 198 ? 16.920  74.772  27.570  1.00 33.56  ? 198 LEU B CA    1 
ATOM   4179 C C     . LEU D 3 198 ? 18.439  74.826  27.539  1.00 33.88  ? 198 LEU B C     1 
ATOM   4180 O O     . LEU D 3 198 ? 19.115  74.317  28.431  1.00 34.86  ? 198 LEU B O     1 
ATOM   4181 C CB    . LEU D 3 198 ? 16.429  73.875  26.433  1.00 32.14  ? 198 LEU B CB    1 
ATOM   4182 C CG    . LEU D 3 198 ? 16.223  72.385  26.760  1.00 32.09  ? 198 LEU B CG    1 
ATOM   4183 C CD1   . LEU D 3 198 ? 16.110  71.603  25.472  1.00 31.27  ? 198 LEU B CD1   1 
ATOM   4184 C CD2   . LEU D 3 198 ? 17.363  71.830  27.582  1.00 31.06  ? 198 LEU B CD2   1 
ATOM   4185 N N     . ALA D 3 199 ? 18.972  75.462  26.505  1.00 34.71  ? 199 ALA B N     1 
ATOM   4186 C CA    . ALA D 3 199 ? 20.411  75.586  26.376  1.00 35.49  ? 199 ALA B CA    1 
ATOM   4187 C C     . ALA D 3 199 ? 20.953  76.193  27.659  1.00 35.69  ? 199 ALA B C     1 
ATOM   4188 O O     . ALA D 3 199 ? 21.806  75.612  28.330  1.00 35.82  ? 199 ALA B O     1 
ATOM   4189 C CB    . ALA D 3 199 ? 20.752  76.462  25.196  1.00 36.10  ? 199 ALA B CB    1 
ATOM   4190 N N     . GLY D 3 200 ? 20.449  77.366  28.002  1.00 35.59  ? 200 GLY B N     1 
ATOM   4191 C CA    . GLY D 3 200 ? 20.905  78.007  29.213  1.00 37.54  ? 200 GLY B CA    1 
ATOM   4192 C C     . GLY D 3 200 ? 21.083  77.010  30.342  1.00 38.40  ? 200 GLY B C     1 
ATOM   4193 O O     . GLY D 3 200 ? 22.147  76.943  30.955  1.00 39.01  ? 200 GLY B O     1 
ATOM   4194 N N     . TRP D 3 201 ? 20.050  76.219  30.611  1.00 39.21  ? 201 TRP B N     1 
ATOM   4195 C CA    . TRP D 3 201 ? 20.134  75.246  31.686  1.00 40.16  ? 201 TRP B CA    1 
ATOM   4196 C C     . TRP D 3 201 ? 21.267  74.272  31.483  1.00 41.16  ? 201 TRP B C     1 
ATOM   4197 O O     . TRP D 3 201 ? 22.078  74.052  32.376  1.00 42.26  ? 201 TRP B O     1 
ATOM   4198 C CB    . TRP D 3 201 ? 18.840  74.467  31.820  1.00 39.24  ? 201 TRP B CB    1 
ATOM   4199 C CG    . TRP D 3 201 ? 17.704  75.275  32.295  1.00 38.46  ? 201 TRP B CG    1 
ATOM   4200 C CD1   . TRP D 3 201 ? 17.739  76.300  33.191  1.00 38.43  ? 201 TRP B CD1   1 
ATOM   4201 C CD2   . TRP D 3 201 ? 16.338  75.068  31.972  1.00 38.35  ? 201 TRP B CD2   1 
ATOM   4202 N NE1   . TRP D 3 201 ? 16.472  76.742  33.454  1.00 38.04  ? 201 TRP B NE1   1 
ATOM   4203 C CE2   . TRP D 3 201 ? 15.588  75.999  32.717  1.00 38.52  ? 201 TRP B CE2   1 
ATOM   4204 C CE3   . TRP D 3 201 ? 15.667  74.177  31.125  1.00 38.61  ? 201 TRP B CE3   1 
ATOM   4205 C CZ2   . TRP D 3 201 ? 14.195  76.071  32.641  1.00 39.45  ? 201 TRP B CZ2   1 
ATOM   4206 C CZ3   . TRP D 3 201 ? 14.285  74.244  31.045  1.00 39.16  ? 201 TRP B CZ3   1 
ATOM   4207 C CH2   . TRP D 3 201 ? 13.561  75.186  31.802  1.00 39.28  ? 201 TRP B CH2   1 
ATOM   4208 N N     . HIS D 3 202 ? 21.322  73.666  30.311  1.00 41.42  ? 202 HIS B N     1 
ATOM   4209 C CA    . HIS D 3 202 ? 22.390  72.724  30.052  1.00 41.56  ? 202 HIS B CA    1 
ATOM   4210 C C     . HIS D 3 202 ? 23.719  73.409  30.300  1.00 41.49  ? 202 HIS B C     1 
ATOM   4211 O O     . HIS D 3 202 ? 24.555  72.898  31.042  1.00 41.89  ? 202 HIS B O     1 
ATOM   4212 C CB    . HIS D 3 202 ? 22.316  72.199  28.619  1.00 41.16  ? 202 HIS B CB    1 
ATOM   4213 C CG    . HIS D 3 202 ? 21.405  71.025  28.462  1.00 40.51  ? 202 HIS B CG    1 
ATOM   4214 N ND1   . HIS D 3 202 ? 20.476  70.931  27.450  1.00 40.29  ? 202 HIS B ND1   1 
ATOM   4215 C CD2   . HIS D 3 202 ? 21.277  69.898  29.198  1.00 40.74  ? 202 HIS B CD2   1 
ATOM   4216 C CE1   . HIS D 3 202 ? 19.811  69.797  27.571  1.00 40.79  ? 202 HIS B CE1   1 
ATOM   4217 N NE2   . HIS D 3 202 ? 20.278  69.152  28.624  1.00 41.39  ? 202 HIS B NE2   1 
ATOM   4218 N N     . LYS D 3 203 ? 23.905  74.582  29.710  1.00 41.10  ? 203 LYS B N     1 
ATOM   4219 C CA    . LYS D 3 203 ? 25.152  75.291  29.894  1.00 41.84  ? 203 LYS B CA    1 
ATOM   4220 C C     . LYS D 3 203 ? 25.624  75.369  31.344  1.00 42.23  ? 203 LYS B C     1 
ATOM   4221 O O     . LYS D 3 203 ? 26.678  74.842  31.685  1.00 43.59  ? 203 LYS B O     1 
ATOM   4222 C CB    . LYS D 3 203 ? 25.061  76.702  29.337  1.00 42.11  ? 203 LYS B CB    1 
ATOM   4223 C CG    . LYS D 3 203 ? 26.299  77.512  29.682  1.00 43.34  ? 203 LYS B CG    1 
ATOM   4224 C CD    . LYS D 3 203 ? 26.312  78.873  29.035  1.00 44.20  ? 203 LYS B CD    1 
ATOM   4225 C CE    . LYS D 3 203 ? 27.473  79.674  29.582  1.00 45.06  ? 203 LYS B CE    1 
ATOM   4226 N NZ    . LYS D 3 203 ? 27.528  81.045  29.024  1.00 46.98  ? 203 LYS B NZ    1 
ATOM   4227 N N     . TYR D 3 204 ? 24.854  76.023  32.202  1.00 41.69  ? 204 TYR B N     1 
ATOM   4228 C CA    . TYR D 3 204 ? 25.260  76.161  33.590  1.00 41.39  ? 204 TYR B CA    1 
ATOM   4229 C C     . TYR D 3 204 ? 25.160  74.928  34.437  1.00 41.61  ? 204 TYR B C     1 
ATOM   4230 O O     . TYR D 3 204 ? 25.825  74.829  35.454  1.00 41.56  ? 204 TYR B O     1 
ATOM   4231 C CB    . TYR D 3 204 ? 24.494  77.282  34.243  1.00 40.69  ? 204 TYR B CB    1 
ATOM   4232 C CG    . TYR D 3 204 ? 24.814  78.587  33.591  1.00 40.48  ? 204 TYR B CG    1 
ATOM   4233 C CD1   . TYR D 3 204 ? 24.179  78.969  32.422  1.00 40.45  ? 204 TYR B CD1   1 
ATOM   4234 C CD2   . TYR D 3 204 ? 25.807  79.416  34.106  1.00 41.20  ? 204 TYR B CD2   1 
ATOM   4235 C CE1   . TYR D 3 204 ? 24.524  80.145  31.776  1.00 41.32  ? 204 TYR B CE1   1 
ATOM   4236 C CE2   . TYR D 3 204 ? 26.162  80.597  33.468  1.00 41.63  ? 204 TYR B CE2   1 
ATOM   4237 C CZ    . TYR D 3 204 ? 25.516  80.956  32.302  1.00 41.59  ? 204 TYR B CZ    1 
ATOM   4238 O OH    . TYR D 3 204 ? 25.857  82.127  31.667  1.00 41.76  ? 204 TYR B OH    1 
ATOM   4239 N N     . LEU D 3 205 ? 24.316  73.989  34.042  1.00 43.01  ? 205 LEU B N     1 
ATOM   4240 C CA    . LEU D 3 205 ? 24.221  72.757  34.803  1.00 45.25  ? 205 LEU B CA    1 
ATOM   4241 C C     . LEU D 3 205 ? 25.569  72.074  34.617  1.00 47.79  ? 205 LEU B C     1 
ATOM   4242 O O     . LEU D 3 205 ? 26.141  71.512  35.557  1.00 49.53  ? 205 LEU B O     1 
ATOM   4243 C CB    . LEU D 3 205 ? 23.090  71.863  34.285  1.00 43.25  ? 205 LEU B CB    1 
ATOM   4244 C CG    . LEU D 3 205 ? 21.728  72.150  34.913  1.00 41.84  ? 205 LEU B CG    1 
ATOM   4245 C CD1   . LEU D 3 205 ? 20.749  71.131  34.419  1.00 41.83  ? 205 LEU B CD1   1 
ATOM   4246 C CD2   . LEU D 3 205 ? 21.809  72.091  36.427  1.00 40.42  ? 205 LEU B CD2   1 
ATOM   4247 N N     . THR D 3 206 ? 26.082  72.150  33.395  1.00 49.22  ? 206 THR B N     1 
ATOM   4248 C CA    . THR D 3 206 ? 27.369  71.561  33.066  1.00 49.94  ? 206 THR B CA    1 
ATOM   4249 C C     . THR D 3 206 ? 28.496  72.186  33.900  1.00 51.82  ? 206 THR B C     1 
ATOM   4250 O O     . THR D 3 206 ? 29.267  71.462  34.522  1.00 52.22  ? 206 THR B O     1 
ATOM   4251 C CB    . THR D 3 206 ? 27.653  71.708  31.553  1.00 49.03  ? 206 THR B CB    1 
ATOM   4252 O OG1   . THR D 3 206 ? 26.934  70.699  30.833  1.00 46.82  ? 206 THR B OG1   1 
ATOM   4253 C CG2   . THR D 3 206 ? 29.120  71.573  31.259  1.00 48.59  ? 206 THR B CG2   1 
ATOM   4254 N N     . ARG D 3 207 ? 28.584  73.512  33.942  1.00 53.43  ? 207 ARG B N     1 
ATOM   4255 C CA    . ARG D 3 207 ? 29.633  74.154  34.724  1.00 56.37  ? 207 ARG B CA    1 
ATOM   4256 C C     . ARG D 3 207 ? 29.644  73.766  36.202  1.00 56.69  ? 207 ARG B C     1 
ATOM   4257 O O     . ARG D 3 207 ? 30.580  74.101  36.925  1.00 56.80  ? 207 ARG B O     1 
ATOM   4258 C CB    . ARG D 3 207 ? 29.542  75.673  34.623  1.00 59.80  ? 207 ARG B CB    1 
ATOM   4259 C CG    . ARG D 3 207 ? 30.069  76.261  33.336  1.00 65.26  ? 207 ARG B CG    1 
ATOM   4260 C CD    . ARG D 3 207 ? 30.216  77.784  33.456  1.00 70.65  ? 207 ARG B CD    1 
ATOM   4261 N NE    . ARG D 3 207 ? 30.499  78.413  32.158  1.00 75.62  ? 207 ARG B NE    1 
ATOM   4262 C CZ    . ARG D 3 207 ? 30.562  79.733  31.944  1.00 77.72  ? 207 ARG B CZ    1 
ATOM   4263 N NH1   . ARG D 3 207 ? 30.363  80.594  32.952  1.00 78.62  ? 207 ARG B NH1   1 
ATOM   4264 N NH2   . ARG D 3 207 ? 30.819  80.197  30.716  1.00 78.00  ? 207 ARG B NH2   1 
ATOM   4265 N N     . ASN D 3 208 ? 28.606  73.086  36.669  1.00 57.43  ? 208 ASN B N     1 
ATOM   4266 C CA    . ASN D 3 208 ? 28.582  72.669  38.065  1.00 59.03  ? 208 ASN B CA    1 
ATOM   4267 C C     . ASN D 3 208 ? 28.654  71.156  38.134  1.00 59.98  ? 208 ASN B C     1 
ATOM   4268 O O     . ASN D 3 208 ? 28.382  70.545  39.171  1.00 60.57  ? 208 ASN B O     1 
ATOM   4269 C CB    . ASN D 3 208 ? 27.332  73.185  38.781  1.00 58.28  ? 208 ASN B CB    1 
ATOM   4270 C CG    . ASN D 3 208 ? 27.429  74.656  39.116  1.00 58.31  ? 208 ASN B CG    1 
ATOM   4271 O OD1   . ASN D 3 208 ? 27.294  75.513  38.243  1.00 58.77  ? 208 ASN B OD1   1 
ATOM   4272 N ND2   . ASN D 3 208 ? 27.684  74.958  40.384  1.00 57.24  ? 208 ASN B ND2   1 
ATOM   4273 N N     . GLN D 3 209 ? 29.048  70.568  37.009  1.00 61.52  ? 209 GLN B N     1 
ATOM   4274 C CA    . GLN D 3 209 ? 29.199  69.126  36.867  1.00 63.51  ? 209 GLN B CA    1 
ATOM   4275 C C     . GLN D 3 209 ? 27.938  68.371  37.271  1.00 63.61  ? 209 GLN B C     1 
ATOM   4276 O O     . GLN D 3 209 ? 27.990  67.439  38.080  1.00 64.24  ? 209 GLN B O     1 
ATOM   4277 C CB    . GLN D 3 209 ? 30.390  68.627  37.694  1.00 65.66  ? 209 GLN B CB    1 
ATOM   4278 C CG    . GLN D 3 209 ? 31.695  69.359  37.414  1.00 69.61  ? 209 GLN B CG    1 
ATOM   4279 C CD    . GLN D 3 209 ? 32.332  69.932  38.687  1.00 72.86  ? 209 GLN B CD    1 
ATOM   4280 O OE1   . GLN D 3 209 ? 32.847  69.188  39.533  1.00 74.60  ? 209 GLN B OE1   1 
ATOM   4281 N NE2   . GLN D 3 209 ? 32.289  71.261  38.830  1.00 74.21  ? 209 GLN B NE2   1 
ATOM   4282 N N     . ILE D 3 210 ? 26.806  68.777  36.704  1.00 63.05  ? 210 ILE B N     1 
ATOM   4283 C CA    . ILE D 3 210 ? 25.539  68.122  36.984  1.00 62.31  ? 210 ILE B CA    1 
ATOM   4284 C C     . ILE D 3 210 ? 24.866  67.732  35.678  1.00 62.30  ? 210 ILE B C     1 
ATOM   4285 O O     . ILE D 3 210 ? 24.965  68.441  34.680  1.00 61.86  ? 210 ILE B O     1 
ATOM   4286 C CB    . ILE D 3 210 ? 24.593  69.037  37.748  1.00 62.56  ? 210 ILE B CB    1 
ATOM   4287 C CG1   . ILE D 3 210 ? 25.193  69.386  39.105  1.00 63.27  ? 210 ILE B CG1   1 
ATOM   4288 C CG2   . ILE D 3 210 ? 23.262  68.355  37.925  1.00 63.11  ? 210 ILE B CG2   1 
ATOM   4289 C CD1   . ILE D 3 210 ? 24.321  70.310  39.940  1.00 64.89  ? 210 ILE B CD1   1 
ATOM   4290 N N     . GLN D 3 211 ? 24.192  66.593  35.679  1.00 62.48  ? 211 GLN B N     1 
ATOM   4291 C CA    . GLN D 3 211 ? 23.496  66.145  34.484  1.00 62.47  ? 211 GLN B CA    1 
ATOM   4292 C C     . GLN D 3 211 ? 22.038  65.927  34.817  1.00 60.51  ? 211 GLN B C     1 
ATOM   4293 O O     . GLN D 3 211 ? 21.703  65.203  35.754  1.00 60.62  ? 211 GLN B O     1 
ATOM   4294 C CB    . GLN D 3 211 ? 24.084  64.841  33.957  1.00 65.60  ? 211 GLN B CB    1 
ATOM   4295 C CG    . GLN D 3 211 ? 25.497  64.955  33.404  1.00 70.47  ? 211 GLN B CG    1 
ATOM   4296 C CD    . GLN D 3 211 ? 26.041  63.608  32.913  1.00 73.40  ? 211 GLN B CD    1 
ATOM   4297 O OE1   . GLN D 3 211 ? 25.413  62.945  32.069  1.00 74.54  ? 211 GLN B OE1   1 
ATOM   4298 N NE2   . GLN D 3 211 ? 27.210  63.195  33.439  1.00 73.89  ? 211 GLN B NE2   1 
ATOM   4299 N N     . PRO D 3 212 ? 21.143  66.559  34.058  1.00 58.56  ? 212 PRO B N     1 
ATOM   4300 C CA    . PRO D 3 212 ? 19.724  66.380  34.336  1.00 56.71  ? 212 PRO B CA    1 
ATOM   4301 C C     . PRO D 3 212 ? 19.374  64.902  34.317  1.00 55.22  ? 212 PRO B C     1 
ATOM   4302 O O     . PRO D 3 212 ? 19.700  64.189  33.372  1.00 54.80  ? 212 PRO B O     1 
ATOM   4303 C CB    . PRO D 3 212 ? 19.054  67.175  33.213  1.00 57.11  ? 212 PRO B CB    1 
ATOM   4304 C CG    . PRO D 3 212 ? 20.056  67.131  32.104  1.00 57.28  ? 212 PRO B CG    1 
ATOM   4305 C CD    . PRO D 3 212 ? 21.343  67.363  32.843  1.00 58.05  ? 212 PRO B CD    1 
ATOM   4306 N N     . ILE D 3 213 ? 18.727  64.437  35.371  1.00 53.60  ? 213 ILE B N     1 
ATOM   4307 C CA    . ILE D 3 213 ? 18.356  63.044  35.430  1.00 52.91  ? 213 ILE B CA    1 
ATOM   4308 C C     . ILE D 3 213 ? 17.077  62.821  34.635  1.00 52.63  ? 213 ILE B C     1 
ATOM   4309 O O     . ILE D 3 213 ? 16.537  61.724  34.610  1.00 52.46  ? 213 ILE B O     1 
ATOM   4310 C CB    . ILE D 3 213 ? 18.156  62.609  36.877  1.00 53.73  ? 213 ILE B CB    1 
ATOM   4311 C CG1   . ILE D 3 213 ? 16.821  63.116  37.398  1.00 54.48  ? 213 ILE B CG1   1 
ATOM   4312 C CG2   . ILE D 3 213 ? 19.250  63.215  37.751  1.00 53.70  ? 213 ILE B CG2   1 
ATOM   4313 C CD1   . ILE D 3 213 ? 16.477  62.573  38.776  1.00 55.53  ? 213 ILE B CD1   1 
ATOM   4314 N N     . ALA D 3 214 ? 16.605  63.877  33.979  1.00 52.91  ? 214 ALA B N     1 
ATOM   4315 C CA    . ALA D 3 214 ? 15.387  63.824  33.164  1.00 53.27  ? 214 ALA B CA    1 
ATOM   4316 C C     . ALA D 3 214 ? 15.163  65.128  32.388  1.00 53.56  ? 214 ALA B C     1 
ATOM   4317 O O     . ALA D 3 214 ? 15.434  66.216  32.894  1.00 53.89  ? 214 ALA B O     1 
ATOM   4318 C CB    . ALA D 3 214 ? 14.192  63.540  34.043  1.00 53.43  ? 214 ALA B CB    1 
ATOM   4319 N N     . GLU D 3 215 ? 14.645  65.024  31.171  1.00 53.26  ? 215 GLU B N     1 
ATOM   4320 C CA    . GLU D 3 215 ? 14.427  66.209  30.357  1.00 53.64  ? 215 GLU B CA    1 
ATOM   4321 C C     . GLU D 3 215 ? 13.193  66.034  29.473  1.00 53.56  ? 215 GLU B C     1 
ATOM   4322 O O     . GLU D 3 215 ? 13.229  65.277  28.514  1.00 52.89  ? 215 GLU B O     1 
ATOM   4323 C CB    . GLU D 3 215 ? 15.691  66.443  29.531  1.00 55.04  ? 215 GLU B CB    1 
ATOM   4324 C CG    . GLU D 3 215 ? 15.650  67.548  28.494  1.00 57.70  ? 215 GLU B CG    1 
ATOM   4325 C CD    . GLU D 3 215 ? 16.999  67.717  27.773  1.00 58.80  ? 215 GLU B CD    1 
ATOM   4326 O OE1   . GLU D 3 215 ? 17.029  68.355  26.695  1.00 59.51  ? 215 GLU B OE1   1 
ATOM   4327 O OE2   . GLU D 3 215 ? 18.031  67.217  28.285  1.00 58.59  ? 215 GLU B OE2   1 
ATOM   4328 N N     . ARG D 3 216 ? 12.109  66.741  29.809  1.00 54.55  ? 216 ARG B N     1 
ATOM   4329 C CA    . ARG D 3 216 ? 10.834  66.662  29.077  1.00 55.12  ? 216 ARG B CA    1 
ATOM   4330 C C     . ARG D 3 216 ? 10.387  67.975  28.419  1.00 54.66  ? 216 ARG B C     1 
ATOM   4331 O O     . ARG D 3 216 ? 10.762  69.076  28.838  1.00 53.92  ? 216 ARG B O     1 
ATOM   4332 C CB    . ARG D 3 216 ? 9.719   66.203  30.009  1.00 56.54  ? 216 ARG B CB    1 
ATOM   4333 C CG    . ARG D 3 216 ? 10.196  65.380  31.180  1.00 59.79  ? 216 ARG B CG    1 
ATOM   4334 C CD    . ARG D 3 216 ? 10.493  63.953  30.786  1.00 62.87  ? 216 ARG B CD    1 
ATOM   4335 N NE    . ARG D 3 216 ? 9.274   63.218  30.464  1.00 65.34  ? 216 ARG B NE    1 
ATOM   4336 C CZ    . ARG D 3 216 ? 9.151   61.896  30.565  1.00 66.73  ? 216 ARG B CZ    1 
ATOM   4337 N NH1   . ARG D 3 216 ? 10.180  61.162  30.983  1.00 66.93  ? 216 ARG B NH1   1 
ATOM   4338 N NH2   . ARG D 3 216 ? 7.998   61.309  30.255  1.00 67.27  ? 216 ARG B NH2   1 
ATOM   4339 N N     . GLU D 3 217 ? 9.532   67.836  27.411  1.00 54.42  ? 217 GLU B N     1 
ATOM   4340 C CA    . GLU D 3 217 ? 9.033   68.970  26.636  1.00 54.45  ? 217 GLU B CA    1 
ATOM   4341 C C     . GLU D 3 217 ? 7.529   69.219  26.797  1.00 53.50  ? 217 GLU B C     1 
ATOM   4342 O O     . GLU D 3 217 ? 6.700   68.333  26.543  1.00 53.91  ? 217 GLU B O     1 
ATOM   4343 C CB    . GLU D 3 217 ? 9.350   68.733  25.153  1.00 56.00  ? 217 GLU B CB    1 
ATOM   4344 C CG    . GLU D 3 217 ? 9.064   69.890  24.216  1.00 58.02  ? 217 GLU B CG    1 
ATOM   4345 C CD    . GLU D 3 217 ? 9.104   69.473  22.747  1.00 59.65  ? 217 GLU B CD    1 
ATOM   4346 O OE1   . GLU D 3 217 ? 9.903   68.571  22.398  1.00 60.12  ? 217 GLU B OE1   1 
ATOM   4347 O OE2   . GLU D 3 217 ? 8.344   70.057  21.939  1.00 60.35  ? 217 GLU B OE2   1 
ATOM   4348 N N     . GLY D 3 218 ? 7.191   70.435  27.218  1.00 51.91  ? 218 GLY B N     1 
ATOM   4349 C CA    . GLY D 3 218 ? 5.799   70.818  27.383  1.00 49.17  ? 218 GLY B CA    1 
ATOM   4350 C C     . GLY D 3 218 ? 5.383   71.725  26.237  1.00 47.10  ? 218 GLY B C     1 
ATOM   4351 O O     . GLY D 3 218 ? 6.110   71.854  25.250  1.00 46.90  ? 218 GLY B O     1 
ATOM   4352 N N     . ASP D 3 219 ? 4.223   72.361  26.356  1.00 44.96  ? 219 ASP B N     1 
ATOM   4353 C CA    . ASP D 3 219 ? 3.744   73.249  25.302  1.00 43.28  ? 219 ASP B CA    1 
ATOM   4354 C C     . ASP D 3 219 ? 3.283   74.597  25.859  1.00 41.48  ? 219 ASP B C     1 
ATOM   4355 O O     . ASP D 3 219 ? 2.411   75.260  25.286  1.00 40.74  ? 219 ASP B O     1 
ATOM   4356 C CB    . ASP D 3 219 ? 2.599   72.581  24.538  1.00 44.31  ? 219 ASP B CB    1 
ATOM   4357 C CG    . ASP D 3 219 ? 1.384   72.341  25.407  1.00 45.37  ? 219 ASP B CG    1 
ATOM   4358 O OD1   . ASP D 3 219 ? 0.412   71.717  24.924  1.00 45.74  ? 219 ASP B OD1   1 
ATOM   4359 O OD2   . ASP D 3 219 ? 1.399   72.782  26.576  1.00 46.30  ? 219 ASP B OD2   1 
ATOM   4360 N N     . TRP D 3 220 ? 3.884   74.983  26.980  1.00 39.33  ? 220 TRP B N     1 
ATOM   4361 C CA    . TRP D 3 220 ? 3.581   76.233  27.667  1.00 37.27  ? 220 TRP B CA    1 
ATOM   4362 C C     . TRP D 3 220 ? 2.372   76.120  28.596  1.00 37.55  ? 220 TRP B C     1 
ATOM   4363 O O     . TRP D 3 220 ? 2.263   76.875  29.561  1.00 37.46  ? 220 TRP B O     1 
ATOM   4364 C CB    . TRP D 3 220 ? 3.332   77.350  26.658  1.00 35.40  ? 220 TRP B CB    1 
ATOM   4365 C CG    . TRP D 3 220 ? 4.530   77.792  25.897  1.00 33.34  ? 220 TRP B CG    1 
ATOM   4366 C CD1   . TRP D 3 220 ? 4.602   78.023  24.555  1.00 33.29  ? 220 TRP B CD1   1 
ATOM   4367 C CD2   . TRP D 3 220 ? 5.810   78.118  26.424  1.00 32.79  ? 220 TRP B CD2   1 
ATOM   4368 N NE1   . TRP D 3 220 ? 5.845   78.484  24.215  1.00 33.25  ? 220 TRP B NE1   1 
ATOM   4369 C CE2   . TRP D 3 220 ? 6.611   78.562  25.353  1.00 33.25  ? 220 TRP B CE2   1 
ATOM   4370 C CE3   . TRP D 3 220 ? 6.358   78.105  27.712  1.00 33.22  ? 220 TRP B CE3   1 
ATOM   4371 C CZ2   . TRP D 3 220 ? 7.942   78.958  25.510  1.00 34.12  ? 220 TRP B CZ2   1 
ATOM   4372 C CZ3   . TRP D 3 220 ? 7.686   78.502  27.876  1.00 34.20  ? 220 TRP B CZ3   1 
ATOM   4373 C CH2   . TRP D 3 220 ? 8.457   78.934  26.781  1.00 34.55  ? 220 TRP B CH2   1 
ATOM   4374 N N     . SER D 3 221 ? 1.478   75.171  28.314  1.00 38.08  ? 221 SER B N     1 
ATOM   4375 C CA    . SER D 3 221 ? 0.259   74.978  29.110  1.00 38.61  ? 221 SER B CA    1 
ATOM   4376 C C     . SER D 3 221 ? 0.457   74.265  30.433  1.00 38.74  ? 221 SER B C     1 
ATOM   4377 O O     . SER D 3 221 ? 1.338   73.423  30.578  1.00 38.51  ? 221 SER B O     1 
ATOM   4378 C CB    . SER D 3 221 ? -0.770  74.179  28.326  1.00 38.53  ? 221 SER B CB    1 
ATOM   4379 O OG    . SER D 3 221 ? -0.497  72.800  28.462  1.00 37.93  ? 221 SER B OG    1 
ATOM   4380 N N     . ALA D 3 222 ? -0.401  74.582  31.391  1.00 39.60  ? 222 ALA B N     1 
ATOM   4381 C CA    . ALA D 3 222 ? -0.318  73.959  32.699  1.00 40.98  ? 222 ALA B CA    1 
ATOM   4382 C C     . ALA D 3 222 ? -0.593  72.468  32.604  1.00 42.11  ? 222 ALA B C     1 
ATOM   4383 O O     . ALA D 3 222 ? 0.010   71.678  33.318  1.00 43.08  ? 222 ALA B O     1 
ATOM   4384 C CB    . ALA D 3 222 ? -1.306  74.595  33.643  1.00 40.83  ? 222 ALA B CB    1 
ATOM   4385 N N     . MET D 3 223 ? -1.510  72.083  31.728  1.00 43.67  ? 223 MET B N     1 
ATOM   4386 C CA    . MET D 3 223 ? -1.850  70.675  31.577  1.00 45.88  ? 223 MET B CA    1 
ATOM   4387 C C     . MET D 3 223 ? -0.604  69.887  31.208  1.00 46.06  ? 223 MET B C     1 
ATOM   4388 O O     . MET D 3 223 ? -0.299  68.868  31.827  1.00 45.70  ? 223 MET B O     1 
ATOM   4389 C CB    . MET D 3 223 ? -2.920  70.504  30.493  1.00 48.54  ? 223 MET B CB    1 
ATOM   4390 C CG    . MET D 3 223 ? -3.667  69.183  30.552  1.00 50.40  ? 223 MET B CG    1 
ATOM   4391 S SD    . MET D 3 223 ? -4.264  68.934  32.219  1.00 52.72  ? 223 MET B SD    1 
ATOM   4392 C CE    . MET D 3 223 ? -3.958  67.204  32.441  1.00 53.15  ? 223 MET B CE    1 
ATOM   4393 N N     . SER D 3 224 ? 0.117   70.371  30.201  1.00 46.56  ? 224 SER B N     1 
ATOM   4394 C CA    . SER D 3 224 ? 1.333   69.707  29.757  1.00 47.53  ? 224 SER B CA    1 
ATOM   4395 C C     . SER D 3 224 ? 2.269   69.554  30.951  1.00 48.34  ? 224 SER B C     1 
ATOM   4396 O O     . SER D 3 224 ? 2.739   68.451  31.246  1.00 49.41  ? 224 SER B O     1 
ATOM   4397 C CB    . SER D 3 224 ? 2.019   70.519  28.651  1.00 47.36  ? 224 SER B CB    1 
ATOM   4398 O OG    . SER D 3 224 ? 2.437   71.787  29.126  1.00 47.20  ? 224 SER B OG    1 
ATOM   4399 N N     . GLY D 3 225 ? 2.531   70.663  31.640  1.00 48.21  ? 225 GLY B N     1 
ATOM   4400 C CA    . GLY D 3 225 ? 3.404   70.620  32.797  1.00 47.93  ? 225 GLY B CA    1 
ATOM   4401 C C     . GLY D 3 225 ? 2.980   69.509  33.734  1.00 48.13  ? 225 GLY B C     1 
ATOM   4402 O O     . GLY D 3 225 ? 3.810   68.893  34.397  1.00 47.65  ? 225 GLY B O     1 
ATOM   4403 N N     . PHE D 3 226 ? 1.678   69.250  33.777  1.00 48.73  ? 226 PHE B N     1 
ATOM   4404 C CA    . PHE D 3 226 ? 1.121   68.209  34.624  1.00 49.36  ? 226 PHE B CA    1 
ATOM   4405 C C     . PHE D 3 226 ? 1.450   66.839  34.049  1.00 50.51  ? 226 PHE B C     1 
ATOM   4406 O O     . PHE D 3 226 ? 2.143   66.042  34.679  1.00 50.84  ? 226 PHE B O     1 
ATOM   4407 C CB    . PHE D 3 226 ? -0.395  68.371  34.723  1.00 49.25  ? 226 PHE B CB    1 
ATOM   4408 C CG    . PHE D 3 226 ? -1.062  67.308  35.535  1.00 49.46  ? 226 PHE B CG    1 
ATOM   4409 C CD1   . PHE D 3 226 ? -0.799  67.187  36.901  1.00 48.98  ? 226 PHE B CD1   1 
ATOM   4410 C CD2   . PHE D 3 226 ? -1.931  66.404  34.929  1.00 49.40  ? 226 PHE B CD2   1 
ATOM   4411 C CE1   . PHE D 3 226 ? -1.389  66.176  37.652  1.00 49.13  ? 226 PHE B CE1   1 
ATOM   4412 C CE2   . PHE D 3 226 ? -2.530  65.385  35.666  1.00 49.66  ? 226 PHE B CE2   1 
ATOM   4413 C CZ    . PHE D 3 226 ? -2.260  65.267  37.032  1.00 49.69  ? 226 PHE B CZ    1 
ATOM   4414 N N     . GLN D 3 227 ? 0.952   66.570  32.848  1.00 51.31  ? 227 GLN B N     1 
ATOM   4415 C CA    . GLN D 3 227 ? 1.194   65.292  32.188  1.00 52.57  ? 227 GLN B CA    1 
ATOM   4416 C C     . GLN D 3 227 ? 2.660   64.904  32.163  1.00 52.31  ? 227 GLN B C     1 
ATOM   4417 O O     . GLN D 3 227 ? 3.021   63.825  32.614  1.00 53.01  ? 227 GLN B O     1 
ATOM   4418 C CB    . GLN D 3 227 ? 0.643   65.316  30.764  1.00 55.00  ? 227 GLN B CB    1 
ATOM   4419 C CG    . GLN D 3 227 ? -0.871  65.065  30.694  1.00 59.23  ? 227 GLN B CG    1 
ATOM   4420 C CD    . GLN D 3 227 ? -1.542  65.657  29.439  1.00 61.69  ? 227 GLN B CD    1 
ATOM   4421 O OE1   . GLN D 3 227 ? -2.752  65.499  29.237  1.00 62.96  ? 227 GLN B OE1   1 
ATOM   4422 N NE2   . GLN D 3 227 ? -0.761  66.348  28.604  1.00 62.34  ? 227 GLN B NE2   1 
ATOM   4423 N N     . GLN D 3 228 ? 3.514   65.774  31.646  1.00 51.31  ? 228 GLN B N     1 
ATOM   4424 C CA    . GLN D 3 228 ? 4.936   65.462  31.603  1.00 50.56  ? 228 GLN B CA    1 
ATOM   4425 C C     . GLN D 3 228 ? 5.518   65.107  32.975  1.00 50.36  ? 228 GLN B C     1 
ATOM   4426 O O     . GLN D 3 228 ? 6.237   64.114  33.103  1.00 49.91  ? 228 GLN B O     1 
ATOM   4427 C CB    . GLN D 3 228 ? 5.720   66.625  30.996  1.00 50.80  ? 228 GLN B CB    1 
ATOM   4428 C CG    . GLN D 3 228 ? 5.504   66.814  29.494  1.00 50.95  ? 228 GLN B CG    1 
ATOM   4429 C CD    . GLN D 3 228 ? 5.768   65.547  28.691  1.00 51.34  ? 228 GLN B CD    1 
ATOM   4430 O OE1   . GLN D 3 228 ? 6.815   64.903  28.833  1.00 51.65  ? 228 GLN B OE1   1 
ATOM   4431 N NE2   . GLN D 3 228 ? 4.819   65.189  27.834  1.00 50.40  ? 228 GLN B NE2   1 
ATOM   4432 N N     . THR D 3 229 ? 5.212   65.904  33.998  1.00 50.45  ? 229 THR B N     1 
ATOM   4433 C CA    . THR D 3 229 ? 5.734   65.619  35.329  1.00 50.71  ? 229 THR B CA    1 
ATOM   4434 C C     . THR D 3 229 ? 5.108   64.349  35.881  1.00 52.44  ? 229 THR B C     1 
ATOM   4435 O O     . THR D 3 229 ? 5.678   63.705  36.752  1.00 53.01  ? 229 THR B O     1 
ATOM   4436 C CB    . THR D 3 229 ? 5.513   66.794  36.305  1.00 49.04  ? 229 THR B CB    1 
ATOM   4437 O OG1   . THR D 3 229 ? 6.212   67.944  35.823  1.00 47.90  ? 229 THR B OG1   1 
ATOM   4438 C CG2   . THR D 3 229 ? 6.069   66.468  37.671  1.00 47.97  ? 229 THR B CG2   1 
ATOM   4439 N N     . MET D 3 230 ? 3.939   63.973  35.380  1.00 54.64  ? 230 MET B N     1 
ATOM   4440 C CA    . MET D 3 230 ? 3.331   62.733  35.845  1.00 57.48  ? 230 MET B CA    1 
ATOM   4441 C C     . MET D 3 230 ? 4.120   61.561  35.243  1.00 58.93  ? 230 MET B C     1 
ATOM   4442 O O     . MET D 3 230 ? 4.722   60.778  35.987  1.00 59.43  ? 230 MET B O     1 
ATOM   4443 C CB    . MET D 3 230 ? 1.856   62.643  35.437  1.00 58.62  ? 230 MET B CB    1 
ATOM   4444 C CG    . MET D 3 230 ? 0.863   63.052  36.526  1.00 60.45  ? 230 MET B CG    1 
ATOM   4445 S SD    . MET D 3 230 ? 0.859   61.984  37.989  1.00 63.28  ? 230 MET B SD    1 
ATOM   4446 C CE    . MET D 3 230 ? -0.354  60.725  37.491  1.00 62.42  ? 230 MET B CE    1 
ATOM   4447 N N     . GLN D 3 231 ? 4.128   61.455  33.908  1.00 59.91  ? 231 GLN B N     1 
ATOM   4448 C CA    . GLN D 3 231 ? 4.850   60.387  33.203  1.00 60.54  ? 231 GLN B CA    1 
ATOM   4449 C C     . GLN D 3 231 ? 6.236   60.200  33.799  1.00 59.83  ? 231 GLN B C     1 
ATOM   4450 O O     . GLN D 3 231 ? 6.682   59.068  34.003  1.00 60.08  ? 231 GLN B O     1 
ATOM   4451 C CB    . GLN D 3 231 ? 5.023   60.715  31.722  1.00 62.81  ? 231 GLN B CB    1 
ATOM   4452 C CG    . GLN D 3 231 ? 3.749   60.799  30.920  1.00 67.43  ? 231 GLN B CG    1 
ATOM   4453 C CD    . GLN D 3 231 ? 3.998   61.332  29.506  1.00 70.64  ? 231 GLN B CD    1 
ATOM   4454 O OE1   . GLN D 3 231 ? 3.063   61.478  28.705  1.00 72.44  ? 231 GLN B OE1   1 
ATOM   4455 N NE2   . GLN D 3 231 ? 5.266   61.629  29.196  1.00 71.80  ? 231 GLN B NE2   1 
ATOM   4456 N N     . MET D 3 232 ? 6.913   61.319  34.056  1.00 58.25  ? 232 MET B N     1 
ATOM   4457 C CA    . MET D 3 232 ? 8.248   61.303  34.630  1.00 56.83  ? 232 MET B CA    1 
ATOM   4458 C C     . MET D 3 232 ? 8.232   60.621  35.986  1.00 57.11  ? 232 MET B C     1 
ATOM   4459 O O     . MET D 3 232 ? 9.085   59.782  36.272  1.00 57.69  ? 232 MET B O     1 
ATOM   4460 C CB    . MET D 3 232 ? 8.781   62.721  34.793  1.00 54.75  ? 232 MET B CB    1 
ATOM   4461 C CG    . MET D 3 232 ? 10.125  62.767  35.474  1.00 53.07  ? 232 MET B CG    1 
ATOM   4462 S SD    . MET D 3 232 ? 10.686  64.417  35.795  1.00 50.29  ? 232 MET B SD    1 
ATOM   4463 C CE    . MET D 3 232 ? 10.122  64.656  37.436  1.00 51.14  ? 232 MET B CE    1 
ATOM   4464 N N     . LEU D 3 233 ? 7.270   60.984  36.826  1.00 56.69  ? 233 LEU B N     1 
ATOM   4465 C CA    . LEU D 3 233 ? 7.172   60.379  38.143  1.00 56.98  ? 233 LEU B CA    1 
ATOM   4466 C C     . LEU D 3 233 ? 6.732   58.918  38.080  1.00 58.22  ? 233 LEU B C     1 
ATOM   4467 O O     . LEU D 3 233 ? 7.046   58.137  38.978  1.00 59.15  ? 233 LEU B O     1 
ATOM   4468 C CB    . LEU D 3 233 ? 6.218   61.177  39.027  1.00 55.59  ? 233 LEU B CB    1 
ATOM   4469 C CG    . LEU D 3 233 ? 6.788   62.484  39.583  1.00 55.21  ? 233 LEU B CG    1 
ATOM   4470 C CD1   . LEU D 3 233 ? 5.735   63.192  40.399  1.00 55.09  ? 233 LEU B CD1   1 
ATOM   4471 C CD2   . LEU D 3 233 ? 7.994   62.205  40.448  1.00 54.59  ? 233 LEU B CD2   1 
ATOM   4472 N N     . ASN D 3 234 ? 6.017   58.537  37.024  1.00 59.40  ? 234 ASN B N     1 
ATOM   4473 C CA    . ASN D 3 234 ? 5.566   57.150  36.880  1.00 60.51  ? 234 ASN B CA    1 
ATOM   4474 C C     . ASN D 3 234 ? 6.669   56.227  36.383  1.00 60.55  ? 234 ASN B C     1 
ATOM   4475 O O     . ASN D 3 234 ? 6.598   55.012  36.560  1.00 60.88  ? 234 ASN B O     1 
ATOM   4476 C CB    . ASN D 3 234 ? 4.358   57.060  35.947  1.00 61.77  ? 234 ASN B CB    1 
ATOM   4477 C CG    . ASN D 3 234 ? 3.110   57.658  36.565  1.00 62.98  ? 234 ASN B CG    1 
ATOM   4478 O OD1   . ASN D 3 234 ? 2.847   57.477  37.761  1.00 63.01  ? 234 ASN B OD1   1 
ATOM   4479 N ND2   . ASN D 3 234 ? 2.327   58.367  35.754  1.00 63.68  ? 234 ASN B ND2   1 
ATOM   4480 N N     . GLU D 3 235 ? 7.686   56.812  35.759  1.00 60.70  ? 235 GLU B N     1 
ATOM   4481 C CA    . GLU D 3 235 ? 8.824   56.047  35.267  1.00 60.50  ? 235 GLU B CA    1 
ATOM   4482 C C     . GLU D 3 235 ? 9.836   55.887  36.404  1.00 58.99  ? 235 GLU B C     1 
ATOM   4483 O O     . GLU D 3 235 ? 10.977  55.500  36.173  1.00 59.65  ? 235 GLU B O     1 
ATOM   4484 C CB    . GLU D 3 235 ? 9.496   56.761  34.087  1.00 62.38  ? 235 GLU B CB    1 
ATOM   4485 C CG    . GLU D 3 235 ? 8.667   56.840  32.806  1.00 64.55  ? 235 GLU B CG    1 
ATOM   4486 C CD    . GLU D 3 235 ? 9.388   57.607  31.701  1.00 66.32  ? 235 GLU B CD    1 
ATOM   4487 O OE1   . GLU D 3 235 ? 8.820   57.732  30.591  1.00 66.58  ? 235 GLU B OE1   1 
ATOM   4488 O OE2   . GLU D 3 235 ? 10.523  58.088  31.946  1.00 67.53  ? 235 GLU B OE2   1 
ATOM   4489 N N     . GLY D 3 236 ? 9.415   56.204  37.626  1.00 56.72  ? 236 GLY B N     1 
ATOM   4490 C CA    . GLY D 3 236 ? 10.293  56.077  38.778  1.00 53.98  ? 236 GLY B CA    1 
ATOM   4491 C C     . GLY D 3 236 ? 11.381  57.133  38.929  1.00 51.62  ? 236 GLY B C     1 
ATOM   4492 O O     . GLY D 3 236 ? 12.156  57.099  39.894  1.00 51.97  ? 236 GLY B O     1 
ATOM   4493 N N     . ILE D 3 237 ? 11.455  58.069  37.990  1.00 48.49  ? 237 ILE B N     1 
ATOM   4494 C CA    . ILE D 3 237 ? 12.467  59.112  38.065  1.00 46.04  ? 237 ILE B CA    1 
ATOM   4495 C C     . ILE D 3 237 ? 11.983  60.223  38.967  1.00 44.17  ? 237 ILE B C     1 
ATOM   4496 O O     . ILE D 3 237 ? 11.134  61.015  38.577  1.00 45.27  ? 237 ILE B O     1 
ATOM   4497 C CB    . ILE D 3 237 ? 12.725  59.724  36.714  1.00 46.27  ? 237 ILE B CB    1 
ATOM   4498 C CG1   . ILE D 3 237 ? 12.939  58.620  35.683  1.00 46.39  ? 237 ILE B CG1   1 
ATOM   4499 C CG2   . ILE D 3 237 ? 13.915  60.664  36.819  1.00 46.26  ? 237 ILE B CG2   1 
ATOM   4500 C CD1   . ILE D 3 237 ? 12.997  59.121  34.260  1.00 47.63  ? 237 ILE B CD1   1 
ATOM   4501 N N     . VAL D 3 238 ? 12.528  60.310  40.166  1.00 40.83  ? 238 VAL B N     1 
ATOM   4502 C CA    . VAL D 3 238 ? 12.062  61.340  41.058  1.00 37.95  ? 238 VAL B CA    1 
ATOM   4503 C C     . VAL D 3 238 ? 13.164  62.253  41.537  1.00 35.87  ? 238 VAL B C     1 
ATOM   4504 O O     . VAL D 3 238 ? 13.926  61.902  42.431  1.00 36.23  ? 238 VAL B O     1 
ATOM   4505 C CB    . VAL D 3 238 ? 11.335  60.713  42.255  1.00 38.26  ? 238 VAL B CB    1 
ATOM   4506 C CG1   . VAL D 3 238 ? 12.153  59.580  42.812  1.00 38.44  ? 238 VAL B CG1   1 
ATOM   4507 C CG2   . VAL D 3 238 ? 11.081  61.756  43.317  1.00 38.56  ? 238 VAL B CG2   1 
ATOM   4508 N N     . PRO D 3 239 ? 13.263  63.447  40.938  1.00 33.81  ? 239 PRO B N     1 
ATOM   4509 C CA    . PRO D 3 239 ? 14.273  64.449  41.290  1.00 33.05  ? 239 PRO B CA    1 
ATOM   4510 C C     . PRO D 3 239 ? 14.037  65.098  42.647  1.00 32.76  ? 239 PRO B C     1 
ATOM   4511 O O     . PRO D 3 239 ? 13.162  64.686  43.397  1.00 32.54  ? 239 PRO B O     1 
ATOM   4512 C CB    . PRO D 3 239 ? 14.163  65.454  40.155  1.00 32.38  ? 239 PRO B CB    1 
ATOM   4513 C CG    . PRO D 3 239 ? 12.737  65.342  39.741  1.00 32.42  ? 239 PRO B CG    1 
ATOM   4514 C CD    . PRO D 3 239 ? 12.506  63.867  39.748  1.00 32.68  ? 239 PRO B CD    1 
ATOM   4515 N N     . THR D 3 240 ? 14.843  66.102  42.970  1.00 32.81  ? 240 THR B N     1 
ATOM   4516 C CA    . THR D 3 240 ? 14.681  66.826  44.225  1.00 33.53  ? 240 THR B CA    1 
ATOM   4517 C C     . THR D 3 240 ? 14.464  68.294  43.902  1.00 34.91  ? 240 THR B C     1 
ATOM   4518 O O     . THR D 3 240 ? 14.289  69.121  44.800  1.00 35.75  ? 240 THR B O     1 
ATOM   4519 C CB    . THR D 3 240 ? 15.894  66.698  45.157  1.00 32.74  ? 240 THR B CB    1 
ATOM   4520 O OG1   . THR D 3 240 ? 17.028  67.370  44.598  1.00 31.25  ? 240 THR B OG1   1 
ATOM   4521 C CG2   . THR D 3 240 ? 16.218  65.254  45.363  1.00 33.50  ? 240 THR B CG2   1 
ATOM   4522 N N     . ALA D 3 241 ? 14.475  68.605  42.606  1.00 35.41  ? 241 ALA B N     1 
ATOM   4523 C CA    . ALA D 3 241 ? 14.248  69.961  42.109  1.00 35.44  ? 241 ALA B CA    1 
ATOM   4524 C C     . ALA D 3 241 ? 14.007  69.904  40.606  1.00 35.64  ? 241 ALA B C     1 
ATOM   4525 O O     . ALA D 3 241 ? 14.599  69.082  39.902  1.00 35.54  ? 241 ALA B O     1 
ATOM   4526 C CB    . ALA D 3 241 ? 15.442  70.852  42.412  1.00 34.46  ? 241 ALA B CB    1 
ATOM   4527 N N     . MET D 3 242 ? 13.124  70.769  40.126  1.00 35.33  ? 242 MET B N     1 
ATOM   4528 C CA    . MET D 3 242 ? 12.813  70.833  38.711  1.00 35.14  ? 242 MET B CA    1 
ATOM   4529 C C     . MET D 3 242 ? 12.950  72.262  38.236  1.00 34.92  ? 242 MET B C     1 
ATOM   4530 O O     . MET D 3 242 ? 12.651  73.196  38.966  1.00 35.54  ? 242 MET B O     1 
ATOM   4531 C CB    . MET D 3 242 ? 11.382  70.378  38.453  1.00 35.01  ? 242 MET B CB    1 
ATOM   4532 C CG    . MET D 3 242 ? 11.161  68.898  38.524  1.00 36.76  ? 242 MET B CG    1 
ATOM   4533 S SD    . MET D 3 242 ? 9.409   68.513  38.292  1.00 37.61  ? 242 MET B SD    1 
ATOM   4534 C CE    . MET D 3 242 ? 9.250   68.626  36.545  1.00 39.12  ? 242 MET B CE    1 
ATOM   4535 N N     . LEU D 3 243 ? 13.423  72.430  37.014  1.00 34.37  ? 243 LEU B N     1 
ATOM   4536 C CA    . LEU D 3 243 ? 13.538  73.751  36.429  1.00 34.05  ? 243 LEU B CA    1 
ATOM   4537 C C     . LEU D 3 243 ? 12.499  73.695  35.307  1.00 34.31  ? 243 LEU B C     1 
ATOM   4538 O O     . LEU D 3 243 ? 12.565  72.817  34.444  1.00 34.32  ? 243 LEU B O     1 
ATOM   4539 C CB    . LEU D 3 243 ? 14.952  73.974  35.886  1.00 33.59  ? 243 LEU B CB    1 
ATOM   4540 C CG    . LEU D 3 243 ? 16.049  74.008  36.952  1.00 32.86  ? 243 LEU B CG    1 
ATOM   4541 C CD1   . LEU D 3 243 ? 17.394  73.858  36.303  1.00 33.38  ? 243 LEU B CD1   1 
ATOM   4542 C CD2   . LEU D 3 243 ? 15.991  75.295  37.705  1.00 32.43  ? 243 LEU B CD2   1 
ATOM   4543 N N     . VAL D 3 244 ? 11.518  74.596  35.337  1.00 33.57  ? 244 VAL B N     1 
ATOM   4544 C CA    . VAL D 3 244 ? 10.477  74.591  34.323  1.00 31.66  ? 244 VAL B CA    1 
ATOM   4545 C C     . VAL D 3 244 ? 10.523  75.840  33.465  1.00 32.06  ? 244 VAL B C     1 
ATOM   4546 O O     . VAL D 3 244 ? 10.773  76.929  33.960  1.00 31.47  ? 244 VAL B O     1 
ATOM   4547 C CB    . VAL D 3 244 ? 9.103   74.463  34.964  1.00 31.29  ? 244 VAL B CB    1 
ATOM   4548 C CG1   . VAL D 3 244 ? 8.108   74.017  33.930  1.00 31.12  ? 244 VAL B CG1   1 
ATOM   4549 C CG2   . VAL D 3 244 ? 9.158   73.474  36.102  1.00 30.77  ? 244 VAL B CG2   1 
ATOM   4550 N N     . ALA D 3 245 ? 10.267  75.666  32.174  1.00 32.36  ? 245 ALA B N     1 
ATOM   4551 C CA    . ALA D 3 245 ? 10.310  76.754  31.200  1.00 32.74  ? 245 ALA B CA    1 
ATOM   4552 C C     . ALA D 3 245 ? 9.367   77.935  31.403  1.00 32.45  ? 245 ALA B C     1 
ATOM   4553 O O     . ALA D 3 245 ? 9.513   78.952  30.736  1.00 31.76  ? 245 ALA B O     1 
ATOM   4554 C CB    . ALA D 3 245 ? 10.125  76.189  29.798  1.00 33.74  ? 245 ALA B CB    1 
ATOM   4555 N N     . ASN D 3 246 ? 8.399   77.812  32.300  1.00 32.91  ? 246 ASN B N     1 
ATOM   4556 C CA    . ASN D 3 246 ? 7.488   78.921  32.545  1.00 34.13  ? 246 ASN B CA    1 
ATOM   4557 C C     . ASN D 3 246 ? 6.590   78.649  33.726  1.00 35.07  ? 246 ASN B C     1 
ATOM   4558 O O     . ASN D 3 246 ? 6.337   77.502  34.058  1.00 36.95  ? 246 ASN B O     1 
ATOM   4559 C CB    . ASN D 3 246 ? 6.649   79.202  31.306  1.00 34.46  ? 246 ASN B CB    1 
ATOM   4560 C CG    . ASN D 3 246 ? 5.529   78.205  31.109  1.00 35.76  ? 246 ASN B CG    1 
ATOM   4561 O OD1   . ASN D 3 246 ? 5.630   77.051  31.514  1.00 36.00  ? 246 ASN B OD1   1 
ATOM   4562 N ND2   . ASN D 3 246 ? 4.454   78.646  30.455  1.00 35.68  ? 246 ASN B ND2   1 
ATOM   4563 N N     . ASP D 3 247 ? 6.096   79.700  34.360  1.00 35.09  ? 247 ASP B N     1 
ATOM   4564 C CA    . ASP D 3 247 ? 5.250   79.515  35.527  1.00 35.49  ? 247 ASP B CA    1 
ATOM   4565 C C     . ASP D 3 247 ? 4.074   78.556  35.324  1.00 34.97  ? 247 ASP B C     1 
ATOM   4566 O O     . ASP D 3 247 ? 3.886   77.632  36.119  1.00 34.97  ? 247 ASP B O     1 
ATOM   4567 C CB    . ASP D 3 247 ? 4.761   80.870  36.031  1.00 36.68  ? 247 ASP B CB    1 
ATOM   4568 C CG    . ASP D 3 247 ? 5.893   81.725  36.575  1.00 37.36  ? 247 ASP B CG    1 
ATOM   4569 O OD1   . ASP D 3 247 ? 5.667   82.927  36.853  1.00 38.73  ? 247 ASP B OD1   1 
ATOM   4570 O OD2   . ASP D 3 247 ? 7.013   81.188  36.727  1.00 35.56  ? 247 ASP B OD2   1 
ATOM   4571 N N     . GLN D 3 248 ? 3.292   78.742  34.269  1.00 34.58  ? 248 GLN B N     1 
ATOM   4572 C CA    . GLN D 3 248 ? 2.157   77.855  34.059  1.00 34.62  ? 248 GLN B CA    1 
ATOM   4573 C C     . GLN D 3 248 ? 2.478   76.367  34.070  1.00 33.31  ? 248 GLN B C     1 
ATOM   4574 O O     . GLN D 3 248 ? 1.763   75.600  34.699  1.00 33.26  ? 248 GLN B O     1 
ATOM   4575 C CB    . GLN D 3 248 ? 1.433   78.215  32.777  1.00 37.09  ? 248 GLN B CB    1 
ATOM   4576 C CG    . GLN D 3 248 ? 0.514   79.395  32.948  1.00 40.79  ? 248 GLN B CG    1 
ATOM   4577 C CD    . GLN D 3 248 ? 0.254   80.105  31.639  1.00 43.81  ? 248 GLN B CD    1 
ATOM   4578 O OE1   . GLN D 3 248 ? 1.161   80.713  31.055  1.00 46.57  ? 248 GLN B OE1   1 
ATOM   4579 N NE2   . GLN D 3 248 ? -0.981  80.027  31.161  1.00 44.42  ? 248 GLN B NE2   1 
ATOM   4580 N N     . MET D 3 249 ? 3.531   75.937  33.384  1.00 32.19  ? 249 MET B N     1 
ATOM   4581 C CA    . MET D 3 249 ? 3.855   74.516  33.400  1.00 31.09  ? 249 MET B CA    1 
ATOM   4582 C C     . MET D 3 249 ? 4.338   74.132  34.783  1.00 29.83  ? 249 MET B C     1 
ATOM   4583 O O     . MET D 3 249 ? 4.240   72.978  35.179  1.00 29.31  ? 249 MET B O     1 
ATOM   4584 C CB    . MET D 3 249 ? 4.929   74.171  32.377  1.00 32.45  ? 249 MET B CB    1 
ATOM   4585 C CG    . MET D 3 249 ? 4.468   74.274  30.958  1.00 34.73  ? 249 MET B CG    1 
ATOM   4586 S SD    . MET D 3 249 ? 5.662   73.518  29.866  1.00 36.29  ? 249 MET B SD    1 
ATOM   4587 C CE    . MET D 3 249 ? 6.995   74.648  30.039  1.00 37.15  ? 249 MET B CE    1 
ATOM   4588 N N     . ALA D 3 250 ? 4.867   75.104  35.515  1.00 28.51  ? 250 ALA B N     1 
ATOM   4589 C CA    . ALA D 3 250 ? 5.355   74.863  36.863  1.00 27.65  ? 250 ALA B CA    1 
ATOM   4590 C C     . ALA D 3 250 ? 4.156   74.499  37.696  1.00 27.17  ? 250 ALA B C     1 
ATOM   4591 O O     . ALA D 3 250 ? 4.224   73.645  38.576  1.00 26.54  ? 250 ALA B O     1 
ATOM   4592 C CB    . ALA D 3 250 ? 5.997   76.107  37.413  1.00 28.04  ? 250 ALA B CB    1 
ATOM   4593 N N     . LEU D 3 251 ? 3.052   75.169  37.407  1.00 27.48  ? 251 LEU B N     1 
ATOM   4594 C CA    . LEU D 3 251 ? 1.804   74.920  38.107  1.00 27.74  ? 251 LEU B CA    1 
ATOM   4595 C C     . LEU D 3 251 ? 1.408   73.456  37.909  1.00 27.41  ? 251 LEU B C     1 
ATOM   4596 O O     . LEU D 3 251 ? 1.221   72.715  38.874  1.00 26.94  ? 251 LEU B O     1 
ATOM   4597 C CB    . LEU D 3 251 ? 0.703   75.832  37.562  1.00 27.07  ? 251 LEU B CB    1 
ATOM   4598 C CG    . LEU D 3 251 ? -0.648  75.699  38.266  1.00 26.85  ? 251 LEU B CG    1 
ATOM   4599 C CD1   . LEU D 3 251 ? -0.518  76.249  39.662  1.00 26.50  ? 251 LEU B CD1   1 
ATOM   4600 C CD2   . LEU D 3 251 ? -1.725  76.446  37.518  1.00 26.37  ? 251 LEU B CD2   1 
ATOM   4601 N N     . GLY D 3 252 ? 1.286   73.044  36.652  1.00 26.68  ? 252 GLY B N     1 
ATOM   4602 C CA    . GLY D 3 252 ? 0.930   71.670  36.362  1.00 26.35  ? 252 GLY B CA    1 
ATOM   4603 C C     . GLY D 3 252 ? 1.892   70.710  37.027  1.00 26.72  ? 252 GLY B C     1 
ATOM   4604 O O     . GLY D 3 252 ? 1.495   69.660  37.517  1.00 25.70  ? 252 GLY B O     1 
ATOM   4605 N N     . ALA D 3 253 ? 3.165   71.083  37.042  1.00 28.44  ? 253 ALA B N     1 
ATOM   4606 C CA    . ALA D 3 253 ? 4.201   70.264  37.655  1.00 30.00  ? 253 ALA B CA    1 
ATOM   4607 C C     . ALA D 3 253 ? 3.908   70.146  39.128  1.00 30.90  ? 253 ALA B C     1 
ATOM   4608 O O     . ALA D 3 253 ? 3.919   69.058  39.693  1.00 31.12  ? 253 ALA B O     1 
ATOM   4609 C CB    . ALA D 3 253 ? 5.561   70.902  37.459  1.00 30.42  ? 253 ALA B CB    1 
ATOM   4610 N N     . MET D 3 254 ? 3.650   71.282  39.752  1.00 31.52  ? 254 MET B N     1 
ATOM   4611 C CA    . MET D 3 254 ? 3.358   71.290  41.163  1.00 33.36  ? 254 MET B CA    1 
ATOM   4612 C C     . MET D 3 254 ? 2.148   70.429  41.458  1.00 34.66  ? 254 MET B C     1 
ATOM   4613 O O     . MET D 3 254 ? 2.114   69.714  42.456  1.00 34.29  ? 254 MET B O     1 
ATOM   4614 C CB    . MET D 3 254 ? 3.129   72.715  41.612  1.00 34.48  ? 254 MET B CB    1 
ATOM   4615 C CG    . MET D 3 254 ? 4.382   73.535  41.506  1.00 36.96  ? 254 MET B CG    1 
ATOM   4616 S SD    . MET D 3 254 ? 4.066   75.268  41.810  1.00 39.69  ? 254 MET B SD    1 
ATOM   4617 C CE    . MET D 3 254 ? 3.955   75.271  43.555  1.00 38.39  ? 254 MET B CE    1 
ATOM   4618 N N     . ARG D 3 255 ? 1.156   70.473  40.581  1.00 36.31  ? 255 ARG B N     1 
ATOM   4619 C CA    . ARG D 3 255 ? -0.030  69.666  40.812  1.00 37.87  ? 255 ARG B CA    1 
ATOM   4620 C C     . ARG D 3 255 ? 0.379   68.203  40.909  1.00 38.38  ? 255 ARG B C     1 
ATOM   4621 O O     . ARG D 3 255 ? 0.208   67.571  41.954  1.00 38.31  ? 255 ARG B O     1 
ATOM   4622 C CB    . ARG D 3 255 ? -1.051  69.853  39.682  1.00 39.29  ? 255 ARG B CB    1 
ATOM   4623 C CG    . ARG D 3 255 ? -2.498  69.748  40.158  1.00 39.67  ? 255 ARG B CG    1 
ATOM   4624 C CD    . ARG D 3 255 ? -3.150  68.435  39.770  1.00 39.67  ? 255 ARG B CD    1 
ATOM   4625 N NE    . ARG D 3 255 ? -3.838  68.535  38.490  1.00 40.50  ? 255 ARG B NE    1 
ATOM   4626 C CZ    . ARG D 3 255 ? -4.714  67.643  38.045  1.00 41.86  ? 255 ARG B CZ    1 
ATOM   4627 N NH1   . ARG D 3 255 ? -5.004  66.582  38.783  1.00 42.67  ? 255 ARG B NH1   1 
ATOM   4628 N NH2   . ARG D 3 255 ? -5.312  67.814  36.871  1.00 42.94  ? 255 ARG B NH2   1 
ATOM   4629 N N     . ALA D 3 256 ? 0.940   67.682  39.820  1.00 38.52  ? 256 ALA B N     1 
ATOM   4630 C CA    . ALA D 3 256 ? 1.378   66.291  39.756  1.00 38.53  ? 256 ALA B CA    1 
ATOM   4631 C C     . ALA D 3 256 ? 2.248   65.886  40.940  1.00 38.55  ? 256 ALA B C     1 
ATOM   4632 O O     . ALA D 3 256 ? 2.108   64.787  41.461  1.00 38.41  ? 256 ALA B O     1 
ATOM   4633 C CB    . ALA D 3 256 ? 2.125   66.044  38.459  1.00 39.33  ? 256 ALA B CB    1 
ATOM   4634 N N     . ILE D 3 257 ? 3.152   66.767  41.352  1.00 38.38  ? 257 ILE B N     1 
ATOM   4635 C CA    . ILE D 3 257 ? 4.025   66.488  42.478  1.00 38.45  ? 257 ILE B CA    1 
ATOM   4636 C C     . ILE D 3 257 ? 3.191   66.265  43.726  1.00 40.17  ? 257 ILE B C     1 
ATOM   4637 O O     . ILE D 3 257 ? 3.402   65.291  44.456  1.00 39.88  ? 257 ILE B O     1 
ATOM   4638 C CB    . ILE D 3 257 ? 4.994   67.656  42.716  1.00 37.90  ? 257 ILE B CB    1 
ATOM   4639 C CG1   . ILE D 3 257 ? 6.086   67.626  41.651  1.00 37.77  ? 257 ILE B CG1   1 
ATOM   4640 C CG2   . ILE D 3 257 ? 5.565   67.597  44.112  1.00 37.38  ? 257 ILE B CG2   1 
ATOM   4641 C CD1   . ILE D 3 257 ? 7.122   68.693  41.808  1.00 38.32  ? 257 ILE B CD1   1 
ATOM   4642 N N     . THR D 3 258 ? 2.232   67.165  43.950  1.00 41.91  ? 258 THR B N     1 
ATOM   4643 C CA    . THR D 3 258 ? 1.350   67.107  45.116  1.00 43.37  ? 258 THR B CA    1 
ATOM   4644 C C     . THR D 3 258 ? 0.395   65.918  45.125  1.00 44.60  ? 258 THR B C     1 
ATOM   4645 O O     . THR D 3 258 ? 0.248   65.237  46.139  1.00 44.36  ? 258 THR B O     1 
ATOM   4646 C CB    . THR D 3 258 ? 0.494   68.370  45.239  1.00 43.52  ? 258 THR B CB    1 
ATOM   4647 O OG1   . THR D 3 258 ? 1.334   69.519  45.380  1.00 43.10  ? 258 THR B OG1   1 
ATOM   4648 C CG2   . THR D 3 258 ? -0.402  68.266  46.454  1.00 44.24  ? 258 THR B CG2   1 
ATOM   4649 N N     . GLU D 3 259 ? -0.271  65.683  44.002  1.00 45.88  ? 259 GLU B N     1 
ATOM   4650 C CA    . GLU D 3 259 ? -1.211  64.575  43.904  1.00 47.46  ? 259 GLU B CA    1 
ATOM   4651 C C     . GLU D 3 259 ? -0.477  63.252  43.940  1.00 48.60  ? 259 GLU B C     1 
ATOM   4652 O O     . GLU D 3 259 ? -1.086  62.187  43.866  1.00 48.75  ? 259 GLU B O     1 
ATOM   4653 C CB    . GLU D 3 259 ? -2.025  64.675  42.612  1.00 47.90  ? 259 GLU B CB    1 
ATOM   4654 C CG    . GLU D 3 259 ? -2.962  65.874  42.574  1.00 48.32  ? 259 GLU B CG    1 
ATOM   4655 C CD    . GLU D 3 259 ? -3.974  65.797  41.450  1.00 48.44  ? 259 GLU B CD    1 
ATOM   4656 O OE1   . GLU D 3 259 ? -4.880  66.661  41.415  1.00 47.82  ? 259 GLU B OE1   1 
ATOM   4657 O OE2   . GLU D 3 259 ? -3.860  64.877  40.606  1.00 48.77  ? 259 GLU B OE2   1 
ATOM   4658 N N     . SER D 3 260 ? 0.841   63.328  44.052  1.00 49.85  ? 260 SER B N     1 
ATOM   4659 C CA    . SER D 3 260 ? 1.659   62.134  44.089  1.00 50.86  ? 260 SER B CA    1 
ATOM   4660 C C     . SER D 3 260 ? 2.176   61.902  45.493  1.00 51.36  ? 260 SER B C     1 
ATOM   4661 O O     . SER D 3 260 ? 3.038   61.063  45.721  1.00 51.84  ? 260 SER B O     1 
ATOM   4662 C CB    . SER D 3 260 ? 2.810   62.260  43.089  1.00 51.88  ? 260 SER B CB    1 
ATOM   4663 O OG    . SER D 3 260 ? 2.313   62.272  41.752  1.00 52.26  ? 260 SER B OG    1 
ATOM   4664 N N     . GLY D 3 261 ? 1.637   62.656  46.437  1.00 51.77  ? 261 GLY B N     1 
ATOM   4665 C CA    . GLY D 3 261 ? 2.034   62.480  47.815  1.00 53.26  ? 261 GLY B CA    1 
ATOM   4666 C C     . GLY D 3 261 ? 3.351   63.119  48.193  1.00 54.20  ? 261 GLY B C     1 
ATOM   4667 O O     . GLY D 3 261 ? 3.862   62.889  49.292  1.00 55.29  ? 261 GLY B O     1 
ATOM   4668 N N     . LEU D 3 262 ? 3.923   63.911  47.301  1.00 54.10  ? 262 LEU B N     1 
ATOM   4669 C CA    . LEU D 3 262 ? 5.170   64.562  47.643  1.00 54.85  ? 262 LEU B CA    1 
ATOM   4670 C C     . LEU D 3 262 ? 4.881   66.028  47.986  1.00 56.00  ? 262 LEU B C     1 
ATOM   4671 O O     . LEU D 3 262 ? 3.828   66.554  47.618  1.00 55.82  ? 262 LEU B O     1 
ATOM   4672 C CB    . LEU D 3 262 ? 6.143   64.414  46.481  1.00 53.84  ? 262 LEU B CB    1 
ATOM   4673 C CG    . LEU D 3 262 ? 6.440   62.939  46.197  1.00 52.74  ? 262 LEU B CG    1 
ATOM   4674 C CD1   . LEU D 3 262 ? 7.339   62.797  44.989  1.00 53.35  ? 262 LEU B CD1   1 
ATOM   4675 C CD2   . LEU D 3 262 ? 7.104   62.327  47.405  1.00 51.94  ? 262 LEU B CD2   1 
ATOM   4676 N N     . ARG D 3 263 ? 5.789   66.675  48.717  1.00 57.64  ? 263 ARG B N     1 
ATOM   4677 C CA    . ARG D 3 263 ? 5.597   68.076  49.108  1.00 59.38  ? 263 ARG B CA    1 
ATOM   4678 C C     . ARG D 3 263 ? 6.454   69.058  48.302  1.00 58.34  ? 263 ARG B C     1 
ATOM   4679 O O     . ARG D 3 263 ? 7.665   69.136  48.509  1.00 58.60  ? 263 ARG B O     1 
ATOM   4680 C CB    . ARG D 3 263 ? 5.922   68.275  50.596  1.00 62.23  ? 263 ARG B CB    1 
ATOM   4681 C CG    . ARG D 3 263 ? 5.186   67.357  51.566  1.00 67.02  ? 263 ARG B CG    1 
ATOM   4682 C CD    . ARG D 3 263 ? 5.432   67.765  53.035  1.00 70.95  ? 263 ARG B CD    1 
