data_1K2I
# 
_entry.id   1K2I 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1K2I         
RCSB  RCSB014478   
WWPDB D_1000014478 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1GCT 
_pdbx_database_related.details        
;1GCT contains native gamma chymotrypsin 
with a peptide bound at the active site
;
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1K2I 
_pdbx_database_status.recvd_initial_deposition_date   2001-09-27 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ghani, U.'       1 
'Ng, K.K.S.'      2 
Atta-ur-Rahman    3 
'Choudhary, M.I.' 4 
'Ullah, N.'       5 
'James, M.N.G.'   6 
# 
_citation.id                        primary 
_citation.title                     'Crystal structure of gamma-chymotrypsin in complex with 7-hydroxycoumarin.' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            314 
_citation.page_first                519 
_citation.page_last                 525 
_citation.year                      2001 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11846564 
_citation.pdbx_database_id_DOI      10.1006/jmbi.2001.5148 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Ghani, U.'       1 
primary 'Ng, K.K.'        2 
primary Atta-ur-Rahman    3 
primary 'Choudhary, M.I.' 4 
primary 'Ullah, N.'       5 
primary 'James, M.N.'     6 
# 
_cell.entry_id           1K2I 
_cell.length_a           69.852 
_cell.length_b           69.852 
_cell.length_c           97.380 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1K2I 
_symmetry.space_group_name_H-M             'P 42 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                94 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'CHYMOTRYPSINOGEN A'                25686.037 1   3.4.21.1 ? ? ? 
2 non-polymer syn 'SULFATE ION'                       96.063    1   ?        ? ? ? 
3 non-polymer syn '2,4-DIHYDROXY-TRANS CINNAMIC ACID' 180.157   1   ?        ? ? ? 
4 water       nat water                               18.015    134 ?        ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;CGVPAIQPVLSGLSRIVNGEEAVPGSWPWQVSLQDKTGFHFCGGSLINENWVVTAAHCGVTTSDVVVAGEFDQGSSSEKI
QKLKIAKVFKNSKYNSLTINNDITLLKLSTAASFSQTVSAVCLPSASDDFAAGTTCVTTGWGLTRYTNANTPDRLQQASL
PLLSNTNCKKYWGTKIKDAMICAGASGVSSCMGDSGGPLVCKKNGAWTLVGIVSWGSSTCSTSTPGVYARVTALVNWVQQ
TLAAN
;
_entity_poly.pdbx_seq_one_letter_code_can   
;CGVPAIQPVLSGLSRIVNGEEAVPGSWPWQVSLQDKTGFHFCGGSLINENWVVTAAHCGVTTSDVVVAGEFDQGSSSEKI
QKLKIAKVFKNSKYNSLTINNDITLLKLSTAASFSQTVSAVCLPSASDDFAAGTTCVTTGWGLTRYTNANTPDRLQQASL
PLLSNTNCKKYWGTKIKDAMICAGASGVSSCMGDSGGPLVCKKNGAWTLVGIVSWGSSTCSTSTPGVYARVTALVNWVQQ
TLAAN
;
_entity_poly.pdbx_strand_id                 1 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   CYS n 
1 2   GLY n 
1 3   VAL n 
1 4   PRO n 
1 5   ALA n 
1 6   ILE n 
1 7   GLN n 
1 8   PRO n 
1 9   VAL n 
1 10  LEU n 
1 11  SER n 
1 12  GLY n 
1 13  LEU n 
1 14  SER n 
1 15  ARG n 
1 16  ILE n 
1 17  VAL n 
1 18  ASN n 
1 19  GLY n 
1 20  GLU n 
1 21  GLU n 
1 22  ALA n 
1 23  VAL n 
1 24  PRO n 
1 25  GLY n 
1 26  SER n 
1 27  TRP n 
1 28  PRO n 
1 29  TRP n 
1 30  GLN n 
1 31  VAL n 
1 32  SER n 
1 33  LEU n 
1 34  GLN n 
1 35  ASP n 
1 36  LYS n 
1 37  THR n 
1 38  GLY n 
1 39  PHE n 
1 40  HIS n 
1 41  PHE n 
1 42  CYS n 
1 43  GLY n 
1 44  GLY n 
1 45  SER n 
1 46  LEU n 
1 47  ILE n 
1 48  ASN n 
1 49  GLU n 
1 50  ASN n 
1 51  TRP n 
1 52  VAL n 
1 53  VAL n 
1 54  THR n 
1 55  ALA n 
1 56  ALA n 
1 57  HIS n 
1 58  CYS n 
1 59  GLY n 
1 60  VAL n 
1 61  THR n 
1 62  THR n 
1 63  SER n 
1 64  ASP n 
1 65  VAL n 
1 66  VAL n 
1 67  VAL n 
1 68  ALA n 
1 69  GLY n 
1 70  GLU n 
1 71  PHE n 
1 72  ASP n 
1 73  GLN n 
1 74  GLY n 
1 75  SER n 
1 76  SER n 
1 77  SER n 
1 78  GLU n 
1 79  LYS n 
1 80  ILE n 
1 81  GLN n 
1 82  LYS n 
1 83  LEU n 
1 84  LYS n 
1 85  ILE n 
1 86  ALA n 
1 87  LYS n 
1 88  VAL n 
1 89  PHE n 
1 90  LYS n 
1 91  ASN n 
1 92  SER n 
1 93  LYS n 
1 94  TYR n 
1 95  ASN n 
1 96  SER n 
1 97  LEU n 
1 98  THR n 
1 99  ILE n 
1 100 ASN n 
1 101 ASN n 
1 102 ASP n 
1 103 ILE n 
1 104 THR n 
1 105 LEU n 
1 106 LEU n 
1 107 LYS n 
1 108 LEU n 
1 109 SER n 
1 110 THR n 
1 111 ALA n 
1 112 ALA n 
1 113 SER n 
1 114 PHE n 
1 115 SER n 
1 116 GLN n 
1 117 THR n 
1 118 VAL n 
1 119 SER n 
1 120 ALA n 
1 121 VAL n 
1 122 CYS n 
1 123 LEU n 
1 124 PRO n 
1 125 SER n 
1 126 ALA n 
1 127 SER n 
1 128 ASP n 
1 129 ASP n 
1 130 PHE n 
1 131 ALA n 
1 132 ALA n 
1 133 GLY n 
1 134 THR n 
1 135 THR n 
1 136 CYS n 
1 137 VAL n 
1 138 THR n 
1 139 THR n 
1 140 GLY n 
1 141 TRP n 
1 142 GLY n 
1 143 LEU n 
1 144 THR n 
1 145 ARG n 
1 146 TYR n 
1 147 THR n 
1 148 ASN n 
1 149 ALA n 
1 150 ASN n 
1 151 THR n 
1 152 PRO n 
1 153 ASP n 
1 154 ARG n 
1 155 LEU n 
1 156 GLN n 
1 157 GLN n 
1 158 ALA n 
1 159 SER n 
1 160 LEU n 
1 161 PRO n 
1 162 LEU n 
1 163 LEU n 
1 164 SER n 
1 165 ASN n 
1 166 THR n 
1 167 ASN n 
1 168 CYS n 
1 169 LYS n 
1 170 LYS n 
1 171 TYR n 
1 172 TRP n 
1 173 GLY n 
1 174 THR n 
1 175 LYS n 
1 176 ILE n 
1 177 LYS n 
1 178 ASP n 
1 179 ALA n 
1 180 MET n 
1 181 ILE n 
1 182 CYS n 
1 183 ALA n 
1 184 GLY n 
1 185 ALA n 
1 186 SER n 
1 187 GLY n 
1 188 VAL n 
1 189 SER n 
1 190 SER n 
1 191 CYS n 
1 192 MET n 
1 193 GLY n 
1 194 ASP n 
1 195 SER n 
1 196 GLY n 
1 197 GLY n 
1 198 PRO n 
1 199 LEU n 
1 200 VAL n 
1 201 CYS n 
1 202 LYS n 
1 203 LYS n 
1 204 ASN n 
1 205 GLY n 
1 206 ALA n 
1 207 TRP n 
1 208 THR n 
1 209 LEU n 
1 210 VAL n 
1 211 GLY n 
1 212 ILE n 
1 213 VAL n 
1 214 SER n 
1 215 TRP n 
1 216 GLY n 
1 217 SER n 
1 218 SER n 
1 219 THR n 
1 220 CYS n 
1 221 SER n 
1 222 THR n 
1 223 SER n 
1 224 THR n 
1 225 PRO n 
1 226 GLY n 
1 227 VAL n 
1 228 TYR n 
1 229 ALA n 
1 230 ARG n 
1 231 VAL n 
1 232 THR n 
1 233 ALA n 
1 234 LEU n 
1 235 VAL n 
1 236 ASN n 
1 237 TRP n 
1 238 VAL n 
1 239 GLN n 
1 240 GLN n 
1 241 THR n 
1 242 LEU n 
1 243 ALA n 
1 244 ALA n 
1 245 ASN n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                cattle 
_entity_src_nat.pdbx_organism_scientific   'Bos taurus' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      9913 
_entity_src_nat.genus                      Bos 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CTRA_BOVIN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;CGVPAIQPVLSGLSRIVNGEEAVPGSWPWQVSLQDKTGFHFCGGSLINENWVVTAAHCGVTTSDVVVAGEFDQGSSSEKI
QKLKIAKVFKNSKYNSLTINNDITLLKLSTAASFSQTVSAVCLPSASDDFAAGTTCVTTGWGLTRYTNANTPDRLQQASL
PLLSNTNCKKYWGTKIKDAMICAGASGVSSCMGDSGGPLVCKKNGAWTLVGIVSWGSSTCSTSTPGVYARVTALVNWVQQ
TLAAN
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_accession          P00766 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1K2I 
_struct_ref_seq.pdbx_strand_id                1 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 245 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P00766 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  245 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       245 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                             ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                            ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                          ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                     ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                            ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                           ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                     ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                             ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                           ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                               ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                          ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                             ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                              ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                          ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                       ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                             ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                              ? 'C3 H7 N O3'     105.093 
SN1 non-polymer         . '2,4-DIHYDROXY-TRANS CINNAMIC ACID' ? 'C9 H8 O4'       180.157 
SO4 non-polymer         . 'SULFATE ION'                       ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE                           ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                          ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                            ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                              ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1K2I 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.31 
_exptl_crystal.density_percent_sol   46.79 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_details    
'ammonium sulfate, sodium cacodylate, dioxane, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           298 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MACSCIENCE 
_diffrn_detector.pdbx_collection_date   1999-08-17 
_diffrn_detector.details                'double-focusing mirrors' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Yale mirrors + Ni filter' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     1K2I 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             30 
_reflns.d_resolution_high            1.8 
_reflns.number_obs                   22972 
_reflns.number_all                   23275 
_reflns.percent_possible_obs         99.7 
_reflns.pdbx_Rmerge_I_obs            0.084 
_reflns.pdbx_Rsym_value              0.084 
_reflns.pdbx_netI_over_sigmaI        18.3 
_reflns.B_iso_Wilson_estimate        24.5 
_reflns.pdbx_redundancy              4.5 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.8 
_reflns_shell.d_res_low              1.86 
_reflns_shell.percent_possible_all   100 
_reflns_shell.Rmerge_I_obs           0.351 
_reflns_shell.pdbx_Rsym_value        0.351 
_reflns_shell.meanI_over_sigI_obs    4.3 
_reflns_shell.pdbx_redundancy        4.5 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      2229 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1K2I 
_refine.ls_number_reflns_obs                     22635 
_refine.ls_number_reflns_all                     23007 
_refine.pdbx_ls_sigma_I                          0 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             30 
_refine.ls_d_res_high                            1.8 
_refine.ls_percent_reflns_obs                    98.4 
_refine.ls_R_factor_obs                          0.19 
_refine.ls_R_factor_all                          0.19 
_refine.ls_R_factor_R_work                       0.1796 
_refine.ls_R_factor_R_free                       0.1995 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 9.90 
_refine.ls_number_reflns_R_free                  2241 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               16.7 
_refine.aniso_B[1][1]                            -0.658 
_refine.aniso_B[2][2]                            -0.658 
_refine.aniso_B[3][3]                            1.316 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB entry 1GCT' 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_isotropic_thermal_model             anisotropic 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            Random 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1735 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         17 
_refine_hist.number_atoms_solvent             134 
_refine_hist.number_atoms_total               1886 
_refine_hist.d_res_high                       1.8 
_refine_hist.d_res_low                        30 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_angle_deg  1.29   ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d     0.0045 ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it 1.706  ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it  1.152  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1K2I 
_struct.title                     'Crystal Structure of Gamma-Chymotrypsin in Complex with 7-Hydroxycoumarin' 
_struct.pdbx_descriptor           'CHYMOTRYPSINOGEN A (E.C.3.4.21.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1K2I 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'enzyme-inhibitor complex, hydrolase' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               ? 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ALA A 55  ? GLY A 59  ? ALA 1 55  GLY 1 59  5 ? 5  
HELX_P HELX_P2 2 SER A 164 ? GLY A 173 ? SER 1 164 GLY 1 173 1 ? 10 
HELX_P HELX_P3 3 THR A 174 ? ILE A 176 ? THR 1 174 ILE 1 176 5 ? 3  
HELX_P HELX_P4 4 LEU A 234 ? ASN A 245 ? LEU 1 234 ASN 1 245 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 1   SG ? ? ? 1_555 A CYS 122 SG ? ? 1 CYS 1   1 CYS 122 1_555 ? ? ? ? ? ? ? 2.030 ? 
disulf2 disulf ? ? A CYS 42  SG ? ? ? 1_555 A CYS 58  SG ? ? 1 CYS 42  1 CYS 58  1_555 ? ? ? ? ? ? ? 2.029 ? 
disulf3 disulf ? ? A CYS 136 SG ? ? ? 1_555 A CYS 201 SG ? ? 1 CYS 136 1 CYS 201 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf4 disulf ? ? A CYS 168 SG ? ? ? 1_555 A CYS 182 SG ? ? 1 CYS 168 1 CYS 182 1_555 ? ? ? ? ? ? ? 2.026 ? 
disulf5 disulf ? ? A CYS 191 SG ? ? ? 1_555 A CYS 220 SG ? ? 1 CYS 191 1 CYS 220 1_555 ? ? ? ? ? ? ? 2.032 ? 
covale1 covale ? ? A SER 195 OG ? ? ? 1_555 C SN1 .   C2 ? ? 1 SER 195 1 SN1 400 1_555 ? ? ? ? ? ? ? 1.322 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7 ? 
B ? 7 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
B 6 7 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU A 20  ? GLU A 21  ? GLU 1 20  GLU 1 21  
A 2 GLN A 156 ? PRO A 161 ? GLN 1 156 PRO 1 161 
A 3 THR A 135 ? GLY A 140 ? THR 1 135 GLY 1 140 
A 4 PRO A 198 ? LYS A 203 ? PRO 1 198 LYS 1 203 
A 5 ALA A 206 ? TRP A 215 ? ALA 1 206 TRP 1 215 
A 6 PRO A 225 ? ARG A 230 ? PRO 1 225 ARG 1 230 
A 7 MET A 180 ? GLY A 184 ? MET 1 180 GLY 1 184 
B 1 GLN A 30  ? GLN A 34  ? GLN 1 30  GLN 1 34  
B 2 HIS A 40  ? LEU A 46  ? HIS 1 40  LEU 1 46  
B 3 TRP A 51  ? THR A 54  ? TRP 1 51  THR 1 54  
B 4 THR A 104 ? LEU A 108 ? THR 1 104 LEU 1 108 
B 5 GLN A 81  ? LYS A 90  ? GLN 1 81  LYS 1 90  
B 6 VAL A 65  ? ALA A 68  ? VAL 1 65  ALA 1 68  
B 7 GLN A 30  ? GLN A 34  ? GLN 1 30  GLN 1 34  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLU A 20  ? N GLU 1 20  O GLN A 157 ? O GLN 1 157 
A 2 3 O LEU A 160 ? O LEU 1 160 N CYS A 136 ? N CYS 1 136 
A 3 4 N VAL A 137 ? N VAL 1 137 O VAL A 200 ? O VAL 1 200 
A 4 5 N LYS A 203 ? N LYS 1 203 O ALA A 206 ? O ALA 1 206 
A 5 6 N TRP A 215 ? N TRP 1 215 O VAL A 227 ? O VAL 1 227 
A 6 7 O GLY A 226 ? O GLY 1 226 N ALA A 183 ? N ALA 1 183 
B 1 2 N LEU A 33  ? N LEU 1 33  O CYS A 42  ? O CYS 1 42  
B 2 3 N SER A 45  ? N SER 1 45  O VAL A 53  ? O VAL 1 53  
B 3 4 N VAL A 52  ? N VAL 1 52  O LEU A 106 ? O LEU 1 106 
B 4 5 O LEU A 105 ? O LEU 1 105 N PHE A 89  ? N PHE 1 89  
B 5 6 O LEU A 83  ? O LEU 1 83  N VAL A 66  ? N VAL 1 66  
B 6 7 O VAL A 65  ? O VAL 1 65  N GLN A 34  ? N GLN 1 34  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SO4 1 501' 
AC2 Software ? ? ? ? 9 'BINDING SITE FOR RESIDUE SN1 1 400' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 LYS A 36  ? LYS 1 36  . ? 2_655 ? 
2  AC1 5 SER A 92  ? SER 1 92  . ? 1_555 ? 
3  AC1 5 TRP A 237 ? TRP 1 237 . ? 1_555 ? 
4  AC1 5 HOH D .   ? HOH 1 517 . ? 1_555 ? 
5  AC1 5 HOH D .   ? HOH 1 593 . ? 6_555 ? 
6  AC2 9 SER A 190 ? SER 1 190 . ? 1_555 ? 
7  AC2 9 CYS A 191 ? CYS 1 191 . ? 1_555 ? 
8  AC2 9 GLY A 193 ? GLY 1 193 . ? 1_555 ? 
9  AC2 9 SER A 195 ? SER 1 195 . ? 1_555 ? 
10 AC2 9 VAL A 213 ? VAL 1 213 . ? 1_555 ? 
11 AC2 9 TRP A 215 ? TRP 1 215 . ? 1_555 ? 
12 AC2 9 GLY A 216 ? GLY 1 216 . ? 1_555 ? 
13 AC2 9 SER A 217 ? SER 1 217 . ? 1_555 ? 
14 AC2 9 HOH D .   ? HOH 1 635 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1K2I 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1K2I 
_atom_sites.fract_transf_matrix[1][1]   0.014316 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014316 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010269 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . CYS A 1 1   ? 13.593 19.842  22.817 1.00 16.30 ? 1   CYS 1 N   1 
ATOM   2    C CA  . CYS A 1 1   ? 14.180 18.841  23.763 1.00 14.94 ? 1   CYS 1 CA  1 
ATOM   3    C C   . CYS A 1 1   ? 13.603 19.001  25.167 1.00 14.37 ? 1   CYS 1 C   1 
ATOM   4    O O   . CYS A 1 1   ? 12.993 20.021  25.489 1.00 13.27 ? 1   CYS 1 O   1 
ATOM   5    C CB  . CYS A 1 1   ? 15.704 19.021  23.844 1.00 13.89 ? 1   CYS 1 CB  1 
ATOM   6    S SG  . CYS A 1 1   ? 16.203 20.678  24.425 1.00 14.67 ? 1   CYS 1 SG  1 
ATOM   7    N N   . GLY A 1 2   ? 13.803 17.974  25.987 1.00 13.15 ? 2   GLY 1 N   1 
ATOM   8    C CA  . GLY A 1 2   ? 13.378 17.999  27.378 1.00 13.20 ? 2   GLY 1 CA  1 
ATOM   9    C C   . GLY A 1 2   ? 11.917 18.090  27.766 1.00 13.70 ? 2   GLY 1 C   1 
ATOM   10   O O   . GLY A 1 2   ? 11.624 18.333  28.932 1.00 14.04 ? 2   GLY 1 O   1 
ATOM   11   N N   . VAL A 1 3   ? 10.999 17.901  26.823 1.00 13.91 ? 3   VAL 1 N   1 
ATOM   12   C CA  . VAL A 1 3   ? 9.577  17.971  27.143 1.00 13.73 ? 3   VAL 1 CA  1 
ATOM   13   C C   . VAL A 1 3   ? 8.891  16.686  26.689 1.00 14.18 ? 3   VAL 1 C   1 
ATOM   14   O O   . VAL A 1 3   ? 8.474  16.569  25.538 1.00 15.55 ? 3   VAL 1 O   1 
ATOM   15   C CB  . VAL A 1 3   ? 8.903  19.185  26.452 1.00 14.66 ? 3   VAL 1 CB  1 
ATOM   16   C CG1 . VAL A 1 3   ? 7.437  19.269  26.858 1.00 15.73 ? 3   VAL 1 CG1 1 
ATOM   17   C CG2 . VAL A 1 3   ? 9.630  20.468  26.830 1.00 15.91 ? 3   VAL 1 CG2 1 
ATOM   18   N N   . PRO A 1 4   ? 8.767  15.702  27.595 1.00 15.03 ? 4   PRO 1 N   1 
ATOM   19   C CA  . PRO A 1 4   ? 8.130  14.418  27.274 1.00 14.92 ? 4   PRO 1 CA  1 
ATOM   20   C C   . PRO A 1 4   ? 6.669  14.558  26.851 1.00 16.54 ? 4   PRO 1 C   1 
ATOM   21   O O   . PRO A 1 4   ? 5.935  15.383  27.396 1.00 14.98 ? 4   PRO 1 O   1 
ATOM   22   C CB  . PRO A 1 4   ? 8.261  13.626  28.575 1.00 14.21 ? 4   PRO 1 CB  1 
ATOM   23   C CG  . PRO A 1 4   ? 9.467  14.233  29.241 1.00 17.57 ? 4   PRO 1 CG  1 
ATOM   24   C CD  . PRO A 1 4   ? 9.273  15.703  28.979 1.00 14.15 ? 4   PRO 1 CD  1 
ATOM   25   N N   . ALA A 1 5   ? 6.253  13.745  25.883 1.00 16.81 ? 5   ALA 1 N   1 
ATOM   26   C CA  . ALA A 1 5   ? 4.870  13.764  25.418 1.00 17.68 ? 5   ALA 1 CA  1 
ATOM   27   C C   . ALA A 1 5   ? 4.016  13.133  26.514 1.00 18.59 ? 5   ALA 1 C   1 
ATOM   28   O O   . ALA A 1 5   ? 2.855  13.498  26.715 1.00 16.88 ? 5   ALA 1 O   1 
ATOM   29   C CB  . ALA A 1 5   ? 4.738  12.972  24.123 1.00 17.48 ? 5   ALA 1 CB  1 
ATOM   30   N N   . ILE A 1 6   ? 4.605  12.173  27.220 1.00 16.86 ? 6   ILE 1 N   1 
ATOM   31   C CA  . ILE A 1 6   ? 3.929  11.498  28.322 1.00 17.78 ? 6   ILE 1 CA  1 
ATOM   32   C C   . ILE A 1 6   ? 4.580  12.058  29.578 1.00 19.92 ? 6   ILE 1 C   1 
ATOM   33   O O   . ILE A 1 6   ? 5.732  11.746  29.884 1.00 17.58 ? 6   ILE 1 O   1 
ATOM   34   C CB  . ILE A 1 6   ? 4.140  9.972   28.259 1.00 18.88 ? 6   ILE 1 CB  1 
ATOM   35   C CG1 . ILE A 1 6   ? 3.535  9.422   26.964 1.00 19.51 ? 6   ILE 1 CG1 1 
ATOM   36   C CG2 . ILE A 1 6   ? 3.510  9.303   29.477 1.00 19.22 ? 6   ILE 1 CG2 1 
ATOM   37   C CD1 . ILE A 1 6   ? 3.784  7.945   26.748 1.00 22.81 ? 6   ILE 1 CD1 1 
ATOM   38   N N   . GLN A 1 7   ? 3.847  12.897  30.301 1.00 19.69 ? 7   GLN 1 N   1 
ATOM   39   C CA  . GLN A 1 7   ? 4.394  13.527  31.494 1.00 21.79 ? 7   GLN 1 CA  1 
ATOM   40   C C   . GLN A 1 7   ? 4.729  12.596  32.644 1.00 20.56 ? 7   GLN 1 C   1 
ATOM   41   O O   . GLN A 1 7   ? 3.953  11.712  33.000 1.00 18.97 ? 7   GLN 1 O   1 
ATOM   42   C CB  . GLN A 1 7   ? 3.458  14.627  31.990 1.00 24.31 ? 7   GLN 1 CB  1 
ATOM   43   C CG  . GLN A 1 7   ? 3.280  15.752  30.992 1.00 31.07 ? 7   GLN 1 CG  1 
ATOM   44   C CD  . GLN A 1 7   ? 2.588  16.959  31.588 1.00 34.39 ? 7   GLN 1 CD  1 
ATOM   45   O OE1 . GLN A 1 7   ? 2.284  17.921  30.883 1.00 38.53 ? 7   GLN 1 OE1 1 
ATOM   46   N NE2 . GLN A 1 7   ? 2.342  16.918  32.894 1.00 35.99 ? 7   GLN 1 NE2 1 
ATOM   47   N N   . PRO A 1 8   ? 5.913  12.787  33.239 1.00 20.76 ? 8   PRO 1 N   1 
ATOM   48   C CA  . PRO A 1 8   ? 6.361  11.967  34.363 1.00 19.84 ? 8   PRO 1 CA  1 
ATOM   49   C C   . PRO A 1 8   ? 5.538  12.304  35.604 1.00 21.24 ? 8   PRO 1 C   1 
ATOM   50   O O   . PRO A 1 8   ? 5.068  13.434  35.760 1.00 20.37 ? 8   PRO 1 O   1 
ATOM   51   C CB  . PRO A 1 8   ? 7.826  12.379  34.536 1.00 20.34 ? 8   PRO 1 CB  1 
ATOM   52   C CG  . PRO A 1 8   ? 8.213  12.936  33.197 1.00 22.94 ? 8   PRO 1 CG  1 
ATOM   53   C CD  . PRO A 1 8   ? 6.984  13.694  32.793 1.00 21.05 ? 8   PRO 1 CD  1 
ATOM   54   N N   . VAL A 1 9   ? 5.356  11.318  36.473 1.00 19.90 ? 9   VAL 1 N   1 
ATOM   55   C CA  . VAL A 1 9   ? 4.624  11.516  37.715 1.00 21.60 ? 9   VAL 1 CA  1 
ATOM   56   C C   . VAL A 1 9   ? 5.583  11.170  38.848 1.00 22.00 ? 9   VAL 1 C   1 
ATOM   57   O O   . VAL A 1 9   ? 6.030  10.029  38.957 1.00 20.80 ? 9   VAL 1 O   1 
ATOM   58   C CB  . VAL A 1 9   ? 3.390  10.594  37.807 1.00 22.19 ? 9   VAL 1 CB  1 
ATOM   59   C CG1 . VAL A 1 9   ? 2.718  10.770  39.163 1.00 23.74 ? 9   VAL 1 CG1 1 
ATOM   60   C CG2 . VAL A 1 9   ? 2.412  10.916  36.684 1.00 22.11 ? 9   VAL 1 CG2 1 
ATOM   61   N N   . LEU A 1 10  ? 5.904  12.159  39.677 1.00 24.46 ? 10  LEU 1 N   1 
ATOM   62   C CA  . LEU A 1 10  ? 6.821  11.962  40.798 1.00 28.53 ? 10  LEU 1 CA  1 
ATOM   63   C C   . LEU A 1 10  ? 6.083  11.901  42.132 1.00 30.39 ? 10  LEU 1 C   1 
ATOM   64   O O   . LEU A 1 10  ? 6.241  10.886  42.844 1.00 32.72 ? 10  LEU 1 O   1 
ATOM   65   C CB  . LEU A 1 10  ? 7.855  13.091  40.843 1.00 29.48 ? 10  LEU 1 CB  1 
ATOM   66   C CG  . LEU A 1 10  ? 8.886  13.193  39.713 1.00 32.25 ? 10  LEU 1 CG  1 
ATOM   67   C CD1 . LEU A 1 10  ? 9.734  11.931  39.684 1.00 31.17 ? 10  LEU 1 CD1 1 
ATOM   68   C CD2 . LEU A 1 10  ? 8.185  13.403  38.382 1.00 33.27 ? 10  LEU 1 CD2 1 
ATOM   69   N N   . ILE A 1 16  ? 18.551 1.572   40.776 1.00 8.01  ? 16  ILE 1 N   1 
ATOM   70   C CA  . ILE A 1 16  ? 18.234 2.598   41.808 1.00 10.10 ? 16  ILE 1 CA  1 
ATOM   71   C C   . ILE A 1 16  ? 17.662 1.942   43.058 1.00 11.42 ? 16  ILE 1 C   1 
ATOM   72   O O   . ILE A 1 16  ? 16.696 1.185   42.984 1.00 11.77 ? 16  ILE 1 O   1 
ATOM   73   C CB  . ILE A 1 16  ? 17.203 3.622   41.284 1.00 10.88 ? 16  ILE 1 CB  1 
ATOM   74   C CG1 . ILE A 1 16  ? 17.778 4.372   40.077 1.00 10.28 ? 16  ILE 1 CG1 1 
ATOM   75   C CG2 . ILE A 1 16  ? 16.842 4.610   42.387 1.00 10.99 ? 16  ILE 1 CG2 1 
ATOM   76   C CD1 . ILE A 1 16  ? 16.794 5.321   39.415 1.00 12.90 ? 16  ILE 1 CD1 1 
ATOM   77   N N   . VAL A 1 17  ? 18.272 2.229   44.201 1.00 12.89 ? 17  VAL 1 N   1 
ATOM   78   C CA  . VAL A 1 17  ? 17.808 1.684   45.469 1.00 13.04 ? 17  VAL 1 CA  1 
ATOM   79   C C   . VAL A 1 17  ? 16.764 2.625   46.058 1.00 14.04 ? 17  VAL 1 C   1 
ATOM   80   O O   . VAL A 1 17  ? 16.982 3.833   46.133 1.00 13.01 ? 17  VAL 1 O   1 
ATOM   81   C CB  . VAL A 1 17  ? 18.970 1.534   46.471 1.00 14.41 ? 17  VAL 1 CB  1 
ATOM   82   C CG1 . VAL A 1 17  ? 18.443 1.043   47.811 1.00 13.51 ? 17  VAL 1 CG1 1 
ATOM   83   C CG2 . VAL A 1 17  ? 20.004 0.560   45.920 1.00 14.13 ? 17  VAL 1 CG2 1 
ATOM   84   N N   . ASN A 1 18  ? 15.629 2.061   46.459 1.00 14.21 ? 18  ASN 1 N   1 
ATOM   85   C CA  . ASN A 1 18  ? 14.529 2.822   47.049 1.00 17.18 ? 18  ASN 1 CA  1 
ATOM   86   C C   . ASN A 1 18  ? 13.863 3.801   46.094 1.00 17.39 ? 18  ASN 1 C   1 
ATOM   87   O O   . ASN A 1 18  ? 13.334 4.831   46.518 1.00 17.52 ? 18  ASN 1 O   1 
ATOM   88   C CB  . ASN A 1 18  ? 14.991 3.578   48.299 1.00 18.35 ? 18  ASN 1 CB  1 
ATOM   89   C CG  . ASN A 1 18  ? 15.323 2.653   49.447 1.00 23.51 ? 18  ASN 1 CG  1 
ATOM   90   O OD1 . ASN A 1 18  ? 14.657 1.635   49.650 1.00 27.77 ? 18  ASN 1 OD1 1 
ATOM   91   N ND2 . ASN A 1 18  ? 16.346 3.008   50.220 1.00 25.21 ? 18  ASN 1 ND2 1 
ATOM   92   N N   . GLY A 1 19  ? 13.894 3.482   44.805 1.00 17.07 ? 19  GLY 1 N   1 
ATOM   93   C CA  . GLY A 1 19  ? 13.253 4.334   43.826 1.00 17.94 ? 19  GLY 1 CA  1 
