data_1K2P
# 
_entry.id   1K2P 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1K2P         
RCSB  RCSB014485   
WWPDB D_1000014485 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1K2P 
_pdbx_database_status.recvd_initial_deposition_date   2001-09-28 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Mao, C.'     1 
'Zhou, M.'    2 
'Uckun, F.M.' 3 
# 
_citation.id                        primary 
_citation.title                     
;Crystal structure of Bruton's tyrosine kinase domain suggests a novel pathway for activation and provides insights into the molecular basis of X-linked agammaglobulinemia.
;
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            276 
_citation.page_first                41435 
_citation.page_last                 41443 
_citation.year                      2001 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11527964 
_citation.pdbx_database_id_DOI      10.1074/jbc.M104828200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Mao, C.'     1 
primary 'Zhou, M.'    2 
primary 'Uckun, F.M.' 3 
# 
_cell.entry_id           1K2P 
_cell.length_a           45 
_cell.length_b           104 
_cell.length_c           116 
_cell.angle_alpha        90 
_cell.angle_beta         90 
_cell.angle_gamma        90 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1K2P 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Tyrosine-protein kinase BTK' 
_entity.formula_weight             30748.400 
_entity.pdbx_number_of_molecules   2 
_entity.pdbx_ec                    2.7.1.112 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              
;Bruton's tyrosine kinase domain
;
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;IDPKDLTFLKELGTGQFGVVKYGKWRGQYDVAIKMIKEGSMSEDEFIEEAKVMMNLSHEKLVQLYGVCTKQRPIFIITEY
MANGCLLNYLREMRHRFQTQQLLEMCKDVCEAMEYLESKQFLHRDLAARNCLVNDQGVVKVSDFGLSRYVLDDEYTSSVG
SKFPVRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLGKMPYERFTNSETAEHIAQGLRLYRPHLASEKVYTIMYSCWHE
KADERPTFKILLSNILDVMDEES
;
_entity_poly.pdbx_seq_one_letter_code_can   
;IDPKDLTFLKELGTGQFGVVKYGKWRGQYDVAIKMIKEGSMSEDEFIEEAKVMMNLSHEKLVQLYGVCTKQRPIFIITEY
MANGCLLNYLREMRHRFQTQQLLEMCKDVCEAMEYLESKQFLHRDLAARNCLVNDQGVVKVSDFGLSRYVLDDEYTSSVG
SKFPVRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLGKMPYERFTNSETAEHIAQGLRLYRPHLASEKVYTIMYSCWHE
KADERPTFKILLSNILDVMDEES
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ILE n 
1 2   ASP n 
1 3   PRO n 
1 4   LYS n 
1 5   ASP n 
1 6   LEU n 
1 7   THR n 
1 8   PHE n 
1 9   LEU n 
1 10  LYS n 
1 11  GLU n 
1 12  LEU n 
1 13  GLY n 
1 14  THR n 
1 15  GLY n 
1 16  GLN n 
1 17  PHE n 
1 18  GLY n 
1 19  VAL n 
1 20  VAL n 
1 21  LYS n 
1 22  TYR n 
1 23  GLY n 
1 24  LYS n 
1 25  TRP n 
1 26  ARG n 
1 27  GLY n 
1 28  GLN n 
1 29  TYR n 
1 30  ASP n 
1 31  VAL n 
1 32  ALA n 
1 33  ILE n 
1 34  LYS n 
1 35  MET n 
1 36  ILE n 
1 37  LYS n 
1 38  GLU n 
1 39  GLY n 
1 40  SER n 
1 41  MET n 
1 42  SER n 
1 43  GLU n 
1 44  ASP n 
1 45  GLU n 
1 46  PHE n 
1 47  ILE n 
1 48  GLU n 
1 49  GLU n 
1 50  ALA n 
1 51  LYS n 
1 52  VAL n 
1 53  MET n 
1 54  MET n 
1 55  ASN n 
1 56  LEU n 
1 57  SER n 
1 58  HIS n 
1 59  GLU n 
1 60  LYS n 
1 61  LEU n 
1 62  VAL n 
1 63  GLN n 
1 64  LEU n 
1 65  TYR n 
1 66  GLY n 
1 67  VAL n 
1 68  CYS n 
1 69  THR n 
1 70  LYS n 
1 71  GLN n 
1 72  ARG n 
1 73  PRO n 
1 74  ILE n 
1 75  PHE n 
1 76  ILE n 
1 77  ILE n 
1 78  THR n 
1 79  GLU n 
1 80  TYR n 
1 81  MET n 
1 82  ALA n 
1 83  ASN n 
1 84  GLY n 
1 85  CYS n 
1 86  LEU n 
1 87  LEU n 
1 88  ASN n 
1 89  TYR n 
1 90  LEU n 
1 91  ARG n 
1 92  GLU n 
1 93  MET n 
1 94  ARG n 
1 95  HIS n 
1 96  ARG n 
1 97  PHE n 
1 98  GLN n 
1 99  THR n 
1 100 GLN n 
1 101 GLN n 
1 102 LEU n 
1 103 LEU n 
1 104 GLU n 
1 105 MET n 
1 106 CYS n 
1 107 LYS n 
1 108 ASP n 
1 109 VAL n 
1 110 CYS n 
1 111 GLU n 
1 112 ALA n 
1 113 MET n 
1 114 GLU n 
1 115 TYR n 
1 116 LEU n 
1 117 GLU n 
1 118 SER n 
1 119 LYS n 
1 120 GLN n 
1 121 PHE n 
1 122 LEU n 
1 123 HIS n 
1 124 ARG n 
1 125 ASP n 
1 126 LEU n 
1 127 ALA n 
1 128 ALA n 
1 129 ARG n 
1 130 ASN n 
1 131 CYS n 
1 132 LEU n 
1 133 VAL n 
1 134 ASN n 
1 135 ASP n 
1 136 GLN n 
1 137 GLY n 
1 138 VAL n 
1 139 VAL n 
1 140 LYS n 
1 141 VAL n 
1 142 SER n 
1 143 ASP n 
1 144 PHE n 
1 145 GLY n 
1 146 LEU n 
1 147 SER n 
1 148 ARG n 
1 149 TYR n 
1 150 VAL n 
1 151 LEU n 
1 152 ASP n 
1 153 ASP n 
1 154 GLU n 
1 155 TYR n 
1 156 THR n 
1 157 SER n 
1 158 SER n 
1 159 VAL n 
1 160 GLY n 
1 161 SER n 
1 162 LYS n 
1 163 PHE n 
1 164 PRO n 
1 165 VAL n 
1 166 ARG n 
1 167 TRP n 
1 168 SER n 
1 169 PRO n 
1 170 PRO n 
1 171 GLU n 
1 172 VAL n 
1 173 LEU n 
1 174 MET n 
1 175 TYR n 
1 176 SER n 
1 177 LYS n 
1 178 PHE n 
1 179 SER n 
1 180 SER n 
1 181 LYS n 
1 182 SER n 
1 183 ASP n 
1 184 ILE n 
1 185 TRP n 
1 186 ALA n 
1 187 PHE n 
1 188 GLY n 
1 189 VAL n 
1 190 LEU n 
1 191 MET n 
1 192 TRP n 
1 193 GLU n 
1 194 ILE n 
1 195 TYR n 
1 196 SER n 
1 197 LEU n 
1 198 GLY n 
1 199 LYS n 
1 200 MET n 
1 201 PRO n 
1 202 TYR n 
1 203 GLU n 
1 204 ARG n 
1 205 PHE n 
1 206 THR n 
1 207 ASN n 
1 208 SER n 
1 209 GLU n 
1 210 THR n 
1 211 ALA n 
1 212 GLU n 
1 213 HIS n 
1 214 ILE n 
1 215 ALA n 
1 216 GLN n 
1 217 GLY n 
1 218 LEU n 
1 219 ARG n 
1 220 LEU n 
1 221 TYR n 
1 222 ARG n 
1 223 PRO n 
1 224 HIS n 
1 225 LEU n 
1 226 ALA n 
1 227 SER n 
1 228 GLU n 
1 229 LYS n 
1 230 VAL n 
1 231 TYR n 
1 232 THR n 
1 233 ILE n 
1 234 MET n 
1 235 TYR n 
1 236 SER n 
1 237 CYS n 
1 238 TRP n 
1 239 HIS n 
1 240 GLU n 
1 241 LYS n 
1 242 ALA n 
1 243 ASP n 
1 244 GLU n 
1 245 ARG n 
1 246 PRO n 
1 247 THR n 
1 248 PHE n 
1 249 LYS n 
1 250 ILE n 
1 251 LEU n 
1 252 LEU n 
1 253 SER n 
1 254 ASN n 
1 255 ILE n 
1 256 LEU n 
1 257 ASP n 
1 258 VAL n 
1 259 MET n 
1 260 ASP n 
1 261 GLU n 
1 262 GLU n 
1 263 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    BTK_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;IDPKDLTFLKELGTGQFGVVKYGKWRGQYDVAIKMIKEGSMSEDEFIEEAKVMMNLSHEKLVQLYGVCTKQRPIFIITEY
MANGCLLNYLREMRHRFQTQQLLEMCKDVCEAMEYLESKQFLHRDLAARNCLVNDQGVVKVSDFGLSRYVLDDEYTSSVG
SKFPVRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLGKMPYERFTNSETAEHIAQGLRLYRPHLASEKVYTIMYSCWHE
KADERPTFKILLSNILDVMDEES
;
_struct_ref.pdbx_align_begin           397 
_struct_ref.pdbx_db_accession          Q06187 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1K2P A 1 ? 263 ? Q06187 397 ? 659 ? 397 659 
2 1 1K2P B 1 ? 263 ? Q06187 397 ? 659 ? 397 659 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1K2P 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.21 
_exptl_crystal.density_percent_sol   44.25 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.009 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'CHESS BEAMLINE F1' 
_diffrn_source.pdbx_synchrotron_site       CHESS 
_diffrn_source.pdbx_synchrotron_beamline   F1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.009 
# 
_reflns.entry_id                     1K2P 
_reflns.observed_criterion_sigma_I   1 
_reflns.observed_criterion_sigma_F   2 
_reflns.d_resolution_low             15. 
_reflns.d_resolution_high            2.1 
_reflns.number_obs                   25284 
_reflns.number_all                   41078 
_reflns.percent_possible_obs         0.80 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.0540000 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 1K2P 
_refine.ls_number_reflns_obs                     19351 
_refine.ls_number_reflns_all                     20370 
_refine.pdbx_ls_sigma_I                          1.0 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             5.0 
_refine.ls_d_res_high                            2.1 
_refine.ls_percent_reflns_obs                    95 
_refine.ls_R_factor_obs                          0.2210000 
_refine.ls_R_factor_all                          0.2800000 
_refine.ls_R_factor_R_work                       0.2210000 
_refine.ls_R_factor_R_free                       0.2870000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  1019 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MIR 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            Random 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4180 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               4180 
_refine_hist.d_res_high                       2.1 
_refine_hist.d_res_low                        5.0 
# 
_struct.entry_id                  1K2P 
_struct.title                     
;Crystal structure of Bruton's tyrosine kinase domain
;
_struct.pdbx_descriptor           'Tyrosine-protein kinase BTK (E.C.2.7.1.112)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1K2P 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'Bruton tryosine kinase, kinase domain, TRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 42  ? ASN A 55  ? SER A 438 ASN A 451 1 ? 14 
HELX_P HELX_P2  2  LEU A 86  ? GLU A 92  ? LEU A 482 GLU A 488 1 ? 7  
HELX_P HELX_P3  3  MET A 93  ? ARG A 96  ? MET A 489 ARG A 492 5 ? 4  
HELX_P HELX_P4  4  GLN A 98  ? LYS A 119 ? GLN A 494 LYS A 515 1 ? 22 
HELX_P HELX_P5  5  ALA A 127 ? ARG A 129 ? ALA A 523 ARG A 525 5 ? 3  
HELX_P HELX_P6  6  PRO A 164 ? SER A 168 ? PRO A 560 SER A 564 5 ? 5  
HELX_P HELX_P7  7  PRO A 169 ? SER A 176 ? PRO A 565 SER A 572 1 ? 8  
HELX_P HELX_P8  8  SER A 179 ? SER A 196 ? SER A 575 SER A 592 1 ? 18 
HELX_P HELX_P9  9  THR A 206 ? GLN A 216 ? THR A 602 GLN A 612 1 ? 11 
HELX_P HELX_P10 10 SER A 227 ? CYS A 237 ? SER A 623 CYS A 633 1 ? 11 
HELX_P HELX_P11 11 LYS A 241 ? ARG A 245 ? LYS A 637 ARG A 641 5 ? 5  
HELX_P HELX_P12 12 THR A 247 ? ASP A 257 ? THR A 643 ASP A 653 1 ? 11 
HELX_P HELX_P13 13 GLU B 45  ? MET B 54  ? GLU B 441 MET B 450 1 ? 10 
HELX_P HELX_P14 14 CYS B 85  ? ARG B 91  ? CYS B 481 ARG B 487 1 ? 7  
HELX_P HELX_P15 15 GLN B 98  ? LYS B 119 ? GLN B 494 LYS B 515 1 ? 22 
HELX_P HELX_P16 16 ALA B 127 ? ARG B 129 ? ALA B 523 ARG B 525 5 ? 3  
HELX_P HELX_P17 17 PRO B 169 ? SER B 176 ? PRO B 565 SER B 572 1 ? 8  
HELX_P HELX_P18 18 SER B 179 ? SER B 196 ? SER B 575 SER B 592 1 ? 18 
HELX_P HELX_P19 19 THR B 206 ? GLY B 217 ? THR B 602 GLY B 613 1 ? 12 
HELX_P HELX_P20 20 SER B 227 ? CYS B 237 ? SER B 623 CYS B 633 1 ? 11 
HELX_P HELX_P21 21 LYS B 241 ? ARG B 245 ? LYS B 637 ARG B 641 5 ? 5  
HELX_P HELX_P22 22 THR B 247 ? ASP B 257 ? THR B 643 ASP B 653 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 3 ? 
C ? 5 ? 
D ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 14  ? GLY A 15  ? THR A 410 GLY A 411 
A 2 GLY A 18  ? TRP A 25  ? GLY A 414 TRP A 421 
A 3 ILE A 74  ? GLU A 79  ? ILE A 470 GLU A 475 
A 4 LEU A 64  ? CYS A 68  ? LEU A 460 CYS A 464 
B 1 GLY A 84  ? CYS A 85  ? GLY A 480 CYS A 481 
B 2 CYS A 131 ? VAL A 133 ? CYS A 527 VAL A 529 
B 3 VAL A 139 ? VAL A 141 ? VAL A 535 VAL A 537 
C 1 GLU B 11  ? THR B 14  ? GLU B 407 THR B 410 
C 2 VAL B 19  ? TRP B 25  ? VAL B 415 TRP B 421 
C 3 ILE B 76  ? GLU B 79  ? ILE B 472 GLU B 475 
C 4 LEU B 64  ? VAL B 67  ? LEU B 460 VAL B 463 
D 1 CYS B 131 ? VAL B 133 ? CYS B 527 VAL B 529 
D 2 VAL B 139 ? VAL B 141 ? VAL B 535 VAL B 537 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLY A 15  ? N GLY A 411 O GLY A 18  ? O GLY A 414 
A 2 3 N LYS A 34  ? N LYS A 430 O ILE A 76  ? O ILE A 472 
A 3 4 O PHE A 75  ? O PHE A 471 N CYS A 68  ? N CYS A 464 
B 1 2 N GLY A 84  ? N GLY A 480 O VAL A 133 ? O VAL A 529 
B 2 3 N LEU A 132 ? N LEU A 528 O LYS A 140 ? O LYS A 536 
C 1 2 N GLY B 13  ? N GLY B 409 O VAL B 20  ? O VAL B 416 
C 2 3 N ALA B 32  ? N ALA B 428 O THR B 78  ? O THR B 474 
C 3 4 O ILE B 77  ? O ILE B 473 N GLY B 66  ? N GLY B 462 
D 1 2 N LEU B 132 ? N LEU B 528 O LYS B 140 ? O LYS B 536 
# 
_database_PDB_matrix.entry_id          1K2P 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1K2P 
_atom_sites.fract_transf_matrix[1][1]   0.022222 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009615 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008621 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N   . ILE A 1 1   ? 39.699 5.634  15.537 1.00 31.08 ? 397 ILE A N   1 
ATOM 2    C CA  . ILE A 1 1   ? 39.996 6.043  16.938 1.00 27.95 ? 397 ILE A CA  1 
ATOM 3    C C   . ILE A 1 1   ? 41.382 6.663  16.890 1.00 28.45 ? 397 ILE A C   1 
ATOM 4    O O   . ILE A 1 1   ? 42.042 6.591  15.857 1.00 27.84 ? 397 ILE A O   1 
ATOM 5    C CB  . ILE A 1 1   ? 39.984 4.826  17.892 1.00 26.05 ? 397 ILE A CB  1 
ATOM 6    C CG1 . ILE A 1 1   ? 39.927 5.294  19.346 1.00 21.76 ? 397 ILE A CG1 1 
ATOM 7    C CG2 . ILE A 1 1   ? 41.212 3.952  17.664 1.00 28.70 ? 397 ILE A CG2 1 
ATOM 8    C CD1 . ILE A 1 1   ? 38.668 6.044  19.704 1.00 19.11 ? 397 ILE A CD1 1 
ATOM 9    N N   . ASP A 1 2   ? 41.833 7.254  17.988 1.00 29.89 ? 398 ASP A N   1 
ATOM 10   C CA  . ASP A 1 2   ? 43.142 7.879  17.991 1.00 30.58 ? 398 ASP A CA  1 
ATOM 11   C C   . ASP A 1 2   ? 43.966 7.548  19.230 1.00 33.13 ? 398 ASP A C   1 
ATOM 12   O O   . ASP A 1 2   ? 43.564 7.860  20.350 1.00 34.18 ? 398 ASP A O   1 
ATOM 13   C CB  . ASP A 1 2   ? 42.982 9.399  17.868 1.00 27.36 ? 398 ASP A CB  1 
ATOM 14   C CG  . ASP A 1 2   ? 44.227 10.080 17.336 1.00 26.98 ? 398 ASP A CG  1 
ATOM 15   O OD1 . ASP A 1 2   ? 45.346 9.607  17.635 1.00 23.87 ? 398 ASP A OD1 1 
ATOM 16   O OD2 . ASP A 1 2   ? 44.078 11.087 16.601 1.00 23.63 ? 398 ASP A OD2 1 
ATOM 17   N N   . PRO A 1 3   ? 45.080 6.820  19.050 1.00 36.49 ? 399 PRO A N   1 
ATOM 18   C CA  . PRO A 1 3   ? 45.938 6.472  20.187 1.00 36.60 ? 399 PRO A CA  1 
ATOM 19   C C   . PRO A 1 3   ? 46.625 7.765  20.581 1.00 35.91 ? 399 PRO A C   1 
ATOM 20   O O   . PRO A 1 3   ? 47.165 8.454  19.718 1.00 35.42 ? 399 PRO A O   1 
ATOM 21   C CB  . PRO A 1 3   ? 46.941 5.494  19.573 1.00 34.91 ? 399 PRO A CB  1 
ATOM 22   C CG  . PRO A 1 3   ? 46.157 4.851  18.479 1.00 38.91 ? 399 PRO A CG  1 
ATOM 23   C CD  . PRO A 1 3   ? 45.461 6.040  17.861 1.00 38.51 ? 399 PRO A CD  1 
ATOM 24   N N   . LYS A 1 4   ? 46.574 8.114  21.861 1.00 36.75 ? 400 LYS A N   1 
ATOM 25   C CA  . LYS A 1 4   ? 47.189 9.349  22.325 1.00 33.61 ? 400 LYS A CA  1 
ATOM 26   C C   . LYS A 1 4   ? 48.698 9.448  22.083 1.00 31.96 ? 400 LYS A C   1 
ATOM 27   O O   . LYS A 1 4   ? 49.510 9.153  22.958 1.00 27.95 ? 400 LYS A O   1 
ATOM 28   C CB  . LYS A 1 4   ? 46.860 9.604  23.800 1.00 34.79 ? 400 LYS A CB  1 
ATOM 29   C CG  . LYS A 1 4   ? 47.406 10.924 24.332 1.00 32.92 ? 400 LYS A CG  1 
ATOM 30   C CD  . LYS A 1 4   ? 47.052 11.127 25.795 1.00 32.83 ? 400 LYS A CD  1 
ATOM 31   C CE  . LYS A 1 4   ? 45.589 11.506 25.982 1.00 33.63 ? 400 LYS A CE  1 
ATOM 32   N NZ  . LYS A 1 4   ? 45.298 12.915 25.566 1.00 32.25 ? 400 LYS A NZ  1 
ATOM 33   N N   . ASP A 1 5   ? 49.059 9.828  20.863 1.00 32.35 ? 401 ASP A N   1 
ATOM 34   C CA  . ASP A 1 5   ? 50.453 10.014 20.493 1.00 31.87 ? 401 ASP A CA  1 
ATOM 35   C C   . ASP A 1 5   ? 50.645 11.520 20.347 1.00 29.99 ? 401 ASP A C   1 
ATOM 36   O O   . ASP A 1 5   ? 51.112 12.016 19.321 1.00 28.60 ? 401 ASP A O   1 
ATOM 37   C CB  . ASP A 1 5   ? 50.805 9.258  19.196 1.00 32.78 ? 401 ASP A CB  1 
ATOM 38   C CG  . ASP A 1 5   ? 49.823 9.521  18.057 1.00 34.30 ? 401 ASP A CG  1 
ATOM 39   O OD1 . ASP A 1 5   ? 49.422 8.542  17.390 1.00 31.33 ? 401 ASP A OD1 1 
ATOM 40   O OD2 . ASP A 1 5   ? 49.466 10.692 17.811 1.00 34.83 ? 401 ASP A OD2 1 
ATOM 41   N N   . LEU A 1 6   ? 50.212 12.238 21.378 1.00 30.44 ? 402 LEU A N   1 
ATOM 42   C CA  . LEU A 1 6   ? 50.307 13.686 21.416 1.00 32.58 ? 402 LEU A CA  1 
ATOM 43   C C   . LEU A 1 6   ? 51.150 14.087 22.624 1.00 35.40 ? 402 LEU A C   1 
ATOM 44   O O   . LEU A 1 6   ? 51.460 13.254 23.476 1.00 36.97 ? 402 LEU A O   1 
ATOM 45   C CB  . LEU A 1 6   ? 48.911 14.310 21.538 1.00 29.13 ? 402 LEU A CB  1 
ATOM 46   C CG  . LEU A 1 6   ? 47.769 13.911 20.596 1.00 28.32 ? 402 LEU A CG  1 
ATOM 47   C CD1 . LEU A 1 6   ? 47.220 12.552 20.969 1.00 26.12 ? 402 LEU A CD1 1 
ATOM 48   C CD2 . LEU A 1 6   ? 46.662 14.931 20.708 1.00 26.92 ? 402 LEU A CD2 1 
ATOM 49   N N   . THR A 1 7   ? 51.538 15.356 22.681 1.00 36.15 ? 403 THR A N   1 
ATOM 50   C CA  . THR A 1 7   ? 52.330 15.864 23.793 1.00 35.21 ? 403 THR A CA  1 
ATOM 51   C C   . THR A 1 7   ? 51.448 16.724 24.705 1.00 35.29 ? 403 THR A C   1 
ATOM 52   O O   . THR A 1 7   ? 50.473 16.214 25.266 1.00 34.77 ? 403 THR A O   1 
ATOM 53   C CB  . THR A 1 7   ? 53.584 16.641 23.296 1.00 35.16 ? 403 THR A CB  1 
ATOM 54   O OG1 . THR A 1 7   ? 53.287 17.328 22.073 1.00 36.34 ? 403 THR A OG1 1 
ATOM 55   C CG2 . THR A 1 7   ? 54.745 15.688 23.072 1.00 33.51 ? 403 THR A CG2 1 
ATOM 56   N N   . PHE A 1 8   ? 51.761 18.014 24.834 1.00 32.58 ? 404 PHE A N   1 
ATOM 57   C CA  . PHE A 1 8   ? 50.985 18.918 25.683 1.00 32.99 ? 404 PHE A CA  1 
ATOM 58   C C   . PHE A 1 8   ? 51.559 20.327 25.551 1.00 30.92 ? 404 PHE A C   1 
ATOM 59   O O   . PHE A 1 8   ? 52.748 20.484 25.275 1.00 28.05 ? 404 PHE A O   1 
ATOM 60   C CB  . PHE A 1 8   ? 51.060 18.457 27.151 1.00 33.57 ? 404 PHE A CB  1 
ATOM 61   C CG  . PHE A 1 8   ? 49.973 19.023 28.034 1.00 36.18 ? 404 PHE A CG  1 
ATOM 62   C CD1 . PHE A 1 8   ? 50.063 20.317 28.541 1.00 36.37 ? 404 PHE A CD1 1 
ATOM 63   C CD2 . PHE A 1 8   ? 48.873 18.248 28.383 1.00 35.88 ? 404 PHE A CD2 1 
ATOM 64   C CE1 . PHE A 1 8   ? 49.076 20.828 29.383 1.00 36.13 ? 404 PHE A CE1 1 
ATOM 65   C CE2 . PHE A 1 8   ? 47.881 18.750 29.224 1.00 36.02 ? 404 PHE A CE2 1 
ATOM 66   C CZ  . PHE A 1 8   ? 47.982 20.041 29.726 1.00 36.27 ? 404 PHE A CZ  1 
ATOM 67   N N   . LEU A 1 9   ? 50.710 21.341 25.706 1.00 31.51 ? 405 LEU A N   1 
ATOM 68   C CA  . LEU A 1 9   ? 51.156 22.730 25.627 1.00 31.53 ? 405 LEU A CA  1 
ATOM 69   C C   . LEU A 1 9   ? 50.343 23.672 26.521 1.00 32.49 ? 405 LEU A C   1 
ATOM 70   O O   . LEU A 1 9   ? 50.538 23.676 27.735 1.00 33.98 ? 405 LEU A O   1 
ATOM 71   C CB  . LEU A 1 9   ? 51.175 23.239 24.183 1.00 32.59 ? 405 LEU A CB  1 
ATOM 72   C CG  . LEU A 1 9   ? 51.990 24.521 23.961 1.00 33.86 ? 405 LEU A CG  1 
ATOM 73   C CD1 . LEU A 1 9   ? 53.466 24.150 23.845 1.00 34.64 ? 405 LEU A CD1 1 
ATOM 74   C CD2 . LEU A 1 9   ? 51.533 25.263 22.706 1.00 37.27 ? 405 LEU A CD2 1 
ATOM 75   N N   . LYS A 1 10  ? 49.411 24.434 25.948 1.00 35.17 ? 406 LYS A N   1 
ATOM 76   C CA  . LYS A 1 10  ? 48.630 25.387 26.742 1.00 36.21 ? 406 LYS A CA  1 
ATOM 77   C C   . LYS A 1 10  ? 47.182 25.679 26.303 1.00 37.77 ? 406 LYS A C   1 
ATOM 78   O O   . LYS A 1 10  ? 46.588 24.939 25.512 1.00 39.12 ? 406 LYS A O   1 
ATOM 79   C CB  . LYS A 1 10  ? 49.411 26.702 26.877 1.00 33.84 ? 406 LYS A CB  1 
ATOM 80   C CG  . LYS A 1 10  ? 50.477 26.685 27.960 1.00 33.94 ? 406 LYS A CG  1 
ATOM 81   C CD  . LYS A 1 10  ? 51.410 27.884 27.867 1.00 35.43 ? 406 LYS A CD  1 
ATOM 82   C CE  . LYS A 1 10  ? 52.445 27.713 26.760 1.00 37.40 ? 406 LYS A CE  1 
ATOM 83   N NZ  . LYS A 1 10  ? 53.438 26.632 27.055 1.00 35.32 ? 406 LYS A NZ  1 
ATOM 84   N N   . GLU A 1 11  ? 46.629 26.752 26.873 1.00 35.20 ? 407 GLU A N   1 
ATOM 85   C CA  . GLU A 1 11  ? 45.263 27.221 26.633 1.00 34.68 ? 407 GLU A CA  1 
ATOM 86   C C   . GLU A 1 11  ? 44.833 27.253 25.178 1.00 34.30 ? 407 GLU A C   1 
ATOM 87   O O   . GLU A 1 11  ? 45.664 27.386 24.283 1.00 38.04 ? 407 GLU A O   1 
ATOM 88   C CB  . GLU A 1 11  ? 45.105 28.626 27.220 1.00 34.04 ? 407 GLU A CB  1 
ATOM 89   C CG  . GLU A 1 11  ? 43.747 29.277 26.974 1.00 28.63 ? 407 GLU A CG  1 
ATOM 90   C CD  . GLU A 1 11  ? 43.628 30.632 27.624 1.00 23.09 ? 407 GLU A CD  1 
ATOM 91   O OE1 . GLU A 1 11  ? 44.594 31.415 27.557 1.00 19.69 ? 407 GLU A OE1 1 
ATOM 92   O OE2 . GLU A 1 11  ? 42.570 30.912 28.213 1.00 19.52 ? 407 GLU A OE2 1 
ATOM 93   N N   . LEU A 1 12  ? 43.523 27.209 24.957 1.00 33.77 ? 408 LEU A N   1 
ATOM 94   C CA  . LEU A 1 12  ? 42.980 27.248 23.608 1.00 35.95 ? 408 LEU A CA  1 
ATOM 95   C C   . LEU A 1 12  ? 41.473 27.516 23.537 1.00 36.07 ? 408 LEU A C   1 
ATOM 96   O O   . LEU A 1 12  ? 40.836 27.827 24.549 1.00 30.55 ? 408 LEU A O   1 
ATOM 97   C CB  . LEU A 1 12  ? 43.335 25.958 22.888 1.00 35.53 ? 408 LEU A CB  1 
ATOM 98   C CG  . LEU A 1 12  ? 44.349 26.065 21.763 1.00 33.73 ? 408 LEU A CG  1 
ATOM 99   C CD1 . LEU A 1 12  ? 45.091 24.751 21.657 1.00 32.87 ? 408 LEU A CD1 1 
ATOM 100  C CD2 . LEU A 1 12  ? 43.649 26.440 20.453 1.00 33.61 ? 408 LEU A CD2 1 
ATOM 101  N N   . GLY A 1 13  ? 40.923 27.400 22.328 1.00 37.82 ? 409 GLY A N   1 
ATOM 102  C CA  . GLY A 1 13  ? 39.509 27.647 22.086 1.00 42.67 ? 409 GLY A CA  1 
ATOM 103  C C   . GLY A 1 13  ? 38.531 26.929 23.000 1.00 43.77 ? 409 GLY A C   1 
ATOM 104  O O   . GLY A 1 13  ? 38.872 25.926 23.621 1.00 44.19 ? 409 GLY A O   1 
ATOM 105  N N   . THR A 1 14  ? 37.300 27.426 23.053 1.00 44.64 ? 410 THR A N   1 
ATOM 106  C CA  . THR A 1 14  ? 36.269 26.844 23.903 1.00 44.12 ? 410 THR A CA  1 
ATOM 107  C C   . THR A 1 14  ? 35.056 26.429 23.076 1.00 45.63 ? 410 THR A C   1 
ATOM 108  O O   . THR A 1 14  ? 34.984 26.700 21.874 1.00 46.48 ? 410 THR A O   1 
ATOM 109  C CB  . THR A 1 14  ? 35.790 27.859 24.963 1.00 42.36 ? 410 THR A CB  1 
ATOM 110  O OG1 . THR A 1 14  ? 36.859 28.760 25.285 1.00 38.07 ? 410 THR A OG1 1 
ATOM 111  C CG2 . THR A 1 14  ? 35.353 27.141 26.225 1.00 42.56 ? 410 THR A CG2 1 
ATOM 112  N N   . GLY A 1 15  ? 34.106 25.776 23.739 1.00 45.00 ? 411 GLY A N   1 
ATOM 113  C CA  . GLY A 1 15  ? 32.882 25.326 23.104 1.00 43.61 ? 411 GLY A CA  1 
ATOM 114  C C   . GLY A 1 15  ? 31.968 24.888 24.228 1.00 42.95 ? 411 GLY A C   1 
ATOM 115  O O   . GLY A 1 15  ? 32.438 24.681 25.347 1.00 42.15 ? 411 GLY A O   1 
ATOM 116  N N   . GLN A 1 16  ? 30.682 24.697 23.946 1.00 41.91 ? 412 GLN A N   1 
ATOM 117  C CA  . GLN A 1 16  ? 29.736 24.291 24.984 1.00 40.64 ? 412 GLN A CA  1 
ATOM 118  C C   . GLN A 1 16  ? 30.050 22.969 25.692 1.00 37.36 ? 412 GLN A C   1 