ATOM   4683 N NE    . ARG D 3 263 ? 6.848   67.795  53.421  1.00 74.55  ? 263 ARG B NE    1 
ATOM   4684 C CZ    . ARG D 3 263 ? 7.673   66.747  53.375  1.00 76.36  ? 263 ARG B CZ    1 
ATOM   4685 N NH1   . ARG D 3 263 ? 7.241   65.559  52.953  1.00 77.67  ? 263 ARG B NH1   1 
ATOM   4686 N NH2   . ARG D 3 263 ? 8.938   66.881  53.764  1.00 77.37  ? 263 ARG B NH2   1 
ATOM   4687 N N     . VAL D 3 264 ? 5.832   69.808  47.394  1.00 56.96  ? 264 VAL B N     1 
ATOM   4688 C CA    . VAL D 3 264 ? 6.568   70.784  46.607  1.00 55.17  ? 264 VAL B CA    1 
ATOM   4689 C C     . VAL D 3 264 ? 7.364   71.594  47.617  1.00 53.99  ? 264 VAL B C     1 
ATOM   4690 O O     . VAL D 3 264 ? 6.831   72.011  48.643  1.00 53.43  ? 264 VAL B O     1 
ATOM   4691 C CB    . VAL D 3 264 ? 5.604   71.696  45.812  1.00 55.54  ? 264 VAL B CB    1 
ATOM   4692 C CG1   . VAL D 3 264 ? 6.362   72.849  45.170  1.00 55.97  ? 264 VAL B CG1   1 
ATOM   4693 C CG2   . VAL D 3 264 ? 4.902   70.880  44.737  1.00 55.50  ? 264 VAL B CG2   1 
ATOM   4694 N N     . GLY D 3 265 ? 8.646   71.790  47.335  1.00 52.98  ? 265 GLY B N     1 
ATOM   4695 C CA    . GLY D 3 265 ? 9.504   72.516  48.250  1.00 52.38  ? 265 GLY B CA    1 
ATOM   4696 C C     . GLY D 3 265 ? 10.316  71.503  49.041  1.00 52.36  ? 265 GLY B C     1 
ATOM   4697 O O     . GLY D 3 265 ? 11.472  71.218  48.722  1.00 53.36  ? 265 GLY B O     1 
ATOM   4698 N N     . ALA D 3 266 ? 9.693   70.928  50.061  1.00 51.36  ? 266 ALA B N     1 
ATOM   4699 C CA    . ALA D 3 266 ? 10.327  69.926  50.921  1.00 49.38  ? 266 ALA B CA    1 
ATOM   4700 C C     . ALA D 3 266 ? 10.833  68.663  50.210  1.00 47.57  ? 266 ALA B C     1 
ATOM   4701 O O     . ALA D 3 266 ? 11.927  68.183  50.496  1.00 46.70  ? 266 ALA B O     1 
ATOM   4702 C CB    . ALA D 3 266 ? 9.357   69.528  52.023  1.00 50.71  ? 266 ALA B CB    1 
ATOM   4703 N N     . ASP D 3 267 ? 10.031  68.107  49.309  1.00 45.84  ? 267 ASP B N     1 
ATOM   4704 C CA    . ASP D 3 267 ? 10.447  66.905  48.601  1.00 44.37  ? 267 ASP B CA    1 
ATOM   4705 C C     . ASP D 3 267 ? 11.030  67.220  47.233  1.00 42.28  ? 267 ASP B C     1 
ATOM   4706 O O     . ASP D 3 267 ? 12.137  66.796  46.922  1.00 42.59  ? 267 ASP B O     1 
ATOM   4707 C CB    . ASP D 3 267 ? 9.277   65.920  48.458  1.00 46.11  ? 267 ASP B CB    1 
ATOM   4708 C CG    . ASP D 3 267 ? 8.816   65.353  49.797  1.00 47.62  ? 267 ASP B CG    1 
ATOM   4709 O OD1   . ASP D 3 267 ? 9.651   65.261  50.728  1.00 47.77  ? 267 ASP B OD1   1 
ATOM   4710 O OD2   . ASP D 3 267 ? 7.623   64.984  49.912  1.00 48.15  ? 267 ASP B OD2   1 
ATOM   4711 N N     . ILE D 3 268 ? 10.288  67.956  46.416  1.00 39.19  ? 268 ILE B N     1 
ATOM   4712 C CA    . ILE D 3 268 ? 10.754  68.319  45.087  1.00 35.90  ? 268 ILE B CA    1 
ATOM   4713 C C     . ILE D 3 268 ? 10.638  69.829  44.898  1.00 35.90  ? 268 ILE B C     1 
ATOM   4714 O O     . ILE D 3 268 ? 9.546   70.326  44.676  1.00 36.93  ? 268 ILE B O     1 
ATOM   4715 C CB    . ILE D 3 268 ? 9.913   67.632  43.996  1.00 33.67  ? 268 ILE B CB    1 
ATOM   4716 C CG1   . ILE D 3 268 ? 10.027  66.119  44.113  1.00 31.64  ? 268 ILE B CG1   1 
ATOM   4717 C CG2   . ILE D 3 268 ? 10.374  68.075  42.637  1.00 32.63  ? 268 ILE B CG2   1 
ATOM   4718 C CD1   . ILE D 3 268 ? 9.303   65.384  43.016  1.00 30.65  ? 268 ILE B CD1   1 
ATOM   4719 N N     . SER D 3 269 ? 11.744  70.565  44.998  1.00 34.71  ? 269 SER B N     1 
ATOM   4720 C CA    . SER D 3 269 ? 11.694  72.020  44.806  1.00 32.91  ? 269 SER B CA    1 
ATOM   4721 C C     . SER D 3 269 ? 11.321  72.326  43.364  1.00 31.73  ? 269 SER B C     1 
ATOM   4722 O O     . SER D 3 269 ? 11.498  71.486  42.483  1.00 31.28  ? 269 SER B O     1 
ATOM   4723 C CB    . SER D 3 269 ? 13.048  72.680  45.110  1.00 32.89  ? 269 SER B CB    1 
ATOM   4724 O OG    . SER D 3 269 ? 13.263  72.845  46.498  1.00 32.80  ? 269 SER B OG    1 
ATOM   4725 N N     . VAL D 3 270 ? 10.807  73.527  43.120  1.00 30.10  ? 270 VAL B N     1 
ATOM   4726 C CA    . VAL D 3 270 ? 10.440  73.908  41.772  1.00 28.46  ? 270 VAL B CA    1 
ATOM   4727 C C     . VAL D 3 270 ? 10.764  75.355  41.476  1.00 28.74  ? 270 VAL B C     1 
ATOM   4728 O O     . VAL D 3 270 ? 10.730  76.201  42.359  1.00 28.42  ? 270 VAL B O     1 
ATOM   4729 C CB    . VAL D 3 270 ? 8.958   73.687  41.517  1.00 27.55  ? 270 VAL B CB    1 
ATOM   4730 C CG1   . VAL D 3 270 ? 8.609   74.140  40.128  1.00 26.86  ? 270 VAL B CG1   1 
ATOM   4731 C CG2   . VAL D 3 270 ? 8.632   72.233  41.674  1.00 27.77  ? 270 VAL B CG2   1 
ATOM   4732 N N     . VAL D 3 271 ? 11.095  75.625  40.221  1.00 28.86  ? 271 VAL B N     1 
ATOM   4733 C CA    . VAL D 3 271 ? 11.410  76.974  39.772  1.00 28.92  ? 271 VAL B CA    1 
ATOM   4734 C C     . VAL D 3 271 ? 10.807  77.262  38.406  1.00 30.46  ? 271 VAL B C     1 
ATOM   4735 O O     . VAL D 3 271 ? 11.024  76.538  37.437  1.00 30.35  ? 271 VAL B O     1 
ATOM   4736 C CB    . VAL D 3 271 ? 12.911  77.221  39.674  1.00 27.75  ? 271 VAL B CB    1 
ATOM   4737 C CG1   . VAL D 3 271 ? 13.161  78.622  39.164  1.00 26.90  ? 271 VAL B CG1   1 
ATOM   4738 C CG2   . VAL D 3 271 ? 13.545  77.040  41.017  1.00 27.24  ? 271 VAL B CG2   1 
ATOM   4739 N N     . GLY D 3 272 ? 10.058  78.352  38.343  1.00 32.04  ? 272 GLY B N     1 
ATOM   4740 C CA    . GLY D 3 272 ? 9.400   78.737  37.114  1.00 32.72  ? 272 GLY B CA    1 
ATOM   4741 C C     . GLY D 3 272 ? 10.088  79.847  36.362  1.00 33.26  ? 272 GLY B C     1 
ATOM   4742 O O     . GLY D 3 272 ? 11.220  80.226  36.660  1.00 32.95  ? 272 GLY B O     1 
ATOM   4743 N N     . TYR D 3 273 ? 9.374   80.392  35.392  1.00 33.49  ? 273 TYR B N     1 
ATOM   4744 C CA    . TYR D 3 273 ? 9.935   81.435  34.564  1.00 34.74  ? 273 TYR B CA    1 
ATOM   4745 C C     . TYR D 3 273 ? 8.787   82.340  34.124  1.00 35.76  ? 273 TYR B C     1 
ATOM   4746 O O     . TYR D 3 273 ? 7.760   81.841  33.653  1.00 36.22  ? 273 TYR B O     1 
ATOM   4747 C CB    . TYR D 3 273 ? 10.624  80.763  33.367  1.00 34.30  ? 273 TYR B CB    1 
ATOM   4748 C CG    . TYR D 3 273 ? 11.875  81.447  32.868  1.00 32.27  ? 273 TYR B CG    1 
ATOM   4749 C CD1   . TYR D 3 273 ? 11.796  82.495  31.964  1.00 32.25  ? 273 TYR B CD1   1 
ATOM   4750 C CD2   . TYR D 3 273 ? 13.131  81.056  33.309  1.00 31.01  ? 273 TYR B CD2   1 
ATOM   4751 C CE1   . TYR D 3 273 ? 12.917  83.135  31.510  1.00 31.31  ? 273 TYR B CE1   1 
ATOM   4752 C CE2   . TYR D 3 273 ? 14.261  81.699  32.859  1.00 31.04  ? 273 TYR B CE2   1 
ATOM   4753 C CZ    . TYR D 3 273 ? 14.138  82.741  31.957  1.00 31.38  ? 273 TYR B CZ    1 
ATOM   4754 O OH    . TYR D 3 273 ? 15.218  83.435  31.495  1.00 32.67  ? 273 TYR B OH    1 
ATOM   4755 N N     . ASP D 3 274 ? 8.974   83.653  34.303  1.00 36.39  ? 274 ASP B N     1 
ATOM   4756 C CA    . ASP D 3 274 ? 8.003   84.704  33.962  1.00 36.60  ? 274 ASP B CA    1 
ATOM   4757 C C     . ASP D 3 274 ? 7.634   85.556  35.150  1.00 37.49  ? 274 ASP B C     1 
ATOM   4758 O O     . ASP D 3 274 ? 7.724   86.778  35.106  1.00 37.73  ? 274 ASP B O     1 
ATOM   4759 C CB    . ASP D 3 274 ? 6.682   84.153  33.448  1.00 35.68  ? 274 ASP B CB    1 
ATOM   4760 C CG    . ASP D 3 274 ? 6.743   83.750  32.023  1.00 35.39  ? 274 ASP B CG    1 
ATOM   4761 O OD1   . ASP D 3 274 ? 7.678   84.171  31.318  1.00 33.76  ? 274 ASP B OD1   1 
ATOM   4762 O OD2   . ASP D 3 274 ? 5.832   83.016  31.617  1.00 36.50  ? 274 ASP B OD2   1 
ATOM   4763 N N     . ASP D 3 275 ? 7.202   84.889  36.210  1.00 38.41  ? 275 ASP B N     1 
ATOM   4764 C CA    . ASP D 3 275 ? 6.742   85.562  37.405  1.00 40.01  ? 275 ASP B CA    1 
ATOM   4765 C C     . ASP D 3 275 ? 5.462   86.242  36.961  1.00 41.33  ? 275 ASP B C     1 
ATOM   4766 O O     . ASP D 3 275 ? 5.354   87.467  37.001  1.00 42.71  ? 275 ASP B O     1 
ATOM   4767 C CB    . ASP D 3 275 ? 7.744   86.611  37.902  1.00 40.31  ? 275 ASP B CB    1 
ATOM   4768 C CG    . ASP D 3 275 ? 7.201   87.435  39.077  1.00 40.65  ? 275 ASP B CG    1 
ATOM   4769 O OD1   . ASP D 3 275 ? 6.638   86.829  40.022  1.00 39.49  ? 275 ASP B OD1   1 
ATOM   4770 O OD2   . ASP D 3 275 ? 7.348   88.684  39.054  1.00 40.28  ? 275 ASP B OD2   1 
ATOM   4771 N N     . THR D 3 276 ? 4.501   85.446  36.500  1.00 41.81  ? 276 THR B N     1 
ATOM   4772 C CA    . THR D 3 276 ? 3.222   85.988  36.064  1.00 42.64  ? 276 THR B CA    1 
ATOM   4773 C C     . THR D 3 276 ? 2.531   86.480  37.312  1.00 43.42  ? 276 THR B C     1 
ATOM   4774 O O     . THR D 3 276 ? 2.947   86.169  38.419  1.00 42.84  ? 276 THR B O     1 
ATOM   4775 C CB    . THR D 3 276 ? 2.331   84.924  35.456  1.00 42.37  ? 276 THR B CB    1 
ATOM   4776 O OG1   . THR D 3 276 ? 2.005   83.966  36.465  1.00 42.29  ? 276 THR B OG1   1 
ATOM   4777 C CG2   . THR D 3 276 ? 3.037   84.235  34.301  1.00 42.55  ? 276 THR B CG2   1 
ATOM   4778 N N     . GLU D 3 277 ? 1.466   87.240  37.144  1.00 45.36  ? 277 GLU B N     1 
ATOM   4779 C CA    . GLU D 3 277 ? 0.757   87.741  38.305  1.00 47.05  ? 277 GLU B CA    1 
ATOM   4780 C C     . GLU D 3 277 ? 0.304   86.601  39.222  1.00 45.40  ? 277 GLU B C     1 
ATOM   4781 O O     . GLU D 3 277 ? 0.564   86.630  40.420  1.00 44.64  ? 277 GLU B O     1 
ATOM   4782 C CB    . GLU D 3 277 ? -0.439  88.603  37.858  1.00 51.20  ? 277 GLU B CB    1 
ATOM   4783 C CG    . GLU D 3 277 ? -0.046  90.015  37.365  1.00 56.39  ? 277 GLU B CG    1 
ATOM   4784 C CD    . GLU D 3 277 ? 0.290   90.976  38.520  1.00 59.24  ? 277 GLU B CD    1 
ATOM   4785 O OE1   . GLU D 3 277 ? -0.640  91.311  39.293  1.00 60.72  ? 277 GLU B OE1   1 
ATOM   4786 O OE2   . GLU D 3 277 ? 1.471   91.391  38.660  1.00 60.20  ? 277 GLU B OE2   1 
ATOM   4787 N N     . ASP D 3 278 ? -0.340  85.587  38.657  1.00 44.43  ? 278 ASP B N     1 
ATOM   4788 C CA    . ASP D 3 278 ? -0.836  84.454  39.442  1.00 43.96  ? 278 ASP B CA    1 
ATOM   4789 C C     . ASP D 3 278 ? 0.213   83.661  40.249  1.00 43.13  ? 278 ASP B C     1 
ATOM   4790 O O     . ASP D 3 278 ? -0.061  83.180  41.356  1.00 42.82  ? 278 ASP B O     1 
ATOM   4791 C CB    . ASP D 3 278 ? -1.594  83.482  38.526  1.00 43.97  ? 278 ASP B CB    1 
ATOM   4792 C CG    . ASP D 3 278 ? -2.775  84.128  37.842  1.00 43.87  ? 278 ASP B CG    1 
ATOM   4793 O OD1   . ASP D 3 278 ? -3.068  85.308  38.145  1.00 43.28  ? 278 ASP B OD1   1 
ATOM   4794 O OD2   . ASP D 3 278 ? -3.407  83.444  37.007  1.00 43.65  ? 278 ASP B OD2   1 
ATOM   4795 N N     . SER D 3 279 ? 1.403   83.518  39.684  1.00 41.88  ? 279 SER B N     1 
ATOM   4796 C CA    . SER D 3 279 ? 2.469   82.771  40.321  1.00 40.21  ? 279 SER B CA    1 
ATOM   4797 C C     . SER D 3 279 ? 2.653   83.061  41.803  1.00 38.56  ? 279 SER B C     1 
ATOM   4798 O O     . SER D 3 279 ? 3.026   82.174  42.555  1.00 38.71  ? 279 SER B O     1 
ATOM   4799 C CB    . SER D 3 279 ? 3.780   83.055  39.602  1.00 41.48  ? 279 SER B CB    1 
ATOM   4800 O OG    . SER D 3 279 ? 4.148   84.417  39.770  1.00 42.86  ? 279 SER B OG    1 
ATOM   4801 N N     . SER D 3 280 ? 2.397   84.292  42.229  1.00 36.37  ? 280 SER B N     1 
ATOM   4802 C CA    . SER D 3 280 ? 2.599   84.646  43.629  1.00 34.98  ? 280 SER B CA    1 
ATOM   4803 C C     . SER D 3 280 ? 1.561   84.110  44.595  1.00 33.93  ? 280 SER B C     1 
ATOM   4804 O O     . SER D 3 280 ? 1.670   84.318  45.798  1.00 32.89  ? 280 SER B O     1 
ATOM   4805 C CB    . SER D 3 280 ? 2.656   86.154  43.788  1.00 35.83  ? 280 SER B CB    1 
ATOM   4806 O OG    . SER D 3 280 ? 1.364   86.711  43.665  1.00 36.40  ? 280 SER B OG    1 
ATOM   4807 N N     . CYS D 3 281 ? 0.543   83.436  44.077  1.00 33.58  ? 281 CYS B N     1 
ATOM   4808 C CA    . CYS D 3 281 ? -0.489  82.878  44.938  1.00 33.21  ? 281 CYS B CA    1 
ATOM   4809 C C     . CYS D 3 281 ? -0.717  81.405  44.631  1.00 33.20  ? 281 CYS B C     1 
ATOM   4810 O O     . CYS D 3 281 ? -1.800  80.878  44.844  1.00 33.38  ? 281 CYS B O     1 
ATOM   4811 C CB    . CYS D 3 281 ? -1.786  83.676  44.795  1.00 32.67  ? 281 CYS B CB    1 
ATOM   4812 S SG    . CYS D 3 281 ? -1.668  85.364  45.461  1.00 31.01  ? 281 CYS B SG    1 
ATOM   4813 N N     . TYR D 3 282 ? 0.320   80.760  44.106  1.00 33.21  ? 282 TYR B N     1 
ATOM   4814 C CA    . TYR D 3 282 ? 0.296   79.338  43.801  1.00 32.64  ? 282 TYR B CA    1 
ATOM   4815 C C     . TYR D 3 282 ? 0.488   78.609  45.137  1.00 31.98  ? 282 TYR B C     1 
ATOM   4816 O O     . TYR D 3 282 ? 1.010   79.176  46.096  1.00 31.29  ? 282 TYR B O     1 
ATOM   4817 C CB    . TYR D 3 282 ? 1.442   78.978  42.860  1.00 31.78  ? 282 TYR B CB    1 
ATOM   4818 C CG    . TYR D 3 282 ? 1.202   79.296  41.408  1.00 31.09  ? 282 TYR B CG    1 
ATOM   4819 C CD1   . TYR D 3 282 ? -0.005  79.820  40.972  1.00 30.54  ? 282 TYR B CD1   1 
ATOM   4820 C CD2   . TYR D 3 282 ? 2.169   79.003  40.457  1.00 32.03  ? 282 TYR B CD2   1 
ATOM   4821 C CE1   . TYR D 3 282 ? -0.245  80.030  39.623  1.00 31.17  ? 282 TYR B CE1   1 
ATOM   4822 C CE2   . TYR D 3 282 ? 1.939   79.212  39.107  1.00 32.02  ? 282 TYR B CE2   1 
ATOM   4823 C CZ    . TYR D 3 282 ? 0.730   79.721  38.699  1.00 31.38  ? 282 TYR B CZ    1 
ATOM   4824 O OH    . TYR D 3 282 ? 0.485   79.898  37.363  1.00 32.24  ? 282 TYR B OH    1 
ATOM   4825 N N     . ILE D 3 283 ? 0.076   77.351  45.203  1.00 31.87  ? 283 ILE B N     1 
ATOM   4826 C CA    . ILE D 3 283 ? 0.200   76.600  46.449  1.00 32.99  ? 283 ILE B CA    1 
ATOM   4827 C C     . ILE D 3 283 ? 1.339   75.581  46.405  1.00 31.51  ? 283 ILE B C     1 
ATOM   4828 O O     . ILE D 3 283 ? 1.190   74.467  45.883  1.00 30.85  ? 283 ILE B O     1 
ATOM   4829 C CB    . ILE D 3 283 ? -1.091  75.838  46.777  1.00 33.24  ? 283 ILE B CB    1 
ATOM   4830 C CG1   . ILE D 3 283 ? -2.328  76.608  46.291  1.00 32.24  ? 283 ILE B CG1   1 
ATOM   4831 C CG2   . ILE D 3 283 ? -1.163  75.622  48.278  1.00 33.91  ? 283 ILE B CG2   1 
ATOM   4832 C CD1   . ILE D 3 283 ? -2.622  77.843  47.090  1.00 32.11  ? 283 ILE B CD1   1 
ATOM   4833 N N     . PRO D 3 284 ? 2.487   75.934  47.001  1.00 29.99  ? 284 PRO B N     1 
ATOM   4834 C CA    . PRO D 3 284 ? 2.744   77.223  47.646  1.00 31.38  ? 284 PRO B CA    1 
ATOM   4835 C C     . PRO D 3 284 ? 3.267   78.210  46.623  1.00 30.82  ? 284 PRO B C     1 
ATOM   4836 O O     . PRO D 3 284 ? 3.485   77.848  45.468  1.00 30.97  ? 284 PRO B O     1 
ATOM   4837 C CB    . PRO D 3 284 ? 3.816   76.863  48.672  1.00 30.50  ? 284 PRO B CB    1 
ATOM   4838 C CG    . PRO D 3 284 ? 4.646   75.900  47.894  1.00 30.49  ? 284 PRO B CG    1 
ATOM   4839 C CD    . PRO D 3 284 ? 3.609   75.012  47.215  1.00 30.64  ? 284 PRO B CD    1 
ATOM   4840 N N     . PRO D 3 285 ? 3.506   79.464  47.032  1.00 29.30  ? 285 PRO B N     1 
ATOM   4841 C CA    . PRO D 3 285 ? 4.013   80.515  46.148  1.00 30.54  ? 285 PRO B CA    1 
ATOM   4842 C C     . PRO D 3 285 ? 5.238   80.056  45.351  1.00 30.12  ? 285 PRO B C     1 
ATOM   4843 O O     . PRO D 3 285 ? 6.206   79.561  45.920  1.00 31.55  ? 285 PRO B O     1 
ATOM   4844 C CB    . PRO D 3 285 ? 4.316   81.633  47.119  1.00 30.45  ? 285 PRO B CB    1 
ATOM   4845 C CG    . PRO D 3 285 ? 3.210   81.489  48.100  1.00 31.35  ? 285 PRO B CG    1 
ATOM   4846 C CD    . PRO D 3 285 ? 3.220   80.010  48.366  1.00 30.61  ? 285 PRO B CD    1 
ATOM   4847 N N     . LEU D 3 286 ? 5.183   80.236  44.034  1.00 28.32  ? 286 LEU B N     1 
ATOM   4848 C CA    . LEU D 3 286 ? 6.236   79.810  43.126  1.00 26.76  ? 286 LEU B CA    1 
ATOM   4849 C C     . LEU D 3 286 ? 7.453   80.701  42.998  1.00 26.97  ? 286 LEU B C     1 
ATOM   4850 O O     . LEU D 3 286 ? 7.336   81.891  42.772  1.00 26.68  ? 286 LEU B O     1 
ATOM   4851 C CB    . LEU D 3 286 ? 5.643   79.607  41.742  1.00 24.47  ? 286 LEU B CB    1 
ATOM   4852 C CG    . LEU D 3 286 ? 6.635   79.270  40.641  1.00 23.91  ? 286 LEU B CG    1 
ATOM   4853 C CD1   . LEU D 3 286 ? 7.249   77.933  40.927  1.00 24.30  ? 286 LEU B CD1   1 
ATOM   4854 C CD2   . LEU D 3 286 ? 5.931   79.241  39.306  1.00 23.68  ? 286 LEU B CD2   1 
ATOM   4855 N N     . THR D 3 287 ? 8.629   80.097  43.134  1.00 27.88  ? 287 THR B N     1 
ATOM   4856 C CA    . THR D 3 287 ? 9.900   80.799  42.999  1.00 28.69  ? 287 THR B CA    1 
ATOM   4857 C C     . THR D 3 287 ? 10.087  80.845  41.510  1.00 28.75  ? 287 THR B C     1 
ATOM   4858 O O     . THR D 3 287 ? 9.922   79.829  40.857  1.00 28.42  ? 287 THR B O     1 
ATOM   4859 C CB    . THR D 3 287 ? 11.063  79.987  43.573  1.00 29.52  ? 287 THR B CB    1 
ATOM   4860 O OG1   . THR D 3 287 ? 10.908  79.849  44.987  1.00 31.77  ? 287 THR B OG1   1 
ATOM   4861 C CG2   . THR D 3 287 ? 12.371  80.668  43.274  1.00 29.89  ? 287 THR B CG2   1 
ATOM   4862 N N     . THR D 3 288 ? 10.429  81.995  40.954  1.00 29.62  ? 288 THR B N     1 
ATOM   4863 C CA    . THR D 3 288 ? 10.592  82.039  39.512  1.00 31.32  ? 288 THR B CA    1 
ATOM   4864 C C     . THR D 3 288 ? 11.543  83.116  39.000  1.00 32.84  ? 288 THR B C     1 
ATOM   4865 O O     . THR D 3 288 ? 12.162  83.844  39.775  1.00 32.22  ? 288 THR B O     1 
ATOM   4866 C CB    . THR D 3 288 ? 9.210   82.187  38.836  1.00 31.52  ? 288 THR B CB    1 
ATOM   4867 O OG1   . THR D 3 288 ? 9.358   82.176  37.411  1.00 31.20  ? 288 THR B OG1   1 
ATOM   4868 C CG2   . THR D 3 288 ? 8.545   83.472  39.276  1.00 32.16  ? 288 THR B CG2   1 
ATOM   4869 N N     . ILE D 3 289 ? 11.669  83.185  37.681  1.00 34.44  ? 289 ILE B N     1 
ATOM   4870 C CA    . ILE D 3 289 ? 12.525  84.157  37.023  1.00 36.63  ? 289 ILE B CA    1 
ATOM   4871 C C     . ILE D 3 289 ? 11.644  85.275  36.462  1.00 38.97  ? 289 ILE B C     1 
ATOM   4872 O O     . ILE D 3 289 ? 10.799  85.040  35.594  1.00 39.24  ? 289 ILE B O     1 
ATOM   4873 C CB    . ILE D 3 289 ? 13.293  83.484  35.886  1.00 36.47  ? 289 ILE B CB    1 
ATOM   4874 C CG1   . ILE D 3 289 ? 14.074  82.299  36.441  1.00 36.52  ? 289 ILE B CG1   1 
ATOM   4875 C CG2   . ILE D 3 289 ? 14.252  84.459  35.242  1.00 36.50  ? 289 ILE B CG2   1 
ATOM   4876 C CD1   . ILE D 3 289 ? 15.024  82.687  37.542  1.00 37.03  ? 289 ILE B CD1   1 
ATOM   4877 N N     . LYS D 3 290 ? 11.854  86.494  36.947  1.00 41.00  ? 290 LYS B N     1 
ATOM   4878 C CA    . LYS D 3 290 ? 11.045  87.637  36.530  1.00 42.85  ? 290 LYS B CA    1 
ATOM   4879 C C     . LYS D 3 290 ? 11.399  88.257  35.192  1.00 42.75  ? 290 LYS B C     1 
ATOM   4880 O O     . LYS D 3 290 ? 12.540  88.658  34.968  1.00 42.78  ? 290 LYS B O     1 
ATOM   4881 C CB    . LYS D 3 290 ? 11.108  88.735  37.593  1.00 45.20  ? 290 LYS B CB    1 
ATOM   4882 C CG    . LYS D 3 290 ? 10.198  89.924  37.327  1.00 48.67  ? 290 LYS B CG    1 
ATOM   4883 C CD    . LYS D 3 290 ? 10.324  91.003  38.415  1.00 51.99  ? 290 LYS B CD    1 
ATOM   4884 C CE    . LYS D 3 290 ? 9.444   92.229  38.119  1.00 54.31  ? 290 LYS B CE    1 
ATOM   4885 N NZ    . LYS D 3 290 ? 9.726   93.402  39.010  1.00 55.31  ? 290 LYS B NZ    1 
ATOM   4886 N N     . GLN D 3 291 ? 10.399  88.359  34.321  1.00 42.71  ? 291 GLN B N     1 
ATOM   4887 C CA    . GLN D 3 291 ? 10.571  88.972  33.008  1.00 42.77  ? 291 GLN B CA    1 
ATOM   4888 C C     . GLN D 3 291 ? 9.567   90.118  32.904  1.00 42.19  ? 291 GLN B C     1 
ATOM   4889 O O     . GLN D 3 291 ? 8.377   89.905  32.675  1.00 41.01  ? 291 GLN B O     1 
ATOM   4890 C CB    . GLN D 3 291 ? 10.321  87.954  31.902  1.00 43.05  ? 291 GLN B CB    1 
ATOM   4891 C CG    . GLN D 3 291 ? 11.179  86.706  31.997  1.00 43.93  ? 291 GLN B CG    1 
ATOM   4892 C CD    . GLN D 3 291 ? 11.143  85.895  30.717  1.00 45.03  ? 291 GLN B CD    1 
ATOM   4893 O OE1   . GLN D 3 291 ? 12.059  85.971  29.887  1.00 44.79  ? 291 GLN B OE1   1 
ATOM   4894 N NE2   . GLN D 3 291 ? 10.069  85.125  30.538  1.00 45.92  ? 291 GLN B NE2   1 
ATOM   4895 N N     . ASP D 3 292 ? 10.062  91.338  33.074  1.00 42.46  ? 292 ASP B N     1 
ATOM   4896 C CA    . ASP D 3 292 ? 9.218   92.524  33.053  1.00 42.82  ? 292 ASP B CA    1 
ATOM   4897 C C     . ASP D 3 292 ? 8.586   92.855  31.709  1.00 42.30  ? 292 ASP B C     1 
ATOM   4898 O O     . ASP D 3 292 ? 9.038   93.764  31.017  1.00 42.13  ? 292 ASP B O     1 
ATOM   4899 C CB    . ASP D 3 292 ? 10.025  93.724  33.564  1.00 44.09  ? 292 ASP B CB    1 
ATOM   4900 C CG    . ASP D 3 292 ? 9.158   94.939  33.835  1.00 45.93  ? 292 ASP B CG    1 
ATOM   4901 O OD1   . ASP D 3 292 ? 9.606   95.831  34.593  1.00 45.96  ? 292 ASP B OD1   1 
ATOM   4902 O OD2   . ASP D 3 292 ? 8.032   94.997  33.288  1.00 46.94  ? 292 ASP B OD2   1 
ATOM   4903 N N     . PHE D 3 293 ? 7.521   92.143  31.353  1.00 42.35  ? 293 PHE B N     1 
ATOM   4904 C CA    . PHE D 3 293 ? 6.850   92.388  30.081  1.00 43.43  ? 293 PHE B CA    1 
ATOM   4905 C C     . PHE D 3 293 ? 6.585   93.865  29.786  1.00 45.50  ? 293 PHE B C     1 
ATOM   4906 O O     . PHE D 3 293 ? 6.684   94.289  28.633  1.00 45.56  ? 293 PHE B O     1 
ATOM   4907 C CB    . PHE D 3 293 ? 5.528   91.634  30.012  1.00 41.35  ? 293 PHE B CB    1 
ATOM   4908 C CG    . PHE D 3 293 ? 5.659   90.149  30.175  1.00 39.43  ? 293 PHE B CG    1 
ATOM   4909 C CD1   . PHE D 3 293 ? 5.202   89.526  31.328  1.00 38.71  ? 293 PHE B CD1   1 
ATOM   4910 C CD2   . PHE D 3 293 ? 6.200   89.369  29.173  1.00 38.46  ? 293 PHE B CD2   1 
ATOM   4911 C CE1   . PHE D 3 293 ? 5.275   88.160  31.478  1.00 38.05  ? 293 PHE B CE1   1 
ATOM   4912 C CE2   . PHE D 3 293 ? 6.274   87.999  29.325  1.00 38.15  ? 293 PHE B CE2   1 
ATOM   4913 C CZ    . PHE D 3 293 ? 5.813   87.397  30.471  1.00 38.17  ? 293 PHE B CZ    1 
ATOM   4914 N N     . ARG D 3 294 ? 6.243   94.649  30.810  1.00 48.38  ? 294 ARG B N     1 
ATOM   4915 C CA    . ARG D 3 294 ? 5.973   96.078  30.600  1.00 51.09  ? 294 ARG B CA    1 
ATOM   4916 C C     . ARG D 3 294 ? 7.192   96.736  29.973  1.00 49.50  ? 294 ARG B C     1 
ATOM   4917 O O     . ARG D 3 294 ? 7.066   97.495  29.009  1.00 49.82  ? 294 ARG B O     1 
ATOM   4918 C CB    . ARG D 3 294 ? 5.669   96.832  31.916  1.00 56.74  ? 294 ARG B CB    1 
ATOM   4919 C CG    . ARG D 3 294 ? 4.331   96.592  32.649  1.00 64.59  ? 294 ARG B CG    1 
ATOM   4920 C CD    . ARG D 3 294 ? 3.026   96.937  31.908  1.00 72.54  ? 294 ARG B CD    1 
ATOM   4921 N NE    . ARG D 3 294 ? 2.739   98.251  31.454  1.00 78.10  ? 294 ARG B NE    1 
ATOM   4922 C CZ    . ARG D 3 294 ? 1.920   98.724  30.512  1.00 80.94  ? 294 ARG B CZ    1 
ATOM   4923 N NH1   . ARG D 3 294 ? 1.952   100.037 30.443  1.00 81.81  ? 294 ARG B NH1   1 
ATOM   4924 N NH2   . ARG D 3 294 ? 1.137   98.029  29.668  1.00 82.16  ? 294 ARG B NH2   1 
ATOM   4925 N N     . LEU D 3 295 ? 8.364   96.439  30.541  1.00 47.16  ? 295 LEU B N     1 
ATOM   4926 C CA    . LEU D 3 295 ? 9.637   96.992  30.085  1.00 45.07  ? 295 LEU B CA    1 
ATOM   4927 C C     . LEU D 3 295 ? 9.928   96.616  28.643  1.00 43.79  ? 295 LEU B C     1 
ATOM   4928 O O     . LEU D 3 295 ? 10.304  97.464  27.826  1.00 43.76  ? 295 LEU B O     1 
ATOM   4929 C CB    . LEU D 3 295 ? 10.765  96.501  30.986  1.00 44.06  ? 295 LEU B CB    1 
ATOM   4930 C CG    . LEU D 3 295 ? 12.183  96.989  30.686  1.00 43.94  ? 295 LEU B CG    1 
ATOM   4931 C CD1   . LEU D 3 295 ? 12.221  98.497  30.621  1.00 43.64  ? 295 LEU B CD1   1 
ATOM   4932 C CD2   . LEU D 3 295 ? 13.123  96.489  31.769  1.00 44.40  ? 295 LEU B CD2   1 
ATOM   4933 N N     . LEU D 3 296 ? 9.753   95.340  28.334  1.00 42.52  ? 296 LEU B N     1 
ATOM   4934 C CA    . LEU D 3 296 ? 9.976   94.860  26.987  1.00 41.73  ? 296 LEU B CA    1 
ATOM   4935 C C     . LEU D 3 296 ? 9.117   95.673  26.033  1.00 42.72  ? 296 LEU B C     1 
ATOM   4936 O O     . LEU D 3 296 ? 9.628   96.349  25.144  1.00 43.25  ? 296 LEU B O     1 
ATOM   4937 C CB    . LEU D 3 296 ? 9.595   93.394  26.886  1.00 39.34  ? 296 LEU B CB    1 
ATOM   4938 C CG    . LEU D 3 296 ? 9.629   92.885  25.459  1.00 37.84  ? 296 LEU B CG    1 
ATOM   4939 C CD1   . LEU D 3 296 ? 11.028  93.044  24.924  1.00 38.04  ? 296 LEU B CD1   1 
ATOM   4940 C CD2   . LEU D 3 296 ? 9.185   91.452  25.419  1.00 36.96  ? 296 LEU B CD2   1 
ATOM   4941 N N     . GLY D 3 297 ? 7.805   95.612  26.237  1.00 43.96  ? 297 GLY B N     1 
ATOM   4942 C CA    . GLY D 3 297 ? 6.878   96.344  25.390  1.00 45.26  ? 297 GLY B CA    1 
ATOM   4943 C C     . GLY D 3 297 ? 7.201   97.821  25.273  1.00 46.22  ? 297 GLY B C     1 
ATOM   4944 O O     . GLY D 3 297 ? 7.188   98.367  24.171  1.00 46.13  ? 297 GLY B O     1 
ATOM   4945 N N     . GLN D 3 298 ? 7.483   98.467  26.405  1.00 47.32  ? 298 GLN B N     1 
ATOM   4946 C CA    . GLN D 3 298 ? 7.820   99.888  26.420  1.00 48.20  ? 298 GLN B CA    1 
ATOM   4947 C C     . GLN D 3 298 ? 9.095   100.102 25.610  1.00 47.54  ? 298 GLN B C     1 
ATOM   4948 O O     . GLN D 3 298 ? 9.122   100.909 24.678  1.00 48.09  ? 298 GLN B O     1 
ATOM   4949 C CB    . GLN D 3 298 ? 8.006   100.387 27.868  1.00 50.03  ? 298 GLN B CB    1 
ATOM   4950 C CG    . GLN D 3 298 ? 8.374   101.872 28.013  1.00 54.91  ? 298 GLN B CG    1 
ATOM   4951 C CD    . GLN D 3 298 ? 9.884   102.125 28.179  1.00 58.25  ? 298 GLN B CD    1 
ATOM   4952 O OE1   . GLN D 3 298 ? 10.463  101.794 29.218  1.00 60.57  ? 298 GLN B OE1   1 
ATOM   4953 N NE2   . GLN D 3 298 ? 10.520  102.720 27.157  1.00 59.58  ? 298 GLN B NE2   1 
ATOM   4954 N N     . THR D 3 299 ? 10.144  99.362  25.946  1.00 46.33  ? 299 THR B N     1 
ATOM   4955 C CA    . THR D 3 299 ? 11.394  99.505  25.234  1.00 45.59  ? 299 THR B CA    1 
ATOM   4956 C C     . THR D 3 299 ? 11.215  99.251  23.737  1.00 46.21  ? 299 THR B C     1 
ATOM   4957 O O     . THR D 3 299 ? 11.724  100.005 22.914  1.00 46.67  ? 299 THR B O     1 
ATOM   4958 C CB    . THR D 3 299 ? 12.438  98.572  25.808  1.00 44.62  ? 299 THR B CB    1 
ATOM   4959 O OG1   . THR D 3 299 ? 12.643  98.901  27.185  1.00 43.55  ? 299 THR B OG1   1 
ATOM   4960 C CG2   . THR D 3 299 ? 13.743  98.718  25.062  1.00 44.74  ? 299 THR B CG2   1 
ATOM   4961 N N     . SER D 3 300 ? 10.472  98.214  23.374  1.00 46.65  ? 300 SER B N     1 
ATOM   4962 C CA    . SER D 3 300 ? 10.263  97.918  21.963  1.00 47.64  ? 300 SER B CA    1 
ATOM   4963 C C     . SER D 3 300 ? 9.752   99.098  21.151  1.00 48.39  ? 300 SER B C     1 
ATOM   4964 O O     . SER D 3 300 ? 10.232  99.332  20.043  1.00 49.12  ? 300 SER B O     1 
ATOM   4965 C CB    . SER D 3 300 ? 9.298   96.748  21.792  1.00 47.72  ? 300 SER B CB    1 
ATOM   4966 O OG    . SER D 3 300 ? 9.902   95.540  22.208  1.00 48.90  ? 300 SER B OG    1 
ATOM   4967 N N     . VAL D 3 301 ? 8.780   99.839  21.674  1.00 48.99  ? 301 VAL B N     1 
ATOM   4968 C CA    . VAL D 3 301 ? 8.263   100.967 20.916  1.00 49.74  ? 301 VAL B CA    1 
ATOM   4969 C C     . VAL D 3 301 ? 9.317   102.061 20.831  1.00 50.49  ? 301 VAL B C     1 
ATOM   4970 O O     . VAL D 3 301 ? 9.630   102.533 19.739  1.00 50.89  ? 301 VAL B O     1 
ATOM   4971 C CB    . VAL D 3 301 ? 6.942   101.521 21.516  1.00 49.75  ? 301 VAL B CB    1 
ATOM   4972 C CG1   . VAL D 3 301 ? 6.526   102.793 20.786  1.00 50.31  ? 301 VAL B CG1   1 
ATOM   4973 C CG2   . VAL D 3 301 ? 5.832   100.488 21.363  1.00 49.08  ? 301 VAL B CG2   1 
ATOM   4974 N N     . ASP D 3 302 ? 9.880   102.452 21.968  1.00 51.02  ? 302 ASP B N     1 
ATOM   4975 C CA    . ASP D 3 302 ? 10.907  103.488 21.974  1.00 52.58  ? 302 ASP B CA    1 
ATOM   4976 C C     . ASP D 3 302 ? 11.961  103.199 20.928  1.00 53.54  ? 302 ASP B C     1 
ATOM   4977 O O     . ASP D 3 302 ? 12.335  104.061 20.141  1.00 54.28  ? 302 ASP B O     1 
ATOM   4978 C CB    . ASP D 3 302 ? 11.583  103.564 23.335  1.00 53.30  ? 302 ASP B CB    1 
ATOM   4979 C CG    . ASP D 3 302 ? 10.712  104.200 24.375  1.00 53.87  ? 302 ASP B CG    1 
ATOM   4980 O OD1   . ASP D 3 302 ? 9.483   104.226 24.158  1.00 54.45  ? 302 ASP B OD1   1 
ATOM   4981 O OD2   . ASP D 3 302 ? 11.252  104.659 25.406  1.00 52.76  ? 302 ASP B OD2   1 
ATOM   4982 N N     . ARG D 3 303 ? 12.443  101.972 20.925  1.00 54.64  ? 303 ARG B N     1 
ATOM   4983 C CA    . ARG D 3 303 ? 13.457  101.581 19.979  1.00 56.37  ? 303 ARG B CA    1 
ATOM   4984 C C     . ARG D 3 303 ? 12.994  101.602 18.518  1.00 57.22  ? 303 ARG B C     1 
ATOM   4985 O O     . ARG D 3 303 ? 13.714  102.093 17.647  1.00 57.39  ? 303 ARG B O     1 
ATOM   4986 C CB    . ARG D 3 303 ? 13.945  100.197 20.331  1.00 57.26  ? 303 ARG B CB    1 
ATOM   4987 C CG    . ARG D 3 303 ? 14.944  99.680  19.381  1.00 58.87  ? 303 ARG B CG    1 
ATOM   4988 C CD    . ARG D 3 303 ? 16.285  99.691  20.068  1.00 59.76  ? 303 ARG B CD    1 
ATOM   4989 N NE    . ARG D 3 303 ? 17.033  98.722  19.376  1.00 60.78  ? 303 ARG B NE    1 
ATOM   4990 C CZ    . ARG D 3 303 ? 17.605  97.573  19.667  1.00 61.02  ? 303 ARG B CZ    1 
ATOM   4991 N NH1   . ARG D 3 303 ? 18.157  97.046  18.600  1.00 61.05  ? 303 ARG B NH1   1 
ATOM   4992 N NH2   . ARG D 3 303 ? 17.691  96.967  20.842  1.00 61.13  ? 303 ARG B NH2   1 
ATOM   4993 N N     . LEU D 3 304 ? 11.809  101.069 18.233  1.00 57.90  ? 304 LEU B N     1 
ATOM   4994 C CA    . LEU D 3 304 ? 11.345  101.063 16.849  1.00 59.18  ? 304 LEU B CA    1 
ATOM   4995 C C     . LEU D 3 304 ? 11.259  102.479 16.303  1.00 60.33  ? 304 LEU B C     1 
ATOM   4996 O O     . LEU D 3 304 ? 11.417  102.697 15.102  1.00 60.91  ? 304 LEU B O     1 
ATOM   4997 C CB    . LEU D 3 304 ? 9.979   100.376 16.697  1.00 58.47  ? 304 LEU B CB    1 
ATOM   4998 C CG    . LEU D 3 304 ? 9.506   100.244 15.233  1.00 58.19  ? 304 LEU B CG    1 
ATOM   4999 C CD1   . LEU D 3 304 ? 10.424  99.314  14.464  1.00 58.22  ? 304 LEU B CD1   1 
ATOM   5000 C CD2   . LEU D 3 304 ? 8.100   99.700  15.172  1.00 57.71  ? 304 LEU B CD2   1 
ATOM   5001 N N     . LEU D 3 305 ? 11.006  103.442 17.179  1.00 62.18  ? 305 LEU B N     1 
ATOM   5002 C CA    . LEU D 3 305 ? 10.918  104.827 16.743  1.00 64.68  ? 305 LEU B CA    1 
ATOM   5003 C C     . LEU D 3 305 ? 12.310  105.373 16.465  1.00 66.66  ? 305 LEU B C     1 
ATOM   5004 O O     . LEU D 3 305 ? 12.518  106.102 15.491  1.00 67.28  ? 305 LEU B O     1 
ATOM   5005 C CB    . LEU D 3 305 ? 10.221  105.684 17.800  1.00 64.31  ? 305 LEU B CB    1 
ATOM   5006 C CG    . LEU D 3 305 ? 8.743   105.367 18.057  1.00 64.28  ? 305 LEU B CG    1 
ATOM   5007 C CD1   . LEU D 3 305 ? 8.196   106.326 19.103  1.00 64.07  ? 305 LEU B CD1   1 
ATOM   5008 C CD2   . LEU D 3 305 ? 7.945   105.484 16.767  1.00 64.39  ? 305 LEU B CD2   1 
ATOM   5009 N N     . GLN D 3 306 ? 13.261  105.016 17.323  1.00 68.66  ? 306 GLN B N     1 
ATOM   5010 C CA    . GLN D 3 306 ? 14.636  105.464 17.156  1.00 71.03  ? 306 GLN B CA    1 
ATOM   5011 C C     . GLN D 3 306 ? 15.150  104.972 15.807  1.00 72.86  ? 306 GLN B C     1 
ATOM   5012 O O     . GLN D 3 306 ? 15.712  105.746 15.031  1.00 73.16  ? 306 GLN B O     1 
ATOM   5013 C CB    . GLN D 3 306 ? 15.516  104.926 18.287  1.00 70.87  ? 306 GLN B CB    1 
ATOM   5014 C CG    . GLN D 3 306 ? 15.163  105.472 19.664  1.00 71.59  ? 306 GLN B CG    1 
ATOM   5015 C CD    . GLN D 3 306 ? 15.977  104.836 20.779  1.00 72.31  ? 306 GLN B CD    1 
ATOM   5016 O OE1   . GLN D 3 306 ? 15.850  105.207 21.945  1.00 72.50  ? 306 GLN B OE1   1 
ATOM   5017 N NE2   . GLN D 3 306 ? 16.816  103.871 20.426  1.00 73.11  ? 306 GLN B NE2   1 
ATOM   5018 N N     . LEU D 3 307 ? 14.944  103.689 15.522  1.00 75.15  ? 307 LEU B N     1 
ATOM   5019 C CA    . LEU D 3 307 ? 15.391  103.125 14.257  1.00 77.78  ? 307 LEU B CA    1 
ATOM   5020 C C     . LEU D 3 307 ? 14.726  103.839 13.084  1.00 80.16  ? 307 LEU B C     1 
ATOM   5021 O O     . LEU D 3 307 ? 15.376  104.127 12.077  1.00 80.72  ? 307 LEU B O     1 
ATOM   5022 C CB    . LEU D 3 307 ? 15.081  101.626 14.191  1.00 77.19  ? 307 LEU B CB    1 
ATOM   5023 C CG    . LEU D 3 307 ? 15.839  100.685 15.135  1.00 77.04  ? 307 LEU B CG    1 
ATOM   5024 C CD1   . LEU D 3 307 ? 15.293  99.285  14.961  1.00 77.09  ? 307 LEU B CD1   1 
ATOM   5025 C CD2   . LEU D 3 307 ? 17.335  100.704 14.846  1.00 77.00  ? 307 LEU B CD2   1 
ATOM   5026 N N     . SER D 3 308 ? 13.434  104.132 13.217  1.00 82.80  ? 308 SER B N     1 
ATOM   5027 C CA    . SER D 3 308 ? 12.695  104.814 12.154  1.00 85.60  ? 308 SER B CA    1 
ATOM   5028 C C     . SER D 3 308 ? 13.313  106.182 11.859  1.00 87.37  ? 308 SER B C     1 
ATOM   5029 O O     . SER D 3 308 ? 13.187  106.709 10.747  1.00 87.44  ? 308 SER B O     1 
ATOM   5030 C CB    . SER D 3 308 ? 11.218  104.974 12.547  1.00 85.86  ? 308 SER B CB    1 
ATOM   5031 O OG    . SER D 3 308 ? 10.428  105.397 11.441  1.00 86.25  ? 308 SER B OG    1 
ATOM   5032 N N     . GLN D 3 309 ? 13.981  106.744 12.864  1.00 89.66  ? 309 GLN B N     1 
ATOM   5033 C CA    . GLN D 3 309 ? 14.643  108.038 12.741  1.00 92.48  ? 309 GLN B CA    1 
ATOM   5034 C C     . GLN D 3 309 ? 16.125  107.864 12.431  1.00 93.94  ? 309 GLN B C     1 
ATOM   5035 O O     . GLN D 3 309 ? 16.948  108.709 12.800  1.00 94.04  ? 309 GLN B O     1 
ATOM   5036 C CB    . GLN D 3 309 ? 14.503  108.832 14.035  1.00 93.58  ? 309 GLN B CB    1 
ATOM   5037 C CG    . GLN D 3 309 ? 13.167  109.526 14.224  1.00 95.93  ? 309 GLN B CG    1 
ATOM   5038 C CD    . GLN D 3 309 ? 13.050  110.188 15.599  1.00 97.36  ? 309 GLN B CD    1 
ATOM   5039 O OE1   . GLN D 3 309 ? 14.059  110.559 16.214  1.00 97.95  ? 309 GLN B OE1   1 
ATOM   5040 N NE2   . GLN D 3 309 ? 11.815  110.347 16.080  1.00 97.82  ? 309 GLN B NE2   1 
ATOM   5041 N N     . GLY D 3 310 ? 16.462  106.761 11.767  1.00 95.73  ? 310 GLY B N     1 
ATOM   5042 C CA    . GLY D 3 310 ? 17.847  106.497 11.416  1.00 97.63  ? 310 GLY B CA    1 
ATOM   5043 C C     . GLY D 3 310 ? 18.854  106.688 12.543  1.00 98.89  ? 310 GLY B C     1 
ATOM   5044 O O     . GLY D 3 310 ? 20.007  107.049 12.291  1.00 99.11  ? 310 GLY B O     1 
ATOM   5045 N N     . GLN D 3 311 ? 18.425  106.461 13.784  1.00 100.05 ? 311 GLN B N     1 
ATOM   5046 C CA    . GLN D 3 311 ? 19.313  106.592 14.940  1.00 101.10 ? 311 GLN B CA    1 
ATOM   5047 C C     . GLN D 3 311 ? 20.168  105.311 14.982  1.00 100.94 ? 311 GLN B C     1 
ATOM   5048 O O     . GLN D 3 311 ? 19.664  104.209 14.720  1.00 101.35 ? 311 GLN B O     1 
ATOM   5049 C CB    . GLN D 3 311 ? 18.480  106.740 16.221  1.00 102.65 ? 311 GLN B CB    1 
ATOM   5050 C CG    . GLN D 3 311 ? 19.215  107.331 17.424  1.00 105.03 ? 311 GLN B CG    1 
ATOM   5051 C CD    . GLN D 3 311 ? 18.286  107.583 18.622  1.00 106.85 ? 311 GLN B CD    1 
ATOM   5052 O OE1   . GLN D 3 311 ? 17.309  108.342 18.521  1.00 107.97 ? 311 GLN B OE1   1 
ATOM   5053 N NE2   . GLN D 3 311 ? 18.591  106.950 19.760  1.00 107.47 ? 311 GLN B NE2   1 
ATOM   5054 N N     . ALA D 3 312 ? 21.457  105.460 15.296  1.00 100.09 ? 312 ALA B N     1 
ATOM   5055 C CA    . ALA D 3 312 ? 22.396  104.325 15.344  1.00 98.16  ? 312 ALA B CA    1 
ATOM   5056 C C     . ALA D 3 312 ? 22.283  103.457 16.604  1.00 96.41  ? 312 ALA B C     1 
ATOM   5057 O O     . ALA D 3 312 ? 23.074  103.583 17.550  1.00 95.68  ? 312 ALA B O     1 
ATOM   5058 C CB    . ALA D 3 312 ? 23.837  104.831 15.185  1.00 98.77  ? 312 ALA B CB    1 
ATOM   5059 N N     . VAL D 3 313 ? 21.298  102.563 16.587  1.00 94.11  ? 313 VAL B N     1 
ATOM   5060 C CA    . VAL D 3 313 ? 21.037  101.655 17.692  1.00 91.33  ? 313 VAL B CA    1 
ATOM   5061 C C     . VAL D 3 313 ? 20.746  100.260 17.131  1.00 89.56  ? 313 VAL B C     1 
ATOM   5062 O O     . VAL D 3 313 ? 19.909  99.526  17.661  1.00 89.29  ? 313 VAL B O     1 
ATOM   5063 C CB    . VAL D 3 313 ? 19.833  102.157 18.528  1.00 91.45  ? 313 VAL B CB    1 
ATOM   5064 C CG1   . VAL D 3 313 ? 20.202  103.456 19.237  1.00 91.67  ? 313 VAL B CG1   1 
ATOM   5065 C CG2   . VAL D 3 313 ? 18.629  102.396 17.622  1.00 91.10  ? 313 VAL B CG2   1 
ATOM   5066 N N     . LYS D 3 314 ? 21.450  99.912  16.051  1.00 87.20  ? 314 LYS B N     1 
ATOM   5067 C CA    . LYS D 3 314 ? 21.297  98.615  15.379  1.00 84.25  ? 314 LYS B CA    1 
ATOM   5068 C C     . LYS D 3 314 ? 21.849  97.456  16.204  1.00 81.04  ? 314 LYS B C     1 
ATOM   5069 O O     . LYS D 3 314 ? 22.768  97.632  17.009  1.00 80.60  ? 314 LYS B O     1 
ATOM   5070 C CB    . LYS D 3 314 ? 22.008  98.622  14.011  1.00 86.03  ? 314 LYS B CB    1 
ATOM   5071 C CG    . LYS D 3 314 ? 21.322  99.424  12.879  1.00 88.31  ? 314 LYS B CG    1 
ATOM   5072 C CD    . LYS D 3 314 ? 20.067  98.722  12.295  1.00 89.95  ? 314 LYS B CD    1 
ATOM   5073 C CE    . LYS D 3 314 ? 19.431  99.522  11.127  1.00 90.23  ? 314 LYS B CE    1 
ATOM   5074 N NZ    . LYS D 3 314 ? 18.112  98.982  10.652  1.00 90.06  ? 314 LYS B NZ    1 
ATOM   5075 N N     . GLY D 3 315 ? 21.283  96.269  15.998  1.00 77.47  ? 315 GLY B N     1 
ATOM   5076 C CA    . GLY D 3 315 ? 21.760  95.098  16.715  1.00 73.31  ? 315 GLY B CA    1 
ATOM   5077 C C     . GLY D 3 315 ? 20.791  94.432  17.675  1.00 70.01  ? 315 GLY B C     1 
ATOM   5078 O O     . GLY D 3 315 ? 19.571  94.591  17.560  1.00 70.04  ? 315 GLY B O     1 
ATOM   5079 N N     . ASN D 3 316 ? 21.351  93.675  18.620  1.00 66.29  ? 316 ASN B N     1 
ATOM   5080 C CA    . ASN D 3 316 ? 20.572  92.963  19.624  1.00 62.83  ? 316 ASN B CA    1 
ATOM   5081 C C     . ASN D 3 316 ? 20.771  93.543  21.008  1.00 60.83  ? 316 ASN B C     1 
ATOM   5082 O O     . ASN D 3 316 ? 21.886  93.862  21.407  1.00 59.96  ? 316 ASN B O     1 
ATOM   5083 C CB    . ASN D 3 316 ? 20.945  91.487  19.644  1.00 62.14  ? 316 ASN B CB    1 
ATOM   5084 C CG    . ASN D 3 316 ? 20.645  90.832  20.977  1.00 61.97  ? 316 ASN B CG    1 
ATOM   5085 O OD1   . ASN D 3 316 ? 21.441  90.897  21.913  1.00 61.47  ? 316 ASN B OD1   1 
ATOM   5086 N ND2   . ASN D 3 316 ? 19.486  90.203  21.073  1.00 62.08  ? 316 ASN B ND2   1 
ATOM   5087 N N     . GLN D 3 317 ? 19.672  93.658  21.743  1.00 59.70  ? 317 GLN B N     1 
ATOM   5088 C CA    . GLN D 3 317 ? 19.689  94.214  23.089  1.00 58.27  ? 317 GLN B CA    1 
ATOM   5089 C C     . GLN D 3 317 ? 19.206  93.186  24.096  1.00 55.45  ? 317 GLN B C     1 
ATOM   5090 O O     . GLN D 3 317 ? 18.304  92.386  23.813  1.00 54.93  ? 317 GLN B O     1 
ATOM   5091 C CB    . GLN D 3 317 ? 18.779  95.444  23.164  1.00 60.70  ? 317 GLN B CB    1 
ATOM   5092 C CG    . GLN D 3 317 ? 19.112  96.433  24.289  1.00 63.70  ? 317 GLN B CG    1 
ATOM   5093 C CD    . GLN D 3 317 ? 18.094  97.567  24.391  1.00 65.15  ? 317 GLN B CD    1 
ATOM   5094 O OE1   . GLN D 3 317 ? 17.640  98.110  23.374  1.00 65.46  ? 317 GLN B OE1   1 
ATOM   5095 N NE2   . GLN D 3 317 ? 17.739  97.935  25.624  1.00 65.80  ? 317 GLN B NE2   1 
ATOM   5096 N N     . LEU D 3 318 ? 19.806  93.225  25.279  1.00 52.53  ? 318 LEU B N     1 
ATOM   5097 C CA    . LEU D 3 318 ? 19.438  92.303  26.334  1.00 50.22  ? 318 LEU B CA    1 
ATOM   5098 C C     . LEU D 3 318 ? 18.809  93.025  27.526  1.00 48.76  ? 318 LEU B C     1 
ATOM   5099 O O     . LEU D 3 318 ? 19.384  93.983  28.070  1.00 48.99  ? 318 LEU B O     1 
ATOM   5100 C CB    . LEU D 3 318 ? 20.667  91.503  26.771  1.00 49.66  ? 318 LEU B CB    1 
ATOM   5101 C CG    . LEU D 3 318 ? 20.768  90.074  26.211  1.00 49.14  ? 318 LEU B CG    1 
ATOM   5102 C CD1   . LEU D 3 318 ? 20.368  90.022  24.739  1.00 48.93  ? 318 LEU B CD1   1 
ATOM   5103 C CD2   . LEU D 3 318 ? 22.189  89.577  26.396  1.00 49.55  ? 318 LEU B CD2   1 
ATOM   5104 N N     . LEU D 3 319 ? 17.609  92.565  27.899  1.00 46.21  ? 319 LEU B N     1 
ATOM   5105 C CA    . LEU D 3 319 ? 16.844  93.104  29.026  1.00 42.08  ? 319 LEU B CA    1 
ATOM   5106 C C     . LEU D 3 319 ? 17.100  92.231  30.229  1.00 40.27  ? 319 LEU B C     1 
ATOM   5107 O O     . LEU D 3 319 ? 17.021  91.012  30.157  1.00 40.59  ? 319 LEU B O     1 
ATOM   5108 C CB    . LEU D 3 319 ? 15.348  93.096  28.722  1.00 41.06  ? 319 LEU B CB    1 
ATOM   5109 C CG    . LEU D 3 319 ? 14.762  94.392  28.177  1.00 39.77  ? 319 LEU B CG    1 
ATOM   5110 C CD1   . LEU D 3 319 ? 15.738  95.065  27.239  1.00 39.85  ? 319 LEU B CD1   1 
ATOM   5111 C CD2   . LEU D 3 319 ? 13.455  94.075  27.478  1.00 39.95  ? 319 LEU B CD2   1 
ATOM   5112 N N     . PRO D 3 320 ? 17.399  92.849  31.358  1.00 38.05  ? 320 PRO B N     1 
ATOM   5113 C CA    . PRO D 3 320 ? 17.675  92.127  32.592  1.00 36.35  ? 320 PRO B CA    1 
ATOM   5114 C C     . PRO D 3 320 ? 16.499  91.306  33.093  1.00 35.62  ? 320 PRO B C     1 
ATOM   5115 O O     . PRO D 3 320 ? 15.359  91.562  32.747  1.00 34.87  ? 320 PRO B O     1 
ATOM   5116 C CB    . PRO D 3 320 ? 18.033  93.245  33.555  1.00 37.61  ? 320 PRO B CB    1 
ATOM   5117 C CG    . PRO D 3 320 ? 17.101  94.337  33.102  1.00 38.26  ? 320 PRO B CG    1 
ATOM   5118 C CD    . PRO D 3 320 ? 17.282  94.292  31.606  1.00 37.88  ? 320 PRO B CD    1 
ATOM   5119 N N     . VAL D 3 321 ? 16.808  90.311  33.914  1.00 34.64  ? 321 VAL B N     1 
ATOM   5120 C CA    . VAL D 3 321 ? 15.816  89.444  34.530  1.00 34.22  ? 321 VAL B CA    1 
ATOM   5121 C C     . VAL D 3 321 ? 16.292  89.262  35.958  1.00 34.92  ? 321 VAL B C     1 
ATOM   5122 O O     . VAL D 3 321 ? 17.385  89.712  36.303  1.00 34.70  ? 321 VAL B O     1 
ATOM   5123 C CB    . VAL D 3 321 ? 15.763  88.082  33.870  1.00 33.75  ? 321 VAL B CB    1 
ATOM   5124 C CG1   . VAL D 3 321 ? 15.571  88.244  32.388  1.00 34.05  ? 321 VAL B CG1   1 
ATOM   5125 C CG2   . VAL D 3 321 ? 17.028  87.322  34.154  1.00 33.68  ? 321 VAL B CG2   1 
ATOM   5126 N N     . SER D 3 322 ? 15.491  88.602  36.789  1.00 35.85  ? 322 SER B N     1 
ATOM   5127 C CA    . SER D 3 322 ? 15.879  88.417  38.183  1.00 36.64  ? 322 SER B CA    1 
ATOM   5128 C C     . SER D 3 322 ? 15.200  87.251  38.875  1.00 37.44  ? 322 SER B C     1 
ATOM   5129 O O     . SER D 3 322 ? 14.165  86.755  38.434  1.00 35.95  ? 322 SER B O     1 
ATOM   5130 C CB    . SER D 3 322 ? 15.578  89.682  38.966  1.00 37.12  ? 322 SER B CB    1 
ATOM   5131 O OG    . SER D 3 322 ? 14.192  89.964  38.886  1.00 38.03  ? 322 SER B OG    1 
ATOM   5132 N N     . LEU D 3 323 ? 15.795  86.829  39.982  1.00 38.86  ? 323 LEU B N     1 
ATOM   5133 C CA    . LEU D 3 323 ? 15.257  85.720  40.748  1.00 40.78  ? 323 LEU B CA    1 
ATOM   5134 C C     . LEU D 3 323 ? 14.338  86.213  41.839  1.00 42.93  ? 323 LEU B C     1 
ATOM   5135 O O     . LEU D 3 323 ? 14.687  87.114  42.602  1.00 42.26  ? 323 LEU B O     1 
ATOM   5136 C CB    . LEU D 3 323 ? 16.376  84.895  41.385  1.00 40.98  ? 323 LEU B CB    1 
ATOM   5137 C CG    . LEU D 3 323 ? 15.912  83.750  42.286  1.00 40.04  ? 323 LEU B CG    1 
ATOM   5138 C CD1   . LEU D 3 323 ? 15.060  82.811  41.488  1.00 40.72  ? 323 LEU B CD1   1 
ATOM   5139 C CD2   . LEU D 3 323 ? 17.100  83.015  42.848  1.00 40.13  ? 323 LEU B CD2   1 
ATOM   5140 N N     . VAL D 3 324 ? 13.161  85.601  41.903  1.00 45.13  ? 324 VAL B N     1 
ATOM   5141 C CA    . VAL D 3 324 ? 12.145  85.933  42.889  1.00 46.38  ? 324 VAL B CA    1 
ATOM   5142 C C     . VAL D 3 324 ? 11.954  84.720  43.771  1.00 48.06  ? 324 VAL B C     1 
ATOM   5143 O O     . VAL D 3 324 ? 11.272  83.765  43.387  1.00 47.16  ? 324 VAL B O     1 
ATOM   5144 C CB    . VAL D 3 324 ? 10.805  86.240  42.229  1.00 46.86  ? 324 VAL B CB    1 
ATOM   5145 C CG1   . VAL D 3 324 ? 9.812   86.681  43.269  1.00 47.46  ? 324 VAL B CG1   1 
ATOM   5146 C CG2   . VAL D 3 324 ? 10.977  87.312  41.194  1.00 48.05  ? 324 VAL B CG2   1 
ATOM   5147 N N     . LYS D 3 325 ? 12.560  84.763  44.953  1.00 50.16  ? 325 LYS B N     1 
ATOM   5148 C CA    . LYS D 3 325 ? 12.481  83.654  45.902  1.00 52.13  ? 325 LYS B CA    1 
ATOM   5149 C C     . LYS D 3 325 ? 11.150  83.577  46.604  1.00 50.50  ? 325 LYS B C     1 
ATOM   5150 O O     . LYS D 3 325 ? 10.790  84.474  47.357  1.00 50.83  ? 325 LYS B O     1 
ATOM   5151 C CB    . LYS D 3 325 ? 13.564  83.774  46.969  1.00 54.70  ? 325 LYS B CB    1 
ATOM   5152 C CG    . LYS D 3 325 ? 14.965  83.821  46.407  1.00 60.14  ? 325 LYS B CG    1 
ATOM   5153 C CD    . LYS D 3 325 ? 15.986  83.721  47.523  1.00 63.26  ? 325 LYS B CD    1 
ATOM   5154 C CE    . LYS D 3 325 ? 15.926  84.926  48.445  1.00 64.69  ? 325 LYS B CE    1 
ATOM   5155 N NZ    . LYS D 3 325 ? 16.864  84.768  49.589  1.00 66.57  ? 325 LYS B NZ    1 
ATOM   5156 N N     . ARG D 3 326 ? 10.420  82.502  46.361  1.00 49.68  ? 326 ARG B N     1 
ATOM   5157 C CA    . ARG D 3 326 ? 9.138   82.328  47.006  1.00 50.94  ? 326 ARG B CA    1 
ATOM   5158 C C     . ARG D 3 326 ? 9.238   81.102  47.920  1.00 51.85  ? 326 ARG B C     1 
ATOM   5159 O O     . ARG D 3 326 ? 10.185  80.994  48.698  1.00 51.38  ? 326 ARG B O     1 
ATOM   5160 C CB    . ARG D 3 326 ? 8.042   82.166  45.952  1.00 48.03  ? 326 ARG B CB    1 
ATOM   5161 C CG    . ARG D 3 326 ? 6.923   83.200  46.063  1.00 46.22  ? 326 ARG B CG    1 
ATOM   5162 C CD    . ARG D 3 326 ? 7.127   84.478  45.234  1.00 44.60  ? 326 ARG B CD    1 
ATOM   5163 N NE    . ARG D 3 326 ? 6.558   84.369  43.886  1.00 43.86  ? 326 ARG B NE    1 
ATOM   5164 C CZ    . ARG D 3 326 ? 6.301   85.403  43.086  1.00 42.52  ? 326 ARG B CZ    1 
ATOM   5165 N NH1   . ARG D 3 326 ? 6.552   86.639  43.489  1.00 41.71  ? 326 ARG B NH1   1 
ATOM   5166 N NH2   . ARG D 3 326 ? 5.805   85.205  41.873  1.00 41.80  ? 326 ARG B NH2   1 
ATOM   5167 N N     . LYS D 3 327 ? 8.292   80.171  47.821  1.00 55.48  ? 327 LYS B N     1 
ATOM   5168 C CA    . LYS D 3 327 ? 8.317   78.990  48.680  1.00 54.40  ? 327 LYS B CA    1 
ATOM   5169 C C     . LYS D 3 327 ? 8.482   77.643  47.997  1.00 53.30  ? 327 LYS B C     1 
ATOM   5170 O O     . LYS D 3 327 ? 8.385   76.620  48.664  1.00 57.47  ? 327 LYS B O     1 
ATOM   5171 C CB    . LYS D 3 327 ? 7.041   78.919  49.524  1.00 57.02  ? 327 LYS B CB    1 
ATOM   5172 C CG    . LYS D 3 327 ? 6.760   80.156  50.365  1.00 58.91  ? 327 LYS B CG    1 
ATOM   5173 C CD    . LYS D 3 327 ? 7.799   80.363  51.467  1.00 60.44  ? 327 LYS B CD    1 
ATOM   5174 C CE    . LYS D 3 327 ? 7.415   81.558  52.355  1.00 61.00  ? 327 LYS B CE    1 
ATOM   5175 N NZ    . LYS D 3 327 ? 8.414   81.846  53.437  1.00 61.63  ? 327 LYS B NZ    1 
ATOM   5176 N N     . THR D 3 328 ? 8.731   77.601  46.695  1.00 56.35  ? 328 THR B N     1 
ATOM   5177 C CA    . THR D 3 328 ? 8.860   76.294  46.047  1.00 58.07  ? 328 THR B CA    1 
ATOM   5178 C C     . THR D 3 328 ? 10.274  75.684  46.032  1.00 61.88  ? 328 THR B C     1 
ATOM   5179 O O     . THR D 3 328 ? 10.458  74.542  45.624  1.00 58.54  ? 328 THR B O     1 
ATOM   5180 C CB    . THR D 3 328 ? 8.309   76.329  44.596  1.00 57.11  ? 328 THR B CB    1 
ATOM   5181 O OG1   . THR D 3 328 ? 8.814   77.486  43.917  1.00 57.87  ? 328 THR B OG1   1 
ATOM   5182 C CG2   . THR D 3 328 ? 6.772   76.349  44.595  1.00 57.34  ? 328 THR B CG2   1 
ATOM   5183 N N     . THR D 3 329 ? 11.255  76.449  46.499  1.00 61.02  ? 329 THR B N     1 
ATOM   5184 C CA    . THR D 3 329 ? 12.651  76.026  46.553  1.00 65.64  ? 329 THR B CA    1 
ATOM   5185 C C     . THR D 3 329 ? 13.078  75.984  48.005  1.00 64.60  ? 329 THR B C     1 
ATOM   5186 O O     . THR D 3 329 ? 13.383  76.968  48.618  1.00 65.28  ? 329 THR B O     1 
ATOM   5187 C CB    . THR D 3 329 ? 13.568  77.000  45.776  1.00 64.61  ? 329 THR B CB    1 