ATOM   94   C C   . GLY A 1 19  ? 11.845 3.809   43.618 1.00 18.53 ? 19  GLY 1 C   1 
ATOM   95   O O   . GLY A 1 19  ? 11.341 3.038   44.436 1.00 19.61 ? 19  GLY 1 O   1 
ATOM   96   N N   . GLU A 1 20  ? 11.200 4.226   42.539 1.00 16.38 ? 20  GLU 1 N   1 
ATOM   97   C CA  . GLU A 1 20  ? 9.855  3.760   42.246 1.00 16.07 ? 20  GLU 1 CA  1 
ATOM   98   C C   . GLU A 1 20  ? 9.726  3.522   40.751 1.00 16.75 ? 20  GLU 1 C   1 
ATOM   99   O O   . GLU A 1 20  ? 10.546 3.997   39.961 1.00 14.37 ? 20  GLU 1 O   1 
ATOM   100  C CB  . GLU A 1 20  ? 8.820  4.789   42.710 1.00 18.58 ? 20  GLU 1 CB  1 
ATOM   101  C CG  . GLU A 1 20  ? 8.952  6.142   42.037 1.00 22.62 ? 20  GLU 1 CG  1 
ATOM   102  C CD  . GLU A 1 20  ? 8.002  7.181   42.608 1.00 26.54 ? 20  GLU 1 CD  1 
ATOM   103  O OE1 . GLU A 1 20  ? 7.268  6.863   43.568 1.00 28.58 ? 20  GLU 1 OE1 1 
ATOM   104  O OE2 . GLU A 1 20  ? 7.995  8.320   42.094 1.00 26.74 ? 20  GLU 1 OE2 1 
ATOM   105  N N   . GLU A 1 21  ? 8.694  2.780   40.369 1.00 14.60 ? 21  GLU 1 N   1 
ATOM   106  C CA  . GLU A 1 21  ? 8.452  2.476   38.969 1.00 16.07 ? 21  GLU 1 CA  1 
ATOM   107  C C   . GLU A 1 21  ? 7.998  3.748   38.262 1.00 16.20 ? 21  GLU 1 C   1 
ATOM   108  O O   . GLU A 1 21  ? 7.148  4.480   38.771 1.00 16.27 ? 21  GLU 1 O   1 
ATOM   109  C CB  . GLU A 1 21  ? 7.369  1.404   38.865 1.00 18.50 ? 21  GLU 1 CB  1 
ATOM   110  C CG  . GLU A 1 21  ? 7.410  0.601   37.596 1.00 21.54 ? 21  GLU 1 CG  1 
ATOM   111  C CD  . GLU A 1 21  ? 6.337  -0.460  37.570 1.00 23.86 ? 21  GLU 1 CD  1 
ATOM   112  O OE1 . GLU A 1 21  ? 5.217  -0.164  37.100 1.00 25.18 ? 21  GLU 1 OE1 1 
ATOM   113  O OE2 . GLU A 1 21  ? 6.614  -1.584  38.036 1.00 26.02 ? 21  GLU 1 OE2 1 
ATOM   114  N N   . ALA A 1 22  ? 8.565  4.015   37.091 1.00 13.67 ? 22  ALA 1 N   1 
ATOM   115  C CA  . ALA A 1 22  ? 8.204  5.210   36.339 1.00 14.29 ? 22  ALA 1 CA  1 
ATOM   116  C C   . ALA A 1 22  ? 6.975  4.978   35.475 1.00 14.87 ? 22  ALA 1 C   1 
ATOM   117  O O   . ALA A 1 22  ? 6.577  3.835   35.226 1.00 13.93 ? 22  ALA 1 O   1 
ATOM   118  C CB  . ALA A 1 22  ? 9.374  5.647   35.452 1.00 14.91 ? 22  ALA 1 CB  1 
ATOM   119  N N   . VAL A 1 23  ? 6.363  6.069   35.031 1.00 14.31 ? 23  VAL 1 N   1 
ATOM   120  C CA  . VAL A 1 23  ? 5.213  5.966   34.149 1.00 15.43 ? 23  VAL 1 CA  1 
ATOM   121  C C   . VAL A 1 23  ? 5.811  5.543   32.813 1.00 15.14 ? 23  VAL 1 C   1 
ATOM   122  O O   . VAL A 1 23  ? 6.786  6.134   32.355 1.00 14.21 ? 23  VAL 1 O   1 
ATOM   123  C CB  . VAL A 1 23  ? 4.501  7.321   33.985 1.00 16.13 ? 23  VAL 1 CB  1 
ATOM   124  C CG1 . VAL A 1 23  ? 3.405  7.210   32.933 1.00 18.02 ? 23  VAL 1 CG1 1 
ATOM   125  C CG2 . VAL A 1 23  ? 3.910  7.755   35.318 1.00 16.02 ? 23  VAL 1 CG2 1 
ATOM   126  N N   . PRO A 1 24  ? 5.247  4.507   32.177 1.00 16.11 ? 24  PRO 1 N   1 
ATOM   127  C CA  . PRO A 1 24  ? 5.765  4.035   30.891 1.00 16.44 ? 24  PRO 1 CA  1 
ATOM   128  C C   . PRO A 1 24  ? 5.935  5.135   29.848 1.00 17.03 ? 24  PRO 1 C   1 
ATOM   129  O O   . PRO A 1 24  ? 4.991  5.870   29.551 1.00 14.43 ? 24  PRO 1 O   1 
ATOM   130  C CB  . PRO A 1 24  ? 4.731  2.996   30.467 1.00 18.70 ? 24  PRO 1 CB  1 
ATOM   131  C CG  . PRO A 1 24  ? 4.274  2.438   31.777 1.00 18.89 ? 24  PRO 1 CG  1 
ATOM   132  C CD  . PRO A 1 24  ? 4.106  3.683   32.614 1.00 17.32 ? 24  PRO 1 CD  1 
ATOM   133  N N   . GLY A 1 25  ? 7.150  5.241   29.312 1.00 15.69 ? 25  GLY 1 N   1 
ATOM   134  C CA  . GLY A 1 25  ? 7.448  6.224   28.285 1.00 15.31 ? 25  GLY 1 CA  1 
ATOM   135  C C   . GLY A 1 25  ? 7.610  7.670   28.720 1.00 16.33 ? 25  GLY 1 C   1 
ATOM   136  O O   . GLY A 1 25  ? 7.785  8.541   27.869 1.00 16.98 ? 25  GLY 1 O   1 
ATOM   137  N N   . SER A 1 26  ? 7.573  7.930   30.026 1.00 15.32 ? 26  SER 1 N   1 
ATOM   138  C CA  . SER A 1 26  ? 7.687  9.295   30.546 1.00 14.25 ? 26  SER 1 CA  1 
ATOM   139  C C   . SER A 1 26  ? 9.106  9.870   30.589 1.00 13.17 ? 26  SER 1 C   1 
ATOM   140  O O   . SER A 1 26  ? 9.293  11.047  30.890 1.00 13.32 ? 26  SER 1 O   1 
ATOM   141  C CB  . SER A 1 26  ? 7.054  9.378   31.940 1.00 13.96 ? 26  SER 1 CB  1 
ATOM   142  O OG  . SER A 1 26  ? 7.719  8.535   32.861 1.00 14.73 ? 26  SER 1 OG  1 
ATOM   143  N N   . TRP A 1 27  ? 10.099 9.035   30.304 1.00 12.39 ? 27  TRP 1 N   1 
ATOM   144  C CA  . TRP A 1 27  ? 11.493 9.469   30.259 1.00 12.19 ? 27  TRP 1 CA  1 
ATOM   145  C C   . TRP A 1 27  ? 11.961 8.956   28.899 1.00 12.64 ? 27  TRP 1 C   1 
ATOM   146  O O   . TRP A 1 27  ? 12.784 8.042   28.812 1.00 11.03 ? 27  TRP 1 O   1 
ATOM   147  C CB  . TRP A 1 27  ? 12.301 8.826   31.393 1.00 12.20 ? 27  TRP 1 CB  1 
ATOM   148  C CG  . TRP A 1 27  ? 11.803 9.185   32.763 1.00 12.00 ? 27  TRP 1 CG  1 
ATOM   149  C CD1 . TRP A 1 27  ? 11.243 8.343   33.682 1.00 13.15 ? 27  TRP 1 CD1 1 
ATOM   150  C CD2 . TRP A 1 27  ? 11.799 10.488  33.359 1.00 11.66 ? 27  TRP 1 CD2 1 
ATOM   151  N NE1 . TRP A 1 27  ? 10.889 9.041   34.816 1.00 11.91 ? 27  TRP 1 NE1 1 
ATOM   152  C CE2 . TRP A 1 27  ? 11.219 10.360  34.642 1.00 12.76 ? 27  TRP 1 CE2 1 
ATOM   153  C CE3 . TRP A 1 27  ? 12.226 11.753  32.933 1.00 12.03 ? 27  TRP 1 CE3 1 
ATOM   154  C CZ2 . TRP A 1 27  ? 11.055 11.452  35.503 1.00 12.69 ? 27  TRP 1 CZ2 1 
ATOM   155  C CZ3 . TRP A 1 27  ? 12.063 12.839  33.789 1.00 13.00 ? 27  TRP 1 CZ3 1 
ATOM   156  C CH2 . TRP A 1 27  ? 11.481 12.680  35.061 1.00 13.33 ? 27  TRP 1 CH2 1 
ATOM   157  N N   . PRO A 1 28  ? 11.441 9.561   27.816 1.00 12.91 ? 28  PRO 1 N   1 
ATOM   158  C CA  . PRO A 1 28  ? 11.723 9.226   26.416 1.00 12.11 ? 28  PRO 1 CA  1 
ATOM   159  C C   . PRO A 1 28  ? 13.160 9.214   25.912 1.00 11.44 ? 28  PRO 1 C   1 
ATOM   160  O O   . PRO A 1 28  ? 13.440 8.577   24.895 1.00 11.69 ? 28  PRO 1 O   1 
ATOM   161  C CB  . PRO A 1 28  ? 10.837 10.207  25.645 1.00 12.26 ? 28  PRO 1 CB  1 
ATOM   162  C CG  . PRO A 1 28  ? 10.852 11.416  26.517 1.00 13.63 ? 28  PRO 1 CG  1 
ATOM   163  C CD  . PRO A 1 28  ? 10.664 10.816  27.900 1.00 13.34 ? 28  PRO 1 CD  1 
ATOM   164  N N   . TRP A 1 29  ? 14.065 9.902   26.601 1.00 9.73  ? 29  TRP 1 N   1 
ATOM   165  C CA  . TRP A 1 29  ? 15.467 9.934   26.182 1.00 9.47  ? 29  TRP 1 CA  1 
ATOM   166  C C   . TRP A 1 29  ? 16.283 8.792   26.781 1.00 9.88  ? 29  TRP 1 C   1 
ATOM   167  O O   . TRP A 1 29  ? 17.403 8.526   26.347 1.00 9.23  ? 29  TRP 1 O   1 
ATOM   168  C CB  . TRP A 1 29  ? 16.106 11.273  26.561 1.00 8.37  ? 29  TRP 1 CB  1 
ATOM   169  C CG  . TRP A 1 29  ? 15.792 11.704  27.951 1.00 8.54  ? 29  TRP 1 CG  1 
ATOM   170  C CD1 . TRP A 1 29  ? 16.370 11.260  29.106 1.00 9.23  ? 29  TRP 1 CD1 1 
ATOM   171  C CD2 . TRP A 1 29  ? 14.782 12.643  28.342 1.00 10.84 ? 29  TRP 1 CD2 1 
ATOM   172  N NE1 . TRP A 1 29  ? 15.780 11.865  30.195 1.00 10.85 ? 29  TRP 1 NE1 1 
ATOM   173  C CE2 . TRP A 1 29  ? 14.802 12.717  29.754 1.00 9.22  ? 29  TRP 1 CE2 1 
ATOM   174  C CE3 . TRP A 1 29  ? 13.861 13.428  27.635 1.00 11.78 ? 29  TRP 1 CE3 1 
ATOM   175  C CZ2 . TRP A 1 29  ? 13.933 13.548  30.474 1.00 9.78  ? 29  TRP 1 CZ2 1 
ATOM   176  C CZ3 . TRP A 1 29  ? 12.996 14.255  28.351 1.00 11.27 ? 29  TRP 1 CZ3 1 
ATOM   177  C CH2 . TRP A 1 29  ? 13.041 14.306  29.757 1.00 9.47  ? 29  TRP 1 CH2 1 
ATOM   178  N N   . GLN A 1 30  ? 15.711 8.113   27.768 1.00 9.21  ? 30  GLN 1 N   1 
ATOM   179  C CA  . GLN A 1 30  ? 16.390 7.002   28.427 1.00 8.93  ? 30  GLN 1 CA  1 
ATOM   180  C C   . GLN A 1 30  ? 16.522 5.783   27.521 1.00 8.93  ? 30  GLN 1 C   1 
ATOM   181  O O   . GLN A 1 30  ? 15.530 5.280   27.002 1.00 10.08 ? 30  GLN 1 O   1 
ATOM   182  C CB  . GLN A 1 30  ? 15.622 6.594   29.686 1.00 9.19  ? 30  GLN 1 CB  1 
ATOM   183  C CG  . GLN A 1 30  ? 16.128 5.318   30.366 1.00 10.01 ? 30  GLN 1 CG  1 
ATOM   184  C CD  . GLN A 1 30  ? 17.313 5.562   31.289 1.00 12.80 ? 30  GLN 1 CD  1 
ATOM   185  O OE1 . GLN A 1 30  ? 17.230 6.360   32.225 1.00 13.13 ? 30  GLN 1 OE1 1 
ATOM   186  N NE2 . GLN A 1 30  ? 18.423 4.869   31.033 1.00 10.23 ? 30  GLN 1 NE2 1 
ATOM   187  N N   . VAL A 1 31  ? 17.750 5.313   27.337 1.00 8.92  ? 31  VAL 1 N   1 
ATOM   188  C CA  . VAL A 1 31  ? 17.989 4.124   26.534 1.00 9.05  ? 31  VAL 1 CA  1 
ATOM   189  C C   . VAL A 1 31  ? 18.733 3.105   27.388 1.00 8.90  ? 31  VAL 1 C   1 
ATOM   190  O O   . VAL A 1 31  ? 19.286 3.436   28.438 1.00 8.33  ? 31  VAL 1 O   1 
ATOM   191  C CB  . VAL A 1 31  ? 18.838 4.411   25.256 1.00 10.68 ? 31  VAL 1 CB  1 
ATOM   192  C CG1 . VAL A 1 31  ? 18.094 5.365   24.336 1.00 10.54 ? 31  VAL 1 CG1 1 
ATOM   193  C CG2 . VAL A 1 31  ? 20.207 4.962   25.636 1.00 8.58  ? 31  VAL 1 CG2 1 
ATOM   194  N N   . SER A 1 32  ? 18.711 1.859   26.942 1.00 9.37  ? 32  SER 1 N   1 
ATOM   195  C CA  . SER A 1 32  ? 19.396 0.781   27.632 1.00 9.37  ? 32  SER 1 CA  1 
ATOM   196  C C   . SER A 1 32  ? 20.497 0.291   26.712 1.00 10.64 ? 32  SER 1 C   1 
ATOM   197  O O   . SER A 1 32  ? 20.279 0.125   25.510 1.00 11.05 ? 32  SER 1 O   1 
ATOM   198  C CB  . SER A 1 32  ? 18.427 -0.369  27.925 1.00 10.41 ? 32  SER 1 CB  1 
ATOM   199  O OG  . SER A 1 32  ? 19.124 -1.568  28.239 1.00 10.44 ? 32  SER 1 OG  1 
ATOM   200  N N   . LEU A 1 33  ? 21.687 0.095   27.266 1.00 8.76  ? 33  LEU 1 N   1 
ATOM   201  C CA  . LEU A 1 33  ? 22.800 -0.425  26.484 1.00 10.18 ? 33  LEU 1 CA  1 
ATOM   202  C C   . LEU A 1 33  ? 22.863 -1.915  26.815 1.00 9.34  ? 33  LEU 1 C   1 
ATOM   203  O O   . LEU A 1 33  ? 23.033 -2.296  27.973 1.00 9.56  ? 33  LEU 1 O   1 
ATOM   204  C CB  . LEU A 1 33  ? 24.108 0.274   26.868 1.00 10.48 ? 33  LEU 1 CB  1 
ATOM   205  C CG  . LEU A 1 33  ? 24.146 1.767   26.538 1.00 14.84 ? 33  LEU 1 CG  1 
ATOM   206  C CD1 . LEU A 1 33  ? 25.478 2.363   26.970 1.00 18.76 ? 33  LEU 1 CD1 1 
ATOM   207  C CD2 . LEU A 1 33  ? 23.927 1.964   25.045 1.00 18.81 ? 33  LEU 1 CD2 1 
ATOM   208  N N   . GLN A 1 34  ? 22.692 -2.749  25.795 1.00 9.22  ? 34  GLN 1 N   1 
ATOM   209  C CA  . GLN A 1 34  ? 22.700 -4.196  25.968 1.00 10.13 ? 34  GLN 1 CA  1 
ATOM   210  C C   . GLN A 1 34  ? 23.767 -4.844  25.087 1.00 10.47 ? 34  GLN 1 C   1 
ATOM   211  O O   . GLN A 1 34  ? 24.039 -4.360  23.989 1.00 10.41 ? 34  GLN 1 O   1 
ATOM   212  C CB  . GLN A 1 34  ? 21.313 -4.760  25.609 1.00 10.75 ? 34  GLN 1 CB  1 
ATOM   213  C CG  . GLN A 1 34  ? 20.219 -4.421  26.617 1.00 14.50 ? 34  GLN 1 CG  1 
ATOM   214  C CD  . GLN A 1 34  ? 18.812 -4.633  26.079 1.00 17.34 ? 34  GLN 1 CD  1 
ATOM   215  O OE1 . GLN A 1 34  ? 18.569 -5.525  25.262 1.00 16.65 ? 34  GLN 1 OE1 1 
ATOM   216  N NE2 . GLN A 1 34  ? 17.871 -3.819  26.554 1.00 16.85 ? 34  GLN 1 NE2 1 
ATOM   217  N N   . ASP A 1 35  ? 24.389 -5.917  25.572 1.00 11.39 ? 35  ASP 1 N   1 
ATOM   218  C CA  . ASP A 1 35  ? 25.392 -6.604  24.763 1.00 12.93 ? 35  ASP 1 CA  1 
ATOM   219  C C   . ASP A 1 35  ? 24.647 -7.557  23.826 1.00 14.05 ? 35  ASP 1 C   1 
ATOM   220  O O   . ASP A 1 35  ? 23.418 -7.603  23.849 1.00 13.77 ? 35  ASP 1 O   1 
ATOM   221  C CB  . ASP A 1 35  ? 26.425 -7.335  25.644 1.00 13.22 ? 35  ASP 1 CB  1 
ATOM   222  C CG  . ASP A 1 35  ? 25.814 -8.401  26.541 1.00 14.81 ? 35  ASP 1 CG  1 
ATOM   223  O OD1 . ASP A 1 35  ? 24.759 -8.972  26.198 1.00 14.11 ? 35  ASP 1 OD1 1 
ATOM   224  O OD2 . ASP A 1 35  ? 26.418 -8.682  27.600 1.00 14.55 ? 35  ASP 1 OD2 1 
ATOM   225  N N   . LYS A 1 36  ? 25.366 -8.307  22.998 1.00 15.65 ? 36  LYS 1 N   1 
ATOM   226  C CA  . LYS A 1 36  ? 24.703 -9.192  22.047 1.00 17.47 ? 36  LYS 1 CA  1 
ATOM   227  C C   . LYS A 1 36  ? 23.831 -10.291 22.648 1.00 17.03 ? 36  LYS 1 C   1 
ATOM   228  O O   . LYS A 1 36  ? 22.992 -10.859 21.949 1.00 17.03 ? 36  LYS 1 O   1 
ATOM   229  C CB  . LYS A 1 36  ? 25.724 -9.816  21.086 1.00 19.57 ? 36  LYS 1 CB  1 
ATOM   230  C CG  . LYS A 1 36  ? 26.726 -10.739 21.736 1.00 22.56 ? 36  LYS 1 CG  1 
ATOM   231  C CD  . LYS A 1 36  ? 27.553 -11.467 20.683 1.00 25.62 ? 36  LYS 1 CD  1 
ATOM   232  C CE  . LYS A 1 36  ? 28.390 -10.503 19.858 1.00 26.78 ? 36  LYS 1 CE  1 
ATOM   233  N NZ  . LYS A 1 36  ? 29.289 -11.224 18.911 1.00 27.51 ? 36  LYS 1 NZ  1 
ATOM   234  N N   . THR A 1 37  ? 24.015 -10.599 23.929 1.00 15.17 ? 37  THR 1 N   1 
ATOM   235  C CA  . THR A 1 37  ? 23.195 -11.635 24.555 1.00 15.16 ? 37  THR 1 CA  1 
ATOM   236  C C   . THR A 1 37  ? 21.900 -11.037 25.110 1.00 15.06 ? 37  THR 1 C   1 
ATOM   237  O O   . THR A 1 37  ? 21.065 -11.757 25.655 1.00 16.28 ? 37  THR 1 O   1 
ATOM   238  C CB  . THR A 1 37  ? 23.943 -12.349 25.707 1.00 14.86 ? 37  THR 1 CB  1 
ATOM   239  O OG1 . THR A 1 37  ? 24.022 -11.484 26.847 1.00 16.10 ? 37  THR 1 OG1 1 
ATOM   240  C CG2 . THR A 1 37  ? 25.350 -12.731 25.271 1.00 17.02 ? 37  THR 1 CG2 1 
ATOM   241  N N   . GLY A 1 38  ? 21.744 -9.721  24.969 1.00 13.63 ? 38  GLY 1 N   1 
ATOM   242  C CA  . GLY A 1 38  ? 20.554 -9.041  25.459 1.00 14.41 ? 38  GLY 1 CA  1 
ATOM   243  C C   . GLY A 1 38  ? 20.645 -8.589  26.909 1.00 14.86 ? 38  GLY 1 C   1 
ATOM   244  O O   . GLY A 1 38  ? 19.652 -8.163  27.506 1.00 16.39 ? 38  GLY 1 O   1 
ATOM   245  N N   . PHE A 1 39  ? 21.843 -8.677  27.474 1.00 13.53 ? 39  PHE 1 N   1 
ATOM   246  C CA  . PHE A 1 39  ? 22.099 -8.298  28.865 1.00 12.73 ? 39  PHE 1 CA  1 
ATOM   247  C C   . PHE A 1 39  ? 22.233 -6.782  29.015 1.00 10.88 ? 39  PHE 1 C   1 
ATOM   248  O O   . PHE A 1 39  ? 23.064 -6.165  28.352 1.00 9.26  ? 39  PHE 1 O   1 
ATOM   249  C CB  . PHE A 1 39  ? 23.398 -8.970  29.331 1.00 11.90 ? 39  PHE 1 CB  1 
ATOM   250  C CG  . PHE A 1 39  ? 23.766 -8.682  30.761 1.00 14.29 ? 39  PHE 1 CG  1 
ATOM   251  C CD1 . PHE A 1 39  ? 23.091 -9.301  31.805 1.00 17.84 ? 39  PHE 1 CD1 1 
ATOM   252  C CD2 . PHE A 1 39  ? 24.807 -7.806  31.060 1.00 16.31 ? 39  PHE 1 CD2 1 
ATOM   253  C CE1 . PHE A 1 39  ? 23.446 -9.055  33.134 1.00 18.28 ? 39  PHE 1 CE1 1 
ATOM   254  C CE2 . PHE A 1 39  ? 25.171 -7.550  32.385 1.00 17.00 ? 39  PHE 1 CE2 1 
ATOM   255  C CZ  . PHE A 1 39  ? 24.489 -8.177  33.421 1.00 17.39 ? 39  PHE 1 CZ  1 
ATOM   256  N N   . HIS A 1 40  ? 21.413 -6.182  29.878 1.00 11.33 ? 40  HIS 1 N   1 
ATOM   257  C CA  . HIS A 1 40  ? 21.482 -4.737  30.116 1.00 11.22 ? 40  HIS 1 CA  1 
ATOM   258  C C   . HIS A 1 40  ? 22.672 -4.459  31.032 1.00 12.14 ? 40  HIS 1 C   1 
ATOM   259  O O   . HIS A 1 40  ? 22.761 -5.032  32.119 1.00 11.56 ? 40  HIS 1 O   1 
ATOM   260  C CB  . HIS A 1 40  ? 20.204 -4.236  30.798 1.00 11.16 ? 40  HIS 1 CB  1 
ATOM   261  C CG  . HIS A 1 40  ? 20.348 -2.880  31.421 1.00 12.04 ? 40  HIS 1 CG  1 
ATOM   262  N ND1 . HIS A 1 40  ? 20.057 -1.713  30.748 1.00 10.99 ? 40  HIS 1 ND1 1 
ATOM   263  C CD2 . HIS A 1 40  ? 20.818 -2.506  32.635 1.00 11.84 ? 40  HIS 1 CD2 1 
ATOM   264  C CE1 . HIS A 1 40  ? 20.344 -0.679  31.518 1.00 12.70 ? 40  HIS 1 CE1 1 
ATOM   265  N NE2 . HIS A 1 40  ? 20.809 -1.132  32.668 1.00 10.78 ? 40  HIS 1 NE2 1 
ATOM   266  N N   . PHE A 1 41  ? 23.576 -3.577  30.613 1.00 10.95 ? 41  PHE 1 N   1 
ATOM   267  C CA  . PHE A 1 41  ? 24.739 -3.276  31.443 1.00 12.09 ? 41  PHE 1 CA  1 
ATOM   268  C C   . PHE A 1 41  ? 24.957 -1.792  31.738 1.00 11.68 ? 41  PHE 1 C   1 
ATOM   269  O O   . PHE A 1 41  ? 25.741 -1.438  32.618 1.00 11.57 ? 41  PHE 1 O   1 
ATOM   270  C CB  . PHE A 1 41  ? 26.006 -3.894  30.825 1.00 12.23 ? 41  PHE 1 CB  1 
ATOM   271  C CG  . PHE A 1 41  ? 26.421 -3.290  29.503 1.00 11.04 ? 41  PHE 1 CG  1 
ATOM   272  C CD1 . PHE A 1 41  ? 27.274 -2.191  29.460 1.00 9.53  ? 41  PHE 1 CD1 1 
ATOM   273  C CD2 . PHE A 1 41  ? 25.989 -3.848  28.300 1.00 10.51 ? 41  PHE 1 CD2 1 
ATOM   274  C CE1 . PHE A 1 41  ? 27.697 -1.656  28.238 1.00 10.15 ? 41  PHE 1 CE1 1 
ATOM   275  C CE2 . PHE A 1 41  ? 26.405 -3.321  27.070 1.00 10.56 ? 41  PHE 1 CE2 1 
ATOM   276  C CZ  . PHE A 1 41  ? 27.261 -2.224  27.040 1.00 10.06 ? 41  PHE 1 CZ  1 
ATOM   277  N N   . CYS A 1 42  ? 24.257 -0.923  31.016 1.00 9.28  ? 42  CYS 1 N   1 
ATOM   278  C CA  . CYS A 1 42  ? 24.391 0.513   31.232 1.00 9.38  ? 42  CYS 1 CA  1 
ATOM   279  C C   . CYS A 1 42  ? 23.219 1.290   30.657 1.00 9.08  ? 42  CYS 1 C   1 
ATOM   280  O O   . CYS A 1 42  ? 22.489 0.792   29.798 1.00 8.61  ? 42  CYS 1 O   1 
ATOM   281  C CB  . CYS A 1 42  ? 25.690 1.033   30.605 1.00 9.71  ? 42  CYS 1 CB  1 
ATOM   282  S SG  . CYS A 1 42  ? 27.130 1.046   31.730 1.00 9.11  ? 42  CYS 1 SG  1 
ATOM   283  N N   . GLY A 1 43  ? 23.038 2.507   31.157 1.00 8.74  ? 43  GLY 1 N   1 
ATOM   284  C CA  . GLY A 1 43  ? 21.980 3.363   30.658 1.00 8.02  ? 43  GLY 1 CA  1 
ATOM   285  C C   . GLY A 1 43  ? 22.615 4.392   29.739 1.00 8.17  ? 43  GLY 1 C   1 
ATOM   286  O O   . GLY A 1 43  ? 23.835 4.401   29.569 1.00 7.95  ? 43  GLY 1 O   1 
ATOM   287  N N   . GLY A 1 44  ? 21.792 5.251   29.146 1.00 7.59  ? 44  GLY 1 N   1 
ATOM   288  C CA  . GLY A 1 44  ? 22.287 6.284   28.254 1.00 7.04  ? 44  GLY 1 CA  1 
ATOM   289  C C   . GLY A 1 44  ? 21.166 7.270   27.977 1.00 7.73  ? 44  GLY 1 C   1 
ATOM   290  O O   . GLY A 1 44  ? 20.014 7.007   28.342 1.00 7.51  ? 44  GLY 1 O   1 
ATOM   291  N N   . SER A 1 45  ? 21.490 8.399   27.352 1.00 7.80  ? 45  SER 1 N   1 
ATOM   292  C CA  . SER A 1 45  ? 20.478 9.411   27.034 1.00 7.88  ? 45  SER 1 CA  1 
ATOM   293  C C   . SER A 1 45  ? 20.580 9.906   25.600 1.00 9.00  ? 45  SER 1 C   1 
ATOM   294  O O   . SER A 1 45  ? 21.661 10.248  25.127 1.00 7.73  ? 45  SER 1 O   1 
ATOM   295  C CB  . SER A 1 45  ? 20.608 10.621  27.966 1.00 9.71  ? 45  SER 1 CB  1 
ATOM   296  O OG  . SER A 1 45  ? 20.465 10.256  29.327 1.00 10.15 ? 45  SER 1 OG  1 
ATOM   297  N N   . LEU A 1 46  ? 19.446 9.948   24.909 1.00 9.85  ? 46  LEU 1 N   1 
ATOM   298  C CA  . LEU A 1 46  ? 19.417 10.451  23.539 1.00 11.19 ? 46  LEU 1 CA  1 
ATOM   299  C C   . LEU A 1 46  ? 19.486 11.977  23.575 1.00 11.67 ? 46  LEU 1 C   1 
ATOM   300  O O   . LEU A 1 46  ? 18.743 12.613  24.327 1.00 10.41 ? 46  LEU 1 O   1 
ATOM   301  C CB  . LEU A 1 46  ? 18.118 10.029  22.846 1.00 12.35 ? 46  LEU 1 CB  1 
ATOM   302  C CG  . LEU A 1 46  ? 18.014 8.578   22.375 1.00 12.80 ? 46  LEU 1 CG  1 
ATOM   303  C CD1 . LEU A 1 46  ? 16.556 8.215   22.140 1.00 13.79 ? 46  LEU 1 CD1 1 
ATOM   304  C CD2 . LEU A 1 46  ? 18.828 8.401   21.103 1.00 12.52 ? 46  LEU 1 CD2 1 
ATOM   305  N N   . ILE A 1 47  ? 20.381 12.566  22.783 1.00 11.18 ? 47  ILE 1 N   1 
ATOM   306  C CA  . ILE A 1 47  ? 20.473 14.024  22.733 1.00 14.22 ? 47  ILE 1 CA  1 
ATOM   307  C C   . ILE A 1 47  ? 19.953 14.524  21.384 1.00 13.76 ? 47  ILE 1 C   1 
ATOM   308  O O   . ILE A 1 47  ? 19.780 15.721  21.175 1.00 14.82 ? 47  ILE 1 O   1 
ATOM   309  C CB  . ILE A 1 47  ? 21.916 14.535  22.981 1.00 14.69 ? 47  ILE 1 CB  1 
ATOM   310  C CG1 . ILE A 1 47  ? 22.887 13.926  21.972 1.00 16.36 ? 47  ILE 1 CG1 1 
ATOM   311  C CG2 . ILE A 1 47  ? 22.335 14.205  24.410 1.00 16.03 ? 47  ILE 1 CG2 1 
ATOM   312  C CD1 . ILE A 1 47  ? 24.307 14.456  22.109 1.00 16.48 ? 47  ILE 1 CD1 1 
ATOM   313  N N   . ASN A 1 48  ? 19.716 13.579  20.478 1.00 14.50 ? 48  ASN 1 N   1 
ATOM   314  C CA  . ASN A 1 48  ? 19.149 13.835  19.152 1.00 15.45 ? 48  ASN 1 CA  1 
ATOM   315  C C   . ASN A 1 48  ? 18.955 12.488  18.452 1.00 15.29 ? 48  ASN 1 C   1 
ATOM   316  O O   . ASN A 1 48  ? 19.240 11.443  19.040 1.00 15.11 ? 48  ASN 1 O   1 
ATOM   317  C CB  . ASN A 1 48  ? 20.003 14.826  18.329 1.00 17.61 ? 48  ASN 1 CB  1 
ATOM   318  C CG  . ASN A 1 48  ? 21.376 14.298  17.971 1.00 19.96 ? 48  ASN 1 CG  1 
ATOM   319  O OD1 . ASN A 1 48  ? 22.339 15.064  17.906 1.00 25.95 ? 48  ASN 1 OD1 1 
ATOM   320  N ND2 . ASN A 1 48  ? 21.474 13.008  17.709 1.00 19.80 ? 48  ASN 1 ND2 1 
ATOM   321  N N   . GLU A 1 49  ? 18.468 12.485  17.217 1.00 13.90 ? 49  GLU 1 N   1 
ATOM   322  C CA  . GLU A 1 49  ? 18.204 11.216  16.542 1.00 16.42 ? 49  GLU 1 CA  1 
ATOM   323  C C   . GLU A 1 49  ? 19.399 10.325  16.227 1.00 15.40 ? 49  GLU 1 C   1 
ATOM   324  O O   . GLU A 1 49  ? 19.233 9.124   16.025 1.00 17.26 ? 49  GLU 1 O   1 
ATOM   325  C CB  . GLU A 1 49  ? 17.419 11.455  15.247 1.00 18.49 ? 49  GLU 1 CB  1 
ATOM   326  C CG  . GLU A 1 49  ? 16.113 12.197  15.450 1.00 23.91 ? 49  GLU 1 CG  1 
ATOM   327  C CD  . GLU A 1 49  ? 16.262 13.701  15.308 1.00 26.98 ? 49  GLU 1 CD  1 
ATOM   328  O OE1 . GLU A 1 49  ? 17.277 14.255  15.779 1.00 28.23 ? 49  GLU 1 OE1 1 
ATOM   329  O OE2 . GLU A 1 49  ? 15.352 14.331  14.729 1.00 30.91 ? 49  GLU 1 OE2 1 
ATOM   330  N N   . ASN A 1 50  ? 20.600 10.889  16.209 1.00 14.95 ? 50  ASN 1 N   1 
ATOM   331  C CA  . ASN A 1 50  ? 21.776 10.102  15.852 1.00 14.56 ? 50  ASN 1 CA  1 
ATOM   332  C C   . ASN A 1 50  ? 22.823 9.906   16.939 1.00 13.22 ? 50  ASN 1 C   1 
ATOM   333  O O   . ASN A 1 50  ? 23.774 9.156   16.739 1.00 12.66 ? 50  ASN 1 O   1 
ATOM   334  C CB  . ASN A 1 50  ? 22.458 10.735  14.635 1.00 17.46 ? 50  ASN 1 CB  1 
ATOM   335  C CG  . ASN A 1 50  ? 21.545 10.810  13.424 1.00 22.18 ? 50  ASN 1 CG  1 
ATOM   336  O OD1 . ASN A 1 50  ? 21.162 9.788   12.859 1.00 25.28 ? 50  ASN 1 OD1 1 
ATOM   337  N ND2 . ASN A 1 50  ? 21.191 12.026  13.023 1.00 24.45 ? 50  ASN 1 ND2 1 
ATOM   338  N N   . TRP A 1 51  ? 22.654 10.563  18.083 1.00 12.37 ? 51  TRP 1 N   1 
ATOM   339  C CA  . TRP A 1 51  ? 23.644 10.463  19.152 1.00 10.29 ? 51  TRP 1 CA  1 
ATOM   340  C C   . TRP A 1 51  ? 23.115 10.115  20.533 1.00 9.93  ? 51  TRP 1 C   1 
ATOM   341  O O   . TRP A 1 51  ? 22.050 10.565  20.941 1.00 9.45  ? 51  TRP 1 O   1 
ATOM   342  C CB  . TRP A 1 51  ? 24.422 11.772  19.264 1.00 10.40 ? 51  TRP 1 CB  1 
ATOM   343  C CG  . TRP A 1 51  ? 25.204 12.126  18.046 1.00 11.46 ? 51  TRP 1 CG  1 
ATOM   344  C CD1 . TRP A 1 51  ? 24.741 12.738  16.916 1.00 13.41 ? 51  TRP 1 CD1 1 
ATOM   345  C CD2 . TRP A 1 51  ? 26.598 11.890  17.835 1.00 12.43 ? 51  TRP 1 CD2 1 
ATOM   346  N NE1 . TRP A 1 51  ? 25.767 12.902  16.013 1.00 13.42 ? 51  TRP 1 NE1 1 
ATOM   347  C CE2 . TRP A 1 51  ? 26.918 12.391  16.553 1.00 14.13 ? 51  TRP 1 CE2 1 
ATOM   348  C CE3 . TRP A 1 51  ? 27.611 11.305  18.606 1.00 12.46 ? 51  TRP 1 CE3 1 
ATOM   349  C CZ2 . TRP A 1 51  ? 28.215 12.325  16.025 1.00 13.58 ? 51  TRP 1 CZ2 1 
ATOM   350  C CZ3 . TRP A 1 51  ? 28.898 11.239  18.081 1.00 13.16 ? 51  TRP 1 CZ3 1 
ATOM   351  C CH2 . TRP A 1 51  ? 29.187 11.748  16.802 1.00 14.52 ? 51  TRP 1 CH2 1 
ATOM   352  N N   . VAL A 1 52  ? 23.903 9.327   21.255 1.00 10.28 ? 52  VAL 1 N   1 
ATOM   353  C CA  . VAL A 1 52  ? 23.565 8.910   22.606 1.00 10.86 ? 52  VAL 1 CA  1 
ATOM   354  C C   . VAL A 1 52  ? 24.733 9.258   23.520 1.00 11.22 ? 52  VAL 1 C   1 
ATOM   355  O O   . VAL A 1 52  ? 25.892 9.069   23.153 1.00 11.26 ? 52  VAL 1 O   1 
ATOM   356  C CB  . VAL A 1 52  ? 23.327 7.385   22.679 1.00 10.83 ? 52  VAL 1 CB  1 
ATOM   357  C CG1 . VAL A 1 52  ? 23.189 6.943   24.131 1.00 11.27 ? 52  VAL 1 CG1 1 
ATOM   358  C CG2 . VAL A 1 52  ? 22.077 7.016   21.890 1.00 13.53 ? 52  VAL 1 CG2 1 
ATOM   359  N N   . VAL A 1 53  ? 24.432 9.784   24.703 1.00 11.47 ? 53  VAL 1 N   1 
ATOM   360  C CA  . VAL A 1 53  ? 25.490 10.111  25.650 1.00 12.07 ? 53  VAL 1 CA  1 
ATOM   361  C C   . VAL A 1 53  ? 25.434 9.091   26.776 1.00 10.08 ? 53  VAL 1 C   1 
ATOM   362  O O   . VAL A 1 53  ? 24.354 8.764   27.275 1.00 10.15 ? 53  VAL 1 O   1 
ATOM   363  C CB  . VAL A 1 53  ? 25.330 11.537  26.245 1.00 14.27 ? 53  VAL 1 CB  1 
ATOM   364  C CG1 . VAL A 1 53  ? 25.401 12.564  25.142 1.00 18.28 ? 53  VAL 1 CG1 1 
ATOM   365  C CG2 . VAL A 1 53  ? 24.017 11.658  26.993 1.00 17.24 ? 53  VAL 1 CG2 1 
ATOM   366  N N   . THR A 1 54  ? 26.594 8.571   27.159 1.00 8.83  ? 54  THR 1 N   1 
ATOM   367  C CA  . THR A 1 54  ? 26.657 7.587   28.234 1.00 9.13  ? 54  THR 1 CA  1 
ATOM   368  C C   . THR A 1 54  ? 27.968 7.785   28.993 1.00 8.87  ? 54  THR 1 C   1 
ATOM   369  O O   . THR A 1 54  ? 28.671 8.771   28.771 1.00 8.20  ? 54  THR 1 O   1 
ATOM   370  C CB  . THR A 1 54  ? 26.559 6.136   27.676 1.00 8.71  ? 54  THR 1 CB  1 
ATOM   371  O OG1 . THR A 1 54  ? 26.478 5.205   28.763 1.00 8.14  ? 54  THR 1 OG1 1 
ATOM   372  C CG2 . THR A 1 54  ? 27.772 5.800   26.812 1.00 9.15  ? 54  THR 1 CG2 1 
ATOM   373  N N   . ALA A 1 55  ? 28.292 6.869   29.899 1.00 8.48  ? 55  ALA 1 N   1 
ATOM   374  C CA  . ALA A 1 55  ? 29.521 6.987   30.674 1.00 8.11  ? 55  ALA 1 CA  1 
ATOM   375  C C   . ALA A 1 55  ? 30.667 6.290   29.960 1.00 9.18  ? 55  ALA 1 C   1 
ATOM   376  O O   . ALA A 1 55  ? 30.477 5.248   29.339 1.00 8.93  ? 55  ALA 1 O   1 
