data_1JYE
# 
_entry.id   1JYE 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.341 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1JYE         
RCSB  RCSB014330   
WWPDB D_1000014330 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1JYF 
_pdbx_database_related.details        'Dimeric Lac Repressor with an 11-residue C-terminal Deletion' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1JYE 
_pdbx_database_status.recvd_initial_deposition_date   2001-09-12 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Bell, C.E.'     1 
'Barry, J.'      2 
'Matthews, K.S.' 3 
'Lewis, M.'      4 
# 
_citation.id                        primary 
_citation.title                     
'Structure of a variant of lac repressor with increased thermostability and decreased affinity for operator.' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            313 
_citation.page_first                99 
_citation.page_last                 109 
_citation.year                      2001 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11601849 
_citation.pdbx_database_id_DOI      10.1006/jmbi.2001.5041 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Bell, C.E.'     1 ? 
primary 'Barry, J.'      2 ? 
primary 'Matthews, K.S.' 3 ? 
primary 'Lewis, M.'      4 ? 
# 
_cell.entry_id           1JYE 
_cell.length_a           87.007 
_cell.length_b           87.007 
_cell.length_c           224.098 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1JYE 
_symmetry.space_group_name_H-M             'I 41 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                98 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Lactose Operon Repressor' 37426.691 1   ? YES 'C-TERMINAL DELETION MUTANT' ? 
2 non-polymer syn GLYCEROL                   92.094    1   ? ?   ?                            ? 
3 water       nat water                      18.015    235 ? ?   ?                            ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIV
AAILSRADQLGASVVVSMVERSGVEACKTAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSII
FSHEDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSAMSGFQQTMQMLNEGIVPT
AMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSCYIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLP
VSLVKRKTTLAPNTQTASPRALADSLMQL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIV
AAILSRADQLGASVVVSMVERSGVEACKTAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSII
FSHEDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSAMSGFQQTMQMLNEGIVPT
AMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSCYIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLP
VSLVKRKTTLAPNTQTASPRALADSLMQL
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LYS n 
1 3   PRO n 
1 4   VAL n 
1 5   THR n 
1 6   LEU n 
1 7   TYR n 
1 8   ASP n 
1 9   VAL n 
1 10  ALA n 
1 11  GLU n 
1 12  TYR n 
1 13  ALA n 
1 14  GLY n 
1 15  VAL n 
1 16  SER n 
1 17  TYR n 
1 18  GLN n 
1 19  THR n 
1 20  VAL n 
1 21  SER n 
1 22  ARG n 
1 23  VAL n 
1 24  VAL n 
1 25  ASN n 
1 26  GLN n 
1 27  ALA n 
1 28  SER n 
1 29  HIS n 
1 30  VAL n 
1 31  SER n 
1 32  ALA n 
1 33  LYS n 
1 34  THR n 
1 35  ARG n 
1 36  GLU n 
1 37  LYS n 
1 38  VAL n 
1 39  GLU n 
1 40  ALA n 
1 41  ALA n 
1 42  MET n 
1 43  ALA n 
1 44  GLU n 
1 45  LEU n 
1 46  ASN n 
1 47  TYR n 
1 48  ILE n 
1 49  PRO n 
1 50  ASN n 
1 51  ARG n 
1 52  VAL n 
1 53  ALA n 
1 54  GLN n 
1 55  GLN n 
1 56  LEU n 
1 57  ALA n 
1 58  GLY n 
1 59  LYS n 
1 60  GLN n 
1 61  SER n 
1 62  LEU n 
1 63  LEU n 
1 64  ILE n 
1 65  GLY n 
1 66  VAL n 
1 67  ALA n 
1 68  THR n 
1 69  SER n 
1 70  SER n 
1 71  LEU n 
1 72  ALA n 
1 73  LEU n 
1 74  HIS n 
1 75  ALA n 
1 76  PRO n 
1 77  SER n 
1 78  GLN n 
1 79  ILE n 
1 80  VAL n 
1 81  ALA n 
1 82  ALA n 
1 83  ILE n 
1 84  LEU n 
1 85  SER n 
1 86  ARG n 
1 87  ALA n 
1 88  ASP n 
1 89  GLN n 
1 90  LEU n 
1 91  GLY n 
1 92  ALA n 
1 93  SER n 
1 94  VAL n 
1 95  VAL n 
1 96  VAL n 
1 97  SER n 
1 98  MET n 
1 99  VAL n 
1 100 GLU n 
1 101 ARG n 
1 102 SER n 
1 103 GLY n 
1 104 VAL n 
1 105 GLU n 
1 106 ALA n 
1 107 CYS n 
1 108 LYS n 
1 109 THR n 
1 110 ALA n 
1 111 VAL n 
1 112 HIS n 
1 113 ASN n 
1 114 LEU n 
1 115 LEU n 
1 116 ALA n 
1 117 GLN n 
1 118 ARG n 
1 119 VAL n 
1 120 SER n 
1 121 GLY n 
1 122 LEU n 
1 123 ILE n 
1 124 ILE n 
1 125 ASN n 
1 126 TYR n 
1 127 PRO n 
1 128 LEU n 
1 129 ASP n 
1 130 ASP n 
1 131 GLN n 
1 132 ASP n 
1 133 ALA n 
1 134 ILE n 
1 135 ALA n 
1 136 VAL n 
1 137 GLU n 
1 138 ALA n 
1 139 ALA n 
1 140 CYS n 
1 141 THR n 
1 142 ASN n 
1 143 VAL n 
1 144 PRO n 
1 145 ALA n 
1 146 LEU n 
1 147 PHE n 
1 148 LEU n 
1 149 ASP n 
1 150 VAL n 
1 151 SER n 
1 152 ASP n 
1 153 GLN n 
1 154 THR n 
1 155 PRO n 
1 156 ILE n 
1 157 ASN n 
1 158 SER n 
1 159 ILE n 
1 160 ILE n 
1 161 PHE n 
1 162 SER n 
1 163 HIS n 
1 164 GLU n 
1 165 ASP n 
1 166 GLY n 
1 167 THR n 
1 168 ARG n 
1 169 LEU n 
1 170 GLY n 
1 171 VAL n 
1 172 GLU n 
1 173 HIS n 
1 174 LEU n 
1 175 VAL n 
1 176 ALA n 
1 177 LEU n 
1 178 GLY n 
1 179 HIS n 
1 180 GLN n 
1 181 GLN n 
1 182 ILE n 
1 183 ALA n 
1 184 LEU n 
1 185 LEU n 
1 186 ALA n 
1 187 GLY n 
1 188 PRO n 
1 189 LEU n 
1 190 SER n 
1 191 SER n 
1 192 VAL n 
1 193 SER n 
1 194 ALA n 
1 195 ARG n 
1 196 LEU n 
1 197 ARG n 
1 198 LEU n 
1 199 ALA n 
1 200 GLY n 
1 201 TRP n 
1 202 HIS n 
1 203 LYS n 
1 204 TYR n 
1 205 LEU n 
1 206 THR n 
1 207 ARG n 
1 208 ASN n 
1 209 GLN n 
1 210 ILE n 
1 211 GLN n 
1 212 PRO n 
1 213 ILE n 
1 214 ALA n 
1 215 GLU n 
1 216 ARG n 
1 217 GLU n 
1 218 GLY n 
1 219 ASP n 
1 220 TRP n 
1 221 SER n 
1 222 ALA n 
1 223 MET n 
1 224 SER n 
1 225 GLY n 
1 226 PHE n 
1 227 GLN n 
1 228 GLN n 
1 229 THR n 
1 230 MET n 
1 231 GLN n 
1 232 MET n 
1 233 LEU n 
1 234 ASN n 
1 235 GLU n 
1 236 GLY n 
1 237 ILE n 
1 238 VAL n 
1 239 PRO n 
1 240 THR n 
1 241 ALA n 
1 242 MET n 
1 243 LEU n 
1 244 VAL n 
1 245 ALA n 
1 246 ASN n 
1 247 ASP n 
1 248 GLN n 
1 249 MET n 
1 250 ALA n 
1 251 LEU n 
1 252 GLY n 
1 253 ALA n 
1 254 MET n 
1 255 ARG n 
1 256 ALA n 
1 257 ILE n 
1 258 THR n 
1 259 GLU n 
1 260 SER n 
1 261 GLY n 
1 262 LEU n 
1 263 ARG n 
1 264 VAL n 
1 265 GLY n 
1 266 ALA n 
1 267 ASP n 
1 268 ILE n 
1 269 SER n 
1 270 VAL n 
1 271 VAL n 
1 272 GLY n 
1 273 TYR n 
1 274 ASP n 
1 275 ASP n 
1 276 THR n 
1 277 GLU n 
1 278 ASP n 
1 279 SER n 
1 280 SER n 
1 281 CYS n 
1 282 TYR n 
1 283 ILE n 
1 284 PRO n 
1 285 PRO n 
1 286 LEU n 
1 287 THR n 
1 288 THR n 
1 289 ILE n 
1 290 LYS n 
1 291 GLN n 
1 292 ASP n 
1 293 PHE n 
1 294 ARG n 
1 295 LEU n 
1 296 LEU n 
1 297 GLY n 
1 298 GLN n 
1 299 THR n 
1 300 SER n 
1 301 VAL n 
1 302 ASP n 
1 303 ARG n 
1 304 LEU n 
1 305 LEU n 
1 306 GLN n 
1 307 LEU n 
1 308 SER n 
1 309 GLN n 
1 310 GLY n 
1 311 GLN n 
1 312 ALA n 
1 313 VAL n 
1 314 LYS n 
1 315 GLY n 
1 316 ASN n 
1 317 GLN n 
1 318 LEU n 
1 319 LEU n 
1 320 PRO n 
1 321 VAL n 
1 322 SER n 
1 323 LEU n 
1 324 VAL n 
1 325 LYS n 
1 326 ARG n 
1 327 LYS n 
1 328 THR n 
1 329 THR n 
1 330 LEU n 
1 331 ALA n 
1 332 PRO n 
1 333 ASN n 
1 334 THR n 
1 335 GLN n 
1 336 THR n 
1 337 ALA n 
1 338 SER n 
1 339 PRO n 
1 340 ARG n 
1 341 ALA n 
1 342 LEU n 
1 343 ALA n 
1 344 ASP n 
1 345 SER n 
1 346 LEU n 
1 347 MET n 
1 348 GLN n 
1 349 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Escherichia 
_entity_src_gen.pdbx_gene_src_gene                 LacI 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     562 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               TB-1 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pJC-1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    LACI_ECOLI 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIV
AAIKSRADQLGASVVVSMVERSGVEACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSII
FSHEDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSAMSGFQQTMQMLNEGIVPT
AMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSCYIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLP
VSLVKRKTTLAPNTQTASPRALADSLMQL
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_accession          P03023 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1JYE 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 349 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P03023 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  349 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       349 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1JYE LEU A 84  ? UNP P03023 LYS 84  ENGINEERED       84  1 
1 1JYE THR A 109 ? UNP P03023 ALA 109 'SEE REMARK 999' 109 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL        'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE       ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                               'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1JYE 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.83 
_exptl_crystal.density_percent_sol   56.57 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.6 
_exptl_crystal_grow.pdbx_details    'Sodium Acetate, Sodium Citrate, pH 5.6, VAPOR DIFFUSION, HANGING DROP, temperature 295K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'BRANDEIS - B4' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.1000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X25' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X25 
_diffrn_source.pdbx_wavelength             1.1000 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1JYE 
_reflns.observed_criterion_sigma_I   -2.0 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.d_resolution_low             17.0 
_reflns.d_resolution_high            1.7 
_reflns.number_obs                   44403 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         93.1 
_reflns.pdbx_Rmerge_I_obs            0.0630000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        12.5 
_reflns.B_iso_Wilson_estimate        23.4 
_reflns.pdbx_redundancy              5.8 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.7 
_reflns_shell.d_res_low              ? 
_reflns_shell.percent_possible_all   72.7 
_reflns_shell.Rmerge_I_obs           0.0890000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    7.2 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1JYE 
_refine.ls_number_reflns_obs                     43541 
_refine.ls_number_reflns_all                     43541 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               1304025.40 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.ls_d_res_low                             9.95 
_refine.ls_d_res_high                            1.70 
_refine.ls_percent_reflns_obs                    91.6 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2230000 
_refine.ls_R_factor_R_free                       0.2410000 
_refine.ls_R_factor_R_free_error                 0.004 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.0 
_refine.ls_number_reflns_R_free                  4366 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               22.0 
_refine.aniso_B[1][1]                            2.71 
_refine.aniso_B[2][2]                            2.71 
_refine.aniso_B[3][3]                            -5.42 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.520559 
_refine.solvent_model_param_bsol                 66.1617 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'lac repressor' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           1304025.40 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1JYE 
_refine_analyze.Luzzati_coordinate_error_obs    0.20 
_refine_analyze.Luzzati_sigma_a_obs             -0.02 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.22 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2026 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         6 
_refine_hist.number_atoms_solvent             235 
_refine_hist.number_atoms_total               2267 
_refine_hist.d_res_high                       1.70 
_refine_hist.d_res_low                        9.95 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.004 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.3   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 22.4  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.76  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        1.17  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       1.84  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        1.95  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       2.95  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       1.70 
_refine_ls_shell.d_res_low                        1.81 
_refine_ls_shell.number_reflns_R_work             5181 
_refine_ls_shell.R_factor_R_work                  0.2840000 
_refine_ls_shell.percent_reflns_obs               74.0 
_refine_ls_shell.R_factor_R_free                  0.2840000 
_refine_ls_shell.R_factor_R_free_error            0.012 
_refine_ls_shell.percent_reflns_R_free            10.1 
_refine_ls_shell.number_reflns_R_free             580 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM  PROTEIN.TOP      'X-RAY DIFFRACTION' 
2 WATER_REP.PARAM    WATER.TOP        'X-RAY DIFFRACTION' 
3 CARBOHYDRATE.PARAM CARBOHYDRATE.TOP 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1JYE 
_struct.title                     'Structure of a Dimeric Lac Repressor with C-terminal Deletion and K84L Substitution' 
_struct.pdbx_descriptor           'Lactose Operon Repressor' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1JYE 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
_struct_keywords.text            'Gene Regulation, Protein Stability, Protein DNA-binding, TRANSCRIPTION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 LEU A 73  ? LEU A 90  ? LEU A 73  LEU A 90  1 ? 18 
HELX_P HELX_P2 2 GLY A 103 ? ALA A 116 ? GLY A 103 ALA A 116 1 ? 14 
HELX_P HELX_P3 3 ASP A 129 ? CYS A 140 ? ASP A 129 CYS A 140 1 ? 12 
HELX_P HELX_P4 4 SER A 162 ? GLY A 178 ? SER A 162 GLY A 178 1 ? 17 
HELX_P HELX_P5 5 SER A 191 ? ASN A 208 ? SER A 191 ASN A 208 1 ? 18 
HELX_P HELX_P6 6 SER A 221 ? GLU A 235 ? SER A 221 GLU A 235 1 ? 15 
HELX_P HELX_P7 7 ASN A 246 ? SER A 260 ? ASN A 246 SER A 260 1 ? 15 
HELX_P HELX_P8 8 THR A 276 ? TYR A 282 ? THR A 276 TYR A 282 5 ? 7  
HELX_P HELX_P9 9 ASP A 292 ? GLN A 309 ? ASP A 292 GLN A 309 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          ILE 
_struct_mon_prot_cis.label_seq_id           283 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           ILE 
_struct_mon_prot_cis.auth_seq_id            283 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    284 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     284 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -0.29 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 2 ? 
C ? 4 ? 
D ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
B 1 2 ? parallel      
C 1 2 ? parallel      
C 2 3 ? parallel      
C 3 4 ? parallel      
D 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER A 93  ? MET A 98  ? SER A 93  MET A 98  
A 2 LEU A 63  ? THR A 68  ? LEU A 63  THR A 68  
A 3 LEU A 122 ? ASN A 125 ? LEU A 122 ASN A 125 
A 4 ALA A 145 ? PHE A 147 ? ALA A 145 PHE A 147 
B 1 SER A 158 ? PHE A 161 ? SER A 158 PHE A 161 
B 2 ASN A 316 ? LEU A 319 ? ASN A 316 LEU A 319 
C 1 ALA A 214 ? GLU A 217 ? ALA A 214 GLU A 217 
C 2 ILE A 182 ? ALA A 186 ? ILE A 182 ALA A 186 
C 3 ALA A 241 ? VAL A 244 ? ALA A 241 VAL A 244 
C 4 SER A 269 ? VAL A 271 ? SER A 269 VAL A 271 
D 1 THR A 288 ? LYS A 290 ? THR A 288 LYS A 290 
D 2 SER A 322 ? VAL A 324 ? SER A 322 VAL A 324 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O SER A 97  ? O SER A 97  N VAL A 66  ? N VAL A 66  
A 2 3 N ALA A 67  ? N ALA A 67  O ASN A 125 ? O ASN A 125 
A 3 4 N ILE A 124 ? N ILE A 124 O LEU A 146 ? O LEU A 146 
B 1 2 N ILE A 160 ? N ILE A 160 O LEU A 319 ? O LEU A 319 
C 1 2 O ARG A 216 ? O ARG A 216 N ALA A 186 ? N ALA A 186 
C 2 3 N LEU A 185 ? N LEU A 185 O LEU A 243 ? O LEU A 243 
C 3 4 N MET A 242 ? N MET A 242 O SER A 269 ? O SER A 269 
D 1 2 N THR A 288 ? N THR A 288 O VAL A 324 ? O VAL A 324 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    A 
_struct_site.pdbx_auth_comp_id    GOL 
_struct_site.pdbx_auth_seq_id     350 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    6 
_struct_site.details              'BINDING SITE FOR RESIDUE GOL A 350' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 6 ARG A 197 ? ARG A 197 . ? 1_555 ? 
2 AC1 6 ASN A 246 ? ASN A 246 . ? 1_555 ? 
3 AC1 6 ASP A 274 ? ASP A 274 . ? 1_555 ? 
4 AC1 6 GLN A 291 ? GLN A 291 . ? 1_555 ? 
5 AC1 6 HOH C .   ? HOH A 354 . ? 1_555 ? 
6 AC1 6 HOH C .   ? HOH A 576 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1JYE 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1JYE 
_atom_sites.fract_transf_matrix[1][1]   0.011493 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011493 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004462 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . LEU A 1 62  ? 55.976 64.305 82.310  1.00 32.68 ? 62  LEU A N   1 
ATOM   2    C CA  . LEU A 1 62  ? 55.750 63.452 83.513  1.00 31.86 ? 62  LEU A CA  1 
ATOM   3    C C   . LEU A 1 62  ? 56.924 62.500 83.707  1.00 31.25 ? 62  LEU A C   1 
ATOM   4    O O   . LEU A 1 62  ? 57.338 61.815 82.771  1.00 29.73 ? 62  LEU A O   1 
ATOM   5    C CB  . LEU A 1 62  ? 54.453 62.657 83.357  1.00 33.97 ? 62  LEU A CB  1 
ATOM   6    C CG  . LEU A 1 62  ? 54.062 61.747 84.523  1.00 35.02 ? 62  LEU A CG  1 
ATOM   7    C CD1 . LEU A 1 62  ? 54.021 62.548 85.820  1.00 35.56 ? 62  LEU A CD1 1 
ATOM   8    C CD2 . LEU A 1 62  ? 52.708 61.115 84.236  1.00 36.02 ? 62  LEU A CD2 1 
ATOM   9    N N   . LEU A 1 63  ? 57.447 62.454 84.929  1.00 30.31 ? 63  LEU A N   1 
ATOM   10   C CA  . LEU A 1 63  ? 58.591 61.603 85.238  1.00 28.59 ? 63  LEU A CA  1 
ATOM   11   C C   . LEU A 1 63  ? 58.507 60.962 86.622  1.00 27.73 ? 63  LEU A C   1 
ATOM   12   O O   . LEU A 1 63  ? 58.271 61.645 87.620  1.00 29.08 ? 63  LEU A O   1 
ATOM   13   C CB  . LEU A 1 63  ? 59.876 62.430 85.149  1.00 28.54 ? 63  LEU A CB  1 
ATOM   14   C CG  . LEU A 1 63  ? 61.208 61.732 85.421  1.00 27.93 ? 63  LEU A CG  1 
ATOM   15   C CD1 . LEU A 1 63  ? 61.561 60.832 84.252  1.00 28.46 ? 63  LEU A CD1 1 
ATOM   16   C CD2 . LEU A 1 63  ? 62.296 62.775 85.626  1.00 29.00 ? 63  LEU A CD2 1 
ATOM   17   N N   . ILE A 1 64  ? 58.707 59.649 86.679  1.00 24.75 ? 64  ILE A N   1 
ATOM   18   C CA  . ILE A 1 64  ? 58.683 58.934 87.948  1.00 22.99 ? 64  ILE A CA  1 
ATOM   19   C C   . ILE A 1 64  ? 60.006 58.205 88.151  1.00 21.61 ? 64  ILE A C   1 
ATOM   20   O O   . ILE A 1 64  ? 60.744 57.954 87.196  1.00 21.12 ? 64  ILE A O   1 
ATOM   21   C CB  . ILE A 1 64  ? 57.518 57.926 88.014  1.00 24.95 ? 64  ILE A CB  1 
ATOM   22   C CG1 . ILE A 1 64  ? 57.621 56.915 86.871  1.00 25.77 ? 64  ILE A CG1 1 
ATOM   23   C CG2 . ILE A 1 64  ? 56.191 58.676 87.954  1.00 26.37 ? 64  ILE A CG2 1 
ATOM   24   C CD1 . ILE A 1 64  ? 56.499 55.889 86.862  1.00 28.19 ? 64  ILE A CD1 1 
ATOM   25   N N   . GLY A 1 65  ? 60.310 57.880 89.401  1.00 18.01 ? 65  GLY A N   1 
ATOM   26   C CA  . GLY A 1 65  ? 61.552 57.197 89.694  1.00 16.95 ? 65  GLY A CA  1 
ATOM   27   C C   . GLY A 1 65  ? 61.335 55.844 90.335  1.00 17.21 ? 65  GLY A C   1 
ATOM   28   O O   . GLY A 1 65  ? 60.389 55.648 91.098  1.00 17.01 ? 65  GLY A O   1 
ATOM   29   N N   . VAL A 1 66  ? 62.215 54.904 90.015  1.00 15.38 ? 66  VAL A N   1 
ATOM   30   C CA  . VAL A 1 66  ? 62.131 53.563 90.572  1.00 15.56 ? 66  VAL A CA  1 
ATOM   31   C C   . VAL A 1 66  ? 63.460 53.173 91.210  1.00 16.12 ? 66  VAL A C   1 
ATOM   32   O O   . VAL A 1 66  ? 64.502 53.212 90.555  1.00 15.27 ? 66  VAL A O   1 
ATOM   33   C CB  . VAL A 1 66  ? 61.802 52.508 89.484  1.00 15.95 ? 66  VAL A CB  1 
ATOM   34   C CG1 . VAL A 1 66  ? 61.790 51.114 90.103  1.00 17.10 ? 66  VAL A CG1 1 
ATOM   35   C CG2 . VAL A 1 66  ? 60.453 52.811 88.841  1.00 15.53 ? 66  VAL A CG2 1 
ATOM   36   N N   . ALA A 1 67  ? 63.421 52.824 92.493  1.00 15.57 ? 67  ALA A N   1 
ATOM   37   C CA  . ALA A 1 67  ? 64.613 52.364 93.201  1.00 16.19 ? 67  ALA A CA  1 
ATOM   38   C C   . ALA A 1 67  ? 64.375 50.859 93.221  1.00 16.28 ? 67  ALA A C   1 
ATOM   39   O O   . ALA A 1 67  ? 63.389 50.393 93.792  1.00 16.50 ? 67  ALA A O   1 
ATOM   40   C CB  . ALA A 1 67  ? 64.649 52.926 94.621  1.00 15.56 ? 67  ALA A CB  1 
ATOM   41   N N   . THR A 1 68  ? 65.261 50.088 92.603  1.00 15.96 ? 68  THR A N   1 
ATOM   42   C CA  . THR A 1 68  ? 65.019 48.651 92.526  1.00 15.23 ? 68  THR A CA  1 
ATOM   43   C C   . THR A 1 68  ? 66.161 47.711 92.867  1.00 16.33 ? 68  THR A C   1 
ATOM   44   O O   . THR A 1 68  ? 67.336 48.058 92.741  1.00 16.65 ? 68  THR A O   1 
ATOM   45   C CB  . THR A 1 68  ? 64.534 48.279 91.104  1.00 15.65 ? 68  THR A CB  1 
ATOM   46   O OG1 . THR A 1 68  ? 64.294 46.869 91.024  1.00 15.54 ? 68  THR A OG1 1 
ATOM   47   C CG2 . THR A 1 68  ? 65.591 48.665 90.072  1.00 16.48 ? 68  THR A CG2 1 
ATOM   48   N N   . SER A 1 69  ? 65.789 46.508 93.298  1.00 16.44 ? 69  SER A N   1 
ATOM   49   C CA  . SER A 1 69  ? 66.756 45.465 93.595  1.00 17.34 ? 69  SER A CA  1 
ATOM   50   C C   . SER A 1 69  ? 67.341 45.132 92.226  1.00 17.36 ? 69  SER A C   1 
ATOM   51   O O   . SER A 1 69  ? 66.770 45.506 91.202  1.00 18.20 ? 69  SER A O   1 
ATOM   52   C CB  . SER A 1 69  ? 66.059 44.227 94.163  1.00 18.73 ? 69  SER A CB  1 
ATOM   53   O OG  . SER A 1 69  ? 65.452 44.502 95.414  1.00 19.94 ? 69  SER A OG  1 
ATOM   54   N N   . SER A 1 70  ? 68.461 44.421 92.207  1.00 17.91 ? 70  SER A N   1 
ATOM   55   C CA  . SER A 1 70  ? 69.108 44.070 90.949  1.00 18.11 ? 70  SER A CA  1 
ATOM   56   C C   . SER A 1 70  ? 68.174 43.462 89.906  1.00 18.27 ? 70  SER A C   1 
ATOM   57   O O   . SER A 1 70  ? 67.407 42.542 90.196  1.00 17.28 ? 70  SER A O   1 
ATOM   58   C CB  . SER A 1 70  ? 70.266 43.105 91.203  1.00 19.39 ? 70  SER A CB  1 
ATOM   59   O OG  . SER A 1 70  ? 70.834 42.693 89.971  1.00 20.00 ? 70  SER A OG  1 
ATOM   60   N N   . LEU A 1 71  ? 68.254 43.977 88.683  1.00 17.64 ? 71  LEU A N   1 
ATOM   61   C CA  . LEU A 1 71  ? 67.428 43.473 87.595  1.00 19.22 ? 71  LEU A CA  1 
ATOM   62   C C   . LEU A 1 71  ? 67.989 42.159 87.061  1.00 18.93 ? 71  LEU A C   1 
ATOM   63   O O   . LEU A 1 71  ? 67.422 41.554 86.153  1.00 19.78 ? 71  LEU A O   1 
ATOM   64   C CB  . LEU A 1 71  ? 67.330 44.509 86.472  1.00 20.67 ? 71  LEU A CB  1 
ATOM   65   C CG  . LEU A 1 71  ? 66.662 45.825 86.884  1.00 21.28 ? 71  LEU A CG  1 
ATOM   66   C CD1 . LEU A 1 71  ? 66.507 46.719 85.666  1.00 24.01 ? 71  LEU A CD1 1 
ATOM   67   C CD2 . LEU A 1 71  ? 65.299 45.540 87.512  1.00 23.99 ? 71  LEU A CD2 1 
ATOM   68   N N   . ALA A 1 72  ? 69.107 41.722 87.634  1.00 20.23 ? 72  ALA A N   1 
ATOM   69   C CA  . ALA A 1 72  ? 69.714 40.458 87.236  1.00 21.19 ? 72  ALA A CA  1 
ATOM   70   C C   . ALA A 1 72  ? 68.844 39.356 87.829  1.00 21.91 ? 72  ALA A C   1 
ATOM   71   O O   . ALA A 1 72  ? 68.890 38.205 87.392  1.00 22.12 ? 72  ALA A O   1 
ATOM   72   C CB  . ALA A 1 72  ? 71.133 40.357 87.776  1.00 22.08 ? 72  ALA A CB  1 
ATOM   73   N N   . LEU A 1 73  ? 68.054 39.730 88.834  1.00 20.99 ? 73  LEU A N   1 
ATOM   74   C CA  . LEU A 1 73  ? 67.140 38.812 89.507  1.00 21.41 ? 73  LEU A CA  1 
ATOM   75   C C   . LEU A 1 73  ? 65.840 38.766 88.705  1.00 21.70 ? 73  LEU A C   1 
ATOM   76   O O   . LEU A 1 73  ? 65.375 39.791 88.203  1.00 21.82 ? 73  LEU A O   1 
ATOM   77   C CB  . LEU A 1 73  ? 66.863 39.300 90.936  1.00 22.31 ? 73  LEU A CB  1 
ATOM   78   C CG  . LEU A 1 73  ? 68.063 39.333 91.889  1.00 24.75 ? 73  LEU A CG  1 
ATOM   79   C CD1 . LEU A 1 73  ? 67.717 40.138 93.135  1.00 26.70 ? 73  LEU A CD1 1 
ATOM   80   C CD2 . LEU A 1 73  ? 68.456 37.910 92.257  1.00 27.63 ? 73  LEU A CD2 1 
ATOM   81   N N   . HIS A 1 74  ? 65.249 37.581 88.594  1.00 21.18 ? 74  HIS A N   1 
ATOM   82   C CA  . HIS A 1 74  ? 64.025 37.410 87.821  1.00 21.94 ? 74  HIS A CA  1 
ATOM   83   C C   . HIS A 1 74  ? 62.822 38.232 88.274  1.00 20.43 ? 74  HIS A C   1 
ATOM   84   O O   . HIS A 1 74  ? 62.254 38.983 87.483  1.00 19.62 ? 74  HIS A O   1 
ATOM   85   C CB  . HIS A 1 74  ? 63.644 35.926 87.768  1.00 25.18 ? 74  HIS A CB  1 
ATOM   86   C CG  . HIS A 1 74  ? 62.362 35.658 87.040  1.00 26.89 ? 74  HIS A CG  1 
ATOM   87   N ND1 . HIS A 1 74  ? 61.132 35.697 87.660  1.00 29.82 ? 74  HIS A ND1 1 
ATOM   88   C CD2 . HIS A 1 74  ? 62.118 35.370 85.740  1.00 29.33 ? 74  HIS A CD2 1 
ATOM   89   C CE1 . HIS A 1 74  ? 60.185 35.444 86.774  1.00 29.26 ? 74  HIS A CE1 1 
ATOM   90   N NE2 . HIS A 1 74  ? 60.757 35.243 85.601  1.00 29.57 ? 74  HIS A NE2 1 
ATOM   91   N N   . ALA A 1 75  ? 62.428 38.095 89.536  1.00 19.89 ? 75  ALA A N   1 
ATOM   92   C CA  . ALA A 1 75  ? 61.269 38.831 90.037  1.00 20.23 ? 75  ALA A CA  1 
ATOM   93   C C   . ALA A 1 75  ? 61.368 40.344 89.817  1.00 18.21 ? 75  ALA A C   1 
ATOM   94   O O   . ALA A 1 75  ? 60.463 40.953 89.244  1.00 17.81 ? 75  ALA A O   1 
ATOM   95   C CB  . ALA A 1 75  ? 61.050 38.522 91.519  1.00 20.40 ? 75  ALA A CB  1 
ATOM   96   N N   . PRO A 1 76  ? 62.465 40.974 90.268  1.00 18.35 ? 76  PRO A N   1 
ATOM   97   C CA  . PRO A 1 76  ? 62.593 42.421 90.074  1.00 18.45 ? 76  PRO A CA  1 
ATOM   98   C C   . PRO A 1 76  ? 62.488 42.837 88.604  1.00 18.19 ? 76  PRO A C   1 
ATOM   99   O O   . PRO A 1 76  ? 61.826 43.819 88.277  1.00 17.11 ? 76  PRO A O   1 
ATOM   100  C CB  . PRO A 1 76  ? 63.967 42.727 90.668  1.00 20.09 ? 76  PRO A CB  1 
ATOM   101  C CG  . PRO A 1 76  ? 64.103 41.692 91.745  1.00 20.93 ? 76  PRO A CG  1 
ATOM   102  C CD  . PRO A 1 76  ? 63.599 40.451 91.052  1.00 18.85 ? 76  PRO A CD  1 
ATOM   103  N N   . SER A 1 77  ? 63.132 42.087 87.714  1.00 17.74 ? 77  SER A N   1 
ATOM   104  C CA  . SER A 1 77  ? 63.081 42.429 86.297  1.00 18.13 ? 77  SER A CA  1 
ATOM   105  C C   . SER A 1 77  ? 61.670 42.318 85.718  1.00 16.97 ? 77  SER A C   1 
ATOM   106  O O   . SER A 1 77  ? 61.285 43.109 84.864  1.00 16.89 ? 77  SER A O   1 
ATOM   107  C CB  . SER A 1 77  ? 64.057 41.554 85.499  1.00 20.08 ? 77  SER A CB  1 
ATOM   108  O OG  . SER A 1 77  ? 63.758 40.181 85.644  1.00 22.81 ? 77  SER A OG  1 
ATOM   109  N N   . GLN A 1 78  ? 60.887 41.352 86.186  1.00 16.19 ? 78  GLN A N   1 
ATOM   110  C CA  . GLN A 1 78  ? 59.526 41.206 85.675  1.00 16.84 ? 78  GLN A CA  1 
ATOM   111  C C   . GLN A 1 78  ? 58.676 42.383 86.145  1.00 15.26 ? 78  GLN A C   1 
ATOM   112  O O   . GLN A 1 78  ? 57.870 42.929 85.392  1.00 14.26 ? 78  GLN A O   1 
ATOM   113  C CB  . GLN A 1 78  ? 58.912 39.890 86.161  1.00 18.23 ? 78  GLN A CB  1 
ATOM   114  C CG  . GLN A 1 78  ? 59.686 38.649 85.733  1.00 20.96 ? 78  GLN A CG  1 
ATOM   115  C CD  . GLN A 1 78  ? 59.819 38.530 84.225  1.00 23.49 ? 78  GLN A CD  1 
ATOM   116  O OE1 . GLN A 1 78  ? 58.824 38.502 83.505  1.00 25.29 ? 78  GLN A OE1 1 
ATOM   117  N NE2 . GLN A 1 78  ? 61.055 38.457 83.742  1.00 25.00 ? 78  GLN A NE2 1 
ATOM   118  N N   . ILE A 1 79  ? 58.859 42.774 87.400  1.00 14.42 ? 79  ILE A N   1 
ATOM   119  C CA  . ILE A 1 79  ? 58.108 43.892 87.948  1.00 14.19 ? 79  ILE A CA  1 
ATOM   120  C C   . ILE A 1 79  ? 58.455 45.198 87.238  1.00 13.42 ? 79  ILE A C   1 
ATOM   121  O O   . ILE A 1 79  ? 57.567 45.935 86.811  1.00 13.87 ? 79  ILE A O   1 
ATOM   122  C CB  . ILE A 1 79  ? 58.384 44.045 89.457  1.00 14.56 ? 79  ILE A CB  1 
ATOM   123  C CG1 . ILE A 1 79  ? 57.903 42.786 90.181  1.00 15.71 ? 79  ILE A CG1 1 
ATOM   124  C CG2 . ILE A 1 79  ? 57.706 45.309 89.991  1.00 15.01 ? 79  ILE A CG2 1 
ATOM   125  C CD1 . ILE A 1 79  ? 58.232 42.747 91.670  1.00 15.85 ? 79  ILE A CD1 1 
ATOM   126  N N   . VAL A 1 80  ? 59.746 45.481 87.099  1.00 15.25 ? 80  VAL A N   1 
ATOM   127  C CA  . VAL A 1 80  ? 60.163 46.718 86.450  1.00 13.69 ? 80  VAL A CA  1 
ATOM   128  C C   . VAL A 1 80  ? 59.743 46.762 84.983  1.00 13.23 ? 80  VAL A C   1 
ATOM   129  O O   . VAL A 1 80  ? 59.404 47.824 84.464  1.00 12.87 ? 80  VAL A O   1 
ATOM   130  C CB  . VAL A 1 80  ? 61.686 46.937 86.599  1.00 14.24 ? 80  VAL A CB  1 
ATOM   131  C CG1 . VAL A 1 80  ? 62.126 48.157 85.800  1.00 15.96 ? 80  VAL A CG1 1 
ATOM   132  C CG2 . VAL A 1 80  ? 62.029 47.146 88.072  1.00 16.91 ? 80  VAL A CG2 1 
ATOM   133  N N   . ALA A 1 81  ? 59.749 45.611 84.317  1.00 14.56 ? 81  ALA A N   1 
ATOM   134  C CA  . ALA A 1 81  ? 59.328 45.561 82.919  1.00 14.07 ? 81  ALA A CA  1 
ATOM   135  C C   . ALA A 1 81  ? 57.879 46.036 82.831  1.00 13.91 ? 81  ALA A C   1 
ATOM   136  O O   . ALA A 1 81  ? 57.520 46.829 81.963  1.00 14.97 ? 81  ALA A O   1 
ATOM   137  C CB  . ALA A 1 81  ? 59.445 44.139 82.382  1.00 14.07 ? 81  ALA A CB  1 
ATOM   138  N N   . ALA A 1 82  ? 57.047 45.546 83.745  1.00 14.10 ? 82  ALA A N   1 
ATOM   139  C CA  . ALA A 1 82  ? 55.638 45.918 83.774  1.00 14.16 ? 82  ALA A CA  1 
ATOM   140  C C   . ALA A 1 82  ? 55.481 47.397 84.113  1.00 14.18 ? 82  ALA A C   1 
ATOM   141  O O   . ALA A 1 82  ? 54.597 48.072 83.589  1.00 15.41 ? 82  ALA A O   1 
ATOM   142  C CB  . ALA A 1 82  ? 54.895 45.064 84.791  1.00 14.24 ? 82  ALA A CB  1 
ATOM   143  N N   . ILE A 1 83  ? 56.332 47.895 85.003  1.00 13.31 ? 83  ILE A N   1 
ATOM   144  C CA  . ILE A 1 83  ? 56.291 49.303 85.377  1.00 13.53 ? 83  ILE A CA  1 
ATOM   145  C C   . ILE A 1 83  ? 56.587 50.161 84.148  1.00 14.83 ? 83  ILE A C   1 
ATOM   146  O O   . ILE A 1 83  ? 55.864 51.115 83.850  1.00 15.96 ? 83  ILE A O   1 
ATOM   147  C CB  . ILE A 1 83  ? 57.336 49.623 86.470  1.00 13.70 ? 83  ILE A CB  1 
ATOM   148  C CG1 . ILE A 1 83  ? 56.899 49.002 87.802  1.00 13.60 ? 83  ILE A CG1 1 
ATOM   149  C CG2 . ILE A 1 83  ? 57.511 51.136 86.606  1.00 13.64 ? 83  ILE A CG2 1 
ATOM   150  C CD1 . ILE A 1 83  ? 57.913 49.172 88.915  1.00 14.92 ? 83  ILE A CD1 1 