ATOM   5188 O OG1   . THR D 3 329 ? 13.464  78.303  46.356  1.00 65.22  ? 329 THR B OG1   1 
ATOM   5189 C CG2   . THR D 3 329 ? 13.176  77.048  44.329  1.00 66.44  ? 329 THR B CG2   1 
ATOM   5190 N N     . LEU D 3 330 ? 13.027  74.818  48.600  1.00 64.30  ? 330 LEU B N     1 
ATOM   5191 C CA    . LEU D 3 330 ? 13.463  74.661  50.005  1.00 66.84  ? 330 LEU B CA    1 
ATOM   5192 C C     . LEU D 3 330 ? 14.243  73.331  50.006  1.00 68.40  ? 330 LEU B C     1 
ATOM   5193 O O     . LEU D 3 330 ? 15.483  73.265  49.725  1.00 65.10  ? 330 LEU B O     1 
ATOM   5194 C CB    . LEU D 3 330 ? 12.269  74.520  50.976  1.00 63.30  ? 330 LEU B CB    1 
ATOM   5195 C CG    . LEU D 3 330 ? 11.217  75.651  50.909  1.00 67.87  ? 330 LEU B CG    1 
ATOM   5196 C CD1   . LEU D 3 330 ? 9.995   75.404  51.813  1.00 62.65  ? 330 LEU B CD1   1 
ATOM   5197 C CD2   . LEU D 3 330 ? 11.922  76.941  51.350  1.00 59.54  ? 330 LEU B CD2   1 
ATOM   5198 N N     . LEU E 3 62  ? 70.099  70.868  57.573  1.00 62.40  ? 62  LEU C N     1 
ATOM   5199 C CA    . LEU E 3 62  ? 69.075  71.910  57.264  1.00 62.28  ? 62  LEU C CA    1 
ATOM   5200 C C     . LEU E 3 62  ? 68.153  72.102  58.465  1.00 61.84  ? 62  LEU C C     1 
ATOM   5201 O O     . LEU E 3 62  ? 67.325  71.251  58.781  1.00 61.72  ? 62  LEU C O     1 
ATOM   5202 C CB    . LEU E 3 62  ? 68.282  71.528  55.996  1.00 62.02  ? 62  LEU C CB    1 
ATOM   5203 C CG    . LEU E 3 62  ? 67.605  70.157  55.832  1.00 62.22  ? 62  LEU C CG    1 
ATOM   5204 C CD1   . LEU E 3 62  ? 67.318  69.938  54.356  1.00 61.60  ? 62  LEU C CD1   1 
ATOM   5205 C CD2   . LEU E 3 62  ? 68.497  69.024  56.332  1.00 62.28  ? 62  LEU C CD2   1 
ATOM   5206 N N     . LEU E 3 63  ? 68.324  73.233  59.139  1.00 62.43  ? 63  LEU C N     1 
ATOM   5207 C CA    . LEU E 3 63  ? 67.545  73.563  60.322  1.00 60.87  ? 63  LEU C CA    1 
ATOM   5208 C C     . LEU E 3 63  ? 66.607  74.765  60.097  1.00 59.66  ? 63  LEU C C     1 
ATOM   5209 O O     . LEU E 3 63  ? 67.051  75.914  60.012  1.00 60.26  ? 63  LEU C O     1 
ATOM   5210 C CB    . LEU E 3 63  ? 68.517  73.822  61.474  1.00 61.75  ? 63  LEU C CB    1 
ATOM   5211 C CG    . LEU E 3 63  ? 68.058  74.122  62.902  1.00 62.35  ? 63  LEU C CG    1 
ATOM   5212 C CD1   . LEU E 3 63  ? 68.207  75.600  63.191  1.00 63.38  ? 63  LEU C CD1   1 
ATOM   5213 C CD2   . LEU E 3 63  ? 66.635  73.671  63.100  1.00 63.50  ? 63  LEU C CD2   1 
ATOM   5214 N N     . ILE E 3 64  ? 65.309  74.470  60.011  1.00 56.54  ? 64  ILE C N     1 
ATOM   5215 C CA    . ILE E 3 64  ? 64.253  75.451  59.774  1.00 52.74  ? 64  ILE C CA    1 
ATOM   5216 C C     . ILE E 3 64  ? 63.779  76.165  61.029  1.00 52.09  ? 64  ILE C C     1 
ATOM   5217 O O     . ILE E 3 64  ? 63.333  75.525  61.972  1.00 52.69  ? 64  ILE C O     1 
ATOM   5218 C CB    . ILE E 3 64  ? 63.025  74.780  59.176  1.00 50.82  ? 64  ILE C CB    1 
ATOM   5219 C CG1   . ILE E 3 64  ? 63.391  74.056  57.889  1.00 49.73  ? 64  ILE C CG1   1 
ATOM   5220 C CG2   . ILE E 3 64  ? 61.965  75.800  58.925  1.00 50.46  ? 64  ILE C CG2   1 
ATOM   5221 C CD1   . ILE E 3 64  ? 62.221  73.365  57.240  1.00 49.65  ? 64  ILE C CD1   1 
ATOM   5222 N N     . GLY E 3 65  ? 63.859  77.492  61.029  1.00 50.83  ? 65  GLY C N     1 
ATOM   5223 C CA    . GLY E 3 65  ? 63.404  78.280  62.169  1.00 49.41  ? 65  GLY C CA    1 
ATOM   5224 C C     . GLY E 3 65  ? 61.992  78.797  61.922  1.00 48.21  ? 65  GLY C C     1 
ATOM   5225 O O     . GLY E 3 65  ? 61.647  79.138  60.792  1.00 48.93  ? 65  GLY C O     1 
ATOM   5226 N N     . VAL E 3 66  ? 61.165  78.866  62.960  1.00 46.10  ? 66  VAL C N     1 
ATOM   5227 C CA    . VAL E 3 66  ? 59.792  79.324  62.777  1.00 43.73  ? 66  VAL C CA    1 
ATOM   5228 C C     . VAL E 3 66  ? 59.315  80.313  63.814  1.00 43.26  ? 66  VAL C C     1 
ATOM   5229 O O     . VAL E 3 66  ? 59.283  80.004  65.002  1.00 44.07  ? 66  VAL C O     1 
ATOM   5230 C CB    . VAL E 3 66  ? 58.800  78.147  62.806  1.00 42.77  ? 66  VAL C CB    1 
ATOM   5231 C CG1   . VAL E 3 66  ? 57.377  78.661  62.765  1.00 41.74  ? 66  VAL C CG1   1 
ATOM   5232 C CG2   . VAL E 3 66  ? 59.046  77.235  61.646  1.00 42.68  ? 66  VAL C CG2   1 
ATOM   5233 N N     . ALA E 3 67  ? 58.943  81.504  63.367  1.00 41.95  ? 67  ALA C N     1 
ATOM   5234 C CA    . ALA E 3 67  ? 58.412  82.503  64.274  1.00 41.12  ? 67  ALA C CA    1 
ATOM   5235 C C     . ALA E 3 67  ? 56.920  82.383  64.016  1.00 40.60  ? 67  ALA C C     1 
ATOM   5236 O O     . ALA E 3 67  ? 56.494  82.434  62.870  1.00 41.44  ? 67  ALA C O     1 
ATOM   5237 C CB    . ALA E 3 67  ? 58.912  83.881  63.900  1.00 41.51  ? 67  ALA C CB    1 
ATOM   5238 N N     . THR E 3 68  ? 56.125  82.205  65.063  1.00 38.88  ? 68  THR C N     1 
ATOM   5239 C CA    . THR E 3 68  ? 54.692  82.057  64.880  1.00 36.72  ? 68  THR C CA    1 
ATOM   5240 C C     . THR E 3 68  ? 53.914  82.726  65.995  1.00 36.35  ? 68  THR C C     1 
ATOM   5241 O O     . THR E 3 68  ? 54.456  82.994  67.056  1.00 35.96  ? 68  THR C O     1 
ATOM   5242 C CB    . THR E 3 68  ? 54.326  80.574  64.814  1.00 36.19  ? 68  THR C CB    1 
ATOM   5243 O OG1   . THR E 3 68  ? 52.914  80.430  64.692  1.00 35.69  ? 68  THR C OG1   1 
ATOM   5244 C CG2   . THR E 3 68  ? 54.779  79.870  66.057  1.00 36.51  ? 68  THR C CG2   1 
ATOM   5245 N N     . SER E 3 69  ? 52.647  83.014  65.729  1.00 36.18  ? 69  SER C N     1 
ATOM   5246 C CA    . SER E 3 69  ? 51.755  83.646  66.697  1.00 36.67  ? 69  SER C CA    1 
ATOM   5247 C C     . SER E 3 69  ? 51.494  82.588  67.738  1.00 36.57  ? 69  SER C C     1 
ATOM   5248 O O     . SER E 3 69  ? 51.813  81.435  67.500  1.00 36.97  ? 69  SER C O     1 
ATOM   5249 C CB    . SER E 3 69  ? 50.449  84.045  66.023  1.00 37.34  ? 69  SER C CB    1 
ATOM   5250 O OG    . SER E 3 69  ? 50.704  84.678  64.780  1.00 39.38  ? 69  SER C OG    1 
ATOM   5251 N N     . SER E 3 70  ? 50.905  82.947  68.876  1.00 36.71  ? 70  SER C N     1 
ATOM   5252 C CA    . SER E 3 70  ? 50.683  81.950  69.926  1.00 37.33  ? 70  SER C CA    1 
ATOM   5253 C C     . SER E 3 70  ? 50.096  80.647  69.415  1.00 37.52  ? 70  SER C C     1 
ATOM   5254 O O     . SER E 3 70  ? 49.189  80.650  68.576  1.00 38.40  ? 70  SER C O     1 
ATOM   5255 C CB    . SER E 3 70  ? 49.791  82.479  71.045  1.00 37.29  ? 70  SER C CB    1 
ATOM   5256 O OG    . SER E 3 70  ? 49.604  81.458  72.013  1.00 36.79  ? 70  SER C OG    1 
ATOM   5257 N N     . LEU E 3 71  ? 50.626  79.538  69.936  1.00 36.82  ? 71  LEU C N     1 
ATOM   5258 C CA    . LEU E 3 71  ? 50.195  78.198  69.549  1.00 35.54  ? 71  LEU C CA    1 
ATOM   5259 C C     . LEU E 3 71  ? 48.833  77.901  70.144  1.00 35.22  ? 71  LEU C C     1 
ATOM   5260 O O     . LEU E 3 71  ? 48.183  76.921  69.779  1.00 35.63  ? 71  LEU C O     1 
ATOM   5261 C CB    . LEU E 3 71  ? 51.227  77.158  70.004  1.00 34.67  ? 71  LEU C CB    1 
ATOM   5262 C CG    . LEU E 3 71  ? 52.525  77.137  69.191  1.00 33.69  ? 71  LEU C CG    1 
ATOM   5263 C CD1   . LEU E 3 71  ? 53.597  76.329  69.903  1.00 33.54  ? 71  LEU C CD1   1 
ATOM   5264 C CD2   . LEU E 3 71  ? 52.230  76.567  67.816  1.00 32.69  ? 71  LEU C CD2   1 
ATOM   5265 N N     . ALA E 3 72  ? 48.404  78.775  71.047  1.00 34.39  ? 72  ALA C N     1 
ATOM   5266 C CA    . ALA E 3 72  ? 47.116  78.647  71.700  1.00 34.73  ? 72  ALA C CA    1 
ATOM   5267 C C     . ALA E 3 72  ? 45.987  78.863  70.707  1.00 35.01  ? 72  ALA C C     1 
ATOM   5268 O O     . ALA E 3 72  ? 44.831  78.549  70.980  1.00 35.04  ? 72  ALA C O     1 
ATOM   5269 C CB    . ALA E 3 72  ? 47.016  79.656  72.795  1.00 34.85  ? 72  ALA C CB    1 
ATOM   5270 N N     . LEU E 3 73  ? 46.338  79.414  69.553  1.00 35.56  ? 73  LEU C N     1 
ATOM   5271 C CA    . LEU E 3 73  ? 45.373  79.707  68.505  1.00 36.22  ? 73  LEU C CA    1 
ATOM   5272 C C     . LEU E 3 73  ? 45.290  78.532  67.559  1.00 36.52  ? 73  LEU C C     1 
ATOM   5273 O O     . LEU E 3 73  ? 46.305  77.931  67.234  1.00 36.81  ? 73  LEU C O     1 
ATOM   5274 C CB    . LEU E 3 73  ? 45.806  80.965  67.749  1.00 35.98  ? 73  LEU C CB    1 
ATOM   5275 C CG    . LEU E 3 73  ? 45.860  82.226  68.607  1.00 36.15  ? 73  LEU C CG    1 
ATOM   5276 C CD1   . LEU E 3 73  ? 46.720  83.253  67.941  1.00 36.20  ? 73  LEU C CD1   1 
ATOM   5277 C CD2   . LEU E 3 73  ? 44.469  82.752  68.833  1.00 35.58  ? 73  LEU C CD2   1 
ATOM   5278 N N     . HIS E 3 74  ? 44.079  78.217  67.110  1.00 37.30  ? 74  HIS C N     1 
ATOM   5279 C CA    . HIS E 3 74  ? 43.862  77.091  66.203  1.00 37.75  ? 74  HIS C CA    1 
ATOM   5280 C C     . HIS E 3 74  ? 44.803  76.955  64.998  1.00 37.53  ? 74  HIS C C     1 
ATOM   5281 O O     . HIS E 3 74  ? 45.675  76.090  64.958  1.00 37.47  ? 74  HIS C O     1 
ATOM   5282 C CB    . HIS E 3 74  ? 42.435  77.099  65.679  1.00 37.72  ? 74  HIS C CB    1 
ATOM   5283 C CG    . HIS E 3 74  ? 42.061  75.828  64.998  1.00 37.15  ? 74  HIS C CG    1 
ATOM   5284 N ND1   . HIS E 3 74  ? 41.957  74.634  65.676  1.00 36.91  ? 74  HIS C ND1   1 
ATOM   5285 C CD2   . HIS E 3 74  ? 41.822  75.548  63.699  1.00 37.56  ? 74  HIS C CD2   1 
ATOM   5286 C CE1   . HIS E 3 74  ? 41.669  73.670  64.820  1.00 37.92  ? 74  HIS C CE1   1 
ATOM   5287 N NE2   . HIS E 3 74  ? 41.581  74.199  63.614  1.00 37.84  ? 74  HIS C NE2   1 
ATOM   5288 N N     . ALA E 3 75  ? 44.614  77.799  64.003  1.00 37.05  ? 75  ALA C N     1 
ATOM   5289 C CA    . ALA E 3 75  ? 45.443  77.733  62.819  1.00 37.40  ? 75  ALA C CA    1 
ATOM   5290 C C     . ALA E 3 75  ? 46.950  77.724  63.056  1.00 37.10  ? 75  ALA C C     1 
ATOM   5291 O O     . ALA E 3 75  ? 47.666  76.941  62.451  1.00 37.29  ? 75  ALA C O     1 
ATOM   5292 C CB    . ALA E 3 75  ? 45.087  78.857  61.906  1.00 38.32  ? 75  ALA C CB    1 
ATOM   5293 N N     . PRO E 3 76  ? 47.462  78.605  63.918  1.00 37.11  ? 76  PRO C N     1 
ATOM   5294 C CA    . PRO E 3 76  ? 48.910  78.551  64.104  1.00 37.08  ? 76  PRO C CA    1 
ATOM   5295 C C     . PRO E 3 76  ? 49.359  77.128  64.432  1.00 38.21  ? 76  PRO C C     1 
ATOM   5296 O O     . PRO E 3 76  ? 50.201  76.565  63.738  1.00 39.17  ? 76  PRO C O     1 
ATOM   5297 C CB    . PRO E 3 76  ? 49.143  79.506  65.263  1.00 37.10  ? 76  PRO C CB    1 
ATOM   5298 C CG    . PRO E 3 76  ? 48.065  80.504  65.088  1.00 37.14  ? 76  PRO C CG    1 
ATOM   5299 C CD    . PRO E 3 76  ? 46.865  79.652  64.757  1.00 37.23  ? 76  PRO C CD    1 
ATOM   5300 N N     . SER E 3 77  ? 48.776  76.543  65.477  1.00 38.19  ? 77  SER C N     1 
ATOM   5301 C CA    . SER E 3 77  ? 49.129  75.188  65.902  1.00 37.54  ? 77  SER C CA    1 
ATOM   5302 C C     . SER E 3 77  ? 49.039  74.200  64.745  1.00 36.38  ? 77  SER C C     1 
ATOM   5303 O O     . SER E 3 77  ? 50.003  73.507  64.441  1.00 35.97  ? 77  SER C O     1 
ATOM   5304 C CB    . SER E 3 77  ? 48.235  74.727  67.067  1.00 38.32  ? 77  SER C CB    1 
ATOM   5305 O OG    . SER E 3 77  ? 46.950  74.337  66.621  1.00 40.81  ? 77  SER C OG    1 
ATOM   5306 N N     . GLN E 3 78  ? 47.893  74.140  64.088  1.00 34.95  ? 78  GLN C N     1 
ATOM   5307 C CA    . GLN E 3 78  ? 47.743  73.229  62.971  1.00 34.99  ? 78  GLN C CA    1 
ATOM   5308 C C     . GLN E 3 78  ? 48.921  73.352  62.022  1.00 34.72  ? 78  GLN C C     1 
ATOM   5309 O O     . GLN E 3 78  ? 49.485  72.356  61.569  1.00 35.00  ? 78  GLN C O     1 
ATOM   5310 C CB    . GLN E 3 78  ? 46.468  73.543  62.212  1.00 35.93  ? 78  GLN C CB    1 
ATOM   5311 C CG    . GLN E 3 78  ? 45.243  73.415  63.058  1.00 35.87  ? 78  GLN C CG    1 
ATOM   5312 C CD    . GLN E 3 78  ? 45.124  72.044  63.656  1.00 35.00  ? 78  GLN C CD    1 
ATOM   5313 O OE1   . GLN E 3 78  ? 44.929  71.056  62.949  1.00 33.50  ? 78  GLN C OE1   1 
ATOM   5314 N NE2   . GLN E 3 78  ? 45.252  71.970  64.968  1.00 33.71  ? 78  GLN C NE2   1 
ATOM   5315 N N     . ILE E 3 79  ? 49.286  74.588  61.720  1.00 33.85  ? 79  ILE C N     1 
ATOM   5316 C CA    . ILE E 3 79  ? 50.391  74.844  60.819  1.00 33.23  ? 79  ILE C CA    1 
ATOM   5317 C C     . ILE E 3 79  ? 51.732  74.388  61.375  1.00 34.38  ? 79  ILE C C     1 
ATOM   5318 O O     . ILE E 3 79  ? 52.463  73.692  60.685  1.00 35.08  ? 79  ILE C O     1 
ATOM   5319 C CB    . ILE E 3 79  ? 50.473  76.325  60.461  1.00 32.71  ? 79  ILE C CB    1 
ATOM   5320 C CG1   . ILE E 3 79  ? 49.282  76.700  59.598  1.00 32.30  ? 79  ILE C CG1   1 
ATOM   5321 C CG2   . ILE E 3 79  ? 51.747  76.616  59.708  1.00 32.06  ? 79  ILE C CG2   1 
ATOM   5322 C CD1   . ILE E 3 79  ? 49.079  78.169  59.502  1.00 32.19  ? 79  ILE C CD1   1 
ATOM   5323 N N     . VAL E 3 80  ? 52.079  74.771  62.602  1.00 34.41  ? 80  VAL C N     1 
ATOM   5324 C CA    . VAL E 3 80  ? 53.356  74.332  63.156  1.00 34.81  ? 80  VAL C CA    1 
ATOM   5325 C C     . VAL E 3 80  ? 53.386  72.821  63.050  1.00 36.02  ? 80  VAL C C     1 
ATOM   5326 O O     . VAL E 3 80  ? 54.390  72.226  62.684  1.00 36.57  ? 80  VAL C O     1 
ATOM   5327 C CB    . VAL E 3 80  ? 53.522  74.738  64.629  1.00 33.91  ? 80  VAL C CB    1 
ATOM   5328 C CG1   . VAL E 3 80  ? 54.607  73.891  65.298  1.00 32.89  ? 80  VAL C CG1   1 
ATOM   5329 C CG2   . VAL E 3 80  ? 53.893  76.204  64.705  1.00 34.39  ? 80  VAL C CG2   1 
ATOM   5330 N N     . ALA E 3 81  ? 52.253  72.207  63.353  1.00 37.70  ? 81  ALA C N     1 
ATOM   5331 C CA    . ALA E 3 81  ? 52.129  70.761  63.290  1.00 39.01  ? 81  ALA C CA    1 
ATOM   5332 C C     . ALA E 3 81  ? 52.575  70.261  61.933  1.00 39.46  ? 81  ALA C C     1 
ATOM   5333 O O     . ALA E 3 81  ? 53.577  69.562  61.824  1.00 39.31  ? 81  ALA C O     1 
ATOM   5334 C CB    . ALA E 3 81  ? 50.687  70.351  63.548  1.00 39.54  ? 81  ALA C CB    1 
ATOM   5335 N N     . ALA E 3 82  ? 51.832  70.631  60.898  1.00 40.65  ? 82  ALA C N     1 
ATOM   5336 C CA    . ALA E 3 82  ? 52.156  70.205  59.543  1.00 42.76  ? 82  ALA C CA    1 
ATOM   5337 C C     . ALA E 3 82  ? 53.585  70.536  59.151  1.00 44.12  ? 82  ALA C C     1 
ATOM   5338 O O     . ALA E 3 82  ? 54.197  69.810  58.377  1.00 44.27  ? 82  ALA C O     1 
ATOM   5339 C CB    . ALA E 3 82  ? 51.187  70.820  58.555  1.00 43.47  ? 82  ALA C CB    1 
ATOM   5340 N N     . ILE E 3 83  ? 54.120  71.632  59.677  1.00 46.50  ? 83  ILE C N     1 
ATOM   5341 C CA    . ILE E 3 83  ? 55.495  71.992  59.360  1.00 49.30  ? 83  ILE C CA    1 
ATOM   5342 C C     . ILE E 3 83  ? 56.413  70.918  59.928  1.00 51.63  ? 83  ILE C C     1 
ATOM   5343 O O     . ILE E 3 83  ? 57.067  70.209  59.158  1.00 52.36  ? 83  ILE C O     1 
ATOM   5344 C CB    . ILE E 3 83  ? 55.906  73.374  59.940  1.00 48.39  ? 83  ILE C CB    1 
ATOM   5345 C CG1   . ILE E 3 83  ? 55.213  74.493  59.165  1.00 48.24  ? 83  ILE C CG1   1 
ATOM   5346 C CG2   . ILE E 3 83  ? 57.415  73.558  59.850  1.00 47.20  ? 83  ILE C CG2   1 
ATOM   5347 C CD1   . ILE E 3 83  ? 55.536  75.869  59.688  1.00 48.23  ? 83  ILE C CD1   1 
ATOM   5348 N N     . LYS E 3 84  ? 56.452  70.779  61.260  1.00 53.80  ? 84  LYS C N     1 
ATOM   5349 C CA    . LYS E 3 84  ? 57.316  69.772  61.895  1.00 55.66  ? 84  LYS C CA    1 
ATOM   5350 C C     . LYS E 3 84  ? 57.120  68.459  61.188  1.00 56.07  ? 84  LYS C C     1 
ATOM   5351 O O     . LYS E 3 84  ? 58.075  67.834  60.761  1.00 56.20  ? 84  LYS C O     1 
ATOM   5352 C CB    . LYS E 3 84  ? 57.009  69.585  63.384  1.00 56.73  ? 84  LYS C CB    1 
ATOM   5353 C CG    . LYS E 3 84  ? 57.257  70.825  64.235  1.00 59.59  ? 84  LYS C CG    1 
ATOM   5354 C CD    . LYS E 3 84  ? 57.216  70.539  65.732  1.00 61.28  ? 84  LYS C CD    1 
ATOM   5355 C CE    . LYS E 3 84  ? 58.615  70.335  66.303  1.00 61.93  ? 84  LYS C CE    1 
ATOM   5356 N NZ    . LYS E 3 84  ? 59.404  71.596  66.305  1.00 62.69  ? 84  LYS C NZ    1 
ATOM   5357 N N     . SER E 3 85  ? 55.869  68.048  61.049  1.00 57.60  ? 85  SER C N     1 
ATOM   5358 C CA    . SER E 3 85  ? 55.566  66.803  60.355  1.00 59.53  ? 85  SER C CA    1 
ATOM   5359 C C     . SER E 3 85  ? 56.402  66.687  59.087  1.00 60.30  ? 85  SER C C     1 
ATOM   5360 O O     . SER E 3 85  ? 57.315  65.862  59.005  1.00 61.62  ? 85  SER C O     1 
ATOM   5361 C CB    . SER E 3 85  ? 54.084  66.739  59.969  1.00 59.79  ? 85  SER C CB    1 
ATOM   5362 O OG    . SER E 3 85  ? 53.833  65.654  59.083  1.00 59.49  ? 85  SER C OG    1 
ATOM   5363 N N     . ARG E 3 86  ? 56.079  67.518  58.099  1.00 60.60  ? 86  ARG C N     1 
ATOM   5364 C CA    . ARG E 3 86  ? 56.786  67.508  56.829  1.00 60.62  ? 86  ARG C CA    1 
ATOM   5365 C C     . ARG E 3 86  ? 58.289  67.640  57.001  1.00 60.58  ? 86  ARG C C     1 
ATOM   5366 O O     . ARG E 3 86  ? 59.048  67.052  56.241  1.00 61.07  ? 86  ARG C O     1 
ATOM   5367 C CB    . ARG E 3 86  ? 56.251  68.618  55.923  1.00 60.45  ? 86  ARG C CB    1 
ATOM   5368 C CG    . ARG E 3 86  ? 57.170  68.995  54.782  1.00 59.89  ? 86  ARG C CG    1 
ATOM   5369 C CD    . ARG E 3 86  ? 57.519  67.823  53.895  1.00 58.54  ? 86  ARG C CD    1 
ATOM   5370 N NE    . ARG E 3 86  ? 56.443  67.467  52.989  1.00 57.81  ? 86  ARG C NE    1 
ATOM   5371 C CZ    . ARG E 3 86  ? 56.650  66.896  51.810  1.00 58.60  ? 86  ARG C CZ    1 
ATOM   5372 N NH1   . ARG E 3 86  ? 57.889  66.630  51.421  1.00 58.69  ? 86  ARG C NH1   1 
ATOM   5373 N NH2   . ARG E 3 86  ? 55.631  66.592  51.017  1.00 59.36  ? 86  ARG C NH2   1 
ATOM   5374 N N     . ALA E 3 87  ? 58.728  68.398  57.995  1.00 60.86  ? 87  ALA C N     1 
ATOM   5375 C CA    . ALA E 3 87  ? 60.156  68.548  58.211  1.00 62.10  ? 87  ALA C CA    1 
ATOM   5376 C C     . ALA E 3 87  ? 60.787  67.194  58.524  1.00 63.14  ? 87  ALA C C     1 
ATOM   5377 O O     . ALA E 3 87  ? 61.743  66.790  57.862  1.00 63.37  ? 87  ALA C O     1 
ATOM   5378 C CB    . ALA E 3 87  ? 60.417  69.516  59.336  1.00 62.44  ? 87  ALA C CB    1 
ATOM   5379 N N     . ASP E 3 88  ? 60.250  66.496  59.528  1.00 64.61  ? 88  ASP C N     1 
ATOM   5380 C CA    . ASP E 3 88  ? 60.764  65.175  59.929  1.00 65.89  ? 88  ASP C CA    1 
ATOM   5381 C C     . ASP E 3 88  ? 60.814  64.258  58.737  1.00 65.32  ? 88  ASP C C     1 
ATOM   5382 O O     . ASP E 3 88  ? 61.758  63.499  58.556  1.00 65.83  ? 88  ASP C O     1 
ATOM   5383 C CB    . ASP E 3 88  ? 59.867  64.490  60.967  1.00 68.11  ? 88  ASP C CB    1 
ATOM   5384 C CG    . ASP E 3 88  ? 59.928  65.146  62.332  1.00 71.15  ? 88  ASP C CG    1 
ATOM   5385 O OD1   . ASP E 3 88  ? 61.046  65.515  62.774  1.00 72.20  ? 88  ASP C OD1   1 
ATOM   5386 O OD2   . ASP E 3 88  ? 58.852  65.275  62.970  1.00 72.92  ? 88  ASP C OD2   1 
ATOM   5387 N N     . GLN E 3 89  ? 59.764  64.327  57.934  1.00 64.69  ? 89  GLN C N     1 
ATOM   5388 C CA    . GLN E 3 89  ? 59.637  63.508  56.748  1.00 63.91  ? 89  GLN C CA    1 
ATOM   5389 C C     . GLN E 3 89  ? 60.733  63.788  55.726  1.00 63.06  ? 89  GLN C C     1 
ATOM   5390 O O     . GLN E 3 89  ? 61.018  62.957  54.871  1.00 62.61  ? 89  GLN C O     1 
ATOM   5391 C CB    . GLN E 3 89  ? 58.271  63.750  56.135  1.00 64.10  ? 89  GLN C CB    1 
ATOM   5392 C CG    . GLN E 3 89  ? 57.936  62.842  55.000  1.00 65.64  ? 89  GLN C CG    1 
ATOM   5393 C CD    . GLN E 3 89  ? 56.534  63.087  54.498  1.00 66.62  ? 89  GLN C CD    1 
ATOM   5394 O OE1   . GLN E 3 89  ? 56.072  62.444  53.550  1.00 67.51  ? 89  GLN C OE1   1 
ATOM   5395 N NE2   . GLN E 3 89  ? 55.841  64.026  55.135  1.00 66.18  ? 89  GLN C NE2   1 
ATOM   5396 N N     . LEU E 3 90  ? 61.347  64.960  55.818  1.00 62.46  ? 90  LEU C N     1 
ATOM   5397 C CA    . LEU E 3 90  ? 62.412  65.324  54.898  1.00 61.96  ? 90  LEU C CA    1 
ATOM   5398 C C     . LEU E 3 90  ? 63.746  65.320  55.624  1.00 61.82  ? 90  LEU C C     1 
ATOM   5399 O O     . LEU E 3 90  ? 64.750  65.778  55.097  1.00 61.87  ? 90  LEU C O     1 
ATOM   5400 C CB    . LEU E 3 90  ? 62.155  66.712  54.290  1.00 62.22  ? 90  LEU C CB    1 
ATOM   5401 C CG    . LEU E 3 90  ? 60.982  66.911  53.315  1.00 62.12  ? 90  LEU C CG    1 
ATOM   5402 C CD1   . LEU E 3 90  ? 60.936  68.364  52.838  1.00 61.18  ? 90  LEU C CD1   1 
ATOM   5403 C CD2   . LEU E 3 90  ? 61.138  65.977  52.126  1.00 61.61  ? 90  LEU C CD2   1 
ATOM   5404 N N     . GLY E 3 91  ? 63.750  64.799  56.843  1.00 62.05  ? 91  GLY C N     1 
ATOM   5405 C CA    . GLY E 3 91  ? 64.981  64.745  57.609  1.00 62.72  ? 91  GLY C CA    1 
ATOM   5406 C C     . GLY E 3 91  ? 65.488  66.117  57.989  1.00 62.50  ? 91  GLY C C     1 
ATOM   5407 O O     . GLY E 3 91  ? 66.674  66.307  58.231  1.00 62.57  ? 91  GLY C O     1 
ATOM   5408 N N     . ALA E 3 92  ? 64.577  67.076  58.039  1.00 62.59  ? 92  ALA C N     1 
ATOM   5409 C CA    . ALA E 3 92  ? 64.926  68.435  58.395  1.00 63.14  ? 92  ALA C CA    1 
ATOM   5410 C C     . ALA E 3 92  ? 64.536  68.716  59.843  1.00 63.58  ? 92  ALA C C     1 
ATOM   5411 O O     . ALA E 3 92  ? 63.493  68.273  60.313  1.00 63.59  ? 92  ALA C O     1 
ATOM   5412 C CB    . ALA E 3 92  ? 64.222  69.402  57.461  1.00 63.55  ? 92  ALA C CB    1 
ATOM   5413 N N     . SER E 3 93  ? 65.379  69.450  60.556  1.00 63.92  ? 93  SER C N     1 
ATOM   5414 C CA    . SER E 3 93  ? 65.088  69.778  61.948  1.00 64.22  ? 93  SER C CA    1 
ATOM   5415 C C     . SER E 3 93  ? 64.268  71.072  61.982  1.00 64.09  ? 93  SER C C     1 
ATOM   5416 O O     . SER E 3 93  ? 64.253  71.818  61.008  1.00 65.03  ? 93  SER C O     1 
ATOM   5417 C CB    . SER E 3 93  ? 66.402  69.946  62.723  1.00 64.83  ? 93  SER C CB    1 
ATOM   5418 O OG    . SER E 3 93  ? 66.186  69.944  64.126  1.00 65.51  ? 93  SER C OG    1 
ATOM   5419 N N     . VAL E 3 94  ? 63.582  71.341  63.090  1.00 63.28  ? 94  VAL C N     1 
ATOM   5420 C CA    . VAL E 3 94  ? 62.778  72.556  63.195  1.00 62.23  ? 94  VAL C CA    1 
ATOM   5421 C C     . VAL E 3 94  ? 62.740  73.165  64.585  1.00 62.64  ? 94  VAL C C     1 
ATOM   5422 O O     . VAL E 3 94  ? 62.285  72.529  65.525  1.00 63.08  ? 94  VAL C O     1 
ATOM   5423 C CB    . VAL E 3 94  ? 61.319  72.301  62.808  1.00 61.85  ? 94  VAL C CB    1 
ATOM   5424 C CG1   . VAL E 3 94  ? 60.504  73.568  63.009  1.00 61.74  ? 94  VAL C CG1   1 
ATOM   5425 C CG2   . VAL E 3 94  ? 61.229  71.835  61.384  1.00 61.77  ? 94  VAL C CG2   1 
ATOM   5426 N N     . VAL E 3 95  ? 63.205  74.398  64.721  1.00 62.71  ? 95  VAL C N     1 
ATOM   5427 C CA    . VAL E 3 95  ? 63.152  75.083  66.010  1.00 63.15  ? 95  VAL C CA    1 
ATOM   5428 C C     . VAL E 3 95  ? 62.113  76.190  65.839  1.00 63.95  ? 95  VAL C C     1 
ATOM   5429 O O     . VAL E 3 95  ? 62.096  76.858  64.807  1.00 64.01  ? 95  VAL C O     1 
ATOM   5430 C CB    . VAL E 3 95  ? 64.522  75.706  66.394  1.00 63.15  ? 95  VAL C CB    1 
ATOM   5431 C CG1   . VAL E 3 95  ? 65.126  76.420  65.204  1.00 63.25  ? 95  VAL C CG1   1 
ATOM   5432 C CG2   . VAL E 3 95  ? 64.345  76.683  67.550  1.00 62.97  ? 95  VAL C CG2   1 
ATOM   5433 N N     . VAL E 3 96  ? 61.235  76.383  66.823  1.00 64.08  ? 96  VAL C N     1 
ATOM   5434 C CA    . VAL E 3 96  ? 60.211  77.422  66.689  1.00 63.48  ? 96  VAL C CA    1 
ATOM   5435 C C     . VAL E 3 96  ? 60.219  78.440  67.827  1.00 64.39  ? 96  VAL C C     1 
ATOM   5436 O O     . VAL E 3 96  ? 60.331  78.070  68.993  1.00 64.77  ? 96  VAL C O     1 
ATOM   5437 C CB    . VAL E 3 96  ? 58.775  76.796  66.574  1.00 62.48  ? 96  VAL C CB    1 
ATOM   5438 C CG1   . VAL E 3 96  ? 58.867  75.349  66.151  1.00 61.61  ? 96  VAL C CG1   1 
ATOM   5439 C CG2   . VAL E 3 96  ? 58.027  76.911  67.881  1.00 62.02  ? 96  VAL C CG2   1 
ATOM   5440 N N     . SER E 3 97  ? 60.117  79.721  67.492  1.00 65.01  ? 97  SER C N     1 
ATOM   5441 C CA    . SER E 3 97  ? 60.077  80.746  68.523  1.00 66.36  ? 97  SER C CA    1 
ATOM   5442 C C     . SER E 3 97  ? 58.689  81.354  68.537  1.00 67.24  ? 97  SER C C     1 
ATOM   5443 O O     . SER E 3 97  ? 58.237  81.920  67.548  1.00 66.90  ? 97  SER C O     1 
ATOM   5444 C CB    . SER E 3 97  ? 61.120  81.834  68.270  1.00 67.32  ? 97  SER C CB    1 
ATOM   5445 O OG    . SER E 3 97  ? 61.226  82.701  69.395  1.00 67.95  ? 97  SER C OG    1 
ATOM   5446 N N     . MET E 3 98  ? 58.017  81.240  69.673  1.00 68.55  ? 98  MET C N     1 
ATOM   5447 C CA    . MET E 3 98  ? 56.666  81.752  69.809  1.00 70.62  ? 98  MET C CA    1 
ATOM   5448 C C     . MET E 3 98  ? 56.651  83.204  70.248  1.00 73.01  ? 98  MET C C     1 
ATOM   5449 O O     . MET E 3 98  ? 57.246  83.549  71.264  1.00 72.69  ? 98  MET C O     1 
ATOM   5450 C CB    . MET E 3 98  ? 55.891  80.891  70.811  1.00 69.68  ? 98  MET C CB    1 
ATOM   5451 C CG    . MET E 3 98  ? 54.372  81.067  70.774  1.00 68.51  ? 98  MET C CG    1 
ATOM   5452 S SD    . MET E 3 98  ? 53.429  79.934  71.848  1.00 65.90  ? 98  MET C SD    1 
ATOM   5453 C CE    . MET E 3 98  ? 53.017  81.013  73.225  1.00 66.42  ? 98  MET C CE    1 
ATOM   5454 N N     . VAL E 3 99  ? 55.966  84.040  69.466  1.00 76.13  ? 99  VAL C N     1 
ATOM   5455 C CA    . VAL E 3 99  ? 55.831  85.474  69.731  1.00 79.31  ? 99  VAL C CA    1 
ATOM   5456 C C     . VAL E 3 99  ? 54.485  85.755  70.372  1.00 81.96  ? 99  VAL C C     1 
ATOM   5457 O O     . VAL E 3 99  ? 53.457  85.566  69.740  1.00 82.19  ? 99  VAL C O     1 
ATOM   5458 C CB    . VAL E 3 99  ? 55.854  86.304  68.438  1.00 79.34  ? 99  VAL C CB    1 
ATOM   5459 C CG1   . VAL E 3 99  ? 55.801  87.782  68.788  1.00 79.86  ? 99  VAL C CG1   1 
ATOM   5460 C CG2   . VAL E 3 99  ? 57.076  85.969  67.604  1.00 79.58  ? 99  VAL C CG2   1 
ATOM   5461 N N     . GLU E 3 100 ? 54.474  86.227  71.611  1.00 85.72  ? 100 GLU C N     1 
ATOM   5462 C CA    . GLU E 3 100 ? 53.200  86.510  72.273  1.00 89.77  ? 100 GLU C CA    1 
ATOM   5463 C C     . GLU E 3 100 ? 52.863  87.996  72.314  1.00 91.57  ? 100 GLU C C     1 
ATOM   5464 O O     . GLU E 3 100 ? 51.731  88.396  72.016  1.00 91.82  ? 100 GLU C O     1 
ATOM   5465 C CB    . GLU E 3 100 ? 53.196  85.939  73.696  1.00 91.10  ? 100 GLU C CB    1 
ATOM   5466 C CG    . GLU E 3 100 ? 53.158  84.414  73.744  1.00 93.32  ? 100 GLU C CG    1 
ATOM   5467 C CD    . GLU E 3 100 ? 53.198  83.861  75.162  1.00 94.14  ? 100 GLU C CD    1 
ATOM   5468 O OE1   . GLU E 3 100 ? 54.183  84.152  75.886  1.00 94.56  ? 100 GLU C OE1   1 
ATOM   5469 O OE2   . GLU E 3 100 ? 52.246  83.132  75.543  1.00 93.94  ? 100 GLU C OE2   1 
ATOM   5470 N N     . ARG E 3 101 ? 53.844  88.811  72.692  1.00 93.56  ? 101 ARG C N     1 
ATOM   5471 C CA    . ARG E 3 101 ? 53.650  90.255  72.757  1.00 95.09  ? 101 ARG C CA    1 
ATOM   5472 C C     . ARG E 3 101 ? 53.269  90.713  71.346  1.00 94.99  ? 101 ARG C C     1 
ATOM   5473 O O     . ARG E 3 101 ? 53.758  90.164  70.350  1.00 95.06  ? 101 ARG C O     1 
ATOM   5474 C CB    . ARG E 3 101 ? 54.951  90.946  73.214  1.00 96.81  ? 101 ARG C CB    1 
ATOM   5475 C CG    . ARG E 3 101 ? 55.500  90.459  74.575  1.00 99.08  ? 101 ARG C CG    1 
ATOM   5476 C CD    . ARG E 3 101 ? 56.911  90.998  74.892  1.00 101.16 ? 101 ARG C CD    1 
ATOM   5477 N NE    . ARG E 3 101 ? 57.912  90.569  73.905  1.00 103.62 ? 101 ARG C NE    1 
ATOM   5478 C CZ    . ARG E 3 101 ? 59.217  90.863  73.949  1.00 104.71 ? 101 ARG C CZ    1 
ATOM   5479 N NH1   . ARG E 3 101 ? 59.717  91.598  74.939  1.00 104.96 ? 101 ARG C NH1   1 
ATOM   5480 N NH2   . ARG E 3 101 ? 60.031  90.425  72.990  1.00 104.92 ? 101 ARG C NH2   1 
ATOM   5481 N N     . SER E 3 102 ? 52.371  91.689  71.255  1.00 94.76  ? 102 SER C N     1 
ATOM   5482 C CA    . SER E 3 102 ? 51.957  92.210  69.952  1.00 94.28  ? 102 SER C CA    1 
ATOM   5483 C C     . SER E 3 102 ? 52.959  93.288  69.557  1.00 93.52  ? 102 SER C C     1 
ATOM   5484 O O     . SER E 3 102 ? 53.360  94.096  70.394  1.00 93.56  ? 102 SER C O     1 
ATOM   5485 C CB    . SER E 3 102 ? 50.552  92.820  70.032  1.00 94.86  ? 102 SER C CB    1 
ATOM   5486 O OG    . SER E 3 102 ? 50.167  93.389  68.789  1.00 94.76  ? 102 SER C OG    1 
ATOM   5487 N N     . GLY E 3 103 ? 53.378  93.297  68.297  1.00 92.25  ? 103 GLY C N     1 
ATOM   5488 C CA    . GLY E 3 103 ? 54.331  94.303  67.868  1.00 90.95  ? 103 GLY C CA    1 
ATOM   5489 C C     . GLY E 3 103 ? 55.396  93.755  66.949  1.00 90.24  ? 103 GLY C C     1 
ATOM   5490 O O     . GLY E 3 103 ? 55.643  92.553  66.926  1.00 90.23  ? 103 GLY C O     1 
ATOM   5491 N N     . VAL E 3 104 ? 56.024  94.645  66.188  1.00 89.92  ? 104 VAL C N     1 
ATOM   5492 C CA    . VAL E 3 104 ? 57.077  94.266  65.250  1.00 89.78  ? 104 VAL C CA    1 
ATOM   5493 C C     . VAL E 3 104 ? 58.367  93.936  66.006  1.00 90.57  ? 104 VAL C C     1 
ATOM   5494 O O     . VAL E 3 104 ? 59.131  93.041  65.617  1.00 90.90  ? 104 VAL C O     1 
ATOM   5495 C CB    . VAL E 3 104 ? 57.370  95.412  64.262  1.00 88.95  ? 104 VAL C CB    1 
ATOM   5496 C CG1   . VAL E 3 104 ? 58.314  94.933  63.164  1.00 88.31  ? 104 VAL C CG1   1 
ATOM   5497 C CG2   . VAL E 3 104 ? 56.072  95.931  63.684  1.00 88.51  ? 104 VAL C CG2   1 
ATOM   5498 N N     . GLU E 3 105 ? 58.604  94.672  67.088  1.00 90.65  ? 105 GLU C N     1 
ATOM   5499 C CA    . GLU E 3 105 ? 59.786  94.470  67.911  1.00 90.14  ? 105 GLU C CA    1 
ATOM   5500 C C     . GLU E 3 105 ? 59.851  93.032  68.413  1.00 88.50  ? 105 GLU C C     1 
ATOM   5501 O O     . GLU E 3 105 ? 60.882  92.370  68.301  1.00 87.94  ? 105 GLU C O     1 
ATOM   5502 C CB    . GLU E 3 105 ? 59.766  95.451  69.090  1.00 92.09  ? 105 GLU C CB    1 
ATOM   5503 C CG    . GLU E 3 105 ? 60.008  96.902  68.677  1.00 94.88  ? 105 GLU C CG    1 
ATOM   5504 C CD    . GLU E 3 105 ? 61.350  97.086  67.967  1.00 96.81  ? 105 GLU C CD    1 
ATOM   5505 O OE1   . GLU E 3 105 ? 62.408  96.976  68.638  1.00 97.76  ? 105 GLU C OE1   1 
ATOM   5506 O OE2   . GLU E 3 105 ? 61.342  97.331  66.735  1.00 97.62  ? 105 GLU C OE2   1 
ATOM   5507 N N     . ALA E 3 106 ? 58.735  92.558  68.956  1.00 86.95  ? 106 ALA C N     1 
ATOM   5508 C CA    . ALA E 3 106 ? 58.647  91.203  69.478  1.00 85.46  ? 106 ALA C CA    1 
ATOM   5509 C C     . ALA E 3 106 ? 58.947  90.197  68.380  1.00 84.58  ? 106 ALA C C     1 
ATOM   5510 O O     . ALA E 3 106 ? 59.652  89.216  68.616  1.00 84.67  ? 106 ALA C O     1 
ATOM   5511 C CB    . ALA E 3 106 ? 57.259  90.953  70.048  1.00 85.84  ? 106 ALA C CB    1 
ATOM   5512 N N     . CYS E 3 107 ? 58.413  90.449  67.185  1.00 83.39  ? 107 CYS C N     1 
ATOM   5513 C CA    . CYS E 3 107 ? 58.611  89.564  66.040  1.00 82.18  ? 107 CYS C CA    1 
ATOM   5514 C C     . CYS E 3 107 ? 60.041  89.631  65.534  1.00 82.75  ? 107 CYS C C     1 
ATOM   5515 O O     . CYS E 3 107 ? 60.522  88.711  64.867  1.00 82.82  ? 107 CYS C O     1 
ATOM   5516 C CB    . CYS E 3 107 ? 57.660  89.922  64.908  1.00 80.85  ? 107 CYS C CB    1 
ATOM   5517 S SG    . CYS E 3 107 ? 57.816  88.801  63.526  1.00 78.17  ? 107 CYS C SG    1 
ATOM   5518 N N     . LYS E 3 108 ? 60.716  90.735  65.833  1.00 83.09  ? 108 LYS C N     1 
ATOM   5519 C CA    . LYS E 3 108 ? 62.111  90.878  65.447  1.00 83.57  ? 108 LYS C CA    1 
ATOM   5520 C C     . LYS E 3 108 ? 62.935  90.085  66.481  1.00 83.28  ? 108 LYS C C     1 
ATOM   5521 O O     . LYS E 3 108 ? 63.829  89.306  66.124  1.00 83.13  ? 108 LYS C O     1 
ATOM   5522 C CB    . LYS E 3 108 ? 62.521  92.357  65.445  1.00 85.01  ? 108 LYS C CB    1 
ATOM   5523 C CG    . LYS E 3 108 ? 62.149  93.135  64.173  1.00 86.72  ? 108 LYS C CG    1 
ATOM   5524 C CD    . LYS E 3 108 ? 62.785  94.537  64.178  1.00 88.08  ? 108 LYS C CD    1 
ATOM   5525 C CE    . LYS E 3 108 ? 62.468  95.339  62.917  1.00 88.77  ? 108 LYS C CE    1 
ATOM   5526 N NZ    . LYS E 3 108 ? 63.048  96.720  62.955  1.00 88.28  ? 108 LYS C NZ    1 
ATOM   5527 N N     . THR E 3 109 ? 62.619  90.286  67.761  1.00 82.20  ? 109 THR C N     1 
ATOM   5528 C CA    . THR E 3 109 ? 63.290  89.580  68.849  1.00 80.74  ? 109 THR C CA    1 
ATOM   5529 C C     . THR E 3 109 ? 63.298  88.108  68.466  1.00 79.91  ? 109 THR C C     1 
ATOM   5530 O O     . THR E 3 109 ? 64.326  87.452  68.501  1.00 79.81  ? 109 THR C O     1 
ATOM   5531 C CB    . THR E 3 109 ? 62.516  89.745  70.177  1.00 80.97  ? 109 THR C CB    1 
ATOM   5532 O OG1   . THR E 3 109 ? 62.476  91.130  70.543  1.00 81.28  ? 109 THR C OG1   1 
ATOM   5533 C CG2   . THR E 3 109 ? 63.183  88.957  71.291  1.00 81.06  ? 109 THR C CG2   1 
ATOM   5534 N N     . ALA E 3 110 ? 62.129  87.611  68.082  1.00 79.55  ? 110 ALA C N     1 
ATOM   5535 C CA    . ALA E 3 110 ? 61.953  86.226  67.673  1.00 79.54  ? 110 ALA C CA    1 
ATOM   5536 C C     . ALA E 3 110 ? 62.883  85.840  66.530  1.00 79.70  ? 110 ALA C C     1 
ATOM   5537 O O     . ALA E 3 110 ? 63.560  84.818  66.584  1.00 79.56  ? 110 ALA C O     1 
ATOM   5538 C CB    . ALA E 3 110 ? 60.513  85.999  67.256  1.00 79.44  ? 110 ALA C CB    1 
ATOM   5539 N N     . VAL E 3 111 ? 62.909  86.649  65.483  1.00 79.97  ? 111 VAL C N     1 
ATOM   5540 C CA    . VAL E 3 111 ? 63.771  86.351  64.355  1.00 80.92  ? 111 VAL C CA    1 
ATOM   5541 C C     . VAL E 3 111 ? 65.239  86.403  64.780  1.00 82.54  ? 111 VAL C C     1 
ATOM   5542 O O     . VAL E 3 111 ? 66.073  85.684  64.234  1.00 82.71  ? 111 VAL C O     1 
ATOM   5543 C CB    . VAL E 3 111 ? 63.538  87.340  63.205  1.00 80.38  ? 111 VAL C CB    1 
ATOM   5544 C CG1   . VAL E 3 111 ? 64.459  87.013  62.045  1.00 79.78  ? 111 VAL C CG1   1 
ATOM   5545 C CG2   . VAL E 3 111 ? 62.089  87.284  62.761  1.00 79.67  ? 111 VAL C CG2   1 
ATOM   5546 N N     . HIS E 3 112 ? 65.545  87.253  65.759  1.00 84.60  ? 112 HIS C N     1 
ATOM   5547 C CA    . HIS E 3 112 ? 66.911  87.405  66.276  1.00 86.24  ? 112 HIS C CA    1 
ATOM   5548 C C     . HIS E 3 112 ? 67.406  86.082  66.896  1.00 85.45  ? 112 HIS C C     1 
ATOM   5549 O O     . HIS E 3 112 ? 68.481  85.594  66.542  1.00 85.36  ? 112 HIS C O     1 
ATOM   5550 C CB    . HIS E 3 112 ? 66.944  88.543  67.319  1.00 89.56  ? 112 HIS C CB    1 
ATOM   5551 C CG    . HIS E 3 112 ? 68.317  88.899  67.818  1.00 92.72  ? 112 HIS C CG    1 
ATOM   5552 N ND1   . HIS E 3 112 ? 68.520  89.743  68.892  1.00 94.15  ? 112 HIS C ND1   1 
ATOM   5553 C CD2   . HIS E 3 112 ? 69.551  88.533  67.393  1.00 93.85  ? 112 HIS C CD2   1 
ATOM   5554 C CE1   . HIS E 3 112 ? 69.816  89.879  69.110  1.00 94.48  ? 112 HIS C CE1   1 
ATOM   5555 N NE2   . HIS E 3 112 ? 70.464  89.155  68.214  1.00 94.65  ? 112 HIS C NE2   1 
ATOM   5556 N N     . ASN E 3 113 ? 66.619  85.503  67.805  1.00 84.17  ? 113 ASN C N     1 
ATOM   5557 C CA    . ASN E 3 113 ? 66.987  84.242  68.454  1.00 82.75  ? 113 ASN C CA    1 
ATOM   5558 C C     . ASN E 3 113 ? 67.046  83.102  67.453  1.00 81.27  ? 113 ASN C C     1 
ATOM   5559 O O     . ASN E 3 113 ? 67.905  82.227  67.549  1.00 81.09  ? 113 ASN C O     1 
ATOM   5560 C CB    . ASN E 3 113 ? 65.990  83.869  69.552  1.00 83.74  ? 113 ASN C CB    1 
ATOM   5561 C CG    . ASN E 3 113 ? 65.862  84.939  70.614  1.00 84.66  ? 113 ASN C CG    1 
ATOM   5562 O OD1   . ASN E 3 113 ? 66.847  85.583  70.990  1.00 84.25  ? 113 ASN C OD1   1 
ATOM   5563 N ND2   . ASN E 3 113 ? 64.643  85.128  71.120  1.00 85.53  ? 113 ASN C ND2   1 
ATOM   5564 N N     . LEU E 3 114 ? 66.117  83.101  66.507  1.00 79.88  ? 114 LEU C N     1 
ATOM   5565 C CA    . LEU E 3 114 ? 66.094  82.067  65.489  1.00 79.43  ? 114 LEU C CA    1 
ATOM   5566 C C     . LEU E 3 114 ? 67.373  82.160  64.664  1.00 79.28  ? 114 LEU C C     1 
ATOM   5567 O O     . LEU E 3 114 ? 67.924  81.146  64.226  1.00 79.71  ? 114 LEU C O     1 
ATOM   5568 C CB    . LEU E 3 114 ? 64.877  82.246  64.586  1.00 79.36  ? 114 LEU C CB    1 
ATOM   5569 C CG    . LEU E 3 114 ? 63.828  81.139  64.680  1.00 79.33  ? 114 LEU C CG    1 
ATOM   5570 C CD1   . LEU E 3 114 ? 63.465  80.900  66.134  1.00 79.94  ? 114 LEU C CD1   1 
ATOM   5571 C CD2   . LEU E 3 114 ? 62.602  81.527  63.879  1.00 79.32  ? 114 LEU C CD2   1 
ATOM   5572 N N     . LEU E 3 115 ? 67.840  83.388  64.455  1.00 78.91  ? 115 LEU C N     1 
ATOM   5573 C CA    . LEU E 3 115 ? 69.063  83.629  63.699  1.00 78.14  ? 115 LEU C CA    1 
ATOM   5574 C C     . LEU E 3 115 ? 70.264  83.138  64.504  1.00 77.77  ? 115 LEU C C     1 
ATOM   5575 O O     . LEU E 3 115 ? 71.158  82.477  63.973  1.00 77.30  ? 115 LEU C O     1 
ATOM   5576 C CB    . LEU E 3 115 ? 69.192  85.121  63.404  1.00 77.53  ? 115 LEU C CB    1 
ATOM   5577 C CG    . LEU E 3 115 ? 68.934  85.541  61.956  1.00 76.78  ? 115 LEU C CG    1 
ATOM   5578 C CD1   . LEU E 3 115 ? 67.838  84.696  61.341  1.00 76.05  ? 115 LEU C CD1   1 
ATOM   5579 C CD2   . LEU E 3 115 ? 68.567  87.011  61.931  1.00 77.25  ? 115 LEU C CD2   1 
ATOM   5580 N N     . ALA E 3 116 ? 70.262  83.461  65.793  1.00 77.44  ? 116 ALA C N     1 
ATOM   5581 C CA    . ALA E 3 116 ? 71.324  83.053  66.694  1.00 77.36  ? 116 ALA C CA    1 
ATOM   5582 C C     . ALA E 3 116 ? 71.555  81.549  66.620  1.00 77.43  ? 116 ALA C C     1 
ATOM   5583 O O     . ALA E 3 116 ? 72.693  81.097  66.689  1.00 78.22  ? 116 ALA C O     1 
ATOM   5584 C CB    . ALA E 3 116 ? 70.984  83.457  68.124  1.00 77.60  ? 116 ALA C CB    1 
ATOM   5585 N N     . GLN E 3 117 ? 70.485  80.771  66.481  1.00 77.14  ? 117 GLN C N     1 
ATOM   5586 C CA    . GLN E 3 117 ? 70.616  79.316  66.403  1.00 76.38  ? 117 GLN C CA    1 
ATOM   5587 C C     . GLN E 3 117 ? 71.061  78.879  65.016  1.00 75.62  ? 117 GLN C C     1 
ATOM   5588 O O     . GLN E 3 117 ? 70.971  77.713  64.666  1.00 74.81  ? 117 GLN C O     1 
ATOM   5589 C CB    . GLN E 3 117 ? 69.294  78.640  66.780  1.00 77.02  ? 117 GLN C CB    1 
ATOM   5590 C CG    . GLN E 3 117 ? 68.835  78.968  68.200  1.00 78.87  ? 117 GLN C CG    1 
ATOM   5591 C CD    . GLN E 3 117 ? 67.537  78.279  68.590  1.00 79.95  ? 117 GLN C CD    1 
ATOM   5592 O OE1   . GLN E 3 117 ? 67.467  77.048  68.658  1.00 80.64  ? 117 GLN C OE1   1 
ATOM   5593 N NE2   . GLN E 3 117 ? 66.500  79.074  68.852  1.00 80.31  ? 117 GLN C NE2   1 
ATOM   5594 N N     . ARG E 3 118 ? 71.558  79.839  64.247  1.00 75.79  ? 118 ARG C N     1 
ATOM   5595 C CA    . ARG E 3 118 ? 72.038  79.615  62.891  1.00 76.41  ? 118 ARG C CA    1 
ATOM   5596 C C     . ARG E 3 118 ? 71.150  78.704  62.053  1.00 74.73  ? 118 ARG C C     1 
ATOM   5597 O O     . ARG E 3 118 ? 71.616  77.705  61.502  1.00 74.26  ? 118 ARG C O     1 
ATOM   5598 C CB    . ARG E 3 118 ? 73.470  79.067  62.915  1.00 79.69  ? 118 ARG C CB    1 
ATOM   5599 C CG    . ARG E 3 118 ? 74.539  80.055  63.442  1.00 84.65  ? 118 ARG C CG    1 
ATOM   5600 C CD    . ARG E 3 118 ? 74.698  81.350  62.593  1.00 88.13  ? 118 ARG C CD    1 
ATOM   5601 N NE    . ARG E 3 118 ? 75.646  82.308  63.190  1.00 90.84  ? 118 ARG C NE    1 
ATOM   5602 C CZ    . ARG E 3 118 ? 75.363  83.131  64.207  1.00 92.24  ? 118 ARG C CZ    1 
ATOM   5603 N NH1   . ARG E 3 118 ? 74.149  83.132  64.749  1.00 93.63  ? 118 ARG C NH1   1 
ATOM   5604 N NH2   . ARG E 3 118 ? 76.293  83.943  64.705  1.00 92.01  ? 118 ARG C NH2   1 
ATOM   5605 N N     . VAL E 3 119 ? 69.870  79.062  61.959  1.00 72.79  ? 119 VAL C N     1 
ATOM   5606 C CA    . VAL E 3 119 ? 68.896  78.306  61.169  1.00 70.51  ? 119 VAL C CA    1 
ATOM   5607 C C     . VAL E 3 119 ? 69.252  78.518  59.705  1.00 68.30  ? 119 VAL C C     1 
ATOM   5608 O O     . VAL E 3 119 ? 69.875  79.518  59.375  1.00 68.84  ? 119 VAL C O     1 
ATOM   5609 C CB    . VAL E 3 119 ? 67.462  78.838  61.382  1.00 70.80  ? 119 VAL C CB    1 
ATOM   5610 C CG1   . VAL E 3 119 ? 67.014  78.618  62.812  1.00 70.57  ? 119 VAL C CG1   1 
ATOM   5611 C CG2   . VAL E 3 119 ? 67.417  80.317  61.047  1.00 71.33  ? 119 VAL C CG2   1 
ATOM   5612 N N     . SER E 3 120 ? 68.857  77.604  58.825  1.00 65.75  ? 120 SER C N     1 
ATOM   5613 C CA    . SER E 3 120 ? 69.171  77.778  57.410  1.00 64.09  ? 120 SER C CA    1 
ATOM   5614 C C     . SER E 3 120 ? 68.069  78.491  56.613  1.00 62.21  ? 120 SER C C     1 
ATOM   5615 O O     . SER E 3 120 ? 68.210  78.721  55.412  1.00 61.87  ? 120 SER C O     1 
ATOM   5616 C CB    . SER E 3 120 ? 69.499  76.429  56.760  1.00 64.63  ? 120 SER C CB    1 
ATOM   5617 O OG    . SER E 3 120 ? 68.382  75.562  56.750  1.00 65.61  ? 120 SER C OG    1 
ATOM   5618 N N     . GLY E 3 121 ? 66.983  78.847  57.289  1.00 60.10  ? 121 GLY C N     1 
ATOM   5619 C CA    . GLY E 3 121 ? 65.885  79.539  56.638  1.00 58.25  ? 121 GLY C CA    1 
ATOM   5620 C C     . GLY E 3 121 ? 64.816  79.862  57.661  1.00 56.66  ? 121 GLY C C     1 
ATOM   5621 O O     . GLY E 3 121 ? 64.724  79.179  58.670  1.00 57.81  ? 121 GLY C O     1 
ATOM   5622 N N     . LEU E 3 122 ? 64.012  80.892  57.433  1.00 54.18  ? 122 LEU C N     1 
ATOM   5623 C CA    . LEU E 3 122 ? 62.972  81.228  58.395  1.00 51.24  ? 122 LEU C CA    1 
ATOM   5624 C C     . LEU E 3 122 ? 61.589  81.156  57.785  1.00 50.76  ? 122 LEU C C     1 
ATOM   5625 O O     . LEU E 3 122 ? 61.426  81.372  56.591  1.00 51.22  ? 122 LEU C O     1 
ATOM   5626 C CB    . LEU E 3 122 ? 63.176  82.639  58.956  1.00 49.07  ? 122 LEU C CB    1 
ATOM   5627 C CG    . LEU E 3 122 ? 64.310  82.895  59.939  1.00 47.43  ? 122 LEU C CG    1 
ATOM   5628 C CD1   . LEU E 3 122 ? 64.084  84.225  60.625  1.00 47.45  ? 122 LEU C CD1   1 
ATOM   5629 C CD2   . LEU E 3 122 ? 64.348  81.795  60.968  1.00 47.68  ? 122 LEU C CD2   1 
ATOM   5630 N N     . ILE E 3 123 ? 60.602  80.812  58.607  1.00 49.33  ? 123 ILE C N     1 
ATOM   5631 C CA    . ILE E 3 123 ? 59.209  80.793  58.179  1.00 47.06  ? 123 ILE C CA    1 
ATOM   5632 C C     . ILE E 3 123 ? 58.530  81.687  59.213  1.00 47.53  ? 123 ILE C C     1 
ATOM   5633 O O     . ILE E 3 123 ? 58.544  81.383  60.408  1.00 47.09  ? 123 ILE C O     1 
ATOM   5634 C CB    . ILE E 3 123 ? 58.573  79.385  58.204  1.00 45.63  ? 123 ILE C CB    1 
ATOM   5635 C CG1   . ILE E 3 123 ? 59.160  78.521  57.091  1.00 44.19  ? 123 ILE C CG1   1 
ATOM   5636 C CG2   . ILE E 3 123 ? 57.072  79.493  57.987  1.00 44.16  ? 123 ILE C CG2   1 
ATOM   5637 C CD1   . ILE E 3 123 ? 58.315  77.313  56.747  1.00 43.83  ? 123 ILE C CD1   1 
ATOM   5638 N N     . ILE E 3 124 ? 57.975  82.807  58.758  1.00 47.23  ? 124 ILE C N     1 
ATOM   5639 C CA    . ILE E 3 124 ? 57.323  83.750  59.659  1.00 46.62  ? 124 ILE C CA    1 
ATOM   5640 C C     . ILE E 3 124 ? 55.796  83.710  59.561  1.00 47.16  ? 124 ILE C C     1 
ATOM   5641 O O     . ILE E 3 124 ? 55.202  84.233  58.617  1.00 47.16  ? 124 ILE C O     1 
ATOM   5642 C CB    . ILE E 3 124 ? 57.773  85.199  59.378  1.00 46.62  ? 124 ILE C CB    1 
ATOM   5643 C CG1   . ILE E 3 124 ? 59.279  85.265  59.122  1.00 46.46  ? 124 ILE C CG1   1 
ATOM   5644 C CG2   . ILE E 3 124 ? 57.435  86.072  60.569  1.00 46.36  ? 124 ILE C CG2   1 
ATOM   5645 C CD1   . ILE E 3 124 ? 60.118  85.315  60.368  1.00 46.57  ? 124 ILE C CD1   1 
ATOM   5646 N N     . ASN E 3 125 ? 55.166  83.083  60.547  1.00 47.36  ? 125 ASN C N     1 
ATOM   5647 C CA    . ASN E 3 125 ? 53.715  82.985  60.603  1.00 47.19  ? 125 ASN C CA    1 
ATOM   5648 C C     . ASN E 3 125 ? 53.270  83.929  61.697  1.00 46.49  ? 125 ASN C C     1 
ATOM   5649 O O     . ASN E 3 125 ? 52.840  83.514  62.769  1.00 45.37  ? 125 ASN C O     1 
ATOM   5650 C CB    . ASN E 3 125 ? 53.274  81.562  60.936  1.00 49.01  ? 125 ASN C CB    1 
ATOM   5651 C CG    . ASN E 3 125 ? 51.766  81.433  61.078  1.00 50.57  ? 125 ASN C CG    1 
ATOM   5652 O OD1   . ASN E 3 125 ? 51.249  80.355  61.375  1.00 52.15  ? 125 ASN C OD1   1 
ATOM   5653 N ND2   . ASN E 3 125 ? 51.054  82.530  60.870  1.00 50.45  ? 125 ASN C ND2   1 
ATOM   5654 N N     . TYR E 3 126 ? 53.404  85.213  61.404  1.00 46.58  ? 126 TYR C N     1 
ATOM   5655 C CA    . TYR E 3 126 ? 53.036  86.282  62.317  1.00 46.81  ? 126 TYR C CA    1 
ATOM   5656 C C     . TYR E 3 126 ? 52.513  87.444  61.463  1.00 47.18  ? 126 TYR C C     1 
ATOM   5657 O O     . TYR E 3 126 ? 53.063  87.730  60.397  1.00 47.84  ? 126 TYR C O     1 
ATOM   5658 C CB    . TYR E 3 126 ? 54.272  86.701  63.110  1.00 46.29  ? 126 TYR C CB    1 
ATOM   5659 C CG    . TYR E 3 126 ? 54.001  87.684  64.205  1.00 46.07  ? 126 TYR C CG    1 
ATOM   5660 C CD1   . TYR E 3 126 ? 53.873  89.034  63.937  1.00 46.89  ? 126 TYR C CD1   1 
ATOM   5661 C CD2   . TYR E 3 126 ? 53.838  87.257  65.509  1.00 46.82  ? 126 TYR C CD2   1 
ATOM   5662 C CE1   . TYR E 3 126 ? 53.587  89.940  64.950  1.00 48.28  ? 126 TYR C CE1   1 
ATOM   5663 C CE2   . TYR E 3 126 ? 53.548  88.148  66.528  1.00 48.03  ? 126 TYR C CE2   1 
ATOM   5664 C CZ    . TYR E 3 126 ? 53.422  89.487  66.249  1.00 48.19  ? 126 TYR C CZ    1 
ATOM   5665 O OH    . TYR E 3 126 ? 53.118  90.361  67.274  1.00 48.58  ? 126 TYR C OH    1 
ATOM   5666 N N     . PRO E 3 127 ? 51.437  88.112  61.905  1.00 46.48  ? 127 PRO C N     1 
ATOM   5667 C CA    . PRO E 3 127 ? 50.842  89.238  61.177  1.00 47.40  ? 127 PRO C CA    1 
ATOM   5668 C C     . PRO E 3 127 ? 51.794  90.426  61.083  1.00 47.33  ? 127 PRO C C     1 
ATOM   5669 O O     . PRO E 3 127 ? 52.166  91.036  62.083  1.00 46.04  ? 127 PRO C O     1 
ATOM   5670 C CB    . PRO E 3 127 ? 49.615  89.553  61.998  1.00 47.46  ? 127 PRO C CB    1 
ATOM   5671 C CG    . PRO E 3 127 ? 50.113  89.286  63.379  1.00 47.71  ? 127 PRO C CG    1 
ATOM   5672 C CD    . PRO E 3 127 ? 50.806  87.962  63.222  1.00 46.84  ? 127 PRO C CD    1 
ATOM   5673 N N     . LEU E 3 128 ? 52.172  90.753  59.857  1.00 48.54  ? 128 LEU C N     1 
ATOM   5674 C CA    . LEU E 3 128 ? 53.103  91.839  59.604  1.00 49.87  ? 128 LEU C CA    1 
ATOM   5675 C C     . LEU E 3 128 ? 52.593  92.806  58.538  1.00 51.70  ? 128 LEU C C     1 
ATOM   5676 O O     . LEU E 3 128 ? 52.051  92.391  57.499  1.00 51.71  ? 128 LEU C O     1 
ATOM   5677 C CB    . LEU E 3 128 ? 54.449  91.250  59.165  1.00 48.58  ? 128 LEU C CB    1 
ATOM   5678 C CG    . LEU E 3 128 ? 55.623  91.260  60.135  1.00 46.35  ? 128 LEU C CG    1 
ATOM   5679 C CD1   . LEU E 3 128 ? 55.112  91.222  61.546  1.00 45.91  ? 128 LEU C CD1   1 
ATOM   5680 C CD2   . LEU E 3 128 ? 56.540  90.094  59.835  1.00 45.44  ? 128 LEU C CD2   1 
ATOM   5681 N N     . ASP E 3 129 ? 52.753  94.099  58.807  1.00 53.53  ? 129 ASP C N     1 
ATOM   5682 C CA    . ASP E 3 129 ? 52.337  95.111  57.850  1.00 55.99  ? 129 ASP C CA    1 
ATOM   5683 C C     . ASP E 3 129 ? 53.464  95.197  56.822  1.00 57.14  ? 129 ASP C C     1 
ATOM   5684 O O     . ASP E 3 129 ? 54.614  94.891  57.145  1.00 57.39  ? 129 ASP C O     1 
ATOM   5685 C CB    . ASP E 3 129 ? 52.102  96.459  58.548  1.00 56.88  ? 129 ASP C CB    1 
ATOM   5686 C CG    . ASP E 3 129 ? 50.637  96.664  58.972  1.00 57.74  ? 129 ASP C CG    1 
ATOM   5687 O OD1   . ASP E 3 129 ? 50.278  97.789  59.392  1.00 58.29  ? 129 ASP C OD1   1 
ATOM   5688 O OD2   . ASP E 3 129 ? 49.840  95.703  58.887  1.00 58.03  ? 129 ASP C OD2   1 
ATOM   5689 N N     . ASP E 3 130 ? 53.134  95.604  55.596  1.00 58.18  ? 130 ASP C N     1 
ATOM   5690 C CA    . ASP E 3 130 ? 54.105  95.677  54.503  1.00 59.17  ? 130 ASP C CA    1 
ATOM   5691 C C     . ASP E 3 130 ? 55.539  96.081  54.812  1.00 59.86  ? 130 ASP C C     1 
ATOM   5692 O O     . ASP E 3 130 ? 56.455  95.288  54.621  1.00 60.81  ? 130 ASP C O     1 