ATOM   377  C CB  . ALA A 1 55  ? 29.329 6.384   32.063 1.00 7.06  ? 55  ALA 1 CB  1 
ATOM   378  N N   . ALA A 1 56  ? 31.858 6.867   30.046 1.00 8.91  ? 56  ALA 1 N   1 
ATOM   379  C CA  . ALA A 1 56  ? 33.015 6.267   29.403 1.00 10.29 ? 56  ALA 1 CA  1 
ATOM   380  C C   . ALA A 1 56  ? 33.364 4.920   30.042 1.00 9.73  ? 56  ALA 1 C   1 
ATOM   381  O O   . ALA A 1 56  ? 33.793 3.998   29.349 1.00 10.35 ? 56  ALA 1 O   1 
ATOM   382  C CB  . ALA A 1 56  ? 34.220 7.222   29.479 1.00 8.54  ? 56  ALA 1 CB  1 
ATOM   383  N N   . HIS A 1 57  ? 33.164 4.786   31.351 1.00 9.60  ? 57  HIS 1 N   1 
ATOM   384  C CA  . HIS A 1 57  ? 33.513 3.529   32.009 1.00 9.44  ? 57  HIS 1 CA  1 
ATOM   385  C C   . HIS A 1 57  ? 32.599 2.359   31.653 1.00 9.47  ? 57  HIS 1 C   1 
ATOM   386  O O   . HIS A 1 57  ? 32.882 1.221   32.027 1.00 9.76  ? 57  HIS 1 O   1 
ATOM   387  C CB  . HIS A 1 57  ? 33.581 3.696   33.541 1.00 10.19 ? 57  HIS 1 CB  1 
ATOM   388  C CG  . HIS A 1 57  ? 32.251 3.643   34.230 1.00 11.44 ? 57  HIS 1 CG  1 
ATOM   389  N ND1 . HIS A 1 57  ? 31.506 4.771   34.503 1.00 12.24 ? 57  HIS 1 ND1 1 
ATOM   390  C CD2 . HIS A 1 57  ? 31.534 2.596   34.705 1.00 13.18 ? 57  HIS 1 CD2 1 
ATOM   391  C CE1 . HIS A 1 57  ? 30.389 4.421   35.116 1.00 13.82 ? 57  HIS 1 CE1 1 
ATOM   392  N NE2 . HIS A 1 57  ? 30.382 3.106   35.251 1.00 13.89 ? 57  HIS 1 NE2 1 
ATOM   393  N N   . CYS A 1 58  ? 31.511 2.629   30.933 1.00 8.83  ? 58  CYS 1 N   1 
ATOM   394  C CA  . CYS A 1 58  ? 30.599 1.560   30.530 1.00 10.84 ? 58  CYS 1 CA  1 
ATOM   395  C C   . CYS A 1 58  ? 31.261 0.619   29.526 1.00 11.16 ? 58  CYS 1 C   1 
ATOM   396  O O   . CYS A 1 58  ? 30.782 -0.491  29.298 1.00 12.05 ? 58  CYS 1 O   1 
ATOM   397  C CB  . CYS A 1 58  ? 29.313 2.137   29.929 1.00 9.96  ? 58  CYS 1 CB  1 
ATOM   398  S SG  . CYS A 1 58  ? 28.141 2.721   31.194 1.00 9.47  ? 58  CYS 1 SG  1 
ATOM   399  N N   . GLY A 1 59  ? 32.349 1.081   28.916 1.00 11.03 ? 59  GLY 1 N   1 
ATOM   400  C CA  . GLY A 1 59  ? 33.088 0.265   27.963 1.00 11.39 ? 59  GLY 1 CA  1 
ATOM   401  C C   . GLY A 1 59  ? 32.312 -0.264  26.772 1.00 12.03 ? 59  GLY 1 C   1 
ATOM   402  O O   . GLY A 1 59  ? 32.476 -1.422  26.382 1.00 11.53 ? 59  GLY 1 O   1 
ATOM   403  N N   . VAL A 1 60  ? 31.475 0.586   26.188 1.00 11.46 ? 60  VAL 1 N   1 
ATOM   404  C CA  . VAL A 1 60  ? 30.672 0.210   25.029 1.00 11.43 ? 60  VAL 1 CA  1 
ATOM   405  C C   . VAL A 1 60  ? 31.533 -0.097  23.802 1.00 12.99 ? 60  VAL 1 C   1 
ATOM   406  O O   . VAL A 1 60  ? 32.577 0.529   23.590 1.00 12.24 ? 60  VAL 1 O   1 
ATOM   407  C CB  . VAL A 1 60  ? 29.683 1.342   24.653 1.00 10.63 ? 60  VAL 1 CB  1 
ATOM   408  C CG1 . VAL A 1 60  ? 28.891 0.961   23.408 1.00 12.87 ? 60  VAL 1 CG1 1 
ATOM   409  C CG2 . VAL A 1 60  ? 28.739 1.612   25.816 1.00 12.23 ? 60  VAL 1 CG2 1 
ATOM   410  N N   . THR A 1 61  ? 31.097 -1.074  23.010 1.00 12.54 ? 61  THR 1 N   1 
ATOM   411  C CA  . THR A 1 61  ? 31.793 -1.445  21.776 1.00 13.91 ? 61  THR 1 CA  1 
ATOM   412  C C   . THR A 1 61  ? 30.754 -1.390  20.665 1.00 14.07 ? 61  THR 1 C   1 
ATOM   413  O O   . THR A 1 61  ? 29.562 -1.278  20.942 1.00 12.75 ? 61  THR 1 O   1 
ATOM   414  C CB  . THR A 1 61  ? 32.367 -2.881  21.819 1.00 13.96 ? 61  THR 1 CB  1 
ATOM   415  O OG1 . THR A 1 61  ? 31.293 -3.831  21.823 1.00 13.64 ? 61  THR 1 OG1 1 
ATOM   416  C CG2 . THR A 1 61  ? 33.228 -3.079  23.053 1.00 15.56 ? 61  THR 1 CG2 1 
ATOM   417  N N   . THR A 1 62  ? 31.198 -1.472  19.414 1.00 14.26 ? 62  THR 1 N   1 
ATOM   418  C CA  . THR A 1 62  ? 30.269 -1.422  18.291 1.00 15.27 ? 62  THR 1 CA  1 
ATOM   419  C C   . THR A 1 62  ? 29.441 -2.699  18.141 1.00 15.21 ? 62  THR 1 C   1 
ATOM   420  O O   . THR A 1 62  ? 28.595 -2.787  17.255 1.00 16.00 ? 62  THR 1 O   1 
ATOM   421  C CB  . THR A 1 62  ? 31.007 -1.146  16.969 1.00 16.19 ? 62  THR 1 CB  1 
ATOM   422  O OG1 . THR A 1 62  ? 32.097 -2.065  16.830 1.00 17.02 ? 62  THR 1 OG1 1 
ATOM   423  C CG2 . THR A 1 62  ? 31.537 0.282   16.944 1.00 17.88 ? 62  THR 1 CG2 1 
ATOM   424  N N   . SER A 1 63  ? 29.688 -3.690  18.994 1.00 14.18 ? 63  SER 1 N   1 
ATOM   425  C CA  . SER A 1 63  ? 28.919 -4.931  18.937 1.00 16.01 ? 63  SER 1 CA  1 
ATOM   426  C C   . SER A 1 63  ? 27.747 -4.848  19.913 1.00 14.72 ? 63  SER 1 C   1 
ATOM   427  O O   . SER A 1 63  ? 26.867 -5.709  19.917 1.00 15.33 ? 63  SER 1 O   1 
ATOM   428  C CB  . SER A 1 63  ? 29.799 -6.140  19.280 1.00 19.63 ? 63  SER 1 CB  1 
ATOM   429  O OG  . SER A 1 63  ? 30.052 -6.215  20.671 1.00 25.25 ? 63  SER 1 OG  1 
ATOM   430  N N   . ASP A 1 64  ? 27.741 -3.808  20.746 1.00 12.92 ? 64  ASP 1 N   1 
ATOM   431  C CA  . ASP A 1 64  ? 26.660 -3.607  21.712 1.00 12.52 ? 64  ASP 1 CA  1 
ATOM   432  C C   . ASP A 1 64  ? 25.488 -2.933  21.004 1.00 12.29 ? 64  ASP 1 C   1 
ATOM   433  O O   . ASP A 1 64  ? 25.653 -2.382  19.918 1.00 14.05 ? 64  ASP 1 O   1 
ATOM   434  C CB  . ASP A 1 64  ? 27.144 -2.741  22.877 1.00 11.57 ? 64  ASP 1 CB  1 
ATOM   435  C CG  . ASP A 1 64  ? 28.189 -3.442  23.728 1.00 12.02 ? 64  ASP 1 CG  1 
ATOM   436  O OD1 . ASP A 1 64  ? 28.057 -4.665  23.963 1.00 12.29 ? 64  ASP 1 OD1 1 
ATOM   437  O OD2 . ASP A 1 64  ? 29.140 -2.767  24.172 1.00 13.40 ? 64  ASP 1 OD2 1 
ATOM   438  N N   . VAL A 1 65  ? 24.312 -2.966  21.623 1.00 11.52 ? 65  VAL 1 N   1 
ATOM   439  C CA  . VAL A 1 65  ? 23.120 -2.386  21.012 1.00 12.71 ? 65  VAL 1 CA  1 
ATOM   440  C C   . VAL A 1 65  ? 22.428 -1.347  21.886 1.00 11.19 ? 65  VAL 1 C   1 
ATOM   441  O O   . VAL A 1 65  ? 22.369 -1.489  23.106 1.00 11.44 ? 65  VAL 1 O   1 
ATOM   442  C CB  . VAL A 1 65  ? 22.097 -3.500  20.673 1.00 14.29 ? 65  VAL 1 CB  1 
ATOM   443  C CG1 . VAL A 1 65  ? 20.857 -2.907  20.019 1.00 18.23 ? 65  VAL 1 CG1 1 
ATOM   444  C CG2 . VAL A 1 65  ? 22.742 -4.526  19.747 1.00 19.55 ? 65  VAL 1 CG2 1 
ATOM   445  N N   . VAL A 1 66  ? 21.910 -0.301  21.248 1.00 11.31 ? 66  VAL 1 N   1 
ATOM   446  C CA  . VAL A 1 66  ? 21.187 0.757   21.953 1.00 11.00 ? 66  VAL 1 CA  1 
ATOM   447  C C   . VAL A 1 66  ? 19.699 0.466   21.802 1.00 11.02 ? 66  VAL 1 C   1 
ATOM   448  O O   . VAL A 1 66  ? 19.194 0.360   20.684 1.00 12.12 ? 66  VAL 1 O   1 
ATOM   449  C CB  . VAL A 1 66  ? 21.473 2.153   21.353 1.00 12.54 ? 66  VAL 1 CB  1 
ATOM   450  C CG1 . VAL A 1 66  ? 20.497 3.181   21.930 1.00 13.77 ? 66  VAL 1 CG1 1 
ATOM   451  C CG2 . VAL A 1 66  ? 22.904 2.572   21.661 1.00 11.74 ? 66  VAL 1 CG2 1 
ATOM   452  N N   . VAL A 1 67  ? 19.001 0.330   22.924 1.00 11.10 ? 67  VAL 1 N   1 
ATOM   453  C CA  . VAL A 1 67  ? 17.573 0.049   22.893 1.00 10.70 ? 67  VAL 1 CA  1 
ATOM   454  C C   . VAL A 1 67  ? 16.791 1.267   23.372 1.00 11.08 ? 67  VAL 1 C   1 
ATOM   455  O O   . VAL A 1 67  ? 16.955 1.721   24.507 1.00 11.43 ? 67  VAL 1 O   1 
ATOM   456  C CB  . VAL A 1 67  ? 17.232 -1.168  23.776 1.00 12.38 ? 67  VAL 1 CB  1 
ATOM   457  C CG1 . VAL A 1 67  ? 15.742 -1.495  23.674 1.00 13.69 ? 67  VAL 1 CG1 1 
ATOM   458  C CG2 . VAL A 1 67  ? 18.067 -2.363  23.340 1.00 12.81 ? 67  VAL 1 CG2 1 
ATOM   459  N N   . ALA A 1 68  ? 15.951 1.800   22.492 1.00 9.63  ? 68  ALA 1 N   1 
ATOM   460  C CA  . ALA A 1 68  ? 15.145 2.973   22.807 1.00 11.26 ? 68  ALA 1 CA  1 
ATOM   461  C C   . ALA A 1 68  ? 13.659 2.634   22.862 1.00 11.65 ? 68  ALA 1 C   1 
ATOM   462  O O   . ALA A 1 68  ? 13.204 1.699   22.203 1.00 11.79 ? 68  ALA 1 O   1 
ATOM   463  C CB  . ALA A 1 68  ? 15.387 4.058   21.769 1.00 11.88 ? 68  ALA 1 CB  1 
ATOM   464  N N   . GLY A 1 69  ? 12.912 3.401   23.653 1.00 12.84 ? 69  GLY 1 N   1 
ATOM   465  C CA  . GLY A 1 69  ? 11.479 3.187   23.773 1.00 13.92 ? 69  GLY 1 CA  1 
ATOM   466  C C   . GLY A 1 69  ? 11.069 1.997   24.619 1.00 15.07 ? 69  GLY 1 C   1 
ATOM   467  O O   . GLY A 1 69  ? 9.925  1.550   24.562 1.00 15.74 ? 69  GLY 1 O   1 
ATOM   468  N N   . GLU A 1 70  ? 11.992 1.481   25.419 1.00 15.67 ? 70  GLU 1 N   1 
ATOM   469  C CA  . GLU A 1 70  ? 11.693 0.329   26.258 1.00 15.65 ? 70  GLU 1 CA  1 
ATOM   470  C C   . GLU A 1 70  ? 11.334 0.743   27.683 1.00 16.21 ? 70  GLU 1 C   1 
ATOM   471  O O   . GLU A 1 70  ? 11.839 1.744   28.196 1.00 17.01 ? 70  GLU 1 O   1 
ATOM   472  C CB  . GLU A 1 70  ? 12.897 -0.620  26.259 1.00 16.57 ? 70  GLU 1 CB  1 
ATOM   473  C CG  . GLU A 1 70  ? 12.738 -1.863  27.113 1.00 19.47 ? 70  GLU 1 CG  1 
ATOM   474  C CD  . GLU A 1 70  ? 13.776 -2.918  26.783 1.00 19.73 ? 70  GLU 1 CD  1 
ATOM   475  O OE1 . GLU A 1 70  ? 14.966 -2.708  27.100 1.00 21.85 ? 70  GLU 1 OE1 1 
ATOM   476  O OE2 . GLU A 1 70  ? 13.401 -3.954  26.197 1.00 20.34 ? 70  GLU 1 OE2 1 
ATOM   477  N N   . PHE A 1 71  ? 10.434 -0.015  28.305 1.00 15.14 ? 71  PHE 1 N   1 
ATOM   478  C CA  . PHE A 1 71  ? 10.020 0.248   29.682 1.00 14.47 ? 71  PHE 1 CA  1 
ATOM   479  C C   . PHE A 1 71  ? 10.198 -1.016  30.508 1.00 14.62 ? 71  PHE 1 C   1 
ATOM   480  O O   . PHE A 1 71  ? 10.868 -1.011  31.534 1.00 13.03 ? 71  PHE 1 O   1 
ATOM   481  C CB  . PHE A 1 71  ? 8.554  0.677   29.751 1.00 14.70 ? 71  PHE 1 CB  1 
ATOM   482  C CG  . PHE A 1 71  ? 7.980  0.641   31.144 1.00 16.67 ? 71  PHE 1 CG  1 
ATOM   483  C CD1 . PHE A 1 71  ? 8.435  1.519   32.126 1.00 17.23 ? 71  PHE 1 CD1 1 
ATOM   484  C CD2 . PHE A 1 71  ? 6.999  -0.288  31.481 1.00 16.39 ? 71  PHE 1 CD2 1 
ATOM   485  C CE1 . PHE A 1 71  ? 7.923  1.473   33.426 1.00 16.62 ? 71  PHE 1 CE1 1 
ATOM   486  C CE2 . PHE A 1 71  ? 6.480  -0.345  32.778 1.00 18.62 ? 71  PHE 1 CE2 1 
ATOM   487  C CZ  . PHE A 1 71  ? 6.945  0.540   33.752 1.00 17.84 ? 71  PHE 1 CZ  1 
ATOM   488  N N   . ASP A 1 72  ? 9.571  -2.095  30.054 1.00 14.97 ? 72  ASP 1 N   1 
ATOM   489  C CA  . ASP A 1 72  ? 9.649  -3.377  30.738 1.00 16.38 ? 72  ASP 1 CA  1 
ATOM   490  C C   . ASP A 1 72  ? 10.510 -4.309  29.892 1.00 16.96 ? 72  ASP 1 C   1 
ATOM   491  O O   . ASP A 1 72  ? 10.081 -4.787  28.840 1.00 16.33 ? 72  ASP 1 O   1 
ATOM   492  C CB  . ASP A 1 72  ? 8.235  -3.942  30.919 1.00 18.97 ? 72  ASP 1 CB  1 
ATOM   493  C CG  . ASP A 1 72  ? 8.214  -5.245  31.685 1.00 20.06 ? 72  ASP 1 CG  1 
ATOM   494  O OD1 . ASP A 1 72  ? 9.284  -5.858  31.879 1.00 21.26 ? 72  ASP 1 OD1 1 
ATOM   495  O OD2 . ASP A 1 72  ? 7.109  -5.660  32.089 1.00 23.81 ? 72  ASP 1 OD2 1 
ATOM   496  N N   . GLN A 1 73  ? 11.733 -4.552  30.353 1.00 16.46 ? 73  GLN 1 N   1 
ATOM   497  C CA  . GLN A 1 73  ? 12.665 -5.408  29.630 1.00 19.06 ? 73  GLN 1 CA  1 
ATOM   498  C C   . GLN A 1 73  ? 12.242 -6.873  29.610 1.00 21.06 ? 73  GLN 1 C   1 
ATOM   499  O O   . GLN A 1 73  ? 12.847 -7.691  28.916 1.00 21.72 ? 73  GLN 1 O   1 
ATOM   500  C CB  . GLN A 1 73  ? 14.071 -5.255  30.222 1.00 19.53 ? 73  GLN 1 CB  1 
ATOM   501  C CG  . GLN A 1 73  ? 14.626 -3.848  30.028 1.00 20.46 ? 73  GLN 1 CG  1 
ATOM   502  C CD  . GLN A 1 73  ? 16.057 -3.685  30.500 1.00 21.26 ? 73  GLN 1 CD  1 
ATOM   503  O OE1 . GLN A 1 73  ? 16.704 -2.683  30.199 1.00 22.92 ? 73  GLN 1 OE1 1 
ATOM   504  N NE2 . GLN A 1 73  ? 16.555 -4.660  31.245 1.00 21.66 ? 73  GLN 1 NE2 1 
ATOM   505  N N   . GLY A 1 74  ? 11.192 -7.197  30.358 1.00 21.41 ? 74  GLY 1 N   1 
ATOM   506  C CA  . GLY A 1 74  ? 10.706 -8.565  30.394 1.00 21.90 ? 74  GLY 1 CA  1 
ATOM   507  C C   . GLY A 1 74  ? 9.519  -8.766  29.468 1.00 22.72 ? 74  GLY 1 C   1 
ATOM   508  O O   . GLY A 1 74  ? 8.996  -9.876  29.337 1.00 23.14 ? 74  GLY 1 O   1 
ATOM   509  N N   . SER A 1 75  ? 9.096  -7.687  28.818 1.00 20.97 ? 75  SER 1 N   1 
ATOM   510  C CA  . SER A 1 75  ? 7.963  -7.730  27.902 1.00 21.73 ? 75  SER 1 CA  1 
ATOM   511  C C   . SER A 1 75  ? 8.408  -7.883  26.455 1.00 21.98 ? 75  SER 1 C   1 
ATOM   512  O O   . SER A 1 75  ? 9.434  -7.341  26.051 1.00 21.49 ? 75  SER 1 O   1 
ATOM   513  C CB  . SER A 1 75  ? 7.129  -6.456  28.040 1.00 21.61 ? 75  SER 1 CB  1 
ATOM   514  O OG  . SER A 1 75  ? 6.140  -6.388  27.030 1.00 23.68 ? 75  SER 1 OG  1 
ATOM   515  N N   . SER A 1 76  ? 7.625  -8.619  25.674 1.00 22.34 ? 76  SER 1 N   1 
ATOM   516  C CA  . SER A 1 76  ? 7.942  -8.832  24.267 1.00 23.07 ? 76  SER 1 CA  1 
ATOM   517  C C   . SER A 1 76  ? 6.934  -8.119  23.374 1.00 21.88 ? 76  SER 1 C   1 
ATOM   518  O O   . SER A 1 76  ? 7.015  -8.204  22.150 1.00 22.58 ? 76  SER 1 O   1 
ATOM   519  C CB  . SER A 1 76  ? 7.924  -10.328 23.944 1.00 24.06 ? 76  SER 1 CB  1 
ATOM   520  O OG  . SER A 1 76  ? 6.614  -10.853 24.087 1.00 27.74 ? 76  SER 1 OG  1 
ATOM   521  N N   . SER A 1 77  ? 5.991  -7.412  23.986 1.00 20.69 ? 77  SER 1 N   1 
ATOM   522  C CA  . SER A 1 77  ? 4.963  -6.716  23.225 1.00 21.16 ? 77  SER 1 CA  1 
ATOM   523  C C   . SER A 1 77  ? 5.195  -5.217  23.068 1.00 21.64 ? 77  SER 1 C   1 
ATOM   524  O O   . SER A 1 77  ? 4.355  -4.510  22.511 1.00 22.72 ? 77  SER 1 O   1 
ATOM   525  C CB  . SER A 1 77  ? 3.588  -6.962  23.857 1.00 21.90 ? 77  SER 1 CB  1 
ATOM   526  O OG  . SER A 1 77  ? 3.561  -6.541  25.208 1.00 24.72 ? 77  SER 1 OG  1 
ATOM   527  N N   . GLU A 1 78  ? 6.327  -4.724  23.557 1.00 20.28 ? 78  GLU 1 N   1 
ATOM   528  C CA  . GLU A 1 78  ? 6.627  -3.305  23.426 1.00 19.87 ? 78  GLU 1 CA  1 
ATOM   529  C C   . GLU A 1 78  ? 7.277  -3.031  22.078 1.00 20.52 ? 78  GLU 1 C   1 
ATOM   530  O O   . GLU A 1 78  ? 8.113  -3.806  21.615 1.00 19.57 ? 78  GLU 1 O   1 
ATOM   531  C CB  . GLU A 1 78  ? 7.567  -2.841  24.543 1.00 19.46 ? 78  GLU 1 CB  1 
ATOM   532  C CG  . GLU A 1 78  ? 6.917  -2.740  25.909 1.00 18.91 ? 78  GLU 1 CG  1 
ATOM   533  C CD  . GLU A 1 78  ? 7.887  -2.286  26.989 1.00 18.15 ? 78  GLU 1 CD  1 
ATOM   534  O OE1 . GLU A 1 78  ? 9.092  -2.148  26.696 1.00 19.00 ? 78  GLU 1 OE1 1 
ATOM   535  O OE2 . GLU A 1 78  ? 7.444  -2.073  28.136 1.00 17.50 ? 78  GLU 1 OE2 1 
ATOM   536  N N   . LYS A 1 79  ? 6.881  -1.934  21.442 1.00 22.17 ? 79  LYS 1 N   1 
ATOM   537  C CA  . LYS A 1 79  ? 7.461  -1.562  20.160 1.00 23.66 ? 79  LYS 1 CA  1 
ATOM   538  C C   . LYS A 1 79  ? 8.735  -0.786  20.448 1.00 23.06 ? 79  LYS 1 C   1 
ATOM   539  O O   . LYS A 1 79  ? 8.728  0.441   20.525 1.00 24.16 ? 79  LYS 1 O   1 
ATOM   540  C CB  . LYS A 1 79  ? 6.498  -0.690  19.356 1.00 27.51 ? 79  LYS 1 CB  1 
ATOM   541  C CG  . LYS A 1 79  ? 5.327  -1.447  18.747 1.00 32.73 ? 79  LYS 1 CG  1 
ATOM   542  C CD  . LYS A 1 79  ? 4.583  -0.573  17.749 1.00 36.47 ? 79  LYS 1 CD  1 
ATOM   543  C CE  . LYS A 1 79  ? 5.512  -0.104  16.635 1.00 39.55 ? 79  LYS 1 CE  1 
ATOM   544  N NZ  . LYS A 1 79  ? 4.848  0.844   15.695 1.00 43.52 ? 79  LYS 1 NZ  1 
ATOM   545  N N   . ILE A 1 80  ? 9.830  -1.514  20.619 1.00 21.50 ? 80  ILE 1 N   1 
ATOM   546  C CA  . ILE A 1 80  ? 11.111 -0.894  20.915 1.00 20.70 ? 80  ILE 1 CA  1 
ATOM   547  C C   . ILE A 1 80  ? 11.954 -0.739  19.659 1.00 19.07 ? 80  ILE 1 C   1 
ATOM   548  O O   . ILE A 1 80  ? 11.643 -1.307  18.611 1.00 19.79 ? 80  ILE 1 O   1 
ATOM   549  C CB  . ILE A 1 80  ? 11.900 -1.736  21.933 1.00 20.46 ? 80  ILE 1 CB  1 
ATOM   550  C CG1 . ILE A 1 80  ? 12.176 -3.126  21.353 1.00 21.37 ? 80  ILE 1 CG1 1 
ATOM   551  C CG2 . ILE A 1 80  ? 11.110 -1.847  23.229 1.00 20.70 ? 80  ILE 1 CG2 1 
ATOM   552  C CD1 . ILE A 1 80  ? 13.052 -3.999  22.227 1.00 23.64 ? 80  ILE 1 CD1 1 
ATOM   553  N N   . GLN A 1 81  ? 13.022 0.042   19.770 1.00 16.96 ? 81  GLN 1 N   1 
ATOM   554  C CA  . GLN A 1 81  ? 13.923 0.253   18.649 1.00 16.36 ? 81  GLN 1 CA  1 
ATOM   555  C C   . GLN A 1 81  ? 15.316 -0.215  19.050 1.00 16.21 ? 81  GLN 1 C   1 
ATOM   556  O O   . GLN A 1 81  ? 15.882 0.286   20.019 1.00 15.93 ? 81  GLN 1 O   1 
ATOM   557  C CB  . GLN A 1 81  ? 13.977 1.735   18.271 1.00 15.62 ? 81  GLN 1 CB  1 
ATOM   558  C CG  . GLN A 1 81  ? 12.669 2.315   17.763 1.00 17.48 ? 81  GLN 1 CG  1 
ATOM   559  C CD  . GLN A 1 81  ? 12.803 3.780   17.396 1.00 18.95 ? 81  GLN 1 CD  1 
ATOM   560  O OE1 . GLN A 1 81  ? 13.733 4.169   16.687 1.00 18.87 ? 81  GLN 1 OE1 1 
ATOM   561  N NE2 . GLN A 1 81  ? 11.873 4.600   17.871 1.00 18.90 ? 81  GLN 1 NE2 1 
ATOM   562  N N   . LYS A 1 82  ? 15.848 -1.192  18.321 1.00 16.54 ? 82  LYS 1 N   1 
ATOM   563  C CA  . LYS A 1 82  ? 17.191 -1.702  18.586 1.00 17.74 ? 82  LYS 1 CA  1 
ATOM   564  C C   . LYS A 1 82  ? 18.101 -1.054  17.553 1.00 17.75 ? 82  LYS 1 C   1 
ATOM   565  O O   . LYS A 1 82  ? 18.061 -1.388  16.367 1.00 18.30 ? 82  LYS 1 O   1 
ATOM   566  C CB  . LYS A 1 82  ? 17.227 -3.226  18.463 1.00 20.25 ? 82  LYS 1 CB  1 
ATOM   567  C CG  . LYS A 1 82  ? 16.470 -3.933  19.576 1.00 24.34 ? 82  LYS 1 CG  1 
ATOM   568  C CD  . LYS A 1 82  ? 16.706 -5.432  19.557 1.00 29.74 ? 82  LYS 1 CD  1 
ATOM   569  C CE  . LYS A 1 82  ? 16.143 -6.089  20.810 1.00 32.06 ? 82  LYS 1 CE  1 
ATOM   570  N NZ  . LYS A 1 82  ? 16.516 -7.531  20.904 1.00 36.28 ? 82  LYS 1 NZ  1 
ATOM   571  N N   . LEU A 1 83  ? 18.919 -0.118  18.017 1.00 16.41 ? 83  LEU 1 N   1 
ATOM   572  C CA  . LEU A 1 83  ? 19.805 0.636   17.144 1.00 15.55 ? 83  LEU 1 CA  1 
ATOM   573  C C   . LEU A 1 83  ? 21.270 0.212   17.224 1.00 15.45 ? 83  LEU 1 C   1 
ATOM   574  O O   . LEU A 1 83  ? 21.831 0.076   18.310 1.00 13.43 ? 83  LEU 1 O   1 
ATOM   575  C CB  . LEU A 1 83  ? 19.675 2.119   17.491 1.00 16.98 ? 83  LEU 1 CB  1 
ATOM   576  C CG  . LEU A 1 83  ? 18.221 2.597   17.562 1.00 18.55 ? 83  LEU 1 CG  1 
ATOM   577  C CD1 . LEU A 1 83  ? 18.142 3.928   18.286 1.00 20.08 ? 83  LEU 1 CD1 1 
ATOM   578  C CD2 . LEU A 1 83  ? 17.649 2.701   16.154 1.00 20.07 ? 83  LEU 1 CD2 1 
ATOM   579  N N   . LYS A 1 84  ? 21.885 0.018   16.062 1.00 13.92 ? 84  LYS 1 N   1 
ATOM   580  C CA  . LYS A 1 84  ? 23.286 -0.373  15.995 1.00 16.23 ? 84  LYS 1 CA  1 
ATOM   581  C C   . LYS A 1 84  ? 24.179 0.844   16.214 1.00 14.78 ? 84  LYS 1 C   1 
ATOM   582  O O   . LYS A 1 84  ? 23.776 1.979   15.947 1.00 15.69 ? 84  LYS 1 O   1 
ATOM   583  C CB  . LYS A 1 84  ? 23.589 -1.011  14.639 1.00 18.68 ? 84  LYS 1 CB  1 
ATOM   584  C CG  . LYS A 1 84  ? 22.778 -2.270  14.373 1.00 24.41 ? 84  LYS 1 CG  1 
ATOM   585  C CD  . LYS A 1 84  ? 23.119 -2.885  13.026 1.00 28.85 ? 84  LYS 1 CD  1 
ATOM   586  C CE  . LYS A 1 84  ? 22.247 -4.102  12.752 1.00 30.58 ? 84  LYS 1 CE  1 
ATOM   587  N NZ  . LYS A 1 84  ? 22.522 -4.689  11.412 1.00 34.34 ? 84  LYS 1 NZ  1 
ATOM   588  N N   . ILE A 1 85  ? 25.391 0.603   16.702 1.00 14.72 ? 85  ILE 1 N   1 
ATOM   589  C CA  . ILE A 1 85  ? 26.342 1.677   16.975 1.00 14.75 ? 85  ILE 1 CA  1 
ATOM   590  C C   . ILE A 1 85  ? 27.413 1.760   15.889 1.00 15.09 ? 85  ILE 1 C   1 
ATOM   591  O O   . ILE A 1 85  ? 28.097 0.779   15.610 1.00 15.63 ? 85  ILE 1 O   1 
ATOM   592  C CB  . ILE A 1 85  ? 27.024 1.453   18.344 1.00 14.39 ? 85  ILE 1 CB  1 
ATOM   593  C CG1 . ILE A 1 85  ? 25.957 1.405   19.445 1.00 15.16 ? 85  ILE 1 CG1 1 
ATOM   594  C CG2 . ILE A 1 85  ? 28.034 2.563   18.619 1.00 16.21 ? 85  ILE 1 CG2 1 
ATOM   595  C CD1 . ILE A 1 85  ? 26.474 0.945   20.794 1.00 17.30 ? 85  ILE 1 CD1 1 
ATOM   596  N N   . ALA A 1 86  ? 27.558 2.937   15.288 1.00 14.77 ? 86  ALA 1 N   1 
ATOM   597  C CA  . ALA A 1 86  ? 28.541 3.145   14.226 1.00 16.13 ? 86  ALA 1 CA  1 
ATOM   598  C C   . ALA A 1 86  ? 29.940 3.432   14.765 1.00 17.23 ? 86  ALA 1 C   1 
ATOM   599  O O   . ALA A 1 86  ? 30.924 2.862   14.291 1.00 17.66 ? 86  ALA 1 O   1 
ATOM   600  C CB  . ALA A 1 86  ? 28.094 4.287   13.315 1.00 15.65 ? 86  ALA 1 CB  1 
ATOM   601  N N   . LYS A 1 87  ? 30.033 4.322   15.747 1.00 16.89 ? 87  LYS 1 N   1 
ATOM   602  C CA  . LYS A 1 87  ? 31.327 4.660   16.319 1.00 18.12 ? 87  LYS 1 CA  1 
ATOM   603  C C   . LYS A 1 87  ? 31.215 5.061   17.784 1.00 17.09 ? 87  LYS 1 C   1 
ATOM   604  O O   . LYS A 1 87  ? 30.199 5.606   18.218 1.00 15.78 ? 87  LYS 1 O   1 
ATOM   605  C CB  . LYS A 1 87  ? 31.977 5.795   15.520 1.00 20.93 ? 87  LYS 1 CB  1 
ATOM   606  C CG  . LYS A 1 87  ? 33.403 6.113   15.953 1.00 25.90 ? 87  LYS 1 CG  1 
ATOM   607  C CD  . LYS A 1 87  ? 34.066 7.122   15.023 1.00 29.74 ? 87  LYS 1 CD  1 
ATOM   608  C CE  . LYS A 1 87  ? 35.485 7.439   15.480 1.00 31.76 ? 87  LYS 1 CE  1 
ATOM   609  N NZ  . LYS A 1 87  ? 36.146 8.448   14.602 1.00 34.16 ? 87  LYS 1 NZ  1 
ATOM   610  N N   . VAL A 1 88  ? 32.268 4.774   18.540 1.00 15.78 ? 88  VAL 1 N   1 
ATOM   611  C CA  . VAL A 1 88  ? 32.319 5.099   19.958 1.00 15.53 ? 88  VAL 1 CA  1 
ATOM   612  C C   . VAL A 1 88  ? 33.341 6.214   20.162 1.00 15.99 ? 88  VAL 1 C   1 
ATOM   613  O O   . VAL A 1 88  ? 34.511 6.063   19.808 1.00 15.07 ? 88  VAL 1 O   1 
ATOM   614  C CB  . VAL A 1 88  ? 32.740 3.868   20.794 1.00 16.18 ? 88  VAL 1 CB  1 
ATOM   615  C CG1 . VAL A 1 88  ? 32.824 4.239   22.264 1.00 13.96 ? 88  VAL 1 CG1 1 
ATOM   616  C CG2 . VAL A 1 88  ? 31.738 2.731   20.590 1.00 15.30 ? 88  VAL 1 CG2 1 
ATOM   617  N N   . PHE A 1 89  ? 32.888 7.337   20.714 1.00 12.85 ? 89  PHE 1 N   1 
ATOM   618  C CA  . PHE A 1 89  ? 33.764 8.474   20.972 1.00 12.72 ? 89  PHE 1 CA  1 
ATOM   619  C C   . PHE A 1 89  ? 33.978 8.632   22.465 1.00 12.83 ? 89  PHE 1 C   1 
ATOM   620  O O   . PHE A 1 89  ? 33.144 9.215   23.158 1.00 11.91 ? 89  PHE 1 O   1 
ATOM   621  C CB  . PHE A 1 89  ? 33.158 9.777   20.436 1.00 13.89 ? 89  PHE 1 CB  1 
ATOM   622  C CG  . PHE A 1 89  ? 33.068 9.843   18.943 1.00 15.16 ? 89  PHE 1 CG  1 
ATOM   623  C CD1 . PHE A 1 89  ? 32.032 9.212   18.264 1.00 16.57 ? 89  PHE 1 CD1 1 
ATOM   624  C CD2 . PHE A 1 89  ? 34.019 10.551  18.213 1.00 15.78 ? 89  PHE 1 CD2 1 
ATOM   625  C CE1 . PHE A 1 89  ? 31.943 9.288   16.875 1.00 16.70 ? 89  PHE 1 CE1 1 
ATOM   626  C CE2 . PHE A 1 89  ? 33.940 10.633  16.824 1.00 17.02 ? 89  PHE 1 CE2 1 
ATOM   627  C CZ  . PHE A 1 89  ? 32.899 10.000  16.155 1.00 16.62 ? 89  PHE 1 CZ  1 
ATOM   628  N N   . LYS A 1 90  ? 35.092 8.107   22.960 1.00 13.16 ? 90  LYS 1 N   1 
ATOM   629  C CA  . LYS A 1 90  ? 35.418 8.210   24.373 1.00 14.22 ? 90  LYS 1 CA  1 
ATOM   630  C C   . LYS A 1 90  ? 36.183 9.520   24.549 1.00 15.32 ? 90  LYS 1 C   1 
ATOM   631  O O   . LYS A 1 90  ? 37.179 9.755   23.865 1.00 15.84 ? 90  LYS 1 O   1 
ATOM   632  C CB  . LYS A 1 90  ? 36.282 7.013   24.789 1.00 15.93 ? 90  LYS 1 CB  1 
ATOM   633  C CG  . LYS A 1 90  ? 36.707 7.000   26.248 1.00 17.29 ? 90  LYS 1 CG  1 
ATOM   634  C CD  . LYS A 1 90  ? 37.373 5.676   26.606 1.00 20.03 ? 90  LYS 1 CD  1 
ATOM   635  C CE  . LYS A 1 90  ? 38.600 5.409   25.737 1.00 21.08 ? 90  LYS 1 CE  1 
ATOM   636  N NZ  . LYS A 1 90  ? 39.221 4.091   26.050 1.00 22.56 ? 90  LYS 1 NZ  1 
ATOM   637  N N   . ASN A 1 91  ? 35.708 10.379  25.446 1.00 13.95 ? 91  ASN 1 N   1 
ATOM   638  C CA  . ASN A 1 91  ? 36.359 11.664  25.690 1.00 14.69 ? 91  ASN 1 CA  1 
ATOM   639  C C   . ASN A 1 91  ? 37.835 11.414  25.985 1.00 15.84 ? 91  ASN 1 C   1 
ATOM   640  O O   . ASN A 1 91  ? 38.168 10.648  26.889 1.00 14.80 ? 91  ASN 1 O   1 
ATOM   641  C CB  . ASN A 1 91  ? 35.706 12.370  26.882 1.00 15.52 ? 91  ASN 1 CB  1 
ATOM   642  C CG  . ASN A 1 91  ? 36.171 13.806  27.040 1.00 18.36 ? 91  ASN 1 CG  1 
ATOM   643  O OD1 . ASN A 1 91  ? 37.364 14.102  26.953 1.00 20.53 ? 91  ASN 1 OD1 1 
ATOM   644  N ND2 . ASN A 1 91  ? 35.227 14.707  27.289 1.00 18.44 ? 91  ASN 1 ND2 1 
ATOM   645  N N   . SER A 1 92  ? 38.719 12.057  25.225 1.00 16.76 ? 92  SER 1 N   1 
ATOM   646  C CA  . SER A 1 92  ? 40.153 11.869  25.422 1.00 17.65 ? 92  SER 1 CA  1 
ATOM   647  C C   . SER A 1 92  ? 40.626 12.300  26.810 1.00 17.18 ? 92  SER 1 C   1 
ATOM   648  O O   . SER A 1 92  ? 41.686 11.866  27.267 1.00 18.79 ? 92  SER 1 O   1 
ATOM   649  C CB  . SER A 1 92  ? 40.948 12.630  24.353 1.00 19.12 ? 92  SER 1 CB  1 
ATOM   650  O OG  . SER A 1 92  ? 40.779 14.031  24.493 1.00 23.66 ? 92  SER 1 OG  1 
ATOM   651  N N   . LYS A 1 93  ? 39.851 13.151  27.479 1.00 16.44 ? 93  LYS 1 N   1 
ATOM   652  C CA  . LYS A 1 93  ? 40.214 13.616  28.819 1.00 15.92 ? 93  LYS 1 CA  1 
ATOM   653  C C   . LYS A 1 93  ? 39.813 12.620  29.904 1.00 14.85 ? 93  LYS 1 C   1 
ATOM   654  O O   . LYS A 1 93  ? 40.150 12.796  31.076 1.00 12.69 ? 93  LYS 1 O   1 
ATOM   655  C CB  . LYS A 1 93  ? 39.569 14.974  29.123 1.00 19.51 ? 93  LYS 1 CB  1 
ATOM   656  C CG  . LYS A 1 93  ? 40.230 16.160  28.433 1.00 26.32 ? 93  LYS 1 CG  1 
ATOM   657  C CD  . LYS A 1 93  ? 39.771 17.470  29.059 1.00 30.88 ? 93  LYS 1 CD  1 
ATOM   658  C CE  . LYS A 1 93  ? 40.553 18.669  28.524 1.00 34.49 ? 93  LYS 1 CE  1 