ATOM 119  O O   . GLN A 1 16  ? 29.342 22.585 26.627 1.00 36.95 ? 412 GLN A O   1 
ATOM 120  C CB  . GLN A 1 16  ? 28.300 24.300 24.452 1.00 40.22 ? 412 GLN A CB  1 
ATOM 121  C CG  . GLN A 1 16  ? 27.748 25.702 24.225 1.00 38.55 ? 412 GLN A CG  1 
ATOM 122  C CD  . GLN A 1 16  ? 26.335 25.717 23.663 1.00 34.81 ? 412 GLN A CD  1 
ATOM 123  O OE1 . GLN A 1 16  ? 25.732 26.780 23.514 1.00 33.50 ? 412 GLN A OE1 1 
ATOM 124  N NE2 . GLN A 1 16  ? 25.799 24.545 23.354 1.00 28.18 ? 412 GLN A NE2 1 
ATOM 125  N N   . PHE A 1 17  ? 31.060 22.248 25.214 1.00 34.84 ? 413 PHE A N   1 
ATOM 126  C CA  . PHE A 1 17  ? 31.468 21.000 25.853 1.00 32.28 ? 413 PHE A CA  1 
ATOM 127  C C   . PHE A 1 17  ? 32.649 21.334 26.753 1.00 31.49 ? 413 PHE A C   1 
ATOM 128  O O   . PHE A 1 17  ? 32.865 20.701 27.783 1.00 28.50 ? 413 PHE A O   1 
ATOM 129  C CB  . PHE A 1 17  ? 31.890 19.942 24.825 1.00 33.34 ? 413 PHE A CB  1 
ATOM 130  C CG  . PHE A 1 17  ? 30.742 19.163 24.226 1.00 30.57 ? 413 PHE A CG  1 
ATOM 131  C CD1 . PHE A 1 17  ? 29.490 19.749 24.032 1.00 30.22 ? 413 PHE A CD1 1 
ATOM 132  C CD2 . PHE A 1 17  ? 30.934 17.850 23.800 1.00 29.00 ? 413 PHE A CD2 1 
ATOM 133  C CE1 . PHE A 1 17  ? 28.451 19.039 23.417 1.00 29.05 ? 413 PHE A CE1 1 
ATOM 134  C CE2 . PHE A 1 17  ? 29.899 17.133 23.183 1.00 27.19 ? 413 PHE A CE2 1 
ATOM 135  C CZ  . PHE A 1 17  ? 28.659 17.728 22.990 1.00 25.29 ? 413 PHE A CZ  1 
ATOM 136  N N   . GLY A 1 18  ? 33.413 22.346 26.353 1.00 33.87 ? 414 GLY A N   1 
ATOM 137  C CA  . GLY A 1 18  ? 34.562 22.763 27.134 1.00 36.54 ? 414 GLY A CA  1 
ATOM 138  C C   . GLY A 1 18  ? 35.623 23.439 26.288 1.00 38.54 ? 414 GLY A C   1 
ATOM 139  O O   . GLY A 1 18  ? 35.372 23.843 25.144 1.00 37.26 ? 414 GLY A O   1 
ATOM 140  N N   . VAL A 1 19  ? 36.800 23.604 26.883 1.00 38.40 ? 415 VAL A N   1 
ATOM 141  C CA  . VAL A 1 19  ? 37.944 24.225 26.228 1.00 35.19 ? 415 VAL A CA  1 
ATOM 142  C C   . VAL A 1 19  ? 38.735 23.136 25.499 1.00 33.93 ? 415 VAL A C   1 
ATOM 143  O O   . VAL A 1 19  ? 38.348 21.961 25.515 1.00 33.38 ? 415 VAL A O   1 
ATOM 144  C CB  . VAL A 1 19  ? 38.859 24.900 27.286 1.00 33.66 ? 415 VAL A CB  1 
ATOM 145  C CG1 . VAL A 1 19  ? 39.567 23.841 28.118 1.00 33.58 ? 415 VAL A CG1 1 
ATOM 146  C CG2 . VAL A 1 19  ? 39.851 25.858 26.639 1.00 29.68 ? 415 VAL A CG2 1 
ATOM 147  N N   . VAL A 1 20  ? 39.821 23.544 24.845 1.00 33.13 ? 416 VAL A N   1 
ATOM 148  C CA  . VAL A 1 20  ? 40.716 22.648 24.124 1.00 28.19 ? 416 VAL A CA  1 
ATOM 149  C C   . VAL A 1 20  ? 42.138 22.937 24.628 1.00 25.73 ? 416 VAL A C   1 
ATOM 150  O O   . VAL A 1 20  ? 42.344 23.904 25.354 1.00 25.11 ? 416 VAL A O   1 
ATOM 151  C CB  . VAL A 1 20  ? 40.608 22.849 22.570 1.00 27.16 ? 416 VAL A CB  1 
ATOM 152  C CG1 . VAL A 1 20  ? 39.236 22.466 22.080 1.00 24.50 ? 416 VAL A CG1 1 
ATOM 153  C CG2 . VAL A 1 20  ? 40.838 24.282 22.184 1.00 21.15 ? 416 VAL A CG2 1 
ATOM 154  N N   . LYS A 1 21  ? 43.100 22.079 24.298 1.00 27.45 ? 417 LYS A N   1 
ATOM 155  C CA  . LYS A 1 21  ? 44.505 22.255 24.723 1.00 28.38 ? 417 LYS A CA  1 
ATOM 156  C C   . LYS A 1 21  ? 45.429 22.050 23.531 1.00 22.74 ? 417 LYS A C   1 
ATOM 157  O O   . LYS A 1 21  ? 44.971 21.628 22.482 1.00 23.20 ? 417 LYS A O   1 
ATOM 158  C CB  . LYS A 1 21  ? 44.875 21.266 25.838 1.00 30.82 ? 417 LYS A CB  1 
ATOM 159  C CG  . LYS A 1 21  ? 44.299 21.627 27.207 1.00 32.85 ? 417 LYS A CG  1 
ATOM 160  C CD  . LYS A 1 21  ? 44.889 22.936 27.747 1.00 32.78 ? 417 LYS A CD  1 
ATOM 161  C CE  . LYS A 1 21  ? 44.092 23.465 28.933 1.00 30.38 ? 417 LYS A CE  1 
ATOM 162  N NZ  . LYS A 1 21  ? 42.671 23.743 28.566 1.00 24.07 ? 417 LYS A NZ  1 
ATOM 163  N N   . TYR A 1 22  ? 46.717 22.344 23.670 1.00 19.60 ? 418 TYR A N   1 
ATOM 164  C CA  . TYR A 1 22  ? 47.625 22.172 22.532 1.00 19.78 ? 418 TYR A CA  1 
ATOM 165  C C   . TYR A 1 22  ? 48.493 20.924 22.550 1.00 19.25 ? 418 TYR A C   1 
ATOM 166  O O   . TYR A 1 22  ? 48.892 20.446 23.619 1.00 19.18 ? 418 TYR A O   1 
ATOM 167  C CB  . TYR A 1 22  ? 48.484 23.410 22.334 1.00 19.67 ? 418 TYR A CB  1 
ATOM 168  N N   . GLY A 1 23  ? 48.751 20.398 21.352 1.00 16.40 ? 419 GLY A N   1 
ATOM 169  C CA  . GLY A 1 23  ? 49.570 19.210 21.176 1.00 14.78 ? 419 GLY A CA  1 
ATOM 170  C C   . GLY A 1 23  ? 49.886 18.994 19.704 1.00 14.35 ? 419 GLY A C   1 
ATOM 171  O O   . GLY A 1 23  ? 49.350 19.692 18.841 1.00 15.21 ? 419 GLY A O   1 
ATOM 172  N N   . LYS A 1 24  ? 50.787 18.063 19.411 1.00 12.74 ? 420 LYS A N   1 
ATOM 173  C CA  . LYS A 1 24  ? 51.152 17.747 18.034 1.00 10.26 ? 420 LYS A CA  1 
ATOM 174  C C   . LYS A 1 24  ? 50.631 16.345 17.776 1.00 9.89  ? 420 LYS A C   1 
ATOM 175  O O   . LYS A 1 24  ? 50.619 15.520 18.685 1.00 8.22  ? 420 LYS A O   1 
ATOM 176  C CB  . LYS A 1 24  ? 52.660 17.800 17.855 1.00 10.16 ? 420 LYS A CB  1 
ATOM 177  N N   . TRP A 1 25  ? 50.185 16.073 16.557 1.00 10.66 ? 421 TRP A N   1 
ATOM 178  C CA  . TRP A 1 25  ? 49.637 14.759 16.236 1.00 14.79 ? 421 TRP A CA  1 
ATOM 179  C C   . TRP A 1 25  ? 50.270 14.085 15.011 1.00 16.84 ? 421 TRP A C   1 
ATOM 180  O O   . TRP A 1 25  ? 50.448 14.721 13.969 1.00 17.90 ? 421 TRP A O   1 
ATOM 181  C CB  . TRP A 1 25  ? 48.117 14.878 16.060 1.00 13.99 ? 421 TRP A CB  1 
ATOM 182  C CG  . TRP A 1 25  ? 47.433 13.605 15.683 1.00 15.77 ? 421 TRP A CG  1 
ATOM 183  C CD1 . TRP A 1 25  ? 47.380 12.452 16.414 1.00 18.99 ? 421 TRP A CD1 1 
ATOM 184  C CD2 . TRP A 1 25  ? 46.685 13.355 14.486 1.00 17.12 ? 421 TRP A CD2 1 
ATOM 185  N NE1 . TRP A 1 25  ? 46.646 11.498 15.746 1.00 21.46 ? 421 TRP A NE1 1 
ATOM 186  C CE2 . TRP A 1 25  ? 46.203 12.027 14.563 1.00 19.95 ? 421 TRP A CE2 1 
ATOM 187  C CE3 . TRP A 1 25  ? 46.373 14.123 13.357 1.00 13.78 ? 421 TRP A CE3 1 
ATOM 188  C CZ2 . TRP A 1 25  ? 45.419 11.454 13.552 1.00 19.23 ? 421 TRP A CZ2 1 
ATOM 189  C CZ3 . TRP A 1 25  ? 45.595 13.552 12.354 1.00 9.53  ? 421 TRP A CZ3 1 
ATOM 190  C CH2 . TRP A 1 25  ? 45.127 12.233 12.460 1.00 12.55 ? 421 TRP A CH2 1 
ATOM 191  N N   . ARG A 1 26  ? 50.600 12.799 15.158 1.00 18.95 ? 422 ARG A N   1 
ATOM 192  C CA  . ARG A 1 26  ? 51.194 11.983 14.091 1.00 24.07 ? 422 ARG A CA  1 
ATOM 193  C C   . ARG A 1 26  ? 52.263 12.701 13.267 1.00 26.23 ? 422 ARG A C   1 
ATOM 194  O O   . ARG A 1 26  ? 52.163 12.802 12.043 1.00 25.36 ? 422 ARG A O   1 
ATOM 195  C CB  . ARG A 1 26  ? 50.111 11.437 13.144 1.00 24.28 ? 422 ARG A CB  1 
ATOM 196  C CG  . ARG A 1 26  ? 49.243 10.342 13.724 1.00 21.64 ? 422 ARG A CG  1 
ATOM 197  C CD  . ARG A 1 26  ? 48.551 9.548  12.621 1.00 22.23 ? 422 ARG A CD  1 
ATOM 198  N NE  . ARG A 1 26  ? 47.770 10.392 11.720 1.00 25.72 ? 422 ARG A NE  1 
ATOM 199  C CZ  . ARG A 1 26  ? 46.956 9.936  10.769 1.00 26.16 ? 422 ARG A CZ  1 
ATOM 200  N NH1 . ARG A 1 26  ? 46.292 10.799 10.011 1.00 24.22 ? 422 ARG A NH1 1 
ATOM 201  N NH2 . ARG A 1 26  ? 46.799 8.630  10.568 1.00 25.98 ? 422 ARG A NH2 1 
ATOM 202  N N   . GLY A 1 27  ? 53.308 13.160 13.935 1.00 28.03 ? 423 GLY A N   1 
ATOM 203  C CA  . GLY A 1 27  ? 54.347 13.876 13.234 1.00 28.68 ? 423 GLY A CA  1 
ATOM 204  C C   . GLY A 1 27  ? 54.117 15.347 13.502 1.00 31.49 ? 423 GLY A C   1 
ATOM 205  O O   . GLY A 1 27  ? 54.093 15.758 14.666 1.00 33.41 ? 423 GLY A O   1 
ATOM 206  N N   . GLN A 1 28  ? 53.831 16.124 12.460 1.00 30.81 ? 424 GLN A N   1 
ATOM 207  C CA  . GLN A 1 28  ? 53.635 17.553 12.660 1.00 29.14 ? 424 GLN A CA  1 
ATOM 208  C C   . GLN A 1 28  ? 52.301 18.185 12.256 1.00 25.28 ? 424 GLN A C   1 
ATOM 209  O O   . GLN A 1 28  ? 52.227 18.989 11.324 1.00 22.96 ? 424 GLN A O   1 
ATOM 210  C CB  . GLN A 1 28  ? 54.793 18.322 12.067 1.00 32.15 ? 424 GLN A CB  1 
ATOM 211  N N   . TYR A 1 29  ? 51.249 17.822 12.978 1.00 21.73 ? 425 TYR A N   1 
ATOM 212  C CA  . TYR A 1 29  ? 49.936 18.390 12.753 1.00 17.25 ? 425 TYR A CA  1 
ATOM 213  C C   . TYR A 1 29  ? 49.623 19.102 14.062 1.00 17.01 ? 425 TYR A C   1 
ATOM 214  O O   . TYR A 1 29  ? 49.656 18.490 15.128 1.00 16.50 ? 425 TYR A O   1 
ATOM 215  C CB  . TYR A 1 29  ? 48.910 17.300 12.468 1.00 14.79 ? 425 TYR A CB  1 
ATOM 216  N N   . ASP A 1 30  ? 49.445 20.415 13.996 1.00 16.77 ? 426 ASP A N   1 
ATOM 217  C CA  . ASP A 1 30  ? 49.137 21.200 15.179 1.00 14.51 ? 426 ASP A CA  1 
ATOM 218  C C   . ASP A 1 30  ? 47.672 20.983 15.507 1.00 15.14 ? 426 ASP A C   1 
ATOM 219  O O   . ASP A 1 30  ? 46.796 21.258 14.682 1.00 15.14 ? 426 ASP A O   1 
ATOM 220  C CB  . ASP A 1 30  ? 49.418 22.681 14.926 1.00 16.45 ? 426 ASP A CB  1 
ATOM 221  C CG  . ASP A 1 30  ? 50.882 22.956 14.643 1.00 20.73 ? 426 ASP A CG  1 
ATOM 222  O OD1 . ASP A 1 30  ? 51.185 23.493 13.558 1.00 19.46 ? 426 ASP A OD1 1 
ATOM 223  O OD2 . ASP A 1 30  ? 51.732 22.637 15.504 1.00 22.08 ? 426 ASP A OD2 1 
ATOM 224  N N   . VAL A 1 31  ? 47.408 20.473 16.706 1.00 15.54 ? 427 VAL A N   1 
ATOM 225  C CA  . VAL A 1 31  ? 46.046 20.196 17.125 1.00 12.56 ? 427 VAL A CA  1 
ATOM 226  C C   . VAL A 1 31  ? 45.659 20.908 18.421 1.00 12.59 ? 427 VAL A C   1 
ATOM 227  O O   . VAL A 1 31  ? 46.516 21.391 19.166 1.00 15.43 ? 427 VAL A O   1 
ATOM 228  C CB  . VAL A 1 31  ? 45.814 18.664 17.291 1.00 13.80 ? 427 VAL A CB  1 
ATOM 229  C CG1 . VAL A 1 31  ? 46.243 17.926 16.041 1.00 7.25  ? 427 VAL A CG1 1 
ATOM 230  C CG2 . VAL A 1 31  ? 46.557 18.122 18.511 1.00 13.29 ? 427 VAL A CG2 1 
ATOM 231  N N   . ALA A 1 32  ? 44.354 21.023 18.634 1.00 11.11 ? 428 ALA A N   1 
ATOM 232  C CA  . ALA A 1 32  ? 43.785 21.637 19.822 1.00 12.87 ? 428 ALA A CA  1 
ATOM 233  C C   . ALA A 1 32  ? 42.860 20.565 20.380 1.00 12.26 ? 428 ALA A C   1 
ATOM 234  O O   . ALA A 1 32  ? 41.833 20.263 19.775 1.00 17.33 ? 428 ALA A O   1 
ATOM 235  C CB  . ALA A 1 32  ? 42.995 22.872 19.449 1.00 9.07  ? 428 ALA A CB  1 
ATOM 236  N N   . ILE A 1 33  ? 43.246 19.957 21.501 1.00 16.62 ? 429 ILE A N   1 
ATOM 237  C CA  . ILE A 1 33  ? 42.461 18.889 22.117 1.00 15.64 ? 429 ILE A CA  1 
ATOM 238  C C   . ILE A 1 33  ? 41.342 19.321 23.067 1.00 16.00 ? 429 ILE A C   1 
ATOM 239  O O   . ILE A 1 33  ? 41.583 19.938 24.114 1.00 12.97 ? 429 ILE A O   1 
ATOM 240  C CB  . ILE A 1 33  ? 43.383 17.773 22.733 1.00 14.98 ? 429 ILE A CB  1 
ATOM 241  C CG1 . ILE A 1 33  ? 42.855 17.290 24.088 1.00 15.92 ? 429 ILE A CG1 1 
ATOM 242  C CG2 . ILE A 1 33  ? 44.844 18.223 22.770 1.00 13.61 ? 429 ILE A CG2 1 
ATOM 243  C CD1 . ILE A 1 33  ? 43.679 16.183 24.712 1.00 20.29 ? 429 ILE A CD1 1 
ATOM 244  N N   . LYS A 1 34  ? 40.112 19.013 22.657 1.00 20.23 ? 430 LYS A N   1 
ATOM 245  C CA  . LYS A 1 34  ? 38.892 19.327 23.403 1.00 22.33 ? 430 LYS A CA  1 
ATOM 246  C C   . LYS A 1 34  ? 38.454 18.119 24.208 1.00 21.53 ? 430 LYS A C   1 
ATOM 247  O O   . LYS A 1 34  ? 38.614 16.984 23.767 1.00 23.61 ? 430 LYS A O   1 
ATOM 248  C CB  . LYS A 1 34  ? 37.769 19.692 22.422 1.00 25.59 ? 430 LYS A CB  1 
ATOM 249  C CG  . LYS A 1 34  ? 36.474 20.199 23.049 1.00 29.20 ? 430 LYS A CG  1 
ATOM 250  C CD  . LYS A 1 34  ? 35.457 20.560 21.963 1.00 31.15 ? 430 LYS A CD  1 
ATOM 251  C CE  . LYS A 1 34  ? 34.196 21.193 22.544 1.00 32.32 ? 430 LYS A CE  1 
ATOM 252  N NZ  . LYS A 1 34  ? 33.185 21.522 21.491 1.00 25.96 ? 430 LYS A NZ  1 
ATOM 253  N N   . MET A 1 35  ? 37.899 18.364 25.385 1.00 22.32 ? 431 MET A N   1 
ATOM 254  C CA  . MET A 1 35  ? 37.420 17.281 26.232 1.00 25.57 ? 431 MET A CA  1 
ATOM 255  C C   . MET A 1 35  ? 35.906 17.271 26.143 1.00 24.67 ? 431 MET A C   1 
ATOM 256  O O   . MET A 1 35  ? 35.288 18.316 25.941 1.00 27.00 ? 431 MET A O   1 
ATOM 257  C CB  . MET A 1 35  ? 37.831 17.490 27.696 1.00 23.66 ? 431 MET A CB  1 
ATOM 258  C CG  . MET A 1 35  ? 39.313 17.321 27.980 1.00 28.55 ? 431 MET A CG  1 
ATOM 259  S SD  . MET A 1 35  ? 39.644 17.035 29.737 1.00 29.62 ? 431 MET A SD  1 
ATOM 260  C CE  . MET A 1 35  ? 39.350 18.692 30.411 1.00 25.27 ? 431 MET A CE  1 
ATOM 261  N N   . ILE A 1 36  ? 35.320 16.084 26.199 1.00 26.73 ? 432 ILE A N   1 
ATOM 262  C CA  . ILE A 1 36  ? 33.871 15.969 26.178 1.00 30.90 ? 432 ILE A CA  1 
ATOM 263  C C   . ILE A 1 36  ? 33.450 15.767 27.638 1.00 32.06 ? 432 ILE A C   1 
ATOM 264  O O   . ILE A 1 36  ? 32.315 16.075 28.011 1.00 33.24 ? 432 ILE A O   1 
ATOM 265  C CB  . ILE A 1 36  ? 33.392 14.792 25.284 1.00 32.72 ? 432 ILE A CB  1 
ATOM 266  C CG1 . ILE A 1 36  ? 33.547 15.149 23.802 1.00 31.51 ? 432 ILE A CG1 1 
ATOM 267  C CG2 . ILE A 1 36  ? 31.937 14.456 25.569 1.00 29.29 ? 432 ILE A CG2 1 
ATOM 268  C CD1 . ILE A 1 36  ? 34.977 15.269 23.324 1.00 30.77 ? 432 ILE A CD1 1 
ATOM 269  N N   . LYS A 1 37  ? 34.419 15.307 28.440 1.00 33.53 ? 433 LYS A N   1 
ATOM 270  C CA  . LYS A 1 37  ? 34.341 15.031 29.885 1.00 34.00 ? 433 LYS A CA  1 
ATOM 271  C C   . LYS A 1 37  ? 34.519 13.555 30.235 1.00 35.56 ? 433 LYS A C   1 
ATOM 272  O O   . LYS A 1 37  ? 34.910 12.755 29.384 1.00 36.53 ? 433 LYS A O   1 
ATOM 273  C CB  . LYS A 1 37  ? 33.097 15.629 30.549 1.00 31.21 ? 433 LYS A CB  1 
ATOM 274  C CG  . LYS A 1 37  ? 33.169 17.155 30.714 1.00 30.57 ? 433 LYS A CG  1 
ATOM 275  C CD  . LYS A 1 37  ? 33.736 17.553 32.070 1.00 25.39 ? 433 LYS A CD  1 
ATOM 276  C CE  . LYS A 1 37  ? 32.746 17.249 33.191 1.00 24.00 ? 433 LYS A CE  1 
ATOM 277  N NZ  . LYS A 1 37  ? 31.467 17.997 33.006 1.00 15.65 ? 433 LYS A NZ  1 
ATOM 278  N N   . GLU A 1 38  ? 34.292 13.210 31.500 1.00 35.04 ? 434 GLU A N   1 
ATOM 279  C CA  . GLU A 1 38  ? 34.464 11.841 31.979 1.00 31.68 ? 434 GLU A CA  1 
ATOM 280  C C   . GLU A 1 38  ? 33.159 11.074 32.177 1.00 31.82 ? 434 GLU A C   1 
ATOM 281  O O   . GLU A 1 38  ? 32.313 11.481 32.969 1.00 28.09 ? 434 GLU A O   1 
ATOM 282  C CB  . GLU A 1 38  ? 35.236 11.859 33.299 1.00 31.76 ? 434 GLU A CB  1 
ATOM 283  C CG  . GLU A 1 38  ? 35.525 10.480 33.868 1.00 25.49 ? 434 GLU A CG  1 
ATOM 284  C CD  . GLU A 1 38  ? 36.019 10.534 35.283 1.00 25.78 ? 434 GLU A CD  1 
ATOM 285  O OE1 . GLU A 1 38  ? 35.196 10.333 36.191 1.00 30.32 ? 434 GLU A OE1 1 
ATOM 286  O OE2 . GLU A 1 38  ? 37.222 10.776 35.491 1.00 30.52 ? 434 GLU A OE2 1 
ATOM 287  N N   . GLY A 1 39  ? 33.031 9.938  31.495 1.00 34.12 ? 435 GLY A N   1 
ATOM 288  C CA  . GLY A 1 39  ? 31.844 9.110  31.610 1.00 35.84 ? 435 GLY A CA  1 
ATOM 289  C C   . GLY A 1 39  ? 30.583 9.721  31.023 1.00 37.43 ? 435 GLY A C   1 
ATOM 290  O O   . GLY A 1 39  ? 29.953 9.120  30.144 1.00 36.18 ? 435 GLY A O   1 
ATOM 291  N N   . SER A 1 40  ? 30.200 10.880 31.562 1.00 37.72 ? 436 SER A N   1 
ATOM 292  C CA  . SER A 1 40  ? 29.024 11.656 31.157 1.00 35.78 ? 436 SER A CA  1 
ATOM 293  C C   . SER A 1 40  ? 28.442 11.227 29.825 1.00 34.88 ? 436 SER A C   1 
ATOM 294  O O   . SER A 1 40  ? 27.311 10.745 29.752 1.00 33.75 ? 436 SER A O   1 
ATOM 295  C CB  . SER A 1 40  ? 29.380 13.149 31.108 1.00 35.22 ? 436 SER A CB  1 
ATOM 296  O OG  . SER A 1 40  ? 30.577 13.383 30.374 1.00 28.66 ? 436 SER A OG  1 
ATOM 297  N N   . MET A 1 41  ? 29.236 11.407 28.778 1.00 35.33 ? 437 MET A N   1 
ATOM 298  C CA  . MET A 1 41  ? 28.848 11.037 27.432 1.00 36.32 ? 437 MET A CA  1 
ATOM 299  C C   . MET A 1 41  ? 29.702 9.815  27.112 1.00 35.84 ? 437 MET A C   1 
ATOM 300  O O   . MET A 1 41  ? 30.916 9.829  27.323 1.00 33.00 ? 437 MET A O   1 
ATOM 301  C CB  . MET A 1 41  ? 29.146 12.191 26.467 1.00 35.52 ? 437 MET A CB  1 
ATOM 302  C CG  . MET A 1 41  ? 28.879 13.578 27.063 1.00 36.44 ? 437 MET A CG  1 
ATOM 303  S SD  . MET A 1 41  ? 27.262 13.773 27.876 1.00 30.54 ? 437 MET A SD  1 
ATOM 304  C CE  . MET A 1 41  ? 26.468 14.965 26.768 1.00 30.24 ? 437 MET A CE  1 
ATOM 305  N N   . SER A 1 42  ? 29.060 8.741  26.668 1.00 38.82 ? 438 SER A N   1 
ATOM 306  C CA  . SER A 1 42  ? 29.770 7.507  26.353 1.00 39.46 ? 438 SER A CA  1 
ATOM 307  C C   . SER A 1 42  ? 30.291 7.349  24.928 1.00 37.92 ? 438 SER A C   1 
ATOM 308  O O   . SER A 1 42  ? 29.699 7.844  23.964 1.00 35.58 ? 438 SER A O   1 
ATOM 309  C CB  . SER A 1 42  ? 28.923 6.288  26.739 1.00 39.31 ? 438 SER A CB  1 
ATOM 310  O OG  . SER A 1 42  ? 28.946 6.080  28.141 1.00 42.46 ? 438 SER A OG  1 
ATOM 311  N N   . GLU A 1 43  ? 31.387 6.598  24.830 1.00 38.56 ? 439 GLU A N   1 
ATOM 312  C CA  . GLU A 1 43  ? 32.072 6.281  23.579 1.00 37.22 ? 439 GLU A CA  1 
ATOM 313  C C   . GLU A 1 43  ? 31.122 5.968  22.428 1.00 36.18 ? 439 GLU A C   1 
ATOM 314  O O   . GLU A 1 43  ? 31.254 6.535  21.347 1.00 37.11 ? 439 GLU A O   1 
ATOM 315  C CB  . GLU A 1 43  ? 33.015 5.098  23.820 1.00 38.03 ? 439 GLU A CB  1 
ATOM 316  C CG  . GLU A 1 43  ? 33.578 4.444  22.567 1.00 39.09 ? 439 GLU A CG  1 
ATOM 317  C CD  . GLU A 1 43  ? 34.595 3.357  22.887 1.00 36.27 ? 439 GLU A CD  1 
ATOM 318  O OE1 . GLU A 1 43  ? 34.313 2.514  23.771 1.00 36.28 ? 439 GLU A OE1 1 
ATOM 319  O OE2 . GLU A 1 43  ? 35.677 3.350  22.257 1.00 32.61 ? 439 GLU A OE2 1 
ATOM 320  N N   . ASP A 1 44  ? 30.154 5.090  22.678 1.00 35.64 ? 440 ASP A N   1 
ATOM 321  C CA  . ASP A 1 44  ? 29.172 4.692  21.665 1.00 36.29 ? 440 ASP A CA  1 
ATOM 322  C C   . ASP A 1 44  ? 28.343 5.838  21.089 1.00 35.32 ? 440 ASP A C   1 
ATOM 323  O O   . ASP A 1 44  ? 28.079 5.876  19.884 1.00 31.62 ? 440 ASP A O   1 
ATOM 324  C CB  . ASP A 1 44  ? 28.228 3.619  22.223 1.00 35.13 ? 440 ASP A CB  1 
ATOM 325  C CG  . ASP A 1 44  ? 28.822 2.223  22.157 1.00 33.91 ? 440 ASP A CG  1 
ATOM 326  O OD1 . ASP A 1 44  ? 29.754 1.921  22.933 1.00 33.93 ? 440 ASP A OD1 1 
ATOM 327  O OD2 . ASP A 1 44  ? 28.342 1.425  21.328 1.00 33.14 ? 440 ASP A OD2 1 
ATOM 328  N N   . GLU A 1 45  ? 27.939 6.764  21.954 1.00 34.63 ? 441 GLU A N   1 
ATOM 329  C CA  . GLU A 1 45  ? 27.120 7.905  21.546 1.00 33.66 ? 441 GLU A CA  1 
ATOM 330  C C   . GLU A 1 45  ? 27.786 8.756  20.462 1.00 32.20 ? 441 GLU A C   1 
ATOM 331  O O   . GLU A 1 45  ? 27.301 8.861  19.333 1.00 29.93 ? 441 GLU A O   1 
ATOM 332  C CB  . GLU A 1 45  ? 26.845 8.819  22.742 1.00 35.94 ? 441 GLU A CB  1 
ATOM 333  C CG  . GLU A 1 45  ? 26.422 8.150  24.039 1.00 35.11 ? 441 GLU A CG  1 
ATOM 334  C CD  . GLU A 1 45  ? 26.394 9.138  25.203 1.00 35.16 ? 441 GLU A CD  1 
ATOM 335  O OE1 . GLU A 1 45  ? 26.838 10.292 25.024 1.00 36.46 ? 441 GLU A OE1 1 
ATOM 336  O OE2 . GLU A 1 45  ? 25.946 8.765  26.306 1.00 35.56 ? 441 GLU A OE2 1 
ATOM 337  N N   . PHE A 1 46  ? 28.908 9.361  20.841 1.00 31.11 ? 442 PHE A N   1 
ATOM 338  C CA  . PHE A 1 46  ? 29.683 10.253 19.987 1.00 29.28 ? 442 PHE A CA  1 
ATOM 339  C C   . PHE A 1 46  ? 30.182 9.638  18.671 1.00 27.25 ? 442 PHE A C   1 
ATOM 340  O O   . PHE A 1 46  ? 30.363 10.351 17.688 1.00 26.62 ? 442 PHE A O   1 
ATOM 341  C CB  . PHE A 1 46  ? 30.854 10.837 20.804 1.00 29.09 ? 442 PHE A CB  1 
ATOM 342  C CG  . PHE A 1 46  ? 31.563 11.990 20.135 1.00 31.98 ? 442 PHE A CG  1 
ATOM 343  C CD1 . PHE A 1 46  ? 30.865 12.888 19.325 1.00 32.20 ? 442 PHE A CD1 1 
ATOM 344  C CD2 . PHE A 1 46  ? 32.932 12.173 20.308 1.00 30.79 ? 442 PHE A CD2 1 
ATOM 345  C CE1 . PHE A 1 46  ? 31.517 13.947 18.697 1.00 27.29 ? 442 PHE A CE1 1 
ATOM 346  C CE2 . PHE A 1 46  ? 33.592 13.229 19.684 1.00 29.97 ? 442 PHE A CE2 1 
ATOM 347  C CZ  . PHE A 1 46  ? 32.879 14.117 18.876 1.00 27.41 ? 442 PHE A CZ  1 
ATOM 348  N N   . ILE A 1 47  ? 30.377 8.325  18.646 1.00 26.46 ? 443 ILE A N   1 
ATOM 349  C CA  . ILE A 1 47  ? 30.866 7.639  17.450 1.00 26.92 ? 443 ILE A CA  1 
ATOM 350  C C   . ILE A 1 47  ? 30.173 8.079  16.160 1.00 27.64 ? 443 ILE A C   1 
ATOM 351  O O   . ILE A 1 47  ? 30.834 8.451  15.189 1.00 27.13 ? 443 ILE A O   1 
ATOM 352  C CB  . ILE A 1 47  ? 30.753 6.097  17.608 1.00 27.02 ? 443 ILE A CB  1 
ATOM 353  C CG1 . ILE A 1 47  ? 31.808 5.586  18.602 1.00 26.98 ? 443 ILE A CG1 1 
ATOM 354  C CG2 . ILE A 1 47  ? 30.893 5.399  16.262 1.00 29.28 ? 443 ILE A CG2 1 
ATOM 355  C CD1 . ILE A 1 47  ? 33.253 5.879  18.207 1.00 23.34 ? 443 ILE A CD1 1 
ATOM 356  N N   . GLU A 1 48  ? 28.843 8.057  16.163 1.00 29.25 ? 444 GLU A N   1 
ATOM 357  C CA  . GLU A 1 48  ? 28.061 8.449  14.992 1.00 30.51 ? 444 GLU A CA  1 
ATOM 358  C C   . GLU A 1 48  ? 28.353 9.886  14.571 1.00 29.10 ? 444 GLU A C   1 
ATOM 359  O O   . GLU A 1 48  ? 28.781 10.139 13.445 1.00 29.32 ? 444 GLU A O   1 
ATOM 360  C CB  . GLU A 1 48  ? 26.552 8.274  15.256 1.00 32.35 ? 444 GLU A CB  1 
ATOM 361  C CG  . GLU A 1 48  ? 26.053 8.917  16.553 1.00 35.88 ? 444 GLU A CG  1 
ATOM 362  C CD  . GLU A 1 48  ? 24.549 9.144  16.582 1.00 35.26 ? 444 GLU A CD  1 
ATOM 363  O OE1 . GLU A 1 48  ? 24.116 10.292 16.319 1.00 33.49 ? 444 GLU A OE1 1 
ATOM 364  O OE2 . GLU A 1 48  ? 23.802 8.186  16.886 1.00 36.30 ? 444 GLU A OE2 1 
ATOM 365  N N   . GLU A 1 49  ? 28.173 10.816 15.502 1.00 26.25 ? 445 GLU A N   1 
ATOM 366  C CA  . GLU A 1 49  ? 28.384 12.226 15.229 1.00 25.93 ? 445 GLU A CA  1 
ATOM 367  C C   . GLU A 1 49  ? 29.817 12.534 14.835 1.00 26.08 ? 445 GLU A C   1 
ATOM 368  O O   . GLU A 1 49  ? 30.075 13.505 14.117 1.00 26.43 ? 445 GLU A O   1 
ATOM 369  C CB  . GLU A 1 49  ? 27.935 13.073 16.420 1.00 24.15 ? 445 GLU A CB  1 
ATOM 370  C CG  . GLU A 1 49  ? 26.435 12.964 16.694 1.00 25.82 ? 445 GLU A CG  1 
ATOM 371  C CD  . GLU A 1 49  ? 25.860 14.206 17.357 1.00 26.92 ? 445 GLU A CD  1 
ATOM 372  O OE1 . GLU A 1 49  ? 25.282 14.077 18.454 1.00 21.98 ? 445 GLU A OE1 1 
ATOM 373  O OE2 . GLU A 1 49  ? 25.973 15.308 16.775 1.00 27.91 ? 445 GLU A OE2 1 
ATOM 374  N N   . ALA A 1 50  ? 30.739 11.679 15.272 1.00 26.04 ? 446 ALA A N   1 
ATOM 375  C CA  . ALA A 1 50  ? 32.152 11.831 14.949 1.00 24.80 ? 446 ALA A CA  1 
ATOM 376  C C   . ALA A 1 50  ? 32.346 11.504 13.468 1.00 24.74 ? 446 ALA A C   1 
ATOM 377  O O   . ALA A 1 50  ? 33.003 12.264 12.746 1.00 23.97 ? 446 ALA A O   1 
ATOM 378  C CB  . ALA A 1 50  ? 32.998 10.909 15.813 1.00 24.38 ? 446 ALA A CB  1 
ATOM 379  N N   . LYS A 1 51  ? 31.755 10.391 13.020 1.00 22.24 ? 447 LYS A N   1 
ATOM 380  C CA  . LYS A 1 51  ? 31.841 9.971  11.620 1.00 20.97 ? 447 LYS A CA  1 