ATOM   5693 C CB    . ASP E 3 130 ? 53.563  96.544  53.368  1.00 59.54  ? 130 ASP C CB    1 
ATOM   5694 C CG    . ASP E 3 130 ? 52.584  95.791  52.495  1.00 60.45  ? 130 ASP C CG    1 
ATOM   5695 O OD1   . ASP E 3 130 ? 52.192  96.305  51.423  1.00 60.77  ? 130 ASP C OD1   1 
ATOM   5696 O OD2   . ASP E 3 130 ? 52.202  94.671  52.893  1.00 61.60  ? 130 ASP C OD2   1 
ATOM   5697 N N     . GLN E 3 131 ? 55.756  97.300  55.279  1.00 60.28  ? 131 GLN C N     1 
ATOM   5698 C CA    . GLN E 3 131 ? 57.118  97.721  55.576  1.00 60.78  ? 131 GLN C CA    1 
ATOM   5699 C C     . GLN E 3 131 ? 57.744  96.906  56.703  1.00 59.96  ? 131 GLN C C     1 
ATOM   5700 O O     . GLN E 3 131 ? 58.914  96.537  56.634  1.00 59.52  ? 131 GLN C O     1 
ATOM   5701 C CB    . GLN E 3 131 ? 57.130  99.212  55.891  1.00 63.16  ? 131 GLN C CB    1 
ATOM   5702 C CG    . GLN E 3 131 ? 56.694  100.040 54.677  1.00 66.22  ? 131 GLN C CG    1 
ATOM   5703 C CD    . GLN E 3 131 ? 56.799  101.546 54.878  1.00 67.51  ? 131 GLN C CD    1 
ATOM   5704 O OE1   . GLN E 3 131 ? 57.871  102.071 55.183  1.00 68.76  ? 131 GLN C OE1   1 
ATOM   5705 N NE2   . GLN E 3 131 ? 55.684  102.249 54.693  1.00 67.38  ? 131 GLN C NE2   1 
ATOM   5706 N N     . ASP E 3 132 ? 56.958  96.620  57.732  1.00 58.97  ? 132 ASP C N     1 
ATOM   5707 C CA    . ASP E 3 132 ? 57.427  95.826  58.853  1.00 57.80  ? 132 ASP C CA    1 
ATOM   5708 C C     . ASP E 3 132 ? 57.910  94.500  58.299  1.00 56.55  ? 132 ASP C C     1 
ATOM   5709 O O     . ASP E 3 132 ? 58.975  94.015  58.665  1.00 56.40  ? 132 ASP C O     1 
ATOM   5710 C CB    . ASP E 3 132 ? 56.277  95.592  59.825  1.00 59.55  ? 132 ASP C CB    1 
ATOM   5711 C CG    . ASP E 3 132 ? 55.939  96.826  60.627  1.00 60.24  ? 132 ASP C CG    1 
ATOM   5712 O OD1   . ASP E 3 132 ? 54.772  96.956  61.073  1.00 60.67  ? 132 ASP C OD1   1 
ATOM   5713 O OD2   . ASP E 3 132 ? 56.855  97.656  60.820  1.00 60.49  ? 132 ASP C OD2   1 
ATOM   5714 N N     . ALA E 3 133 ? 57.113  93.916  57.413  1.00 55.08  ? 133 ALA C N     1 
ATOM   5715 C CA    . ALA E 3 133 ? 57.469  92.650  56.807  1.00 54.40  ? 133 ALA C CA    1 
ATOM   5716 C C     . ALA E 3 133 ? 58.787  92.819  56.079  1.00 54.29  ? 133 ALA C C     1 
ATOM   5717 O O     . ALA E 3 133 ? 59.667  91.974  56.169  1.00 54.70  ? 133 ALA C O     1 
ATOM   5718 C CB    . ALA E 3 133 ? 56.392  92.213  55.840  1.00 53.80  ? 133 ALA C CB    1 
ATOM   5719 N N     . ILE E 3 134 ? 58.934  93.926  55.365  1.00 54.34  ? 134 ILE C N     1 
ATOM   5720 C CA    . ILE E 3 134 ? 60.163  94.172  54.623  1.00 54.43  ? 134 ILE C CA    1 
ATOM   5721 C C     . ILE E 3 134 ? 61.354  94.337  55.552  1.00 54.86  ? 134 ILE C C     1 
ATOM   5722 O O     . ILE E 3 134 ? 62.464  93.932  55.222  1.00 54.86  ? 134 ILE C O     1 
ATOM   5723 C CB    . ILE E 3 134 ? 60.055  95.427  53.729  1.00 54.04  ? 134 ILE C CB    1 
ATOM   5724 C CG1   . ILE E 3 134 ? 59.046  95.192  52.603  1.00 53.39  ? 134 ILE C CG1   1 
ATOM   5725 C CG2   . ILE E 3 134 ? 61.399  95.730  53.114  1.00 54.06  ? 134 ILE C CG2   1 
ATOM   5726 C CD1   . ILE E 3 134 ? 58.929  96.335  51.631  1.00 52.17  ? 134 ILE C CD1   1 
ATOM   5727 N N     . ALA E 3 135 ? 61.125  94.932  56.716  1.00 55.94  ? 135 ALA C N     1 
ATOM   5728 C CA    . ALA E 3 135 ? 62.201  95.134  57.685  1.00 57.28  ? 135 ALA C CA    1 
ATOM   5729 C C     . ALA E 3 135 ? 62.670  93.787  58.223  1.00 57.77  ? 135 ALA C C     1 
ATOM   5730 O O     . ALA E 3 135 ? 63.873  93.526  58.305  1.00 57.78  ? 135 ALA C O     1 
ATOM   5731 C CB    . ALA E 3 135 ? 61.720  96.021  58.831  1.00 58.07  ? 135 ALA C CB    1 
ATOM   5732 N N     . VAL E 3 136 ? 61.709  92.946  58.597  1.00 58.26  ? 136 VAL C N     1 
ATOM   5733 C CA    . VAL E 3 136 ? 62.005  91.617  59.102  1.00 59.34  ? 136 VAL C CA    1 
ATOM   5734 C C     . VAL E 3 136 ? 62.776  90.906  57.997  1.00 60.28  ? 136 VAL C C     1 
ATOM   5735 O O     . VAL E 3 136 ? 63.860  90.380  58.215  1.00 59.94  ? 136 VAL C O     1 
ATOM   5736 C CB    . VAL E 3 136 ? 60.701  90.857  59.437  1.00 59.43  ? 136 VAL C CB    1 
ATOM   5737 C CG1   . VAL E 3 136 ? 60.984  89.371  59.644  1.00 59.57  ? 136 VAL C CG1   1 
ATOM   5738 C CG2   . VAL E 3 136 ? 60.070  91.459  60.693  1.00 59.89  ? 136 VAL C CG2   1 
ATOM   5739 N N     . GLU E 3 137 ? 62.218  90.913  56.798  1.00 62.23  ? 137 GLU C N     1 
ATOM   5740 C CA    . GLU E 3 137 ? 62.871  90.293  55.659  1.00 64.72  ? 137 GLU C CA    1 
ATOM   5741 C C     . GLU E 3 137 ? 64.331  90.705  55.642  1.00 66.27  ? 137 GLU C C     1 
ATOM   5742 O O     . GLU E 3 137 ? 65.206  89.875  55.463  1.00 66.71  ? 137 GLU C O     1 
ATOM   5743 C CB    . GLU E 3 137 ? 62.183  90.736  54.360  1.00 65.43  ? 137 GLU C CB    1 
ATOM   5744 C CG    . GLU E 3 137 ? 63.042  90.683  53.100  1.00 66.15  ? 137 GLU C CG    1 
ATOM   5745 C CD    . GLU E 3 137 ? 63.440  89.277  52.698  1.00 67.38  ? 137 GLU C CD    1 
ATOM   5746 O OE1   . GLU E 3 137 ? 62.579  88.509  52.217  1.00 68.00  ? 137 GLU C OE1   1 
ATOM   5747 O OE2   . GLU E 3 137 ? 64.627  88.936  52.863  1.00 69.06  ? 137 GLU C OE2   1 
ATOM   5748 N N     . ALA E 3 138 ? 64.589  91.990  55.851  1.00 68.64  ? 138 ALA C N     1 
ATOM   5749 C CA    . ALA E 3 138 ? 65.952  92.509  55.842  1.00 71.75  ? 138 ALA C CA    1 
ATOM   5750 C C     . ALA E 3 138 ? 66.837  91.968  56.961  1.00 74.56  ? 138 ALA C C     1 
ATOM   5751 O O     . ALA E 3 138 ? 67.983  91.577  56.718  1.00 75.01  ? 138 ALA C O     1 
ATOM   5752 C CB    . ALA E 3 138 ? 65.924  94.016  55.903  1.00 71.45  ? 138 ALA C CB    1 
ATOM   5753 N N     . ALA E 3 139 ? 66.316  91.948  58.185  1.00 77.74  ? 139 ALA C N     1 
ATOM   5754 C CA    . ALA E 3 139 ? 67.085  91.456  59.331  1.00 80.67  ? 139 ALA C CA    1 
ATOM   5755 C C     . ALA E 3 139 ? 67.560  90.014  59.155  1.00 82.48  ? 139 ALA C C     1 
ATOM   5756 O O     . ALA E 3 139 ? 68.509  89.594  59.815  1.00 82.73  ? 139 ALA C O     1 
ATOM   5757 C CB    . ALA E 3 139 ? 66.269  91.593  60.626  1.00 80.72  ? 139 ALA C CB    1 
ATOM   5758 N N     . CYS E 3 140 ? 66.903  89.261  58.273  1.00 84.63  ? 140 CYS C N     1 
ATOM   5759 C CA    . CYS E 3 140 ? 67.295  87.879  58.010  1.00 87.19  ? 140 CYS C CA    1 
ATOM   5760 C C     . CYS E 3 140 ? 68.586  87.902  57.221  1.00 87.99  ? 140 CYS C C     1 
ATOM   5761 O O     . CYS E 3 140 ? 68.611  87.736  56.000  1.00 87.43  ? 140 CYS C O     1 
ATOM   5762 C CB    . CYS E 3 140 ? 66.215  87.146  57.226  1.00 88.43  ? 140 CYS C CB    1 
ATOM   5763 S SG    . CYS E 3 140 ? 64.666  87.018  58.146  1.00 92.90  ? 140 CYS C SG    1 
ATOM   5764 N N     . THR E 3 141 ? 69.658  88.130  57.967  1.00 90.12  ? 141 THR C N     1 
ATOM   5765 C CA    . THR E 3 141 ? 71.022  88.220  57.461  1.00 91.70  ? 141 THR C CA    1 
ATOM   5766 C C     . THR E 3 141 ? 71.420  87.060  56.545  1.00 91.16  ? 141 THR C C     1 
ATOM   5767 O O     . THR E 3 141 ? 71.841  86.001  57.025  1.00 92.00  ? 141 THR C O     1 
ATOM   5768 C CB    . THR E 3 141 ? 72.031  88.303  58.662  1.00 92.83  ? 141 THR C CB    1 
ATOM   5769 O OG1   . THR E 3 141 ? 71.659  89.387  59.532  1.00 94.11  ? 141 THR C OG1   1 
ATOM   5770 C CG2   . THR E 3 141 ? 73.461  88.528  58.163  1.00 93.51  ? 141 THR C CG2   1 
ATOM   5771 N N     . ASN E 3 142 ? 71.263  87.262  55.236  1.00 89.73  ? 142 ASN C N     1 
ATOM   5772 C CA    . ASN E 3 142 ? 71.644  86.256  54.251  1.00 88.05  ? 142 ASN C CA    1 
ATOM   5773 C C     . ASN E 3 142 ? 70.674  85.068  54.078  1.00 85.74  ? 142 ASN C C     1 
ATOM   5774 O O     . ASN E 3 142 ? 70.540  84.545  52.969  1.00 85.47  ? 142 ASN C O     1 
ATOM   5775 C CB    . ASN E 3 142 ? 73.055  85.755  54.603  1.00 91.31  ? 142 ASN C CB    1 
ATOM   5776 C CG    . ASN E 3 142 ? 73.703  84.934  53.489  1.00 94.22  ? 142 ASN C CG    1 
ATOM   5777 O OD1   . ASN E 3 142 ? 73.253  83.828  53.166  1.00 96.08  ? 142 ASN C OD1   1 
ATOM   5778 N ND2   . ASN E 3 142 ? 74.777  85.473  52.902  1.00 95.50  ? 142 ASN C ND2   1 
ATOM   5779 N N     . VAL E 3 143 ? 69.993  84.651  55.151  1.00 82.27  ? 143 VAL C N     1 
ATOM   5780 C CA    . VAL E 3 143 ? 69.062  83.508  55.094  1.00 77.89  ? 143 VAL C CA    1 
ATOM   5781 C C     . VAL E 3 143 ? 67.667  83.792  54.537  1.00 74.44  ? 143 VAL C C     1 
ATOM   5782 O O     . VAL E 3 143 ? 67.071  84.834  54.825  1.00 74.19  ? 143 VAL C O     1 
ATOM   5783 C CB    . VAL E 3 143 ? 68.879  82.862  56.479  1.00 78.57  ? 143 VAL C CB    1 
ATOM   5784 C CG1   . VAL E 3 143 ? 70.182  82.214  56.914  1.00 79.15  ? 143 VAL C CG1   1 
ATOM   5785 C CG2   . VAL E 3 143 ? 68.422  83.908  57.490  1.00 78.78  ? 143 VAL C CG2   1 
ATOM   5786 N N     . PRO E 3 144 ? 67.122  82.848  53.743  1.00 70.51  ? 144 PRO C N     1 
ATOM   5787 C CA    . PRO E 3 144 ? 65.795  82.995  53.141  1.00 67.91  ? 144 PRO C CA    1 
ATOM   5788 C C     . PRO E 3 144 ? 64.658  83.002  54.150  1.00 65.62  ? 144 PRO C C     1 
ATOM   5789 O O     . PRO E 3 144 ? 64.697  82.295  55.155  1.00 66.62  ? 144 PRO C O     1 
ATOM   5790 C CB    . PRO E 3 144 ? 65.715  81.807  52.186  1.00 67.77  ? 144 PRO C CB    1 
ATOM   5791 C CG    . PRO E 3 144 ? 66.523  80.778  52.870  1.00 68.40  ? 144 PRO C CG    1 
ATOM   5792 C CD    . PRO E 3 144 ? 67.721  81.557  53.357  1.00 69.44  ? 144 PRO C CD    1 
ATOM   5793 N N     . ALA E 3 145 ? 63.648  83.819  53.878  1.00 62.58  ? 145 ALA C N     1 
ATOM   5794 C CA    . ALA E 3 145 ? 62.492  83.914  54.753  1.00 59.02  ? 145 ALA C CA    1 
ATOM   5795 C C     . ALA E 3 145 ? 61.231  83.815  53.910  1.00 56.32  ? 145 ALA C C     1 
ATOM   5796 O O     . ALA E 3 145 ? 61.144  84.378  52.819  1.00 56.07  ? 145 ALA C O     1 
ATOM   5797 C CB    . ALA E 3 145 ? 62.514  85.227  55.527  1.00 58.82  ? 145 ALA C CB    1 
ATOM   5798 N N     . LEU E 3 146 ? 60.260  83.079  54.426  1.00 53.02  ? 146 LEU C N     1 
ATOM   5799 C CA    . LEU E 3 146 ? 58.996  82.884  53.752  1.00 49.35  ? 146 LEU C CA    1 
ATOM   5800 C C     . LEU E 3 146 ? 57.918  83.391  54.701  1.00 48.39  ? 146 LEU C C     1 
ATOM   5801 O O     . LEU E 3 146 ? 57.943  83.089  55.889  1.00 48.14  ? 146 LEU C O     1 
ATOM   5802 C CB    . LEU E 3 146 ? 58.828  81.404  53.462  1.00 47.82  ? 146 LEU C CB    1 
ATOM   5803 C CG    . LEU E 3 146 ? 57.675  80.958  52.592  1.00 46.83  ? 146 LEU C CG    1 
ATOM   5804 C CD1   . LEU E 3 146 ? 57.732  81.671  51.280  1.00 47.21  ? 146 LEU C CD1   1 
ATOM   5805 C CD2   . LEU E 3 146 ? 57.773  79.474  52.374  1.00 47.10  ? 146 LEU C CD2   1 
ATOM   5806 N N     . PHE E 3 147 ? 56.986  84.184  54.190  1.00 47.05  ? 147 PHE C N     1 
ATOM   5807 C CA    . PHE E 3 147 ? 55.934  84.724  55.036  1.00 45.90  ? 147 PHE C CA    1 
ATOM   5808 C C     . PHE E 3 147 ? 54.595  84.034  54.808  1.00 45.90  ? 147 PHE C C     1 
ATOM   5809 O O     . PHE E 3 147 ? 54.273  83.644  53.683  1.00 45.45  ? 147 PHE C O     1 
ATOM   5810 C CB    . PHE E 3 147 ? 55.813  86.234  54.816  1.00 45.17  ? 147 PHE C CB    1 
ATOM   5811 C CG    . PHE E 3 147 ? 57.028  87.006  55.259  1.00 43.90  ? 147 PHE C CG    1 
ATOM   5812 C CD1   . PHE E 3 147 ? 58.197  86.967  54.520  1.00 43.50  ? 147 PHE C CD1   1 
ATOM   5813 C CD2   . PHE E 3 147 ? 57.014  87.727  56.444  1.00 43.13  ? 147 PHE C CD2   1 
ATOM   5814 C CE1   . PHE E 3 147 ? 59.324  87.625  54.954  1.00 42.81  ? 147 PHE C CE1   1 
ATOM   5815 C CE2   . PHE E 3 147 ? 58.143  88.389  56.886  1.00 42.52  ? 147 PHE C CE2   1 
ATOM   5816 C CZ    . PHE E 3 147 ? 59.299  88.336  56.140  1.00 42.68  ? 147 PHE C CZ    1 
ATOM   5817 N N     . LEU E 3 148 ? 53.825  83.877  55.889  1.00 45.79  ? 148 LEU C N     1 
ATOM   5818 C CA    . LEU E 3 148 ? 52.520  83.216  55.833  1.00 44.87  ? 148 LEU C CA    1 
ATOM   5819 C C     . LEU E 3 148 ? 51.375  84.097  56.274  1.00 44.08  ? 148 LEU C C     1 
ATOM   5820 O O     . LEU E 3 148 ? 50.225  83.728  56.062  1.00 44.25  ? 148 LEU C O     1 
ATOM   5821 C CB    . LEU E 3 148 ? 52.494  81.957  56.700  1.00 44.31  ? 148 LEU C CB    1 
ATOM   5822 C CG    . LEU E 3 148 ? 53.470  80.840  56.375  1.00 44.34  ? 148 LEU C CG    1 
ATOM   5823 C CD1   . LEU E 3 148 ? 53.098  79.646  57.224  1.00 43.79  ? 148 LEU C CD1   1 
ATOM   5824 C CD2   . LEU E 3 148 ? 53.425  80.504  54.879  1.00 44.65  ? 148 LEU C CD2   1 
ATOM   5825 N N     . ASP E 3 149 ? 51.681  85.231  56.911  1.00 42.95  ? 149 ASP C N     1 
ATOM   5826 C CA    . ASP E 3 149 ? 50.640  86.161  57.361  1.00 42.24  ? 149 ASP C CA    1 
ATOM   5827 C C     . ASP E 3 149 ? 50.965  87.572  56.920  1.00 40.45  ? 149 ASP C C     1 
ATOM   5828 O O     . ASP E 3 149 ? 51.239  88.446  57.737  1.00 40.36  ? 149 ASP C O     1 
ATOM   5829 C CB    . ASP E 3 149 ? 50.467  86.138  58.894  1.00 44.70  ? 149 ASP C CB    1 
ATOM   5830 C CG    . ASP E 3 149 ? 49.114  86.736  59.364  1.00 45.36  ? 149 ASP C CG    1 
ATOM   5831 O OD1   . ASP E 3 149 ? 48.230  86.974  58.509  1.00 45.73  ? 149 ASP C OD1   1 
ATOM   5832 O OD2   . ASP E 3 149 ? 48.933  86.949  60.591  1.00 44.69  ? 149 ASP C OD2   1 
ATOM   5833 N N     . VAL E 3 150 ? 50.954  87.776  55.612  1.00 39.01  ? 150 VAL C N     1 
ATOM   5834 C CA    . VAL E 3 150 ? 51.200  89.085  55.024  1.00 38.00  ? 150 VAL C CA    1 
ATOM   5835 C C     . VAL E 3 150 ? 50.192  89.180  53.898  1.00 37.86  ? 150 VAL C C     1 
ATOM   5836 O O     . VAL E 3 150 ? 49.445  88.234  53.650  1.00 37.78  ? 150 VAL C O     1 
ATOM   5837 C CB    . VAL E 3 150 ? 52.639  89.230  54.442  1.00 36.25  ? 150 VAL C CB    1 
ATOM   5838 C CG1   . VAL E 3 150 ? 53.655  89.128  55.548  1.00 35.66  ? 150 VAL C CG1   1 
ATOM   5839 C CG2   . VAL E 3 150 ? 52.900  88.176  53.396  1.00 34.92  ? 150 VAL C CG2   1 
ATOM   5840 N N     . SER E 3 151 ? 50.145  90.322  53.230  1.00 37.84  ? 151 SER C N     1 
ATOM   5841 C CA    . SER E 3 151 ? 49.221  90.479  52.130  1.00 37.68  ? 151 SER C CA    1 
ATOM   5842 C C     . SER E 3 151 ? 49.863  90.017  50.837  1.00 37.56  ? 151 SER C C     1 
ATOM   5843 O O     . SER E 3 151 ? 51.087  89.992  50.710  1.00 36.73  ? 151 SER C O     1 
ATOM   5844 C CB    . SER E 3 151 ? 48.818  91.924  51.976  1.00 38.09  ? 151 SER C CB    1 
ATOM   5845 O OG    . SER E 3 151 ? 48.329  92.110  50.663  1.00 39.75  ? 151 SER C OG    1 
ATOM   5846 N N     . ASP E 3 152 ? 49.032  89.663  49.866  1.00 37.89  ? 152 ASP C N     1 
ATOM   5847 C CA    . ASP E 3 152 ? 49.546  89.197  48.593  1.00 38.80  ? 152 ASP C CA    1 
ATOM   5848 C C     . ASP E 3 152 ? 50.312  90.288  47.882  1.00 39.78  ? 152 ASP C C     1 
ATOM   5849 O O     . ASP E 3 152 ? 51.055  90.022  46.952  1.00 40.96  ? 152 ASP C O     1 
ATOM   5850 C CB    . ASP E 3 152 ? 48.414  88.696  47.692  1.00 38.30  ? 152 ASP C CB    1 
ATOM   5851 C CG    . ASP E 3 152 ? 47.239  89.647  47.637  1.00 37.80  ? 152 ASP C CG    1 
ATOM   5852 O OD1   . ASP E 3 152 ? 46.413  89.529  46.709  1.00 38.22  ? 152 ASP C OD1   1 
ATOM   5853 O OD2   . ASP E 3 152 ? 47.126  90.500  48.529  1.00 37.09  ? 152 ASP C OD2   1 
ATOM   5854 N N     . GLN E 3 153 ? 50.147  91.521  48.331  1.00 40.05  ? 153 GLN C N     1 
ATOM   5855 C CA    . GLN E 3 153 ? 50.826  92.638  47.694  1.00 40.82  ? 153 GLN C CA    1 
ATOM   5856 C C     . GLN E 3 153 ? 52.186  92.944  48.260  1.00 41.92  ? 153 GLN C C     1 
ATOM   5857 O O     . GLN E 3 153 ? 52.936  93.739  47.689  1.00 42.20  ? 153 GLN C O     1 
ATOM   5858 C CB    . GLN E 3 153 ? 49.977  93.885  47.795  1.00 40.69  ? 153 GLN C CB    1 
ATOM   5859 C CG    . GLN E 3 153 ? 48.762  93.826  46.941  1.00 41.19  ? 153 GLN C CG    1 
ATOM   5860 C CD    . GLN E 3 153 ? 47.751  94.837  47.370  1.00 41.16  ? 153 GLN C CD    1 
ATOM   5861 O OE1   . GLN E 3 153 ? 46.787  95.116  46.647  1.00 41.42  ? 153 GLN C OE1   1 
ATOM   5862 N NE2   . GLN E 3 153 ? 47.950  95.396  48.565  1.00 39.55  ? 153 GLN C NE2   1 
ATOM   5863 N N     . THR E 3 154 ? 52.512  92.334  49.386  1.00 42.39  ? 154 THR C N     1 
ATOM   5864 C CA    . THR E 3 154 ? 53.805  92.602  49.960  1.00 43.65  ? 154 THR C CA    1 
ATOM   5865 C C     . THR E 3 154 ? 54.862  92.000  49.069  1.00 44.08  ? 154 THR C C     1 
ATOM   5866 O O     . THR E 3 154 ? 54.789  90.836  48.677  1.00 44.29  ? 154 THR C O     1 
ATOM   5867 C CB    . THR E 3 154 ? 53.937  92.018  51.332  1.00 45.03  ? 154 THR C CB    1 
ATOM   5868 O OG1   . THR E 3 154 ? 52.743  92.290  52.074  1.00 46.45  ? 154 THR C OG1   1 
ATOM   5869 C CG2   . THR E 3 154 ? 55.130  92.645  52.032  1.00 45.37  ? 154 THR C CG2   1 
ATOM   5870 N N     . PRO E 3 155 ? 55.869  92.798  48.733  1.00 44.56  ? 155 PRO C N     1 
ATOM   5871 C CA    . PRO E 3 155 ? 56.966  92.372  47.874  1.00 45.10  ? 155 PRO C CA    1 
ATOM   5872 C C     . PRO E 3 155 ? 57.939  91.426  48.553  1.00 45.40  ? 155 PRO C C     1 
ATOM   5873 O O     . PRO E 3 155 ? 59.116  91.736  48.670  1.00 47.19  ? 155 PRO C O     1 
ATOM   5874 C CB    . PRO E 3 155 ? 57.610  93.693  47.489  1.00 44.99  ? 155 PRO C CB    1 
ATOM   5875 C CG    . PRO E 3 155 ? 57.451  94.497  48.755  1.00 44.99  ? 155 PRO C CG    1 
ATOM   5876 C CD    . PRO E 3 155 ? 56.027  94.203  49.145  1.00 44.43  ? 155 PRO C CD    1 
ATOM   5877 N N     . ILE E 3 156 ? 57.457  90.282  49.017  1.00 45.08  ? 156 ILE C N     1 
ATOM   5878 C CA    . ILE E 3 156 ? 58.344  89.316  49.650  1.00 45.30  ? 156 ILE C CA    1 
ATOM   5879 C C     . ILE E 3 156 ? 57.885  87.910  49.299  1.00 45.10  ? 156 ILE C C     1 
ATOM   5880 O O     . ILE E 3 156 ? 56.895  87.754  48.596  1.00 45.55  ? 156 ILE C O     1 
ATOM   5881 C CB    . ILE E 3 156 ? 58.412  89.504  51.200  1.00 45.36  ? 156 ILE C CB    1 
ATOM   5882 C CG1   . ILE E 3 156 ? 57.022  89.716  51.781  1.00 46.12  ? 156 ILE C CG1   1 
ATOM   5883 C CG2   . ILE E 3 156 ? 59.286  90.695  51.553  1.00 45.75  ? 156 ILE C CG2   1 
ATOM   5884 C CD1   . ILE E 3 156 ? 57.008  89.765  53.306  1.00 47.04  ? 156 ILE C CD1   1 
ATOM   5885 N N     . ASN E 3 157 ? 58.618  86.890  49.740  1.00 44.49  ? 157 ASN C N     1 
ATOM   5886 C CA    . ASN E 3 157 ? 58.216  85.524  49.450  1.00 44.16  ? 157 ASN C CA    1 
ATOM   5887 C C     . ASN E 3 157 ? 57.100  85.220  50.424  1.00 43.70  ? 157 ASN C C     1 
ATOM   5888 O O     . ASN E 3 157 ? 57.206  85.539  51.613  1.00 44.12  ? 157 ASN C O     1 
ATOM   5889 C CB    . ASN E 3 157 ? 59.378  84.571  49.661  1.00 45.63  ? 157 ASN C CB    1 
ATOM   5890 C CG    . ASN E 3 157 ? 60.520  84.866  48.747  1.00 46.34  ? 157 ASN C CG    1 
ATOM   5891 O OD1   . ASN E 3 157 ? 60.363  84.832  47.528  1.00 46.58  ? 157 ASN C OD1   1 
ATOM   5892 N ND2   . ASN E 3 157 ? 61.686  85.170  49.323  1.00 46.85  ? 157 ASN C ND2   1 
ATOM   5893 N N     . SER E 3 158 ? 56.032  84.599  49.934  1.00 41.86  ? 158 SER C N     1 
ATOM   5894 C CA    . SER E 3 158 ? 54.908  84.318  50.808  1.00 39.86  ? 158 SER C CA    1 
ATOM   5895 C C     . SER E 3 158 ? 53.920  83.319  50.258  1.00 39.38  ? 158 SER C C     1 
ATOM   5896 O O     . SER E 3 158 ? 53.742  83.212  49.052  1.00 38.66  ? 158 SER C O     1 
ATOM   5897 C CB    . SER E 3 158 ? 54.168  85.606  51.068  1.00 39.23  ? 158 SER C CB    1 
ATOM   5898 O OG    . SER E 3 158 ? 53.742  86.133  49.826  1.00 39.21  ? 158 SER C OG    1 
ATOM   5899 N N     . ILE E 3 159 ? 53.273  82.597  51.167  1.00 39.29  ? 159 ILE C N     1 
ATOM   5900 C CA    . ILE E 3 159 ? 52.262  81.629  50.796  1.00 38.98  ? 159 ILE C CA    1 
ATOM   5901 C C     . ILE E 3 159 ? 51.066  81.908  51.682  1.00 39.14  ? 159 ILE C C     1 
ATOM   5902 O O     . ILE E 3 159 ? 51.167  81.984  52.910  1.00 38.52  ? 159 ILE C O     1 
ATOM   5903 C CB    . ILE E 3 159 ? 52.701  80.173  51.013  1.00 39.32  ? 159 ILE C CB    1 
ATOM   5904 C CG1   . ILE E 3 159 ? 54.029  79.906  50.324  1.00 40.27  ? 159 ILE C CG1   1 
ATOM   5905 C CG2   . ILE E 3 159 ? 51.691  79.245  50.385  1.00 39.00  ? 159 ILE C CG2   1 
ATOM   5906 C CD1   . ILE E 3 159 ? 54.465  78.468  50.433  1.00 41.18  ? 159 ILE C CD1   1 
ATOM   5907 N N     . ILE E 3 160 ? 49.925  82.074  51.034  1.00 39.37  ? 160 ILE C N     1 
ATOM   5908 C CA    . ILE E 3 160 ? 48.682  82.362  51.725  1.00 39.84  ? 160 ILE C CA    1 
ATOM   5909 C C     . ILE E 3 160 ? 47.488  81.833  50.941  1.00 41.31  ? 160 ILE C C     1 
ATOM   5910 O O     . ILE E 3 160 ? 47.531  81.724  49.714  1.00 42.26  ? 160 ILE C O     1 
ATOM   5911 C CB    . ILE E 3 160 ? 48.500  83.849  51.864  1.00 39.13  ? 160 ILE C CB    1 
ATOM   5912 C CG1   . ILE E 3 160 ? 48.281  84.459  50.480  1.00 39.21  ? 160 ILE C CG1   1 
ATOM   5913 C CG2   . ILE E 3 160 ? 49.740  84.454  52.464  1.00 39.30  ? 160 ILE C CG2   1 
ATOM   5914 C CD1   . ILE E 3 160 ? 47.914  85.896  50.512  1.00 39.51  ? 160 ILE C CD1   1 
ATOM   5915 N N     . PHE E 3 161 ? 46.416  81.508  51.649  1.00 42.03  ? 161 PHE C N     1 
ATOM   5916 C CA    . PHE E 3 161 ? 45.227  81.015  50.979  1.00 43.00  ? 161 PHE C CA    1 
ATOM   5917 C C     . PHE E 3 161 ? 44.570  82.187  50.276  1.00 43.33  ? 161 PHE C C     1 
ATOM   5918 O O     . PHE E 3 161 ? 44.661  83.326  50.755  1.00 44.11  ? 161 PHE C O     1 
ATOM   5919 C CB    . PHE E 3 161 ? 44.259  80.417  51.983  1.00 44.26  ? 161 PHE C CB    1 
ATOM   5920 C CG    . PHE E 3 161 ? 44.703  79.096  52.531  1.00 45.63  ? 161 PHE C CG    1 
ATOM   5921 C CD1   . PHE E 3 161 ? 45.391  79.025  53.727  1.00 45.59  ? 161 PHE C CD1   1 
ATOM   5922 C CD2   . PHE E 3 161 ? 44.440  77.918  51.842  1.00 46.72  ? 161 PHE C CD2   1 
ATOM   5923 C CE1   . PHE E 3 161 ? 45.813  77.804  54.241  1.00 45.29  ? 161 PHE C CE1   1 
ATOM   5924 C CE2   . PHE E 3 161 ? 44.857  76.691  52.347  1.00 46.74  ? 161 PHE C CE2   1 
ATOM   5925 C CZ    . PHE E 3 161 ? 45.547  76.636  53.556  1.00 46.09  ? 161 PHE C CZ    1 
ATOM   5926 N N     . SER E 3 162 ? 43.900  81.907  49.157  1.00 42.86  ? 162 SER C N     1 
ATOM   5927 C CA    . SER E 3 162 ? 43.238  82.937  48.369  1.00 42.36  ? 162 SER C CA    1 
ATOM   5928 C C     . SER E 3 162 ? 41.968  83.523  48.958  1.00 42.01  ? 162 SER C C     1 
ATOM   5929 O O     . SER E 3 162 ? 40.864  83.046  48.702  1.00 40.84  ? 162 SER C O     1 
ATOM   5930 C CB    . SER E 3 162 ? 42.913  82.420  46.982  1.00 42.31  ? 162 SER C CB    1 
ATOM   5931 O OG    . SER E 3 162 ? 42.029  83.319  46.345  1.00 42.65  ? 162 SER C OG    1 
ATOM   5932 N N     . HIS E 3 163 ? 42.148  84.589  49.722  1.00 42.59  ? 163 HIS C N     1 
ATOM   5933 C CA    . HIS E 3 163 ? 41.054  85.288  50.349  1.00 42.49  ? 163 HIS C CA    1 
ATOM   5934 C C     . HIS E 3 163 ? 40.152  85.802  49.253  1.00 41.57  ? 163 HIS C C     1 
ATOM   5935 O O     . HIS E 3 163 ? 38.965  86.007  49.453  1.00 41.13  ? 163 HIS C O     1 
ATOM   5936 C CB    . HIS E 3 163 ? 41.612  86.435  51.181  1.00 43.99  ? 163 HIS C CB    1 
ATOM   5937 C CG    . HIS E 3 163 ? 42.522  87.340  50.419  1.00 44.61  ? 163 HIS C CG    1 
ATOM   5938 N ND1   . HIS E 3 163 ? 42.058  88.388  49.655  1.00 45.71  ? 163 HIS C ND1   1 
ATOM   5939 C CD2   . HIS E 3 163 ? 43.868  87.338  50.282  1.00 45.51  ? 163 HIS C CD2   1 
ATOM   5940 C CE1   . HIS E 3 163 ? 43.081  88.995  49.079  1.00 46.57  ? 163 HIS C CE1   1 
ATOM   5941 N NE2   . HIS E 3 163 ? 44.191  88.377  49.443  1.00 46.24  ? 163 HIS C NE2   1 
ATOM   5942 N N     . GLU E 3 164 ? 40.718  86.003  48.079  1.00 41.19  ? 164 GLU C N     1 
ATOM   5943 C CA    . GLU E 3 164 ? 39.907  86.472  46.986  1.00 42.33  ? 164 GLU C CA    1 
ATOM   5944 C C     . GLU E 3 164 ? 38.884  85.371  46.697  1.00 42.11  ? 164 GLU C C     1 
ATOM   5945 O O     . GLU E 3 164 ? 37.688  85.634  46.641  1.00 43.29  ? 164 GLU C O     1 
ATOM   5946 C CB    . GLU E 3 164 ? 40.767  86.751  45.748  1.00 44.59  ? 164 GLU C CB    1 
ATOM   5947 C CG    . GLU E 3 164 ? 40.200  87.819  44.805  1.00 47.66  ? 164 GLU C CG    1 
ATOM   5948 C CD    . GLU E 3 164 ? 40.675  89.229  45.145  1.00 49.37  ? 164 GLU C CD    1 
ATOM   5949 O OE1   . GLU E 3 164 ? 40.055  90.193  44.655  1.00 51.02  ? 164 GLU C OE1   1 
ATOM   5950 O OE2   . GLU E 3 164 ? 41.673  89.380  45.888  1.00 50.14  ? 164 GLU C OE2   1 
ATOM   5951 N N     . ASP E 3 165 ? 39.338  84.131  46.542  1.00 40.56  ? 165 ASP C N     1 
ATOM   5952 C CA    . ASP E 3 165 ? 38.417  83.032  46.250  1.00 38.68  ? 165 ASP C CA    1 
ATOM   5953 C C     . ASP E 3 165 ? 37.489  82.689  47.397  1.00 37.22  ? 165 ASP C C     1 
ATOM   5954 O O     . ASP E 3 165 ? 36.338  82.332  47.193  1.00 36.31  ? 165 ASP C O     1 
ATOM   5955 C CB    . ASP E 3 165 ? 39.183  81.770  45.870  1.00 39.69  ? 165 ASP C CB    1 
ATOM   5956 C CG    . ASP E 3 165 ? 39.759  81.835  44.486  1.00 40.35  ? 165 ASP C CG    1 
ATOM   5957 O OD1   . ASP E 3 165 ? 38.981  82.035  43.537  1.00 40.45  ? 165 ASP C OD1   1 
ATOM   5958 O OD2   . ASP E 3 165 ? 40.988  81.678  44.342  1.00 41.51  ? 165 ASP C OD2   1 
ATOM   5959 N N     . GLY E 3 166 ? 37.999  82.784  48.612  1.00 36.15  ? 166 GLY C N     1 
ATOM   5960 C CA    . GLY E 3 166 ? 37.182  82.451  49.754  1.00 35.48  ? 166 GLY C CA    1 
ATOM   5961 C C     . GLY E 3 166 ? 36.018  83.396  49.960  1.00 35.65  ? 166 GLY C C     1 
ATOM   5962 O O     . GLY E 3 166 ? 34.885  82.957  50.132  1.00 36.15  ? 166 GLY C O     1 
ATOM   5963 N N     . THR E 3 167 ? 36.288  84.697  49.949  1.00 35.07  ? 167 THR C N     1 
ATOM   5964 C CA    . THR E 3 167 ? 35.241  85.671  50.171  1.00 34.85  ? 167 THR C CA    1 
ATOM   5965 C C     . THR E 3 167 ? 34.234  85.656  49.051  1.00 36.04  ? 167 THR C C     1 
ATOM   5966 O O     . THR E 3 167 ? 33.054  85.870  49.289  1.00 36.91  ? 167 THR C O     1 
ATOM   5967 C CB    . THR E 3 167 ? 35.814  87.052  50.283  1.00 33.69  ? 167 THR C CB    1 
ATOM   5968 O OG1   . THR E 3 167 ? 36.724  87.248  49.207  1.00 32.64  ? 167 THR C OG1   1 
ATOM   5969 C CG2   . THR E 3 167 ? 36.541  87.223  51.589  1.00 33.17  ? 167 THR C CG2   1 
ATOM   5970 N N     . ARG E 3 168 ? 34.689  85.405  47.830  1.00 37.08  ? 168 ARG C N     1 
ATOM   5971 C CA    . ARG E 3 168 ? 33.784  85.365  46.685  1.00 38.94  ? 168 ARG C CA    1 
ATOM   5972 C C     . ARG E 3 168 ? 32.812  84.195  46.883  1.00 38.82  ? 168 ARG C C     1 
ATOM   5973 O O     . ARG E 3 168 ? 31.589  84.362  46.869  1.00 38.80  ? 168 ARG C O     1 
ATOM   5974 C CB    . ARG E 3 168 ? 34.586  85.176  45.390  1.00 41.70  ? 168 ARG C CB    1 
ATOM   5975 C CG    . ARG E 3 168 ? 33.818  85.453  44.096  1.00 46.31  ? 168 ARG C CG    1 
ATOM   5976 C CD    . ARG E 3 168 ? 34.537  84.861  42.892  1.00 49.44  ? 168 ARG C CD    1 
ATOM   5977 N NE    . ARG E 3 168 ? 34.541  83.405  42.981  1.00 54.81  ? 168 ARG C NE    1 
ATOM   5978 C CZ    . ARG E 3 168 ? 35.432  82.619  42.388  1.00 58.26  ? 168 ARG C CZ    1 
ATOM   5979 N NH1   . ARG E 3 168 ? 36.398  83.158  41.654  1.00 61.27  ? 168 ARG C NH1   1 
ATOM   5980 N NH2   . ARG E 3 168 ? 35.370  81.295  42.545  1.00 59.21  ? 168 ARG C NH2   1 
ATOM   5981 N N     . LEU E 3 169 ? 33.381  83.012  47.073  1.00 38.37  ? 169 LEU C N     1 
ATOM   5982 C CA    . LEU E 3 169 ? 32.626  81.784  47.290  1.00 38.08  ? 169 LEU C CA    1 
ATOM   5983 C C     . LEU E 3 169 ? 31.530  81.988  48.319  1.00 38.34  ? 169 LEU C C     1 
ATOM   5984 O O     . LEU E 3 169 ? 30.413  81.516  48.158  1.00 38.71  ? 169 LEU C O     1 
ATOM   5985 C CB    . LEU E 3 169 ? 33.568  80.703  47.792  1.00 37.40  ? 169 LEU C CB    1 
ATOM   5986 C CG    . LEU E 3 169 ? 33.851  79.512  46.893  1.00 37.50  ? 169 LEU C CG    1 
ATOM   5987 C CD1   . LEU E 3 169 ? 33.596  79.842  45.446  1.00 37.15  ? 169 LEU C CD1   1 
ATOM   5988 C CD2   . LEU E 3 169 ? 35.292  79.109  47.112  1.00 39.07  ? 169 LEU C CD2   1 
ATOM   5989 N N     . GLY E 3 170 ? 31.875  82.689  49.390  1.00 38.01  ? 170 GLY C N     1 
ATOM   5990 C CA    . GLY E 3 170 ? 30.927  82.944  50.449  1.00 37.44  ? 170 GLY C CA    1 
ATOM   5991 C C     . GLY E 3 170 ? 29.863  83.917  50.013  1.00 37.74  ? 170 GLY C C     1 
ATOM   5992 O O     . GLY E 3 170 ? 28.686  83.671  50.231  1.00 38.85  ? 170 GLY C O     1 
ATOM   5993 N N     . VAL E 3 171 ? 30.267  85.025  49.399  1.00 37.22  ? 171 VAL C N     1 
ATOM   5994 C CA    . VAL E 3 171 ? 29.306  86.024  48.956  1.00 36.84  ? 171 VAL C CA    1 
ATOM   5995 C C     . VAL E 3 171 ? 28.421  85.500  47.847  1.00 37.84  ? 171 VAL C C     1 
ATOM   5996 O O     . VAL E 3 171 ? 27.208  85.670  47.895  1.00 37.98  ? 171 VAL C O     1 
ATOM   5997 C CB    . VAL E 3 171 ? 29.984  87.301  48.462  1.00 35.63  ? 171 VAL C CB    1 
ATOM   5998 C CG1   . VAL E 3 171 ? 28.945  88.257  47.951  1.00 35.03  ? 171 VAL C CG1   1 
ATOM   5999 C CG2   . VAL E 3 171 ? 30.745  87.949  49.582  1.00 35.09  ? 171 VAL C CG2   1 
ATOM   6000 N N     . GLU E 3 172 ? 29.008  84.860  46.845  1.00 38.69  ? 172 GLU C N     1 
ATOM   6001 C CA    . GLU E 3 172 ? 28.196  84.342  45.758  1.00 40.48  ? 172 GLU C CA    1 
ATOM   6002 C C     . GLU E 3 172 ? 27.247  83.245  46.221  1.00 40.67  ? 172 GLU C C     1 
ATOM   6003 O O     . GLU E 3 172 ? 26.197  83.046  45.618  1.00 41.35  ? 172 GLU C O     1 
ATOM   6004 C CB    . GLU E 3 172 ? 29.072  83.838  44.618  1.00 42.77  ? 172 GLU C CB    1 
ATOM   6005 C CG    . GLU E 3 172 ? 29.675  84.957  43.767  1.00 46.90  ? 172 GLU C CG    1 
ATOM   6006 C CD    . GLU E 3 172 ? 30.569  84.434  42.648  1.00 49.69  ? 172 GLU C CD    1 
ATOM   6007 O OE1   . GLU E 3 172 ? 31.115  85.265  41.887  1.00 50.57  ? 172 GLU C OE1   1 
ATOM   6008 O OE2   . GLU E 3 172 ? 30.730  83.194  42.525  1.00 51.26  ? 172 GLU C OE2   1 
ATOM   6009 N N     . HIS E 3 173 ? 27.600  82.542  47.295  1.00 40.50  ? 173 HIS C N     1 
ATOM   6010 C CA    . HIS E 3 173 ? 26.731  81.482  47.824  1.00 40.43  ? 173 HIS C CA    1 
ATOM   6011 C C     . HIS E 3 173 ? 25.488  82.107  48.467  1.00 40.90  ? 173 HIS C C     1 
ATOM   6012 O O     . HIS E 3 173 ? 24.360  81.690  48.202  1.00 40.95  ? 173 HIS C O     1 
ATOM   6013 C CB    . HIS E 3 173 ? 27.471  80.633  48.867  1.00 39.77  ? 173 HIS C CB    1 
ATOM   6014 C CG    . HIS E 3 173 ? 26.632  79.551  49.480  1.00 38.70  ? 173 HIS C CG    1 
ATOM   6015 N ND1   . HIS E 3 173 ? 26.125  78.501  48.750  1.00 37.27  ? 173 HIS C ND1   1 
ATOM   6016 C CD2   . HIS E 3 173 ? 26.233  79.349  50.758  1.00 38.05  ? 173 HIS C CD2   1 
ATOM   6017 C CE1   . HIS E 3 173 ? 25.452  77.697  49.554  1.00 37.48  ? 173 HIS C CE1   1 
ATOM   6018 N NE2   . HIS E 3 173 ? 25.503  78.190  50.777  1.00 37.22  ? 173 HIS C NE2   1 
ATOM   6019 N N     . LEU E 3 174 ? 25.706  83.106  49.317  1.00 40.40  ? 174 LEU C N     1 
ATOM   6020 C CA    . LEU E 3 174 ? 24.618  83.792  49.991  1.00 39.87  ? 174 LEU C CA    1 
ATOM   6021 C C     . LEU E 3 174 ? 23.687  84.471  49.000  1.00 41.22  ? 174 LEU C C     1 
ATOM   6022 O O     . LEU E 3 174 ? 22.469  84.463  49.173  1.00 42.29  ? 174 LEU C O     1 
ATOM   6023 C CB    . LEU E 3 174 ? 25.179  84.829  50.950  1.00 38.13  ? 174 LEU C CB    1 
ATOM   6024 C CG    . LEU E 3 174 ? 25.827  84.225  52.174  1.00 37.19  ? 174 LEU C CG    1 
ATOM   6025 C CD1   . LEU E 3 174 ? 26.451  85.312  52.989  1.00 37.91  ? 174 LEU C CD1   1 
ATOM   6026 C CD2   . LEU E 3 174 ? 24.773  83.491  52.970  1.00 37.45  ? 174 LEU C CD2   1 
ATOM   6027 N N     . VAL E 3 175 ? 24.260  85.068  47.964  1.00 41.90  ? 175 VAL C N     1 
ATOM   6028 C CA    . VAL E 3 175 ? 23.463  85.754  46.962  1.00 42.73  ? 175 VAL C CA    1 
ATOM   6029 C C     . VAL E 3 175 ? 22.633  84.779  46.145  1.00 44.58  ? 175 VAL C C     1 
ATOM   6030 O O     . VAL E 3 175 ? 21.458  85.020  45.892  1.00 45.18  ? 175 VAL C O     1 
ATOM   6031 C CB    . VAL E 3 175 ? 24.348  86.575  46.028  1.00 41.56  ? 175 VAL C CB    1 
ATOM   6032 C CG1   . VAL E 3 175 ? 23.555  87.030  44.821  1.00 41.71  ? 175 VAL C CG1   1 
ATOM   6033 C CG2   . VAL E 3 175 ? 24.894  87.763  46.771  1.00 40.99  ? 175 VAL C CG2   1 
ATOM   6034 N N     . ALA E 3 176 ? 23.241  83.677  45.728  1.00 46.36  ? 176 ALA C N     1 
ATOM   6035 C CA    . ALA E 3 176 ? 22.519  82.679  44.949  1.00 48.74  ? 176 ALA C CA    1 
ATOM   6036 C C     . ALA E 3 176 ? 21.326  82.154  45.757  1.00 50.58  ? 176 ALA C C     1 
ATOM   6037 O O     . ALA E 3 176 ? 20.323  81.699  45.195  1.00 51.34  ? 176 ALA C O     1 
ATOM   6038 C CB    . ALA E 3 176 ? 23.452  81.539  44.571  1.00 48.29  ? 176 ALA C CB    1 
ATOM   6039 N N     . LEU E 3 177 ? 21.439  82.216  47.081  1.00 52.20  ? 177 LEU C N     1 
ATOM   6040 C CA    . LEU E 3 177 ? 20.361  81.770  47.955  1.00 53.24  ? 177 LEU C CA    1 
ATOM   6041 C C     . LEU E 3 177 ? 19.355  82.896  48.045  1.00 53.93  ? 177 LEU C C     1 
ATOM   6042 O O     . LEU E 3 177 ? 18.281  82.734  48.606  1.00 54.13  ? 177 LEU C O     1 
ATOM   6043 C CB    . LEU E 3 177 ? 20.898  81.426  49.347  1.00 53.24  ? 177 LEU C CB    1 
ATOM   6044 C CG    . LEU E 3 177 ? 21.018  79.947  49.707  1.00 52.52  ? 177 LEU C CG    1 
ATOM   6045 C CD1   . LEU E 3 177 ? 21.074  79.106  48.454  1.00 52.68  ? 177 LEU C CD1   1 
ATOM   6046 C CD2   . LEU E 3 177 ? 22.252  79.744  50.557  1.00 52.66  ? 177 LEU C CD2   1 
ATOM   6047 N N     . GLY E 3 178 ? 19.734  84.045  47.494  1.00 54.95  ? 178 GLY C N     1 
ATOM   6048 C CA    . GLY E 3 178 ? 18.861  85.202  47.474  1.00 56.84  ? 178 GLY C CA    1 
ATOM   6049 C C     . GLY E 3 178 ? 18.943  86.154  48.644  1.00 57.51  ? 178 GLY C C     1 
ATOM   6050 O O     . GLY E 3 178 ? 18.032  86.938  48.878  1.00 57.72  ? 178 GLY C O     1 
ATOM   6051 N N     . HIS E 3 179 ? 20.030  86.101  49.386  1.00 58.72  ? 179 HIS C N     1 
ATOM   6052 C CA    . HIS E 3 179 ? 20.175  86.981  50.523  1.00 60.85  ? 179 HIS C CA    1 
ATOM   6053 C C     . HIS E 3 179 ? 20.586  88.389  50.102  1.00 61.54  ? 179 HIS C C     1 
ATOM   6054 O O     . HIS E 3 179 ? 21.367  88.564  49.170  1.00 61.80  ? 179 HIS C O     1 
ATOM   6055 C CB    . HIS E 3 179 ? 21.200  86.387  51.481  1.00 62.46  ? 179 HIS C CB    1 
ATOM   6056 C CG    . HIS E 3 179 ? 20.732  85.137  52.164  1.00 63.89  ? 179 HIS C CG    1 
ATOM   6057 N ND1   . HIS E 3 179 ? 19.810  85.151  53.188  1.00 64.52  ? 179 HIS C ND1   1 
ATOM   6058 C CD2   . HIS E 3 179 ? 21.026  83.832  51.945  1.00 65.08  ? 179 HIS C CD2   1 
ATOM   6059 C CE1   . HIS E 3 179 ? 19.554  83.911  53.570  1.00 64.73  ? 179 HIS C CE1   1 
ATOM   6060 N NE2   . HIS E 3 179 ? 20.279  83.091  52.831  1.00 65.08  ? 179 HIS C NE2   1 
ATOM   6061 N N     . GLN E 3 180 ? 20.046  89.394  50.785  1.00 62.29  ? 180 GLN C N     1 
ATOM   6062 C CA    . GLN E 3 180 ? 20.369  90.791  50.481  1.00 62.87  ? 180 GLN C CA    1 
ATOM   6063 C C     . GLN E 3 180 ? 20.728  91.538  51.763  1.00 60.96  ? 180 GLN C C     1 
ATOM   6064 O O     . GLN E 3 180 ? 21.545  92.458  51.760  1.00 60.67  ? 180 GLN C O     1 
ATOM   6065 C CB    . GLN E 3 180 ? 19.184  91.481  49.781  1.00 66.25  ? 180 GLN C CB    1 
ATOM   6066 C CG    . GLN E 3 180 ? 18.816  90.877  48.414  1.00 70.34  ? 180 GLN C CG    1 
ATOM   6067 C CD    . GLN E 3 180 ? 17.716  91.642  47.670  1.00 72.45  ? 180 GLN C CD    1 
ATOM   6068 O OE1   . GLN E 3 180 ? 16.597  91.823  48.174  1.00 72.78  ? 180 GLN C OE1   1 
ATOM   6069 N NE2   . GLN E 3 180 ? 18.034  92.084  46.457  1.00 73.85  ? 180 GLN C NE2   1 
ATOM   6070 N N     . GLN E 3 181 ? 20.109  91.131  52.863  1.00 59.03  ? 181 GLN C N     1 
ATOM   6071 C CA    . GLN E 3 181 ? 20.375  91.743  54.157  1.00 56.90  ? 181 GLN C CA    1 
ATOM   6072 C C     . GLN E 3 181 ? 21.525  90.986  54.827  1.00 53.77  ? 181 GLN C C     1 
ATOM   6073 O O     . GLN E 3 181 ? 21.295  90.141  55.698  1.00 52.86  ? 181 GLN C O     1 
ATOM   6074 C CB    . GLN E 3 181 ? 19.123  91.652  55.029  1.00 59.61  ? 181 GLN C CB    1 
ATOM   6075 C CG    . GLN E 3 181 ? 17.894  92.358  54.464  1.00 62.28  ? 181 GLN C CG    1 
ATOM   6076 C CD    . GLN E 3 181 ? 18.016  93.872  54.525  1.00 64.35  ? 181 GLN C CD    1 
ATOM   6077 O OE1   . GLN E 3 181 ? 17.951  94.477  55.606  1.00 64.86  ? 181 GLN C OE1   1 
ATOM   6078 N NE2   . GLN E 3 181 ? 18.205  94.496  53.359  1.00 65.30  ? 181 GLN C NE2   1 
ATOM   6079 N N     . ILE E 3 182 ? 22.760  91.284  54.427  1.00 49.60  ? 182 ILE C N     1 
ATOM   6080 C CA    . ILE E 3 182 ? 23.911  90.589  54.992  1.00 44.78  ? 182 ILE C CA    1 
ATOM   6081 C C     . ILE E 3 182 ? 24.695  91.449  55.968  1.00 42.89  ? 182 ILE C C     1 
ATOM   6082 O O     . ILE E 3 182 ? 24.820  92.658  55.778  1.00 42.82  ? 182 ILE C O     1 
ATOM   6083 C CB    . ILE E 3 182 ? 24.846  90.100  53.878  1.00 43.18  ? 182 ILE C CB    1 
ATOM   6084 C CG1   . ILE E 3 182 ? 24.076  89.173  52.938  1.00 42.10  ? 182 ILE C CG1   1 
ATOM   6085 C CG2   . ILE E 3 182 ? 26.012  89.369  54.472  1.00 42.14  ? 182 ILE C CG2   1 
ATOM   6086 C CD1   . ILE E 3 182 ? 24.803  88.818  51.678  1.00 40.86  ? 182 ILE C CD1   1 
ATOM   6087 N N     . ALA E 3 183 ? 25.198  90.809  57.023  1.00 40.39  ? 183 ALA C N     1 
ATOM   6088 C CA    . ALA E 3 183 ? 25.984  91.471  58.066  1.00 37.91  ? 183 ALA C CA    1 
ATOM   6089 C C     . ALA E 3 183 ? 27.375  90.874  58.030  1.00 35.91  ? 183 ALA C C     1 
ATOM   6090 O O     . ALA E 3 183 ? 27.551  89.770  57.554  1.00 36.52  ? 183 ALA C O     1 
ATOM   6091 C CB    . ALA E 3 183 ? 25.355  91.232  59.430  1.00 37.52  ? 183 ALA C CB    1 
ATOM   6092 N N     . LEU E 3 184 ? 28.367  91.581  58.538  1.00 33.33  ? 184 LEU C N     1 
ATOM   6093 C CA    . LEU E 3 184 ? 29.706  91.041  58.493  1.00 31.96  ? 184 LEU C CA    1 
ATOM   6094 C C     . LEU E 3 184 ? 30.349  91.018  59.853  1.00 32.08  ? 184 LEU C C     1 
ATOM   6095 O O     . LEU E 3 184 ? 30.275  91.984  60.584  1.00 33.41  ? 184 LEU C O     1 
ATOM   6096 C CB    . LEU E 3 184 ? 30.564  91.870  57.549  1.00 31.85  ? 184 LEU C CB    1 
ATOM   6097 C CG    . LEU E 3 184 ? 30.101  92.050  56.104  1.00 32.57  ? 184 LEU C CG    1 
ATOM   6098 C CD1   . LEU E 3 184 ? 31.079  92.954  55.373  1.00 32.85  ? 184 LEU C CD1   1 
ATOM   6099 C CD2   . LEU E 3 184 ? 30.007  90.704  55.414  1.00 32.69  ? 184 LEU C CD2   1 
ATOM   6100 N N     . LEU E 3 185 ? 30.988  89.910  60.192  1.00 31.83  ? 185 LEU C N     1 
ATOM   6101 C CA    . LEU E 3 185 ? 31.674  89.775  61.470  1.00 32.42  ? 185 LEU C CA    1 
ATOM   6102 C C     . LEU E 3 185 ? 33.115  89.448  61.128  1.00 32.97  ? 185 LEU C C     1 
ATOM   6103 O O     . LEU E 3 185 ? 33.445  88.298  60.857  1.00 33.50  ? 185 LEU C O     1 
ATOM   6104 C CB    . LEU E 3 185 ? 31.045  88.644  62.285  1.00 32.32  ? 185 LEU C CB    1 
ATOM   6105 C CG    . LEU E 3 185 ? 31.578  88.371  63.690  1.00 32.69  ? 185 LEU C CG    1 
ATOM   6106 C CD1   . LEU E 3 185 ? 31.744  89.661  64.456  1.00 33.12  ? 185 LEU C CD1   1 
ATOM   6107 C CD2   . LEU E 3 185 ? 30.616  87.454  64.411  1.00 32.87  ? 185 LEU C CD2   1 
ATOM   6108 N N     . ALA E 3 186 ? 33.978  90.457  61.131  1.00 33.32  ? 186 ALA C N     1 
ATOM   6109 C CA    . ALA E 3 186 ? 35.368  90.228  60.766  1.00 34.20  ? 186 ALA C CA    1 
ATOM   6110 C C     . ALA E 3 186 ? 36.288  90.014  61.930  1.00 35.22  ? 186 ALA C C     1 
ATOM   6111 O O     . ALA E 3 186 ? 36.016  90.472  63.034  1.00 35.99  ? 186 ALA C O     1 
ATOM   6112 C CB    . ALA E 3 186 ? 35.874  91.368  59.946  1.00 34.20  ? 186 ALA C CB    1 
ATOM   6113 N N     . GLY E 3 187 ? 37.391  89.322  61.664  1.00 35.66  ? 187 GLY C N     1 
ATOM   6114 C CA    . GLY E 3 187 ? 38.366  89.057  62.700  1.00 37.36  ? 187 GLY C CA    1 
ATOM   6115 C C     . GLY E 3 187 ? 38.964  90.360  63.178  1.00 38.40  ? 187 GLY C C     1 
ATOM   6116 O O     . GLY E 3 187 ? 38.585  91.420  62.690  1.00 38.86  ? 187 GLY C O     1 
ATOM   6117 N N     . PRO E 3 188 ? 39.897  90.324  64.131  1.00 38.74  ? 188 PRO C N     1 
ATOM   6118 C CA    . PRO E 3 188 ? 40.517  91.551  64.637  1.00 39.68  ? 188 PRO C CA    1 
ATOM   6119 C C     . PRO E 3 188 ? 41.321  92.254  63.551  1.00 40.36  ? 188 PRO C C     1 
ATOM   6120 O O     . PRO E 3 188 ? 42.133  91.636  62.861  1.00 40.29  ? 188 PRO C O     1 
ATOM   6121 C CB    . PRO E 3 188 ? 41.396  91.046  65.759  1.00 40.01  ? 188 PRO C CB    1 
ATOM   6122 C CG    . PRO E 3 188 ? 41.827  89.713  65.233  1.00 40.22  ? 188 PRO C CG    1 
ATOM   6123 C CD    . PRO E 3 188 ? 40.546  89.136  64.699  1.00 38.91  ? 188 PRO C CD    1 
ATOM   6124 N N     . LEU E 3 189 ? 41.084  93.553  63.413  1.00 40.68  ? 189 LEU C N     1 
ATOM   6125 C CA    . LEU E 3 189 ? 41.750  94.359  62.406  1.00 40.87  ? 189 LEU C CA    1 
ATOM   6126 C C     . LEU E 3 189 ? 43.259  94.432  62.562  1.00 40.56  ? 189 LEU C C     1 
ATOM   6127 O O     . LEU E 3 189 ? 43.949  94.968  61.693  1.00 41.33  ? 189 LEU C O     1 
ATOM   6128 C CB    . LEU E 3 189 ? 41.164  95.766  62.411  1.00 41.30  ? 189 LEU C CB    1 
ATOM   6129 C CG    . LEU E 3 189 ? 40.069  96.077  61.397  1.00 41.62  ? 189 LEU C CG    1 
ATOM   6130 C CD1   . LEU E 3 189 ? 39.304  94.830  60.976  1.00 40.92  ? 189 LEU C CD1   1 
ATOM   6131 C CD2   . LEU E 3 189 ? 39.159  97.104  62.031  1.00 42.84  ? 189 LEU C CD2   1 
ATOM   6132 N N     . SER E 3 190 ? 43.779  93.908  63.664  1.00 39.58  ? 190 SER C N     1 
ATOM   6133 C CA    . SER E 3 190 ? 45.213  93.941  63.859  1.00 39.36  ? 190 SER C CA    1 
ATOM   6134 C C     . SER E 3 190 ? 45.801  92.790  63.072  1.00 38.77  ? 190 SER C C     1 
ATOM   6135 O O     . SER E 3 190 ? 47.009  92.685  62.918  1.00 38.46  ? 190 SER C O     1 
ATOM   6136 C CB    . SER E 3 190 ? 45.552  93.793  65.333  1.00 40.11  ? 190 SER C CB    1 
ATOM   6137 O OG    . SER E 3 190 ? 45.023  92.586  65.836  1.00 40.58  ? 190 SER C OG    1 
ATOM   6138 N N     . SER E 3 191 ? 44.933  91.928  62.561  1.00 38.62  ? 191 SER C N     1 
ATOM   6139 C CA    . SER E 3 191 ? 45.393  90.787  61.786  1.00 38.89  ? 191 SER C CA    1 
ATOM   6140 C C     . SER E 3 191 ? 45.235  90.947  60.292  1.00 38.58  ? 191 SER C C     1 
ATOM   6141 O O     . SER E 3 191 ? 44.122  91.042  59.780  1.00 38.90  ? 191 SER C O     1 
ATOM   6142 C CB    . SER E 3 191 ? 44.664  89.513  62.200  1.00 39.92  ? 191 SER C CB    1 
ATOM   6143 O OG    . SER E 3 191 ? 44.955  88.457  61.292  1.00 40.04  ? 191 SER C OG    1 
ATOM   6144 N N     . VAL E 3 192 ? 46.365  90.956  59.598  1.00 37.93  ? 192 VAL C N     1 
ATOM   6145 C CA    . VAL E 3 192 ? 46.393  91.073  58.147  1.00 37.52  ? 192 VAL C CA    1 
ATOM   6146 C C     . VAL E 3 192 ? 45.314  90.214  57.498  1.00 37.14  ? 192 VAL C C     1 
ATOM   6147 O O     . VAL E 3 192 ? 44.489  90.702  56.717  1.00 36.18  ? 192 VAL C O     1 
ATOM   6148 C CB    . VAL E 3 192 ? 47.757  90.614  57.598  1.00 38.06  ? 192 VAL C CB    1 
ATOM   6149 C CG1   . VAL E 3 192 ? 47.723  90.552  56.076  1.00 37.76  ? 192 VAL C CG1   1 
ATOM   6150 C CG2   . VAL E 3 192 ? 48.852  91.549  58.087  1.00 38.41  ? 192 VAL C CG2   1 
ATOM   6151 N N     . SER E 3 193 ? 45.321  88.929  57.834  1.00 37.10  ? 193 SER C N     1 
ATOM   6152 C CA    . SER E 3 193 ? 44.358  88.000  57.263  1.00 36.96  ? 193 SER C CA    1 
ATOM   6153 C C     . SER E 3 193 ? 42.901  88.332  57.577  1.00 35.66  ? 193 SER C C     1 
ATOM   6154 O O     . SER E 3 193 ? 41.995  87.997  56.817  1.00 34.57  ? 193 SER C O     1 
ATOM   6155 C CB    . SER E 3 193 ? 44.676  86.577  57.703  1.00 37.59  ? 193 SER C CB    1 
ATOM   6156 O OG    . SER E 3 193 ? 43.959  85.658  56.900  1.00 39.44  ? 193 SER C OG    1 
ATOM   6157 N N     . ALA E 3 194 ? 42.662  88.989  58.696  1.00 35.55  ? 194 ALA C N     1 
ATOM   6158 C CA    . ALA E 3 194 ? 41.296  89.354  59.019  1.00 35.39  ? 194 ALA C CA    1 
ATOM   6159 C C     . ALA E 3 194 ? 40.883  90.402  57.998  1.00 34.39  ? 194 ALA C C     1 
ATOM   6160 O O     . ALA E 3 194 ? 39.827  90.303  57.375  1.00 34.42  ? 194 ALA C O     1 
ATOM   6161 C CB    . ALA E 3 194 ? 41.215  89.928  60.430  1.00 35.81  ? 194 ALA C CB    1 
ATOM   6162 N N     . ARG E 3 195 ? 41.756  91.390  57.821  1.00 33.05  ? 195 ARG C N     1 
ATOM   6163 C CA    . ARG E 3 195 ? 41.529  92.498  56.902  1.00 31.15  ? 195 ARG C CA    1 
ATOM   6164 C C     . ARG E 3 195 ? 41.307  92.039  55.480  1.00 30.05  ? 195 ARG C C     1 
ATOM   6165 O O     . ARG E 3 195 ? 40.341  92.466  54.839  1.00 29.98  ? 195 ARG C O     1 
ATOM   6166 C CB    . ARG E 3 195 ? 42.704  93.488  56.941  1.00 29.67  ? 195 ARG C CB    1 
ATOM   6167 C CG    . ARG E 3 195 ? 42.964  94.105  58.314  1.00 28.47  ? 195 ARG C CG    1 
ATOM   6168 C CD    . ARG E 3 195 ? 43.809  95.362  58.222  1.00 26.47  ? 195 ARG C CD    1 
ATOM   6169 N NE    . ARG E 3 195 ? 45.149  95.125  57.702  1.00 24.98  ? 195 ARG C NE    1 
ATOM   6170 C CZ    . ARG E 3 195 ? 46.225  94.914  58.454  1.00 24.55  ? 195 ARG C CZ    1 
ATOM   6171 N NH1   . ARG E 3 195 ? 46.135  94.902  59.771  1.00 24.13  ? 195 ARG C NH1   1 
ATOM   6172 N NH2   . ARG E 3 195 ? 47.407  94.745  57.885  1.00 24.31  ? 195 ARG C NH2   1 
ATOM   6173 N N     . LEU E 3 196 ? 42.196  91.176  54.989  1.00 28.98  ? 196 LEU C N     1 
ATOM   6174 C CA    . LEU E 3 196 ? 42.079  90.673  53.632  1.00 29.21  ? 196 LEU C CA    1 
ATOM   6175 C C     . LEU E 3 196 ? 40.693  90.112  53.406  1.00 30.11  ? 196 LEU C C     1 
ATOM   6176 O O     . LEU E 3 196 ? 40.054  90.395  52.391  1.00 30.76  ? 196 LEU C O     1 
ATOM   6177 C CB    . LEU E 3 196 ? 43.116  89.598  53.369  1.00 27.84  ? 196 LEU C CB    1 
ATOM   6178 C CG    . LEU E 3 196 ? 44.547  90.118  53.337  1.00 27.96  ? 196 LEU C CG    1 
ATOM   6179 C CD1   . LEU E 3 196 ? 45.521  88.992  53.148  1.00 29.47  ? 196 LEU C CD1   1 
ATOM   6180 C CD2   . LEU E 3 196 ? 44.687  91.069  52.204  1.00 27.61  ? 196 LEU C CD2   1 
ATOM   6181 N N     . ARG E 3 197 ? 40.217  89.332  54.369  1.00 30.76  ? 197 ARG C N     1 
ATOM   6182 C CA    . ARG E 3 197 ? 38.892  88.740  54.264  1.00 31.45  ? 197 ARG C CA    1 
ATOM   6183 C C     . ARG E 3 197 ? 37.793  89.793  54.322  1.00 32.14  ? 197 ARG C C     1 
ATOM   6184 O O     . ARG E 3 197 ? 36.782  89.669  53.631  1.00 32.04  ? 197 ARG C O     1 
ATOM   6185 C CB    . ARG E 3 197 ? 38.700  87.710  55.363  1.00 31.26  ? 197 ARG C CB    1 
ATOM   6186 C CG    . ARG E 3 197 ? 39.673  86.562  55.256  1.00 31.16  ? 197 ARG C CG    1 
ATOM   6187 C CD    . ARG E 3 197 ? 39.549  85.633  56.421  1.00 30.64  ? 197 ARG C CD    1 
ATOM   6188 N NE    . ARG E 3 197 ? 40.628  84.661  56.452  1.00 30.75  ? 197 ARG C NE    1 
ATOM   6189 C CZ    . ARG E 3 197 ? 40.871  83.885  57.495  1.00 31.21  ? 197 ARG C CZ    1 
ATOM   6190 N NH1   . ARG E 3 197 ? 40.107  83.986  58.571  1.00 31.20  ? 197 ARG C NH1   1 
ATOM   6191 N NH2   . ARG E 3 197 ? 41.864  83.009  57.464  1.00 30.79  ? 197 ARG C NH2   1 
ATOM   6192 N N     . LEU E 3 198 ? 37.988  90.832  55.134  1.00 32.57  ? 198 LEU C N     1 
ATOM   6193 C CA    . LEU E 3 198 ? 36.995  91.898  55.227  1.00 33.66  ? 198 LEU C CA    1 
ATOM   6194 C C     . LEU E 3 198 ? 36.945  92.524  53.844  1.00 34.51  ? 198 LEU C C     1 
ATOM   6195 O O     . LEU E 3 198 ? 35.886  92.671  53.242  1.00 35.72  ? 198 LEU C O     1 
ATOM   6196 C CB    . LEU E 3 198 ? 37.406  92.966  56.247  1.00 33.15  ? 198 LEU C CB    1 
ATOM   6197 C CG    . LEU E 3 198 ? 36.271  93.727  56.958  1.00 32.88  ? 198 LEU C CG    1 
ATOM   6198 C CD1   . LEU E 3 198 ? 36.854  94.962  57.619  1.00 31.97  ? 198 LEU C CD1   1 