ATOM   659  N NZ  . LYS A 1 93  ? 40.308 18.927  27.074 1.00 36.61 ? 93  LYS 1 NZ  1 
ATOM   660  N N   . TYR A 1 94  ? 39.090 11.576  29.517 1.00 13.22 ? 94  TYR 1 N   1 
ATOM   661  C CA  . TYR A 1 94  ? 38.662 10.564  30.477 1.00 12.14 ? 94  TYR 1 CA  1 
ATOM   662  C C   . TYR A 1 94  ? 39.865 9.930   31.164 1.00 13.00 ? 94  TYR 1 C   1 
ATOM   663  O O   . TYR A 1 94  ? 40.802 9.478   30.508 1.00 11.61 ? 94  TYR 1 O   1 
ATOM   664  C CB  . TYR A 1 94  ? 37.841 9.476   29.777 1.00 11.31 ? 94  TYR 1 CB  1 
ATOM   665  C CG  . TYR A 1 94  ? 37.514 8.292   30.662 1.00 11.90 ? 94  TYR 1 CG  1 
ATOM   666  C CD1 . TYR A 1 94  ? 36.801 8.461   31.848 1.00 10.83 ? 94  TYR 1 CD1 1 
ATOM   667  C CD2 . TYR A 1 94  ? 37.917 7.001   30.313 1.00 13.34 ? 94  TYR 1 CD2 1 
ATOM   668  C CE1 . TYR A 1 94  ? 36.493 7.378   32.667 1.00 11.50 ? 94  TYR 1 CE1 1 
ATOM   669  C CE2 . TYR A 1 94  ? 37.613 5.906   31.126 1.00 14.00 ? 94  TYR 1 CE2 1 
ATOM   670  C CZ  . TYR A 1 94  ? 36.899 6.106   32.301 1.00 14.58 ? 94  TYR 1 CZ  1 
ATOM   671  O OH  . TYR A 1 94  ? 36.572 5.036   33.104 1.00 16.82 ? 94  TYR 1 OH  1 
ATOM   672  N N   . ASN A 1 95  ? 39.824 9.905   32.491 1.00 13.01 ? 95  ASN 1 N   1 
ATOM   673  C CA  . ASN A 1 95  ? 40.890 9.328   33.300 1.00 14.59 ? 95  ASN 1 CA  1 
ATOM   674  C C   . ASN A 1 95  ? 40.296 8.130   34.033 1.00 14.44 ? 95  ASN 1 C   1 
ATOM   675  O O   . ASN A 1 95  ? 39.565 8.300   35.005 1.00 14.80 ? 95  ASN 1 O   1 
ATOM   676  C CB  . ASN A 1 95  ? 41.384 10.357  34.316 1.00 14.67 ? 95  ASN 1 CB  1 
ATOM   677  C CG  . ASN A 1 95  ? 42.579 9.868   35.110 1.00 16.57 ? 95  ASN 1 CG  1 
ATOM   678  O OD1 . ASN A 1 95  ? 42.640 8.706   35.512 1.00 16.47 ? 95  ASN 1 OD1 1 
ATOM   679  N ND2 . ASN A 1 95  ? 43.531 10.762  35.353 1.00 16.97 ? 95  ASN 1 ND2 1 
ATOM   680  N N   . SER A 1 96  ? 40.609 6.925   33.570 1.00 14.55 ? 96  SER 1 N   1 
ATOM   681  C CA  . SER A 1 96  ? 40.071 5.711   34.183 1.00 17.33 ? 96  SER 1 CA  1 
ATOM   682  C C   . SER A 1 96  ? 40.545 5.452   35.614 1.00 18.68 ? 96  SER 1 C   1 
ATOM   683  O O   . SER A 1 96  ? 39.914 4.694   36.351 1.00 18.44 ? 96  SER 1 O   1 
ATOM   684  C CB  . SER A 1 96  ? 40.399 4.500   33.307 1.00 18.28 ? 96  SER 1 CB  1 
ATOM   685  O OG  . SER A 1 96  ? 41.791 4.401   33.098 1.00 22.57 ? 96  SER 1 OG  1 
ATOM   686  N N   . LEU A 1 97  ? 41.650 6.071   36.010 1.00 19.13 ? 97  LEU 1 N   1 
ATOM   687  C CA  . LEU A 1 97  ? 42.162 5.882   37.363 1.00 21.10 ? 97  LEU 1 CA  1 
ATOM   688  C C   . LEU A 1 97  ? 41.364 6.689   38.383 1.00 20.73 ? 97  LEU 1 C   1 
ATOM   689  O O   . LEU A 1 97  ? 41.117 6.221   39.493 1.00 21.73 ? 97  LEU 1 O   1 
ATOM   690  C CB  . LEU A 1 97  ? 43.641 6.276   37.436 1.00 23.05 ? 97  LEU 1 CB  1 
ATOM   691  C CG  . LEU A 1 97  ? 44.664 5.253   36.925 1.00 25.70 ? 97  LEU 1 CG  1 
ATOM   692  C CD1 . LEU A 1 97  ? 44.333 4.831   35.503 1.00 27.13 ? 97  LEU 1 CD1 1 
ATOM   693  C CD2 . LEU A 1 97  ? 46.055 5.866   36.992 1.00 27.98 ? 97  LEU 1 CD2 1 
ATOM   694  N N   . THR A 1 98  ? 40.961 7.897   38.001 1.00 18.82 ? 98  THR 1 N   1 
ATOM   695  C CA  . THR A 1 98  ? 40.191 8.768   38.890 1.00 18.44 ? 98  THR 1 CA  1 
ATOM   696  C C   . THR A 1 98  ? 38.717 8.805   38.493 1.00 17.50 ? 98  THR 1 C   1 
ATOM   697  O O   . THR A 1 98  ? 37.878 9.334   39.226 1.00 16.86 ? 98  THR 1 O   1 
ATOM   698  C CB  . THR A 1 98  ? 40.727 10.209  38.848 1.00 20.22 ? 98  THR 1 CB  1 
ATOM   699  O OG1 . THR A 1 98  ? 40.561 10.738  37.526 1.00 19.72 ? 98  THR 1 OG1 1 
ATOM   700  C CG2 . THR A 1 98  ? 42.205 10.241  39.219 1.00 19.44 ? 98  THR 1 CG2 1 
ATOM   701  N N   . ILE A 1 99  ? 38.418 8.237   37.329 1.00 15.33 ? 99  ILE 1 N   1 
ATOM   702  C CA  . ILE A 1 99  ? 37.063 8.199   36.786 1.00 15.76 ? 99  ILE 1 CA  1 
ATOM   703  C C   . ILE A 1 99  ? 36.556 9.615   36.489 1.00 15.93 ? 99  ILE 1 C   1 
ATOM   704  O O   . ILE A 1 99  ? 35.351 9.866   36.482 1.00 16.28 ? 99  ILE 1 O   1 
ATOM   705  C CB  . ILE A 1 99  ? 36.075 7.494   37.751 1.00 17.63 ? 99  ILE 1 CB  1 
ATOM   706  C CG1 . ILE A 1 99  ? 36.702 6.211   38.300 1.00 19.99 ? 99  ILE 1 CG1 1 
ATOM   707  C CG2 . ILE A 1 99  ? 34.799 7.111   37.003 1.00 17.23 ? 99  ILE 1 CG2 1 
ATOM   708  C CD1 . ILE A 1 99  ? 35.791 5.437   39.245 1.00 25.14 ? 99  ILE 1 CD1 1 
ATOM   709  N N   . ASN A 1 100 ? 37.478 10.539  36.238 1.00 13.64 ? 100 ASN 1 N   1 
ATOM   710  C CA  . ASN A 1 100 ? 37.101 11.917  35.932 1.00 14.03 ? 100 ASN 1 CA  1 
ATOM   711  C C   . ASN A 1 100 ? 36.796 12.049  34.438 1.00 12.40 ? 100 ASN 1 C   1 
ATOM   712  O O   . ASN A 1 100 ? 37.387 11.344  33.615 1.00 11.09 ? 100 ASN 1 O   1 
ATOM   713  C CB  . ASN A 1 100 ? 38.234 12.877  36.304 1.00 14.97 ? 100 ASN 1 CB  1 
ATOM   714  C CG  . ASN A 1 100 ? 37.759 14.312  36.435 1.00 16.98 ? 100 ASN 1 CG  1 
ATOM   715  O OD1 . ASN A 1 100 ? 38.551 15.255  36.339 1.00 20.00 ? 100 ASN 1 OD1 1 
ATOM   716  N ND2 . ASN A 1 100 ? 36.466 14.486  36.674 1.00 15.10 ? 100 ASN 1 ND2 1 
ATOM   717  N N   . ASN A 1 101 ? 35.877 12.953  34.098 1.00 10.16 ? 101 ASN 1 N   1 
ATOM   718  C CA  . ASN A 1 101 ? 35.474 13.192  32.711 1.00 10.24 ? 101 ASN 1 CA  1 
ATOM   719  C C   . ASN A 1 101 ? 34.912 11.899  32.131 1.00 10.01 ? 101 ASN 1 C   1 
ATOM   720  O O   . ASN A 1 101 ? 35.258 11.489  31.023 1.00 10.11 ? 101 ASN 1 O   1 
ATOM   721  C CB  . ASN A 1 101 ? 36.669 13.670  31.879 1.00 11.94 ? 101 ASN 1 CB  1 
ATOM   722  C CG  . ASN A 1 101 ? 37.293 14.938  32.434 1.00 16.00 ? 101 ASN 1 CG  1 
ATOM   723  O OD1 . ASN A 1 101 ? 36.627 15.966  32.568 1.00 16.05 ? 101 ASN 1 OD1 1 
ATOM   724  N ND2 . ASN A 1 101 ? 38.578 14.871  32.763 1.00 16.19 ? 101 ASN 1 ND2 1 
ATOM   725  N N   . ASP A 1 102 ? 34.025 11.278  32.903 1.00 9.49  ? 102 ASP 1 N   1 
ATOM   726  C CA  . ASP A 1 102 ? 33.403 10.006  32.555 1.00 9.75  ? 102 ASP 1 CA  1 
ATOM   727  C C   . ASP A 1 102 ? 32.264 10.141  31.547 1.00 9.26  ? 102 ASP 1 C   1 
ATOM   728  O O   . ASP A 1 102 ? 31.089 9.992   31.897 1.00 9.98  ? 102 ASP 1 O   1 
ATOM   729  C CB  . ASP A 1 102 ? 32.896 9.354   33.844 1.00 9.25  ? 102 ASP 1 CB  1 
ATOM   730  C CG  . ASP A 1 102 ? 32.522 7.901   33.663 1.00 10.38 ? 102 ASP 1 CG  1 
ATOM   731  O OD1 . ASP A 1 102 ? 32.823 7.319   32.597 1.00 8.83  ? 102 ASP 1 OD1 1 
ATOM   732  O OD2 . ASP A 1 102 ? 31.927 7.339   34.604 1.00 11.14 ? 102 ASP 1 OD2 1 
ATOM   733  N N   . ILE A 1 103 ? 32.610 10.405  30.290 1.00 8.37  ? 103 ILE 1 N   1 
ATOM   734  C CA  . ILE A 1 103 ? 31.598 10.569  29.256 1.00 8.47  ? 103 ILE 1 CA  1 
ATOM   735  C C   . ILE A 1 103 ? 32.027 10.007  27.905 1.00 9.21  ? 103 ILE 1 C   1 
ATOM   736  O O   . ILE A 1 103 ? 33.177 10.154  27.486 1.00 9.62  ? 103 ILE 1 O   1 
ATOM   737  C CB  . ILE A 1 103 ? 31.226 12.067  29.084 1.00 9.30  ? 103 ILE 1 CB  1 
ATOM   738  C CG1 . ILE A 1 103 ? 30.071 12.213  28.092 1.00 10.17 ? 103 ILE 1 CG1 1 
ATOM   739  C CG2 . ILE A 1 103 ? 32.444 12.860  28.603 1.00 9.75  ? 103 ILE 1 CG2 1 
ATOM   740  C CD1 . ILE A 1 103 ? 29.503 13.623  28.020 1.00 10.65 ? 103 ILE 1 CD1 1 
ATOM   741  N N   . THR A 1 104 ? 31.083 9.352   27.239 1.00 8.98  ? 104 THR 1 N   1 
ATOM   742  C CA  . THR A 1 104 ? 31.306 8.777   25.924 1.00 9.48  ? 104 THR 1 CA  1 
ATOM   743  C C   . THR A 1 104 ? 30.100 9.078   25.049 1.00 9.93  ? 104 THR 1 C   1 
ATOM   744  O O   . THR A 1 104 ? 28.957 9.046   25.515 1.00 9.65  ? 104 THR 1 O   1 
ATOM   745  C CB  . THR A 1 104 ? 31.499 7.237   25.988 1.00 10.62 ? 104 THR 1 CB  1 
ATOM   746  O OG1 . THR A 1 104 ? 32.853 6.940   26.347 1.00 12.21 ? 104 THR 1 OG1 1 
ATOM   747  C CG2 . THR A 1 104 ? 31.183 6.592   24.632 1.00 11.44 ? 104 THR 1 CG2 1 
ATOM   748  N N   . LEU A 1 105 ? 30.361 9.395   23.785 1.00 8.55  ? 105 LEU 1 N   1 
ATOM   749  C CA  . LEU A 1 105 ? 29.292 9.668   22.837 1.00 10.54 ? 105 LEU 1 CA  1 
ATOM   750  C C   . LEU A 1 105 ? 29.197 8.489   21.883 1.00 10.86 ? 105 LEU 1 C   1 
ATOM   751  O O   . LEU A 1 105 ? 30.219 7.937   21.461 1.00 11.66 ? 105 LEU 1 O   1 
ATOM   752  C CB  . LEU A 1 105 ? 29.576 10.944  22.043 1.00 9.86  ? 105 LEU 1 CB  1 
ATOM   753  C CG  . LEU A 1 105 ? 29.224 12.274  22.715 1.00 12.71 ? 105 LEU 1 CG  1 
ATOM   754  C CD1 . LEU A 1 105 ? 29.745 13.435  21.878 1.00 12.22 ? 105 LEU 1 CD1 1 
ATOM   755  C CD2 . LEU A 1 105 ? 27.714 12.371  22.873 1.00 14.46 ? 105 LEU 1 CD2 1 
ATOM   756  N N   . LEU A 1 106 ? 27.971 8.097   21.556 1.00 10.31 ? 106 LEU 1 N   1 
ATOM   757  C CA  . LEU A 1 106 ? 27.751 6.990   20.638 1.00 9.23  ? 106 LEU 1 CA  1 
ATOM   758  C C   . LEU A 1 106 ? 27.047 7.512   19.395 1.00 11.43 ? 106 LEU 1 C   1 
ATOM   759  O O   . LEU A 1 106 ? 25.984 8.129   19.490 1.00 11.75 ? 106 LEU 1 O   1 
ATOM   760  C CB  . LEU A 1 106 ? 26.882 5.906   21.290 1.00 11.16 ? 106 LEU 1 CB  1 
ATOM   761  C CG  . LEU A 1 106 ? 27.369 5.290   22.605 1.00 11.29 ? 106 LEU 1 CG  1 
ATOM   762  C CD1 . LEU A 1 106 ? 26.318 4.324   23.132 1.00 11.84 ? 106 LEU 1 CD1 1 
ATOM   763  C CD2 . LEU A 1 106 ? 28.696 4.568   22.383 1.00 11.23 ? 106 LEU 1 CD2 1 
ATOM   764  N N   . LYS A 1 107 ? 27.658 7.282   18.237 1.00 11.23 ? 107 LYS 1 N   1 
ATOM   765  C CA  . LYS A 1 107 ? 27.085 7.689   16.959 1.00 13.32 ? 107 LYS 1 CA  1 
ATOM   766  C C   . LYS A 1 107 ? 26.324 6.466   16.451 1.00 13.30 ? 107 LYS 1 C   1 
ATOM   767  O O   . LYS A 1 107 ? 26.915 5.405   16.249 1.00 13.75 ? 107 LYS 1 O   1 
ATOM   768  C CB  . LYS A 1 107 ? 28.197 8.058   15.969 1.00 16.46 ? 107 LYS 1 CB  1 
ATOM   769  C CG  . LYS A 1 107 ? 27.725 8.389   14.553 1.00 21.97 ? 107 LYS 1 CG  1 
ATOM   770  C CD  . LYS A 1 107 ? 27.067 9.754   14.482 1.00 27.78 ? 107 LYS 1 CD  1 
ATOM   771  C CE  . LYS A 1 107 ? 26.777 10.178  13.043 1.00 31.03 ? 107 LYS 1 CE  1 
ATOM   772  N NZ  . LYS A 1 107 ? 25.697 9.363   12.415 1.00 33.72 ? 107 LYS 1 NZ  1 
ATOM   773  N N   . LEU A 1 108 ? 25.019 6.612   16.253 1.00 13.02 ? 108 LEU 1 N   1 
ATOM   774  C CA  . LEU A 1 108 ? 24.193 5.503   15.785 1.00 13.31 ? 108 LEU 1 CA  1 
ATOM   775  C C   . LEU A 1 108 ? 24.295 5.341   14.273 1.00 16.50 ? 108 LEU 1 C   1 
ATOM   776  O O   . LEU A 1 108 ? 24.317 6.328   13.537 1.00 14.90 ? 108 LEU 1 O   1 
ATOM   777  C CB  . LEU A 1 108 ? 22.733 5.736   16.182 1.00 14.91 ? 108 LEU 1 CB  1 
ATOM   778  C CG  . LEU A 1 108 ? 22.487 6.008   17.670 1.00 14.77 ? 108 LEU 1 CG  1 
ATOM   779  C CD1 . LEU A 1 108 ? 21.019 6.350   17.892 1.00 15.50 ? 108 LEU 1 CD1 1 
ATOM   780  C CD2 . LEU A 1 108 ? 22.886 4.791   18.490 1.00 14.15 ? 108 LEU 1 CD2 1 
ATOM   781  N N   . SER A 1 109 ? 24.364 4.093   13.816 1.00 18.24 ? 109 SER 1 N   1 
ATOM   782  C CA  . SER A 1 109 ? 24.457 3.805   12.389 1.00 21.30 ? 109 SER 1 CA  1 
ATOM   783  C C   . SER A 1 109 ? 23.071 3.960   11.776 1.00 22.98 ? 109 SER 1 C   1 
ATOM   784  O O   . SER A 1 109 ? 22.927 4.250   10.591 1.00 24.80 ? 109 SER 1 O   1 
ATOM   785  C CB  . SER A 1 109 ? 24.983 2.383   12.163 1.00 23.19 ? 109 SER 1 CB  1 
ATOM   786  O OG  . SER A 1 109 ? 24.137 1.418   12.760 1.00 27.65 ? 109 SER 1 OG  1 
ATOM   787  N N   . THR A 1 110 ? 22.057 3.762   12.609 1.00 23.01 ? 110 THR 1 N   1 
ATOM   788  C CA  . THR A 1 110 ? 20.669 3.892   12.203 1.00 25.11 ? 110 THR 1 CA  1 
ATOM   789  C C   . THR A 1 110 ? 20.007 4.911   13.129 1.00 23.87 ? 110 THR 1 C   1 
ATOM   790  O O   . THR A 1 110 ? 19.965 4.723   14.347 1.00 23.89 ? 110 THR 1 O   1 
ATOM   791  C CB  . THR A 1 110 ? 19.934 2.540   12.307 1.00 26.44 ? 110 THR 1 CB  1 
ATOM   792  O OG1 . THR A 1 110 ? 18.526 2.752   12.160 1.00 30.76 ? 110 THR 1 OG1 1 
ATOM   793  C CG2 . THR A 1 110 ? 20.212 1.876   13.649 1.00 28.37 ? 110 THR 1 CG2 1 
ATOM   794  N N   . ALA A 1 111 ? 19.503 5.995   12.551 1.00 22.07 ? 111 ALA 1 N   1 
ATOM   795  C CA  . ALA A 1 111 ? 18.862 7.045   13.334 1.00 21.90 ? 111 ALA 1 CA  1 
ATOM   796  C C   . ALA A 1 111 ? 17.624 6.565   14.077 1.00 20.82 ? 111 ALA 1 C   1 
ATOM   797  O O   . ALA A 1 111 ? 16.838 5.768   13.560 1.00 20.89 ? 111 ALA 1 O   1 
ATOM   798  C CB  . ALA A 1 111 ? 18.500 8.219   12.435 1.00 21.95 ? 111 ALA 1 CB  1 
ATOM   799  N N   . ALA A 1 112 ? 17.458 7.051   15.301 1.00 19.27 ? 112 ALA 1 N   1 
ATOM   800  C CA  . ALA A 1 112 ? 16.302 6.691   16.102 1.00 19.12 ? 112 ALA 1 CA  1 
ATOM   801  C C   . ALA A 1 112 ? 15.095 7.403   15.500 1.00 18.78 ? 112 ALA 1 C   1 
ATOM   802  O O   . ALA A 1 112 ? 15.232 8.450   14.868 1.00 19.30 ? 112 ALA 1 O   1 
ATOM   803  C CB  . ALA A 1 112 ? 16.508 7.128   17.549 1.00 19.07 ? 112 ALA 1 CB  1 
ATOM   804  N N   . SER A 1 113 ? 13.917 6.824   15.684 1.00 18.84 ? 113 SER 1 N   1 
ATOM   805  C CA  . SER A 1 113 ? 12.694 7.418   15.165 1.00 19.23 ? 113 SER 1 CA  1 
ATOM   806  C C   . SER A 1 113 ? 11.948 8.033   16.340 1.00 18.59 ? 113 SER 1 C   1 
ATOM   807  O O   . SER A 1 113 ? 11.372 7.319   17.156 1.00 18.50 ? 113 SER 1 O   1 
ATOM   808  C CB  . SER A 1 113 ? 11.835 6.346   14.493 1.00 20.71 ? 113 SER 1 CB  1 
ATOM   809  O OG  . SER A 1 113 ? 10.612 6.889   14.035 1.00 26.13 ? 113 SER 1 OG  1 
ATOM   810  N N   . PHE A 1 114 ? 11.968 9.359   16.433 1.00 17.56 ? 114 PHE 1 N   1 
ATOM   811  C CA  . PHE A 1 114 ? 11.300 10.029  17.536 1.00 17.95 ? 114 PHE 1 CA  1 
ATOM   812  C C   . PHE A 1 114 ? 9.792  9.864   17.483 1.00 19.81 ? 114 PHE 1 C   1 
ATOM   813  O O   . PHE A 1 114 ? 9.178  9.899   16.417 1.00 19.54 ? 114 PHE 1 O   1 
ATOM   814  C CB  . PHE A 1 114 ? 11.686 11.510  17.572 1.00 18.59 ? 114 PHE 1 CB  1 
ATOM   815  C CG  . PHE A 1 114 ? 13.051 11.764  18.157 1.00 17.45 ? 114 PHE 1 CG  1 
ATOM   816  C CD1 . PHE A 1 114 ? 13.901 10.703  18.465 1.00 16.56 ? 114 PHE 1 CD1 1 
ATOM   817  C CD2 . PHE A 1 114 ? 13.489 13.063  18.395 1.00 18.20 ? 114 PHE 1 CD2 1 
ATOM   818  C CE1 . PHE A 1 114 ? 15.168 10.930  19.003 1.00 18.07 ? 114 PHE 1 CE1 1 
ATOM   819  C CE2 . PHE A 1 114 ? 14.755 13.303  18.933 1.00 18.65 ? 114 PHE 1 CE2 1 
ATOM   820  C CZ  . PHE A 1 114 ? 15.596 12.234  19.238 1.00 17.57 ? 114 PHE 1 CZ  1 
ATOM   821  N N   . SER A 1 115 ? 9.205  9.669   18.656 1.00 18.90 ? 115 SER 1 N   1 
ATOM   822  C CA  . SER A 1 115 ? 7.773  9.472   18.782 1.00 20.08 ? 115 SER 1 CA  1 
ATOM   823  C C   . SER A 1 115 ? 7.357  9.943   20.163 1.00 20.37 ? 115 SER 1 C   1 
ATOM   824  O O   . SER A 1 115 ? 8.088  10.679  20.824 1.00 19.04 ? 115 SER 1 O   1 
ATOM   825  C CB  . SER A 1 115 ? 7.435  7.989   18.632 1.00 21.33 ? 115 SER 1 CB  1 
ATOM   826  O OG  . SER A 1 115 ? 8.015  7.238   19.690 1.00 20.61 ? 115 SER 1 OG  1 
ATOM   827  N N   . GLN A 1 116 ? 6.186  9.498   20.598 1.00 20.95 ? 116 GLN 1 N   1 
ATOM   828  C CA  . GLN A 1 116 ? 5.665  9.868   21.902 1.00 22.28 ? 116 GLN 1 CA  1 
ATOM   829  C C   . GLN A 1 116 ? 6.513  9.254   23.015 1.00 20.89 ? 116 GLN 1 C   1 
ATOM   830  O O   . GLN A 1 116 ? 6.564  9.779   24.125 1.00 22.33 ? 116 GLN 1 O   1 
ATOM   831  C CB  . GLN A 1 116 ? 4.213  9.393   22.020 1.00 25.95 ? 116 GLN 1 CB  1 
ATOM   832  C CG  . GLN A 1 116 ? 3.434  10.004  23.163 1.00 33.73 ? 116 GLN 1 CG  1 
ATOM   833  C CD  . GLN A 1 116 ? 1.959  9.637   23.118 1.00 37.95 ? 116 GLN 1 CD  1 
ATOM   834  O OE1 . GLN A 1 116 ? 1.592  8.469   23.263 1.00 40.99 ? 116 GLN 1 OE1 1 
ATOM   835  N NE2 . GLN A 1 116 ? 1.106  10.636  22.911 1.00 39.48 ? 116 GLN 1 NE2 1 
ATOM   836  N N   . THR A 1 117 ? 7.192  8.151   22.711 1.00 18.57 ? 117 THR 1 N   1 
ATOM   837  C CA  . THR A 1 117 ? 8.009  7.471   23.710 1.00 16.40 ? 117 THR 1 CA  1 
ATOM   838  C C   . THR A 1 117 ? 9.514  7.555   23.482 1.00 14.68 ? 117 THR 1 C   1 
ATOM   839  O O   . THR A 1 117 ? 10.293 7.011   24.265 1.00 13.18 ? 117 THR 1 O   1 
ATOM   840  C CB  . THR A 1 117 ? 7.614  5.985   23.821 1.00 15.23 ? 117 THR 1 CB  1 
ATOM   841  O OG1 . THR A 1 117 ? 7.806  5.341   22.556 1.00 17.06 ? 117 THR 1 OG1 1 
ATOM   842  C CG2 . THR A 1 117 ? 6.155  5.857   24.234 1.00 17.44 ? 117 THR 1 CG2 1 
ATOM   843  N N   . VAL A 1 118 ? 9.923  8.230   22.414 1.00 13.58 ? 118 VAL 1 N   1 
ATOM   844  C CA  . VAL A 1 118 ? 11.341 8.379   22.106 1.00 13.13 ? 118 VAL 1 CA  1 
ATOM   845  C C   . VAL A 1 118 ? 11.650 9.806   21.649 1.00 12.82 ? 118 VAL 1 C   1 
ATOM   846  O O   . VAL A 1 118 ? 11.187 10.240  20.598 1.00 13.50 ? 118 VAL 1 O   1 
ATOM   847  C CB  . VAL A 1 118 ? 11.783 7.401   20.987 1.00 13.56 ? 118 VAL 1 CB  1 
ATOM   848  C CG1 . VAL A 1 118 ? 13.253 7.617   20.652 1.00 13.29 ? 118 VAL 1 CG1 1 
ATOM   849  C CG2 . VAL A 1 118 ? 11.542 5.957   21.424 1.00 13.03 ? 118 VAL 1 CG2 1 
ATOM   850  N N   . SER A 1 119 ? 12.429 10.529  22.447 1.00 11.78 ? 119 SER 1 N   1 
ATOM   851  C CA  . SER A 1 119 ? 12.816 11.896  22.115 1.00 11.63 ? 119 SER 1 CA  1 
ATOM   852  C C   . SER A 1 119 ? 14.080 12.290  22.876 1.00 12.47 ? 119 SER 1 C   1 
ATOM   853  O O   . SER A 1 119 ? 14.620 11.498  23.650 1.00 12.92 ? 119 SER 1 O   1 
ATOM   854  C CB  . SER A 1 119 ? 11.675 12.877  22.413 1.00 10.97 ? 119 SER 1 CB  1 
ATOM   855  O OG  . SER A 1 119 ? 11.127 12.661  23.697 1.00 14.90 ? 119 SER 1 OG  1 
ATOM   856  N N   . ALA A 1 120 ? 14.537 13.520  22.669 1.00 10.37 ? 120 ALA 1 N   1 
ATOM   857  C CA  . ALA A 1 120 ? 15.775 13.982  23.285 1.00 11.52 ? 120 ALA 1 CA  1 
ATOM   858  C C   . ALA A 1 120 ? 15.672 14.821  24.549 1.00 11.53 ? 120 ALA 1 C   1 
ATOM   859  O O   . ALA A 1 120 ? 14.691 15.532  24.777 1.00 12.09 ? 120 ALA 1 O   1 
ATOM   860  C CB  . ALA A 1 120 ? 16.592 14.746  22.247 1.00 11.83 ? 120 ALA 1 CB  1 
ATOM   861  N N   . VAL A 1 121 ? 16.719 14.728  25.363 1.00 9.38  ? 121 VAL 1 N   1 
ATOM   862  C CA  . VAL A 1 121 ? 16.817 15.502  26.590 1.00 10.42 ? 121 VAL 1 CA  1 
ATOM   863  C C   . VAL A 1 121 ? 17.624 16.736  26.186 1.00 11.48 ? 121 VAL 1 C   1 
ATOM   864  O O   . VAL A 1 121 ? 18.337 16.710  25.178 1.00 11.08 ? 121 VAL 1 O   1 
ATOM   865  C CB  . VAL A 1 121 ? 17.565 14.707  27.703 1.00 10.18 ? 121 VAL 1 CB  1 
ATOM   866  C CG1 . VAL A 1 121 ? 19.004 14.447  27.291 1.00 11.48 ? 121 VAL 1 CG1 1 
ATOM   867  C CG2 . VAL A 1 121 ? 17.520 15.474  29.025 1.00 8.80  ? 121 VAL 1 CG2 1 
ATOM   868  N N   . CYS A 1 122 ? 17.490 17.822  26.936 1.00 10.36 ? 122 CYS 1 N   1 
ATOM   869  C CA  . CYS A 1 122 ? 18.235 19.036  26.627 1.00 11.96 ? 122 CYS 1 CA  1 
ATOM   870  C C   . CYS A 1 122 ? 19.602 19.030  27.289 1.00 11.70 ? 122 CYS 1 C   1 
ATOM   871  O O   . CYS A 1 122 ? 19.794 18.419  28.340 1.00 12.12 ? 122 CYS 1 O   1 
ATOM   872  C CB  . CYS A 1 122 ? 17.508 20.275  27.134 1.00 12.17 ? 122 CYS 1 CB  1 
ATOM   873  S SG  . CYS A 1 122 ? 15.881 20.634  26.429 1.00 12.90 ? 122 CYS 1 SG  1 
ATOM   874  N N   . LEU A 1 123 ? 20.547 19.726  26.670 1.00 10.66 ? 123 LEU 1 N   1 
ATOM   875  C CA  . LEU A 1 123 ? 21.884 19.853  27.227 1.00 12.07 ? 123 LEU 1 CA  1 
ATOM   876  C C   . LEU A 1 123 ? 21.956 21.264  27.802 1.00 12.91 ? 123 LEU 1 C   1 
ATOM   877  O O   . LEU A 1 123 ? 21.306 22.179  27.299 1.00 13.94 ? 123 LEU 1 O   1 
ATOM   878  C CB  . LEU A 1 123 ? 22.945 19.666  26.139 1.00 12.53 ? 123 LEU 1 CB  1 
ATOM   879  C CG  . LEU A 1 123 ? 23.128 18.244  25.595 1.00 14.80 ? 123 LEU 1 CG  1 
ATOM   880  C CD1 . LEU A 1 123 ? 24.195 18.245  24.510 1.00 16.14 ? 123 LEU 1 CD1 1 
ATOM   881  C CD2 . LEU A 1 123 ? 23.528 17.304  26.726 1.00 14.39 ? 123 LEU 1 CD2 1 
ATOM   882  N N   . PRO A 1 124 ? 22.730 21.457  28.875 1.00 13.54 ? 124 PRO 1 N   1 
ATOM   883  C CA  . PRO A 1 124 ? 22.845 22.786  29.481 1.00 14.49 ? 124 PRO 1 CA  1 
ATOM   884  C C   . PRO A 1 124 ? 23.925 23.620  28.811 1.00 16.16 ? 124 PRO 1 C   1 
ATOM   885  O O   . PRO A 1 124 ? 24.686 23.113  27.989 1.00 14.39 ? 124 PRO 1 O   1 
ATOM   886  C CB  . PRO A 1 124 ? 23.209 22.458  30.919 1.00 15.05 ? 124 PRO 1 CB  1 
ATOM   887  C CG  . PRO A 1 124 ? 24.154 21.298  30.729 1.00 14.76 ? 124 PRO 1 CG  1 
ATOM   888  C CD  . PRO A 1 124 ? 23.425 20.444  29.692 1.00 13.59 ? 124 PRO 1 CD  1 
ATOM   889  N N   . SER A 1 125 ? 23.977 24.905  29.149 1.00 18.05 ? 125 SER 1 N   1 
ATOM   890  C CA  . SER A 1 125 ? 25.015 25.778  28.619 1.00 20.61 ? 125 SER 1 CA  1 
ATOM   891  C C   . SER A 1 125 ? 26.169 25.585  29.589 1.00 20.94 ? 125 SER 1 C   1 
ATOM   892  O O   . SER A 1 125 ? 25.949 25.277  30.761 1.00 21.83 ? 125 SER 1 O   1 
ATOM   893  C CB  . SER A 1 125 ? 24.570 27.244  28.634 1.00 22.34 ? 125 SER 1 CB  1 
ATOM   894  O OG  . SER A 1 125 ? 23.504 27.466  27.730 1.00 27.66 ? 125 SER 1 OG  1 
ATOM   895  N N   . ALA A 1 126 ? 27.396 25.759  29.115 1.00 21.03 ? 126 ALA 1 N   1 
ATOM   896  C CA  . ALA A 1 126 ? 28.555 25.583  29.979 1.00 22.11 ? 126 ALA 1 CA  1 
ATOM   897  C C   . ALA A 1 126 ? 28.472 26.472  31.219 1.00 23.79 ? 126 ALA 1 C   1 
ATOM   898  O O   . ALA A 1 126 ? 29.007 26.128  32.274 1.00 24.13 ? 126 ALA 1 O   1 
ATOM   899  C CB  . ALA A 1 126 ? 29.833 25.878  29.204 1.00 22.54 ? 126 ALA 1 CB  1 
ATOM   900  N N   . SER A 1 127 ? 27.783 27.603  31.094 1.00 23.50 ? 127 SER 1 N   1 
ATOM   901  C CA  . SER A 1 127 ? 27.648 28.543  32.204 1.00 25.74 ? 127 SER 1 CA  1 
ATOM   902  C C   . SER A 1 127 ? 26.406 28.339  33.075 1.00 26.22 ? 127 SER 1 C   1 
ATOM   903  O O   . SER A 1 127 ? 26.187 29.092  34.028 1.00 26.66 ? 127 SER 1 O   1 
ATOM   904  C CB  . SER A 1 127 ? 27.655 29.979  31.668 1.00 25.55 ? 127 SER 1 CB  1 
ATOM   905  O OG  . SER A 1 127 ? 26.602 30.177  30.739 1.00 28.97 ? 127 SER 1 OG  1 
ATOM   906  N N   . ASP A 1 128 ? 25.593 27.335  32.758 1.00 25.89 ? 128 ASP 1 N   1 
ATOM   907  C CA  . ASP A 1 128 ? 24.388 27.076  33.543 1.00 26.33 ? 128 ASP 1 CA  1 
ATOM   908  C C   . ASP A 1 128 ? 24.725 26.699  34.978 1.00 26.33 ? 128 ASP 1 C   1 
ATOM   909  O O   . ASP A 1 128 ? 25.689 25.980  35.235 1.00 26.27 ? 128 ASP 1 O   1 
ATOM   910  C CB  . ASP A 1 128 ? 23.547 25.970  32.897 1.00 25.93 ? 128 ASP 1 CB  1 
ATOM   911  C CG  . ASP A 1 128 ? 22.627 26.498  31.818 1.00 26.59 ? 128 ASP 1 CG  1 
ATOM   912  O OD1 . ASP A 1 128 ? 22.578 27.732  31.636 1.00 29.69 ? 128 ASP 1 OD1 1 
ATOM   913  O OD2 . ASP A 1 128 ? 21.950 25.688  31.154 1.00 25.08 ? 128 ASP 1 OD2 1 
ATOM   914  N N   . ASP A 1 129 ? 23.919 27.193  35.912 1.00 26.65 ? 129 ASP 1 N   1 
ATOM   915  C CA  . ASP A 1 129 ? 24.133 26.922  37.326 1.00 26.46 ? 129 ASP 1 CA  1 
ATOM   916  C C   . ASP A 1 129 ? 22.996 26.121  37.942 1.00 24.02 ? 129 ASP 1 C   1 
ATOM   917  O O   . ASP A 1 129 ? 21.826 26.466  37.794 1.00 23.81 ? 129 ASP 1 O   1 
ATOM   918  C CB  . ASP A 1 129 ? 24.297 28.238  38.091 1.00 30.36 ? 129 ASP 1 CB  1 
ATOM   919  C CG  . ASP A 1 129 ? 24.405 28.032  39.591 1.00 34.63 ? 129 ASP 1 CG  1 
ATOM   920  O OD1 . ASP A 1 129 ? 25.327 27.312  40.031 1.00 36.59 ? 129 ASP 1 OD1 1 
ATOM   921  O OD2 . ASP A 1 129 ? 23.567 28.593  40.330 1.00 38.39 ? 129 ASP 1 OD2 1 
ATOM   922  N N   . PHE A 1 130 ? 23.354 25.041  38.625 1.00 21.82 ? 130 PHE 1 N   1 
ATOM   923  C CA  . PHE A 1 130 ? 22.378 24.196  39.298 1.00 19.85 ? 130 PHE 1 CA  1 
ATOM   924  C C   . PHE A 1 130 ? 22.814 24.146  40.757 1.00 18.60 ? 130 PHE 1 C   1 
ATOM   925  O O   . PHE A 1 130 ? 23.748 23.435  41.116 1.00 19.89 ? 130 PHE 1 O   1 
ATOM   926  C CB  . PHE A 1 130 ? 22.354 22.801  38.667 1.00 20.39 ? 130 PHE 1 CB  1 
ATOM   927  C CG  . PHE A 1 130 ? 21.953 22.808  37.218 1.00 19.52 ? 130 PHE 1 CG  1 
ATOM   928  C CD1 . PHE A 1 130 ? 22.902 23.003  36.217 1.00 19.93 ? 130 PHE 1 CD1 1 
ATOM   929  C CD2 . PHE A 1 130 ? 20.616 22.671  36.855 1.00 20.46 ? 130 PHE 1 CD2 1 
ATOM   930  C CE1 . PHE A 1 130 ? 22.523 23.063  34.874 1.00 20.41 ? 130 PHE 1 CE1 1 
ATOM   931  C CE2 . PHE A 1 130 ? 20.226 22.730  35.517 1.00 21.13 ? 130 PHE 1 CE2 1 
ATOM   932  C CZ  . PHE A 1 130 ? 21.183 22.928  34.523 1.00 19.38 ? 130 PHE 1 CZ  1 
ATOM   933  N N   . ALA A 1 131 ? 22.129 24.929  41.584 1.00 18.25 ? 131 ALA 1 N   1 
ATOM   934  C CA  . ALA A 1 131 ? 22.436 25.060  43.006 1.00 17.94 ? 131 ALA 1 CA  1 
ATOM   935  C C   . ALA A 1 131 ? 22.258 23.825  43.878 1.00 16.79 ? 131 ALA 1 C   1 
ATOM   936  O O   . ALA A 1 131 ? 21.417 22.969  43.609 1.00 16.17 ? 131 ALA 1 O   1 
ATOM   937  C CB  . ALA A 1 131 ? 21.622 26.207  43.589 1.00 17.09 ? 131 ALA 1 CB  1 
ATOM   938  N N   . ALA A 1 132 ? 23.065 23.749  44.934 1.00 16.39 ? 132 ALA 1 N   1 
ATOM   939  C CA  . ALA A 1 132 ? 22.977 22.648  45.884 1.00 15.85 ? 132 ALA 1 CA  1 
ATOM   940  C C   . ALA A 1 132 ? 21.601 22.757  46.531 1.00 16.04 ? 132 ALA 1 C   1 