ATOM   151  N N   . LEU A 1 84  ? 57.647 49.809 83.426  1.00 15.11 ? 84  LEU A N   1 
ATOM   152  C CA  . LEU A 1 84  ? 58.032 50.564 82.239  1.00 15.82 ? 84  LEU A CA  1 
ATOM   153  C C   . LEU A 1 84  ? 56.961 50.507 81.158  1.00 17.11 ? 84  LEU A C   1 
ATOM   154  O O   . LEU A 1 84  ? 56.714 51.495 80.467  1.00 18.44 ? 84  LEU A O   1 
ATOM   155  C CB  . LEU A 1 84  ? 59.359 50.039 81.683  1.00 16.02 ? 84  LEU A CB  1 
ATOM   156  C CG  . LEU A 1 84  ? 60.567 50.171 82.613  1.00 17.06 ? 84  LEU A CG  1 
ATOM   157  C CD1 . LEU A 1 84  ? 61.784 49.524 81.963  1.00 19.52 ? 84  LEU A CD1 1 
ATOM   158  C CD2 . LEU A 1 84  ? 60.831 51.638 82.918  1.00 17.22 ? 84  LEU A CD2 1 
ATOM   159  N N   . SER A 1 85  ? 56.325 49.351 81.009  1.00 17.29 ? 85  SER A N   1 
ATOM   160  C CA  . SER A 1 85  ? 55.278 49.203 80.007  1.00 18.95 ? 85  SER A CA  1 
ATOM   161  C C   . SER A 1 85  ? 54.085 50.104 80.318  1.00 18.77 ? 85  SER A C   1 
ATOM   162  O O   . SER A 1 85  ? 53.599 50.831 79.448  1.00 18.18 ? 85  SER A O   1 
ATOM   163  C CB  . SER A 1 85  ? 54.813 47.747 79.930  1.00 20.71 ? 85  SER A CB  1 
ATOM   164  O OG  . SER A 1 85  ? 53.762 47.604 78.989  1.00 23.50 ? 85  SER A OG  1 
ATOM   165  N N   . ARG A 1 86  ? 53.618 50.061 81.564  1.00 16.83 ? 86  ARG A N   1 
ATOM   166  C CA  . ARG A 1 86  ? 52.471 50.867 81.968  1.00 18.16 ? 86  ARG A CA  1 
ATOM   167  C C   . ARG A 1 86  ? 52.793 52.358 81.955  1.00 19.37 ? 86  ARG A C   1 
ATOM   168  O O   . ARG A 1 86  ? 51.947 53.180 81.594  1.00 20.62 ? 86  ARG A O   1 
ATOM   169  C CB  . ARG A 1 86  ? 51.989 50.442 83.358  1.00 18.97 ? 86  ARG A CB  1 
ATOM   170  C CG  . ARG A 1 86  ? 50.693 51.109 83.801  1.00 20.15 ? 86  ARG A CG  1 
ATOM   171  C CD  . ARG A 1 86  ? 49.584 50.920 82.769  1.00 25.63 ? 86  ARG A CD  1 
ATOM   172  N NE  . ARG A 1 86  ? 48.297 51.411 83.255  1.00 27.31 ? 86  ARG A NE  1 
ATOM   173  C CZ  . ARG A 1 86  ? 47.256 51.683 82.474  1.00 30.90 ? 86  ARG A CZ  1 
ATOM   174  N NH1 . ARG A 1 86  ? 47.346 51.515 81.161  1.00 30.91 ? 86  ARG A NH1 1 
ATOM   175  N NH2 . ARG A 1 86  ? 46.123 52.123 83.007  1.00 31.30 ? 86  ARG A NH2 1 
ATOM   176  N N   . ALA A 1 87  ? 54.014 52.708 82.348  1.00 18.09 ? 87  ALA A N   1 
ATOM   177  C CA  . ALA A 1 87  ? 54.431 54.105 82.358  1.00 18.76 ? 87  ALA A CA  1 
ATOM   178  C C   . ALA A 1 87  ? 54.359 54.650 80.934  1.00 20.74 ? 87  ALA A C   1 
ATOM   179  O O   . ALA A 1 87  ? 53.839 55.742 80.700  1.00 20.99 ? 87  ALA A O   1 
ATOM   180  C CB  . ALA A 1 87  ? 55.849 54.225 82.894  1.00 18.90 ? 87  ALA A CB  1 
ATOM   181  N N   . ASP A 1 88  ? 54.884 53.875 79.990  1.00 22.03 ? 88  ASP A N   1 
ATOM   182  C CA  . ASP A 1 88  ? 54.876 54.256 78.580  1.00 25.37 ? 88  ASP A CA  1 
ATOM   183  C C   . ASP A 1 88  ? 53.433 54.488 78.143  1.00 26.27 ? 88  ASP A C   1 
ATOM   184  O O   . ASP A 1 88  ? 53.125 55.471 77.467  1.00 26.33 ? 88  ASP A O   1 
ATOM   185  C CB  . ASP A 1 88  ? 55.493 53.141 77.733  1.00 27.49 ? 88  ASP A CB  1 
ATOM   186  C CG  . ASP A 1 88  ? 55.645 53.526 76.271  1.00 31.82 ? 88  ASP A CG  1 
ATOM   187  O OD1 . ASP A 1 88  ? 55.699 52.613 75.422  1.00 36.02 ? 88  ASP A OD1 1 
ATOM   188  O OD2 . ASP A 1 88  ? 55.723 54.735 75.970  1.00 34.30 ? 88  ASP A OD2 1 
ATOM   189  N N   . GLN A 1 89  ? 52.554 53.574 78.542  1.00 26.20 ? 89  GLN A N   1 
ATOM   190  C CA  . GLN A 1 89  ? 51.136 53.652 78.205  1.00 27.58 ? 89  GLN A CA  1 
ATOM   191  C C   . GLN A 1 89  ? 50.490 54.932 78.718  1.00 27.65 ? 89  GLN A C   1 
ATOM   192  O O   . GLN A 1 89  ? 49.633 55.513 78.052  1.00 27.87 ? 89  GLN A O   1 
ATOM   193  C CB  . GLN A 1 89  ? 50.384 52.457 78.796  1.00 29.06 ? 89  GLN A CB  1 
ATOM   194  C CG  . GLN A 1 89  ? 50.713 51.110 78.179  1.00 33.11 ? 89  GLN A CG  1 
ATOM   195  C CD  . GLN A 1 89  ? 50.118 49.958 78.973  1.00 35.27 ? 89  GLN A CD  1 
ATOM   196  O OE1 . GLN A 1 89  ? 48.931 49.963 79.300  1.00 35.69 ? 89  GLN A OE1 1 
ATOM   197  N NE2 . GLN A 1 89  ? 50.944 48.965 79.286  1.00 37.83 ? 89  GLN A NE2 1 
ATOM   198  N N   . LEU A 1 90  ? 50.902 55.368 79.903  1.00 25.93 ? 90  LEU A N   1 
ATOM   199  C CA  . LEU A 1 90  ? 50.334 56.567 80.506  1.00 27.21 ? 90  LEU A CA  1 
ATOM   200  C C   . LEU A 1 90  ? 51.125 57.843 80.227  1.00 27.11 ? 90  LEU A C   1 
ATOM   201  O O   . LEU A 1 90  ? 50.834 58.895 80.798  1.00 28.45 ? 90  LEU A O   1 
ATOM   202  C CB  . LEU A 1 90  ? 50.185 56.358 82.016  1.00 27.37 ? 90  LEU A CB  1 
ATOM   203  C CG  . LEU A 1 90  ? 49.309 55.160 82.408  1.00 29.06 ? 90  LEU A CG  1 
ATOM   204  C CD1 . LEU A 1 90  ? 49.319 54.982 83.918  1.00 28.37 ? 90  LEU A CD1 1 
ATOM   205  C CD2 . LEU A 1 90  ? 47.887 55.368 81.901  1.00 29.17 ? 90  LEU A CD2 1 
ATOM   206  N N   . GLY A 1 91  ? 52.122 57.747 79.353  1.00 26.98 ? 91  GLY A N   1 
ATOM   207  C CA  . GLY A 1 91  ? 52.921 58.910 79.002  1.00 26.50 ? 91  GLY A CA  1 
ATOM   208  C C   . GLY A 1 91  ? 53.887 59.399 80.064  1.00 26.09 ? 91  GLY A C   1 
ATOM   209  O O   . GLY A 1 91  ? 54.165 60.595 80.155  1.00 27.58 ? 91  GLY A O   1 
ATOM   210  N N   . ALA A 1 92  ? 54.412 58.483 80.869  1.00 23.81 ? 92  ALA A N   1 
ATOM   211  C CA  . ALA A 1 92  ? 55.353 58.857 81.915  1.00 22.52 ? 92  ALA A CA  1 
ATOM   212  C C   . ALA A 1 92  ? 56.725 58.249 81.660  1.00 20.82 ? 92  ALA A C   1 
ATOM   213  O O   . ALA A 1 92  ? 56.834 57.067 81.333  1.00 22.21 ? 92  ALA A O   1 
ATOM   214  C CB  . ALA A 1 92  ? 54.833 58.399 83.272  1.00 22.24 ? 92  ALA A CB  1 
ATOM   215  N N   . SER A 1 93  ? 57.766 59.064 81.796  1.00 20.42 ? 93  SER A N   1 
ATOM   216  C CA  . SER A 1 93  ? 59.132 58.593 81.621  1.00 20.28 ? 93  SER A CA  1 
ATOM   217  C C   . SER A 1 93  ? 59.573 58.059 82.973  1.00 19.66 ? 93  SER A C   1 
ATOM   218  O O   . SER A 1 93  ? 59.035 58.459 84.007  1.00 19.88 ? 93  SER A O   1 
ATOM   219  C CB  . SER A 1 93  ? 60.048 59.732 81.174  1.00 22.44 ? 93  SER A CB  1 
ATOM   220  O OG  . SER A 1 93  ? 59.781 60.072 79.826  1.00 24.32 ? 93  SER A OG  1 
ATOM   221  N N   . VAL A 1 94  ? 60.554 57.166 82.968  1.00 18.52 ? 94  VAL A N   1 
ATOM   222  C CA  . VAL A 1 94  ? 61.012 56.558 84.209  1.00 17.07 ? 94  VAL A CA  1 
ATOM   223  C C   . VAL A 1 94  ? 62.520 56.561 84.419  1.00 17.89 ? 94  VAL A C   1 
ATOM   224  O O   . VAL A 1 94  ? 63.280 56.094 83.567  1.00 18.21 ? 94  VAL A O   1 
ATOM   225  C CB  . VAL A 1 94  ? 60.535 55.088 84.290  1.00 15.64 ? 94  VAL A CB  1 
ATOM   226  C CG1 . VAL A 1 94  ? 60.865 54.499 85.655  1.00 16.78 ? 94  VAL A CG1 1 
ATOM   227  C CG2 . VAL A 1 94  ? 59.045 55.008 84.008  1.00 17.53 ? 94  VAL A CG2 1 
ATOM   228  N N   . VAL A 1 95  ? 62.946 57.092 85.562  1.00 16.87 ? 95  VAL A N   1 
ATOM   229  C CA  . VAL A 1 95  ? 64.356 57.103 85.922  1.00 16.93 ? 95  VAL A CA  1 
ATOM   230  C C   . VAL A 1 95  ? 64.500 55.881 86.824  1.00 17.60 ? 95  VAL A C   1 
ATOM   231  O O   . VAL A 1 95  ? 63.745 55.722 87.783  1.00 17.14 ? 95  VAL A O   1 
ATOM   232  C CB  . VAL A 1 95  ? 64.740 58.371 86.719  1.00 18.62 ? 95  VAL A CB  1 
ATOM   233  C CG1 . VAL A 1 95  ? 66.225 58.336 87.071  1.00 19.00 ? 95  VAL A CG1 1 
ATOM   234  C CG2 . VAL A 1 95  ? 64.414 59.618 85.904  1.00 20.29 ? 95  VAL A CG2 1 
ATOM   235  N N   . VAL A 1 96  ? 65.454 55.011 86.510  1.00 16.68 ? 96  VAL A N   1 
ATOM   236  C CA  . VAL A 1 96  ? 65.650 53.799 87.295  1.00 17.43 ? 96  VAL A CA  1 
ATOM   237  C C   . VAL A 1 96  ? 67.007 53.771 87.981  1.00 19.33 ? 96  VAL A C   1 
ATOM   238  O O   . VAL A 1 96  ? 68.042 53.967 87.342  1.00 19.59 ? 96  VAL A O   1 
ATOM   239  C CB  . VAL A 1 96  ? 65.527 52.538 86.405  1.00 17.31 ? 96  VAL A CB  1 
ATOM   240  C CG1 . VAL A 1 96  ? 65.630 51.275 87.264  1.00 16.45 ? 96  VAL A CG1 1 
ATOM   241  C CG2 . VAL A 1 96  ? 64.212 52.567 85.646  1.00 17.64 ? 96  VAL A CG2 1 
ATOM   242  N N   . SER A 1 97  ? 66.992 53.529 89.289  1.00 18.57 ? 97  SER A N   1 
ATOM   243  C CA  . SER A 1 97  ? 68.216 53.452 90.074  1.00 19.83 ? 97  SER A CA  1 
ATOM   244  C C   . SER A 1 97  ? 68.276 52.067 90.709  1.00 21.21 ? 97  SER A C   1 
ATOM   245  O O   . SER A 1 97  ? 67.341 51.654 91.401  1.00 19.82 ? 97  SER A O   1 
ATOM   246  C CB  . SER A 1 97  ? 68.221 54.529 91.165  1.00 19.49 ? 97  SER A CB  1 
ATOM   247  O OG  . SER A 1 97  ? 69.387 54.435 91.969  1.00 22.44 ? 97  SER A OG  1 
ATOM   248  N N   . MET A 1 98  ? 69.363 51.344 90.462  1.00 20.50 ? 98  MET A N   1 
ATOM   249  C CA  . MET A 1 98  ? 69.518 50.005 91.016  1.00 23.54 ? 98  MET A CA  1 
ATOM   250  C C   . MET A 1 98  ? 70.311 50.119 92.312  1.00 27.23 ? 98  MET A C   1 
ATOM   251  O O   . MET A 1 98  ? 71.440 50.606 92.321  1.00 27.25 ? 98  MET A O   1 
ATOM   252  C CB  . MET A 1 98  ? 70.237 49.102 90.008  1.00 23.91 ? 98  MET A CB  1 
ATOM   253  C CG  . MET A 1 98  ? 69.775 47.649 90.030  1.00 23.39 ? 98  MET A CG  1 
ATOM   254  S SD  . MET A 1 98  ? 70.346 46.708 88.581  1.00 22.03 ? 98  MET A SD  1 
ATOM   255  C CE  . MET A 1 98  ? 72.026 46.378 89.064  1.00 21.97 ? 98  MET A CE  1 
ATOM   256  N N   . VAL A 1 99  ? 69.710 49.669 93.408  1.00 29.46 ? 99  VAL A N   1 
ATOM   257  C CA  . VAL A 1 99  ? 70.339 49.758 94.720  1.00 34.49 ? 99  VAL A CA  1 
ATOM   258  C C   . VAL A 1 99  ? 71.606 48.930 94.884  1.00 38.61 ? 99  VAL A C   1 
ATOM   259  O O   . VAL A 1 99  ? 71.648 47.752 94.533  1.00 39.19 ? 99  VAL A O   1 
ATOM   260  C CB  . VAL A 1 99  ? 69.338 49.374 95.828  1.00 33.56 ? 99  VAL A CB  1 
ATOM   261  C CG1 . VAL A 1 99  ? 69.988 49.523 97.200  1.00 33.98 ? 99  VAL A CG1 1 
ATOM   262  C CG2 . VAL A 1 99  ? 68.108 50.260 95.730  1.00 33.87 ? 99  VAL A CG2 1 
ATOM   263  N N   . GLU A 1 100 ? 72.636 49.568 95.438  1.00 43.06 ? 100 GLU A N   1 
ATOM   264  C CA  . GLU A 1 100 ? 73.928 48.933 95.672  1.00 47.51 ? 100 GLU A CA  1 
ATOM   265  C C   . GLU A 1 100 ? 73.795 47.658 96.502  1.00 49.08 ? 100 GLU A C   1 
ATOM   266  O O   . GLU A 1 100 ? 74.787 46.988 96.788  1.00 50.20 ? 100 GLU A O   1 
ATOM   267  C CB  . GLU A 1 100 ? 74.869 49.914 96.377  1.00 49.54 ? 100 GLU A CB  1 
ATOM   268  C CG  . GLU A 1 100 ? 75.093 51.210 95.610  1.00 52.13 ? 100 GLU A CG  1 
ATOM   269  C CD  . GLU A 1 100 ? 76.052 52.152 96.314  1.00 53.31 ? 100 GLU A CD  1 
ATOM   270  O OE1 . GLU A 1 100 ? 75.752 52.571 97.452  1.00 54.90 ? 100 GLU A OE1 1 
ATOM   271  O OE2 . GLU A 1 100 ? 77.106 52.475 95.726  1.00 54.34 ? 100 GLU A OE2 1 
ATOM   272  N N   . ARG A 1 101 ? 72.564 47.339 96.891  1.00 51.10 ? 101 ARG A N   1 
ATOM   273  C CA  . ARG A 1 101 ? 72.271 46.141 97.670  1.00 51.91 ? 101 ARG A CA  1 
ATOM   274  C C   . ARG A 1 101 ? 72.701 46.223 99.130  1.00 51.21 ? 101 ARG A C   1 
ATOM   275  O O   . ARG A 1 101 ? 73.656 46.919 99.477  1.00 51.25 ? 101 ARG A O   1 
ATOM   276  C CB  . ARG A 1 101 ? 72.929 44.916 97.024  1.00 53.40 ? 101 ARG A CB  1 
ATOM   277  C CG  . ARG A 1 101 ? 72.480 44.641 95.601  1.00 56.54 ? 101 ARG A CG  1 
ATOM   278  C CD  . ARG A 1 101 ? 73.181 43.423 95.000  1.00 58.41 ? 101 ARG A CD  1 
ATOM   279  N NE  . ARG A 1 101 ? 72.921 42.191 95.744  1.00 59.92 ? 101 ARG A NE  1 
ATOM   280  C CZ  . ARG A 1 101 ? 73.584 41.812 96.834  1.00 60.39 ? 101 ARG A CZ  1 
ATOM   281  N NH1 . ARG A 1 101 ? 74.561 42.566 97.321  1.00 61.09 ? 101 ARG A NH1 1 
ATOM   282  N NH2 . ARG A 1 101 ? 73.268 40.676 97.440  1.00 60.66 ? 101 ARG A NH2 1 
ATOM   283  N N   . SER A 1 102 ? 71.975 45.497 99.974  1.00 49.97 ? 102 SER A N   1 
ATOM   284  C CA  . SER A 1 102 ? 72.245 45.430 101.404 1.00 48.39 ? 102 SER A CA  1 
ATOM   285  C C   . SER A 1 102 ? 72.261 46.769 102.131 1.00 46.59 ? 102 SER A C   1 
ATOM   286  O O   . SER A 1 102 ? 73.210 47.546 102.005 1.00 47.06 ? 102 SER A O   1 
ATOM   287  C CB  . SER A 1 102 ? 73.575 44.712 101.647 1.00 49.21 ? 102 SER A CB  1 
ATOM   288  O OG  . SER A 1 102 ? 73.543 43.389 101.141 1.00 50.92 ? 102 SER A OG  1 
ATOM   289  N N   . GLY A 1 103 ? 71.206 47.037 102.895 1.00 43.84 ? 103 GLY A N   1 
ATOM   290  C CA  . GLY A 1 103 ? 71.158 48.268 103.660 1.00 40.40 ? 103 GLY A CA  1 
ATOM   291  C C   . GLY A 1 103 ? 70.136 49.325 103.293 1.00 37.03 ? 103 GLY A C   1 
ATOM   292  O O   . GLY A 1 103 ? 69.854 49.579 102.120 1.00 35.59 ? 103 GLY A O   1 
ATOM   293  N N   . VAL A 1 104 ? 69.589 49.954 104.328 1.00 33.50 ? 104 VAL A N   1 
ATOM   294  C CA  . VAL A 1 104 ? 68.609 51.013 104.164 1.00 30.14 ? 104 VAL A CA  1 
ATOM   295  C C   . VAL A 1 104 ? 69.324 52.264 103.656 1.00 28.78 ? 104 VAL A C   1 
ATOM   296  O O   . VAL A 1 104 ? 68.734 53.088 102.961 1.00 27.00 ? 104 VAL A O   1 
ATOM   297  C CB  . VAL A 1 104 ? 67.911 51.325 105.509 1.00 30.20 ? 104 VAL A CB  1 
ATOM   298  C CG1 . VAL A 1 104 ? 68.952 51.687 106.561 1.00 30.05 ? 104 VAL A CG1 1 
ATOM   299  C CG2 . VAL A 1 104 ? 66.911 52.456 105.333 1.00 28.96 ? 104 VAL A CG2 1 
ATOM   300  N N   . GLU A 1 105 ? 70.603 52.397 103.999 1.00 28.32 ? 105 GLU A N   1 
ATOM   301  C CA  . GLU A 1 105 ? 71.383 53.552 103.567 1.00 27.82 ? 105 GLU A CA  1 
ATOM   302  C C   . GLU A 1 105 ? 71.568 53.552 102.053 1.00 26.09 ? 105 GLU A C   1 
ATOM   303  O O   . GLU A 1 105 ? 71.523 54.602 101.417 1.00 25.70 ? 105 GLU A O   1 
ATOM   304  C CB  . GLU A 1 105 ? 72.753 53.562 104.249 1.00 30.38 ? 105 GLU A CB  1 
ATOM   305  C CG  . GLU A 1 105 ? 72.697 53.756 105.755 1.00 33.87 ? 105 GLU A CG  1 
ATOM   306  C CD  . GLU A 1 105 ? 71.882 54.970 106.153 1.00 36.37 ? 105 GLU A CD  1 
ATOM   307  O OE1 . GLU A 1 105 ? 72.080 56.043 105.547 1.00 37.86 ? 105 GLU A OE1 1 
ATOM   308  O OE2 . GLU A 1 105 ? 71.046 54.853 107.075 1.00 38.81 ? 105 GLU A OE2 1 
ATOM   309  N N   . ALA A 1 106 ? 71.780 52.370 101.485 1.00 25.15 ? 106 ALA A N   1 
ATOM   310  C CA  . ALA A 1 106 ? 71.963 52.240 100.044 1.00 23.61 ? 106 ALA A CA  1 
ATOM   311  C C   . ALA A 1 106 ? 70.678 52.650 99.332  1.00 23.24 ? 106 ALA A C   1 
ATOM   312  O O   . ALA A 1 106 ? 70.716 53.286 98.278  1.00 21.49 ? 106 ALA A O   1 
ATOM   313  C CB  . ALA A 1 106 ? 72.324 50.802 99.690  1.00 24.61 ? 106 ALA A CB  1 
ATOM   314  N N   . CYS A 1 107 ? 69.539 52.289 99.917  1.00 21.43 ? 107 CYS A N   1 
ATOM   315  C CA  . CYS A 1 107 ? 68.250 52.627 99.326  1.00 21.37 ? 107 CYS A CA  1 
ATOM   316  C C   . CYS A 1 107 ? 67.988 54.122 99.466  1.00 21.84 ? 107 CYS A C   1 
ATOM   317  O O   . CYS A 1 107 ? 67.458 54.753 98.555  1.00 21.84 ? 107 CYS A O   1 
ATOM   318  C CB  . CYS A 1 107 ? 67.127 51.830 99.998  1.00 21.38 ? 107 CYS A CB  1 
ATOM   319  S SG  . CYS A 1 107 ? 65.563 51.862 99.085  1.00 21.53 ? 107 CYS A SG  1 
ATOM   320  N N   . LYS A 1 108 ? 68.360 54.691 100.609 1.00 21.55 ? 108 LYS A N   1 
ATOM   321  C CA  . LYS A 1 108 ? 68.168 56.121 100.822 1.00 22.06 ? 108 LYS A CA  1 
ATOM   322  C C   . LYS A 1 108 ? 68.979 56.913 99.801  1.00 20.78 ? 108 LYS A C   1 
ATOM   323  O O   . LYS A 1 108 ? 68.528 57.939 99.295  1.00 21.54 ? 108 LYS A O   1 
ATOM   324  C CB  . LYS A 1 108 ? 68.595 56.511 102.237 1.00 23.66 ? 108 LYS A CB  1 
ATOM   325  C CG  . LYS A 1 108 ? 67.660 56.002 103.317 1.00 26.57 ? 108 LYS A CG  1 
ATOM   326  C CD  . LYS A 1 108 ? 68.188 56.348 104.700 1.00 29.40 ? 108 LYS A CD  1 
ATOM   327  C CE  . LYS A 1 108 ? 67.194 55.963 105.774 1.00 32.84 ? 108 LYS A CE  1 
ATOM   328  N NZ  . LYS A 1 108 ? 65.926 56.720 105.612 1.00 37.17 ? 108 LYS A NZ  1 
ATOM   329  N N   . THR A 1 109 ? 70.179 56.431 99.502  1.00 21.74 ? 109 THR A N   1 
ATOM   330  C CA  . THR A 1 109 ? 71.039 57.099 98.533  1.00 22.29 ? 109 THR A CA  1 
ATOM   331  C C   . THR A 1 109 ? 70.377 57.071 97.158  1.00 21.33 ? 109 THR A C   1 
ATOM   332  O O   . THR A 1 109 ? 70.373 58.071 96.438  1.00 21.16 ? 109 THR A O   1 
ATOM   333  C CB  . THR A 1 109 ? 72.421 56.416 98.456  1.00 23.33 ? 109 THR A CB  1 
ATOM   334  O OG1 . THR A 1 109 ? 73.102 56.586 99.707  1.00 26.44 ? 109 THR A OG1 1 
ATOM   335  C CG2 . THR A 1 109 ? 73.263 57.021 97.337  1.00 25.53 ? 109 THR A CG2 1 
ATOM   336  N N   . ALA A 1 110 ? 69.812 55.921 96.801  1.00 20.75 ? 110 ALA A N   1 
ATOM   337  C CA  . ALA A 1 110 ? 69.139 55.781 95.516  1.00 18.95 ? 110 ALA A CA  1 
ATOM   338  C C   . ALA A 1 110 ? 67.988 56.778 95.430  1.00 19.85 ? 110 ALA A C   1 
ATOM   339  O O   . ALA A 1 110 ? 67.815 57.458 94.417  1.00 18.51 ? 110 ALA A O   1 
ATOM   340  C CB  . ALA A 1 110 ? 68.620 54.356 95.346  1.00 19.77 ? 110 ALA A CB  1 
ATOM   341  N N   . VAL A 1 111 ? 67.202 56.862 96.499  1.00 19.35 ? 111 VAL A N   1 
ATOM   342  C CA  . VAL A 1 111 ? 66.076 57.784 96.544  1.00 20.44 ? 111 VAL A CA  1 
ATOM   343  C C   . VAL A 1 111 ? 66.566 59.222 96.400  1.00 20.86 ? 111 VAL A C   1 
ATOM   344  O O   . VAL A 1 111 ? 65.965 60.021 95.684  1.00 20.70 ? 111 VAL A O   1 
ATOM   345  C CB  . VAL A 1 111 ? 65.289 57.638 97.866  1.00 20.56 ? 111 VAL A CB  1 
ATOM   346  C CG1 . VAL A 1 111 ? 64.288 58.773 98.009  1.00 20.94 ? 111 VAL A CG1 1 
ATOM   347  C CG2 . VAL A 1 111 ? 64.569 56.296 97.887  1.00 22.74 ? 111 VAL A CG2 1 
ATOM   348  N N   . HIS A 1 112 ? 67.661 59.548 97.079  1.00 22.41 ? 112 HIS A N   1 
ATOM   349  C CA  . HIS A 1 112 ? 68.224 60.891 96.999  1.00 24.22 ? 112 HIS A CA  1 
ATOM   350  C C   . HIS A 1 112 ? 68.586 61.239 95.553  1.00 24.22 ? 112 HIS A C   1 
ATOM   351  O O   . HIS A 1 112 ? 68.237 62.313 95.063  1.00 23.16 ? 112 HIS A O   1 
ATOM   352  C CB  . HIS A 1 112 ? 69.466 60.995 97.889  1.00 27.72 ? 112 HIS A CB  1 
ATOM   353  C CG  . HIS A 1 112 ? 70.161 62.319 97.807  1.00 33.48 ? 112 HIS A CG  1 
ATOM   354  N ND1 . HIS A 1 112 ? 70.888 62.711 96.703  1.00 36.05 ? 112 HIS A ND1 1 
ATOM   355  C CD2 . HIS A 1 112 ? 70.228 63.347 98.686  1.00 34.60 ? 112 HIS A CD2 1 
ATOM   356  C CE1 . HIS A 1 112 ? 71.373 63.924 96.906  1.00 36.11 ? 112 HIS A CE1 1 
ATOM   357  N NE2 . HIS A 1 112 ? 70.987 64.332 98.101  1.00 36.72 ? 112 HIS A NE2 1 
ATOM   358  N N   . ASN A 1 113 ? 69.276 60.328 94.872  1.00 23.30 ? 113 ASN A N   1 
ATOM   359  C CA  . ASN A 1 113 ? 69.673 60.567 93.486  1.00 24.47 ? 113 ASN A CA  1 
ATOM   360  C C   . ASN A 1 113 ? 68.464 60.715 92.568  1.00 23.19 ? 113 ASN A C   1 
ATOM   361  O O   . ASN A 1 113 ? 68.485 61.506 91.626  1.00 23.15 ? 113 ASN A O   1 
ATOM   362  C CB  . ASN A 1 113 ? 70.565 59.434 92.967  1.00 24.91 ? 113 ASN A CB  1 
ATOM   363  C CG  . ASN A 1 113 ? 71.854 59.299 93.751  1.00 28.10 ? 113 ASN A CG  1 
ATOM   364  O OD1 . ASN A 1 113 ? 72.409 60.287 94.233  1.00 29.65 ? 113 ASN A OD1 1 
ATOM   365  N ND2 . ASN A 1 113 ? 72.350 58.072 93.865  1.00 27.80 ? 113 ASN A ND2 1 
ATOM   366  N N   . LEU A 1 114 ? 67.411 59.946 92.835  1.00 22.80 ? 114 LEU A N   1 
ATOM   367  C CA  . LEU A 1 114 ? 66.201 60.013 92.023  1.00 22.07 ? 114 LEU A CA  1 
ATOM   368  C C   . LEU A 1 114 ? 65.497 61.356 92.208  1.00 23.01 ? 114 LEU A C   1 
ATOM   369  O O   . LEU A 1 114 ? 65.004 61.948 91.245  1.00 22.87 ? 114 LEU A O   1 
ATOM   370  C CB  . LEU A 1 114 ? 65.254 58.864 92.389  1.00 21.47 ? 114 LEU A CB  1 
ATOM   371  C CG  . LEU A 1 114 ? 65.719 57.470 91.952  1.00 19.83 ? 114 LEU A CG  1 
ATOM   372  C CD1 . LEU A 1 114 ? 64.845 56.407 92.594  1.00 20.34 ? 114 LEU A CD1 1 
ATOM   373  C CD2 . LEU A 1 114 ? 65.660 57.365 90.431  1.00 20.59 ? 114 LEU A CD2 1 
ATOM   374  N N   . LEU A 1 115 ? 65.455 61.834 93.447  1.00 23.15 ? 115 LEU A N   1 
ATOM   375  C CA  . LEU A 1 115 ? 64.820 63.113 93.742  1.00 24.46 ? 115 LEU A CA  1 
ATOM   376  C C   . LEU A 1 115 ? 65.585 64.248 93.069  1.00 25.26 ? 115 LEU A C   1 
ATOM   377  O O   . LEU A 1 115 ? 65.004 65.271 92.703  1.00 25.41 ? 115 LEU A O   1 
ATOM   378  C CB  . LEU A 1 115 ? 64.769 63.348 95.255  1.00 24.82 ? 115 LEU A CB  1 
ATOM   379  C CG  . LEU A 1 115 ? 63.793 62.482 96.054  1.00 25.32 ? 115 LEU A CG  1 
ATOM   380  C CD1 . LEU A 1 115 ? 63.977 62.748 97.541  1.00 26.76 ? 115 LEU A CD1 1 
ATOM   381  C CD2 . LEU A 1 115 ? 62.361 62.787 95.623  1.00 24.28 ? 115 LEU A CD2 1 
ATOM   382  N N   . ALA A 1 116 ? 66.890 64.062 92.906  1.00 26.52 ? 116 ALA A N   1 
ATOM   383  C CA  . ALA A 1 116 ? 67.728 65.073 92.270  1.00 28.15 ? 116 ALA A CA  1 
ATOM   384  C C   . ALA A 1 116 ? 67.399 65.184 90.782  1.00 28.84 ? 116 ALA A C   1 
ATOM   385  O O   . ALA A 1 116 ? 67.738 66.177 90.132  1.00 28.41 ? 116 ALA A O   1 
ATOM   386  C CB  . ALA A 1 116 ? 69.198 64.728 92.459  1.00 29.04 ? 116 ALA A CB  1 
ATOM   387  N N   . GLN A 1 117 ? 66.745 64.159 90.244  1.00 28.64 ? 117 GLN A N   1 
ATOM   388  C CA  . GLN A 1 117 ? 66.366 64.159 88.835  1.00 28.98 ? 117 GLN A CA  1 
ATOM   389  C C   . GLN A 1 117 ? 64.964 64.736 88.658  1.00 29.25 ? 117 GLN A C   1 
ATOM   390  O O   . GLN A 1 117 ? 64.390 64.688 87.572  1.00 29.73 ? 117 GLN A O   1 
ATOM   391  C CB  . GLN A 1 117 ? 66.429 62.741 88.261  1.00 29.08 ? 117 GLN A CB  1 
ATOM   392  C CG  . GLN A 1 117 ? 67.833 62.155 88.204  1.00 29.61 ? 117 GLN A CG  1 
ATOM   393  C CD  . GLN A 1 117 ? 68.810 63.054 87.463  1.00 30.12 ? 117 GLN A CD  1 
ATOM   394  O OE1 . GLN A 1 117 ? 68.494 63.587 86.401  1.00 30.50 ? 117 GLN A OE1 1 
ATOM   395  N NE2 . GLN A 1 117 ? 70.004 63.217 88.020  1.00 30.96 ? 117 GLN A NE2 1 
ATOM   396  N N   . ARG A 1 118 ? 64.421 65.277 89.745  1.00 30.35 ? 118 ARG A N   1 
ATOM   397  C CA  . ARG A 1 118 ? 63.098 65.894 89.749  1.00 31.03 ? 118 ARG A CA  1 
ATOM   398  C C   . ARG A 1 118 ? 61.921 64.965 89.458  1.00 29.91 ? 118 ARG A C   1 
ATOM   399  O O   . ARG A 1 118 ? 60.981 65.349 88.763  1.00 28.92 ? 118 ARG A O   1 
ATOM   400  C CB  . ARG A 1 118 ? 63.055 67.069 88.764  1.00 34.33 ? 118 ARG A CB  1 
ATOM   401  C CG  . ARG A 1 118 ? 64.087 68.157 89.022  1.00 38.53 ? 118 ARG A CG  1 
ATOM   402  C CD  . ARG A 1 118 ? 63.684 69.450 88.328  1.00 42.56 ? 118 ARG A CD  1 
ATOM   403  N NE  . ARG A 1 118 ? 63.326 69.230 86.928  1.00 45.80 ? 118 ARG A NE  1 
ATOM   404  C CZ  . ARG A 1 118 ? 62.754 70.144 86.150  1.00 47.69 ? 118 ARG A CZ  1 
ATOM   405  N NH1 . ARG A 1 118 ? 62.471 71.347 86.632  1.00 49.10 ? 118 ARG A NH1 1 
ATOM   406  N NH2 . ARG A 1 118 ? 62.460 69.853 84.889  1.00 48.20 ? 118 ARG A NH2 1 
ATOM   407  N N   . VAL A 1 119 ? 61.961 63.748 89.988  1.00 28.64 ? 119 VAL A N   1 
ATOM   408  C CA  . VAL A 1 119 ? 60.858 62.818 89.780  1.00 27.54 ? 119 VAL A CA  1 
ATOM   409  C C   . VAL A 1 119 ? 59.693 63.292 90.653  1.00 26.72 ? 119 VAL A C   1 
ATOM   410  O O   . VAL A 1 119 ? 59.914 63.880 91.714  1.00 27.09 ? 119 VAL A O   1 
ATOM   411  C CB  . VAL A 1 119 ? 61.252 61.380 90.180  1.00 26.11 ? 119 VAL A CB  1 
ATOM   412  C CG1 . VAL A 1 119 ? 62.425 60.911 89.334  1.00 26.02 ? 119 VAL A CG1 1 
ATOM   413  C CG2 . VAL A 1 119 ? 61.608 61.323 91.658  1.00 25.69 ? 119 VAL A CG2 1 
ATOM   414  N N   . SER A 1 120 ? 58.462 63.049 90.207  1.00 25.41 ? 120 SER A N   1 
ATOM   415  C CA  . SER A 1 120 ? 57.281 63.472 90.959  1.00 25.61 ? 120 SER A CA  1 
ATOM   416  C C   . SER A 1 120 ? 56.597 62.308 91.669  1.00 23.41 ? 120 SER A C   1 
ATOM   417  O O   . SER A 1 120 ? 55.523 62.464 92.255  1.00 23.38 ? 120 SER A O   1 
ATOM   418  C CB  . SER A 1 120 ? 56.281 64.167 90.029  1.00 27.41 ? 120 SER A CB  1 
ATOM   419  O OG  . SER A 1 120 ? 55.812 63.292 89.018  1.00 30.17 ? 120 SER A OG  1 
ATOM   420  N N   . GLY A 1 121 ? 57.229 61.142 91.611  1.00 21.14 ? 121 GLY A N   1 
ATOM   421  C CA  . GLY A 1 121 ? 56.683 59.961 92.253  1.00 19.72 ? 121 GLY A CA  1 
ATOM   422  C C   . GLY A 1 121 ? 57.757 58.898 92.327  1.00 18.86 ? 121 GLY A C   1 
ATOM   423  O O   . GLY A 1 121 ? 58.601 58.805 91.437  1.00 18.52 ? 121 GLY A O   1 
ATOM   424  N N   . LEU A 1 122 ? 57.730 58.095 93.386  1.00 16.45 ? 122 LEU A N   1 
ATOM   425  C CA  . LEU A 1 122 ? 58.725 57.049 93.567  1.00 16.45 ? 122 LEU A CA  1 
ATOM   426  C C   . LEU A 1 122 ? 58.138 55.669 93.829  1.00 16.14 ? 122 LEU A C   1 
ATOM   427  O O   . LEU A 1 122 ? 57.210 55.518 94.619  1.00 15.89 ? 122 LEU A O   1 
ATOM   428  C CB  . LEU A 1 122 ? 59.642 57.402 94.740  1.00 18.58 ? 122 LEU A CB  1 
ATOM   429  C CG  . LEU A 1 122 ? 60.516 58.647 94.608  1.00 21.14 ? 122 LEU A CG  1 
ATOM   430  C CD1 . LEU A 1 122 ? 61.030 59.061 95.980  1.00 23.11 ? 122 LEU A CD1 1 
ATOM   431  C CD2 . LEU A 1 122 ? 61.668 58.357 93.663  1.00 23.59 ? 122 LEU A CD2 1 
ATOM   432  N N   . ILE A 1 123 ? 58.681 54.665 93.148  1.00 13.71 ? 123 ILE A N   1 
ATOM   433  C CA  . ILE A 1 123 ? 58.268 53.287 93.379  1.00 13.48 ? 123 ILE A CA  1 
ATOM   434  C C   . ILE A 1 123 ? 59.504 52.611 93.970  1.00 15.22 ? 123 ILE A C   1 
ATOM   435  O O   . ILE A 1 123 ? 60.570 52.589 93.350  1.00 16.20 ? 123 ILE A O   1 
ATOM   436  C CB  . ILE A 1 123 ? 57.847 52.576 92.073  1.00 13.64 ? 123 ILE A CB  1 
ATOM   437  C CG1 . ILE A 1 123 ? 56.598 53.254 91.502  1.00 15.81 ? 123 ILE A CG1 1 
ATOM   438  C CG2 . ILE A 1 123 ? 57.562 51.108 92.356  1.00 15.06 ? 123 ILE A CG2 1 
ATOM   439  C CD1 . ILE A 1 123 ? 56.102 52.662 90.191  1.00 15.35 ? 123 ILE A CD1 1 
ATOM   440  N N   . ILE A 1 124 ? 59.369 52.094 95.187  1.00 13.66 ? 124 ILE A N   1 
ATOM   441  C CA  . ILE A 1 124 ? 60.478 51.438 95.871  1.00 14.60 ? 124 ILE A CA  1 
ATOM   442  C C   . ILE A 1 124 ? 60.328 49.922 95.757  1.00 14.41 ? 124 ILE A C   1 
ATOM   443  O O   . ILE A 1 124 ? 59.558 49.297 96.495  1.00 14.78 ? 124 ILE A O   1 
ATOM   444  C CB  . ILE A 1 124 ? 60.518 51.837 97.367  1.00 15.03 ? 124 ILE A CB  1 
ATOM   445  C CG1 . ILE A 1 124 ? 60.435 53.363 97.511  1.00 17.42 ? 124 ILE A CG1 1 
ATOM   446  C CG2 . ILE A 1 124 ? 61.801 51.323 98.008  1.00 16.15 ? 124 ILE A CG2 1 
ATOM   447  C CD1 . ILE A 1 124 ? 61.587 54.120 96.875  1.00 19.56 ? 124 ILE A CD1 1 
ATOM   448  N N   . ASN A 1 125 ? 61.069 49.342 94.818  1.00 13.94 ? 125 ASN A N   1 
ATOM   449  C CA  . ASN A 1 125 ? 61.040 47.905 94.562  1.00 14.82 ? 125 ASN A CA  1 
ATOM   450  C C   . ASN A 1 125 ? 62.295 47.282 95.174  1.00 16.00 ? 125 ASN A C   1 
ATOM   451  O O   . ASN A 1 125 ? 63.107 46.670 94.481  1.00 14.65 ? 125 ASN A O   1 
ATOM   452  C CB  . ASN A 1 125 ? 60.998 47.677 93.047  1.00 16.83 ? 125 ASN A CB  1 
ATOM   453  C CG  . ASN A 1 125 ? 60.805 46.225 92.679  1.00 19.61 ? 125 ASN A CG  1 
ATOM   454  O OD1 . ASN A 1 125 ? 59.949 45.543 93.241  1.00 21.22 ? 125 ASN A OD1 1 
ATOM   455  N ND2 . ASN A 1 125 ? 61.592 45.746 91.717  1.00 20.56 ? 125 ASN A ND2 1 
ATOM   456  N N   . TYR A 1 126 ? 62.429 47.435 96.489  1.00 16.14 ? 126 TYR A N   1 
ATOM   457  C CA  . TYR A 1 126 ? 63.589 46.950 97.228  1.00 16.45 ? 126 TYR A CA  1 
ATOM   458  C C   . TYR A 1 126 ? 63.110 46.449 98.597  1.00 16.25 ? 126 TYR A C   1 
ATOM   459  O O   . TYR A 1 126 ? 62.297 47.102 99.243  1.00 16.83 ? 126 TYR A O   1 
ATOM   460  C CB  . TYR A 1 126 ? 64.568 48.114 97.395  1.00 17.58 ? 126 TYR A CB  1 
ATOM   461  C CG  . TYR A 1 126 ? 65.885 47.750 98.029  1.00 19.05 ? 126 TYR A CG  1 
ATOM   462  C CD1 . TYR A 1 126 ? 66.892 47.133 97.289  1.00 20.55 ? 126 TYR A CD1 1 
ATOM   463  C CD2 . TYR A 1 126 ? 66.125 48.017 99.375  1.00 20.34 ? 126 TYR A CD2 1 
ATOM   464  C CE1 . TYR A 1 126 ? 68.108 46.790 97.876  1.00 21.33 ? 126 TYR A CE1 1 
ATOM   465  C CE2 . TYR A 1 126 ? 67.334 47.679 99.973  1.00 22.70 ? 126 TYR A CE2 1 
ATOM   466  C CZ  . TYR A 1 126 ? 68.321 47.066 99.219  1.00 23.49 ? 126 TYR A CZ  1 
ATOM   467  O OH  . TYR A 1 126 ? 69.516 46.730 99.811  1.00 25.63 ? 126 TYR A OH  1 
ATOM   468  N N   . PRO A 1 127 ? 63.615 45.291 99.059  1.00 15.94 ? 127 PRO A N   1 
ATOM   469  C CA  . PRO A 1 127 ? 63.194 44.741 100.356 1.00 15.66 ? 127 PRO A CA  1 
ATOM   470  C C   . PRO A 1 127 ? 63.596 45.578 101.567 1.00 15.27 ? 127 PRO A C   1 
ATOM   471  O O   . PRO A 1 127 ? 64.776 45.825 101.800 1.00 16.64 ? 127 PRO A O   1 
ATOM   472  C CB  . PRO A 1 127 ? 63.832 43.355 100.359 1.00 16.03 ? 127 PRO A CB  1 
ATOM   473  C CG  . PRO A 1 127 ? 65.109 43.587 99.615  1.00 17.39 ? 127 PRO A CG  1 
ATOM   474  C CD  . PRO A 1 127 ? 64.666 44.454 98.452  1.00 17.01 ? 127 PRO A CD  1 
ATOM   475  N N   . LEU A 1 128 ? 62.604 46.001 102.346 1.00 14.30 ? 128 LEU A N   1 
ATOM   476  C CA  . LEU A 1 128 ? 62.860 46.829 103.523 1.00 15.18 ? 128 LEU A CA  1 
ATOM   477  C C   . LEU A 1 128 ? 62.011 46.392 104.710 1.00 15.46 ? 128 LEU A C   1 
ATOM   478  O O   . LEU A 1 128 ? 60.821 46.132 104.552 1.00 15.74 ? 128 LEU A O   1 
ATOM   479  C CB  . LEU A 1 128 ? 62.539 48.291 103.204 1.00 14.42 ? 128 LEU A CB  1 
ATOM   480  C CG  . LEU A 1 128 ? 63.430 48.987 102.176 1.00 15.61 ? 128 LEU A CG  1 
ATOM   481  C CD1 . LEU A 1 128 ? 62.729 50.220 101.633 1.00 15.24 ? 128 LEU A CD1 1 
ATOM   482  C CD2 . LEU A 1 128 ? 64.763 49.352 102.826 1.00 16.07 ? 128 LEU A CD2 1 
ATOM   483  N N   . ASP A 1 129 ? 62.609 46.312 105.896 1.00 17.00 ? 129 ASP A N   1 
ATOM   484  C CA  . ASP A 1 129 ? 61.820 45.929 107.059 1.00 18.19 ? 129 ASP A CA  1 
ATOM   485  C C   . ASP A 1 129 ? 61.001 47.140 107.501 1.00 19.73 ? 129 ASP A C   1 
ATOM   486  O O   . ASP A 1 129 ? 61.105 48.211 106.902 1.00 19.19 ? 129 ASP A O   1 
ATOM   487  C CB  . ASP A 1 129 ? 62.703 45.384 108.199 1.00 19.65 ? 129 ASP A CB  1 
ATOM   488  C CG  . ASP A 1 129 ? 63.562 46.446 108.869 1.00 22.18 ? 129 ASP A CG  1 
ATOM   489  O OD1 . ASP A 1 129 ? 63.410 47.649 108.584 1.00 22.51 ? 129 ASP A OD1 1 
ATOM   490  O OD2 . ASP A 1 129 ? 64.398 46.056 109.715 1.00 23.39 ? 129 ASP A OD2 1 
ATOM   491  N N   . ASP A 1 130 ? 60.182 46.973 108.533 1.00 19.47 ? 130 ASP A N   1 
ATOM   492  C CA  . ASP A 1 130 ? 59.319 48.054 108.999 1.00 22.54 ? 130 ASP A CA  1 
ATOM   493  C C   . ASP A 1 130 ? 60.013 49.394 109.221 1.00 22.09 ? 130 ASP A C   1 
ATOM   494  O O   . ASP A 1 130 ? 59.670 50.390 108.580 1.00 22.12 ? 130 ASP A O   1 
ATOM   495  C CB  . ASP A 1 130 ? 58.593 47.624 110.278 1.00 24.19 ? 130 ASP A CB  1 
ATOM   496  C CG  . ASP A 1 130 ? 57.496 48.595 110.683 1.00 28.86 ? 130 ASP A CG  1 
ATOM   497  O OD1 . ASP A 1 130 ? 57.773 49.531 111.465 1.00 31.02 ? 130 ASP A OD1 1 