ATOM   6199 C CD2   . LEU E 3 198 ? 35.170  94.130  55.989  1.00 32.25  ? 198 LEU C CD2   1 
ATOM   6200 N N     . ALA E 3 199 ? 38.107  92.893  53.336  1.00 34.73  ? 199 ALA C N     1 
ATOM   6201 C CA    . ALA E 3 199 ? 38.159  93.486  52.020  1.00 35.32  ? 199 ALA C CA    1 
ATOM   6202 C C     . ALA E 3 199 ? 37.450  92.562  51.053  1.00 35.14  ? 199 ALA C C     1 
ATOM   6203 O O     . ALA E 3 199 ? 36.496  92.945  50.389  1.00 35.17  ? 199 ALA C O     1 
ATOM   6204 C CB    . ALA E 3 199 ? 39.593  93.684  51.598  1.00 36.38  ? 199 ALA C CB    1 
ATOM   6205 N N     . GLY E 3 200 ? 37.920  91.332  50.992  1.00 34.73  ? 200 GLY C N     1 
ATOM   6206 C CA    . GLY E 3 200 ? 37.308  90.378  50.102  1.00 37.33  ? 200 GLY C CA    1 
ATOM   6207 C C     . GLY E 3 200 ? 35.802  90.523  50.086  1.00 38.12  ? 200 GLY C C     1 
ATOM   6208 O O     . GLY E 3 200 ? 35.197  90.711  49.035  1.00 39.65  ? 200 GLY C O     1 
ATOM   6209 N N     . TRP E 3 201 ? 35.185  90.456  51.253  1.00 38.84  ? 201 TRP C N     1 
ATOM   6210 C CA    . TRP E 3 201 ? 33.739  90.571  51.310  1.00 39.86  ? 201 TRP C CA    1 
ATOM   6211 C C     . TRP E 3 201 ? 33.232  91.859  50.695  1.00 40.92  ? 201 TRP C C     1 
ATOM   6212 O O     . TRP E 3 201 ? 32.336  91.837  49.853  1.00 40.95  ? 201 TRP C O     1 
ATOM   6213 C CB    . TRP E 3 201 ? 33.249  90.489  52.745  1.00 39.91  ? 201 TRP C CB    1 
ATOM   6214 C CG    . TRP E 3 201 ? 33.452  89.174  53.374  1.00 39.46  ? 201 TRP C CG    1 
ATOM   6215 C CD1   . TRP E 3 201 ? 33.363  87.956  52.769  1.00 39.83  ? 201 TRP C CD1   1 
ATOM   6216 C CD2   . TRP E 3 201 ? 33.693  88.921  54.756  1.00 39.01  ? 201 TRP C CD2   1 
ATOM   6217 N NE1   . TRP E 3 201 ? 33.521  86.955  53.694  1.00 39.62  ? 201 TRP C NE1   1 
ATOM   6218 C CE2   . TRP E 3 201 ? 33.719  87.523  54.927  1.00 39.12  ? 201 TRP C CE2   1 
ATOM   6219 C CE3   . TRP E 3 201 ? 33.873  89.744  55.873  1.00 38.82  ? 201 TRP C CE3   1 
ATOM   6220 C CZ2   . TRP E 3 201 ? 33.936  86.923  56.166  1.00 39.63  ? 201 TRP C CZ2   1 
ATOM   6221 C CZ3   . TRP E 3 201 ? 34.090  89.151  57.100  1.00 39.46  ? 201 TRP C CZ3   1 
ATOM   6222 C CH2   . TRP E 3 201 ? 34.112  87.749  57.241  1.00 39.47  ? 201 TRP C CH2   1 
ATOM   6223 N N     . HIS E 3 202 ? 33.793  92.987  51.119  1.00 41.77  ? 202 HIS C N     1 
ATOM   6224 C CA    . HIS E 3 202 ? 33.357  94.263  50.579  1.00 41.97  ? 202 HIS C CA    1 
ATOM   6225 C C     . HIS E 3 202 ? 33.460  94.217  49.075  1.00 41.84  ? 202 HIS C C     1 
ATOM   6226 O O     . HIS E 3 202 ? 32.503  94.515  48.370  1.00 42.27  ? 202 HIS C O     1 
ATOM   6227 C CB    . HIS E 3 202 ? 34.195  95.408  51.145  1.00 42.06  ? 202 HIS C CB    1 
ATOM   6228 C CG    . HIS E 3 202 ? 33.680  95.929  52.448  1.00 42.94  ? 202 HIS C CG    1 
ATOM   6229 N ND1   . HIS E 3 202 ? 34.498  96.176  53.528  1.00 43.59  ? 202 HIS C ND1   1 
ATOM   6230 C CD2   . HIS E 3 202 ? 32.423  96.235  52.850  1.00 43.83  ? 202 HIS C CD2   1 
ATOM   6231 C CE1   . HIS E 3 202 ? 33.767  96.609  54.541  1.00 44.14  ? 202 HIS C CE1   1 
ATOM   6232 N NE2   . HIS E 3 202 ? 32.504  96.654  54.157  1.00 44.39  ? 202 HIS C NE2   1 
ATOM   6233 N N     . LYS E 3 203 ? 34.615  93.805  48.580  1.00 41.51  ? 203 LYS C N     1 
ATOM   6234 C CA    . LYS E 3 203 ? 34.807  93.735  47.150  1.00 41.65  ? 203 LYS C CA    1 
ATOM   6235 C C     . LYS E 3 203 ? 33.665  93.061  46.414  1.00 42.10  ? 203 LYS C C     1 
ATOM   6236 O O     . LYS E 3 203 ? 32.987  93.698  45.617  1.00 43.13  ? 203 LYS C O     1 
ATOM   6237 C CB    . LYS E 3 203 ? 36.101  93.013  46.804  1.00 42.06  ? 203 LYS C CB    1 
ATOM   6238 C CG    . LYS E 3 203 ? 36.221  92.790  45.318  1.00 43.19  ? 203 LYS C CG    1 
ATOM   6239 C CD    . LYS E 3 203 ? 37.552  92.216  44.921  1.00 44.78  ? 203 LYS C CD    1 
ATOM   6240 C CE    . LYS E 3 203 ? 37.520  91.860  43.448  1.00 46.44  ? 203 LYS C CE    1 
ATOM   6241 N NZ    . LYS E 3 203 ? 38.777  91.227  42.969  1.00 48.43  ? 203 LYS C NZ    1 
ATOM   6242 N N     . TYR E 3 204 ? 33.444  91.777  46.673  1.00 41.74  ? 204 TYR C N     1 
ATOM   6243 C CA    . TYR E 3 204 ? 32.390  91.063  45.973  1.00 41.47  ? 204 TYR C CA    1 
ATOM   6244 C C     . TYR E 3 204 ? 30.989  91.409  46.372  1.00 42.76  ? 204 TYR C C     1 
ATOM   6245 O O     . TYR E 3 204 ? 30.067  91.188  45.590  1.00 43.17  ? 204 TYR C O     1 
ATOM   6246 C CB    . TYR E 3 204 ? 32.589  89.570  46.087  1.00 39.98  ? 204 TYR C CB    1 
ATOM   6247 C CG    . TYR E 3 204 ? 33.853  89.163  45.437  1.00 38.89  ? 204 TYR C CG    1 
ATOM   6248 C CD1   . TYR E 3 204 ? 35.061  89.296  46.092  1.00 39.22  ? 204 TYR C CD1   1 
ATOM   6249 C CD2   . TYR E 3 204 ? 33.858  88.703  44.141  1.00 39.41  ? 204 TYR C CD2   1 
ATOM   6250 C CE1   . TYR E 3 204 ? 36.256  88.979  45.470  1.00 39.87  ? 204 TYR C CE1   1 
ATOM   6251 C CE2   . TYR E 3 204 ? 35.049  88.380  43.501  1.00 40.93  ? 204 TYR C CE2   1 
ATOM   6252 C CZ    . TYR E 3 204 ? 36.247  88.519  44.172  1.00 40.43  ? 204 TYR C CZ    1 
ATOM   6253 O OH    . TYR E 3 204 ? 37.429  88.187  43.549  1.00 40.87  ? 204 TYR C OH    1 
ATOM   6254 N N     . LEU E 3 205 ? 30.804  91.927  47.582  1.00 44.18  ? 205 LEU C N     1 
ATOM   6255 C CA    . LEU E 3 205 ? 29.461  92.318  47.985  1.00 46.56  ? 205 LEU C CA    1 
ATOM   6256 C C     . LEU E 3 205 ? 29.088  93.484  47.072  1.00 49.08  ? 205 LEU C C     1 
ATOM   6257 O O     . LEU E 3 205 ? 27.949  93.586  46.592  1.00 51.13  ? 205 LEU C O     1 
ATOM   6258 C CB    . LEU E 3 205 ? 29.416  92.753  49.451  1.00 44.34  ? 205 LEU C CB    1 
ATOM   6259 C CG    . LEU E 3 205 ? 29.189  91.615  50.440  1.00 43.10  ? 205 LEU C CG    1 
ATOM   6260 C CD1   . LEU E 3 205 ? 29.041  92.187  51.828  1.00 42.36  ? 205 LEU C CD1   1 
ATOM   6261 C CD2   . LEU E 3 205 ? 27.945  90.837  50.056  1.00 41.96  ? 205 LEU C CD2   1 
ATOM   6262 N N     . THR E 3 206 ? 30.069  94.345  46.813  1.00 50.01  ? 206 THR C N     1 
ATOM   6263 C CA    . THR E 3 206 ? 29.870  95.495  45.954  1.00 50.45  ? 206 THR C CA    1 
ATOM   6264 C C     . THR E 3 206 ? 29.484  95.075  44.536  1.00 52.01  ? 206 THR C C     1 
ATOM   6265 O O     . THR E 3 206 ? 28.508  95.573  43.990  1.00 51.89  ? 206 THR C O     1 
ATOM   6266 C CB    . THR E 3 206 ? 31.129  96.359  45.944  1.00 49.42  ? 206 THR C CB    1 
ATOM   6267 O OG1   . THR E 3 206 ? 31.153  97.161  47.131  1.00 48.00  ? 206 THR C OG1   1 
ATOM   6268 C CG2   . THR E 3 206 ? 31.168  97.245  44.730  1.00 49.09  ? 206 THR C CG2   1 
ATOM   6269 N N     . ARG E 3 207 ? 30.225  94.143  43.947  1.00 54.52  ? 207 ARG C N     1 
ATOM   6270 C CA    . ARG E 3 207 ? 29.913  93.689  42.592  1.00 57.72  ? 207 ARG C CA    1 
ATOM   6271 C C     . ARG E 3 207 ? 28.504  93.128  42.425  1.00 57.77  ? 207 ARG C C     1 
ATOM   6272 O O     . ARG E 3 207 ? 28.060  92.894  41.301  1.00 58.05  ? 207 ARG C O     1 
ATOM   6273 C CB    . ARG E 3 207 ? 30.922  92.637  42.112  1.00 61.00  ? 207 ARG C CB    1 
ATOM   6274 C CG    . ARG E 3 207 ? 32.280  93.188  41.681  1.00 66.24  ? 207 ARG C CG    1 
ATOM   6275 C CD    . ARG E 3 207 ? 33.093  92.122  40.944  1.00 70.67  ? 207 ARG C CD    1 
ATOM   6276 N NE    . ARG E 3 207 ? 34.473  92.540  40.703  1.00 74.35  ? 207 ARG C NE    1 
ATOM   6277 C CZ    . ARG E 3 207 ? 35.411  91.762  40.158  1.00 76.60  ? 207 ARG C CZ    1 
ATOM   6278 N NH1   . ARG E 3 207 ? 35.130  90.509  39.786  1.00 77.13  ? 207 ARG C NH1   1 
ATOM   6279 N NH2   . ARG E 3 207 ? 36.639  92.237  39.989  1.00 77.70  ? 207 ARG C NH2   1 
ATOM   6280 N N     . ASN E 3 208 ? 27.804  92.893  43.528  1.00 58.11  ? 208 ASN C N     1 
ATOM   6281 C CA    . ASN E 3 208 ? 26.446  92.376  43.434  1.00 58.70  ? 208 ASN C CA    1 
ATOM   6282 C C     . ASN E 3 208 ? 25.479  93.421  43.938  1.00 59.47  ? 208 ASN C C     1 
ATOM   6283 O O     . ASN E 3 208 ? 24.318  93.141  44.208  1.00 58.67  ? 208 ASN C O     1 
ATOM   6284 C CB    . ASN E 3 208 ? 26.296  91.077  44.223  1.00 58.48  ? 208 ASN C CB    1 
ATOM   6285 C CG    . ASN E 3 208 ? 26.918  89.886  43.507  1.00 58.39  ? 208 ASN C CG    1 
ATOM   6286 O OD1   . ASN E 3 208 ? 28.137  89.729  43.479  1.00 58.28  ? 208 ASN C OD1   1 
ATOM   6287 N ND2   . ASN E 3 208 ? 26.076  89.048  42.910  1.00 58.17  ? 208 ASN C ND2   1 
ATOM   6288 N N     . GLN E 3 209 ? 25.994  94.640  44.038  1.00 61.40  ? 209 GLN C N     1 
ATOM   6289 C CA    . GLN E 3 209 ? 25.238  95.800  44.485  1.00 63.77  ? 209 GLN C CA    1 
ATOM   6290 C C     . GLN E 3 209 ? 24.569  95.573  45.834  1.00 63.46  ? 209 GLN C C     1 
ATOM   6291 O O     . GLN E 3 209 ? 23.373  95.798  45.998  1.00 64.17  ? 209 GLN C O     1 
ATOM   6292 C CB    . GLN E 3 209 ? 24.189  96.184  43.433  1.00 66.35  ? 209 GLN C CB    1 
ATOM   6293 C CG    . GLN E 3 209 ? 24.750  96.394  42.028  1.00 70.00  ? 209 GLN C CG    1 
ATOM   6294 C CD    . GLN E 3 209 ? 24.024  95.546  40.985  1.00 72.86  ? 209 GLN C CD    1 
ATOM   6295 O OE1   . GLN E 3 209 ? 22.858  95.805  40.653  1.00 74.11  ? 209 GLN C OE1   1 
ATOM   6296 N NE2   . GLN E 3 209 ? 24.708  94.518  40.471  1.00 74.18  ? 209 GLN C NE2   1 
ATOM   6297 N N     . ILE E 3 210 ? 25.352  95.129  46.804  1.00 62.73  ? 210 ILE C N     1 
ATOM   6298 C CA    . ILE E 3 210 ? 24.835  94.890  48.133  1.00 62.43  ? 210 ILE C CA    1 
ATOM   6299 C C     . ILE E 3 210 ? 25.687  95.625  49.155  1.00 61.91  ? 210 ILE C C     1 
ATOM   6300 O O     . ILE E 3 210 ? 26.894  95.750  49.000  1.00 61.46  ? 210 ILE C O     1 
ATOM   6301 C CB    . ILE E 3 210 ? 24.853  93.397  48.472  1.00 62.68  ? 210 ILE C CB    1 
ATOM   6302 C CG1   . ILE E 3 210 ? 23.943  92.628  47.521  1.00 62.81  ? 210 ILE C CG1   1 
ATOM   6303 C CG2   . ILE E 3 210 ? 24.396  93.193  49.896  1.00 64.26  ? 210 ILE C CG2   1 
ATOM   6304 C CD1   . ILE E 3 210 ? 23.884  91.140  47.812  1.00 63.33  ? 210 ILE C CD1   1 
ATOM   6305 N N     . GLN E 3 211 ? 25.055  96.124  50.202  1.00 61.94  ? 211 GLN C N     1 
ATOM   6306 C CA    . GLN E 3 211 ? 25.790  96.818  51.239  1.00 62.19  ? 211 GLN C CA    1 
ATOM   6307 C C     . GLN E 3 211 ? 25.510  96.152  52.563  1.00 60.37  ? 211 GLN C C     1 
ATOM   6308 O O     . GLN E 3 211 ? 24.357  95.957  52.934  1.00 60.46  ? 211 GLN C O     1 
ATOM   6309 C CB    . GLN E 3 211 ? 25.373  98.282  51.325  1.00 65.44  ? 211 GLN C CB    1 
ATOM   6310 C CG    . GLN E 3 211 ? 25.766  99.122  50.123  1.00 70.16  ? 211 GLN C CG    1 
ATOM   6311 C CD    . GLN E 3 211 ? 25.300  100.568 50.264  1.00 72.71  ? 211 GLN C CD    1 
ATOM   6312 O OE1   . GLN E 3 211 ? 25.613  101.235 51.258  1.00 74.05  ? 211 GLN C OE1   1 
ATOM   6313 N NE2   . GLN E 3 211 ? 24.546  101.060 49.271  1.00 73.73  ? 211 GLN C NE2   1 
ATOM   6314 N N     . PRO E 3 212 ? 26.567  95.778  53.292  1.00 58.85  ? 212 PRO C N     1 
ATOM   6315 C CA    . PRO E 3 212 ? 26.355  95.135  54.585  1.00 57.32  ? 212 PRO C CA    1 
ATOM   6316 C C     . PRO E 3 212 ? 25.518  96.036  55.485  1.00 55.79  ? 212 PRO C C     1 
ATOM   6317 O O     . PRO E 3 212 ? 25.833  97.214  55.674  1.00 54.83  ? 212 PRO C O     1 
ATOM   6318 C CB    . PRO E 3 212 ? 27.781  94.929  55.104  1.00 58.13  ? 212 PRO C CB    1 
ATOM   6319 C CG    . PRO E 3 212 ? 28.561  96.023  54.440  1.00 57.94  ? 212 PRO C CG    1 
ATOM   6320 C CD    . PRO E 3 212 ? 28.002  95.988  53.042  1.00 58.78  ? 212 PRO C CD    1 
ATOM   6321 N N     . ILE E 3 213 ? 24.441  95.484  56.027  1.00 54.19  ? 213 ILE C N     1 
ATOM   6322 C CA    . ILE E 3 213 ? 23.582  96.261  56.887  1.00 52.93  ? 213 ILE C CA    1 
ATOM   6323 C C     . ILE E 3 213 ? 24.184  96.300  58.279  1.00 52.45  ? 213 ILE C C     1 
ATOM   6324 O O     . ILE E 3 213 ? 23.575  96.820  59.204  1.00 52.67  ? 213 ILE C O     1 
ATOM   6325 C CB    . ILE E 3 213 ? 22.183  95.663  56.945  1.00 52.85  ? 213 ILE C CB    1 
ATOM   6326 C CG1   . ILE E 3 213 ? 22.185  94.438  57.829  1.00 53.88  ? 213 ILE C CG1   1 
ATOM   6327 C CG2   . ILE E 3 213 ? 21.753  95.218  55.563  1.00 52.26  ? 213 ILE C CG2   1 
ATOM   6328 C CD1   . ILE E 3 213 ? 20.811  93.898  58.046  1.00 55.99  ? 213 ILE C CD1   1 
ATOM   6329 N N     . ALA E 3 214 ? 25.385  95.746  58.417  1.00 52.07  ? 214 ALA C N     1 
ATOM   6330 C CA    . ALA E 3 214 ? 26.096  95.720  59.695  1.00 52.23  ? 214 ALA C CA    1 
ATOM   6331 C C     . ALA E 3 214 ? 27.505  95.143  59.550  1.00 52.47  ? 214 ALA C C     1 
ATOM   6332 O O     . ALA E 3 214 ? 27.729  94.209  58.784  1.00 52.35  ? 214 ALA C O     1 
ATOM   6333 C CB    . ALA E 3 214 ? 25.313  94.920  60.703  1.00 52.62  ? 214 ALA C CB    1 
ATOM   6334 N N     . GLU E 3 215 ? 28.454  95.686  60.304  1.00 52.68  ? 215 GLU C N     1 
ATOM   6335 C CA    . GLU E 3 215 ? 29.837  95.229  60.218  1.00 53.58  ? 215 GLU C CA    1 
ATOM   6336 C C     . GLU E 3 215 ? 30.529  95.335  61.579  1.00 54.12  ? 215 GLU C C     1 
ATOM   6337 O O     . GLU E 3 215 ? 30.830  96.431  62.037  1.00 54.42  ? 215 GLU C O     1 
ATOM   6338 C CB    . GLU E 3 215 ? 30.545  96.077  59.160  1.00 54.77  ? 215 GLU C CB    1 
ATOM   6339 C CG    . GLU E 3 215 ? 32.038  95.889  58.994  1.00 57.15  ? 215 GLU C CG    1 
ATOM   6340 C CD    . GLU E 3 215 ? 32.607  96.762  57.863  1.00 58.80  ? 215 GLU C CD    1 
ATOM   6341 O OE1   . GLU E 3 215 ? 33.841  96.956  57.821  1.00 59.36  ? 215 GLU C OE1   1 
ATOM   6342 O OE2   . GLU E 3 215 ? 31.823  97.250  57.013  1.00 59.32  ? 215 GLU C OE2   1 
ATOM   6343 N N     . ARG E 3 216 ? 30.770  94.187  62.219  1.00 55.08  ? 216 ARG C N     1 
ATOM   6344 C CA    . ARG E 3 216 ? 31.403  94.115  63.547  1.00 55.15  ? 216 ARG C CA    1 
ATOM   6345 C C     . ARG E 3 216 ? 32.751  93.378  63.573  1.00 54.59  ? 216 ARG C C     1 
ATOM   6346 O O     . ARG E 3 216 ? 33.052  92.528  62.725  1.00 53.21  ? 216 ARG C O     1 
ATOM   6347 C CB    . ARG E 3 216 ? 30.471  93.427  64.539  1.00 56.43  ? 216 ARG C CB    1 
ATOM   6348 C CG    . ARG E 3 216 ? 29.018  93.544  64.194  1.00 59.51  ? 216 ARG C CG    1 
ATOM   6349 C CD    . ARG E 3 216 ? 28.479  94.906  64.550  1.00 62.92  ? 216 ARG C CD    1 
ATOM   6350 N NE    . ARG E 3 216 ? 28.374  95.076  65.996  1.00 65.66  ? 216 ARG C NE    1 
ATOM   6351 C CZ    . ARG E 3 216 ? 27.503  95.892  66.592  1.00 67.68  ? 216 ARG C CZ    1 
ATOM   6352 N NH1   . ARG E 3 216 ? 26.654  96.621  65.862  1.00 68.02  ? 216 ARG C NH1   1 
ATOM   6353 N NH2   . ARG E 3 216 ? 27.473  95.971  67.923  1.00 68.21  ? 216 ARG C NH2   1 
ATOM   6354 N N     . GLU E 3 217 ? 33.534  93.686  64.601  1.00 54.29  ? 217 GLU C N     1 
ATOM   6355 C CA    . GLU E 3 217 ? 34.868  93.125  64.773  1.00 54.14  ? 217 GLU C CA    1 
ATOM   6356 C C     . GLU E 3 217 ? 35.012  92.220  65.996  1.00 52.76  ? 217 GLU C C     1 
ATOM   6357 O O     . GLU E 3 217 ? 34.777  92.641  67.128  1.00 52.13  ? 217 GLU C O     1 
ATOM   6358 C CB    . GLU E 3 217 ? 35.878  94.278  64.879  1.00 56.39  ? 217 GLU C CB    1 
ATOM   6359 C CG    . GLU E 3 217 ? 37.356  93.883  64.855  1.00 58.80  ? 217 GLU C CG    1 
ATOM   6360 C CD    . GLU E 3 217 ? 38.277  95.031  65.275  1.00 59.92  ? 217 GLU C CD    1 
ATOM   6361 O OE1   . GLU E 3 217 ? 37.941  96.202  64.989  1.00 60.19  ? 217 GLU C OE1   1 
ATOM   6362 O OE2   . GLU E 3 217 ? 39.340  94.765  65.881  1.00 60.68  ? 217 GLU C OE2   1 
ATOM   6363 N N     . GLY E 3 218 ? 35.420  90.979  65.749  1.00 51.57  ? 218 GLY C N     1 
ATOM   6364 C CA    . GLY E 3 218 ? 35.640  90.015  66.816  1.00 49.08  ? 218 GLY C CA    1 
ATOM   6365 C C     . GLY E 3 218 ? 37.133  89.851  67.072  1.00 46.78  ? 218 GLY C C     1 
ATOM   6366 O O     . GLY E 3 218 ? 37.941  90.633  66.576  1.00 46.63  ? 218 GLY C O     1 
ATOM   6367 N N     . ASP E 3 219 ? 37.516  88.839  67.839  1.00 44.34  ? 219 ASP C N     1 
ATOM   6368 C CA    . ASP E 3 219 ? 38.925  88.621  68.134  1.00 42.15  ? 219 ASP C CA    1 
ATOM   6369 C C     . ASP E 3 219 ? 39.316  87.167  67.921  1.00 40.27  ? 219 ASP C C     1 
ATOM   6370 O O     . ASP E 3 219 ? 40.234  86.661  68.560  1.00 39.05  ? 219 ASP C O     1 
ATOM   6371 C CB    . ASP E 3 219 ? 39.223  89.029  69.574  1.00 43.86  ? 219 ASP C CB    1 
ATOM   6372 C CG    . ASP E 3 219 ? 38.474  88.181  70.586  1.00 45.90  ? 219 ASP C CG    1 
ATOM   6373 O OD1   . ASP E 3 219 ? 38.558  88.472  71.804  1.00 46.92  ? 219 ASP C OD1   1 
ATOM   6374 O OD2   . ASP E 3 219 ? 37.801  87.217  70.163  1.00 47.23  ? 219 ASP C OD2   1 
ATOM   6375 N N     . TRP E 3 220 ? 38.600  86.508  67.016  1.00 38.78  ? 220 TRP C N     1 
ATOM   6376 C CA    . TRP E 3 220 ? 38.834  85.108  66.676  1.00 37.23  ? 220 TRP C CA    1 
ATOM   6377 C C     . TRP E 3 220 ? 38.118  84.149  67.620  1.00 36.95  ? 220 TRP C C     1 
ATOM   6378 O O     . TRP E 3 220 ? 37.787  83.043  67.232  1.00 37.67  ? 220 TRP C O     1 
ATOM   6379 C CB    . TRP E 3 220 ? 40.335  84.790  66.677  1.00 35.03  ? 220 TRP C CB    1 
ATOM   6380 C CG    . TRP E 3 220 ? 41.126  85.419  65.561  1.00 32.58  ? 220 TRP C CG    1 
ATOM   6381 C CD1   . TRP E 3 220 ? 42.327  86.055  65.670  1.00 32.09  ? 220 TRP C CD1   1 
ATOM   6382 C CD2   . TRP E 3 220 ? 40.794  85.445  64.178  1.00 31.55  ? 220 TRP C CD2   1 
ATOM   6383 N NE1   . TRP E 3 220 ? 42.764  86.472  64.445  1.00 31.11  ? 220 TRP C NE1   1 
ATOM   6384 C CE2   . TRP E 3 220 ? 41.835  86.107  63.503  1.00 31.17  ? 220 TRP C CE2   1 
ATOM   6385 C CE3   . TRP E 3 220 ? 39.708  84.958  63.435  1.00 31.89  ? 220 TRP C CE3   1 
ATOM   6386 C CZ2   . TRP E 3 220 ? 41.835  86.315  62.140  1.00 32.45  ? 220 TRP C CZ2   1 
ATOM   6387 C CZ3   . TRP E 3 220 ? 39.703  85.161  62.071  1.00 33.22  ? 220 TRP C CZ3   1 
ATOM   6388 C CH2   . TRP E 3 220 ? 40.763  85.832  61.435  1.00 33.81  ? 220 TRP C CH2   1 
ATOM   6389 N N     . SER E 3 221 ? 37.862  84.577  68.851  1.00 37.28  ? 221 SER C N     1 
ATOM   6390 C CA    . SER E 3 221 ? 37.203  83.732  69.851  1.00 37.64  ? 221 SER C CA    1 
ATOM   6391 C C     . SER E 3 221 ? 35.705  83.566  69.682  1.00 38.36  ? 221 SER C C     1 
ATOM   6392 O O     . SER E 3 221 ? 35.020  84.459  69.198  1.00 38.18  ? 221 SER C O     1 
ATOM   6393 C CB    . SER E 3 221 ? 37.410  84.301  71.232  1.00 37.80  ? 221 SER C CB    1 
ATOM   6394 O OG    . SER E 3 221 ? 36.438  85.306  71.460  1.00 36.99  ? 221 SER C OG    1 
ATOM   6395 N N     . ALA E 3 222 ? 35.193  82.432  70.145  1.00 39.38  ? 222 ALA C N     1 
ATOM   6396 C CA    . ALA E 3 222 ? 33.770  82.148  70.049  1.00 40.65  ? 222 ALA C CA    1 
ATOM   6397 C C     . ALA E 3 222 ? 32.979  83.130  70.877  1.00 41.90  ? 222 ALA C C     1 
ATOM   6398 O O     . ALA E 3 222 ? 31.895  83.541  70.485  1.00 43.29  ? 222 ALA C O     1 
ATOM   6399 C CB    . ALA E 3 222 ? 33.480  80.748  70.521  1.00 39.71  ? 222 ALA C CB    1 
ATOM   6400 N N     . MET E 3 223 ? 33.517  83.506  72.028  1.00 43.26  ? 223 MET C N     1 
ATOM   6401 C CA    . MET E 3 223 ? 32.823  84.448  72.899  1.00 45.26  ? 223 MET C CA    1 
ATOM   6402 C C     . MET E 3 223 ? 32.550  85.758  72.159  1.00 45.25  ? 223 MET C C     1 
ATOM   6403 O O     . MET E 3 223 ? 31.426  86.270  72.168  1.00 44.88  ? 223 MET C O     1 
ATOM   6404 C CB    . MET E 3 223 ? 33.658  84.717  74.156  1.00 47.44  ? 223 MET C CB    1 
ATOM   6405 C CG    . MET E 3 223 ? 32.874  85.298  75.324  1.00 49.26  ? 223 MET C CG    1 
ATOM   6406 S SD    . MET E 3 223 ? 31.459  84.275  75.693  1.00 51.02  ? 223 MET C SD    1 
ATOM   6407 C CE    . MET E 3 223 ? 30.230  85.493  75.998  1.00 53.08  ? 223 MET C CE    1 
ATOM   6408 N N     . SER E 3 224 ? 33.581  86.293  71.511  1.00 45.48  ? 224 SER C N     1 
ATOM   6409 C CA    . SER E 3 224 ? 33.436  87.536  70.775  1.00 46.02  ? 224 SER C CA    1 
ATOM   6410 C C     . SER E 3 224 ? 32.331  87.368  69.754  1.00 46.48  ? 224 SER C C     1 
ATOM   6411 O O     . SER E 3 224 ? 31.422  88.191  69.682  1.00 47.23  ? 224 SER C O     1 
ATOM   6412 C CB    . SER E 3 224 ? 34.740  87.896  70.074  1.00 46.08  ? 224 SER C CB    1 
ATOM   6413 O OG    . SER E 3 224 ? 35.087  86.903  69.136  1.00 46.61  ? 224 SER C OG    1 
ATOM   6414 N N     . GLY E 3 225 ? 32.409  86.292  68.974  1.00 46.44  ? 225 GLY C N     1 
ATOM   6415 C CA    . GLY E 3 225 ? 31.399  86.026  67.965  1.00 46.90  ? 225 GLY C CA    1 
ATOM   6416 C C     . GLY E 3 225 ? 30.012  86.084  68.566  1.00 47.60  ? 225 GLY C C     1 
ATOM   6417 O O     . GLY E 3 225 ? 29.051  86.479  67.912  1.00 47.40  ? 225 GLY C O     1 
ATOM   6418 N N     . PHE E 3 226 ? 29.919  85.692  69.831  1.00 48.75  ? 226 PHE C N     1 
ATOM   6419 C CA    . PHE E 3 226 ? 28.662  85.704  70.565  1.00 49.77  ? 226 PHE C CA    1 
ATOM   6420 C C     . PHE E 3 226 ? 28.267  87.130  70.920  1.00 50.70  ? 226 PHE C C     1 
ATOM   6421 O O     . PHE E 3 226 ? 27.227  87.622  70.483  1.00 51.42  ? 226 PHE C O     1 
ATOM   6422 C CB    . PHE E 3 226 ? 28.797  84.903  71.849  1.00 49.50  ? 226 PHE C CB    1 
ATOM   6423 C CG    . PHE E 3 226 ? 27.567  84.919  72.693  1.00 49.22  ? 226 PHE C CG    1 
ATOM   6424 C CD1   . PHE E 3 226 ? 26.388  84.346  72.229  1.00 49.69  ? 226 PHE C CD1   1 
ATOM   6425 C CD2   . PHE E 3 226 ? 27.578  85.514  73.946  1.00 48.87  ? 226 PHE C CD2   1 
ATOM   6426 C CE1   . PHE E 3 226 ? 25.240  84.367  73.002  1.00 49.73  ? 226 PHE C CE1   1 
ATOM   6427 C CE2   . PHE E 3 226 ? 26.439  85.543  74.731  1.00 48.97  ? 226 PHE C CE2   1 
ATOM   6428 C CZ    . PHE E 3 226 ? 25.267  84.970  74.262  1.00 49.85  ? 226 PHE C CZ    1 
ATOM   6429 N N     . GLN E 3 227 ? 29.104  87.789  71.716  1.00 51.73  ? 227 GLN C N     1 
ATOM   6430 C CA    . GLN E 3 227 ? 28.850  89.166  72.119  1.00 53.34  ? 227 GLN C CA    1 
ATOM   6431 C C     . GLN E 3 227 ? 28.517  90.085  70.942  1.00 52.83  ? 227 GLN C C     1 
ATOM   6432 O O     . GLN E 3 227 ? 27.471  90.738  70.939  1.00 53.31  ? 227 GLN C O     1 
ATOM   6433 C CB    . GLN E 3 227 ? 30.050  89.712  72.894  1.00 55.59  ? 227 GLN C CB    1 
ATOM   6434 C CG    . GLN E 3 227 ? 30.052  89.282  74.364  1.00 59.62  ? 227 GLN C CG    1 
ATOM   6435 C CD    . GLN E 3 227 ? 31.434  89.318  75.006  1.00 62.33  ? 227 GLN C CD    1 
ATOM   6436 O OE1   . GLN E 3 227 ? 31.587  89.033  76.208  1.00 62.69  ? 227 GLN C OE1   1 
ATOM   6437 N NE2   . GLN E 3 227 ? 32.452  89.660  74.206  1.00 64.18  ? 227 GLN C NE2   1 
ATOM   6438 N N     . GLN E 3 228 ? 29.388  90.137  69.939  1.00 51.62  ? 228 GLN C N     1 
ATOM   6439 C CA    . GLN E 3 228 ? 29.132  90.989  68.790  1.00 49.99  ? 228 GLN C CA    1 
ATOM   6440 C C     . GLN E 3 228 ? 27.797  90.707  68.140  1.00 49.39  ? 228 GLN C C     1 
ATOM   6441 O O     . GLN E 3 228 ? 27.058  91.638  67.857  1.00 49.18  ? 228 GLN C O     1 
ATOM   6442 C CB    . GLN E 3 228 ? 30.241  90.851  67.761  1.00 49.98  ? 228 GLN C CB    1 
ATOM   6443 C CG    . GLN E 3 228 ? 31.558  91.489  68.196  1.00 50.56  ? 228 GLN C CG    1 
ATOM   6444 C CD    . GLN E 3 228 ? 31.409  92.956  68.609  1.00 50.41  ? 228 GLN C CD    1 
ATOM   6445 O OE1   . GLN E 3 228 ? 30.811  93.763  67.887  1.00 50.16  ? 228 GLN C OE1   1 
ATOM   6446 N NE2   . GLN E 3 228 ? 31.966  93.308  69.771  1.00 49.35  ? 228 GLN C NE2   1 
ATOM   6447 N N     . THR E 3 229 ? 27.475  89.437  67.908  1.00 49.45  ? 229 THR C N     1 
ATOM   6448 C CA    . THR E 3 229 ? 26.200  89.103  67.281  1.00 50.19  ? 229 THR C CA    1 
ATOM   6449 C C     . THR E 3 229 ? 25.044  89.399  68.211  1.00 52.06  ? 229 THR C C     1 
ATOM   6450 O O     . THR E 3 229 ? 23.916  89.560  67.765  1.00 52.57  ? 229 THR C O     1 
ATOM   6451 C CB    . THR E 3 229 ? 26.126  87.632  66.833  1.00 48.71  ? 229 THR C CB    1 
ATOM   6452 O OG1   . THR E 3 229 ? 27.145  87.378  65.864  1.00 48.27  ? 229 THR C OG1   1 
ATOM   6453 C CG2   . THR E 3 229 ? 24.792  87.346  66.178  1.00 47.28  ? 229 THR C CG2   1 
ATOM   6454 N N     . MET E 3 230 ? 25.312  89.472  69.507  1.00 54.32  ? 230 MET C N     1 
ATOM   6455 C CA    . MET E 3 230 ? 24.245  89.806  70.439  1.00 57.23  ? 230 MET C CA    1 
ATOM   6456 C C     . MET E 3 230 ? 23.957  91.302  70.311  1.00 58.80  ? 230 MET C C     1 
ATOM   6457 O O     . MET E 3 230 ? 22.841  91.683  69.950  1.00 59.27  ? 230 MET C O     1 
ATOM   6458 C CB    . MET E 3 230 ? 24.632  89.474  71.883  1.00 58.61  ? 230 MET C CB    1 
ATOM   6459 C CG    . MET E 3 230 ? 24.072  88.151  72.404  1.00 60.52  ? 230 MET C CG    1 
ATOM   6460 S SD    . MET E 3 230 ? 22.267  88.100  72.515  1.00 62.38  ? 230 MET C SD    1 
ATOM   6461 C CE    . MET E 3 230 ? 22.024  88.713  74.190  1.00 61.63  ? 230 MET C CE    1 
ATOM   6462 N N     . GLN E 3 231 ? 24.964  92.142  70.590  1.00 60.06  ? 231 GLN C N     1 
ATOM   6463 C CA    . GLN E 3 231 ? 24.823  93.608  70.501  1.00 60.77  ? 231 GLN C CA    1 
ATOM   6464 C C     . GLN E 3 231 ? 24.118  94.001  69.212  1.00 59.56  ? 231 GLN C C     1 
ATOM   6465 O O     . GLN E 3 231 ? 23.229  94.854  69.216  1.00 59.39  ? 231 GLN C O     1 
ATOM   6466 C CB    . GLN E 3 231 ? 26.187  94.302  70.523  1.00 63.11  ? 231 GLN C CB    1 
ATOM   6467 C CG    . GLN E 3 231 ? 26.978  94.142  71.806  1.00 67.44  ? 231 GLN C CG    1 
ATOM   6468 C CD    . GLN E 3 231 ? 28.405  94.675  71.670  1.00 70.47  ? 231 GLN C CD    1 
ATOM   6469 O OE1   . GLN E 3 231 ? 29.206  94.607  72.618  1.00 71.76  ? 231 GLN C OE1   1 
ATOM   6470 N NE2   . GLN E 3 231 ? 28.732  95.207  70.483  1.00 71.74  ? 231 GLN C NE2   1 
ATOM   6471 N N     . MET E 3 232 ? 24.535  93.374  68.113  1.00 58.41  ? 232 MET C N     1 
ATOM   6472 C CA    . MET E 3 232 ? 23.961  93.628  66.800  1.00 56.84  ? 232 MET C CA    1 
ATOM   6473 C C     . MET E 3 232 ? 22.476  93.328  66.810  1.00 57.38  ? 232 MET C C     1 
ATOM   6474 O O     . MET E 3 232 ? 21.678  94.125  66.328  1.00 57.90  ? 232 MET C O     1 
ATOM   6475 C CB    . MET E 3 232 ? 24.632  92.763  65.748  1.00 54.80  ? 232 MET C CB    1 
ATOM   6476 C CG    . MET E 3 232 ? 24.031  92.919  64.392  1.00 53.11  ? 232 MET C CG    1 
ATOM   6477 S SD    . MET E 3 232 ? 24.787  91.802  63.240  1.00 52.47  ? 232 MET C SD    1 
ATOM   6478 C CE    . MET E 3 232 ? 23.638  90.458  63.278  1.00 54.01  ? 232 MET C CE    1 
ATOM   6479 N N     . LEU E 3 233 ? 22.101  92.177  67.357  1.00 57.43  ? 233 LEU C N     1 
ATOM   6480 C CA    . LEU E 3 233 ? 20.694  91.801  67.417  1.00 57.39  ? 233 LEU C CA    1 
ATOM   6481 C C     . LEU E 3 233 ? 19.902  92.670  68.393  1.00 58.54  ? 233 LEU C C     1 
ATOM   6482 O O     . LEU E 3 233 ? 18.689  92.830  68.228  1.00 58.85  ? 233 LEU C O     1 
ATOM   6483 C CB    . LEU E 3 233 ? 20.549  90.319  67.783  1.00 55.97  ? 233 LEU C CB    1 
ATOM   6484 C CG    . LEU E 3 233 ? 20.851  89.328  66.655  1.00 54.46  ? 233 LEU C CG    1 
ATOM   6485 C CD1   . LEU E 3 233 ? 20.734  87.917  67.169  1.00 54.10  ? 233 LEU C CD1   1 
ATOM   6486 C CD2   . LEU E 3 233 ? 19.885  89.539  65.513  1.00 54.11  ? 233 LEU C CD2   1 
ATOM   6487 N N     . ASN E 3 234 ? 20.578  93.239  69.396  1.00 59.75  ? 234 ASN C N     1 
ATOM   6488 C CA    . ASN E 3 234 ? 19.902  94.101  70.369  1.00 60.74  ? 234 ASN C CA    1 
ATOM   6489 C C     . ASN E 3 234 ? 19.674  95.508  69.834  1.00 60.37  ? 234 ASN C C     1 
ATOM   6490 O O     . ASN E 3 234 ? 18.834  96.249  70.350  1.00 60.65  ? 234 ASN C O     1 
ATOM   6491 C CB    . ASN E 3 234 ? 20.678  94.173  71.683  1.00 61.75  ? 234 ASN C CB    1 
ATOM   6492 C CG    . ASN E 3 234 ? 20.629  92.871  72.448  1.00 63.23  ? 234 ASN C CG    1 
ATOM   6493 O OD1   . ASN E 3 234 ? 19.584  92.214  72.516  1.00 62.67  ? 234 ASN C OD1   1 
ATOM   6494 N ND2   . ASN E 3 234 ? 21.759  92.490  73.038  1.00 64.97  ? 234 ASN C ND2   1 
ATOM   6495 N N     . GLU E 3 235 ? 20.426  95.873  68.800  1.00 59.33  ? 235 GLU C N     1 
ATOM   6496 C CA    . GLU E 3 235 ? 20.275  97.174  68.177  1.00 58.54  ? 235 GLU C CA    1 
ATOM   6497 C C     . GLU E 3 235 ? 19.204  97.071  67.107  1.00 56.91  ? 235 GLU C C     1 
ATOM   6498 O O     . GLU E 3 235 ? 19.064  97.967  66.286  1.00 57.57  ? 235 GLU C O     1 
ATOM   6499 C CB    . GLU E 3 235 ? 21.579  97.628  67.526  1.00 60.54  ? 235 GLU C CB    1 
ATOM   6500 C CG    . GLU E 3 235 ? 22.712  97.952  68.491  1.00 64.33  ? 235 GLU C CG    1 
ATOM   6501 C CD    . GLU E 3 235 ? 24.003  98.365  67.776  1.00 65.96  ? 235 GLU C CD    1 
ATOM   6502 O OE1   . GLU E 3 235 ? 25.007  98.659  68.465  1.00 66.33  ? 235 GLU C OE1   1 
ATOM   6503 O OE2   . GLU E 3 235 ? 24.016  98.394  66.524  1.00 67.04  ? 235 GLU C OE2   1 
ATOM   6504 N N     . GLY E 3 236 ? 18.461  95.968  67.112  1.00 54.97  ? 236 GLY C N     1 
ATOM   6505 C CA    . GLY E 3 236 ? 17.394  95.775  66.142  1.00 52.79  ? 236 GLY C CA    1 
ATOM   6506 C C     . GLY E 3 236 ? 17.807  95.419  64.719  1.00 50.63  ? 236 GLY C C     1 
ATOM   6507 O O     . GLY E 3 236 ? 16.963  95.234  63.841  1.00 50.75  ? 236 GLY C O     1 
ATOM   6508 N N     . ILE E 3 237 ? 19.104  95.322  64.475  1.00 47.96  ? 237 ILE C N     1 
ATOM   6509 C CA    . ILE E 3 237 ? 19.579  94.987  63.143  1.00 45.70  ? 237 ILE C CA    1 
ATOM   6510 C C     . ILE E 3 237 ? 19.565  93.493  62.979  1.00 43.58  ? 237 ILE C C     1 
ATOM   6511 O O     . ILE E 3 237 ? 20.413  92.806  63.515  1.00 44.78  ? 237 ILE C O     1 
ATOM   6512 C CB    . ILE E 3 237 ? 21.003  95.436  62.943  1.00 47.06  ? 237 ILE C CB    1 
ATOM   6513 C CG1   . ILE E 3 237 ? 21.145  96.893  63.370  1.00 48.23  ? 237 ILE C CG1   1 
ATOM   6514 C CG2   . ILE E 3 237 ? 21.397  95.228  61.502  1.00 46.54  ? 237 ILE C CG2   1 
ATOM   6515 C CD1   . ILE E 3 237 ? 22.580  97.376  63.416  1.00 50.56  ? 237 ILE C CD1   1 
ATOM   6516 N N     . VAL E 3 238 ? 18.624  92.973  62.223  1.00 40.67  ? 238 VAL C N     1 
ATOM   6517 C CA    . VAL E 3 238 ? 18.576  91.535  62.072  1.00 38.02  ? 238 VAL C CA    1 
ATOM   6518 C C     . VAL E 3 238 ? 18.650  91.086  60.630  1.00 35.73  ? 238 VAL C C     1 
ATOM   6519 O O     . VAL E 3 238 ? 17.662  91.118  59.907  1.00 35.44  ? 238 VAL C O     1 
ATOM   6520 C CB    . VAL E 3 238 ? 17.310  90.974  62.732  1.00 38.53  ? 238 VAL C CB    1 
ATOM   6521 C CG1   . VAL E 3 238 ? 16.121  91.801  62.331  1.00 39.30  ? 238 VAL C CG1   1 
ATOM   6522 C CG2   . VAL E 3 238 ? 17.102  89.535  62.332  1.00 38.48  ? 238 VAL C CG2   1 
ATOM   6523 N N     . PRO E 3 239 ? 19.838  90.659  60.191  1.00 33.30  ? 239 PRO C N     1 
ATOM   6524 C CA    . PRO E 3 239 ? 20.074  90.192  58.825  1.00 32.56  ? 239 PRO C CA    1 
ATOM   6525 C C     . PRO E 3 239 ? 19.403  88.869  58.514  1.00 32.40  ? 239 PRO C C     1 
ATOM   6526 O O     . PRO E 3 239 ? 18.615  88.373  59.309  1.00 32.03  ? 239 PRO C O     1 
ATOM   6527 C CB    . PRO E 3 239 ? 21.590  90.098  58.758  1.00 32.21  ? 239 PRO C CB    1 
ATOM   6528 C CG    . PRO E 3 239 ? 21.973  89.819  60.167  1.00 32.12  ? 239 PRO C CG    1 
ATOM   6529 C CD    . PRO E 3 239 ? 21.101  90.741  60.940  1.00 31.90  ? 239 PRO C CD    1 
ATOM   6530 N N     . THR E 3 240 ? 19.692  88.318  57.338  1.00 32.23  ? 240 THR C N     1 
ATOM   6531 C CA    . THR E 3 240 ? 19.139  87.025  56.957  1.00 33.19  ? 240 THR C CA    1 
ATOM   6532 C C     . THR E 3 240 ? 20.293  86.083  56.663  1.00 34.57  ? 240 THR C C     1 
ATOM   6533 O O     . THR E 3 240 ? 20.092  84.918  56.336  1.00 35.82  ? 240 THR C O     1 
ATOM   6534 C CB    . THR E 3 240 ? 18.234  87.103  55.722  1.00 32.69  ? 240 THR C CB    1 
ATOM   6535 O OG1   . THR E 3 240 ? 19.001  87.465  54.572  1.00 31.45  ? 240 THR C OG1   1 
ATOM   6536 C CG2   . THR E 3 240 ? 17.166  88.122  55.939  1.00 33.75  ? 240 THR C CG2   1 
ATOM   6537 N N     . ALA E 3 241 ? 21.510  86.605  56.786  1.00 35.16  ? 241 ALA C N     1 
ATOM   6538 C CA    . ALA E 3 241 ? 22.732  85.834  56.571  1.00 35.04  ? 241 ALA C CA    1 
ATOM   6539 C C     . ALA E 3 241 ? 23.921  86.628  57.107  1.00 35.11  ? 241 ALA C C     1 
ATOM   6540 O O     . ALA E 3 241 ? 23.950  87.856  57.034  1.00 35.01  ? 241 ALA C O     1 
ATOM   6541 C CB    . ALA E 3 241 ? 22.923  85.531  55.087  1.00 33.95  ? 241 ALA C CB    1 
ATOM   6542 N N     . MET E 3 242 ? 24.893  85.923  57.665  1.00 34.70  ? 242 MET C N     1 
ATOM   6543 C CA    . MET E 3 242 ? 26.082  86.558  58.200  1.00 34.65  ? 242 MET C CA    1 
ATOM   6544 C C     . MET E 3 242 ? 27.306  85.878  57.634  1.00 34.89  ? 242 MET C C     1 
ATOM   6545 O O     . MET E 3 242 ? 27.310  84.680  57.424  1.00 35.72  ? 242 MET C O     1 
ATOM   6546 C CB    . MET E 3 242 ? 26.133  86.429  59.716  1.00 34.38  ? 242 MET C CB    1 
ATOM   6547 C CG    . MET E 3 242 ? 25.206  87.324  60.477  1.00 35.41  ? 242 MET C CG    1 
ATOM   6548 S SD    . MET E 3 242 ? 25.305  86.956  62.245  1.00 36.37  ? 242 MET C SD    1 
ATOM   6549 C CE    . MET E 3 242 ? 26.750  87.812  62.684  1.00 37.95  ? 242 MET C CE    1 
ATOM   6550 N N     . LEU E 3 243 ? 28.344  86.652  57.372  1.00 34.88  ? 243 LEU C N     1 
ATOM   6551 C CA    . LEU E 3 243 ? 29.592  86.107  56.874  1.00 34.35  ? 243 LEU C CA    1 
ATOM   6552 C C     . LEU E 3 243 ? 30.526  86.336  58.051  1.00 34.71  ? 243 LEU C C     1 
ATOM   6553 O O     . LEU E 3 243 ? 30.681  87.470  58.498  1.00 36.02  ? 243 LEU C O     1 
ATOM   6554 C CB    . LEU E 3 243 ? 30.058  86.883  55.639  1.00 32.88  ? 243 LEU C CB    1 
ATOM   6555 C CG    . LEU E 3 243 ? 29.136  86.731  54.433  1.00 32.12  ? 243 LEU C CG    1 
ATOM   6556 C CD1   . LEU E 3 243 ? 29.434  87.794  53.423  1.00 33.04  ? 243 LEU C CD1   1 
ATOM   6557 C CD2   . LEU E 3 243 ? 29.316  85.370  53.829  1.00 31.88  ? 243 LEU C CD2   1 
ATOM   6558 N N     . VAL E 3 244 ? 31.117  85.269  58.582  1.00 34.07  ? 244 VAL C N     1 
ATOM   6559 C CA    . VAL E 3 244 ? 32.012  85.411  59.728  1.00 33.13  ? 244 VAL C CA    1 
ATOM   6560 C C     . VAL E 3 244 ? 33.455  85.055  59.379  1.00 32.31  ? 244 VAL C C     1 
ATOM   6561 O O     . VAL E 3 244 ? 33.704  84.110  58.641  1.00 31.31  ? 244 VAL C O     1 
ATOM   6562 C CB    . VAL E 3 244 ? 31.522  84.547  60.908  1.00 32.51  ? 244 VAL C CB    1 
ATOM   6563 C CG1   . VAL E 3 244 ? 32.146  85.025  62.199  1.00 32.06  ? 244 VAL C CG1   1 
ATOM   6564 C CG2   . VAL E 3 244 ? 30.026  84.626  61.004  1.00 31.27  ? 244 VAL C CG2   1 
ATOM   6565 N N     . ALA E 3 245 ? 34.394  85.820  59.925  1.00 31.66  ? 245 ALA C N     1 
ATOM   6566 C CA    . ALA E 3 245 ? 35.812  85.638  59.666  1.00 31.70  ? 245 ALA C CA    1 
ATOM   6567 C C     . ALA E 3 245 ? 36.418  84.290  60.018  1.00 32.39  ? 245 ALA C C     1 
ATOM   6568 O O     . ALA E 3 245 ? 37.540  84.016  59.622  1.00 31.89  ? 245 ALA C O     1 
ATOM   6569 C CB    . ALA E 3 245 ? 36.591  86.734  60.349  1.00 31.17  ? 245 ALA C CB    1 
ATOM   6570 N N     . ASN E 3 246 ? 35.698  83.454  60.759  1.00 34.05  ? 246 ASN C N     1 
ATOM   6571 C CA    . ASN E 3 246 ? 36.219  82.138  61.128  1.00 35.64  ? 246 ASN C CA    1 
ATOM   6572 C C     . ASN E 3 246 ? 35.182  81.259  61.820  1.00 36.06  ? 246 ASN C C     1 
ATOM   6573 O O     . ASN E 3 246 ? 34.253  81.756  62.441  1.00 36.09  ? 246 ASN C O     1 
ATOM   6574 C CB    . ASN E 3 246 ? 37.459  82.291  62.020  1.00 36.15  ? 246 ASN C CB    1 
ATOM   6575 C CG    . ASN E 3 246 ? 37.119  82.611  63.454  1.00 35.88  ? 246 ASN C CG    1 
ATOM   6576 O OD1   . ASN E 3 246 ? 36.094  83.225  63.745  1.00 36.03  ? 246 ASN C OD1   1 
ATOM   6577 N ND2   . ASN E 3 246 ? 37.994  82.209  64.363  1.00 36.68  ? 246 ASN C ND2   1 
ATOM   6578 N N     . ASP E 3 247 ? 35.349  79.948  61.721  1.00 36.09  ? 247 ASP C N     1 
ATOM   6579 C CA    . ASP E 3 247 ? 34.397  79.035  62.316  1.00 35.44  ? 247 ASP C CA    1 
ATOM   6580 C C     . ASP E 3 247 ? 34.093  79.328  63.772  1.00 34.71  ? 247 ASP C C     1 
ATOM   6581 O O     . ASP E 3 247 ? 32.929  79.433  64.143  1.00 34.95  ? 247 ASP C O     1 
ATOM   6582 C CB    . ASP E 3 247 ? 34.871  77.589  62.137  1.00 36.99  ? 247 ASP C CB    1 
ATOM   6583 C CG    . ASP E 3 247 ? 34.863  77.156  60.677  1.00 38.11  ? 247 ASP C CG    1 
ATOM   6584 O OD1   . ASP E 3 247 ? 35.380  76.057  60.382  1.00 39.67  ? 247 ASP C OD1   1 
ATOM   6585 O OD2   . ASP E 3 247 ? 34.341  77.917  59.826  1.00 36.85  ? 247 ASP C OD2   1 
ATOM   6586 N N     . GLN E 3 248 ? 35.113  79.484  64.603  1.00 33.89  ? 248 GLN C N     1 
ATOM   6587 C CA    . GLN E 3 248 ? 34.838  79.739  66.007  1.00 33.91  ? 248 GLN C CA    1 
ATOM   6588 C C     . GLN E 3 248 ? 33.906  80.909  66.296  1.00 32.94  ? 248 GLN C C     1 
ATOM   6589 O O     . GLN E 3 248 ? 33.000  80.789  67.112  1.00 33.19  ? 248 GLN C O     1 
ATOM   6590 C CB    . GLN E 3 248 ? 36.135  79.894  66.781  1.00 35.73  ? 248 GLN C CB    1 
ATOM   6591 C CG    . GLN E 3 248 ? 36.764  78.569  67.139  1.00 39.10  ? 248 GLN C CG    1 
ATOM   6592 C CD    . GLN E 3 248 ? 38.252  78.685  67.350  1.00 42.24  ? 248 GLN C CD    1 
ATOM   6593 O OE1   . GLN E 3 248 ? 39.011  78.957  66.406  1.00 45.42  ? 248 GLN C OE1   1 
ATOM   6594 N NE2   . GLN E 3 248 ? 38.689  78.487  68.589  1.00 43.20  ? 248 GLN C NE2   1 
ATOM   6595 N N     . MET E 3 249 ? 34.103  82.043  65.642  1.00 31.68  ? 249 MET C N     1 
ATOM   6596 C CA    . MET E 3 249 ? 33.217  83.168  65.901  1.00 30.54  ? 249 MET C CA    1 
ATOM   6597 C C     . MET E 3 249 ? 31.844  82.860  65.348  1.00 29.37  ? 249 MET C C     1 
ATOM   6598 O O     . MET E 3 249 ? 30.843  83.384  65.817  1.00 28.71  ? 249 MET C O     1 
ATOM   6599 C CB    . MET E 3 249 ? 33.751  84.447  65.266  1.00 31.58  ? 249 MET C CB    1 
ATOM   6600 C CG    . MET E 3 249 ? 35.008  84.988  65.919  1.00 32.67  ? 249 MET C CG    1 
ATOM   6601 S SD    . MET E 3 249 ? 35.419  86.650  65.357  1.00 31.12  ? 249 MET C SD    1 
ATOM   6602 C CE    . MET E 3 249 ? 35.745  86.336  63.720  1.00 32.87  ? 249 MET C CE    1 
ATOM   6603 N N     . ALA E 3 250 ? 31.803  82.006  64.339  1.00 28.81  ? 250 ALA C N     1 
ATOM   6604 C CA    . ALA E 3 250 ? 30.540  81.612  63.740  1.00 28.45  ? 250 ALA C CA    1 
ATOM   6605 C C     . ALA E 3 250 ? 29.752  80.865  64.799  1.00 27.65  ? 250 ALA C C     1 
ATOM   6606 O O     . ALA E 3 250 ? 28.533  80.989  64.901  1.00 26.45  ? 250 ALA C O     1 
ATOM   6607 C CB    . ALA E 3 250 ? 30.790  80.708  62.556  1.00 29.93  ? 250 ALA C CB    1 
ATOM   6608 N N     . LEU E 3 251 ? 30.472  80.077  65.585  1.00 27.61  ? 251 LEU C N     1 
ATOM   6609 C CA    . LEU E 3 251 ? 29.860  79.310  66.656  1.00 27.97  ? 251 LEU C CA    1 
ATOM   6610 C C     . LEU E 3 251 ? 29.169  80.277  67.607  1.00 28.56  ? 251 LEU C C     1 
ATOM   6611 O O     . LEU E 3 251 ? 27.972  80.154  67.877  1.00 28.70  ? 251 LEU C O     1 
ATOM   6612 C CB    . LEU E 3 251 ? 30.920  78.516  67.418  1.00 27.03  ? 251 LEU C CB    1 
ATOM   6613 C CG    . LEU E 3 251 ? 30.386  77.638  68.548  1.00 26.19  ? 251 LEU C CG    1 
ATOM   6614 C CD1   . LEU E 3 251 ? 29.608  76.506  67.932  1.00 26.36  ? 251 LEU C CD1   1 
ATOM   6615 C CD2   . LEU E 3 251 ? 31.514  77.088  69.386  1.00 25.70  ? 251 LEU C CD2   1 
ATOM   6616 N N     . GLY E 3 252 ? 29.935  81.243  68.106  1.00 28.41  ? 252 GLY C N     1 
ATOM   6617 C CA    . GLY E 3 252 ? 29.386  82.232  69.016  1.00 28.33  ? 252 GLY C CA    1 
ATOM   6618 C C     . GLY E 3 252 ? 28.205  82.938  68.391  1.00 27.81  ? 252 GLY C C     1 
ATOM   6619 O O     . GLY E 3 252 ? 27.215  83.228  69.048  1.00 27.25  ? 252 GLY C O     1 
ATOM   6620 N N     . ALA E 3 253 ? 28.316  83.212  67.104  1.00 28.54  ? 253 ALA C N     1 
ATOM   6621 C CA    . ALA E 3 253 ? 27.251  83.876  66.387  1.00 29.46  ? 253 ALA C CA    1 
ATOM   6622 C C     . ALA E 3 253 ? 26.035  82.983  66.413  1.00 29.95  ? 253 ALA C C     1 
ATOM   6623 O O     . ALA E 3 253 ? 24.931  83.410  66.730  1.00 29.73  ? 253 ALA C O     1 
ATOM   6624 C CB    . ALA E 3 253 ? 27.672  84.122  64.965  1.00 30.11  ? 253 ALA C CB    1 
ATOM   6625 N N     . MET E 3 254 ? 26.248  81.727  66.077  1.00 30.50  ? 254 MET C N     1 
ATOM   6626 C CA    . MET E 3 254 ? 25.156  80.794  66.059  1.00 32.45  ? 254 MET C CA    1 
ATOM   6627 C C     . MET E 3 254 ? 24.501  80.719  67.420  1.00 33.54  ? 254 MET C C     1 
ATOM   6628 O O     . MET E 3 254 ? 23.282  80.652  67.526  1.00 34.16  ? 254 MET C O     1 
ATOM   6629 C CB    . MET E 3 254 ? 25.671  79.440  65.617  1.00 33.23  ? 254 MET C CB    1 
ATOM   6630 C CG    . MET E 3 254 ? 26.137  79.476  64.195  1.00 35.09  ? 254 MET C CG    1 
ATOM   6631 S SD    . MET E 3 254 ? 26.951  77.983  63.756  1.00 38.22  ? 254 MET C SD    1 
ATOM   6632 C CE    . MET E 3 254 ? 25.556  76.907  63.540  1.00 37.68  ? 254 MET C CE    1 
ATOM   6633 N N     . ARG E 3 255 ? 25.299  80.756  68.473  1.00 34.92  ? 255 ARG C N     1 
ATOM   6634 C CA    . ARG E 3 255 ? 24.720  80.683  69.803  1.00 36.45  ? 255 ARG C CA    1 
ATOM   6635 C C     . ARG E 3 255 ? 23.731  81.817  69.987  1.00 36.86  ? 255 ARG C C     1 
ATOM   6636 O O     . ARG E 3 255 ? 22.542  81.583  70.196  1.00 36.69  ? 255 ARG C O     1 
ATOM   6637 C CB    . ARG E 3 255 ? 25.804  80.765  70.876  1.00 37.13  ? 255 ARG C CB    1 
ATOM   6638 C CG    . ARG E 3 255 ? 25.471  79.962  72.112  1.00 38.64  ? 255 ARG C CG    1 
ATOM   6639 C CD    . ARG E 3 255 ? 25.031  80.818  73.275  1.00 38.67  ? 255 ARG C CD    1 
ATOM   6640 N NE    . ARG E 3 255 ? 26.164  81.161  74.129  1.00 40.38  ? 255 ARG C NE    1 
ATOM   6641 C CZ    . ARG E 3 255 ? 26.054  81.653  75.361  1.00 41.02  ? 255 ARG C CZ    1 
ATOM   6642 N NH1   . ARG E 3 255 ? 24.857  81.859  75.881  1.00 41.18  ? 255 ARG C NH1   1 
ATOM   6643 N NH2   . ARG E 3 255 ? 27.137  81.930  76.080  1.00 42.04  ? 255 ARG C NH2   1 
ATOM   6644 N N     . ALA E 3 256 ? 24.232  83.044  69.884  1.00 37.62  ? 256 ALA C N     1 
ATOM   6645 C CA    . ALA E 3 256 ? 23.417  84.246  70.039  1.00 38.47  ? 256 ALA C CA    1 
ATOM   6646 C C     . ALA E 3 256 ? 22.173  84.230  69.163  1.00 38.90  ? 256 ALA C C     1 
ATOM   6647 O O     . ALA E 3 256 ? 21.106  84.653  69.596  1.00 39.68  ? 256 ALA C O     1 
ATOM   6648 C CB    . ALA E 3 256 ? 24.242  85.475  69.727  1.00 39.13  ? 256 ALA C CB    1 
ATOM   6649 N N     . ILE E 3 257 ? 22.308  83.761  67.929  1.00 38.43  ? 257 ILE C N     1 
ATOM   6650 C CA    . ILE E 3 257 ? 21.171  83.693  67.034  1.00 38.90  ? 257 ILE C CA    1 
ATOM   6651 C C     . ILE E 3 257 ? 20.109  82.779  67.627  1.00 40.28  ? 257 ILE C C     1 
ATOM   6652 O O     . ILE E 3 257 ? 18.934  83.139  67.666  1.00 41.07  ? 257 ILE C O     1 
ATOM   6653 C CB    . ILE E 3 257 ? 21.593  83.155  65.663  1.00 38.68  ? 257 ILE C CB    1 
ATOM   6654 C CG1   . ILE E 3 257 ? 22.343  84.246  64.903  1.00 39.39  ? 257 ILE C CG1   1 
ATOM   6655 C CG2   . ILE E 3 257 ? 20.381  82.670  64.884  1.00 38.82  ? 257 ILE C CG2   1 
ATOM   6656 C CD1   . ILE E 3 257 ? 22.775  83.852  63.500  1.00 40.03  ? 257 ILE C CD1   1 
ATOM   6657 N N     . THR E 3 258 ? 20.538  81.607  68.105  1.00 41.61  ? 258 THR C N     1 
ATOM   6658 C CA    . THR E 3 258 ? 19.641  80.602  68.679  1.00 42.42  ? 258 THR C CA    1 
ATOM   6659 C C     . THR E 3 258 ? 18.990  81.021  69.973  1.00 43.69  ? 258 THR C C     1 
ATOM   6660 O O     . THR E 3 258 ? 17.786  80.862  70.147  1.00 43.88  ? 258 THR C O     1 
ATOM   6661 C CB    . THR E 3 258 ? 20.362  79.284  68.956  1.00 42.31  ? 258 THR C CB    1 
ATOM   6662 O OG1   . THR E 3 258 ? 20.877  78.738  67.740  1.00 42.64  ? 258 THR C OG1   1 
ATOM   6663 C CG2   . THR E 3 258 ? 19.395  78.296  69.546  1.00 43.06  ? 258 THR C CG2   1 
ATOM   6664 N N     . GLU E 3 259 ? 19.796  81.539  70.891  1.00 45.12  ? 259 GLU C N     1 
ATOM   6665 C CA    . GLU E 3 259 ? 19.289  81.982  72.187  1.00 46.79  ? 259 GLU C CA    1 
ATOM   6666 C C     . GLU E 3 259 ? 18.411  83.204  72.036  1.00 47.41  ? 259 GLU C C     1 
ATOM   6667 O O     . GLU E 3 259 ? 17.891  83.729  73.009  1.00 47.42  ? 259 GLU C O     1 
ATOM   6668 C CB    . GLU E 3 259 ? 20.441  82.305  73.145  1.00 47.21  ? 259 GLU C CB    1 
ATOM   6669 C CG    . GLU E 3 259 ? 21.274  81.088  73.529  1.00 48.36  ? 259 GLU C CG    1 
ATOM   6670 C CD    . GLU E 3 259 ? 22.187  81.346  74.706  1.00 48.53  ? 259 GLU C CD    1 
ATOM   6671 O OE1   . GLU E 3 259 ? 22.807  80.376  75.197  1.00 48.48  ? 259 GLU C OE1   1 
ATOM   6672 O OE2   . GLU E 3 259 ? 22.279  82.516  75.137  1.00 48.61  ? 259 GLU C OE2   1 
ATOM   6673 N N     . SER E 3 260 ? 18.251  83.652  70.803  1.00 48.66  ? 260 SER C N     1 
ATOM   6674 C CA    . SER E 3 260 ? 17.439  84.819  70.531  1.00 49.67  ? 260 SER C CA    1 
ATOM   6675 C C     . SER E 3 260 ? 16.138  84.396  69.873  1.00 50.30  ? 260 SER C C     1 
ATOM   6676 O O     . SER E 3 260 ? 15.377  85.223  69.382  1.00 51.02  ? 260 SER C O     1 
ATOM   6677 C CB    . SER E 3 260 ? 18.216  85.797  69.645  1.00 50.34  ? 260 SER C CB    1 
ATOM   6678 O OG    . SER E 3 260 ? 19.327  86.335  70.353  1.00 50.18  ? 260 SER C OG    1 
ATOM   6679 N N     . GLY E 3 261 ? 15.888  83.095  69.866  1.00 50.64  ? 261 GLY C N     1 
ATOM   6680 C CA    . GLY E 3 261 ? 14.657  82.598  69.291  1.00 51.79  ? 261 GLY C CA    1 
ATOM   6681 C C     . GLY E 3 261 ? 14.622  82.504  67.784  1.00 52.55  ? 261 GLY C C     1 
ATOM   6682 O O     . GLY E 3 261 ? 13.565  82.269  67.206  1.00 53.13  ? 261 GLY C O     1 
ATOM   6683 N N     . LEU E 3 262 ? 15.760  82.695  67.133  1.00 52.99  ? 262 LEU C N     1 
ATOM   6684 C CA    . LEU E 3 262 ? 15.797  82.588  65.683  1.00 53.88  ? 262 LEU C CA    1 
ATOM   6685 C C     . LEU E 3 262 ? 16.419  81.239  65.307  1.00 54.97  ? 262 LEU C C     1 
ATOM   6686 O O     . LEU E 3 262 ? 17.095  80.620  66.126  1.00 55.14  ? 262 LEU C O     1 
ATOM   6687 C CB    . LEU E 3 262 ? 16.582  83.765  65.108  1.00 53.35  ? 262 LEU C CB    1 
ATOM   6688 C CG    . LEU E 3 262 ? 15.906  85.088  65.473  1.00 52.53  ? 262 LEU C CG    1 
ATOM   6689 C CD1   . LEU E 3 262 ? 16.706  86.263  64.972  1.00 52.74  ? 262 LEU C CD1   1 
ATOM   6690 C CD2   . LEU E 3 262 ? 14.522  85.107  64.866  1.00 52.96  ? 262 LEU C CD2   1 
ATOM   6691 N N     . ARG E 3 263 ? 16.164  80.760  64.093  1.00 56.23  ? 263 ARG C N     1 
ATOM   6692 C CA    . ARG E 3 263 ? 16.707  79.470  63.672  1.00 58.19  ? 263 ARG C CA    1 
ATOM   6693 C C     . ARG E 3 263 ? 17.872  79.598  62.691  1.00 57.83  ? 263 ARG C C     1 
ATOM   6694 O O     . ARG E 3 263 ? 17.659  79.928  61.527  1.00 58.43  ? 263 ARG C O     1 
ATOM   6695 C CB    . ARG E 3 263 ? 15.619  78.617  63.007  1.00 61.54  ? 263 ARG C CB    1 
ATOM   6696 C CG    . ARG E 3 263 ? 14.354  78.395  63.820  1.00 66.49  ? 263 ARG C CG    1 
ATOM   6697 C CD    . ARG E 3 263 ? 13.414  77.380  63.151  1.00 70.53  ? 263 ARG C CD    1 
ATOM   6698 N NE    . ARG E 3 263 ? 13.014  77.746  61.788  1.00 74.75  ? 263 ARG C NE    1 
ATOM   6699 C CZ    . ARG E 3 263 ? 12.354  78.861  61.458  1.00 76.78  ? 263 ARG C CZ    1 
ATOM   6700 N NH1   . ARG E 3 263 ? 12.012  79.746  62.394  1.00 77.82  ? 263 ARG C NH1   1 
ATOM   6701 N NH2   . ARG E 3 263 ? 12.017  79.089  60.187  1.00 78.09  ? 263 ARG C NH2   1 
ATOM   6702 N N     . VAL E 3 264 ? 19.095  79.334  63.147  1.00 56.30  ? 264 VAL C N     1 
ATOM   6703 C CA    . VAL E 3 264 ? 20.246  79.405  62.266  1.00 54.33  ? 264 VAL C CA    1 