ATOM 381  C C   . LYS A 1 51  ? 31.223 11.066 10.762 1.00 20.28 ? 447 LYS A C   1 
ATOM 382  O O   . LYS A 1 51  ? 31.770 11.457 9.727  1.00 18.27 ? 447 LYS A O   1 
ATOM 383  C CB  . LYS A 1 51  ? 31.065 8.669  11.380 1.00 20.58 ? 447 LYS A CB  1 
ATOM 384  C CG  . LYS A 1 51  ? 31.559 7.450  12.143 1.00 22.18 ? 447 LYS A CG  1 
ATOM 385  C CD  . LYS A 1 51  ? 30.767 6.201  11.752 1.00 22.45 ? 447 LYS A CD  1 
ATOM 386  C CE  . LYS A 1 51  ? 30.957 5.063  12.752 1.00 23.27 ? 447 LYS A CE  1 
ATOM 387  N NZ  . LYS A 1 51  ? 32.367 4.595  12.843 1.00 25.50 ? 447 LYS A NZ  1 
ATOM 388  N N   . VAL A 1 52  ? 30.068 11.544 11.210 1.00 22.03 ? 448 VAL A N   1 
ATOM 389  C CA  . VAL A 1 52  ? 29.332 12.599 10.532 1.00 23.98 ? 448 VAL A CA  1 
ATOM 390  C C   . VAL A 1 52  ? 30.154 13.886 10.382 1.00 23.84 ? 448 VAL A C   1 
ATOM 391  O O   . VAL A 1 52  ? 30.177 14.479 9.304  1.00 22.58 ? 448 VAL A O   1 
ATOM 392  C CB  . VAL A 1 52  ? 27.996 12.881 11.266 1.00 26.86 ? 448 VAL A CB  1 
ATOM 393  C CG1 . VAL A 1 52  ? 27.403 14.218 10.835 1.00 26.50 ? 448 VAL A CG1 1 
ATOM 394  C CG2 . VAL A 1 52  ? 27.013 11.760 10.976 1.00 24.51 ? 448 VAL A CG2 1 
ATOM 395  N N   . MET A 1 53  ? 30.848 14.300 11.439 1.00 25.01 ? 449 MET A N   1 
ATOM 396  C CA  . MET A 1 53  ? 31.659 15.514 11.375 1.00 26.00 ? 449 MET A CA  1 
ATOM 397  C C   . MET A 1 53  ? 32.910 15.374 10.514 1.00 26.88 ? 449 MET A C   1 
ATOM 398  O O   . MET A 1 53  ? 33.239 16.271 9.742  1.00 24.06 ? 449 MET A O   1 
ATOM 399  C CB  . MET A 1 53  ? 32.036 15.992 12.775 1.00 28.34 ? 449 MET A CB  1 
ATOM 400  C CG  . MET A 1 53  ? 30.941 16.778 13.471 1.00 29.82 ? 449 MET A CG  1 
ATOM 401  S SD  . MET A 1 53  ? 31.446 17.269 15.116 1.00 32.37 ? 449 MET A SD  1 
ATOM 402  C CE  . MET A 1 53  ? 32.786 18.412 14.721 1.00 32.43 ? 449 MET A CE  1 
ATOM 403  N N   . MET A 1 54  ? 33.610 14.254 10.645 1.00 29.26 ? 450 MET A N   1 
ATOM 404  C CA  . MET A 1 54  ? 34.811 14.023 9.849  1.00 31.06 ? 450 MET A CA  1 
ATOM 405  C C   . MET A 1 54  ? 34.502 13.938 8.351  1.00 28.32 ? 450 MET A C   1 
ATOM 406  O O   . MET A 1 54  ? 35.390 14.091 7.517  1.00 27.65 ? 450 MET A O   1 
ATOM 407  C CB  . MET A 1 54  ? 35.558 12.780 10.336 1.00 34.52 ? 450 MET A CB  1 
ATOM 408  C CG  . MET A 1 54  ? 36.186 12.976 11.709 1.00 35.20 ? 450 MET A CG  1 
ATOM 409  S SD  . MET A 1 54  ? 37.355 11.695 12.173 1.00 38.54 ? 450 MET A SD  1 
ATOM 410  C CE  . MET A 1 54  ? 36.287 10.551 13.085 1.00 33.93 ? 450 MET A CE  1 
ATOM 411  N N   . ASN A 1 55  ? 33.244 13.680 8.007  1.00 27.43 ? 451 ASN A N   1 
ATOM 412  C CA  . ASN A 1 55  ? 32.853 13.636 6.603  1.00 25.78 ? 451 ASN A CA  1 
ATOM 413  C C   . ASN A 1 55  ? 32.781 15.071 6.073  1.00 24.17 ? 451 ASN A C   1 
ATOM 414  O O   . ASN A 1 55  ? 32.831 15.308 4.862  1.00 23.10 ? 451 ASN A O   1 
ATOM 415  C CB  . ASN A 1 55  ? 31.515 12.912 6.417  1.00 25.17 ? 451 ASN A CB  1 
ATOM 416  C CG  . ASN A 1 55  ? 31.681 11.499 5.858  1.00 24.38 ? 451 ASN A CG  1 
ATOM 417  O OD1 . ASN A 1 55  ? 30.703 10.778 5.673  1.00 24.24 ? 451 ASN A OD1 1 
ATOM 418  N ND2 . ASN A 1 55  ? 32.919 11.104 5.576  1.00 27.13 ? 451 ASN A ND2 1 
ATOM 419  N N   . LEU A 1 56  ? 32.656 16.025 6.989  1.00 23.71 ? 452 LEU A N   1 
ATOM 420  C CA  . LEU A 1 56  ? 32.616 17.436 6.627  1.00 21.99 ? 452 LEU A CA  1 
ATOM 421  C C   . LEU A 1 56  ? 34.055 17.854 6.387  1.00 22.15 ? 452 LEU A C   1 
ATOM 422  O O   . LEU A 1 56  ? 34.966 17.356 7.041  1.00 26.28 ? 452 LEU A O   1 
ATOM 423  C CB  . LEU A 1 56  ? 32.023 18.279 7.767  1.00 18.83 ? 452 LEU A CB  1 
ATOM 424  C CG  . LEU A 1 56  ? 30.602 18.795 7.552  1.00 14.55 ? 452 LEU A CG  1 
ATOM 425  C CD1 . LEU A 1 56  ? 29.724 17.669 7.063  1.00 13.88 ? 452 LEU A CD1 1 
ATOM 426  C CD2 . LEU A 1 56  ? 30.064 19.402 8.828  1.00 16.37 ? 452 LEU A CD2 1 
ATOM 427  N N   . SER A 1 57  ? 34.267 18.720 5.414  1.00 18.69 ? 453 SER A N   1 
ATOM 428  C CA  . SER A 1 57  ? 35.598 19.194 5.117  1.00 17.44 ? 453 SER A CA  1 
ATOM 429  C C   . SER A 1 57  ? 35.551 20.344 4.147  1.00 15.35 ? 453 SER A C   1 
ATOM 430  O O   . SER A 1 57  ? 34.960 20.253 3.083  1.00 16.35 ? 453 SER A O   1 
ATOM 431  C CB  . SER A 1 57  ? 36.468 18.074 4.552  1.00 20.39 ? 453 SER A CB  1 
ATOM 432  O OG  . SER A 1 57  ? 37.270 17.498 5.569  1.00 32.76 ? 453 SER A OG  1 
ATOM 433  N N   . HIS A 1 58  ? 36.153 21.445 4.554  1.00 11.81 ? 454 HIS A N   1 
ATOM 434  C CA  . HIS A 1 58  ? 36.240 22.647 3.753  1.00 9.84  ? 454 HIS A CA  1 
ATOM 435  C C   . HIS A 1 58  ? 37.361 23.382 4.449  1.00 9.19  ? 454 HIS A C   1 
ATOM 436  O O   . HIS A 1 58  ? 37.456 23.331 5.676  1.00 8.32  ? 454 HIS A O   1 
ATOM 437  C CB  . HIS A 1 58  ? 34.942 23.469 3.833  1.00 11.56 ? 454 HIS A CB  1 
ATOM 438  C CG  . HIS A 1 58  ? 34.869 24.572 2.821  1.00 5.59  ? 454 HIS A CG  1 
ATOM 439  N ND1 . HIS A 1 58  ? 35.448 25.806 3.020  1.00 2.00  ? 454 HIS A ND1 1 
ATOM 440  C CD2 . HIS A 1 58  ? 34.345 24.601 1.574  1.00 3.51  ? 454 HIS A CD2 1 
ATOM 441  C CE1 . HIS A 1 58  ? 35.292 26.545 1.935  1.00 3.01  ? 454 HIS A CE1 1 
ATOM 442  N NE2 . HIS A 1 58  ? 34.625 25.837 1.044  1.00 4.91  ? 454 HIS A NE2 1 
ATOM 443  N N   . GLU A 1 59  ? 38.232 24.028 3.682  1.00 10.17 ? 455 GLU A N   1 
ATOM 444  C CA  . GLU A 1 59  ? 39.351 24.770 4.262  1.00 10.17 ? 455 GLU A CA  1 
ATOM 445  C C   . GLU A 1 59  ? 38.913 25.952 5.141  1.00 12.87 ? 455 GLU A C   1 
ATOM 446  O O   . GLU A 1 59  ? 39.748 26.617 5.762  1.00 14.07 ? 455 GLU A O   1 
ATOM 447  C CB  . GLU A 1 59  ? 40.280 25.267 3.154  1.00 13.02 ? 455 GLU A CB  1 
ATOM 448  C CG  . GLU A 1 59  ? 39.603 26.176 2.162  1.00 15.79 ? 455 GLU A CG  1 
ATOM 449  C CD  . GLU A 1 59  ? 40.544 26.677 1.091  1.00 20.82 ? 455 GLU A CD  1 
ATOM 450  O OE1 . GLU A 1 59  ? 40.670 27.909 0.940  1.00 24.47 ? 455 GLU A OE1 1 
ATOM 451  O OE2 . GLU A 1 59  ? 41.145 25.840 0.387  1.00 24.08 ? 455 GLU A OE2 1 
ATOM 452  N N   . LYS A 1 60  ? 37.611 26.234 5.163  1.00 8.19  ? 456 LYS A N   1 
ATOM 453  C CA  . LYS A 1 60  ? 37.084 27.334 5.963  1.00 7.61  ? 456 LYS A CA  1 
ATOM 454  C C   . LYS A 1 60  ? 36.266 26.821 7.152  1.00 5.26  ? 456 LYS A C   1 
ATOM 455  O O   . LYS A 1 60  ? 35.500 27.555 7.770  1.00 3.31  ? 456 LYS A O   1 
ATOM 456  C CB  . LYS A 1 60  ? 36.272 28.282 5.078  1.00 6.39  ? 456 LYS A CB  1 
ATOM 457  C CG  . LYS A 1 60  ? 37.102 28.927 3.974  1.00 9.24  ? 456 LYS A CG  1 
ATOM 458  C CD  . LYS A 1 60  ? 38.167 29.879 4.537  1.00 11.93 ? 456 LYS A CD  1 
ATOM 459  C CE  . LYS A 1 60  ? 39.236 30.217 3.493  1.00 13.97 ? 456 LYS A CE  1 
ATOM 460  N NZ  . LYS A 1 60  ? 38.693 30.793 2.222  1.00 11.85 ? 456 LYS A NZ  1 
ATOM 461  N N   . LEU A 1 61  ? 36.419 25.533 7.429  1.00 7.43  ? 457 LEU A N   1 
ATOM 462  C CA  . LEU A 1 61  ? 35.747 24.870 8.542  1.00 7.04  ? 457 LEU A CA  1 
ATOM 463  C C   . LEU A 1 61  ? 36.886 24.267 9.335  1.00 5.80  ? 457 LEU A C   1 
ATOM 464  O O   . LEU A 1 61  ? 37.797 23.684 8.756  1.00 8.77  ? 457 LEU A O   1 
ATOM 465  C CB  . LEU A 1 61  ? 34.833 23.732 8.051  1.00 5.48  ? 457 LEU A CB  1 
ATOM 466  C CG  . LEU A 1 61  ? 33.423 24.015 7.512  1.00 12.38 ? 457 LEU A CG  1 
ATOM 467  C CD1 . LEU A 1 61  ? 32.887 22.821 6.734  1.00 6.71  ? 457 LEU A CD1 1 
ATOM 468  C CD2 . LEU A 1 61  ? 32.491 24.355 8.648  1.00 2.00  ? 457 LEU A CD2 1 
ATOM 469  N N   . VAL A 1 62  ? 36.897 24.497 10.638 1.00 5.47  ? 458 VAL A N   1 
ATOM 470  C CA  . VAL A 1 62  ? 37.928 23.925 11.478 1.00 5.34  ? 458 VAL A CA  1 
ATOM 471  C C   . VAL A 1 62  ? 37.645 22.427 11.404 1.00 9.05  ? 458 VAL A C   1 
ATOM 472  O O   . VAL A 1 62  ? 36.517 21.990 11.660 1.00 8.51  ? 458 VAL A O   1 
ATOM 473  C CB  . VAL A 1 62  ? 37.817 24.471 12.907 1.00 5.74  ? 458 VAL A CB  1 
ATOM 474  C CG1 . VAL A 1 62  ? 38.738 23.703 13.862 1.00 4.86  ? 458 VAL A CG1 1 
ATOM 475  C CG2 . VAL A 1 62  ? 38.169 25.956 12.901 1.00 2.00  ? 458 VAL A CG2 1 
ATOM 476  N N   . GLN A 1 63  ? 38.640 21.670 10.947 1.00 12.50 ? 459 GLN A N   1 
ATOM 477  C CA  . GLN A 1 63  ? 38.532 20.223 10.769 1.00 11.11 ? 459 GLN A CA  1 
ATOM 478  C C   . GLN A 1 63  ? 38.737 19.413 12.034 1.00 10.27 ? 459 GLN A C   1 
ATOM 479  O O   . GLN A 1 63  ? 39.607 19.710 12.855 1.00 10.07 ? 459 GLN A O   1 
ATOM 480  C CB  . GLN A 1 63  ? 39.567 19.716 9.751  1.00 12.18 ? 459 GLN A CB  1 
ATOM 481  C CG  . GLN A 1 63  ? 39.885 20.639 8.588  1.00 14.96 ? 459 GLN A CG  1 
ATOM 482  C CD  . GLN A 1 63  ? 38.883 20.575 7.462  1.00 16.30 ? 459 GLN A CD  1 
ATOM 483  O OE1 . GLN A 1 63  ? 37.686 20.837 7.644  1.00 18.40 ? 459 GLN A OE1 1 
ATOM 484  N NE2 . GLN A 1 63  ? 39.375 20.255 6.265  1.00 15.08 ? 459 GLN A NE2 1 
ATOM 485  N N   . LEU A 1 64  ? 37.964 18.345 12.143 1.00 11.55 ? 460 LEU A N   1 
ATOM 486  C CA  . LEU A 1 64  ? 38.069 17.422 13.253 1.00 12.61 ? 460 LEU A CA  1 
ATOM 487  C C   . LEU A 1 64  ? 39.012 16.356 12.712 1.00 12.22 ? 460 LEU A C   1 
ATOM 488  O O   . LEU A 1 64  ? 38.832 15.883 11.588 1.00 9.11  ? 460 LEU A O   1 
ATOM 489  C CB  . LEU A 1 64  ? 36.702 16.791 13.552 1.00 10.46 ? 460 LEU A CB  1 
ATOM 490  C CG  . LEU A 1 64  ? 36.480 16.009 14.854 1.00 9.21  ? 460 LEU A CG  1 
ATOM 491  C CD1 . LEU A 1 64  ? 35.616 14.793 14.552 1.00 10.03 ? 460 LEU A CD1 1 
ATOM 492  C CD2 . LEU A 1 64  ? 37.789 15.552 15.490 1.00 10.95 ? 460 LEU A CD2 1 
ATOM 493  N N   . TYR A 1 65  ? 40.019 15.988 13.496 1.00 14.03 ? 461 TYR A N   1 
ATOM 494  C CA  . TYR A 1 65  ? 40.970 14.972 13.063 1.00 17.98 ? 461 TYR A CA  1 
ATOM 495  C C   . TYR A 1 65  ? 40.593 13.578 13.527 1.00 19.94 ? 461 TYR A C   1 
ATOM 496  O O   . TYR A 1 65  ? 40.611 12.630 12.747 1.00 20.11 ? 461 TYR A O   1 
ATOM 497  C CB  . TYR A 1 65  ? 42.385 15.311 13.531 1.00 15.90 ? 461 TYR A CB  1 
ATOM 498  C CG  . TYR A 1 65  ? 42.994 16.477 12.797 1.00 14.99 ? 461 TYR A CG  1 
ATOM 499  C CD1 . TYR A 1 65  ? 43.523 17.553 13.489 1.00 10.88 ? 461 TYR A CD1 1 
ATOM 500  C CD2 . TYR A 1 65  ? 43.007 16.517 11.403 1.00 18.59 ? 461 TYR A CD2 1 
ATOM 501  C CE1 . TYR A 1 65  ? 44.047 18.645 12.821 1.00 18.55 ? 461 TYR A CE1 1 
ATOM 502  C CE2 . TYR A 1 65  ? 43.532 17.611 10.720 1.00 18.77 ? 461 TYR A CE2 1 
ATOM 503  C CZ  . TYR A 1 65  ? 44.046 18.673 11.439 1.00 18.48 ? 461 TYR A CZ  1 
ATOM 504  O OH  . TYR A 1 65  ? 44.539 19.774 10.780 1.00 17.96 ? 461 TYR A OH  1 
ATOM 505  N N   . GLY A 1 66  ? 40.226 13.455 14.796 1.00 22.97 ? 462 GLY A N   1 
ATOM 506  C CA  . GLY A 1 66  ? 39.872 12.155 15.319 1.00 21.20 ? 462 GLY A CA  1 
ATOM 507  C C   . GLY A 1 66  ? 39.280 12.224 16.705 1.00 19.72 ? 462 GLY A C   1 
ATOM 508  O O   . GLY A 1 66  ? 39.205 13.291 17.320 1.00 15.82 ? 462 GLY A O   1 
ATOM 509  N N   . VAL A 1 67  ? 38.841 11.070 17.186 1.00 17.64 ? 463 VAL A N   1 
ATOM 510  C CA  . VAL A 1 67  ? 38.231 10.961 18.494 1.00 19.56 ? 463 VAL A CA  1 
ATOM 511  C C   . VAL A 1 67  ? 39.036 10.004 19.345 1.00 22.19 ? 463 VAL A C   1 
ATOM 512  O O   . VAL A 1 67  ? 39.563 9.008  18.851 1.00 26.83 ? 463 VAL A O   1 
ATOM 513  C CB  . VAL A 1 67  ? 36.778 10.448 18.397 1.00 14.65 ? 463 VAL A CB  1 
ATOM 514  C CG1 . VAL A 1 67  ? 35.920 11.446 17.649 1.00 12.04 ? 463 VAL A CG1 1 
ATOM 515  C CG2 . VAL A 1 67  ? 36.737 9.090  17.715 1.00 16.09 ? 463 VAL A CG2 1 
ATOM 516  N N   . CYS A 1 68  ? 39.170 10.340 20.617 1.00 26.12 ? 464 CYS A N   1 
ATOM 517  C CA  . CYS A 1 68  ? 39.893 9.505  21.559 1.00 28.36 ? 464 CYS A CA  1 
ATOM 518  C C   . CYS A 1 68  ? 38.834 9.182  22.613 1.00 31.37 ? 464 CYS A C   1 
ATOM 519  O O   . CYS A 1 68  ? 38.850 9.707  23.726 1.00 32.82 ? 464 CYS A O   1 
ATOM 520  C CB  . CYS A 1 68  ? 41.077 10.279 22.153 1.00 28.93 ? 464 CYS A CB  1 
ATOM 521  S SG  . CYS A 1 68  ? 42.375 9.282  22.957 1.00 33.22 ? 464 CYS A SG  1 
ATOM 522  N N   . THR A 1 69  ? 37.859 8.377  22.204 1.00 32.79 ? 465 THR A N   1 
ATOM 523  C CA  . THR A 1 69  ? 36.759 7.968  23.071 1.00 33.01 ? 465 THR A CA  1 
ATOM 524  C C   . THR A 1 69  ? 37.150 6.759  23.921 1.00 34.05 ? 465 THR A C   1 
ATOM 525  O O   . THR A 1 69  ? 36.283 6.010  24.378 1.00 31.83 ? 465 THR A O   1 
ATOM 526  C CB  . THR A 1 69  ? 35.521 7.569  22.227 1.00 31.07 ? 465 THR A CB  1 
ATOM 527  O OG1 . THR A 1 69  ? 35.870 6.490  21.350 1.00 30.45 ? 465 THR A OG1 1 
ATOM 528  C CG2 . THR A 1 69  ? 35.026 8.741  21.397 1.00 28.93 ? 465 THR A CG2 1 
ATOM 529  N N   . LYS A 1 70  ? 38.447 6.571  24.138 1.00 35.70 ? 466 LYS A N   1 
ATOM 530  C CA  . LYS A 1 70  ? 38.926 5.426  24.901 1.00 36.53 ? 466 LYS A CA  1 
ATOM 531  C C   . LYS A 1 70  ? 38.461 5.332  26.349 1.00 36.75 ? 466 LYS A C   1 
ATOM 532  O O   . LYS A 1 70  ? 39.215 5.624  27.278 1.00 34.39 ? 466 LYS A O   1 
ATOM 533  C CB  . LYS A 1 70  ? 40.447 5.308  24.793 1.00 35.48 ? 466 LYS A CB  1 
ATOM 534  C CG  . LYS A 1 70  ? 40.955 4.991  23.376 1.00 38.68 ? 466 LYS A CG  1 
ATOM 535  C CD  . LYS A 1 70  ? 40.542 3.589  22.894 1.00 39.29 ? 466 LYS A CD  1 
ATOM 536  C CE  . LYS A 1 70  ? 39.081 3.514  22.451 1.00 38.59 ? 466 LYS A CE  1 
ATOM 537  N NZ  . LYS A 1 70  ? 38.664 2.137  22.077 1.00 40.01 ? 466 LYS A NZ  1 
ATOM 538  N N   . GLN A 1 71  ? 37.226 4.861  26.513 1.00 37.31 ? 467 GLN A N   1 
ATOM 539  C CA  . GLN A 1 71  ? 36.588 4.671  27.809 1.00 38.68 ? 467 GLN A CA  1 
ATOM 540  C C   . GLN A 1 71  ? 36.671 5.870  28.743 1.00 40.26 ? 467 GLN A C   1 
ATOM 541  O O   . GLN A 1 71  ? 35.659 6.531  29.004 1.00 43.24 ? 467 GLN A O   1 
ATOM 542  C CB  . GLN A 1 71  ? 37.121 3.402  28.476 1.00 36.64 ? 467 GLN A CB  1 
ATOM 543  C CG  . GLN A 1 71  ? 36.249 2.166  28.246 1.00 35.25 ? 467 GLN A CG  1 
ATOM 544  C CD  . GLN A 1 71  ? 35.842 1.967  26.787 1.00 33.56 ? 467 GLN A CD  1 
ATOM 545  O OE1 . GLN A 1 71  ? 36.529 2.412  25.864 1.00 32.22 ? 467 GLN A OE1 1 
ATOM 546  N NE2 . GLN A 1 71  ? 34.716 1.289  26.578 1.00 27.03 ? 467 GLN A NE2 1 
ATOM 547  N N   . ARG A 1 72  ? 37.860 6.118  29.282 1.00 40.19 ? 468 ARG A N   1 
ATOM 548  C CA  . ARG A 1 72  ? 38.082 7.248  30.173 1.00 38.09 ? 468 ARG A CA  1 
ATOM 549  C C   . ARG A 1 72  ? 37.861 8.506  29.328 1.00 37.39 ? 468 ARG A C   1 
ATOM 550  O O   . ARG A 1 72  ? 37.805 8.408  28.105 1.00 37.02 ? 468 ARG A O   1 
ATOM 551  C CB  . ARG A 1 72  ? 39.501 7.183  30.746 1.00 35.92 ? 468 ARG A CB  1 
ATOM 552  C CG  . ARG A 1 72  ? 39.801 5.921  31.551 1.00 30.86 ? 468 ARG A CG  1 
ATOM 553  C CD  . ARG A 1 72  ? 38.832 5.707  32.719 1.00 32.42 ? 468 ARG A CD  1 
ATOM 554  N NE  . ARG A 1 72  ? 37.508 5.243  32.293 1.00 33.04 ? 468 ARG A NE  1 
ATOM 555  C CZ  . ARG A 1 72  ? 37.243 4.020  31.837 1.00 35.40 ? 468 ARG A CZ  1 
ATOM 556  N NH1 . ARG A 1 72  ? 38.206 3.109  31.740 1.00 37.18 ? 468 ARG A NH1 1 
ATOM 557  N NH2 . ARG A 1 72  ? 36.010 3.707  31.465 1.00 35.12 ? 468 ARG A NH2 1 
ATOM 558  N N   . PRO A 1 73  ? 37.755 9.695  29.961 1.00 37.24 ? 469 PRO A N   1 
ATOM 559  C CA  . PRO A 1 73  ? 37.532 10.971 29.266 1.00 36.80 ? 469 PRO A CA  1 
ATOM 560  C C   . PRO A 1 73  ? 37.672 10.973 27.742 1.00 34.06 ? 469 PRO A C   1 
ATOM 561  O O   . PRO A 1 73  ? 38.733 10.653 27.196 1.00 32.99 ? 469 PRO A O   1 
ATOM 562  C CB  . PRO A 1 73  ? 38.542 11.886 29.943 1.00 36.83 ? 469 PRO A CB  1 
ATOM 563  C CG  . PRO A 1 73  ? 38.390 11.487 31.363 1.00 35.94 ? 469 PRO A CG  1 
ATOM 564  C CD  . PRO A 1 73  ? 38.219 9.958  31.336 1.00 35.17 ? 469 PRO A CD  1 
ATOM 565  N N   . ILE A 1 74  ? 36.569 11.286 27.066 1.00 33.42 ? 470 ILE A N   1 
ATOM 566  C CA  . ILE A 1 74  ? 36.537 11.338 25.608 1.00 29.80 ? 470 ILE A CA  1 
ATOM 567  C C   . ILE A 1 74  ? 37.156 12.645 25.148 1.00 28.29 ? 470 ILE A C   1 
ATOM 568  O O   . ILE A 1 74  ? 36.724 13.725 25.563 1.00 28.16 ? 470 ILE A O   1 
ATOM 569  C CB  . ILE A 1 74  ? 35.096 11.277 25.068 1.00 28.92 ? 470 ILE A CB  1 
ATOM 570  C CG1 . ILE A 1 74  ? 34.434 9.950  25.447 1.00 32.53 ? 470 ILE A CG1 1 
ATOM 571  C CG2 . ILE A 1 74  ? 35.095 11.469 23.561 1.00 28.43 ? 470 ILE A CG2 1 
ATOM 572  C CD1 . ILE A 1 74  ? 32.980 9.858  25.017 1.00 31.41 ? 470 ILE A CD1 1 
ATOM 573  N N   . PHE A 1 75  ? 38.171 12.542 24.302 1.00 26.48 ? 471 PHE A N   1 
ATOM 574  C CA  . PHE A 1 75  ? 38.848 13.718 23.782 1.00 23.24 ? 471 PHE A CA  1 
ATOM 575  C C   . PHE A 1 75  ? 38.589 13.837 22.289 1.00 19.98 ? 471 PHE A C   1 
ATOM 576  O O   . PHE A 1 75  ? 38.237 12.862 21.614 1.00 18.06 ? 471 PHE A O   1 
ATOM 577  C CB  . PHE A 1 75  ? 40.362 13.623 24.005 1.00 26.91 ? 471 PHE A CB  1 
ATOM 578  C CG  . PHE A 1 75  ? 40.753 12.964 25.294 1.00 33.25 ? 471 PHE A CG  1 
ATOM 579  C CD1 . PHE A 1 75  ? 40.457 13.560 26.517 1.00 34.40 ? 471 PHE A CD1 1 
ATOM 580  C CD2 . PHE A 1 75  ? 41.419 11.742 25.286 1.00 33.15 ? 471 PHE A CD2 1 
ATOM 581  C CE1 . PHE A 1 75  ? 40.821 12.949 27.708 1.00 37.94 ? 471 PHE A CE1 1 
ATOM 582  C CE2 . PHE A 1 75  ? 41.787 11.120 26.474 1.00 37.98 ? 471 PHE A CE2 1 
ATOM 583  C CZ  . PHE A 1 75  ? 41.489 11.723 27.687 1.00 38.55 ? 471 PHE A CZ  1 
ATOM 584  N N   . ILE A 1 76  ? 38.796 15.038 21.776 1.00 15.89 ? 472 ILE A N   1 
ATOM 585  C CA  . ILE A 1 76  ? 38.624 15.310 20.367 1.00 16.13 ? 472 ILE A CA  1 
ATOM 586  C C   . ILE A 1 76  ? 39.763 16.270 20.030 1.00 15.65 ? 472 ILE A C   1 
ATOM 587  O O   . ILE A 1 76  ? 40.164 17.076 20.876 1.00 14.58 ? 472 ILE A O   1 
ATOM 588  C CB  . ILE A 1 76  ? 37.214 15.928 20.068 1.00 19.20 ? 472 ILE A CB  1 
ATOM 589  C CG1 . ILE A 1 76  ? 36.746 15.519 18.672 1.00 22.75 ? 472 ILE A CG1 1 
ATOM 590  C CG2 . ILE A 1 76  ? 37.237 17.445 20.155 1.00 21.36 ? 472 ILE A CG2 1 
ATOM 591  C CD1 . ILE A 1 76  ? 35.491 16.217 18.204 1.00 19.43 ? 472 ILE A CD1 1 
ATOM 592  N N   . ILE A 1 77  ? 40.374 16.081 18.861 1.00 12.55 ? 473 ILE A N   1 
ATOM 593  C CA  . ILE A 1 77  ? 41.460 16.941 18.410 1.00 8.29  ? 473 ILE A CA  1 
ATOM 594  C C   . ILE A 1 77  ? 41.023 17.624 17.140 1.00 10.43 ? 473 ILE A C   1 
ATOM 595  O O   . ILE A 1 77  ? 40.655 16.974 16.163 1.00 10.61 ? 473 ILE A O   1 
ATOM 596  C CB  . ILE A 1 77  ? 42.760 16.179 18.121 1.00 6.11  ? 473 ILE A CB  1 
ATOM 597  C CG1 . ILE A 1 77  ? 42.469 14.896 17.351 1.00 12.26 ? 473 ILE A CG1 1 
ATOM 598  C CG2 . ILE A 1 77  ? 43.512 15.930 19.394 1.00 8.19  ? 473 ILE A CG2 1 
ATOM 599  C CD1 . ILE A 1 77  ? 43.722 14.129 16.949 1.00 12.28 ? 473 ILE A CD1 1 
ATOM 600  N N   . THR A 1 78  ? 41.039 18.943 17.169 1.00 10.11 ? 474 THR A N   1 
ATOM 601  C CA  . THR A 1 78  ? 40.646 19.740 16.031 1.00 12.13 ? 474 THR A CA  1 
ATOM 602  C C   . THR A 1 78  ? 41.897 20.487 15.586 1.00 12.41 ? 474 THR A C   1 
ATOM 603  O O   . THR A 1 78  ? 42.914 20.444 16.278 1.00 12.99 ? 474 THR A O   1 
ATOM 604  C CB  . THR A 1 78  ? 39.527 20.724 16.452 1.00 13.64 ? 474 THR A CB  1 
ATOM 605  O OG1 . THR A 1 78  ? 39.496 20.831 17.885 1.00 11.89 ? 474 THR A OG1 1 
ATOM 606  C CG2 . THR A 1 78  ? 38.169 20.231 15.967 1.00 14.36 ? 474 THR A CG2 1 
ATOM 607  N N   . GLU A 1 79  ? 41.862 21.114 14.413 1.00 14.37 ? 475 GLU A N   1 
ATOM 608  C CA  . GLU A 1 79  ? 43.032 21.851 13.951 1.00 14.93 ? 475 GLU A CA  1 
ATOM 609  C C   . GLU A 1 79  ? 43.267 23.084 14.813 1.00 15.03 ? 475 GLU A C   1 
ATOM 610  O O   . GLU A 1 79  ? 42.311 23.751 15.216 1.00 16.87 ? 475 GLU A O   1 
ATOM 611  C CB  . GLU A 1 79  ? 42.927 22.210 12.462 1.00 14.14 ? 475 GLU A CB  1 
ATOM 612  C CG  . GLU A 1 79  ? 41.841 23.163 12.075 1.00 18.34 ? 475 GLU A CG  1 
ATOM 613  C CD  . GLU A 1 79  ? 41.887 23.516 10.590 1.00 18.18 ? 475 GLU A CD  1 
ATOM 614  O OE1 . GLU A 1 79  ? 42.827 24.212 10.143 1.00 19.64 ? 475 GLU A OE1 1 
ATOM 615  O OE2 . GLU A 1 79  ? 40.976 23.102 9.860  1.00 17.68 ? 475 GLU A OE2 1 
ATOM 616  N N   . TYR A 1 80  ? 44.533 23.327 15.156 1.00 16.03 ? 476 TYR A N   1 
ATOM 617  C CA  . TYR A 1 80  ? 44.938 24.462 15.985 1.00 12.78 ? 476 TYR A CA  1 
ATOM 618  C C   . TYR A 1 80  ? 44.864 25.760 15.202 1.00 9.86  ? 476 TYR A C   1 
ATOM 619  O O   . TYR A 1 80  ? 45.291 25.822 14.053 1.00 12.02 ? 476 TYR A O   1 
ATOM 620  C CB  . TYR A 1 80  ? 46.367 24.263 16.516 1.00 14.76 ? 476 TYR A CB  1 
ATOM 621  C CG  . TYR A 1 80  ? 46.849 25.389 17.397 1.00 17.47 ? 476 TYR A CG  1 
ATOM 622  C CD1 . TYR A 1 80  ? 46.426 25.491 18.719 1.00 21.65 ? 476 TYR A CD1 1 
ATOM 623  C CD2 . TYR A 1 80  ? 47.676 26.394 16.895 1.00 16.67 ? 476 TYR A CD2 1 
ATOM 624  C CE1 . TYR A 1 80  ? 46.806 26.566 19.519 1.00 18.11 ? 476 TYR A CE1 1 
ATOM 625  C CE2 . TYR A 1 80  ? 48.059 27.477 17.690 1.00 15.07 ? 476 TYR A CE2 1 
ATOM 626  C CZ  . TYR A 1 80  ? 47.617 27.555 19.000 1.00 20.25 ? 476 TYR A CZ  1 
ATOM 627  O OH  . TYR A 1 80  ? 47.963 28.621 19.801 1.00 22.07 ? 476 TYR A OH  1 
ATOM 628  N N   . MET A 1 81  ? 44.341 26.798 15.850 1.00 12.43 ? 477 MET A N   1 
ATOM 629  C CA  . MET A 1 81  ? 44.180 28.122 15.248 1.00 10.82 ? 477 MET A CA  1 
ATOM 630  C C   . MET A 1 81  ? 44.923 29.171 16.076 1.00 8.89  ? 477 MET A C   1 
ATOM 631  O O   . MET A 1 81  ? 44.402 29.665 17.076 1.00 10.46 ? 477 MET A O   1 
ATOM 632  C CB  . MET A 1 81  ? 42.690 28.470 15.173 1.00 13.68 ? 477 MET A CB  1 
ATOM 633  C CG  . MET A 1 81  ? 41.854 27.466 14.373 1.00 12.55 ? 477 MET A CG  1 
ATOM 634  S SD  . MET A 1 81  ? 42.224 27.500 12.622 1.00 8.47  ? 477 MET A SD  1 
ATOM 635  C CE  . MET A 1 81  ? 41.240 28.862 12.158 1.00 8.85  ? 477 MET A CE  1 
ATOM 636  N N   . ALA A 1 82  ? 46.112 29.547 15.613 1.00 8.05  ? 478 ALA A N   1 
ATOM 637  C CA  . ALA A 1 82  ? 46.980 30.503 16.300 1.00 6.04  ? 478 ALA A CA  1 
ATOM 638  C C   . ALA A 1 82  ? 46.437 31.822 16.827 1.00 7.42  ? 478 ALA A C   1 
ATOM 639  O O   . ALA A 1 82  ? 46.895 32.297 17.862 1.00 9.51  ? 478 ALA A O   1 
ATOM 640  C CB  . ALA A 1 82  ? 48.218 30.762 15.478 1.00 6.02  ? 478 ALA A CB  1 
ATOM 641  N N   . ASN A 1 83  ? 45.508 32.452 16.127 1.00 8.70  ? 479 ASN A N   1 
ATOM 642  C CA  . ASN A 1 83  ? 44.997 33.721 16.625 1.00 11.12 ? 479 ASN A CA  1 