ATOM   498  O OD2 . ASP A 1 130 ? 56.353 48.427 110.209 1.00 31.27 ? 130 ASP A OD2 1 
ATOM   499  N N   . GLN A 1 131 ? 60.988 49.421 110.122 1.00 22.06 ? 131 GLN A N   1 
ATOM   500  C CA  . GLN A 1 131 ? 61.704 50.654 110.425 1.00 23.03 ? 131 GLN A CA  1 
ATOM   501  C C   . GLN A 1 131 ? 62.458 51.258 109.245 1.00 21.59 ? 131 GLN A C   1 
ATOM   502  O O   . GLN A 1 131 ? 62.456 52.477 109.067 1.00 20.89 ? 131 GLN A O   1 
ATOM   503  C CB  . GLN A 1 131 ? 62.657 50.427 111.600 1.00 26.50 ? 131 GLN A CB  1 
ATOM   504  C CG  . GLN A 1 131 ? 61.998 50.611 112.960 1.00 32.47 ? 131 GLN A CG  1 
ATOM   505  C CD  . GLN A 1 131 ? 60.668 49.891 113.078 1.00 35.19 ? 131 GLN A CD  1 
ATOM   506  O OE1 . GLN A 1 131 ? 60.609 48.661 113.064 1.00 38.90 ? 131 GLN A OE1 1 
ATOM   507  N NE2 . GLN A 1 131 ? 59.589 50.658 113.193 1.00 36.33 ? 131 GLN A NE2 1 
ATOM   508  N N   . ASP A 1 132 ? 63.096 50.417 108.437 1.00 21.04 ? 132 ASP A N   1 
ATOM   509  C CA  . ASP A 1 132 ? 63.837 50.920 107.286 1.00 20.21 ? 132 ASP A CA  1 
ATOM   510  C C   . ASP A 1 132 ? 62.911 51.498 106.218 1.00 19.56 ? 132 ASP A C   1 
ATOM   511  O O   . ASP A 1 132 ? 63.249 52.492 105.572 1.00 17.96 ? 132 ASP A O   1 
ATOM   512  C CB  . ASP A 1 132 ? 64.716 49.820 106.678 1.00 21.03 ? 132 ASP A CB  1 
ATOM   513  C CG  . ASP A 1 132 ? 65.884 49.441 107.575 1.00 23.10 ? 132 ASP A CG  1 
ATOM   514  O OD1 . ASP A 1 132 ? 66.243 50.248 108.462 1.00 24.04 ? 132 ASP A OD1 1 
ATOM   515  O OD2 . ASP A 1 132 ? 66.455 48.346 107.384 1.00 21.59 ? 132 ASP A OD2 1 
ATOM   516  N N   . ALA A 1 133 ? 61.746 50.882 106.026 1.00 18.16 ? 133 ALA A N   1 
ATOM   517  C CA  . ALA A 1 133 ? 60.800 51.381 105.030 1.00 18.11 ? 133 ALA A CA  1 
ATOM   518  C C   . ALA A 1 133 ? 60.295 52.754 105.466 1.00 18.54 ? 133 ALA A C   1 
ATOM   519  O O   . ALA A 1 133 ? 60.153 53.667 104.650 1.00 18.35 ? 133 ALA A O   1 
ATOM   520  C CB  . ALA A 1 133 ? 59.630 50.407 104.870 1.00 18.65 ? 133 ALA A CB  1 
ATOM   521  N N   . ILE A 1 134 ? 60.023 52.898 106.759 1.00 18.87 ? 134 ILE A N   1 
ATOM   522  C CA  . ILE A 1 134 ? 59.555 54.176 107.284 1.00 19.54 ? 134 ILE A CA  1 
ATOM   523  C C   . ILE A 1 134 ? 60.649 55.223 107.078 1.00 19.53 ? 134 ILE A C   1 
ATOM   524  O O   . ILE A 1 134 ? 60.369 56.369 106.724 1.00 20.91 ? 134 ILE A O   1 
ATOM   525  C CB  . ILE A 1 134 ? 59.206 54.062 108.783 1.00 20.21 ? 134 ILE A CB  1 
ATOM   526  C CG1 . ILE A 1 134 ? 57.933 53.223 108.947 1.00 20.66 ? 134 ILE A CG1 1 
ATOM   527  C CG2 . ILE A 1 134 ? 59.018 55.454 109.390 1.00 20.57 ? 134 ILE A CG2 1 
ATOM   528  C CD1 . ILE A 1 134 ? 57.586 52.897 110.391 1.00 24.43 ? 134 ILE A CD1 1 
ATOM   529  N N   . ALA A 1 135 ? 61.898 54.814 107.280 1.00 20.53 ? 135 ALA A N   1 
ATOM   530  C CA  . ALA A 1 135 ? 63.036 55.711 107.110 1.00 20.82 ? 135 ALA A CA  1 
ATOM   531  C C   . ALA A 1 135 ? 63.166 56.147 105.651 1.00 20.83 ? 135 ALA A C   1 
ATOM   532  O O   . ALA A 1 135 ? 63.426 57.317 105.360 1.00 20.25 ? 135 ALA A O   1 
ATOM   533  C CB  . ALA A 1 135 ? 64.313 55.024 107.572 1.00 20.06 ? 135 ALA A CB  1 
ATOM   534  N N   . VAL A 1 136 ? 62.992 55.206 104.729 1.00 19.17 ? 136 VAL A N   1 
ATOM   535  C CA  . VAL A 1 136 ? 63.081 55.536 103.311 1.00 18.84 ? 136 VAL A CA  1 
ATOM   536  C C   . VAL A 1 136 ? 61.947 56.480 102.917 1.00 19.16 ? 136 VAL A C   1 
ATOM   537  O O   . VAL A 1 136 ? 62.153 57.427 102.158 1.00 19.04 ? 136 VAL A O   1 
ATOM   538  C CB  . VAL A 1 136 ? 63.020 54.264 102.439 1.00 17.99 ? 136 VAL A CB  1 
ATOM   539  C CG1 . VAL A 1 136 ? 62.902 54.640 100.962 1.00 18.15 ? 136 VAL A CG1 1 
ATOM   540  C CG2 . VAL A 1 136 ? 64.273 53.432 102.665 1.00 17.83 ? 136 VAL A CG2 1 
ATOM   541  N N   . GLU A 1 137 ? 60.750 56.235 103.440 1.00 17.85 ? 137 GLU A N   1 
ATOM   542  C CA  . GLU A 1 137 ? 59.615 57.092 103.121 1.00 20.64 ? 137 GLU A CA  1 
ATOM   543  C C   . GLU A 1 137 ? 59.899 58.525 103.570 1.00 21.01 ? 137 GLU A C   1 
ATOM   544  O O   . GLU A 1 137 ? 59.565 59.484 102.873 1.00 21.24 ? 137 GLU A O   1 
ATOM   545  C CB  . GLU A 1 137 ? 58.345 56.585 103.808 1.00 22.05 ? 137 GLU A CB  1 
ATOM   546  C CG  . GLU A 1 137 ? 57.105 57.400 103.473 1.00 26.58 ? 137 GLU A CG  1 
ATOM   547  C CD  . GLU A 1 137 ? 55.913 57.040 104.339 1.00 30.77 ? 137 GLU A CD  1 
ATOM   548  O OE1 . GLU A 1 137 ? 56.022 57.156 105.577 1.00 33.03 ? 137 GLU A OE1 1 
ATOM   549  O OE2 . GLU A 1 137 ? 54.867 56.644 103.782 1.00 34.37 ? 137 GLU A OE2 1 
ATOM   550  N N   . ALA A 1 138 ? 60.518 58.665 104.737 1.00 21.98 ? 138 ALA A N   1 
ATOM   551  C CA  . ALA A 1 138 ? 60.836 59.987 105.263 1.00 23.94 ? 138 ALA A CA  1 
ATOM   552  C C   . ALA A 1 138 ? 61.815 60.705 104.336 1.00 24.85 ? 138 ALA A C   1 
ATOM   553  O O   . ALA A 1 138 ? 61.758 61.923 104.178 1.00 27.10 ? 138 ALA A O   1 
ATOM   554  C CB  . ALA A 1 138 ? 61.431 59.862 106.667 1.00 22.52 ? 138 ALA A CB  1 
ATOM   555  N N   . ALA A 1 139 ? 62.704 59.939 103.716 1.00 25.61 ? 139 ALA A N   1 
ATOM   556  C CA  . ALA A 1 139 ? 63.705 60.503 102.817 1.00 27.79 ? 139 ALA A CA  1 
ATOM   557  C C   . ALA A 1 139 ? 63.147 60.938 101.463 1.00 29.23 ? 139 ALA A C   1 
ATOM   558  O O   . ALA A 1 139 ? 63.829 61.620 100.701 1.00 29.22 ? 139 ALA A O   1 
ATOM   559  C CB  . ALA A 1 139 ? 64.831 59.499 102.612 1.00 27.78 ? 139 ALA A CB  1 
ATOM   560  N N   . CYS A 1 140 ? 61.912 60.556 101.162 1.00 30.14 ? 140 CYS A N   1 
ATOM   561  C CA  . CYS A 1 140 ? 61.313 60.913 99.879  1.00 31.85 ? 140 CYS A CA  1 
ATOM   562  C C   . CYS A 1 140 ? 60.853 62.370 99.789  1.00 34.20 ? 140 CYS A C   1 
ATOM   563  O O   . CYS A 1 140 ? 60.377 62.817 98.745  1.00 34.11 ? 140 CYS A O   1 
ATOM   564  C CB  . CYS A 1 140 ? 60.156 59.964 99.570  1.00 31.32 ? 140 CYS A CB  1 
ATOM   565  S SG  . CYS A 1 140 ? 60.692 58.254 99.327  1.00 29.59 ? 140 CYS A SG  1 
ATOM   566  N N   . THR A 1 141 ? 61.004 63.106 100.885 1.00 36.51 ? 141 THR A N   1 
ATOM   567  C CA  . THR A 1 141 ? 60.633 64.519 100.935 1.00 38.16 ? 141 THR A CA  1 
ATOM   568  C C   . THR A 1 141 ? 59.244 64.846 100.380 1.00 39.02 ? 141 THR A C   1 
ATOM   569  O O   . THR A 1 141 ? 59.115 65.577 99.397  1.00 39.19 ? 141 THR A O   1 
ATOM   570  C CB  . THR A 1 141 ? 61.668 65.385 100.182 1.00 39.06 ? 141 THR A CB  1 
ATOM   571  O OG1 . THR A 1 141 ? 61.586 65.122 98.776  1.00 41.17 ? 141 THR A OG1 1 
ATOM   572  C CG2 . THR A 1 141 ? 63.075 65.066 100.662 1.00 38.54 ? 141 THR A CG2 1 
ATOM   573  N N   . ASN A 1 142 ? 58.210 64.305 101.016 1.00 38.93 ? 142 ASN A N   1 
ATOM   574  C CA  . ASN A 1 142 ? 56.827 64.551 100.611 1.00 38.90 ? 142 ASN A CA  1 
ATOM   575  C C   . ASN A 1 142 ? 56.433 64.076 99.212  1.00 37.18 ? 142 ASN A C   1 
ATOM   576  O O   . ASN A 1 142 ? 55.258 64.131 98.847  1.00 37.80 ? 142 ASN A O   1 
ATOM   577  C CB  . ASN A 1 142 ? 56.499 66.039 100.760 1.00 41.29 ? 142 ASN A CB  1 
ATOM   578  C CG  . ASN A 1 142 ? 56.447 66.480 102.211 1.00 44.07 ? 142 ASN A CG  1 
ATOM   579  O OD1 . ASN A 1 142 ? 56.252 67.659 102.509 1.00 46.12 ? 142 ASN A OD1 1 
ATOM   580  N ND2 . ASN A 1 142 ? 56.616 65.529 103.125 1.00 43.95 ? 142 ASN A ND2 1 
ATOM   581  N N   . VAL A 1 143 ? 57.403 63.628 98.421  1.00 33.64 ? 143 VAL A N   1 
ATOM   582  C CA  . VAL A 1 143 ? 57.097 63.119 97.088  1.00 30.30 ? 143 VAL A CA  1 
ATOM   583  C C   . VAL A 1 143 ? 56.413 61.772 97.324  1.00 26.79 ? 143 VAL A C   1 
ATOM   584  O O   . VAL A 1 143 ? 56.903 60.961 98.102  1.00 27.20 ? 143 VAL A O   1 
ATOM   585  C CB  . VAL A 1 143 ? 58.384 62.893 96.261  1.00 29.96 ? 143 VAL A CB  1 
ATOM   586  C CG1 . VAL A 1 143 ? 58.048 62.204 94.951  1.00 30.24 ? 143 VAL A CG1 1 
ATOM   587  C CG2 . VAL A 1 143 ? 59.074 64.223 95.997  1.00 31.07 ? 143 VAL A CG2 1 
ATOM   588  N N   . PRO A 1 144 ? 55.273 61.516 96.662  1.00 25.06 ? 144 PRO A N   1 
ATOM   589  C CA  . PRO A 1 144 ? 54.604 60.229 96.881  1.00 24.09 ? 144 PRO A CA  1 
ATOM   590  C C   . PRO A 1 144 ? 55.522 59.033 96.647  1.00 21.50 ? 144 PRO A C   1 
ATOM   591  O O   . PRO A 1 144 ? 56.260 58.990 95.663  1.00 20.91 ? 144 PRO A O   1 
ATOM   592  C CB  . PRO A 1 144 ? 53.425 60.279 95.907  1.00 25.45 ? 144 PRO A CB  1 
ATOM   593  C CG  . PRO A 1 144 ? 53.912 61.193 94.822  1.00 27.73 ? 144 PRO A CG  1 
ATOM   594  C CD  . PRO A 1 144 ? 54.604 62.280 95.596  1.00 25.69 ? 144 PRO A CD  1 
ATOM   595  N N   . ALA A 1 145 ? 55.479 58.072 97.566  1.00 20.46 ? 145 ALA A N   1 
ATOM   596  C CA  . ALA A 1 145 ? 56.308 56.876 97.469  1.00 18.55 ? 145 ALA A CA  1 
ATOM   597  C C   . ALA A 1 145 ? 55.476 55.617 97.682  1.00 18.73 ? 145 ALA A C   1 
ATOM   598  O O   . ALA A 1 145 ? 54.695 55.527 98.631  1.00 18.66 ? 145 ALA A O   1 
ATOM   599  C CB  . ALA A 1 145 ? 57.431 56.935 98.496  1.00 20.31 ? 145 ALA A CB  1 
ATOM   600  N N   . LEU A 1 146 ? 55.665 54.641 96.801  1.00 16.71 ? 146 LEU A N   1 
ATOM   601  C CA  . LEU A 1 146 ? 54.935 53.382 96.869  1.00 15.06 ? 146 LEU A CA  1 
ATOM   602  C C   . LEU A 1 146 ? 55.935 52.233 96.988  1.00 14.50 ? 146 LEU A C   1 
ATOM   603  O O   . LEU A 1 146 ? 56.843 52.110 96.169  1.00 15.09 ? 146 LEU A O   1 
ATOM   604  C CB  . LEU A 1 146 ? 54.086 53.225 95.606  1.00 15.35 ? 146 LEU A CB  1 
ATOM   605  C CG  . LEU A 1 146 ? 53.170 52.011 95.482  1.00 15.22 ? 146 LEU A CG  1 
ATOM   606  C CD1 . LEU A 1 146 ? 52.071 52.071 96.549  1.00 15.53 ? 146 LEU A CD1 1 
ATOM   607  C CD2 . LEU A 1 146 ? 52.553 52.003 94.095  1.00 16.81 ? 146 LEU A CD2 1 
ATOM   608  N N   . PHE A 1 147 ? 55.765 51.397 98.010  1.00 13.60 ? 147 PHE A N   1 
ATOM   609  C CA  . PHE A 1 147 ? 56.673 50.274 98.252  1.00 13.71 ? 147 PHE A CA  1 
ATOM   610  C C   . PHE A 1 147 ? 56.110 48.943 97.764  1.00 14.00 ? 147 PHE A C   1 
ATOM   611  O O   . PHE A 1 147 ? 54.943 48.630 98.003  1.00 13.70 ? 147 PHE A O   1 
ATOM   612  C CB  . PHE A 1 147 ? 56.990 50.173 99.750  1.00 13.72 ? 147 PHE A CB  1 
ATOM   613  C CG  . PHE A 1 147 ? 57.709 51.375 100.305 1.00 14.04 ? 147 PHE A CG  1 
ATOM   614  C CD1 . PHE A 1 147 ? 57.039 52.583 100.493 1.00 14.08 ? 147 PHE A CD1 1 
ATOM   615  C CD2 . PHE A 1 147 ? 59.055 51.298 100.639 1.00 13.67 ? 147 PHE A CD2 1 
ATOM   616  C CE1 . PHE A 1 147 ? 57.705 53.699 101.012 1.00 14.59 ? 147 PHE A CE1 1 
ATOM   617  C CE2 . PHE A 1 147 ? 59.734 52.407 101.157 1.00 14.76 ? 147 PHE A CE2 1 
ATOM   618  C CZ  . PHE A 1 147 ? 59.054 53.611 101.344 1.00 14.31 ? 147 PHE A CZ  1 
ATOM   619  N N   . LEU A 1 148 ? 56.951 48.153 97.100  1.00 12.95 ? 148 LEU A N   1 
ATOM   620  C CA  . LEU A 1 148 ? 56.522 46.862 96.568  1.00 12.66 ? 148 LEU A CA  1 
ATOM   621  C C   . LEU A 1 148 ? 57.167 45.642 97.230  1.00 13.60 ? 148 LEU A C   1 
ATOM   622  O O   . LEU A 1 148 ? 56.843 44.504 96.883  1.00 14.99 ? 148 LEU A O   1 
ATOM   623  C CB  . LEU A 1 148 ? 56.790 46.814 95.059  1.00 13.11 ? 148 LEU A CB  1 
ATOM   624  C CG  . LEU A 1 148 ? 56.246 47.981 94.229  1.00 13.27 ? 148 LEU A CG  1 
ATOM   625  C CD1 . LEU A 1 148 ? 56.534 47.737 92.743  1.00 14.38 ? 148 LEU A CD1 1 
ATOM   626  C CD2 . LEU A 1 148 ? 54.745 48.130 94.470  1.00 14.26 ? 148 LEU A CD2 1 
ATOM   627  N N   . ASP A 1 149 ? 58.074 45.862 98.178  1.00 14.05 ? 149 ASP A N   1 
ATOM   628  C CA  . ASP A 1 149 ? 58.741 44.743 98.847  1.00 15.62 ? 149 ASP A CA  1 
ATOM   629  C C   . ASP A 1 149 ? 58.891 45.039 100.332 1.00 16.15 ? 149 ASP A C   1 
ATOM   630  O O   . ASP A 1 149 ? 59.988 45.317 100.823 1.00 15.65 ? 149 ASP A O   1 
ATOM   631  C CB  . ASP A 1 149 ? 60.120 44.499 98.230  1.00 16.70 ? 149 ASP A CB  1 
ATOM   632  C CG  . ASP A 1 149 ? 60.671 43.118 98.550  1.00 19.50 ? 149 ASP A CG  1 
ATOM   633  O OD1 . ASP A 1 149 ? 60.106 42.426 99.428  1.00 20.42 ? 149 ASP A OD1 1 
ATOM   634  O OD2 . ASP A 1 149 ? 61.676 42.726 97.921  1.00 21.11 ? 149 ASP A OD2 1 
ATOM   635  N N   . VAL A 1 150 ? 57.769 44.974 101.035 1.00 14.88 ? 150 VAL A N   1 
ATOM   636  C CA  . VAL A 1 150 ? 57.719 45.247 102.466 1.00 14.80 ? 150 VAL A CA  1 
ATOM   637  C C   . VAL A 1 150 ? 56.655 44.356 103.094 1.00 15.62 ? 150 VAL A C   1 
ATOM   638  O O   . VAL A 1 150 ? 56.004 43.568 102.405 1.00 16.60 ? 150 VAL A O   1 
ATOM   639  C CB  . VAL A 1 150 ? 57.309 46.715 102.731 1.00 14.48 ? 150 VAL A CB  1 
ATOM   640  C CG1 . VAL A 1 150 ? 58.397 47.658 102.269 1.00 15.15 ? 150 VAL A CG1 1 
ATOM   641  C CG2 . VAL A 1 150 ? 55.997 47.032 101.998 1.00 15.38 ? 150 VAL A CG2 1 
ATOM   642  N N   . SER A 1 151 ? 56.494 44.477 104.406 1.00 16.18 ? 151 SER A N   1 
ATOM   643  C CA  . SER A 1 151 ? 55.462 43.732 105.110 1.00 16.86 ? 151 SER A CA  1 
ATOM   644  C C   . SER A 1 151 ? 54.200 44.558 104.916 1.00 17.49 ? 151 SER A C   1 
ATOM   645  O O   . SER A 1 151 ? 54.277 45.777 104.784 1.00 17.18 ? 151 SER A O   1 
ATOM   646  C CB  . SER A 1 151 ? 55.778 43.653 106.603 1.00 17.95 ? 151 SER A CB  1 
ATOM   647  O OG  . SER A 1 151 ? 54.628 43.263 107.331 1.00 21.33 ? 151 SER A OG  1 
ATOM   648  N N   . ASP A 1 152 ? 53.040 43.912 104.901 1.00 19.04 ? 152 ASP A N   1 
ATOM   649  C CA  . ASP A 1 152 ? 51.799 44.653 104.725 1.00 20.49 ? 152 ASP A CA  1 
ATOM   650  C C   . ASP A 1 152 ? 51.373 45.347 106.018 1.00 21.93 ? 152 ASP A C   1 
ATOM   651  O O   . ASP A 1 152 ? 50.355 46.038 106.056 1.00 23.06 ? 152 ASP A O   1 
ATOM   652  C CB  . ASP A 1 152 ? 50.690 43.725 104.214 1.00 21.05 ? 152 ASP A CB  1 
ATOM   653  C CG  . ASP A 1 152 ? 50.549 42.460 105.040 1.00 24.04 ? 152 ASP A CG  1 
ATOM   654  O OD1 . ASP A 1 152 ? 51.565 41.764 105.252 1.00 24.69 ? 152 ASP A OD1 1 
ATOM   655  O OD2 . ASP A 1 152 ? 49.413 42.154 105.464 1.00 25.11 ? 152 ASP A OD2 1 
ATOM   656  N N   . GLN A 1 153 ? 52.168 45.171 107.070 1.00 21.13 ? 153 GLN A N   1 
ATOM   657  C CA  . GLN A 1 153 ? 51.874 45.785 108.360 1.00 23.39 ? 153 GLN A CA  1 
ATOM   658  C C   . GLN A 1 153 ? 52.551 47.145 108.513 1.00 22.89 ? 153 GLN A C   1 
ATOM   659  O O   . GLN A 1 153 ? 52.178 47.934 109.379 1.00 23.09 ? 153 GLN A O   1 
ATOM   660  C CB  . GLN A 1 153 ? 52.319 44.864 109.499 1.00 25.62 ? 153 GLN A CB  1 
ATOM   661  C CG  . GLN A 1 153 ? 51.559 43.548 109.570 1.00 30.21 ? 153 GLN A CG  1 
ATOM   662  C CD  . GLN A 1 153 ? 50.064 43.751 109.727 1.00 33.16 ? 153 GLN A CD  1 
ATOM   663  O OE1 . GLN A 1 153 ? 49.616 44.474 110.617 1.00 35.53 ? 153 GLN A OE1 1 
ATOM   664  N NE2 . GLN A 1 153 ? 49.285 43.108 108.865 1.00 35.62 ? 153 GLN A NE2 1 
ATOM   665  N N   . THR A 1 154 ? 53.546 47.419 107.675 1.00 21.36 ? 154 THR A N   1 
ATOM   666  C CA  . THR A 1 154 ? 54.256 48.692 107.747 1.00 20.38 ? 154 THR A CA  1 
ATOM   667  C C   . THR A 1 154 ? 53.343 49.821 107.269 1.00 20.56 ? 154 THR A C   1 
ATOM   668  O O   . THR A 1 154 ? 52.755 49.742 106.191 1.00 19.57 ? 154 THR A O   1 
ATOM   669  C CB  . THR A 1 154 ? 55.535 48.652 106.895 1.00 20.84 ? 154 THR A CB  1 
ATOM   670  O OG1 . THR A 1 154 ? 56.302 47.497 107.259 1.00 22.83 ? 154 THR A OG1 1 
ATOM   671  C CG2 . THR A 1 154 ? 56.376 49.903 107.131 1.00 19.90 ? 154 THR A CG2 1 
ATOM   672  N N   . PRO A 1 155 ? 53.217 50.890 108.075 1.00 20.56 ? 155 PRO A N   1 
ATOM   673  C CA  . PRO A 1 155 ? 52.380 52.059 107.787 1.00 20.41 ? 155 PRO A CA  1 
ATOM   674  C C   . PRO A 1 155 ? 52.852 53.002 106.686 1.00 21.63 ? 155 PRO A C   1 
ATOM   675  O O   . PRO A 1 155 ? 53.105 54.184 106.933 1.00 21.91 ? 155 PRO A O   1 
ATOM   676  C CB  . PRO A 1 155 ? 52.299 52.754 109.141 1.00 21.28 ? 155 PRO A CB  1 
ATOM   677  C CG  . PRO A 1 155 ? 53.664 52.515 109.690 1.00 21.45 ? 155 PRO A CG  1 
ATOM   678  C CD  . PRO A 1 155 ? 53.890 51.045 109.378 1.00 21.37 ? 155 PRO A CD  1 
ATOM   679  N N   . ILE A 1 156 ? 52.970 52.472 105.473 1.00 19.13 ? 156 ILE A N   1 
ATOM   680  C CA  . ILE A 1 156 ? 53.373 53.257 104.312 1.00 19.03 ? 156 ILE A CA  1 
ATOM   681  C C   . ILE A 1 156 ? 52.496 52.804 103.151 1.00 17.12 ? 156 ILE A C   1 
ATOM   682  O O   . ILE A 1 156 ? 51.706 51.875 103.307 1.00 17.23 ? 156 ILE A O   1 
ATOM   683  C CB  . ILE A 1 156 ? 54.874 53.034 103.962 1.00 19.60 ? 156 ILE A CB  1 
ATOM   684  C CG1 . ILE A 1 156 ? 55.215 51.538 103.943 1.00 23.47 ? 156 ILE A CG1 1 
ATOM   685  C CG2 . ILE A 1 156 ? 55.751 53.730 104.993 1.00 20.44 ? 156 ILE A CG2 1 
ATOM   686  C CD1 . ILE A 1 156 ? 54.628 50.764 102.793 1.00 26.38 ? 156 ILE A CD1 1 
ATOM   687  N N   . ASN A 1 157 ? 52.614 53.459 102.000 1.00 16.53 ? 157 ASN A N   1 
ATOM   688  C CA  . ASN A 1 157 ? 51.824 53.064 100.836 1.00 16.30 ? 157 ASN A CA  1 
ATOM   689  C C   . ASN A 1 157 ? 52.528 51.877 100.204 1.00 15.59 ? 157 ASN A C   1 
ATOM   690  O O   . ASN A 1 157 ? 53.726 51.940 99.928  1.00 14.43 ? 157 ASN A O   1 
ATOM   691  C CB  . ASN A 1 157 ? 51.734 54.210 99.826  1.00 18.98 ? 157 ASN A CB  1 
ATOM   692  C CG  . ASN A 1 157 ? 50.994 55.409 100.378 1.00 23.47 ? 157 ASN A CG  1 
ATOM   693  O OD1 . ASN A 1 157 ? 49.954 55.265 101.017 1.00 27.52 ? 157 ASN A OD1 1 
ATOM   694  N ND2 . ASN A 1 157 ? 51.520 56.601 100.124 1.00 23.35 ? 157 ASN A ND2 1 
ATOM   695  N N   . SER A 1 158 ? 51.794 50.794 99.971  1.00 15.70 ? 158 SER A N   1 
ATOM   696  C CA  . SER A 1 158 ? 52.412 49.608 99.402  1.00 15.19 ? 158 SER A CA  1 
ATOM   697  C C   . SER A 1 158 ? 51.449 48.672 98.693  1.00 15.06 ? 158 SER A C   1 
ATOM   698  O O   . SER A 1 158 ? 50.234 48.759 98.848  1.00 14.09 ? 158 SER A O   1 
ATOM   699  C CB  . SER A 1 158 ? 53.111 48.817 100.511 1.00 14.46 ? 158 SER A CB  1 
ATOM   700  O OG  . SER A 1 158 ? 52.162 48.366 101.472 1.00 15.85 ? 158 SER A OG  1 
ATOM   701  N N   . ILE A 1 159 ? 52.027 47.785 97.893  1.00 13.97 ? 159 ILE A N   1 
ATOM   702  C CA  . ILE A 1 159 ? 51.276 46.757 97.192  1.00 13.73 ? 159 ILE A CA  1 
ATOM   703  C C   . ILE A 1 159 ? 52.177 45.540 97.240  1.00 14.16 ? 159 ILE A C   1 
ATOM   704  O O   . ILE A 1 159 ? 53.301 45.579 96.733  1.00 13.89 ? 159 ILE A O   1 
ATOM   705  C CB  . ILE A 1 159 ? 51.028 47.081 95.704  1.00 12.93 ? 159 ILE A CB  1 
ATOM   706  C CG1 . ILE A 1 159 ? 50.354 48.446 95.558  1.00 14.56 ? 159 ILE A CG1 1 
ATOM   707  C CG2 . ILE A 1 159 ? 50.152 45.982 95.094  1.00 12.37 ? 159 ILE A CG2 1 
ATOM   708  C CD1 . ILE A 1 159 ? 50.194 48.895 94.108  1.00 15.57 ? 159 ILE A CD1 1 
ATOM   709  N N   . ILE A 1 160 ? 51.715 44.470 97.876  1.00 13.03 ? 160 ILE A N   1 
ATOM   710  C CA  . ILE A 1 160 ? 52.514 43.257 97.929  1.00 13.03 ? 160 ILE A CA  1 
ATOM   711  C C   . ILE A 1 160 ? 51.608 42.056 97.730  1.00 13.35 ? 160 ILE A C   1 
ATOM   712  O O   . ILE A 1 160 ? 50.384 42.169 97.811  1.00 14.53 ? 160 ILE A O   1 
ATOM   713  C CB  . ILE A 1 160 ? 53.269 43.091 99.276  1.00 15.28 ? 160 ILE A CB  1 
ATOM   714  C CG1 . ILE A 1 160 ? 52.281 42.811 100.409 1.00 15.11 ? 160 ILE A CG1 1 
ATOM   715  C CG2 . ILE A 1 160 ? 54.105 44.336 99.565  1.00 14.95 ? 160 ILE A CG2 1 
ATOM   716  C CD1 . ILE A 1 160 ? 52.961 42.419 101.710 1.00 19.71 ? 160 ILE A CD1 1 
ATOM   717  N N   . PHE A 1 161 ? 52.214 40.912 97.444  1.00 14.44 ? 161 PHE A N   1 
ATOM   718  C CA  . PHE A 1 161 ? 51.459 39.682 97.258  1.00 13.41 ? 161 PHE A CA  1 
ATOM   719  C C   . PHE A 1 161 ? 51.145 39.088 98.625  1.00 14.20 ? 161 PHE A C   1 
ATOM   720  O O   . PHE A 1 161 ? 51.878 39.308 99.591  1.00 14.39 ? 161 PHE A O   1 
ATOM   721  C CB  . PHE A 1 161 ? 52.273 38.689 96.434  1.00 13.85 ? 161 PHE A CB  1 
ATOM   722  C CG  . PHE A 1 161 ? 52.405 39.074 94.995  1.00 16.65 ? 161 PHE A CG  1 
ATOM   723  C CD1 . PHE A 1 161 ? 51.298 39.038 94.154  1.00 16.85 ? 161 PHE A CD1 1 
ATOM   724  C CD2 . PHE A 1 161 ? 53.628 39.492 94.482  1.00 17.62 ? 161 PHE A CD2 1 
ATOM   725  C CE1 . PHE A 1 161 ? 51.405 39.415 92.811  1.00 18.30 ? 161 PHE A CE1 1 
ATOM   726  C CE2 . PHE A 1 161 ? 53.747 39.870 93.143  1.00 19.64 ? 161 PHE A CE2 1 
ATOM   727  C CZ  . PHE A 1 161 ? 52.630 39.831 92.309  1.00 17.78 ? 161 PHE A CZ  1 
ATOM   728  N N   . SER A 1 162 ? 50.053 38.340 98.708  1.00 14.46 ? 162 SER A N   1 
ATOM   729  C CA  . SER A 1 162 ? 49.669 37.722 99.970  1.00 14.92 ? 162 SER A CA  1 
ATOM   730  C C   . SER A 1 162 ? 50.581 36.551 100.336 1.00 15.16 ? 162 SER A C   1 
ATOM   731  O O   . SER A 1 162 ? 50.442 35.451 99.799  1.00 16.39 ? 162 SER A O   1 
ATOM   732  C CB  . SER A 1 162 ? 48.223 37.233 99.904  1.00 16.18 ? 162 SER A CB  1 
ATOM   733  O OG  . SER A 1 162 ? 47.866 36.584 101.116 1.00 17.78 ? 162 SER A OG  1 
ATOM   734  N N   . HIS A 1 163 ? 51.516 36.793 101.247 1.00 13.94 ? 163 HIS A N   1 
ATOM   735  C CA  . HIS A 1 163 ? 52.424 35.746 101.698 1.00 14.12 ? 163 HIS A CA  1 
ATOM   736  C C   . HIS A 1 163 ? 51.672 34.707 102.531 1.00 15.15 ? 163 HIS A C   1 
ATOM   737  O O   . HIS A 1 163 ? 52.025 33.532 102.529 1.00 13.89 ? 163 HIS A O   1 
ATOM   738  C CB  . HIS A 1 163 ? 53.566 36.359 102.513 1.00 16.47 ? 163 HIS A CB  1 
ATOM   739  C CG  . HIS A 1 163 ? 53.111 37.348 103.538 1.00 17.67 ? 163 HIS A CG  1 
ATOM   740  N ND1 . HIS A 1 163 ? 52.779 36.988 104.827 1.00 20.01 ? 163 HIS A ND1 1 
ATOM   741  C CD2 . HIS A 1 163 ? 52.899 38.683 103.453 1.00 18.63 ? 163 HIS A CD2 1 
ATOM   742  C CE1 . HIS A 1 163 ? 52.382 38.059 105.491 1.00 19.06 ? 163 HIS A CE1 1 
ATOM   743  N NE2 . HIS A 1 163 ? 52.445 39.101 104.680 1.00 20.38 ? 163 HIS A NE2 1 
ATOM   744  N N   . GLU A 1 164 ? 50.635 35.141 103.242 1.00 15.28 ? 164 GLU A N   1 
ATOM   745  C CA  . GLU A 1 164 ? 49.843 34.214 104.052 1.00 16.38 ? 164 GLU A CA  1 
ATOM   746  C C   . GLU A 1 164 ? 49.202 33.164 103.147 1.00 15.89 ? 164 GLU A C   1 
ATOM   747  O O   . GLU A 1 164 ? 49.208 31.970 103.454 1.00 15.86 ? 164 GLU A O   1 
ATOM   748  C CB  . GLU A 1 164 ? 48.739 34.965 104.805 1.00 17.54 ? 164 GLU A CB  1 
ATOM   749  C CG  . GLU A 1 164 ? 49.242 35.944 105.855 1.00 19.18 ? 164 GLU A CG  1 
ATOM   750  C CD  . GLU A 1 164 ? 49.716 35.259 107.123 1.00 22.34 ? 164 GLU A CD  1 
ATOM   751  O OE1 . GLU A 1 164 ? 50.273 35.953 107.996 1.00 23.61 ? 164 GLU A OE1 1 
ATOM   752  O OE2 . GLU A 1 164 ? 49.525 34.032 107.253 1.00 23.06 ? 164 GLU A OE2 1 
ATOM   753  N N   . ASP A 1 165 ? 48.652 33.615 102.024 1.00 15.17 ? 165 ASP A N   1 
ATOM   754  C CA  . ASP A 1 165 ? 47.998 32.706 101.095 1.00 16.10 ? 165 ASP A CA  1 
ATOM   755  C C   . ASP A 1 165 ? 48.993 31.823 100.349 1.00 14.84 ? 165 ASP A C   1 
ATOM   756  O O   . ASP A 1 165 ? 48.756 30.634 100.177 1.00 14.39 ? 165 ASP A O   1 
ATOM   757  C CB  . ASP A 1 165 ? 47.143 33.499 100.102 1.00 18.83 ? 165 ASP A CB  1 
ATOM   758  C CG  . ASP A 1 165 ? 45.903 34.096 100.750 1.00 24.41 ? 165 ASP A CG  1 
ATOM   759  O OD1 . ASP A 1 165 ? 45.368 35.094 100.227 1.00 27.81 ? 165 ASP A OD1 1 
ATOM   760  O OD2 . ASP A 1 165 ? 45.453 33.552 101.779 1.00 28.60 ? 165 ASP A OD2 1 
ATOM   761  N N   . GLY A 1 166 ? 50.108 32.407 99.916  1.00 13.58 ? 166 GLY A N   1 
ATOM   762  C CA  . GLY A 1 166 ? 51.102 31.635 99.190  1.00 13.47 ? 166 GLY A CA  1 
ATOM   763  C C   . GLY A 1 166 ? 51.718 30.513 100.003 1.00 13.91 ? 166 GLY A C   1 
ATOM   764  O O   . GLY A 1 166 ? 51.913 29.408 99.498  1.00 13.66 ? 166 GLY A O   1 
ATOM   765  N N   . THR A 1 167 ? 52.024 30.785 101.270 1.00 12.52 ? 167 THR A N   1 
ATOM   766  C CA  . THR A 1 167 ? 52.618 29.770 102.122 1.00 12.67 ? 167 THR A CA  1 
ATOM   767  C C   . THR A 1 167 ? 51.580 28.733 102.546 1.00 13.59 ? 167 THR A C   1 
ATOM   768  O O   . THR A 1 167 ? 51.881 27.545 102.616 1.00 12.57 ? 167 THR A O   1 
ATOM   769  C CB  . THR A 1 167 ? 53.290 30.411 103.364 1.00 12.44 ? 167 THR A CB  1 
ATOM   770  O OG1 . THR A 1 167 ? 52.335 31.204 104.084 1.00 14.00 ? 167 THR A OG1 1 
ATOM   771  C CG2 . THR A 1 167 ? 54.452 31.302 102.929 1.00 13.25 ? 167 THR A CG2 1 
ATOM   772  N N   . ARG A 1 168 ? 50.356 29.177 102.812 1.00 13.10 ? 168 ARG A N   1 
ATOM   773  C CA  . ARG A 1 168 ? 49.300 28.250 103.202 1.00 13.57 ? 168 ARG A CA  1 
ATOM   774  C C   . ARG A 1 168 ? 49.015 27.289 102.048 1.00 14.72 ? 168 ARG A C   1 
ATOM   775  O O   . ARG A 1 168 ? 48.883 26.086 102.250 1.00 14.04 ? 168 ARG A O   1 
ATOM   776  C CB  . ARG A 1 168 ? 48.022 29.007 103.564 1.00 14.65 ? 168 ARG A CB  1 
ATOM   777  C CG  . ARG A 1 168 ? 46.826 28.096 103.849 1.00 16.32 ? 168 ARG A CG  1 
ATOM   778  C CD  . ARG A 1 168 ? 45.573 28.919 104.099 1.00 21.71 ? 168 ARG A CD  1 
ATOM   779  N NE  . ARG A 1 168 ? 45.282 29.789 102.965 1.00 24.80 ? 168 ARG A NE  1 
ATOM   780  C CZ  . ARG A 1 168 ? 44.807 29.372 101.796 1.00 26.71 ? 168 ARG A CZ  1 
ATOM   781  N NH1 . ARG A 1 168 ? 44.552 28.087 101.590 1.00 27.36 ? 168 ARG A NH1 1 
ATOM   782  N NH2 . ARG A 1 168 ? 44.614 30.244 100.818 1.00 27.13 ? 168 ARG A NH2 1 
ATOM   783  N N   . LEU A 1 169 ? 48.933 27.825 100.835 1.00 14.06 ? 169 LEU A N   1 
ATOM   784  C CA  . LEU A 1 169 ? 48.660 26.995 99.664  1.00 14.00 ? 169 LEU A CA  1 
ATOM   785  C C   . LEU A 1 169 ? 49.692 25.887 99.495  1.00 14.50 ? 169 LEU A C   1 
ATOM   786  O O   . LEU A 1 169 ? 49.336 24.738 99.235  1.00 14.61 ? 169 LEU A O   1 
ATOM   787  C CB  . LEU A 1 169 ? 48.618 27.854 98.395  1.00 13.78 ? 169 LEU A CB  1 
ATOM   788  C CG  . LEU A 1 169 ? 47.349 28.676 98.162  1.00 16.28 ? 169 LEU A CG  1 
ATOM   789  C CD1 . LEU A 1 169 ? 47.571 29.657 97.020  1.00 17.65 ? 169 LEU A CD1 1 
ATOM   790  C CD2 . LEU A 1 169 ? 46.185 27.741 97.856  1.00 17.89 ? 169 LEU A CD2 1 
ATOM   791  N N   . GLY A 1 170 ? 50.968 26.236 99.642  1.00 12.50 ? 170 GLY A N   1 
ATOM   792  C CA  . GLY A 1 170 ? 52.026 25.253 99.499  1.00 13.20 ? 170 GLY A CA  1 
ATOM   793  C C   . GLY A 1 170 ? 51.957 24.188 100.576 1.00 13.83 ? 170 GLY A C   1 
ATOM   794  O O   . GLY A 1 170 ? 52.038 22.995 100.291 1.00 14.15 ? 170 GLY A O   1 
ATOM   795  N N   . VAL A 1 171 ? 51.805 24.620 101.823 1.00 13.54 ? 171 VAL A N   1 
ATOM   796  C CA  . VAL A 1 171 ? 51.726 23.680 102.934 1.00 14.26 ? 171 VAL A CA  1 
ATOM   797  C C   . VAL A 1 171 ? 50.497 22.782 102.830 1.00 14.81 ? 171 VAL A C   1 
ATOM   798  O O   . VAL A 1 171 ? 50.605 21.560 102.938 1.00 16.23 ? 171 VAL A O   1 
ATOM   799  C CB  . VAL A 1 171 ? 51.683 24.420 104.293 1.00 14.47 ? 171 VAL A CB  1 
ATOM   800  C CG1 . VAL A 1 171 ? 51.380 23.432 105.417 1.00 15.97 ? 171 VAL A CG1 1 
ATOM   801  C CG2 . VAL A 1 171 ? 53.018 25.109 104.550 1.00 16.61 ? 171 VAL A CG2 1 
ATOM   802  N N   . GLU A 1 172 ? 49.330 23.380 102.618 1.00 16.29 ? 172 GLU A N   1 
ATOM   803  C CA  . GLU A 1 172 ? 48.104 22.594 102.533 1.00 17.43 ? 172 GLU A CA  1 
ATOM   804  C C   . GLU A 1 172 ? 48.097 21.614 101.368 1.00 16.98 ? 172 GLU A C   1 
ATOM   805  O O   . GLU A 1 172 ? 47.516 20.533 101.466 1.00 17.04 ? 172 GLU A O   1 
ATOM   806  C CB  . GLU A 1 172 ? 46.884 23.520 102.483 1.00 17.52 ? 172 GLU A CB  1 
ATOM   807  C CG  . GLU A 1 172 ? 46.645 24.203 103.828 1.00 18.80 ? 172 GLU A CG  1 
ATOM   808  C CD  . GLU A 1 172 ? 45.377 25.028 103.890 1.00 20.92 ? 172 GLU A CD  1 
ATOM   809  O OE1 . GLU A 1 172 ? 45.047 25.492 105.001 1.00 20.94 ? 172 GLU A OE1 1 
ATOM   810  O OE2 . GLU A 1 172 ? 44.715 25.220 102.849 1.00 20.23 ? 172 GLU A OE2 1 
ATOM   811  N N   . HIS A 1 173 ? 48.754 21.982 100.273 1.00 16.21 ? 173 HIS A N   1 
ATOM   812  C CA  . HIS A 1 173 ? 48.828 21.104 99.110  1.00 15.48 ? 173 HIS A CA  1 
ATOM   813  C C   . HIS A 1 173 ? 49.594 19.831 99.482  1.00 15.52 ? 173 HIS A C   1 
ATOM   814  O O   . HIS A 1 173 ? 49.136 18.718 99.213  1.00 16.39 ? 173 HIS A O   1 
ATOM   815  C CB  . HIS A 1 173 ? 49.532 21.827 97.954  1.00 15.31 ? 173 HIS A CB  1 
ATOM   816  C CG  . HIS A 1 173 ? 49.685 20.993 96.719  1.00 18.20 ? 173 HIS A CG  1 
ATOM   817  N ND1 . HIS A 1 173 ? 48.615 20.403 96.082  1.00 18.71 ? 173 HIS A ND1 1 
ATOM   818  C CD2 . HIS A 1 173 ? 50.782 20.665 95.995  1.00 19.27 ? 173 HIS A CD2 1 
ATOM   819  C CE1 . HIS A 1 173 ? 49.046 19.748 95.017  1.00 20.07 ? 173 HIS A CE1 1 
ATOM   820  N NE2 . HIS A 1 173 ? 50.357 19.892 94.942  1.00 19.63 ? 173 HIS A NE2 1 
ATOM   821  N N   . LEU A 1 174 ? 50.755 20.000 100.110 1.00 15.07 ? 174 LEU A N   1 
ATOM   822  C CA  . LEU A 1 174 ? 51.583 18.871 100.520 1.00 15.89 ? 174 LEU A CA  1 
ATOM   823  C C   . LEU A 1 174 ? 50.904 18.040 101.603 1.00 17.34 ? 174 LEU A C   1 
ATOM   824  O O   . LEU A 1 174 ? 50.950 16.810 101.572 1.00 16.70 ? 174 LEU A O   1 
ATOM   825  C CB  . LEU A 1 174 ? 52.945 19.364 101.018 1.00 15.84 ? 174 LEU A CB  1 
ATOM   826  C CG  . LEU A 1 174 ? 53.811 20.010 99.929  1.00 14.24 ? 174 LEU A CG  1 
ATOM   827  C CD1 . LEU A 1 174 ? 55.110 20.511 100.522 1.00 14.39 ? 174 LEU A CD1 1 
ATOM   828  C CD2 . LEU A 1 174 ? 54.084 18.986 98.827  1.00 14.66 ? 174 LEU A CD2 1 
ATOM   829  N N   . VAL A 1 175 ? 50.271 18.712 102.559 1.00 17.37 ? 175 VAL A N   1 
ATOM   830  C CA  . VAL A 1 175 ? 49.583 18.003 103.638 1.00 18.51 ? 175 VAL A CA  1 
ATOM   831  C C   . VAL A 1 175 ? 48.429 17.170 103.083 1.00 19.69 ? 175 VAL A C   1 
ATOM   832  O O   . VAL A 1 175 ? 48.243 16.010 103.474 1.00 19.17 ? 175 VAL A O   1 
ATOM   833  C CB  . VAL A 1 175 ? 49.040 18.988 104.695 1.00 18.43 ? 175 VAL A CB  1 
ATOM   834  C CG1 . VAL A 1 175 ? 48.163 18.248 105.707 1.00 20.26 ? 175 VAL A CG1 1 
ATOM   835  C CG2 . VAL A 1 175 ? 50.203 19.657 105.413 1.00 18.07 ? 175 VAL A CG2 1 
ATOM   836  N N   . ALA A 1 176 ? 47.668 17.761 102.166 1.00 19.05 ? 176 ALA A N   1 
ATOM   837  C CA  . ALA A 1 176 ? 46.530 17.086 101.555 1.00 20.70 ? 176 ALA A CA  1 
ATOM   838  C C   . ALA A 1 176 ? 46.968 15.843 100.786 1.00 21.14 ? 176 ALA A C   1 
ATOM   839  O O   . ALA A 1 176 ? 46.216 14.873 100.689 1.00 20.78 ? 176 ALA A O   1 
ATOM   840  C CB  . ALA A 1 176 ? 45.789 18.042 100.628 1.00 20.86 ? 176 ALA A CB  1 
ATOM   841  N N   . LEU A 1 177 ? 48.180 15.879 100.236 1.00 19.82 ? 177 LEU A N   1 
ATOM   842  C CA  . LEU A 1 177 ? 48.712 14.744 99.491  1.00 20.33 ? 177 LEU A CA  1 
ATOM   843  C C   . LEU A 1 177 ? 49.209 13.645 100.426 1.00 20.76 ? 177 LEU A C   1 