ATOM   6704 C C     . VAL E 3 264 ? 19.863  78.604  61.035  1.00 53.36  ? 264 VAL C C     1 
ATOM   6705 O O     . VAL E 3 264 ? 19.345  77.497  61.141  1.00 52.53  ? 264 VAL C O     1 
ATOM   6706 C CB    . VAL E 3 264 ? 21.482  78.805  62.933  1.00 54.30  ? 264 VAL C CB    1 
ATOM   6707 C CG1   . VAL E 3 264 ? 22.611  78.682  61.936  1.00 56.06  ? 264 VAL C CG1   1 
ATOM   6708 C CG2   . VAL E 3 264 ? 21.909  79.685  64.078  1.00 54.22  ? 264 VAL C CG2   1 
ATOM   6709 N N     . GLY E 3 265 ? 20.093  79.188  59.866  1.00 52.60  ? 265 GLY C N     1 
ATOM   6710 C CA    . GLY E 3 265 ? 19.734  78.539  58.618  1.00 52.21  ? 265 GLY C CA    1 
ATOM   6711 C C     . GLY E 3 265 ? 18.431  79.132  58.103  1.00 51.16  ? 265 GLY C C     1 
ATOM   6712 O O     . GLY E 3 265 ? 18.428  79.980  57.211  1.00 51.61  ? 265 GLY C O     1 
ATOM   6713 N N     . ALA E 3 266 ? 17.323  78.694  58.691  1.00 49.60  ? 266 ALA C N     1 
ATOM   6714 C CA    . ALA E 3 266 ? 15.987  79.159  58.328  1.00 47.44  ? 266 ALA C CA    1 
ATOM   6715 C C     . ALA E 3 266 ? 15.748  80.664  58.507  1.00 45.86  ? 266 ALA C C     1 
ATOM   6716 O O     . ALA E 3 266 ? 15.130  81.301  57.662  1.00 44.90  ? 266 ALA C O     1 
ATOM   6717 C CB    . ALA E 3 266 ? 14.962  78.385  59.126  1.00 48.81  ? 266 ALA C CB    1 
ATOM   6718 N N     . ASP E 3 267 ? 16.209  81.231  59.615  1.00 44.78  ? 267 ASP C N     1 
ATOM   6719 C CA    . ASP E 3 267 ? 16.021  82.659  59.850  1.00 44.06  ? 267 ASP C CA    1 
ATOM   6720 C C     . ASP E 3 267 ? 17.259  83.476  59.476  1.00 42.35  ? 267 ASP C C     1 
ATOM   6721 O O     . ASP E 3 267 ? 17.165  84.423  58.708  1.00 42.94  ? 267 ASP C O     1 
ATOM   6722 C CB    . ASP E 3 267 ? 15.643  82.929  61.318  1.00 46.11  ? 267 ASP C CB    1 
ATOM   6723 C CG    . ASP E 3 267 ? 14.266  82.376  61.689  1.00 47.33  ? 267 ASP C CG    1 
ATOM   6724 O OD1   . ASP E 3 267 ? 13.407  82.270  60.788  1.00 48.05  ? 267 ASP C OD1   1 
ATOM   6725 O OD2   . ASP E 3 267 ? 14.036  82.068  62.882  1.00 47.54  ? 267 ASP C OD2   1 
ATOM   6726 N N     . ILE E 3 268 ? 18.415  83.109  60.018  1.00 39.59  ? 268 ILE C N     1 
ATOM   6727 C CA    . ILE E 3 268 ? 19.660  83.810  59.728  1.00 36.59  ? 268 ILE C CA    1 
ATOM   6728 C C     . ILE E 3 268 ? 20.720  82.803  59.297  1.00 36.48  ? 268 ILE C C     1 
ATOM   6729 O O     . ILE E 3 268 ? 21.281  82.118  60.139  1.00 37.94  ? 268 ILE C O     1 
ATOM   6730 C CB    . ILE E 3 268 ? 20.188  84.540  60.969  1.00 34.72  ? 268 ILE C CB    1 
ATOM   6731 C CG1   . ILE E 3 268 ? 19.177  85.570  61.438  1.00 33.46  ? 268 ILE C CG1   1 
ATOM   6732 C CG2   . ILE E 3 268 ? 21.497  85.213  60.663  1.00 33.24  ? 268 ILE C CG2   1 
ATOM   6733 C CD1   . ILE E 3 268 ? 19.674  86.396  62.597  1.00 33.12  ? 268 ILE C CD1   1 
ATOM   6734 N N     . SER E 3 269 ? 20.993  82.697  58.000  1.00 34.98  ? 269 SER C N     1 
ATOM   6735 C CA    . SER E 3 269 ? 22.014  81.762  57.525  1.00 33.24  ? 269 SER C CA    1 
ATOM   6736 C C     . SER E 3 269 ? 23.376  82.206  58.020  1.00 31.78  ? 269 SER C C     1 
ATOM   6737 O O     . SER E 3 269 ? 23.571  83.372  58.338  1.00 31.27  ? 269 SER C O     1 
ATOM   6738 C CB    . SER E 3 269 ? 22.049  81.710  55.999  1.00 34.14  ? 269 SER C CB    1 
ATOM   6739 O OG    . SER E 3 269 ? 20.993  80.923  55.486  1.00 35.36  ? 269 SER C OG    1 
ATOM   6740 N N     . VAL E 3 270 ? 24.324  81.284  58.086  1.00 29.91  ? 270 VAL C N     1 
ATOM   6741 C CA    . VAL E 3 270 ? 25.650  81.647  58.543  1.00 28.56  ? 270 VAL C CA    1 
ATOM   6742 C C     . VAL E 3 270 ? 26.734  80.945  57.735  1.00 29.92  ? 270 VAL C C     1 
ATOM   6743 O O     . VAL E 3 270 ? 26.520  79.845  57.231  1.00 31.00  ? 270 VAL C O     1 
ATOM   6744 C CB    . VAL E 3 270 ? 25.831  81.308  60.028  1.00 26.70  ? 270 VAL C CB    1 
ATOM   6745 C CG1   . VAL E 3 270 ? 27.233  81.616  60.451  1.00 26.62  ? 270 VAL C CG1   1 
ATOM   6746 C CG2   . VAL E 3 270 ? 24.868  82.097  60.856  1.00 24.58  ? 270 VAL C CG2   1 
ATOM   6747 N N     . VAL E 3 271 ? 27.887  81.598  57.594  1.00 29.57  ? 271 VAL C N     1 
ATOM   6748 C CA    . VAL E 3 271 ? 29.024  81.031  56.877  1.00 28.73  ? 271 VAL C CA    1 
ATOM   6749 C C     . VAL E 3 271 ? 30.324  81.351  57.589  1.00 30.16  ? 271 VAL C C     1 
ATOM   6750 O O     . VAL E 3 271 ? 30.637  82.501  57.882  1.00 30.51  ? 271 VAL C O     1 
ATOM   6751 C CB    . VAL E 3 271 ? 29.137  81.544  55.454  1.00 27.48  ? 271 VAL C CB    1 
ATOM   6752 C CG1   . VAL E 3 271 ? 30.357  80.940  54.811  1.00 26.94  ? 271 VAL C CG1   1 
ATOM   6753 C CG2   . VAL E 3 271 ? 27.908  81.188  54.677  1.00 26.61  ? 271 VAL C CG2   1 
ATOM   6754 N N     . GLY E 3 272 ? 31.092  80.306  57.844  1.00 31.55  ? 272 GLY C N     1 
ATOM   6755 C CA    . GLY E 3 272 ? 32.348  80.465  58.543  1.00 32.62  ? 272 GLY C CA    1 
ATOM   6756 C C     . GLY E 3 272 ? 33.561  80.415  57.655  1.00 32.77  ? 272 GLY C C     1 
ATOM   6757 O O     . GLY E 3 272 ? 33.453  80.470  56.431  1.00 32.86  ? 272 GLY C O     1 
ATOM   6758 N N     . TYR E 3 273 ? 34.720  80.280  58.283  1.00 32.48  ? 273 TYR C N     1 
ATOM   6759 C CA    . TYR E 3 273 ? 35.963  80.253  57.553  1.00 32.92  ? 273 TYR C CA    1 
ATOM   6760 C C     . TYR E 3 273 ? 36.944  79.371  58.320  1.00 33.61  ? 273 TYR C C     1 
ATOM   6761 O O     . TYR E 3 273 ? 37.110  79.535  59.515  1.00 33.44  ? 273 TYR C O     1 
ATOM   6762 C CB    . TYR E 3 273 ? 36.464  81.695  57.427  1.00 32.20  ? 273 TYR C CB    1 
ATOM   6763 C CG    . TYR E 3 273 ? 37.164  82.025  56.130  1.00 31.15  ? 273 TYR C CG    1 
ATOM   6764 C CD1   . TYR E 3 273 ? 38.512  81.779  55.977  1.00 31.64  ? 273 TYR C CD1   1 
ATOM   6765 C CD2   . TYR E 3 273 ? 36.481  82.585  55.064  1.00 30.04  ? 273 TYR C CD2   1 
ATOM   6766 C CE1   . TYR E 3 273 ? 39.166  82.077  54.809  1.00 31.04  ? 273 TYR C CE1   1 
ATOM   6767 C CE2   . TYR E 3 273 ? 37.133  82.884  53.889  1.00 29.55  ? 273 TYR C CE2   1 
ATOM   6768 C CZ    . TYR E 3 273 ? 38.479  82.624  53.774  1.00 30.04  ? 273 TYR C CZ    1 
ATOM   6769 O OH    . TYR E 3 273 ? 39.174  82.879  52.624  1.00 30.99  ? 273 TYR C OH    1 
ATOM   6770 N N     . ASP E 3 274 ? 37.564  78.427  57.615  1.00 35.36  ? 274 ASP C N     1 
ATOM   6771 C CA    . ASP E 3 274 ? 38.539  77.472  58.161  1.00 36.47  ? 274 ASP C CA    1 
ATOM   6772 C C     . ASP E 3 274 ? 38.155  76.025  57.925  1.00 38.07  ? 274 ASP C C     1 
ATOM   6773 O O     . ASP E 3 274 ? 38.933  75.226  57.400  1.00 38.56  ? 274 ASP C O     1 
ATOM   6774 C CB    . ASP E 3 274 ? 38.698  77.601  59.661  1.00 34.70  ? 274 ASP C CB    1 
ATOM   6775 C CG    . ASP E 3 274 ? 39.596  78.706  60.048  1.00 33.27  ? 274 ASP C CG    1 
ATOM   6776 O OD1   . ASP E 3 274 ? 40.332  79.210  59.180  1.00 32.79  ? 274 ASP C OD1   1 
ATOM   6777 O OD2   . ASP E 3 274 ? 39.567  79.052  61.238  1.00 33.16  ? 274 ASP C OD2   1 
ATOM   6778 N N     . ASP E 3 275 ? 36.943  75.697  58.347  1.00 39.10  ? 275 ASP C N     1 
ATOM   6779 C CA    . ASP E 3 275 ? 36.444  74.342  58.259  1.00 39.96  ? 275 ASP C CA    1 
ATOM   6780 C C     . ASP E 3 275 ? 37.307  73.578  59.221  1.00 39.86  ? 275 ASP C C     1 
ATOM   6781 O O     . ASP E 3 275 ? 38.032  72.669  58.836  1.00 39.06  ? 275 ASP C O     1 
ATOM   6782 C CB    . ASP E 3 275 ? 36.601  73.754  56.860  1.00 42.01  ? 275 ASP C CB    1 
ATOM   6783 C CG    . ASP E 3 275 ? 36.207  72.270  56.801  1.00 43.13  ? 275 ASP C CG    1 
ATOM   6784 O OD1   . ASP E 3 275 ? 35.142  71.920  57.361  1.00 42.86  ? 275 ASP C OD1   1 
ATOM   6785 O OD2   . ASP E 3 275 ? 36.952  71.458  56.189  1.00 44.04  ? 275 ASP C OD2   1 
ATOM   6786 N N     . THR E 3 276 ? 37.252  73.989  60.481  1.00 41.35  ? 276 THR C N     1 
ATOM   6787 C CA    . THR E 3 276 ? 38.017  73.328  61.528  1.00 43.85  ? 276 THR C CA    1 
ATOM   6788 C C     . THR E 3 276 ? 37.379  71.970  61.712  1.00 45.42  ? 276 THR C C     1 
ATOM   6789 O O     . THR E 3 276 ? 36.278  71.729  61.217  1.00 46.41  ? 276 THR C O     1 
ATOM   6790 C CB    . THR E 3 276 ? 37.915  74.061  62.868  1.00 43.57  ? 276 THR C CB    1 
ATOM   6791 O OG1   . THR E 3 276 ? 36.555  74.052  63.312  1.00 42.71  ? 276 THR C OG1   1 
ATOM   6792 C CG2   . THR E 3 276 ? 38.376  75.493  62.725  1.00 43.98  ? 276 THR C CG2   1 
ATOM   6793 N N     . GLU E 3 277 ? 38.051  71.081  62.428  1.00 46.38  ? 277 GLU C N     1 
ATOM   6794 C CA    . GLU E 3 277 ? 37.488  69.760  62.639  1.00 47.27  ? 277 GLU C CA    1 
ATOM   6795 C C     . GLU E 3 277 ? 36.106  69.836  63.290  1.00 44.95  ? 277 GLU C C     1 
ATOM   6796 O O     . GLU E 3 277 ? 35.154  69.254  62.796  1.00 44.56  ? 277 GLU C O     1 
ATOM   6797 C CB    . GLU E 3 277 ? 38.456  68.903  63.471  1.00 51.01  ? 277 GLU C CB    1 
ATOM   6798 C CG    . GLU E 3 277 ? 39.667  68.364  62.664  1.00 57.07  ? 277 GLU C CG    1 
ATOM   6799 C CD    . GLU E 3 277 ? 39.317  67.174  61.747  1.00 60.13  ? 277 GLU C CD    1 
ATOM   6800 O OE1   . GLU E 3 277 ? 38.991  66.096  62.299  1.00 61.96  ? 277 GLU C OE1   1 
ATOM   6801 O OE2   . GLU E 3 277 ? 39.368  67.311  60.492  1.00 60.91  ? 277 GLU C OE2   1 
ATOM   6802 N N     . ASP E 3 278 ? 35.992  70.587  64.374  1.00 43.18  ? 278 ASP C N     1 
ATOM   6803 C CA    . ASP E 3 278 ? 34.724  70.722  65.087  1.00 42.16  ? 278 ASP C CA    1 
ATOM   6804 C C     . ASP E 3 278 ? 33.531  71.274  64.277  1.00 41.13  ? 278 ASP C C     1 
ATOM   6805 O O     . ASP E 3 278 ? 32.386  70.865  64.477  1.00 40.45  ? 278 ASP C O     1 
ATOM   6806 C CB    . ASP E 3 278 ? 34.931  71.604  66.327  1.00 43.42  ? 278 ASP C CB    1 
ATOM   6807 C CG    . ASP E 3 278 ? 35.964  71.041  67.283  1.00 43.63  ? 278 ASP C CG    1 
ATOM   6808 O OD1   . ASP E 3 278 ? 36.447  69.921  67.024  1.00 44.00  ? 278 ASP C OD1   1 
ATOM   6809 O OD2   . ASP E 3 278 ? 36.284  71.715  68.292  1.00 43.05  ? 278 ASP C OD2   1 
ATOM   6810 N N     . SER E 3 279 ? 33.798  72.209  63.374  1.00 40.12  ? 279 SER C N     1 
ATOM   6811 C CA    . SER E 3 279 ? 32.756  72.834  62.579  1.00 38.44  ? 279 SER C CA    1 
ATOM   6812 C C     . SER E 3 279 ? 31.743  71.875  62.004  1.00 37.19  ? 279 SER C C     1 
ATOM   6813 O O     . SER E 3 279 ? 30.595  72.236  61.850  1.00 37.79  ? 279 SER C O     1 
ATOM   6814 C CB    . SER E 3 279 ? 33.378  73.610  61.435  1.00 39.71  ? 279 SER C CB    1 
ATOM   6815 O OG    . SER E 3 279 ? 34.011  72.714  60.542  1.00 40.48  ? 279 SER C OG    1 
ATOM   6816 N N     . SER E 3 280 ? 32.153  70.657  61.687  1.00 35.44  ? 280 SER C N     1 
ATOM   6817 C CA    . SER E 3 280 ? 31.230  69.691  61.089  1.00 34.11  ? 280 SER C CA    1 
ATOM   6818 C C     . SER E 3 280 ? 30.217  69.057  62.028  1.00 32.52  ? 280 SER C C     1 
ATOM   6819 O O     . SER E 3 280 ? 29.394  68.249  61.608  1.00 31.17  ? 280 SER C O     1 
ATOM   6820 C CB    . SER E 3 280 ? 32.003  68.572  60.413  1.00 35.66  ? 280 SER C CB    1 
ATOM   6821 O OG    . SER E 3 280 ? 32.540  67.689  61.378  1.00 37.01  ? 280 SER C OG    1 
ATOM   6822 N N     . CYS E 3 281 ? 30.284  69.408  63.301  1.00 31.73  ? 281 CYS C N     1 
ATOM   6823 C CA    . CYS E 3 281 ? 29.348  68.859  64.264  1.00 31.43  ? 281 CYS C CA    1 
ATOM   6824 C C     . CYS E 3 281 ? 28.731  69.963  65.106  1.00 31.58  ? 281 CYS C C     1 
ATOM   6825 O O     . CYS E 3 281 ? 28.319  69.740  66.241  1.00 30.60  ? 281 CYS C O     1 
ATOM   6826 C CB    . CYS E 3 281 ? 30.046  67.819  65.144  1.00 32.33  ? 281 CYS C CB    1 
ATOM   6827 S SG    . CYS E 3 281 ? 30.541  66.302  64.258  1.00 30.74  ? 281 CYS C SG    1 
ATOM   6828 N N     . TYR E 3 282 ? 28.691  71.162  64.530  1.00 31.69  ? 282 TYR C N     1 
ATOM   6829 C CA    . TYR E 3 282 ? 28.094  72.329  65.169  1.00 31.10  ? 282 TYR C CA    1 
ATOM   6830 C C     . TYR E 3 282 ? 26.585  72.172  65.003  1.00 31.56  ? 282 TYR C C     1 
ATOM   6831 O O     . TYR E 3 282 ? 26.124  71.478  64.105  1.00 31.25  ? 282 TYR C O     1 
ATOM   6832 C CB    . TYR E 3 282 ? 28.541  73.611  64.469  1.00 31.06  ? 282 TYR C CB    1 
ATOM   6833 C CG    . TYR E 3 282 ? 29.906  74.119  64.853  1.00 30.44  ? 282 TYR C CG    1 
ATOM   6834 C CD1   . TYR E 3 282 ? 30.656  73.496  65.831  1.00 30.36  ? 282 TYR C CD1   1 
ATOM   6835 C CD2   . TYR E 3 282 ? 30.420  75.275  64.275  1.00 31.15  ? 282 TYR C CD2   1 
ATOM   6836 C CE1   . TYR E 3 282 ? 31.875  74.014  66.230  1.00 31.03  ? 282 TYR C CE1   1 
ATOM   6837 C CE2   . TYR E 3 282 ? 31.639  75.797  64.668  1.00 30.83  ? 282 TYR C CE2   1 
ATOM   6838 C CZ    . TYR E 3 282 ? 32.356  75.160  65.647  1.00 30.60  ? 282 TYR C CZ    1 
ATOM   6839 O OH    . TYR E 3 282 ? 33.556  75.664  66.063  1.00 30.70  ? 282 TYR C OH    1 
ATOM   6840 N N     . ILE E 3 283 ? 25.809  72.827  65.856  1.00 30.94  ? 283 ILE C N     1 
ATOM   6841 C CA    . ILE E 3 283 ? 24.358  72.701  65.772  1.00 29.54  ? 283 ILE C CA    1 
ATOM   6842 C C     . ILE E 3 283 ? 23.706  73.921  65.145  1.00 30.38  ? 283 ILE C C     1 
ATOM   6843 O O     . ILE E 3 283 ? 23.483  74.930  65.801  1.00 30.36  ? 283 ILE C O     1 
ATOM   6844 C CB    . ILE E 3 283 ? 23.737  72.513  67.157  1.00 30.64  ? 283 ILE C CB    1 
ATOM   6845 C CG1   . ILE E 3 283 ? 24.670  71.720  68.072  1.00 30.50  ? 283 ILE C CG1   1 
ATOM   6846 C CG2   . ILE E 3 283 ? 22.428  71.787  67.016  1.00 31.75  ? 283 ILE C CG2   1 
ATOM   6847 C CD1   . ILE E 3 283 ? 24.799  70.270  67.699  1.00 30.41  ? 283 ILE C CD1   1 
ATOM   6848 N N     . PRO E 3 284 ? 23.356  73.838  63.851  1.00 30.27  ? 284 PRO C N     1 
ATOM   6849 C CA    . PRO E 3 284 ? 23.579  72.661  63.009  1.00 28.21  ? 284 PRO C CA    1 
ATOM   6850 C C     . PRO E 3 284 ? 24.938  72.773  62.353  1.00 29.07  ? 284 PRO C C     1 
ATOM   6851 O O     . PRO E 3 284 ? 25.627  73.766  62.531  1.00 28.88  ? 284 PRO C O     1 
ATOM   6852 C CB    . PRO E 3 284 ? 22.459  72.796  61.985  1.00 30.14  ? 284 PRO C CB    1 
ATOM   6853 C CG    . PRO E 3 284 ? 22.458  74.277  61.767  1.00 30.02  ? 284 PRO C CG    1 
ATOM   6854 C CD    . PRO E 3 284 ? 22.554  74.845  63.158  1.00 29.08  ? 284 PRO C CD    1 
ATOM   6855 N N     . PRO E 3 285 ? 25.333  71.770  61.568  1.00 28.91  ? 285 PRO C N     1 
ATOM   6856 C CA    . PRO E 3 285 ? 26.624  71.759  60.887  1.00 27.93  ? 285 PRO C CA    1 
ATOM   6857 C C     . PRO E 3 285 ? 26.884  73.054  60.130  1.00 28.17  ? 285 PRO C C     1 
ATOM   6858 O O     . PRO E 3 285 ? 26.057  73.489  59.346  1.00 28.36  ? 285 PRO C O     1 
ATOM   6859 C CB    . PRO E 3 285 ? 26.501  70.554  59.983  1.00 30.08  ? 285 PRO C CB    1 
ATOM   6860 C CG    . PRO E 3 285 ? 25.704  69.610  60.826  1.00 29.97  ? 285 PRO C CG    1 
ATOM   6861 C CD    . PRO E 3 285 ? 24.612  70.510  61.343  1.00 29.16  ? 285 PRO C CD    1 
ATOM   6862 N N     . LEU E 3 286 ? 28.052  73.648  60.366  1.00 27.93  ? 286 LEU C N     1 
ATOM   6863 C CA    . LEU E 3 286 ? 28.443  74.922  59.762  1.00 27.16  ? 286 LEU C CA    1 
ATOM   6864 C C     . LEU E 3 286 ? 28.997  74.887  58.344  1.00 28.04  ? 286 LEU C C     1 
ATOM   6865 O O     . LEU E 3 286 ? 29.906  74.117  58.034  1.00 28.16  ? 286 LEU C O     1 
ATOM   6866 C CB    . LEU E 3 286 ? 29.463  75.618  60.663  1.00 25.81  ? 286 LEU C CB    1 
ATOM   6867 C CG    . LEU E 3 286 ? 30.050  76.914  60.133  1.00 25.21  ? 286 LEU C CG    1 
ATOM   6868 C CD1   . LEU E 3 286 ? 28.974  77.944  60.050  1.00 24.32  ? 286 LEU C CD1   1 
ATOM   6869 C CD2   . LEU E 3 286 ? 31.146  77.380  61.050  1.00 25.45  ? 286 LEU C CD2   1 
ATOM   6870 N N     . THR E 3 287 ? 28.438  75.746  57.494  1.00 28.42  ? 287 THR C N     1 
ATOM   6871 C CA    . THR E 3 287 ? 28.867  75.880  56.110  1.00 28.98  ? 287 THR C CA    1 
ATOM   6872 C C     . THR E 3 287 ? 30.063  76.786  56.227  1.00 29.14  ? 287 THR C C     1 
ATOM   6873 O O     . THR E 3 287 ? 29.989  77.809  56.886  1.00 28.26  ? 287 THR C O     1 
ATOM   6874 C CB    . THR E 3 287 ? 27.810  76.599  55.255  1.00 30.21  ? 287 THR C CB    1 
ATOM   6875 O OG1   . THR E 3 287 ? 26.644  75.781  55.139  1.00 31.68  ? 287 THR C OG1   1 
ATOM   6876 C CG2   . THR E 3 287 ? 28.344  76.885  53.882  1.00 31.45  ? 287 THR C CG2   1 
ATOM   6877 N N     . THR E 3 288 ? 31.170  76.436  55.600  1.00 30.32  ? 288 THR C N     1 
ATOM   6878 C CA    . THR E 3 288 ? 32.326  77.299  55.730  1.00 32.33  ? 288 THR C CA    1 
ATOM   6879 C C     . THR E 3 288 ? 33.301  77.238  54.556  1.00 33.86  ? 288 THR C C     1 
ATOM   6880 O O     . THR E 3 288 ? 33.054  76.565  53.560  1.00 34.15  ? 288 THR C O     1 
ATOM   6881 C CB    . THR E 3 288 ? 33.053  76.977  57.049  1.00 32.11  ? 288 THR C CB    1 
ATOM   6882 O OG1   . THR E 3 288 ? 34.174  77.850  57.220  1.00 32.52  ? 288 THR C OG1   1 
ATOM   6883 C CG2   . THR E 3 288 ? 33.515  75.545  57.057  1.00 33.01  ? 288 THR C CG2   1 
ATOM   6884 N N     . ILE E 3 289 ? 34.399  77.973  54.678  1.00 35.20  ? 289 ILE C N     1 
ATOM   6885 C CA    . ILE E 3 289 ? 35.434  78.028  53.661  1.00 36.05  ? 289 ILE C CA    1 
ATOM   6886 C C     . ILE E 3 289 ? 36.605  77.179  54.134  1.00 37.28  ? 289 ILE C C     1 
ATOM   6887 O O     . ILE E 3 289 ? 37.209  77.460  55.155  1.00 37.05  ? 289 ILE C O     1 
ATOM   6888 C CB    . ILE E 3 289 ? 35.879  79.484  53.454  1.00 35.84  ? 289 ILE C CB    1 
ATOM   6889 C CG1   . ILE E 3 289 ? 34.664  80.335  53.097  1.00 35.85  ? 289 ILE C CG1   1 
ATOM   6890 C CG2   . ILE E 3 289 ? 36.889  79.582  52.341  1.00 35.81  ? 289 ILE C CG2   1 
ATOM   6891 C CD1   . ILE E 3 289 ? 33.942  79.844  51.871  1.00 36.49  ? 289 ILE C CD1   1 
ATOM   6892 N N     . LYS E 3 290 ? 36.927  76.141  53.381  1.00 38.99  ? 290 LYS C N     1 
ATOM   6893 C CA    . LYS E 3 290 ? 38.006  75.236  53.751  1.00 41.22  ? 290 LYS C CA    1 
ATOM   6894 C C     . LYS E 3 290 ? 39.423  75.715  53.475  1.00 41.74  ? 290 LYS C C     1 
ATOM   6895 O O     . LYS E 3 290 ? 39.757  76.048  52.340  1.00 43.01  ? 290 LYS C O     1 
ATOM   6896 C CB    . LYS E 3 290 ? 37.810  73.896  53.049  1.00 43.44  ? 290 LYS C CB    1 
ATOM   6897 C CG    . LYS E 3 290 ? 38.807  72.836  53.472  1.00 48.12  ? 290 LYS C CG    1 
ATOM   6898 C CD    . LYS E 3 290 ? 38.571  71.500  52.762  1.00 52.52  ? 290 LYS C CD    1 
ATOM   6899 C CE    . LYS E 3 290 ? 39.617  70.434  53.148  1.00 55.12  ? 290 LYS C CE    1 
ATOM   6900 N NZ    . LYS E 3 290 ? 39.607  69.229  52.243  1.00 57.27  ? 290 LYS C NZ    1 
ATOM   6901 N N     . GLN E 3 291 ? 40.257  75.718  54.511  1.00 41.41  ? 291 GLN C N     1 
ATOM   6902 C CA    . GLN E 3 291 ? 41.650  76.118  54.376  1.00 41.14  ? 291 GLN C CA    1 
ATOM   6903 C C     . GLN E 3 291 ? 42.504  74.945  54.854  1.00 41.13  ? 291 GLN C C     1 
ATOM   6904 O O     . GLN E 3 291 ? 42.655  74.716  56.051  1.00 40.55  ? 291 GLN C O     1 
ATOM   6905 C CB    . GLN E 3 291 ? 41.932  77.351  55.222  1.00 41.38  ? 291 GLN C CB    1 
ATOM   6906 C CG    . GLN E 3 291 ? 41.062  78.548  54.918  1.00 40.70  ? 291 GLN C CG    1 
ATOM   6907 C CD    . GLN E 3 291 ? 41.614  79.816  55.526  1.00 41.16  ? 291 GLN C CD    1 
ATOM   6908 O OE1   . GLN E 3 291 ? 42.242  80.622  54.846  1.00 41.74  ? 291 GLN C OE1   1 
ATOM   6909 N NE2   . GLN E 3 291 ? 41.394  79.993  56.819  1.00 41.25  ? 291 GLN C NE2   1 
ATOM   6910 N N     . ASP E 3 292 ? 43.068  74.208  53.908  1.00 41.36  ? 292 ASP C N     1 
ATOM   6911 C CA    . ASP E 3 292 ? 43.861  73.025  54.224  1.00 41.56  ? 292 ASP C CA    1 
ATOM   6912 C C     . ASP E 3 292 ? 45.179  73.285  54.936  1.00 41.19  ? 292 ASP C C     1 
ATOM   6913 O O     . ASP E 3 292 ? 46.238  73.239  54.332  1.00 41.00  ? 292 ASP C O     1 
ATOM   6914 C CB    . ASP E 3 292 ? 44.102  72.234  52.936  1.00 42.81  ? 292 ASP C CB    1 
ATOM   6915 C CG    . ASP E 3 292 ? 44.655  70.865  53.197  1.00 44.53  ? 292 ASP C CG    1 
ATOM   6916 O OD1   . ASP E 3 292 ? 44.576  70.007  52.286  1.00 45.03  ? 292 ASP C OD1   1 
ATOM   6917 O OD2   . ASP E 3 292 ? 45.169  70.657  54.317  1.00 46.07  ? 292 ASP C OD2   1 
ATOM   6918 N N     . PHE E 3 293 ? 45.119  73.534  56.234  1.00 41.48  ? 293 PHE C N     1 
ATOM   6919 C CA    . PHE E 3 293 ? 46.332  73.799  56.996  1.00 43.03  ? 293 PHE C CA    1 
ATOM   6920 C C     . PHE E 3 293 ? 47.475  72.821  56.720  1.00 44.98  ? 293 PHE C C     1 
ATOM   6921 O O     . PHE E 3 293 ? 48.634  73.220  56.700  1.00 44.99  ? 293 PHE C O     1 
ATOM   6922 C CB    . PHE E 3 293 ? 46.043  73.794  58.494  1.00 40.86  ? 293 PHE C CB    1 
ATOM   6923 C CG    . PHE E 3 293 ? 45.008  74.785  58.920  1.00 38.62  ? 293 PHE C CG    1 
ATOM   6924 C CD1   . PHE E 3 293 ? 43.749  74.360  59.320  1.00 37.65  ? 293 PHE C CD1   1 
ATOM   6925 C CD2   . PHE E 3 293 ? 45.299  76.132  58.956  1.00 38.25  ? 293 PHE C CD2   1 
ATOM   6926 C CE1   . PHE E 3 293 ? 42.803  75.250  59.749  1.00 37.86  ? 293 PHE C CE1   1 
ATOM   6927 C CE2   . PHE E 3 293 ? 44.350  77.038  59.389  1.00 38.42  ? 293 PHE C CE2   1 
ATOM   6928 C CZ    . PHE E 3 293 ? 43.101  76.600  59.787  1.00 38.38  ? 293 PHE C CZ    1 
ATOM   6929 N N     . ARG E 3 294 ? 47.163  71.544  56.521  1.00 48.15  ? 294 ARG C N     1 
ATOM   6930 C CA    . ARG E 3 294 ? 48.209  70.554  56.252  1.00 51.30  ? 294 ARG C CA    1 
ATOM   6931 C C     . ARG E 3 294 ? 49.013  70.964  55.015  1.00 49.76  ? 294 ARG C C     1 
ATOM   6932 O O     . ARG E 3 294 ? 50.245  70.914  55.005  1.00 49.95  ? 294 ARG C O     1 
ATOM   6933 C CB    . ARG E 3 294 ? 47.600  69.163  56.002  1.00 57.02  ? 294 ARG C CB    1 
ATOM   6934 C CG    . ARG E 3 294 ? 47.072  68.415  57.226  1.00 65.11  ? 294 ARG C CG    1 
ATOM   6935 C CD    . ARG E 3 294 ? 48.049  67.312  57.634  1.00 73.18  ? 294 ARG C CD    1 
ATOM   6936 N NE    . ARG E 3 294 ? 48.966  67.628  58.707  1.00 80.87  ? 294 ARG C NE    1 
ATOM   6937 C CZ    . ARG E 3 294 ? 50.166  67.103  58.989  1.00 84.19  ? 294 ARG C CZ    1 
ATOM   6938 N NH1   . ARG E 3 294 ? 50.767  66.148  58.264  1.00 85.00  ? 294 ARG C NH1   1 
ATOM   6939 N NH2   . ARG E 3 294 ? 50.747  67.545  60.102  1.00 86.09  ? 294 ARG C NH2   1 
ATOM   6940 N N     . LEU E 3 295 ? 48.292  71.361  53.972  1.00 47.66  ? 295 LEU C N     1 
ATOM   6941 C CA    . LEU E 3 295 ? 48.886  71.760  52.708  1.00 45.15  ? 295 LEU C CA    1 
ATOM   6942 C C     . LEU E 3 295 ? 49.780  72.961  52.900  1.00 44.03  ? 295 LEU C C     1 
ATOM   6943 O O     . LEU E 3 295 ? 50.912  72.982  52.428  1.00 44.33  ? 295 LEU C O     1 
ATOM   6944 C CB    . LEU E 3 295 ? 47.783  72.079  51.698  1.00 44.52  ? 295 LEU C CB    1 
ATOM   6945 C CG    . LEU E 3 295 ? 48.181  72.513  50.291  1.00 44.14  ? 295 LEU C CG    1 
ATOM   6946 C CD1   . LEU E 3 295 ? 49.126  71.501  49.695  1.00 44.91  ? 295 LEU C CD1   1 
ATOM   6947 C CD2   . LEU E 3 295 ? 46.935  72.639  49.430  1.00 44.07  ? 295 LEU C CD2   1 
ATOM   6948 N N     . LEU E 3 296 ? 49.269  73.965  53.595  1.00 42.47  ? 296 LEU C N     1 
ATOM   6949 C CA    . LEU E 3 296 ? 50.045  75.163  53.841  1.00 41.40  ? 296 LEU C CA    1 
ATOM   6950 C C     . LEU E 3 296 ? 51.357  74.770  54.499  1.00 42.37  ? 296 LEU C C     1 
ATOM   6951 O O     . LEU E 3 296 ? 52.435  75.009  53.967  1.00 42.23  ? 296 LEU C O     1 
ATOM   6952 C CB    . LEU E 3 296 ? 49.274  76.104  54.750  1.00 39.35  ? 296 LEU C CB    1 
ATOM   6953 C CG    . LEU E 3 296 ? 50.104  77.285  55.208  1.00 37.60  ? 296 LEU C CG    1 
ATOM   6954 C CD1   . LEU E 3 296 ? 50.489  78.084  54.009  1.00 37.01  ? 296 LEU C CD1   1 
ATOM   6955 C CD2   . LEU E 3 296 ? 49.326  78.124  56.178  1.00 37.84  ? 296 LEU C CD2   1 
ATOM   6956 N N     . GLY E 3 297 ? 51.256  74.140  55.657  1.00 43.71  ? 297 GLY C N     1 
ATOM   6957 C CA    . GLY E 3 297 ? 52.443  73.720  56.375  1.00 45.27  ? 297 GLY C CA    1 
ATOM   6958 C C     . GLY E 3 297 ? 53.384  72.883  55.536  1.00 46.18  ? 297 GLY C C     1 
ATOM   6959 O O     . GLY E 3 297 ? 54.583  73.120  55.555  1.00 46.85  ? 297 GLY C O     1 
ATOM   6960 N N     . GLN E 3 298 ? 52.849  71.905  54.809  1.00 47.00  ? 298 GLN C N     1 
ATOM   6961 C CA    . GLN E 3 298 ? 53.668  71.044  53.964  1.00 48.21  ? 298 GLN C CA    1 
ATOM   6962 C C     . GLN E 3 298 ? 54.350  71.894  52.899  1.00 48.04  ? 298 GLN C C     1 
ATOM   6963 O O     . GLN E 3 298 ? 55.571  71.848  52.736  1.00 48.58  ? 298 GLN C O     1 
ATOM   6964 C CB    . GLN E 3 298 ? 52.799  69.956  53.306  1.00 50.39  ? 298 GLN C CB    1 
ATOM   6965 C CG    . GLN E 3 298 ? 53.552  68.986  52.380  1.00 55.43  ? 298 GLN C CG    1 
ATOM   6966 C CD    . GLN E 3 298 ? 53.453  69.354  50.891  1.00 59.20  ? 298 GLN C CD    1 
ATOM   6967 O OE1   . GLN E 3 298 ? 52.383  69.244  50.279  1.00 61.54  ? 298 GLN C OE1   1 
ATOM   6968 N NE2   . GLN E 3 298 ? 54.575  69.790  50.303  1.00 61.00  ? 298 GLN C NE2   1 
ATOM   6969 N N     . THR E 3 299 ? 53.561  72.687  52.184  1.00 46.93  ? 299 THR C N     1 
ATOM   6970 C CA    . THR E 3 299 ? 54.108  73.525  51.136  1.00 45.04  ? 299 THR C CA    1 
ATOM   6971 C C     . THR E 3 299 ? 55.161  74.458  51.700  1.00 45.29  ? 299 THR C C     1 
ATOM   6972 O O     . THR E 3 299 ? 56.230  74.586  51.128  1.00 45.31  ? 299 THR C O     1 
ATOM   6973 C CB    . THR E 3 299 ? 53.003  74.320  50.439  1.00 43.85  ? 299 THR C CB    1 
ATOM   6974 O OG1   . THR E 3 299 ? 52.080  73.410  49.834  1.00 42.33  ? 299 THR C OG1   1 
ATOM   6975 C CG2   . THR E 3 299 ? 53.580  75.200  49.370  1.00 43.54  ? 299 THR C CG2   1 
ATOM   6976 N N     . SER E 3 300 ? 54.885  75.080  52.838  1.00 45.37  ? 300 SER C N     1 
ATOM   6977 C CA    . SER E 3 300 ? 55.853  75.991  53.431  1.00 46.67  ? 300 SER C CA    1 
ATOM   6978 C C     . SER E 3 300 ? 57.247  75.418  53.611  1.00 47.94  ? 300 SER C C     1 
ATOM   6979 O O     . SER E 3 300 ? 58.228  76.098  53.329  1.00 48.87  ? 300 SER C O     1 
ATOM   6980 C CB    . SER E 3 300 ? 55.368  76.490  54.778  1.00 47.14  ? 300 SER C CB    1 
ATOM   6981 O OG    . SER E 3 300 ? 54.275  77.353  54.598  1.00 49.78  ? 300 SER C OG    1 
ATOM   6982 N N     . VAL E 3 301 ? 57.359  74.184  54.090  1.00 48.56  ? 301 VAL C N     1 
ATOM   6983 C CA    . VAL E 3 301 ? 58.684  73.612  54.280  1.00 48.70  ? 301 VAL C CA    1 
ATOM   6984 C C     . VAL E 3 301 ? 59.316  73.333  52.925  1.00 50.17  ? 301 VAL C C     1 
ATOM   6985 O O     . VAL E 3 301 ? 60.447  73.734  52.689  1.00 50.80  ? 301 VAL C O     1 
ATOM   6986 C CB    . VAL E 3 301 ? 58.649  72.325  55.133  1.00 48.39  ? 301 VAL C CB    1 
ATOM   6987 C CG1   . VAL E 3 301 ? 60.020  71.686  55.162  1.00 48.52  ? 301 VAL C CG1   1 
ATOM   6988 C CG2   . VAL E 3 301 ? 58.235  72.658  56.555  1.00 47.50  ? 301 VAL C CG2   1 
ATOM   6989 N N     . ASP E 3 302 ? 58.590  72.671  52.029  1.00 51.02  ? 302 ASP C N     1 
ATOM   6990 C CA    . ASP E 3 302 ? 59.122  72.379  50.698  1.00 52.95  ? 302 ASP C CA    1 
ATOM   6991 C C     . ASP E 3 302 ? 59.706  73.622  50.061  1.00 54.18  ? 302 ASP C C     1 
ATOM   6992 O O     . ASP E 3 302 ? 60.820  73.610  49.548  1.00 54.99  ? 302 ASP C O     1 
ATOM   6993 C CB    . ASP E 3 302 ? 58.026  71.842  49.794  1.00 54.07  ? 302 ASP C CB    1 
ATOM   6994 C CG    . ASP E 3 302 ? 57.656  70.430  50.128  1.00 55.50  ? 302 ASP C CG    1 
ATOM   6995 O OD1   . ASP E 3 302 ? 57.932  70.006  51.269  1.00 56.02  ? 302 ASP C OD1   1 
ATOM   6996 O OD2   . ASP E 3 302 ? 57.082  69.745  49.258  1.00 55.79  ? 302 ASP C OD2   1 
ATOM   6997 N N     . ARG E 3 303 ? 58.940  74.702  50.093  1.00 55.16  ? 303 ARG C N     1 
ATOM   6998 C CA    . ARG E 3 303 ? 59.385  75.955  49.513  1.00 55.71  ? 303 ARG C CA    1 
ATOM   6999 C C     . ARG E 3 303 ? 60.584  76.568  50.223  1.00 56.24  ? 303 ARG C C     1 
ATOM   7000 O O     . ARG E 3 303 ? 61.505  77.014  49.557  1.00 56.55  ? 303 ARG C O     1 
ATOM   7001 C CB    . ARG E 3 303 ? 58.244  76.961  49.491  1.00 56.15  ? 303 ARG C CB    1 
ATOM   7002 C CG    . ARG E 3 303 ? 58.698  78.359  49.148  1.00 57.23  ? 303 ARG C CG    1 
ATOM   7003 C CD    . ARG E 3 303 ? 58.483  78.740  47.700  1.00 58.20  ? 303 ARG C CD    1 
ATOM   7004 N NE    . ARG E 3 303 ? 57.185  79.331  47.506  1.00 59.18  ? 303 ARG C NE    1 
ATOM   7005 C CZ    . ARG E 3 303 ? 56.815  80.603  47.413  1.00 59.73  ? 303 ARG C CZ    1 
ATOM   7006 N NH1   . ARG E 3 303 ? 57.639  81.643  47.473  1.00 59.34  ? 303 ARG C NH1   1 
ATOM   7007 N NH2   . ARG E 3 303 ? 55.520  80.797  47.292  1.00 60.48  ? 303 ARG C NH2   1 
ATOM   7008 N N     . LEU E 3 304 ? 60.589  76.601  51.557  1.00 56.87  ? 304 LEU C N     1 
ATOM   7009 C CA    . LEU E 3 304 ? 61.729  77.188  52.269  1.00 58.21  ? 304 LEU C CA    1 
ATOM   7010 C C     . LEU E 3 304 ? 63.017  76.464  51.927  1.00 59.99  ? 304 LEU C C     1 
ATOM   7011 O O     . LEU E 3 304 ? 64.086  77.058  51.978  1.00 60.79  ? 304 LEU C O     1 
ATOM   7012 C CB    . LEU E 3 304 ? 61.548  77.165  53.791  1.00 57.53  ? 304 LEU C CB    1 
ATOM   7013 C CG    . LEU E 3 304 ? 62.674  77.877  54.558  1.00 56.76  ? 304 LEU C CG    1 
ATOM   7014 C CD1   . LEU E 3 304 ? 62.663  79.353  54.241  1.00 56.15  ? 304 LEU C CD1   1 
ATOM   7015 C CD2   . LEU E 3 304 ? 62.494  77.695  56.041  1.00 57.49  ? 304 LEU C CD2   1 
ATOM   7016 N N     . LEU E 3 305 ? 62.921  75.183  51.585  1.00 62.16  ? 305 LEU C N     1 
ATOM   7017 C CA    . LEU E 3 305 ? 64.107  74.412  51.218  1.00 64.27  ? 305 LEU C CA    1 
ATOM   7018 C C     . LEU E 3 305 ? 64.538  74.778  49.808  1.00 65.95  ? 305 LEU C C     1 
ATOM   7019 O O     . LEU E 3 305 ? 65.727  74.902  49.533  1.00 66.28  ? 305 LEU C O     1 
ATOM   7020 C CB    . LEU E 3 305 ? 63.837  72.909  51.294  1.00 63.83  ? 305 LEU C CB    1 
ATOM   7021 C CG    . LEU E 3 305 ? 63.562  72.356  52.691  1.00 64.48  ? 305 LEU C CG    1 
ATOM   7022 C CD1   . LEU E 3 305 ? 63.335  70.857  52.596  1.00 64.31  ? 305 LEU C CD1   1 
ATOM   7023 C CD2   . LEU E 3 305 ? 64.730  72.676  53.622  1.00 64.93  ? 305 LEU C CD2   1 
ATOM   7024 N N     . GLN E 3 306 ? 63.566  74.953  48.918  1.00 67.99  ? 306 GLN C N     1 
ATOM   7025 C CA    . GLN E 3 306 ? 63.862  75.324  47.544  1.00 70.46  ? 306 GLN C CA    1 
ATOM   7026 C C     . GLN E 3 306 ? 64.596  76.655  47.542  1.00 72.32  ? 306 GLN C C     1 
ATOM   7027 O O     . GLN E 3 306 ? 65.628  76.797  46.896  1.00 72.88  ? 306 GLN C O     1 
ATOM   7028 C CB    . GLN E 3 306 ? 62.575  75.439  46.736  1.00 70.86  ? 306 GLN C CB    1 
ATOM   7029 C CG    . GLN E 3 306 ? 61.841  74.119  46.572  1.00 72.79  ? 306 GLN C CG    1 
ATOM   7030 C CD    . GLN E 3 306 ? 60.510  74.277  45.862  1.00 74.24  ? 306 GLN C CD    1 
ATOM   7031 O OE1   . GLN E 3 306 ? 59.800  73.300  45.607  1.00 74.38  ? 306 GLN C OE1   1 
ATOM   7032 N NE2   . GLN E 3 306 ? 60.162  75.516  45.539  1.00 75.84  ? 306 GLN C NE2   1 
ATOM   7033 N N     . LEU E 3 307 ? 64.074  77.632  48.275  1.00 74.74  ? 307 LEU C N     1 
ATOM   7034 C CA    . LEU E 3 307 ? 64.718  78.940  48.344  1.00 77.18  ? 307 LEU C CA    1 
ATOM   7035 C C     . LEU E 3 307 ? 66.129  78.819  48.910  1.00 79.29  ? 307 LEU C C     1 
ATOM   7036 O O     . LEU E 3 307 ? 67.046  79.465  48.420  1.00 79.86  ? 307 LEU C O     1 
ATOM   7037 C CB    . LEU E 3 307 ? 63.904  79.911  49.209  1.00 76.78  ? 307 LEU C CB    1 
ATOM   7038 C CG    . LEU E 3 307 ? 62.532  80.371  48.709  1.00 76.55  ? 307 LEU C CG    1 
ATOM   7039 C CD1   . LEU E 3 307 ? 61.880  81.217  49.788  1.00 77.01  ? 307 LEU C CD1   1 
ATOM   7040 C CD2   . LEU E 3 307 ? 62.664  81.163  47.425  1.00 75.92  ? 307 LEU C CD2   1 
ATOM   7041 N N     . SER E 3 308 ? 66.304  77.988  49.934  1.00 81.90  ? 308 SER C N     1 
ATOM   7042 C CA    . SER E 3 308 ? 67.619  77.804  50.552  1.00 84.81  ? 308 SER C CA    1 
ATOM   7043 C C     . SER E 3 308 ? 68.624  77.266  49.535  1.00 86.74  ? 308 SER C C     1 
ATOM   7044 O O     . SER E 3 308 ? 69.833  77.444  49.681  1.00 86.72  ? 308 SER C O     1 
ATOM   7045 C CB    . SER E 3 308 ? 67.522  76.845  51.746  1.00 85.09  ? 308 SER C CB    1 
ATOM   7046 O OG    . SER E 3 308 ? 68.719  76.855  52.514  1.00 85.40  ? 308 SER C OG    1 
ATOM   7047 N N     . GLN E 3 309 ? 68.107  76.605  48.506  1.00 89.42  ? 309 GLN C N     1 
ATOM   7048 C CA    . GLN E 3 309 ? 68.931  76.047  47.440  1.00 92.26  ? 309 GLN C CA    1 
ATOM   7049 C C     . GLN E 3 309 ? 68.949  76.978  46.237  1.00 93.38  ? 309 GLN C C     1 
ATOM   7050 O O     . GLN E 3 309 ? 69.086  76.529  45.099  1.00 93.00  ? 309 GLN C O     1 
ATOM   7051 C CB    . GLN E 3 309 ? 68.388  74.693  46.996  1.00 94.09  ? 309 GLN C CB    1 
ATOM   7052 C CG    . GLN E 3 309 ? 68.754  73.529  47.896  1.00 97.19  ? 309 GLN C CG    1 
ATOM   7053 C CD    . GLN E 3 309 ? 68.056  72.243  47.473  1.00 99.01  ? 309 GLN C CD    1 
ATOM   7054 O OE1   . GLN E 3 309 ? 67.692  72.077  46.297  1.00 99.63  ? 309 GLN C OE1   1 
ATOM   7055 N NE2   . GLN E 3 309 ? 67.874  71.317  48.427  1.00 99.84  ? 309 GLN C NE2   1 
ATOM   7056 N N     . GLY E 3 310 ? 68.796  78.271  46.493  1.00 95.09  ? 310 GLY C N     1 
ATOM   7057 C CA    . GLY E 3 310 ? 68.808  79.250  45.421  1.00 97.15  ? 310 GLY C CA    1 
ATOM   7058 C C     . GLY E 3 310 ? 67.947  78.906  44.219  1.00 98.65  ? 310 GLY C C     1 
ATOM   7059 O O     . GLY E 3 310 ? 68.272  79.291  43.100  1.00 98.81  ? 310 GLY C O     1 
ATOM   7060 N N     . GLN E 3 311 ? 66.858  78.173  44.439  1.00 100.21 ? 311 GLN C N     1 
ATOM   7061 C CA    . GLN E 3 311 ? 65.941  77.806  43.354  1.00 101.56 ? 311 GLN C CA    1 
ATOM   7062 C C     . GLN E 3 311 ? 65.074  79.048  43.070  1.00 101.40 ? 311 GLN C C     1 
ATOM   7063 O O     . GLN E 3 311 ? 64.659  79.755  43.997  1.00 101.83 ? 311 GLN C O     1 
ATOM   7064 C CB    . GLN E 3 311 ? 65.063  76.618  43.787  1.00 103.61 ? 311 GLN C CB    1 
ATOM   7065 C CG    . GLN E 3 311 ? 64.400  75.820  42.651  1.00 106.05 ? 311 GLN C CG    1 
ATOM   7066 C CD    . GLN E 3 311 ? 63.662  74.562  43.155  1.00 107.72 ? 311 GLN C CD    1 
ATOM   7067 O OE1   . GLN E 3 311 ? 64.267  73.663  43.768  1.00 108.66 ? 311 GLN C OE1   1 
ATOM   7068 N NE2   . GLN E 3 311 ? 62.354  74.497  42.894  1.00 108.06 ? 311 GLN C NE2   1 
ATOM   7069 N N     . ALA E 3 312 ? 64.813  79.317  41.794  1.00 100.77 ? 312 ALA C N     1 
ATOM   7070 C CA    . ALA E 3 312 ? 64.028  80.490  41.391  1.00 99.48  ? 312 ALA C CA    1 
ATOM   7071 C C     . ALA E 3 312 ? 62.512  80.332  41.577  1.00 97.96  ? 312 ALA C C     1 
ATOM   7072 O O     . ALA E 3 312 ? 61.773  80.041  40.630  1.00 98.57  ? 312 ALA C O     1 
ATOM   7073 C CB    . ALA E 3 312 ? 64.347  80.848  39.931  1.00 100.44 ? 312 ALA C CB    1 
ATOM   7074 N N     . VAL E 3 313 ? 62.056  80.543  42.804  1.00 95.18  ? 313 VAL C N     1 
ATOM   7075 C CA    . VAL E 3 313 ? 60.643  80.431  43.136  1.00 92.04  ? 313 VAL C CA    1 
ATOM   7076 C C     . VAL E 3 313 ? 60.268  81.610  44.041  1.00 90.06  ? 313 VAL C C     1 
ATOM   7077 O O     . VAL E 3 313 ? 59.467  81.467  44.968  1.00 90.05  ? 313 VAL C O     1 
ATOM   7078 C CB    . VAL E 3 313 ? 60.366  79.081  43.855  1.00 91.84  ? 313 VAL C CB    1 
ATOM   7079 C CG1   . VAL E 3 313 ? 60.551  77.922  42.878  1.00 91.22  ? 313 VAL C CG1   1 
ATOM   7080 C CG2   . VAL E 3 313 ? 61.328  78.903  45.036  1.00 91.89  ? 313 VAL C CG2   1 
ATOM   7081 N N     . LYS E 3 314 ? 60.861  82.774  43.757  1.00 87.42  ? 314 LYS C N     1 
ATOM   7082 C CA    . LYS E 3 314 ? 60.633  84.002  44.534  1.00 84.36  ? 314 LYS C CA    1 
ATOM   7083 C C     . LYS E 3 314 ? 59.243  84.583  44.324  1.00 80.61  ? 314 LYS C C     1 
ATOM   7084 O O     . LYS E 3 314 ? 58.634  84.395  43.277  1.00 79.63  ? 314 LYS C O     1 
ATOM   7085 C CB    . LYS E 3 314 ? 61.679  85.086  44.179  1.00 86.33  ? 314 LYS C CB    1 
ATOM   7086 C CG    . LYS E 3 314 ? 63.117  84.875  44.729  1.00 88.77  ? 314 LYS C CG    1 
ATOM   7087 C CD    . LYS E 3 314 ? 63.250  85.165  46.252  1.00 90.51  ? 314 LYS C CD    1 
ATOM   7088 C CE    . LYS E 3 314 ? 64.699  84.957  46.770  1.00 91.36  ? 314 LYS C CE    1 
ATOM   7089 N NZ    . LYS E 3 314 ? 64.853  85.062  48.266  1.00 91.04  ? 314 LYS C NZ    1 
ATOM   7090 N N     . GLY E 3 315 ? 58.743  85.283  45.335  1.00 77.00  ? 315 GLY C N     1 
ATOM   7091 C CA    . GLY E 3 315 ? 57.435  85.900  45.219  1.00 72.70  ? 315 GLY C CA    1 
ATOM   7092 C C     . GLY E 3 315 ? 56.355  85.405  46.163  1.00 69.79  ? 315 GLY C C     1 
ATOM   7093 O O     . GLY E 3 315 ? 56.639  84.838  47.228  1.00 69.53  ? 315 GLY C O     1 
ATOM   7094 N N     . ASN E 3 316 ? 55.105  85.639  45.759  1.00 66.41  ? 316 ASN C N     1 
ATOM   7095 C CA    . ASN E 3 316 ? 53.938  85.239  46.530  1.00 63.26  ? 316 ASN C CA    1 
ATOM   7096 C C     . ASN E 3 316 ? 53.165  84.129  45.850  1.00 61.51  ? 316 ASN C C     1 
ATOM   7097 O O     . ASN E 3 316 ? 52.941  84.167  44.644  1.00 60.50  ? 316 ASN C O     1 
ATOM   7098 C CB    . ASN E 3 316 ? 53.009  86.428  46.747  1.00 62.83  ? 316 ASN C CB    1 
ATOM   7099 C CG    . ASN E 3 316 ? 51.574  86.005  47.004  1.00 62.60  ? 316 ASN C CG    1 
ATOM   7100 O OD1   . ASN E 3 316 ? 50.811  85.768  46.071  1.00 61.55  ? 316 ASN C OD1   1 
ATOM   7101 N ND2   . ASN E 3 316 ? 51.207  85.894  48.273  1.00 63.63  ? 316 ASN C ND2   1 
ATOM   7102 N N     . GLN E 3 317 ? 52.739  83.153  46.647  1.00 60.17  ? 317 GLN C N     1 
ATOM   7103 C CA    . GLN E 3 317 ? 51.993  82.003  46.147  1.00 58.38  ? 317 GLN C CA    1 
ATOM   7104 C C     . GLN E 3 317 ? 50.613  81.953  46.773  1.00 55.63  ? 317 GLN C C     1 
ATOM   7105 O O     . GLN E 3 317 ? 50.437  82.289  47.944  1.00 55.10  ? 317 GLN C O     1 
ATOM   7106 C CB    . GLN E 3 317 ? 52.738  80.702  46.486  1.00 61.37  ? 317 GLN C CB    1 
ATOM   7107 C CG    . GLN E 3 317 ? 52.433  79.511  45.567  1.00 64.14  ? 317 GLN C CG    1 
ATOM   7108 C CD    . GLN E 3 317 ? 53.103  78.221  46.031  1.00 65.54  ? 317 GLN C CD    1 
ATOM   7109 O OE1   . GLN E 3 317 ? 54.268  78.222  46.449  1.00 65.71  ? 317 GLN C OE1   1 
ATOM   7110 N NE2   . GLN E 3 317 ? 52.369  77.111  45.946  1.00 66.38  ? 317 GLN C NE2   1 
ATOM   7111 N N     . LEU E 3 318 ? 49.639  81.520  45.985  1.00 52.45  ? 318 LEU C N     1 
ATOM   7112 C CA    . LEU E 3 318 ? 48.274  81.402  46.462  1.00 49.58  ? 318 LEU C CA    1 
ATOM   7113 C C     . LEU E 3 318 ? 47.794  79.945  46.530  1.00 48.03  ? 318 LEU C C     1 
ATOM   7114 O O     . LEU E 3 318 ? 47.864  79.206  45.540  1.00 49.10  ? 318 LEU C O     1 
ATOM   7115 C CB    . LEU E 3 318 ? 47.351  82.224  45.569  1.00 48.91  ? 318 LEU C CB    1 
ATOM   7116 C CG    . LEU E 3 318 ? 46.936  83.586  46.136  1.00 49.07  ? 318 LEU C CG    1 
ATOM   7117 C CD1   . LEU E 3 318 ? 48.124  84.279  46.800  1.00 49.56  ? 318 LEU C CD1   1 
ATOM   7118 C CD2   . LEU E 3 318 ? 46.358  84.442  45.017  1.00 49.06  ? 318 LEU C CD2   1 
ATOM   7119 N N     . LEU E 3 319 ? 47.331  79.536  47.714  1.00 44.58  ? 319 LEU C N     1 
ATOM   7120 C CA    . LEU E 3 319 ? 46.821  78.188  47.950  1.00 40.64  ? 319 LEU C CA    1 
ATOM   7121 C C     . LEU E 3 319 ? 45.321  78.218  47.800  1.00 38.96  ? 319 LEU C C     1 
ATOM   7122 O O     . LEU E 3 319 ? 44.658  79.087  48.337  1.00 39.29  ? 319 LEU C O     1 
ATOM   7123 C CB    . LEU E 3 319 ? 47.174  77.726  49.352  1.00 38.74  ? 319 LEU C CB    1 
ATOM   7124 C CG    . LEU E 3 319 ? 48.417  76.865  49.485  1.00 38.08  ? 319 LEU C CG    1 
ATOM   7125 C CD1   . LEU E 3 319 ? 49.486  77.343  48.549  1.00 38.77  ? 319 LEU C CD1   1 
ATOM   7126 C CD2   . LEU E 3 319 ? 48.889  76.906  50.915  1.00 38.39  ? 319 LEU C CD2   1 
ATOM   7127 N N     . PRO E 3 320 ? 44.764  77.265  47.065  1.00 36.70  ? 320 PRO C N     1 
ATOM   7128 C CA    . PRO E 3 320 ? 43.328  77.190  46.840  1.00 35.45  ? 320 PRO C CA    1 
ATOM   7129 C C     . PRO E 3 320 ? 42.535  76.967  48.111  1.00 34.53  ? 320 PRO C C     1 
ATOM   7130 O O     . PRO E 3 320 ? 43.065  76.490  49.106  1.00 33.87  ? 320 PRO C O     1 
ATOM   7131 C CB    . PRO E 3 320 ? 43.208  76.017  45.891  1.00 35.78  ? 320 PRO C CB    1 
ATOM   7132 C CG    . PRO E 3 320 ? 44.277  75.114  46.392  1.00 36.12  ? 320 PRO C CG    1 
ATOM   7133 C CD    . PRO E 3 320 ? 45.429  76.065  46.546  1.00 37.10  ? 320 PRO C CD    1 
ATOM   7134 N N     . VAL E 3 321 ? 41.257  77.330  48.057  1.00 33.82  ? 321 VAL C N     1 
ATOM   7135 C CA    . VAL E 3 321 ? 40.322  77.157  49.163  1.00 33.54  ? 321 VAL C CA    1 
ATOM   7136 C C     . VAL E 3 321 ? 39.041  76.684  48.515  1.00 33.68  ? 321 VAL C C     1 
ATOM   7137 O O     . VAL E 3 321 ? 38.951  76.637  47.295  1.00 33.04  ? 321 VAL C O     1 
ATOM   7138 C CB    . VAL E 3 321 ? 40.031  78.455  49.886  1.00 33.51  ? 321 VAL C CB    1 
ATOM   7139 C CG1   . VAL E 3 321 ? 41.321  79.110  50.304  1.00 34.51  ? 321 VAL C CG1   1 
ATOM   7140 C CG2   . VAL E 3 321 ? 39.233  79.361  49.002  1.00 34.43  ? 321 VAL C CG2   1 
ATOM   7141 N N     . SER E 3 322 ? 38.045  76.343  49.316  1.00 35.08  ? 322 SER C N     1 
ATOM   7142 C CA    . SER E 3 322 ? 36.800  75.840  48.749  1.00 37.26  ? 322 SER C CA    1 
ATOM   7143 C C     . SER E 3 322 ? 35.606  75.963  49.670  1.00 38.52  ? 322 SER C C     1 
ATOM   7144 O O     . SER E 3 322 ? 35.754  76.098  50.887  1.00 38.58  ? 322 SER C O     1 
ATOM   7145 C CB    . SER E 3 322 ? 36.963  74.378  48.391  1.00 38.23  ? 322 SER C CB    1 
ATOM   7146 O OG    . SER E 3 322 ? 37.311  73.646  49.558  1.00 39.24  ? 322 SER C OG    1 
ATOM   7147 N N     . LEU E 3 323 ? 34.417  75.889  49.080  1.00 39.74  ? 323 LEU C N     1 
ATOM   7148 C CA    . LEU E 3 323 ? 33.188  76.003  49.847  1.00 41.11  ? 323 LEU C CA    1 
ATOM   7149 C C     . LEU E 3 323 ? 32.689  74.640  50.262  1.00 42.42  ? 323 LEU C C     1 
ATOM   7150 O O     . LEU E 3 323 ? 32.618  73.722  49.454  1.00 42.27  ? 323 LEU C O     1 
ATOM   7151 C CB    . LEU E 3 323 ? 32.110  76.710  49.037  1.00 40.36  ? 323 LEU C CB    1 
ATOM   7152 C CG    . LEU E 3 323 ? 30.757  76.810  49.723  1.00 40.18  ? 323 LEU C CG    1 
ATOM   7153 C CD1   . LEU E 3 323 ? 30.909  77.562  51.005  1.00 40.15  ? 323 LEU C CD1   1 
ATOM   7154 C CD2   . LEU E 3 323 ? 29.777  77.508  48.816  1.00 41.56  ? 323 LEU C CD2   1 
ATOM   7155 N N     . VAL E 3 324 ? 32.344  74.525  51.538  1.00 44.59  ? 324 VAL C N     1 
ATOM   7156 C CA    . VAL E 3 324 ? 31.844  73.287  52.116  1.00 46.56  ? 324 VAL C CA    1 
ATOM   7157 C C     . VAL E 3 324 ? 30.433  73.548  52.580  1.00 47.47  ? 324 VAL C C     1 
ATOM   7158 O O     . VAL E 3 324 ? 30.222  74.124  53.645  1.00 47.07  ? 324 VAL C O     1 
ATOM   7159 C CB    . VAL E 3 324 ? 32.665  72.871  53.338  1.00 47.02  ? 324 VAL C CB    1 
ATOM   7160 C CG1   . VAL E 3 324 ? 32.160  71.551  53.866  1.00 47.72  ? 324 VAL C CG1   1 
ATOM   7161 C CG2   . VAL E 3 324 ? 34.134  72.774  52.971  1.00 48.13  ? 324 VAL C CG2   1 
ATOM   7162 N N     . LYS E 3 325 ? 29.469  73.118  51.777  1.00 49.12  ? 325 LYS C N     1 
ATOM   7163 C CA    . LYS E 3 325 ? 28.063  73.326  52.087  1.00 51.09  ? 325 LYS C CA    1 
ATOM   7164 C C     . LYS E 3 325 ? 27.540  72.430  53.182  1.00 50.42  ? 325 LYS C C     1 
ATOM   7165 O O     . LYS E 3 325 ? 27.477  71.226  53.015  1.00 51.19  ? 325 LYS C O     1 
ATOM   7166 C CB    . LYS E 3 325 ? 27.220  73.105  50.842  1.00 54.07  ? 325 LYS C CB    1 
ATOM   7167 C CG    . LYS E 3 325 ? 27.612  73.991  49.680  1.00 59.04  ? 325 LYS C CG    1 
ATOM   7168 C CD    . LYS E 3 325 ? 26.611  73.888  48.539  1.00 62.98  ? 325 LYS C CD    1 
ATOM   7169 C CE    . LYS E 3 325 ? 26.612  72.495  47.918  1.00 65.10  ? 325 LYS C CE    1 
ATOM   7170 N NZ    . LYS E 3 325 ? 25.518  72.339  46.904  1.00 67.72  ? 325 LYS C NZ    1 
ATOM   7171 N N     . ARG E 3 326 ? 27.144  73.013  54.300  1.00 49.04  ? 326 ARG C N     1 
ATOM   7172 C CA    . ARG E 3 326 ? 26.626  72.215  55.388  1.00 48.62  ? 326 ARG C CA    1 
ATOM   7173 C C     . ARG E 3 326 ? 25.170  72.602  55.583  1.00 49.13  ? 326 ARG C C     1 
ATOM   7174 O O     . ARG E 3 326 ? 24.432  72.672  54.621  1.00 48.16  ? 326 ARG C O     1 
ATOM   7175 C CB    . ARG E 3 326 ? 27.456  72.446  56.658  1.00 47.84  ? 326 ARG C CB    1 
ATOM   7176 C CG    . ARG E 3 326 ? 28.090  71.169  57.250  1.00 46.78  ? 326 ARG C CG    1 
ATOM   7177 C CD    . ARG E 3 326 ? 29.494  70.833  56.749  1.00 45.03  ? 326 ARG C CD    1 
ATOM   7178 N NE    . ARG E 3 326 ? 30.528  71.453  57.569  1.00 44.45  ? 326 ARG C NE    1 
ATOM   7179 C CZ    . ARG E 3 326 ? 31.800  71.076  57.567  1.00 44.92  ? 326 ARG C CZ    1 
ATOM   7180 N NH1   . ARG E 3 326 ? 32.194  70.073  56.787  1.00 45.02  ? 326 ARG C NH1   1 
ATOM   7181 N NH2   . ARG E 3 326 ? 32.677  71.702  58.342  1.00 44.47  ? 326 ARG C NH2   1 
ATOM   7182 N N     . LYS E 3 327 ? 24.755  72.874  56.811  1.00 50.59  ? 327 LYS C N     1 
ATOM   7183 C CA    . LYS E 3 327 ? 23.362  73.230  57.068  1.00 52.06  ? 327 LYS C CA    1 
ATOM   7184 C C     . LYS E 3 327 ? 23.069  74.641  57.593  1.00 52.38  ? 327 LYS C C     1 
ATOM   7185 O O     . LYS E 3 327 ? 21.932  74.928  57.936  1.00 53.51  ? 327 LYS C O     1 
ATOM   7186 C CB    . LYS E 3 327 ? 22.744  72.248  58.059  1.00 54.75  ? 327 LYS C CB    1 
ATOM   7187 C CG    . LYS E 3 327 ? 22.842  70.791  57.674  1.00 57.46  ? 327 LYS C CG    1 
ATOM   7188 C CD    . LYS E 3 327 ? 21.990  70.472  56.455  1.00 60.05  ? 327 LYS C CD    1 
ATOM   7189 C CE    . LYS E 3 327 ? 22.033  68.967  56.153  1.00 62.18  ? 327 LYS C CE    1 
ATOM   7190 N NZ    . LYS E 3 327 ? 21.270  68.579  54.919  1.00 62.88  ? 327 LYS C NZ    1 
ATOM   7191 N N     . THR E 3 328 ? 24.060  75.521  57.678  1.00 53.37  ? 328 THR C N     1 
ATOM   7192 C CA    . THR E 3 328 ? 23.799  76.863  58.189  1.00 54.21  ? 328 THR C CA    1 
ATOM   7193 C C     . THR E 3 328 ? 23.352  77.894  57.144  1.00 56.74  ? 328 THR C C     1 
ATOM   7194 O O     . THR E 3 328 ? 22.993  79.008  57.498  1.00 53.97  ? 328 THR C O     1 
ATOM   7195 C CB    . THR E 3 328 ? 25.022  77.418  58.973  1.00 52.57  ? 328 THR C CB    1 
ATOM   7196 O OG1   . THR E 3 328 ? 26.223  77.204  58.226  1.00 53.38  ? 328 THR C OG1   1 
ATOM   7197 C CG2   . THR E 3 328 ? 25.141  76.745  60.318  1.00 52.44  ? 328 THR C CG2   1 
ATOM   7198 N N     . THR E 3 329 ? 23.355  77.511  55.870  1.00 56.73  ? 329 THR C N     1 
ATOM   7199 C CA    . THR E 3 329 ? 22.960  78.383  54.779  1.00 59.02  ? 329 THR C CA    1 
ATOM   7200 C C     . THR E 3 329 ? 21.722  77.753  54.142  1.00 60.20  ? 329 THR C C     1 
ATOM   7201 O O     . THR E 3 329 ? 21.797  76.718  53.470  1.00 62.34  ? 329 THR C O     1 
ATOM   7202 C CB    . THR E 3 329 ? 24.130  78.523  53.720  1.00 60.90  ? 329 THR C CB    1 
ATOM   7203 O OG1   . THR E 3 329 ? 24.493  77.231  53.217  1.00 61.22  ? 329 THR C OG1   1 
ATOM   7204 C CG2   . THR E 3 329 ? 25.381  79.148  54.345  1.00 60.62  ? 329 THR C CG2   1 
ATOM   7205 N N     . LEU E 3 330 ? 20.562  78.334  54.425  1.00 62.70  ? 330 LEU C N     1 
ATOM   7206 C CA    . LEU E 3 330 ? 19.285  77.831  53.850  1.00 64.09  ? 330 LEU C CA    1 
ATOM   7207 C C     . LEU E 3 330 ? 18.374  78.991  53.408  1.00 63.71  ? 330 LEU C C     1 
ATOM   7208 O O     . LEU E 3 330 ? 18.745  79.793  52.518  1.00 63.69  ? 330 LEU C O     1 