ATOM   941  O O   . ALA A 1 132 ? 21.117 23.862  46.784 1.00 16.22 ? 132 ALA 1 O   1 
ATOM   942  C CB  . ALA A 1 132 ? 24.064 22.774  46.936 1.00 16.75 ? 132 ALA 1 CB  1 
ATOM   943  N N   . GLY A 1 133 ? 20.967 21.619  46.790 1.00 14.38 ? 133 GLY 1 N   1 
ATOM   944  C CA  . GLY A 1 133 ? 19.648 21.640  47.394 1.00 13.44 ? 133 GLY 1 CA  1 
ATOM   945  C C   . GLY A 1 133 ? 18.552 21.449  46.363 1.00 13.09 ? 133 GLY 1 C   1 
ATOM   946  O O   . GLY A 1 133 ? 17.435 21.053  46.696 1.00 14.17 ? 133 GLY 1 O   1 
ATOM   947  N N   . THR A 1 134 ? 18.867 21.740  45.105 1.00 12.08 ? 134 THR 1 N   1 
ATOM   948  C CA  . THR A 1 134 ? 17.905 21.579  44.026 1.00 12.07 ? 134 THR 1 CA  1 
ATOM   949  C C   . THR A 1 134 ? 17.544 20.103  43.914 1.00 11.69 ? 134 THR 1 C   1 
ATOM   950  O O   . THR A 1 134 ? 18.418 19.235  43.967 1.00 11.49 ? 134 THR 1 O   1 
ATOM   951  C CB  . THR A 1 134 ? 18.492 22.031  42.669 1.00 14.27 ? 134 THR 1 CB  1 
ATOM   952  O OG1 . THR A 1 134 ? 18.931 23.392  42.759 1.00 16.55 ? 134 THR 1 OG1 1 
ATOM   953  C CG2 . THR A 1 134 ? 17.446 21.916  41.575 1.00 14.46 ? 134 THR 1 CG2 1 
ATOM   954  N N   . THR A 1 135 ? 16.259 19.812  43.764 1.00 10.35 ? 135 THR 1 N   1 
ATOM   955  C CA  . THR A 1 135 ? 15.840 18.427  43.627 1.00 9.76  ? 135 THR 1 CA  1 
ATOM   956  C C   . THR A 1 135 ? 15.738 18.069  42.149 1.00 10.74 ? 135 THR 1 C   1 
ATOM   957  O O   . THR A 1 135 ? 15.041 18.735  41.376 1.00 9.84  ? 135 THR 1 O   1 
ATOM   958  C CB  . THR A 1 135 ? 14.484 18.177  44.306 1.00 10.34 ? 135 THR 1 CB  1 
ATOM   959  O OG1 . THR A 1 135 ? 14.612 18.421  45.712 1.00 11.53 ? 135 THR 1 OG1 1 
ATOM   960  C CG2 . THR A 1 135 ? 14.038 16.735  44.096 1.00 10.38 ? 135 THR 1 CG2 1 
ATOM   961  N N   . CYS A 1 136 ? 16.450 17.018  41.763 1.00 9.67  ? 136 CYS 1 N   1 
ATOM   962  C CA  . CYS A 1 136 ? 16.444 16.556  40.383 1.00 9.70  ? 136 CYS 1 CA  1 
ATOM   963  C C   . CYS A 1 136 ? 16.002 15.101  40.353 1.00 9.45  ? 136 CYS 1 C   1 
ATOM   964  O O   . CYS A 1 136 ? 15.579 14.552  41.374 1.00 9.72  ? 136 CYS 1 O   1 
ATOM   965  C CB  . CYS A 1 136 ? 17.836 16.729  39.778 1.00 9.51  ? 136 CYS 1 CB  1 
ATOM   966  S SG  . CYS A 1 136 ? 18.423 18.453  39.899 1.00 12.15 ? 136 CYS 1 SG  1 
ATOM   967  N N   . VAL A 1 137 ? 16.101 14.473  39.188 1.00 7.97  ? 137 VAL 1 N   1 
ATOM   968  C CA  . VAL A 1 137 ? 15.657 13.097  39.037 1.00 9.95  ? 137 VAL 1 CA  1 
ATOM   969  C C   . VAL A 1 137 ? 16.668 12.242  38.289 1.00 10.02 ? 137 VAL 1 C   1 
ATOM   970  O O   . VAL A 1 137 ? 17.340 12.718  37.380 1.00 8.46  ? 137 VAL 1 O   1 
ATOM   971  C CB  . VAL A 1 137 ? 14.312 13.049  38.257 1.00 9.71  ? 137 VAL 1 CB  1 
ATOM   972  C CG1 . VAL A 1 137 ? 13.887 11.612  38.019 1.00 11.04 ? 137 VAL 1 CG1 1 
ATOM   973  C CG2 . VAL A 1 137 ? 13.237 13.803  39.022 1.00 11.73 ? 137 VAL 1 CG2 1 
ATOM   974  N N   . THR A 1 138 ? 16.787 10.982  38.696 1.00 10.37 ? 138 THR 1 N   1 
ATOM   975  C CA  . THR A 1 138 ? 17.670 10.056  38.006 1.00 9.57  ? 138 THR 1 CA  1 
ATOM   976  C C   . THR A 1 138 ? 16.823 8.823   37.705 1.00 9.58  ? 138 THR 1 C   1 
ATOM   977  O O   . THR A 1 138 ? 15.902 8.494   38.458 1.00 9.85  ? 138 THR 1 O   1 
ATOM   978  C CB  . THR A 1 138 ? 18.914 9.677   38.842 1.00 10.17 ? 138 THR 1 CB  1 
ATOM   979  O OG1 . THR A 1 138 ? 19.815 8.930   38.013 1.00 8.82  ? 138 THR 1 OG1 1 
ATOM   980  C CG2 . THR A 1 138 ? 18.534 8.842   40.058 1.00 10.45 ? 138 THR 1 CG2 1 
ATOM   981  N N   . THR A 1 139 ? 17.121 8.158   36.595 1.00 8.06  ? 139 THR 1 N   1 
ATOM   982  C CA  . THR A 1 139 ? 16.363 6.987   36.171 1.00 8.37  ? 139 THR 1 CA  1 
ATOM   983  C C   . THR A 1 139 ? 17.291 5.880   35.689 1.00 9.78  ? 139 THR 1 C   1 
ATOM   984  O O   . THR A 1 139 ? 18.447 6.136   35.353 1.00 9.79  ? 139 THR 1 O   1 
ATOM   985  C CB  . THR A 1 139 ? 15.403 7.353   35.016 1.00 9.10  ? 139 THR 1 CB  1 
ATOM   986  O OG1 . THR A 1 139 ? 16.145 7.981   33.959 1.00 9.35  ? 139 THR 1 OG1 1 
ATOM   987  C CG2 . THR A 1 139 ? 14.325 8.315   35.497 1.00 9.55  ? 139 THR 1 CG2 1 
ATOM   988  N N   . GLY A 1 140 ? 16.780 4.651   35.657 1.00 10.31 ? 140 GLY 1 N   1 
ATOM   989  C CA  . GLY A 1 140 ? 17.591 3.539   35.196 1.00 10.47 ? 140 GLY 1 CA  1 
ATOM   990  C C   . GLY A 1 140 ? 17.077 2.164   35.585 1.00 12.65 ? 140 GLY 1 C   1 
ATOM   991  O O   . GLY A 1 140 ? 16.100 2.032   36.331 1.00 10.39 ? 140 GLY 1 O   1 
ATOM   992  N N   . TRP A 1 141 ? 17.746 1.138   35.065 1.00 11.94 ? 141 TRP 1 N   1 
ATOM   993  C CA  . TRP A 1 141 ? 17.402 -0.253  35.338 1.00 11.76 ? 141 TRP 1 CA  1 
ATOM   994  C C   . TRP A 1 141 ? 18.468 -0.907  36.225 1.00 12.77 ? 141 TRP 1 C   1 
ATOM   995  O O   . TRP A 1 141 ? 18.640 -2.124  36.199 1.00 13.31 ? 141 TRP 1 O   1 
ATOM   996  C CB  . TRP A 1 141 ? 17.291 -1.035  34.023 1.00 10.40 ? 141 TRP 1 CB  1 
ATOM   997  C CG  . TRP A 1 141 ? 16.051 -0.750  33.209 1.00 12.07 ? 141 TRP 1 CG  1 
ATOM   998  C CD1 . TRP A 1 141 ? 14.816 -1.313  33.374 1.00 11.19 ? 141 TRP 1 CD1 1 
ATOM   999  C CD2 . TRP A 1 141 ? 15.946 0.118   32.070 1.00 11.46 ? 141 TRP 1 CD2 1 
ATOM   1000 N NE1 . TRP A 1 141 ? 13.952 -0.857  32.404 1.00 12.44 ? 141 TRP 1 NE1 1 
ATOM   1001 C CE2 . TRP A 1 141 ? 14.619 0.023   31.593 1.00 10.94 ? 141 TRP 1 CE2 1 
ATOM   1002 C CE3 . TRP A 1 141 ? 16.846 0.964   31.404 1.00 11.14 ? 141 TRP 1 CE3 1 
ATOM   1003 C CZ2 . TRP A 1 141 ? 14.169 0.742   30.478 1.00 10.77 ? 141 TRP 1 CZ2 1 
ATOM   1004 C CZ3 . TRP A 1 141 ? 16.399 1.678   30.296 1.00 9.96  ? 141 TRP 1 CZ3 1 
ATOM   1005 C CH2 . TRP A 1 141 ? 15.070 1.561   29.845 1.00 11.02 ? 141 TRP 1 CH2 1 
ATOM   1006 N N   . GLY A 1 142 ? 19.183 -0.096  37.001 1.00 12.42 ? 142 GLY 1 N   1 
ATOM   1007 C CA  . GLY A 1 142 ? 20.211 -0.632  37.877 1.00 10.65 ? 142 GLY 1 CA  1 
ATOM   1008 C C   . GLY A 1 142 ? 19.604 -1.374  39.054 1.00 12.79 ? 142 GLY 1 C   1 
ATOM   1009 O O   . GLY A 1 142 ? 18.394 -1.319  39.271 1.00 10.43 ? 142 GLY 1 O   1 
ATOM   1010 N N   . LEU A 1 143 ? 20.440 -2.066  39.823 1.00 13.11 ? 143 LEU 1 N   1 
ATOM   1011 C CA  . LEU A 1 143 ? 19.965 -2.825  40.978 1.00 15.80 ? 143 LEU 1 CA  1 
ATOM   1012 C C   . LEU A 1 143 ? 19.102 -1.978  41.912 1.00 14.92 ? 143 LEU 1 C   1 
ATOM   1013 O O   . LEU A 1 143 ? 19.397 -0.810  42.153 1.00 14.28 ? 143 LEU 1 O   1 
ATOM   1014 C CB  . LEU A 1 143 ? 21.154 -3.384  41.762 1.00 15.84 ? 143 LEU 1 CB  1 
ATOM   1015 C CG  . LEU A 1 143 ? 22.104 -4.302  40.990 1.00 19.14 ? 143 LEU 1 CG  1 
ATOM   1016 C CD1 . LEU A 1 143 ? 23.243 -4.732  41.902 1.00 19.99 ? 143 LEU 1 CD1 1 
ATOM   1017 C CD2 . LEU A 1 143 ? 21.344 -5.515  40.470 1.00 21.30 ? 143 LEU 1 CD2 1 
ATOM   1018 N N   . THR A 1 144 ? 18.038 -2.579  42.439 1.00 16.00 ? 144 THR 1 N   1 
ATOM   1019 C CA  . THR A 1 144 ? 17.135 -1.888  43.357 1.00 18.37 ? 144 THR 1 CA  1 
ATOM   1020 C C   . THR A 1 144 ? 17.450 -2.281  44.795 1.00 21.50 ? 144 THR 1 C   1 
ATOM   1021 O O   . THR A 1 144 ? 16.883 -1.738  45.741 1.00 20.64 ? 144 THR 1 O   1 
ATOM   1022 C CB  . THR A 1 144 ? 15.665 -2.242  43.071 1.00 19.84 ? 144 THR 1 CB  1 
ATOM   1023 O OG1 . THR A 1 144 ? 15.462 -3.648  43.264 1.00 18.44 ? 144 THR 1 OG1 1 
ATOM   1024 C CG2 . THR A 1 144 ? 15.303 -1.872  41.644 1.00 18.61 ? 144 THR 1 CG2 1 
ATOM   1025 N N   . ARG A 1 145 ? 18.361 -3.234  44.943 1.00 25.09 ? 145 ARG 1 N   1 
ATOM   1026 C CA  . ARG A 1 145 ? 18.774 -3.724  46.249 1.00 30.65 ? 145 ARG 1 CA  1 
ATOM   1027 C C   . ARG A 1 145 ? 20.139 -4.377  46.088 1.00 32.15 ? 145 ARG 1 C   1 
ATOM   1028 O O   . ARG A 1 145 ? 20.361 -5.141  45.147 1.00 31.56 ? 145 ARG 1 O   1 
ATOM   1029 C CB  . ARG A 1 145 ? 17.753 -4.742  46.768 1.00 33.83 ? 145 ARG 1 CB  1 
ATOM   1030 C CG  . ARG A 1 145 ? 18.123 -5.420  48.076 1.00 39.75 ? 145 ARG 1 CG  1 
ATOM   1031 C CD  . ARG A 1 145 ? 17.023 -6.388  48.501 1.00 43.63 ? 145 ARG 1 CD  1 
ATOM   1032 N NE  . ARG A 1 145 ? 17.388 -7.190  49.668 1.00 47.50 ? 145 ARG 1 NE  1 
ATOM   1033 C CZ  . ARG A 1 145 ? 17.645 -6.692  50.874 1.00 49.59 ? 145 ARG 1 CZ  1 
ATOM   1034 N NH1 . ARG A 1 145 ? 17.581 -5.383  51.087 1.00 50.81 ? 145 ARG 1 NH1 1 
ATOM   1035 N NH2 . ARG A 1 145 ? 17.968 -7.506  51.872 1.00 50.20 ? 145 ARG 1 NH2 1 
ATOM   1036 N N   . TYR A 1 146 ? 21.060 -4.066  46.993 1.00 34.03 ? 146 TYR 1 N   1 
ATOM   1037 C CA  . TYR A 1 146 ? 22.395 -4.641  46.921 1.00 37.40 ? 146 TYR 1 CA  1 
ATOM   1038 C C   . TYR A 1 146 ? 22.525 -5.810  47.891 1.00 38.73 ? 146 TYR 1 C   1 
ATOM   1039 O O   . TYR A 1 146 ? 21.701 -5.892  48.826 1.00 40.52 ? 146 TYR 1 O   1 
ATOM   1040 C CB  . TYR A 1 146 ? 23.450 -3.578  47.244 1.00 39.09 ? 146 TYR 1 CB  1 
ATOM   1041 C CG  . TYR A 1 146 ? 24.869 -4.087  47.145 1.00 41.26 ? 146 TYR 1 CG  1 
ATOM   1042 C CD1 . TYR A 1 146 ? 25.375 -4.563  45.937 1.00 43.17 ? 146 TYR 1 CD1 1 
ATOM   1043 C CD2 . TYR A 1 146 ? 25.697 -4.122  48.265 1.00 42.06 ? 146 TYR 1 CD2 1 
ATOM   1044 C CE1 . TYR A 1 146 ? 26.673 -5.066  45.847 1.00 44.11 ? 146 TYR 1 CE1 1 
ATOM   1045 C CE2 . TYR A 1 146 ? 26.994 -4.621  48.186 1.00 43.52 ? 146 TYR 1 CE2 1 
ATOM   1046 C CZ  . TYR A 1 146 ? 27.475 -5.092  46.974 1.00 44.04 ? 146 TYR 1 CZ  1 
ATOM   1047 O OH  . TYR A 1 146 ? 28.755 -5.595  46.891 1.00 45.20 ? 146 TYR 1 OH  1 
ATOM   1048 N N   . THR A 1 151 ? 18.932 -7.175  37.869 1.00 23.37 ? 151 THR 1 N   1 
ATOM   1049 C CA  . THR A 1 151 ? 18.317 -5.825  37.683 1.00 22.65 ? 151 THR 1 CA  1 
ATOM   1050 C C   . THR A 1 151 ? 16.814 -5.934  37.438 1.00 21.40 ? 151 THR 1 C   1 
ATOM   1051 O O   . THR A 1 151 ? 16.340 -6.932  36.897 1.00 23.42 ? 151 THR 1 O   1 
ATOM   1052 C CB  . THR A 1 151 ? 18.958 -5.078  36.491 1.00 22.85 ? 151 THR 1 CB  1 
ATOM   1053 O OG1 . THR A 1 151 ? 18.873 -5.886  35.310 1.00 25.55 ? 151 THR 1 OG1 1 
ATOM   1054 C CG2 . THR A 1 151 ? 20.418 -4.763  36.781 1.00 23.41 ? 151 THR 1 CG2 1 
ATOM   1055 N N   . PRO A 1 152 ? 16.046 -4.902  37.832 1.00 18.93 ? 152 PRO 1 N   1 
ATOM   1056 C CA  . PRO A 1 152 ? 14.590 -4.884  37.654 1.00 17.04 ? 152 PRO 1 CA  1 
ATOM   1057 C C   . PRO A 1 152 ? 14.187 -4.828  36.183 1.00 16.15 ? 152 PRO 1 C   1 
ATOM   1058 O O   . PRO A 1 152 ? 14.899 -4.265  35.355 1.00 15.11 ? 152 PRO 1 O   1 
ATOM   1059 C CB  . PRO A 1 152 ? 14.174 -3.623  38.399 1.00 16.97 ? 152 PRO 1 CB  1 
ATOM   1060 C CG  . PRO A 1 152 ? 15.328 -2.705  38.127 1.00 17.19 ? 152 PRO 1 CG  1 
ATOM   1061 C CD  . PRO A 1 152 ? 16.512 -3.618  38.387 1.00 15.82 ? 152 PRO 1 CD  1 
ATOM   1062 N N   . ASP A 1 153 ? 13.035 -5.405  35.863 1.00 16.59 ? 153 ASP 1 N   1 
ATOM   1063 C CA  . ASP A 1 153 ? 12.545 -5.399  34.490 1.00 16.66 ? 153 ASP 1 CA  1 
ATOM   1064 C C   . ASP A 1 153 ? 12.042 -4.021  34.067 1.00 14.66 ? 153 ASP 1 C   1 
ATOM   1065 O O   . ASP A 1 153 ? 12.281 -3.584  32.941 1.00 13.86 ? 153 ASP 1 O   1 
ATOM   1066 C CB  . ASP A 1 153 ? 11.403 -6.409  34.331 1.00 19.55 ? 153 ASP 1 CB  1 
ATOM   1067 C CG  . ASP A 1 153 ? 11.886 -7.849  34.303 1.00 23.11 ? 153 ASP 1 CG  1 
ATOM   1068 O OD1 . ASP A 1 153 ? 13.114 -8.080  34.274 1.00 25.91 ? 153 ASP 1 OD1 1 
ATOM   1069 O OD2 . ASP A 1 153 ? 11.025 -8.755  34.300 1.00 24.17 ? 153 ASP 1 OD2 1 
ATOM   1070 N N   . ARG A 1 154 ? 11.346 -3.343  34.975 1.00 13.43 ? 154 ARG 1 N   1 
ATOM   1071 C CA  . ARG A 1 154 ? 10.768 -2.034  34.683 1.00 14.73 ? 154 ARG 1 CA  1 
ATOM   1072 C C   . ARG A 1 154 ? 11.605 -0.837  35.120 1.00 12.81 ? 154 ARG 1 C   1 
ATOM   1073 O O   . ARG A 1 154 ? 12.203 -0.838  36.192 1.00 13.06 ? 154 ARG 1 O   1 
ATOM   1074 C CB  . ARG A 1 154 ? 9.377  -1.946  35.308 1.00 16.86 ? 154 ARG 1 CB  1 
ATOM   1075 C CG  . ARG A 1 154 ? 8.434  -3.009  34.781 1.00 23.38 ? 154 ARG 1 CG  1 
ATOM   1076 C CD  . ARG A 1 154 ? 7.143  -3.067  35.570 1.00 27.96 ? 154 ARG 1 CD  1 
ATOM   1077 N NE  . ARG A 1 154 ? 6.273  -4.127  35.071 1.00 35.10 ? 154 ARG 1 NE  1 
ATOM   1078 C CZ  . ARG A 1 154 ? 5.135  -4.497  35.649 1.00 38.10 ? 154 ARG 1 CZ  1 
ATOM   1079 N NH1 . ARG A 1 154 ? 4.723  -3.891  36.756 1.00 40.10 ? 154 ARG 1 NH1 1 
ATOM   1080 N NH2 . ARG A 1 154 ? 4.410  -5.475  35.121 1.00 38.92 ? 154 ARG 1 NH2 1 
ATOM   1081 N N   . LEU A 1 155 ? 11.622 0.188   34.271 1.00 11.44 ? 155 LEU 1 N   1 
ATOM   1082 C CA  . LEU A 1 155 ? 12.378 1.412   34.515 1.00 11.98 ? 155 LEU 1 CA  1 
ATOM   1083 C C   . LEU A 1 155 ? 12.025 2.077   35.846 1.00 11.14 ? 155 LEU 1 C   1 
ATOM   1084 O O   . LEU A 1 155 ? 10.855 2.323   36.144 1.00 11.91 ? 155 LEU 1 O   1 
ATOM   1085 C CB  . LEU A 1 155 ? 12.140 2.399   33.369 1.00 9.54  ? 155 LEU 1 CB  1 
ATOM   1086 C CG  . LEU A 1 155 ? 12.888 3.734   33.406 1.00 11.58 ? 155 LEU 1 CG  1 
ATOM   1087 C CD1 . LEU A 1 155 ? 14.390 3.489   33.287 1.00 10.60 ? 155 LEU 1 CD1 1 
ATOM   1088 C CD2 . LEU A 1 155 ? 12.397 4.614   32.260 1.00 11.76 ? 155 LEU 1 CD2 1 
ATOM   1089 N N   . GLN A 1 156 ? 13.051 2.383   36.634 1.00 11.39 ? 156 GLN 1 N   1 
ATOM   1090 C CA  . GLN A 1 156 ? 12.859 3.014   37.936 1.00 10.47 ? 156 GLN 1 CA  1 
ATOM   1091 C C   . GLN A 1 156 ? 13.252 4.488   37.890 1.00 10.77 ? 156 GLN 1 C   1 
ATOM   1092 O O   . GLN A 1 156 ? 14.017 4.913   37.024 1.00 8.33  ? 156 GLN 1 O   1 
ATOM   1093 C CB  . GLN A 1 156 ? 13.709 2.307   38.996 1.00 10.62 ? 156 GLN 1 CB  1 
ATOM   1094 C CG  . GLN A 1 156 ? 13.490 0.802   39.086 1.00 10.94 ? 156 GLN 1 CG  1 
ATOM   1095 C CD  . GLN A 1 156 ? 12.152 0.438   39.706 1.00 14.54 ? 156 GLN 1 CD  1 
ATOM   1096 O OE1 . GLN A 1 156 ? 11.860 0.816   40.841 1.00 13.20 ? 156 GLN 1 OE1 1 
ATOM   1097 N NE2 . GLN A 1 156 ? 11.334 -0.302  38.965 1.00 14.18 ? 156 GLN 1 NE2 1 
ATOM   1098 N N   . GLN A 1 157 ? 12.727 5.256   38.838 1.00 9.36  ? 157 GLN 1 N   1 
ATOM   1099 C CA  . GLN A 1 157 ? 13.023 6.679   38.937 1.00 10.87 ? 157 GLN 1 CA  1 
ATOM   1100 C C   . GLN A 1 157 ? 13.156 7.052   40.406 1.00 10.56 ? 157 GLN 1 C   1 
ATOM   1101 O O   . GLN A 1 157 ? 12.672 6.337   41.280 1.00 12.46 ? 157 GLN 1 O   1 
ATOM   1102 C CB  . GLN A 1 157 ? 11.895 7.506   38.312 1.00 11.69 ? 157 GLN 1 CB  1 
ATOM   1103 C CG  . GLN A 1 157 ? 10.520 7.232   38.920 1.00 13.34 ? 157 GLN 1 CG  1 
ATOM   1104 C CD  . GLN A 1 157 ? 9.448  8.177   38.403 1.00 14.28 ? 157 GLN 1 CD  1 
ATOM   1105 O OE1 . GLN A 1 157 ? 9.429  8.524   37.226 1.00 13.84 ? 157 GLN 1 OE1 1 
ATOM   1106 N NE2 . GLN A 1 157 ? 8.538  8.581   39.283 1.00 16.32 ? 157 GLN 1 NE2 1 
ATOM   1107 N N   . ALA A 1 158 ? 13.816 8.173   40.672 1.00 12.12 ? 158 ALA 1 N   1 
ATOM   1108 C CA  . ALA A 1 158 ? 13.982 8.651   42.037 1.00 11.28 ? 158 ALA 1 CA  1 
ATOM   1109 C C   . ALA A 1 158 ? 14.357 10.118  42.033 1.00 12.21 ? 158 ALA 1 C   1 
ATOM   1110 O O   . ALA A 1 158 ? 15.160 10.556  41.210 1.00 10.12 ? 158 ALA 1 O   1 
ATOM   1111 C CB  . ALA A 1 158 ? 15.067 7.847   42.757 1.00 13.06 ? 158 ALA 1 CB  1 
ATOM   1112 N N   . SER A 1 159 ? 13.764 10.876  42.949 1.00 11.15 ? 159 SER 1 N   1 
ATOM   1113 C CA  . SER A 1 159 ? 14.073 12.291  43.084 1.00 11.75 ? 159 SER 1 CA  1 
ATOM   1114 C C   . SER A 1 159 ? 15.173 12.356  44.133 1.00 11.43 ? 159 SER 1 C   1 
ATOM   1115 O O   . SER A 1 159 ? 15.163 11.590  45.095 1.00 11.22 ? 159 SER 1 O   1 
ATOM   1116 C CB  . SER A 1 159 ? 12.849 13.071  43.578 1.00 13.81 ? 159 SER 1 CB  1 
ATOM   1117 O OG  . SER A 1 159 ? 11.795 13.005  42.635 1.00 21.54 ? 159 SER 1 OG  1 
ATOM   1118 N N   . LEU A 1 160 ? 16.126 13.258  43.947 1.00 10.18 ? 160 LEU 1 N   1 
ATOM   1119 C CA  . LEU A 1 160 ? 17.217 13.398  44.901 1.00 10.83 ? 160 LEU 1 CA  1 
ATOM   1120 C C   . LEU A 1 160 ? 17.809 14.790  44.773 1.00 10.07 ? 160 LEU 1 C   1 
ATOM   1121 O O   . LEU A 1 160 ? 17.732 15.413  43.716 1.00 10.74 ? 160 LEU 1 O   1 
ATOM   1122 C CB  . LEU A 1 160 ? 18.297 12.331  44.658 1.00 12.57 ? 160 LEU 1 CB  1 
ATOM   1123 C CG  . LEU A 1 160 ? 19.115 12.365  43.361 1.00 13.94 ? 160 LEU 1 CG  1 
ATOM   1124 C CD1 . LEU A 1 160 ? 20.139 11.239  43.391 1.00 14.11 ? 160 LEU 1 CD1 1 
ATOM   1125 C CD2 . LEU A 1 160 ? 18.209 12.222  42.150 1.00 12.98 ? 160 LEU 1 CD2 1 
ATOM   1126 N N   . PRO A 1 161 ? 18.404 15.301  45.858 1.00 10.07 ? 161 PRO 1 N   1 
ATOM   1127 C CA  . PRO A 1 161 ? 19.006 16.635  45.863 1.00 11.07 ? 161 PRO 1 CA  1 
ATOM   1128 C C   . PRO A 1 161 ? 20.460 16.696  45.413 1.00 11.81 ? 161 PRO 1 C   1 
ATOM   1129 O O   . PRO A 1 161 ? 21.214 15.736  45.570 1.00 10.91 ? 161 PRO 1 O   1 
ATOM   1130 C CB  . PRO A 1 161 ? 18.857 17.058  47.317 1.00 12.50 ? 161 PRO 1 CB  1 
ATOM   1131 C CG  . PRO A 1 161 ? 19.148 15.774  48.036 1.00 12.69 ? 161 PRO 1 CG  1 
ATOM   1132 C CD  . PRO A 1 161 ? 18.371 14.737  47.223 1.00 11.68 ? 161 PRO 1 CD  1 
ATOM   1133 N N   . LEU A 1 162 ? 20.846 17.837  44.853 1.00 11.68 ? 162 LEU 1 N   1 
ATOM   1134 C CA  . LEU A 1 162 ? 22.224 18.047  44.429 1.00 11.78 ? 162 LEU 1 CA  1 
ATOM   1135 C C   . LEU A 1 162 ? 22.987 18.569  45.642 1.00 12.53 ? 162 LEU 1 C   1 
ATOM   1136 O O   . LEU A 1 162 ? 22.419 19.265  46.483 1.00 12.38 ? 162 LEU 1 O   1 
ATOM   1137 C CB  . LEU A 1 162 ? 22.298 19.098  43.321 1.00 11.68 ? 162 LEU 1 CB  1 
ATOM   1138 C CG  . LEU A 1 162 ? 21.548 18.852  42.013 1.00 11.98 ? 162 LEU 1 CG  1 
ATOM   1139 C CD1 . LEU A 1 162 ? 21.797 20.025  41.083 1.00 9.75  ? 162 LEU 1 CD1 1 
ATOM   1140 C CD2 . LEU A 1 162 ? 22.014 17.551  41.373 1.00 13.98 ? 162 LEU 1 CD2 1 
ATOM   1141 N N   . LEU A 1 163 ? 24.268 18.232  45.731 1.00 13.60 ? 163 LEU 1 N   1 
ATOM   1142 C CA  . LEU A 1 163 ? 25.105 18.698  46.829 1.00 14.90 ? 163 LEU 1 CA  1 
ATOM   1143 C C   . LEU A 1 163 ? 26.196 19.559  46.211 1.00 16.64 ? 163 LEU 1 C   1 
ATOM   1144 O O   . LEU A 1 163 ? 26.385 19.541  44.997 1.00 17.65 ? 163 LEU 1 O   1 
ATOM   1145 C CB  . LEU A 1 163 ? 25.755 17.517  47.558 1.00 15.76 ? 163 LEU 1 CB  1 
ATOM   1146 C CG  . LEU A 1 163 ? 24.903 16.346  48.058 1.00 18.72 ? 163 LEU 1 CG  1 
ATOM   1147 C CD1 . LEU A 1 163 ? 25.796 15.399  48.857 1.00 20.95 ? 163 LEU 1 CD1 1 
ATOM   1148 C CD2 . LEU A 1 163 ? 23.764 16.844  48.928 1.00 22.28 ? 163 LEU 1 CD2 1 
ATOM   1149 N N   . SER A 1 164 ? 26.912 20.320  47.032 1.00 17.72 ? 164 SER 1 N   1 
ATOM   1150 C CA  . SER A 1 164 ? 28.003 21.134  46.506 1.00 19.69 ? 164 SER 1 CA  1 
ATOM   1151 C C   . SER A 1 164 ? 29.244 20.244  46.567 1.00 18.92 ? 164 SER 1 C   1 
ATOM   1152 O O   . SER A 1 164 ? 29.308 19.327  47.384 1.00 19.08 ? 164 SER 1 O   1 
ATOM   1153 C CB  . SER A 1 164 ? 28.219 22.381  47.366 1.00 20.47 ? 164 SER 1 CB  1 
ATOM   1154 O OG  . SER A 1 164 ? 28.747 22.036  48.635 1.00 22.42 ? 164 SER 1 OG  1 
ATOM   1155 N N   . ASN A 1 165 ? 30.221 20.503  45.707 1.00 20.46 ? 165 ASN 1 N   1 
ATOM   1156 C CA  . ASN A 1 165 ? 31.438 19.699  45.698 1.00 21.78 ? 165 ASN 1 CA  1 
ATOM   1157 C C   . ASN A 1 165 ? 32.198 19.813  47.011 1.00 22.88 ? 165 ASN 1 C   1 
ATOM   1158 O O   . ASN A 1 165 ? 32.821 18.851  47.459 1.00 22.69 ? 165 ASN 1 O   1 
ATOM   1159 C CB  . ASN A 1 165 ? 32.332 20.104  44.526 1.00 22.49 ? 165 ASN 1 CB  1 
ATOM   1160 C CG  . ASN A 1 165 ? 32.011 19.327  43.262 1.00 23.77 ? 165 ASN 1 CG  1 
ATOM   1161 O OD1 . ASN A 1 165 ? 30.857 18.972  43.020 1.00 24.72 ? 165 ASN 1 OD1 1 
ATOM   1162 N ND2 . ASN A 1 165 ? 33.029 19.067  42.445 1.00 22.98 ? 165 ASN 1 ND2 1 
ATOM   1163 N N   . THR A 1 166 ? 32.139 20.986  47.632 1.00 23.93 ? 166 THR 1 N   1 
ATOM   1164 C CA  . THR A 1 166 ? 32.822 21.199  48.902 1.00 25.83 ? 166 THR 1 CA  1 
ATOM   1165 C C   . THR A 1 166 ? 32.227 20.262  49.946 1.00 24.86 ? 166 THR 1 C   1 
ATOM   1166 O O   . THR A 1 166 ? 32.950 19.565  50.655 1.00 25.29 ? 166 THR 1 O   1 
ATOM   1167 C CB  . THR A 1 166 ? 32.665 22.657  49.382 1.00 27.42 ? 166 THR 1 CB  1 
ATOM   1168 O OG1 . THR A 1 166 ? 33.280 23.539  48.435 1.00 29.67 ? 166 THR 1 OG1 1 
ATOM   1169 C CG2 . THR A 1 166 ? 33.317 22.846  50.745 1.00 27.64 ? 166 THR 1 CG2 1 
ATOM   1170 N N   . ASN A 1 167 ? 30.901 20.241  50.027 1.00 23.73 ? 167 ASN 1 N   1 
ATOM   1171 C CA  . ASN A 1 167 ? 30.210 19.385  50.982 1.00 23.36 ? 167 ASN 1 CA  1 
ATOM   1172 C C   . ASN A 1 167 ? 30.349 17.904  50.636 1.00 22.40 ? 167 ASN 1 C   1 
ATOM   1173 O O   . ASN A 1 167 ? 30.340 17.048  51.522 1.00 22.28 ? 167 ASN 1 O   1 
ATOM   1174 C CB  . ASN A 1 167 ? 28.727 19.755  51.044 1.00 25.92 ? 167 ASN 1 CB  1 
ATOM   1175 C CG  . ASN A 1 167 ? 27.951 18.874  52.002 1.00 29.32 ? 167 ASN 1 CG  1 
ATOM   1176 O OD1 . ASN A 1 167 ? 28.282 18.783  53.185 1.00 33.55 ? 167 ASN 1 OD1 1 
ATOM   1177 N ND2 . ASN A 1 167 ? 26.912 18.217  51.496 1.00 29.87 ? 167 ASN 1 ND2 1 
ATOM   1178 N N   . CYS A 1 168 ? 30.476 17.599  49.348 1.00 20.51 ? 168 CYS 1 N   1 
ATOM   1179 C CA  . CYS A 1 168 ? 30.608 16.212  48.927 1.00 18.83 ? 168 CYS 1 CA  1 
ATOM   1180 C C   . CYS A 1 168 ? 31.942 15.639  49.377 1.00 19.60 ? 168 CYS 1 C   1 
ATOM   1181 O O   . CYS A 1 168 ? 32.045 14.453  49.683 1.00 20.57 ? 168 CYS 1 O   1 
ATOM   1182 C CB  . CYS A 1 168 ? 30.506 16.090  47.407 1.00 17.99 ? 168 CYS 1 CB  1 
ATOM   1183 S SG  . CYS A 1 168 ? 30.285 14.365  46.864 1.00 16.14 ? 168 CYS 1 SG  1 
ATOM   1184 N N   . LYS A 1 169 ? 32.964 16.487  49.405 1.00 21.26 ? 169 LYS 1 N   1 
ATOM   1185 C CA  . LYS A 1 169 ? 34.298 16.060  49.812 1.00 23.37 ? 169 LYS 1 CA  1 
ATOM   1186 C C   . LYS A 1 169 ? 34.326 15.576  51.256 1.00 23.99 ? 169 LYS 1 C   1 
ATOM   1187 O O   . LYS A 1 169 ? 35.239 14.853  51.659 1.00 22.95 ? 169 LYS 1 O   1 
ATOM   1188 C CB  . LYS A 1 169 ? 35.298 17.200  49.614 1.00 25.15 ? 169 LYS 1 CB  1 
ATOM   1189 C CG  . LYS A 1 169 ? 35.488 17.582  48.156 1.00 27.49 ? 169 LYS 1 CG  1 
ATOM   1190 C CD  . LYS A 1 169 ? 36.553 18.646  47.987 1.00 29.88 ? 169 LYS 1 CD  1 
ATOM   1191 C CE  . LYS A 1 169 ? 36.753 18.985  46.520 1.00 31.53 ? 169 LYS 1 CE  1 
ATOM   1192 N NZ  . LYS A 1 169 ? 37.854 19.968  46.330 1.00 34.11 ? 169 LYS 1 NZ  1 
ATOM   1193 N N   . LYS A 1 170 ? 33.329 15.971  52.040 1.00 24.38 ? 170 LYS 1 N   1 
ATOM   1194 C CA  . LYS A 1 170 ? 33.271 15.523  53.423 1.00 25.64 ? 170 LYS 1 CA  1 
ATOM   1195 C C   . LYS A 1 170 ? 33.019 14.022  53.406 1.00 24.93 ? 170 LYS 1 C   1 
ATOM   1196 O O   . LYS A 1 170 ? 33.307 13.321  54.373 1.00 25.32 ? 170 LYS 1 O   1 
ATOM   1197 C CB  . LYS A 1 170 ? 32.144 16.232  54.179 1.00 28.27 ? 170 LYS 1 CB  1 
ATOM   1198 C CG  . LYS A 1 170 ? 32.338 17.735  54.320 1.00 32.36 ? 170 LYS 1 CG  1 
ATOM   1199 C CD  . LYS A 1 170 ? 31.248 18.356  55.188 1.00 35.79 ? 170 LYS 1 CD  1 
ATOM   1200 C CE  . LYS A 1 170 ? 31.296 17.815  56.613 1.00 38.06 ? 170 LYS 1 CE  1 
ATOM   1201 N NZ  . LYS A 1 170 ? 30.205 18.364  57.468 1.00 40.20 ? 170 LYS 1 NZ  1 
ATOM   1202 N N   . TYR A 1 171 ? 32.487 13.537  52.286 1.00 23.54 ? 171 TYR 1 N   1 
ATOM   1203 C CA  . TYR A 1 171 ? 32.182 12.120  52.108 1.00 23.86 ? 171 TYR 1 CA  1 
ATOM   1204 C C   . TYR A 1 171 ? 33.255 11.369  51.328 1.00 23.37 ? 171 TYR 1 C   1 
ATOM   1205 O O   . TYR A 1 171 ? 33.700 10.293  51.735 1.00 23.56 ? 171 TYR 1 O   1 
ATOM   1206 C CB  . TYR A 1 171 ? 30.867 11.952  51.343 1.00 25.50 ? 171 TYR 1 CB  1 
ATOM   1207 C CG  . TYR A 1 171 ? 29.614 12.269  52.117 1.00 25.06 ? 171 TYR 1 CG  1 
ATOM   1208 C CD1 . TYR A 1 171 ? 29.033 11.320  52.960 1.00 25.81 ? 171 TYR 1 CD1 1 
ATOM   1209 C CD2 . TYR A 1 171 ? 28.981 13.503  51.977 1.00 25.31 ? 171 TYR 1 CD2 1 
ATOM   1210 C CE1 . TYR A 1 171 ? 27.847 11.591  53.638 1.00 25.05 ? 171 TYR 1 CE1 1 
ATOM   1211 C CE2 . TYR A 1 171 ? 27.798 13.784  52.652 1.00 26.33 ? 171 TYR 1 CE2 1 
ATOM   1212 C CZ  . TYR A 1 171 ? 27.237 12.823  53.478 1.00 25.15 ? 171 TYR 1 CZ  1 
ATOM   1213 O OH  . TYR A 1 171 ? 26.062 13.095  54.136 1.00 26.44 ? 171 TYR 1 OH  1 
ATOM   1214 N N   . TRP A 1 172 ? 33.657 11.938  50.197 1.00 21.99 ? 172 TRP 1 N   1 
ATOM   1215 C CA  . TRP A 1 172 ? 34.630 11.295  49.325 1.00 21.40 ? 172 TRP 1 CA  1 
ATOM   1216 C C   . TRP A 1 172 ? 36.029 11.901  49.289 1.00 21.52 ? 172 TRP 1 C   1 
ATOM   1217 O O   . TRP A 1 172 ? 36.895 11.416  48.563 1.00 21.24 ? 172 TRP 1 O   1 
ATOM   1218 C CB  . TRP A 1 172 ? 34.066 11.239  47.904 1.00 18.83 ? 172 TRP 1 CB  1 
ATOM   1219 C CG  . TRP A 1 172 ? 32.825 10.416  47.795 1.00 17.25 ? 172 TRP 1 CG  1 
ATOM   1220 C CD1 . TRP A 1 172 ? 31.555 10.865  47.553 1.00 16.28 ? 172 TRP 1 CD1 1 
ATOM   1221 C CD2 . TRP A 1 172 ? 32.734 8.993   47.899 1.00 16.21 ? 172 TRP 1 CD2 1 
ATOM   1222 N NE1 . TRP A 1 172 ? 30.682 9.805   47.495 1.00 13.78 ? 172 TRP 1 NE1 1 