ATOM   844  O O   . LEU A 1 177 ? 49.486 12.529 99.985  1.00 21.75 ? 177 LEU A O   1 
ATOM   845  C CB  . LEU A 1 177 ? 49.849 15.193 98.567  1.00 21.21 ? 177 LEU A CB  1 
ATOM   846  C CG  . LEU A 1 177 ? 49.431 15.971 97.316  1.00 20.98 ? 177 LEU A CG  1 
ATOM   847  C CD1 . LEU A 1 177 ? 50.667 16.517 96.616  1.00 20.76 ? 177 LEU A CD1 1 
ATOM   848  C CD2 . LEU A 1 177 ? 48.637 15.061 96.382  1.00 22.42 ? 177 LEU A CD2 1 
ATOM   849  N N   . GLY A 1 178 ? 49.326 13.965 101.715 1.00 20.35 ? 178 GLY A N   1 
ATOM   850  C CA  . GLY A 1 178 ? 49.772 12.979 102.688 1.00 20.01 ? 178 GLY A CA  1 
ATOM   851  C C   . GLY A 1 178 ? 51.186 13.139 103.225 1.00 19.41 ? 178 GLY A C   1 
ATOM   852  O O   . GLY A 1 178 ? 51.666 12.294 103.983 1.00 19.92 ? 178 GLY A O   1 
ATOM   853  N N   . HIS A 1 179 ? 51.862 14.220 102.850 1.00 18.46 ? 179 HIS A N   1 
ATOM   854  C CA  . HIS A 1 179 ? 53.231 14.446 103.308 1.00 18.30 ? 179 HIS A CA  1 
ATOM   855  C C   . HIS A 1 179 ? 53.328 14.841 104.778 1.00 19.56 ? 179 HIS A C   1 
ATOM   856  O O   . HIS A 1 179 ? 52.562 15.674 105.259 1.00 20.02 ? 179 HIS A O   1 
ATOM   857  C CB  . HIS A 1 179 ? 53.897 15.523 102.451 1.00 17.86 ? 179 HIS A CB  1 
ATOM   858  C CG  . HIS A 1 179 ? 54.171 15.085 101.049 1.00 16.92 ? 179 HIS A CG  1 
ATOM   859  N ND1 . HIS A 1 179 ? 55.225 14.261 100.720 1.00 17.23 ? 179 HIS A ND1 1 
ATOM   860  C CD2 . HIS A 1 179 ? 53.501 15.319 99.896  1.00 18.04 ? 179 HIS A CD2 1 
ATOM   861  C CE1 . HIS A 1 179 ? 55.191 14.003 99.425  1.00 16.25 ? 179 HIS A CE1 1 
ATOM   862  N NE2 . HIS A 1 179 ? 54.154 14.632 98.903  1.00 16.88 ? 179 HIS A NE2 1 
ATOM   863  N N   . GLN A 1 180 ? 54.292 14.239 105.470 1.00 20.41 ? 180 GLN A N   1 
ATOM   864  C CA  . GLN A 1 180 ? 54.537 14.506 106.885 1.00 22.76 ? 180 GLN A CA  1 
ATOM   865  C C   . GLN A 1 180 ? 56.010 14.843 107.119 1.00 22.53 ? 180 GLN A C   1 
ATOM   866  O O   . GLN A 1 180 ? 56.349 15.508 108.095 1.00 22.97 ? 180 GLN A O   1 
ATOM   867  C CB  . GLN A 1 180 ? 54.151 13.285 107.725 1.00 25.89 ? 180 GLN A CB  1 
ATOM   868  C CG  . GLN A 1 180 ? 52.678 12.912 107.647 1.00 31.99 ? 180 GLN A CG  1 
ATOM   869  C CD  . GLN A 1 180 ? 51.773 13.953 108.275 1.00 36.42 ? 180 GLN A CD  1 
ATOM   870  O OE1 . GLN A 1 180 ? 51.705 15.093 107.816 1.00 41.09 ? 180 GLN A OE1 1 
ATOM   871  N NE2 . GLN A 1 180 ? 51.070 13.564 109.334 1.00 39.81 ? 180 GLN A NE2 1 
ATOM   872  N N   . GLN A 1 181 ? 56.878 14.370 106.224 1.00 21.68 ? 181 GLN A N   1 
ATOM   873  C CA  . GLN A 1 181 ? 58.320 14.621 106.304 1.00 19.74 ? 181 GLN A CA  1 
ATOM   874  C C   . GLN A 1 181 ? 58.644 15.716 105.297 1.00 19.40 ? 181 GLN A C   1 
ATOM   875  O O   . GLN A 1 181 ? 58.912 15.437 104.128 1.00 19.46 ? 181 GLN A O   1 
ATOM   876  C CB  . GLN A 1 181 ? 59.103 13.355 105.946 1.00 22.85 ? 181 GLN A CB  1 
ATOM   877  C CG  . GLN A 1 181 ? 58.945 12.206 106.930 1.00 26.86 ? 181 GLN A CG  1 
ATOM   878  C CD  . GLN A 1 181 ? 59.581 12.501 108.274 1.00 29.90 ? 181 GLN A CD  1 
ATOM   879  O OE1 . GLN A 1 181 ? 59.027 13.237 109.090 1.00 33.79 ? 181 GLN A OE1 1 
ATOM   880  N NE2 . GLN A 1 181 ? 60.759 11.935 108.505 1.00 32.98 ? 181 GLN A NE2 1 
ATOM   881  N N   . ILE A 1 182 ? 58.641 16.959 105.762 1.00 17.29 ? 182 ILE A N   1 
ATOM   882  C CA  . ILE A 1 182 ? 58.867 18.100 104.887 1.00 16.84 ? 182 ILE A CA  1 
ATOM   883  C C   . ILE A 1 182 ? 60.083 18.950 105.230 1.00 16.62 ? 182 ILE A C   1 
ATOM   884  O O   . ILE A 1 182 ? 60.379 19.193 106.398 1.00 18.01 ? 182 ILE A O   1 
ATOM   885  C CB  . ILE A 1 182 ? 57.607 18.990 104.887 1.00 16.23 ? 182 ILE A CB  1 
ATOM   886  C CG1 . ILE A 1 182 ? 56.405 18.151 104.439 1.00 16.49 ? 182 ILE A CG1 1 
ATOM   887  C CG2 . ILE A 1 182 ? 57.803 20.204 103.976 1.00 17.45 ? 182 ILE A CG2 1 
ATOM   888  C CD1 . ILE A 1 182 ? 55.066 18.838 104.588 1.00 17.76 ? 182 ILE A CD1 1 
ATOM   889  N N   . ALA A 1 183 ? 60.794 19.397 104.197 1.00 15.29 ? 183 ALA A N   1 
ATOM   890  C CA  . ALA A 1 183 ? 61.962 20.241 104.391 1.00 15.01 ? 183 ALA A CA  1 
ATOM   891  C C   . ALA A 1 183 ? 61.676 21.599 103.765 1.00 13.97 ? 183 ALA A C   1 
ATOM   892  O O   . ALA A 1 183 ? 60.903 21.698 102.809 1.00 14.07 ? 183 ALA A O   1 
ATOM   893  C CB  . ALA A 1 183 ? 63.195 19.611 103.745 1.00 16.12 ? 183 ALA A CB  1 
ATOM   894  N N   . LEU A 1 184 ? 62.292 22.639 104.316 1.00 14.03 ? 184 LEU A N   1 
ATOM   895  C CA  . LEU A 1 184 ? 62.107 23.997 103.824 1.00 14.48 ? 184 LEU A CA  1 
ATOM   896  C C   . LEU A 1 184 ? 63.405 24.571 103.281 1.00 15.13 ? 184 LEU A C   1 
ATOM   897  O O   . LEU A 1 184 ? 64.466 24.393 103.875 1.00 14.95 ? 184 LEU A O   1 
ATOM   898  C CB  . LEU A 1 184 ? 61.620 24.914 104.951 1.00 14.64 ? 184 LEU A CB  1 
ATOM   899  C CG  . LEU A 1 184 ? 60.402 24.475 105.768 1.00 14.71 ? 184 LEU A CG  1 
ATOM   900  C CD1 . LEU A 1 184 ? 60.118 25.524 106.847 1.00 15.31 ? 184 LEU A CD1 1 
ATOM   901  C CD2 . LEU A 1 184 ? 59.201 24.295 104.859 1.00 15.69 ? 184 LEU A CD2 1 
ATOM   902  N N   . LEU A 1 185 ? 63.322 25.253 102.143 1.00 14.25 ? 185 LEU A N   1 
ATOM   903  C CA  . LEU A 1 185 ? 64.493 25.903 101.564 1.00 14.17 ? 185 LEU A CA  1 
ATOM   904  C C   . LEU A 1 185 ? 64.079 27.353 101.381 1.00 13.81 ? 185 LEU A C   1 
ATOM   905  O O   . LEU A 1 185 ? 63.395 27.704 100.417 1.00 14.82 ? 185 LEU A O   1 
ATOM   906  C CB  . LEU A 1 185 ? 64.878 25.281 100.217 1.00 16.38 ? 185 LEU A CB  1 
ATOM   907  C CG  . LEU A 1 185 ? 66.023 25.997 99.485  1.00 18.05 ? 185 LEU A CG  1 
ATOM   908  C CD1 . LEU A 1 185 ? 67.212 26.197 100.421 1.00 20.89 ? 185 LEU A CD1 1 
ATOM   909  C CD2 . LEU A 1 185 ? 66.433 25.177 98.270  1.00 21.55 ? 185 LEU A CD2 1 
ATOM   910  N N   . ALA A 1 186 ? 64.491 28.186 102.330 1.00 13.30 ? 186 ALA A N   1 
ATOM   911  C CA  . ALA A 1 186 ? 64.144 29.600 102.333 1.00 12.22 ? 186 ALA A CA  1 
ATOM   912  C C   . ALA A 1 186 ? 65.031 30.458 101.451 1.00 13.55 ? 186 ALA A C   1 
ATOM   913  O O   . ALA A 1 186 ? 66.125 30.051 101.060 1.00 14.13 ? 186 ALA A O   1 
ATOM   914  C CB  . ALA A 1 186 ? 64.187 30.131 103.769 1.00 14.65 ? 186 ALA A CB  1 
ATOM   915  N N   . GLY A 1 187 ? 64.534 31.650 101.138 1.00 14.58 ? 187 GLY A N   1 
ATOM   916  C CA  . GLY A 1 187 ? 65.304 32.595 100.353 1.00 14.27 ? 187 GLY A CA  1 
ATOM   917  C C   . GLY A 1 187 ? 66.253 33.270 101.329 1.00 15.51 ? 187 GLY A C   1 
ATOM   918  O O   . GLY A 1 187 ? 66.218 32.961 102.521 1.00 14.05 ? 187 GLY A O   1 
ATOM   919  N N   . PRO A 1 188 ? 67.107 34.193 100.870 1.00 14.77 ? 188 PRO A N   1 
ATOM   920  C CA  . PRO A 1 188 ? 68.042 34.869 101.774 1.00 14.65 ? 188 PRO A CA  1 
ATOM   921  C C   . PRO A 1 188 ? 67.281 35.665 102.831 1.00 14.34 ? 188 PRO A C   1 
ATOM   922  O O   . PRO A 1 188 ? 66.489 36.546 102.507 1.00 15.07 ? 188 PRO A O   1 
ATOM   923  C CB  . PRO A 1 188 ? 68.862 35.742 100.826 1.00 15.72 ? 188 PRO A CB  1 
ATOM   924  C CG  . PRO A 1 188 ? 67.884 36.058 99.727  1.00 14.38 ? 188 PRO A CG  1 
ATOM   925  C CD  . PRO A 1 188 ? 67.199 34.734 99.502  1.00 15.33 ? 188 PRO A CD  1 
ATOM   926  N N   . LEU A 1 189 ? 67.524 35.356 104.100 1.00 15.57 ? 189 LEU A N   1 
ATOM   927  C CA  . LEU A 1 189 ? 66.796 36.035 105.164 1.00 14.86 ? 189 LEU A CA  1 
ATOM   928  C C   . LEU A 1 189 ? 67.067 37.525 105.318 1.00 16.62 ? 189 LEU A C   1 
ATOM   929  O O   . LEU A 1 189 ? 66.458 38.180 106.157 1.00 16.64 ? 189 LEU A O   1 
ATOM   930  C CB  . LEU A 1 189 ? 66.998 35.299 106.494 1.00 16.70 ? 189 LEU A CB  1 
ATOM   931  C CG  . LEU A 1 189 ? 66.489 33.852 106.454 1.00 17.15 ? 189 LEU A CG  1 
ATOM   932  C CD1 . LEU A 1 189 ? 66.565 33.256 107.854 1.00 17.81 ? 189 LEU A CD1 1 
ATOM   933  C CD2 . LEU A 1 189 ? 65.047 33.806 105.936 1.00 15.94 ? 189 LEU A CD2 1 
ATOM   934  N N   . SER A 1 190 ? 67.967 38.069 104.501 1.00 16.50 ? 190 SER A N   1 
ATOM   935  C CA  . SER A 1 190 ? 68.237 39.501 104.551 1.00 17.47 ? 190 SER A CA  1 
ATOM   936  C C   . SER A 1 190 ? 67.066 40.195 103.853 1.00 17.30 ? 190 SER A C   1 
ATOM   937  O O   . SER A 1 190 ? 66.857 41.400 104.007 1.00 17.75 ? 190 SER A O   1 
ATOM   938  C CB  . SER A 1 190 ? 69.543 39.825 103.822 1.00 17.45 ? 190 SER A CB  1 
ATOM   939  O OG  . SER A 1 190 ? 69.512 39.326 102.497 1.00 20.43 ? 190 SER A OG  1 
ATOM   940  N N   . SER A 1 191 ? 66.301 39.412 103.095 1.00 16.86 ? 191 SER A N   1 
ATOM   941  C CA  . SER A 1 191 ? 65.141 39.910 102.355 1.00 16.09 ? 191 SER A CA  1 
ATOM   942  C C   . SER A 1 191 ? 63.826 39.724 103.106 1.00 15.96 ? 191 SER A C   1 
ATOM   943  O O   . SER A 1 191 ? 63.486 38.610 103.500 1.00 14.87 ? 191 SER A O   1 
ATOM   944  C CB  . SER A 1 191 ? 65.038 39.194 101.007 1.00 18.02 ? 191 SER A CB  1 
ATOM   945  O OG  . SER A 1 191 ? 63.716 39.262 100.499 1.00 20.13 ? 191 SER A OG  1 
ATOM   946  N N   . VAL A 1 192 ? 63.078 40.809 103.277 1.00 15.32 ? 192 VAL A N   1 
ATOM   947  C CA  . VAL A 1 192 ? 61.797 40.737 103.973 1.00 16.89 ? 192 VAL A CA  1 
ATOM   948  C C   . VAL A 1 192 ? 60.861 39.718 103.309 1.00 16.59 ? 192 VAL A C   1 
ATOM   949  O O   . VAL A 1 192 ? 60.118 39.018 103.993 1.00 16.35 ? 192 VAL A O   1 
ATOM   950  C CB  . VAL A 1 192 ? 61.112 42.132 104.039 1.00 18.05 ? 192 VAL A CB  1 
ATOM   951  C CG1 . VAL A 1 192 ? 60.770 42.625 102.645 1.00 18.37 ? 192 VAL A CG1 1 
ATOM   952  C CG2 . VAL A 1 192 ? 59.860 42.056 104.901 1.00 18.12 ? 192 VAL A CG2 1 
ATOM   953  N N   . SER A 1 193 ? 60.900 39.620 101.982 1.00 16.67 ? 193 SER A N   1 
ATOM   954  C CA  . SER A 1 193 ? 60.046 38.657 101.291 1.00 16.04 ? 193 SER A CA  1 
ATOM   955  C C   . SER A 1 193 ? 60.385 37.224 101.685 1.00 14.89 ? 193 SER A C   1 
ATOM   956  O O   . SER A 1 193 ? 59.492 36.407 101.907 1.00 15.85 ? 193 SER A O   1 
ATOM   957  C CB  . SER A 1 193 ? 60.163 38.811 99.770  1.00 18.06 ? 193 SER A CB  1 
ATOM   958  O OG  . SER A 1 193 ? 59.353 39.880 99.319  1.00 22.93 ? 193 SER A OG  1 
ATOM   959  N N   . ALA A 1 194 ? 61.675 36.921 101.767 1.00 13.71 ? 194 ALA A N   1 
ATOM   960  C CA  . ALA A 1 194 ? 62.109 35.582 102.142 1.00 13.09 ? 194 ALA A CA  1 
ATOM   961  C C   . ALA A 1 194 ? 61.694 35.290 103.580 1.00 12.95 ? 194 ALA A C   1 
ATOM   962  O O   . ALA A 1 194 ? 61.305 34.169 103.906 1.00 13.04 ? 194 ALA A O   1 
ATOM   963  C CB  . ALA A 1 194 ? 63.615 35.461 102.006 1.00 14.15 ? 194 ALA A CB  1 
ATOM   964  N N   . ARG A 1 195 ? 61.792 36.301 104.436 1.00 12.70 ? 195 ARG A N   1 
ATOM   965  C CA  . ARG A 1 195 ? 61.432 36.132 105.840 1.00 12.82 ? 195 ARG A CA  1 
ATOM   966  C C   . ARG A 1 195 ? 59.941 35.874 106.022 1.00 13.52 ? 195 ARG A C   1 
ATOM   967  O O   . ARG A 1 195 ? 59.550 34.969 106.761 1.00 13.97 ? 195 ARG A O   1 
ATOM   968  C CB  . ARG A 1 195 ? 61.852 37.360 106.655 1.00 12.54 ? 195 ARG A CB  1 
ATOM   969  C CG  . ARG A 1 195 ? 63.364 37.558 106.738 1.00 12.41 ? 195 ARG A CG  1 
ATOM   970  C CD  . ARG A 1 195 ? 63.741 38.521 107.864 1.00 13.21 ? 195 ARG A CD  1 
ATOM   971  N NE  . ARG A 1 195 ? 63.204 39.867 107.675 1.00 14.03 ? 195 ARG A NE  1 
ATOM   972  C CZ  . ARG A 1 195 ? 63.834 40.848 107.035 1.00 16.71 ? 195 ARG A CZ  1 
ATOM   973  N NH1 . ARG A 1 195 ? 63.262 42.042 106.920 1.00 15.90 ? 195 ARG A NH1 1 
ATOM   974  N NH2 . ARG A 1 195 ? 65.034 40.640 106.509 1.00 15.59 ? 195 ARG A NH2 1 
ATOM   975  N N   . LEU A 1 196 ? 59.107 36.667 105.355 1.00 13.34 ? 196 LEU A N   1 
ATOM   976  C CA  . LEU A 1 196 ? 57.661 36.489 105.458 1.00 14.48 ? 196 LEU A CA  1 
ATOM   977  C C   . LEU A 1 196 ? 57.267 35.104 104.958 1.00 14.49 ? 196 LEU A C   1 
ATOM   978  O O   . LEU A 1 196 ? 56.392 34.447 105.532 1.00 13.80 ? 196 LEU A O   1 
ATOM   979  C CB  . LEU A 1 196 ? 56.930 37.559 104.643 1.00 15.55 ? 196 LEU A CB  1 
ATOM   980  C CG  . LEU A 1 196 ? 57.042 38.994 105.163 1.00 16.98 ? 196 LEU A CG  1 
ATOM   981  C CD1 . LEU A 1 196 ? 56.459 39.956 104.130 1.00 18.12 ? 196 LEU A CD1 1 
ATOM   982  C CD2 . LEU A 1 196 ? 56.308 39.116 106.497 1.00 19.25 ? 196 LEU A CD2 1 
ATOM   983  N N   . ARG A 1 197 ? 57.921 34.660 103.889 1.00 12.88 ? 197 ARG A N   1 
ATOM   984  C CA  . ARG A 1 197 ? 57.642 33.351 103.308 1.00 12.38 ? 197 ARG A CA  1 
ATOM   985  C C   . ARG A 1 197 ? 58.023 32.230 104.277 1.00 13.02 ? 197 ARG A C   1 
ATOM   986  O O   . ARG A 1 197 ? 57.249 31.295 104.492 1.00 13.45 ? 197 ARG A O   1 
ATOM   987  C CB  . ARG A 1 197 ? 58.410 33.209 101.986 1.00 14.07 ? 197 ARG A CB  1 
ATOM   988  C CG  . ARG A 1 197 ? 58.014 32.024 101.107 1.00 16.47 ? 197 ARG A CG  1 
ATOM   989  C CD  . ARG A 1 197 ? 58.473 32.295 99.665  1.00 16.36 ? 197 ARG A CD  1 
ATOM   990  N NE  . ARG A 1 197 ? 57.897 33.555 99.203  1.00 15.52 ? 197 ARG A NE  1 
ATOM   991  C CZ  . ARG A 1 197 ? 58.336 34.274 98.172  1.00 17.44 ? 197 ARG A CZ  1 
ATOM   992  N NH1 . ARG A 1 197 ? 59.379 33.871 97.455  1.00 13.78 ? 197 ARG A NH1 1 
ATOM   993  N NH2 . ARG A 1 197 ? 57.738 35.420 97.874  1.00 16.59 ? 197 ARG A NH2 1 
ATOM   994  N N   . LEU A 1 198 ? 59.205 32.327 104.876 1.00 12.26 ? 198 LEU A N   1 
ATOM   995  C CA  . LEU A 1 198 ? 59.644 31.297 105.811 1.00 12.61 ? 198 LEU A CA  1 
ATOM   996  C C   . LEU A 1 198 ? 58.744 31.267 107.048 1.00 12.03 ? 198 LEU A C   1 
ATOM   997  O O   . LEU A 1 198 ? 58.363 30.193 107.516 1.00 12.55 ? 198 LEU A O   1 
ATOM   998  C CB  . LEU A 1 198 ? 61.101 31.534 106.226 1.00 12.85 ? 198 LEU A CB  1 
ATOM   999  C CG  . LEU A 1 198 ? 61.694 30.535 107.230 1.00 12.62 ? 198 LEU A CG  1 
ATOM   1000 C CD1 . LEU A 1 198 ? 61.539 29.110 106.709 1.00 13.79 ? 198 LEU A CD1 1 
ATOM   1001 C CD2 . LEU A 1 198 ? 63.166 30.866 107.462 1.00 13.48 ? 198 LEU A CD2 1 
ATOM   1002 N N   . ALA A 1 199 ? 58.398 32.440 107.570 1.00 12.42 ? 199 ALA A N   1 
ATOM   1003 C CA  . ALA A 1 199 ? 57.538 32.509 108.753 1.00 13.43 ? 199 ALA A CA  1 
ATOM   1004 C C   . ALA A 1 199 ? 56.184 31.888 108.442 1.00 14.06 ? 199 ALA A C   1 
ATOM   1005 O O   . ALA A 1 199 ? 55.593 31.202 109.282 1.00 13.79 ? 199 ALA A O   1 
ATOM   1006 C CB  . ALA A 1 199 ? 57.364 33.956 109.196 1.00 14.98 ? 199 ALA A CB  1 
ATOM   1007 N N   . GLY A 1 200 ? 55.698 32.138 107.230 1.00 14.63 ? 200 GLY A N   1 
ATOM   1008 C CA  . GLY A 1 200 ? 54.420 31.592 106.811 1.00 14.91 ? 200 GLY A CA  1 
ATOM   1009 C C   . GLY A 1 200 ? 54.437 30.081 106.740 1.00 13.72 ? 200 GLY A C   1 
ATOM   1010 O O   . GLY A 1 200 ? 53.498 29.432 107.207 1.00 14.47 ? 200 GLY A O   1 
ATOM   1011 N N   . TRP A 1 201 ? 55.485 29.508 106.147 1.00 13.08 ? 201 TRP A N   1 
ATOM   1012 C CA  . TRP A 1 201 ? 55.567 28.057 106.065 1.00 12.78 ? 201 TRP A CA  1 
ATOM   1013 C C   . TRP A 1 201 ? 55.498 27.462 107.462 1.00 13.75 ? 201 TRP A C   1 
ATOM   1014 O O   . TRP A 1 201 ? 54.770 26.502 107.695 1.00 14.45 ? 201 TRP A O   1 
ATOM   1015 C CB  . TRP A 1 201 ? 56.867 27.594 105.414 1.00 13.92 ? 201 TRP A CB  1 
ATOM   1016 C CG  . TRP A 1 201 ? 56.912 27.806 103.947 1.00 12.00 ? 201 TRP A CG  1 
ATOM   1017 C CD1 . TRP A 1 201 ? 55.855 27.810 103.086 1.00 13.06 ? 201 TRP A CD1 1 
ATOM   1018 C CD2 . TRP A 1 201 ? 58.086 27.971 103.150 1.00 13.29 ? 201 TRP A CD2 1 
ATOM   1019 N NE1 . TRP A 1 201 ? 56.301 27.965 101.792 1.00 12.87 ? 201 TRP A NE1 1 
ATOM   1020 C CE2 . TRP A 1 201 ? 57.666 28.066 101.805 1.00 12.87 ? 201 TRP A CE2 1 
ATOM   1021 C CE3 . TRP A 1 201 ? 59.453 28.045 103.440 1.00 14.87 ? 201 TRP A CE3 1 
ATOM   1022 C CZ2 . TRP A 1 201 ? 58.570 28.231 100.749 1.00 14.12 ? 201 TRP A CZ2 1 
ATOM   1023 C CZ3 . TRP A 1 201 ? 60.352 28.210 102.391 1.00 17.01 ? 201 TRP A CZ3 1 
ATOM   1024 C CH2 . TRP A 1 201 ? 59.903 28.299 101.062 1.00 14.41 ? 201 TRP A CH2 1 
ATOM   1025 N N   . HIS A 1 202 ? 56.264 28.029 108.387 1.00 13.13 ? 202 HIS A N   1 
ATOM   1026 C CA  . HIS A 1 202 ? 56.267 27.521 109.754 1.00 14.25 ? 202 HIS A CA  1 
ATOM   1027 C C   . HIS A 1 202 ? 54.902 27.644 110.405 1.00 14.39 ? 202 HIS A C   1 
ATOM   1028 O O   . HIS A 1 202 ? 54.469 26.742 111.120 1.00 14.77 ? 202 HIS A O   1 
ATOM   1029 C CB  . HIS A 1 202 ? 57.316 28.253 110.591 1.00 14.57 ? 202 HIS A CB  1 
ATOM   1030 C CG  . HIS A 1 202 ? 58.709 27.745 110.380 1.00 14.45 ? 202 HIS A CG  1 
ATOM   1031 N ND1 . HIS A 1 202 ? 59.089 26.464 110.717 1.00 15.41 ? 202 HIS A ND1 1 
ATOM   1032 C CD2 . HIS A 1 202 ? 59.810 28.342 109.868 1.00 15.51 ? 202 HIS A CD2 1 
ATOM   1033 C CE1 . HIS A 1 202 ? 60.366 26.293 110.423 1.00 16.51 ? 202 HIS A CE1 1 
ATOM   1034 N NE2 . HIS A 1 202 ? 60.827 27.418 109.906 1.00 15.84 ? 202 HIS A NE2 1 
ATOM   1035 N N   . LYS A 1 203 ? 54.225 28.760 110.158 1.00 14.10 ? 203 LYS A N   1 
ATOM   1036 C CA  . LYS A 1 203 ? 52.901 28.982 110.728 1.00 15.38 ? 203 LYS A CA  1 
ATOM   1037 C C   . LYS A 1 203 ? 51.918 27.895 110.302 1.00 15.57 ? 203 LYS A C   1 
ATOM   1038 O O   . LYS A 1 203 ? 51.265 27.272 111.138 1.00 14.87 ? 203 LYS A O   1 
ATOM   1039 C CB  . LYS A 1 203 ? 52.360 30.350 110.304 1.00 16.30 ? 203 LYS A CB  1 
ATOM   1040 C CG  . LYS A 1 203 ? 50.917 30.602 110.727 1.00 19.69 ? 203 LYS A CG  1 
ATOM   1041 C CD  . LYS A 1 203 ? 50.427 31.962 110.253 1.00 21.02 ? 203 LYS A CD  1 
ATOM   1042 C CE  . LYS A 1 203 ? 48.940 32.133 110.515 1.00 23.03 ? 203 LYS A CE  1 
ATOM   1043 N NZ  . LYS A 1 203 ? 48.435 33.462 110.064 1.00 22.70 ? 203 LYS A NZ  1 
ATOM   1044 N N   . TYR A 1 204 ? 51.816 27.657 109.000 1.00 14.15 ? 204 TYR A N   1 
ATOM   1045 C CA  . TYR A 1 204 ? 50.879 26.655 108.517 1.00 13.45 ? 204 TYR A CA  1 
ATOM   1046 C C   . TYR A 1 204 ? 51.299 25.212 108.775 1.00 13.52 ? 204 TYR A C   1 
ATOM   1047 O O   . TYR A 1 204 ? 50.443 24.346 108.961 1.00 15.38 ? 204 TYR A O   1 
ATOM   1048 C CB  . TYR A 1 204 ? 50.565 26.929 107.043 1.00 14.76 ? 204 TYR A CB  1 
ATOM   1049 C CG  . TYR A 1 204 ? 49.810 28.234 106.910 1.00 14.65 ? 204 TYR A CG  1 
ATOM   1050 C CD1 . TYR A 1 204 ? 48.480 28.334 107.330 1.00 14.94 ? 204 TYR A CD1 1 
ATOM   1051 C CD2 . TYR A 1 204 ? 50.449 29.393 106.471 1.00 15.72 ? 204 TYR A CD2 1 
ATOM   1052 C CE1 . TYR A 1 204 ? 47.810 29.555 107.327 1.00 15.75 ? 204 TYR A CE1 1 
ATOM   1053 C CE2 . TYR A 1 204 ? 49.786 30.622 106.462 1.00 14.10 ? 204 TYR A CE2 1 
ATOM   1054 C CZ  . TYR A 1 204 ? 48.470 30.695 106.896 1.00 17.44 ? 204 TYR A CZ  1 
ATOM   1055 O OH  . TYR A 1 204 ? 47.820 31.906 106.927 1.00 19.17 ? 204 TYR A OH  1 
ATOM   1056 N N   . LEU A 1 205 ? 52.601 24.943 108.812 1.00 13.53 ? 205 LEU A N   1 
ATOM   1057 C CA  . LEU A 1 205 ? 53.050 23.589 109.114 1.00 13.21 ? 205 LEU A CA  1 
ATOM   1058 C C   . LEU A 1 205 ? 52.655 23.315 110.568 1.00 14.26 ? 205 LEU A C   1 
ATOM   1059 O O   . LEU A 1 205 ? 52.154 22.236 110.891 1.00 14.46 ? 205 LEU A O   1 
ATOM   1060 C CB  . LEU A 1 205 ? 54.568 23.458 108.954 1.00 15.59 ? 205 LEU A CB  1 
ATOM   1061 C CG  . LEU A 1 205 ? 55.085 23.283 107.521 1.00 15.79 ? 205 LEU A CG  1 
ATOM   1062 C CD1 . LEU A 1 205 ? 56.604 23.253 107.518 1.00 18.60 ? 205 LEU A CD1 1 
ATOM   1063 C CD2 . LEU A 1 205 ? 54.523 21.994 106.933 1.00 17.30 ? 205 LEU A CD2 1 
ATOM   1064 N N   . THR A 1 206 ? 52.861 24.308 111.429 1.00 15.26 ? 206 THR A N   1 
ATOM   1065 C CA  . THR A 1 206 ? 52.516 24.171 112.844 1.00 14.99 ? 206 THR A CA  1 
ATOM   1066 C C   . THR A 1 206 ? 51.013 23.959 113.001 1.00 15.02 ? 206 THR A C   1 
ATOM   1067 O O   . THR A 1 206 ? 50.575 23.127 113.799 1.00 14.61 ? 206 THR A O   1 
ATOM   1068 C CB  . THR A 1 206 ? 52.939 25.419 113.649 1.00 16.67 ? 206 THR A CB  1 
ATOM   1069 O OG1 . THR A 1 206 ? 54.361 25.576 113.573 1.00 17.83 ? 206 THR A OG1 1 
ATOM   1070 C CG2 . THR A 1 206 ? 52.541 25.267 115.116 1.00 18.34 ? 206 THR A CG2 1 
ATOM   1071 N N   . ARG A 1 207 ? 50.219 24.702 112.238 1.00 14.45 ? 207 ARG A N   1 
ATOM   1072 C CA  . ARG A 1 207 ? 48.770 24.557 112.311 1.00 16.41 ? 207 ARG A CA  1 
ATOM   1073 C C   . ARG A 1 207 ? 48.349 23.140 111.925 1.00 16.86 ? 207 ARG A C   1 
ATOM   1074 O O   . ARG A 1 207 ? 47.306 22.650 112.363 1.00 17.43 ? 207 ARG A O   1 
ATOM   1075 C CB  . ARG A 1 207 ? 48.075 25.570 111.397 1.00 18.66 ? 207 ARG A CB  1 
ATOM   1076 C CG  . ARG A 1 207 ? 48.103 27.003 111.915 1.00 24.08 ? 207 ARG A CG  1 
ATOM   1077 C CD  . ARG A 1 207 ? 47.133 27.874 111.126 1.00 28.06 ? 207 ARG A CD  1 
ATOM   1078 N NE  . ARG A 1 207 ? 47.033 29.228 111.658 1.00 33.96 ? 207 ARG A NE  1 
ATOM   1079 C CZ  . ARG A 1 207 ? 46.217 30.158 111.173 1.00 34.40 ? 207 ARG A CZ  1 
ATOM   1080 N NH1 . ARG A 1 207 ? 45.430 29.877 110.143 1.00 37.63 ? 207 ARG A NH1 1 
ATOM   1081 N NH2 . ARG A 1 207 ? 46.188 31.368 111.715 1.00 38.62 ? 207 ARG A NH2 1 
ATOM   1082 N N   . ASN A 1 208 ? 49.165 22.487 111.103 1.00 16.35 ? 208 ASN A N   1 
ATOM   1083 C CA  . ASN A 1 208 ? 48.883 21.123 110.667 1.00 15.36 ? 208 ASN A CA  1 
ATOM   1084 C C   . ASN A 1 208 ? 49.657 20.107 111.510 1.00 16.33 ? 208 ASN A C   1 
ATOM   1085 O O   . ASN A 1 208 ? 49.810 18.944 111.131 1.00 16.83 ? 208 ASN A O   1 
ATOM   1086 C CB  . ASN A 1 208 ? 49.213 20.977 109.175 1.00 15.43 ? 208 ASN A CB  1 
ATOM   1087 C CG  . ASN A 1 208 ? 48.133 21.575 108.287 1.00 16.67 ? 208 ASN A CG  1 
ATOM   1088 O OD1 . ASN A 1 208 ? 47.119 20.934 108.009 1.00 18.71 ? 208 ASN A OD1 1 
ATOM   1089 N ND2 . ASN A 1 208 ? 48.330 22.819 107.865 1.00 16.97 ? 208 ASN A ND2 1 
ATOM   1090 N N   . GLN A 1 209 ? 50.134 20.570 112.664 1.00 16.99 ? 209 GLN A N   1 
ATOM   1091 C CA  . GLN A 1 209 ? 50.872 19.753 113.625 1.00 16.47 ? 209 GLN A CA  1 
ATOM   1092 C C   . GLN A 1 209 ? 52.084 19.031 113.058 1.00 16.77 ? 209 GLN A C   1 
ATOM   1093 O O   . GLN A 1 209 ? 52.371 17.889 113.416 1.00 17.47 ? 209 GLN A O   1 
ATOM   1094 C CB  . GLN A 1 209 ? 49.905 18.761 114.292 1.00 17.31 ? 209 GLN A CB  1 
ATOM   1095 C CG  . GLN A 1 209 ? 48.652 19.463 114.806 1.00 17.50 ? 209 GLN A CG  1 
ATOM   1096 C CD  . GLN A 1 209 ? 47.707 18.565 115.594 1.00 18.73 ? 209 GLN A CD  1 
ATOM   1097 O OE1 . GLN A 1 209 ? 46.514 18.849 115.691 1.00 21.20 ? 209 GLN A OE1 1 
ATOM   1098 N NE2 . GLN A 1 209 ? 48.236 17.496 116.172 1.00 18.18 ? 209 GLN A NE2 1 
ATOM   1099 N N   . ILE A 1 210 ? 52.811 19.720 112.185 1.00 16.28 ? 210 ILE A N   1 
ATOM   1100 C CA  . ILE A 1 210 ? 54.000 19.162 111.564 1.00 15.93 ? 210 ILE A CA  1 
ATOM   1101 C C   . ILE A 1 210 ? 55.205 20.061 111.783 1.00 15.98 ? 210 ILE A C   1 
ATOM   1102 O O   . ILE A 1 210 ? 55.121 21.279 111.615 1.00 17.12 ? 210 ILE A O   1 
ATOM   1103 C CB  . ILE A 1 210 ? 53.819 19.013 110.033 1.00 17.26 ? 210 ILE A CB  1 
ATOM   1104 C CG1 . ILE A 1 210 ? 52.717 18.000 109.731 1.00 18.58 ? 210 ILE A CG1 1 
ATOM   1105 C CG2 . ILE A 1 210 ? 55.144 18.597 109.392 1.00 18.97 ? 210 ILE A CG2 1 
ATOM   1106 C CD1 . ILE A 1 210 ? 52.309 17.966 108.271 1.00 20.51 ? 210 ILE A CD1 1 
ATOM   1107 N N   . GLN A 1 211 ? 56.319 19.457 112.182 1.00 15.93 ? 211 GLN A N   1 
ATOM   1108 C CA  . GLN A 1 211 ? 57.564 20.190 112.348 1.00 15.93 ? 211 GLN A CA  1 
ATOM   1109 C C   . GLN A 1 211 ? 58.444 19.710 111.192 1.00 15.67 ? 211 GLN A C   1 
ATOM   1110 O O   . GLN A 1 211 ? 58.616 18.508 110.994 1.00 16.40 ? 211 GLN A O   1 
ATOM   1111 C CB  . GLN A 1 211 ? 58.225 19.861 113.690 1.00 17.27 ? 211 GLN A CB  1 
ATOM   1112 C CG  . GLN A 1 211 ? 57.548 20.530 114.882 1.00 17.52 ? 211 GLN A CG  1 
ATOM   1113 C CD  . GLN A 1 211 ? 58.298 20.299 116.183 1.00 18.33 ? 211 GLN A CD  1 
ATOM   1114 O OE1 . GLN A 1 211 ? 58.428 19.168 116.639 1.00 20.20 ? 211 GLN A OE1 1 
ATOM   1115 N NE2 . GLN A 1 211 ? 58.800 21.376 116.782 1.00 18.43 ? 211 GLN A NE2 1 
ATOM   1116 N N   . PRO A 1 212 ? 58.990 20.642 110.394 1.00 16.54 ? 212 PRO A N   1 
ATOM   1117 C CA  . PRO A 1 212 ? 59.839 20.230 109.270 1.00 16.83 ? 212 PRO A CA  1 
ATOM   1118 C C   . PRO A 1 212 ? 61.069 19.459 109.740 1.00 17.64 ? 212 PRO A C   1 
ATOM   1119 O O   . PRO A 1 212 ? 61.598 19.734 110.818 1.00 18.30 ? 212 PRO A O   1 
ATOM   1120 C CB  . PRO A 1 212 ? 60.195 21.559 108.604 1.00 16.55 ? 212 PRO A CB  1 
ATOM   1121 C CG  . PRO A 1 212 ? 60.191 22.526 109.748 1.00 18.02 ? 212 PRO A CG  1 
ATOM   1122 C CD  . PRO A 1 212 ? 58.951 22.108 110.521 1.00 15.75 ? 212 PRO A CD  1 
ATOM   1123 N N   . ILE A 1 213 ? 61.527 18.497 108.941 1.00 17.65 ? 213 ILE A N   1 
ATOM   1124 C CA  . ILE A 1 213 ? 62.696 17.717 109.337 1.00 19.57 ? 213 ILE A CA  1 
ATOM   1125 C C   . ILE A 1 213 ? 63.998 18.449 109.060 1.00 19.50 ? 213 ILE A C   1 
ATOM   1126 O O   . ILE A 1 213 ? 65.072 18.000 109.463 1.00 20.72 ? 213 ILE A O   1 
ATOM   1127 C CB  . ILE A 1 213 ? 62.733 16.329 108.653 1.00 20.85 ? 213 ILE A CB  1 
ATOM   1128 C CG1 . ILE A 1 213 ? 62.853 16.476 107.136 1.00 22.17 ? 213 ILE A CG1 1 
ATOM   1129 C CG2 . ILE A 1 213 ? 61.479 15.551 109.007 1.00 22.39 ? 213 ILE A CG2 1 
ATOM   1130 C CD1 . ILE A 1 213 ? 63.068 15.147 106.431 1.00 23.61 ? 213 ILE A CD1 1 
ATOM   1131 N N   . ALA A 1 214 ? 63.901 19.580 108.368 1.00 18.36 ? 214 ALA A N   1 
ATOM   1132 C CA  . ALA A 1 214 ? 65.069 20.389 108.068 1.00 17.30 ? 214 ALA A CA  1 
ATOM   1133 C C   . ALA A 1 214 ? 64.663 21.682 107.388 1.00 15.99 ? 214 ALA A C   1 
ATOM   1134 O O   . ALA A 1 214 ? 63.654 21.735 106.688 1.00 15.76 ? 214 ALA A O   1 
ATOM   1135 C CB  . ALA A 1 214 ? 66.034 19.617 107.167 1.00 19.24 ? 214 ALA A CB  1 
ATOM   1136 N N   . GLU A 1 215 ? 65.436 22.732 107.633 1.00 16.67 ? 215 GLU A N   1 
ATOM   1137 C CA  . GLU A 1 215 ? 65.197 24.014 106.993 1.00 17.40 ? 215 GLU A CA  1 
ATOM   1138 C C   . GLU A 1 215 ? 66.550 24.637 106.712 1.00 17.95 ? 215 GLU A C   1 
ATOM   1139 O O   . GLU A 1 215 ? 67.441 24.653 107.568 1.00 18.31 ? 215 GLU A O   1 
ATOM   1140 C CB  . GLU A 1 215 ? 64.317 24.944 107.850 1.00 19.38 ? 215 GLU A CB  1 
ATOM   1141 C CG  . GLU A 1 215 ? 64.870 25.380 109.199 1.00 20.46 ? 215 GLU A CG  1 
ATOM   1142 C CD  . GLU A 1 215 ? 63.965 26.407 109.872 1.00 23.44 ? 215 GLU A CD  1 
ATOM   1143 O OE1 . GLU A 1 215 ? 63.612 26.214 111.055 1.00 22.39 ? 215 GLU A OE1 1 
ATOM   1144 O OE2 . GLU A 1 215 ? 63.602 27.411 109.217 1.00 21.32 ? 215 GLU A OE2 1 
ATOM   1145 N N   . ARG A 1 216 ? 66.706 25.117 105.485 1.00 15.76 ? 216 ARG A N   1 
ATOM   1146 C CA  . ARG A 1 216 ? 67.948 25.729 105.051 1.00 14.93 ? 216 ARG A CA  1 
ATOM   1147 C C   . ARG A 1 216 ? 67.665 27.065 104.389 1.00 14.98 ? 216 ARG A C   1 
ATOM   1148 O O   . ARG A 1 216 ? 66.506 27.463 104.242 1.00 14.68 ? 216 ARG A O   1 
ATOM   1149 C CB  . ARG A 1 216 ? 68.683 24.788 104.091 1.00 15.53 ? 216 ARG A CB  1 
ATOM   1150 C CG  . ARG A 1 216 ? 69.399 23.644 104.808 1.00 18.93 ? 216 ARG A CG  1 
ATOM   1151 C CD  . ARG A 1 216 ? 69.809 22.540 103.845 1.00 20.73 ? 216 ARG A CD  1 
ATOM   1152 N NE  . ARG A 1 216 ? 70.693 21.565 104.481 1.00 23.96 ? 216 ARG A NE  1 
ATOM   1153 C CZ  . ARG A 1 216 ? 72.000 21.740 104.652 1.00 26.46 ? 216 ARG A CZ  1 
ATOM   1154 N NH1 . ARG A 1 216 ? 72.586 22.854 104.231 1.00 25.79 ? 216 ARG A NH1 1 
ATOM   1155 N NH2 . ARG A 1 216 ? 72.727 20.797 105.241 1.00 25.86 ? 216 ARG A NH2 1 
ATOM   1156 N N   . GLU A 1 217 ? 68.732 27.750 103.990 1.00 15.46 ? 217 GLU A N   1 
ATOM   1157 C CA  . GLU A 1 217 ? 68.620 29.068 103.382 1.00 16.25 ? 217 GLU A CA  1 
ATOM   1158 C C   . GLU A 1 217 ? 69.480 29.181 102.128 1.00 15.81 ? 217 GLU A C   1 
ATOM   1159 O O   . GLU A 1 217 ? 70.654 28.810 102.139 1.00 16.23 ? 217 GLU A O   1 
ATOM   1160 C CB  . GLU A 1 217 ? 69.061 30.121 104.402 1.00 17.49 ? 217 GLU A CB  1 
ATOM   1161 C CG  . GLU A 1 217 ? 68.972 31.559 103.933 1.00 20.38 ? 217 GLU A CG  1 
ATOM   1162 C CD  . GLU A 1 217 ? 69.582 32.524 104.934 1.00 21.95 ? 217 GLU A CD  1 
ATOM   1163 O OE1 . GLU A 1 217 ? 69.811 32.117 106.099 1.00 24.64 ? 217 GLU A OE1 1 
ATOM   1164 O OE2 . GLU A 1 217 ? 69.825 33.689 104.567 1.00 20.21 ? 217 GLU A OE2 1 
ATOM   1165 N N   . GLY A 1 218 ? 68.886 29.700 101.057 1.00 16.81 ? 218 GLY A N   1 
ATOM   1166 C CA  . GLY A 1 218 ? 69.605 29.873 99.803  1.00 16.59 ? 218 GLY A CA  1 
ATOM   1167 C C   . GLY A 1 218 ? 69.729 31.347 99.460  1.00 16.73 ? 218 GLY A C   1 
ATOM   1168 O O   . GLY A 1 218 ? 69.608 32.194 100.344 1.00 16.03 ? 218 GLY A O   1 
ATOM   1169 N N   . ASP A 1 219 ? 69.961 31.672 98.188  1.00 14.69 ? 219 ASP A N   1 
ATOM   1170 C CA  . ASP A 1 219 ? 70.102 33.075 97.800  1.00 16.07 ? 219 ASP A CA  1 
ATOM   1171 C C   . ASP A 1 219 ? 69.302 33.474 96.557  1.00 15.79 ? 219 ASP A C   1 
ATOM   1172 O O   . ASP A 1 219 ? 69.638 34.462 95.896  1.00 16.48 ? 219 ASP A O   1 
ATOM   1173 C CB  . ASP A 1 219 ? 71.585 33.424 97.583  1.00 17.87 ? 219 ASP A CB  1 
ATOM   1174 C CG  . ASP A 1 219 ? 72.201 32.687 96.400  1.00 20.73 ? 219 ASP A CG  1 
ATOM   1175 O OD1 . ASP A 1 219 ? 71.452 32.087 95.606  1.00 19.74 ? 219 ASP A OD1 1 
ATOM   1176 O OD2 . ASP A 1 219 ? 73.444 32.718 96.260  1.00 22.00 ? 219 ASP A OD2 1 
ATOM   1177 N N   . TRP A 1 220 ? 68.248 32.709 96.267  1.00 13.91 ? 220 TRP A N   1 
ATOM   1178 C CA  . TRP A 1 220 ? 67.354 32.917 95.119  1.00 14.33 ? 220 TRP A CA  1 
ATOM   1179 C C   . TRP A 1 220 ? 67.872 32.246 93.843  1.00 14.11 ? 220 TRP A C   1 
ATOM   1180 O O   . TRP A 1 220 ? 67.121 32.092 92.878  1.00 16.18 ? 220 TRP A O   1 
ATOM   1181 C CB  . TRP A 1 220 ? 67.142 34.411 94.817  1.00 14.38 ? 220 TRP A CB  1 
ATOM   1182 C CG  . TRP A 1 220 ? 66.434 35.240 95.873  1.00 14.13 ? 220 TRP A CG  1 
ATOM   1183 C CD1 . TRP A 1 220 ? 66.803 36.486 96.302  1.00 15.49 ? 220 TRP A CD1 1 
ATOM   1184 C CD2 . TRP A 1 220 ? 65.198 34.939 96.548  1.00 14.47 ? 220 TRP A CD2 1 
ATOM   1185 N NE1 . TRP A 1 220 ? 65.879 36.979 97.190  1.00 15.96 ? 220 TRP A NE1 1 
ATOM   1186 C CE2 . TRP A 1 220 ? 64.885 36.053 97.361  1.00 14.67 ? 220 TRP A CE2 1 
ATOM   1187 C CE3 . TRP A 1 220 ? 64.326 33.841 96.541  1.00 15.31 ? 220 TRP A CE3 1 
ATOM   1188 C CZ2 . TRP A 1 220 ? 63.734 36.103 98.163  1.00 15.03 ? 220 TRP A CZ2 1 
ATOM   1189 C CZ3 . TRP A 1 220 ? 63.177 33.891 97.341  1.00 13.62 ? 220 TRP A CZ3 1 
ATOM   1190 C CH2 . TRP A 1 220 ? 62.897 35.017 98.139  1.00 12.46 ? 220 TRP A CH2 1 