ATOM   7209 C CB    . LEU E 3 330 ? 18.482  76.924  54.834  1.00 65.50  ? 330 LEU C CB    1 
ATOM   7210 C CG    . LEU E 3 330 ? 19.284  75.755  55.426  1.00 70.18  ? 330 LEU C CG    1 
ATOM   7211 C CD1   . LEU E 3 330 ? 18.433  74.945  56.485  1.00 69.01  ? 330 LEU C CD1   1 
ATOM   7212 C CD2   . LEU E 3 330 ? 19.748  74.822  54.256  1.00 69.10  ? 330 LEU C CD2   1 
HETATM 7213 C C1A   . NPF F 4 .   ? -13.592 89.298  32.961  1.00 46.31  ? 334 NPF A C1A   1 
HETATM 7214 C C2A   . NPF F 4 .   ? -12.784 90.469  32.778  1.00 46.63  ? 334 NPF A C2A   1 
HETATM 7215 C C3A   . NPF F 4 .   ? -11.509 90.635  33.343  1.00 46.75  ? 334 NPF A C3A   1 
HETATM 7216 C C4A   . NPF F 4 .   ? -10.980 89.605  34.146  1.00 47.03  ? 334 NPF A C4A   1 
HETATM 7217 C C5A   . NPF F 4 .   ? -11.775 88.487  34.448  1.00 46.69  ? 334 NPF A C5A   1 
HETATM 7218 C C6A   . NPF F 4 .   ? -13.085 88.346  33.893  1.00 47.36  ? 334 NPF A C6A   1 
HETATM 7219 N N6    . NPF F 4 .   ? -13.907 87.299  34.363  1.00 48.85  ? 334 NPF A N6    1 
HETATM 7220 O O6A   . NPF F 4 .   ? -14.937 86.931  33.827  1.00 49.04  ? 334 NPF A O6A   1 
HETATM 7221 O O6B   . NPF F 4 .   ? -13.515 86.573  35.249  1.00 50.92  ? 334 NPF A O6B   1 
HETATM 7222 O O1    . NPF F 4 .   ? -14.337 88.747  31.821  1.00 45.67  ? 334 NPF A O1    1 
HETATM 7223 C C1    . NPF F 4 .   ? -15.763 88.900  31.600  1.00 46.51  ? 334 NPF A C1    1 
HETATM 7224 C C2    . NPF F 4 .   ? -15.956 90.179  30.749  1.00 48.27  ? 334 NPF A C2    1 
HETATM 7225 O O2    . NPF F 4 .   ? -16.214 91.294  31.610  1.00 51.51  ? 334 NPF A O2    1 
HETATM 7226 C C3    . NPF F 4 .   ? -17.014 90.175  29.666  1.00 49.06  ? 334 NPF A C3    1 
HETATM 7227 O O3    . NPF F 4 .   ? -16.722 91.301  28.804  1.00 49.56  ? 334 NPF A O3    1 
HETATM 7228 C C4    . NPF F 4 .   ? -16.862 88.881  28.900  1.00 48.99  ? 334 NPF A C4    1 
HETATM 7229 O O4    . NPF F 4 .   ? -15.527 88.961  28.334  1.00 49.55  ? 334 NPF A O4    1 
HETATM 7230 C C5    . NPF F 4 .   ? -17.141 87.689  29.859  1.00 47.46  ? 334 NPF A C5    1 
HETATM 7231 C C6    . NPF F 4 .   ? -17.034 86.364  29.133  1.00 46.64  ? 334 NPF A C6    1 
HETATM 7232 O O5    . NPF F 4 .   ? -16.248 87.659  31.008  1.00 45.23  ? 334 NPF A O5    1 
HETATM 7233 C C1A   . NPF G 4 .   ? 6.047   82.779  26.415  1.00 12.29  ? 334 NPF B C1A   1 
HETATM 7234 C C2A   . NPF G 4 .   ? 5.363   82.486  25.215  1.00 11.77  ? 334 NPF B C2A   1 
HETATM 7235 C C3A   . NPF G 4 .   ? 4.101   81.894  25.156  1.00 12.99  ? 334 NPF B C3A   1 
HETATM 7236 C C4A   . NPF G 4 .   ? 3.466   81.525  26.350  1.00 14.37  ? 334 NPF B C4A   1 
HETATM 7237 C C5A   . NPF G 4 .   ? 4.104   81.726  27.555  1.00 14.01  ? 334 NPF B C5A   1 
HETATM 7238 C C6A   . NPF G 4 .   ? 5.374   82.333  27.569  1.00 16.11  ? 334 NPF B C6A   1 
HETATM 7239 N N6    . NPF G 4 .   ? 5.950   82.405  28.818  1.00 20.93  ? 334 NPF B N6    1 
HETATM 7240 O O6A   . NPF G 4 .   ? 7.024   82.936  29.029  1.00 23.24  ? 334 NPF B O6A   1 
HETATM 7241 O O6B   . NPF G 4 .   ? 5.356   81.870  29.735  1.00 25.26  ? 334 NPF B O6B   1 
HETATM 7242 O O1    . NPF G 4 .   ? 6.791   84.023  26.577  1.00 10.23  ? 334 NPF B O1    1 
HETATM 7243 C C1    . NPF G 4 .   ? 8.181   84.435  26.305  1.00 11.08  ? 334 NPF B C1    1 
HETATM 7244 C C2    . NPF G 4 .   ? 8.250   84.957  24.872  1.00 12.22  ? 334 NPF B C2    1 
HETATM 7245 O O2    . NPF G 4 .   ? 8.040   83.908  23.924  1.00 14.48  ? 334 NPF B O2    1 
HETATM 7246 C C3    . NPF G 4 .   ? 9.537   85.712  24.575  1.00 13.67  ? 334 NPF B C3    1 
HETATM 7247 O O3    . NPF G 4 .   ? 9.582   85.923  23.157  1.00 14.22  ? 334 NPF B O3    1 
HETATM 7248 C C4    . NPF G 4 .   ? 9.609   86.986  25.413  1.00 12.77  ? 334 NPF B C4    1 
HETATM 7249 O O4    . NPF G 4 .   ? 8.382   87.707  25.263  1.00 12.54  ? 334 NPF B O4    1 
HETATM 7250 C C5    . NPF G 4 .   ? 9.637   86.591  26.878  1.00 11.71  ? 334 NPF B C5    1 
HETATM 7251 C C6    . NPF G 4 .   ? 9.268   87.824  27.679  1.00 9.92   ? 334 NPF B C6    1 
HETATM 7252 O O5    . NPF G 4 .   ? 8.685   85.506  27.198  1.00 10.93  ? 334 NPF B O5    1 
HETATM 7253 C C1A   . NPF H 4 .   ? 43.623  82.300  61.844  1.00 6.95   ? 334 NPF C C1A   1 
HETATM 7254 C C2A   . NPF H 4 .   ? 44.499  82.863  62.803  1.00 6.63   ? 334 NPF C C2A   1 
HETATM 7255 C C3A   . NPF H 4 .   ? 44.366  82.712  64.189  1.00 7.14   ? 334 NPF C C3A   1 
HETATM 7256 C C4A   . NPF H 4 .   ? 43.282  81.984  64.682  1.00 7.60   ? 334 NPF C C4A   1 
HETATM 7257 C C5A   . NPF H 4 .   ? 42.340  81.491  63.787  1.00 6.56   ? 334 NPF C C5A   1 
HETATM 7258 C C6A   . NPF H 4 .   ? 42.502  81.682  62.399  1.00 7.30   ? 334 NPF C C6A   1 
HETATM 7259 N N6    . NPF H 4 .   ? 41.444  81.359  61.588  1.00 9.18   ? 334 NPF C N6    1 
HETATM 7260 O O6A   . NPF H 4 .   ? 41.434  81.559  60.391  1.00 8.04   ? 334 NPF C O6A   1 
HETATM 7261 O O6B   . NPF H 4 .   ? 40.488  80.860  62.118  1.00 11.03  ? 334 NPF C O6B   1 
HETATM 7262 O O1    . NPF H 4 .   ? 44.063  81.586  60.659  1.00 9.28   ? 334 NPF C O1    1 
HETATM 7263 C C1    . NPF H 4 .   ? 44.600  82.034  59.369  1.00 12.61  ? 334 NPF C C1    1 
HETATM 7264 C C2    . NPF H 4 .   ? 46.111  82.343  59.474  1.00 14.30  ? 334 NPF C C2    1 
HETATM 7265 O O2    . NPF H 4 .   ? 46.440  83.517  60.224  1.00 13.89  ? 334 NPF C O2    1 
HETATM 7266 C C3    . NPF H 4 .   ? 46.792  82.396  58.131  1.00 16.12  ? 334 NPF C C3    1 
HETATM 7267 O O3    . NPF H 4 .   ? 48.117  82.854  58.415  1.00 16.11  ? 334 NPF C O3    1 
HETATM 7268 C C4    . NPF H 4 .   ? 46.728  81.014  57.481  1.00 17.81  ? 334 NPF C C4    1 
HETATM 7269 O O4    . NPF H 4 .   ? 47.213  80.072  58.454  1.00 20.33  ? 334 NPF C O4    1 
HETATM 7270 C C5    . NPF H 4 .   ? 45.272  80.624  57.237  1.00 16.56  ? 334 NPF C C5    1 
HETATM 7271 C C6    . NPF H 4 .   ? 45.243  79.124  57.056  1.00 14.71  ? 334 NPF C C6    1 
HETATM 7272 O O5    . NPF H 4 .   ? 44.375  80.967  58.365  1.00 14.55  ? 334 NPF C O5    1 
# 
_database_PDB_caveat.id     1 
_database_PDB_caveat.text   
;DT E 10 HAS WRONG CHIRALITY AT ATOM C1'
;
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DA  1   1   ?   ?   ?   D . n 
A 1 2   DG  2   2   ?   ?   ?   D . n 
A 1 3   DA  3   3   ?   ?   ?   D . n 
A 1 4   DA  4   4   ?   ?   ?   D . n 
A 1 5   DT  5   5   ?   ?   ?   D . n 
A 1 6   DT  6   6   6   DT  THY D . n 
A 1 7   DG  7   7   7   DG  GUA D . n 
A 1 8   DT  8   8   8   DT  THY D . n 
A 1 9   DG  9   9   9   DG  GUA D . n 
A 1 10  DA  10  10  10  DA  ADE D . n 
A 1 11  DG  11  11  11  DG  GUA D . n 
A 1 12  DC  12  12  12  DC  CYT D . n 
A 1 13  DG  13  13  13  DG  GUA D . n 
A 1 14  DG  14  14  14  DG  GUA D . n 
A 1 15  DA  15  15  15  DA  ADE D . n 
A 1 16  DT  16  16  16  DT  THY D . n 
A 1 17  DA  17  17  17  DA  ADE D . n 
A 1 18  DA  18  18  18  DA  ADE D . n 
A 1 19  DC  19  19  19  DC  CYT D . n 
A 1 20  DA  20  20  ?   ?   ?   D . n 
A 1 21  DA  21  21  ?   ?   ?   D . n 
A 1 22  DT  22  22  ?   ?   ?   D . n 
A 1 23  DT  23  23  ?   ?   ?   D . n 
B 2 1   DT  1   1   ?   ?   ?   E . n 
B 2 2   DA  2   2   ?   ?   ?   E . n 
B 2 3   DA  3   3   ?   ?   ?   E . n 
B 2 4   DT  4   4   ?   ?   ?   E . n 
B 2 5   DT  5   5   ?   ?   ?   E . n 
B 2 6   DG  6   6   6   DG  GUA E . n 
B 2 7   DT  7   7   7   DT  THY E . n 
B 2 8   DT  8   8   8   DT  THY E . n 
B 2 9   DA  9   9   9   DA  ADE E . n 
B 2 10  DT  10  10  10  DT  THY E . n 
B 2 11  DC  11  11  11  DC  CYT E . n 
B 2 12  DC  12  12  12  DC  CYT E . n 
B 2 13  DG  13  13  13  DG  GUA E . n 
B 2 14  DC  14  14  14  DC  CYT E . n 
B 2 15  DT  15  15  15  DT  THY E . n 
B 2 16  DC  16  16  16  DC  CYT E . n 
B 2 17  DA  17  17  17  DA  ADE E . n 
B 2 18  DC  18  18  18  DC  CYT E . n 
B 2 19  DA  19  19  19  DA  ADE E . n 
B 2 20  DA  20  20  ?   ?   ?   E . n 
B 2 21  DT  21  21  ?   ?   ?   E . n 
B 2 22  DT  22  22  ?   ?   ?   E . n 
B 2 23  DC  23  23  ?   ?   ?   E . n 
C 3 1   MET 1   1   ?   ?   ?   A . n 
C 3 2   LYS 2   2   2   LYS LYS A . n 
C 3 3   PRO 3   3   3   PRO PRO A . n 
C 3 4   VAL 4   4   4   VAL VAL A . n 
C 3 5   THR 5   5   5   THR THR A . n 
C 3 6   LEU 6   6   6   LEU LEU A . n 
C 3 7   TYR 7   7   7   TYR TYR A . n 
C 3 8   ASP 8   8   8   ASP ASP A . n 
C 3 9   VAL 9   9   9   VAL VAL A . n 
C 3 10  ALA 10  10  10  ALA ALA A . n 
C 3 11  GLU 11  11  11  GLU GLU A . n 
C 3 12  TYR 12  12  12  TYR TYR A . n 
C 3 13  ALA 13  13  13  ALA ALA A . n 
C 3 14  GLY 14  14  14  GLY GLY A . n 
C 3 15  VAL 15  15  15  VAL VAL A . n 
C 3 16  SER 16  16  16  SER SER A . n 
C 3 17  TYR 17  17  17  TYR TYR A . n 
C 3 18  GLN 18  18  18  GLN GLN A . n 
C 3 19  THR 19  19  19  THR THR A . n 
C 3 20  VAL 20  20  20  VAL VAL A . n 
C 3 21  SER 21  21  21  SER SER A . n 
C 3 22  ARG 22  22  22  ARG ARG A . n 
C 3 23  VAL 23  23  23  VAL VAL A . n 
C 3 24  VAL 24  24  24  VAL VAL A . n 
C 3 25  ASN 25  25  25  ASN ASN A . n 
C 3 26  GLN 26  26  26  GLN GLN A . n 
C 3 27  ALA 27  27  27  ALA ALA A . n 
C 3 28  SER 28  28  28  SER SER A . n 
C 3 29  HIS 29  29  29  HIS HIS A . n 
C 3 30  VAL 30  30  30  VAL VAL A . n 
C 3 31  SER 31  31  31  SER SER A . n 
C 3 32  ALA 32  32  32  ALA ALA A . n 
C 3 33  LYS 33  33  33  LYS LYS A . n 
C 3 34  THR 34  34  34  THR THR A . n 
C 3 35  ARG 35  35  35  ARG ARG A . n 
C 3 36  GLU 36  36  36  GLU GLU A . n 
C 3 37  LYS 37  37  37  LYS LYS A . n 
C 3 38  VAL 38  38  38  VAL VAL A . n 
C 3 39  GLU 39  39  39  GLU GLU A . n 
C 3 40  ALA 40  40  40  ALA ALA A . n 
C 3 41  ALA 41  41  41  ALA ALA A . n 
C 3 42  MET 42  42  42  MET MET A . n 
C 3 43  ALA 43  43  43  ALA ALA A . n 
C 3 44  GLU 44  44  44  GLU GLU A . n 
C 3 45  LEU 45  45  45  LEU LEU A . n 
C 3 46  ASN 46  46  46  ASN ASN A . n 
C 3 47  TYR 47  47  47  TYR TYR A . n 
C 3 48  ILE 48  48  48  ILE ILE A . n 
C 3 49  PRO 49  49  49  PRO PRO A . n 
C 3 50  ASN 50  50  50  ASN ASN A . n 
C 3 51  ARG 51  51  51  ARG ARG A . n 
C 3 52  VAL 52  52  52  VAL VAL A . n 
C 3 53  ALA 53  53  53  ALA ALA A . n 
C 3 54  GLN 54  54  54  GLN GLN A . n 
C 3 55  GLN 55  55  55  GLN GLN A . n 
C 3 56  LEU 56  56  56  LEU LEU A . n 
C 3 57  ALA 57  57  57  ALA ALA A . n 
C 3 58  GLY 58  58  58  GLY GLY A . n 
C 3 59  LYS 59  59  59  LYS LYS A . n 
C 3 60  GLN 60  60  60  GLN GLN A . n 
C 3 61  SER 61  61  61  SER SER A . n 
C 3 62  LEU 62  62  62  LEU LEU A . n 
C 3 63  LEU 63  63  63  LEU LEU A . n 
C 3 64  ILE 64  64  64  ILE ILE A . n 
C 3 65  GLY 65  65  65  GLY GLY A . n 
C 3 66  VAL 66  66  66  VAL VAL A . n 
C 3 67  ALA 67  67  67  ALA ALA A . n 
C 3 68  THR 68  68  68  THR THR A . n 
C 3 69  SER 69  69  69  SER SER A . n 
C 3 70  SER 70  70  70  SER SER A . n 
C 3 71  LEU 71  71  71  LEU LEU A . n 
C 3 72  ALA 72  72  72  ALA ALA A . n 
C 3 73  LEU 73  73  73  LEU LEU A . n 
C 3 74  HIS 74  74  74  HIS HIS A . n 
C 3 75  ALA 75  75  75  ALA ALA A . n 
C 3 76  PRO 76  76  76  PRO PRO A . n 
C 3 77  SER 77  77  77  SER SER A . n 
C 3 78  GLN 78  78  78  GLN GLN A . n 
C 3 79  ILE 79  79  79  ILE ILE A . n 
C 3 80  VAL 80  80  80  VAL VAL A . n 
C 3 81  ALA 81  81  81  ALA ALA A . n 
C 3 82  ALA 82  82  82  ALA ALA A . n 
C 3 83  ILE 83  83  83  ILE ILE A . n 
C 3 84  LYS 84  84  84  LYS LYS A . n 
C 3 85  SER 85  85  85  SER SER A . n 
C 3 86  ARG 86  86  86  ARG ARG A . n 
C 3 87  ALA 87  87  87  ALA ALA A . n 
C 3 88  ASP 88  88  88  ASP ASP A . n 
C 3 89  GLN 89  89  89  GLN GLN A . n 
C 3 90  LEU 90  90  90  LEU LEU A . n 
C 3 91  GLY 91  91  91  GLY GLY A . n 
C 3 92  ALA 92  92  92  ALA ALA A . n 
C 3 93  SER 93  93  93  SER SER A . n 
C 3 94  VAL 94  94  94  VAL VAL A . n 
C 3 95  VAL 95  95  95  VAL VAL A . n 
C 3 96  VAL 96  96  96  VAL VAL A . n 
C 3 97  SER 97  97  97  SER SER A . n 
C 3 98  MET 98  98  98  MET MET A . n 
C 3 99  VAL 99  99  99  VAL VAL A . n 
C 3 100 GLU 100 100 100 GLU GLU A . n 
C 3 101 ARG 101 101 101 ARG ARG A . n 
C 3 102 SER 102 102 102 SER SER A . n 
C 3 103 GLY 103 103 103 GLY GLY A . n 
C 3 104 VAL 104 104 104 VAL VAL A . n 
C 3 105 GLU 105 105 105 GLU GLU A . n 
C 3 106 ALA 106 106 106 ALA ALA A . n 
C 3 107 CYS 107 107 107 CYS CYS A . n 
C 3 108 LYS 108 108 108 LYS LYS A . n 
C 3 109 THR 109 109 109 THR THR A . n 
C 3 110 ALA 110 110 110 ALA ALA A . n 
C 3 111 VAL 111 111 111 VAL VAL A . n 
C 3 112 HIS 112 112 112 HIS HIS A . n 
C 3 113 ASN 113 113 113 ASN ASN A . n 
C 3 114 LEU 114 114 114 LEU LEU A . n 
C 3 115 LEU 115 115 115 LEU LEU A . n 
C 3 116 ALA 116 116 116 ALA ALA A . n 
C 3 117 GLN 117 117 117 GLN GLN A . n 
C 3 118 ARG 118 118 118 ARG ARG A . n 
C 3 119 VAL 119 119 119 VAL VAL A . n 
C 3 120 SER 120 120 120 SER SER A . n 
C 3 121 GLY 121 121 121 GLY GLY A . n 
C 3 122 LEU 122 122 122 LEU LEU A . n 
C 3 123 ILE 123 123 123 ILE ILE A . n 
C 3 124 ILE 124 124 124 ILE ILE A . n 
C 3 125 ASN 125 125 125 ASN ASN A . n 
C 3 126 TYR 126 126 126 TYR TYR A . n 
C 3 127 PRO 127 127 127 PRO PRO A . n 
C 3 128 LEU 128 128 128 LEU LEU A . n 
C 3 129 ASP 129 129 129 ASP ASP A . n 
C 3 130 ASP 130 130 130 ASP ASP A . n 
C 3 131 GLN 131 131 131 GLN GLN A . n 
C 3 132 ASP 132 132 132 ASP ASP A . n 
C 3 133 ALA 133 133 133 ALA ALA A . n 
C 3 134 ILE 134 134 134 ILE ILE A . n 
C 3 135 ALA 135 135 135 ALA ALA A . n 
C 3 136 VAL 136 136 136 VAL VAL A . n 
C 3 137 GLU 137 137 137 GLU GLU A . n 
C 3 138 ALA 138 138 138 ALA ALA A . n 
C 3 139 ALA 139 139 139 ALA ALA A . n 
C 3 140 CYS 140 140 140 CYS CYS A . n 
C 3 141 THR 141 141 141 THR THR A . n 
C 3 142 ASN 142 142 142 ASN ASN A . n 
C 3 143 VAL 143 143 143 VAL VAL A . n 
C 3 144 PRO 144 144 144 PRO PRO A . n 
C 3 145 ALA 145 145 145 ALA ALA A . n 
C 3 146 LEU 146 146 146 LEU LEU A . n 
C 3 147 PHE 147 147 147 PHE PHE A . n 
C 3 148 LEU 148 148 148 LEU LEU A . n 
C 3 149 ASP 149 149 149 ASP ASP A . n 
C 3 150 VAL 150 150 150 VAL VAL A . n 
C 3 151 SER 151 151 151 SER SER A . n 
C 3 152 ASP 152 152 152 ASP ASP A . n 
C 3 153 GLN 153 153 153 GLN GLN A . n 
C 3 154 THR 154 154 154 THR THR A . n 
C 3 155 PRO 155 155 155 PRO PRO A . n 
C 3 156 ILE 156 156 156 ILE ILE A . n 
C 3 157 ASN 157 157 157 ASN ASN A . n 
C 3 158 SER 158 158 158 SER SER A . n 
C 3 159 ILE 159 159 159 ILE ILE A . n 
C 3 160 ILE 160 160 160 ILE ILE A . n 
C 3 161 PHE 161 161 161 PHE PHE A . n 
C 3 162 SER 162 162 162 SER SER A . n 
C 3 163 HIS 163 163 163 HIS HIS A . n 
C 3 164 GLU 164 164 164 GLU GLU A . n 
C 3 165 ASP 165 165 165 ASP ASP A . n 
C 3 166 GLY 166 166 166 GLY GLY A . n 
C 3 167 THR 167 167 167 THR THR A . n 
C 3 168 ARG 168 168 168 ARG ARG A . n 
C 3 169 LEU 169 169 169 LEU LEU A . n 
C 3 170 GLY 170 170 170 GLY GLY A . n 
C 3 171 VAL 171 171 171 VAL VAL A . n 
C 3 172 GLU 172 172 172 GLU GLU A . n 
C 3 173 HIS 173 173 173 HIS HIS A . n 
C 3 174 LEU 174 174 174 LEU LEU A . n 
C 3 175 VAL 175 175 175 VAL VAL A . n 
C 3 176 ALA 176 176 176 ALA ALA A . n 
C 3 177 LEU 177 177 177 LEU LEU A . n 
C 3 178 GLY 178 178 178 GLY GLY A . n 
C 3 179 HIS 179 179 179 HIS HIS A . n 
C 3 180 GLN 180 180 180 GLN GLN A . n 
C 3 181 GLN 181 181 181 GLN GLN A . n 
C 3 182 ILE 182 182 182 ILE ILE A . n 
C 3 183 ALA 183 183 183 ALA ALA A . n 
C 3 184 LEU 184 184 184 LEU LEU A . n 
C 3 185 LEU 185 185 185 LEU LEU A . n 
C 3 186 ALA 186 186 186 ALA ALA A . n 
C 3 187 GLY 187 187 187 GLY GLY A . n 
C 3 188 PRO 188 188 188 PRO PRO A . n 
C 3 189 LEU 189 189 189 LEU LEU A . n 
C 3 190 SER 190 190 190 SER SER A . n 
C 3 191 SER 191 191 191 SER SER A . n 
C 3 192 VAL 192 192 192 VAL VAL A . n 
C 3 193 SER 193 193 193 SER SER A . n 
C 3 194 ALA 194 194 194 ALA ALA A . n 
C 3 195 ARG 195 195 195 ARG ARG A . n 
C 3 196 LEU 196 196 196 LEU LEU A . n 
C 3 197 ARG 197 197 197 ARG ARG A . n 
C 3 198 LEU 198 198 198 LEU LEU A . n 
C 3 199 ALA 199 199 199 ALA ALA A . n 
C 3 200 GLY 200 200 200 GLY GLY A . n 
C 3 201 TRP 201 201 201 TRP TRP A . n 
C 3 202 HIS 202 202 202 HIS HIS A . n 
C 3 203 LYS 203 203 203 LYS LYS A . n 
C 3 204 TYR 204 204 204 TYR TYR A . n 
C 3 205 LEU 205 205 205 LEU LEU A . n 
C 3 206 THR 206 206 206 THR THR A . n 
C 3 207 ARG 207 207 207 ARG ARG A . n 
C 3 208 ASN 208 208 208 ASN ASN A . n 
C 3 209 GLN 209 209 209 GLN GLN A . n 
C 3 210 ILE 210 210 210 ILE ILE A . n 
C 3 211 GLN 211 211 211 GLN GLN A . n 
C 3 212 PRO 212 212 212 PRO PRO A . n 
C 3 213 ILE 213 213 213 ILE ILE A . n 
C 3 214 ALA 214 214 214 ALA ALA A . n 
C 3 215 GLU 215 215 215 GLU GLU A . n 
C 3 216 ARG 216 216 216 ARG ARG A . n 
C 3 217 GLU 217 217 217 GLU GLU A . n 
C 3 218 GLY 218 218 218 GLY GLY A . n 
C 3 219 ASP 219 219 219 ASP ASP A . n 
C 3 220 TRP 220 220 220 TRP TRP A . n 
C 3 221 SER 221 221 221 SER SER A . n 
C 3 222 ALA 222 222 222 ALA ALA A . n 
C 3 223 MET 223 223 223 MET MET A . n 
C 3 224 SER 224 224 224 SER SER A . n 
C 3 225 GLY 225 225 225 GLY GLY A . n 
C 3 226 PHE 226 226 226 PHE PHE A . n 
C 3 227 GLN 227 227 227 GLN GLN A . n 
C 3 228 GLN 228 228 228 GLN GLN A . n 
C 3 229 THR 229 229 229 THR THR A . n 
C 3 230 MET 230 230 230 MET MET A . n 
C 3 231 GLN 231 231 231 GLN GLN A . n 
C 3 232 MET 232 232 232 MET MET A . n 
C 3 233 LEU 233 233 233 LEU LEU A . n 
C 3 234 ASN 234 234 234 ASN ASN A . n 
C 3 235 GLU 235 235 235 GLU GLU A . n 
C 3 236 GLY 236 236 236 GLY GLY A . n 
C 3 237 ILE 237 237 237 ILE ILE A . n 
C 3 238 VAL 238 238 238 VAL VAL A . n 
C 3 239 PRO 239 239 239 PRO PRO A . n 
C 3 240 THR 240 240 240 THR THR A . n 
C 3 241 ALA 241 241 241 ALA ALA A . n 
C 3 242 MET 242 242 242 MET MET A . n 
C 3 243 LEU 243 243 243 LEU LEU A . n 
C 3 244 VAL 244 244 244 VAL VAL A . n 
C 3 245 ALA 245 245 245 ALA ALA A . n 
C 3 246 ASN 246 246 246 ASN ASN A . n 
C 3 247 ASP 247 247 247 ASP ASP A . n 
C 3 248 GLN 248 248 248 GLN GLN A . n 
C 3 249 MET 249 249 249 MET MET A . n 
C 3 250 ALA 250 250 250 ALA ALA A . n 
C 3 251 LEU 251 251 251 LEU LEU A . n 
C 3 252 GLY 252 252 252 GLY GLY A . n 
C 3 253 ALA 253 253 253 ALA ALA A . n 
C 3 254 MET 254 254 254 MET MET A . n 
C 3 255 ARG 255 255 255 ARG ARG A . n 
C 3 256 ALA 256 256 256 ALA ALA A . n 
C 3 257 ILE 257 257 257 ILE ILE A . n 
C 3 258 THR 258 258 258 THR THR A . n 
C 3 259 GLU 259 259 259 GLU GLU A . n 
C 3 260 SER 260 260 260 SER SER A . n 
C 3 261 GLY 261 261 261 GLY GLY A . n 
C 3 262 LEU 262 262 262 LEU LEU A . n 
C 3 263 ARG 263 263 263 ARG ARG A . n 
C 3 264 VAL 264 264 264 VAL VAL A . n 
C 3 265 GLY 265 265 265 GLY GLY A . n 
C 3 266 ALA 266 266 266 ALA ALA A . n 
C 3 267 ASP 267 267 267 ASP ASP A . n 
C 3 268 ILE 268 268 268 ILE ILE A . n 
C 3 269 SER 269 269 269 SER SER A . n 
C 3 270 VAL 270 270 270 VAL VAL A . n 
C 3 271 VAL 271 271 271 VAL VAL A . n 
C 3 272 GLY 272 272 272 GLY GLY A . n 
C 3 273 TYR 273 273 273 TYR TYR A . n 
C 3 274 ASP 274 274 274 ASP ASP A . n 
C 3 275 ASP 275 275 275 ASP ASP A . n 
C 3 276 THR 276 276 276 THR THR A . n 
C 3 277 GLU 277 277 277 GLU GLU A . n 
C 3 278 ASP 278 278 278 ASP ASP A . n 
C 3 279 SER 279 279 279 SER SER A . n 
C 3 280 SER 280 280 280 SER SER A . n 
C 3 281 CYS 281 281 281 CYS CYS A . n 
C 3 282 TYR 282 282 282 TYR TYR A . n 
C 3 283 ILE 283 283 283 ILE ILE A . n 
C 3 284 PRO 284 284 284 PRO PRO A . n 
C 3 285 PRO 285 285 285 PRO PRO A . n 
C 3 286 LEU 286 286 286 LEU LEU A . n 
C 3 287 THR 287 287 287 THR THR A . n 
C 3 288 THR 288 288 288 THR THR A . n 
C 3 289 ILE 289 289 289 ILE ILE A . n 
C 3 290 LYS 290 290 290 LYS LYS A . n 
C 3 291 GLN 291 291 291 GLN GLN A . n 
C 3 292 ASP 292 292 292 ASP ASP A . n 
C 3 293 PHE 293 293 293 PHE PHE A . n 
C 3 294 ARG 294 294 294 ARG ARG A . n 
C 3 295 LEU 295 295 295 LEU LEU A . n 
C 3 296 LEU 296 296 296 LEU LEU A . n 
C 3 297 GLY 297 297 297 GLY GLY A . n 
C 3 298 GLN 298 298 298 GLN GLN A . n 
C 3 299 THR 299 299 299 THR THR A . n 
C 3 300 SER 300 300 300 SER SER A . n 
C 3 301 VAL 301 301 301 VAL VAL A . n 
C 3 302 ASP 302 302 302 ASP ASP A . n 
C 3 303 ARG 303 303 303 ARG ARG A . n 
C 3 304 LEU 304 304 304 LEU LEU A . n 
C 3 305 LEU 305 305 305 LEU LEU A . n 
C 3 306 GLN 306 306 306 GLN GLN A . n 
C 3 307 LEU 307 307 307 LEU LEU A . n 
C 3 308 SER 308 308 308 SER SER A . n 
C 3 309 GLN 309 309 309 GLN GLN A . n 
C 3 310 GLY 310 310 310 GLY GLY A . n 
C 3 311 GLN 311 311 311 GLN GLN A . n 
C 3 312 ALA 312 312 312 ALA ALA A . n 
C 3 313 VAL 313 313 313 VAL VAL A . n 
C 3 314 LYS 314 314 314 LYS LYS A . n 
C 3 315 GLY 315 315 315 GLY GLY A . n 
C 3 316 ASN 316 316 316 ASN ASN A . n 
C 3 317 GLN 317 317 317 GLN GLN A . n 
C 3 318 LEU 318 318 318 LEU LEU A . n 
C 3 319 LEU 319 319 319 LEU LEU A . n 
C 3 320 PRO 320 320 320 PRO PRO A . n 
C 3 321 VAL 321 321 321 VAL VAL A . n 
C 3 322 SER 322 322 322 SER SER A . n 
C 3 323 LEU 323 323 323 LEU LEU A . n 
C 3 324 VAL 324 324 324 VAL VAL A . n 
C 3 325 LYS 325 325 325 LYS LYS A . n 
C 3 326 ARG 326 326 326 ARG ARG A . n 
C 3 327 LYS 327 327 327 LYS LYS A . n 
C 3 328 THR 328 328 328 THR THR A . n 
C 3 329 THR 329 329 329 THR THR A . n 
C 3 330 LEU 330 330 330 LEU LEU A . n 
C 3 331 ALA 331 331 ?   ?   ?   A . n 
C 3 332 PRO 332 332 ?   ?   ?   A . n 
C 3 333 ASN 333 333 ?   ?   ?   A . n 
D 3 1   MET 1   1   ?   ?   ?   B . n 
D 3 2   LYS 2   2   2   LYS LYS B . n 
D 3 3   PRO 3   3   3   PRO PRO B . n 
D 3 4   VAL 4   4   4   VAL VAL B . n 
D 3 5   THR 5   5   5   THR THR B . n 
D 3 6   LEU 6   6   6   LEU LEU B . n 
D 3 7   TYR 7   7   7   TYR TYR B . n 
D 3 8   ASP 8   8   8   ASP ASP B . n 
D 3 9   VAL 9   9   9   VAL VAL B . n 
D 3 10  ALA 10  10  10  ALA ALA B . n 
D 3 11  GLU 11  11  11  GLU GLU B . n 
D 3 12  TYR 12  12  12  TYR TYR B . n 
D 3 13  ALA 13  13  13  ALA ALA B . n 
D 3 14  GLY 14  14  14  GLY GLY B . n 
D 3 15  VAL 15  15  15  VAL VAL B . n 
D 3 16  SER 16  16  16  SER SER B . n 
D 3 17  TYR 17  17  17  TYR TYR B . n 
D 3 18  GLN 18  18  18  GLN GLN B . n 
D 3 19  THR 19  19  19  THR THR B . n 
D 3 20  VAL 20  20  20  VAL VAL B . n 
D 3 21  SER 21  21  21  SER SER B . n 
D 3 22  ARG 22  22  22  ARG ARG B . n 
D 3 23  VAL 23  23  23  VAL VAL B . n 
D 3 24  VAL 24  24  24  VAL VAL B . n 
D 3 25  ASN 25  25  25  ASN ASN B . n 
D 3 26  GLN 26  26  26  GLN GLN B . n 
D 3 27  ALA 27  27  27  ALA ALA B . n 
D 3 28  SER 28  28  28  SER SER B . n 
D 3 29  HIS 29  29  29  HIS HIS B . n 
D 3 30  VAL 30  30  30  VAL VAL B . n 
D 3 31  SER 31  31  31  SER SER B . n 
D 3 32  ALA 32  32  32  ALA ALA B . n 
D 3 33  LYS 33  33  33  LYS LYS B . n 
D 3 34  THR 34  34  34  THR THR B . n 
D 3 35  ARG 35  35  35  ARG ARG B . n 
D 3 36  GLU 36  36  36  GLU GLU B . n 
D 3 37  LYS 37  37  37  LYS LYS B . n 
D 3 38  VAL 38  38  38  VAL VAL B . n 
D 3 39  GLU 39  39  39  GLU GLU B . n 
D 3 40  ALA 40  40  40  ALA ALA B . n 
D 3 41  ALA 41  41  41  ALA ALA B . n 
D 3 42  MET 42  42  42  MET MET B . n 
D 3 43  ALA 43  43  43  ALA ALA B . n 
D 3 44  GLU 44  44  44  GLU GLU B . n 
D 3 45  LEU 45  45  45  LEU LEU B . n 
D 3 46  ASN 46  46  46  ASN ASN B . n 
D 3 47  TYR 47  47  47  TYR TYR B . n 
D 3 48  ILE 48  48  48  ILE ILE B . n 
D 3 49  PRO 49  49  49  PRO PRO B . n 
D 3 50  ASN 50  50  50  ASN ASN B . n 
D 3 51  ARG 51  51  51  ARG ARG B . n 
D 3 52  VAL 52  52  52  VAL VAL B . n 
D 3 53  ALA 53  53  53  ALA ALA B . n 
D 3 54  GLN 54  54  54  GLN GLN B . n 
D 3 55  GLN 55  55  55  GLN GLN B . n 
D 3 56  LEU 56  56  56  LEU LEU B . n 
D 3 57  ALA 57  57  57  ALA ALA B . n 
D 3 58  GLY 58  58  58  GLY GLY B . n 
D 3 59  LYS 59  59  59  LYS LYS B . n 
D 3 60  GLN 60  60  60  GLN GLN B . n 
D 3 61  SER 61  61  61  SER SER B . n 
D 3 62  LEU 62  62  62  LEU LEU B . n 
D 3 63  LEU 63  63  63  LEU LEU B . n 
D 3 64  ILE 64  64  64  ILE ILE B . n 
D 3 65  GLY 65  65  65  GLY GLY B . n 
D 3 66  VAL 66  66  66  VAL VAL B . n 
D 3 67  ALA 67  67  67  ALA ALA B . n 
D 3 68  THR 68  68  68  THR THR B . n 
D 3 69  SER 69  69  69  SER SER B . n 
D 3 70  SER 70  70  70  SER SER B . n 
D 3 71  LEU 71  71  71  LEU LEU B . n 
D 3 72  ALA 72  72  72  ALA ALA B . n 
D 3 73  LEU 73  73  73  LEU LEU B . n 
D 3 74  HIS 74  74  74  HIS HIS B . n 
D 3 75  ALA 75  75  75  ALA ALA B . n 
D 3 76  PRO 76  76  76  PRO PRO B . n 
D 3 77  SER 77  77  77  SER SER B . n 
D 3 78  GLN 78  78  78  GLN GLN B . n 
D 3 79  ILE 79  79  79  ILE ILE B . n 
D 3 80  VAL 80  80  80  VAL VAL B . n 
D 3 81  ALA 81  81  81  ALA ALA B . n 
D 3 82  ALA 82  82  82  ALA ALA B . n 
D 3 83  ILE 83  83  83  ILE ILE B . n 
D 3 84  LYS 84  84  84  LYS LYS B . n 
D 3 85  SER 85  85  85  SER SER B . n 
D 3 86  ARG 86  86  86  ARG ARG B . n 
D 3 87  ALA 87  87  87  ALA ALA B . n 
D 3 88  ASP 88  88  88  ASP ASP B . n 
D 3 89  GLN 89  89  89  GLN GLN B . n 
D 3 90  LEU 90  90  90  LEU LEU B . n 
D 3 91  GLY 91  91  91  GLY GLY B . n 
D 3 92  ALA 92  92  92  ALA ALA B . n 
D 3 93  SER 93  93  93  SER SER B . n 
D 3 94  VAL 94  94  94  VAL VAL B . n 
D 3 95  VAL 95  95  95  VAL VAL B . n 
D 3 96  VAL 96  96  96  VAL VAL B . n 
D 3 97  SER 97  97  97  SER SER B . n 
D 3 98  MET 98  98  98  MET MET B . n 
D 3 99  VAL 99  99  99  VAL VAL B . n 
D 3 100 GLU 100 100 100 GLU GLU B . n 
D 3 101 ARG 101 101 101 ARG ARG B . n 
D 3 102 SER 102 102 102 SER SER B . n 
D 3 103 GLY 103 103 103 GLY GLY B . n 
D 3 104 VAL 104 104 104 VAL VAL B . n 
D 3 105 GLU 105 105 105 GLU GLU B . n 
D 3 106 ALA 106 106 106 ALA ALA B . n 
D 3 107 CYS 107 107 107 CYS CYS B . n 
D 3 108 LYS 108 108 108 LYS LYS B . n 
D 3 109 THR 109 109 109 THR THR B . n 
D 3 110 ALA 110 110 110 ALA ALA B . n 
D 3 111 VAL 111 111 111 VAL VAL B . n 
D 3 112 HIS 112 112 112 HIS HIS B . n 
D 3 113 ASN 113 113 113 ASN ASN B . n 
D 3 114 LEU 114 114 114 LEU LEU B . n 
D 3 115 LEU 115 115 115 LEU LEU B . n 
D 3 116 ALA 116 116 116 ALA ALA B . n 
D 3 117 GLN 117 117 117 GLN GLN B . n 
D 3 118 ARG 118 118 118 ARG ARG B . n 
D 3 119 VAL 119 119 119 VAL VAL B . n 
D 3 120 SER 120 120 120 SER SER B . n 
D 3 121 GLY 121 121 121 GLY GLY B . n 
D 3 122 LEU 122 122 122 LEU LEU B . n 
D 3 123 ILE 123 123 123 ILE ILE B . n 
D 3 124 ILE 124 124 124 ILE ILE B . n 
D 3 125 ASN 125 125 125 ASN ASN B . n 
D 3 126 TYR 126 126 126 TYR TYR B . n 
D 3 127 PRO 127 127 127 PRO PRO B . n 
D 3 128 LEU 128 128 128 LEU LEU B . n 
D 3 129 ASP 129 129 129 ASP ASP B . n 
D 3 130 ASP 130 130 130 ASP ASP B . n 
D 3 131 GLN 131 131 131 GLN GLN B . n 
D 3 132 ASP 132 132 132 ASP ASP B . n 
D 3 133 ALA 133 133 133 ALA ALA B . n 
D 3 134 ILE 134 134 134 ILE ILE B . n 
D 3 135 ALA 135 135 135 ALA ALA B . n 
D 3 136 VAL 136 136 136 VAL VAL B . n 
D 3 137 GLU 137 137 137 GLU GLU B . n 
D 3 138 ALA 138 138 138 ALA ALA B . n 
D 3 139 ALA 139 139 139 ALA ALA B . n 
D 3 140 CYS 140 140 140 CYS CYS B . n 
D 3 141 THR 141 141 141 THR THR B . n 
D 3 142 ASN 142 142 142 ASN ASN B . n 
D 3 143 VAL 143 143 143 VAL VAL B . n 
D 3 144 PRO 144 144 144 PRO PRO B . n 
D 3 145 ALA 145 145 145 ALA ALA B . n 
D 3 146 LEU 146 146 146 LEU LEU B . n 
D 3 147 PHE 147 147 147 PHE PHE B . n 
D 3 148 LEU 148 148 148 LEU LEU B . n 
D 3 149 ASP 149 149 149 ASP ASP B . n 
D 3 150 VAL 150 150 150 VAL VAL B . n 
D 3 151 SER 151 151 151 SER SER B . n 
D 3 152 ASP 152 152 152 ASP ASP B . n 
D 3 153 GLN 153 153 153 GLN GLN B . n 
D 3 154 THR 154 154 154 THR THR B . n 
D 3 155 PRO 155 155 155 PRO PRO B . n 
D 3 156 ILE 156 156 156 ILE ILE B . n 
D 3 157 ASN 157 157 157 ASN ASN B . n 
D 3 158 SER 158 158 158 SER SER B . n 
D 3 159 ILE 159 159 159 ILE ILE B . n 
D 3 160 ILE 160 160 160 ILE ILE B . n 
D 3 161 PHE 161 161 161 PHE PHE B . n 
D 3 162 SER 162 162 162 SER SER B . n 
D 3 163 HIS 163 163 163 HIS HIS B . n 
D 3 164 GLU 164 164 164 GLU GLU B . n 
D 3 165 ASP 165 165 165 ASP ASP B . n 
D 3 166 GLY 166 166 166 GLY GLY B . n 
D 3 167 THR 167 167 167 THR THR B . n 
D 3 168 ARG 168 168 168 ARG ARG B . n 
D 3 169 LEU 169 169 169 LEU LEU B . n 
D 3 170 GLY 170 170 170 GLY GLY B . n 
D 3 171 VAL 171 171 171 VAL VAL B . n 
D 3 172 GLU 172 172 172 GLU GLU B . n 
D 3 173 HIS 173 173 173 HIS HIS B . n 
D 3 174 LEU 174 174 174 LEU LEU B . n 
D 3 175 VAL 175 175 175 VAL VAL B . n 
D 3 176 ALA 176 176 176 ALA ALA B . n 
D 3 177 LEU 177 177 177 LEU LEU B . n 
D 3 178 GLY 178 178 178 GLY GLY B . n 
D 3 179 HIS 179 179 179 HIS HIS B . n 
D 3 180 GLN 180 180 180 GLN GLN B . n 
D 3 181 GLN 181 181 181 GLN GLN B . n 
D 3 182 ILE 182 182 182 ILE ILE B . n 
D 3 183 ALA 183 183 183 ALA ALA B . n 
D 3 184 LEU 184 184 184 LEU LEU B . n 
D 3 185 LEU 185 185 185 LEU LEU B . n 
D 3 186 ALA 186 186 186 ALA ALA B . n 
D 3 187 GLY 187 187 187 GLY GLY B . n 
D 3 188 PRO 188 188 188 PRO PRO B . n 
D 3 189 LEU 189 189 189 LEU LEU B . n 
D 3 190 SER 190 190 190 SER SER B . n 
D 3 191 SER 191 191 191 SER SER B . n 
D 3 192 VAL 192 192 192 VAL VAL B . n 
D 3 193 SER 193 193 193 SER SER B . n 
D 3 194 ALA 194 194 194 ALA ALA B . n 
D 3 195 ARG 195 195 195 ARG ARG B . n 
D 3 196 LEU 196 196 196 LEU LEU B . n 
D 3 197 ARG 197 197 197 ARG ARG B . n 
D 3 198 LEU 198 198 198 LEU LEU B . n 
D 3 199 ALA 199 199 199 ALA ALA B . n 
D 3 200 GLY 200 200 200 GLY GLY B . n 
D 3 201 TRP 201 201 201 TRP TRP B . n 
D 3 202 HIS 202 202 202 HIS HIS B . n 
D 3 203 LYS 203 203 203 LYS LYS B . n 
D 3 204 TYR 204 204 204 TYR TYR B . n 
D 3 205 LEU 205 205 205 LEU LEU B . n 
D 3 206 THR 206 206 206 THR THR B . n 
D 3 207 ARG 207 207 207 ARG ARG B . n 
D 3 208 ASN 208 208 208 ASN ASN B . n 
D 3 209 GLN 209 209 209 GLN GLN B . n 
D 3 210 ILE 210 210 210 ILE ILE B . n 
D 3 211 GLN 211 211 211 GLN GLN B . n 
D 3 212 PRO 212 212 212 PRO PRO B . n 
D 3 213 ILE 213 213 213 ILE ILE B . n 
D 3 214 ALA 214 214 214 ALA ALA B . n 
D 3 215 GLU 215 215 215 GLU GLU B . n 
D 3 216 ARG 216 216 216 ARG ARG B . n 
D 3 217 GLU 217 217 217 GLU GLU B . n 
D 3 218 GLY 218 218 218 GLY GLY B . n 
D 3 219 ASP 219 219 219 ASP ASP B . n 
D 3 220 TRP 220 220 220 TRP TRP B . n 
D 3 221 SER 221 221 221 SER SER B . n 
D 3 222 ALA 222 222 222 ALA ALA B . n 
D 3 223 MET 223 223 223 MET MET B . n 
D 3 224 SER 224 224 224 SER SER B . n 
D 3 225 GLY 225 225 225 GLY GLY B . n 
D 3 226 PHE 226 226 226 PHE PHE B . n 
D 3 227 GLN 227 227 227 GLN GLN B . n 
D 3 228 GLN 228 228 228 GLN GLN B . n 
D 3 229 THR 229 229 229 THR THR B . n 
D 3 230 MET 230 230 230 MET MET B . n 
D 3 231 GLN 231 231 231 GLN GLN B . n 
D 3 232 MET 232 232 232 MET MET B . n 
D 3 233 LEU 233 233 233 LEU LEU B . n 
D 3 234 ASN 234 234 234 ASN ASN B . n 
D 3 235 GLU 235 235 235 GLU GLU B . n 
D 3 236 GLY 236 236 236 GLY GLY B . n 
D 3 237 ILE 237 237 237 ILE ILE B . n 
D 3 238 VAL 238 238 238 VAL VAL B . n 
D 3 239 PRO 239 239 239 PRO PRO B . n 
D 3 240 THR 240 240 240 THR THR B . n 
D 3 241 ALA 241 241 241 ALA ALA B . n 
D 3 242 MET 242 242 242 MET MET B . n 
D 3 243 LEU 243 243 243 LEU LEU B . n 
D 3 244 VAL 244 244 244 VAL VAL B . n 
D 3 245 ALA 245 245 245 ALA ALA B . n 
D 3 246 ASN 246 246 246 ASN ASN B . n 
D 3 247 ASP 247 247 247 ASP ASP B . n 
D 3 248 GLN 248 248 248 GLN GLN B . n 
D 3 249 MET 249 249 249 MET MET B . n 
D 3 250 ALA 250 250 250 ALA ALA B . n 
D 3 251 LEU 251 251 251 LEU LEU B . n 
D 3 252 GLY 252 252 252 GLY GLY B . n 
D 3 253 ALA 253 253 253 ALA ALA B . n 
D 3 254 MET 254 254 254 MET MET B . n 
D 3 255 ARG 255 255 255 ARG ARG B . n 
D 3 256 ALA 256 256 256 ALA ALA B . n 
D 3 257 ILE 257 257 257 ILE ILE B . n 
D 3 258 THR 258 258 258 THR THR B . n 
D 3 259 GLU 259 259 259 GLU GLU B . n 
D 3 260 SER 260 260 260 SER SER B . n 
D 3 261 GLY 261 261 261 GLY GLY B . n 
D 3 262 LEU 262 262 262 LEU LEU B . n 
D 3 263 ARG 263 263 263 ARG ARG B . n 
D 3 264 VAL 264 264 264 VAL VAL B . n 
D 3 265 GLY 265 265 265 GLY GLY B . n 
D 3 266 ALA 266 266 266 ALA ALA B . n 
D 3 267 ASP 267 267 267 ASP ASP B . n 
D 3 268 ILE 268 268 268 ILE ILE B . n 
D 3 269 SER 269 269 269 SER SER B . n 
D 3 270 VAL 270 270 270 VAL VAL B . n 
D 3 271 VAL 271 271 271 VAL VAL B . n 
D 3 272 GLY 272 272 272 GLY GLY B . n 
D 3 273 TYR 273 273 273 TYR TYR B . n 
D 3 274 ASP 274 274 274 ASP ASP B . n 
D 3 275 ASP 275 275 275 ASP ASP B . n 
D 3 276 THR 276 276 276 THR THR B . n 
D 3 277 GLU 277 277 277 GLU GLU B . n 
D 3 278 ASP 278 278 278 ASP ASP B . n 
D 3 279 SER 279 279 279 SER SER B . n 
D 3 280 SER 280 280 280 SER SER B . n 
D 3 281 CYS 281 281 281 CYS CYS B . n 
D 3 282 TYR 282 282 282 TYR TYR B . n 
D 3 283 ILE 283 283 283 ILE ILE B . n 
D 3 284 PRO 284 284 284 PRO PRO B . n 
D 3 285 PRO 285 285 285 PRO PRO B . n 
D 3 286 LEU 286 286 286 LEU LEU B . n 
D 3 287 THR 287 287 287 THR THR B . n 
D 3 288 THR 288 288 288 THR THR B . n 
D 3 289 ILE 289 289 289 ILE ILE B . n 
D 3 290 LYS 290 290 290 LYS LYS B . n 
D 3 291 GLN 291 291 291 GLN GLN B . n 
D 3 292 ASP 292 292 292 ASP ASP B . n 
D 3 293 PHE 293 293 293 PHE PHE B . n 
D 3 294 ARG 294 294 294 ARG ARG B . n 
D 3 295 LEU 295 295 295 LEU LEU B . n 
D 3 296 LEU 296 296 296 LEU LEU B . n 
D 3 297 GLY 297 297 297 GLY GLY B . n 
D 3 298 GLN 298 298 298 GLN GLN B . n 
D 3 299 THR 299 299 299 THR THR B . n 
D 3 300 SER 300 300 300 SER SER B . n 
D 3 301 VAL 301 301 301 VAL VAL B . n 
D 3 302 ASP 302 302 302 ASP ASP B . n 
D 3 303 ARG 303 303 303 ARG ARG B . n 
D 3 304 LEU 304 304 304 LEU LEU B . n 
D 3 305 LEU 305 305 305 LEU LEU B . n 
D 3 306 GLN 306 306 306 GLN GLN B . n 
D 3 307 LEU 307 307 307 LEU LEU B . n 
D 3 308 SER 308 308 308 SER SER B . n 
D 3 309 GLN 309 309 309 GLN GLN B . n 
D 3 310 GLY 310 310 310 GLY GLY B . n 
D 3 311 GLN 311 311 311 GLN GLN B . n 
D 3 312 ALA 312 312 312 ALA ALA B . n 
D 3 313 VAL 313 313 313 VAL VAL B . n 
D 3 314 LYS 314 314 314 LYS LYS B . n 
D 3 315 GLY 315 315 315 GLY GLY B . n 
D 3 316 ASN 316 316 316 ASN ASN B . n 
D 3 317 GLN 317 317 317 GLN GLN B . n 
D 3 318 LEU 318 318 318 LEU LEU B . n 
D 3 319 LEU 319 319 319 LEU LEU B . n 
D 3 320 PRO 320 320 320 PRO PRO B . n 
D 3 321 VAL 321 321 321 VAL VAL B . n 
D 3 322 SER 322 322 322 SER SER B . n 
D 3 323 LEU 323 323 323 LEU LEU B . n 
D 3 324 VAL 324 324 324 VAL VAL B . n 
D 3 325 LYS 325 325 325 LYS LYS B . n 
D 3 326 ARG 326 326 326 ARG ARG B . n 
D 3 327 LYS 327 327 327 LYS LYS B . n 
D 3 328 THR 328 328 328 THR THR B . n 
D 3 329 THR 329 329 329 THR THR B . n 
D 3 330 LEU 330 330 330 LEU LEU B . n 
D 3 331 ALA 331 331 ?   ?   ?   B . n 
D 3 332 PRO 332 332 ?   ?   ?   B . n 
D 3 333 ASN 333 333 ?   ?   ?   B . n 
E 3 1   MET 1   1   ?   ?   ?   C . n 
E 3 2   LYS 2   2   ?   ?   ?   C . n 
E 3 3   PRO 3   3   ?   ?   ?   C . n 
E 3 4   VAL 4   4   ?   ?   ?   C . n 
E 3 5   THR 5   5   ?   ?   ?   C . n 
E 3 6   LEU 6   6   ?   ?   ?   C . n 
E 3 7   TYR 7   7   ?   ?   ?   C . n 
E 3 8   ASP 8   8   ?   ?   ?   C . n 
E 3 9   VAL 9   9   ?   ?   ?   C . n 
E 3 10  ALA 10  10  ?   ?   ?   C . n 
E 3 11  GLU 11  11  ?   ?   ?   C . n 
E 3 12  TYR 12  12  ?   ?   ?   C . n 
E 3 13  ALA 13  13  ?   ?   ?   C . n 
E 3 14  GLY 14  14  ?   ?   ?   C . n 
E 3 15  VAL 15  15  ?   ?   ?   C . n 
E 3 16  SER 16  16  ?   ?   ?   C . n 
E 3 17  TYR 17  17  ?   ?   ?   C . n 
E 3 18  GLN 18  18  ?   ?   ?   C . n 
E 3 19  THR 19  19  ?   ?   ?   C . n 
E 3 20  VAL 20  20  ?   ?   ?   C . n 
E 3 21  SER 21  21  ?   ?   ?   C . n 
E 3 22  ARG 22  22  ?   ?   ?   C . n 
E 3 23  VAL 23  23  ?   ?   ?   C . n 
E 3 24  VAL 24  24  ?   ?   ?   C . n 
E 3 25  ASN 25  25  ?   ?   ?   C . n 
E 3 26  GLN 26  26  ?   ?   ?   C . n 
E 3 27  ALA 27  27  ?   ?   ?   C . n 
E 3 28  SER 28  28  ?   ?   ?   C . n 
E 3 29  HIS 29  29  ?   ?   ?   C . n 
E 3 30  VAL 30  30  ?   ?   ?   C . n 
E 3 31  SER 31  31  ?   ?   ?   C . n 
E 3 32  ALA 32  32  ?   ?   ?   C . n 
E 3 33  LYS 33  33  ?   ?   ?   C . n 
E 3 34  THR 34  34  ?   ?   ?   C . n 
E 3 35  ARG 35  35  ?   ?   ?   C . n 
E 3 36  GLU 36  36  ?   ?   ?   C . n 
E 3 37  LYS 37  37  ?   ?   ?   C . n 
E 3 38  VAL 38  38  ?   ?   ?   C . n 
E 3 39  GLU 39  39  ?   ?   ?   C . n 
E 3 40  ALA 40  40  ?   ?   ?   C . n 
E 3 41  ALA 41  41  ?   ?   ?   C . n 
E 3 42  MET 42  42  ?   ?   ?   C . n 
E 3 43  ALA 43  43  ?   ?   ?   C . n 
E 3 44  GLU 44  44  ?   ?   ?   C . n 
E 3 45  LEU 45  45  ?   ?   ?   C . n 
E 3 46  ASN 46  46  ?   ?   ?   C . n 
E 3 47  TYR 47  47  ?   ?   ?   C . n 
E 3 48  ILE 48  48  ?   ?   ?   C . n 
E 3 49  PRO 49  49  ?   ?   ?   C . n 
E 3 50  ASN 50  50  ?   ?   ?   C . n 
E 3 51  ARG 51  51  ?   ?   ?   C . n 
E 3 52  VAL 52  52  ?   ?   ?   C . n 
E 3 53  ALA 53  53  ?   ?   ?   C . n 
E 3 54  GLN 54  54  ?   ?   ?   C . n 
E 3 55  GLN 55  55  ?   ?   ?   C . n 
E 3 56  LEU 56  56  ?   ?   ?   C . n 
E 3 57  ALA 57  57  ?   ?   ?   C . n 
E 3 58  GLY 58  58  ?   ?   ?   C . n 
E 3 59  LYS 59  59  ?   ?   ?   C . n 
E 3 60  GLN 60  60  ?   ?   ?   C . n 
E 3 61  SER 61  61  ?   ?   ?   C . n 
E 3 62  LEU 62  62  62  LEU LEU C . n 
E 3 63  LEU 63  63  63  LEU LEU C . n 
E 3 64  ILE 64  64  64  ILE ILE C . n 
E 3 65  GLY 65  65  65  GLY GLY C . n 
E 3 66  VAL 66  66  66  VAL VAL C . n 
E 3 67  ALA 67  67  67  ALA ALA C . n 
E 3 68  THR 68  68  68  THR THR C . n 
E 3 69  SER 69  69  69  SER SER C . n 
E 3 70  SER 70  70  70  SER SER C . n 
E 3 71  LEU 71  71  71  LEU LEU C . n 
E 3 72  ALA 72  72  72  ALA ALA C . n 
E 3 73  LEU 73  73  73  LEU LEU C . n 
E 3 74  HIS 74  74  74  HIS HIS C . n 
E 3 75  ALA 75  75  75  ALA ALA C . n 
E 3 76  PRO 76  76  76  PRO PRO C . n 
E 3 77  SER 77  77  77  SER SER C . n 
E 3 78  GLN 78  78  78  GLN GLN C . n 
E 3 79  ILE 79  79  79  ILE ILE C . n 
E 3 80  VAL 80  80  80  VAL VAL C . n 
E 3 81  ALA 81  81  81  ALA ALA C . n 
E 3 82  ALA 82  82  82  ALA ALA C . n 
E 3 83  ILE 83  83  83  ILE ILE C . n 
E 3 84  LYS 84  84  84  LYS LYS C . n 
E 3 85  SER 85  85  85  SER SER C . n 
E 3 86  ARG 86  86  86  ARG ARG C . n 
E 3 87  ALA 87  87  87  ALA ALA C . n 
E 3 88  ASP 88  88  88  ASP ASP C . n 
E 3 89  GLN 89  89  89  GLN GLN C . n 
E 3 90  LEU 90  90  90  LEU LEU C . n 
E 3 91  GLY 91  91  91  GLY GLY C . n 
E 3 92  ALA 92  92  92  ALA ALA C . n 
E 3 93  SER 93  93  93  SER SER C . n 
E 3 94  VAL 94  94  94  VAL VAL C . n 
E 3 95  VAL 95  95  95  VAL VAL C . n 
E 3 96  VAL 96  96  96  VAL VAL C . n 
E 3 97  SER 97  97  97  SER SER C . n 
E 3 98  MET 98  98  98  MET MET C . n 
E 3 99  VAL 99  99  99  VAL VAL C . n 
E 3 100 GLU 100 100 100 GLU GLU C . n 
E 3 101 ARG 101 101 101 ARG ARG C . n 
E 3 102 SER 102 102 102 SER SER C . n 
E 3 103 GLY 103 103 103 GLY GLY C . n 
E 3 104 VAL 104 104 104 VAL VAL C . n 
E 3 105 GLU 105 105 105 GLU GLU C . n 
E 3 106 ALA 106 106 106 ALA ALA C . n 
E 3 107 CYS 107 107 107 CYS CYS C . n 
E 3 108 LYS 108 108 108 LYS LYS C . n 
E 3 109 THR 109 109 109 THR THR C . n 
E 3 110 ALA 110 110 110 ALA ALA C . n 
E 3 111 VAL 111 111 111 VAL VAL C . n 
E 3 112 HIS 112 112 112 HIS HIS C . n 
E 3 113 ASN 113 113 113 ASN ASN C . n 
E 3 114 LEU 114 114 114 LEU LEU C . n 
E 3 115 LEU 115 115 115 LEU LEU C . n 
E 3 116 ALA 116 116 116 ALA ALA C . n 
E 3 117 GLN 117 117 117 GLN GLN C . n 
E 3 118 ARG 118 118 118 ARG ARG C . n 
E 3 119 VAL 119 119 119 VAL VAL C . n 
E 3 120 SER 120 120 120 SER SER C . n 
E 3 121 GLY 121 121 121 GLY GLY C . n 
E 3 122 LEU 122 122 122 LEU LEU C . n 
E 3 123 ILE 123 123 123 ILE ILE C . n 
E 3 124 ILE 124 124 124 ILE ILE C . n 
E 3 125 ASN 125 125 125 ASN ASN C . n 
E 3 126 TYR 126 126 126 TYR TYR C . n 
E 3 127 PRO 127 127 127 PRO PRO C . n 
E 3 128 LEU 128 128 128 LEU LEU C . n 
E 3 129 ASP 129 129 129 ASP ASP C . n 
E 3 130 ASP 130 130 130 ASP ASP C . n 
E 3 131 GLN 131 131 131 GLN GLN C . n 
E 3 132 ASP 132 132 132 ASP ASP C . n 
E 3 133 ALA 133 133 133 ALA ALA C . n 
E 3 134 ILE 134 134 134 ILE ILE C . n 
E 3 135 ALA 135 135 135 ALA ALA C . n 
E 3 136 VAL 136 136 136 VAL VAL C . n 
E 3 137 GLU 137 137 137 GLU GLU C . n 
E 3 138 ALA 138 138 138 ALA ALA C . n 
E 3 139 ALA 139 139 139 ALA ALA C . n 
E 3 140 CYS 140 140 140 CYS CYS C . n 
E 3 141 THR 141 141 141 THR THR C . n 
E 3 142 ASN 142 142 142 ASN ASN C . n 
E 3 143 VAL 143 143 143 VAL VAL C . n 
E 3 144 PRO 144 144 144 PRO PRO C . n 
E 3 145 ALA 145 145 145 ALA ALA C . n 
E 3 146 LEU 146 146 146 LEU LEU C . n 
E 3 147 PHE 147 147 147 PHE PHE C . n 
E 3 148 LEU 148 148 148 LEU LEU C . n 
E 3 149 ASP 149 149 149 ASP ASP C . n 
E 3 150 VAL 150 150 150 VAL VAL C . n 
E 3 151 SER 151 151 151 SER SER C . n 
E 3 152 ASP 152 152 152 ASP ASP C . n 
E 3 153 GLN 153 153 153 GLN GLN C . n 
E 3 154 THR 154 154 154 THR THR C . n 
E 3 155 PRO 155 155 155 PRO PRO C . n 
E 3 156 ILE 156 156 156 ILE ILE C . n 
E 3 157 ASN 157 157 157 ASN ASN C . n 
E 3 158 SER 158 158 158 SER SER C . n 
E 3 159 ILE 159 159 159 ILE ILE C . n 
E 3 160 ILE 160 160 160 ILE ILE C . n 
E 3 161 PHE 161 161 161 PHE PHE C . n 
E 3 162 SER 162 162 162 SER SER C . n 
E 3 163 HIS 163 163 163 HIS HIS C . n 
E 3 164 GLU 164 164 164 GLU GLU C . n 
E 3 165 ASP 165 165 165 ASP ASP C . n 
E 3 166 GLY 166 166 166 GLY GLY C . n 
E 3 167 THR 167 167 167 THR THR C . n 
E 3 168 ARG 168 168 168 ARG ARG C . n 
E 3 169 LEU 169 169 169 LEU LEU C . n 
E 3 170 GLY 170 170 170 GLY GLY C . n 
E 3 171 VAL 171 171 171 VAL VAL C . n 
E 3 172 GLU 172 172 172 GLU GLU C . n 
E 3 173 HIS 173 173 173 HIS HIS C . n 
E 3 174 LEU 174 174 174 LEU LEU C . n 
E 3 175 VAL 175 175 175 VAL VAL C . n 
E 3 176 ALA 176 176 176 ALA ALA C . n 
E 3 177 LEU 177 177 177 LEU LEU C . n 
E 3 178 GLY 178 178 178 GLY GLY C . n 
E 3 179 HIS 179 179 179 HIS HIS C . n 
E 3 180 GLN 180 180 180 GLN GLN C . n 
E 3 181 GLN 181 181 181 GLN GLN C . n 
E 3 182 ILE 182 182 182 ILE ILE C . n 
E 3 183 ALA 183 183 183 ALA ALA C . n 
E 3 184 LEU 184 184 184 LEU LEU C . n 
E 3 185 LEU 185 185 185 LEU LEU C . n 
E 3 186 ALA 186 186 186 ALA ALA C . n 
E 3 187 GLY 187 187 187 GLY GLY C . n 
E 3 188 PRO 188 188 188 PRO PRO C . n 
E 3 189 LEU 189 189 189 LEU LEU C . n 
E 3 190 SER 190 190 190 SER SER C . n 
E 3 191 SER 191 191 191 SER SER C . n 
E 3 192 VAL 192 192 192 VAL VAL C . n 
E 3 193 SER 193 193 193 SER SER C . n 
E 3 194 ALA 194 194 194 ALA ALA C . n 
E 3 195 ARG 195 195 195 ARG ARG C . n 
E 3 196 LEU 196 196 196 LEU LEU C . n 
E 3 197 ARG 197 197 197 ARG ARG C . n 
E 3 198 LEU 198 198 198 LEU LEU C . n 
E 3 199 ALA 199 199 199 ALA ALA C . n 
E 3 200 GLY 200 200 200 GLY GLY C . n 
E 3 201 TRP 201 201 201 TRP TRP C . n 
E 3 202 HIS 202 202 202 HIS HIS C . n 
E 3 203 LYS 203 203 203 LYS LYS C . n 
E 3 204 TYR 204 204 204 TYR TYR C . n 
E 3 205 LEU 205 205 205 LEU LEU C . n 
E 3 206 THR 206 206 206 THR THR C . n 
E 3 207 ARG 207 207 207 ARG ARG C . n 
E 3 208 ASN 208 208 208 ASN ASN C . n 
E 3 209 GLN 209 209 209 GLN GLN C . n 
E 3 210 ILE 210 210 210 ILE ILE C . n 
E 3 211 GLN 211 211 211 GLN GLN C . n 
E 3 212 PRO 212 212 212 PRO PRO C . n 
E 3 213 ILE 213 213 213 ILE ILE C . n 
E 3 214 ALA 214 214 214 ALA ALA C . n 
E 3 215 GLU 215 215 215 GLU GLU C . n 
E 3 216 ARG 216 216 216 ARG ARG C . n 
E 3 217 GLU 217 217 217 GLU GLU C . n 
E 3 218 GLY 218 218 218 GLY GLY C . n 
E 3 219 ASP 219 219 219 ASP ASP C . n 
E 3 220 TRP 220 220 220 TRP TRP C . n 
E 3 221 SER 221 221 221 SER SER C . n 
E 3 222 ALA 222 222 222 ALA ALA C . n 
E 3 223 MET 223 223 223 MET MET C . n 
E 3 224 SER 224 224 224 SER SER C . n 
E 3 225 GLY 225 225 225 GLY GLY C . n 
E 3 226 PHE 226 226 226 PHE PHE C . n 
E 3 227 GLN 227 227 227 GLN GLN C . n 
E 3 228 GLN 228 228 228 GLN GLN C . n 
E 3 229 THR 229 229 229 THR THR C . n 
E 3 230 MET 230 230 230 MET MET C . n 
E 3 231 GLN 231 231 231 GLN GLN C . n 
E 3 232 MET 232 232 232 MET MET C . n 
E 3 233 LEU 233 233 233 LEU LEU C . n 
E 3 234 ASN 234 234 234 ASN ASN C . n 
E 3 235 GLU 235 235 235 GLU GLU C . n 
E 3 236 GLY 236 236 236 GLY GLY C . n 
E 3 237 ILE 237 237 237 ILE ILE C . n 
E 3 238 VAL 238 238 238 VAL VAL C . n 
E 3 239 PRO 239 239 239 PRO PRO C . n 
E 3 240 THR 240 240 240 THR THR C . n 
E 3 241 ALA 241 241 241 ALA ALA C . n 
E 3 242 MET 242 242 242 MET MET C . n 
E 3 243 LEU 243 243 243 LEU LEU C . n 
E 3 244 VAL 244 244 244 VAL VAL C . n 
E 3 245 ALA 245 245 245 ALA ALA C . n 
E 3 246 ASN 246 246 246 ASN ASN C . n 
E 3 247 ASP 247 247 247 ASP ASP C . n 
E 3 248 GLN 248 248 248 GLN GLN C . n 
E 3 249 MET 249 249 249 MET MET C . n 
E 3 250 ALA 250 250 250 ALA ALA C . n 
E 3 251 LEU 251 251 251 LEU LEU C . n 
E 3 252 GLY 252 252 252 GLY GLY C . n 
E 3 253 ALA 253 253 253 ALA ALA C . n 
E 3 254 MET 254 254 254 MET MET C . n 
E 3 255 ARG 255 255 255 ARG ARG C . n 
E 3 256 ALA 256 256 256 ALA ALA C . n 
E 3 257 ILE 257 257 257 ILE ILE C . n 
E 3 258 THR 258 258 258 THR THR C . n 
E 3 259 GLU 259 259 259 GLU GLU C . n 
E 3 260 SER 260 260 260 SER SER C . n 
E 3 261 GLY 261 261 261 GLY GLY C . n 
E 3 262 LEU 262 262 262 LEU LEU C . n 
E 3 263 ARG 263 263 263 ARG ARG C . n 
E 3 264 VAL 264 264 264 VAL VAL C . n 
E 3 265 GLY 265 265 265 GLY GLY C . n 
E 3 266 ALA 266 266 266 ALA ALA C . n 
E 3 267 ASP 267 267 267 ASP ASP C . n 
E 3 268 ILE 268 268 268 ILE ILE C . n 
E 3 269 SER 269 269 269 SER SER C . n 
E 3 270 VAL 270 270 270 VAL VAL C . n 
E 3 271 VAL 271 271 271 VAL VAL C . n 
E 3 272 GLY 272 272 272 GLY GLY C . n 
E 3 273 TYR 273 273 273 TYR TYR C . n 
E 3 274 ASP 274 274 274 ASP ASP C . n 
E 3 275 ASP 275 275 275 ASP ASP C . n 
E 3 276 THR 276 276 276 THR THR C . n 
E 3 277 GLU 277 277 277 GLU GLU C . n 
E 3 278 ASP 278 278 278 ASP ASP C . n 
E 3 279 SER 279 279 279 SER SER C . n 
E 3 280 SER 280 280 280 SER SER C . n 
E 3 281 CYS 281 281 281 CYS CYS C . n 
E 3 282 TYR 282 282 282 TYR TYR C . n 
E 3 283 ILE 283 283 283 ILE ILE C . n 
E 3 284 PRO 284 284 284 PRO PRO C . n 
E 3 285 PRO 285 285 285 PRO PRO C . n 
E 3 286 LEU 286 286 286 LEU LEU C . n 
E 3 287 THR 287 287 287 THR THR C . n 
E 3 288 THR 288 288 288 THR THR C . n 
E 3 289 ILE 289 289 289 ILE ILE C . n 
E 3 290 LYS 290 290 290 LYS LYS C . n 
E 3 291 GLN 291 291 291 GLN GLN C . n 
E 3 292 ASP 292 292 292 ASP ASP C . n 
E 3 293 PHE 293 293 293 PHE PHE C . n 
E 3 294 ARG 294 294 294 ARG ARG C . n 
E 3 295 LEU 295 295 295 LEU LEU C . n 
E 3 296 LEU 296 296 296 LEU LEU C . n 
E 3 297 GLY 297 297 297 GLY GLY C . n 
E 3 298 GLN 298 298 298 GLN GLN C . n 
E 3 299 THR 299 299 299 THR THR C . n 
E 3 300 SER 300 300 300 SER SER C . n 
E 3 301 VAL 301 301 301 VAL VAL C . n 
E 3 302 ASP 302 302 302 ASP ASP C . n 
E 3 303 ARG 303 303 303 ARG ARG C . n 
E 3 304 LEU 304 304 304 LEU LEU C . n 
E 3 305 LEU 305 305 305 LEU LEU C . n 
E 3 306 GLN 306 306 306 GLN GLN C . n 
E 3 307 LEU 307 307 307 LEU LEU C . n 
E 3 308 SER 308 308 308 SER SER C . n 
E 3 309 GLN 309 309 309 GLN GLN C . n 
E 3 310 GLY 310 310 310 GLY GLY C . n 
E 3 311 GLN 311 311 311 GLN GLN C . n 
E 3 312 ALA 312 312 312 ALA ALA C . n 
E 3 313 VAL 313 313 313 VAL VAL C . n 
E 3 314 LYS 314 314 314 LYS LYS C . n 
E 3 315 GLY 315 315 315 GLY GLY C . n 
E 3 316 ASN 316 316 316 ASN ASN C . n 
E 3 317 GLN 317 317 317 GLN GLN C . n 
E 3 318 LEU 318 318 318 LEU LEU C . n 
E 3 319 LEU 319 319 319 LEU LEU C . n 
E 3 320 PRO 320 320 320 PRO PRO C . n 
E 3 321 VAL 321 321 321 VAL VAL C . n 
E 3 322 SER 322 322 322 SER SER C . n 
E 3 323 LEU 323 323 323 LEU LEU C . n 
E 3 324 VAL 324 324 324 VAL VAL C . n 
E 3 325 LYS 325 325 325 LYS LYS C . n 
E 3 326 ARG 326 326 326 ARG ARG C . n 
E 3 327 LYS 327 327 327 LYS LYS C . n 
E 3 328 THR 328 328 328 THR THR C . n 
E 3 329 THR 329 329 329 THR THR C . n 
E 3 330 LEU 330 330 330 LEU LEU C . n 
E 3 331 ALA 331 331 ?   ?   ?   C . n 
E 3 332 PRO 332 332 ?   ?   ?   C . n 
E 3 333 ASN 333 333 ?   ?   ?   C . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
F 4 NPF 1 334 1 NPF ONP A . 