ATOM 643  C C   . ASN A 1 83  ? 43.778 33.594 17.527 1.00 10.80 ? 479 ASN A C   1 
ATOM 644  O O   . ASN A 1 83  ? 43.300 34.593 18.066 1.00 13.56 ? 479 ASN A O   1 
ATOM 645  C CB  . ASN A 1 83  ? 44.736 34.705 15.482 1.00 10.56 ? 479 ASN A CB  1 
ATOM 646  C CG  . ASN A 1 83  ? 46.014 35.189 14.823 1.00 10.54 ? 479 ASN A CG  1 
ATOM 647  O OD1 . ASN A 1 83  ? 46.162 35.116 13.607 1.00 14.22 ? 479 ASN A OD1 1 
ATOM 648  N ND2 . ASN A 1 83  ? 46.944 35.693 15.623 1.00 5.93  ? 479 ASN A ND2 1 
ATOM 649  N N   . GLY A 1 84  ? 43.309 32.371 17.742 1.00 13.64 ? 480 GLY A N   1 
ATOM 650  C CA  . GLY A 1 84  ? 42.153 32.165 18.600 1.00 18.12 ? 480 GLY A CA  1 
ATOM 651  C C   . GLY A 1 84  ? 40.822 32.436 17.919 1.00 18.79 ? 480 GLY A C   1 
ATOM 652  O O   . GLY A 1 84  ? 40.670 32.194 16.723 1.00 18.15 ? 480 GLY A O   1 
ATOM 653  N N   . CYS A 1 85  ? 39.844 32.921 18.679 1.00 20.27 ? 481 CYS A N   1 
ATOM 654  C CA  . CYS A 1 85  ? 38.534 33.210 18.108 1.00 16.03 ? 481 CYS A CA  1 
ATOM 655  C C   . CYS A 1 85  ? 38.471 34.591 17.466 1.00 14.17 ? 481 CYS A C   1 
ATOM 656  O O   . CYS A 1 85  ? 39.155 35.525 17.895 1.00 12.70 ? 481 CYS A O   1 
ATOM 657  C CB  . CYS A 1 85  ? 37.429 33.058 19.155 1.00 12.24 ? 481 CYS A CB  1 
ATOM 658  S SG  . CYS A 1 85  ? 37.336 34.396 20.332 1.00 19.49 ? 481 CYS A SG  1 
ATOM 659  N N   . LEU A 1 86  ? 37.617 34.710 16.457 1.00 13.70 ? 482 LEU A N   1 
ATOM 660  C CA  . LEU A 1 86  ? 37.419 35.940 15.711 1.00 14.10 ? 482 LEU A CA  1 
ATOM 661  C C   . LEU A 1 86  ? 37.042 37.100 16.620 1.00 13.30 ? 482 LEU A C   1 
ATOM 662  O O   . LEU A 1 86  ? 37.436 38.235 16.371 1.00 11.50 ? 482 LEU A O   1 
ATOM 663  C CB  . LEU A 1 86  ? 36.332 35.727 14.658 1.00 15.16 ? 482 LEU A CB  1 
ATOM 664  C CG  . LEU A 1 86  ? 35.978 36.880 13.718 1.00 15.54 ? 482 LEU A CG  1 
ATOM 665  C CD1 . LEU A 1 86  ? 37.163 37.237 12.839 1.00 13.49 ? 482 LEU A CD1 1 
ATOM 666  C CD2 . LEU A 1 86  ? 34.792 36.478 12.866 1.00 11.61 ? 482 LEU A CD2 1 
ATOM 667  N N   . LEU A 1 87  ? 36.283 36.816 17.674 1.00 14.77 ? 483 LEU A N   1 
ATOM 668  C CA  . LEU A 1 87  ? 35.861 37.856 18.604 1.00 18.16 ? 483 LEU A CA  1 
ATOM 669  C C   . LEU A 1 87  ? 37.079 38.543 19.224 1.00 18.15 ? 483 LEU A C   1 
ATOM 670  O O   . LEU A 1 87  ? 37.198 39.770 19.181 1.00 17.24 ? 483 LEU A O   1 
ATOM 671  C CB  . LEU A 1 87  ? 34.949 37.266 19.682 1.00 16.94 ? 483 LEU A CB  1 
ATOM 672  C CG  . LEU A 1 87  ? 34.146 38.245 20.538 1.00 14.08 ? 483 LEU A CG  1 
ATOM 673  C CD1 . LEU A 1 87  ? 33.408 39.261 19.667 1.00 16.88 ? 483 LEU A CD1 1 
ATOM 674  C CD2 . LEU A 1 87  ? 33.162 37.464 21.361 1.00 14.16 ? 483 LEU A CD2 1 
ATOM 675  N N   . ASN A 1 88  ? 38.009 37.739 19.729 1.00 18.40 ? 484 ASN A N   1 
ATOM 676  C CA  . ASN A 1 88  ? 39.238 38.239 20.340 1.00 17.40 ? 484 ASN A CA  1 
ATOM 677  C C   . ASN A 1 88  ? 40.086 38.925 19.286 1.00 16.06 ? 484 ASN A C   1 
ATOM 678  O O   . ASN A 1 88  ? 40.682 39.971 19.535 1.00 22.07 ? 484 ASN A O   1 
ATOM 679  C CB  . ASN A 1 88  ? 40.024 37.078 20.957 1.00 20.05 ? 484 ASN A CB  1 
ATOM 680  C CG  . ASN A 1 88  ? 41.426 37.474 21.390 1.00 22.96 ? 484 ASN A CG  1 
ATOM 681  O OD1 . ASN A 1 88  ? 41.687 38.628 21.741 1.00 27.75 ? 484 ASN A OD1 1 
ATOM 682  N ND2 . ASN A 1 88  ? 42.338 36.511 21.374 1.00 26.58 ? 484 ASN A ND2 1 
ATOM 683  N N   . TYR A 1 89  ? 40.101 38.350 18.092 1.00 13.87 ? 485 TYR A N   1 
ATOM 684  C CA  . TYR A 1 89  ? 40.880 38.889 16.985 1.00 8.60  ? 485 TYR A CA  1 
ATOM 685  C C   . TYR A 1 89  ? 40.432 40.296 16.587 1.00 9.48  ? 485 TYR A C   1 
ATOM 686  O O   . TYR A 1 89  ? 41.250 41.203 16.394 1.00 8.68  ? 485 TYR A O   1 
ATOM 687  C CB  . TYR A 1 89  ? 40.775 37.944 15.791 1.00 5.86  ? 485 TYR A CB  1 
ATOM 688  C CG  . TYR A 1 89  ? 41.861 38.126 14.770 1.00 6.11  ? 485 TYR A CG  1 
ATOM 689  C CD1 . TYR A 1 89  ? 43.186 37.815 15.073 1.00 8.26  ? 485 TYR A CD1 1 
ATOM 690  C CD2 . TYR A 1 89  ? 41.568 38.600 13.492 1.00 11.03 ? 485 TYR A CD2 1 
ATOM 691  C CE1 . TYR A 1 89  ? 44.193 37.969 14.128 1.00 12.73 ? 485 TYR A CE1 1 
ATOM 692  C CE2 . TYR A 1 89  ? 42.575 38.763 12.535 1.00 12.88 ? 485 TYR A CE2 1 
ATOM 693  C CZ  . TYR A 1 89  ? 43.881 38.445 12.861 1.00 13.61 ? 485 TYR A CZ  1 
ATOM 694  O OH  . TYR A 1 89  ? 44.873 38.605 11.920 1.00 19.94 ? 485 TYR A OH  1 
ATOM 695  N N   . LEU A 1 90  ? 39.121 40.472 16.516 1.00 8.14  ? 486 LEU A N   1 
ATOM 696  C CA  . LEU A 1 90  ? 38.504 41.729 16.137 1.00 10.39 ? 486 LEU A CA  1 
ATOM 697  C C   . LEU A 1 90  ? 38.770 42.885 17.088 1.00 9.35  ? 486 LEU A C   1 
ATOM 698  O O   . LEU A 1 90  ? 38.730 44.047 16.679 1.00 10.01 ? 486 LEU A O   1 
ATOM 699  C CB  . LEU A 1 90  ? 36.996 41.521 15.971 1.00 7.77  ? 486 LEU A CB  1 
ATOM 700  C CG  . LEU A 1 90  ? 36.398 41.527 14.560 1.00 10.49 ? 486 LEU A CG  1 
ATOM 701  C CD1 . LEU A 1 90  ? 37.380 41.001 13.537 1.00 13.85 ? 486 LEU A CD1 1 
ATOM 702  C CD2 . LEU A 1 90  ? 35.114 40.699 14.561 1.00 13.88 ? 486 LEU A CD2 1 
ATOM 703  N N   . ARG A 1 91  ? 39.022 42.585 18.353 1.00 11.39 ? 487 ARG A N   1 
ATOM 704  C CA  . ARG A 1 91  ? 39.269 43.634 19.337 1.00 13.42 ? 487 ARG A CA  1 
ATOM 705  C C   . ARG A 1 91  ? 40.718 43.882 19.691 1.00 15.16 ? 487 ARG A C   1 
ATOM 706  O O   . ARG A 1 91  ? 41.069 45.007 20.043 1.00 15.60 ? 487 ARG A O   1 
ATOM 707  C CB  . ARG A 1 91  ? 38.530 43.331 20.623 1.00 12.34 ? 487 ARG A CB  1 
ATOM 708  C CG  . ARG A 1 91  ? 37.048 43.342 20.498 1.00 6.56  ? 487 ARG A CG  1 
ATOM 709  C CD  . ARG A 1 91  ? 36.480 42.775 21.757 1.00 9.94  ? 487 ARG A CD  1 
ATOM 710  N NE  . ARG A 1 91  ? 35.036 42.696 21.683 1.00 10.94 ? 487 ARG A NE  1 
ATOM 711  C CZ  . ARG A 1 91  ? 34.323 41.676 22.134 1.00 8.89  ? 487 ARG A CZ  1 
ATOM 712  N NH1 . ARG A 1 91  ? 34.917 40.631 22.700 1.00 8.34  ? 487 ARG A NH1 1 
ATOM 713  N NH2 . ARG A 1 91  ? 33.004 41.715 22.036 1.00 6.96  ? 487 ARG A NH2 1 
ATOM 714  N N   . GLU A 1 92  ? 41.542 42.835 19.625 1.00 21.25 ? 488 GLU A N   1 
ATOM 715  C CA  . GLU A 1 92  ? 42.958 42.918 19.980 1.00 22.43 ? 488 GLU A CA  1 
ATOM 716  C C   . GLU A 1 92  ? 43.813 43.825 19.095 1.00 24.56 ? 488 GLU A C   1 
ATOM 717  O O   . GLU A 1 92  ? 43.294 44.710 18.418 1.00 24.48 ? 488 GLU A O   1 
ATOM 718  C CB  . GLU A 1 92  ? 43.576 41.513 20.072 1.00 20.93 ? 488 GLU A CB  1 
ATOM 719  C CG  . GLU A 1 92  ? 43.928 40.849 18.742 1.00 22.66 ? 488 GLU A CG  1 
ATOM 720  C CD  . GLU A 1 92  ? 44.657 39.525 18.926 1.00 25.51 ? 488 GLU A CD  1 
ATOM 721  O OE1 . GLU A 1 92  ? 45.809 39.523 19.417 1.00 25.84 ? 488 GLU A OE1 1 
ATOM 722  O OE2 . GLU A 1 92  ? 44.072 38.476 18.590 1.00 29.76 ? 488 GLU A OE2 1 
ATOM 723  N N   . MET A 1 93  ? 45.130 43.609 19.127 1.00 28.65 ? 489 MET A N   1 
ATOM 724  C CA  . MET A 1 93  ? 46.093 44.396 18.351 1.00 31.30 ? 489 MET A CA  1 
ATOM 725  C C   . MET A 1 93  ? 45.736 44.554 16.880 1.00 31.31 ? 489 MET A C   1 
ATOM 726  O O   . MET A 1 93  ? 46.058 45.571 16.263 1.00 28.54 ? 489 MET A O   1 
ATOM 727  C CB  . MET A 1 93  ? 47.494 43.788 18.466 1.00 31.45 ? 489 MET A CB  1 
ATOM 728  C CG  . MET A 1 93  ? 48.348 44.318 19.616 1.00 29.69 ? 489 MET A CG  1 
ATOM 729  S SD  . MET A 1 93  ? 47.736 43.928 21.263 1.00 34.34 ? 489 MET A SD  1 
ATOM 730  C CE  . MET A 1 93  ? 46.980 45.509 21.726 1.00 31.43 ? 489 MET A CE  1 
ATOM 731  N N   . ARG A 1 94  ? 45.066 43.553 16.319 1.00 32.07 ? 490 ARG A N   1 
ATOM 732  C CA  . ARG A 1 94  ? 44.671 43.593 14.914 1.00 31.59 ? 490 ARG A CA  1 
ATOM 733  C C   . ARG A 1 94  ? 43.524 44.567 14.632 1.00 31.84 ? 490 ARG A C   1 
ATOM 734  O O   . ARG A 1 94  ? 43.181 44.797 13.475 1.00 31.98 ? 490 ARG A O   1 
ATOM 735  C CB  . ARG A 1 94  ? 44.288 42.197 14.419 1.00 28.74 ? 490 ARG A CB  1 
ATOM 736  C CG  . ARG A 1 94  ? 45.454 41.270 14.138 1.00 27.20 ? 490 ARG A CG  1 
ATOM 737  C CD  . ARG A 1 94  ? 45.992 40.612 15.406 1.00 29.57 ? 490 ARG A CD  1 
ATOM 738  N NE  . ARG A 1 94  ? 47.097 41.349 16.016 1.00 30.05 ? 490 ARG A NE  1 
ATOM 739  C CZ  . ARG A 1 94  ? 48.120 40.767 16.631 1.00 25.67 ? 490 ARG A CZ  1 
ATOM 740  N NH1 . ARG A 1 94  ? 48.180 39.446 16.723 1.00 24.51 ? 490 ARG A NH1 1 
ATOM 741  N NH2 . ARG A 1 94  ? 49.098 41.505 17.129 1.00 26.01 ? 490 ARG A NH2 1 
ATOM 742  N N   . HIS A 1 95  ? 42.977 45.166 15.688 1.00 31.55 ? 491 HIS A N   1 
ATOM 743  C CA  . HIS A 1 95  ? 41.863 46.110 15.596 1.00 33.20 ? 491 HIS A CA  1 
ATOM 744  C C   . HIS A 1 95  ? 41.927 47.055 14.401 1.00 35.09 ? 491 HIS A C   1 
ATOM 745  O O   . HIS A 1 95  ? 40.892 47.404 13.828 1.00 37.68 ? 491 HIS A O   1 
ATOM 746  C CB  . HIS A 1 95  ? 41.770 46.937 16.885 1.00 33.15 ? 491 HIS A CB  1 
ATOM 747  C CG  . HIS A 1 95  ? 40.366 47.220 17.328 1.00 34.60 ? 491 HIS A CG  1 
ATOM 748  N ND1 . HIS A 1 95  ? 39.277 46.525 16.847 1.00 33.41 ? 491 HIS A ND1 1 
ATOM 749  C CD2 . HIS A 1 95  ? 39.877 48.096 18.237 1.00 34.07 ? 491 HIS A CD2 1 
ATOM 750  C CE1 . HIS A 1 95  ? 38.180 46.956 17.444 1.00 31.28 ? 491 HIS A CE1 1 
ATOM 751  N NE2 . HIS A 1 95  ? 38.517 47.909 18.292 1.00 32.75 ? 491 HIS A NE2 1 
ATOM 752  N N   . ARG A 1 96  ? 43.136 47.484 14.046 1.00 34.42 ? 492 ARG A N   1 
ATOM 753  C CA  . ARG A 1 96  ? 43.341 48.393 12.922 1.00 31.97 ? 492 ARG A CA  1 
ATOM 754  C C   . ARG A 1 96  ? 43.208 47.640 11.600 1.00 29.95 ? 492 ARG A C   1 
ATOM 755  O O   . ARG A 1 96  ? 44.205 47.236 11.004 1.00 30.14 ? 492 ARG A O   1 
ATOM 756  C CB  . ARG A 1 96  ? 44.726 49.047 13.013 1.00 33.81 ? 492 ARG A CB  1 
ATOM 757  C CG  . ARG A 1 96  ? 44.925 49.990 14.200 1.00 34.48 ? 492 ARG A CG  1 
ATOM 758  C CD  . ARG A 1 96  ? 44.943 49.258 15.537 1.00 35.35 ? 492 ARG A CD  1 
ATOM 759  N NE  . ARG A 1 96  ? 46.024 48.277 15.623 1.00 37.69 ? 492 ARG A NE  1 
ATOM 760  C CZ  . ARG A 1 96  ? 47.317 48.584 15.713 1.00 41.57 ? 492 ARG A CZ  1 
ATOM 761  N NH1 . ARG A 1 96  ? 47.711 49.853 15.725 1.00 42.87 ? 492 ARG A NH1 1 
ATOM 762  N NH2 . ARG A 1 96  ? 48.223 47.619 15.805 1.00 41.91 ? 492 ARG A NH2 1 
ATOM 763  N N   . PHE A 1 97  ? 41.972 47.420 11.169 1.00 25.31 ? 493 PHE A N   1 
ATOM 764  C CA  . PHE A 1 97  ? 41.722 46.704 9.927  1.00 25.42 ? 493 PHE A CA  1 
ATOM 765  C C   . PHE A 1 97  ? 41.532 47.663 8.751  1.00 28.44 ? 493 PHE A C   1 
ATOM 766  O O   . PHE A 1 97  ? 42.235 48.669 8.625  1.00 28.08 ? 493 PHE A O   1 
ATOM 767  C CB  . PHE A 1 97  ? 40.492 45.790 10.069 1.00 21.25 ? 493 PHE A CB  1 
ATOM 768  C CG  . PHE A 1 97  ? 40.713 44.585 10.943 1.00 20.61 ? 493 PHE A CG  1 
ATOM 769  C CD1 . PHE A 1 97  ? 41.466 43.508 10.488 1.00 19.35 ? 493 PHE A CD1 1 
ATOM 770  C CD2 . PHE A 1 97  ? 40.151 44.518 12.215 1.00 18.30 ? 493 PHE A CD2 1 
ATOM 771  C CE1 . PHE A 1 97  ? 41.656 42.382 11.290 1.00 19.86 ? 493 PHE A CE1 1 
ATOM 772  C CE2 . PHE A 1 97  ? 40.335 43.396 13.024 1.00 18.27 ? 493 PHE A CE2 1 
ATOM 773  C CZ  . PHE A 1 97  ? 41.084 42.328 12.565 1.00 14.30 ? 493 PHE A CZ  1 
ATOM 774  N N   . GLN A 1 98  ? 40.585 47.315 7.884  1.00 28.76 ? 494 GLN A N   1 
ATOM 775  C CA  . GLN A 1 98  ? 40.222 48.074 6.695  1.00 25.62 ? 494 GLN A CA  1 
ATOM 776  C C   . GLN A 1 98  ? 39.082 47.251 6.098  1.00 23.81 ? 494 GLN A C   1 
ATOM 777  O O   . GLN A 1 98  ? 39.051 46.032 6.270  1.00 22.09 ? 494 GLN A O   1 
ATOM 778  C CB  . GLN A 1 98  ? 41.401 48.139 5.723  1.00 26.48 ? 494 GLN A CB  1 
ATOM 779  C CG  . GLN A 1 98  ? 41.889 46.775 5.258  1.00 31.44 ? 494 GLN A CG  1 
ATOM 780  C CD  . GLN A 1 98  ? 43.164 46.832 4.437  1.00 31.26 ? 494 GLN A CD  1 
ATOM 781  O OE1 . GLN A 1 98  ? 43.411 45.961 3.598  1.00 31.88 ? 494 GLN A OE1 1 
ATOM 782  N NE2 . GLN A 1 98  ? 43.989 47.846 4.679  1.00 31.84 ? 494 GLN A NE2 1 
ATOM 783  N N   . THR A 1 99  ? 38.140 47.908 5.429  1.00 24.19 ? 495 THR A N   1 
ATOM 784  C CA  . THR A 1 99  ? 36.991 47.241 4.820  1.00 21.26 ? 495 THR A CA  1 
ATOM 785  C C   . THR A 1 99  ? 37.376 45.978 4.061  1.00 18.91 ? 495 THR A C   1 
ATOM 786  O O   . THR A 1 99  ? 36.650 44.982 4.081  1.00 19.68 ? 495 THR A O   1 
ATOM 787  C CB  . THR A 1 99  ? 36.291 48.166 3.820  1.00 24.52 ? 495 THR A CB  1 
ATOM 788  O OG1 . THR A 1 99  ? 36.242 49.495 4.352  1.00 28.48 ? 495 THR A OG1 1 
ATOM 789  C CG2 . THR A 1 99  ? 34.875 47.661 3.529  1.00 24.14 ? 495 THR A CG2 1 
ATOM 790  N N   . GLN A 1 100 ? 38.528 46.030 3.400  1.00 19.97 ? 496 GLN A N   1 
ATOM 791  C CA  . GLN A 1 100 ? 39.026 44.915 2.612  1.00 19.83 ? 496 GLN A CA  1 
ATOM 792  C C   . GLN A 1 100 ? 39.162 43.639 3.431  1.00 18.82 ? 496 GLN A C   1 
ATOM 793  O O   . GLN A 1 100 ? 38.719 42.570 3.001  1.00 18.80 ? 496 GLN A O   1 
ATOM 794  C CB  . GLN A 1 100 ? 40.354 45.289 1.954  1.00 18.70 ? 496 GLN A CB  1 
ATOM 795  C CG  . GLN A 1 100 ? 40.198 46.264 0.789  1.00 23.77 ? 496 GLN A CG  1 
ATOM 796  C CD  . GLN A 1 100 ? 39.583 47.592 1.201  1.00 26.56 ? 496 GLN A CD  1 
ATOM 797  O OE1 . GLN A 1 100 ? 39.831 48.089 2.301  1.00 27.00 ? 496 GLN A OE1 1 
ATOM 798  N NE2 . GLN A 1 100 ? 38.762 48.166 0.328  1.00 24.89 ? 496 GLN A NE2 1 
ATOM 799  N N   . GLN A 1 101 ? 39.716 43.773 4.634  1.00 18.01 ? 497 GLN A N   1 
ATOM 800  C CA  . GLN A 1 101 ? 39.910 42.644 5.542  1.00 16.28 ? 497 GLN A CA  1 
ATOM 801  C C   . GLN A 1 101 ? 38.586 42.243 6.198  1.00 12.86 ? 497 GLN A C   1 
ATOM 802  O O   . GLN A 1 101 ? 38.377 41.085 6.546  1.00 10.95 ? 497 GLN A O   1 
ATOM 803  C CB  . GLN A 1 101 ? 40.942 43.003 6.613  1.00 15.98 ? 497 GLN A CB  1 
ATOM 804  C CG  . GLN A 1 101 ? 42.329 43.311 6.059  1.00 16.87 ? 497 GLN A CG  1 
ATOM 805  C CD  . GLN A 1 101 ? 43.258 43.930 7.096  1.00 21.37 ? 497 GLN A CD  1 
ATOM 806  O OE1 . GLN A 1 101 ? 43.364 45.153 7.202  1.00 21.47 ? 497 GLN A OE1 1 
ATOM 807  N NE2 . GLN A 1 101 ? 43.936 43.087 7.864  1.00 22.57 ? 497 GLN A NE2 1 
ATOM 808  N N   . LEU A 1 102 ? 37.683 43.202 6.342  1.00 10.21 ? 498 LEU A N   1 
ATOM 809  C CA  . LEU A 1 102 ? 36.388 42.924 6.944  1.00 9.62  ? 498 LEU A CA  1 
ATOM 810  C C   . LEU A 1 102 ? 35.535 42.078 6.004  1.00 10.86 ? 498 LEU A C   1 
ATOM 811  O O   . LEU A 1 102 ? 34.959 41.070 6.420  1.00 12.75 ? 498 LEU A O   1 
ATOM 812  C CB  . LEU A 1 102 ? 35.682 44.230 7.306  1.00 10.33 ? 498 LEU A CB  1 
ATOM 813  C CG  . LEU A 1 102 ? 35.894 44.842 8.700  1.00 8.10  ? 498 LEU A CG  1 
ATOM 814  C CD1 . LEU A 1 102 ? 37.228 44.470 9.307  1.00 11.10 ? 498 LEU A CD1 1 
ATOM 815  C CD2 . LEU A 1 102 ? 35.750 46.335 8.611  1.00 6.67  ? 498 LEU A CD2 1 
ATOM 816  N N   . LEU A 1 103 ? 35.514 42.429 4.722  1.00 9.42  ? 499 LEU A N   1 
ATOM 817  C CA  . LEU A 1 103 ? 34.725 41.661 3.764  1.00 11.87 ? 499 LEU A CA  1 
ATOM 818  C C   . LEU A 1 103 ? 35.327 40.270 3.548  1.00 12.95 ? 499 LEU A C   1 
ATOM 819  O O   . LEU A 1 103 ? 34.592 39.287 3.410  1.00 16.98 ? 499 LEU A O   1 
ATOM 820  C CB  . LEU A 1 103 ? 34.588 42.401 2.424  1.00 8.90  ? 499 LEU A CB  1 
ATOM 821  C CG  . LEU A 1 103 ? 33.332 42.005 1.634  1.00 9.18  ? 499 LEU A CG  1 
ATOM 822  C CD1 . LEU A 1 103 ? 32.100 42.507 2.347  1.00 4.94  ? 499 LEU A CD1 1 
ATOM 823  C CD2 . LEU A 1 103 ? 33.371 42.551 0.226  1.00 9.87  ? 499 LEU A CD2 1 
ATOM 824  N N   . GLU A 1 104 ? 36.658 40.190 3.515  1.00 13.94 ? 500 GLU A N   1 
ATOM 825  C CA  . GLU A 1 104 ? 37.369 38.922 3.327  1.00 13.24 ? 500 GLU A CA  1 
ATOM 826  C C   . GLU A 1 104 ? 36.923 37.909 4.377  1.00 10.91 ? 500 GLU A C   1 
ATOM 827  O O   . GLU A 1 104 ? 36.671 36.739 4.068  1.00 10.95 ? 500 GLU A O   1 
ATOM 828  C CB  . GLU A 1 104 ? 38.887 39.150 3.415  1.00 16.16 ? 500 GLU A CB  1 
ATOM 829  C CG  . GLU A 1 104 ? 39.771 37.887 3.353  1.00 20.06 ? 500 GLU A CG  1 
ATOM 830  C CD  . GLU A 1 104 ? 39.721 37.146 2.016  1.00 22.89 ? 500 GLU A CD  1 
ATOM 831  O OE1 . GLU A 1 104 ? 39.841 35.901 2.032  1.00 26.56 ? 500 GLU A OE1 1 
ATOM 832  O OE2 . GLU A 1 104 ? 39.571 37.791 0.953  1.00 24.13 ? 500 GLU A OE2 1 
ATOM 833  N N   . MET A 1 105 ? 36.795 38.377 5.614  1.00 11.96 ? 501 MET A N   1 
ATOM 834  C CA  . MET A 1 105 ? 36.365 37.533 6.722  1.00 11.06 ? 501 MET A CA  1 
ATOM 835  C C   . MET A 1 105 ? 34.947 37.032 6.503  1.00 9.64  ? 501 MET A C   1 
ATOM 836  O O   . MET A 1 105 ? 34.661 35.876 6.772  1.00 8.63  ? 501 MET A O   1 
ATOM 837  C CB  . MET A 1 105 ? 36.449 38.289 8.047  1.00 10.47 ? 501 MET A CB  1 
ATOM 838  C CG  . MET A 1 105 ? 37.854 38.714 8.415  1.00 13.77 ? 501 MET A CG  1 
ATOM 839  S SD  . MET A 1 105 ? 37.954 39.544 10.013 1.00 20.98 ? 501 MET A SD  1 
ATOM 840  C CE  . MET A 1 105 ? 39.741 39.784 10.118 1.00 14.07 ? 501 MET A CE  1 
ATOM 841  N N   . CYS A 1 106 ? 34.057 37.897 6.027  1.00 11.41 ? 502 CYS A N   1 
ATOM 842  C CA  . CYS A 1 106 ? 32.676 37.493 5.768  1.00 13.88 ? 502 CYS A CA  1 
ATOM 843  C C   . CYS A 1 106 ? 32.642 36.410 4.688  1.00 12.88 ? 502 CYS A C   1 
ATOM 844  O O   . CYS A 1 106 ? 31.844 35.473 4.763  1.00 14.89 ? 502 CYS A O   1 
ATOM 845  C CB  . CYS A 1 106 ? 31.827 38.688 5.321  1.00 16.90 ? 502 CYS A CB  1 
ATOM 846  S SG  . CYS A 1 106 ? 31.751 40.046 6.496  1.00 14.48 ? 502 CYS A SG  1 
ATOM 847  N N   . LYS A 1 107 ? 33.508 36.552 3.688  1.00 13.23 ? 503 LYS A N   1 
ATOM 848  C CA  . LYS A 1 107 ? 33.622 35.597 2.586  1.00 10.87 ? 503 LYS A CA  1 
ATOM 849  C C   . LYS A 1 107 ? 34.082 34.224 3.095  1.00 10.24 ? 503 LYS A C   1 
ATOM 850  O O   . LYS A 1 107 ? 33.471 33.203 2.765  1.00 9.05  ? 503 LYS A O   1 
ATOM 851  C CB  . LYS A 1 107 ? 34.606 36.132 1.539  1.00 12.02 ? 503 LYS A CB  1 
ATOM 852  C CG  . LYS A 1 107 ? 34.948 35.161 0.415  1.00 11.71 ? 503 LYS A CG  1 
ATOM 853  C CD  . LYS A 1 107 ? 35.937 35.789 -0.550 1.00 17.80 ? 503 LYS A CD  1 
ATOM 854  C CE  . LYS A 1 107 ? 36.351 34.811 -1.638 1.00 18.39 ? 503 LYS A CE  1 
ATOM 855  N NZ  . LYS A 1 107 ? 37.022 35.506 -2.763 1.00 19.21 ? 503 LYS A NZ  1 
ATOM 856  N N   . ASP A 1 108 ? 35.131 34.204 3.921  1.00 10.68 ? 504 ASP A N   1 
ATOM 857  C CA  . ASP A 1 108 ? 35.653 32.954 4.486  1.00 7.72  ? 504 ASP A CA  1 
ATOM 858  C C   . ASP A 1 108 ? 34.538 32.178 5.185  1.00 7.40  ? 504 ASP A C   1 
ATOM 859  O O   . ASP A 1 108 ? 34.425 30.957 5.041  1.00 7.01  ? 504 ASP A O   1 
ATOM 860  C CB  . ASP A 1 108 ? 36.748 33.229 5.530  1.00 8.01  ? 504 ASP A CB  1 
ATOM 861  C CG  . ASP A 1 108 ? 37.947 33.983 4.972  1.00 12.07 ? 504 ASP A CG  1 
ATOM 862  O OD1 . ASP A 1 108 ? 38.633 34.654 5.773  1.00 7.24  ? 504 ASP A OD1 1 
ATOM 863  O OD2 . ASP A 1 108 ? 38.225 33.906 3.756  1.00 18.62 ? 504 ASP A OD2 1 
ATOM 864  N N   . VAL A 1 109 ? 33.740 32.896 5.971  1.00 8.06  ? 505 VAL A N   1 
ATOM 865  C CA  . VAL A 1 109 ? 32.640 32.302 6.726  1.00 6.77  ? 505 VAL A CA  1 
ATOM 866  C C   . VAL A 1 109 ? 31.507 31.854 5.809  1.00 4.31  ? 505 VAL A C   1 
ATOM 867  O O   . VAL A 1 109 ? 30.924 30.787 6.008  1.00 4.27  ? 505 VAL A O   1 
ATOM 868  C CB  . VAL A 1 109 ? 32.097 33.280 7.799  1.00 7.29  ? 505 VAL A CB  1 
ATOM 869  C CG1 . VAL A 1 109 ? 31.036 32.590 8.662  1.00 6.82  ? 505 VAL A CG1 1 
ATOM 870  C CG2 . VAL A 1 109 ? 33.230 33.779 8.673  1.00 10.15 ? 505 VAL A CG2 1 
ATOM 871  N N   . CYS A 1 110 ? 31.201 32.660 4.803  1.00 7.86  ? 506 CYS A N   1 
ATOM 872  C CA  . CYS A 1 110 ? 30.144 32.331 3.847  1.00 8.57  ? 506 CYS A CA  1 
ATOM 873  C C   . CYS A 1 110 ? 30.531 31.120 2.987  1.00 8.76  ? 506 CYS A C   1 
ATOM 874  O O   . CYS A 1 110 ? 29.668 30.406 2.479  1.00 8.42  ? 506 CYS A O   1 
ATOM 875  C CB  . CYS A 1 110 ? 29.838 33.529 2.950  1.00 8.83  ? 506 CYS A CB  1 
ATOM 876  S SG  . CYS A 1 110 ? 28.173 33.501 2.267  1.00 9.16  ? 506 CYS A SG  1 
ATOM 877  N N   . GLU A 1 111 ? 31.831 30.904 2.810  1.00 9.14  ? 507 GLU A N   1 
ATOM 878  C CA  . GLU A 1 111 ? 32.307 29.765 2.044  1.00 8.13  ? 507 GLU A CA  1 
ATOM 879  C C   . GLU A 1 111 ? 32.079 28.493 2.836  1.00 4.79  ? 507 GLU A C   1 
ATOM 880  O O   . GLU A 1 111 ? 31.679 27.467 2.290  1.00 5.50  ? 507 GLU A O   1 
ATOM 881  C CB  . GLU A 1 111 ? 33.786 29.915 1.707  1.00 7.62  ? 507 GLU A CB  1 
ATOM 882  C CG  . GLU A 1 111 ? 34.049 30.890 0.567  1.00 10.42 ? 507 GLU A CG  1 
ATOM 883  C CD  . GLU A 1 111 ? 35.508 30.972 0.200  1.00 8.86  ? 507 GLU A CD  1 
ATOM 884  O OE1 . GLU A 1 111 ? 35.807 31.383 -0.932 1.00 14.46 ? 507 GLU A OE1 1 
ATOM 885  O OE2 . GLU A 1 111 ? 36.364 30.625 1.039  1.00 11.94 ? 507 GLU A OE2 1 
ATOM 886  N N   . ALA A 1 112 ? 32.331 28.560 4.133  1.00 4.69  ? 508 ALA A N   1 
ATOM 887  C CA  . ALA A 1 112 ? 32.132 27.411 5.003  1.00 2.84  ? 508 ALA A CA  1 
ATOM 888  C C   . ALA A 1 112 ? 30.640 27.148 5.217  1.00 2.47  ? 508 ALA A C   1 
ATOM 889  O O   . ALA A 1 112 ? 30.208 26.006 5.312  1.00 3.01  ? 508 ALA A O   1 
ATOM 890  C CB  . ALA A 1 112 ? 32.819 27.647 6.328  1.00 3.35  ? 508 ALA A CB  1 
ATOM 891  N N   . MET A 1 113 ? 29.851 28.214 5.261  1.00 4.27  ? 509 MET A N   1 
ATOM 892  C CA  . MET A 1 113 ? 28.415 28.096 5.459  1.00 3.24  ? 509 MET A CA  1 
ATOM 893  C C   . MET A 1 113 ? 27.699 27.571 4.224  1.00 4.52  ? 509 MET A C   1 
ATOM 894  O O   . MET A 1 113 ? 26.794 26.748 4.333  1.00 8.63  ? 509 MET A O   1 
ATOM 895  C CB  . MET A 1 113 ? 27.829 29.434 5.905  1.00 2.63  ? 509 MET A CB  1 
ATOM 896  C CG  . MET A 1 113 ? 28.209 29.825 7.328  1.00 5.18  ? 509 MET A CG  1 
ATOM 897  S SD  . MET A 1 113 ? 27.764 28.538 8.519  1.00 12.83 ? 509 MET A SD  1 
ATOM 898  C CE  . MET A 1 113 ? 29.227 28.333 9.323  1.00 11.58 ? 509 MET A CE  1 
ATOM 899  N N   . GLU A 1 114 ? 28.094 28.057 3.050  1.00 5.93  ? 510 GLU A N   1 
ATOM 900  C CA  . GLU A 1 114 ? 27.504 27.606 1.788  1.00 7.82  ? 510 GLU A CA  1 
ATOM 901  C C   . GLU A 1 114 ? 27.719 26.090 1.671  1.00 5.58  ? 510 GLU A C   1 
ATOM 902  O O   . GLU A 1 114 ? 26.811 25.347 1.292  1.00 5.09  ? 510 GLU A O   1 
ATOM 903  C CB  . GLU A 1 114 ? 28.167 28.327 0.615  1.00 7.50  ? 510 GLU A CB  1 