ATOM   1191 N N   . SER A 1 221 ? 69.139 31.839 93.833  1.00 15.07 ? 221 SER A N   1 
ATOM   1192 C CA  . SER A 1 221 ? 69.712 31.213 92.636  1.00 13.57 ? 221 SER A CA  1 
ATOM   1193 C C   . SER A 1 221 ? 69.536 29.703 92.569  1.00 15.37 ? 221 SER A C   1 
ATOM   1194 O O   . SER A 1 221 ? 69.424 29.024 93.593  1.00 15.24 ? 221 SER A O   1 
ATOM   1195 C CB  . SER A 1 221 ? 71.209 31.533 92.523  1.00 15.62 ? 221 SER A CB  1 
ATOM   1196 O OG  . SER A 1 221 ? 71.963 30.806 93.482  1.00 15.88 ? 221 SER A OG  1 
ATOM   1197 N N   . ALA A 1 222 ? 69.521 29.176 91.348  1.00 13.96 ? 222 ALA A N   1 
ATOM   1198 C CA  . ALA A 1 222 ? 69.380 27.744 91.154  1.00 14.07 ? 222 ALA A CA  1 
ATOM   1199 C C   . ALA A 1 222 ? 70.538 27.008 91.817  1.00 14.86 ? 222 ALA A C   1 
ATOM   1200 O O   . ALA A 1 222 ? 70.341 25.961 92.432  1.00 15.72 ? 222 ALA A O   1 
ATOM   1201 C CB  . ALA A 1 222 ? 69.332 27.412 89.659  1.00 15.34 ? 222 ALA A CB  1 
ATOM   1202 N N   . MET A 1 223 ? 71.746 27.555 91.709  1.00 16.19 ? 223 MET A N   1 
ATOM   1203 C CA  . MET A 1 223 ? 72.896 26.887 92.302  1.00 17.04 ? 223 MET A CA  1 
ATOM   1204 C C   . MET A 1 223 ? 72.767 26.770 93.816  1.00 15.63 ? 223 MET A C   1 
ATOM   1205 O O   . MET A 1 223 ? 73.181 25.767 94.393  1.00 16.48 ? 223 MET A O   1 
ATOM   1206 C CB  . MET A 1 223 ? 74.199 27.606 91.944  1.00 19.37 ? 223 MET A CB  1 
ATOM   1207 C CG  . MET A 1 223 ? 75.455 26.823 92.344  1.00 23.15 ? 223 MET A CG  1 
ATOM   1208 S SD  . MET A 1 223 ? 75.513 25.136 91.651  1.00 29.02 ? 223 MET A SD  1 
ATOM   1209 C CE  . MET A 1 223 ? 75.961 25.486 89.951  1.00 28.34 ? 223 MET A CE  1 
ATOM   1210 N N   . SER A 1 224 ? 72.188 27.776 94.465  1.00 15.77 ? 224 SER A N   1 
ATOM   1211 C CA  . SER A 1 224 ? 72.036 27.694 95.919  1.00 16.42 ? 224 SER A CA  1 
ATOM   1212 C C   . SER A 1 224 ? 71.029 26.596 96.261  1.00 17.09 ? 224 SER A C   1 
ATOM   1213 O O   . SER A 1 224 ? 71.162 25.913 97.278  1.00 16.67 ? 224 SER A O   1 
ATOM   1214 C CB  . SER A 1 224 ? 71.594 29.043 96.511  1.00 17.33 ? 224 SER A CB  1 
ATOM   1215 O OG  . SER A 1 224 ? 70.233 29.335 96.243  1.00 19.62 ? 224 SER A OG  1 
ATOM   1216 N N   . GLY A 1 225 ? 70.026 26.417 95.406  1.00 15.93 ? 225 GLY A N   1 
ATOM   1217 C CA  . GLY A 1 225 ? 69.042 25.374 95.645  1.00 14.82 ? 225 GLY A CA  1 
ATOM   1218 C C   . GLY A 1 225 ? 69.695 24.012 95.502  1.00 16.11 ? 225 GLY A C   1 
ATOM   1219 O O   . GLY A 1 225 ? 69.407 23.077 96.250  1.00 14.51 ? 225 GLY A O   1 
ATOM   1220 N N   . PHE A 1 226 ? 70.589 23.900 94.526  1.00 14.01 ? 226 PHE A N   1 
ATOM   1221 C CA  . PHE A 1 226 ? 71.300 22.652 94.284  1.00 15.31 ? 226 PHE A CA  1 
ATOM   1222 C C   . PHE A 1 226 ? 72.229 22.325 95.454  1.00 15.59 ? 226 PHE A C   1 
ATOM   1223 O O   . PHE A 1 226 ? 72.235 21.202 95.965  1.00 16.64 ? 226 PHE A O   1 
ATOM   1224 C CB  . PHE A 1 226 ? 72.134 22.765 93.006  1.00 14.70 ? 226 PHE A CB  1 
ATOM   1225 C CG  . PHE A 1 226 ? 72.989 21.560 92.735  1.00 15.62 ? 226 PHE A CG  1 
ATOM   1226 C CD1 . PHE A 1 226 ? 72.427 20.388 92.241  1.00 15.04 ? 226 PHE A CD1 1 
ATOM   1227 C CD2 . PHE A 1 226 ? 74.356 21.589 92.999  1.00 17.34 ? 226 PHE A CD2 1 
ATOM   1228 C CE1 . PHE A 1 226 ? 73.212 19.258 92.014  1.00 16.59 ? 226 PHE A CE1 1 
ATOM   1229 C CE2 . PHE A 1 226 ? 75.148 20.464 92.776  1.00 16.76 ? 226 PHE A CE2 1 
ATOM   1230 C CZ  . PHE A 1 226 ? 74.574 19.298 92.283  1.00 17.02 ? 226 PHE A CZ  1 
ATOM   1231 N N   . GLN A 1 227 ? 73.017 23.312 95.867  1.00 16.53 ? 227 GLN A N   1 
ATOM   1232 C CA  . GLN A 1 227 ? 73.968 23.124 96.960  1.00 18.09 ? 227 GLN A CA  1 
ATOM   1233 C C   . GLN A 1 227 ? 73.291 22.777 98.281  1.00 17.65 ? 227 GLN A C   1 
ATOM   1234 O O   . GLN A 1 227 ? 73.674 21.817 98.948  1.00 17.91 ? 227 GLN A O   1 
ATOM   1235 C CB  . GLN A 1 227 ? 74.819 24.380 97.138  1.00 19.32 ? 227 GLN A CB  1 
ATOM   1236 C CG  . GLN A 1 227 ? 75.617 24.761 95.900  1.00 26.63 ? 227 GLN A CG  1 
ATOM   1237 C CD  . GLN A 1 227 ? 76.390 26.055 96.072  1.00 29.33 ? 227 GLN A CD  1 
ATOM   1238 O OE1 . GLN A 1 227 ? 75.837 27.071 96.495  1.00 33.63 ? 227 GLN A OE1 1 
ATOM   1239 N NE2 . GLN A 1 227 ? 77.671 26.027 95.731  1.00 33.15 ? 227 GLN A NE2 1 
ATOM   1240 N N   . GLN A 1 228 ? 72.286 23.557 98.660  1.00 17.57 ? 228 GLN A N   1 
ATOM   1241 C CA  . GLN A 1 228 ? 71.587 23.309 99.918  1.00 16.29 ? 228 GLN A CA  1 
ATOM   1242 C C   . GLN A 1 228 ? 70.902 21.951 99.943  1.00 17.44 ? 228 GLN A C   1 
ATOM   1243 O O   . GLN A 1 228 ? 70.933 21.244 100.959 1.00 16.42 ? 228 GLN A O   1 
ATOM   1244 C CB  . GLN A 1 228 ? 70.560 24.415 100.181 1.00 15.19 ? 228 GLN A CB  1 
ATOM   1245 C CG  . GLN A 1 228 ? 71.188 25.768 100.473 1.00 16.16 ? 228 GLN A CG  1 
ATOM   1246 C CD  . GLN A 1 228 ? 72.151 25.710 101.645 1.00 17.77 ? 228 GLN A CD  1 
ATOM   1247 O OE1 . GLN A 1 228 ? 71.802 25.228 102.721 1.00 18.78 ? 228 GLN A OE1 1 
ATOM   1248 N NE2 . GLN A 1 228 ? 73.368 26.205 101.441 1.00 18.64 ? 228 GLN A NE2 1 
ATOM   1249 N N   . THR A 1 229 ? 70.284 21.578 98.828  1.00 15.57 ? 229 THR A N   1 
ATOM   1250 C CA  . THR A 1 229 ? 69.593 20.300 98.753  1.00 16.25 ? 229 THR A CA  1 
ATOM   1251 C C   . THR A 1 229 ? 70.588 19.142 98.781  1.00 17.84 ? 229 THR A C   1 
ATOM   1252 O O   . THR A 1 229 ? 70.352 18.133 99.444  1.00 17.94 ? 229 THR A O   1 
ATOM   1253 C CB  . THR A 1 229 ? 68.716 20.225 97.492  1.00 15.90 ? 229 THR A CB  1 
ATOM   1254 O OG1 . THR A 1 229 ? 67.781 21.312 97.513  1.00 16.85 ? 229 THR A OG1 1 
ATOM   1255 C CG2 . THR A 1 229 ? 67.944 18.909 97.447  1.00 16.20 ? 229 THR A CG2 1 
ATOM   1256 N N   . MET A 1 230 ? 71.702 19.283 98.068  1.00 17.87 ? 230 MET A N   1 
ATOM   1257 C CA  . MET A 1 230 ? 72.711 18.230 98.066  1.00 20.27 ? 230 MET A CA  1 
ATOM   1258 C C   . MET A 1 230 ? 73.278 18.055 99.471  1.00 19.85 ? 230 MET A C   1 
ATOM   1259 O O   . MET A 1 230 ? 73.518 16.933 99.915  1.00 21.38 ? 230 MET A O   1 
ATOM   1260 C CB  . MET A 1 230 ? 73.851 18.561 97.098  1.00 22.59 ? 230 MET A CB  1 
ATOM   1261 C CG  . MET A 1 230 ? 73.535 18.302 95.635  1.00 25.58 ? 230 MET A CG  1 
ATOM   1262 S SD  . MET A 1 230 ? 73.072 16.585 95.309  1.00 30.18 ? 230 MET A SD  1 
ATOM   1263 C CE  . MET A 1 230 ? 74.383 15.716 96.117  1.00 28.41 ? 230 MET A CE  1 
ATOM   1264 N N   . GLN A 1 231 ? 73.490 19.166 100.171 1.00 19.82 ? 231 GLN A N   1 
ATOM   1265 C CA  . GLN A 1 231 ? 74.036 19.108 101.526 1.00 21.74 ? 231 GLN A CA  1 
ATOM   1266 C C   . GLN A 1 231 ? 73.071 18.399 102.465 1.00 21.37 ? 231 GLN A C   1 
ATOM   1267 O O   . GLN A 1 231 ? 73.486 17.621 103.327 1.00 22.09 ? 231 GLN A O   1 
ATOM   1268 C CB  . GLN A 1 231 ? 74.335 20.518 102.042 1.00 22.89 ? 231 GLN A CB  1 
ATOM   1269 C CG  . GLN A 1 231 ? 75.447 21.218 101.270 1.00 27.56 ? 231 GLN A CG  1 
ATOM   1270 C CD  . GLN A 1 231 ? 75.785 22.591 101.819 1.00 29.37 ? 231 GLN A CD  1 
ATOM   1271 O OE1 . GLN A 1 231 ? 76.552 23.342 101.214 1.00 33.59 ? 231 GLN A OE1 1 
ATOM   1272 N NE2 . GLN A 1 231 ? 75.219 22.926 102.971 1.00 29.97 ? 231 GLN A NE2 1 
ATOM   1273 N N   . MET A 1 232 ? 71.782 18.672 102.290 1.00 19.73 ? 232 MET A N   1 
ATOM   1274 C CA  . MET A 1 232 ? 70.745 18.051 103.105 1.00 20.68 ? 232 MET A CA  1 
ATOM   1275 C C   . MET A 1 232 ? 70.721 16.546 102.856 1.00 21.31 ? 232 MET A C   1 
ATOM   1276 O O   . MET A 1 232 ? 70.732 15.744 103.794 1.00 20.73 ? 232 MET A O   1 
ATOM   1277 C CB  . MET A 1 232 ? 69.380 18.648 102.759 1.00 19.89 ? 232 MET A CB  1 
ATOM   1278 C CG  . MET A 1 232 ? 68.216 17.981 103.473 1.00 20.28 ? 232 MET A CG  1 
ATOM   1279 S SD  . MET A 1 232 ? 66.630 18.619 102.919 1.00 20.28 ? 232 MET A SD  1 
ATOM   1280 C CE  . MET A 1 232 ? 66.508 17.846 101.296 1.00 21.60 ? 232 MET A CE  1 
ATOM   1281 N N   . LEU A 1 233 ? 70.694 16.166 101.582 1.00 21.04 ? 233 LEU A N   1 
ATOM   1282 C CA  . LEU A 1 233 ? 70.667 14.759 101.209 1.00 22.59 ? 233 LEU A CA  1 
ATOM   1283 C C   . LEU A 1 233 ? 71.933 14.026 101.643 1.00 23.20 ? 233 LEU A C   1 
ATOM   1284 O O   . LEU A 1 233 ? 71.865 12.889 102.111 1.00 24.43 ? 233 LEU A O   1 
ATOM   1285 C CB  . LEU A 1 233 ? 70.477 14.620 99.696  1.00 21.93 ? 233 LEU A CB  1 
ATOM   1286 C CG  . LEU A 1 233 ? 69.156 15.173 99.156  1.00 22.89 ? 233 LEU A CG  1 
ATOM   1287 C CD1 . LEU A 1 233 ? 69.145 15.074 97.637  1.00 23.74 ? 233 LEU A CD1 1 
ATOM   1288 C CD2 . LEU A 1 233 ? 67.986 14.398 99.751  1.00 21.75 ? 233 LEU A CD2 1 
ATOM   1289 N N   . ASN A 1 234 ? 73.086 14.669 101.490 1.00 24.85 ? 234 ASN A N   1 
ATOM   1290 C CA  . ASN A 1 234 ? 74.343 14.043 101.882 1.00 26.71 ? 234 ASN A CA  1 
ATOM   1291 C C   . ASN A 1 234 ? 74.400 13.833 103.394 1.00 28.26 ? 234 ASN A C   1 
ATOM   1292 O O   . ASN A 1 234 ? 75.162 12.995 103.880 1.00 28.50 ? 234 ASN A O   1 
ATOM   1293 C CB  . ASN A 1 234 ? 75.542 14.885 101.428 1.00 27.74 ? 234 ASN A CB  1 
ATOM   1294 C CG  . ASN A 1 234 ? 75.701 14.911 99.915  1.00 29.47 ? 234 ASN A CG  1 
ATOM   1295 O OD1 . ASN A 1 234 ? 75.319 13.969 99.222  1.00 30.16 ? 234 ASN A OD1 1 
ATOM   1296 N ND2 . ASN A 1 234 ? 76.286 15.987 99.400  1.00 30.77 ? 234 ASN A ND2 1 
ATOM   1297 N N   . GLU A 1 235 ? 73.592 14.594 104.130 1.00 27.99 ? 235 GLU A N   1 
ATOM   1298 C CA  . GLU A 1 235 ? 73.532 14.485 105.590 1.00 29.61 ? 235 GLU A CA  1 
ATOM   1299 C C   . GLU A 1 235 ? 72.675 13.302 106.018 1.00 28.86 ? 235 GLU A C   1 
ATOM   1300 O O   . GLU A 1 235 ? 72.652 12.936 107.194 1.00 29.72 ? 235 GLU A O   1 
ATOM   1301 C CB  . GLU A 1 235 ? 72.925 15.747 106.211 1.00 31.67 ? 235 GLU A CB  1 
ATOM   1302 C CG  . GLU A 1 235 ? 73.861 16.922 106.368 1.00 35.64 ? 235 GLU A CG  1 
ATOM   1303 C CD  . GLU A 1 235 ? 73.261 18.002 107.249 1.00 37.30 ? 235 GLU A CD  1 
ATOM   1304 O OE1 . GLU A 1 235 ? 72.193 18.545 106.892 1.00 37.71 ? 235 GLU A OE1 1 
ATOM   1305 O OE2 . GLU A 1 235 ? 73.854 18.303 108.305 1.00 40.13 ? 235 GLU A OE2 1 
ATOM   1306 N N   . GLY A 1 236 ? 71.954 12.717 105.069 1.00 27.47 ? 236 GLY A N   1 
ATOM   1307 C CA  . GLY A 1 236 ? 71.096 11.595 105.395 1.00 26.70 ? 236 GLY A CA  1 
ATOM   1308 C C   . GLY A 1 236 ? 69.675 12.046 105.677 1.00 26.10 ? 236 GLY A C   1 
ATOM   1309 O O   . GLY A 1 236 ? 68.837 11.255 106.108 1.00 26.49 ? 236 GLY A O   1 
ATOM   1310 N N   . ILE A 1 237 ? 69.401 13.326 105.441 1.00 23.70 ? 237 ILE A N   1 
ATOM   1311 C CA  . ILE A 1 237 ? 68.066 13.867 105.657 1.00 22.32 ? 237 ILE A CA  1 
ATOM   1312 C C   . ILE A 1 237 ? 67.321 13.802 104.331 1.00 22.36 ? 237 ILE A C   1 
ATOM   1313 O O   . ILE A 1 237 ? 67.622 14.553 103.402 1.00 22.19 ? 237 ILE A O   1 
ATOM   1314 C CB  . ILE A 1 237 ? 68.128 15.325 106.151 1.00 22.03 ? 237 ILE A CB  1 
ATOM   1315 C CG1 . ILE A 1 237 ? 68.874 15.379 107.487 1.00 23.76 ? 237 ILE A CG1 1 
ATOM   1316 C CG2 . ILE A 1 237 ? 66.719 15.889 106.299 1.00 21.80 ? 237 ILE A CG2 1 
ATOM   1317 C CD1 . ILE A 1 237 ? 69.021 16.774 108.068 1.00 25.62 ? 237 ILE A CD1 1 
ATOM   1318 N N   . VAL A 1 238 ? 66.353 12.895 104.248 1.00 21.64 ? 238 VAL A N   1 
ATOM   1319 C CA  . VAL A 1 238 ? 65.586 12.711 103.023 1.00 22.04 ? 238 VAL A CA  1 
ATOM   1320 C C   . VAL A 1 238 ? 64.096 12.917 103.252 1.00 21.46 ? 238 VAL A C   1 
ATOM   1321 O O   . VAL A 1 238 ? 63.385 12.011 103.693 1.00 22.35 ? 238 VAL A O   1 
ATOM   1322 C CB  . VAL A 1 238 ? 65.807 11.292 102.438 1.00 23.30 ? 238 VAL A CB  1 
ATOM   1323 C CG1 . VAL A 1 238 ? 65.157 11.180 101.067 1.00 23.98 ? 238 VAL A CG1 1 
ATOM   1324 C CG2 . VAL A 1 238 ? 67.293 10.994 102.352 1.00 23.98 ? 238 VAL A CG2 1 
ATOM   1325 N N   . PRO A 1 239 ? 63.599 14.123 102.955 1.00 19.23 ? 239 PRO A N   1 
ATOM   1326 C CA  . PRO A 1 239 ? 62.177 14.404 103.142 1.00 18.31 ? 239 PRO A CA  1 
ATOM   1327 C C   . PRO A 1 239 ? 61.398 13.794 101.985 1.00 18.26 ? 239 PRO A C   1 
ATOM   1328 O O   . PRO A 1 239 ? 61.993 13.336 101.011 1.00 19.22 ? 239 PRO A O   1 
ATOM   1329 C CB  . PRO A 1 239 ? 62.133 15.926 103.117 1.00 19.56 ? 239 PRO A CB  1 
ATOM   1330 C CG  . PRO A 1 239 ? 63.162 16.243 102.060 1.00 19.39 ? 239 PRO A CG  1 
ATOM   1331 C CD  . PRO A 1 239 ? 64.309 15.308 102.435 1.00 20.85 ? 239 PRO A CD  1 
ATOM   1332 N N   . THR A 1 240 ? 60.075 13.767 102.095 1.00 17.29 ? 240 THR A N   1 
ATOM   1333 C CA  . THR A 1 240 ? 59.261 13.255 101.005 1.00 17.06 ? 240 THR A CA  1 
ATOM   1334 C C   . THR A 1 240 ? 58.796 14.456 100.185 1.00 16.47 ? 240 THR A C   1 
ATOM   1335 O O   . THR A 1 240 ? 58.321 14.309 99.064  1.00 16.34 ? 240 THR A O   1 
ATOM   1336 C CB  . THR A 1 240 ? 58.034 12.454 101.506 1.00 17.74 ? 240 THR A CB  1 
ATOM   1337 O OG1 . THR A 1 240 ? 57.237 13.266 102.376 1.00 17.85 ? 240 THR A OG1 1 
ATOM   1338 C CG2 . THR A 1 240 ? 58.487 11.198 102.243 1.00 17.69 ? 240 THR A CG2 1 
ATOM   1339 N N   . ALA A 1 241 ? 58.953 15.652 100.748 1.00 17.17 ? 241 ALA A N   1 
ATOM   1340 C CA  . ALA A 1 241 ? 58.553 16.871 100.052 1.00 17.07 ? 241 ALA A CA  1 
ATOM   1341 C C   . ALA A 1 241 ? 59.358 18.080 100.511 1.00 15.91 ? 241 ALA A C   1 
ATOM   1342 O O   . ALA A 1 241 ? 59.832 18.138 101.647 1.00 14.98 ? 241 ALA A O   1 
ATOM   1343 C CB  . ALA A 1 241 ? 57.061 17.130 100.259 1.00 17.56 ? 241 ALA A CB  1 
ATOM   1344 N N   . MET A 1 242 ? 59.504 19.047 99.611  1.00 14.94 ? 242 MET A N   1 
ATOM   1345 C CA  . MET A 1 242 ? 60.241 20.267 99.904  1.00 15.16 ? 242 MET A CA  1 
ATOM   1346 C C   . MET A 1 242 ? 59.460 21.501 99.475  1.00 14.80 ? 242 MET A C   1 
ATOM   1347 O O   . MET A 1 242 ? 58.868 21.525 98.397  1.00 15.64 ? 242 MET A O   1 
ATOM   1348 C CB  . MET A 1 242 ? 61.584 20.280 99.159  1.00 15.67 ? 242 MET A CB  1 
ATOM   1349 C CG  . MET A 1 242 ? 62.583 19.213 99.569  1.00 17.92 ? 242 MET A CG  1 
ATOM   1350 S SD  . MET A 1 242 ? 64.097 19.350 98.581  1.00 18.83 ? 242 MET A SD  1 
ATOM   1351 C CE  . MET A 1 242 ? 64.875 20.771 99.321  1.00 18.92 ? 242 MET A CE  1 
ATOM   1352 N N   . LEU A 1 243 ? 59.445 22.516 100.335 1.00 12.63 ? 243 LEU A N   1 
ATOM   1353 C CA  . LEU A 1 243 ? 58.817 23.792 100.013 1.00 12.76 ? 243 LEU A CA  1 
ATOM   1354 C C   . LEU A 1 243 ? 60.027 24.676 99.717  1.00 13.10 ? 243 LEU A C   1 
ATOM   1355 O O   . LEU A 1 243 ? 60.888 24.860 100.577 1.00 12.93 ? 243 LEU A O   1 
ATOM   1356 C CB  . LEU A 1 243 ? 58.034 24.333 101.217 1.00 13.08 ? 243 LEU A CB  1 
ATOM   1357 C CG  . LEU A 1 243 ? 56.679 23.658 101.431 1.00 14.55 ? 243 LEU A CG  1 
ATOM   1358 C CD1 . LEU A 1 243 ? 56.181 23.923 102.851 1.00 15.13 ? 243 LEU A CD1 1 
ATOM   1359 C CD2 . LEU A 1 243 ? 55.686 24.170 100.397 1.00 14.95 ? 243 LEU A CD2 1 
ATOM   1360 N N   . VAL A 1 244 ? 60.110 25.199 98.495  1.00 12.51 ? 244 VAL A N   1 
ATOM   1361 C CA  . VAL A 1 244 ? 61.247 26.029 98.096  1.00 13.74 ? 244 VAL A CA  1 
ATOM   1362 C C   . VAL A 1 244 ? 60.811 27.473 97.836  1.00 12.43 ? 244 VAL A C   1 
ATOM   1363 O O   . VAL A 1 244 ? 59.759 27.715 97.244  1.00 12.68 ? 244 VAL A O   1 
ATOM   1364 C CB  . VAL A 1 244 ? 61.928 25.423 96.847  1.00 13.34 ? 244 VAL A CB  1 
ATOM   1365 C CG1 . VAL A 1 244 ? 63.190 26.196 96.509  1.00 14.64 ? 244 VAL A CG1 1 
ATOM   1366 C CG2 . VAL A 1 244 ? 62.257 23.956 97.113  1.00 17.01 ? 244 VAL A CG2 1 
ATOM   1367 N N   . ALA A 1 245 ? 61.639 28.422 98.275  1.00 13.04 ? 245 ALA A N   1 
ATOM   1368 C CA  . ALA A 1 245 ? 61.328 29.847 98.197  1.00 12.38 ? 245 ALA A CA  1 
ATOM   1369 C C   . ALA A 1 245 ? 61.102 30.480 96.827  1.00 12.29 ? 245 ALA A C   1 
ATOM   1370 O O   . ALA A 1 245 ? 60.485 31.538 96.739  1.00 12.99 ? 245 ALA A O   1 
ATOM   1371 C CB  . ALA A 1 245 ? 62.371 30.645 98.984  1.00 15.40 ? 245 ALA A CB  1 
ATOM   1372 N N   . ASN A 1 246 ? 61.628 29.875 95.770  1.00 12.69 ? 246 ASN A N   1 
ATOM   1373 C CA  . ASN A 1 246 ? 61.352 30.396 94.435  1.00 12.16 ? 246 ASN A CA  1 
ATOM   1374 C C   . ASN A 1 246 ? 61.606 29.312 93.409  1.00 12.14 ? 246 ASN A C   1 
ATOM   1375 O O   . ASN A 1 246 ? 62.176 28.270 93.727  1.00 12.71 ? 246 ASN A O   1 
ATOM   1376 C CB  . ASN A 1 246 ? 62.115 31.714 94.150  1.00 12.76 ? 246 ASN A CB  1 
ATOM   1377 C CG  . ASN A 1 246 ? 63.571 31.515 93.761  1.00 11.82 ? 246 ASN A CG  1 
ATOM   1378 O OD1 . ASN A 1 246 ? 64.161 30.467 93.988  1.00 16.14 ? 246 ASN A OD1 1 
ATOM   1379 N ND2 . ASN A 1 246 ? 64.165 32.563 93.183  1.00 14.67 ? 246 ASN A ND2 1 
ATOM   1380 N N   . ASP A 1 247 ? 61.145 29.531 92.185  1.00 11.82 ? 247 ASP A N   1 
ATOM   1381 C CA  . ASP A 1 247 ? 61.291 28.518 91.156  1.00 13.30 ? 247 ASP A CA  1 
ATOM   1382 C C   . ASP A 1 247 ? 62.727 28.197 90.770  1.00 11.54 ? 247 ASP A C   1 
ATOM   1383 O O   . ASP A 1 247 ? 63.048 27.044 90.497  1.00 12.93 ? 247 ASP A O   1 
ATOM   1384 C CB  . ASP A 1 247 ? 60.481 28.914 89.918  1.00 13.18 ? 247 ASP A CB  1 
ATOM   1385 C CG  . ASP A 1 247 ? 58.984 28.903 90.175  1.00 15.60 ? 247 ASP A CG  1 
ATOM   1386 O OD1 . ASP A 1 247 ? 58.553 28.304 91.189  1.00 15.04 ? 247 ASP A OD1 1 
ATOM   1387 O OD2 . ASP A 1 247 ? 58.233 29.480 89.362  1.00 16.73 ? 247 ASP A OD2 1 
ATOM   1388 N N   . GLN A 1 248 ? 63.596 29.199 90.750  1.00 13.03 ? 248 GLN A N   1 
ATOM   1389 C CA  . GLN A 1 248 ? 64.983 28.943 90.391  1.00 14.36 ? 248 GLN A CA  1 
ATOM   1390 C C   . GLN A 1 248 ? 65.674 28.068 91.431  1.00 13.60 ? 248 GLN A C   1 
ATOM   1391 O O   . GLN A 1 248 ? 66.405 27.150 91.076  1.00 13.00 ? 248 GLN A O   1 
ATOM   1392 C CB  . GLN A 1 248 ? 65.729 30.259 90.195  1.00 15.34 ? 248 GLN A CB  1 
ATOM   1393 C CG  . GLN A 1 248 ? 65.345 30.954 88.899  1.00 18.85 ? 248 GLN A CG  1 
ATOM   1394 C CD  . GLN A 1 248 ? 65.731 32.410 88.891  1.00 20.17 ? 248 GLN A CD  1 
ATOM   1395 O OE1 . GLN A 1 248 ? 65.123 33.224 89.582  1.00 22.75 ? 248 GLN A OE1 1 
ATOM   1396 N NE2 . GLN A 1 248 ? 66.755 32.749 88.115  1.00 22.74 ? 248 GLN A NE2 1 
ATOM   1397 N N   . MET A 1 249 ? 65.450 28.335 92.714  1.00 14.04 ? 249 MET A N   1 
ATOM   1398 C CA  . MET A 1 249 ? 66.067 27.482 93.719  1.00 13.38 ? 249 MET A CA  1 
ATOM   1399 C C   . MET A 1 249 ? 65.440 26.096 93.619  1.00 13.09 ? 249 MET A C   1 
ATOM   1400 O O   . MET A 1 249 ? 66.101 25.093 93.877  1.00 13.75 ? 249 MET A O   1 
ATOM   1401 C CB  . MET A 1 249 ? 65.872 28.053 95.129  1.00 12.76 ? 249 MET A CB  1 
ATOM   1402 C CG  . MET A 1 249 ? 66.668 29.319 95.376  1.00 13.93 ? 249 MET A CG  1 
ATOM   1403 S SD  . MET A 1 249 ? 66.742 29.750 97.122  1.00 18.06 ? 249 MET A SD  1 
ATOM   1404 C CE  . MET A 1 249 ? 65.106 30.262 97.398  1.00 22.58 ? 249 MET A CE  1 
ATOM   1405 N N   . ALA A 1 250 ? 64.167 26.038 93.234  1.00 12.56 ? 250 ALA A N   1 
ATOM   1406 C CA  . ALA A 1 250 ? 63.489 24.749 93.097  1.00 12.85 ? 250 ALA A CA  1 
ATOM   1407 C C   . ALA A 1 250 ? 64.138 23.951 91.973  1.00 12.60 ? 250 ALA A C   1 
ATOM   1408 O O   . ALA A 1 250 ? 64.270 22.732 92.065  1.00 12.46 ? 250 ALA A O   1 
ATOM   1409 C CB  . ALA A 1 250 ? 61.999 24.945 92.816  1.00 12.72 ? 250 ALA A CB  1 
ATOM   1410 N N   . LEU A 1 251 ? 64.535 24.640 90.906  1.00 13.83 ? 251 LEU A N   1 
ATOM   1411 C CA  . LEU A 1 251 ? 65.192 23.980 89.782  1.00 14.41 ? 251 LEU A CA  1 
ATOM   1412 C C   . LEU A 1 251 ? 66.469 23.317 90.295  1.00 14.03 ? 251 LEU A C   1 
ATOM   1413 O O   . LEU A 1 251 ? 66.779 22.174 89.942  1.00 15.56 ? 251 LEU A O   1 
ATOM   1414 C CB  . LEU A 1 251 ? 65.547 25.005 88.699  1.00 13.63 ? 251 LEU A CB  1 
ATOM   1415 C CG  . LEU A 1 251 ? 66.362 24.479 87.508  1.00 16.74 ? 251 LEU A CG  1 
ATOM   1416 C CD1 . LEU A 1 251 ? 65.494 23.576 86.642  1.00 18.08 ? 251 LEU A CD1 1 
ATOM   1417 C CD2 . LEU A 1 251 ? 66.872 25.658 86.692  1.00 15.90 ? 251 LEU A CD2 1 
ATOM   1418 N N   . GLY A 1 252 ? 67.206 24.049 91.124  1.00 13.59 ? 252 GLY A N   1 
ATOM   1419 C CA  . GLY A 1 252 ? 68.436 23.528 91.688  1.00 14.13 ? 252 GLY A CA  1 
ATOM   1420 C C   . GLY A 1 252 ? 68.163 22.318 92.564  1.00 14.20 ? 252 GLY A C   1 
ATOM   1421 O O   . GLY A 1 252 ? 68.885 21.328 92.507  1.00 13.91 ? 252 GLY A O   1 
ATOM   1422 N N   . ALA A 1 253 ? 67.116 22.401 93.379  1.00 14.76 ? 253 ALA A N   1 
ATOM   1423 C CA  . ALA A 1 253 ? 66.748 21.295 94.259  1.00 15.29 ? 253 ALA A CA  1 
ATOM   1424 C C   . ALA A 1 253 ? 66.392 20.070 93.430  1.00 15.22 ? 253 ALA A C   1 
ATOM   1425 O O   . ALA A 1 253 ? 66.793 18.952 93.747  1.00 15.57 ? 253 ALA A O   1 
ATOM   1426 C CB  . ALA A 1 253 ? 65.561 21.694 95.135  1.00 14.18 ? 253 ALA A CB  1 
ATOM   1427 N N   . MET A 1 254 ? 65.632 20.288 92.363  1.00 14.61 ? 254 MET A N   1 
ATOM   1428 C CA  . MET A 1 254 ? 65.221 19.199 91.489  1.00 15.02 ? 254 MET A CA  1 
ATOM   1429 C C   . MET A 1 254 ? 66.437 18.515 90.873  1.00 14.87 ? 254 MET A C   1 
ATOM   1430 O O   . MET A 1 254 ? 66.469 17.290 90.741  1.00 16.60 ? 254 MET A O   1 
ATOM   1431 C CB  . MET A 1 254 ? 64.291 19.736 90.401  1.00 16.48 ? 254 MET A CB  1 
ATOM   1432 C CG  . MET A 1 254 ? 62.914 20.122 90.929  1.00 17.54 ? 254 MET A CG  1 
ATOM   1433 S SD  . MET A 1 254 ? 61.940 21.066 89.745  1.00 19.60 ? 254 MET A SD  1 
ATOM   1434 C CE  . MET A 1 254 ? 61.832 19.886 88.398  1.00 20.97 ? 254 MET A CE  1 
ATOM   1435 N N   . ARG A 1 255 ? 67.440 19.301 90.500  1.00 15.53 ? 255 ARG A N   1 
ATOM   1436 C CA  . ARG A 1 255 ? 68.647 18.721 89.929  1.00 16.01 ? 255 ARG A CA  1 
ATOM   1437 C C   . ARG A 1 255 ? 69.366 17.886 90.989  1.00 16.68 ? 255 ARG A C   1 
ATOM   1438 O O   . ARG A 1 255 ? 69.838 16.787 90.706  1.00 16.91 ? 255 ARG A O   1 
ATOM   1439 C CB  . ARG A 1 255 ? 69.597 19.805 89.412  1.00 15.67 ? 255 ARG A CB  1 
ATOM   1440 C CG  . ARG A 1 255 ? 70.904 19.217 88.897  1.00 16.42 ? 255 ARG A CG  1 
ATOM   1441 C CD  . ARG A 1 255 ? 71.937 20.262 88.512  1.00 16.60 ? 255 ARG A CD  1 
ATOM   1442 N NE  . ARG A 1 255 ? 73.263 19.645 88.484  1.00 18.48 ? 255 ARG A NE  1 
ATOM   1443 C CZ  . ARG A 1 255 ? 74.395 20.274 88.777  1.00 18.53 ? 255 ARG A CZ  1 
ATOM   1444 N NH1 . ARG A 1 255 ? 74.385 21.555 89.115  1.00 19.71 ? 255 ARG A NH1 1 
ATOM   1445 N NH2 . ARG A 1 255 ? 75.541 19.603 88.774  1.00 21.55 ? 255 ARG A NH2 1 
ATOM   1446 N N   . ALA A 1 256 ? 69.439 18.405 92.211  1.00 16.87 ? 256 ALA A N   1 
ATOM   1447 C CA  . ALA A 1 256 ? 70.107 17.687 93.296  1.00 17.01 ? 256 ALA A CA  1 
ATOM   1448 C C   . ALA A 1 256 ? 69.409 16.354 93.547  1.00 18.01 ? 256 ALA A C   1 
ATOM   1449 O O   . ALA A 1 256 ? 70.055 15.313 93.672  1.00 19.16 ? 256 ALA A O   1 
ATOM   1450 C CB  . ALA A 1 256 ? 70.099 18.533 94.570  1.00 16.94 ? 256 ALA A CB  1 
ATOM   1451 N N   . ILE A 1 257 ? 68.085 16.397 93.623  1.00 18.13 ? 257 ILE A N   1 
ATOM   1452 C CA  . ILE A 1 257 ? 67.283 15.201 93.850  1.00 17.83 ? 257 ILE A CA  1 
ATOM   1453 C C   . ILE A 1 257 ? 67.556 14.163 92.764  1.00 19.84 ? 257 ILE A C   1 
ATOM   1454 O O   . ILE A 1 257 ? 67.848 13.000 93.050  1.00 18.80 ? 257 ILE A O   1 
ATOM   1455 C CB  . ILE A 1 257 ? 65.778 15.552 93.849  1.00 18.66 ? 257 ILE A CB  1 
ATOM   1456 C CG1 . ILE A 1 257 ? 65.453 16.427 95.064  1.00 18.47 ? 257 ILE A CG1 1 
ATOM   1457 C CG2 . ILE A 1 257 ? 64.934 14.282 93.859  1.00 19.26 ? 257 ILE A CG2 1 
ATOM   1458 C CD1 . ILE A 1 257 ? 64.098 17.106 94.992  1.00 17.67 ? 257 ILE A CD1 1 
ATOM   1459 N N   . THR A 1 258 ? 67.476 14.602 91.514  1.00 18.63 ? 258 THR A N   1 
ATOM   1460 C CA  . THR A 1 258 ? 67.688 13.719 90.375  1.00 20.29 ? 258 THR A CA  1 
ATOM   1461 C C   . THR A 1 258 ? 69.087 13.109 90.327  1.00 21.10 ? 258 THR A C   1 
ATOM   1462 O O   . THR A 1 258 ? 69.234 11.908 90.103  1.00 22.69 ? 258 THR A O   1 
ATOM   1463 C CB  . THR A 1 258 ? 67.421 14.468 89.056  1.00 20.16 ? 258 THR A CB  1 
ATOM   1464 O OG1 . THR A 1 258 ? 66.100 15.023 89.085  1.00 20.93 ? 258 THR A OG1 1 
ATOM   1465 C CG2 . THR A 1 258 ? 67.533 13.518 87.870  1.00 21.66 ? 258 THR A CG2 1 
ATOM   1466 N N   . GLU A 1 259 ? 70.113 13.925 90.541  1.00 22.03 ? 259 GLU A N   1 
ATOM   1467 C CA  . GLU A 1 259 ? 71.479 13.422 90.497  1.00 23.79 ? 259 GLU A CA  1 
ATOM   1468 C C   . GLU A 1 259 ? 71.793 12.521 91.685  1.00 25.67 ? 259 GLU A C   1 
ATOM   1469 O O   . GLU A 1 259 ? 72.779 11.781 91.666  1.00 26.58 ? 259 GLU A O   1 
ATOM   1470 C CB  . GLU A 1 259 ? 72.476 14.583 90.419  1.00 25.16 ? 259 GLU A CB  1 
ATOM   1471 C CG  . GLU A 1 259 ? 72.211 15.515 89.237  1.00 24.38 ? 259 GLU A CG  1 
ATOM   1472 C CD  . GLU A 1 259 ? 73.392 16.399 88.877  1.00 25.22 ? 259 GLU A CD  1 
ATOM   1473 O OE1 . GLU A 1 259 ? 74.196 16.734 89.771  1.00 22.50 ? 259 GLU A OE1 1 
ATOM   1474 O OE2 . GLU A 1 259 ? 73.503 16.776 87.689  1.00 24.68 ? 259 GLU A OE2 1 
ATOM   1475 N N   . SER A 1 260 ? 70.948 12.576 92.712  1.00 24.24 ? 260 SER A N   1 
ATOM   1476 C CA  . SER A 1 260 ? 71.135 11.744 93.896  1.00 25.76 ? 260 SER A CA  1 
ATOM   1477 C C   . SER A 1 260 ? 70.482 10.381 93.680  1.00 26.34 ? 260 SER A C   1 
ATOM   1478 O O   . SER A 1 260 ? 70.456 9.541  94.582  1.00 27.63 ? 260 SER A O   1 
ATOM   1479 C CB  . SER A 1 260 ? 70.525 12.419 95.128  1.00 24.70 ? 260 SER A CB  1 
ATOM   1480 O OG  . SER A 1 260 ? 71.250 13.584 95.479  1.00 25.24 ? 260 SER A OG  1 
ATOM   1481 N N   . GLY A 1 261 ? 69.946 10.174 92.482  1.00 26.32 ? 261 GLY A N   1 
ATOM   1482 C CA  . GLY A 1 261 ? 69.308 8.910  92.160  1.00 25.49 ? 261 GLY A CA  1 
ATOM   1483 C C   . GLY A 1 261 ? 67.856 8.810  92.583  1.00 25.44 ? 261 GLY A C   1 
ATOM   1484 O O   . GLY A 1 261 ? 67.306 7.712  92.662  1.00 26.52 ? 261 GLY A O   1 
ATOM   1485 N N   . LEU A 1 262 ? 67.229 9.952  92.853  1.00 23.73 ? 262 LEU A N   1 
ATOM   1486 C CA  . LEU A 1 262 ? 65.830 9.973  93.266  1.00 24.23 ? 262 LEU A CA  1 
ATOM   1487 C C   . LEU A 1 262 ? 64.955 10.634 92.209  1.00 23.81 ? 262 LEU A C   1 
ATOM   1488 O O   . LEU A 1 262 ? 65.444 11.365 91.347  1.00 24.93 ? 262 LEU A O   1 
ATOM   1489 C CB  . LEU A 1 262 ? 65.683 10.716 94.597  1.00 23.53 ? 262 LEU A CB  1 
ATOM   1490 C CG  . LEU A 1 262 ? 66.433 10.106 95.784  1.00 24.20 ? 262 LEU A CG  1 
ATOM   1491 C CD1 . LEU A 1 262 ? 66.241 10.984 97.014  1.00 25.27 ? 262 LEU A CD1 1 
ATOM   1492 C CD2 . LEU A 1 262 ? 65.920 8.697  96.048  1.00 25.46 ? 262 LEU A CD2 1 
ATOM   1493 N N   . ARG A 1 263 ? 63.657 10.375 92.281  1.00 23.43 ? 263 ARG A N   1 
ATOM   1494 C CA  . ARG A 1 263 ? 62.716 10.939 91.325  1.00 22.90 ? 263 ARG A CA  1 
ATOM   1495 C C   . ARG A 1 263 ? 61.975 12.139 91.892  1.00 22.84 ? 263 ARG A C   1 
ATOM   1496 O O   . ARG A 1 263 ? 61.390 12.063 92.973  1.00 20.93 ? 263 ARG A O   1 
ATOM   1497 C CB  . ARG A 1 263 ? 61.695 9.880  90.911  1.00 25.43 ? 263 ARG A CB  1 
ATOM   1498 C CG  . ARG A 1 263 ? 62.288 8.679  90.193  1.00 27.91 ? 263 ARG A CG  1 
ATOM   1499 C CD  . ARG A 1 263 ? 61.274 7.550  90.136  1.00 29.90 ? 263 ARG A CD  1 
ATOM   1500 N NE  . ARG A 1 263 ? 60.941 7.071  91.475  1.00 32.48 ? 263 ARG A NE  1 
ATOM   1501 C CZ  . ARG A 1 263 ? 59.986 6.185  91.740  1.00 32.33 ? 263 ARG A CZ  1 
ATOM   1502 N NH1 . ARG A 1 263 ? 59.260 5.673  90.756  1.00 33.80 ? 263 ARG A NH1 1 
ATOM   1503 N NH2 . ARG A 1 263 ? 59.756 5.812  92.992  1.00 32.67 ? 263 ARG A NH2 1 
ATOM   1504 N N   . VAL A 1 264 ? 62.007 13.253 91.169  1.00 21.15 ? 264 VAL A N   1 
ATOM   1505 C CA  . VAL A 1 264 ? 61.279 14.434 91.612  1.00 20.81 ? 264 VAL A CA  1 
ATOM   1506 C C   . VAL A 1 264 ? 59.811 14.060 91.456  1.00 22.21 ? 264 VAL A C   1 
ATOM   1507 O O   . VAL A 1 264 ? 59.395 13.584 90.398  1.00 22.64 ? 264 VAL A O   1 
ATOM   1508 C CB  . VAL A 1 264 ? 61.594 15.661 90.733  1.00 19.74 ? 264 VAL A CB  1 
ATOM   1509 C CG1 . VAL A 1 264 ? 60.712 16.838 91.137  1.00 20.28 ? 264 VAL A CG1 1 
ATOM   1510 C CG2 . VAL A 1 264 ? 63.056 16.029 90.868  1.00 19.57 ? 264 VAL A CG2 1 
ATOM   1511 N N   . GLY A 1 265 ? 59.034 14.259 92.514  1.00 22.34 ? 265 GLY A N   1 
ATOM   1512 C CA  . GLY A 1 265 ? 57.628 13.913 92.471  1.00 23.05 ? 265 GLY A CA  1 
ATOM   1513 C C   . GLY A 1 265 ? 57.373 12.583 93.161  1.00 24.88 ? 265 GLY A C   1 
ATOM   1514 O O   . GLY A 1 265 ? 56.852 12.540 94.274  1.00 25.77 ? 265 GLY A O   1 
ATOM   1515 N N   . ALA A 1 266 ? 57.760 11.493 92.506  1.00 24.94 ? 266 ALA A N   1 
ATOM   1516 C CA  . ALA A 1 266 ? 57.559 10.153 93.048  1.00 25.53 ? 266 ALA A CA  1 
ATOM   1517 C C   . ALA A 1 266 ? 58.307 9.894  94.356  1.00 25.42 ? 266 ALA A C   1 
ATOM   1518 O O   . ALA A 1 266 ? 57.768 9.271  95.269  1.00 26.21 ? 266 ALA A O   1 
ATOM   1519 C CB  . ALA A 1 266 ? 57.957 9.112  92.007  1.00 26.73 ? 266 ALA A CB  1 
ATOM   1520 N N   . ASP A 1 267 ? 59.549 10.361 94.445  1.00 23.81 ? 267 ASP A N   1 
ATOM   1521 C CA  . ASP A 1 267 ? 60.348 10.162 95.650  1.00 22.87 ? 267 ASP A CA  1 
ATOM   1522 C C   . ASP A 1 267 ? 60.344 11.402 96.534  1.00 21.59 ? 267 ASP A C   1 
ATOM   1523 O O   . ASP A 1 267 ? 60.104 11.314 97.736  1.00 21.21 ? 267 ASP A O   1 
ATOM   1524 C CB  . ASP A 1 267 ? 61.782 9.782  95.272  1.00 23.77 ? 267 ASP A CB  1 
ATOM   1525 C CG  . ASP A 1 267 ? 61.871 8.395  94.654  1.00 24.54 ? 267 ASP A CG  1 
ATOM   1526 O OD1 . ASP A 1 267 ? 62.775 8.165  93.826  1.00 25.14 ? 267 ASP A OD1 1 
ATOM   1527 O OD2 . ASP A 1 267 ? 61.038 7.530  95.007  1.00 26.04 ? 267 ASP A OD2 1 
ATOM   1528 N N   . ILE A 1 268 ? 60.620 12.558 95.940  1.00 20.11 ? 268 ILE A N   1 
ATOM   1529 C CA  . ILE A 1 268 ? 60.616 13.805 96.693  1.00 18.18 ? 268 ILE A CA  1 
ATOM   1530 C C   . ILE A 1 268 ? 59.836 14.861 95.925  1.00 19.25 ? 268 ILE A C   1 
ATOM   1531 O O   . ILE A 1 268 ? 60.240 15.274 94.835  1.00 18.31 ? 268 ILE A O   1 
ATOM   1532 C CB  . ILE A 1 268 ? 62.043 14.333 96.945  1.00 17.56 ? 268 ILE A CB  1 
ATOM   1533 C CG1 . ILE A 1 268 ? 62.844 13.312 97.759  1.00 16.74 ? 268 ILE A CG1 1 
ATOM   1534 C CG2 . ILE A 1 268 ? 61.975 15.666 97.694  1.00 17.44 ? 268 ILE A CG2 1 
ATOM   1535 C CD1 . ILE A 1 268 ? 64.240 13.770 98.120  1.00 18.99 ? 268 ILE A CD1 1 
ATOM   1536 N N   . SER A 1 269 ? 58.708 15.281 96.488  1.00 16.34 ? 269 SER A N   1 
ATOM   1537 C CA  . SER A 1 269 ? 57.878 16.299 95.856  1.00 16.48 ? 269 SER A CA  1 