G 4 NPF 1 334 1 NPF ONP B . 
H 4 NPF 1 334 1 NPF ONP C . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? tetrameric 4 
2 author_defined_assembly ? dimeric    2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1   A,B,C,D,F,G 
2 1,2 E,H         
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555  x,y,z                 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 
1.0000000000  0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 17_555 x-y+1/3,-y+2/3,-z+2/3 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 
-1.0000000000 0.0000000000 147.6694557009 0.0000000000 0.0000000000 -1.0000000000 137.8633333333 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2001-10-05 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 2 0 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 4 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' Advisory                    
4 4 'Structure model' 'Atomic model'              
5 4 'Structure model' 'Data collection'           
6 4 'Structure model' 'Derived calculations'      
7 4 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' atom_site                 
2 4 'Structure model' chem_comp                 
3 4 'Structure model' database_PDB_caveat       
4 4 'Structure model' entity                    
5 4 'Structure model' pdbx_chem_comp_identifier 
6 4 'Structure model' pdbx_entity_nonpoly       
7 4 'Structure model' struct_site               
8 4 'Structure model' struct_site_gen           
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_atom_site.auth_atom_id'   
2 4 'Structure model' '_atom_site.label_atom_id'  
3 4 'Structure model' '_chem_comp.mon_nstd_flag'  
4 4 'Structure model' '_chem_comp.name'           
5 4 'Structure model' '_chem_comp.type'           
6 4 'Structure model' '_database_PDB_caveat.text' 
7 4 'Structure model' '_entity.pdbx_description'  
8 4 'Structure model' '_pdbx_entity_nonpoly.name' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
AMoRE     phasing          .   ? 1 
CNS       refinement       1.0 ? 2 
DENZO     'data reduction' .   ? 3 
SCALEPACK 'data scaling'   .   ? 4 
# 
_pdbx_database_remark.id     300 
_pdbx_database_remark.text   
;
BIOMOLECULE: 1, 2
THIS ENTRY CONTAINS THE CRYSTALLOGRAPHIC ASYMMETRIC
UNIT WHICH CONSISTS OF 5 CHAIN(S). BIOMOLECULE 1 IS
COMPLETE BUT BIOMOLECULE 2 IS INCOMPLETE.  BIOMOLECULE
2 DOES NOT CONTAIN THE DNA CHAINS BECAUSE THEY ARE
DISORDERED.  SEE REMARK 350 FOR INFORMATION ON
GENERATING THE BIOLOGICAL MOLECULE(S).
;
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CA A LYS 2  ? ? CB A LYS 2  ? ? 1.379 1.535 -0.156 0.022 N 
2 1 C  B LEU 45 ? ? O  B LEU 45 ? ? 1.362 1.229 0.133  0.019 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 "O4'" E DG  6   ? ? "C1'" E DG  6   ? ? N9    E DG  6   ? ? 113.12 108.30 4.82   0.30 N 
2  1 "O4'" E DT  10  ? ? "C1'" E DT  10  ? ? "C2'" E DT  10  ? ? 110.41 106.80 3.61   0.50 N 
3  1 N1    E DT  10  ? ? "C1'" E DT  10  ? ? "C2'" E DT  10  ? ? 128.48 114.30 14.18  1.40 N 
4  1 "O4'" E DT  10  ? ? "C1'" E DT  10  ? ? N1    E DT  10  ? ? 113.27 108.30 4.97   0.30 N 
5  1 N     A LYS 2   ? ? CA    A LYS 2   ? ? CB    A LYS 2   ? ? 99.22  110.60 -11.38 1.80 N 
6  1 C     A LYS 2   ? ? N     A PRO 3   ? ? CA    A PRO 3   ? ? 133.14 119.30 13.84  1.50 Y 
7  1 N     A ALA 27  ? ? CA    A ALA 27  ? ? C     A ALA 27  ? ? 129.60 111.00 18.60  2.70 N 
8  1 NE    A ARG 294 ? ? CZ    A ARG 294 ? ? NH1   A ARG 294 ? ? 124.31 120.30 4.01   0.50 N 
9  1 NE    A ARG 294 ? ? CZ    A ARG 294 ? ? NH2   A ARG 294 ? ? 115.85 120.30 -4.45  0.50 N 
10 1 NE    A ARG 303 ? ? CZ    A ARG 303 ? ? NH1   A ARG 303 ? ? 125.00 120.30 4.70   0.50 N 
11 1 NE    A ARG 303 ? ? CZ    A ARG 303 ? ? NH2   A ARG 303 ? ? 115.31 120.30 -4.99  0.50 N 
12 1 C     B LYS 2   ? ? N     B PRO 3   ? ? CA    B PRO 3   ? ? 129.99 119.30 10.69  1.50 Y 
13 1 CD    B ARG 294 ? ? NE    B ARG 294 ? ? CZ    B ARG 294 ? ? 132.67 123.60 9.07   1.40 N 
14 1 NE    B ARG 294 ? ? CZ    B ARG 294 ? ? NH1   B ARG 294 ? ? 112.08 120.30 -8.22  0.50 N 
15 1 NE    B ARG 294 ? ? CZ    B ARG 294 ? ? NH2   B ARG 294 ? ? 128.10 120.30 7.80   0.50 N 
16 1 CD    B ARG 303 ? ? NE    B ARG 303 ? ? CZ    B ARG 303 ? ? 136.39 123.60 12.79  1.40 N 
17 1 NE    B ARG 303 ? ? CZ    B ARG 303 ? ? NH1   B ARG 303 ? ? 110.72 120.30 -9.58  0.50 N 
18 1 NE    B ARG 303 ? ? CZ    B ARG 303 ? ? NH2   B ARG 303 ? ? 128.58 120.30 8.28   0.50 N 
19 1 NE    C ARG 294 ? ? CZ    C ARG 294 ? ? NH1   C ARG 294 ? ? 124.51 120.30 4.21   0.50 N 
20 1 NE    C ARG 294 ? ? CZ    C ARG 294 ? ? NH2   C ARG 294 ? ? 115.90 120.30 -4.40  0.50 N 
21 1 NE    C ARG 303 ? ? CZ    C ARG 303 ? ? NH1   C ARG 303 ? ? 125.03 120.30 4.73   0.50 N 
22 1 NE    C ARG 303 ? ? CZ    C ARG 303 ? ? NH2   C ARG 303 ? ? 114.97 120.30 -5.33  0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PRO A 3   ? ? -28.03  157.88  
2  1 ALA A 13  ? ? -143.62 -11.91  
3  1 VAL A 15  ? ? -122.20 -161.85 
4  1 ALA A 27  ? ? -17.97  156.18  
5  1 HIS A 29  ? ? 72.93   109.61  
6  1 SER A 31  ? ? -60.75  29.56   
7  1 ALA A 32  ? ? 57.51   -91.23  
8  1 ASN A 46  ? ? 116.24  63.16   
9  1 ASN A 50  ? ? -65.61  86.35   
10 1 GLN A 60  ? ? -69.80  97.37   
11 1 LEU A 62  ? ? -56.07  76.81   
12 1 HIS A 74  ? ? -45.86  -76.19  
13 1 SER A 85  ? ? -43.11  -70.91  
14 1 ASN A 125 ? ? -106.08 70.51   
15 1 THR A 141 ? ? -49.17  94.90   
16 1 ASN A 142 ? ? 77.44   -32.64  
17 1 GLN A 180 ? ? -131.54 -32.13  
18 1 ALA A 214 ? ? -174.46 144.73  
19 1 TRP A 220 ? ? 84.87   -26.24  
20 1 ASP A 274 ? ? 122.70  -52.13  
21 1 ASP A 275 ? ? 65.37   61.56   
22 1 ASP A 292 ? ? -66.08  78.63   
23 1 ARG A 326 ? ? -115.11 -131.82 
24 1 PRO B 3   ? ? -18.14  148.28  
25 1 ALA B 13  ? ? -143.42 -11.27  
26 1 VAL B 15  ? ? -122.39 -161.94 
27 1 ALA B 27  ? ? -26.47  157.77  
28 1 HIS B 29  ? ? 76.27   105.76  
29 1 SER B 31  ? ? -63.01  30.76   
30 1 ALA B 32  ? ? 58.22   -89.43  
31 1 ASN B 46  ? ? 94.77   67.58   
32 1 ASN B 50  ? ? -66.26  86.21   
33 1 GLN B 60  ? ? -69.73  95.90   
34 1 HIS B 74  ? ? -45.92  -75.22  
35 1 SER B 85  ? ? -42.70  -70.20  
36 1 ASN B 125 ? ? -107.51 69.54   
37 1 THR B 141 ? ? -49.57  94.63   
38 1 ASN B 142 ? ? 78.03   -34.12  
39 1 GLN B 180 ? ? -132.67 -30.83  
40 1 ALA B 214 ? ? -173.20 143.88  
41 1 TRP B 220 ? ? 83.99   -24.74  
42 1 GLU B 259 ? ? -68.85  0.09    
43 1 ASP B 274 ? ? 122.44  -53.87  
44 1 ASP B 292 ? ? -67.18  78.31   
45 1 ARG B 326 ? ? -115.28 -129.80 
46 1 HIS C 74  ? ? -46.60  -74.51  
47 1 SER C 85  ? ? -43.41  -70.51  
48 1 ASN C 125 ? ? -106.69 70.55   
49 1 THR C 141 ? ? -49.42  94.28   
50 1 ASN C 142 ? ? 77.42   -32.49  
51 1 GLN C 180 ? ? -131.07 -31.84  
52 1 ALA C 214 ? ? -174.68 143.78  
53 1 TRP C 220 ? ? 85.02   -26.47  
54 1 PRO C 239 ? ? -69.52  -173.12 
55 1 GLU C 259 ? ? -68.42  0.10    
56 1 ASP C 274 ? ? 123.48  -53.81  
57 1 ASP C 275 ? ? 66.99   60.23   
58 1 ASP C 292 ? ? -67.77  78.44   
59 1 ARG C 326 ? ? -115.70 -131.33 
# 
_pdbx_validate_chiral.id              1 
_pdbx_validate_chiral.PDB_model_num   1 
_pdbx_validate_chiral.auth_atom_id    "C1'" 
_pdbx_validate_chiral.label_alt_id    ? 
_pdbx_validate_chiral.auth_asym_id    E 
_pdbx_validate_chiral.auth_comp_id    DT 
_pdbx_validate_chiral.auth_seq_id     10 
_pdbx_validate_chiral.PDB_ins_code    ? 
_pdbx_validate_chiral.details         'WRONG HAND' 
_pdbx_validate_chiral.omega           . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 D DT  6  ? P   ? A DT  6  P   
2   1 Y 1 D DT  6  ? OP1 ? A DT  6  OP1 
3   1 Y 1 D DT  6  ? OP2 ? A DT  6  OP2 
4   1 Y 1 A LYS 2  ? CG  ? C LYS 2  CG  
5   1 Y 1 A LYS 2  ? CD  ? C LYS 2  CD  
6   1 Y 1 A LYS 2  ? CE  ? C LYS 2  CE  
7   1 Y 1 A LYS 2  ? NZ  ? C LYS 2  NZ  
8   1 Y 1 A PRO 3  ? CG  ? C PRO 3  CG  
9   1 Y 1 A PRO 3  ? CD  ? C PRO 3  CD  
10  1 Y 1 A VAL 4  ? CG1 ? C VAL 4  CG1 
11  1 Y 1 A VAL 4  ? CG2 ? C VAL 4  CG2 
12  1 Y 1 A THR 5  ? OG1 ? C THR 5  OG1 
13  1 Y 1 A THR 5  ? CG2 ? C THR 5  CG2 
14  1 Y 1 A LEU 6  ? CG  ? C LEU 6  CG  
15  1 Y 1 A LEU 6  ? CD1 ? C LEU 6  CD1 
16  1 Y 1 A LEU 6  ? CD2 ? C LEU 6  CD2 
17  1 Y 1 A TYR 7  ? CG  ? C TYR 7  CG  
18  1 Y 1 A TYR 7  ? CD1 ? C TYR 7  CD1 
19  1 Y 1 A TYR 7  ? CD2 ? C TYR 7  CD2 
20  1 Y 1 A TYR 7  ? CE1 ? C TYR 7  CE1 
21  1 Y 1 A TYR 7  ? CE2 ? C TYR 7  CE2 
22  1 Y 1 A TYR 7  ? CZ  ? C TYR 7  CZ  
23  1 Y 1 A TYR 7  ? OH  ? C TYR 7  OH  
24  1 Y 1 A ASP 8  ? CG  ? C ASP 8  CG  
25  1 Y 1 A ASP 8  ? OD1 ? C ASP 8  OD1 
26  1 Y 1 A ASP 8  ? OD2 ? C ASP 8  OD2 
27  1 Y 1 A VAL 9  ? CG1 ? C VAL 9  CG1 
28  1 Y 1 A VAL 9  ? CG2 ? C VAL 9  CG2 
29  1 Y 1 A GLU 11 ? CG  ? C GLU 11 CG  
30  1 Y 1 A GLU 11 ? CD  ? C GLU 11 CD  
31  1 Y 1 A GLU 11 ? OE1 ? C GLU 11 OE1 
32  1 Y 1 A GLU 11 ? OE2 ? C GLU 11 OE2 
33  1 Y 1 A TYR 12 ? CG  ? C TYR 12 CG  
34  1 Y 1 A TYR 12 ? CD1 ? C TYR 12 CD1 
35  1 Y 1 A TYR 12 ? CD2 ? C TYR 12 CD2 
36  1 Y 1 A TYR 12 ? CE1 ? C TYR 12 CE1 
37  1 Y 1 A TYR 12 ? CE2 ? C TYR 12 CE2 
38  1 Y 1 A TYR 12 ? CZ  ? C TYR 12 CZ  
39  1 Y 1 A TYR 12 ? OH  ? C TYR 12 OH  
40  1 Y 1 A VAL 15 ? CG1 ? C VAL 15 CG1 
41  1 Y 1 A VAL 15 ? CG2 ? C VAL 15 CG2 
42  1 Y 1 A SER 16 ? OG  ? C SER 16 OG  
43  1 Y 1 A TYR 17 ? CG  ? C TYR 17 CG  
44  1 Y 1 A TYR 17 ? CD1 ? C TYR 17 CD1 
45  1 Y 1 A TYR 17 ? CD2 ? C TYR 17 CD2 
46  1 Y 1 A TYR 17 ? CE1 ? C TYR 17 CE1 
47  1 Y 1 A TYR 17 ? CE2 ? C TYR 17 CE2 
48  1 Y 1 A TYR 17 ? CZ  ? C TYR 17 CZ  
49  1 Y 1 A TYR 17 ? OH  ? C TYR 17 OH  
50  1 Y 1 A GLN 18 ? CG  ? C GLN 18 CG  
51  1 Y 1 A GLN 18 ? CD  ? C GLN 18 CD  
52  1 Y 1 A GLN 18 ? OE1 ? C GLN 18 OE1 
53  1 Y 1 A GLN 18 ? NE2 ? C GLN 18 NE2 
54  1 Y 1 A THR 19 ? OG1 ? C THR 19 OG1 
55  1 Y 1 A THR 19 ? CG2 ? C THR 19 CG2 
56  1 Y 1 A VAL 20 ? CG1 ? C VAL 20 CG1 
57  1 Y 1 A VAL 20 ? CG2 ? C VAL 20 CG2 
58  1 Y 1 A SER 21 ? OG  ? C SER 21 OG  
59  1 Y 1 A ARG 22 ? CG  ? C ARG 22 CG  
60  1 Y 1 A ARG 22 ? CD  ? C ARG 22 CD  
61  1 Y 1 A ARG 22 ? NE  ? C ARG 22 NE  
62  1 Y 1 A ARG 22 ? CZ  ? C ARG 22 CZ  
63  1 Y 1 A ARG 22 ? NH1 ? C ARG 22 NH1 
64  1 Y 1 A ARG 22 ? NH2 ? C ARG 22 NH2 
65  1 Y 1 A VAL 23 ? CG1 ? C VAL 23 CG1 
66  1 Y 1 A VAL 23 ? CG2 ? C VAL 23 CG2 
67  1 Y 1 A VAL 24 ? CG1 ? C VAL 24 CG1 
68  1 Y 1 A VAL 24 ? CG2 ? C VAL 24 CG2 
69  1 Y 1 A ASN 25 ? CG  ? C ASN 25 CG  
70  1 Y 1 A ASN 25 ? OD1 ? C ASN 25 OD1 
71  1 Y 1 A ASN 25 ? ND2 ? C ASN 25 ND2 
72  1 Y 1 A GLN 26 ? CG  ? C GLN 26 CG  
73  1 Y 1 A GLN 26 ? CD  ? C GLN 26 CD  
74  1 Y 1 A GLN 26 ? OE1 ? C GLN 26 OE1 
75  1 Y 1 A GLN 26 ? NE2 ? C GLN 26 NE2 
76  1 Y 1 A SER 28 ? OG  ? C SER 28 OG  
77  1 Y 1 A HIS 29 ? CG  ? C HIS 29 CG  
78  1 Y 1 A HIS 29 ? ND1 ? C HIS 29 ND1 
79  1 Y 1 A HIS 29 ? CD2 ? C HIS 29 CD2 
80  1 Y 1 A HIS 29 ? CE1 ? C HIS 29 CE1 
81  1 Y 1 A HIS 29 ? NE2 ? C HIS 29 NE2 
82  1 Y 1 A VAL 30 ? CG1 ? C VAL 30 CG1 
83  1 Y 1 A VAL 30 ? CG2 ? C VAL 30 CG2 
84  1 Y 1 A SER 31 ? OG  ? C SER 31 OG  
85  1 Y 1 A LYS 33 ? CG  ? C LYS 33 CG  
86  1 Y 1 A LYS 33 ? CD  ? C LYS 33 CD  
87  1 Y 1 A LYS 33 ? CE  ? C LYS 33 CE  
88  1 Y 1 A LYS 33 ? NZ  ? C LYS 33 NZ  
89  1 Y 1 A THR 34 ? OG1 ? C THR 34 OG1 
90  1 Y 1 A THR 34 ? CG2 ? C THR 34 CG2 
91  1 Y 1 A ARG 35 ? CG  ? C ARG 35 CG  
92  1 Y 1 A ARG 35 ? CD  ? C ARG 35 CD  
93  1 Y 1 A ARG 35 ? NE  ? C ARG 35 NE  
94  1 Y 1 A ARG 35 ? CZ  ? C ARG 35 CZ  
95  1 Y 1 A ARG 35 ? NH1 ? C ARG 35 NH1 
96  1 Y 1 A ARG 35 ? NH2 ? C ARG 35 NH2 
97  1 Y 1 A GLU 36 ? CG  ? C GLU 36 CG  
98  1 Y 1 A GLU 36 ? CD  ? C GLU 36 CD  
99  1 Y 1 A GLU 36 ? OE1 ? C GLU 36 OE1 
100 1 Y 1 A GLU 36 ? OE2 ? C GLU 36 OE2 
101 1 Y 1 A LYS 37 ? CG  ? C LYS 37 CG  
102 1 Y 1 A LYS 37 ? CD  ? C LYS 37 CD  
103 1 Y 1 A LYS 37 ? CE  ? C LYS 37 CE  
104 1 Y 1 A LYS 37 ? NZ  ? C LYS 37 NZ  
105 1 Y 1 A VAL 38 ? CG1 ? C VAL 38 CG1 
106 1 Y 1 A VAL 38 ? CG2 ? C VAL 38 CG2 
107 1 Y 1 A GLU 39 ? CG  ? C GLU 39 CG  
108 1 Y 1 A GLU 39 ? CD  ? C GLU 39 CD  
109 1 Y 1 A GLU 39 ? OE1 ? C GLU 39 OE1 
110 1 Y 1 A GLU 39 ? OE2 ? C GLU 39 OE2 
111 1 Y 1 A MET 42 ? CG  ? C MET 42 CG  
112 1 Y 1 A MET 42 ? SD  ? C MET 42 SD  
113 1 Y 1 A MET 42 ? CE  ? C MET 42 CE  
114 1 Y 1 A GLU 44 ? CG  ? C GLU 44 CG  
115 1 Y 1 A GLU 44 ? CD  ? C GLU 44 CD  
116 1 Y 1 A GLU 44 ? OE1 ? C GLU 44 OE1 
117 1 Y 1 A GLU 44 ? OE2 ? C GLU 44 OE2 
118 1 Y 1 A LEU 45 ? CG  ? C LEU 45 CG  
119 1 Y 1 A LEU 45 ? CD1 ? C LEU 45 CD1 
120 1 Y 1 A LEU 45 ? CD2 ? C LEU 45 CD2 
121 1 Y 1 A ASN 46 ? CG  ? C ASN 46 CG  
122 1 Y 1 A ASN 46 ? OD1 ? C ASN 46 OD1 
123 1 Y 1 A ASN 46 ? ND2 ? C ASN 46 ND2 
124 1 Y 1 A TYR 47 ? CG  ? C TYR 47 CG  
125 1 Y 1 A TYR 47 ? CD1 ? C TYR 47 CD1 
126 1 Y 1 A TYR 47 ? CD2 ? C TYR 47 CD2 
127 1 Y 1 A TYR 47 ? CE1 ? C TYR 47 CE1 
128 1 Y 1 A TYR 47 ? CE2 ? C TYR 47 CE2 
129 1 Y 1 A TYR 47 ? CZ  ? C TYR 47 CZ  
130 1 Y 1 A TYR 47 ? OH  ? C TYR 47 OH  
131 1 Y 1 A ILE 48 ? CG1 ? C ILE 48 CG1 
132 1 Y 1 A ILE 48 ? CG2 ? C ILE 48 CG2 
133 1 Y 1 A ILE 48 ? CD1 ? C ILE 48 CD1 
134 1 Y 1 A PRO 49 ? CG  ? C PRO 49 CG  
135 1 Y 1 A PRO 49 ? CD  ? C PRO 49 CD  
136 1 Y 1 A ASN 50 ? CG  ? C ASN 50 CG  
137 1 Y 1 A ASN 50 ? OD1 ? C ASN 50 OD1 
138 1 Y 1 A ASN 50 ? ND2 ? C ASN 50 ND2 
139 1 Y 1 A ARG 51 ? CG  ? C ARG 51 CG  
140 1 Y 1 A ARG 51 ? CD  ? C ARG 51 CD  
141 1 Y 1 A ARG 51 ? NE  ? C ARG 51 NE  
142 1 Y 1 A ARG 51 ? CZ  ? C ARG 51 CZ  
143 1 Y 1 A ARG 51 ? NH1 ? C ARG 51 NH1 
144 1 Y 1 A ARG 51 ? NH2 ? C ARG 51 NH2 
145 1 Y 1 A VAL 52 ? CG1 ? C VAL 52 CG1 
146 1 Y 1 A VAL 52 ? CG2 ? C VAL 52 CG2 
147 1 Y 1 A GLN 54 ? CG  ? C GLN 54 CG  
148 1 Y 1 A GLN 54 ? CD  ? C GLN 54 CD  
149 1 Y 1 A GLN 54 ? OE1 ? C GLN 54 OE1 
150 1 Y 1 A GLN 54 ? NE2 ? C GLN 54 NE2 
151 1 Y 1 A GLN 55 ? CG  ? C GLN 55 CG  
152 1 Y 1 A GLN 55 ? CD  ? C GLN 55 CD  
153 1 Y 1 A GLN 55 ? OE1 ? C GLN 55 OE1 
154 1 Y 1 A GLN 55 ? NE2 ? C GLN 55 NE2 
155 1 Y 1 A LEU 56 ? CG  ? C LEU 56 CG  
156 1 Y 1 A LEU 56 ? CD1 ? C LEU 56 CD1 
157 1 Y 1 A LEU 56 ? CD2 ? C LEU 56 CD2 
158 1 Y 1 A LYS 59 ? CG  ? C LYS 59 CG  
159 1 Y 1 A LYS 59 ? CD  ? C LYS 59 CD  
160 1 Y 1 A LYS 59 ? CE  ? C LYS 59 CE  
161 1 Y 1 A LYS 59 ? NZ  ? C LYS 59 NZ  
162 1 Y 1 A GLN 60 ? CG  ? C GLN 60 CG  
163 1 Y 1 A GLN 60 ? CD  ? C GLN 60 CD  
164 1 Y 1 A GLN 60 ? OE1 ? C GLN 60 OE1 
165 1 Y 1 A GLN 60 ? NE2 ? C GLN 60 NE2 
166 1 Y 1 A SER 61 ? OG  ? C SER 61 OG  
167 1 Y 1 B LYS 2  ? CG  ? D LYS 2  CG  
168 1 Y 1 B LYS 2  ? CD  ? D LYS 2  CD  
169 1 Y 1 B LYS 2  ? CE  ? D LYS 2  CE  
170 1 Y 1 B LYS 2  ? NZ  ? D LYS 2  NZ  
171 1 Y 1 B PRO 3  ? CG  ? D PRO 3  CG  
172 1 Y 1 B PRO 3  ? CD  ? D PRO 3  CD  
173 1 Y 1 B VAL 4  ? CG1 ? D VAL 4  CG1 
174 1 Y 1 B VAL 4  ? CG2 ? D VAL 4  CG2 
175 1 Y 1 B THR 5  ? OG1 ? D THR 5  OG1 
176 1 Y 1 B THR 5  ? CG2 ? D THR 5  CG2 
177 1 Y 1 B LEU 6  ? CG  ? D LEU 6  CG  
178 1 Y 1 B LEU 6  ? CD1 ? D LEU 6  CD1 
179 1 Y 1 B LEU 6  ? CD2 ? D LEU 6  CD2 
180 1 Y 1 B TYR 7  ? CG  ? D TYR 7  CG  
181 1 Y 1 B TYR 7  ? CD1 ? D TYR 7  CD1 
182 1 Y 1 B TYR 7  ? CD2 ? D TYR 7  CD2 
183 1 Y 1 B TYR 7  ? CE1 ? D TYR 7  CE1 
184 1 Y 1 B TYR 7  ? CE2 ? D TYR 7  CE2 
185 1 Y 1 B TYR 7  ? CZ  ? D TYR 7  CZ  
186 1 Y 1 B TYR 7  ? OH  ? D TYR 7  OH  
187 1 Y 1 B ASP 8  ? CG  ? D ASP 8  CG  
188 1 Y 1 B ASP 8  ? OD1 ? D ASP 8  OD1 
189 1 Y 1 B ASP 8  ? OD2 ? D ASP 8  OD2 
190 1 Y 1 B VAL 9  ? CG1 ? D VAL 9  CG1 
191 1 Y 1 B VAL 9  ? CG2 ? D VAL 9  CG2 
192 1 Y 1 B GLU 11 ? CG  ? D GLU 11 CG  
193 1 Y 1 B GLU 11 ? CD  ? D GLU 11 CD  
194 1 Y 1 B GLU 11 ? OE1 ? D GLU 11 OE1 
195 1 Y 1 B GLU 11 ? OE2 ? D GLU 11 OE2 
196 1 Y 1 B TYR 12 ? CG  ? D TYR 12 CG  
197 1 Y 1 B TYR 12 ? CD1 ? D TYR 12 CD1 
198 1 Y 1 B TYR 12 ? CD2 ? D TYR 12 CD2 
199 1 Y 1 B TYR 12 ? CE1 ? D TYR 12 CE1 
200 1 Y 1 B TYR 12 ? CE2 ? D TYR 12 CE2 
201 1 Y 1 B TYR 12 ? CZ  ? D TYR 12 CZ  
202 1 Y 1 B TYR 12 ? OH  ? D TYR 12 OH  
203 1 Y 1 B VAL 15 ? CG1 ? D VAL 15 CG1 
204 1 Y 1 B VAL 15 ? CG2 ? D VAL 15 CG2 
205 1 Y 1 B SER 16 ? OG  ? D SER 16 OG  
206 1 Y 1 B TYR 17 ? CG  ? D TYR 17 CG  
207 1 Y 1 B TYR 17 ? CD1 ? D TYR 17 CD1 
208 1 Y 1 B TYR 17 ? CD2 ? D TYR 17 CD2 
209 1 Y 1 B TYR 17 ? CE1 ? D TYR 17 CE1 
210 1 Y 1 B TYR 17 ? CE2 ? D TYR 17 CE2 
211 1 Y 1 B TYR 17 ? CZ  ? D TYR 17 CZ  
212 1 Y 1 B TYR 17 ? OH  ? D TYR 17 OH  
213 1 Y 1 B GLN 18 ? CG  ? D GLN 18 CG  
214 1 Y 1 B GLN 18 ? CD  ? D GLN 18 CD  
215 1 Y 1 B GLN 18 ? OE1 ? D GLN 18 OE1 
216 1 Y 1 B GLN 18 ? NE2 ? D GLN 18 NE2 
217 1 Y 1 B THR 19 ? OG1 ? D THR 19 OG1 
218 1 Y 1 B THR 19 ? CG2 ? D THR 19 CG2 
219 1 Y 1 B VAL 20 ? CG1 ? D VAL 20 CG1 
220 1 Y 1 B VAL 20 ? CG2 ? D VAL 20 CG2 
221 1 Y 1 B SER 21 ? OG  ? D SER 21 OG  
222 1 Y 1 B ARG 22 ? CG  ? D ARG 22 CG  
223 1 Y 1 B ARG 22 ? CD  ? D ARG 22 CD  
224 1 Y 1 B ARG 22 ? NE  ? D ARG 22 NE  
225 1 Y 1 B ARG 22 ? CZ  ? D ARG 22 CZ  
226 1 Y 1 B ARG 22 ? NH1 ? D ARG 22 NH1 
227 1 Y 1 B ARG 22 ? NH2 ? D ARG 22 NH2 
228 1 Y 1 B VAL 23 ? CG1 ? D VAL 23 CG1 
229 1 Y 1 B VAL 23 ? CG2 ? D VAL 23 CG2 
230 1 Y 1 B VAL 24 ? CG1 ? D VAL 24 CG1 
231 1 Y 1 B VAL 24 ? CG2 ? D VAL 24 CG2 
232 1 Y 1 B ASN 25 ? CG  ? D ASN 25 CG  
233 1 Y 1 B ASN 25 ? OD1 ? D ASN 25 OD1 
234 1 Y 1 B ASN 25 ? ND2 ? D ASN 25 ND2 
235 1 Y 1 B GLN 26 ? CG  ? D GLN 26 CG  
236 1 Y 1 B GLN 26 ? CD  ? D GLN 26 CD  
237 1 Y 1 B GLN 26 ? OE1 ? D GLN 26 OE1 
238 1 Y 1 B GLN 26 ? NE2 ? D GLN 26 NE2 
239 1 Y 1 B SER 28 ? OG  ? D SER 28 OG  
240 1 Y 1 B HIS 29 ? CG  ? D HIS 29 CG  
241 1 Y 1 B HIS 29 ? ND1 ? D HIS 29 ND1 
242 1 Y 1 B HIS 29 ? CD2 ? D HIS 29 CD2 
243 1 Y 1 B HIS 29 ? CE1 ? D HIS 29 CE1 
244 1 Y 1 B HIS 29 ? NE2 ? D HIS 29 NE2 
245 1 Y 1 B VAL 30 ? CG1 ? D VAL 30 CG1 
246 1 Y 1 B VAL 30 ? CG2 ? D VAL 30 CG2 
247 1 Y 1 B SER 31 ? OG  ? D SER 31 OG  
248 1 Y 1 B LYS 33 ? CG  ? D LYS 33 CG  
249 1 Y 1 B LYS 33 ? CD  ? D LYS 33 CD  
250 1 Y 1 B LYS 33 ? CE  ? D LYS 33 CE  
251 1 Y 1 B LYS 33 ? NZ  ? D LYS 33 NZ  
252 1 Y 1 B THR 34 ? OG1 ? D THR 34 OG1 
253 1 Y 1 B THR 34 ? CG2 ? D THR 34 CG2 
254 1 Y 1 B ARG 35 ? CG  ? D ARG 35 CG  
255 1 Y 1 B ARG 35 ? CD  ? D ARG 35 CD  
256 1 Y 1 B ARG 35 ? NE  ? D ARG 35 NE  
257 1 Y 1 B ARG 35 ? CZ  ? D ARG 35 CZ  
258 1 Y 1 B ARG 35 ? NH1 ? D ARG 35 NH1 
259 1 Y 1 B ARG 35 ? NH2 ? D ARG 35 NH2 
260 1 Y 1 B GLU 36 ? CG  ? D GLU 36 CG  
261 1 Y 1 B GLU 36 ? CD  ? D GLU 36 CD  
262 1 Y 1 B GLU 36 ? OE1 ? D GLU 36 OE1 
263 1 Y 1 B GLU 36 ? OE2 ? D GLU 36 OE2 
264 1 Y 1 B LYS 37 ? CG  ? D LYS 37 CG  
265 1 Y 1 B LYS 37 ? CD  ? D LYS 37 CD  
266 1 Y 1 B LYS 37 ? CE  ? D LYS 37 CE  
267 1 Y 1 B LYS 37 ? NZ  ? D LYS 37 NZ  
268 1 Y 1 B VAL 38 ? CG1 ? D VAL 38 CG1 
269 1 Y 1 B VAL 38 ? CG2 ? D VAL 38 CG2 
270 1 Y 1 B GLU 39 ? CG  ? D GLU 39 CG  
271 1 Y 1 B GLU 39 ? CD  ? D GLU 39 CD  
272 1 Y 1 B GLU 39 ? OE1 ? D GLU 39 OE1 
273 1 Y 1 B GLU 39 ? OE2 ? D GLU 39 OE2 
274 1 Y 1 B MET 42 ? CG  ? D MET 42 CG  
275 1 Y 1 B MET 42 ? SD  ? D MET 42 SD  
276 1 Y 1 B MET 42 ? CE  ? D MET 42 CE  
277 1 Y 1 B GLU 44 ? CG  ? D GLU 44 CG  
278 1 Y 1 B GLU 44 ? CD  ? D GLU 44 CD  
279 1 Y 1 B GLU 44 ? OE1 ? D GLU 44 OE1 
280 1 Y 1 B GLU 44 ? OE2 ? D GLU 44 OE2 
281 1 Y 1 B LEU 45 ? CG  ? D LEU 45 CG  
282 1 Y 1 B LEU 45 ? CD1 ? D LEU 45 CD1 
283 1 Y 1 B LEU 45 ? CD2 ? D LEU 45 CD2 
284 1 Y 1 B ASN 46 ? CG  ? D ASN 46 CG  
285 1 Y 1 B ASN 46 ? OD1 ? D ASN 46 OD1 
286 1 Y 1 B ASN 46 ? ND2 ? D ASN 46 ND2 
287 1 Y 1 B TYR 47 ? CG  ? D TYR 47 CG  
288 1 Y 1 B TYR 47 ? CD1 ? D TYR 47 CD1 
289 1 Y 1 B TYR 47 ? CD2 ? D TYR 47 CD2 
290 1 Y 1 B TYR 47 ? CE1 ? D TYR 47 CE1 
291 1 Y 1 B TYR 47 ? CE2 ? D TYR 47 CE2 
292 1 Y 1 B TYR 47 ? CZ  ? D TYR 47 CZ  
293 1 Y 1 B TYR 47 ? OH  ? D TYR 47 OH  
294 1 Y 1 B ILE 48 ? CG1 ? D ILE 48 CG1 
295 1 Y 1 B ILE 48 ? CG2 ? D ILE 48 CG2 
296 1 Y 1 B ILE 48 ? CD1 ? D ILE 48 CD1 
297 1 Y 1 B PRO 49 ? CG  ? D PRO 49 CG  
298 1 Y 1 B PRO 49 ? CD  ? D PRO 49 CD  
299 1 Y 1 B ASN 50 ? CG  ? D ASN 50 CG  
300 1 Y 1 B ASN 50 ? OD1 ? D ASN 50 OD1 
301 1 Y 1 B ASN 50 ? ND2 ? D ASN 50 ND2 
302 1 Y 1 B ARG 51 ? CG  ? D ARG 51 CG  
303 1 Y 1 B ARG 51 ? CD  ? D ARG 51 CD  
304 1 Y 1 B ARG 51 ? NE  ? D ARG 51 NE  
305 1 Y 1 B ARG 51 ? CZ  ? D ARG 51 CZ  
306 1 Y 1 B ARG 51 ? NH1 ? D ARG 51 NH1 
307 1 Y 1 B ARG 51 ? NH2 ? D ARG 51 NH2 
308 1 Y 1 B VAL 52 ? CG1 ? D VAL 52 CG1 
309 1 Y 1 B VAL 52 ? CG2 ? D VAL 52 CG2 
310 1 Y 1 B GLN 54 ? CG  ? D GLN 54 CG  
311 1 Y 1 B GLN 54 ? CD  ? D GLN 54 CD  
312 1 Y 1 B GLN 54 ? OE1 ? D GLN 54 OE1 
313 1 Y 1 B GLN 54 ? NE2 ? D GLN 54 NE2 
314 1 Y 1 B GLN 55 ? CG  ? D GLN 55 CG  
315 1 Y 1 B GLN 55 ? CD  ? D GLN 55 CD  
316 1 Y 1 B GLN 55 ? OE1 ? D GLN 55 OE1 
317 1 Y 1 B GLN 55 ? NE2 ? D GLN 55 NE2 
318 1 Y 1 B LEU 56 ? CG  ? D LEU 56 CG  
319 1 Y 1 B LEU 56 ? CD1 ? D LEU 56 CD1 
320 1 Y 1 B LEU 56 ? CD2 ? D LEU 56 CD2 
321 1 Y 1 B LYS 59 ? CG  ? D LYS 59 CG  
322 1 Y 1 B LYS 59 ? CD  ? D LYS 59 CD  
323 1 Y 1 B LYS 59 ? CE  ? D LYS 59 CE  
324 1 Y 1 B LYS 59 ? NZ  ? D LYS 59 NZ  
325 1 Y 1 B GLN 60 ? CG  ? D GLN 60 CG  
326 1 Y 1 B GLN 60 ? CD  ? D GLN 60 CD  
327 1 Y 1 B GLN 60 ? OE1 ? D GLN 60 OE1 
328 1 Y 1 B GLN 60 ? NE2 ? D GLN 60 NE2 
329 1 Y 1 B SER 61 ? OG  ? D SER 61 OG  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 D DA  1   ? A DA  1   
2  1 Y 1 D DG  2   ? A DG  2   
3  1 Y 1 D DA  3   ? A DA  3   
4  1 Y 1 D DA  4   ? A DA  4   
5  1 Y 1 D DT  5   ? A DT  5   
6  1 Y 1 D DA  20  ? A DA  20  
7  1 Y 1 D DA  21  ? A DA  21  
8  1 Y 1 D DT  22  ? A DT  22  
9  1 Y 1 D DT  23  ? A DT  23  
10 1 Y 1 E DT  1   ? B DT  1   
11 1 Y 1 E DA  2   ? B DA  2   
12 1 Y 1 E DA  3   ? B DA  3   
13 1 Y 1 E DT  4   ? B DT  4   
14 1 Y 1 E DT  5   ? B DT  5   
15 1 Y 1 E DA  20  ? B DA  20  
16 1 Y 1 E DT  21  ? B DT  21  
17 1 Y 1 E DT  22  ? B DT  22  
18 1 Y 1 E DC  23  ? B DC  23  
19 1 Y 1 A MET 1   ? C MET 1   
20 1 Y 1 A ALA 331 ? C ALA 331 
21 1 Y 1 A PRO 332 ? C PRO 332 
22 1 Y 1 A ASN 333 ? C ASN 333 
23 1 Y 1 B MET 1   ? D MET 1   
24 1 Y 1 B ALA 331 ? D ALA 331 
25 1 Y 1 B PRO 332 ? D PRO 332 
26 1 Y 1 B ASN 333 ? D ASN 333 
27 1 Y 1 C MET 1   ? E MET 1   
28 1 Y 1 C LYS 2   ? E LYS 2   
29 1 Y 1 C PRO 3   ? E PRO 3   
30 1 Y 1 C VAL 4   ? E VAL 4   
31 1 Y 1 C THR 5   ? E THR 5   
32 1 Y 1 C LEU 6   ? E LEU 6   
33 1 Y 1 C TYR 7   ? E TYR 7   
34 1 Y 1 C ASP 8   ? E ASP 8   
35 1 Y 1 C VAL 9   ? E VAL 9   
36 1 Y 1 C ALA 10  ? E ALA 10  
37 1 Y 1 C GLU 11  ? E GLU 11  
38 1 Y 1 C TYR 12  ? E TYR 12  
39 1 Y 1 C ALA 13  ? E ALA 13  
40 1 Y 1 C GLY 14  ? E GLY 14  
41 1 Y 1 C VAL 15  ? E VAL 15  
42 1 Y 1 C SER 16  ? E SER 16  
43 1 Y 1 C TYR 17  ? E TYR 17  
44 1 Y 1 C GLN 18  ? E GLN 18  
45 1 Y 1 C THR 19  ? E THR 19  
46 1 Y 1 C VAL 20  ? E VAL 20  
47 1 Y 1 C SER 21  ? E SER 21  
48 1 Y 1 C ARG 22  ? E ARG 22  
49 1 Y 1 C VAL 23  ? E VAL 23  
50 1 Y 1 C VAL 24  ? E VAL 24  
51 1 Y 1 C ASN 25  ? E ASN 25  
52 1 Y 1 C GLN 26  ? E GLN 26  
53 1 Y 1 C ALA 27  ? E ALA 27  
54 1 Y 1 C SER 28  ? E SER 28  
55 1 Y 1 C HIS 29  ? E HIS 29  
56 1 Y 1 C VAL 30  ? E VAL 30  
57 1 Y 1 C SER 31  ? E SER 31  
58 1 Y 1 C ALA 32  ? E ALA 32  
59 1 Y 1 C LYS 33  ? E LYS 33  
60 1 Y 1 C THR 34  ? E THR 34  
61 1 Y 1 C ARG 35  ? E ARG 35  
62 1 Y 1 C GLU 36  ? E GLU 36  
63 1 Y 1 C LYS 37  ? E LYS 37  
64 1 Y 1 C VAL 38  ? E VAL 38  
65 1 Y 1 C GLU 39  ? E GLU 39  
66 1 Y 1 C ALA 40  ? E ALA 40  
67 1 Y 1 C ALA 41  ? E ALA 41  
68 1 Y 1 C MET 42  ? E MET 42  
69 1 Y 1 C ALA 43  ? E ALA 43  
70 1 Y 1 C GLU 44  ? E GLU 44  
71 1 Y 1 C LEU 45  ? E LEU 45  
72 1 Y 1 C ASN 46  ? E ASN 46  
73 1 Y 1 C TYR 47  ? E TYR 47  
74 1 Y 1 C ILE 48  ? E ILE 48  
75 1 Y 1 C PRO 49  ? E PRO 49  
76 1 Y 1 C ASN 50  ? E ASN 50  
77 1 Y 1 C ARG 51  ? E ARG 51  
78 1 Y 1 C VAL 52  ? E VAL 52  
79 1 Y 1 C ALA 53  ? E ALA 53  
80 1 Y 1 C GLN 54  ? E GLN 54  
81 1 Y 1 C GLN 55  ? E GLN 55  
82 1 Y 1 C LEU 56  ? E LEU 56  
83 1 Y 1 C ALA 57  ? E ALA 57  
84 1 Y 1 C GLY 58  ? E GLY 58  
85 1 Y 1 C LYS 59  ? E LYS 59  
86 1 Y 1 C GLN 60  ? E GLN 60  
87 1 Y 1 C SER 61  ? E SER 61  
88 1 Y 1 C ALA 331 ? E ALA 331 
89 1 Y 1 C PRO 332 ? E PRO 332 
90 1 Y 1 C ASN 333 ? E ASN 333 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1JWL 'double helix'         
1JWL 'b-form double helix'  
1JWL 'mismatched base pair' 
1JWL 'triple helix'         
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DT 6  1_555 B DA 19 1_555 -0.060 -0.118 0.767  2.533   -12.130 -3.964   1  D_DT6:DA19_E  D 6  ? E 19 ? 20 1 
1 A DG 7  1_555 B DC 18 1_555 0.048  -0.065 -0.429 -1.843  -10.278 -5.686   2  D_DG7:DC18_E  D 7  ? E 18 ? 19 1 
1 A DT 8  1_555 B DA 17 1_555 -0.389 0.049  0.070  -3.951  -22.289 -7.463   3  D_DT8:DA17_E  D 8  ? E 17 ? 20 1 
1 A DG 9  1_555 B DC 16 1_555 -0.017 -0.099 -0.245 -4.058  -18.527 -2.855   4  D_DG9:DC16_E  D 9  ? E 16 ? 19 1 
1 A DA 10 1_555 B DT 15 1_555 0.413  0.095  -0.614 -1.010  12.353  -17.304  5  D_DA10:DT15_E D 10 ? E 15 ? 20 1 
1 A DG 11 1_555 B DC 14 1_555 0.051  0.016  -0.047 16.247  -4.769  -3.204   6  D_DG11:DC14_E D 11 ? E 14 ? 19 1 
1 A DC 12 1_555 B DG 13 1_555 -0.161 -0.001 0.191  23.898  -0.723  -5.481   7  D_DC12:DG13_E D 12 ? E 13 ? 19 1 
1 A DG 13 1_555 B DC 12 1_555 0.165  -0.084 0.123  -16.123 0.202   -6.496   8  D_DG13:DC12_E D 13 ? E 12 ? 19 1 
1 A DG 14 1_555 B DC 11 1_555 -0.150 -0.033 0.379  7.731   -2.904  -2.848   9  D_DG14:DC11_E D 14 ? E 11 ? 19 1 
1 A DA 15 1_555 B DT 10 1_555 -0.755 1.884  2.360  7.498   4.734   -118.618 10 D_DA15:DT10_E D 15 ? E 10 ? 20 1 
1 A DT 16 1_555 B DA 9  1_555 -0.216 0.180  0.114  3.788   -27.435 -7.279   11 D_DT16:DA9_E  D 16 ? E 9  ? 20 1 
1 A DA 17 1_555 B DT 8  1_555 0.011  0.050  -0.779 -12.715 -31.903 4.031    12 D_DA17:DT8_E  D 17 ? E 8  ? 20 1 
1 A DA 18 1_555 B DT 7  1_555 0.339  -0.006 0.170  5.286   -27.393 -4.057   13 D_DA18:DT7_E  D 18 ? E 7  ? 20 1 
1 A DC 19 1_555 B DG 6  1_555 0.050  0.130  -0.195 -5.859  -17.721 6.262    14 D_DC19:DG6_E  D 19 ? E 6  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DT 6  1_555 B DA 19 1_555 A DG 7  1_555 B DC 18 1_555 -1.727 0.328  2.920 3.835   2.816   42.066  0.203  2.734  2.775 3.908   
-5.322  42.322  1  DD_DT6DG7:DC18DA19_EE   D 6  ? E 19 ? D 7  ? E 18 ? 
1 A DG 7  1_555 B DC 18 1_555 A DT 8  1_555 B DA 17 1_555 -0.725 -1.339 3.098 -4.710  6.826   32.108  -3.407 0.540  2.837 12.091  
8.342   33.134  2  DD_DG7DT8:DA17DC18_EE   D 7  ? E 18 ? D 8  ? E 17 ? 
1 A DT 8  1_555 B DA 17 1_555 A DG 9  1_555 B DC 16 1_555 -0.110 0.932  3.389 1.330   3.468   36.581  0.982  0.364  3.454 5.508   
-2.113  36.763  3  DD_DT8DG9:DC16DA17_EE   D 8  ? E 17 ? D 9  ? E 16 ? 
1 A DG 9  1_555 B DC 16 1_555 A DA 10 1_555 B DT 15 1_555 -1.596 0.143  3.716 -7.794  1.851   32.276  -0.120 1.232  3.984 3.268   
13.757  33.229  4  DD_DG9DA10:DT15DC16_EE  D 9  ? E 16 ? D 10 ? E 15 ? 
1 A DA 10 1_555 B DT 15 1_555 A DG 11 1_555 B DC 14 1_555 0.844  0.265  3.324 0.152   -6.447  34.907  1.390  -1.363 3.229 -10.635 
-0.252  35.480  5  DD_DA10DG11:DC14DT15_EE D 10 ? E 15 ? D 11 ? E 14 ? 
1 A DG 11 1_555 B DC 14 1_555 A DC 12 1_555 B DG 13 1_555 -0.581 -0.803 3.439 0.411   3.558   30.695  -2.223 1.173  3.319 6.693   
-0.773  30.898  6  DD_DG11DC12:DG13DC14_EE D 11 ? E 14 ? D 12 ? E 13 ? 
1 A DC 12 1_555 B DG 13 1_555 A DG 13 1_555 B DC 12 1_555 -0.435 1.836  5.003 0.955   53.437  20.850  -4.112 0.563  3.587 70.219  
-1.255  57.089  7  DD_DC12DG13:DC12DG13_EE D 12 ? E 13 ? D 13 ? E 12 ? 
1 A DG 13 1_555 B DC 12 1_555 A DG 14 1_555 B DC 11 1_555 1.032  -0.963 2.837 1.204   -3.160  29.009  -1.298 -1.814 2.963 -6.281  
-2.394  29.201  8  DD_DG13DG14:DC11DC12_EE D 13 ? E 12 ? D 14 ? E 11 ? 
1 A DG 14 1_555 B DC 11 1_555 A DA 15 1_555 B DT 10 1_555 0.702  -0.675 4.006 -12.316 11.847  94.538  -0.706 -0.734 3.836 8.014   
8.331   95.708  9  DD_DG14DA15:DT10DC11_EE D 14 ? E 11 ? D 15 ? E 10 ? 
1 A DA 15 1_555 B DT 10 1_555 A DT 16 1_555 B DA 9  1_555 -1.069 0.804  3.789 10.624  -19.571 -31.051 1.975  0.101  3.806 31.926  
17.332  -38.050 10 DD_DA15DT16:DA9DT10_EE  D 15 ? E 10 ? D 16 ? E 9  ? 
1 A DT 16 1_555 B DA 9  1_555 A DA 17 1_555 B DT 8  1_555 0.852  1.562  3.616 8.184   15.867  35.290  -0.010 -0.064 4.030 24.345  
-12.557 39.420  11 DD_DT16DA17:DT8DA9_EE   D 16 ? E 9  ? D 17 ? E 8  ? 
1 A DA 17 1_555 B DT 8  1_555 A DA 18 1_555 B DT 7  1_555 0.164  0.634  2.402 -8.248  -1.449  36.873  1.114  -1.025 2.289 -2.256  
12.837  37.780  12 DD_DA17DA18:DT7DT8_EE   D 17 ? E 8  ? D 18 ? E 7  ? 
1 A DA 18 1_555 B DT 7  1_555 A DC 19 1_555 B DG 6  1_555 0.223  -0.477 3.358 1.013   -3.040  41.235  -0.339 -0.203 3.388 -4.308  
-1.436  41.354  13 DD_DA18DC19:DG6DT7_EE   D 18 ? E 7  ? D 19 ? E 6  ? 
# 
_pdbx_chem_comp_identifier.comp_id           NPF 
_pdbx_chem_comp_identifier.type              'IUPAC CARBOHYDRATE SYMBOL' 
_pdbx_chem_comp_identifier.program           PDB-CARE 
_pdbx_chem_comp_identifier.program_version   1.0 
_pdbx_chem_comp_identifier.identifier        orthonitrophenyl-b-D-fucopyranoside 
# 
_pdbx_entity_nonpoly.entity_id   4 
_pdbx_entity_nonpoly.name        '2-nitrophenyl beta-D-fucopyranoside' 
_pdbx_entity_nonpoly.comp_id     NPF 
#