ATOM 904  C CG  . GLU A 1 114 ? 27.557 28.018 -0.737 1.00 18.01 ? 510 GLU A CG  1 
ATOM 905  C CD  . GLU A 1 114 ? 28.399 28.535 -1.898 1.00 21.81 ? 510 GLU A CD  1 
ATOM 906  O OE1 . GLU A 1 114 ? 27.811 28.919 -2.933 1.00 27.32 ? 510 GLU A OE1 1 
ATOM 907  O OE2 . GLU A 1 114 ? 29.645 28.544 -1.781 1.00 24.20 ? 510 GLU A OE2 1 
ATOM 908  N N   . TYR A 1 115 ? 28.918 25.643 2.049  1.00 7.55  ? 511 TYR A N   1 
ATOM 909  C CA  . TYR A 1 115 ? 29.269 24.229 2.031  1.00 6.74  ? 511 TYR A CA  1 
ATOM 910  C C   . TYR A 1 115 ? 28.368 23.405 2.975  1.00 8.27  ? 511 TYR A C   1 
ATOM 911  O O   . TYR A 1 115 ? 27.916 22.316 2.611  1.00 8.84  ? 511 TYR A O   1 
ATOM 912  C CB  . TYR A 1 115 ? 30.748 24.049 2.400  1.00 9.67  ? 511 TYR A CB  1 
ATOM 913  C CG  . TYR A 1 115 ? 31.172 22.598 2.511  1.00 14.31 ? 511 TYR A CG  1 
ATOM 914  C CD1 . TYR A 1 115 ? 31.217 21.774 1.386  1.00 12.15 ? 511 TYR A CD1 1 
ATOM 915  C CD2 . TYR A 1 115 ? 31.459 22.032 3.751  1.00 13.80 ? 511 TYR A CD2 1 
ATOM 916  C CE1 . TYR A 1 115 ? 31.526 20.423 1.498  1.00 11.02 ? 511 TYR A CE1 1 
ATOM 917  C CE2 . TYR A 1 115 ? 31.768 20.685 3.868  1.00 12.93 ? 511 TYR A CE2 1 
ATOM 918  C CZ  . TYR A 1 115 ? 31.796 19.886 2.739  1.00 11.33 ? 511 TYR A CZ  1 
ATOM 919  O OH  . TYR A 1 115 ? 32.057 18.545 2.875  1.00 14.81 ? 511 TYR A OH  1 
ATOM 920  N N   . LEU A 1 116 ? 28.121 23.907 4.184  1.00 8.72  ? 512 LEU A N   1 
ATOM 921  C CA  . LEU A 1 116 ? 27.267 23.188 5.131  1.00 10.18 ? 512 LEU A CA  1 
ATOM 922  C C   . LEU A 1 116 ? 25.859 23.061 4.579  1.00 12.90 ? 512 LEU A C   1 
ATOM 923  O O   . LEU A 1 116 ? 25.251 21.991 4.639  1.00 12.40 ? 512 LEU A O   1 
ATOM 924  C CB  . LEU A 1 116 ? 27.232 23.878 6.503  1.00 4.04  ? 512 LEU A CB  1 
ATOM 925  C CG  . LEU A 1 116 ? 28.534 23.878 7.307  1.00 3.83  ? 512 LEU A CG  1 
ATOM 926  C CD1 . LEU A 1 116 ? 28.300 24.439 8.703  1.00 2.00  ? 512 LEU A CD1 1 
ATOM 927  C CD2 . LEU A 1 116 ? 29.073 22.449 7.386  1.00 2.00  ? 512 LEU A CD2 1 
ATOM 928  N N   . GLU A 1 117 ? 25.359 24.156 4.012  1.00 13.36 ? 513 GLU A N   1 
ATOM 929  C CA  . GLU A 1 117 ? 24.028 24.197 3.428  1.00 11.85 ? 513 GLU A CA  1 
ATOM 930  C C   . GLU A 1 117 ? 23.852 23.101 2.370  1.00 11.40 ? 513 GLU A C   1 
ATOM 931  O O   . GLU A 1 117 ? 22.850 22.389 2.375  1.00 9.38  ? 513 GLU A O   1 
ATOM 932  C CB  . GLU A 1 117 ? 23.777 25.584 2.831  1.00 13.01 ? 513 GLU A CB  1 
ATOM 933  C CG  . GLU A 1 117 ? 22.368 25.822 2.284  1.00 10.82 ? 513 GLU A CG  1 
ATOM 934  C CD  . GLU A 1 117 ? 22.151 27.264 1.828  1.00 11.92 ? 513 GLU A CD  1 
ATOM 935  O OE1 . GLU A 1 117 ? 22.923 27.742 0.960  1.00 14.37 ? 513 GLU A OE1 1 
ATOM 936  O OE2 . GLU A 1 117 ? 21.208 27.919 2.338  1.00 10.65 ? 513 GLU A OE2 1 
ATOM 937  N N   . SER A 1 118 ? 24.848 22.932 1.502  1.00 13.91 ? 514 SER A N   1 
ATOM 938  C CA  . SER A 1 118 ? 24.785 21.915 0.453  1.00 15.43 ? 514 SER A CA  1 
ATOM 939  C C   . SER A 1 118 ? 24.834 20.500 1.024  1.00 17.44 ? 514 SER A C   1 
ATOM 940  O O   . SER A 1 118 ? 24.500 19.528 0.343  1.00 15.53 ? 514 SER A O   1 
ATOM 941  C CB  . SER A 1 118 ? 25.916 22.109 -0.561 1.00 15.20 ? 514 SER A CB  1 
ATOM 942  O OG  . SER A 1 118 ? 27.179 22.170 0.076  1.00 13.45 ? 514 SER A OG  1 
ATOM 943  N N   . LYS A 1 119 ? 25.278 20.391 2.271  1.00 17.30 ? 515 LYS A N   1 
ATOM 944  C CA  . LYS A 1 119 ? 25.371 19.107 2.943  1.00 12.99 ? 515 LYS A CA  1 
ATOM 945  C C   . LYS A 1 119 ? 24.256 18.942 3.973  1.00 13.83 ? 515 LYS A C   1 
ATOM 946  O O   . LYS A 1 119 ? 24.292 18.024 4.780  1.00 15.25 ? 515 LYS A O   1 
ATOM 947  C CB  . LYS A 1 119 ? 26.740 18.968 3.618  1.00 13.16 ? 515 LYS A CB  1 
ATOM 948  C CG  . LYS A 1 119 ? 27.920 18.997 2.643  1.00 13.40 ? 515 LYS A CG  1 
ATOM 949  C CD  . LYS A 1 119 ? 27.911 17.783 1.725  1.00 10.90 ? 515 LYS A CD  1 
ATOM 950  C CE  . LYS A 1 119 ? 29.045 17.846 0.731  1.00 9.83  ? 515 LYS A CE  1 
ATOM 951  N NZ  . LYS A 1 119 ? 29.193 16.567 -0.031 1.00 11.46 ? 515 LYS A NZ  1 
ATOM 952  N N   . GLN A 1 120 ? 23.265 19.831 3.928  1.00 13.54 ? 516 GLN A N   1 
ATOM 953  C CA  . GLN A 1 120 ? 22.120 19.814 4.848  1.00 15.50 ? 516 GLN A CA  1 
ATOM 954  C C   . GLN A 1 120 ? 22.547 19.738 6.313  1.00 14.29 ? 516 GLN A C   1 
ATOM 955  O O   . GLN A 1 120 ? 21.888 19.123 7.155  1.00 10.17 ? 516 GLN A O   1 
ATOM 956  C CB  . GLN A 1 120 ? 21.149 18.679 4.498  1.00 20.10 ? 516 GLN A CB  1 
ATOM 957  C CG  . GLN A 1 120 ? 20.481 18.812 3.128  1.00 27.83 ? 516 GLN A CG  1 
ATOM 958  C CD  . GLN A 1 120 ? 21.461 18.701 1.976  1.00 30.31 ? 516 GLN A CD  1 
ATOM 959  O OE1 . GLN A 1 120 ? 21.517 19.568 1.107  1.00 31.11 ? 516 GLN A OE1 1 
ATOM 960  N NE2 . GLN A 1 120 ? 22.246 17.634 1.968  1.00 32.70 ? 516 GLN A NE2 1 
ATOM 961  N N   . PHE A 1 121 ? 23.674 20.362 6.608  1.00 15.64 ? 517 PHE A N   1 
ATOM 962  C CA  . PHE A 1 121 ? 24.192 20.388 7.963  1.00 16.92 ? 517 PHE A CA  1 
ATOM 963  C C   . PHE A 1 121 ? 24.022 21.814 8.458  1.00 19.46 ? 517 PHE A C   1 
ATOM 964  O O   . PHE A 1 121 ? 24.510 22.758 7.830  1.00 20.11 ? 517 PHE A O   1 
ATOM 965  C CB  . PHE A 1 121 ? 25.668 20.004 7.974  1.00 13.86 ? 517 PHE A CB  1 
ATOM 966  C CG  . PHE A 1 121 ? 26.230 19.814 9.349  1.00 14.42 ? 517 PHE A CG  1 
ATOM 967  C CD1 . PHE A 1 121 ? 26.109 18.589 9.996  1.00 20.02 ? 517 PHE A CD1 1 
ATOM 968  C CD2 . PHE A 1 121 ? 26.888 20.851 9.994  1.00 13.85 ? 517 PHE A CD2 1 
ATOM 969  C CE1 . PHE A 1 121 ? 26.639 18.398 11.267 1.00 22.95 ? 517 PHE A CE1 1 
ATOM 970  C CE2 . PHE A 1 121 ? 27.421 20.673 11.262 1.00 18.84 ? 517 PHE A CE2 1 
ATOM 971  C CZ  . PHE A 1 121 ? 27.297 19.442 11.901 1.00 23.12 ? 517 PHE A CZ  1 
ATOM 972  N N   . LEU A 1 122 ? 23.293 21.986 9.551  1.00 18.01 ? 518 LEU A N   1 
ATOM 973  C CA  . LEU A 1 122 ? 23.091 23.323 10.069 1.00 17.59 ? 518 LEU A CA  1 
ATOM 974  C C   . LEU A 1 122 ? 23.926 23.569 11.310 1.00 14.94 ? 518 LEU A C   1 
ATOM 975  O O   . LEU A 1 122 ? 24.198 22.660 12.086 1.00 14.17 ? 518 LEU A O   1 
ATOM 976  C CB  . LEU A 1 122 ? 21.604 23.598 10.328 1.00 15.17 ? 518 LEU A CB  1 
ATOM 977  C CG  . LEU A 1 122 ? 20.968 23.286 11.679 1.00 15.72 ? 518 LEU A CG  1 
ATOM 978  C CD1 . LEU A 1 122 ? 20.619 24.599 12.368 1.00 18.80 ? 518 LEU A CD1 1 
ATOM 979  C CD2 . LEU A 1 122 ? 19.717 22.461 11.477 1.00 16.60 ? 518 LEU A CD2 1 
ATOM 980  N N   . HIS A 1 123 ? 24.395 24.801 11.424 1.00 15.04 ? 519 HIS A N   1 
ATOM 981  C CA  . HIS A 1 123 ? 25.205 25.286 12.538 1.00 15.75 ? 519 HIS A CA  1 
ATOM 982  C C   . HIS A 1 123 ? 24.226 26.090 13.405 1.00 17.47 ? 519 HIS A C   1 
ATOM 983  O O   . HIS A 1 123 ? 23.929 27.239 13.093 1.00 21.50 ? 519 HIS A O   1 
ATOM 984  C CB  . HIS A 1 123 ? 26.276 26.213 11.970 1.00 13.52 ? 519 HIS A CB  1 
ATOM 985  C CG  . HIS A 1 123 ? 27.416 26.469 12.894 1.00 8.55  ? 519 HIS A CG  1 
ATOM 986  N ND1 . HIS A 1 123 ? 27.261 26.635 14.250 1.00 2.10  ? 519 HIS A ND1 1 
ATOM 987  C CD2 . HIS A 1 123 ? 28.744 26.566 12.651 1.00 4.28  ? 519 HIS A CD2 1 
ATOM 988  C CE1 . HIS A 1 123 ? 28.444 26.816 14.806 1.00 8.67  ? 519 HIS A CE1 1 
ATOM 989  N NE2 . HIS A 1 123 ? 29.360 26.779 13.858 1.00 4.20  ? 519 HIS A NE2 1 
ATOM 990  N N   . ARG A 1 124 ? 23.774 25.510 14.511 1.00 15.16 ? 520 ARG A N   1 
ATOM 991  C CA  . ARG A 1 124 ? 22.785 26.156 15.382 1.00 15.58 ? 520 ARG A CA  1 
ATOM 992  C C   . ARG A 1 124 ? 23.294 27.261 16.290 1.00 16.19 ? 520 ARG A C   1 
ATOM 993  O O   . ARG A 1 124 ? 22.536 27.798 17.095 1.00 16.18 ? 520 ARG A O   1 
ATOM 994  C CB  . ARG A 1 124 ? 22.065 25.114 16.245 1.00 15.27 ? 520 ARG A CB  1 
ATOM 995  C CG  . ARG A 1 124 ? 21.823 23.780 15.555 1.00 18.29 ? 520 ARG A CG  1 
ATOM 996  C CD  . ARG A 1 124 ? 20.966 22.857 16.392 1.00 20.10 ? 520 ARG A CD  1 
ATOM 997  N NE  . ARG A 1 124 ? 21.449 22.725 17.769 1.00 27.27 ? 520 ARG A NE  1 
ATOM 998  C CZ  . ARG A 1 124 ? 22.581 22.124 18.127 1.00 27.89 ? 520 ARG A CZ  1 
ATOM 999  N NH1 . ARG A 1 124 ? 23.378 21.592 17.215 1.00 27.36 ? 520 ARG A NH1 1 
ATOM 1000 N NH2 . ARG A 1 124 ? 22.904 22.038 19.408 1.00 25.47 ? 520 ARG A NH2 1 
ATOM 1001 N N   . ASP A 1 125 ? 24.557 27.635 16.141 1.00 16.78 ? 521 ASP A N   1 
ATOM 1002 C CA  . ASP A 1 125 ? 25.128 28.669 16.992 1.00 14.05 ? 521 ASP A CA  1 
ATOM 1003 C C   . ASP A 1 125 ? 26.235 29.425 16.269 1.00 11.05 ? 521 ASP A C   1 
ATOM 1004 O O   . ASP A 1 125 ? 27.409 29.277 16.583 1.00 10.26 ? 521 ASP A O   1 
ATOM 1005 C CB  . ASP A 1 125 ? 25.668 28.023 18.278 1.00 14.95 ? 521 ASP A CB  1 
ATOM 1006 C CG  . ASP A 1 125 ? 26.067 29.042 19.330 1.00 13.62 ? 521 ASP A CG  1 
ATOM 1007 O OD1 . ASP A 1 125 ? 25.579 30.194 19.278 1.00 13.41 ? 521 ASP A OD1 1 
ATOM 1008 O OD2 . ASP A 1 125 ? 26.875 28.681 20.209 1.00 8.70  ? 521 ASP A OD2 1 
ATOM 1009 N N   . LEU A 1 126 ? 25.871 30.188 15.251 1.00 12.24 ? 522 LEU A N   1 
ATOM 1010 C CA  . LEU A 1 126 ? 26.868 30.949 14.511 1.00 11.62 ? 522 LEU A CA  1 
ATOM 1011 C C   . LEU A 1 126 ? 27.017 32.325 15.149 1.00 12.66 ? 522 LEU A C   1 
ATOM 1012 O O   . LEU A 1 126 ? 26.043 33.058 15.286 1.00 14.12 ? 522 LEU A O   1 
ATOM 1013 C CB  . LEU A 1 126 ? 26.451 31.112 13.049 1.00 11.48 ? 522 LEU A CB  1 
ATOM 1014 C CG  . LEU A 1 126 ? 27.453 30.814 11.932 1.00 8.77  ? 522 LEU A CG  1 
ATOM 1015 C CD1 . LEU A 1 126 ? 26.970 31.571 10.728 1.00 8.36  ? 522 LEU A CD1 1 
ATOM 1016 C CD2 . LEU A 1 126 ? 28.891 31.232 12.269 1.00 10.90 ? 522 LEU A CD2 1 
ATOM 1017 N N   . ALA A 1 127 ? 28.237 32.657 15.544 1.00 13.37 ? 523 ALA A N   1 
ATOM 1018 C CA  . ALA A 1 127 ? 28.546 33.941 16.157 1.00 13.35 ? 523 ALA A CA  1 
ATOM 1019 C C   . ALA A 1 127 ? 30.050 34.109 15.989 1.00 13.67 ? 523 ALA A C   1 
ATOM 1020 O O   . ALA A 1 127 ? 30.743 33.138 15.661 1.00 14.16 ? 523 ALA A O   1 
ATOM 1021 C CB  . ALA A 1 127 ? 28.169 33.934 17.639 1.00 6.92  ? 523 ALA A CB  1 
ATOM 1022 N N   . ALA A 1 128 ? 30.552 35.326 16.193 1.00 11.77 ? 524 ALA A N   1 
ATOM 1023 C CA  . ALA A 1 128 ? 31.980 35.597 16.062 1.00 12.32 ? 524 ALA A CA  1 
ATOM 1024 C C   . ALA A 1 128 ? 32.771 34.809 17.091 1.00 13.86 ? 524 ALA A C   1 
ATOM 1025 O O   . ALA A 1 128 ? 33.936 34.468 16.856 1.00 17.70 ? 524 ALA A O   1 
ATOM 1026 C CB  . ALA A 1 128 ? 32.262 37.083 16.210 1.00 10.35 ? 524 ALA A CB  1 
ATOM 1027 N N   . ARG A 1 129 ? 32.143 34.541 18.237 1.00 13.11 ? 525 ARG A N   1 
ATOM 1028 C CA  . ARG A 1 129 ? 32.779 33.780 19.302 1.00 13.31 ? 525 ARG A CA  1 
ATOM 1029 C C   . ARG A 1 129 ? 33.112 32.369 18.833 1.00 13.03 ? 525 ARG A C   1 
ATOM 1030 O O   . ARG A 1 129 ? 34.027 31.750 19.360 1.00 12.07 ? 525 ARG A O   1 
ATOM 1031 C CB  . ARG A 1 129 ? 31.873 33.692 20.533 1.00 14.94 ? 525 ARG A CB  1 
ATOM 1032 C CG  . ARG A 1 129 ? 30.736 32.687 20.422 1.00 16.14 ? 525 ARG A CG  1 
ATOM 1033 C CD  . ARG A 1 129 ? 30.031 32.492 21.751 1.00 13.88 ? 525 ARG A CD  1 
ATOM 1034 N NE  . ARG A 1 129 ? 29.478 33.746 22.255 1.00 21.28 ? 525 ARG A NE  1 
ATOM 1035 C CZ  . ARG A 1 129 ? 28.257 34.205 21.989 1.00 22.82 ? 525 ARG A CZ  1 
ATOM 1036 N NH1 . ARG A 1 129 ? 27.425 33.522 21.210 1.00 24.36 ? 525 ARG A NH1 1 
ATOM 1037 N NH2 . ARG A 1 129 ? 27.859 35.343 22.536 1.00 21.29 ? 525 ARG A NH2 1 
ATOM 1038 N N   . ASN A 1 130 ? 32.361 31.873 17.849 1.00 11.96 ? 526 ASN A N   1 
ATOM 1039 C CA  . ASN A 1 130 ? 32.559 30.533 17.314 1.00 10.29 ? 526 ASN A CA  1 
ATOM 1040 C C   . ASN A 1 130 ? 33.475 30.422 16.111 1.00 8.66  ? 526 ASN A C   1 
ATOM 1041 O O   . ASN A 1 130 ? 33.639 29.341 15.560 1.00 10.60 ? 526 ASN A O   1 
ATOM 1042 C CB  . ASN A 1 130 ? 31.225 29.871 16.985 1.00 8.11  ? 526 ASN A CB  1 
ATOM 1043 C CG  . ASN A 1 130 ? 30.715 29.039 18.119 1.00 9.90  ? 526 ASN A CG  1 
ATOM 1044 O OD1 . ASN A 1 130 ? 31.187 29.165 19.247 1.00 11.02 ? 526 ASN A OD1 1 
ATOM 1045 N ND2 . ASN A 1 130 ? 29.761 28.167 17.836 1.00 15.50 ? 526 ASN A ND2 1 
ATOM 1046 N N   . CYS A 1 131 ? 34.056 31.526 15.678 1.00 6.87  ? 527 CYS A N   1 
ATOM 1047 C CA  . CYS A 1 131 ? 34.963 31.476 14.541 1.00 8.50  ? 527 CYS A CA  1 
ATOM 1048 C C   . CYS A 1 131 ? 36.377 31.610 15.081 1.00 9.42  ? 527 CYS A C   1 
ATOM 1049 O O   . CYS A 1 131 ? 36.583 32.269 16.093 1.00 10.96 ? 527 CYS A O   1 
ATOM 1050 C CB  . CYS A 1 131 ? 34.656 32.610 13.558 1.00 10.13 ? 527 CYS A CB  1 
ATOM 1051 S SG  . CYS A 1 131 ? 33.099 32.432 12.694 1.00 7.24  ? 527 CYS A SG  1 
ATOM 1052 N N   . LEU A 1 132 ? 37.331 30.948 14.439 1.00 9.95  ? 528 LEU A N   1 
ATOM 1053 C CA  . LEU A 1 132 ? 38.732 30.998 14.854 1.00 7.80  ? 528 LEU A CA  1 
ATOM 1054 C C   . LEU A 1 132 ? 39.560 31.539 13.693 1.00 7.58  ? 528 LEU A C   1 
ATOM 1055 O O   . LEU A 1 132 ? 39.130 31.474 12.533 1.00 8.42  ? 528 LEU A O   1 
ATOM 1056 C CB  . LEU A 1 132 ? 39.222 29.602 15.262 1.00 8.09  ? 528 LEU A CB  1 
ATOM 1057 C CG  . LEU A 1 132 ? 38.507 28.876 16.411 1.00 4.85  ? 528 LEU A CG  1 
ATOM 1058 C CD1 . LEU A 1 132 ? 39.088 27.501 16.633 1.00 5.23  ? 528 LEU A CD1 1 
ATOM 1059 C CD2 . LEU A 1 132 ? 38.623 29.682 17.687 1.00 12.77 ? 528 LEU A CD2 1 
ATOM 1060 N N   . VAL A 1 133 ? 40.725 32.100 14.010 1.00 9.03  ? 529 VAL A N   1 
ATOM 1061 C CA  . VAL A 1 133 ? 41.631 32.674 13.013 1.00 9.97  ? 529 VAL A CA  1 
ATOM 1062 C C   . VAL A 1 133 ? 43.003 32.008 13.107 1.00 11.90 ? 529 VAL A C   1 
ATOM 1063 O O   . VAL A 1 133 ? 43.581 31.952 14.193 1.00 16.82 ? 529 VAL A O   1 
ATOM 1064 C CB  . VAL A 1 133 ? 41.836 34.180 13.268 1.00 4.59  ? 529 VAL A CB  1 
ATOM 1065 C CG1 . VAL A 1 133 ? 42.609 34.802 12.122 1.00 3.83  ? 529 VAL A CG1 1 
ATOM 1066 C CG2 . VAL A 1 133 ? 40.513 34.871 13.483 1.00 3.81  ? 529 VAL A CG2 1 
ATOM 1067 N N   . ASN A 1 134 ? 43.524 31.492 11.993 1.00 15.54 ? 530 ASN A N   1 
ATOM 1068 C CA  . ASN A 1 134 ? 44.839 30.849 12.016 1.00 16.52 ? 530 ASN A CA  1 
ATOM 1069 C C   . ASN A 1 134 ? 45.959 31.886 11.945 1.00 18.49 ? 530 ASN A C   1 
ATOM 1070 O O   . ASN A 1 134 ? 45.688 33.074 12.064 1.00 23.10 ? 530 ASN A O   1 
ATOM 1071 C CB  . ASN A 1 134 ? 44.975 29.783 10.918 1.00 15.67 ? 530 ASN A CB  1 
ATOM 1072 C CG  . ASN A 1 134 ? 44.676 30.312 9.512  1.00 17.17 ? 530 ASN A CG  1 
ATOM 1073 O OD1 . ASN A 1 134 ? 44.972 31.462 9.168  1.00 11.18 ? 530 ASN A OD1 1 
ATOM 1074 N ND2 . ASN A 1 134 ? 44.111 29.448 8.683  1.00 15.71 ? 530 ASN A ND2 1 
ATOM 1075 N N   . ASP A 1 135 ? 47.208 31.454 11.768 1.00 20.52 ? 531 ASP A N   1 
ATOM 1076 C CA  . ASP A 1 135 ? 48.329 32.397 11.708 1.00 22.28 ? 531 ASP A CA  1 
ATOM 1077 C C   . ASP A 1 135 ? 48.403 33.141 10.370 1.00 24.22 ? 531 ASP A C   1 
ATOM 1078 O O   . ASP A 1 135 ? 49.089 34.162 10.253 1.00 26.63 ? 531 ASP A O   1 
ATOM 1079 C CB  . ASP A 1 135 ? 49.662 31.695 12.018 1.00 24.91 ? 531 ASP A CB  1 
ATOM 1080 C CG  . ASP A 1 135 ? 50.626 32.581 12.834 1.00 28.03 ? 531 ASP A CG  1 
ATOM 1081 O OD1 . ASP A 1 135 ? 50.883 32.262 14.019 1.00 25.89 ? 531 ASP A OD1 1 
ATOM 1082 O OD2 . ASP A 1 135 ? 51.130 33.595 12.298 1.00 27.88 ? 531 ASP A OD2 1 
ATOM 1083 N N   . GLN A 1 136 ? 47.693 32.636 9.365  1.00 22.72 ? 532 GLN A N   1 
ATOM 1084 C CA  . GLN A 1 136 ? 47.663 33.279 8.052  1.00 21.96 ? 532 GLN A CA  1 
ATOM 1085 C C   . GLN A 1 136 ? 46.556 34.333 8.009  1.00 20.47 ? 532 GLN A C   1 
ATOM 1086 O O   . GLN A 1 136 ? 46.376 35.018 6.998  1.00 19.50 ? 532 GLN A O   1 
ATOM 1087 C CB  . GLN A 1 136 ? 47.438 32.255 6.933  1.00 25.06 ? 532 GLN A CB  1 
ATOM 1088 C CG  . GLN A 1 136 ? 48.588 31.275 6.710  1.00 29.08 ? 532 GLN A CG  1 
ATOM 1089 C CD  . GLN A 1 136 ? 48.653 30.189 7.765  1.00 32.01 ? 532 GLN A CD  1 
ATOM 1090 O OE1 . GLN A 1 136 ? 49.302 30.346 8.801  1.00 31.49 ? 532 GLN A OE1 1 
ATOM 1091 N NE2 . GLN A 1 136 ? 47.971 29.080 7.509  1.00 34.18 ? 532 GLN A NE2 1 
ATOM 1092 N N   . GLY A 1 137 ? 45.814 34.448 9.109  1.00 19.48 ? 533 GLY A N   1 
ATOM 1093 C CA  . GLY A 1 137 ? 44.734 35.409 9.181  1.00 17.27 ? 533 GLY A CA  1 
ATOM 1094 C C   . GLY A 1 137 ? 43.434 34.858 8.632  1.00 16.09 ? 533 GLY A C   1 
ATOM 1095 O O   . GLY A 1 137 ? 42.411 35.549 8.624  1.00 15.63 ? 533 GLY A O   1 
ATOM 1096 N N   . VAL A 1 138 ? 43.462 33.606 8.186  1.00 14.60 ? 534 VAL A N   1 
ATOM 1097 C CA  . VAL A 1 138 ? 42.265 32.984 7.633  1.00 10.73 ? 534 VAL A CA  1 
ATOM 1098 C C   . VAL A 1 138 ? 41.257 32.719 8.744  1.00 6.19  ? 534 VAL A C   1 
ATOM 1099 O O   . VAL A 1 138 ? 41.620 32.335 9.859  1.00 8.54  ? 534 VAL A O   1 
ATOM 1100 C CB  . VAL A 1 138 ? 42.579 31.675 6.869  1.00 8.97  ? 534 VAL A CB  1 
ATOM 1101 C CG1 . VAL A 1 138 ? 41.299 31.097 6.283  1.00 10.35 ? 534 VAL A CG1 1 
ATOM 1102 C CG2 . VAL A 1 138 ? 43.589 31.940 5.756  1.00 5.02  ? 534 VAL A CG2 1 
ATOM 1103 N N   . VAL A 1 139 ? 39.998 32.994 8.440  1.00 7.49  ? 535 VAL A N   1 
ATOM 1104 C CA  . VAL A 1 139 ? 38.915 32.820 9.385  1.00 6.02  ? 535 VAL A CA  1 
ATOM 1105 C C   . VAL A 1 139 ? 38.214 31.540 9.018  1.00 10.54 ? 535 VAL A C   1 
ATOM 1106 O O   . VAL A 1 139 ? 37.929 31.283 7.840  1.00 11.45 ? 535 VAL A O   1 
ATOM 1107 C CB  . VAL A 1 139 ? 37.918 34.028 9.338  1.00 5.47  ? 535 VAL A CB  1 
ATOM 1108 C CG1 . VAL A 1 139 ? 36.737 33.808 10.281 1.00 2.00  ? 535 VAL A CG1 1 
ATOM 1109 C CG2 . VAL A 1 139 ? 38.632 35.308 9.725  1.00 4.76  ? 535 VAL A CG2 1 
ATOM 1110 N N   . LYS A 1 140 ? 37.985 30.714 10.029 1.00 13.48 ? 536 LYS A N   1 
ATOM 1111 C CA  . LYS A 1 140 ? 37.314 29.440 9.841  1.00 10.58 ? 536 LYS A CA  1 
ATOM 1112 C C   . LYS A 1 140 ? 36.194 29.328 10.863 1.00 11.55 ? 536 LYS A C   1 
ATOM 1113 O O   . LYS A 1 140 ? 36.291 29.859 11.972 1.00 13.24 ? 536 LYS A O   1 
ATOM 1114 C CB  . LYS A 1 140 ? 38.303 28.286 10.030 1.00 7.32  ? 536 LYS A CB  1 
ATOM 1115 C CG  . LYS A 1 140 ? 39.494 28.342 9.113  1.00 2.94  ? 536 LYS A CG  1 
ATOM 1116 C CD  . LYS A 1 140 ? 40.172 26.996 9.009  1.00 2.00  ? 536 LYS A CD  1 
ATOM 1117 C CE  . LYS A 1 140 ? 41.398 27.103 8.113  1.00 8.60  ? 536 LYS A CE  1 
ATOM 1118 N NZ  . LYS A 1 140 ? 41.911 25.779 7.679  1.00 8.95  ? 536 LYS A NZ  1 
ATOM 1119 N N   . VAL A 1 141 ? 35.112 28.673 10.481 1.00 12.34 ? 537 VAL A N   1 
ATOM 1120 C CA  . VAL A 1 141 ? 34.000 28.503 11.395 1.00 10.90 ? 537 VAL A CA  1 
ATOM 1121 C C   . VAL A 1 141 ? 34.216 27.200 12.165 1.00 8.75  ? 537 VAL A C   1 
ATOM 1122 O O   . VAL A 1 141 ? 34.718 26.220 11.623 1.00 4.07  ? 537 VAL A O   1 
ATOM 1123 C CB  . VAL A 1 141 ? 32.635 28.484 10.649 1.00 11.82 ? 537 VAL A CB  1 
ATOM 1124 C CG1 . VAL A 1 141 ? 32.547 29.644 9.678  1.00 5.08  ? 537 VAL A CG1 1 
ATOM 1125 C CG2 . VAL A 1 141 ? 32.439 27.188 9.923  1.00 8.05  ? 537 VAL A CG2 1 
ATOM 1126 N N   . SER A 1 142 ? 33.850 27.191 13.436 1.00 8.53  ? 538 SER A N   1 
ATOM 1127 C CA  . SER A 1 142 ? 34.023 26.004 14.244 1.00 9.45  ? 538 SER A CA  1 
ATOM 1128 C C   . SER A 1 142 ? 32.810 25.733 15.121 1.00 10.31 ? 538 SER A C   1 
ATOM 1129 O O   . SER A 1 142 ? 31.716 26.215 14.844 1.00 6.08  ? 538 SER A O   1 
ATOM 1130 C CB  . SER A 1 142 ? 35.286 26.161 15.091 1.00 12.59 ? 538 SER A CB  1 
ATOM 1131 O OG  . SER A 1 142 ? 35.492 27.515 15.458 1.00 17.47 ? 538 SER A OG  1 
ATOM 1132 N N   . ASP A 1 143 ? 33.005 24.916 16.150 1.00 15.14 ? 539 ASP A N   1 
ATOM 1133 C CA  . ASP A 1 143 ? 31.962 24.551 17.096 1.00 16.76 ? 539 ASP A CA  1 
ATOM 1134 C C   . ASP A 1 143 ? 30.614 24.162 16.488 1.00 17.48 ? 539 ASP A C   1 
ATOM 1135 O O   . ASP A 1 143 ? 29.555 24.628 16.912 1.00 16.42 ? 539 ASP A O   1 
ATOM 1136 C CB  . ASP A 1 143 ? 31.806 25.633 18.170 1.00 18.57 ? 539 ASP A CB  1 
ATOM 1137 C CG  . ASP A 1 143 ? 32.995 25.693 19.113 1.00 21.43 ? 539 ASP A CG  1 
ATOM 1138 O OD1 . ASP A 1 143 ? 33.900 24.834 18.995 1.00 22.15 ? 539 ASP A OD1 1 
ATOM 1139 O OD2 . ASP A 1 143 ? 33.025 26.597 19.975 1.00 22.92 ? 539 ASP A OD2 1 
ATOM 1140 N N   . PHE A 1 144 ? 30.674 23.321 15.462 1.00 16.99 ? 540 PHE A N   1 
ATOM 1141 C CA  . PHE A 1 144 ? 29.475 22.810 14.814 1.00 16.89 ? 540 PHE A CA  1 
ATOM 1142 C C   . PHE A 1 144 ? 29.408 21.326 15.143 1.00 21.34 ? 540 PHE A C   1 
ATOM 1143 O O   . PHE A 1 144 ? 28.789 20.547 14.428 1.00 23.74 ? 540 PHE A O   1 
ATOM 1144 C CB  . PHE A 1 144 ? 29.500 23.037 13.294 1.00 16.17 ? 540 PHE A CB  1 
ATOM 1145 C CG  . PHE A 1 144 ? 30.740 22.539 12.615 1.00 13.71 ? 540 PHE A CG  1 
ATOM 1146 C CD1 . PHE A 1 144 ? 31.805 23.397 12.371 1.00 16.51 ? 540 PHE A CD1 1 
ATOM 1147 C CD2 . PHE A 1 144 ? 30.845 21.216 12.206 1.00 15.68 ? 540 PHE A CD2 1 
ATOM 1148 C CE1 . PHE A 1 144 ? 32.961 22.945 11.729 1.00 16.66 ? 540 PHE A CE1 1 
ATOM 1149 C CE2 . PHE A 1 144 ? 31.992 20.757 11.565 1.00 17.77 ? 540 PHE A CE2 1 
ATOM 1150 C CZ  . PHE A 1 144 ? 33.053 21.626 11.327 1.00 15.13 ? 540 PHE A CZ  1 
ATOM 1151 N N   . GLY A 1 145 ? 30.058 20.948 16.240 1.00 26.85 ? 541 GLY A N   1 
ATOM 1152 C CA  . GLY A 1 145 ? 30.077 19.561 16.665 1.00 29.31 ? 541 GLY A CA  1 
ATOM 1153 C C   . GLY A 1 145 ? 28.691 19.006 16.891 1.00 30.12 ? 541 GLY A C   1 
ATOM 1154 O O   . GLY A 1 145 ? 28.263 18.096 16.195 1.00 34.04 ? 541 GLY A O   1 
ATOM 1155 N N   . LEU A 1 146 ? 27.977 19.593 17.843 1.00 33.66 ? 542 LEU A N   1 
ATOM 1156 C CA  . LEU A 1 146 ? 26.624 19.162 18.176 1.00 35.98 ? 542 LEU A CA  1 
ATOM 1157 C C   . LEU A 1 146 ? 25.611 19.465 17.073 1.00 37.74 ? 542 LEU A C   1 
ATOM 1158 O O   . LEU A 1 146 ? 24.484 18.974 17.115 1.00 41.14 ? 542 LEU A O   1 
ATOM 1159 C CB  . LEU A 1 146 ? 26.172 19.825 19.477 1.00 34.47 ? 542 LEU A CB  1 
ATOM 1160 C CG  . LEU A 1 146 ? 24.945 19.203 20.138 1.00 32.57 ? 542 LEU A CG  1 
ATOM 1161 C CD1 . LEU A 1 146 ? 25.249 17.747 20.483 1.00 31.46 ? 542 LEU A CD1 1 
ATOM 1162 C CD2 . LEU A 1 146 ? 24.570 19.988 21.384 1.00 34.75 ? 542 LEU A CD2 1 
ATOM 1163 N N   . SER A 1 147 ? 25.998 20.302 16.113 1.00 39.87 ? 543 SER A N   1 
ATOM 1164 C CA  . SER A 1 147 ? 25.119 20.670 15.006 1.00 37.74 ? 543 SER A CA  1 
ATOM 1165 C C   . SER A 1 147 ? 24.500 19.438 14.353 1.00 36.64 ? 543 SER A C   1 