ATOM   1223 C CE2 . TRP A 1 172 ? 31.379 8.644   47.704 1.00 16.38 ? 172 TRP 1 CE2 1 
ATOM   1224 C CE3 . TRP A 1 172 ? 33.669 7.975   48.136 1.00 17.39 ? 172 TRP 1 CE3 1 
ATOM   1225 C CZ2 . TRP A 1 172 ? 30.935 7.318   47.736 1.00 17.66 ? 172 TRP 1 CZ2 1 
ATOM   1226 C CZ3 . TRP A 1 172 ? 33.228 6.658   48.169 1.00 18.43 ? 172 TRP 1 CZ3 1 
ATOM   1227 C CH2 . TRP A 1 172 ? 31.871 6.342   47.970 1.00 19.39 ? 172 TRP 1 CH2 1 
ATOM   1228 N N   . GLY A 1 173 ? 36.248 12.959  50.060 1.00 21.35 ? 173 GLY 1 N   1 
ATOM   1229 C CA  . GLY A 1 173 ? 37.558 13.581  50.085 1.00 21.84 ? 173 GLY 1 CA  1 
ATOM   1230 C C   . GLY A 1 173 ? 38.051 14.089  48.743 1.00 22.68 ? 173 GLY 1 C   1 
ATOM   1231 O O   . GLY A 1 173 ? 37.297 14.697  47.981 1.00 22.09 ? 173 GLY 1 O   1 
ATOM   1232 N N   . THR A 1 174 ? 39.323 13.826  48.451 1.00 21.92 ? 174 THR 1 N   1 
ATOM   1233 C CA  . THR A 1 174 ? 39.949 14.279  47.213 1.00 23.54 ? 174 THR 1 CA  1 
ATOM   1234 C C   . THR A 1 174 ? 39.566 13.510  45.951 1.00 22.68 ? 174 THR 1 C   1 
ATOM   1235 O O   . THR A 1 174 ? 40.071 13.809  44.871 1.00 24.19 ? 174 THR 1 O   1 
ATOM   1236 C CB  . THR A 1 174 ? 41.488 14.262  47.339 1.00 24.94 ? 174 THR 1 CB  1 
ATOM   1237 O OG1 . THR A 1 174 ? 41.925 12.948  47.707 1.00 26.82 ? 174 THR 1 OG1 1 
ATOM   1238 C CG2 . THR A 1 174 ? 41.943 15.254  48.395 1.00 27.10 ? 174 THR 1 CG2 1 
ATOM   1239 N N   . LYS A 1 175 ? 38.682 12.526  46.078 1.00 22.02 ? 175 LYS 1 N   1 
ATOM   1240 C CA  . LYS A 1 175 ? 38.254 11.755  44.915 1.00 20.45 ? 175 LYS 1 CA  1 
ATOM   1241 C C   . LYS A 1 175 ? 37.301 12.578  44.054 1.00 20.04 ? 175 LYS 1 C   1 
ATOM   1242 O O   . LYS A 1 175 ? 37.075 12.263  42.884 1.00 20.11 ? 175 LYS 1 O   1 
ATOM   1243 C CB  . LYS A 1 175 ? 37.569 10.456  45.355 1.00 22.06 ? 175 LYS 1 CB  1 
ATOM   1244 C CG  . LYS A 1 175 ? 38.507 9.468   46.041 1.00 25.35 ? 175 LYS 1 CG  1 
ATOM   1245 C CD  . LYS A 1 175 ? 37.776 8.221   46.529 1.00 29.35 ? 175 LYS 1 CD  1 
ATOM   1246 C CE  . LYS A 1 175 ? 37.225 7.387   45.377 1.00 31.35 ? 175 LYS 1 CE  1 
ATOM   1247 N NZ  . LYS A 1 175 ? 38.298 6.804   44.517 1.00 34.88 ? 175 LYS 1 NZ  1 
ATOM   1248 N N   . ILE A 1 176 ? 36.750 13.637  44.640 1.00 18.92 ? 176 ILE 1 N   1 
ATOM   1249 C CA  . ILE A 1 176 ? 35.816 14.513  43.940 1.00 18.87 ? 176 ILE 1 CA  1 
ATOM   1250 C C   . ILE A 1 176 ? 36.559 15.568  43.124 1.00 19.58 ? 176 ILE 1 C   1 
ATOM   1251 O O   . ILE A 1 176 ? 37.243 16.426  43.684 1.00 19.62 ? 176 ILE 1 O   1 
ATOM   1252 C CB  . ILE A 1 176 ? 34.871 15.227  44.941 1.00 18.34 ? 176 ILE 1 CB  1 
ATOM   1253 C CG1 . ILE A 1 176 ? 34.115 14.190  45.779 1.00 18.36 ? 176 ILE 1 CG1 1 
ATOM   1254 C CG2 . ILE A 1 176 ? 33.897 16.128  44.194 1.00 20.39 ? 176 ILE 1 CG2 1 
ATOM   1255 C CD1 . ILE A 1 176 ? 33.326 13.176  44.964 1.00 17.86 ? 176 ILE 1 CD1 1 
ATOM   1256 N N   . LYS A 1 177 ? 36.419 15.500  41.801 1.00 18.87 ? 177 LYS 1 N   1 
ATOM   1257 C CA  . LYS A 1 177 ? 37.073 16.449  40.899 1.00 19.75 ? 177 LYS 1 CA  1 
ATOM   1258 C C   . LYS A 1 177 ? 36.070 17.472  40.371 1.00 19.28 ? 177 LYS 1 C   1 
ATOM   1259 O O   . LYS A 1 177 ? 34.865 17.338  40.576 1.00 18.09 ? 177 LYS 1 O   1 
ATOM   1260 C CB  . LYS A 1 177 ? 37.713 15.709  39.719 1.00 20.97 ? 177 LYS 1 CB  1 
ATOM   1261 C CG  . LYS A 1 177 ? 38.608 14.541  40.112 1.00 22.25 ? 177 LYS 1 CG  1 
ATOM   1262 C CD  . LYS A 1 177 ? 39.768 14.972  40.996 1.00 25.71 ? 177 LYS 1 CD  1 
ATOM   1263 C CE  . LYS A 1 177 ? 40.651 13.774  41.335 1.00 27.87 ? 177 LYS 1 CE  1 
ATOM   1264 N NZ  . LYS A 1 177 ? 41.793 14.119  42.230 1.00 29.68 ? 177 LYS 1 NZ  1 
ATOM   1265 N N   . ASP A 1 178 ? 36.575 18.489  39.680 1.00 19.66 ? 178 ASP 1 N   1 
ATOM   1266 C CA  . ASP A 1 178 ? 35.733 19.546  39.130 1.00 20.17 ? 178 ASP 1 CA  1 
ATOM   1267 C C   . ASP A 1 178 ? 34.716 19.092  38.086 1.00 17.45 ? 178 ASP 1 C   1 
ATOM   1268 O O   . ASP A 1 178 ? 33.668 19.718  37.935 1.00 16.05 ? 178 ASP 1 O   1 
ATOM   1269 C CB  . ASP A 1 178 ? 36.609 20.651  38.536 1.00 27.06 ? 178 ASP 1 CB  1 
ATOM   1270 C CG  . ASP A 1 178 ? 36.970 21.715  39.552 1.00 32.57 ? 178 ASP 1 CG  1 
ATOM   1271 O OD1 . ASP A 1 178 ? 37.289 21.354  40.707 1.00 36.00 ? 178 ASP 1 OD1 1 
ATOM   1272 O OD2 . ASP A 1 178 ? 36.940 22.913  39.194 1.00 37.34 ? 178 ASP 1 OD2 1 
ATOM   1273 N N   . ALA A 1 179 ? 35.018 18.014  37.367 1.00 14.05 ? 179 ALA 1 N   1 
ATOM   1274 C CA  . ALA A 1 179 ? 34.100 17.518  36.344 1.00 13.18 ? 179 ALA 1 CA  1 
ATOM   1275 C C   . ALA A 1 179 ? 33.125 16.491  36.917 1.00 11.69 ? 179 ALA 1 C   1 
ATOM   1276 O O   . ALA A 1 179 ? 32.574 15.663  36.194 1.00 9.38  ? 179 ALA 1 O   1 
ATOM   1277 C CB  . ALA A 1 179 ? 34.883 16.914  35.176 1.00 12.39 ? 179 ALA 1 CB  1 
ATOM   1278 N N   . MET A 1 180 ? 32.922 16.549  38.227 1.00 11.93 ? 180 MET 1 N   1 
ATOM   1279 C CA  . MET A 1 180 ? 31.999 15.646  38.896 1.00 12.53 ? 180 MET 1 CA  1 
ATOM   1280 C C   . MET A 1 180 ? 31.013 16.489  39.683 1.00 12.57 ? 180 MET 1 C   1 
ATOM   1281 O O   . MET A 1 180 ? 31.314 17.621  40.060 1.00 13.09 ? 180 MET 1 O   1 
ATOM   1282 C CB  . MET A 1 180 ? 32.734 14.731  39.877 1.00 12.94 ? 180 MET 1 CB  1 
ATOM   1283 C CG  . MET A 1 180 ? 33.772 13.816  39.265 1.00 14.58 ? 180 MET 1 CG  1 
ATOM   1284 S SD  . MET A 1 180 ? 34.628 12.866  40.546 1.00 14.31 ? 180 MET 1 SD  1 
ATOM   1285 C CE  . MET A 1 180 ? 35.927 12.083  39.544 1.00 13.57 ? 180 MET 1 CE  1 
ATOM   1286 N N   . ILE A 1 181 ? 29.834 15.931  39.925 1.00 12.21 ? 181 ILE 1 N   1 
ATOM   1287 C CA  . ILE A 1 181 ? 28.814 16.607  40.712 1.00 11.91 ? 181 ILE 1 CA  1 
ATOM   1288 C C   . ILE A 1 181 ? 28.144 15.514  41.531 1.00 11.59 ? 181 ILE 1 C   1 
ATOM   1289 O O   . ILE A 1 181 ? 27.898 14.418  41.029 1.00 11.25 ? 181 ILE 1 O   1 
ATOM   1290 C CB  . ILE A 1 181 ? 27.771 17.333  39.819 1.00 12.73 ? 181 ILE 1 CB  1 
ATOM   1291 C CG1 . ILE A 1 181 ? 26.759 18.061  40.707 1.00 12.75 ? 181 ILE 1 CG1 1 
ATOM   1292 C CG2 . ILE A 1 181 ? 27.069 16.337  38.893 1.00 13.46 ? 181 ILE 1 CG2 1 
ATOM   1293 C CD1 . ILE A 1 181 ? 25.766 18.905  39.932 1.00 15.47 ? 181 ILE 1 CD1 1 
ATOM   1294 N N   . CYS A 1 182 ? 27.876 15.798  42.800 1.00 11.01 ? 182 CYS 1 N   1 
ATOM   1295 C CA  . CYS A 1 182 ? 27.257 14.806  43.668 1.00 11.06 ? 182 CYS 1 CA  1 
ATOM   1296 C C   . CYS A 1 182 ? 25.776 15.049  43.908 1.00 11.82 ? 182 CYS 1 C   1 
ATOM   1297 O O   . CYS A 1 182 ? 25.301 16.181  43.855 1.00 12.01 ? 182 CYS 1 O   1 
ATOM   1298 C CB  . CYS A 1 182 ? 27.970 14.774  45.013 1.00 13.26 ? 182 CYS 1 CB  1 
ATOM   1299 S SG  . CYS A 1 182 ? 29.771 14.551  44.913 1.00 14.37 ? 182 CYS 1 SG  1 
ATOM   1300 N N   . ALA A 1 183 ? 25.056 13.966  44.181 1.00 11.76 ? 183 ALA 1 N   1 
ATOM   1301 C CA  . ALA A 1 183 ? 23.627 14.032  44.456 1.00 11.91 ? 183 ALA 1 CA  1 
ATOM   1302 C C   . ALA A 1 183 ? 23.228 12.790  45.241 1.00 13.21 ? 183 ALA 1 C   1 
ATOM   1303 O O   . ALA A 1 183 ? 23.832 11.726  45.087 1.00 13.24 ? 183 ALA 1 O   1 
ATOM   1304 C CB  . ALA A 1 183 ? 22.839 14.102  43.151 1.00 12.40 ? 183 ALA 1 CB  1 
ATOM   1305 N N   . GLY A 1 184 ? 22.214 12.927  46.087 1.00 12.19 ? 184 GLY 1 N   1 
ATOM   1306 C CA  . GLY A 1 184 ? 21.770 11.788  46.864 1.00 10.75 ? 184 GLY 1 CA  1 
ATOM   1307 C C   . GLY A 1 184 ? 21.961 11.949  48.358 1.00 12.62 ? 184 GLY 1 C   1 
ATOM   1308 O O   . GLY A 1 184 ? 21.765 13.039  48.901 1.00 11.69 ? 184 GLY 1 O   1 
ATOM   1309 N N   . ALA A 1 185 ? 22.357 10.859  49.013 1.00 11.66 ? 185 ALA 1 N   1 
ATOM   1310 C CA  . ALA A 1 185 ? 22.549 10.830  50.463 1.00 12.61 ? 185 ALA 1 CA  1 
ATOM   1311 C C   . ALA A 1 185 ? 21.218 11.194  51.107 1.00 12.97 ? 185 ALA 1 C   1 
ATOM   1312 O O   . ALA A 1 185 ? 21.166 11.645  52.251 1.00 14.47 ? 185 ALA 1 O   1 
ATOM   1313 C CB  . ALA A 1 185 ? 23.630 11.829  50.879 1.00 12.51 ? 185 ALA 1 CB  1 
ATOM   1314 N N   . SER A 1 186 ? 20.140 10.956  50.367 1.00 13.24 ? 186 SER 1 N   1 
ATOM   1315 C CA  . SER A 1 186 ? 18.797 11.303  50.809 1.00 13.13 ? 186 SER 1 CA  1 
ATOM   1316 C C   . SER A 1 186 ? 17.835 10.138  51.033 1.00 13.95 ? 186 SER 1 C   1 
ATOM   1317 O O   . SER A 1 186 ? 16.637 10.356  51.216 1.00 15.13 ? 186 SER 1 O   1 
ATOM   1318 C CB  . SER A 1 186 ? 18.181 12.245  49.782 1.00 13.36 ? 186 SER 1 CB  1 
ATOM   1319 O OG  . SER A 1 186 ? 18.197 11.624  48.504 1.00 15.19 ? 186 SER 1 OG  1 
ATOM   1320 N N   . GLY A 1 187 ? 18.341 8.911   51.020 1.00 12.25 ? 187 GLY 1 N   1 
ATOM   1321 C CA  . GLY A 1 187 ? 17.464 7.773   51.215 1.00 13.17 ? 187 GLY 1 CA  1 
ATOM   1322 C C   . GLY A 1 187 ? 17.312 6.938   49.954 1.00 13.16 ? 187 GLY 1 C   1 
ATOM   1323 O O   . GLY A 1 187 ? 16.645 5.902   49.962 1.00 15.23 ? 187 GLY 1 O   1 
ATOM   1324 N N   . VAL A 1 188 ? 17.912 7.404   48.862 1.00 13.14 ? 188 VAL 1 N   1 
ATOM   1325 C CA  . VAL A 1 188 ? 17.878 6.685   47.593 1.00 12.85 ? 188 VAL 1 CA  1 
ATOM   1326 C C   . VAL A 1 188 ? 19.305 6.674   47.061 1.00 12.44 ? 188 VAL 1 C   1 
ATOM   1327 O O   . VAL A 1 188 ? 20.154 7.425   47.535 1.00 12.23 ? 188 VAL 1 O   1 
ATOM   1328 C CB  . VAL A 1 188 ? 16.969 7.378   46.537 1.00 14.04 ? 188 VAL 1 CB  1 
ATOM   1329 C CG1 . VAL A 1 188 ? 15.537 7.455   47.042 1.00 14.51 ? 188 VAL 1 CG1 1 
ATOM   1330 C CG2 . VAL A 1 188 ? 17.506 8.767   46.212 1.00 14.93 ? 188 VAL 1 CG2 1 
ATOM   1331 N N   . SER A 1 189 ? 19.571 5.826   46.077 1.00 13.53 ? 189 SER 1 N   1 
ATOM   1332 C CA  . SER A 1 189 ? 20.909 5.760   45.509 1.00 13.21 ? 189 SER 1 CA  1 
ATOM   1333 C C   . SER A 1 189 ? 20.930 5.093   44.147 1.00 12.50 ? 189 SER 1 C   1 
ATOM   1334 O O   . SER A 1 189 ? 20.183 4.148   43.904 1.00 10.74 ? 189 SER 1 O   1 
ATOM   1335 C CB  . SER A 1 189 ? 21.837 4.983   46.442 1.00 15.16 ? 189 SER 1 CB  1 
ATOM   1336 O OG  . SER A 1 189 ? 23.105 4.776   45.841 1.00 19.24 ? 189 SER 1 OG  1 
ATOM   1337 N N   . SER A 1 190 ? 21.772 5.607   43.254 1.00 11.51 ? 190 SER 1 N   1 
ATOM   1338 C CA  . SER A 1 190 ? 21.932 4.985   41.948 1.00 10.24 ? 190 SER 1 CA  1 
ATOM   1339 C C   . SER A 1 190 ? 22.753 3.748   42.312 1.00 11.40 ? 190 SER 1 C   1 
ATOM   1340 O O   . SER A 1 190 ? 23.400 3.729   43.359 1.00 12.35 ? 190 SER 1 O   1 
ATOM   1341 C CB  . SER A 1 190 ? 22.718 5.897   41.003 1.00 9.99  ? 190 SER 1 CB  1 
ATOM   1342 O OG  . SER A 1 190 ? 21.909 6.986   40.580 1.00 10.59 ? 190 SER 1 OG  1 
ATOM   1343 N N   . CYS A 1 191 ? 22.733 2.721   41.474 1.00 10.62 ? 191 CYS 1 N   1 
ATOM   1344 C CA  . CYS A 1 191 ? 23.471 1.502   41.798 1.00 12.28 ? 191 CYS 1 CA  1 
ATOM   1345 C C   . CYS A 1 191 ? 23.976 0.832   40.520 1.00 12.83 ? 191 CYS 1 C   1 
ATOM   1346 O O   . CYS A 1 191 ? 23.739 1.335   39.423 1.00 14.04 ? 191 CYS 1 O   1 
ATOM   1347 C CB  . CYS A 1 191 ? 22.545 0.566   42.585 1.00 11.87 ? 191 CYS 1 CB  1 
ATOM   1348 S SG  . CYS A 1 191 ? 23.342 -0.746  43.565 1.00 14.28 ? 191 CYS 1 SG  1 
ATOM   1349 N N   . MET A 1 192 ? 24.679 -0.291  40.653 1.00 13.76 ? 192 MET 1 N   1 
ATOM   1350 C CA  . MET A 1 192 ? 25.203 -0.979  39.472 1.00 14.14 ? 192 MET 1 CA  1 
ATOM   1351 C C   . MET A 1 192 ? 24.138 -1.192  38.404 1.00 12.75 ? 192 MET 1 C   1 
ATOM   1352 O O   . MET A 1 192 ? 23.051 -1.695  38.689 1.00 13.15 ? 192 MET 1 O   1 
ATOM   1353 C CB  . MET A 1 192 ? 25.817 -2.332  39.844 1.00 16.89 ? 192 MET 1 CB  1 
ATOM   1354 C CG  . MET A 1 192 ? 27.133 -2.232  40.595 1.00 22.30 ? 192 MET 1 CG  1 
ATOM   1355 S SD  . MET A 1 192 ? 26.887 -1.782  42.306 1.00 29.28 ? 192 MET 1 SD  1 
ATOM   1356 C CE  . MET A 1 192 ? 26.361 -3.338  42.963 1.00 24.88 ? 192 MET 1 CE  1 
ATOM   1357 N N   . GLY A 1 193 ? 24.466 -0.817  37.170 1.00 11.39 ? 193 GLY 1 N   1 
ATOM   1358 C CA  . GLY A 1 193 ? 23.522 -0.966  36.075 1.00 10.60 ? 193 GLY 1 CA  1 
ATOM   1359 C C   . GLY A 1 193 ? 22.868 0.356   35.711 1.00 11.15 ? 193 GLY 1 C   1 
ATOM   1360 O O   . GLY A 1 193 ? 22.252 0.485   34.653 1.00 11.89 ? 193 GLY 1 O   1 
ATOM   1361 N N   . ASP A 1 194 ? 22.995 1.340   36.599 1.00 10.15 ? 194 ASP 1 N   1 
ATOM   1362 C CA  . ASP A 1 194 ? 22.435 2.667   36.366 1.00 9.00  ? 194 ASP 1 CA  1 
ATOM   1363 C C   . ASP A 1 194 ? 23.451 3.533   35.634 1.00 8.42  ? 194 ASP 1 C   1 
ATOM   1364 O O   . ASP A 1 194 ? 23.093 4.547   35.047 1.00 9.77  ? 194 ASP 1 O   1 
ATOM   1365 C CB  . ASP A 1 194 ? 22.093 3.349   37.695 1.00 9.18  ? 194 ASP 1 CB  1 
ATOM   1366 C CG  . ASP A 1 194 ? 20.787 2.866   38.286 1.00 9.70  ? 194 ASP 1 CG  1 
ATOM   1367 O OD1 . ASP A 1 194 ? 19.828 2.643   37.520 1.00 9.13  ? 194 ASP 1 OD1 1 
ATOM   1368 O OD2 . ASP A 1 194 ? 20.721 2.728   39.525 1.00 10.38 ? 194 ASP 1 OD2 1 
ATOM   1369 N N   . SER A 1 195 ? 24.720 3.132   35.693 1.00 8.56  ? 195 SER 1 N   1 
ATOM   1370 C CA  . SER A 1 195 ? 25.806 3.877   35.060 1.00 9.95  ? 195 SER 1 CA  1 
ATOM   1371 C C   . SER A 1 195 ? 25.506 4.285   33.626 1.00 8.12  ? 195 SER 1 C   1 
ATOM   1372 O O   . SER A 1 195 ? 24.923 3.518   32.868 1.00 7.90  ? 195 SER 1 O   1 
ATOM   1373 C CB  . SER A 1 195 ? 27.104 3.053   35.122 1.00 15.14 ? 195 SER 1 CB  1 
ATOM   1374 O OG  . SER A 1 195 ? 27.444 2.938   36.533 1.00 23.45 ? 195 SER 1 OG  1 
ATOM   1375 N N   . GLY A 1 196 ? 25.913 5.503   33.273 1.00 6.24  ? 196 GLY 1 N   1 
ATOM   1376 C CA  . GLY A 1 196 ? 25.694 6.014   31.932 1.00 7.43  ? 196 GLY 1 CA  1 
ATOM   1377 C C   . GLY A 1 196 ? 24.356 6.719   31.787 1.00 10.14 ? 196 GLY 1 C   1 
ATOM   1378 O O   . GLY A 1 196 ? 24.165 7.522   30.865 1.00 9.28  ? 196 GLY 1 O   1 
ATOM   1379 N N   . GLY A 1 197 ? 23.438 6.406   32.698 1.00 7.80  ? 197 GLY 1 N   1 
ATOM   1380 C CA  . GLY A 1 197 ? 22.109 6.996   32.686 1.00 9.94  ? 197 GLY 1 CA  1 
ATOM   1381 C C   . GLY A 1 197 ? 22.082 8.470   33.049 1.00 10.10 ? 197 GLY 1 C   1 
ATOM   1382 O O   . GLY A 1 197 ? 23.097 9.033   33.444 1.00 9.37  ? 197 GLY 1 O   1 
ATOM   1383 N N   . PRO A 1 198 ? 20.910 9.114   32.957 1.00 9.88  ? 198 PRO 1 N   1 
ATOM   1384 C CA  . PRO A 1 198 ? 20.757 10.537  33.263 1.00 9.21  ? 198 PRO 1 CA  1 
ATOM   1385 C C   . PRO A 1 198 ? 20.397 10.988  34.675 1.00 9.11  ? 198 PRO 1 C   1 
ATOM   1386 O O   . PRO A 1 198 ? 19.748 10.275  35.441 1.00 8.31  ? 198 PRO 1 O   1 
ATOM   1387 C CB  . PRO A 1 198 ? 19.670 10.959  32.290 1.00 10.00 ? 198 PRO 1 CB  1 
ATOM   1388 C CG  . PRO A 1 198 ? 18.725 9.782   32.390 1.00 9.90  ? 198 PRO 1 CG  1 
ATOM   1389 C CD  . PRO A 1 198 ? 19.686 8.584   32.325 1.00 8.98  ? 198 PRO 1 CD  1 
ATOM   1390 N N   . LEU A 1 199 ? 20.840 12.201  34.983 1.00 8.50  ? 199 LEU 1 N   1 
ATOM   1391 C CA  . LEU A 1 199 ? 20.513 12.896  36.219 1.00 8.99  ? 199 LEU 1 CA  1 
ATOM   1392 C C   . LEU A 1 199 ? 19.992 14.169  35.565 1.00 7.91  ? 199 LEU 1 C   1 
ATOM   1393 O O   . LEU A 1 199 ? 20.763 14.923  34.969 1.00 8.74  ? 199 LEU 1 O   1 
ATOM   1394 C CB  . LEU A 1 199 ? 21.748 13.217  37.067 1.00 9.03  ? 199 LEU 1 CB  1 
ATOM   1395 C CG  . LEU A 1 199 ? 21.468 14.165  38.247 1.00 11.47 ? 199 LEU 1 CG  1 
ATOM   1396 C CD1 . LEU A 1 199 ? 20.423 13.567  39.182 1.00 12.62 ? 199 LEU 1 CD1 1 
ATOM   1397 C CD2 . LEU A 1 199 ? 22.757 14.428  39.003 1.00 15.28 ? 199 LEU 1 CD2 1 
ATOM   1398 N N   . VAL A 1 200 ? 18.685 14.382  35.630 1.00 8.97  ? 200 VAL 1 N   1 
ATOM   1399 C CA  . VAL A 1 200 ? 18.089 15.554  35.001 1.00 9.64  ? 200 VAL 1 CA  1 
ATOM   1400 C C   . VAL A 1 200 ? 17.409 16.493  35.984 1.00 10.17 ? 200 VAL 1 C   1 
ATOM   1401 O O   . VAL A 1 200 ? 16.840 16.059  36.989 1.00 11.10 ? 200 VAL 1 O   1 
ATOM   1402 C CB  . VAL A 1 200 ? 17.047 15.145  33.928 1.00 9.67  ? 200 VAL 1 CB  1 
ATOM   1403 C CG1 . VAL A 1 200 ? 17.736 14.426  32.768 1.00 11.67 ? 200 VAL 1 CG1 1 
ATOM   1404 C CG2 . VAL A 1 200 ? 15.987 14.240  34.544 1.00 11.32 ? 200 VAL 1 CG2 1 
ATOM   1405 N N   . CYS A 1 201 ? 17.477 17.786  35.679 1.00 9.94  ? 201 CYS 1 N   1 
ATOM   1406 C CA  . CYS A 1 201 ? 16.851 18.814  36.501 1.00 10.62 ? 201 CYS 1 CA  1 
ATOM   1407 C C   . CYS A 1 201 ? 15.991 19.666  35.579 1.00 12.25 ? 201 CYS 1 C   1 
ATOM   1408 O O   . CYS A 1 201 ? 16.364 19.927  34.436 1.00 12.00 ? 201 CYS 1 O   1 
ATOM   1409 C CB  . CYS A 1 201 ? 17.901 19.710  37.158 1.00 10.93 ? 201 CYS 1 CB  1 
ATOM   1410 S SG  . CYS A 1 201 ? 19.223 18.863  38.077 1.00 10.49 ? 201 CYS 1 SG  1 
ATOM   1411 N N   . LYS A 1 202 ? 14.843 20.104  36.076 1.00 14.27 ? 202 LYS 1 N   1 
ATOM   1412 C CA  . LYS A 1 202 ? 13.949 20.926  35.273 1.00 17.92 ? 202 LYS 1 CA  1 
ATOM   1413 C C   . LYS A 1 202 ? 14.428 22.377  35.312 1.00 19.22 ? 202 LYS 1 C   1 
ATOM   1414 O O   . LYS A 1 202 ? 14.603 22.952  36.386 1.00 20.22 ? 202 LYS 1 O   1 
ATOM   1415 C CB  . LYS A 1 202 ? 12.520 20.815  35.814 1.00 19.24 ? 202 LYS 1 CB  1 
ATOM   1416 C CG  . LYS A 1 202 ? 11.460 20.664  34.735 1.00 23.81 ? 202 LYS 1 CG  1 
ATOM   1417 C CD  . LYS A 1 202 ? 10.089 20.407  35.342 1.00 26.71 ? 202 LYS 1 CD  1 
ATOM   1418 C CE  . LYS A 1 202 ? 9.056  20.120  34.267 1.00 29.53 ? 202 LYS 1 CE  1 
ATOM   1419 N NZ  . LYS A 1 202 ? 7.714  19.831  34.851 1.00 32.94 ? 202 LYS 1 NZ  1 
ATOM   1420 N N   . LYS A 1 203 ? 14.652 22.956  34.135 1.00 19.18 ? 203 LYS 1 N   1 
ATOM   1421 C CA  . LYS A 1 203 ? 15.118 24.336  34.018 1.00 19.34 ? 203 LYS 1 CA  1 
ATOM   1422 C C   . LYS A 1 203 ? 14.239 25.065  33.001 1.00 18.69 ? 203 LYS 1 C   1 
ATOM   1423 O O   . LYS A 1 203 ? 14.194 24.684  31.835 1.00 16.53 ? 203 LYS 1 O   1 
ATOM   1424 C CB  . LYS A 1 203 ? 16.568 24.355  33.536 1.00 20.54 ? 203 LYS 1 CB  1 
ATOM   1425 C CG  . LYS A 1 203 ? 17.272 25.693  33.694 1.00 25.95 ? 203 LYS 1 CG  1 
ATOM   1426 C CD  . LYS A 1 203 ? 17.616 25.948  35.151 1.00 27.79 ? 203 LYS 1 CD  1 
ATOM   1427 C CE  . LYS A 1 203 ? 18.507 27.168  35.302 1.00 30.23 ? 203 LYS 1 CE  1 
ATOM   1428 N NZ  . LYS A 1 203 ? 19.001 27.307  36.701 1.00 32.41 ? 203 LYS 1 NZ  1 
ATOM   1429 N N   . ASN A 1 204 ? 13.547 26.109  33.445 1.00 18.99 ? 204 ASN 1 N   1 
ATOM   1430 C CA  . ASN A 1 204 ? 12.668 26.873  32.564 1.00 20.59 ? 204 ASN 1 CA  1 
ATOM   1431 C C   . ASN A 1 204 ? 11.643 25.985  31.860 1.00 20.25 ? 204 ASN 1 C   1 
ATOM   1432 O O   . ASN A 1 204 ? 11.340 26.187  30.683 1.00 21.05 ? 204 ASN 1 O   1 
ATOM   1433 C CB  . ASN A 1 204 ? 13.490 27.637  31.516 1.00 22.49 ? 204 ASN 1 CB  1 
ATOM   1434 C CG  . ASN A 1 204 ? 14.377 28.706  32.132 1.00 24.99 ? 204 ASN 1 CG  1 
ATOM   1435 O OD1 . ASN A 1 204 ? 13.918 29.525  32.928 1.00 27.43 ? 204 ASN 1 OD1 1 
ATOM   1436 N ND2 . ASN A 1 204 ? 15.651 28.707  31.759 1.00 26.45 ? 204 ASN 1 ND2 1 
ATOM   1437 N N   . GLY A 1 205 ? 11.124 24.992  32.580 1.00 19.33 ? 205 GLY 1 N   1 
ATOM   1438 C CA  . GLY A 1 205 ? 10.120 24.105  32.016 1.00 18.40 ? 205 GLY 1 CA  1 
ATOM   1439 C C   . GLY A 1 205 ? 10.589 22.875  31.256 1.00 17.75 ? 205 GLY 1 C   1 
ATOM   1440 O O   . GLY A 1 205 ? 9.772  22.023  30.898 1.00 19.24 ? 205 GLY 1 O   1 
ATOM   1441 N N   . ALA A 1 206 ? 11.888 22.761  31.004 1.00 15.33 ? 206 ALA 1 N   1 
ATOM   1442 C CA  . ALA A 1 206 ? 12.397 21.605  30.265 1.00 13.27 ? 206 ALA 1 CA  1 
ATOM   1443 C C   . ALA A 1 206 ? 13.436 20.820  31.053 1.00 11.99 ? 206 ALA 1 C   1 
ATOM   1444 O O   . ALA A 1 206 ? 14.231 21.395  31.792 1.00 12.24 ? 206 ALA 1 O   1 
ATOM   1445 C CB  . ALA A 1 206 ? 12.991 22.055  28.940 1.00 12.95 ? 206 ALA 1 CB  1 
ATOM   1446 N N   . TRP A 1 207 ? 13.427 19.502  30.883 1.00 10.82 ? 207 TRP 1 N   1 
ATOM   1447 C CA  . TRP A 1 207 ? 14.384 18.646  31.572 1.00 10.50 ? 207 TRP 1 CA  1 
ATOM   1448 C C   . TRP A 1 207 ? 15.746 18.763  30.905 1.00 9.74  ? 207 TRP 1 C   1 
ATOM   1449 O O   . TRP A 1 207 ? 15.882 18.554  29.698 1.00 10.52 ? 207 TRP 1 O   1 
ATOM   1450 C CB  . TRP A 1 207 ? 13.913 17.193  31.561 1.00 11.78 ? 207 TRP 1 CB  1 
ATOM   1451 C CG  . TRP A 1 207 ? 12.685 16.977  32.382 1.00 12.01 ? 207 TRP 1 CG  1 
ATOM   1452 C CD1 . TRP A 1 207 ? 11.394 16.915  31.935 1.00 12.76 ? 207 TRP 1 CD1 1 
ATOM   1453 C CD2 . TRP A 1 207 ? 12.624 16.834  33.807 1.00 12.73 ? 207 TRP 1 CD2 1 
ATOM   1454 N NE1 . TRP A 1 207 ? 10.534 16.742  32.995 1.00 14.42 ? 207 TRP 1 NE1 1 
ATOM   1455 C CE2 . TRP A 1 207 ? 11.262 16.689  34.155 1.00 13.85 ? 207 TRP 1 CE2 1 
ATOM   1456 C CE3 . TRP A 1 207 ? 13.590 16.817  34.825 1.00 12.70 ? 207 TRP 1 CE3 1 
ATOM   1457 C CZ2 . TRP A 1 207 ? 10.840 16.528  35.479 1.00 13.58 ? 207 TRP 1 CZ2 1 
ATOM   1458 C CZ3 . TRP A 1 207 ? 13.171 16.657  36.140 1.00 13.39 ? 207 TRP 1 CZ3 1 
ATOM   1459 C CH2 . TRP A 1 207 ? 11.805 16.514  36.454 1.00 14.11 ? 207 TRP 1 CH2 1 
ATOM   1460 N N   . THR A 1 208 ? 16.746 19.098  31.710 1.00 11.15 ? 208 THR 1 N   1 
ATOM   1461 C CA  . THR A 1 208 ? 18.107 19.287  31.233 1.00 10.40 ? 208 THR 1 CA  1 
ATOM   1462 C C   . THR A 1 208 ? 19.049 18.260  31.849 1.00 10.11 ? 208 THR 1 C   1 
ATOM   1463 O O   . THR A 1 208 ? 18.958 17.959  33.038 1.00 9.48  ? 208 THR 1 O   1 
ATOM   1464 C CB  . THR A 1 208 ? 18.596 20.699  31.590 1.00 12.72 ? 208 THR 1 CB  1 
ATOM   1465 O OG1 . THR A 1 208 ? 17.664 21.661  31.076 1.00 15.17 ? 208 THR 1 OG1 1 
ATOM   1466 C CG2 . THR A 1 208 ? 19.975 20.963  30.997 1.00 13.54 ? 208 THR 1 CG2 1 
ATOM   1467 N N   . LEU A 1 209 ? 19.951 17.724  31.031 1.00 9.34  ? 209 LEU 1 N   1 
ATOM   1468 C CA  . LEU A 1 209 ? 20.907 16.724  31.499 1.00 10.21 ? 209 LEU 1 CA  1 
ATOM   1469 C C   . LEU A 1 209 ? 22.015 17.417  32.283 1.00 10.24 ? 209 LEU 1 C   1 
ATOM   1470 O O   . LEU A 1 209 ? 22.855 18.110  31.713 1.00 11.02 ? 209 LEU 1 O   1 
ATOM   1471 C CB  . LEU A 1 209 ? 21.504 15.971  30.305 1.00 11.14 ? 209 LEU 1 CB  1 
ATOM   1472 C CG  . LEU A 1 209 ? 22.371 14.753  30.632 1.00 12.11 ? 209 LEU 1 CG  1 
ATOM   1473 C CD1 . LEU A 1 209 ? 21.497 13.645  31.218 1.00 12.81 ? 209 LEU 1 CD1 1 
ATOM   1474 C CD2 . LEU A 1 209 ? 23.059 14.266  29.369 1.00 12.30 ? 209 LEU 1 CD2 1 
ATOM   1475 N N   . VAL A 1 210 ? 22.007 17.224  33.597 1.00 9.51  ? 210 VAL 1 N   1 
ATOM   1476 C CA  . VAL A 1 210 ? 22.995 17.834  34.478 1.00 8.71  ? 210 VAL 1 CA  1 
ATOM   1477 C C   . VAL A 1 210 ? 24.107 16.861  34.857 1.00 9.06  ? 210 VAL 1 C   1 
ATOM   1478 O O   . VAL A 1 210 ? 25.248 17.262  35.088 1.00 8.55  ? 210 VAL 1 O   1 
ATOM   1479 C CB  . VAL A 1 210 ? 22.313 18.349  35.759 1.00 8.78  ? 210 VAL 1 CB  1 
ATOM   1480 C CG1 . VAL A 1 210 ? 23.353 18.828  36.769 1.00 10.48 ? 210 VAL 1 CG1 1 
ATOM   1481 C CG2 . VAL A 1 210 ? 21.373 19.486  35.399 1.00 10.00 ? 210 VAL 1 CG2 1 
ATOM   1482 N N   . GLY A 1 211 ? 23.771 15.580  34.925 1.00 8.23  ? 211 GLY 1 N   1 
ATOM   1483 C CA  . GLY A 1 211 ? 24.771 14.593  35.276 1.00 10.29 ? 211 GLY 1 CA  1 
ATOM   1484 C C   . GLY A 1 211 ? 24.595 13.261  34.579 1.00 10.73 ? 211 GLY 1 C   1 
ATOM   1485 O O   . GLY A 1 211 ? 23.533 12.968  34.022 1.00 11.21 ? 211 GLY 1 O   1 
ATOM   1486 N N   . ILE A 1 212 ? 25.660 12.466  34.600 1.00 9.56  ? 212 ILE 1 N   1 
ATOM   1487 C CA  . ILE A 1 212 ? 25.666 11.129  34.016 1.00 9.31  ? 212 ILE 1 CA  1 
ATOM   1488 C C   . ILE A 1 212 ? 26.082 10.202  35.157 1.00 8.37  ? 212 ILE 1 C   1 
ATOM   1489 O O   . ILE A 1 212 ? 27.129 10.411  35.771 1.00 8.43  ? 212 ILE 1 O   1 
ATOM   1490 C CB  . ILE A 1 212 ? 26.698 11.019  32.871 1.00 9.57  ? 212 ILE 1 CB  1 
ATOM   1491 C CG1 . ILE A 1 212 ? 26.362 12.037  31.773 1.00 12.59 ? 212 ILE 1 CG1 1 
ATOM   1492 C CG2 . ILE A 1 212 ? 26.702 9.595   32.311 1.00 9.74  ? 212 ILE 1 CG2 1 
ATOM   1493 C CD1 . ILE A 1 212 ? 27.376 12.101  30.648 1.00 14.67 ? 212 ILE 1 CD1 1 
ATOM   1494 N N   . VAL A 1 213 ? 25.268 9.189   35.449 1.00 7.84  ? 213 VAL 1 N   1 
ATOM   1495 C CA  . VAL A 1 213 ? 25.583 8.269   36.538 1.00 9.79  ? 213 VAL 1 CA  1 
ATOM   1496 C C   . VAL A 1 213 ? 26.996 7.741   36.330 1.00 9.76  ? 213 VAL 1 C   1 
ATOM   1497 O O   . VAL A 1 213 ? 27.289 7.130   35.301 1.00 10.86 ? 213 VAL 1 O   1 
ATOM   1498 C CB  . VAL A 1 213 ? 24.591 7.095   36.584 1.00 8.70  ? 213 VAL 1 CB  1 
ATOM   1499 C CG1 . VAL A 1 213 ? 24.891 6.211   37.786 1.00 9.92  ? 213 VAL 1 CG1 1 
ATOM   1500 C CG2 . VAL A 1 213 ? 23.163 7.635   36.660 1.00 9.25  ? 213 VAL 1 CG2 1 
ATOM   1501 N N   . SER A 1 214 ? 27.862 7.967   37.314 1.00 9.93  ? 214 SER 1 N   1 
ATOM   1502 C CA  . SER A 1 214 ? 29.259 7.562   37.196 1.00 8.79  ? 214 SER 1 CA  1 
ATOM   1503 C C   . SER A 1 214 ? 29.727 6.557   38.244 1.00 11.75 ? 214 SER 1 C   1 
ATOM   1504 O O   . SER A 1 214 ? 30.029 5.409   37.913 1.00 11.07 ? 214 SER 1 O   1 
ATOM   1505 C CB  . SER A 1 214 ? 30.147 8.814   37.223 1.00 10.56 ? 214 SER 1 CB  1 