ATOM   1538 C C   . SER A 1 269 ? 58.494 17.669 96.085  1.00 16.45 ? 269 SER A C   1 
ATOM   1539 O O   . SER A 1 269 ? 59.169 17.903 97.091  1.00 15.43 ? 269 SER A O   1 
ATOM   1540 C CB  . SER A 1 269 ? 56.456 16.269 96.423  1.00 17.60 ? 269 SER A CB  1 
ATOM   1541 O OG  . SER A 1 269 ? 55.754 15.121 95.981  1.00 18.52 ? 269 SER A OG  1 
ATOM   1542 N N   . VAL A 1 270 ? 58.254 18.579 95.149  1.00 15.16 ? 270 VAL A N   1 
ATOM   1543 C CA  . VAL A 1 270 ? 58.809 19.918 95.249  1.00 15.26 ? 270 VAL A CA  1 
ATOM   1544 C C   . VAL A 1 270 ? 57.790 20.975 94.866  1.00 15.82 ? 270 VAL A C   1 
ATOM   1545 O O   . VAL A 1 270 ? 57.077 20.833 93.870  1.00 16.11 ? 270 VAL A O   1 
ATOM   1546 C CB  . VAL A 1 270 ? 60.045 20.075 94.315  1.00 15.82 ? 270 VAL A CB  1 
ATOM   1547 C CG1 . VAL A 1 270 ? 60.595 21.487 94.402  1.00 14.63 ? 270 VAL A CG1 1 
ATOM   1548 C CG2 . VAL A 1 270 ? 61.116 19.062 94.691  1.00 16.77 ? 270 VAL A CG2 1 
ATOM   1549 N N   . VAL A 1 271 ? 57.711 22.029 95.675  1.00 13.50 ? 271 VAL A N   1 
ATOM   1550 C CA  . VAL A 1 271 ? 56.817 23.141 95.390  1.00 13.44 ? 271 VAL A CA  1 
ATOM   1551 C C   . VAL A 1 271 ? 57.693 24.386 95.302  1.00 14.83 ? 271 VAL A C   1 
ATOM   1552 O O   . VAL A 1 271 ? 58.485 24.662 96.204  1.00 14.96 ? 271 VAL A O   1 
ATOM   1553 C CB  . VAL A 1 271 ? 55.768 23.347 96.507  1.00 14.57 ? 271 VAL A CB  1 
ATOM   1554 C CG1 . VAL A 1 271 ? 54.872 24.522 96.162  1.00 13.65 ? 271 VAL A CG1 1 
ATOM   1555 C CG2 . VAL A 1 271 ? 54.940 22.088 96.678  1.00 15.86 ? 271 VAL A CG2 1 
ATOM   1556 N N   . GLY A 1 272 ? 57.572 25.118 94.199  1.00 14.33 ? 272 GLY A N   1 
ATOM   1557 C CA  . GLY A 1 272 ? 58.358 26.326 94.034  1.00 14.21 ? 272 GLY A CA  1 
ATOM   1558 C C   . GLY A 1 272 ? 57.561 27.560 94.407  1.00 14.49 ? 272 GLY A C   1 
ATOM   1559 O O   . GLY A 1 272 ? 56.572 27.474 95.140  1.00 14.08 ? 272 GLY A O   1 
ATOM   1560 N N   . TYR A 1 273 ? 57.985 28.718 93.907  1.00 12.42 ? 273 TYR A N   1 
ATOM   1561 C CA  . TYR A 1 273 ? 57.287 29.964 94.203  1.00 13.26 ? 273 TYR A CA  1 
ATOM   1562 C C   . TYR A 1 273 ? 57.634 31.002 93.137  1.00 15.19 ? 273 TYR A C   1 
ATOM   1563 O O   . TYR A 1 273 ? 58.812 31.246 92.879  1.00 15.52 ? 273 TYR A O   1 
ATOM   1564 C CB  . TYR A 1 273 ? 57.706 30.471 95.594  1.00 14.06 ? 273 TYR A CB  1 
ATOM   1565 C CG  . TYR A 1 273 ? 56.634 31.222 96.365  1.00 14.94 ? 273 TYR A CG  1 
ATOM   1566 C CD1 . TYR A 1 273 ? 56.203 32.489 95.964  1.00 14.25 ? 273 TYR A CD1 1 
ATOM   1567 C CD2 . TYR A 1 273 ? 56.062 30.667 97.513  1.00 16.29 ? 273 TYR A CD2 1 
ATOM   1568 C CE1 . TYR A 1 273 ? 55.232 33.186 96.693  1.00 15.38 ? 273 TYR A CE1 1 
ATOM   1569 C CE2 . TYR A 1 273 ? 55.096 31.354 98.243  1.00 15.69 ? 273 TYR A CE2 1 
ATOM   1570 C CZ  . TYR A 1 273 ? 54.686 32.609 97.833  1.00 15.56 ? 273 TYR A CZ  1 
ATOM   1571 O OH  . TYR A 1 273 ? 53.743 33.289 98.578  1.00 17.50 ? 273 TYR A OH  1 
ATOM   1572 N N   . ASP A 1 274 ? 56.590 31.578 92.531  1.00 13.79 ? 274 ASP A N   1 
ATOM   1573 C CA  . ASP A 1 274 ? 56.658 32.615 91.491  1.00 16.25 ? 274 ASP A CA  1 
ATOM   1574 C C   . ASP A 1 274 ? 55.849 32.286 90.237  1.00 15.18 ? 274 ASP A C   1 
ATOM   1575 O O   . ASP A 1 274 ? 55.082 33.113 89.749  1.00 14.37 ? 274 ASP A O   1 
ATOM   1576 C CB  . ASP A 1 274 ? 58.095 32.891 91.020  1.00 16.53 ? 274 ASP A CB  1 
ATOM   1577 C CG  . ASP A 1 274 ? 58.903 33.710 92.010  1.00 18.70 ? 274 ASP A CG  1 
ATOM   1578 O OD1 . ASP A 1 274 ? 58.320 34.286 92.953  1.00 19.90 ? 274 ASP A OD1 1 
ATOM   1579 O OD2 . ASP A 1 274 ? 60.135 33.786 91.827  1.00 19.97 ? 274 ASP A OD2 1 
ATOM   1580 N N   . ASP A 1 275 ? 56.034 31.067 89.742  1.00 15.77 ? 275 ASP A N   1 
ATOM   1581 C CA  . ASP A 1 275 ? 55.433 30.583 88.499  1.00 17.38 ? 275 ASP A CA  1 
ATOM   1582 C C   . ASP A 1 275 ? 56.096 31.342 87.361  1.00 18.06 ? 275 ASP A C   1 
ATOM   1583 O O   . ASP A 1 275 ? 55.450 32.087 86.616  1.00 17.07 ? 275 ASP A O   1 
ATOM   1584 C CB  . ASP A 1 275 ? 53.910 30.777 88.427  1.00 18.32 ? 275 ASP A CB  1 
ATOM   1585 C CG  . ASP A 1 275 ? 53.321 30.194 87.142  1.00 21.46 ? 275 ASP A CG  1 
ATOM   1586 O OD1 . ASP A 1 275 ? 53.967 29.295 86.563  1.00 20.79 ? 275 ASP A OD1 1 
ATOM   1587 O OD2 . ASP A 1 275 ? 52.227 30.615 86.707  1.00 21.27 ? 275 ASP A OD2 1 
ATOM   1588 N N   . THR A 1 276 ? 57.408 31.167 87.254  1.00 18.46 ? 276 THR A N   1 
ATOM   1589 C CA  . THR A 1 276 ? 58.171 31.815 86.197  1.00 18.41 ? 276 THR A CA  1 
ATOM   1590 C C   . THR A 1 276 ? 57.786 31.161 84.881  1.00 18.51 ? 276 THR A C   1 
ATOM   1591 O O   . THR A 1 276 ? 57.281 30.041 84.858  1.00 17.88 ? 276 THR A O   1 
ATOM   1592 C CB  . THR A 1 276 ? 59.684 31.630 86.400  1.00 20.97 ? 276 THR A CB  1 
ATOM   1593 O OG1 . THR A 1 276 ? 60.014 30.239 86.286  1.00 20.13 ? 276 THR A OG1 1 
ATOM   1594 C CG2 . THR A 1 276 ? 60.102 32.131 87.773  1.00 20.17 ? 276 THR A CG2 1 
ATOM   1595 N N   . GLU A 1 277 ? 58.024 31.863 83.779  1.00 20.33 ? 277 GLU A N   1 
ATOM   1596 C CA  . GLU A 1 277 ? 57.704 31.324 82.468  1.00 22.96 ? 277 GLU A CA  1 
ATOM   1597 C C   . GLU A 1 277 ? 58.418 29.991 82.268  1.00 21.78 ? 277 GLU A C   1 
ATOM   1598 O O   . GLU A 1 277 ? 57.834 29.035 81.761  1.00 23.72 ? 277 GLU A O   1 
ATOM   1599 C CB  . GLU A 1 277 ? 58.124 32.327 81.393  1.00 27.37 ? 277 GLU A CB  1 
ATOM   1600 C CG  . GLU A 1 277 ? 57.502 33.700 81.597  1.00 34.22 ? 277 GLU A CG  1 
ATOM   1601 C CD  . GLU A 1 277 ? 58.203 34.792 80.813  1.00 38.69 ? 277 GLU A CD  1 
ATOM   1602 O OE1 . GLU A 1 277 ? 58.232 34.704 79.568  1.00 41.32 ? 277 GLU A OE1 1 
ATOM   1603 O OE2 . GLU A 1 277 ? 58.725 35.739 81.448  1.00 40.66 ? 277 GLU A OE2 1 
ATOM   1604 N N   . ASP A 1 278 ? 59.677 29.924 82.690  1.00 19.76 ? 278 ASP A N   1 
ATOM   1605 C CA  . ASP A 1 278 ? 60.471 28.705 82.550  1.00 19.45 ? 278 ASP A CA  1 
ATOM   1606 C C   . ASP A 1 278 ? 59.946 27.514 83.351  1.00 18.76 ? 278 ASP A C   1 
ATOM   1607 O O   . ASP A 1 278 ? 60.126 26.368 82.943  1.00 17.79 ? 278 ASP A O   1 
ATOM   1608 C CB  . ASP A 1 278 ? 61.920 28.945 82.995  1.00 20.52 ? 278 ASP A CB  1 
ATOM   1609 C CG  . ASP A 1 278 ? 62.684 29.879 82.076  1.00 22.55 ? 278 ASP A CG  1 
ATOM   1610 O OD1 . ASP A 1 278 ? 63.820 30.245 82.442  1.00 24.35 ? 278 ASP A OD1 1 
ATOM   1611 O OD2 . ASP A 1 278 ? 62.165 30.242 81.001  1.00 21.87 ? 278 ASP A OD2 1 
ATOM   1612 N N   . SER A 1 279 ? 59.304 27.777 84.487  1.00 17.22 ? 279 SER A N   1 
ATOM   1613 C CA  . SER A 1 279 ? 58.836 26.693 85.347  1.00 17.16 ? 279 SER A CA  1 
ATOM   1614 C C   . SER A 1 279 ? 57.938 25.656 84.683  1.00 17.28 ? 279 SER A C   1 
ATOM   1615 O O   . SER A 1 279 ? 57.923 24.498 85.095  1.00 16.94 ? 279 SER A O   1 
ATOM   1616 C CB  . SER A 1 279 ? 58.145 27.257 86.602  1.00 17.35 ? 279 SER A CB  1 
ATOM   1617 O OG  . SER A 1 279 ? 56.911 27.875 86.296  1.00 19.59 ? 279 SER A OG  1 
ATOM   1618 N N   . SER A 1 280 ? 57.198 26.059 83.657  1.00 17.55 ? 280 SER A N   1 
ATOM   1619 C CA  . SER A 1 280 ? 56.313 25.131 82.966  1.00 18.42 ? 280 SER A CA  1 
ATOM   1620 C C   . SER A 1 280 ? 57.113 24.126 82.142  1.00 19.43 ? 280 SER A C   1 
ATOM   1621 O O   . SER A 1 280 ? 56.575 23.115 81.687  1.00 19.96 ? 280 SER A O   1 
ATOM   1622 C CB  . SER A 1 280 ? 55.361 25.898 82.048  1.00 21.84 ? 280 SER A CB  1 
ATOM   1623 O OG  . SER A 1 280 ? 56.085 26.589 81.044  1.00 22.51 ? 280 SER A OG  1 
ATOM   1624 N N   . CYS A 1 281 ? 58.398 24.404 81.946  1.00 18.29 ? 281 CYS A N   1 
ATOM   1625 C CA  . CYS A 1 281 ? 59.238 23.509 81.162  1.00 18.23 ? 281 CYS A CA  1 
ATOM   1626 C C   . CYS A 1 281 ? 60.376 22.859 81.935  1.00 18.21 ? 281 CYS A C   1 
ATOM   1627 O O   . CYS A 1 281 ? 61.319 22.337 81.345  1.00 17.16 ? 281 CYS A O   1 
ATOM   1628 C CB  . CYS A 1 281 ? 59.773 24.238 79.927  1.00 18.49 ? 281 CYS A CB  1 
ATOM   1629 S SG  . CYS A 1 281 ? 58.487 24.519 78.694  1.00 20.05 ? 281 CYS A SG  1 
ATOM   1630 N N   . TYR A 1 282 ? 60.305 22.902 83.262  1.00 17.36 ? 282 TYR A N   1 
ATOM   1631 C CA  . TYR A 1 282 ? 61.326 22.236 84.053  1.00 17.76 ? 282 TYR A CA  1 
ATOM   1632 C C   . TYR A 1 282 ? 61.046 20.752 83.862  1.00 17.49 ? 282 TYR A C   1 
ATOM   1633 O O   . TYR A 1 282 ? 59.993 20.381 83.341  1.00 18.45 ? 282 TYR A O   1 
ATOM   1634 C CB  . TYR A 1 282 ? 61.204 22.596 85.540  1.00 17.12 ? 282 TYR A CB  1 
ATOM   1635 C CG  . TYR A 1 282 ? 61.719 23.970 85.904  1.00 19.43 ? 282 TYR A CG  1 
ATOM   1636 C CD1 . TYR A 1 282 ? 62.353 24.780 84.959  1.00 21.82 ? 282 TYR A CD1 1 
ATOM   1637 C CD2 . TYR A 1 282 ? 61.611 24.447 87.212  1.00 20.23 ? 282 TYR A CD2 1 
ATOM   1638 C CE1 . TYR A 1 282 ? 62.869 26.022 85.309  1.00 22.47 ? 282 TYR A CE1 1 
ATOM   1639 C CE2 . TYR A 1 282 ? 62.122 25.686 87.570  1.00 20.49 ? 282 TYR A CE2 1 
ATOM   1640 C CZ  . TYR A 1 282 ? 62.750 26.467 86.619  1.00 23.79 ? 282 TYR A CZ  1 
ATOM   1641 O OH  . TYR A 1 282 ? 63.275 27.685 86.975  1.00 24.19 ? 282 TYR A OH  1 
ATOM   1642 N N   . ILE A 1 283 ? 61.977 19.905 84.283  1.00 17.35 ? 283 ILE A N   1 
ATOM   1643 C CA  . ILE A 1 283 ? 61.802 18.468 84.139  1.00 19.29 ? 283 ILE A CA  1 
ATOM   1644 C C   . ILE A 1 283 ? 61.753 17.774 85.496  1.00 19.72 ? 283 ILE A C   1 
ATOM   1645 O O   . ILE A 1 283 ? 62.787 17.585 86.137  1.00 20.27 ? 283 ILE A O   1 
ATOM   1646 C CB  . ILE A 1 283 ? 62.950 17.852 83.312  1.00 20.25 ? 283 ILE A CB  1 
ATOM   1647 C CG1 . ILE A 1 283 ? 63.020 18.530 81.941  1.00 21.78 ? 283 ILE A CG1 1 
ATOM   1648 C CG2 . ILE A 1 283 ? 62.733 16.352 83.160  1.00 22.25 ? 283 ILE A CG2 1 
ATOM   1649 C CD1 . ILE A 1 283 ? 64.196 18.079 81.089  1.00 23.49 ? 283 ILE A CD1 1 
ATOM   1650 N N   . PRO A 1 284 ? 60.545 17.404 85.961  1.00 19.07 ? 284 PRO A N   1 
ATOM   1651 C CA  . PRO A 1 284 ? 59.263 17.615 85.278  1.00 18.35 ? 284 PRO A CA  1 
ATOM   1652 C C   . PRO A 1 284 ? 58.698 19.001 85.593  1.00 17.10 ? 284 PRO A C   1 
ATOM   1653 O O   . PRO A 1 284 ? 59.234 19.710 86.448  1.00 17.69 ? 284 PRO A O   1 
ATOM   1654 C CB  . PRO A 1 284 ? 58.396 16.494 85.839  1.00 20.72 ? 284 PRO A CB  1 
ATOM   1655 C CG  . PRO A 1 284 ? 58.862 16.408 87.246  1.00 20.61 ? 284 PRO A CG  1 
ATOM   1656 C CD  . PRO A 1 284 ? 60.374 16.503 87.116  1.00 19.65 ? 284 PRO A CD  1 
ATOM   1657 N N   . PRO A 1 285 ? 57.618 19.410 84.902  1.00 15.89 ? 285 PRO A N   1 
ATOM   1658 C CA  . PRO A 1 285 ? 57.015 20.725 85.148  1.00 15.70 ? 285 PRO A CA  1 
ATOM   1659 C C   . PRO A 1 285 ? 56.766 20.944 86.637  1.00 15.82 ? 285 PRO A C   1 
ATOM   1660 O O   . PRO A 1 285 ? 56.254 20.067 87.332  1.00 15.70 ? 285 PRO A O   1 
ATOM   1661 C CB  . PRO A 1 285 ? 55.745 20.675 84.312  1.00 16.75 ? 285 PRO A CB  1 
ATOM   1662 C CG  . PRO A 1 285 ? 56.222 19.914 83.098  1.00 16.76 ? 285 PRO A CG  1 
ATOM   1663 C CD  . PRO A 1 285 ? 56.989 18.762 83.734  1.00 16.03 ? 285 PRO A CD  1 
ATOM   1664 N N   . LEU A 1 286 ? 57.125 22.135 87.096  1.00 14.30 ? 286 LEU A N   1 
ATOM   1665 C CA  . LEU A 1 286 ? 57.057 22.504 88.507  1.00 14.70 ? 286 LEU A CA  1 
ATOM   1666 C C   . LEU A 1 286 ? 55.770 23.061 89.108  1.00 14.02 ? 286 LEU A C   1 
ATOM   1667 O O   . LEU A 1 286 ? 55.216 24.049 88.630  1.00 15.75 ? 286 LEU A O   1 
ATOM   1668 C CB  . LEU A 1 286 ? 58.197 23.489 88.788  1.00 14.40 ? 286 LEU A CB  1 
ATOM   1669 C CG  . LEU A 1 286 ? 58.346 24.056 90.200  1.00 12.58 ? 286 LEU A CG  1 
ATOM   1670 C CD1 . LEU A 1 286 ? 58.742 22.938 91.161  1.00 14.51 ? 286 LEU A CD1 1 
ATOM   1671 C CD2 . LEU A 1 286 ? 59.404 25.154 90.193  1.00 14.86 ? 286 LEU A CD2 1 
ATOM   1672 N N   . THR A 1 287 ? 55.309 22.418 90.177  1.00 14.36 ? 287 THR A N   1 
ATOM   1673 C CA  . THR A 1 287 ? 54.133 22.886 90.901  1.00 14.23 ? 287 THR A CA  1 
ATOM   1674 C C   . THR A 1 287 ? 54.668 24.104 91.637  1.00 14.23 ? 287 THR A C   1 
ATOM   1675 O O   . THR A 1 287 ? 55.731 24.036 92.253  1.00 14.10 ? 287 THR A O   1 
ATOM   1676 C CB  . THR A 1 287 ? 53.652 21.845 91.922  1.00 14.90 ? 287 THR A CB  1 
ATOM   1677 O OG1 . THR A 1 287 ? 53.124 20.713 91.223  1.00 16.14 ? 287 THR A OG1 1 
ATOM   1678 C CG2 . THR A 1 287 ? 52.573 22.435 92.827  1.00 13.88 ? 287 THR A CG2 1 
ATOM   1679 N N   . THR A 1 288 ? 53.935 25.209 91.594  1.00 14.08 ? 288 THR A N   1 
ATOM   1680 C CA  . THR A 1 288 ? 54.427 26.428 92.214  1.00 14.75 ? 288 THR A CA  1 
ATOM   1681 C C   . THR A 1 288 ? 53.306 27.381 92.627  1.00 14.93 ? 288 THR A C   1 
ATOM   1682 O O   . THR A 1 288 ? 52.125 27.076 92.466  1.00 15.39 ? 288 THR A O   1 
ATOM   1683 C CB  . THR A 1 288 ? 55.380 27.135 91.214  1.00 14.86 ? 288 THR A CB  1 
ATOM   1684 O OG1 . THR A 1 288 ? 55.934 28.314 91.800  1.00 15.69 ? 288 THR A OG1 1 
ATOM   1685 C CG2 . THR A 1 288 ? 54.623 27.495 89.933  1.00 15.35 ? 288 THR A CG2 1 
ATOM   1686 N N   . ILE A 1 289 ? 53.697 28.527 93.177  1.00 13.83 ? 289 ILE A N   1 
ATOM   1687 C CA  . ILE A 1 289 ? 52.755 29.554 93.607  1.00 13.36 ? 289 ILE A CA  1 
ATOM   1688 C C   . ILE A 1 289 ? 52.902 30.727 92.649  1.00 12.09 ? 289 ILE A C   1 
ATOM   1689 O O   . ILE A 1 289 ? 53.976 31.321 92.536  1.00 13.06 ? 289 ILE A O   1 
ATOM   1690 C CB  . ILE A 1 289 ? 53.069 30.054 95.030  1.00 13.55 ? 289 ILE A CB  1 
ATOM   1691 C CG1 . ILE A 1 289 ? 53.038 28.882 96.015  1.00 15.31 ? 289 ILE A CG1 1 
ATOM   1692 C CG2 . ILE A 1 289 ? 52.085 31.149 95.423  1.00 14.00 ? 289 ILE A CG2 1 
ATOM   1693 C CD1 . ILE A 1 289 ? 51.712 28.148 96.073  1.00 17.02 ? 289 ILE A CD1 1 
ATOM   1694 N N   . LYS A 1 290 ? 51.822 31.063 91.958  1.00 12.80 ? 290 LYS A N   1 
ATOM   1695 C CA  . LYS A 1 290 ? 51.878 32.158 91.007  1.00 13.57 ? 290 LYS A CA  1 
ATOM   1696 C C   . LYS A 1 290 ? 51.812 33.549 91.619  1.00 15.48 ? 290 LYS A C   1 
ATOM   1697 O O   . LYS A 1 290 ? 50.889 33.869 92.369  1.00 15.82 ? 290 LYS A O   1 
ATOM   1698 C CB  . LYS A 1 290 ? 50.753 32.020 89.977  1.00 14.35 ? 290 LYS A CB  1 
ATOM   1699 C CG  . LYS A 1 290 ? 50.684 33.180 88.986  1.00 17.96 ? 290 LYS A CG  1 
ATOM   1700 C CD  . LYS A 1 290 ? 49.571 32.955 87.968  1.00 22.21 ? 290 LYS A CD  1 
ATOM   1701 C CE  . LYS A 1 290 ? 49.498 34.096 86.964  1.00 24.93 ? 290 LYS A CE  1 
ATOM   1702 N NZ  . LYS A 1 290 ? 48.455 33.839 85.932  1.00 26.69 ? 290 LYS A NZ  1 
ATOM   1703 N N   . GLN A 1 291 ? 52.815 34.363 91.301  1.00 15.94 ? 291 GLN A N   1 
ATOM   1704 C CA  . GLN A 1 291 ? 52.867 35.755 91.734  1.00 16.27 ? 291 GLN A CA  1 
ATOM   1705 C C   . GLN A 1 291 ? 52.858 36.514 90.412  1.00 15.47 ? 291 GLN A C   1 
ATOM   1706 O O   . GLN A 1 291 ? 53.832 36.469 89.663  1.00 16.41 ? 291 GLN A O   1 
ATOM   1707 C CB  . GLN A 1 291 ? 54.157 36.078 92.490  1.00 17.75 ? 291 GLN A CB  1 
ATOM   1708 C CG  . GLN A 1 291 ? 54.338 35.322 93.795  1.00 18.86 ? 291 GLN A CG  1 
ATOM   1709 C CD  . GLN A 1 291 ? 55.343 35.996 94.705  1.00 19.58 ? 291 GLN A CD  1 
ATOM   1710 O OE1 . GLN A 1 291 ? 54.969 36.730 95.623  1.00 21.83 ? 291 GLN A OE1 1 
ATOM   1711 N NE2 . GLN A 1 291 ? 56.626 35.768 94.446  1.00 19.11 ? 291 GLN A NE2 1 
ATOM   1712 N N   . ASP A 1 292 ? 51.757 37.200 90.130  1.00 15.39 ? 292 ASP A N   1 
ATOM   1713 C CA  . ASP A 1 292 ? 51.614 37.941 88.876  1.00 14.91 ? 292 ASP A CA  1 
ATOM   1714 C C   . ASP A 1 292 ? 52.397 39.255 88.891  1.00 13.59 ? 292 ASP A C   1 
ATOM   1715 O O   . ASP A 1 292 ? 51.839 40.324 89.136  1.00 13.64 ? 292 ASP A O   1 
ATOM   1716 C CB  . ASP A 1 292 ? 50.128 38.197 88.617  1.00 16.81 ? 292 ASP A CB  1 
ATOM   1717 C CG  . ASP A 1 292 ? 49.846 38.621 87.189  1.00 17.77 ? 292 ASP A CG  1 
ATOM   1718 O OD1 . ASP A 1 292 ? 48.672 38.529 86.775  1.00 20.42 ? 292 ASP A OD1 1 
ATOM   1719 O OD2 . ASP A 1 292 ? 50.788 39.049 86.487  1.00 18.39 ? 292 ASP A OD2 1 
ATOM   1720 N N   . PHE A 1 293 ? 53.695 39.164 88.616  1.00 14.00 ? 293 PHE A N   1 
ATOM   1721 C CA  . PHE A 1 293 ? 54.563 40.337 88.622  1.00 15.09 ? 293 PHE A CA  1 
ATOM   1722 C C   . PHE A 1 293 ? 54.126 41.414 87.642  1.00 14.96 ? 293 PHE A C   1 
ATOM   1723 O O   . PHE A 1 293 ? 54.297 42.605 87.904  1.00 15.55 ? 293 PHE A O   1 
ATOM   1724 C CB  . PHE A 1 293 ? 56.010 39.931 88.326  1.00 14.99 ? 293 PHE A CB  1 
ATOM   1725 C CG  . PHE A 1 293 ? 56.584 38.966 89.323  1.00 17.52 ? 293 PHE A CG  1 
ATOM   1726 C CD1 . PHE A 1 293 ? 56.666 39.304 90.671  1.00 19.23 ? 293 PHE A CD1 1 
ATOM   1727 C CD2 . PHE A 1 293 ? 57.033 37.714 88.918  1.00 19.60 ? 293 PHE A CD2 1 
ATOM   1728 C CE1 . PHE A 1 293 ? 57.187 38.408 91.601  1.00 19.54 ? 293 PHE A CE1 1 
ATOM   1729 C CE2 . PHE A 1 293 ? 57.557 36.809 89.844  1.00 20.31 ? 293 PHE A CE2 1 
ATOM   1730 C CZ  . PHE A 1 293 ? 57.633 37.159 91.186  1.00 20.55 ? 293 PHE A CZ  1 
ATOM   1731 N N   . ARG A 1 294 ? 53.565 41.003 86.510  1.00 16.18 ? 294 ARG A N   1 
ATOM   1732 C CA  . ARG A 1 294 ? 53.111 41.967 85.519  1.00 16.96 ? 294 ARG A CA  1 
ATOM   1733 C C   . ARG A 1 294 ? 51.995 42.809 86.127  1.00 16.13 ? 294 ARG A C   1 
ATOM   1734 O O   . ARG A 1 294 ? 51.971 44.033 85.984  1.00 15.66 ? 294 ARG A O   1 
ATOM   1735 C CB  . ARG A 1 294 ? 52.591 41.251 84.274  1.00 19.95 ? 294 ARG A CB  1 
ATOM   1736 C CG  . ARG A 1 294 ? 52.283 42.186 83.116  1.00 26.57 ? 294 ARG A CG  1 
ATOM   1737 C CD  . ARG A 1 294 ? 51.253 41.580 82.175  1.00 30.89 ? 294 ARG A CD  1 
ATOM   1738 N NE  . ARG A 1 294 ? 49.907 42.096 82.426  1.00 37.14 ? 294 ARG A NE  1 
ATOM   1739 C CZ  . ARG A 1 294 ? 49.231 41.942 83.562  1.00 38.53 ? 294 ARG A CZ  1 
ATOM   1740 N NH1 . ARG A 1 294 ? 49.763 41.278 84.578  1.00 42.60 ? 294 ARG A NH1 1 
ATOM   1741 N NH2 . ARG A 1 294 ? 48.019 42.463 83.686  1.00 38.17 ? 294 ARG A NH2 1 
ATOM   1742 N N   . LEU A 1 295 ? 51.066 42.146 86.810  1.00 15.49 ? 295 LEU A N   1 
ATOM   1743 C CA  . LEU A 1 295 ? 49.959 42.846 87.441  1.00 16.94 ? 295 LEU A CA  1 
ATOM   1744 C C   . LEU A 1 295 ? 50.484 43.809 88.505  1.00 15.26 ? 295 LEU A C   1 
ATOM   1745 O O   . LEU A 1 295 ? 50.024 44.945 88.603  1.00 17.34 ? 295 LEU A O   1 
ATOM   1746 C CB  . LEU A 1 295 ? 48.990 41.847 88.077  1.00 19.02 ? 295 LEU A CB  1 
ATOM   1747 C CG  . LEU A 1 295 ? 47.795 42.457 88.814  1.00 21.17 ? 295 LEU A CG  1 
ATOM   1748 C CD1 . LEU A 1 295 ? 46.945 43.260 87.843  1.00 23.09 ? 295 LEU A CD1 1 
ATOM   1749 C CD2 . LEU A 1 295 ? 46.975 41.353 89.460  1.00 22.72 ? 295 LEU A CD2 1 
ATOM   1750 N N   . LEU A 1 296 ? 51.450 43.356 89.296  1.00 14.08 ? 296 LEU A N   1 
ATOM   1751 C CA  . LEU A 1 296 ? 52.023 44.201 90.342  1.00 14.41 ? 296 LEU A CA  1 
ATOM   1752 C C   . LEU A 1 296 ? 52.666 45.459 89.760  1.00 15.23 ? 296 LEU A C   1 
ATOM   1753 O O   . LEU A 1 296 ? 52.403 46.570 90.220  1.00 14.15 ? 296 LEU A O   1 
ATOM   1754 C CB  . LEU A 1 296 ? 53.067 43.420 91.144  1.00 13.44 ? 296 LEU A CB  1 
ATOM   1755 C CG  . LEU A 1 296 ? 53.821 44.219 92.210  1.00 13.95 ? 296 LEU A CG  1 
ATOM   1756 C CD1 . LEU A 1 296 ? 52.843 44.741 93.260  1.00 15.10 ? 296 LEU A CD1 1 
ATOM   1757 C CD2 . LEU A 1 296 ? 54.876 43.332 92.855  1.00 15.73 ? 296 LEU A CD2 1 
ATOM   1758 N N   . GLY A 1 297 ? 53.513 45.281 88.750  1.00 15.14 ? 297 GLY A N   1 
ATOM   1759 C CA  . GLY A 1 297 ? 54.174 46.419 88.136  1.00 15.31 ? 297 GLY A CA  1 
ATOM   1760 C C   . GLY A 1 297 ? 53.180 47.379 87.513  1.00 15.36 ? 297 GLY A C   1 
ATOM   1761 O O   . GLY A 1 297 ? 53.264 48.591 87.707  1.00 14.75 ? 297 GLY A O   1 
ATOM   1762 N N   . GLN A 1 298 ? 52.231 46.835 86.759  1.00 15.74 ? 298 GLN A N   1 
ATOM   1763 C CA  . GLN A 1 298 ? 51.209 47.651 86.116  1.00 16.66 ? 298 GLN A CA  1 
ATOM   1764 C C   . GLN A 1 298 ? 50.424 48.439 87.162  1.00 16.86 ? 298 GLN A C   1 
ATOM   1765 O O   . GLN A 1 298 ? 50.263 49.658 87.059  1.00 16.85 ? 298 GLN A O   1 
ATOM   1766 C CB  . GLN A 1 298 ? 50.250 46.751 85.334  1.00 20.46 ? 298 GLN A CB  1 
ATOM   1767 C CG  . GLN A 1 298 ? 49.156 47.482 84.580  1.00 26.38 ? 298 GLN A CG  1 
ATOM   1768 C CD  . GLN A 1 298 ? 48.127 46.524 84.011  1.00 30.21 ? 298 GLN A CD  1 
ATOM   1769 O OE1 . GLN A 1 298 ? 47.258 46.028 84.730  1.00 33.33 ? 298 GLN A OE1 1 
ATOM   1770 N NE2 . GLN A 1 298 ? 48.234 46.240 82.718  1.00 32.85 ? 298 GLN A NE2 1 
ATOM   1771 N N   . THR A 1 299 ? 49.944 47.735 88.178  1.00 16.06 ? 299 THR A N   1 
ATOM   1772 C CA  . THR A 1 299 ? 49.158 48.367 89.228  1.00 16.66 ? 299 THR A CA  1 
ATOM   1773 C C   . THR A 1 299 ? 49.939 49.436 89.990  1.00 16.24 ? 299 THR A C   1 
ATOM   1774 O O   . THR A 1 299 ? 49.375 50.465 90.366  1.00 17.34 ? 299 THR A O   1 
ATOM   1775 C CB  . THR A 1 299 ? 48.619 47.310 90.219  1.00 17.30 ? 299 THR A CB  1 
ATOM   1776 O OG1 . THR A 1 299 ? 47.904 46.299 89.491  1.00 19.16 ? 299 THR A OG1 1 
ATOM   1777 C CG2 . THR A 1 299 ? 47.665 47.952 91.224  1.00 18.74 ? 299 THR A CG2 1 
ATOM   1778 N N   . SER A 1 300 ? 51.235 49.214 90.200  1.00 15.53 ? 300 SER A N   1 
ATOM   1779 C CA  . SER A 1 300 ? 52.045 50.186 90.934  1.00 14.70 ? 300 SER A CA  1 
ATOM   1780 C C   . SER A 1 300 ? 52.097 51.540 90.232  1.00 14.80 ? 300 SER A C   1 
ATOM   1781 O O   . SER A 1 300 ? 52.124 52.585 90.883  1.00 14.32 ? 300 SER A O   1 
ATOM   1782 C CB  . SER A 1 300 ? 53.473 49.658 91.155  1.00 15.28 ? 300 SER A CB  1 
ATOM   1783 O OG  . SER A 1 300 ? 54.228 49.632 89.953  1.00 16.44 ? 300 SER A OG  1 
ATOM   1784 N N   . VAL A 1 301 ? 52.109 51.529 88.903  1.00 13.79 ? 301 VAL A N   1 
ATOM   1785 C CA  . VAL A 1 301 ? 52.154 52.780 88.158  1.00 14.03 ? 301 VAL A CA  1 
ATOM   1786 C C   . VAL A 1 301 ? 50.822 53.507 88.288  1.00 15.85 ? 301 VAL A C   1 
ATOM   1787 O O   . VAL A 1 301 ? 50.788 54.705 88.580  1.00 17.29 ? 301 VAL A O   1 
ATOM   1788 C CB  . VAL A 1 301 ? 52.470 52.537 86.665  1.00 14.48 ? 301 VAL A CB  1 
ATOM   1789 C CG1 . VAL A 1 301 ? 52.407 53.854 85.893  1.00 15.60 ? 301 VAL A CG1 1 
ATOM   1790 C CG2 . VAL A 1 301 ? 53.857 51.925 86.530  1.00 14.85 ? 301 VAL A CG2 1 
ATOM   1791 N N   . ASP A 1 302 ? 49.726 52.782 88.086  1.00 16.67 ? 302 ASP A N   1 
ATOM   1792 C CA  . ASP A 1 302 ? 48.403 53.386 88.207  1.00 18.70 ? 302 ASP A CA  1 
ATOM   1793 C C   . ASP A 1 302 ? 48.242 53.978 89.604  1.00 17.04 ? 302 ASP A C   1 
ATOM   1794 O O   . ASP A 1 302 ? 47.760 55.097 89.764  1.00 17.78 ? 302 ASP A O   1 
ATOM   1795 C CB  . ASP A 1 302 ? 47.298 52.347 87.977  1.00 21.97 ? 302 ASP A CB  1 
ATOM   1796 C CG  . ASP A 1 302 ? 47.393 51.672 86.622  1.00 26.55 ? 302 ASP A CG  1 
ATOM   1797 O OD1 . ASP A 1 302 ? 47.814 52.332 85.653  1.00 29.19 ? 302 ASP A OD1 1 
ATOM   1798 O OD2 . ASP A 1 302 ? 47.030 50.480 86.525  1.00 31.67 ? 302 ASP A OD2 1 
ATOM   1799 N N   . ARG A 1 303 ? 48.657 53.217 90.612  1.00 15.77 ? 303 ARG A N   1 
ATOM   1800 C CA  . ARG A 1 303 ? 48.549 53.645 92.005  1.00 15.51 ? 303 ARG A CA  1 
ATOM   1801 C C   . ARG A 1 303 ? 49.388 54.886 92.305  1.00 15.03 ? 303 ARG A C   1 
ATOM   1802 O O   . ARG A 1 303 ? 48.916 55.822 92.951  1.00 14.83 ? 303 ARG A O   1 
ATOM   1803 C CB  . ARG A 1 303 ? 48.972 52.500 92.935  1.00 16.00 ? 303 ARG A CB  1 
ATOM   1804 C CG  . ARG A 1 303 ? 48.720 52.749 94.429  1.00 16.39 ? 303 ARG A CG  1 
ATOM   1805 C CD  . ARG A 1 303 ? 47.230 52.903 94.725  1.00 17.95 ? 303 ARG A CD  1 
ATOM   1806 N NE  . ARG A 1 303 ? 46.440 51.904 94.009  1.00 19.58 ? 303 ARG A NE  1 
ATOM   1807 C CZ  . ARG A 1 303 ? 46.427 50.603 94.287  1.00 19.82 ? 303 ARG A CZ  1 
ATOM   1808 N NH1 . ARG A 1 303 ? 45.681 49.783 93.557  1.00 19.80 ? 303 ARG A NH1 1 
ATOM   1809 N NH2 . ARG A 1 303 ? 47.135 50.120 95.302  1.00 17.50 ? 303 ARG A NH2 1 
ATOM   1810 N N   . LEU A 1 304 ? 50.633 54.893 91.835  1.00 14.43 ? 304 LEU A N   1 
ATOM   1811 C CA  . LEU A 1 304 ? 51.519 56.028 92.076  1.00 15.87 ? 304 LEU A CA  1 
ATOM   1812 C C   . LEU A 1 304 ? 50.955 57.311 91.485  1.00 17.39 ? 304 LEU A C   1 
ATOM   1813 O O   . LEU A 1 304 ? 50.978 58.362 92.127  1.00 17.57 ? 304 LEU A O   1 
ATOM   1814 C CB  . LEU A 1 304 ? 52.905 55.771 91.480  1.00 15.29 ? 304 LEU A CB  1 
ATOM   1815 C CG  . LEU A 1 304 ? 53.916 56.899 91.715  1.00 17.19 ? 304 LEU A CG  1 
ATOM   1816 C CD1 . LEU A 1 304 ? 54.261 56.973 93.195  1.00 16.93 ? 304 LEU A CD1 1 
ATOM   1817 C CD2 . LEU A 1 304 ? 55.170 56.649 90.890  1.00 18.58 ? 304 LEU A CD2 1 
ATOM   1818 N N   . LEU A 1 305 ? 50.455 57.228 90.257  1.00 18.12 ? 305 LEU A N   1 
ATOM   1819 C CA  . LEU A 1 305 ? 49.895 58.407 89.616  1.00 19.65 ? 305 LEU A CA  1 
ATOM   1820 C C   . LEU A 1 305 ? 48.641 58.880 90.350  1.00 19.09 ? 305 LEU A C   1 
ATOM   1821 O O   . LEU A 1 305 ? 48.407 60.081 90.466  1.00 20.40 ? 305 LEU A O   1 
ATOM   1822 C CB  . LEU A 1 305 ? 49.600 58.118 88.140  1.00 22.74 ? 305 LEU A CB  1 
ATOM   1823 C CG  . LEU A 1 305 ? 50.845 57.746 87.323  1.00 25.04 ? 305 LEU A CG  1 
ATOM   1824 C CD1 . LEU A 1 305 ? 50.489 57.685 85.847  1.00 27.17 ? 305 LEU A CD1 1 
ATOM   1825 C CD2 . LEU A 1 305 ? 51.951 58.773 87.550  1.00 27.30 ? 305 LEU A CD2 1 
ATOM   1826 N N   . GLN A 1 306 ? 47.841 57.943 90.855  1.00 17.66 ? 306 GLN A N   1 
ATOM   1827 C CA  . GLN A 1 306 ? 46.637 58.314 91.597  1.00 18.58 ? 306 GLN A CA  1 
ATOM   1828 C C   . GLN A 1 306 ? 47.071 59.005 92.883  1.00 16.88 ? 306 GLN A C   1 
ATOM   1829 O O   . GLN A 1 306 ? 46.481 60.006 93.291  1.00 17.71 ? 306 GLN A O   1 
ATOM   1830 C CB  . GLN A 1 306 ? 45.799 57.076 91.928  1.00 19.92 ? 306 GLN A CB  1 
ATOM   1831 C CG  . GLN A 1 306 ? 45.257 56.355 90.702  1.00 26.25 ? 306 GLN A CG  1 
ATOM   1832 C CD  . GLN A 1 306 ? 43.910 56.874 90.258  1.00 30.87 ? 306 GLN A CD  1 
ATOM   1833 O OE1 . GLN A 1 306 ? 43.659 58.078 90.269  1.00 33.43 ? 306 GLN A OE1 1 
ATOM   1834 N NE2 . GLN A 1 306 ? 43.031 55.963 89.852  1.00 33.57 ? 306 GLN A NE2 1 
ATOM   1835 N N   . LEU A 1 307 ? 48.107 58.468 93.521  1.00 17.20 ? 307 LEU A N   1 
ATOM   1836 C CA  . LEU A 1 307 ? 48.620 59.060 94.753  1.00 18.92 ? 307 LEU A CA  1 
ATOM   1837 C C   . LEU A 1 307 ? 49.122 60.478 94.498  1.00 20.29 ? 307 LEU A C   1 
ATOM   1838 O O   . LEU A 1 307 ? 48.889 61.383 95.307  1.00 20.92 ? 307 LEU A O   1 
ATOM   1839 C CB  . LEU A 1 307 ? 49.766 58.213 95.319  1.00 18.71 ? 307 LEU A CB  1 
ATOM   1840 C CG  . LEU A 1 307 ? 49.360 56.895 95.980  1.00 16.95 ? 307 LEU A CG  1 
ATOM   1841 C CD1 . LEU A 1 307 ? 50.589 56.044 96.238  1.00 17.58 ? 307 LEU A CD1 1 
ATOM   1842 C CD2 . LEU A 1 307 ? 48.611 57.186 97.275  1.00 20.73 ? 307 LEU A CD2 1 
ATOM   1843 N N   . SER A 1 308 ? 49.803 60.669 93.370  1.00 21.36 ? 308 SER A N   1 
ATOM   1844 C CA  . SER A 1 308 ? 50.346 61.978 93.020  1.00 23.79 ? 308 SER A CA  1 
ATOM   1845 C C   . SER A 1 308 ? 49.249 63.007 92.765  1.00 25.55 ? 308 SER A C   1 
ATOM   1846 O O   . SER A 1 308 ? 49.482 64.210 92.878  1.00 26.42 ? 308 SER A O   1 
ATOM   1847 C CB  . SER A 1 308 ? 51.254 61.873 91.788  1.00 24.41 ? 308 SER A CB  1 
ATOM   1848 O OG  . SER A 1 308 ? 50.519 61.595 90.609  1.00 27.03 ? 308 SER A OG  1 
ATOM   1849 N N   . GLN A 1 309 ? 48.053 62.534 92.426  1.00 26.02 ? 309 GLN A N   1 
ATOM   1850 C CA  . GLN A 1 309 ? 46.930 63.429 92.167  1.00 28.34 ? 309 GLN A CA  1 
ATOM   1851 C C   . GLN A 1 309 ? 45.957 63.472 93.344  1.00 28.34 ? 309 GLN A C   1 
ATOM   1852 O O   . GLN A 1 309 ? 44.907 64.112 93.268  1.00 28.57 ? 309 GLN A O   1 
ATOM   1853 C CB  . GLN A 1 309 ? 46.191 62.998 90.898  1.00 31.33 ? 309 GLN A CB  1 
ATOM   1854 C CG  . GLN A 1 309 ? 47.034 63.068 89.636  1.00 35.47 ? 309 GLN A CG  1 
ATOM   1855 C CD  . GLN A 1 309 ? 46.238 62.754 88.383  1.00 39.41 ? 309 GLN A CD  1 
ATOM   1856 O OE1 . GLN A 1 309 ? 46.779 62.742 87.275  1.00 42.60 ? 309 GLN A OE1 1 
ATOM   1857 N NE2 . GLN A 1 309 ? 44.945 62.501 88.551  1.00 39.84 ? 309 GLN A NE2 1 
ATOM   1858 N N   . GLY A 1 310 ? 46.311 62.787 94.428  1.00 27.95 ? 310 GLY A N   1 
ATOM   1859 C CA  . GLY A 1 310 ? 45.467 62.765 95.611  1.00 29.07 ? 310 GLY A CA  1 
ATOM   1860 C C   . GLY A 1 310 ? 44.118 62.103 95.409  1.00 30.11 ? 310 GLY A C   1 
ATOM   1861 O O   . GLY A 1 310 ? 43.125 62.507 96.016  1.00 30.91 ? 310 GLY A O   1 
ATOM   1862 N N   . GLN A 1 311 ? 44.075 61.078 94.564  1.00 28.67 ? 311 GLN A N   1 
ATOM   1863 C CA  . GLN A 1 311 ? 42.825 60.380 94.297  1.00 29.51 ? 311 GLN A CA  1 
ATOM   1864 C C   . GLN A 1 311 ? 42.905 58.891 94.592  1.00 29.11 ? 311 GLN A C   1 
ATOM   1865 O O   . GLN A 1 311 ? 41.967 58.142 94.320  1.00 24.25 ? 311 GLN A O   1 
ATOM   1866 C CB  . GLN A 1 311 ? 42.403 60.608 92.845  1.00 31.98 ? 311 GLN A CB  1 
ATOM   1867 C CG  . GLN A 1 311 ? 43.541 60.557 91.846  1.00 35.46 ? 311 GLN A CG  1 
ATOM   1868 C CD  . GLN A 1 311 ? 43.134 61.085 90.484  1.00 36.64 ? 311 GLN A CD  1 
ATOM   1869 O OE1 . GLN A 1 311 ? 42.507 62.139 90.379  1.00 40.71 ? 311 GLN A OE1 1 
ATOM   1870 N NE2 . GLN A 1 311 ? 43.499 60.364 89.434  1.00 38.91 ? 311 GLN A NE2 1 
ATOM   1871 N N   . ALA A 1 312 ? 44.027 58.465 95.157  1.00 29.57 ? 312 ALA A N   1 
ATOM   1872 C CA  . ALA A 1 312 ? 44.210 57.061 95.484  1.00 33.70 ? 312 ALA A CA  1 
ATOM   1873 C C   . ALA A 1 312 ? 43.754 56.806 96.907  1.00 37.81 ? 312 ALA A C   1 
ATOM   1874 O O   . ALA A 1 312 ? 42.579 56.966 97.237  1.00 41.83 ? 312 ALA A O   1 
ATOM   1875 C CB  . ALA A 1 312 ? 45.670 56.668 95.326  1.00 31.70 ? 312 ALA A CB  1 
ATOM   1876 N N   . VAL A 1 313 ? 44.698 56.415 97.750  1.00 40.31 ? 313 VAL A N   1 
ATOM   1877 C CA  . VAL A 1 313 ? 44.413 56.122 99.141  1.00 41.88 ? 313 VAL A CA  1 
ATOM   1878 C C   . VAL A 1 313 ? 45.615 56.477 100.001 1.00 41.34 ? 313 VAL A C   1 
ATOM   1879 O O   . VAL A 1 313 ? 46.232 57.528 99.826  1.00 42.56 ? 313 VAL A O   1 
ATOM   1880 C CB  . VAL A 1 313 ? 44.098 54.626 99.331  1.00 42.88 ? 313 VAL A CB  1 
ATOM   1881 C CG1 . VAL A 1 313 ? 42.855 54.260 98.551  1.00 44.14 ? 313 VAL A CG1 1 
ATOM   1882 C CG2 . VAL A 1 313 ? 45.276 53.783 98.862  1.00 44.27 ? 313 VAL A CG2 1 
ATOM   1883 N N   . LYS A 1 314 ? 45.938 55.589 100.930 1.00 41.46 ? 314 LYS A N   1 
ATOM   1884 C CA  . LYS A 1 314 ? 47.067 55.774 101.821 1.00 39.37 ? 314 LYS A CA  1 