ATOM 1166 O O   . SER A 1 147 ? 25.122 18.378 14.295 1.00 39.71 ? 543 SER A O   1 
ATOM 1167 C CB  . SER A 1 147 ? 25.884 21.503 13.991 1.00 36.22 ? 543 SER A CB  1 
ATOM 1168 O OG  . SER A 1 147 ? 26.286 22.741 14.549 1.00 39.50 ? 543 SER A OG  1 
ATOM 1169 N N   . ARG A 1 148 ? 23.291 19.588 13.823 1.00 35.36 ? 544 ARG A N   1 
ATOM 1170 C CA  . ARG A 1 148 ? 22.586 18.449 13.243 1.00 35.31 ? 544 ARG A CA  1 
ATOM 1171 C C   . ARG A 1 148 ? 22.490 18.345 11.726 1.00 34.69 ? 544 ARG A C   1 
ATOM 1172 O O   . ARG A 1 148 ? 22.040 19.275 11.050 1.00 34.23 ? 544 ARG A O   1 
ATOM 1173 C CB  . ARG A 1 148 ? 21.158 18.375 13.812 1.00 33.92 ? 544 ARG A CB  1 
ATOM 1174 C CG  . ARG A 1 148 ? 21.042 18.446 15.337 1.00 31.74 ? 544 ARG A CG  1 
ATOM 1175 C CD  . ARG A 1 148 ? 21.624 17.217 16.023 1.00 31.10 ? 544 ARG A CD  1 
ATOM 1176 N NE  . ARG A 1 148 ? 21.323 17.206 17.455 1.00 28.02 ? 544 ARG A NE  1 
ATOM 1177 C CZ  . ARG A 1 148 ? 22.167 16.789 18.394 1.00 27.42 ? 544 ARG A CZ  1 
ATOM 1178 N NH1 . ARG A 1 148 ? 23.374 16.347 18.063 1.00 29.84 ? 544 ARG A NH1 1 
ATOM 1179 N NH2 . ARG A 1 148 ? 21.803 16.809 19.669 1.00 24.16 ? 544 ARG A NH2 1 
ATOM 1180 N N   . TYR A 1 149 ? 22.900 17.195 11.196 1.00 34.38 ? 545 TYR A N   1 
ATOM 1181 C CA  . TYR A 1 149 ? 22.771 16.931 9.772  1.00 33.59 ? 545 TYR A CA  1 
ATOM 1182 C C   . TYR A 1 149 ? 21.303 16.510 9.724  1.00 35.39 ? 545 TYR A C   1 
ATOM 1183 O O   . TYR A 1 149 ? 20.970 15.333 9.879  1.00 37.41 ? 545 TYR A O   1 
ATOM 1184 C CB  . TYR A 1 149 ? 23.675 15.769 9.337  1.00 30.93 ? 545 TYR A CB  1 
ATOM 1185 C CG  . TYR A 1 149 ? 23.699 15.529 7.834  1.00 33.42 ? 545 TYR A CG  1 
ATOM 1186 C CD1 . TYR A 1 149 ? 22.515 15.298 7.120  1.00 31.23 ? 545 TYR A CD1 1 
ATOM 1187 C CD2 . TYR A 1 149 ? 24.904 15.531 7.125  1.00 28.39 ? 545 TYR A CD2 1 
ATOM 1188 C CE1 . TYR A 1 149 ? 22.530 15.081 5.743  1.00 28.45 ? 545 TYR A CE1 1 
ATOM 1189 C CE2 . TYR A 1 149 ? 24.927 15.314 5.743  1.00 28.97 ? 545 TYR A CE2 1 
ATOM 1190 C CZ  . TYR A 1 149 ? 23.735 15.089 5.059  1.00 28.78 ? 545 TYR A CZ  1 
ATOM 1191 O OH  . TYR A 1 149 ? 23.743 14.896 3.694  1.00 25.38 ? 545 TYR A OH  1 
ATOM 1192 N N   . VAL A 1 150 ? 20.428 17.498 9.602  1.00 37.55 ? 546 VAL A N   1 
ATOM 1193 C CA  . VAL A 1 150 ? 18.990 17.264 9.584  1.00 37.08 ? 546 VAL A CA  1 
ATOM 1194 C C   . VAL A 1 150 ? 18.493 16.787 8.224  1.00 37.83 ? 546 VAL A C   1 
ATOM 1195 O O   . VAL A 1 150 ? 18.579 17.512 7.235  1.00 39.72 ? 546 VAL A O   1 
ATOM 1196 C CB  . VAL A 1 150 ? 18.229 18.544 10.010 1.00 37.41 ? 546 VAL A CB  1 
ATOM 1197 C CG1 . VAL A 1 150 ? 16.764 18.249 10.197 1.00 37.58 ? 546 VAL A CG1 1 
ATOM 1198 C CG2 . VAL A 1 150 ? 18.810 19.090 11.301 1.00 35.82 ? 546 VAL A CG2 1 
ATOM 1199 N N   . LEU A 1 151 ? 17.979 15.561 8.183  1.00 38.29 ? 547 LEU A N   1 
ATOM 1200 C CA  . LEU A 1 151 ? 17.464 14.983 6.942  1.00 38.05 ? 547 LEU A CA  1 
ATOM 1201 C C   . LEU A 1 151 ? 16.279 15.781 6.421  1.00 37.96 ? 547 LEU A C   1 
ATOM 1202 O O   . LEU A 1 151 ? 16.163 16.022 5.226  1.00 39.78 ? 547 LEU A O   1 
ATOM 1203 C CB  . LEU A 1 151 ? 17.040 13.525 7.145  1.00 36.02 ? 547 LEU A CB  1 
ATOM 1204 C CG  . LEU A 1 151 ? 18.080 12.537 7.681  1.00 37.29 ? 547 LEU A CG  1 
ATOM 1205 C CD1 . LEU A 1 151 ? 18.006 12.487 9.203  1.00 36.45 ? 547 LEU A CD1 1 
ATOM 1206 C CD2 . LEU A 1 151 ? 17.816 11.151 7.105  1.00 41.49 ? 547 LEU A CD2 1 
ATOM 1207 N N   . ASP A 1 152 ? 15.392 16.174 7.328  1.00 39.49 ? 548 ASP A N   1 
ATOM 1208 C CA  . ASP A 1 152 ? 14.213 16.947 6.961  1.00 38.62 ? 548 ASP A CA  1 
ATOM 1209 C C   . ASP A 1 152 ? 14.523 18.444 6.963  1.00 37.92 ? 548 ASP A C   1 
ATOM 1210 O O   . ASP A 1 152 ? 15.281 18.921 7.799  1.00 39.58 ? 548 ASP A O   1 
ATOM 1211 C CB  . ASP A 1 152 ? 13.035 16.609 7.893  1.00 39.75 ? 548 ASP A CB  1 
ATOM 1212 C CG  . ASP A 1 152 ? 13.449 16.453 9.347  1.00 35.16 ? 548 ASP A CG  1 
ATOM 1213 O OD1 . ASP A 1 152 ? 13.389 15.323 9.871  1.00 35.03 ? 548 ASP A OD1 1 
ATOM 1214 O OD2 . ASP A 1 152 ? 13.823 17.458 9.974  1.00 34.37 ? 548 ASP A OD2 1 
ATOM 1215 N N   . ASP A 1 153 ? 13.945 19.177 6.017  1.00 37.16 ? 549 ASP A N   1 
ATOM 1216 C CA  . ASP A 1 153 ? 14.182 20.621 5.904  1.00 37.60 ? 549 ASP A CA  1 
ATOM 1217 C C   . ASP A 1 153 ? 13.715 21.492 7.081  1.00 39.63 ? 549 ASP A C   1 
ATOM 1218 O O   . ASP A 1 153 ? 14.267 22.570 7.318  1.00 38.62 ? 549 ASP A O   1 
ATOM 1219 C CB  . ASP A 1 153 ? 13.639 21.165 4.571  1.00 29.74 ? 549 ASP A CB  1 
ATOM 1220 C CG  . ASP A 1 153 ? 12.463 20.366 4.046  1.00 24.70 ? 549 ASP A CG  1 
ATOM 1221 O OD1 . ASP A 1 153 ? 11.311 20.721 4.369  1.00 21.17 ? 549 ASP A OD1 1 
ATOM 1222 O OD2 . ASP A 1 153 ? 12.696 19.376 3.316  1.00 21.37 ? 549 ASP A OD2 1 
ATOM 1223 N N   . GLU A 1 154 ? 12.692 21.042 7.800  1.00 42.46 ? 550 GLU A N   1 
ATOM 1224 C CA  . GLU A 1 154 ? 12.183 21.783 8.951  1.00 43.87 ? 550 GLU A CA  1 
ATOM 1225 C C   . GLU A 1 154 ? 12.811 21.061 10.132 1.00 44.39 ? 550 GLU A C   1 
ATOM 1226 O O   . GLU A 1 154 ? 12.798 19.833 10.161 1.00 45.16 ? 550 GLU A O   1 
ATOM 1227 C CB  . GLU A 1 154 ? 10.653 21.676 9.014  1.00 44.48 ? 550 GLU A CB  1 
ATOM 1228 C CG  . GLU A 1 154 ? 9.950  22.690 9.924  1.00 42.81 ? 550 GLU A CG  1 
ATOM 1229 C CD  . GLU A 1 154 ? 10.269 22.514 11.401 1.00 43.82 ? 550 GLU A CD  1 
ATOM 1230 O OE1 . GLU A 1 154 ? 9.910  21.468 11.986 1.00 41.82 ? 550 GLU A OE1 1 
ATOM 1231 O OE2 . GLU A 1 154 ? 10.884 23.428 11.984 1.00 43.35 ? 550 GLU A OE2 1 
ATOM 1232 N N   . TYR A 1 155 ? 13.383 21.803 11.080 1.00 44.30 ? 551 TYR A N   1 
ATOM 1233 C CA  . TYR A 1 155 ? 14.026 21.184 12.239 1.00 42.30 ? 551 TYR A CA  1 
ATOM 1234 C C   . TYR A 1 155 ? 13.384 21.501 13.586 1.00 43.53 ? 551 TYR A C   1 
ATOM 1235 O O   . TYR A 1 155 ? 12.965 22.633 13.849 1.00 41.79 ? 551 TYR A O   1 
ATOM 1236 C CB  . TYR A 1 155 ? 15.516 21.535 12.282 1.00 41.57 ? 551 TYR A CB  1 
ATOM 1237 C CG  . TYR A 1 155 ? 16.221 21.112 13.559 1.00 42.35 ? 551 TYR A CG  1 
ATOM 1238 C CD1 . TYR A 1 155 ? 16.573 19.780 13.786 1.00 43.14 ? 551 TYR A CD1 1 
ATOM 1239 C CD2 . TYR A 1 155 ? 16.550 22.051 14.533 1.00 40.74 ? 551 TYR A CD2 1 
ATOM 1240 C CE1 . TYR A 1 155 ? 17.241 19.402 14.952 1.00 40.79 ? 551 TYR A CE1 1 
ATOM 1241 C CE2 . TYR A 1 155 ? 17.214 21.683 15.697 1.00 38.38 ? 551 TYR A CE2 1 
ATOM 1242 C CZ  . TYR A 1 155 ? 17.555 20.365 15.902 1.00 39.27 ? 551 TYR A CZ  1 
ATOM 1243 O OH  . TYR A 1 155 ? 18.206 20.021 17.061 1.00 41.15 ? 551 TYR A OH  1 
ATOM 1244 N N   . THR A 1 156 ? 13.329 20.475 14.431 1.00 44.17 ? 552 THR A N   1 
ATOM 1245 C CA  . THR A 1 156 ? 12.777 20.559 15.777 1.00 42.48 ? 552 THR A CA  1 
ATOM 1246 C C   . THR A 1 156 ? 13.900 20.118 16.716 1.00 43.93 ? 552 THR A C   1 
ATOM 1247 O O   . THR A 1 156 ? 14.784 19.366 16.300 1.00 45.33 ? 552 THR A O   1 
ATOM 1248 C CB  . THR A 1 156 ? 11.555 19.626 15.927 1.00 40.83 ? 552 THR A CB  1 
ATOM 1249 O OG1 . THR A 1 156 ? 11.850 18.351 15.345 1.00 39.32 ? 552 THR A OG1 1 
ATOM 1250 C CG2 . THR A 1 156 ? 10.343 20.216 15.226 1.00 40.05 ? 552 THR A CG2 1 
ATOM 1251 N N   . SER A 1 157 ? 13.884 20.584 17.963 1.00 42.56 ? 553 SER A N   1 
ATOM 1252 C CA  . SER A 1 157 ? 14.940 20.231 18.909 1.00 41.52 ? 553 SER A CA  1 
ATOM 1253 C C   . SER A 1 157 ? 14.384 19.902 20.299 1.00 41.75 ? 553 SER A C   1 
ATOM 1254 O O   . SER A 1 157 ? 13.185 19.638 20.446 1.00 41.54 ? 553 SER A O   1 
ATOM 1255 C CB  . SER A 1 157 ? 15.942 21.388 18.998 1.00 43.12 ? 553 SER A CB  1 
ATOM 1256 O OG  . SER A 1 157 ? 17.207 20.961 19.479 1.00 42.78 ? 553 SER A OG  1 
ATOM 1257 N N   . SER A 1 158 ? 15.269 19.863 21.296 1.00 40.52 ? 554 SER A N   1 
ATOM 1258 C CA  . SER A 1 158 ? 14.883 19.589 22.678 1.00 41.03 ? 554 SER A CA  1 
ATOM 1259 C C   . SER A 1 158 ? 14.833 20.932 23.406 1.00 41.29 ? 554 SER A C   1 
ATOM 1260 O O   . SER A 1 158 ? 13.833 21.273 24.033 1.00 40.26 ? 554 SER A O   1 
ATOM 1261 C CB  . SER A 1 158 ? 15.895 18.655 23.349 1.00 41.04 ? 554 SER A CB  1 
ATOM 1262 O OG  . SER A 1 158 ? 15.346 18.053 24.515 1.00 41.68 ? 554 SER A OG  1 
ATOM 1263 N N   . VAL A 1 159 ? 15.928 21.681 23.287 1.00 42.31 ? 555 VAL A N   1 
ATOM 1264 C CA  . VAL A 1 159 ? 16.104 23.024 23.858 1.00 44.31 ? 555 VAL A CA  1 
ATOM 1265 C C   . VAL A 1 159 ? 15.979 23.284 25.365 1.00 43.78 ? 555 VAL A C   1 
ATOM 1266 O O   . VAL A 1 159 ? 15.291 22.570 26.101 1.00 43.91 ? 555 VAL A O   1 
ATOM 1267 C CB  . VAL A 1 159 ? 15.284 24.090 23.082 1.00 46.09 ? 555 VAL A CB  1 
ATOM 1268 C CG1 . VAL A 1 159 ? 15.359 23.808 21.607 1.00 45.26 ? 555 VAL A CG1 1 
ATOM 1269 C CG2 . VAL A 1 159 ? 13.840 24.159 23.568 1.00 46.08 ? 555 VAL A CG2 1 
ATOM 1270 N N   . GLY A 1 160 ? 16.690 24.324 25.797 1.00 42.58 ? 556 GLY A N   1 
ATOM 1271 C CA  . GLY A 1 160 ? 16.712 24.732 27.187 1.00 42.48 ? 556 GLY A CA  1 
ATOM 1272 C C   . GLY A 1 160 ? 18.047 25.357 27.556 1.00 41.57 ? 556 GLY A C   1 
ATOM 1273 O O   . GLY A 1 160 ? 18.784 25.812 26.675 1.00 41.16 ? 556 GLY A O   1 
ATOM 1274 N N   . SER A 1 161 ? 18.352 25.378 28.853 1.00 40.73 ? 557 SER A N   1 
ATOM 1275 C CA  . SER A 1 161 ? 19.603 25.934 29.383 1.00 38.88 ? 557 SER A CA  1 
ATOM 1276 C C   . SER A 1 161 ? 19.721 27.453 29.214 1.00 38.15 ? 557 SER A C   1 
ATOM 1277 O O   . SER A 1 161 ? 19.729 28.193 30.197 1.00 37.76 ? 557 SER A O   1 
ATOM 1278 C CB  . SER A 1 161 ? 20.812 25.220 28.764 1.00 40.14 ? 557 SER A CB  1 
ATOM 1279 O OG  . SER A 1 161 ? 20.724 23.812 28.944 1.00 36.05 ? 557 SER A OG  1 
ATOM 1280 N N   . LYS A 1 162 ? 19.826 27.905 27.971 1.00 36.40 ? 558 LYS A N   1 
ATOM 1281 C CA  . LYS A 1 162 ? 19.926 29.323 27.648 1.00 33.00 ? 558 LYS A CA  1 
ATOM 1282 C C   . LYS A 1 162 ? 19.987 29.415 26.127 1.00 32.13 ? 558 LYS A C   1 
ATOM 1283 O O   . LYS A 1 162 ? 20.184 28.403 25.448 1.00 31.90 ? 558 LYS A O   1 
ATOM 1284 C CB  . LYS A 1 162 ? 21.170 29.948 28.284 1.00 32.93 ? 558 LYS A CB  1 
ATOM 1285 C CG  . LYS A 1 162 ? 21.234 31.480 28.249 1.00 28.95 ? 558 LYS A CG  1 
ATOM 1286 C CD  . LYS A 1 162 ? 20.109 32.151 29.034 1.00 25.19 ? 558 LYS A CD  1 
ATOM 1287 C CE  . LYS A 1 162 ? 18.864 32.378 28.182 1.00 24.86 ? 558 LYS A CE  1 
ATOM 1288 N NZ  . LYS A 1 162 ? 19.140 33.238 26.987 1.00 27.50 ? 558 LYS A NZ  1 
ATOM 1289 N N   . PHE A 1 163 ? 19.843 30.618 25.591 1.00 31.72 ? 559 PHE A N   1 
ATOM 1290 C CA  . PHE A 1 163 ? 19.848 30.797 24.147 1.00 30.24 ? 559 PHE A CA  1 
ATOM 1291 C C   . PHE A 1 163 ? 20.672 32.005 23.738 1.00 28.68 ? 559 PHE A C   1 
ATOM 1292 O O   . PHE A 1 163 ? 20.647 33.036 24.418 1.00 32.43 ? 559 PHE A O   1 
ATOM 1293 C CB  . PHE A 1 163 ? 18.410 31.033 23.671 1.00 33.13 ? 559 PHE A CB  1 
ATOM 1294 C CG  . PHE A 1 163 ? 18.028 30.265 22.440 1.00 36.97 ? 559 PHE A CG  1 
ATOM 1295 C CD1 . PHE A 1 163 ? 18.976 29.572 21.698 1.00 37.84 ? 559 PHE A CD1 1 
ATOM 1296 C CD2 . PHE A 1 163 ? 16.697 30.207 22.042 1.00 40.25 ? 559 PHE A CD2 1 
ATOM 1297 C CE1 . PHE A 1 163 ? 18.605 28.832 20.582 1.00 36.42 ? 559 PHE A CE1 1 
ATOM 1298 C CE2 . PHE A 1 163 ? 16.318 29.468 20.932 1.00 39.23 ? 559 PHE A CE2 1 
ATOM 1299 C CZ  . PHE A 1 163 ? 17.275 28.779 20.203 1.00 39.57 ? 559 PHE A CZ  1 
ATOM 1300 N N   . PRO A 1 164 ? 21.505 31.859 22.696 1.00 25.69 ? 560 PRO A N   1 
ATOM 1301 C CA  . PRO A 1 164 ? 22.303 33.003 22.244 1.00 25.30 ? 560 PRO A CA  1 
ATOM 1302 C C   . PRO A 1 164 ? 21.322 33.869 21.439 1.00 22.00 ? 560 PRO A C   1 
ATOM 1303 O O   . PRO A 1 164 ? 21.428 34.002 20.220 1.00 20.54 ? 560 PRO A O   1 
ATOM 1304 C CB  . PRO A 1 164 ? 23.371 32.343 21.371 1.00 24.23 ? 560 PRO A CB  1 
ATOM 1305 C CG  . PRO A 1 164 ? 22.695 31.103 20.873 1.00 23.44 ? 560 PRO A CG  1 
ATOM 1306 C CD  . PRO A 1 164 ? 21.989 30.606 22.090 1.00 23.07 ? 560 PRO A CD  1 
ATOM 1307 N N   . VAL A 1 165 ? 20.370 34.447 22.170 1.00 18.60 ? 561 VAL A N   1 
ATOM 1308 C CA  . VAL A 1 165 ? 19.271 35.271 21.653 1.00 15.90 ? 561 VAL A CA  1 
ATOM 1309 C C   . VAL A 1 165 ? 19.631 36.360 20.645 1.00 12.76 ? 561 VAL A C   1 
ATOM 1310 O O   . VAL A 1 165 ? 18.900 36.595 19.686 1.00 14.28 ? 561 VAL A O   1 
ATOM 1311 C CB  . VAL A 1 165 ? 18.475 35.908 22.840 1.00 13.27 ? 561 VAL A CB  1 
ATOM 1312 C CG1 . VAL A 1 165 ? 17.202 36.587 22.348 1.00 12.23 ? 561 VAL A CG1 1 
ATOM 1313 C CG2 . VAL A 1 165 ? 18.126 34.848 23.858 1.00 10.66 ? 561 VAL A CG2 1 
ATOM 1314 N N   . ARG A 1 166 ? 20.778 36.990 20.849 1.00 11.30 ? 562 ARG A N   1 
ATOM 1315 C CA  . ARG A 1 166 ? 21.238 38.078 19.996 1.00 7.17  ? 562 ARG A CA  1 
ATOM 1316 C C   . ARG A 1 166 ? 21.587 37.696 18.569 1.00 8.37  ? 562 ARG A C   1 
ATOM 1317 O O   . ARG A 1 166 ? 21.885 38.566 17.763 1.00 7.58  ? 562 ARG A O   1 
ATOM 1318 C CB  . ARG A 1 166 ? 22.435 38.756 20.647 1.00 6.00  ? 562 ARG A CB  1 
ATOM 1319 C CG  . ARG A 1 166 ? 22.184 39.160 22.086 1.00 7.62  ? 562 ARG A CG  1 
ATOM 1320 C CD  . ARG A 1 166 ? 23.396 39.859 22.678 1.00 8.88  ? 562 ARG A CD  1 
ATOM 1321 N NE  . ARG A 1 166 ? 23.231 40.134 24.100 1.00 12.40 ? 562 ARG A NE  1 
ATOM 1322 C CZ  . ARG A 1 166 ? 22.311 40.944 24.614 1.00 6.84  ? 562 ARG A CZ  1 
ATOM 1323 N NH1 . ARG A 1 166 ? 22.250 41.118 25.921 1.00 15.72 ? 562 ARG A NH1 1 
ATOM 1324 N NH2 . ARG A 1 166 ? 21.458 41.583 23.835 1.00 7.47  ? 562 ARG A NH2 1 
ATOM 1325 N N   . TRP A 1 167 ? 21.584 36.402 18.264 1.00 9.41  ? 563 TRP A N   1 
ATOM 1326 C CA  . TRP A 1 167 ? 21.909 35.920 16.918 1.00 7.23  ? 563 TRP A CA  1 
ATOM 1327 C C   . TRP A 1 167 ? 20.806 35.000 16.434 1.00 3.39  ? 563 TRP A C   1 
ATOM 1328 O O   . TRP A 1 167 ? 20.986 34.269 15.470 1.00 6.67  ? 563 TRP A O   1 
ATOM 1329 C CB  . TRP A 1 167 ? 23.207 35.107 16.932 1.00 7.42  ? 563 TRP A CB  1 
ATOM 1330 C CG  . TRP A 1 167 ? 24.422 35.878 17.243 1.00 6.68  ? 563 TRP A CG  1 
ATOM 1331 C CD1 . TRP A 1 167 ? 25.306 36.388 16.351 1.00 10.62 ? 563 TRP A CD1 1 
ATOM 1332 C CD2 . TRP A 1 167 ? 24.892 36.249 18.541 1.00 8.73  ? 563 TRP A CD2 1 
ATOM 1333 N NE1 . TRP A 1 167 ? 26.297 37.071 17.010 1.00 11.83 ? 563 TRP A NE1 1 
ATOM 1334 C CE2 . TRP A 1 167 ? 26.070 36.995 18.358 1.00 8.54  ? 563 TRP A CE2 1 
ATOM 1335 C CE3 . TRP A 1 167 ? 24.432 36.021 19.845 1.00 7.52  ? 563 TRP A CE3 1 
ATOM 1336 C CZ2 . TRP A 1 167 ? 26.796 37.525 19.423 1.00 10.18 ? 563 TRP A CZ2 1 
ATOM 1337 C CZ3 . TRP A 1 167 ? 25.153 36.549 20.907 1.00 14.27 ? 563 TRP A CZ3 1 
ATOM 1338 C CH2 . TRP A 1 167 ? 26.325 37.292 20.686 1.00 11.16 ? 563 TRP A CH2 1 
ATOM 1339 N N   . SER A 1 168 ? 19.654 35.063 17.080 1.00 4.53  ? 564 SER A N   1 
ATOM 1340 C CA  . SER A 1 168 ? 18.568 34.179 16.724 1.00 7.96  ? 564 SER A CA  1 
ATOM 1341 C C   . SER A 1 168 ? 17.364 34.853 16.088 1.00 9.34  ? 564 SER A C   1 
ATOM 1342 O O   . SER A 1 168 ? 16.952 35.938 16.501 1.00 8.42  ? 564 SER A O   1 
ATOM 1343 C CB  . SER A 1 168 ? 18.134 33.404 17.971 1.00 9.14  ? 564 SER A CB  1 
ATOM 1344 O OG  . SER A 1 168 ? 19.237 32.702 18.549 1.00 15.71 ? 564 SER A OG  1 
ATOM 1345 N N   . PRO A 1 169 ? 16.839 34.255 15.004 1.00 9.83  ? 565 PRO A N   1 
ATOM 1346 C CA  . PRO A 1 169 ? 15.671 34.821 14.336 1.00 11.63 ? 565 PRO A CA  1 
ATOM 1347 C C   . PRO A 1 169 ? 14.451 34.575 15.225 1.00 11.02 ? 565 PRO A C   1 
ATOM 1348 O O   . PRO A 1 169 ? 14.444 33.649 16.040 1.00 9.72  ? 565 PRO A O   1 
ATOM 1349 C CB  . PRO A 1 169 ? 15.605 34.018 13.033 1.00 7.64  ? 565 PRO A CB  1 
ATOM 1350 C CG  . PRO A 1 169 ? 16.203 32.723 13.395 1.00 3.54  ? 565 PRO A CG  1 
ATOM 1351 C CD  . PRO A 1 169 ? 17.389 33.137 14.219 1.00 10.36 ? 565 PRO A CD  1 
ATOM 1352 N N   . PRO A 1 170 ? 13.397 35.382 15.064 1.00 14.93 ? 566 PRO A N   1 
ATOM 1353 C CA  . PRO A 1 170 ? 12.194 35.207 15.881 1.00 14.83 ? 566 PRO A CA  1 
ATOM 1354 C C   . PRO A 1 170 ? 11.617 33.781 15.963 1.00 12.73 ? 566 PRO A C   1 
ATOM 1355 O O   . PRO A 1 170 ? 11.195 33.361 17.038 1.00 13.91 ? 566 PRO A O   1 
ATOM 1356 C CB  . PRO A 1 170 ? 11.217 36.217 15.272 1.00 14.50 ? 566 PRO A CB  1 
ATOM 1357 C CG  . PRO A 1 170 ? 11.729 36.426 13.876 1.00 18.85 ? 566 PRO A CG  1 
ATOM 1358 C CD  . PRO A 1 170 ? 13.208 36.466 14.085 1.00 16.14 ? 566 PRO A CD  1 
ATOM 1359 N N   . GLU A 1 171 ? 11.636 33.012 14.874 1.00 13.43 ? 567 GLU A N   1 
ATOM 1360 C CA  . GLU A 1 171 ? 11.075 31.652 14.932 1.00 13.41 ? 567 GLU A CA  1 
ATOM 1361 C C   . GLU A 1 171 ? 11.908 30.685 15.769 1.00 11.95 ? 567 GLU A C   1 
ATOM 1362 O O   . GLU A 1 171 ? 11.460 29.581 16.106 1.00 12.58 ? 567 GLU A O   1 
ATOM 1363 C CB  . GLU A 1 171 ? 10.789 31.072 13.541 1.00 15.94 ? 567 GLU A CB  1 
ATOM 1364 C CG  . GLU A 1 171 ? 12.010 30.662 12.730 1.00 17.33 ? 567 GLU A CG  1 
ATOM 1365 C CD  . GLU A 1 171 ? 12.733 31.825 12.072 1.00 12.50 ? 567 GLU A CD  1 
ATOM 1366 O OE1 . GLU A 1 171 ? 12.300 32.993 12.211 1.00 10.98 ? 567 GLU A OE1 1 
ATOM 1367 O OE2 . GLU A 1 171 ? 13.749 31.550 11.404 1.00 9.50  ? 567 GLU A OE2 1 
ATOM 1368 N N   . VAL A 1 172 ? 13.134 31.083 16.078 1.00 10.44 ? 568 VAL A N   1 
ATOM 1369 C CA  . VAL A 1 172 ? 13.994 30.274 16.926 1.00 9.53  ? 568 VAL A CA  1 
ATOM 1370 C C   . VAL A 1 172 ? 13.722 30.798 18.331 1.00 10.51 ? 568 VAL A C   1 
ATOM 1371 O O   . VAL A 1 172 ? 13.608 30.029 19.285 1.00 9.31  ? 568 VAL A O   1 
ATOM 1372 C CB  . VAL A 1 172 ? 15.473 30.421 16.541 1.00 4.21  ? 568 VAL A CB  1 
ATOM 1373 C CG1 . VAL A 1 172 ? 16.331 30.518 17.751 1.00 6.04  ? 568 VAL A CG1 1 
ATOM 1374 C CG2 . VAL A 1 172 ? 15.902 29.228 15.729 1.00 5.60  ? 568 VAL A CG2 1 
ATOM 1375 N N   . LEU A 1 173 ? 13.521 32.110 18.415 1.00 10.75 ? 569 LEU A N   1 
ATOM 1376 C CA  . LEU A 1 173 ? 13.218 32.803 19.663 1.00 14.44 ? 569 LEU A CA  1 
ATOM 1377 C C   . LEU A 1 173 ? 11.885 32.333 20.244 1.00 17.10 ? 569 LEU A C   1 
ATOM 1378 O O   . LEU A 1 173 ? 11.709 32.288 21.462 1.00 20.31 ? 569 LEU A O   1 
ATOM 1379 C CB  . LEU A 1 173 ? 13.137 34.308 19.397 1.00 12.26 ? 569 LEU A CB  1 
ATOM 1380 C CG  . LEU A 1 173 ? 14.207 35.247 19.958 1.00 11.89 ? 569 LEU A CG  1 
ATOM 1381 C CD1 . LEU A 1 173 ? 15.591 34.631 19.852 1.00 11.36 ? 569 LEU A CD1 1 
ATOM 1382 C CD2 . LEU A 1 173 ? 14.135 36.583 19.221 1.00 12.38 ? 569 LEU A CD2 1 
ATOM 1383 N N   . MET A 1 174 ? 10.959 31.964 19.363 1.00 17.50 ? 570 MET A N   1 
ATOM 1384 C CA  . MET A 1 174 ? 9.629  31.528 19.769 1.00 16.12 ? 570 MET A CA  1 
ATOM 1385 C C   . MET A 1 174 ? 9.404  30.043 20.028 1.00 12.94 ? 570 MET A C   1 
ATOM 1386 O O   . MET A 1 174 ? 8.637  29.689 20.923 1.00 15.56 ? 570 MET A O   1 
ATOM 1387 C CB  . MET A 1 174 ? 8.588  32.073 18.797 1.00 16.10 ? 570 MET A CB  1 
ATOM 1388 C CG  . MET A 1 174 ? 8.490  33.593 18.830 1.00 17.26 ? 570 MET A CG  1 
ATOM 1389 S SD  . MET A 1 174 ? 7.274  34.254 17.686 1.00 27.62 ? 570 MET A SD  1 
ATOM 1390 C CE  . MET A 1 174 ? 8.296  34.747 16.354 1.00 23.00 ? 570 MET A CE  1 
ATOM 1391 N N   . TYR A 1 175 ? 10.027 29.172 19.242 1.00 12.61 ? 571 TYR A N   1 
ATOM 1392 C CA  . TYR A 1 175 ? 9.875  27.726 19.448 1.00 14.91 ? 571 TYR A CA  1 
ATOM 1393 C C   . TYR A 1 175 ? 10.983 26.881 18.832 1.00 15.24 ? 571 TYR A C   1 
ATOM 1394 O O   . TYR A 1 175 ? 10.734 25.810 18.286 1.00 17.04 ? 571 TYR A O   1 
ATOM 1395 C CB  . TYR A 1 175 ? 8.489  27.216 19.010 1.00 17.43 ? 571 TYR A CB  1 
ATOM 1396 C CG  . TYR A 1 175 ? 8.126  27.460 17.560 1.00 16.93 ? 571 TYR A CG  1 
ATOM 1397 C CD1 . TYR A 1 175 ? 7.914  26.397 16.691 1.00 17.22 ? 571 TYR A CD1 1 
ATOM 1398 C CD2 . TYR A 1 175 ? 7.983  28.754 17.067 1.00 15.52 ? 571 TYR A CD2 1 
ATOM 1399 C CE1 . TYR A 1 175 ? 7.565  26.612 15.361 1.00 18.55 ? 571 TYR A CE1 1 
ATOM 1400 C CE2 . TYR A 1 175 ? 7.640  28.987 15.742 1.00 21.13 ? 571 TYR A CE2 1 
ATOM 1401 C CZ  . TYR A 1 175 ? 7.428  27.912 14.891 1.00 22.58 ? 571 TYR A CZ  1 
ATOM 1402 O OH  . TYR A 1 175 ? 7.070  28.139 13.582 1.00 18.95 ? 571 TYR A OH  1 
ATOM 1403 N N   . SER A 1 176 ? 12.204 27.398 18.894 1.00 19.07 ? 572 SER A N   1 
ATOM 1404 C CA  . SER A 1 176 ? 13.383 26.696 18.399 1.00 19.19 ? 572 SER A CA  1 
ATOM 1405 C C   . SER A 1 176 ? 13.270 26.088 17.001 1.00 19.87 ? 572 SER A C   1 
ATOM 1406 O O   . SER A 1 176 ? 13.729 24.960 16.761 1.00 16.73 ? 572 SER A O   1 
ATOM 1407 C CB  . SER A 1 176 ? 13.759 25.611 19.399 1.00 16.09 ? 572 SER A CB  1 
ATOM 1408 O OG  . SER A 1 176 ? 13.662 26.109 20.727 1.00 13.53 ? 572 SER A OG  1 
ATOM 1409 N N   . LYS A 1 177 ? 12.679 26.838 16.076 1.00 22.09 ? 573 LYS A N   1 
ATOM 1410 C CA  . LYS A 1 177 ? 12.535 26.364 14.707 1.00 23.82 ? 573 LYS A CA  1 
ATOM 1411 C C   . LYS A 1 177 ? 13.810 26.672 13.898 1.00 24.62 ? 573 LYS A C   1 
ATOM 1412 O O   . LYS A 1 177 ? 13.875 27.661 13.159 1.00 24.59 ? 573 LYS A O   1 
ATOM 1413 C CB  . LYS A 1 177 ? 11.304 27.005 14.060 1.00 24.62 ? 573 LYS A CB  1 
ATOM 1414 C CG  . LYS A 1 177 ? 10.870 26.369 12.755 1.00 24.09 ? 573 LYS A CG  1 
ATOM 1415 C CD  . LYS A 1 177 ? 9.561  26.969 12.289 1.00 27.34 ? 573 LYS A CD  1 
ATOM 1416 C CE  . LYS A 1 177 ? 8.914  26.145 11.197 1.00 27.52 ? 573 LYS A CE  1 
ATOM 1417 N NZ  . LYS A 1 177 ? 7.495  26.549 11.009 1.00 27.13 ? 573 LYS A NZ  1 
ATOM 1418 N N   . PHE A 1 178 ? 14.842 25.857 14.093 1.00 21.87 ? 574 PHE A N   1 
ATOM 1419 C CA  . PHE A 1 178 ? 16.096 26.042 13.379 1.00 17.67 ? 574 PHE A CA  1 
ATOM 1420 C C   . PHE A 1 178 ? 15.941 25.514 11.960 1.00 13.16 ? 574 PHE A C   1 
ATOM 1421 O O   . PHE A 1 178 ? 15.181 24.577 11.716 1.00 13.27 ? 574 PHE A O   1 
ATOM 1422 C CB  . PHE A 1 178 ? 17.238 25.268 14.055 1.00 18.29 ? 574 PHE A CB  1 
ATOM 1423 C CG  . PHE A 1 178 ? 17.489 25.649 15.493 1.00 17.48 ? 574 PHE A CG  1 
ATOM 1424 C CD1 . PHE A 1 178 ? 17.065 24.823 16.527 1.00 20.56 ? 574 PHE A CD1 1 
ATOM 1425 C CD2 . PHE A 1 178 ? 18.200 26.803 15.813 1.00 19.16 ? 574 PHE A CD2 1 
ATOM 1426 C CE1 . PHE A 1 178 ? 17.345 25.132 17.860 1.00 20.84 ? 574 PHE A CE1 1 
ATOM 1427 C CE2 . PHE A 1 178 ? 18.485 27.122 17.144 1.00 19.40 ? 574 PHE A CE2 1 