ATOM   1506 O OG  . SER A 1 214 ? 31.502 8.499   36.956 1.00 9.96  ? 214 SER 1 OG  1 
ATOM   1507 N N   . TRP A 1 215 ? 29.801 6.973   39.504 1.00 10.77 ? 215 TRP 1 N   1 
ATOM   1508 C CA  . TRP A 1 215 ? 30.240 6.050   40.543 1.00 13.05 ? 215 TRP 1 CA  1 
ATOM   1509 C C   . TRP A 1 215 ? 29.719 6.418   41.921 1.00 14.17 ? 215 TRP 1 C   1 
ATOM   1510 O O   . TRP A 1 215 ? 29.021 7.416   42.086 1.00 14.11 ? 215 TRP 1 O   1 
ATOM   1511 C CB  . TRP A 1 215 ? 31.775 5.964   40.577 1.00 13.17 ? 215 TRP 1 CB  1 
ATOM   1512 C CG  . TRP A 1 215 ? 32.481 7.255   40.896 1.00 12.74 ? 215 TRP 1 CG  1 
ATOM   1513 C CD1 . TRP A 1 215 ? 32.799 8.258   40.023 1.00 12.98 ? 215 TRP 1 CD1 1 
ATOM   1514 C CD2 . TRP A 1 215 ? 32.967 7.670   42.178 1.00 12.42 ? 215 TRP 1 CD2 1 
ATOM   1515 N NE1 . TRP A 1 215 ? 33.457 9.271   40.682 1.00 13.57 ? 215 TRP 1 NE1 1 
ATOM   1516 C CE2 . TRP A 1 215 ? 33.573 8.935   42.006 1.00 13.39 ? 215 TRP 1 CE2 1 
ATOM   1517 C CE3 . TRP A 1 215 ? 32.947 7.096   43.457 1.00 14.82 ? 215 TRP 1 CE3 1 
ATOM   1518 C CZ2 . TRP A 1 215 ? 34.156 9.637   43.068 1.00 14.26 ? 215 TRP 1 CZ2 1 
ATOM   1519 C CZ3 . TRP A 1 215 ? 33.527 7.795   44.514 1.00 14.54 ? 215 TRP 1 CZ3 1 
ATOM   1520 C CH2 . TRP A 1 215 ? 34.122 9.053   44.310 1.00 14.02 ? 215 TRP 1 CH2 1 
ATOM   1521 N N   . GLY A 1 216 ? 30.058 5.597   42.909 1.00 13.86 ? 216 GLY 1 N   1 
ATOM   1522 C CA  . GLY A 1 216 ? 29.618 5.858   44.265 1.00 15.74 ? 216 GLY 1 CA  1 
ATOM   1523 C C   . GLY A 1 216 ? 29.931 4.707   45.202 1.00 16.66 ? 216 GLY 1 C   1 
ATOM   1524 O O   . GLY A 1 216 ? 30.829 3.906   44.943 1.00 16.73 ? 216 GLY 1 O   1 
ATOM   1525 N N   . SER A 1 217 ? 29.176 4.628   46.292 1.00 18.03 ? 217 SER 1 N   1 
ATOM   1526 C CA  . SER A 1 217 ? 29.345 3.584   47.296 1.00 18.08 ? 217 SER 1 CA  1 
ATOM   1527 C C   . SER A 1 217 ? 29.307 2.177   46.704 1.00 17.54 ? 217 SER 1 C   1 
ATOM   1528 O O   . SER A 1 217 ? 28.412 1.844   45.930 1.00 17.69 ? 217 SER 1 O   1 
ATOM   1529 C CB  . SER A 1 217 ? 28.251 3.715   48.359 1.00 18.12 ? 217 SER 1 CB  1 
ATOM   1530 O OG  . SER A 1 217 ? 28.203 2.566   49.185 1.00 20.65 ? 217 SER 1 OG  1 
ATOM   1531 N N   . SER A 1 218 ? 30.277 1.350   47.086 1.00 18.74 ? 218 SER 1 N   1 
ATOM   1532 C CA  . SER A 1 218 ? 30.350 -0.022  46.599 1.00 19.91 ? 218 SER 1 CA  1 
ATOM   1533 C C   . SER A 1 218 ? 29.129 -0.843  47.013 1.00 19.45 ? 218 SER 1 C   1 
ATOM   1534 O O   . SER A 1 218 ? 28.852 -1.892  46.431 1.00 19.90 ? 218 SER 1 O   1 
ATOM   1535 C CB  . SER A 1 218 ? 31.621 -0.698  47.119 1.00 23.17 ? 218 SER 1 CB  1 
ATOM   1536 O OG  . SER A 1 218 ? 31.641 -0.722  48.536 1.00 28.60 ? 218 SER 1 OG  1 
ATOM   1537 N N   . THR A 1 219 ? 28.401 -0.372  48.020 1.00 18.01 ? 219 THR 1 N   1 
ATOM   1538 C CA  . THR A 1 219 ? 27.215 -1.082  48.483 1.00 17.88 ? 219 THR 1 CA  1 
ATOM   1539 C C   . THR A 1 219 ? 25.940 -0.301  48.177 1.00 16.83 ? 219 THR 1 C   1 
ATOM   1540 O O   . THR A 1 219 ? 24.856 -0.658  48.638 1.00 16.83 ? 219 THR 1 O   1 
ATOM   1541 C CB  . THR A 1 219 ? 27.284 -1.356  49.998 1.00 20.23 ? 219 THR 1 CB  1 
ATOM   1542 O OG1 . THR A 1 219 ? 27.305 -0.113  50.711 1.00 21.41 ? 219 THR 1 OG1 1 
ATOM   1543 C CG2 . THR A 1 219 ? 28.540 -2.154  50.333 1.00 20.19 ? 219 THR 1 CG2 1 
ATOM   1544 N N   . CYS A 1 220 ? 26.079 0.762   47.393 1.00 15.28 ? 220 CYS 1 N   1 
ATOM   1545 C CA  . CYS A 1 220 ? 24.941 1.592   47.014 1.00 15.15 ? 220 CYS 1 CA  1 
ATOM   1546 C C   . CYS A 1 220 ? 24.207 2.129   48.239 1.00 14.79 ? 220 CYS 1 C   1 
ATOM   1547 O O   . CYS A 1 220 ? 22.979 2.171   48.273 1.00 14.93 ? 220 CYS 1 O   1 
ATOM   1548 C CB  . CYS A 1 220 ? 23.987 0.783   46.131 1.00 15.16 ? 220 CYS 1 CB  1 
ATOM   1549 S SG  . CYS A 1 220 ? 24.802 0.208   44.607 1.00 14.99 ? 220 CYS 1 SG  1 
ATOM   1550 N N   . SER A 1 221 ? 24.976 2.540   49.241 1.00 14.91 ? 221 SER 1 N   1 
ATOM   1551 C CA  . SER A 1 221 ? 24.418 3.082   50.476 1.00 16.44 ? 221 SER 1 CA  1 
ATOM   1552 C C   . SER A 1 221 ? 23.580 4.329   50.201 1.00 16.14 ? 221 SER 1 C   1 
ATOM   1553 O O   . SER A 1 221 ? 24.037 5.258   49.535 1.00 16.57 ? 221 SER 1 O   1 
ATOM   1554 C CB  . SER A 1 221 ? 25.544 3.436   51.449 1.00 18.68 ? 221 SER 1 CB  1 
ATOM   1555 O OG  . SER A 1 221 ? 25.041 4.163   52.555 1.00 21.73 ? 221 SER 1 OG  1 
ATOM   1556 N N   . THR A 1 222 ? 22.365 4.351   50.736 1.00 15.28 ? 222 THR 1 N   1 
ATOM   1557 C CA  . THR A 1 222 ? 21.463 5.478   50.533 1.00 16.98 ? 222 THR 1 CA  1 
ATOM   1558 C C   . THR A 1 222 ? 21.777 6.677   51.425 1.00 16.74 ? 222 THR 1 C   1 
ATOM   1559 O O   . THR A 1 222 ? 21.087 7.692   51.363 1.00 18.00 ? 222 THR 1 O   1 
ATOM   1560 C CB  . THR A 1 222 ? 20.000 5.056   50.758 1.00 16.88 ? 222 THR 1 CB  1 
ATOM   1561 O OG1 . THR A 1 222 ? 19.832 4.597   52.105 1.00 19.72 ? 222 THR 1 OG1 1 
ATOM   1562 C CG2 . THR A 1 222 ? 19.614 3.943   49.791 1.00 16.21 ? 222 THR 1 CG2 1 
ATOM   1563 N N   . SER A 1 223 ? 22.812 6.559   52.254 1.00 16.42 ? 223 SER 1 N   1 
ATOM   1564 C CA  . SER A 1 223 ? 23.212 7.650   53.143 1.00 18.26 ? 223 SER 1 CA  1 
ATOM   1565 C C   . SER A 1 223 ? 24.467 8.334   52.619 1.00 17.60 ? 223 SER 1 C   1 
ATOM   1566 O O   . SER A 1 223 ? 24.953 9.300   53.205 1.00 17.44 ? 223 SER 1 O   1 
ATOM   1567 C CB  . SER A 1 223 ? 23.477 7.121   54.554 1.00 20.10 ? 223 SER 1 CB  1 
ATOM   1568 O OG  . SER A 1 223 ? 22.295 6.577   55.112 1.00 27.92 ? 223 SER 1 OG  1 
ATOM   1569 N N   . THR A 1 224 ? 24.991 7.818   51.512 1.00 16.50 ? 224 THR 1 N   1 
ATOM   1570 C CA  . THR A 1 224 ? 26.192 8.364   50.890 1.00 16.72 ? 224 THR 1 CA  1 
ATOM   1571 C C   . THR A 1 224 ? 25.805 8.952   49.534 1.00 15.76 ? 224 THR 1 C   1 
ATOM   1572 O O   . THR A 1 224 ? 24.974 8.393   48.823 1.00 15.86 ? 224 THR 1 O   1 
ATOM   1573 C CB  . THR A 1 224 ? 27.252 7.260   50.684 1.00 17.61 ? 224 THR 1 CB  1 
ATOM   1574 O OG1 . THR A 1 224 ? 27.592 6.681   51.951 1.00 22.15 ? 224 THR 1 OG1 1 
ATOM   1575 C CG2 . THR A 1 224 ? 28.505 7.834   50.049 1.00 20.92 ? 224 THR 1 CG2 1 
ATOM   1576 N N   . PRO A 1 225 ? 26.395 10.095  49.161 1.00 15.54 ? 225 PRO 1 N   1 
ATOM   1577 C CA  . PRO A 1 225 ? 26.042 10.684  47.867 1.00 14.69 ? 225 PRO 1 CA  1 
ATOM   1578 C C   . PRO A 1 225 ? 26.624 9.941   46.672 1.00 13.94 ? 225 PRO 1 C   1 
ATOM   1579 O O   . PRO A 1 225 ? 27.724 9.388   46.743 1.00 13.93 ? 225 PRO 1 O   1 
ATOM   1580 C CB  . PRO A 1 225 ? 26.582 12.106  47.977 1.00 16.34 ? 225 PRO 1 CB  1 
ATOM   1581 C CG  . PRO A 1 225 ? 27.785 11.935  48.849 1.00 18.43 ? 225 PRO 1 CG  1 
ATOM   1582 C CD  . PRO A 1 225 ? 27.301 10.979  49.916 1.00 16.27 ? 225 PRO 1 CD  1 
ATOM   1583 N N   . GLY A 1 226 ? 25.866 9.929   45.580 1.00 12.89 ? 226 GLY 1 N   1 
ATOM   1584 C CA  . GLY A 1 226 ? 26.319 9.289   44.362 1.00 12.35 ? 226 GLY 1 CA  1 
ATOM   1585 C C   . GLY A 1 226 ? 27.122 10.328  43.608 1.00 11.57 ? 226 GLY 1 C   1 
ATOM   1586 O O   . GLY A 1 226 ? 26.938 11.528  43.827 1.00 11.73 ? 226 GLY 1 O   1 
ATOM   1587 N N   . VAL A 1 227 ? 28.019 9.888   42.732 1.00 10.87 ? 227 VAL 1 N   1 
ATOM   1588 C CA  . VAL A 1 227 ? 28.838 10.820  41.971 1.00 10.83 ? 227 VAL 1 CA  1 
ATOM   1589 C C   . VAL A 1 227 ? 28.478 10.706  40.492 1.00 11.07 ? 227 VAL 1 C   1 
ATOM   1590 O O   . VAL A 1 227 ? 28.418 9.610   39.937 1.00 8.24  ? 227 VAL 1 O   1 
ATOM   1591 C CB  . VAL A 1 227 ? 30.343 10.533  42.180 1.00 11.80 ? 227 VAL 1 CB  1 
ATOM   1592 C CG1 . VAL A 1 227 ? 31.182 11.645  41.550 1.00 11.57 ? 227 VAL 1 CG1 1 
ATOM   1593 C CG2 . VAL A 1 227 ? 30.645 10.427  43.677 1.00 12.26 ? 227 VAL 1 CG2 1 
ATOM   1594 N N   . TYR A 1 228 ? 28.232 11.853  39.871 1.00 10.19 ? 228 TYR 1 N   1 
ATOM   1595 C CA  . TYR A 1 228 ? 27.841 11.915  38.471 1.00 9.90  ? 228 TYR 1 CA  1 
ATOM   1596 C C   . TYR A 1 228 ? 28.807 12.789  37.681 1.00 9.55  ? 228 TYR 1 C   1 
ATOM   1597 O O   . TYR A 1 228 ? 29.431 13.693  38.235 1.00 11.88 ? 228 TYR 1 O   1 
ATOM   1598 C CB  . TYR A 1 228 ? 26.425 12.500  38.363 1.00 9.13  ? 228 TYR 1 CB  1 
ATOM   1599 C CG  . TYR A 1 228 ? 25.385 11.763  39.184 1.00 9.98  ? 228 TYR 1 CG  1 
ATOM   1600 C CD1 . TYR A 1 228 ? 25.404 11.812  40.578 1.00 10.20 ? 228 TYR 1 CD1 1 
ATOM   1601 C CD2 . TYR A 1 228 ? 24.415 10.975  38.567 1.00 8.66  ? 228 TYR 1 CD2 1 
ATOM   1602 C CE1 . TYR A 1 228 ? 24.490 11.089  41.340 1.00 9.95  ? 228 TYR 1 CE1 1 
ATOM   1603 C CE2 . TYR A 1 228 ? 23.494 10.245  39.319 1.00 8.57  ? 228 TYR 1 CE2 1 
ATOM   1604 C CZ  . TYR A 1 228 ? 23.542 10.305  40.706 1.00 9.45  ? 228 TYR 1 CZ  1 
ATOM   1605 O OH  . TYR A 1 228 ? 22.672 9.555   41.457 1.00 9.65  ? 228 TYR 1 OH  1 
ATOM   1606 N N   . ALA A 1 229 ? 28.948 12.511  36.391 1.00 9.58  ? 229 ALA 1 N   1 
ATOM   1607 C CA  . ALA A 1 229 ? 29.816 13.330  35.554 1.00 9.56  ? 229 ALA 1 CA  1 
ATOM   1608 C C   . ALA A 1 229 ? 29.068 14.653  35.397 1.00 11.07 ? 229 ALA 1 C   1 
ATOM   1609 O O   . ALA A 1 229 ? 27.879 14.657  35.084 1.00 12.66 ? 229 ALA 1 O   1 
ATOM   1610 C CB  . ALA A 1 229 ? 30.019 12.672  34.195 1.00 11.01 ? 229 ALA 1 CB  1 
ATOM   1611 N N   . ARG A 1 230 ? 29.758 15.767  35.629 1.00 10.03 ? 230 ARG 1 N   1 
ATOM   1612 C CA  . ARG A 1 230 ? 29.145 17.096  35.532 1.00 11.23 ? 230 ARG 1 CA  1 
ATOM   1613 C C   . ARG A 1 230 ? 29.077 17.535  34.069 1.00 11.40 ? 230 ARG 1 C   1 
ATOM   1614 O O   . ARG A 1 230 ? 30.080 17.935  33.480 1.00 10.27 ? 230 ARG 1 O   1 
ATOM   1615 C CB  . ARG A 1 230 ? 29.965 18.097  36.357 1.00 13.01 ? 230 ARG 1 CB  1 
ATOM   1616 C CG  . ARG A 1 230 ? 29.379 19.504  36.433 1.00 14.90 ? 230 ARG 1 CG  1 
ATOM   1617 C CD  . ARG A 1 230 ? 30.338 20.432  37.180 1.00 17.48 ? 230 ARG 1 CD  1 
ATOM   1618 N NE  . ARG A 1 230 ? 30.456 20.082  38.595 1.00 18.05 ? 230 ARG 1 NE  1 
ATOM   1619 C CZ  . ARG A 1 230 ? 29.637 20.523  39.547 1.00 19.01 ? 230 ARG 1 CZ  1 
ATOM   1620 N NH1 . ARG A 1 230 ? 28.647 21.353  39.243 1.00 17.92 ? 230 ARG 1 NH1 1 
ATOM   1621 N NH2 . ARG A 1 230 ? 29.818 20.148  40.808 1.00 19.75 ? 230 ARG 1 NH2 1 
ATOM   1622 N N   . VAL A 1 231 ? 27.883 17.472  33.492 1.00 10.88 ? 231 VAL 1 N   1 
ATOM   1623 C CA  . VAL A 1 231 ? 27.700 17.818  32.087 1.00 11.79 ? 231 VAL 1 CA  1 
ATOM   1624 C C   . VAL A 1 231 ? 28.100 19.239  31.676 1.00 11.61 ? 231 VAL 1 C   1 
ATOM   1625 O O   . VAL A 1 231 ? 28.584 19.437  30.564 1.00 11.31 ? 231 VAL 1 O   1 
ATOM   1626 C CB  . VAL A 1 231 ? 26.247 17.515  31.647 1.00 11.02 ? 231 VAL 1 CB  1 
ATOM   1627 C CG1 . VAL A 1 231 ? 26.031 17.907  30.183 1.00 11.22 ? 231 VAL 1 CG1 1 
ATOM   1628 C CG2 . VAL A 1 231 ? 25.976 16.026  31.826 1.00 10.84 ? 231 VAL 1 CG2 1 
ATOM   1629 N N   . THR A 1 232 ? 27.919 20.227  32.549 1.00 12.11 ? 232 THR 1 N   1 
ATOM   1630 C CA  . THR A 1 232 ? 28.310 21.591  32.182 1.00 12.39 ? 232 THR 1 CA  1 
ATOM   1631 C C   . THR A 1 232 ? 29.810 21.691  31.892 1.00 12.22 ? 232 THR 1 C   1 
ATOM   1632 O O   . THR A 1 232 ? 30.244 22.541  31.118 1.00 12.61 ? 232 THR 1 O   1 
ATOM   1633 C CB  . THR A 1 232 ? 27.950 22.620  33.284 1.00 12.07 ? 232 THR 1 CB  1 
ATOM   1634 O OG1 . THR A 1 232 ? 28.527 22.217  34.530 1.00 13.70 ? 232 THR 1 OG1 1 
ATOM   1635 C CG2 . THR A 1 232 ? 26.438 22.736  33.434 1.00 12.96 ? 232 THR 1 CG2 1 
ATOM   1636 N N   . ALA A 1 233 ? 30.604 20.820  32.506 1.00 12.22 ? 233 ALA 1 N   1 
ATOM   1637 C CA  . ALA A 1 233 ? 32.046 20.841  32.287 1.00 12.09 ? 233 ALA 1 CA  1 
ATOM   1638 C C   . ALA A 1 233 ? 32.439 20.032  31.055 1.00 12.73 ? 233 ALA 1 C   1 
ATOM   1639 O O   . ALA A 1 233 ? 33.591 20.067  30.616 1.00 13.68 ? 233 ALA 1 O   1 
ATOM   1640 C CB  . ALA A 1 233 ? 32.763 20.289  33.514 1.00 13.72 ? 233 ALA 1 CB  1 
ATOM   1641 N N   . LEU A 1 234 ? 31.474 19.327  30.479 1.00 11.57 ? 234 LEU 1 N   1 
ATOM   1642 C CA  . LEU A 1 234 ? 31.749 18.474  29.332 1.00 12.17 ? 234 LEU 1 CA  1 
ATOM   1643 C C   . LEU A 1 234 ? 30.969 18.815  28.071 1.00 11.93 ? 234 LEU 1 C   1 
ATOM   1644 O O   . LEU A 1 234 ? 31.251 18.275  27.001 1.00 11.80 ? 234 LEU 1 O   1 
ATOM   1645 C CB  . LEU A 1 234 ? 31.450 17.020  29.716 1.00 14.05 ? 234 LEU 1 CB  1 
ATOM   1646 C CG  . LEU A 1 234 ? 32.116 16.512  30.997 1.00 14.96 ? 234 LEU 1 CG  1 
ATOM   1647 C CD1 . LEU A 1 234 ? 31.498 15.183  31.413 1.00 17.44 ? 234 LEU 1 CD1 1 
ATOM   1648 C CD2 . LEU A 1 234 ? 33.615 16.367  30.770 1.00 16.11 ? 234 LEU 1 CD2 1 
ATOM   1649 N N   . VAL A 1 235 ? 29.993 19.709  28.183 1.00 11.44 ? 235 VAL 1 N   1 
ATOM   1650 C CA  . VAL A 1 235 ? 29.172 20.040  27.029 1.00 12.02 ? 235 VAL 1 CA  1 
ATOM   1651 C C   . VAL A 1 235 ? 29.928 20.657  25.851 1.00 11.94 ? 235 VAL 1 C   1 
ATOM   1652 O O   . VAL A 1 235 ? 29.544 20.457  24.695 1.00 12.41 ? 235 VAL 1 O   1 
ATOM   1653 C CB  . VAL A 1 235 ? 27.975 20.942  27.446 1.00 13.93 ? 235 VAL 1 CB  1 
ATOM   1654 C CG1 . VAL A 1 235 ? 28.468 22.296  27.926 1.00 12.78 ? 235 VAL 1 CG1 1 
ATOM   1655 C CG2 . VAL A 1 235 ? 27.001 21.073  26.292 1.00 16.16 ? 235 VAL 1 CG2 1 
ATOM   1656 N N   . ASN A 1 236 ? 31.000 21.394  26.123 1.00 12.75 ? 236 ASN 1 N   1 
ATOM   1657 C CA  . ASN A 1 236 ? 31.774 21.988  25.035 1.00 14.21 ? 236 ASN 1 CA  1 
ATOM   1658 C C   . ASN A 1 236 ? 32.366 20.877  24.160 1.00 13.61 ? 236 ASN 1 C   1 
ATOM   1659 O O   . ASN A 1 236 ? 32.387 20.990  22.931 1.00 13.13 ? 236 ASN 1 O   1 
ATOM   1660 C CB  . ASN A 1 236 ? 32.881 22.888  25.593 1.00 16.39 ? 236 ASN 1 CB  1 
ATOM   1661 C CG  . ASN A 1 236 ? 32.355 24.239  26.062 1.00 19.94 ? 236 ASN 1 CG  1 
ATOM   1662 O OD1 . ASN A 1 236 ? 33.075 25.012  26.696 1.00 24.41 ? 236 ASN 1 OD1 1 
ATOM   1663 N ND2 . ASN A 1 236 ? 31.097 24.530  25.744 1.00 18.99 ? 236 ASN 1 ND2 1 
ATOM   1664 N N   . TRP A 1 237 ? 32.834 19.804  24.794 1.00 12.32 ? 237 TRP 1 N   1 
ATOM   1665 C CA  . TRP A 1 237 ? 33.394 18.664  24.065 1.00 13.20 ? 237 TRP 1 CA  1 
ATOM   1666 C C   . TRP A 1 237 ? 32.294 17.979  23.252 1.00 14.41 ? 237 TRP 1 C   1 
ATOM   1667 O O   . TRP A 1 237 ? 32.513 17.566  22.110 1.00 14.61 ? 237 TRP 1 O   1 
ATOM   1668 C CB  . TRP A 1 237 ? 34.009 17.650  25.040 1.00 13.83 ? 237 TRP 1 CB  1 
ATOM   1669 C CG  . TRP A 1 237 ? 34.405 16.345  24.387 1.00 14.42 ? 237 TRP 1 CG  1 
ATOM   1670 C CD1 . TRP A 1 237 ? 35.513 16.107  23.618 1.00 15.46 ? 237 TRP 1 CD1 1 
ATOM   1671 C CD2 . TRP A 1 237 ? 33.670 15.114  24.420 1.00 13.46 ? 237 TRP 1 CD2 1 
ATOM   1672 N NE1 . TRP A 1 237 ? 35.510 14.803  23.172 1.00 14.54 ? 237 TRP 1 NE1 1 
ATOM   1673 C CE2 . TRP A 1 237 ? 34.390 14.173  23.649 1.00 14.17 ? 237 TRP 1 CE2 1 
ATOM   1674 C CE3 . TRP A 1 237 ? 32.470 14.716  25.026 1.00 12.97 ? 237 TRP 1 CE3 1 
ATOM   1675 C CZ2 . TRP A 1 237 ? 33.950 12.856  23.468 1.00 13.26 ? 237 TRP 1 CZ2 1 
ATOM   1676 C CZ3 . TRP A 1 237 ? 32.032 13.406  24.846 1.00 13.11 ? 237 TRP 1 CZ3 1 
ATOM   1677 C CH2 . TRP A 1 237 ? 32.773 12.492  24.072 1.00 11.62 ? 237 TRP 1 CH2 1 
ATOM   1678 N N   . VAL A 1 238 ? 31.109 17.847  23.844 1.00 12.79 ? 238 VAL 1 N   1 
ATOM   1679 C CA  . VAL A 1 238 ? 29.999 17.219  23.143 1.00 13.13 ? 238 VAL 1 CA  1 
ATOM   1680 C C   . VAL A 1 238 ? 29.681 18.008  21.875 1.00 15.22 ? 238 VAL 1 C   1 
ATOM   1681 O O   . VAL A 1 238 ? 29.509 17.431  20.800 1.00 14.37 ? 238 VAL 1 O   1 
ATOM   1682 C CB  . VAL A 1 238 ? 28.740 17.154  24.028 1.00 12.15 ? 238 VAL 1 CB  1 
ATOM   1683 C CG1 . VAL A 1 238 ? 27.546 16.663  23.208 1.00 12.69 ? 238 VAL 1 CG1 1 
ATOM   1684 C CG2 . VAL A 1 238 ? 28.988 16.215  25.210 1.00 12.88 ? 238 VAL 1 CG2 1 
ATOM   1685 N N   . GLN A 1 239 ? 29.615 19.330  22.012 1.00 16.74 ? 239 GLN 1 N   1 
ATOM   1686 C CA  . GLN A 1 239 ? 29.319 20.223  20.895 1.00 19.64 ? 239 GLN 1 CA  1 
ATOM   1687 C C   . GLN A 1 239 ? 30.356 20.091  19.780 1.00 18.71 ? 239 GLN 1 C   1 
ATOM   1688 O O   . GLN A 1 239 ? 30.005 20.006  18.601 1.00 19.50 ? 239 GLN 1 O   1 
ATOM   1689 C CB  . GLN A 1 239 ? 29.284 21.672  21.386 1.00 24.50 ? 239 GLN 1 CB  1 
ATOM   1690 C CG  . GLN A 1 239 ? 28.067 22.457  20.937 1.00 33.67 ? 239 GLN 1 CG  1 
ATOM   1691 C CD  . GLN A 1 239 ? 26.775 21.899  21.507 1.00 37.98 ? 239 GLN 1 CD  1 
ATOM   1692 O OE1 . GLN A 1 239 ? 26.627 21.768  22.723 1.00 42.05 ? 239 GLN 1 OE1 1 
ATOM   1693 N NE2 . GLN A 1 239 ? 25.831 21.572  20.630 1.00 38.46 ? 239 GLN 1 NE2 1 
ATOM   1694 N N   . GLN A 1 240 ? 31.631 20.085  20.156 1.00 18.14 ? 240 GLN 1 N   1 
ATOM   1695 C CA  . GLN A 1 240 ? 32.718 19.965  19.187 1.00 19.74 ? 240 GLN 1 CA  1 
ATOM   1696 C C   . GLN A 1 240 ? 32.625 18.646  18.422 1.00 19.73 ? 240 GLN 1 C   1 
ATOM   1697 O O   . GLN A 1 240 ? 32.774 18.610  17.198 1.00 18.68 ? 240 GLN 1 O   1 
ATOM   1698 C CB  . GLN A 1 240 ? 34.077 20.036  19.896 1.00 20.92 ? 240 GLN 1 CB  1 
ATOM   1699 C CG  . GLN A 1 240 ? 34.443 21.393  20.490 1.00 23.33 ? 240 GLN 1 CG  1 
ATOM   1700 C CD  . GLN A 1 240 ? 34.878 22.399  19.435 1.00 26.18 ? 240 GLN 1 CD  1 
ATOM   1701 O OE1 . GLN A 1 240 ? 35.772 22.126  18.632 1.00 26.18 ? 240 GLN 1 OE1 1 
ATOM   1702 N NE2 . GLN A 1 240 ? 34.252 23.571  19.438 1.00 26.65 ? 240 GLN 1 NE2 1 
ATOM   1703 N N   . THR A 1 241 ? 32.375 17.564  19.153 1.00 17.91 ? 241 THR 1 N   1 
ATOM   1704 C CA  . THR A 1 241 ? 32.282 16.236  18.559 1.00 17.46 ? 241 THR 1 CA  1 
ATOM   1705 C C   . THR A 1 241 ? 31.142 16.096  17.553 1.00 19.18 ? 241 THR 1 C   1 
ATOM   1706 O O   . THR A 1 241 ? 31.334 15.548  16.467 1.00 17.97 ? 241 THR 1 O   1 
ATOM   1707 C CB  . THR A 1 241 ? 32.136 15.166  19.653 1.00 16.72 ? 241 THR 1 CB  1 
ATOM   1708 O OG1 . THR A 1 241 ? 33.213 15.301  20.588 1.00 16.14 ? 241 THR 1 OG1 1 
ATOM   1709 C CG2 . THR A 1 241 ? 32.176 13.768  19.046 1.00 15.86 ? 241 THR 1 CG2 1 
ATOM   1710 N N   . LEU A 1 242 ? 29.958 16.587  17.907 1.00 18.91 ? 242 LEU 1 N   1 
ATOM   1711 C CA  . LEU A 1 242 ? 28.816 16.508  17.003 1.00 22.55 ? 242 LEU 1 CA  1 
ATOM   1712 C C   . LEU A 1 242 ? 29.057 17.331  15.744 1.00 24.08 ? 242 LEU 1 C   1 
ATOM   1713 O O   . LEU A 1 242 ? 28.674 16.929  14.646 1.00 24.68 ? 242 LEU 1 O   1 
ATOM   1714 C CB  . LEU A 1 242 ? 27.545 17.006  17.697 1.00 22.31 ? 242 LEU 1 CB  1 
ATOM   1715 C CG  . LEU A 1 242 ? 26.644 15.953  18.352 1.00 22.47 ? 242 LEU 1 CG  1 
ATOM   1716 C CD1 . LEU A 1 242 ? 27.450 15.068  19.287 1.00 22.16 ? 242 LEU 1 CD1 1 
ATOM   1717 C CD2 . LEU A 1 242 ? 25.524 16.657  19.099 1.00 23.68 ? 242 LEU 1 CD2 1 
ATOM   1718 N N   . ALA A 1 243 ? 29.697 18.482  15.910 1.00 25.96 ? 243 ALA 1 N   1 
ATOM   1719 C CA  . ALA A 1 243 ? 29.974 19.370  14.789 1.00 27.56 ? 243 ALA 1 CA  1 
ATOM   1720 C C   . ALA A 1 243 ? 30.975 18.789  13.794 1.00 29.29 ? 243 ALA 1 C   1 
ATOM   1721 O O   . ALA A 1 243 ? 30.851 18.998  12.585 1.00 29.24 ? 243 ALA 1 O   1 
ATOM   1722 C CB  . ALA A 1 243 ? 30.481 20.713  15.309 1.00 28.20 ? 243 ALA 1 CB  1 
ATOM   1723 N N   . ALA A 1 244 ? 31.960 18.054  14.298 1.00 29.18 ? 244 ALA 1 N   1 
ATOM   1724 C CA  . ALA A 1 244 ? 32.991 17.476  13.444 1.00 30.90 ? 244 ALA 1 CA  1 
ATOM   1725 C C   . ALA A 1 244 ? 32.680 16.080  12.913 1.00 32.08 ? 244 ALA 1 C   1 
ATOM   1726 O O   . ALA A 1 244 ? 33.469 15.517  12.153 1.00 33.52 ? 244 ALA 1 O   1 
ATOM   1727 C CB  . ALA A 1 244 ? 34.321 17.458  14.188 1.00 30.06 ? 244 ALA 1 CB  1 
ATOM   1728 N N   . ASN A 1 245 ? 31.540 15.520  13.299 1.00 33.10 ? 245 ASN 1 N   1 
ATOM   1729 C CA  . ASN A 1 245 ? 31.177 14.182  12.844 1.00 33.65 ? 245 ASN 1 CA  1 
ATOM   1730 C C   . ASN A 1 245 ? 29.715 14.089  12.420 1.00 34.83 ? 245 ASN 1 C   1 
ATOM   1731 O O   . ASN A 1 245 ? 29.073 13.069  12.746 1.00 36.65 ? 245 ASN 1 O   1 
ATOM   1732 C CB  . ASN A 1 245 ? 31.459 13.168  13.955 1.00 33.47 ? 245 ASN 1 CB  1 
ATOM   1733 C CG  . ASN A 1 245 ? 32.924 13.130  14.351 1.00 33.21 ? 245 ASN 1 CG  1 
ATOM   1734 O OD1 . ASN A 1 245 ? 33.767 12.620  13.614 1.00 33.19 ? 245 ASN 1 OD1 1 
ATOM   1735 N ND2 . ASN A 1 245 ? 33.235 13.684  15.517 1.00 33.55 ? 245 ASN 1 ND2 1 
HETATM 1736 S S   . SO4 B 2 .   ? 38.465 13.925  21.440 1.00 35.54 ? 501 SO4 1 S   1 
HETATM 1737 O O1  . SO4 B 2 .   ? 37.203 13.225  21.141 1.00 38.03 ? 501 SO4 1 O1  1 
HETATM 1738 O O2  . SO4 B 2 .   ? 38.422 15.279  20.855 1.00 38.25 ? 501 SO4 1 O2  1 
HETATM 1739 O O3  . SO4 B 2 .   ? 38.630 14.035  22.899 1.00 37.92 ? 501 SO4 1 O3  1 
HETATM 1740 O O4  . SO4 B 2 .   ? 39.594 13.173  20.865 1.00 37.03 ? 501 SO4 1 O4  1 
HETATM 1741 C CA2 . SN1 C 3 .   ? 27.661 1.866   38.586 1.00 32.03 ? 400 SN1 1 CA2 1 
HETATM 1742 C CB2 . SN1 C 3 .   ? 26.966 2.704   39.352 1.00 35.05 ? 400 SN1 1 CB2 1 
HETATM 1743 C CG  . SN1 C 3 .   ? 27.089 2.951   40.792 1.00 38.36 ? 400 SN1 1 CG  1 
HETATM 1744 C CD1 . SN1 C 3 .   ? 26.624 4.162   41.326 1.00 39.84 ? 400 SN1 1 CD1 1 
HETATM 1745 C CE1 . SN1 C 3 .   ? 26.716 4.399   42.679 1.00 41.96 ? 400 SN1 1 CE1 1 
HETATM 1746 C CD2 . SN1 C 3 .   ? 27.654 2.002   41.636 1.00 39.37 ? 400 SN1 1 CD2 1 
HETATM 1747 C CE2 . SN1 C 3 .   ? 27.744 2.242   43.002 1.00 40.81 ? 400 SN1 1 CE2 1 
HETATM 1748 C CZ  . SN1 C 3 .   ? 27.269 3.447   43.513 1.00 41.98 ? 400 SN1 1 CZ  1 
HETATM 1749 O OH1 . SN1 C 3 .   ? 27.337 3.720   44.858 1.00 45.54 ? 400 SN1 1 OH1 1 
HETATM 1750 O OH2 . SN1 C 3 .   ? 26.066 5.113   40.505 1.00 42.51 ? 400 SN1 1 OH2 1 
HETATM 1751 C C2  . SN1 C 3 .   ? 27.341 1.776   37.156 1.00 29.65 ? 400 SN1 1 C2  1 
HETATM 1752 O O2  . SN1 C 3 .   ? 26.959 0.737   36.612 1.00 29.79 ? 400 SN1 1 O2  1 
HETATM 1753 O O   . HOH D 4 .   ? 20.251 6.215   38.242 1.00 9.76  ? 502 HOH 1 O   1 
HETATM 1754 O O   . HOH D 4 .   ? 15.473 10.739  32.975 1.00 10.34 ? 503 HOH 1 O   1 
HETATM 1755 O O   . HOH D 4 .   ? 22.770 8.606   47.100 1.00 13.45 ? 504 HOH 1 O   1 
HETATM 1756 O O   . HOH D 4 .   ? 20.102 2.038   33.528 1.00 10.68 ? 505 HOH 1 O   1 
HETATM 1757 O O   . HOH D 4 .   ? 7.273  8.924   35.692 1.00 14.08 ? 506 HOH 1 O   1 
HETATM 1758 O O   . HOH D 4 .   ? 22.969 9.800   30.081 1.00 17.86 ? 507 HOH 1 O   1 
HETATM 1759 O O   . HOH D 4 .   ? 26.159 19.849  34.953 1.00 12.95 ? 508 HOH 1 O   1 
HETATM 1760 O O   . HOH D 4 .   ? 14.728 21.061  46.383 1.00 14.04 ? 509 HOH 1 O   1 
HETATM 1761 O O   . HOH D 4 .   ? 33.303 13.057  35.383 1.00 13.31 ? 510 HOH 1 O   1 
HETATM 1762 O O   . HOH D 4 .   ? 34.458 1.904   25.374 1.00 13.33 ? 511 HOH 1 O   1 
HETATM 1763 O O   . HOH D 4 .   ? 31.289 3.554   27.071 1.00 14.28 ? 512 HOH 1 O   1 
HETATM 1764 O O   . HOH D 4 .   ? 14.635 2.290   26.199 1.00 20.20 ? 513 HOH 1 O   1 
HETATM 1765 O O   . HOH D 4 .   ? 34.927 0.000   22.122 0.50 17.85 ? 514 HOH 1 O   1 
HETATM 1766 O O   . HOH D 4 .   ? 13.771 1.469   42.791 1.00 22.36 ? 515 HOH 1 O   1 
HETATM 1767 O O   . HOH D 4 .   ? 15.723 11.407  47.683 1.00 20.38 ? 516 HOH 1 O   1 
HETATM 1768 O O   . HOH D 4 .   ? 36.609 10.622  21.013 1.00 25.38 ? 517 HOH 1 O   1 
HETATM 1769 O O   . HOH D 4 .   ? 9.819  3.745   29.549 1.00 23.11 ? 518 HOH 1 O   1 
HETATM 1770 O O   . HOH D 4 .   ? 31.920 22.469  28.758 1.00 18.36 ? 519 HOH 1 O   1 
HETATM 1771 O O   . HOH D 4 .   ? 28.571 18.061  44.087 1.00 18.57 ? 520 HOH 1 O   1 
HETATM 1772 O O   . HOH D 4 .   ? 10.378 -4.482  37.871 1.00 26.20 ? 521 HOH 1 O   1 
HETATM 1773 O O   . HOH D 4 .   ? 10.709 -4.437  25.940 1.00 23.56 ? 522 HOH 1 O   1 
HETATM 1774 O O   . HOH D 4 .   ? 41.793 6.731   30.471 1.00 25.27 ? 523 HOH 1 O   1 
HETATM 1775 O O   . HOH D 4 .   ? 34.037 20.188  27.650 1.00 18.57 ? 524 HOH 1 O   1 
HETATM 1776 O O   . HOH D 4 .   ? 26.906 21.795  36.933 1.00 22.05 ? 525 HOH 1 O   1 
HETATM 1777 O O   . HOH D 4 .   ? 13.870 5.778   24.777 1.00 17.43 ? 526 HOH 1 O   1 
HETATM 1778 O O   . HOH D 4 .   ? 28.217 -7.153  22.649 1.00 26.11 ? 527 HOH 1 O   1 
HETATM 1779 O O   . HOH D 4 .   ? 11.858 15.079  24.784 1.00 18.93 ? 528 HOH 1 O   1 
HETATM 1780 O O   . HOH D 4 .   ? 19.521 17.818  22.914 1.00 26.45 ? 529 HOH 1 O   1 
HETATM 1781 O O   . HOH D 4 .   ? 27.535 6.714   46.842 1.00 21.72 ? 530 HOH 1 O   1 
HETATM 1782 O O   . HOH D 4 .   ? 8.320  12.549  23.733 1.00 16.75 ? 531 HOH 1 O   1 
HETATM 1783 O O   . HOH D 4 .   ? 19.531 -7.739  31.411 1.00 22.15 ? 532 HOH 1 O   1 
HETATM 1784 O O   . HOH D 4 .   ? 20.998 -6.682  33.535 1.00 21.49 ? 533 HOH 1 O   1 
HETATM 1785 O O   . HOH D 4 .   ? 37.122 2.585   32.187 1.00 24.09 ? 534 HOH 1 O   1 
HETATM 1786 O O   . HOH D 4 .   ? 35.752 17.669  28.061 1.00 26.36 ? 535 HOH 1 O   1 
HETATM 1787 O O   . HOH D 4 .   ? 38.120 18.205  36.657 1.00 25.48 ? 536 HOH 1 O   1 