ATOM   1885 C C   . LYS A 1 314 ? 47.164 54.525 102.681 1.00 36.92 ? 314 LYS A C   1 
ATOM   1886 O O   . LYS A 1 314 ? 46.670 54.498 103.809 1.00 38.64 ? 314 LYS A O   1 
ATOM   1887 C CB  . LYS A 1 314 ? 46.851 57.004 102.703 1.00 41.22 ? 314 LYS A CB  1 
ATOM   1888 C CG  . LYS A 1 314 ? 48.122 57.782 102.978 1.00 42.12 ? 314 LYS A CG  1 
ATOM   1889 C CD  . LYS A 1 314 ? 48.712 58.319 101.683 1.00 43.09 ? 314 LYS A CD  1 
ATOM   1890 C CE  . LYS A 1 314 ? 50.013 59.056 101.928 1.00 44.05 ? 314 LYS A CE  1 
ATOM   1891 N NZ  . LYS A 1 314 ? 50.579 59.569 100.654 1.00 44.81 ? 314 LYS A NZ  1 
ATOM   1892 N N   . GLY A 1 315 ? 47.790 53.487 102.137 1.00 30.93 ? 315 GLY A N   1 
ATOM   1893 C CA  . GLY A 1 315 ? 47.930 52.247 102.873 1.00 25.56 ? 315 GLY A CA  1 
ATOM   1894 C C   . GLY A 1 315 ? 48.405 51.101 102.002 1.00 22.30 ? 315 GLY A C   1 
ATOM   1895 O O   . GLY A 1 315 ? 48.964 51.313 100.926 1.00 19.33 ? 315 GLY A O   1 
ATOM   1896 N N   . ASN A 1 316 ? 48.174 49.883 102.473 1.00 20.34 ? 316 ASN A N   1 
ATOM   1897 C CA  . ASN A 1 316 ? 48.591 48.692 101.751 1.00 18.24 ? 316 ASN A CA  1 
ATOM   1898 C C   . ASN A 1 316 ? 47.482 47.957 101.017 1.00 18.26 ? 316 ASN A C   1 
ATOM   1899 O O   . ASN A 1 316 ? 46.333 47.923 101.460 1.00 18.47 ? 316 ASN A O   1 
ATOM   1900 C CB  . ASN A 1 316 ? 49.266 47.710 102.712 1.00 19.02 ? 316 ASN A CB  1 
ATOM   1901 C CG  . ASN A 1 316 ? 49.415 46.318 102.115 1.00 20.80 ? 316 ASN A CG  1 
ATOM   1902 O OD1 . ASN A 1 316 ? 48.519 45.476 102.227 1.00 19.55 ? 316 ASN A OD1 1 
ATOM   1903 N ND2 . ASN A 1 316 ? 50.544 46.077 101.461 1.00 17.18 ? 316 ASN A ND2 1 
ATOM   1904 N N   . GLN A 1 317 ? 47.849 47.382 99.875  1.00 15.34 ? 317 GLN A N   1 
ATOM   1905 C CA  . GLN A 1 317 ? 46.945 46.566 99.082  1.00 15.77 ? 317 GLN A CA  1 
ATOM   1906 C C   . GLN A 1 317 ? 47.635 45.216 98.992  1.00 16.11 ? 317 GLN A C   1 
ATOM   1907 O O   . GLN A 1 317 ? 48.853 45.145 98.795  1.00 14.99 ? 317 GLN A O   1 
ATOM   1908 C CB  . GLN A 1 317 ? 46.749 47.110 97.657  1.00 15.69 ? 317 GLN A CB  1 
ATOM   1909 C CG  . GLN A 1 317 ? 46.143 46.046 96.723  1.00 17.79 ? 317 GLN A CG  1 
ATOM   1910 C CD  . GLN A 1 317 ? 45.815 46.549 95.325  1.00 18.09 ? 317 GLN A CD  1 
ATOM   1911 O OE1 . GLN A 1 317 ? 46.461 47.458 94.809  1.00 19.67 ? 317 GLN A OE1 1 
ATOM   1912 N NE2 . GLN A 1 317 ? 44.816 45.934 94.697  1.00 17.79 ? 317 GLN A NE2 1 
ATOM   1913 N N   . LEU A 1 318 ? 46.860 44.151 99.163  1.00 14.20 ? 318 LEU A N   1 
ATOM   1914 C CA  . LEU A 1 318 ? 47.380 42.797 99.066  1.00 14.24 ? 318 LEU A CA  1 
ATOM   1915 C C   . LEU A 1 318 ? 46.868 42.197 97.765  1.00 15.48 ? 318 LEU A C   1 
ATOM   1916 O O   . LEU A 1 318 ? 45.666 42.223 97.499  1.00 17.55 ? 318 LEU A O   1 
ATOM   1917 C CB  . LEU A 1 318 ? 46.878 41.943 100.229 1.00 15.04 ? 318 LEU A CB  1 
ATOM   1918 C CG  . LEU A 1 318 ? 47.523 42.161 101.593 1.00 16.56 ? 318 LEU A CG  1 
ATOM   1919 C CD1 . LEU A 1 318 ? 46.745 41.381 102.654 1.00 19.26 ? 318 LEU A CD1 1 
ATOM   1920 C CD2 . LEU A 1 318 ? 48.966 41.690 101.542 1.00 16.56 ? 318 LEU A CD2 1 
ATOM   1921 N N   . LEU A 1 319 ? 47.779 41.672 96.952  1.00 14.99 ? 319 LEU A N   1 
ATOM   1922 C CA  . LEU A 1 319 ? 47.397 41.043 95.694  1.00 15.19 ? 319 LEU A CA  1 
ATOM   1923 C C   . LEU A 1 319 ? 47.311 39.545 95.919  1.00 15.31 ? 319 LEU A C   1 
ATOM   1924 O O   . LEU A 1 319 ? 48.117 38.967 96.646  1.00 15.26 ? 319 LEU A O   1 
ATOM   1925 C CB  . LEU A 1 319 ? 48.426 41.333 94.602  1.00 15.67 ? 319 LEU A CB  1 
ATOM   1926 C CG  . LEU A 1 319 ? 48.556 42.783 94.139  1.00 16.12 ? 319 LEU A CG  1 
ATOM   1927 C CD1 . LEU A 1 319 ? 49.638 42.871 93.068  1.00 17.47 ? 319 LEU A CD1 1 
ATOM   1928 C CD2 . LEU A 1 319 ? 47.224 43.273 93.592  1.00 19.52 ? 319 LEU A CD2 1 
ATOM   1929 N N   . PRO A 1 320 ? 46.328 38.891 95.292  1.00 16.29 ? 320 PRO A N   1 
ATOM   1930 C CA  . PRO A 1 320 ? 46.175 37.446 95.455  1.00 16.45 ? 320 PRO A CA  1 
ATOM   1931 C C   . PRO A 1 320 ? 47.241 36.626 94.735  1.00 16.08 ? 320 PRO A C   1 
ATOM   1932 O O   . PRO A 1 320 ? 47.921 37.113 93.827  1.00 16.62 ? 320 PRO A O   1 
ATOM   1933 C CB  . PRO A 1 320 ? 44.781 37.188 94.890  1.00 19.36 ? 320 PRO A CB  1 
ATOM   1934 C CG  . PRO A 1 320 ? 44.696 38.193 93.777  1.00 20.97 ? 320 PRO A CG  1 
ATOM   1935 C CD  . PRO A 1 320 ? 45.268 39.443 94.428  1.00 18.47 ? 320 PRO A CD  1 
ATOM   1936 N N   . VAL A 1 321 ? 47.384 35.382 95.173  1.00 15.03 ? 321 VAL A N   1 
ATOM   1937 C CA  . VAL A 1 321 ? 48.309 34.433 94.573  1.00 14.54 ? 321 VAL A CA  1 
ATOM   1938 C C   . VAL A 1 321 ? 47.495 33.158 94.404  1.00 15.35 ? 321 VAL A C   1 
ATOM   1939 O O   . VAL A 1 321 ? 46.395 33.040 94.952  1.00 18.57 ? 321 VAL A O   1 
ATOM   1940 C CB  . VAL A 1 321 ? 49.536 34.145 95.477  1.00 14.32 ? 321 VAL A CB  1 
ATOM   1941 C CG1 . VAL A 1 321 ? 50.345 35.423 95.672  1.00 14.77 ? 321 VAL A CG1 1 
ATOM   1942 C CG2 . VAL A 1 321 ? 49.084 33.578 96.829  1.00 14.46 ? 321 VAL A CG2 1 
ATOM   1943 N N   . SER A 1 322 ? 48.017 32.210 93.640  1.00 14.30 ? 322 SER A N   1 
ATOM   1944 C CA  . SER A 1 322 ? 47.307 30.960 93.427  1.00 14.90 ? 322 SER A CA  1 
ATOM   1945 C C   . SER A 1 322 ? 48.287 29.812 93.276  1.00 14.27 ? 322 SER A C   1 
ATOM   1946 O O   . SER A 1 322 ? 49.467 30.019 92.992  1.00 15.25 ? 322 SER A O   1 
ATOM   1947 C CB  . SER A 1 322 ? 46.421 31.056 92.180  1.00 16.56 ? 322 SER A CB  1 
ATOM   1948 O OG  . SER A 1 322 ? 47.201 31.250 91.014  1.00 17.66 ? 322 SER A OG  1 
ATOM   1949 N N   . LEU A 1 323 ? 47.790 28.600 93.486  1.00 13.51 ? 323 LEU A N   1 
ATOM   1950 C CA  . LEU A 1 323 ? 48.600 27.399 93.366  1.00 13.90 ? 323 LEU A CA  1 
ATOM   1951 C C   . LEU A 1 323 ? 48.488 26.865 91.946  1.00 14.64 ? 323 LEU A C   1 
ATOM   1952 O O   . LEU A 1 323 ? 47.387 26.714 91.418  1.00 15.29 ? 323 LEU A O   1 
ATOM   1953 C CB  . LEU A 1 323 ? 48.102 26.331 94.341  1.00 15.13 ? 323 LEU A CB  1 
ATOM   1954 C CG  . LEU A 1 323 ? 48.697 24.925 94.229  1.00 16.87 ? 323 LEU A CG  1 
ATOM   1955 C CD1 . LEU A 1 323 ? 50.156 24.948 94.660  1.00 17.35 ? 323 LEU A CD1 1 
ATOM   1956 C CD2 . LEU A 1 323 ? 47.896 23.964 95.112  1.00 17.81 ? 323 LEU A CD2 1 
ATOM   1957 N N   . VAL A 1 324 ? 49.632 26.588 91.331  1.00 14.42 ? 324 VAL A N   1 
ATOM   1958 C CA  . VAL A 1 324 ? 49.661 26.046 89.976  1.00 15.16 ? 324 VAL A CA  1 
ATOM   1959 C C   . VAL A 1 324 ? 50.155 24.613 90.116  1.00 15.25 ? 324 VAL A C   1 
ATOM   1960 O O   . VAL A 1 324 ? 51.334 24.379 90.369  1.00 16.56 ? 324 VAL A O   1 
ATOM   1961 C CB  . VAL A 1 324 ? 50.631 26.839 89.075  1.00 16.15 ? 324 VAL A CB  1 
ATOM   1962 C CG1 . VAL A 1 324 ? 50.642 26.241 87.675  1.00 18.08 ? 324 VAL A CG1 1 
ATOM   1963 C CG2 . VAL A 1 324 ? 50.216 28.305 89.029  1.00 17.63 ? 324 VAL A CG2 1 
ATOM   1964 N N   . LYS A 1 325 ? 49.246 23.656 89.978  1.00 16.25 ? 325 LYS A N   1 
ATOM   1965 C CA  . LYS A 1 325 ? 49.605 22.252 90.116  1.00 17.32 ? 325 LYS A CA  1 
ATOM   1966 C C   . LYS A 1 325 ? 50.177 21.682 88.833  1.00 17.60 ? 325 LYS A C   1 
ATOM   1967 O O   . LYS A 1 325 ? 49.534 21.727 87.785  1.00 17.28 ? 325 LYS A O   1 
ATOM   1968 C CB  . LYS A 1 325 ? 48.382 21.425 90.527  1.00 19.62 ? 325 LYS A CB  1 
ATOM   1969 C CG  . LYS A 1 325 ? 47.796 21.799 91.880  1.00 22.98 ? 325 LYS A CG  1 
ATOM   1970 C CD  . LYS A 1 325 ? 46.603 20.909 92.213  1.00 25.84 ? 325 LYS A CD  1 
ATOM   1971 C CE  . LYS A 1 325 ? 45.958 21.307 93.530  1.00 28.08 ? 325 LYS A CE  1 
ATOM   1972 N NZ  . LYS A 1 325 ? 44.795 20.432 93.852  1.00 31.52 ? 325 LYS A NZ  1 
ATOM   1973 N N   . ARG A 1 326 ? 51.389 21.149 88.919  1.00 16.32 ? 326 ARG A N   1 
ATOM   1974 C CA  . ARG A 1 326 ? 52.016 20.549 87.754  1.00 17.29 ? 326 ARG A CA  1 
ATOM   1975 C C   . ARG A 1 326 ? 52.453 19.105 88.013  1.00 18.31 ? 326 ARG A C   1 
ATOM   1976 O O   . ARG A 1 326 ? 51.661 18.305 88.517  1.00 20.04 ? 326 ARG A O   1 
ATOM   1977 C CB  . ARG A 1 326 ? 53.183 21.418 87.264  1.00 16.93 ? 326 ARG A CB  1 
ATOM   1978 C CG  . ARG A 1 326 ? 52.727 22.795 86.781  1.00 16.51 ? 326 ARG A CG  1 
ATOM   1979 C CD  . ARG A 1 326 ? 53.690 23.388 85.753  1.00 15.78 ? 326 ARG A CD  1 
ATOM   1980 N NE  . ARG A 1 326 ? 53.253 24.695 85.265  1.00 15.89 ? 326 ARG A NE  1 
ATOM   1981 C CZ  . ARG A 1 326 ? 53.758 25.859 85.664  1.00 16.34 ? 326 ARG A CZ  1 
ATOM   1982 N NH1 . ARG A 1 326 ? 54.727 25.900 86.572  1.00 15.87 ? 326 ARG A NH1 1 
ATOM   1983 N NH2 . ARG A 1 326 ? 53.305 26.988 85.138  1.00 18.25 ? 326 ARG A NH2 1 
ATOM   1984 N N   . LYS A 1 327 ? 53.705 18.771 87.712  1.00 18.14 ? 327 LYS A N   1 
ATOM   1985 C CA  . LYS A 1 327 ? 54.168 17.391 87.849  1.00 18.42 ? 327 LYS A CA  1 
ATOM   1986 C C   . LYS A 1 327 ? 55.163 17.057 88.953  1.00 17.79 ? 327 LYS A C   1 
ATOM   1987 O O   . LYS A 1 327 ? 55.667 15.934 88.999  1.00 19.73 ? 327 LYS A O   1 
ATOM   1988 C CB  . LYS A 1 327 ? 54.775 16.937 86.516  1.00 18.07 ? 327 LYS A CB  1 
ATOM   1989 C CG  . LYS A 1 327 ? 53.851 17.083 85.315  1.00 22.51 ? 327 LYS A CG  1 
ATOM   1990 C CD  . LYS A 1 327 ? 52.673 16.133 85.410  1.00 24.86 ? 327 LYS A CD  1 
ATOM   1991 C CE  . LYS A 1 327 ? 51.807 16.204 84.163  1.00 28.21 ? 327 LYS A CE  1 
ATOM   1992 N NZ  . LYS A 1 327 ? 50.676 15.239 84.236  1.00 31.34 ? 327 LYS A NZ  1 
ATOM   1993 N N   . THR A 1 328 ? 55.445 17.998 89.846  1.00 16.14 ? 328 THR A N   1 
ATOM   1994 C CA  . THR A 1 328 ? 56.428 17.741 90.892  1.00 16.31 ? 328 THR A CA  1 
ATOM   1995 C C   . THR A 1 328 ? 55.864 17.416 92.270  1.00 16.15 ? 328 THR A C   1 
ATOM   1996 O O   . THR A 1 328 ? 56.621 17.318 93.236  1.00 15.93 ? 328 THR A O   1 
ATOM   1997 C CB  . THR A 1 328 ? 57.382 18.932 91.039  1.00 15.48 ? 328 THR A CB  1 
ATOM   1998 O OG1 . THR A 1 328 ? 56.622 20.111 91.323  1.00 15.08 ? 328 THR A OG1 1 
ATOM   1999 C CG2 . THR A 1 328 ? 58.174 19.143 89.742  1.00 15.99 ? 328 THR A CG2 1 
ATOM   2000 N N   . THR A 1 329 ? 54.550 17.248 92.359  1.00 16.41 ? 329 THR A N   1 
ATOM   2001 C CA  . THR A 1 329 ? 53.914 16.929 93.635  1.00 19.25 ? 329 THR A CA  1 
ATOM   2002 C C   . THR A 1 329 ? 52.969 15.736 93.535  1.00 20.66 ? 329 THR A C   1 
ATOM   2003 O O   . THR A 1 329 ? 52.000 15.745 92.769  1.00 21.02 ? 329 THR A O   1 
ATOM   2004 C CB  . THR A 1 329 ? 53.132 18.138 94.198  1.00 19.38 ? 329 THR A CB  1 
ATOM   2005 O OG1 . THR A 1 329 ? 52.286 18.688 93.180  1.00 20.25 ? 329 THR A OG1 1 
ATOM   2006 C CG2 . THR A 1 329 ? 54.090 19.205 94.697  1.00 19.51 ? 329 THR A CG2 1 
ATOM   2007 N N   . LEU A 1 330 ? 53.274 14.708 94.319  1.00 20.92 ? 330 LEU A N   1 
ATOM   2008 C CA  . LEU A 1 330 ? 52.486 13.483 94.366  1.00 21.38 ? 330 LEU A CA  1 
ATOM   2009 C C   . LEU A 1 330 ? 52.437 13.005 95.811  1.00 22.43 ? 330 LEU A C   1 
ATOM   2010 O O   . LEU A 1 330 ? 53.169 13.513 96.662  1.00 21.31 ? 330 LEU A O   1 
ATOM   2011 C CB  . LEU A 1 330 ? 53.138 12.398 93.504  1.00 22.71 ? 330 LEU A CB  1 
ATOM   2012 C CG  . LEU A 1 330 ? 53.171 12.611 91.990  1.00 23.61 ? 330 LEU A CG  1 
ATOM   2013 C CD1 . LEU A 1 330 ? 54.081 11.577 91.344  1.00 26.02 ? 330 LEU A CD1 1 
ATOM   2014 C CD2 . LEU A 1 330 ? 51.762 12.510 91.433  1.00 26.10 ? 330 LEU A CD2 1 
ATOM   2015 N N   . ALA A 1 331 ? 51.574 12.035 96.089  1.00 23.00 ? 331 ALA A N   1 
ATOM   2016 C CA  . ALA A 1 331 ? 51.476 11.489 97.438  1.00 24.65 ? 331 ALA A CA  1 
ATOM   2017 C C   . ALA A 1 331 ? 52.843 10.894 97.767  1.00 26.40 ? 331 ALA A C   1 
ATOM   2018 O O   . ALA A 1 331 ? 53.563 10.453 96.869  1.00 28.64 ? 331 ALA A O   1 
ATOM   2019 C CB  . ALA A 1 331 ? 50.403 10.413 97.491  1.00 25.06 ? 331 ALA A CB  1 
ATOM   2020 N N   . PRO A 1 332 ? 53.224 10.875 99.053  1.00 26.88 ? 332 PRO A N   1 
ATOM   2021 C CA  . PRO A 1 332 ? 54.529 10.319 99.426  1.00 28.16 ? 332 PRO A CA  1 
ATOM   2022 C C   . PRO A 1 332 ? 54.695 8.836  99.108  1.00 29.75 ? 332 PRO A C   1 
ATOM   2023 O O   . PRO A 1 332 ? 53.670 8.154  98.895  1.00 30.49 ? 332 PRO A O   1 
ATOM   2024 C CB  . PRO A 1 332 ? 54.611 10.606 100.924 1.00 27.80 ? 332 PRO A CB  1 
ATOM   2025 C CG  . PRO A 1 332 ? 53.178 10.581 101.351 1.00 27.24 ? 332 PRO A CG  1 
ATOM   2026 C CD  . PRO A 1 332 ? 52.494 11.343 100.242 1.00 27.06 ? 332 PRO A CD  1 
HETATM 2027 C C1  . GOL B 2 .   ? 61.993 35.821 94.205  1.00 21.60 ? 350 GOL A C1  1 
HETATM 2028 O O1  . GOL B 2 .   ? 62.127 34.999 93.053  1.00 19.12 ? 350 GOL A O1  1 
HETATM 2029 C C2  . GOL B 2 .   ? 60.513 36.036 94.520  1.00 23.55 ? 350 GOL A C2  1 
HETATM 2030 O O2  . GOL B 2 .   ? 59.913 34.801 94.878  1.00 22.10 ? 350 GOL A O2  1 
HETATM 2031 C C3  . GOL B 2 .   ? 60.344 37.036 95.659  1.00 26.84 ? 350 GOL A C3  1 
HETATM 2032 O O3  . GOL B 2 .   ? 58.964 37.183 95.960  1.00 27.81 ? 350 GOL A O3  1 
HETATM 2033 O O   . HOH C 3 .   ? 59.061 52.588 79.125  1.00 23.40 ? 351 HOH A O   1 
HETATM 2034 O O   . HOH C 3 .   ? 68.515 34.504 91.264  1.00 26.59 ? 352 HOH A O   1 
HETATM 2035 O O   . HOH C 3 .   ? 65.432 39.780 97.779  1.00 28.54 ? 353 HOH A O   1 
HETATM 2036 O O   . HOH C 3 .   ? 63.949 36.648 91.615  1.00 22.22 ? 354 HOH A O   1 
HETATM 2037 O O   . HOH C 3 .   ? 53.529 35.921 97.994  1.00 23.17 ? 355 HOH A O   1 
HETATM 2038 O O   . HOH C 3 .   ? 70.004 30.681 89.053  1.00 21.29 ? 356 HOH A O   1 
HETATM 2039 O O   . HOH C 3 .   ? 49.432 37.931 103.326 1.00 21.40 ? 357 HOH A O   1 
HETATM 2040 O O   . HOH C 3 .   ? 56.698 27.018 97.838  1.00 16.30 ? 358 HOH A O   1 
HETATM 2041 O O   . HOH C 3 .   ? 59.792 48.121 99.085  1.00 14.36 ? 359 HOH A O   1 
HETATM 2042 O O   . HOH C 3 .   ? 65.515 46.437 105.833 1.00 20.19 ? 360 HOH A O   1 
HETATM 2043 O O   . HOH C 3 .   ? 69.846 45.267 106.068 1.00 46.23 ? 361 HOH A O   1 
HETATM 2044 O O   . HOH C 3 .   ? 56.145 12.351 96.758  1.00 23.02 ? 362 HOH A O   1 
HETATM 2045 O O   . HOH C 3 .   ? 55.154 40.685 97.624  1.00 31.27 ? 363 HOH A O   1 
HETATM 2046 O O   . HOH C 3 .   ? 44.349 37.954 98.416  1.00 48.23 ? 364 HOH A O   1 
HETATM 2047 O O   . HOH C 3 .   ? 62.843 43.654 95.584  1.00 23.10 ? 365 HOH A O   1 
HETATM 2048 O O   . HOH C 3 .   ? 57.121 64.830 86.751  1.00 40.00 ? 366 HOH A O   1 
HETATM 2049 O O   . HOH C 3 .   ? 71.299 26.743 104.955 1.00 17.05 ? 367 HOH A O   1 
HETATM 2050 O O   . HOH C 3 .   ? 63.868 21.419 110.981 1.00 29.88 ? 368 HOH A O   1 
HETATM 2051 O O   . HOH C 3 .   ? 58.251 17.151 108.524 1.00 20.19 ? 369 HOH A O   1 
HETATM 2052 O O   . HOH C 3 .   ? 55.919 12.148 104.362 1.00 19.47 ? 370 HOH A O   1 
HETATM 2053 O O   . HOH C 3 .   ? 56.082 23.238 113.275 1.00 22.27 ? 371 HOH A O   1 
HETATM 2054 O O   . HOH C 3 .   ? 52.860 48.110 103.972 1.00 19.44 ? 372 HOH A O   1 
HETATM 2055 O O   . HOH C 3 .   ? 61.252 32.302 83.407  1.00 20.57 ? 373 HOH A O   1 
HETATM 2056 O O   . HOH C 3 .   ? 55.515 31.495 112.016 0.5  28.19 ? 374 HOH A O   1 
HETATM 2057 O O   . HOH C 3 .   ? 58.054 29.479 78.363  1.00 20.87 ? 375 HOH A O   1 
HETATM 2058 O O   . HOH C 3 .   ? 44.177 44.691 99.987  1.00 17.77 ? 376 HOH A O   1 
HETATM 2059 O O   . HOH C 3 .   ? 62.242 32.051 90.489  1.00 18.46 ? 377 HOH A O   1 
HETATM 2060 O O   . HOH C 3 .   ? 61.288 58.014 78.363  1.00 23.11 ? 378 HOH A O   1 
HETATM 2061 O O   . HOH C 3 .   ? 67.289 22.402 110.061 1.00 22.57 ? 379 HOH A O   1 
HETATM 2062 O O   . HOH C 3 .   ? 58.389 45.950 105.975 1.00 18.57 ? 380 HOH A O   1 
HETATM 2063 O O   . HOH C 3 .   ? 60.971 56.118 80.398  1.00 22.32 ? 381 HOH A O   1 
HETATM 2064 O O   . HOH C 3 .   ? 70.491 35.088 93.326  1.00 22.73 ? 382 HOH A O   1 
HETATM 2065 O O   . HOH C 3 .   ? 54.568 55.490 101.431 1.00 20.37 ? 383 HOH A O   1 
HETATM 2066 O O   . HOH C 3 .   ? 48.789 30.121 113.763 1.00 24.39 ? 384 HOH A O   1 
HETATM 2067 O O   . HOH C 3 .   ? 49.557 36.528 91.716  1.00 22.38 ? 385 HOH A O   1 
HETATM 2068 O O   . HOH C 3 .   ? 53.836 22.361 81.700  1.00 22.77 ? 386 HOH A O   1 
HETATM 2069 O O   . HOH C 3 .   ? 59.888 44.439 109.862 1.00 32.00 ? 387 HOH A O   1 
HETATM 2070 O O   . HOH C 3 .   ? 62.873 40.480 98.264  1.00 25.61 ? 388 HOH A O   1 
HETATM 2071 O O   . HOH C 3 .   ? 45.484 20.209 103.466 1.00 24.70 ? 389 HOH A O   1 
HETATM 2072 O O   . HOH C 3 .   ? 56.363 39.171 83.342  1.00 30.09 ? 390 HOH A O   1 
HETATM 2073 O O   . HOH C 3 .   ? 66.893 46.276 103.443 1.00 28.18 ? 391 HOH A O   1 
HETATM 2074 O O   . HOH C 3 .   ? 46.279 18.741 109.093 1.00 29.80 ? 392 HOH A O   1 
HETATM 2075 O O   . HOH C 3 .   ? 57.625 10.805 98.514  1.00 24.20 ? 393 HOH A O   1 
HETATM 2076 O O   . HOH C 3 .   ? 52.810 33.299 113.179 1.00 29.32 ? 394 HOH A O   1 
HETATM 2077 O O   . HOH C 3 .   ? 53.894 35.102 106.444 1.00 31.72 ? 395 HOH A O   1 
HETATM 2078 O O   . HOH C 3 .   ? 48.727 39.421 105.394 1.00 24.65 ? 396 HOH A O   1 
HETATM 2079 O O   . HOH C 3 .   ? 52.189 16.272 90.247  1.00 31.15 ? 397 HOH A O   1 
HETATM 2080 O O   . HOH C 3 .   ? 64.522 20.420 85.374  1.00 28.63 ? 398 HOH A O   1 
HETATM 2081 O O   . HOH C 3 .   ? 74.361 27.551 99.093  1.00 30.88 ? 399 HOH A O   1 
HETATM 2082 O O   . HOH C 3 .   ? 55.461 34.130 100.628 1.00 21.77 ? 400 HOH A O   1 
HETATM 2083 O O   . HOH C 3 .   ? 49.918 14.837 105.769 1.00 26.18 ? 401 HOH A O   1 
HETATM 2084 O O   . HOH C 3 .   ? 48.431 53.345 98.719  1.00 23.86 ? 402 HOH A O   1 
HETATM 2085 O O   . HOH C 3 .   ? 44.083 44.820 103.079 1.00 33.51 ? 403 HOH A O   1 
HETATM 2086 O O   . HOH C 3 .   ? 54.028 64.532 92.718  1.00 32.70 ? 404 HOH A O   1 
HETATM 2087 O O   . HOH C 3 .   ? 69.921 30.242 108.090 1.00 21.57 ? 405 HOH A O   1 
HETATM 2088 O O   . HOH C 3 .   ? 70.409 13.710 86.351  1.00 44.63 ? 406 HOH A O   1 
HETATM 2089 O O   . HOH C 3 .   ? 46.429 24.927 107.169 1.00 28.18 ? 407 HOH A O   1 
HETATM 2090 O O   . HOH C 3 .   ? 44.655 49.779 102.417 1.00 43.38 ? 408 HOH A O   1 
HETATM 2091 O O   . HOH C 3 .   ? 75.724 15.813 91.622  1.00 36.44 ? 409 HOH A O   1 
HETATM 2092 O O   . HOH C 3 .   ? 64.021 15.235 87.054  1.00 26.99 ? 410 HOH A O   1 
HETATM 2093 O O   . HOH C 3 .   ? 56.385 60.664 100.730 1.00 31.98 ? 411 HOH A O   1 
HETATM 2094 O O   . HOH C 3 .   ? 65.679 43.832 106.487 1.00 27.39 ? 412 HOH A O   1 
HETATM 2095 O O   . HOH C 3 .   ? 54.877 34.851 87.666  1.00 23.96 ? 413 HOH A O   1 
HETATM 2096 O O   . HOH C 3 .   ? 58.138 57.957 107.223 1.00 27.50 ? 414 HOH A O   1 
HETATM 2097 O O   . HOH C 3 .   ? 40.616 58.357 89.656  1.00 27.67 ? 415 HOH A O   1 
HETATM 2098 O O   . HOH C 3 .   ? 58.467 55.450 79.744  1.00 25.81 ? 416 HOH A O   1 
HETATM 2099 O O   . HOH C 3 .   ? 48.518 50.941 97.657  1.00 20.37 ? 417 HOH A O   1 
HETATM 2100 O O   . HOH C 3 .   ? 75.333 25.779 103.604 1.00 39.08 ? 418 HOH A O   1 
HETATM 2101 O O   . HOH C 3 .   ? 64.725 43.250 103.772 1.00 19.64 ? 419 HOH A O   1 
HETATM 2102 O O   . HOH C 3 .   ? 44.343 50.094 90.733  1.00 38.83 ? 420 HOH A O   1 
HETATM 2103 O O   . HOH C 3 .   ? 63.285 23.725 112.045 0.5  26.09 ? 421 HOH A O   1 
HETATM 2104 O O   . HOH C 3 .   ? 50.234 47.517 81.373  1.00 48.39 ? 422 HOH A O   1 
HETATM 2105 O O   . HOH C 3 .   ? 62.943 35.749 80.804  1.00 33.01 ? 423 HOH A O   1 
HETATM 2106 O O   . HOH C 3 .   ? 46.617 24.085 98.661  1.00 25.61 ? 424 HOH A O   1 
HETATM 2107 O O   . HOH C 3 .   ? 46.765 24.084 88.776  1.00 27.77 ? 425 HOH A O   1 
HETATM 2108 O O   . HOH C 3 .   ? 49.539 48.546 106.618 1.00 32.22 ? 426 HOH A O   1 
HETATM 2109 O O   . HOH C 3 .   ? 67.405 19.120 110.632 1.00 29.40 ? 427 HOH A O   1 
HETATM 2110 O O   . HOH C 3 .   ? 65.494 11.564 106.737 1.00 32.93 ? 428 HOH A O   1 
HETATM 2111 O O   . HOH C 3 .   ? 46.079 18.561 111.862 1.00 35.96 ? 429 HOH A O   1 
HETATM 2112 O O   . HOH C 3 .   ? 53.098 34.316 115.637 1.00 20.52 ? 430 HOH A O   1 
HETATM 2113 O O   . HOH C 3 .   ? 56.344 41.871 83.397  1.00 23.62 ? 431 HOH A O   1 
HETATM 2114 O O   . HOH C 3 .   ? 45.669 54.916 85.259  1.00 46.54 ? 432 HOH A O   1 
HETATM 2115 O O   . HOH C 3 .   ? 56.522 13.279 85.532  1.00 39.96 ? 433 HOH A O   1 
HETATM 2116 O O   . HOH C 3 .   ? 66.056 35.417 90.505  1.00 22.77 ? 434 HOH A O   1 
HETATM 2117 O O   . HOH C 3 .   ? 43.242 47.793 103.444 1.00 44.18 ? 435 HOH A O   1 
HETATM 2118 O O   . HOH C 3 .   ? 66.709 20.980 87.589  1.00 34.42 ? 436 HOH A O   1 
HETATM 2119 O O   . HOH C 3 .   ? 56.236 16.831 113.365 1.00 25.20 ? 437 HOH A O   1 
HETATM 2120 O O   . HOH C 3 .   ? 45.430 32.813 109.342 1.00 47.79 ? 438 HOH A O   1 
HETATM 2121 O O   . HOH C 3 .   ? 45.427 21.494 105.897 1.00 29.56 ? 439 HOH A O   1 
HETATM 2122 O O   . HOH C 3 .   ? 65.685 15.810 110.768 1.00 34.37 ? 440 HOH A O   1 
HETATM 2123 O O   . HOH C 3 .   ? 69.747 19.826 106.409 1.00 26.11 ? 441 HOH A O   1 
HETATM 2124 O O   . HOH C 3 .   ? 49.631 38.690 107.926 1.00 31.48 ? 442 HOH A O   1 
HETATM 2125 O O   . HOH C 3 .   ? 47.067 43.248 105.837 1.00 31.03 ? 443 HOH A O   1 
HETATM 2126 O O   . HOH C 3 .   ? 64.071 38.899 82.849  1.00 39.42 ? 444 HOH A O   1 
HETATM 2127 O O   . HOH C 3 .   ? 55.512 44.848 77.426  1.00 39.03 ? 445 HOH A O   1 
HETATM 2128 O O   . HOH C 3 .   ? 61.761 32.042 102.266 1.00 13.73 ? 446 HOH A O   1 
HETATM 2129 O O   . HOH C 3 .   ? 54.459 27.662 99.528  1.00 14.17 ? 447 HOH A O   1 
HETATM 2130 O O   . HOH C 3 .   ? 67.791 43.382 96.797  1.00 24.01 ? 448 HOH A O   1 
HETATM 2131 O O   . HOH C 3 .   ? 50.482 16.255 117.035 1.00 35.23 ? 449 HOH A O   1 
HETATM 2132 O O   . HOH C 3 .   ? 66.136 20.871 112.050 0.5  37.38 ? 450 HOH A O   1 
HETATM 2133 O O   . HOH C 3 .   ? 69.102 48.028 106.552 1.00 33.81 ? 451 HOH A O   1 
HETATM 2134 O O   . HOH C 3 .   ? 65.017 58.881 106.838 1.00 30.93 ? 452 HOH A O   1 
HETATM 2135 O O   . HOH C 3 .   ? 46.511 45.269 104.064 1.00 25.99 ? 453 HOH A O   1 
HETATM 2136 O O   . HOH C 3 .   ? 55.903 43.290 81.029  1.00 35.12 ? 454 HOH A O   1 
HETATM 2137 O O   . HOH C 3 .   ? 71.862 15.798 85.522  1.00 28.61 ? 455 HOH A O   1 
HETATM 2138 O O   . HOH C 3 .   ? 61.671 10.499 99.950  1.00 30.04 ? 456 HOH A O   1 
HETATM 2139 O O   . HOH C 3 .   ? 55.673 13.340 87.963  1.00 29.76 ? 457 HOH A O   1 
HETATM 2140 O O   . HOH C 3 .   ? 54.856 50.317 112.469 1.00 41.51 ? 458 HOH A O   1 
HETATM 2141 O O   . HOH C 3 .   ? 61.215 43.157 93.593  1.00 28.59 ? 459 HOH A O   1 
HETATM 2142 O O   . HOH C 3 .   ? 56.804 36.678 100.749 1.00 30.34 ? 460 HOH A O   1 
HETATM 2143 O O   . HOH C 3 .   ? 72.819 12.918 97.654  1.00 38.98 ? 461 HOH A O   1 
HETATM 2144 O O   . HOH C 3 .   ? 60.244 12.553 88.069  1.00 30.68 ? 462 HOH A O   1 
HETATM 2145 O O   . HOH C 3 .   ? 63.152 13.140 88.503  1.00 27.45 ? 463 HOH A O   1 
HETATM 2146 O O   . HOH C 3 .   ? 78.840 20.186 83.780  1.00 32.17 ? 464 HOH A O   1 
HETATM 2147 O O   . HOH C 3 .   ? 47.393 40.025 85.030  1.00 36.27 ? 465 HOH A O   1 
HETATM 2148 O O   . HOH C 3 .   ? 62.296 57.245 110.147 1.00 39.70 ? 466 HOH A O   1 
HETATM 2149 O O   . HOH C 3 .   ? 77.197 21.656 89.963  1.00 36.18 ? 467 HOH A O   1 
HETATM 2150 O O   . HOH C 3 .   ? 75.736 16.812 86.389  1.00 26.60 ? 468 HOH A O   1 
HETATM 2151 O O   . HOH C 3 .   ? 46.040 32.306 104.363 1.00 29.08 ? 469 HOH A O   1 
HETATM 2152 O O   . HOH C 3 .   ? 54.426 38.074 85.581  1.00 37.23 ? 470 HOH A O   1 
HETATM 2153 O O   . HOH C 3 .   ? 42.698 34.842 96.676  1.00 51.21 ? 471 HOH A O   1 
HETATM 2154 O O   . HOH C 3 .   ? 49.633 28.023 115.141 1.00 24.00 ? 472 HOH A O   1 
HETATM 2155 O O   . HOH C 3 .   ? 49.824 38.857 83.854  1.00 40.40 ? 473 HOH A O   1 
HETATM 2156 O O   . HOH C 3 .   ? 76.266 17.555 103.912 1.00 33.00 ? 474 HOH A O   1 
HETATM 2157 O O   . HOH C 3 .   ? 71.703 25.505 107.252 1.00 50.20 ? 475 HOH A O   1 
HETATM 2158 O O   . HOH C 3 .   ? 52.977 16.605 116.053 1.00 28.23 ? 476 HOH A O   1 
HETATM 2159 O O   . HOH C 3 .   ? 56.166 14.861 83.474  1.00 39.06 ? 477 HOH A O   1 
HETATM 2160 O O   . HOH C 3 .   ? 46.972 38.741 91.706  1.00 38.18 ? 478 HOH A O   1 
HETATM 2161 O O   . HOH C 3 .   ? 44.397 17.820 104.174 1.00 34.62 ? 479 HOH A O   1 
HETATM 2162 O O   . HOH C 3 .   ? 72.449 53.099 96.312  1.00 35.97 ? 480 HOH A O   1 
HETATM 2163 O O   . HOH C 3 .   ? 46.216 38.619 105.210 1.00 42.23 ? 481 HOH A O   1 
HETATM 2164 O O   . HOH C 3 .   ? 50.938 29.558 84.669  1.00 35.80 ? 482 HOH A O   1 
HETATM 2165 O O   . HOH C 3 .   ? 69.618 43.896 94.662  1.00 29.03 ? 483 HOH A O   1 
HETATM 2166 O O   . HOH C 3 .   ? 56.753 41.570 100.452 1.00 36.79 ? 484 HOH A O   1 
HETATM 2167 O O   . HOH C 3 .   ? 43.370 41.052 87.818  1.00 37.44 ? 485 HOH A O   1 
HETATM 2168 O O   . HOH C 3 .   ? 70.770 62.310 90.502  1.00 38.17 ? 486 HOH A O   1 
HETATM 2169 O O   . HOH C 3 .   ? 60.255 40.645 94.016  1.00 34.21 ? 487 HOH A O   1 
HETATM 2170 O O   . HOH C 3 .   ? 58.029 24.563 112.308 1.00 31.52 ? 488 HOH A O   1 
HETATM 2171 O O   . HOH C 3 .   ? 57.123 11.341 89.557  1.00 34.46 ? 489 HOH A O   1 
HETATM 2172 O O   . HOH C 3 .   ? 54.564 47.048 76.541  1.00 46.80 ? 490 HOH A O   1 
HETATM 2173 O O   . HOH C 3 .   ? 44.617 24.994 100.079 1.00 37.00 ? 491 HOH A O   1 
HETATM 2174 O O   . HOH C 3 .   ? 57.988 61.717 102.748 1.00 42.27 ? 492 HOH A O   1 
HETATM 2175 O O   . HOH C 3 .   ? 68.952 20.891 108.683 1.00 44.96 ? 493 HOH A O   1 
HETATM 2176 O O   . HOH C 3 .   ? 69.640 26.109 108.751 1.00 34.34 ? 494 HOH A O   1 
HETATM 2177 O O   . HOH C 3 .   ? 64.477 11.344 87.155  1.00 47.07 ? 495 HOH A O   1 
HETATM 2178 O O   . HOH C 3 .   ? 49.973 51.175 105.298 1.00 30.91 ? 496 HOH A O   1 
HETATM 2179 O O   . HOH C 3 .   ? 53.177 12.581 87.582  1.00 38.33 ? 497 HOH A O   1 
HETATM 2180 O O   . HOH C 3 .   ? 77.610 19.323 85.918  1.00 35.13 ? 498 HOH A O   1 
HETATM 2181 O O   . HOH C 3 .   ? 62.295 11.496 106.212 1.00 48.10 ? 499 HOH A O   1 
HETATM 2182 O O   . HOH C 3 .   ? 64.524 58.568 109.461 1.00 42.40 ? 500 HOH A O   1 
HETATM 2183 O O   . HOH C 3 .   ? 45.325 35.186 97.570  1.00 35.77 ? 501 HOH A O   1 
HETATM 2184 O O   . HOH C 3 .   ? 55.614 14.920 110.875 1.00 42.54 ? 502 HOH A O   1 
HETATM 2185 O O   . HOH C 3 .   ? 50.382 32.011 114.569 1.00 34.07 ? 503 HOH A O   1 
HETATM 2186 O O   . HOH C 3 .   ? 62.453 54.535 110.869 1.00 23.32 ? 504 HOH A O   1 
HETATM 2187 O O   . HOH C 3 .   ? 63.749 5.822  92.920  1.00 41.36 ? 505 HOH A O   1 
HETATM 2188 O O   . HOH C 3 .   ? 52.390 46.724 82.495  1.00 27.61 ? 506 HOH A O   1 
HETATM 2189 O O   . HOH C 3 .   ? 68.573 42.700 106.341 1.00 41.78 ? 507 HOH A O   1 
HETATM 2190 O O   . HOH C 3 .   ? 71.430 33.349 101.958 1.00 34.93 ? 508 HOH A O   1 
HETATM 2191 O O   . HOH C 3 .   ? 45.855 20.984 113.646 1.00 31.11 ? 509 HOH A O   1 
HETATM 2192 O O   . HOH C 3 .   ? 54.981 56.021 108.085 1.00 45.68 ? 510 HOH A O   1 
HETATM 2193 O O   . HOH C 3 .   ? 48.083 27.978 85.170  1.00 48.13 ? 511 HOH A O   1 
HETATM 2194 O O   . HOH C 3 .   ? 43.499 43.507 96.164  0.5  16.74 ? 512 HOH A O   1 
HETATM 2195 O O   . HOH C 3 .   ? 55.815 9.478  105.088 1.00 42.04 ? 513 HOH A O   1 
HETATM 2196 O O   . HOH C 3 .   ? 62.524 30.014 86.958  1.00 39.05 ? 514 HOH A O   1 
HETATM 2197 O O   . HOH C 3 .   ? 60.338 33.344 78.773  1.00 25.54 ? 515 HOH A O   1 
HETATM 2198 O O   . HOH C 3 .   ? 60.966 34.163 81.417  1.00 29.86 ? 516 HOH A O   1 
HETATM 2199 O O   . HOH C 3 .   ? 49.568 11.374 94.258  1.00 35.10 ? 517 HOH A O   1 
HETATM 2200 O O   . HOH C 3 .   ? 70.598 36.931 96.847  1.00 31.23 ? 518 HOH A O   1 
HETATM 2201 O O   . HOH C 3 .   ? 72.335 50.485 105.637 1.00 32.96 ? 519 HOH A O   1 
HETATM 2202 O O   . HOH C 3 .   ? 54.987 56.049 110.763 1.00 35.66 ? 520 HOH A O   1 
HETATM 2203 O O   . HOH C 3 .   ? 57.198 43.212 78.579  1.00 34.55 ? 521 HOH A O   1 
HETATM 2204 O O   . HOH C 3 .   ? 43.413 53.652 94.170  1.00 28.10 ? 522 HOH A O   1 
HETATM 2205 O O   . HOH C 3 .   ? 43.966 45.861 91.937  1.00 30.87 ? 523 HOH A O   1 
HETATM 2206 O O   . HOH C 3 .   ? 58.542 34.801 84.113  1.00 35.47 ? 524 HOH A O   1 
HETATM 2207 O O   . HOH C 3 .   ? 43.503 43.503 90.167  0.5  46.97 ? 525 HOH A O   1 
HETATM 2208 O O   . HOH C 3 .   ? 65.255 28.408 84.037  0.5  43.50 ? 526 HOH A O   1 
HETATM 2209 O O   . HOH C 3 .   ? 66.375 52.700 109.623 1.00 37.38 ? 527 HOH A O   1 
HETATM 2210 O O   . HOH C 3 .   ? 72.382 56.944 102.671 1.00 36.66 ? 528 HOH A O   1 
HETATM 2211 O O   . HOH C 3 .   ? 45.018 24.085 113.469 1.00 32.94 ? 529 HOH A O   1 
HETATM 2212 O O   . HOH C 3 .   ? 46.725 37.696 88.830  1.00 36.51 ? 530 HOH A O   1 
HETATM 2213 O O   . HOH C 3 .   ? 57.063 35.716 86.106  1.00 36.79 ? 531 HOH A O   1 
HETATM 2214 O O   . HOH C 3 .   ? 50.630 24.706 84.171  1.00 40.48 ? 532 HOH A O   1 
HETATM 2215 O O   . HOH C 3 .   ? 64.618 13.476 85.126  1.00 36.91 ? 533 HOH A O   1 
HETATM 2216 O O   . HOH C 3 .   ? 54.597 32.671 84.001  1.00 40.26 ? 534 HOH A O   1 
HETATM 2217 O O   . HOH C 3 .   ? 46.831 26.146 86.753  1.00 43.71 ? 535 HOH A O   1 
HETATM 2218 O O   . HOH C 3 .   ? 54.371 57.285 75.994  1.00 42.03 ? 536 HOH A O   1 
HETATM 2219 O O   . HOH C 3 .   ? 42.736 47.622 90.492  1.00 43.80 ? 537 HOH A O   1 
HETATM 2220 O O   . HOH C 3 .   ? 48.464 36.673 84.746  1.00 43.24 ? 538 HOH A O   1 
HETATM 2221 O O   . HOH C 3 .   ? 53.529 44.529 80.702  1.00 38.02 ? 539 HOH A O   1 
HETATM 2222 O O   . HOH C 3 .   ? 54.772 29.115 83.582  1.00 42.86 ? 540 HOH A O   1 
HETATM 2223 O O   . HOH C 3 .   ? 51.300 56.148 107.914 1.00 43.55 ? 541 HOH A O   1 
HETATM 2224 O O   . HOH C 3 .   ? 51.012 63.384 88.522  1.00 43.42 ? 542 HOH A O   1 
HETATM 2225 O O   . HOH C 3 .   ? 68.546 24.795 110.941 1.00 41.37 ? 543 HOH A O   1 
HETATM 2226 O O   . HOH C 3 .   ? 48.812 16.914 109.546 1.00 39.32 ? 544 HOH A O   1 
HETATM 2227 O O   . HOH C 3 .   ? 67.245 10.084 89.283  1.00 47.44 ? 545 HOH A O   1 
HETATM 2228 O O   . HOH C 3 .   ? 57.122 37.781 81.059  1.00 44.33 ? 546 HOH A O   1 
HETATM 2229 O O   . HOH C 3 .   ? 49.152 31.665 84.283  1.00 46.80 ? 547 HOH A O   1 
HETATM 2230 O O   . HOH C 3 .   ? 54.339 38.370 99.628  1.00 35.77 ? 548 HOH A O   1 