ATOM 1428 C CZ  . PHE A 1 178 ? 18.054 26.280 18.168 1.00 17.92 ? 574 PHE A CZ  1 
ATOM 1429 N N   . SER A 1 179 ? 16.668 26.112 11.028 1.00 13.22 ? 575 SER A N   1 
ATOM 1430 C CA  . SER A 1 179 ? 16.658 25.682 9.634  1.00 12.31 ? 575 SER A CA  1 
ATOM 1431 C C   . SER A 1 179 ? 17.915 26.275 9.017  1.00 13.34 ? 575 SER A C   1 
ATOM 1432 O O   . SER A 1 179 ? 18.848 26.636 9.738  1.00 16.79 ? 575 SER A O   1 
ATOM 1433 C CB  . SER A 1 179 ? 15.405 26.185 8.900  1.00 9.44  ? 575 SER A CB  1 
ATOM 1434 O OG  . SER A 1 179 ? 15.558 27.510 8.406  1.00 5.32  ? 575 SER A OG  1 
ATOM 1435 N N   . SER A 1 180 ? 17.953 26.378 7.696  1.00 12.36 ? 576 SER A N   1 
ATOM 1436 C CA  . SER A 1 180 ? 19.102 26.959 7.033  1.00 11.50 ? 576 SER A CA  1 
ATOM 1437 C C   . SER A 1 180 ? 19.048 28.465 7.250  1.00 9.00  ? 576 SER A C   1 
ATOM 1438 O O   . SER A 1 180 ? 20.068 29.129 7.436  1.00 11.10 ? 576 SER A O   1 
ATOM 1439 C CB  . SER A 1 180 ? 19.033 26.673 5.534  1.00 17.69 ? 576 SER A CB  1 
ATOM 1440 O OG  . SER A 1 180 ? 17.829 27.186 4.970  1.00 25.45 ? 576 SER A OG  1 
ATOM 1441 N N   . LYS A 1 181 ? 17.833 28.995 7.247  1.00 9.50  ? 577 LYS A N   1 
ATOM 1442 C CA  . LYS A 1 181 ? 17.604 30.422 7.402  1.00 9.17  ? 577 LYS A CA  1 
ATOM 1443 C C   . LYS A 1 181 ? 17.878 30.940 8.812  1.00 8.67  ? 577 LYS A C   1 
ATOM 1444 O O   . LYS A 1 181 ? 17.909 32.154 9.032  1.00 9.38  ? 577 LYS A O   1 
ATOM 1445 C CB  . LYS A 1 181 ? 16.190 30.765 6.925  1.00 12.09 ? 577 LYS A CB  1 
ATOM 1446 C CG  . LYS A 1 181 ? 15.892 30.249 5.508  1.00 8.29  ? 577 LYS A CG  1 
ATOM 1447 C CD  . LYS A 1 181 ? 16.752 30.956 4.471  1.00 19.55 ? 577 LYS A CD  1 
ATOM 1448 C CE  . LYS A 1 181 ? 16.830 30.179 3.159  1.00 15.68 ? 577 LYS A CE  1 
ATOM 1449 N NZ  . LYS A 1 181 ? 15.498 29.738 2.670  1.00 20.19 ? 577 LYS A NZ  1 
ATOM 1450 N N   . SER A 1 182 ? 18.054 30.026 9.766  1.00 10.63 ? 578 SER A N   1 
ATOM 1451 C CA  . SER A 1 182 ? 18.378 30.401 11.141 1.00 7.64  ? 578 SER A CA  1 
ATOM 1452 C C   . SER A 1 182 ? 19.862 30.743 11.139 1.00 3.05  ? 578 SER A C   1 
ATOM 1453 O O   . SER A 1 182 ? 20.281 31.699 11.785 1.00 3.62  ? 578 SER A O   1 
ATOM 1454 C CB  . SER A 1 182 ? 18.107 29.250 12.110 1.00 6.86  ? 578 SER A CB  1 
ATOM 1455 O OG  . SER A 1 182 ? 16.743 28.879 12.106 1.00 18.48 ? 578 SER A OG  1 
ATOM 1456 N N   . ASP A 1 183 ? 20.653 29.951 10.415 1.00 4.90  ? 579 ASP A N   1 
ATOM 1457 C CA  . ASP A 1 183 ? 22.092 30.205 10.277 1.00 7.88  ? 579 ASP A CA  1 
ATOM 1458 C C   . ASP A 1 183 ? 22.330 31.496 9.500  1.00 5.97  ? 579 ASP A C   1 
ATOM 1459 O O   . ASP A 1 183 ? 23.275 32.228 9.776  1.00 6.23  ? 579 ASP A O   1 
ATOM 1460 C CB  . ASP A 1 183 ? 22.773 29.075 9.522  1.00 7.80  ? 579 ASP A CB  1 
ATOM 1461 C CG  . ASP A 1 183 ? 22.916 27.838 10.341 1.00 13.43 ? 579 ASP A CG  1 
ATOM 1462 O OD1 . ASP A 1 183 ? 22.190 27.698 11.347 1.00 16.68 ? 579 ASP A OD1 1 
ATOM 1463 O OD2 . ASP A 1 183 ? 23.765 27.003 9.970  1.00 17.47 ? 579 ASP A OD2 1 
ATOM 1464 N N   . ILE A 1 184 ? 21.515 31.715 8.472  1.00 6.76  ? 580 ILE A N   1 
ATOM 1465 C CA  . ILE A 1 184 ? 21.607 32.921 7.652  1.00 8.95  ? 580 ILE A CA  1 
ATOM 1466 C C   . ILE A 1 184 ? 21.452 34.150 8.545  1.00 9.29  ? 580 ILE A C   1 
ATOM 1467 O O   . ILE A 1 184 ? 22.247 35.087 8.449  1.00 14.35 ? 580 ILE A O   1 
ATOM 1468 C CB  . ILE A 1 184 ? 20.548 32.921 6.497  1.00 7.78  ? 580 ILE A CB  1 
ATOM 1469 C CG1 . ILE A 1 184 ? 21.252 32.861 5.136  1.00 6.38  ? 580 ILE A CG1 1 
ATOM 1470 C CG2 . ILE A 1 184 ? 19.670 34.171 6.529  1.00 9.49  ? 580 ILE A CG2 1 
ATOM 1471 C CD1 . ILE A 1 184 ? 21.449 31.477 4.617  1.00 12.06 ? 580 ILE A CD1 1 
ATOM 1472 N N   . TRP A 1 185 ? 20.457 34.127 9.430  1.00 8.74  ? 581 TRP A N   1 
ATOM 1473 C CA  . TRP A 1 185 ? 20.218 35.235 10.339 1.00 4.45  ? 581 TRP A CA  1 
ATOM 1474 C C   . TRP A 1 185 ? 21.442 35.446 11.195 1.00 4.23  ? 581 TRP A C   1 
ATOM 1475 O O   . TRP A 1 185 ? 21.953 36.557 11.290 1.00 7.98  ? 581 TRP A O   1 
ATOM 1476 C CB  . TRP A 1 185 ? 18.997 34.961 11.219 1.00 5.26  ? 581 TRP A CB  1 
ATOM 1477 C CG  . TRP A 1 185 ? 18.656 36.080 12.187 1.00 5.57  ? 581 TRP A CG  1 
ATOM 1478 C CD1 . TRP A 1 185 ? 19.400 36.500 13.253 1.00 7.88  ? 581 TRP A CD1 1 
ATOM 1479 C CD2 . TRP A 1 185 ? 17.478 36.894 12.182 1.00 7.10  ? 581 TRP A CD2 1 
ATOM 1480 N NE1 . TRP A 1 185 ? 18.760 37.520 13.908 1.00 8.39  ? 581 TRP A NE1 1 
ATOM 1481 C CE2 . TRP A 1 185 ? 17.577 37.782 13.276 1.00 8.85  ? 581 TRP A CE2 1 
ATOM 1482 C CE3 . TRP A 1 185 ? 16.343 36.957 11.366 1.00 5.60  ? 581 TRP A CE3 1 
ATOM 1483 C CZ2 . TRP A 1 185 ? 16.590 38.716 13.571 1.00 7.26  ? 581 TRP A CZ2 1 
ATOM 1484 C CZ3 . TRP A 1 185 ? 15.364 37.885 11.661 1.00 2.00  ? 581 TRP A CZ3 1 
ATOM 1485 C CH2 . TRP A 1 185 ? 15.495 38.752 12.753 1.00 6.05  ? 581 TRP A CH2 1 
ATOM 1486 N N   . ALA A 1 186 ? 21.907 34.371 11.821 1.00 9.71  ? 582 ALA A N   1 
ATOM 1487 C CA  . ALA A 1 186 ? 23.083 34.408 12.690 1.00 7.74  ? 582 ALA A CA  1 
ATOM 1488 C C   . ALA A 1 186 ? 24.342 34.878 11.957 1.00 9.07  ? 582 ALA A C   1 
ATOM 1489 O O   . ALA A 1 186 ? 25.189 35.551 12.543 1.00 8.09  ? 582 ALA A O   1 
ATOM 1490 C CB  . ALA A 1 186 ? 23.304 33.041 13.314 1.00 5.41  ? 582 ALA A CB  1 
ATOM 1491 N N   . PHE A 1 187 ? 24.463 34.522 10.675 1.00 12.09 ? 583 PHE A N   1 
ATOM 1492 C CA  . PHE A 1 187 ? 25.609 34.920 9.841  1.00 7.60  ? 583 PHE A CA  1 
ATOM 1493 C C   . PHE A 1 187 ? 25.536 36.416 9.607  1.00 10.14 ? 583 PHE A C   1 
ATOM 1494 O O   . PHE A 1 187 ? 26.556 37.111 9.615  1.00 11.69 ? 583 PHE A O   1 
ATOM 1495 C CB  . PHE A 1 187 ? 25.557 34.201 8.490  1.00 9.22  ? 583 PHE A CB  1 
ATOM 1496 C CG  . PHE A 1 187 ? 26.526 34.740 7.465  1.00 4.47  ? 583 PHE A CG  1 
ATOM 1497 C CD1 . PHE A 1 187 ? 27.877 34.430 7.536  1.00 4.68  ? 583 PHE A CD1 1 
ATOM 1498 C CD2 . PHE A 1 187 ? 26.079 35.549 6.421  1.00 6.35  ? 583 PHE A CD2 1 
ATOM 1499 C CE1 . PHE A 1 187 ? 28.769 34.915 6.585  1.00 5.23  ? 583 PHE A CE1 1 
ATOM 1500 C CE2 . PHE A 1 187 ? 26.969 36.039 5.460  1.00 2.15  ? 583 PHE A CE2 1 
ATOM 1501 C CZ  . PHE A 1 187 ? 28.313 35.719 5.545  1.00 5.61  ? 583 PHE A CZ  1 
ATOM 1502 N N   . GLY A 1 188 ? 24.320 36.895 9.360  1.00 10.66 ? 584 GLY A N   1 
ATOM 1503 C CA  . GLY A 1 188 ? 24.102 38.309 9.128  1.00 9.30  ? 584 GLY A CA  1 
ATOM 1504 C C   . GLY A 1 188 ? 24.514 39.107 10.339 1.00 7.76  ? 584 GLY A C   1 
ATOM 1505 O O   . GLY A 1 188 ? 25.051 40.209 10.212 1.00 10.68 ? 584 GLY A O   1 
ATOM 1506 N N   . VAL A 1 189 ? 24.259 38.559 11.525 1.00 7.75  ? 585 VAL A N   1 
ATOM 1507 C CA  . VAL A 1 189 ? 24.644 39.246 12.750 1.00 6.19  ? 585 VAL A CA  1 
ATOM 1508 C C   . VAL A 1 189 ? 26.169 39.169 12.847 1.00 7.35  ? 585 VAL A C   1 
ATOM 1509 O O   . VAL A 1 189 ? 26.818 40.145 13.201 1.00 10.25 ? 585 VAL A O   1 
ATOM 1510 C CB  . VAL A 1 189 ? 23.995 38.628 14.015 1.00 5.76  ? 585 VAL A CB  1 
ATOM 1511 C CG1 . VAL A 1 189 ? 24.471 39.358 15.246 1.00 8.91  ? 585 VAL A CG1 1 
ATOM 1512 C CG2 . VAL A 1 189 ? 22.478 38.711 13.945 1.00 4.10  ? 585 VAL A CG2 1 
ATOM 1513 N N   . LEU A 1 190 ? 26.746 38.026 12.487 1.00 4.16  ? 586 LEU A N   1 
ATOM 1514 C CA  . LEU A 1 190 ? 28.200 37.873 12.527 1.00 7.72  ? 586 LEU A CA  1 
ATOM 1515 C C   . LEU A 1 190 ? 28.857 38.965 11.695 1.00 6.55  ? 586 LEU A C   1 
ATOM 1516 O O   . LEU A 1 190 ? 29.902 39.502 12.071 1.00 6.94  ? 586 LEU A O   1 
ATOM 1517 C CB  . LEU A 1 190 ? 28.632 36.492 12.005 1.00 5.58  ? 586 LEU A CB  1 
ATOM 1518 C CG  . LEU A 1 190 ? 30.127 36.293 11.693 1.00 6.32  ? 586 LEU A CG  1 
ATOM 1519 C CD1 . LEU A 1 190 ? 31.005 36.643 12.885 1.00 2.00  ? 586 LEU A CD1 1 
ATOM 1520 C CD2 . LEU A 1 190 ? 30.385 34.880 11.254 1.00 6.90  ? 586 LEU A CD2 1 
ATOM 1521 N N   . MET A 1 191 ? 28.242 39.278 10.557 1.00 9.63  ? 587 MET A N   1 
ATOM 1522 C CA  . MET A 1 191 ? 28.745 40.310 9.660  1.00 5.25  ? 587 MET A CA  1 
ATOM 1523 C C   . MET A 1 191 ? 28.755 41.626 10.400 1.00 6.90  ? 587 MET A C   1 
ATOM 1524 O O   . MET A 1 191 ? 29.716 42.387 10.318 1.00 4.22  ? 587 MET A O   1 
ATOM 1525 C CB  . MET A 1 191 ? 27.850 40.442 8.437  1.00 5.01  ? 587 MET A CB  1 
ATOM 1526 C CG  . MET A 1 191 ? 27.974 39.317 7.443  1.00 4.97  ? 587 MET A CG  1 
ATOM 1527 S SD  . MET A 1 191 ? 27.187 39.797 5.910  1.00 9.68  ? 587 MET A SD  1 
ATOM 1528 C CE  . MET A 1 191 ? 28.480 40.808 5.189  1.00 3.35  ? 587 MET A CE  1 
ATOM 1529 N N   . TRP A 1 192 ? 27.680 41.878 11.143 1.00 8.72  ? 588 TRP A N   1 
ATOM 1530 C CA  . TRP A 1 192 ? 27.551 43.096 11.925 1.00 9.02  ? 588 TRP A CA  1 
ATOM 1531 C C   . TRP A 1 192 ? 28.655 43.122 12.980 1.00 11.28 ? 588 TRP A C   1 
ATOM 1532 O O   . TRP A 1 192 ? 29.133 44.186 13.362 1.00 11.93 ? 588 TRP A O   1 
ATOM 1533 C CB  . TRP A 1 192 ? 26.176 43.155 12.595 1.00 7.30  ? 588 TRP A CB  1 
ATOM 1534 C CG  . TRP A 1 192 ? 25.977 44.397 13.389 1.00 3.41  ? 588 TRP A CG  1 
ATOM 1535 C CD1 . TRP A 1 192 ? 25.492 45.591 12.941 1.00 3.84  ? 588 TRP A CD1 1 
ATOM 1536 C CD2 . TRP A 1 192 ? 26.321 44.593 14.759 1.00 5.76  ? 588 TRP A CD2 1 
ATOM 1537 N NE1 . TRP A 1 192 ? 25.518 46.525 13.946 1.00 2.00  ? 588 TRP A NE1 1 
ATOM 1538 C CE2 . TRP A 1 192 ? 26.021 45.939 15.078 1.00 3.37  ? 588 TRP A CE2 1 
ATOM 1539 C CE3 . TRP A 1 192 ? 26.863 43.765 15.756 1.00 7.65  ? 588 TRP A CE3 1 
ATOM 1540 C CZ2 . TRP A 1 192 ? 26.244 46.470 16.348 1.00 3.23  ? 588 TRP A CZ2 1 
ATOM 1541 C CZ3 . TRP A 1 192 ? 27.085 44.298 17.012 1.00 2.00  ? 588 TRP A CZ3 1 
ATOM 1542 C CH2 . TRP A 1 192 ? 26.777 45.635 17.298 1.00 5.01  ? 588 TRP A CH2 1 
ATOM 1543 N N   . GLU A 1 193 ? 29.058 41.942 13.439 1.00 11.46 ? 589 GLU A N   1 
ATOM 1544 C CA  . GLU A 1 193 ? 30.116 41.828 14.430 1.00 10.29 ? 589 GLU A CA  1 
ATOM 1545 C C   . GLU A 1 193 ? 31.442 42.164 13.768 1.00 11.38 ? 589 GLU A C   1 
ATOM 1546 O O   . GLU A 1 193 ? 32.287 42.844 14.349 1.00 9.66  ? 589 GLU A O   1 
ATOM 1547 C CB  . GLU A 1 193 ? 30.177 40.409 15.010 1.00 10.54 ? 589 GLU A CB  1 
ATOM 1548 C CG  . GLU A 1 193 ? 28.996 40.024 15.873 1.00 6.40  ? 589 GLU A CG  1 
ATOM 1549 C CD  . GLU A 1 193 ? 29.184 38.674 16.522 1.00 5.99  ? 589 GLU A CD  1 
ATOM 1550 O OE1 . GLU A 1 193 ? 29.688 38.628 17.661 1.00 10.51 ? 589 GLU A OE1 1 
ATOM 1551 O OE2 . GLU A 1 193 ? 28.835 37.654 15.890 1.00 5.23  ? 589 GLU A OE2 1 
ATOM 1552 N N   . ILE A 1 194 ? 31.632 41.666 12.554 1.00 9.79  ? 590 ILE A N   1 
ATOM 1553 C CA  . ILE A 1 194 ? 32.860 41.931 11.825 1.00 14.53 ? 590 ILE A CA  1 
ATOM 1554 C C   . ILE A 1 194 ? 32.982 43.426 11.552 1.00 14.06 ? 590 ILE A C   1 
ATOM 1555 O O   . ILE A 1 194 ? 33.983 44.052 11.908 1.00 15.05 ? 590 ILE A O   1 
ATOM 1556 C CB  . ILE A 1 194 ? 32.921 41.136 10.476 1.00 13.48 ? 590 ILE A CB  1 
ATOM 1557 C CG1 . ILE A 1 194 ? 33.080 39.637 10.746 1.00 14.32 ? 590 ILE A CG1 1 
ATOM 1558 C CG2 . ILE A 1 194 ? 34.080 41.612 9.628  1.00 13.14 ? 590 ILE A CG2 1 
ATOM 1559 C CD1 . ILE A 1 194 ? 33.136 38.788 9.489  1.00 2.34  ? 590 ILE A CD1 1 
ATOM 1560 N N   . TYR A 1 195 ? 31.931 44.007 10.982 1.00 14.63 ? 591 TYR A N   1 
ATOM 1561 C CA  . TYR A 1 195 ? 31.939 45.423 10.642 1.00 10.81 ? 591 TYR A CA  1 
ATOM 1562 C C   . TYR A 1 195 ? 31.964 46.440 11.780 1.00 8.81  ? 591 TYR A C   1 
ATOM 1563 O O   . TYR A 1 195 ? 32.575 47.505 11.645 1.00 9.70  ? 591 TYR A O   1 
ATOM 1564 C CB  . TYR A 1 195 ? 30.878 45.721 9.592  1.00 11.09 ? 591 TYR A CB  1 
ATOM 1565 C CG  . TYR A 1 195 ? 31.410 45.434 8.213  1.00 11.87 ? 591 TYR A CG  1 
ATOM 1566 C CD1 . TYR A 1 195 ? 31.381 44.144 7.684  1.00 15.61 ? 591 TYR A CD1 1 
ATOM 1567 C CD2 . TYR A 1 195 ? 32.022 46.437 7.466  1.00 10.34 ? 591 TYR A CD2 1 
ATOM 1568 C CE1 . TYR A 1 195 ? 31.955 43.863 6.446  1.00 11.16 ? 591 TYR A CE1 1 
ATOM 1569 C CE2 . TYR A 1 195 ? 32.598 46.170 6.235  1.00 10.30 ? 591 TYR A CE2 1 
ATOM 1570 C CZ  . TYR A 1 195 ? 32.564 44.883 5.731  1.00 11.77 ? 591 TYR A CZ  1 
ATOM 1571 O OH  . TYR A 1 195 ? 33.154 44.620 4.519  1.00 18.27 ? 591 TYR A OH  1 
ATOM 1572 N N   . SER A 1 196 ? 31.330 46.126 12.904 1.00 9.16  ? 592 SER A N   1 
ATOM 1573 C CA  . SER A 1 196 ? 31.377 47.033 14.051 1.00 10.14 ? 592 SER A CA  1 
ATOM 1574 C C   . SER A 1 196 ? 32.684 46.776 14.823 1.00 11.91 ? 592 SER A C   1 
ATOM 1575 O O   . SER A 1 196 ? 32.904 47.341 15.894 1.00 12.09 ? 592 SER A O   1 
ATOM 1576 C CB  . SER A 1 196 ? 30.157 46.849 14.961 1.00 8.60  ? 592 SER A CB  1 
ATOM 1577 O OG  . SER A 1 196 ? 30.143 45.577 15.572 1.00 10.12 ? 592 SER A OG  1 
ATOM 1578 N N   . LEU A 1 197 ? 33.554 45.944 14.247 1.00 8.44  ? 593 LEU A N   1 
ATOM 1579 C CA  . LEU A 1 197 ? 34.837 45.583 14.836 1.00 11.62 ? 593 LEU A CA  1 
ATOM 1580 C C   . LEU A 1 197 ? 34.757 44.901 16.197 1.00 13.49 ? 593 LEU A C   1 
ATOM 1581 O O   . LEU A 1 197 ? 35.398 45.324 17.158 1.00 15.34 ? 593 LEU A O   1 
ATOM 1582 C CB  . LEU A 1 197 ? 35.794 46.784 14.878 1.00 11.72 ? 593 LEU A CB  1 
ATOM 1583 C CG  . LEU A 1 197 ? 36.273 47.296 13.507 1.00 13.96 ? 593 LEU A CG  1 
ATOM 1584 C CD1 . LEU A 1 197 ? 37.035 48.602 13.641 1.00 11.23 ? 593 LEU A CD1 1 
ATOM 1585 C CD2 . LEU A 1 197 ? 37.130 46.246 12.820 1.00 13.30 ? 593 LEU A CD2 1 
ATOM 1586 N N   . GLY A 1 198 ? 33.984 43.820 16.249 1.00 13.34 ? 594 GLY A N   1 
ATOM 1587 C CA  . GLY A 1 198 ? 33.842 43.027 17.460 1.00 13.43 ? 594 GLY A CA  1 
ATOM 1588 C C   . GLY A 1 198 ? 32.899 43.478 18.554 1.00 12.35 ? 594 GLY A C   1 
ATOM 1589 O O   . GLY A 1 198 ? 33.053 43.074 19.702 1.00 16.26 ? 594 GLY A O   1 
ATOM 1590 N N   . LYS A 1 199 ? 31.907 44.292 18.225 1.00 15.44 ? 595 LYS A N   1 
ATOM 1591 C CA  . LYS A 1 199 ? 30.982 44.751 19.252 1.00 14.58 ? 595 LYS A CA  1 
ATOM 1592 C C   . LYS A 1 199 ? 29.862 43.746 19.481 1.00 11.31 ? 595 LYS A C   1 
ATOM 1593 O O   . LYS A 1 199 ? 29.561 42.941 18.600 1.00 11.64 ? 595 LYS A O   1 
ATOM 1594 C CB  . LYS A 1 199 ? 30.422 46.133 18.902 1.00 16.29 ? 595 LYS A CB  1 
ATOM 1595 C CG  . LYS A 1 199 ? 31.498 47.153 18.538 1.00 17.65 ? 595 LYS A CG  1 
ATOM 1596 C CD  . LYS A 1 199 ? 32.699 47.035 19.468 1.00 20.70 ? 595 LYS A CD  1 
ATOM 1597 C CE  . LYS A 1 199 ? 33.937 47.733 18.911 1.00 19.00 ? 595 LYS A CE  1 
ATOM 1598 N NZ  . LYS A 1 199 ? 35.142 47.357 19.707 1.00 21.27 ? 595 LYS A NZ  1 
ATOM 1599 N N   . MET A 1 200 ? 29.311 43.743 20.695 1.00 13.47 ? 596 MET A N   1 
ATOM 1600 C CA  . MET A 1 200 ? 28.212 42.842 21.044 1.00 13.02 ? 596 MET A CA  1 
ATOM 1601 C C   . MET A 1 200 ? 26.908 43.396 20.502 1.00 8.51  ? 596 MET A C   1 
ATOM 1602 O O   . MET A 1 200 ? 26.670 44.611 20.547 1.00 8.39  ? 596 MET A O   1 
ATOM 1603 C CB  . MET A 1 200 ? 28.097 42.639 22.569 1.00 17.06 ? 596 MET A CB  1 
ATOM 1604 C CG  . MET A 1 200 ? 26.706 42.143 23.017 1.00 18.96 ? 596 MET A CG  1 
ATOM 1605 S SD  . MET A 1 200 ? 26.594 41.087 24.493 1.00 25.10 ? 596 MET A SD  1 
ATOM 1606 C CE  . MET A 1 200 ? 26.050 42.271 25.755 1.00 16.77 ? 596 MET A CE  1 
ATOM 1607 N N   . PRO A 1 201 ? 26.042 42.511 19.986 1.00 6.79  ? 597 PRO A N   1 
ATOM 1608 C CA  . PRO A 1 201 ? 24.760 42.938 19.441 1.00 7.77  ? 597 PRO A CA  1 
ATOM 1609 C C   . PRO A 1 201 ? 23.791 43.330 20.541 1.00 5.87  ? 597 PRO A C   1 
ATOM 1610 O O   . PRO A 1 201 ? 23.608 42.598 21.504 1.00 8.10  ? 597 PRO A O   1 
ATOM 1611 C CB  . PRO A 1 201 ? 24.283 41.694 18.679 1.00 2.29  ? 597 PRO A CB  1 
ATOM 1612 C CG  . PRO A 1 201 ? 25.559 40.945 18.387 1.00 2.89  ? 597 PRO A CG  1 
ATOM 1613 C CD  . PRO A 1 201 ? 26.280 41.091 19.679 1.00 2.92  ? 597 PRO A CD  1 
ATOM 1614 N N   . TYR A 1 202 ? 23.198 44.509 20.421 1.00 11.67 ? 598 TYR A N   1 
ATOM 1615 C CA  . TYR A 1 202 ? 22.225 44.984 21.403 1.00 11.39 ? 598 TYR A CA  1 
ATOM 1616 C C   . TYR A 1 202 ? 22.731 45.018 22.851 1.00 13.88 ? 598 TYR A C   1 
ATOM 1617 O O   . TYR A 1 202 ? 21.993 44.656 23.762 1.00 14.96 ? 598 TYR A O   1 
ATOM 1618 C CB  . TYR A 1 202 ? 20.986 44.087 21.374 1.00 11.13 ? 598 TYR A CB  1 
ATOM 1619 C CG  . TYR A 1 202 ? 20.502 43.671 20.010 1.00 10.46 ? 598 TYR A CG  1 
ATOM 1620 C CD1 . TYR A 1 202 ? 20.737 42.384 19.538 1.00 8.57  ? 598 TYR A CD1 1 
ATOM 1621 C CD2 . TYR A 1 202 ? 19.757 44.541 19.219 1.00 11.82 ? 598 TYR A CD2 1 
ATOM 1622 C CE1 . TYR A 1 202 ? 20.241 41.968 18.321 1.00 9.01  ? 598 TYR A CE1 1 
ATOM 1623 C CE2 . TYR A 1 202 ? 19.255 44.139 17.998 1.00 11.15 ? 598 TYR A CE2 1 
ATOM 1624 C CZ  . TYR A 1 202 ? 19.499 42.850 17.553 1.00 10.70 ? 598 TYR A CZ  1 
ATOM 1625 O OH  . TYR A 1 202 ? 19.007 42.443 16.335 1.00 12.06 ? 598 TYR A OH  1 
ATOM 1626 N N   . GLU A 1 203 ? 23.940 45.518 23.078 1.00 17.51 ? 599 GLU A N   1 
ATOM 1627 C CA  . GLU A 1 203 ? 24.506 45.556 24.434 1.00 21.90 ? 599 GLU A CA  1 
ATOM 1628 C C   . GLU A 1 203 ? 23.707 46.290 25.523 1.00 22.83 ? 599 GLU A C   1 
ATOM 1629 O O   . GLU A 1 203 ? 23.867 45.990 26.704 1.00 21.63 ? 599 GLU A O   1 
ATOM 1630 C CB  . GLU A 1 203 ? 25.965 46.063 24.418 1.00 25.83 ? 599 GLU A CB  1 
ATOM 1631 C CG  . GLU A 1 203 ? 26.155 47.580 24.303 1.00 25.70 ? 599 GLU A CG  1 
ATOM 1632 C CD  . GLU A 1 203 ? 25.989 48.100 22.887 1.00 29.61 ? 599 GLU A CD  1 
ATOM 1633 O OE1 . GLU A 1 203 ? 24.842 48.148 22.385 1.00 34.92 ? 599 GLU A OE1 1 
ATOM 1634 O OE2 . GLU A 1 203 ? 27.018 48.465 22.275 1.00 36.19 ? 599 GLU A OE2 1 
ATOM 1635 N N   . ARG A 1 204 ? 22.903 47.285 25.157 1.00 23.83 ? 600 ARG A N   1 
ATOM 1636 C CA  . ARG A 1 204 ? 22.120 47.991 26.170 1.00 25.44 ? 600 ARG A CA  1 
ATOM 1637 C C   . ARG A 1 204 ? 20.750 47.351 26.356 1.00 26.74 ? 600 ARG A C   1 
ATOM 1638 O O   . ARG A 1 204 ? 19.931 47.818 27.162 1.00 27.64 ? 600 ARG A O   1 
ATOM 1639 C CB  . ARG A 1 204 ? 21.977 49.477 25.857 1.00 23.52 ? 600 ARG A CB  1 
ATOM 1640 C CG  . ARG A 1 204 ? 22.569 50.385 26.941 1.00 27.22 ? 600 ARG A CG  1 
ATOM 1641 C CD  . ARG A 1 204 ? 21.939 50.168 28.326 1.00 31.56 ? 600 ARG A CD  1 
ATOM 1642 N NE  . ARG A 1 204 ? 22.425 51.152 29.296 1.00 30.45 ? 600 ARG A NE  1 
ATOM 1643 C CZ  . ARG A 1 204 ? 21.656 51.847 30.136 1.00 28.69 ? 600 ARG A CZ  1 
ATOM 1644 N NH1 . ARG A 1 204 ? 22.211 52.726 30.960 1.00 27.63 ? 600 ARG A NH1 1 
ATOM 1645 N NH2 . ARG A 1 204 ? 20.344 51.659 30.175 1.00 26.46 ? 600 ARG A NH2 1 
ATOM 1646 N N   . PHE A 1 205 ? 20.492 46.309 25.571 1.00 24.54 ? 601 PHE A N   1 
ATOM 1647 C CA  . PHE A 1 205 ? 19.243 45.573 25.664 1.00 20.59 ? 601 PHE A CA  1 
ATOM 1648 C C   . PHE A 1 205 ? 19.511 44.399 26.588 1.00 20.01 ? 601 PHE A C   1 
ATOM 1649 O O   . PHE A 1 205 ? 20.624 44.202 27.074 1.00 18.72 ? 601 PHE A O   1 
ATOM 1650 C CB  . PHE A 1 205 ? 18.841 44.989 24.305 1.00 22.31 ? 601 PHE A CB  1 
ATOM 1651 C CG  . PHE A 1 205 ? 18.485 46.006 23.266 1.00 22.63 ? 601 PHE A CG  1 
ATOM 1652 C CD1 . PHE A 1 205 ? 17.177 46.128 22.823 1.00 23.34 ? 601 PHE A CD1 1 
ATOM 1653 C CD2 . PHE A 1 205 ? 19.460 46.791 22.677 1.00 20.08 ? 601 PHE A CD2 1 
ATOM 1654 C CE1 . PHE A 1 205 ? 16.852 47.011 21.809 1.00 20.90 ? 601 PHE A CE1 1 
ATOM 1655 C CE2 . PHE A 1 205 ? 19.138 47.674 21.660 1.00 20.46 ? 601 PHE A CE2 1 
ATOM 1656 C CZ  . PHE A 1 205 ? 17.832 47.783 21.225 1.00 22.29 ? 601 PHE A CZ  1 
ATOM 1657 N N   . THR A 1 206 ? 18.481 43.601 26.801 1.00 22.29 ? 602 THR A N   1 
ATOM 1658 C CA  . THR A 1 206 ? 18.582 42.400 27.604 1.00 23.72 ? 602 THR A CA  1 
ATOM 1659 C C   . THR A 1 206 ? 18.061 41.323 26.652 1.00 25.22 ? 602 THR A C   1 
ATOM 1660 O O   . THR A 1 206 ? 17.420 41.645 25.644 1.00 27.52 ? 602 THR A O   1 
ATOM 1661 C CB  . THR A 1 206 ? 17.681 42.486 28.861 1.00 24.01 ? 602 THR A CB  1 
ATOM 1662 O OG1 . THR A 1 206 ? 16.339 42.823 28.478 1.00 20.42 ? 602 THR A OG1 1 
ATOM 1663 C CG2 . THR A 1 206 ? 18.204 43.538 29.823 1.00 27.75 ? 602 THR A CG2 1 
ATOM 1664 N N   . ASN A 1 207 ? 18.333 40.055 26.939 1.00 26.65 ? 603 ASN A N   1 
ATOM 1665 C CA  . ASN A 1 207 ? 17.844 38.979 26.072 1.00 25.54 ? 603 ASN A CA  1 
ATOM 1666 C C   . ASN A 1 207 ? 16.337 39.082 25.803 1.00 25.43 ? 603 ASN A C   1 
ATOM 1667 O O   . ASN A 1 207 ? 15.864 38.698 24.736 1.00 23.83 ? 603 ASN A O   1 
ATOM 1668 C CB  . ASN A 1 207 ? 18.192 37.607 26.662 1.00 20.91 ? 603 ASN A CB  1 
ATOM 1669 C CG  . ASN A 1 207 ? 19.674 37.298 26.576 1.00 25.12 ? 603 ASN A CG  1 
ATOM 1670 O OD1 . ASN A 1 207 ? 20.490 38.194 26.385 1.00 25.37 ? 603 ASN A OD1 1 
ATOM 1671 N ND2 . ASN A 1 207 ? 20.026 36.028 26.704 1.00 26.15 ? 603 ASN A ND2 1 
ATOM 1672 N N   . SER A 1 208 ? 15.597 39.655 26.747 1.00 26.48 ? 604 SER A N   1 
ATOM 1673 C CA  . SER A 1 208 ? 14.152 39.806 26.602 1.00 24.32 ? 604 SER A CA  1 
ATOM 1674 C C   . SER A 1 208 ? 13.767 41.025 25.768 1.00 21.82 ? 604 SER A C   1 
ATOM 1675 O O   . SER A 1 208 ? 12.799 40.983 25.005 1.00 19.52 ? 604 SER A O   1 
ATOM 1676 C CB  . SER A 1 208 ? 13.487 39.881 27.977 1.00 24.89 ? 604 SER A CB  1 
ATOM 1677 O OG  . SER A 1 208 ? 14.121 40.858 28.786 1.00 27.86 ? 604 SER A OG  1 
ATOM 1678 N N   . GLU A 1 209 ? 14.505 42.118 25.933 1.00 23.74 ? 605 GLU A N   1 
ATOM 1679 C CA  . GLU A 1 209 ? 14.229 43.343 25.181 1.00 21.76 ? 605 GLU A CA  1 
ATOM 1680 C C   . GLU A 1 209 ? 14.656 43.159 23.733 1.00 19.22 ? 605 GLU A C   1 
ATOM 1681 O O   . GLU A 1 209 ? 14.020 43.688 22.820 1.00 17.88 ? 605 GLU A O   1 
ATOM 1682 C CB  . GLU A 1 209 ? 14.937 44.543 25.815 1.00 19.06 ? 605 GLU A CB  1 
ATOM 1683 C CG  . GLU A 1 209 ? 14.413 44.880 27.213 1.00 21.14 ? 605 GLU A CG  1 
ATOM 1684 C CD  . GLU A 1 209 ? 15.253 45.914 27.930 1.00 18.46 ? 605 GLU A CD  1 
ATOM 1685 O OE1 . GLU A 1 209 ? 14.730 46.576 28.850 1.00 22.19 ? 605 GLU A OE1 1 
ATOM 1686 O OE2 . GLU A 1 209 ? 16.443 46.064 27.583 1.00 25.21 ? 605 GLU A OE2 1 
ATOM 1687 N N   . THR A 1 210 ? 15.710 42.374 23.534 1.00 19.68 ? 606 THR A N   1 
ATOM 1688 C CA  . THR A 1 210 ? 16.231 42.064 22.205 1.00 17.05 ? 606 THR A CA  1 
ATOM 1689 C C   . THR A 1 210 ? 15.138 41.339 21.418 1.00 16.80 ? 606 THR A C   1 