HETATM 1788 O O   . HOH D 4 .   ? 13.272 15.841  21.246 1.00 20.45 ? 537 HOH 1 O   1 
HETATM 1789 O O   . HOH D 4 .   ? 10.773 5.451   26.546 1.00 19.35 ? 538 HOH 1 O   1 
HETATM 1790 O O   . HOH D 4 .   ? 25.882 -2.150  17.311 1.00 17.77 ? 539 HOH 1 O   1 
HETATM 1791 O O   . HOH D 4 .   ? 43.165 10.881  29.157 1.00 21.54 ? 540 HOH 1 O   1 
HETATM 1792 O O   . HOH D 4 .   ? 9.460  -5.603  23.117 1.00 28.56 ? 541 HOH 1 O   1 
HETATM 1793 O O   . HOH D 4 .   ? 32.848 -6.535  21.258 1.00 21.84 ? 542 HOH 1 O   1 
HETATM 1794 O O   . HOH D 4 .   ? 7.850  17.318  32.373 1.00 27.77 ? 543 HOH 1 O   1 
HETATM 1795 O O   . HOH D 4 .   ? 11.175 18.851  21.752 1.00 35.11 ? 544 HOH 1 O   1 
HETATM 1796 O O   . HOH D 4 .   ? 29.881 22.823  43.701 1.00 32.61 ? 545 HOH 1 O   1 
HETATM 1797 O O   . HOH D 4 .   ? 41.759 13.398  36.931 1.00 32.86 ? 546 HOH 1 O   1 
HETATM 1798 O O   . HOH D 4 .   ? 34.462 3.092   17.613 1.00 28.29 ? 547 HOH 1 O   1 
HETATM 1799 O O   . HOH D 4 .   ? 30.981 23.299  34.927 1.00 30.34 ? 548 HOH 1 O   1 
HETATM 1800 O O   . HOH D 4 .   ? 28.776 25.999  35.252 1.00 36.80 ? 549 HOH 1 O   1 
HETATM 1801 O O   . HOH D 4 .   ? 14.291 -2.656  16.397 1.00 36.17 ? 550 HOH 1 O   1 
HETATM 1802 O O   . HOH D 4 .   ? 21.692 1.931   52.773 1.00 35.18 ? 551 HOH 1 O   1 
HETATM 1803 O O   . HOH D 4 .   ? 15.692 20.181  20.467 1.00 37.26 ? 552 HOH 1 O   1 
HETATM 1804 O O   . HOH D 4 .   ? 21.680 0.068   49.904 1.00 35.33 ? 553 HOH 1 O   1 
HETATM 1805 O O   . HOH D 4 .   ? 4.329  2.276   36.074 1.00 31.31 ? 554 HOH 1 O   1 
HETATM 1806 O O   . HOH D 4 .   ? 14.737 -0.501  46.476 1.00 28.57 ? 555 HOH 1 O   1 
HETATM 1807 O O   . HOH D 4 .   ? 1.664  15.361  25.253 1.00 34.80 ? 556 HOH 1 O   1 
HETATM 1808 O O   . HOH D 4 .   ? 8.387  3.261   26.800 1.00 35.24 ? 557 HOH 1 O   1 
HETATM 1809 O O   . HOH D 4 .   ? 24.547 15.198  53.226 1.00 42.40 ? 558 HOH 1 O   1 
HETATM 1810 O O   . HOH D 4 .   ? 8.172  2.553   22.746 1.00 25.92 ? 559 HOH 1 O   1 
HETATM 1811 O O   . HOH D 4 .   ? 36.236 18.285  31.210 1.00 38.12 ? 560 HOH 1 O   1 
HETATM 1812 O O   . HOH D 4 .   ? 26.012 -7.328  17.991 1.00 21.94 ? 561 HOH 1 O   1 
HETATM 1813 O O   . HOH D 4 .   ? 4.987  -2.783  28.743 1.00 25.25 ? 562 HOH 1 O   1 
HETATM 1814 O O   . HOH D 4 .   ? 20.337 4.714   34.034 1.00 11.29 ? 563 HOH 1 O   1 
HETATM 1815 O O   . HOH D 4 .   ? 33.012 10.862  37.291 1.00 12.68 ? 564 HOH 1 O   1 
HETATM 1816 O O   . HOH D 4 .   ? 22.948 8.261   44.130 1.00 13.52 ? 565 HOH 1 O   1 
HETATM 1817 O O   . HOH D 4 .   ? 7.144  10.890  26.563 1.00 13.20 ? 566 HOH 1 O   1 
HETATM 1818 O O   . HOH D 4 .   ? 15.193 16.015  47.341 1.00 18.60 ? 567 HOH 1 O   1 
HETATM 1819 O O   . HOH D 4 .   ? 22.004 14.231  53.665 1.00 19.49 ? 568 HOH 1 O   1 
HETATM 1820 O O   . HOH D 4 .   ? 38.440 10.190  41.887 1.00 22.42 ? 569 HOH 1 O   1 
HETATM 1821 O O   . HOH D 4 .   ? 12.770 4.374   27.827 1.00 25.05 ? 570 HOH 1 O   1 
HETATM 1822 O O   . HOH D 4 .   ? 14.557 19.690  38.924 1.00 26.73 ? 571 HOH 1 O   1 
HETATM 1823 O O   . HOH D 4 .   ? 28.062 28.960  28.552 1.00 26.62 ? 572 HOH 1 O   1 
HETATM 1824 O O   . HOH D 4 .   ? 13.546 27.150  36.465 1.00 37.49 ? 573 HOH 1 O   1 
HETATM 1825 O O   . HOH D 4 .   ? 25.049 6.216   47.128 1.00 37.90 ? 574 HOH 1 O   1 
HETATM 1826 O O   . HOH D 4 .   ? 40.404 4.937   28.657 1.00 24.04 ? 575 HOH 1 O   1 
HETATM 1827 O O   . HOH D 4 .   ? 21.051 -8.226  35.819 1.00 34.55 ? 576 HOH 1 O   1 
HETATM 1828 O O   . HOH D 4 .   ? 7.010  1.580   42.515 1.00 26.20 ? 577 HOH 1 O   1 
HETATM 1829 O O   . HOH D 4 .   ? 36.344 23.787  16.021 1.00 29.78 ? 578 HOH 1 O   1 
HETATM 1830 O O   . HOH D 4 .   ? 20.136 20.546  23.873 1.00 30.71 ? 579 HOH 1 O   1 
HETATM 1831 O O   . HOH D 4 .   ? 4.075  8.194   18.253 1.00 38.52 ? 580 HOH 1 O   1 
HETATM 1832 O O   . HOH D 4 .   ? 9.147  -2.115  39.540 1.00 29.02 ? 581 HOH 1 O   1 
HETATM 1833 O O   . HOH D 4 .   ? 17.824 -5.492  41.638 1.00 29.07 ? 582 HOH 1 O   1 
HETATM 1834 O O   . HOH D 4 .   ? 36.617 4.417   18.647 1.00 25.98 ? 583 HOH 1 O   1 
HETATM 1835 O O   . HOH D 4 .   ? 16.775 -5.307  33.729 1.00 31.17 ? 584 HOH 1 O   1 
HETATM 1836 O O   . HOH D 4 .   ? 11.030 24.811  35.459 1.00 31.85 ? 585 HOH 1 O   1 
HETATM 1837 O O   . HOH D 4 .   ? 36.247 21.462  26.216 1.00 36.72 ? 586 HOH 1 O   1 
HETATM 1838 O O   . HOH D 4 .   ? 35.518 1.182   19.317 1.00 33.78 ? 587 HOH 1 O   1 
HETATM 1839 O O   . HOH D 4 .   ? 44.210 11.547  31.754 1.00 32.78 ? 588 HOH 1 O   1 
HETATM 1840 O O   . HOH D 4 .   ? 31.657 23.762  45.626 1.00 37.84 ? 589 HOH 1 O   1 
HETATM 1841 O O   . HOH D 4 .   ? 32.366 2.465   49.019 1.00 37.15 ? 590 HOH 1 O   1 
HETATM 1842 O O   . HOH D 4 .   ? 12.095 9.487   44.816 1.00 28.12 ? 591 HOH 1 O   1 
HETATM 1843 O O   . HOH D 4 .   ? 35.823 19.913  42.939 1.00 33.32 ? 592 HOH 1 O   1 
HETATM 1844 O O   . HOH D 4 .   ? 3.819  17.135  26.823 1.00 34.01 ? 593 HOH 1 O   1 
HETATM 1845 O O   . HOH D 4 .   ? 21.113 -7.262  22.241 1.00 33.28 ? 594 HOH 1 O   1 
HETATM 1846 O O   . HOH D 4 .   ? 4.761  -4.572  31.047 1.00 36.57 ? 595 HOH 1 O   1 
HETATM 1847 O O   . HOH D 4 .   ? 10.631 6.153   29.218 1.00 22.91 ? 596 HOH 1 O   1 
HETATM 1848 O O   . HOH D 4 .   ? 2.300  5.402   29.433 1.00 28.16 ? 597 HOH 1 O   1 
HETATM 1849 O O   . HOH D 4 .   ? 19.884 -10.634 21.921 1.00 32.54 ? 598 HOH 1 O   1 
HETATM 1850 O O   . HOH D 4 .   ? 9.013  13.279  19.708 1.00 30.37 ? 599 HOH 1 O   1 
HETATM 1851 O O   . HOH D 4 .   ? 5.342  5.639   20.784 1.00 37.93 ? 600 HOH 1 O   1 
HETATM 1852 O O   . HOH D 4 .   ? 11.410 -6.876  38.007 1.00 42.23 ? 601 HOH 1 O   1 
HETATM 1853 O O   . HOH D 4 .   ? 33.772 2.723   45.469 1.00 46.24 ? 602 HOH 1 O   1 
HETATM 1854 O O   . HOH D 4 .   ? 38.112 18.278  33.767 1.00 38.04 ? 603 HOH 1 O   1 
HETATM 1855 O O   . HOH D 4 .   ? 25.124 25.978  45.176 1.00 37.98 ? 604 HOH 1 O   1 
HETATM 1856 O O   . HOH D 4 .   ? 18.051 -10.354 38.186 1.00 44.74 ? 605 HOH 1 O   1 
HETATM 1857 O O   . HOH D 4 .   ? 6.003  16.722  30.041 1.00 28.88 ? 606 HOH 1 O   1 
HETATM 1858 O O   . HOH D 4 .   ? 21.804 -8.992  20.366 1.00 36.78 ? 607 HOH 1 O   1 
HETATM 1859 O O   . HOH D 4 .   ? 19.736 26.439  40.548 1.00 40.12 ? 608 HOH 1 O   1 
HETATM 1860 O O   . HOH D 4 .   ? 31.378 2.832   41.814 1.00 24.28 ? 609 HOH 1 O   1 
HETATM 1861 O O   . HOH D 4 .   ? 13.386 14.035  47.017 1.00 36.82 ? 610 HOH 1 O   1 
HETATM 1862 O O   . HOH D 4 .   ? 42.408 13.940  32.254 1.00 31.35 ? 611 HOH 1 O   1 
HETATM 1863 O O   . HOH D 4 .   ? 39.481 2.323   31.140 1.00 35.94 ? 612 HOH 1 O   1 
HETATM 1864 O O   . HOH D 4 .   ? 17.521 -6.463  28.678 1.00 39.53 ? 613 HOH 1 O   1 
HETATM 1865 O O   . HOH D 4 .   ? 34.720 20.466  16.226 1.00 34.46 ? 614 HOH 1 O   1 
HETATM 1866 O O   . HOH D 4 .   ? 10.209 -0.407  42.500 1.00 33.39 ? 615 HOH 1 O   1 
HETATM 1867 O O   . HOH D 4 .   ? 46.009 9.602   37.087 1.00 31.21 ? 616 HOH 1 O   1 
HETATM 1868 O O   . HOH D 4 .   ? 17.896 17.526  19.961 1.00 42.95 ? 617 HOH 1 O   1 
HETATM 1869 O O   . HOH D 4 .   ? 15.814 28.731  36.663 1.00 46.67 ? 618 HOH 1 O   1 
HETATM 1870 O O   . HOH D 4 .   ? 40.087 8.473   26.736 1.00 31.21 ? 619 HOH 1 O   1 
HETATM 1871 O O   . HOH D 4 .   ? 14.946 17.688  19.955 1.00 35.99 ? 620 HOH 1 O   1 
HETATM 1872 O O   . HOH D 4 .   ? 27.988 -8.675  46.819 1.00 38.92 ? 621 HOH 1 O   1 
HETATM 1873 O O   . HOH D 4 .   ? 27.425 20.948  17.434 1.00 39.33 ? 622 HOH 1 O   1 
HETATM 1874 O O   . HOH D 4 .   ? 27.712 -1.566  34.391 1.00 35.27 ? 623 HOH 1 O   1 
HETATM 1875 O O   . HOH D 4 .   ? 26.087 6.996   11.326 1.00 38.97 ? 624 HOH 1 O   1 
HETATM 1876 O O   . HOH D 4 .   ? 0.817  19.844  31.823 1.00 37.07 ? 625 HOH 1 O   1 
HETATM 1877 O O   . HOH D 4 .   ? 29.468 3.288   51.295 1.00 40.45 ? 626 HOH 1 O   1 
HETATM 1878 O O   . HOH D 4 .   ? 26.352 15.088  13.994 1.00 39.91 ? 627 HOH 1 O   1 
HETATM 1879 O O   . HOH D 4 .   ? 15.113 -5.714  25.883 1.00 44.50 ? 628 HOH 1 O   1 
HETATM 1880 O O   . HOH D 4 .   ? 20.304 -2.213  49.340 1.00 39.42 ? 629 HOH 1 O   1 
HETATM 1881 O O   . HOH D 4 .   ? 33.161 22.211  39.131 1.00 42.31 ? 630 HOH 1 O   1 
HETATM 1882 O O   . HOH D 4 .   ? 0.068  4.499   31.957 1.00 41.29 ? 631 HOH 1 O   1 
HETATM 1883 O O   . HOH D 4 .   ? 35.436 4.774   51.102 1.00 44.98 ? 632 HOH 1 O   1 
HETATM 1884 O O   . HOH D 4 .   ? 12.625 -0.229  44.938 1.00 42.31 ? 633 HOH 1 O   1 
HETATM 1885 O O   . HOH D 4 .   ? 35.642 4.569   45.501 1.00 43.90 ? 634 HOH 1 O   1 
HETATM 1886 O O   . HOH D 4 .   ? 26.017 8.134   40.405 1.00 30.91 ? 635 HOH 1 O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   CYS 1   1   1   CYS CYS 1 . n 
A 1 2   GLY 2   2   2   GLY GLY 1 . n 
A 1 3   VAL 3   3   3   VAL VAL 1 . n 
A 1 4   PRO 4   4   4   PRO PRO 1 . n 
A 1 5   ALA 5   5   5   ALA ALA 1 . n 
A 1 6   ILE 6   6   6   ILE ILE 1 . n 
A 1 7   GLN 7   7   7   GLN GLN 1 . n 
A 1 8   PRO 8   8   8   PRO PRO 1 . n 
A 1 9   VAL 9   9   9   VAL VAL 1 . n 
A 1 10  LEU 10  10  10  LEU LEU 1 . n 
A 1 11  SER 11  11  ?   ?   ?   1 . n 
A 1 12  GLY 12  12  ?   ?   ?   1 . n 
A 1 13  LEU 13  13  ?   ?   ?   1 . n 
A 1 14  SER 14  14  ?   ?   ?   1 . n 
A 1 15  ARG 15  15  ?   ?   ?   1 . n 
A 1 16  ILE 16  16  16  ILE ILE 1 . n 
A 1 17  VAL 17  17  17  VAL VAL 1 . n 
A 1 18  ASN 18  18  18  ASN ASN 1 . n 
A 1 19  GLY 19  19  19  GLY GLY 1 . n 
A 1 20  GLU 20  20  20  GLU GLU 1 . n 
A 1 21  GLU 21  21  21  GLU GLU 1 . n 
A 1 22  ALA 22  22  22  ALA ALA 1 . n 
A 1 23  VAL 23  23  23  VAL VAL 1 . n 
A 1 24  PRO 24  24  24  PRO PRO 1 . n 
A 1 25  GLY 25  25  25  GLY GLY 1 . n 
A 1 26  SER 26  26  26  SER SER 1 . n 
A 1 27  TRP 27  27  27  TRP TRP 1 . n 
A 1 28  PRO 28  28  28  PRO PRO 1 . n 
A 1 29  TRP 29  29  29  TRP TRP 1 . n 
A 1 30  GLN 30  30  30  GLN GLN 1 . n 
A 1 31  VAL 31  31  31  VAL VAL 1 . n 
A 1 32  SER 32  32  32  SER SER 1 . n 
A 1 33  LEU 33  33  33  LEU LEU 1 . n 
A 1 34  GLN 34  34  34  GLN GLN 1 . n 
A 1 35  ASP 35  35  35  ASP ASP 1 . n 
A 1 36  LYS 36  36  36  LYS LYS 1 . n 
A 1 37  THR 37  37  37  THR THR 1 . n 
A 1 38  GLY 38  38  38  GLY GLY 1 . n 
A 1 39  PHE 39  39  39  PHE PHE 1 . n 
A 1 40  HIS 40  40  40  HIS HIS 1 . n 
A 1 41  PHE 41  41  41  PHE PHE 1 . n 
A 1 42  CYS 42  42  42  CYS CYS 1 . n 
A 1 43  GLY 43  43  43  GLY GLY 1 . n 
A 1 44  GLY 44  44  44  GLY GLY 1 . n 
A 1 45  SER 45  45  45  SER SER 1 . n 
A 1 46  LEU 46  46  46  LEU LEU 1 . n 
A 1 47  ILE 47  47  47  ILE ILE 1 . n 
A 1 48  ASN 48  48  48  ASN ASN 1 . n 
A 1 49  GLU 49  49  49  GLU GLU 1 . n 
A 1 50  ASN 50  50  50  ASN ASN 1 . n 
A 1 51  TRP 51  51  51  TRP TRP 1 . n 
A 1 52  VAL 52  52  52  VAL VAL 1 . n 
A 1 53  VAL 53  53  53  VAL VAL 1 . n 
A 1 54  THR 54  54  54  THR THR 1 . n 
A 1 55  ALA 55  55  55  ALA ALA 1 . n 
A 1 56  ALA 56  56  56  ALA ALA 1 . n 
A 1 57  HIS 57  57  57  HIS HIS 1 . n 
A 1 58  CYS 58  58  58  CYS CYS 1 . n 
A 1 59  GLY 59  59  59  GLY GLY 1 . n 
A 1 60  VAL 60  60  60  VAL VAL 1 . n 
A 1 61  THR 61  61  61  THR THR 1 . n 
A 1 62  THR 62  62  62  THR THR 1 . n 
A 1 63  SER 63  63  63  SER SER 1 . n 
A 1 64  ASP 64  64  64  ASP ASP 1 . n 
A 1 65  VAL 65  65  65  VAL VAL 1 . n 
A 1 66  VAL 66  66  66  VAL VAL 1 . n 
A 1 67  VAL 67  67  67  VAL VAL 1 . n 
A 1 68  ALA 68  68  68  ALA ALA 1 . n 
A 1 69  GLY 69  69  69  GLY GLY 1 . n 
A 1 70  GLU 70  70  70  GLU GLU 1 . n 
A 1 71  PHE 71  71  71  PHE PHE 1 . n 
A 1 72  ASP 72  72  72  ASP ASP 1 . n 
A 1 73  GLN 73  73  73  GLN GLN 1 . n 
A 1 74  GLY 74  74  74  GLY GLY 1 . n 
A 1 75  SER 75  75  75  SER SER 1 . n 
A 1 76  SER 76  76  76  SER SER 1 . n 
A 1 77  SER 77  77  77  SER SER 1 . n 
A 1 78  GLU 78  78  78  GLU GLU 1 . n 
A 1 79  LYS 79  79  79  LYS LYS 1 . n 
A 1 80  ILE 80  80  80  ILE ILE 1 . n 
A 1 81  GLN 81  81  81  GLN GLN 1 . n 
A 1 82  LYS 82  82  82  LYS LYS 1 . n 
A 1 83  LEU 83  83  83  LEU LEU 1 . n 
A 1 84  LYS 84  84  84  LYS LYS 1 . n 
A 1 85  ILE 85  85  85  ILE ILE 1 . n 
A 1 86  ALA 86  86  86  ALA ALA 1 . n 
A 1 87  LYS 87  87  87  LYS LYS 1 . n 
A 1 88  VAL 88  88  88  VAL VAL 1 . n 
A 1 89  PHE 89  89  89  PHE PHE 1 . n 
A 1 90  LYS 90  90  90  LYS LYS 1 . n 
A 1 91  ASN 91  91  91  ASN ASN 1 . n 
A 1 92  SER 92  92  92  SER SER 1 . n 
A 1 93  LYS 93  93  93  LYS LYS 1 . n 
A 1 94  TYR 94  94  94  TYR TYR 1 . n 
A 1 95  ASN 95  95  95  ASN ASN 1 . n 
A 1 96  SER 96  96  96  SER SER 1 . n 
A 1 97  LEU 97  97  97  LEU LEU 1 . n 
A 1 98  THR 98  98  98  THR THR 1 . n 
A 1 99  ILE 99  99  99  ILE ILE 1 . n 
A 1 100 ASN 100 100 100 ASN ASN 1 . n 
A 1 101 ASN 101 101 101 ASN ASN 1 . n 
A 1 102 ASP 102 102 102 ASP ASP 1 . n 
A 1 103 ILE 103 103 103 ILE ILE 1 . n 
A 1 104 THR 104 104 104 THR THR 1 . n 
A 1 105 LEU 105 105 105 LEU LEU 1 . n 
A 1 106 LEU 106 106 106 LEU LEU 1 . n 
A 1 107 LYS 107 107 107 LYS LYS 1 . n 
A 1 108 LEU 108 108 108 LEU LEU 1 . n 
A 1 109 SER 109 109 109 SER SER 1 . n 
A 1 110 THR 110 110 110 THR THR 1 . n 
A 1 111 ALA 111 111 111 ALA ALA 1 . n 
A 1 112 ALA 112 112 112 ALA ALA 1 . n 
A 1 113 SER 113 113 113 SER SER 1 . n 
A 1 114 PHE 114 114 114 PHE PHE 1 . n 
A 1 115 SER 115 115 115 SER SER 1 . n 
A 1 116 GLN 116 116 116 GLN GLN 1 . n 
A 1 117 THR 117 117 117 THR THR 1 . n 
A 1 118 VAL 118 118 118 VAL VAL 1 . n 
A 1 119 SER 119 119 119 SER SER 1 . n 
A 1 120 ALA 120 120 120 ALA ALA 1 . n 
A 1 121 VAL 121 121 121 VAL VAL 1 . n 
A 1 122 CYS 122 122 122 CYS CYS 1 . n 
A 1 123 LEU 123 123 123 LEU LEU 1 . n 
A 1 124 PRO 124 124 124 PRO PRO 1 . n 
A 1 125 SER 125 125 125 SER SER 1 . n 
A 1 126 ALA 126 126 126 ALA ALA 1 . n 
A 1 127 SER 127 127 127 SER SER 1 . n 
A 1 128 ASP 128 128 128 ASP ASP 1 . n 
A 1 129 ASP 129 129 129 ASP ASP 1 . n 
A 1 130 PHE 130 130 130 PHE PHE 1 . n 
A 1 131 ALA 131 131 131 ALA ALA 1 . n 
A 1 132 ALA 132 132 132 ALA ALA 1 . n 
A 1 133 GLY 133 133 133 GLY GLY 1 . n 
A 1 134 THR 134 134 134 THR THR 1 . n 
A 1 135 THR 135 135 135 THR THR 1 . n 
A 1 136 CYS 136 136 136 CYS CYS 1 . n 
A 1 137 VAL 137 137 137 VAL VAL 1 . n 
A 1 138 THR 138 138 138 THR THR 1 . n 
A 1 139 THR 139 139 139 THR THR 1 . n 
A 1 140 GLY 140 140 140 GLY GLY 1 . n 
A 1 141 TRP 141 141 141 TRP TRP 1 . n 
A 1 142 GLY 142 142 142 GLY GLY 1 . n 
A 1 143 LEU 143 143 143 LEU LEU 1 . n 
A 1 144 THR 144 144 144 THR THR 1 . n 
A 1 145 ARG 145 145 145 ARG ARG 1 . n 
A 1 146 TYR 146 146 146 TYR TYR 1 . n 
A 1 147 THR 147 147 ?   ?   ?   1 . n 
A 1 148 ASN 148 148 ?   ?   ?   1 . n 
A 1 149 ALA 149 149 ?   ?   ?   1 . n 
A 1 150 ASN 150 150 ?   ?   ?   1 . n 
A 1 151 THR 151 151 151 THR THR 1 . n 
A 1 152 PRO 152 152 152 PRO PRO 1 . n 
A 1 153 ASP 153 153 153 ASP ASP 1 . n 
A 1 154 ARG 154 154 154 ARG ARG 1 . n 
A 1 155 LEU 155 155 155 LEU LEU 1 . n 
A 1 156 GLN 156 156 156 GLN GLN 1 . n 
A 1 157 GLN 157 157 157 GLN GLN 1 . n 
A 1 158 ALA 158 158 158 ALA ALA 1 . n 
A 1 159 SER 159 159 159 SER SER 1 . n 
A 1 160 LEU 160 160 160 LEU LEU 1 . n 
A 1 161 PRO 161 161 161 PRO PRO 1 . n 
A 1 162 LEU 162 162 162 LEU LEU 1 . n 
A 1 163 LEU 163 163 163 LEU LEU 1 . n 
A 1 164 SER 164 164 164 SER SER 1 . n 
A 1 165 ASN 165 165 165 ASN ASN 1 . n 
A 1 166 THR 166 166 166 THR THR 1 . n 
A 1 167 ASN 167 167 167 ASN ASN 1 . n 
A 1 168 CYS 168 168 168 CYS CYS 1 . n 
A 1 169 LYS 169 169 169 LYS LYS 1 . n 
A 1 170 LYS 170 170 170 LYS LYS 1 . n 
A 1 171 TYR 171 171 171 TYR TYR 1 . n 
A 1 172 TRP 172 172 172 TRP TRP 1 . n 
A 1 173 GLY 173 173 173 GLY GLY 1 . n 
A 1 174 THR 174 174 174 THR THR 1 . n 
A 1 175 LYS 175 175 175 LYS LYS 1 . n 
A 1 176 ILE 176 176 176 ILE ILE 1 . n 
A 1 177 LYS 177 177 177 LYS LYS 1 . n 
A 1 178 ASP 178 178 178 ASP ASP 1 . n 
A 1 179 ALA 179 179 179 ALA ALA 1 . n 
A 1 180 MET 180 180 180 MET MET 1 . n 
A 1 181 ILE 181 181 181 ILE ILE 1 . n 
A 1 182 CYS 182 182 182 CYS CYS 1 . n 
A 1 183 ALA 183 183 183 ALA ALA 1 . n 
A 1 184 GLY 184 184 184 GLY GLY 1 . n 
A 1 185 ALA 185 185 185 ALA ALA 1 . n 
A 1 186 SER 186 186 186 SER SER 1 . n 
A 1 187 GLY 187 187 187 GLY GLY 1 . n 
A 1 188 VAL 188 188 188 VAL VAL 1 . n 
A 1 189 SER 189 189 189 SER SER 1 . n 
A 1 190 SER 190 190 190 SER SER 1 . n 
A 1 191 CYS 191 191 191 CYS CYS 1 . n 
A 1 192 MET 192 192 192 MET MET 1 . n 
A 1 193 GLY 193 193 193 GLY GLY 1 . n 
A 1 194 ASP 194 194 194 ASP ASP 1 . n 
A 1 195 SER 195 195 195 SER SN1 1 . n 
A 1 196 GLY 196 196 196 GLY GLY 1 . n 
A 1 197 GLY 197 197 197 GLY GLY 1 . n 
A 1 198 PRO 198 198 198 PRO PRO 1 . n 
A 1 199 LEU 199 199 199 LEU LEU 1 . n 
A 1 200 VAL 200 200 200 VAL VAL 1 . n 
A 1 201 CYS 201 201 201 CYS CYS 1 . n 
A 1 202 LYS 202 202 202 LYS LYS 1 . n 
A 1 203 LYS 203 203 203 LYS LYS 1 . n 
A 1 204 ASN 204 204 204 ASN ASN 1 . n 
A 1 205 GLY 205 205 205 GLY GLY 1 . n 
A 1 206 ALA 206 206 206 ALA ALA 1 . n 
A 1 207 TRP 207 207 207 TRP TRP 1 . n 
A 1 208 THR 208 208 208 THR THR 1 . n 
A 1 209 LEU 209 209 209 LEU LEU 1 . n 
A 1 210 VAL 210 210 210 VAL VAL 1 . n 
A 1 211 GLY 211 211 211 GLY GLY 1 . n 
A 1 212 ILE 212 212 212 ILE ILE 1 . n 
A 1 213 VAL 213 213 213 VAL VAL 1 . n 
A 1 214 SER 214 214 214 SER SER 1 . n 
A 1 215 TRP 215 215 215 TRP TRP 1 . n 
A 1 216 GLY 216 216 216 GLY GLY 1 . n 
A 1 217 SER 217 217 217 SER SER 1 . n 
A 1 218 SER 218 218 218 SER SER 1 . n 
A 1 219 THR 219 219 219 THR THR 1 . n 
A 1 220 CYS 220 220 220 CYS CYS 1 . n 
A 1 221 SER 221 221 221 SER SER 1 . n 
A 1 222 THR 222 222 222 THR THR 1 . n 
A 1 223 SER 223 223 223 SER SER 1 . n 
A 1 224 THR 224 224 224 THR THR 1 . n 
A 1 225 PRO 225 225 225 PRO PRO 1 . n 
A 1 226 GLY 226 226 226 GLY GLY 1 . n 
A 1 227 VAL 227 227 227 VAL VAL 1 . n 
A 1 228 TYR 228 228 228 TYR TYR 1 . n 
A 1 229 ALA 229 229 229 ALA ALA 1 . n 
A 1 230 ARG 230 230 230 ARG ARG 1 . n 
A 1 231 VAL 231 231 231 VAL VAL 1 . n 
A 1 232 THR 232 232 232 THR THR 1 . n 
A 1 233 ALA 233 233 233 ALA ALA 1 . n 
A 1 234 LEU 234 234 234 LEU LEU 1 . n 
A 1 235 VAL 235 235 235 VAL VAL 1 . n 
A 1 236 ASN 236 236 236 ASN ASN 1 . n 
A 1 237 TRP 237 237 237 TRP TRP 1 . n 
A 1 238 VAL 238 238 238 VAL VAL 1 . n 
A 1 239 GLN 239 239 239 GLN GLN 1 . n 
A 1 240 GLN 240 240 240 GLN GLN 1 . n 
A 1 241 THR 241 241 241 THR THR 1 . n 
A 1 242 LEU 242 242 242 LEU LEU 1 . n 
A 1 243 ALA 243 243 243 ALA ALA 1 . n 
A 1 244 ALA 244 244 244 ALA ALA 1 . n 
A 1 245 ASN 245 245 245 ASN ASN 1 . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly   ?        monomeric 1 
2 software_defined_assembly PISA,PQS dimeric   2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1   A,B,C,D 
2 1,2 A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
2 'ABSA (A^2)' 3010  ? 
2 MORE         -41   ? 
2 'SSA (A^2)'  18480 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z     1.0000000000  0.0000000000 0.0000000000 0.0000000000  0.0000000000 1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 2_655 -x+1,-y,z -1.0000000000 0.0000000000 0.0000000000 69.8520000000 0.0000000000 -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    1 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     514 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   D 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2001-12-05 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' . ? 1 
SCALEPACK 'data scaling'   . ? 2 
CNS       refinement       . ? 3 
CNS       phasing          . ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASN 1 48 ? ? -176.60 -178.92 
2 1 PHE 1 71 ? ? -126.27 -55.85  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 1 SER 11  ? A SER 11  
2 1 Y 1 1 GLY 12  ? A GLY 12  
3 1 Y 1 1 LEU 13  ? A LEU 13  
4 1 Y 1 1 SER 14  ? A SER 14  
5 1 Y 1 1 ARG 15  ? A ARG 15  
6 1 Y 1 1 THR 147 ? A THR 147 
7 1 Y 1 1 ASN 148 ? A ASN 148 
8 1 Y 1 1 ALA 149 ? A ALA 149 
9 1 Y 1 1 ASN 150 ? A ASN 150 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SULFATE ION'                       SO4 
3 '2,4-DIHYDROXY-TRANS CINNAMIC ACID' SN1 
4 water                               HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 SO4 1   501 1   SO4 SO4 1 . 
C 3 SN1 1   400 195 SN1 SN1 1 . 
D 4 HOH 1   502 1   HOH HOH 1 . 
D 4 HOH 2   503 2   HOH HOH 1 . 
D 4 HOH 3   504 3   HOH HOH 1 . 
D 4 HOH 4   505 4   HOH HOH 1 . 
D 4 HOH 5   506 5   HOH HOH 1 . 
D 4 HOH 6   507 6   HOH HOH 1 . 
D 4 HOH 7   508 7   HOH HOH 1 . 
D 4 HOH 8   509 8   HOH HOH 1 . 
D 4 HOH 9   510 9   HOH HOH 1 . 
D 4 HOH 10  511 10  HOH HOH 1 . 
D 4 HOH 11  512 11  HOH HOH 1 . 
D 4 HOH 12  513 12  HOH HOH 1 . 
D 4 HOH 13  514 13  HOH HOH 1 . 
D 4 HOH 14  515 14  HOH HOH 1 . 
D 4 HOH 15  516 15  HOH HOH 1 . 
D 4 HOH 16  517 16  HOH HOH 1 . 
D 4 HOH 17  518 17  HOH HOH 1 . 
D 4 HOH 18  519 18  HOH HOH 1 . 
D 4 HOH 19  520 19  HOH HOH 1 . 
D 4 HOH 20  521 20  HOH HOH 1 . 
D 4 HOH 21  522 21  HOH HOH 1 . 
D 4 HOH 22  523 22  HOH HOH 1 . 
D 4 HOH 23  524 23  HOH HOH 1 . 
D 4 HOH 24  525 24  HOH HOH 1 . 
D 4 HOH 25  526 25  HOH HOH 1 . 
D 4 HOH 26  527 26  HOH HOH 1 . 
D 4 HOH 27  528 27  HOH HOH 1 . 
D 4 HOH 28  529 28  HOH HOH 1 . 
D 4 HOH 29  530 29  HOH HOH 1 . 
D 4 HOH 30  531 30  HOH HOH 1 . 
D 4 HOH 31  532 31  HOH HOH 1 . 
D 4 HOH 32  533 32  HOH HOH 1 . 
D 4 HOH 33  534 33  HOH HOH 1 . 
D 4 HOH 34  535 34  HOH HOH 1 . 
D 4 HOH 35  536 35  HOH HOH 1 . 
D 4 HOH 36  537 36  HOH HOH 1 . 
D 4 HOH 37  538 37  HOH HOH 1 . 
D 4 HOH 38  539 38  HOH HOH 1 . 
D 4 HOH 39  540 39  HOH HOH 1 . 
D 4 HOH 40  541 40  HOH HOH 1 . 
D 4 HOH 41  542 41  HOH HOH 1 . 
D 4 HOH 42  543 42  HOH HOH 1 . 
D 4 HOH 43  544 43  HOH HOH 1 . 
D 4 HOH 44  545 44  HOH HOH 1 . 
D 4 HOH 45  546 45  HOH HOH 1 . 
D 4 HOH 46  547 46  HOH HOH 1 . 
D 4 HOH 47  548 47  HOH HOH 1 . 
D 4 HOH 48  549 48  HOH HOH 1 . 
D 4 HOH 49  550 49  HOH HOH 1 . 
D 4 HOH 50  551 50  HOH HOH 1 . 
D 4 HOH 51  552 51  HOH HOH 1 . 
D 4 HOH 52  553 52  HOH HOH 1 . 
D 4 HOH 53  554 53  HOH HOH 1 . 
D 4 HOH 54  555 54  HOH HOH 1 . 
D 4 HOH 55  556 55  HOH HOH 1 . 
D 4 HOH 56  557 56  HOH HOH 1 . 
D 4 HOH 57  558 57  HOH HOH 1 . 
D 4 HOH 58  559 58  HOH HOH 1 . 
D 4 HOH 59  560 59  HOH HOH 1 . 
D 4 HOH 60  561 60  HOH HOH 1 . 
D 4 HOH 61  562 61  HOH HOH 1 . 
D 4 HOH 62  563 62  HOH HOH 1 . 
D 4 HOH 63  564 63  HOH HOH 1 . 
D 4 HOH 64  565 64  HOH HOH 1 . 
D 4 HOH 65  566 65  HOH HOH 1 . 
D 4 HOH 66  567 66  HOH HOH 1 . 
D 4 HOH 67  568 67  HOH HOH 1 . 
D 4 HOH 68  569 68  HOH HOH 1 . 
D 4 HOH 69  570 69  HOH HOH 1 . 
D 4 HOH 70  571 70  HOH HOH 1 . 
D 4 HOH 71  572 71  HOH HOH 1 . 
D 4 HOH 72  573 72  HOH HOH 1 . 
D 4 HOH 73  574 73  HOH HOH 1 . 
D 4 HOH 74  575 74  HOH HOH 1 . 
D 4 HOH 75  576 75  HOH HOH 1 . 
D 4 HOH 76  577 76  HOH HOH 1 . 
D 4 HOH 77  578 77  HOH HOH 1 . 
D 4 HOH 78  579 78  HOH HOH 1 . 
D 4 HOH 79  580 79  HOH HOH 1 . 
D 4 HOH 80  581 80  HOH HOH 1 . 
D 4 HOH 81  582 81  HOH HOH 1 . 
D 4 HOH 82  583 82  HOH HOH 1 . 
D 4 HOH 83  584 83  HOH HOH 1 . 
D 4 HOH 84  585 84  HOH HOH 1 . 
D 4 HOH 85  586 85  HOH HOH 1 . 
D 4 HOH 86  587 86  HOH HOH 1 . 
D 4 HOH 87  588 87  HOH HOH 1 . 
D 4 HOH 88  589 88  HOH HOH 1 . 
D 4 HOH 89  590 89  HOH HOH 1 . 
D 4 HOH 90  591 90  HOH HOH 1 . 
D 4 HOH 91  592 91  HOH HOH 1 . 
D 4 HOH 92  593 92  HOH HOH 1 . 
D 4 HOH 93  594 93  HOH HOH 1 . 
D 4 HOH 94  595 94  HOH HOH 1 . 
D 4 HOH 95  596 95  HOH HOH 1 . 
D 4 HOH 96  597 96  HOH HOH 1 . 
D 4 HOH 97  598 97  HOH HOH 1 . 
D 4 HOH 98  599 98  HOH HOH 1 . 
D 4 HOH 99  600 99  HOH HOH 1 . 
D 4 HOH 100 601 100 HOH HOH 1 . 
D 4 HOH 101 602 101 HOH HOH 1 . 
D 4 HOH 102 603 102 HOH HOH 1 . 
D 4 HOH 103 604 103 HOH HOH 1 . 
D 4 HOH 104 605 104 HOH HOH 1 . 
D 4 HOH 105 606 105 HOH HOH 1 . 
D 4 HOH 106 607 106 HOH HOH 1 . 
D 4 HOH 107 608 107 HOH HOH 1 . 
D 4 HOH 108 609 108 HOH HOH 1 . 
D 4 HOH 109 610 109 HOH HOH 1 . 
D 4 HOH 110 611 110 HOH HOH 1 . 
D 4 HOH 111 612 111 HOH HOH 1 . 
D 4 HOH 112 613 112 HOH HOH 1 . 
D 4 HOH 113 614 113 HOH HOH 1 . 
D 4 HOH 114 615 114 HOH HOH 1 . 
D 4 HOH 115 616 115 HOH HOH 1 . 
D 4 HOH 116 617 116 HOH HOH 1 . 
D 4 HOH 117 618 117 HOH HOH 1 . 
D 4 HOH 118 619 118 HOH HOH 1 . 
D 4 HOH 119 620 119 HOH HOH 1 . 
D 4 HOH 120 621 120 HOH HOH 1 . 
D 4 HOH 121 622 121 HOH HOH 1 . 
D 4 HOH 122 623 122 HOH HOH 1 . 
D 4 HOH 123 624 123 HOH HOH 1 . 
D 4 HOH 124 625 124 HOH HOH 1 . 
D 4 HOH 125 626 125 HOH HOH 1 . 
D 4 HOH 126 627 126 HOH HOH 1 . 
D 4 HOH 127 628 127 HOH HOH 1 . 
D 4 HOH 128 629 128 HOH HOH 1 . 
D 4 HOH 129 630 129 HOH HOH 1 . 
D 4 HOH 130 631 130 HOH HOH 1 . 
D 4 HOH 131 632 131 HOH HOH 1 . 
D 4 HOH 132 633 132 HOH HOH 1 . 
D 4 HOH 133 634 133 HOH HOH 1 . 
D 4 HOH 134 635 134 HOH HOH 1 . 
#