HETATM 2231 O O   . HOH C 3 .   ? 56.099 31.353 77.541  1.00 40.38 ? 549 HOH A O   1 
HETATM 2232 O O   . HOH C 3 .   ? 47.446 34.187 90.976  1.00 46.62 ? 550 HOH A O   1 
HETATM 2233 O O   . HOH C 3 .   ? 67.784 54.822 108.516 1.00 48.58 ? 551 HOH A O   1 
HETATM 2234 O O   . HOH C 3 .   ? 46.184 46.853 87.441  1.00 35.46 ? 552 HOH A O   1 
HETATM 2235 O O   . HOH C 3 .   ? 73.213 50.488 103.014 1.00 43.92 ? 553 HOH A O   1 
HETATM 2236 O O   . HOH C 3 .   ? 77.607 17.732 101.645 1.00 45.09 ? 554 HOH A O   1 
HETATM 2237 O O   . HOH C 3 .   ? 59.251 9.887  88.232  1.00 44.77 ? 555 HOH A O   1 
HETATM 2238 O O   . HOH C 3 .   ? 43.241 23.173 105.887 1.00 49.19 ? 556 HOH A O   1 
HETATM 2239 O O   . HOH C 3 .   ? 46.272 18.113 94.485  1.00 45.01 ? 557 HOH A O   1 
HETATM 2240 O O   . HOH C 3 .   ? 68.077 40.707 100.739 1.00 43.95 ? 558 HOH A O   1 
HETATM 2241 O O   . HOH C 3 .   ? 60.564 39.841 108.696 1.00 22.31 ? 559 HOH A O   1 
HETATM 2242 O O   . HOH C 3 .   ? 60.994 42.211 108.743 1.00 26.92 ? 560 HOH A O   1 
HETATM 2243 O O   . HOH C 3 .   ? 43.833 40.421 98.169  1.00 34.68 ? 561 HOH A O   1 
HETATM 2244 O O   . HOH C 3 .   ? 62.004 47.070 111.852 1.00 27.05 ? 562 HOH A O   1 
HETATM 2245 O O   . HOH C 3 .   ? 44.915 52.894 91.879  1.00 38.07 ? 563 HOH A O   1 
HETATM 2246 O O   . HOH C 3 .   ? 45.249 26.841 108.777 1.00 43.27 ? 564 HOH A O   1 
HETATM 2247 O O   . HOH C 3 .   ? 71.971 36.980 99.231  1.00 42.11 ? 565 HOH A O   1 
HETATM 2248 O O   . HOH C 3 .   ? 58.642 59.267 109.492 1.00 36.37 ? 566 HOH A O   1 
HETATM 2249 O O   . HOH C 3 .   ? 56.353 52.096 113.606 1.00 45.87 ? 567 HOH A O   1 
HETATM 2250 O O   . HOH C 3 .   ? 51.409 60.695 98.582  1.00 49.55 ? 568 HOH A O   1 
HETATM 2251 O O   . HOH C 3 .   ? 56.753 62.074 80.126  1.00 42.34 ? 569 HOH A O   1 
HETATM 2252 O O   . HOH C 3 .   ? 67.712 40.822 98.220  1.00 48.45 ? 570 HOH A O   1 
HETATM 2253 O O   . HOH C 3 .   ? 54.099 58.399 102.130 1.00 41.58 ? 571 HOH A O   1 
HETATM 2254 O O   . HOH C 3 .   ? 62.944 32.938 88.135  1.00 53.07 ? 572 HOH A O   1 
HETATM 2255 O O   . HOH C 3 .   ? 44.715 38.631 100.886 1.00 39.46 ? 573 HOH A O   1 
HETATM 2256 O O   . HOH C 3 .   ? 44.901 34.748 103.959 1.00 46.81 ? 574 HOH A O   1 
HETATM 2257 O O   . HOH C 3 .   ? 68.069 60.255 101.258 1.00 47.37 ? 575 HOH A O   1 
HETATM 2258 O O   . HOH C 3 .   ? 59.117 39.912 96.544  1.00 33.00 ? 576 HOH A O   1 
HETATM 2259 O O   . HOH C 3 .   ? 44.164 29.544 106.728 1.00 46.66 ? 577 HOH A O   1 
HETATM 2260 O O   . HOH C 3 .   ? 53.426 58.679 99.630  1.00 36.85 ? 578 HOH A O   1 
HETATM 2261 O O   . HOH C 3 .   ? 68.952 65.598 84.786  1.00 45.54 ? 579 HOH A O   1 
HETATM 2262 O O   . HOH C 3 .   ? 55.856 45.943 109.996 1.00 43.72 ? 580 HOH A O   1 
HETATM 2263 O O   . HOH C 3 .   ? 70.911 66.363 83.123  1.00 45.44 ? 581 HOH A O   1 
HETATM 2264 O O   . HOH C 3 .   ? 66.355 62.320 100.338 1.00 42.66 ? 582 HOH A O   1 
HETATM 2265 O O   . HOH C 3 .   ? 54.308 47.496 111.460 1.00 41.07 ? 583 HOH A O   1 
HETATM 2266 O O   . HOH C 3 .   ? 74.219 59.047 100.338 1.00 44.44 ? 584 HOH A O   1 
HETATM 2267 O O   . HOH C 3 .   ? 44.712 32.069 106.560 1.00 47.14 ? 585 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   LYS 2   2   ?   ?   ?   A . n 
A 1 3   PRO 3   3   ?   ?   ?   A . n 
A 1 4   VAL 4   4   ?   ?   ?   A . n 
A 1 5   THR 5   5   ?   ?   ?   A . n 
A 1 6   LEU 6   6   ?   ?   ?   A . n 
A 1 7   TYR 7   7   ?   ?   ?   A . n 
A 1 8   ASP 8   8   ?   ?   ?   A . n 
A 1 9   VAL 9   9   ?   ?   ?   A . n 
A 1 10  ALA 10  10  ?   ?   ?   A . n 
A 1 11  GLU 11  11  ?   ?   ?   A . n 
A 1 12  TYR 12  12  ?   ?   ?   A . n 
A 1 13  ALA 13  13  ?   ?   ?   A . n 
A 1 14  GLY 14  14  ?   ?   ?   A . n 
A 1 15  VAL 15  15  ?   ?   ?   A . n 
A 1 16  SER 16  16  ?   ?   ?   A . n 
A 1 17  TYR 17  17  ?   ?   ?   A . n 
A 1 18  GLN 18  18  ?   ?   ?   A . n 
A 1 19  THR 19  19  ?   ?   ?   A . n 
A 1 20  VAL 20  20  ?   ?   ?   A . n 
A 1 21  SER 21  21  ?   ?   ?   A . n 
A 1 22  ARG 22  22  ?   ?   ?   A . n 
A 1 23  VAL 23  23  ?   ?   ?   A . n 
A 1 24  VAL 24  24  ?   ?   ?   A . n 
A 1 25  ASN 25  25  ?   ?   ?   A . n 
A 1 26  GLN 26  26  ?   ?   ?   A . n 
A 1 27  ALA 27  27  ?   ?   ?   A . n 
A 1 28  SER 28  28  ?   ?   ?   A . n 
A 1 29  HIS 29  29  ?   ?   ?   A . n 
A 1 30  VAL 30  30  ?   ?   ?   A . n 
A 1 31  SER 31  31  ?   ?   ?   A . n 
A 1 32  ALA 32  32  ?   ?   ?   A . n 
A 1 33  LYS 33  33  ?   ?   ?   A . n 
A 1 34  THR 34  34  ?   ?   ?   A . n 
A 1 35  ARG 35  35  ?   ?   ?   A . n 
A 1 36  GLU 36  36  ?   ?   ?   A . n 
A 1 37  LYS 37  37  ?   ?   ?   A . n 
A 1 38  VAL 38  38  ?   ?   ?   A . n 
A 1 39  GLU 39  39  ?   ?   ?   A . n 
A 1 40  ALA 40  40  ?   ?   ?   A . n 
A 1 41  ALA 41  41  ?   ?   ?   A . n 
A 1 42  MET 42  42  ?   ?   ?   A . n 
A 1 43  ALA 43  43  ?   ?   ?   A . n 
A 1 44  GLU 44  44  ?   ?   ?   A . n 
A 1 45  LEU 45  45  ?   ?   ?   A . n 
A 1 46  ASN 46  46  ?   ?   ?   A . n 
A 1 47  TYR 47  47  ?   ?   ?   A . n 
A 1 48  ILE 48  48  ?   ?   ?   A . n 
A 1 49  PRO 49  49  ?   ?   ?   A . n 
A 1 50  ASN 50  50  ?   ?   ?   A . n 
A 1 51  ARG 51  51  ?   ?   ?   A . n 
A 1 52  VAL 52  52  ?   ?   ?   A . n 
A 1 53  ALA 53  53  ?   ?   ?   A . n 
A 1 54  GLN 54  54  ?   ?   ?   A . n 
A 1 55  GLN 55  55  ?   ?   ?   A . n 
A 1 56  LEU 56  56  ?   ?   ?   A . n 
A 1 57  ALA 57  57  ?   ?   ?   A . n 
A 1 58  GLY 58  58  ?   ?   ?   A . n 
A 1 59  LYS 59  59  ?   ?   ?   A . n 
A 1 60  GLN 60  60  ?   ?   ?   A . n 
A 1 61  SER 61  61  ?   ?   ?   A . n 
A 1 62  LEU 62  62  62  LEU LEU A . n 
A 1 63  LEU 63  63  63  LEU LEU A . n 
A 1 64  ILE 64  64  64  ILE ILE A . n 
A 1 65  GLY 65  65  65  GLY GLY A . n 
A 1 66  VAL 66  66  66  VAL VAL A . n 
A 1 67  ALA 67  67  67  ALA ALA A . n 
A 1 68  THR 68  68  68  THR THR A . n 
A 1 69  SER 69  69  69  SER SER A . n 
A 1 70  SER 70  70  70  SER SER A . n 
A 1 71  LEU 71  71  71  LEU LEU A . n 
A 1 72  ALA 72  72  72  ALA ALA A . n 
A 1 73  LEU 73  73  73  LEU LEU A . n 
A 1 74  HIS 74  74  74  HIS HIS A . n 
A 1 75  ALA 75  75  75  ALA ALA A . n 
A 1 76  PRO 76  76  76  PRO PRO A . n 
A 1 77  SER 77  77  77  SER SER A . n 
A 1 78  GLN 78  78  78  GLN GLN A . n 
A 1 79  ILE 79  79  79  ILE ILE A . n 
A 1 80  VAL 80  80  80  VAL VAL A . n 
A 1 81  ALA 81  81  81  ALA ALA A . n 
A 1 82  ALA 82  82  82  ALA ALA A . n 
A 1 83  ILE 83  83  83  ILE ILE A . n 
A 1 84  LEU 84  84  84  LEU LEU A . n 
A 1 85  SER 85  85  85  SER SER A . n 
A 1 86  ARG 86  86  86  ARG ARG A . n 
A 1 87  ALA 87  87  87  ALA ALA A . n 
A 1 88  ASP 88  88  88  ASP ASP A . n 
A 1 89  GLN 89  89  89  GLN GLN A . n 
A 1 90  LEU 90  90  90  LEU LEU A . n 
A 1 91  GLY 91  91  91  GLY GLY A . n 
A 1 92  ALA 92  92  92  ALA ALA A . n 
A 1 93  SER 93  93  93  SER SER A . n 
A 1 94  VAL 94  94  94  VAL VAL A . n 
A 1 95  VAL 95  95  95  VAL VAL A . n 
A 1 96  VAL 96  96  96  VAL VAL A . n 
A 1 97  SER 97  97  97  SER SER A . n 
A 1 98  MET 98  98  98  MET MET A . n 
A 1 99  VAL 99  99  99  VAL VAL A . n 
A 1 100 GLU 100 100 100 GLU GLU A . n 
A 1 101 ARG 101 101 101 ARG ARG A . n 
A 1 102 SER 102 102 102 SER SER A . n 
A 1 103 GLY 103 103 103 GLY GLY A . n 
A 1 104 VAL 104 104 104 VAL VAL A . n 
A 1 105 GLU 105 105 105 GLU GLU A . n 
A 1 106 ALA 106 106 106 ALA ALA A . n 
A 1 107 CYS 107 107 107 CYS CYS A . n 
A 1 108 LYS 108 108 108 LYS LYS A . n 
A 1 109 THR 109 109 109 THR THR A . n 
A 1 110 ALA 110 110 110 ALA ALA A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 HIS 112 112 112 HIS HIS A . n 
A 1 113 ASN 113 113 113 ASN ASN A . n 
A 1 114 LEU 114 114 114 LEU LEU A . n 
A 1 115 LEU 115 115 115 LEU LEU A . n 
A 1 116 ALA 116 116 116 ALA ALA A . n 
A 1 117 GLN 117 117 117 GLN GLN A . n 
A 1 118 ARG 118 118 118 ARG ARG A . n 
A 1 119 VAL 119 119 119 VAL VAL A . n 
A 1 120 SER 120 120 120 SER SER A . n 
A 1 121 GLY 121 121 121 GLY GLY A . n 
A 1 122 LEU 122 122 122 LEU LEU A . n 
A 1 123 ILE 123 123 123 ILE ILE A . n 
A 1 124 ILE 124 124 124 ILE ILE A . n 
A 1 125 ASN 125 125 125 ASN ASN A . n 
A 1 126 TYR 126 126 126 TYR TYR A . n 
A 1 127 PRO 127 127 127 PRO PRO A . n 
A 1 128 LEU 128 128 128 LEU LEU A . n 
A 1 129 ASP 129 129 129 ASP ASP A . n 
A 1 130 ASP 130 130 130 ASP ASP A . n 
A 1 131 GLN 131 131 131 GLN GLN A . n 
A 1 132 ASP 132 132 132 ASP ASP A . n 
A 1 133 ALA 133 133 133 ALA ALA A . n 
A 1 134 ILE 134 134 134 ILE ILE A . n 
A 1 135 ALA 135 135 135 ALA ALA A . n 
A 1 136 VAL 136 136 136 VAL VAL A . n 
A 1 137 GLU 137 137 137 GLU GLU A . n 
A 1 138 ALA 138 138 138 ALA ALA A . n 
A 1 139 ALA 139 139 139 ALA ALA A . n 
A 1 140 CYS 140 140 140 CYS CYS A . n 
A 1 141 THR 141 141 141 THR THR A . n 
A 1 142 ASN 142 142 142 ASN ASN A . n 
A 1 143 VAL 143 143 143 VAL VAL A . n 
A 1 144 PRO 144 144 144 PRO PRO A . n 
A 1 145 ALA 145 145 145 ALA ALA A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 PHE 147 147 147 PHE PHE A . n 
A 1 148 LEU 148 148 148 LEU LEU A . n 
A 1 149 ASP 149 149 149 ASP ASP A . n 
A 1 150 VAL 150 150 150 VAL VAL A . n 
A 1 151 SER 151 151 151 SER SER A . n 
A 1 152 ASP 152 152 152 ASP ASP A . n 
A 1 153 GLN 153 153 153 GLN GLN A . n 
A 1 154 THR 154 154 154 THR THR A . n 
A 1 155 PRO 155 155 155 PRO PRO A . n 
A 1 156 ILE 156 156 156 ILE ILE A . n 
A 1 157 ASN 157 157 157 ASN ASN A . n 
A 1 158 SER 158 158 158 SER SER A . n 
A 1 159 ILE 159 159 159 ILE ILE A . n 
A 1 160 ILE 160 160 160 ILE ILE A . n 
A 1 161 PHE 161 161 161 PHE PHE A . n 
A 1 162 SER 162 162 162 SER SER A . n 
A 1 163 HIS 163 163 163 HIS HIS A . n 
A 1 164 GLU 164 164 164 GLU GLU A . n 
A 1 165 ASP 165 165 165 ASP ASP A . n 
A 1 166 GLY 166 166 166 GLY GLY A . n 
A 1 167 THR 167 167 167 THR THR A . n 
A 1 168 ARG 168 168 168 ARG ARG A . n 
A 1 169 LEU 169 169 169 LEU LEU A . n 
A 1 170 GLY 170 170 170 GLY GLY A . n 
A 1 171 VAL 171 171 171 VAL VAL A . n 
A 1 172 GLU 172 172 172 GLU GLU A . n 
A 1 173 HIS 173 173 173 HIS HIS A . n 
A 1 174 LEU 174 174 174 LEU LEU A . n 
A 1 175 VAL 175 175 175 VAL VAL A . n 
A 1 176 ALA 176 176 176 ALA ALA A . n 
A 1 177 LEU 177 177 177 LEU LEU A . n 
A 1 178 GLY 178 178 178 GLY GLY A . n 
A 1 179 HIS 179 179 179 HIS HIS A . n 
A 1 180 GLN 180 180 180 GLN GLN A . n 
A 1 181 GLN 181 181 181 GLN GLN A . n 
A 1 182 ILE 182 182 182 ILE ILE A . n 
A 1 183 ALA 183 183 183 ALA ALA A . n 
A 1 184 LEU 184 184 184 LEU LEU A . n 
A 1 185 LEU 185 185 185 LEU LEU A . n 
A 1 186 ALA 186 186 186 ALA ALA A . n 
A 1 187 GLY 187 187 187 GLY GLY A . n 
A 1 188 PRO 188 188 188 PRO PRO A . n 
A 1 189 LEU 189 189 189 LEU LEU A . n 
A 1 190 SER 190 190 190 SER SER A . n 
A 1 191 SER 191 191 191 SER SER A . n 
A 1 192 VAL 192 192 192 VAL VAL A . n 
A 1 193 SER 193 193 193 SER SER A . n 
A 1 194 ALA 194 194 194 ALA ALA A . n 
A 1 195 ARG 195 195 195 ARG ARG A . n 
A 1 196 LEU 196 196 196 LEU LEU A . n 
A 1 197 ARG 197 197 197 ARG ARG A . n 
A 1 198 LEU 198 198 198 LEU LEU A . n 
A 1 199 ALA 199 199 199 ALA ALA A . n 
A 1 200 GLY 200 200 200 GLY GLY A . n 
A 1 201 TRP 201 201 201 TRP TRP A . n 
A 1 202 HIS 202 202 202 HIS HIS A . n 
A 1 203 LYS 203 203 203 LYS LYS A . n 
A 1 204 TYR 204 204 204 TYR TYR A . n 
A 1 205 LEU 205 205 205 LEU LEU A . n 
A 1 206 THR 206 206 206 THR THR A . n 
A 1 207 ARG 207 207 207 ARG ARG A . n 
A 1 208 ASN 208 208 208 ASN ASN A . n 
A 1 209 GLN 209 209 209 GLN GLN A . n 
A 1 210 ILE 210 210 210 ILE ILE A . n 
A 1 211 GLN 211 211 211 GLN GLN A . n 
A 1 212 PRO 212 212 212 PRO PRO A . n 
A 1 213 ILE 213 213 213 ILE ILE A . n 
A 1 214 ALA 214 214 214 ALA ALA A . n 
A 1 215 GLU 215 215 215 GLU GLU A . n 
A 1 216 ARG 216 216 216 ARG ARG A . n 
A 1 217 GLU 217 217 217 GLU GLU A . n 
A 1 218 GLY 218 218 218 GLY GLY A . n 
A 1 219 ASP 219 219 219 ASP ASP A . n 
A 1 220 TRP 220 220 220 TRP TRP A . n 
A 1 221 SER 221 221 221 SER SER A . n 
A 1 222 ALA 222 222 222 ALA ALA A . n 
A 1 223 MET 223 223 223 MET MET A . n 
A 1 224 SER 224 224 224 SER SER A . n 
A 1 225 GLY 225 225 225 GLY GLY A . n 
A 1 226 PHE 226 226 226 PHE PHE A . n 
A 1 227 GLN 227 227 227 GLN GLN A . n 
A 1 228 GLN 228 228 228 GLN GLN A . n 
A 1 229 THR 229 229 229 THR THR A . n 
A 1 230 MET 230 230 230 MET MET A . n 
A 1 231 GLN 231 231 231 GLN GLN A . n 
A 1 232 MET 232 232 232 MET MET A . n 
A 1 233 LEU 233 233 233 LEU LEU A . n 
A 1 234 ASN 234 234 234 ASN ASN A . n 
A 1 235 GLU 235 235 235 GLU GLU A . n 
A 1 236 GLY 236 236 236 GLY GLY A . n 
A 1 237 ILE 237 237 237 ILE ILE A . n 
A 1 238 VAL 238 238 238 VAL VAL A . n 
A 1 239 PRO 239 239 239 PRO PRO A . n 
A 1 240 THR 240 240 240 THR THR A . n 
A 1 241 ALA 241 241 241 ALA ALA A . n 
A 1 242 MET 242 242 242 MET MET A . n 
A 1 243 LEU 243 243 243 LEU LEU A . n 
A 1 244 VAL 244 244 244 VAL VAL A . n 
A 1 245 ALA 245 245 245 ALA ALA A . n 
A 1 246 ASN 246 246 246 ASN ASN A . n 
A 1 247 ASP 247 247 247 ASP ASP A . n 
A 1 248 GLN 248 248 248 GLN GLN A . n 
A 1 249 MET 249 249 249 MET MET A . n 
A 1 250 ALA 250 250 250 ALA ALA A . n 
A 1 251 LEU 251 251 251 LEU LEU A . n 
A 1 252 GLY 252 252 252 GLY GLY A . n 
A 1 253 ALA 253 253 253 ALA ALA A . n 
A 1 254 MET 254 254 254 MET MET A . n 
A 1 255 ARG 255 255 255 ARG ARG A . n 
A 1 256 ALA 256 256 256 ALA ALA A . n 
A 1 257 ILE 257 257 257 ILE ILE A . n 
A 1 258 THR 258 258 258 THR THR A . n 
A 1 259 GLU 259 259 259 GLU GLU A . n 
A 1 260 SER 260 260 260 SER SER A . n 
A 1 261 GLY 261 261 261 GLY GLY A . n 
A 1 262 LEU 262 262 262 LEU LEU A . n 
A 1 263 ARG 263 263 263 ARG ARG A . n 
A 1 264 VAL 264 264 264 VAL VAL A . n 
A 1 265 GLY 265 265 265 GLY GLY A . n 
A 1 266 ALA 266 266 266 ALA ALA A . n 
A 1 267 ASP 267 267 267 ASP ASP A . n 
A 1 268 ILE 268 268 268 ILE ILE A . n 
A 1 269 SER 269 269 269 SER SER A . n 
A 1 270 VAL 270 270 270 VAL VAL A . n 
A 1 271 VAL 271 271 271 VAL VAL A . n 
A 1 272 GLY 272 272 272 GLY GLY A . n 
A 1 273 TYR 273 273 273 TYR TYR A . n 
A 1 274 ASP 274 274 274 ASP ASP A . n 
A 1 275 ASP 275 275 275 ASP ASP A . n 
A 1 276 THR 276 276 276 THR THR A . n 
A 1 277 GLU 277 277 277 GLU GLU A . n 
A 1 278 ASP 278 278 278 ASP ASP A . n 
A 1 279 SER 279 279 279 SER SER A . n 
A 1 280 SER 280 280 280 SER SER A . n 
A 1 281 CYS 281 281 281 CYS CYS A . n 
A 1 282 TYR 282 282 282 TYR TYR A . n 
A 1 283 ILE 283 283 283 ILE ILE A . n 
A 1 284 PRO 284 284 284 PRO PRO A . n 
A 1 285 PRO 285 285 285 PRO PRO A . n 
A 1 286 LEU 286 286 286 LEU LEU A . n 
A 1 287 THR 287 287 287 THR THR A . n 
A 1 288 THR 288 288 288 THR THR A . n 
A 1 289 ILE 289 289 289 ILE ILE A . n 
A 1 290 LYS 290 290 290 LYS LYS A . n 
A 1 291 GLN 291 291 291 GLN GLN A . n 
A 1 292 ASP 292 292 292 ASP ASP A . n 
A 1 293 PHE 293 293 293 PHE PHE A . n 
A 1 294 ARG 294 294 294 ARG ARG A . n 
A 1 295 LEU 295 295 295 LEU LEU A . n 
A 1 296 LEU 296 296 296 LEU LEU A . n 
A 1 297 GLY 297 297 297 GLY GLY A . n 
A 1 298 GLN 298 298 298 GLN GLN A . n 
A 1 299 THR 299 299 299 THR THR A . n 
A 1 300 SER 300 300 300 SER SER A . n 
A 1 301 VAL 301 301 301 VAL VAL A . n 
A 1 302 ASP 302 302 302 ASP ASP A . n 
A 1 303 ARG 303 303 303 ARG ARG A . n 
A 1 304 LEU 304 304 304 LEU LEU A . n 
A 1 305 LEU 305 305 305 LEU LEU A . n 
A 1 306 GLN 306 306 306 GLN GLN A . n 
A 1 307 LEU 307 307 307 LEU LEU A . n 
A 1 308 SER 308 308 308 SER SER A . n 
A 1 309 GLN 309 309 309 GLN GLN A . n 
A 1 310 GLY 310 310 310 GLY GLY A . n 
A 1 311 GLN 311 311 311 GLN GLN A . n 
A 1 312 ALA 312 312 312 ALA ALA A . n 
A 1 313 VAL 313 313 313 VAL VAL A . n 
A 1 314 LYS 314 314 314 LYS LYS A . n 
A 1 315 GLY 315 315 315 GLY GLY A . n 
A 1 316 ASN 316 316 316 ASN ASN A . n 
A 1 317 GLN 317 317 317 GLN GLN A . n 
A 1 318 LEU 318 318 318 LEU LEU A . n 
A 1 319 LEU 319 319 319 LEU LEU A . n 
A 1 320 PRO 320 320 320 PRO PRO A . n 
A 1 321 VAL 321 321 321 VAL VAL A . n 
A 1 322 SER 322 322 322 SER SER A . n 
A 1 323 LEU 323 323 323 LEU LEU A . n 
A 1 324 VAL 324 324 324 VAL VAL A . n 
A 1 325 LYS 325 325 325 LYS LYS A . n 
A 1 326 ARG 326 326 326 ARG ARG A . n 
A 1 327 LYS 327 327 327 LYS LYS A . n 
A 1 328 THR 328 328 328 THR THR A . n 
A 1 329 THR 329 329 329 THR THR A . n 
A 1 330 LEU 330 330 330 LEU LEU A . n 
A 1 331 ALA 331 331 331 ALA ALA A . n 
A 1 332 PRO 332 332 332 PRO PRO A . n 
A 1 333 ASN 333 333 ?   ?   ?   A . n 
A 1 334 THR 334 334 ?   ?   ?   A . n 
A 1 335 GLN 335 335 ?   ?   ?   A . n 
A 1 336 THR 336 336 ?   ?   ?   A . n 
A 1 337 ALA 337 337 ?   ?   ?   A . n 
A 1 338 SER 338 338 ?   ?   ?   A . n 
A 1 339 PRO 339 339 ?   ?   ?   A . n 
A 1 340 ARG 340 340 ?   ?   ?   A . n 
A 1 341 ALA 341 341 ?   ?   ?   A . n 
A 1 342 LEU 342 342 ?   ?   ?   A . n 
A 1 343 ALA 343 343 ?   ?   ?   A . n 
A 1 344 ASP 344 344 ?   ?   ?   A . n 
A 1 345 SER 345 345 ?   ?   ?   A . n 
A 1 346 LEU 346 346 ?   ?   ?   A . n 
A 1 347 MET 347 347 ?   ?   ?   A . n 
A 1 348 GLN 348 348 ?   ?   ?   A . n 
A 1 349 LEU 349 349 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 GOL 1   350 1   GOL GLL A . 
C 3 HOH 1   351 1   HOH WAT A . 
C 3 HOH 2   352 2   HOH WAT A . 
C 3 HOH 3   353 3   HOH WAT A . 
C 3 HOH 4   354 4   HOH WAT A . 
C 3 HOH 5   355 5   HOH WAT A . 
C 3 HOH 6   356 6   HOH WAT A . 
C 3 HOH 7   357 7   HOH WAT A . 
C 3 HOH 8   358 8   HOH WAT A . 
C 3 HOH 9   359 9   HOH WAT A . 
C 3 HOH 10  360 10  HOH WAT A . 
C 3 HOH 11  361 11  HOH WAT A . 
C 3 HOH 12  362 12  HOH WAT A . 
C 3 HOH 13  363 13  HOH WAT A . 
C 3 HOH 14  364 14  HOH WAT A . 
C 3 HOH 15  365 15  HOH WAT A . 
C 3 HOH 16  366 16  HOH WAT A . 
C 3 HOH 17  367 17  HOH WAT A . 
C 3 HOH 18  368 18  HOH WAT A . 
C 3 HOH 19  369 19  HOH WAT A . 
C 3 HOH 20  370 20  HOH WAT A . 
C 3 HOH 21  371 21  HOH WAT A . 
C 3 HOH 22  372 22  HOH WAT A . 
C 3 HOH 23  373 23  HOH WAT A . 
C 3 HOH 24  374 24  HOH WAT A . 
C 3 HOH 25  375 25  HOH WAT A . 
C 3 HOH 26  376 26  HOH WAT A . 
C 3 HOH 27  377 27  HOH WAT A . 
C 3 HOH 28  378 28  HOH WAT A . 
C 3 HOH 29  379 29  HOH WAT A . 
C 3 HOH 30  380 30  HOH WAT A . 
C 3 HOH 31  381 31  HOH WAT A . 
C 3 HOH 32  382 32  HOH WAT A . 
C 3 HOH 33  383 33  HOH WAT A . 
C 3 HOH 34  384 34  HOH WAT A . 
C 3 HOH 35  385 35  HOH WAT A . 
C 3 HOH 36  386 36  HOH WAT A . 
C 3 HOH 37  387 37  HOH WAT A . 
C 3 HOH 38  388 38  HOH WAT A . 
C 3 HOH 39  389 39  HOH WAT A . 
C 3 HOH 40  390 40  HOH WAT A . 
C 3 HOH 41  391 41  HOH WAT A . 
C 3 HOH 42  392 42  HOH WAT A . 
C 3 HOH 43  393 43  HOH WAT A . 
C 3 HOH 44  394 44  HOH WAT A . 
C 3 HOH 45  395 45  HOH WAT A . 
C 3 HOH 46  396 46  HOH WAT A . 
C 3 HOH 47  397 47  HOH WAT A . 
C 3 HOH 48  398 48  HOH WAT A . 
C 3 HOH 49  399 49  HOH WAT A . 
C 3 HOH 50  400 50  HOH WAT A . 
C 3 HOH 51  401 51  HOH WAT A . 
C 3 HOH 52  402 52  HOH WAT A . 
C 3 HOH 53  403 53  HOH WAT A . 
C 3 HOH 54  404 54  HOH WAT A . 
C 3 HOH 55  405 55  HOH WAT A . 
C 3 HOH 56  406 56  HOH WAT A . 
C 3 HOH 57  407 57  HOH WAT A . 
C 3 HOH 58  408 58  HOH WAT A . 
C 3 HOH 59  409 59  HOH WAT A . 
C 3 HOH 60  410 60  HOH WAT A . 
C 3 HOH 61  411 61  HOH WAT A . 
C 3 HOH 62  412 62  HOH WAT A . 
C 3 HOH 63  413 63  HOH WAT A . 
C 3 HOH 64  414 64  HOH WAT A . 
C 3 HOH 65  415 65  HOH WAT A . 
C 3 HOH 66  416 66  HOH WAT A . 
C 3 HOH 67  417 67  HOH WAT A . 
C 3 HOH 68  418 68  HOH WAT A . 
C 3 HOH 69  419 69  HOH WAT A . 
C 3 HOH 70  420 70  HOH WAT A . 
C 3 HOH 71  421 71  HOH WAT A . 
C 3 HOH 72  422 72  HOH WAT A . 
C 3 HOH 73  423 73  HOH WAT A . 
C 3 HOH 74  424 74  HOH WAT A . 
C 3 HOH 75  425 75  HOH WAT A . 
C 3 HOH 76  426 76  HOH WAT A . 
C 3 HOH 77  427 77  HOH WAT A . 
C 3 HOH 78  428 78  HOH WAT A . 
C 3 HOH 79  429 79  HOH WAT A . 
C 3 HOH 80  430 80  HOH WAT A . 
C 3 HOH 81  431 81  HOH WAT A . 
C 3 HOH 82  432 82  HOH WAT A . 
C 3 HOH 83  433 83  HOH WAT A . 
C 3 HOH 84  434 84  HOH WAT A . 
C 3 HOH 85  435 85  HOH WAT A . 
C 3 HOH 86  436 86  HOH WAT A . 
C 3 HOH 87  437 87  HOH WAT A . 
C 3 HOH 88  438 88  HOH WAT A . 
C 3 HOH 89  439 89  HOH WAT A . 
C 3 HOH 90  440 90  HOH WAT A . 
C 3 HOH 91  441 91  HOH WAT A . 
C 3 HOH 92  442 92  HOH WAT A . 
C 3 HOH 93  443 93  HOH WAT A . 
C 3 HOH 94  444 94  HOH WAT A . 
C 3 HOH 95  445 95  HOH WAT A . 
C 3 HOH 96  446 96  HOH WAT A . 
C 3 HOH 97  447 97  HOH WAT A . 
C 3 HOH 98  448 98  HOH WAT A . 
C 3 HOH 99  449 99  HOH WAT A . 
C 3 HOH 100 450 100 HOH WAT A . 
C 3 HOH 101 451 101 HOH WAT A . 
C 3 HOH 102 452 102 HOH WAT A . 
C 3 HOH 103 453 103 HOH WAT A . 
C 3 HOH 104 454 104 HOH WAT A . 
C 3 HOH 105 455 105 HOH WAT A . 
C 3 HOH 106 456 106 HOH WAT A . 
C 3 HOH 107 457 107 HOH WAT A . 
C 3 HOH 108 458 108 HOH WAT A . 
C 3 HOH 109 459 109 HOH WAT A . 
C 3 HOH 110 460 110 HOH WAT A . 
C 3 HOH 111 461 111 HOH WAT A . 
C 3 HOH 112 462 112 HOH WAT A . 
C 3 HOH 113 463 113 HOH WAT A . 
C 3 HOH 114 464 114 HOH WAT A . 
C 3 HOH 115 465 115 HOH WAT A . 
C 3 HOH 116 466 116 HOH WAT A . 
C 3 HOH 117 467 117 HOH WAT A . 
C 3 HOH 118 468 118 HOH WAT A . 
C 3 HOH 119 469 119 HOH WAT A . 
C 3 HOH 120 470 120 HOH WAT A . 
C 3 HOH 121 471 121 HOH WAT A . 
C 3 HOH 122 472 122 HOH WAT A . 
C 3 HOH 123 473 123 HOH WAT A . 
C 3 HOH 124 474 124 HOH WAT A . 
C 3 HOH 125 475 125 HOH WAT A . 
C 3 HOH 126 476 126 HOH WAT A . 
C 3 HOH 127 477 127 HOH WAT A . 
C 3 HOH 128 478 128 HOH WAT A . 
C 3 HOH 129 479 129 HOH WAT A . 
C 3 HOH 130 480 130 HOH WAT A . 
C 3 HOH 131 481 131 HOH WAT A . 
C 3 HOH 132 482 132 HOH WAT A . 
C 3 HOH 133 483 133 HOH WAT A . 
C 3 HOH 134 484 134 HOH WAT A . 
C 3 HOH 135 485 135 HOH WAT A . 
C 3 HOH 136 486 136 HOH WAT A . 
C 3 HOH 137 487 137 HOH WAT A . 
C 3 HOH 138 488 138 HOH WAT A . 
C 3 HOH 139 489 139 HOH WAT A . 
C 3 HOH 140 490 140 HOH WAT A . 
C 3 HOH 141 491 141 HOH WAT A . 
C 3 HOH 142 492 142 HOH WAT A . 
C 3 HOH 143 493 143 HOH WAT A . 
C 3 HOH 144 494 144 HOH WAT A . 
C 3 HOH 145 495 145 HOH WAT A . 
C 3 HOH 146 496 146 HOH WAT A . 
C 3 HOH 147 497 147 HOH WAT A . 
C 3 HOH 148 498 148 HOH WAT A . 
C 3 HOH 149 499 149 HOH WAT A . 
C 3 HOH 150 500 150 HOH WAT A . 
C 3 HOH 151 501 151 HOH WAT A . 
C 3 HOH 152 502 152 HOH WAT A . 
C 3 HOH 153 503 153 HOH WAT A . 
C 3 HOH 154 504 154 HOH WAT A . 
C 3 HOH 155 505 155 HOH WAT A . 
C 3 HOH 156 506 156 HOH WAT A . 
C 3 HOH 157 507 157 HOH WAT A . 
C 3 HOH 158 508 158 HOH WAT A . 
C 3 HOH 159 509 159 HOH WAT A . 
C 3 HOH 160 510 160 HOH WAT A . 
C 3 HOH 161 511 161 HOH WAT A . 
C 3 HOH 162 512 162 HOH WAT A . 
C 3 HOH 163 513 163 HOH WAT A . 
C 3 HOH 164 514 164 HOH WAT A . 
C 3 HOH 165 515 165 HOH WAT A . 
C 3 HOH 166 516 166 HOH WAT A . 
C 3 HOH 167 517 167 HOH WAT A . 
C 3 HOH 168 518 168 HOH WAT A . 
C 3 HOH 169 519 169 HOH WAT A . 
C 3 HOH 170 520 170 HOH WAT A . 
C 3 HOH 171 521 171 HOH WAT A . 
C 3 HOH 172 522 172 HOH WAT A . 
C 3 HOH 173 523 173 HOH WAT A . 
C 3 HOH 174 524 174 HOH WAT A . 
C 3 HOH 175 525 175 HOH WAT A . 
C 3 HOH 176 526 176 HOH WAT A . 
C 3 HOH 177 527 177 HOH WAT A . 
C 3 HOH 178 528 178 HOH WAT A . 
C 3 HOH 179 529 179 HOH WAT A . 
C 3 HOH 180 530 180 HOH WAT A . 
C 3 HOH 181 531 181 HOH WAT A . 
C 3 HOH 182 532 182 HOH WAT A . 
C 3 HOH 183 533 183 HOH WAT A . 
C 3 HOH 184 534 184 HOH WAT A . 
C 3 HOH 185 535 185 HOH WAT A . 
C 3 HOH 186 536 186 HOH WAT A . 
C 3 HOH 187 537 187 HOH WAT A . 
C 3 HOH 188 538 188 HOH WAT A . 
C 3 HOH 189 539 189 HOH WAT A . 
C 3 HOH 190 540 190 HOH WAT A . 
C 3 HOH 191 541 191 HOH WAT A . 
C 3 HOH 192 542 192 HOH WAT A . 
C 3 HOH 193 543 193 HOH WAT A . 
C 3 HOH 194 544 194 HOH WAT A . 
C 3 HOH 195 545 195 HOH WAT A . 
C 3 HOH 196 546 196 HOH WAT A . 
C 3 HOH 197 547 197 HOH WAT A . 
C 3 HOH 198 548 198 HOH WAT A . 
C 3 HOH 199 549 199 HOH WAT A . 
C 3 HOH 200 550 200 HOH WAT A . 
C 3 HOH 201 551 201 HOH WAT A . 
C 3 HOH 202 552 202 HOH WAT A . 
C 3 HOH 203 553 203 HOH WAT A . 
C 3 HOH 204 554 204 HOH WAT A . 
C 3 HOH 205 555 205 HOH WAT A . 
C 3 HOH 206 556 206 HOH WAT A . 
C 3 HOH 207 557 207 HOH WAT A . 
C 3 HOH 208 558 208 HOH WAT A . 
C 3 HOH 209 559 209 HOH WAT A . 
C 3 HOH 210 560 210 HOH WAT A . 
C 3 HOH 211 561 211 HOH WAT A . 
C 3 HOH 212 562 212 HOH WAT A . 
C 3 HOH 213 563 213 HOH WAT A . 
C 3 HOH 214 564 214 HOH WAT A . 
C 3 HOH 215 565 215 HOH WAT A . 
C 3 HOH 216 566 216 HOH WAT A . 
C 3 HOH 217 567 217 HOH WAT A . 
C 3 HOH 218 568 218 HOH WAT A . 
C 3 HOH 219 569 219 HOH WAT A . 
C 3 HOH 220 570 220 HOH WAT A . 
C 3 HOH 221 571 221 HOH WAT A . 
C 3 HOH 222 572 222 HOH WAT A . 
C 3 HOH 223 573 223 HOH WAT A . 
C 3 HOH 224 574 224 HOH WAT A . 
C 3 HOH 225 575 225 HOH WAT A . 
C 3 HOH 226 576 226 HOH WAT A . 
C 3 HOH 227 577 227 HOH WAT A . 
C 3 HOH 228 578 228 HOH WAT A . 
C 3 HOH 229 579 229 HOH WAT A . 
C 3 HOH 230 580 230 HOH WAT A . 
C 3 HOH 231 581 231 HOH WAT A . 
C 3 HOH 232 582 232 HOH WAT A . 
C 3 HOH 233 583 233 HOH WAT A . 
C 3 HOH 234 584 234 HOH WAT A . 
C 3 HOH 235 585 235 HOH WAT A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3610  ? 
1 MORE         -23   ? 
1 'SSA (A^2)'  20200 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z           1.0000000000  0.0000000000 0.0000000000 0.0000000000   0.0000000000 
1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 5_655 -x+3/2,y,-z+3/4 -1.0000000000 0.0000000000 0.0000000000 130.5105000000 0.0000000000 
1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 168.0735000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 374 ? C HOH . 
2 1 A HOH 421 ? C HOH . 
3 1 A HOH 450 ? C HOH . 
4 1 A HOH 512 ? C HOH . 
5 1 A HOH 525 ? C HOH . 
6 1 A HOH 526 ? C HOH . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2001-10-18 
2 'Structure model' 1 1 2007-10-16 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2011-11-16 
5 'Structure model' 1 4 2021-04-14 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Atomic model'              
5 5 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 5 'Structure model' pdbx_struct_assembly      
2 5 'Structure model' pdbx_struct_assembly_gen  
3 5 'Structure model' pdbx_struct_assembly_prop 
4 5 'Structure model' pdbx_struct_oper_list     
5 5 'Structure model' struct_site               
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 5 'Structure model' '_pdbx_struct_assembly_prop.biol_id' 
2 5 'Structure model' '_struct_site.pdbx_auth_asym_id'     
3 5 'Structure model' '_struct_site.pdbx_auth_comp_id'     
4 5 'Structure model' '_struct_site.pdbx_auth_seq_id'      
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
AMoRE     phasing          .   ? 1 
CNS       refinement       1.0 ? 2 
DENZO     'data reduction' .   ? 3 
SCALEPACK 'data scaling'   .   ? 4 
# 
_pdbx_entry_details.entry_id                 1JYE 
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         
;THE DIFFERENCE AT POSITION 109 IS A DIFFERENCE IN THE
SEQUENCE REPORTED BY FARABAUGH, P.J. (1978) NATURE 274,
765-769 AND THE PIQ SEQUENCE REPORTED BY BETZ J.L. (1986)
GENE 42, 283-292.  THE PROTEIN IN THIS STRUCTURE IS DERIVED
FROM PIQ AND HAS THR AT POSITION 109.
;
_pdbx_entry_details.has_ligand_of_interest   ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLU A 100 ? ? -55.25  -0.93   
2  1 ARG A 101 ? ? 73.72   151.15  
3  1 SER A 102 ? ? 56.42   105.57  
4  1 ASN A 125 ? ? -103.19 60.31   
5  1 ASN A 142 ? ? 62.54   -7.82   
6  1 ALA A 214 ? ? -174.58 148.46  
7  1 TRP A 220 ? ? 86.01   -14.41  
8  1 ASP A 274 ? ? 127.92  -48.18  
9  1 ASP A 275 ? ? 69.05   61.13   
10 1 ALA A 312 ? ? -91.93  -116.04 
11 1 VAL A 313 ? ? -147.75 -136.30 
12 1 LYS A 314 ? ? -176.83 82.42   
13 1 ARG A 326 ? ? -125.13 -128.98 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A LYS 2   ? A LYS 2   
3  1 Y 1 A PRO 3   ? A PRO 3   
4  1 Y 1 A VAL 4   ? A VAL 4   
5  1 Y 1 A THR 5   ? A THR 5   
6  1 Y 1 A LEU 6   ? A LEU 6   
7  1 Y 1 A TYR 7   ? A TYR 7   
8  1 Y 1 A ASP 8   ? A ASP 8   
9  1 Y 1 A VAL 9   ? A VAL 9   
10 1 Y 1 A ALA 10  ? A ALA 10  
11 1 Y 1 A GLU 11  ? A GLU 11  
12 1 Y 1 A TYR 12  ? A TYR 12  
13 1 Y 1 A ALA 13  ? A ALA 13  
14 1 Y 1 A GLY 14  ? A GLY 14  
15 1 Y 1 A VAL 15  ? A VAL 15  
16 1 Y 1 A SER 16  ? A SER 16  
17 1 Y 1 A TYR 17  ? A TYR 17  
18 1 Y 1 A GLN 18  ? A GLN 18  
19 1 Y 1 A THR 19  ? A THR 19  
20 1 Y 1 A VAL 20  ? A VAL 20  
21 1 Y 1 A SER 21  ? A SER 21  
22 1 Y 1 A ARG 22  ? A ARG 22  
23 1 Y 1 A VAL 23  ? A VAL 23  
24 1 Y 1 A VAL 24  ? A VAL 24  
25 1 Y 1 A ASN 25  ? A ASN 25  
26 1 Y 1 A GLN 26  ? A GLN 26  
27 1 Y 1 A ALA 27  ? A ALA 27  
28 1 Y 1 A SER 28  ? A SER 28  
29 1 Y 1 A HIS 29  ? A HIS 29  
30 1 Y 1 A VAL 30  ? A VAL 30  
31 1 Y 1 A SER 31  ? A SER 31  
32 1 Y 1 A ALA 32  ? A ALA 32  
33 1 Y 1 A LYS 33  ? A LYS 33  
34 1 Y 1 A THR 34  ? A THR 34  
35 1 Y 1 A ARG 35  ? A ARG 35  
36 1 Y 1 A GLU 36  ? A GLU 36  
37 1 Y 1 A LYS 37  ? A LYS 37  
38 1 Y 1 A VAL 38  ? A VAL 38  
39 1 Y 1 A GLU 39  ? A GLU 39  
40 1 Y 1 A ALA 40  ? A ALA 40  
41 1 Y 1 A ALA 41  ? A ALA 41  
42 1 Y 1 A MET 42  ? A MET 42  
43 1 Y 1 A ALA 43  ? A ALA 43  
44 1 Y 1 A GLU 44  ? A GLU 44  
45 1 Y 1 A LEU 45  ? A LEU 45  
46 1 Y 1 A ASN 46  ? A ASN 46  
47 1 Y 1 A TYR 47  ? A TYR 47  
48 1 Y 1 A ILE 48  ? A ILE 48  
49 1 Y 1 A PRO 49  ? A PRO 49  
50 1 Y 1 A ASN 50  ? A ASN 50  
51 1 Y 1 A ARG 51  ? A ARG 51  
52 1 Y 1 A VAL 52  ? A VAL 52  
53 1 Y 1 A ALA 53  ? A ALA 53  
54 1 Y 1 A GLN 54  ? A GLN 54  
55 1 Y 1 A GLN 55  ? A GLN 55  
56 1 Y 1 A LEU 56  ? A LEU 56  
57 1 Y 1 A ALA 57  ? A ALA 57  
58 1 Y 1 A GLY 58  ? A GLY 58  
59 1 Y 1 A LYS 59  ? A LYS 59  
60 1 Y 1 A GLN 60  ? A GLN 60  
61 1 Y 1 A SER 61  ? A SER 61  
62 1 Y 1 A ASN 333 ? A ASN 333 
63 1 Y 1 A THR 334 ? A THR 334 
64 1 Y 1 A GLN 335 ? A GLN 335 
65 1 Y 1 A THR 336 ? A THR 336 
66 1 Y 1 A ALA 337 ? A ALA 337 
67 1 Y 1 A SER 338 ? A SER 338 
68 1 Y 1 A PRO 339 ? A PRO 339 
69 1 Y 1 A ARG 340 ? A ARG 340 
70 1 Y 1 A ALA 341 ? A ALA 341 
71 1 Y 1 A LEU 342 ? A LEU 342 
72 1 Y 1 A ALA 343 ? A ALA 343 
73 1 Y 1 A ASP 344 ? A ASP 344 
74 1 Y 1 A SER 345 ? A SER 345 
75 1 Y 1 A LEU 346 ? A LEU 346 
76 1 Y 1 A MET 347 ? A MET 347 
77 1 Y 1 A GLN 348 ? A GLN 348 
78 1 Y 1 A LEU 349 ? A LEU 349 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 GLYCEROL GOL 
3 water    HOH 
#