ATOM 1690 O O   . THR A 1 210 ? 14.900 41.637 20.243 1.00 18.76 ? 606 THR A O   1 
ATOM 1691 C CB  . THR A 1 210 ? 17.471 41.148 22.306 1.00 15.00 ? 606 THR A CB  1 
ATOM 1692 O OG1 . THR A 1 210 ? 18.458 41.769 23.139 1.00 15.89 ? 606 THR A OG1 1 
ATOM 1693 C CG2 . THR A 1 210 ? 18.056 40.871 20.938 1.00 12.52 ? 606 THR A CG2 1 
ATOM 1694 N N   . ALA A 1 211 ? 14.457 40.408 22.084 1.00 16.21 ? 607 ALA A N   1 
ATOM 1695 C CA  . ALA A 1 211 ? 13.377 39.648 21.467 1.00 16.69 ? 607 ALA A CA  1 
ATOM 1696 C C   . ALA A 1 211 ? 12.211 40.573 21.138 1.00 17.62 ? 607 ALA A C   1 
ATOM 1697 O O   . ALA A 1 211 ? 11.574 40.417 20.098 1.00 21.64 ? 607 ALA A O   1 
ATOM 1698 C CB  . ALA A 1 211 ? 12.926 38.532 22.384 1.00 14.32 ? 607 ALA A CB  1 
ATOM 1699 N N   . GLU A 1 212 ? 11.940 41.540 22.015 1.00 16.80 ? 608 GLU A N   1 
ATOM 1700 C CA  . GLU A 1 212 ? 10.855 42.497 21.792 1.00 17.47 ? 608 GLU A CA  1 
ATOM 1701 C C   . GLU A 1 212 ? 11.207 43.438 20.631 1.00 13.51 ? 608 GLU A C   1 
ATOM 1702 O O   . GLU A 1 212 ? 10.370 43.714 19.765 1.00 5.86  ? 608 GLU A O   1 
ATOM 1703 C CB  . GLU A 1 212 ? 10.574 43.312 23.064 1.00 24.26 ? 608 GLU A CB  1 
ATOM 1704 C CG  . GLU A 1 212 ? 9.979  42.503 24.219 1.00 31.87 ? 608 GLU A CG  1 
ATOM 1705 C CD  . GLU A 1 212 ? 9.562  43.363 25.414 1.00 32.17 ? 608 GLU A CD  1 
ATOM 1706 O OE1 . GLU A 1 212 ? 8.411  43.210 25.892 1.00 33.50 ? 608 GLU A OE1 1 
ATOM 1707 O OE2 . GLU A 1 212 ? 10.386 44.183 25.886 1.00 34.89 ? 608 GLU A OE2 1 
ATOM 1708 N N   . HIS A 1 213 ? 12.472 43.865 20.603 1.00 9.80  ? 609 HIS A N   1 
ATOM 1709 C CA  . HIS A 1 213 ? 13.025 44.762 19.586 1.00 6.26  ? 609 HIS A CA  1 
ATOM 1710 C C   . HIS A 1 213 ? 12.881 44.121 18.221 1.00 9.48  ? 609 HIS A C   1 
ATOM 1711 O O   . HIS A 1 213 ? 12.489 44.782 17.255 1.00 11.18 ? 609 HIS A O   1 
ATOM 1712 C CB  . HIS A 1 213 ? 14.509 45.014 19.886 1.00 6.17  ? 609 HIS A CB  1 
ATOM 1713 C CG  . HIS A 1 213 ? 15.179 45.976 18.950 1.00 7.14  ? 609 HIS A CG  1 
ATOM 1714 N ND1 . HIS A 1 213 ? 15.114 47.342 19.116 1.00 10.07 ? 609 HIS A ND1 1 
ATOM 1715 C CD2 . HIS A 1 213 ? 15.978 45.769 17.879 1.00 9.08  ? 609 HIS A CD2 1 
ATOM 1716 C CE1 . HIS A 1 213 ? 15.848 47.935 18.192 1.00 4.17  ? 609 HIS A CE1 1 
ATOM 1717 N NE2 . HIS A 1 213 ? 16.384 47.002 17.427 1.00 8.56  ? 609 HIS A NE2 1 
ATOM 1718 N N   . ILE A 1 214 ? 13.214 42.839 18.138 1.00 8.84  ? 610 ILE A N   1 
ATOM 1719 C CA  . ILE A 1 214 ? 13.106 42.113 16.881 1.00 11.99 ? 610 ILE A CA  1 
ATOM 1720 C C   . ILE A 1 214 ? 11.635 41.923 16.527 1.00 14.02 ? 610 ILE A C   1 
ATOM 1721 O O   . ILE A 1 214 ? 11.257 41.964 15.356 1.00 12.60 ? 610 ILE A O   1 
ATOM 1722 C CB  . ILE A 1 214 ? 13.869 40.758 16.945 1.00 13.75 ? 610 ILE A CB  1 
ATOM 1723 C CG1 . ILE A 1 214 ? 15.345 40.991 16.594 1.00 6.66  ? 610 ILE A CG1 1 
ATOM 1724 C CG2 . ILE A 1 214 ? 13.211 39.701 16.048 1.00 13.99 ? 610 ILE A CG2 1 
ATOM 1725 C CD1 . ILE A 1 214 ? 16.188 39.734 16.592 1.00 8.43  ? 610 ILE A CD1 1 
ATOM 1726 N N   . ALA A 1 215 ? 10.802 41.798 17.557 1.00 15.80 ? 611 ALA A N   1 
ATOM 1727 C CA  . ALA A 1 215 ? 9.368  41.631 17.377 1.00 14.09 ? 611 ALA A CA  1 
ATOM 1728 C C   . ALA A 1 215 ? 8.759  42.889 16.767 1.00 13.18 ? 611 ALA A C   1 
ATOM 1729 O O   . ALA A 1 215 ? 7.688  42.843 16.174 1.00 16.50 ? 611 ALA A O   1 
ATOM 1730 C CB  . ALA A 1 215 ? 8.713  41.313 18.710 1.00 15.18 ? 611 ALA A CB  1 
ATOM 1731 N N   . GLN A 1 216 ? 9.448  44.012 16.918 1.00 9.26  ? 612 GLN A N   1 
ATOM 1732 C CA  . GLN A 1 216 ? 8.996  45.288 16.369 1.00 9.32  ? 612 GLN A CA  1 
ATOM 1733 C C   . GLN A 1 216 ? 9.497  45.470 14.939 1.00 8.38  ? 612 GLN A C   1 
ATOM 1734 O O   . GLN A 1 216 ? 9.184  46.471 14.285 1.00 8.92  ? 612 GLN A O   1 
ATOM 1735 C CB  . GLN A 1 216 ? 9.538  46.438 17.214 1.00 12.00 ? 612 GLN A CB  1 
ATOM 1736 C CG  . GLN A 1 216 ? 9.266  46.315 18.699 1.00 15.05 ? 612 GLN A CG  1 
ATOM 1737 C CD  . GLN A 1 216 ? 8.041  47.065 19.115 1.00 19.92 ? 612 GLN A CD  1 
ATOM 1738 O OE1 . GLN A 1 216 ? 6.918  46.656 18.833 1.00 26.26 ? 612 GLN A OE1 1 
ATOM 1739 N NE2 . GLN A 1 216 ? 8.246  48.194 19.773 1.00 24.14 ? 612 GLN A NE2 1 
ATOM 1740 N N   . GLY A 1 217 ? 10.308 44.523 14.476 1.00 11.09 ? 613 GLY A N   1 
ATOM 1741 C CA  . GLY A 1 217 ? 10.861 44.598 13.135 1.00 10.83 ? 613 GLY A CA  1 
ATOM 1742 C C   . GLY A 1 217 ? 12.164 45.381 13.076 1.00 12.46 ? 613 GLY A C   1 
ATOM 1743 O O   . GLY A 1 217 ? 12.642 45.711 11.993 1.00 8.12  ? 613 GLY A O   1 
ATOM 1744 N N   . LEU A 1 218 ? 12.736 45.690 14.237 1.00 10.93 ? 614 LEU A N   1 
ATOM 1745 C CA  . LEU A 1 218 ? 13.988 46.439 14.300 1.00 11.92 ? 614 LEU A CA  1 
ATOM 1746 C C   . LEU A 1 218 ? 15.188 45.495 14.330 1.00 11.01 ? 614 LEU A C   1 
ATOM 1747 O O   . LEU A 1 218 ? 15.148 44.424 14.947 1.00 9.79  ? 614 LEU A O   1 
ATOM 1748 C CB  . LEU A 1 218 ? 14.012 47.375 15.518 1.00 9.21  ? 614 LEU A CB  1 
ATOM 1749 C CG  . LEU A 1 218 ? 13.103 48.609 15.581 1.00 11.29 ? 614 LEU A CG  1 
ATOM 1750 C CD1 . LEU A 1 218 ? 12.426 48.880 14.249 1.00 11.46 ? 614 LEU A CD1 1 
ATOM 1751 C CD2 . LEU A 1 218 ? 12.078 48.433 16.656 1.00 4.88  ? 614 LEU A CD2 1 
ATOM 1752 N N   . ARG A 1 219 ? 16.273 45.920 13.694 1.00 12.00 ? 615 ARG A N   1 
ATOM 1753 C CA  . ARG A 1 219 ? 17.484 45.117 13.603 1.00 9.33  ? 615 ARG A CA  1 
ATOM 1754 C C   . ARG A 1 219 ? 18.704 45.885 14.098 1.00 8.91  ? 615 ARG A C   1 
ATOM 1755 O O   . ARG A 1 219 ? 18.570 46.921 14.762 1.00 7.60  ? 615 ARG A O   1 
ATOM 1756 C CB  . ARG A 1 219 ? 17.704 44.713 12.144 1.00 9.55  ? 615 ARG A CB  1 
ATOM 1757 C CG  . ARG A 1 219 ? 16.518 44.023 11.488 1.00 7.26  ? 615 ARG A CG  1 
ATOM 1758 C CD  . ARG A 1 219 ? 16.209 42.703 12.141 1.00 3.51  ? 615 ARG A CD  1 
ATOM 1759 N NE  . ARG A 1 219 ? 15.114 42.016 11.473 1.00 7.24  ? 615 ARG A NE  1 
ATOM 1760 C CZ  . ARG A 1 219 ? 13.889 41.891 11.976 1.00 8.86  ? 615 ARG A CZ  1 
ATOM 1761 N NH1 . ARG A 1 219 ? 13.582 42.421 13.156 1.00 7.13  ? 615 ARG A NH1 1 
ATOM 1762 N NH2 . ARG A 1 219 ? 12.986 41.170 11.329 1.00 8.16  ? 615 ARG A NH2 1 
ATOM 1763 N N   . LEU A 1 220 ? 19.887 45.379 13.756 1.00 7.61  ? 616 LEU A N   1 
ATOM 1764 C CA  . LEU A 1 220 ? 21.155 45.990 14.138 1.00 9.07  ? 616 LEU A CA  1 
ATOM 1765 C C   . LEU A 1 220 ? 21.545 47.094 13.162 1.00 7.88  ? 616 LEU A C   1 
ATOM 1766 O O   . LEU A 1 220 ? 21.682 46.848 11.965 1.00 11.49 ? 616 LEU A O   1 
ATOM 1767 C CB  . LEU A 1 220 ? 22.255 44.927 14.183 1.00 9.04  ? 616 LEU A CB  1 
ATOM 1768 C CG  . LEU A 1 220 ? 22.202 43.944 15.355 1.00 9.90  ? 616 LEU A CG  1 
ATOM 1769 C CD1 . LEU A 1 220 ? 23.034 42.705 15.046 1.00 6.52  ? 616 LEU A CD1 1 
ATOM 1770 C CD2 . LEU A 1 220 ? 22.690 44.632 16.623 1.00 8.47  ? 616 LEU A CD2 1 
ATOM 1771 N N   . TYR A 1 221 ? 21.770 48.295 13.696 1.00 9.86  ? 617 TYR A N   1 
ATOM 1772 C CA  . TYR A 1 221 ? 22.133 49.480 12.913 1.00 6.95  ? 617 TYR A CA  1 
ATOM 1773 C C   . TYR A 1 221 ? 23.315 49.298 11.962 1.00 7.09  ? 617 TYR A C   1 
ATOM 1774 O O   . TYR A 1 221 ? 24.166 48.440 12.182 1.00 6.00  ? 617 TYR A O   1 
ATOM 1775 C CB  . TYR A 1 221 ? 22.440 50.653 13.853 1.00 8.23  ? 617 TYR A CB  1 
ATOM 1776 C CG  . TYR A 1 221 ? 23.719 50.515 14.674 1.00 11.82 ? 617 TYR A CG  1 
ATOM 1777 C CD1 . TYR A 1 221 ? 24.923 51.090 14.244 1.00 11.55 ? 617 TYR A CD1 1 
ATOM 1778 C CD2 . TYR A 1 221 ? 23.714 49.856 15.897 1.00 10.14 ? 617 TYR A CD2 1 
ATOM 1779 C CE1 . TYR A 1 221 ? 26.086 51.011 15.021 1.00 9.18  ? 617 TYR A CE1 1 
ATOM 1780 C CE2 . TYR A 1 221 ? 24.869 49.777 16.682 1.00 15.29 ? 617 TYR A CE2 1 
ATOM 1781 C CZ  . TYR A 1 221 ? 26.047 50.358 16.240 1.00 13.29 ? 617 TYR A CZ  1 
ATOM 1782 O OH  . TYR A 1 221 ? 27.167 50.305 17.043 1.00 10.85 ? 617 TYR A OH  1 
ATOM 1783 N N   . ARG A 1 222 ? 23.391 50.146 10.938 1.00 7.06  ? 618 ARG A N   1 
ATOM 1784 C CA  . ARG A 1 222 ? 24.498 50.072 9.990  1.00 13.07 ? 618 ARG A CA  1 
ATOM 1785 C C   . ARG A 1 222 ? 25.767 50.547 10.668 1.00 15.11 ? 618 ARG A C   1 
ATOM 1786 O O   . ARG A 1 222 ? 25.798 51.647 11.223 1.00 18.30 ? 618 ARG A O   1 
ATOM 1787 C CB  . ARG A 1 222 ? 24.271 50.947 8.752  1.00 11.95 ? 618 ARG A CB  1 
ATOM 1788 C CG  . ARG A 1 222 ? 25.389 50.761 7.721  1.00 12.02 ? 618 ARG A CG  1 
ATOM 1789 C CD  . ARG A 1 222 ? 25.823 52.046 7.028  1.00 12.70 ? 618 ARG A CD  1 
ATOM 1790 N NE  . ARG A 1 222 ? 24.896 52.504 5.996  1.00 10.05 ? 618 ARG A NE  1 
ATOM 1791 C CZ  . ARG A 1 222 ? 25.263 53.226 4.939  1.00 8.38  ? 618 ARG A CZ  1 
ATOM 1792 N NH1 . ARG A 1 222 ? 26.535 53.561 4.769  1.00 8.75  ? 618 ARG A NH1 1 
ATOM 1793 N NH2 . ARG A 1 222 ? 24.352 53.659 4.076  1.00 8.27  ? 618 ARG A NH2 1 
ATOM 1794 N N   . PRO A 1 223 ? 26.803 49.694 10.713 1.00 17.30 ? 619 PRO A N   1 
ATOM 1795 C CA  . PRO A 1 223 ? 28.045 50.130 11.353 1.00 16.98 ? 619 PRO A CA  1 
ATOM 1796 C C   . PRO A 1 223 ? 28.871 51.039 10.430 1.00 16.87 ? 619 PRO A C   1 
ATOM 1797 O O   . PRO A 1 223 ? 28.956 50.805 9.229  1.00 15.47 ? 619 PRO A O   1 
ATOM 1798 C CB  . PRO A 1 223 ? 28.740 48.808 11.683 1.00 16.78 ? 619 PRO A CB  1 
ATOM 1799 C CG  . PRO A 1 223 ? 28.237 47.876 10.651 1.00 13.87 ? 619 PRO A CG  1 
ATOM 1800 C CD  . PRO A 1 223 ? 26.790 48.234 10.509 1.00 15.23 ? 619 PRO A CD  1 
ATOM 1801 N N   . HIS A 1 224 ? 29.429 52.101 11.008 1.00 16.43 ? 620 HIS A N   1 
ATOM 1802 C CA  . HIS A 1 224 ? 30.243 53.088 10.287 1.00 19.75 ? 620 HIS A CA  1 
ATOM 1803 C C   . HIS A 1 224 ? 31.257 52.589 9.239  1.00 21.42 ? 620 HIS A C   1 
ATOM 1804 O O   . HIS A 1 224 ? 31.646 53.344 8.347  1.00 22.39 ? 620 HIS A O   1 
ATOM 1805 C CB  . HIS A 1 224 ? 30.946 54.021 11.290 1.00 19.36 ? 620 HIS A CB  1 
ATOM 1806 C CG  . HIS A 1 224 ? 31.863 53.317 12.247 1.00 20.09 ? 620 HIS A CG  1 
ATOM 1807 N ND1 . HIS A 1 224 ? 31.407 52.455 13.222 1.00 20.76 ? 620 HIS A ND1 1 
ATOM 1808 C CD2 . HIS A 1 224 ? 33.211 53.355 12.384 1.00 21.52 ? 620 HIS A CD2 1 
ATOM 1809 C CE1 . HIS A 1 224 ? 32.434 51.988 13.912 1.00 16.73 ? 620 HIS A CE1 1 
ATOM 1810 N NE2 . HIS A 1 224 ? 33.538 52.519 13.423 1.00 17.10 ? 620 HIS A NE2 1 
ATOM 1811 N N   . LEU A 1 225 ? 31.695 51.338 9.346  1.00 19.75 ? 621 LEU A N   1 
ATOM 1812 C CA  . LEU A 1 225 ? 32.661 50.793 8.396  1.00 16.60 ? 621 LEU A CA  1 
ATOM 1813 C C   . LEU A 1 225 ? 32.010 49.966 7.296  1.00 17.19 ? 621 LEU A C   1 
ATOM 1814 O O   . LEU A 1 225 ? 32.694 49.260 6.558  1.00 18.71 ? 621 LEU A O   1 
ATOM 1815 C CB  . LEU A 1 225 ? 33.712 49.948 9.118  1.00 13.75 ? 621 LEU A CB  1 
ATOM 1816 C CG  . LEU A 1 225 ? 34.539 50.612 10.226 1.00 9.81  ? 621 LEU A CG  1 
ATOM 1817 C CD1 . LEU A 1 225 ? 35.542 49.613 10.742 1.00 4.63  ? 621 LEU A CD1 1 
ATOM 1818 C CD2 . LEU A 1 225 ? 35.248 51.863 9.713  1.00 9.43  ? 621 LEU A CD2 1 
ATOM 1819 N N   . ALA A 1 226 ? 30.690 50.054 7.184  1.00 18.73 ? 622 ALA A N   1 
ATOM 1820 C CA  . ALA A 1 226 ? 29.958 49.309 6.171  1.00 14.75 ? 622 ALA A CA  1 
ATOM 1821 C C   . ALA A 1 226 ? 29.322 50.248 5.158  1.00 14.61 ? 622 ALA A C   1 
ATOM 1822 O O   . ALA A 1 226 ? 28.808 51.309 5.512  1.00 15.18 ? 622 ALA A O   1 
ATOM 1823 C CB  . ALA A 1 226 ? 28.886 48.449 6.826  1.00 16.96 ? 622 ALA A CB  1 
ATOM 1824 N N   . SER A 1 227 ? 29.396 49.875 3.886  1.00 16.92 ? 623 SER A N   1 
ATOM 1825 C CA  . SER A 1 227 ? 28.793 50.670 2.825  1.00 14.96 ? 623 SER A CA  1 
ATOM 1826 C C   . SER A 1 227 ? 27.309 50.336 2.785  1.00 13.91 ? 623 SER A C   1 
ATOM 1827 O O   . SER A 1 227 ? 26.867 49.392 3.433  1.00 15.97 ? 623 SER A O   1 
ATOM 1828 C CB  . SER A 1 227 ? 29.433 50.326 1.479  1.00 10.06 ? 623 SER A CB  1 
ATOM 1829 O OG  . SER A 1 227 ? 29.253 48.958 1.163  1.00 7.67  ? 623 SER A OG  1 
ATOM 1830 N N   . GLU A 1 228 ? 26.541 51.112 2.028  1.00 15.15 ? 624 GLU A N   1 
ATOM 1831 C CA  . GLU A 1 228 ? 25.110 50.868 1.888  1.00 16.38 ? 624 GLU A CA  1 
ATOM 1832 C C   . GLU A 1 228 ? 24.937 49.499 1.241  1.00 16.27 ? 624 GLU A C   1 
ATOM 1833 O O   . GLU A 1 228 ? 23.935 48.824 1.451  1.00 20.19 ? 624 GLU A O   1 
ATOM 1834 C CB  . GLU A 1 228 ? 24.469 51.937 0.998  1.00 17.21 ? 624 GLU A CB  1 
ATOM 1835 C CG  . GLU A 1 228 ? 22.974 51.725 0.755  1.00 19.41 ? 624 GLU A CG  1 
ATOM 1836 C CD  . GLU A 1 228 ? 22.452 52.478 -0.459 1.00 18.43 ? 624 GLU A CD  1 
ATOM 1837 O OE1 . GLU A 1 228 ? 21.396 53.129 -0.339 1.00 16.44 ? 624 GLU A OE1 1 
ATOM 1838 O OE2 . GLU A 1 228 ? 23.083 52.406 -1.539 1.00 21.39 ? 624 GLU A OE2 1 
ATOM 1839 N N   . LYS A 1 229 ? 25.933 49.111 0.447  1.00 15.04 ? 625 LYS A N   1 
ATOM 1840 C CA  . LYS A 1 229 ? 25.955 47.832 -0.251 1.00 14.80 ? 625 LYS A CA  1 
ATOM 1841 C C   . LYS A 1 229 ? 26.253 46.667 0.702  1.00 15.85 ? 625 LYS A C   1 
ATOM 1842 O O   . LYS A 1 229 ? 25.563 45.645 0.678  1.00 16.83 ? 625 LYS A O   1 
ATOM 1843 C CB  . LYS A 1 229 ? 26.989 47.874 -1.379 1.00 15.10 ? 625 LYS A CB  1 
ATOM 1844 C CG  . LYS A 1 229 ? 26.462 48.451 -2.693 1.00 19.31 ? 625 LYS A CG  1 
ATOM 1845 C CD  . LYS A 1 229 ? 25.903 49.878 -2.565 1.00 22.31 ? 625 LYS A CD  1 
ATOM 1846 C CE  . LYS A 1 229 ? 26.977 50.965 -2.680 1.00 21.63 ? 625 LYS A CE  1 
ATOM 1847 N NZ  . LYS A 1 229 ? 27.815 51.133 -1.465 1.00 17.99 ? 625 LYS A NZ  1 
ATOM 1848 N N   . VAL A 1 230 ? 27.275 46.828 1.539  1.00 13.15 ? 626 VAL A N   1 
ATOM 1849 C CA  . VAL A 1 230 ? 27.648 45.803 2.502  1.00 8.16  ? 626 VAL A CA  1 
ATOM 1850 C C   . VAL A 1 230 ? 26.523 45.649 3.508  1.00 10.56 ? 626 VAL A C   1 
ATOM 1851 O O   . VAL A 1 230 ? 26.211 44.538 3.947  1.00 15.38 ? 626 VAL A O   1 
ATOM 1852 C CB  . VAL A 1 230 ? 28.954 46.166 3.228  1.00 4.19  ? 626 VAL A CB  1 
ATOM 1853 C CG1 . VAL A 1 230 ? 29.170 45.266 4.437  1.00 9.56  ? 626 VAL A CG1 1 
ATOM 1854 C CG2 . VAL A 1 230 ? 30.127 46.037 2.264  1.00 2.00  ? 626 VAL A CG2 1 
ATOM 1855 N N   . TYR A 1 231 ? 25.870 46.754 3.837  1.00 11.00 ? 627 TYR A N   1 
ATOM 1856 C CA  . TYR A 1 231 ? 24.774 46.696 4.791  1.00 6.70  ? 627 TYR A CA  1 
ATOM 1857 C C   . TYR A 1 231 ? 23.566 46.005 4.182  1.00 2.00  ? 627 TYR A C   1 
ATOM 1858 O O   . TYR A 1 231 ? 22.816 45.355 4.884  1.00 7.93  ? 627 TYR A O   1 
ATOM 1859 C CB  . TYR A 1 231 ? 24.406 48.089 5.303  1.00 5.85  ? 627 TYR A CB  1 
ATOM 1860 C CG  . TYR A 1 231 ? 23.438 48.052 6.462  1.00 5.63  ? 627 TYR A CG  1 
ATOM 1861 C CD1 . TYR A 1 231 ? 23.826 47.547 7.699  1.00 5.65  ? 627 TYR A CD1 1 
ATOM 1862 C CD2 . TYR A 1 231 ? 22.133 48.510 6.320  1.00 5.85  ? 627 TYR A CD2 1 
ATOM 1863 C CE1 . TYR A 1 231 ? 22.943 47.500 8.765  1.00 3.44  ? 627 TYR A CE1 1 
ATOM 1864 C CE2 . TYR A 1 231 ? 21.237 48.465 7.383  1.00 7.61  ? 627 TYR A CE2 1 
ATOM 1865 C CZ  . TYR A 1 231 ? 21.649 47.960 8.601  1.00 4.93  ? 627 TYR A CZ  1 
ATOM 1866 O OH  . TYR A 1 231 ? 20.768 47.925 9.657  1.00 9.76  ? 627 TYR A OH  1 
ATOM 1867 N N   . THR A 1 232 ? 23.407 46.106 2.871  1.00 4.56  ? 628 THR A N   1 
ATOM 1868 C CA  . THR A 1 232 ? 22.293 45.463 2.189  1.00 6.68  ? 628 THR A CA  1 
ATOM 1869 C C   . THR A 1 232 ? 22.382 43.938 2.284  1.00 3.84  ? 628 THR A C   1 
ATOM 1870 O O   . THR A 1 232 ? 21.372 43.266 2.450  1.00 2.00  ? 628 THR A O   1 
ATOM 1871 C CB  . THR A 1 232 ? 22.226 45.882 0.704  1.00 12.25 ? 628 THR A CB  1 
ATOM 1872 O OG1 . THR A 1 232 ? 21.878 47.270 0.608  1.00 11.09 ? 628 THR A OG1 1 
ATOM 1873 C CG2 . THR A 1 232 ? 21.196 45.057 -0.043 1.00 12.83 ? 628 THR A CG2 1 
ATOM 1874 N N   . ILE A 1 233 ? 23.586 43.389 2.197  1.00 6.46  ? 629 ILE A N   1 
ATOM 1875 C CA  . ILE A 1 233 ? 23.728 41.941 2.274  1.00 7.81  ? 629 ILE A CA  1 
ATOM 1876 C C   . ILE A 1 233 ? 23.482 41.373 3.676  1.00 7.41  ? 629 ILE A C   1 
ATOM 1877 O O   . ILE A 1 233 ? 22.753 40.385 3.829  1.00 5.64  ? 629 ILE A O   1 
ATOM 1878 C CB  . ILE A 1 233 ? 25.067 41.425 1.645  1.00 8.16  ? 629 ILE A CB  1 
ATOM 1879 C CG1 . ILE A 1 233 ? 26.287 42.154 2.207  1.00 12.39 ? 629 ILE A CG1 1 
ATOM 1880 C CG2 . ILE A 1 233 ? 25.040 41.634 0.154  1.00 5.31  ? 629 ILE A CG2 1 
ATOM 1881 C CD1 . ILE A 1 233 ? 27.561 41.905 1.398  1.00 16.00 ? 629 ILE A CD1 1 
ATOM 1882 N N   . MET A 1 234 ? 24.014 42.025 4.705  1.00 6.37  ? 630 MET A N   1 
ATOM 1883 C CA  . MET A 1 234 ? 23.790 41.527 6.052  1.00 8.30  ? 630 MET A CA  1 
ATOM 1884 C C   . MET A 1 234 ? 22.344 41.777 6.472  1.00 9.78  ? 630 MET A C   1 
ATOM 1885 O O   . MET A 1 234 ? 21.709 40.917 7.084  1.00 13.22 ? 630 MET A O   1 
ATOM 1886 C CB  . MET A 1 234 ? 24.765 42.147 7.057  1.00 9.46  ? 630 MET A CB  1 
ATOM 1887 C CG  . MET A 1 234 ? 24.540 43.605 7.371  1.00 12.86 ? 630 MET A CG  1 
ATOM 1888 S SD  . MET A 1 234 ? 25.803 44.178 8.496  1.00 14.55 ? 630 MET A SD  1 
ATOM 1889 C CE  . MET A 1 234 ? 24.866 44.657 9.833  1.00 15.03 ? 630 MET A CE  1 
ATOM 1890 N N   . TYR A 1 235 ? 21.794 42.920 6.080  1.00 9.86  ? 631 TYR A N   1 
ATOM 1891 C CA  . TYR A 1 235 ? 20.420 43.235 6.446  1.00 9.86  ? 631 TYR A CA  1 
ATOM 1892 C C   . TYR A 1 235 ? 19.415 42.228 5.892  1.00 10.69 ? 631 TYR A C   1 
ATOM 1893 O O   . TYR A 1 235 ? 18.403 41.949 6.532  1.00 12.38 ? 631 TYR A O   1 
ATOM 1894 C CB  . TYR A 1 235 ? 20.040 44.662 6.028  1.00 10.36 ? 631 TYR A CB  1 
ATOM 1895 C CG  . TYR A 1 235 ? 18.706 45.099 6.592  1.00 16.09 ? 631 TYR A CG  1 
ATOM 1896 C CD1 . TYR A 1 235 ? 17.519 44.790 5.929  1.00 17.24 ? 631 TYR A CD1 1 
ATOM 1897 C CD2 . TYR A 1 235 ? 18.622 45.768 7.811  1.00 14.11 ? 631 TYR A CD2 1 
ATOM 1898 C CE1 . TYR A 1 235 ? 16.283 45.124 6.463  1.00 15.16 ? 631 TYR A CE1 1 
ATOM 1899 C CE2 . TYR A 1 235 ? 17.380 46.112 8.359  1.00 17.22 ? 631 TYR A CE2 1 
ATOM 1900 C CZ  . TYR A 1 235 ? 16.218 45.784 7.674  1.00 16.41 ? 631 TYR A CZ  1 
ATOM 1901 O OH  . TYR A 1 235 ? 14.975 46.120 8.166  1.00 18.16 ? 631 TYR A OH  1 
ATOM 1902 N N   . SER A 1 236 ? 19.698 41.666 4.721  1.00 9.17  ? 632 SER A N   1 
ATOM 1903 C CA  . SER A 1 236 ? 18.796 40.692 4.113  1.00 10.83 ? 632 SER A CA  1 
ATOM 1904 C C   . SER A 1 236 ? 18.626 39.450 4.983  1.00 9.86  ? 632 SER A C   1 
ATOM 1905 O O   . SER A 1 236 ? 17.565 38.827 4.991  1.00 10.42 ? 632 SER A O   1 
ATOM 1906 C CB  . SER A 1 236 ? 19.314 40.280 2.728  1.00 6.49  ? 632 SER A CB  1 
ATOM 1907 O OG  . SER A 1 236 ? 20.564 39.615 2.807  1.00 2.00  ? 632 SER A OG  1 
ATOM 1908 N N   . CYS A 1 237 ? 19.667 39.117 5.740  1.00 11.03 ? 633 CYS A N   1 
ATOM 1909 C CA  . CYS A 1 237 ? 19.677 37.933 6.599  1.00 7.43  ? 633 CYS A CA  1 
ATOM 1910 C C   . CYS A 1 237 ? 18.632 37.940 7.699  1.00 6.70  ? 633 CYS A C   1 
ATOM 1911 O O   . CYS A 1 237 ? 18.215 36.888 8.177  1.00 8.11  ? 633 CYS A O   1 
ATOM 1912 C CB  . CYS A 1 237 ? 21.060 37.759 7.231  1.00 6.63  ? 633 CYS A CB  1 
ATOM 1913 S SG  . CYS A 1 237 ? 22.373 37.428 6.045  1.00 4.09  ? 633 CYS A SG  1 
ATOM 1914 N N   . TRP A 1 238 ? 18.156 39.125 8.043  1.00 6.33  ? 634 TRP A N   1 
ATOM 1915 C CA  . TRP A 1 238 ? 17.206 39.273 9.129  1.00 9.48  ? 634 TRP A CA  1 
ATOM 1916 C C   . TRP A 1 238 ? 15.768 39.537 8.697  1.00 10.94 ? 634 TRP A C   1 
ATOM 1917 O O   . TRP A 1 238 ? 15.015 40.182 9.422  1.00 13.81 ? 634 TRP A O   1 
ATOM 1918 C CB  . TRP A 1 238 ? 17.666 40.428 10.010 1.00 9.15  ? 634 TRP A CB  1 
ATOM 1919 C CG  . TRP A 1 238 ? 19.135 40.440 10.331 1.00 4.86  ? 634 TRP A CG  1 
ATOM 1920 C CD1 . TRP A 1 238 ? 19.918 39.378 10.671 1.00 2.00  ? 634 TRP A CD1 1 
ATOM 1921 C CD2 . TRP A 1 238 ? 19.974 41.590 10.376 1.00 3.49  ? 634 TRP A CD2 1 
ATOM 1922 N NE1 . TRP A 1 238 ? 21.197 39.797 10.930 1.00 2.34  ? 634 TRP A NE1 1 
ATOM 1923 C CE2 . TRP A 1 238 ? 21.261 41.154 10.756 1.00 2.25  ? 634 TRP A CE2 1 
ATOM 1924 C CE3 . TRP A 1 238 ? 19.770 42.955 10.140 1.00 3.18  ? 634 TRP A CE3 1 
ATOM 1925 C CZ2 . TRP A 1 238 ? 22.332 42.035 10.904 1.00 2.00  ? 634 TRP A CZ2 1 
ATOM 1926 C CZ3 . TRP A 1 238 ? 20.835 43.827 10.291 1.00 2.00  ? 634 TRP A CZ3 1 
ATOM 1927 C CH2 . TRP A 1 238 ? 22.098 43.361 10.668 1.00 2.00  ? 634 TRP A CH2 1 
ATOM 1928 N N   . HIS A 1 239 ? 15.340 38.956 7.588  1.00 11.56 ? 635 HIS A N   1 
ATOM 1929 C CA  . HIS A 1 239 ? 13.997 39.231 7.090  1.00 13.40 ? 635 HIS A CA  1 
ATOM 1930 C C   . HIS A 1 239 ? 12.720 38.940 7.888  1.00 16.55 ? 635 HIS A C   1 
ATOM 1931 O O   . HIS A 1 239 ? 11.689 39.543 7.589  1.00 21.21 ? 635 HIS A O   1 
ATOM 1932 C CB  . HIS A 1 239 ? 13.833 38.692 5.670  1.00 8.93  ? 635 HIS A CB  1 
ATOM 1933 C CG  . HIS A 1 239 ? 12.712 39.336 4.923  1.00 7.82  ? 635 HIS A CG  1 
ATOM 1934 N ND1 . HIS A 1 239 ? 11.386 39.124 5.236  1.00 6.04  ? 635 HIS A ND1 1 
ATOM 1935 C CD2 . HIS A 1 239 ? 12.720 40.264 3.936  1.00 9.65  ? 635 HIS A CD2 1 
ATOM 1936 C CE1 . HIS A 1 239 ? 10.627 39.896 4.484  1.00 6.47  ? 635 HIS A CE1 1 
ATOM 1937 N NE2 . HIS A 1 239 ? 11.410 40.598 3.687  1.00 11.66 ? 635 HIS A NE2 1 
ATOM 1938 N N   . GLU A 1 240 ? 12.758 38.053 8.877  1.00 16.72 ? 636 GLU A N   1 
ATOM 1939 C CA  . GLU A 1 240 ? 11.563 37.677 9.675  1.00 16.32 ? 636 GLU A CA  1 
ATOM 1940 C C   . GLU A 1 240 ? 10.925 36.492 8.966  1.00 16.71 ? 636 GLU A C   1 
ATOM 1941 O O   . GLU A 1 240 ? 10.924 35.384 9.492  1.00 19.32 ? 636 GLU A O   1 
ATOM 1942 C CB  . GLU A 1 240 ? 10.524 38.810 9.812  1.00 18.59 ? 636 GLU A CB  1 
ATOM 1943 C CG  . GLU A 1 240 ? 9.347  38.458 10.730 1.00 25.85 ? 636 GLU A CG  1 
ATOM 1944 C CD  . GLU A 1 240 ? 8.003  39.015 10.258 1.00 28.55 ? 636 GLU A CD  1 
ATOM 1945 O OE1 . GLU A 1 240 ? 7.772  39.080 9.030  1.00 29.75 ? 636 GLU A OE1 1 
ATOM 1946 O OE2 . GLU A 1 240 ? 7.161  39.364 11.115 1.00 28.67 ? 636 GLU A OE2 1 
ATOM 1947 N N   . LYS A 1 241 ? 10.385 36.728 7.773  1.00 16.09 ? 637 LYS A N   1 
ATOM 1948 C CA  . LYS A 1 241 ? 9.798  35.654 6.979  1.00 15.70 ? 637 LYS A CA  1 
ATOM 1949 C C   . LYS A 1 241 ? 10.996 34.830 6.510  1.00 15.02 ? 637 LYS A C   1 
ATOM 1950 O O   . LYS A 1 241 ? 11.751 35.270 5.636  1.00 14.64 ? 637 LYS A O   1 
ATOM 1951 C CB  . LYS A 1 241 ? 9.072  36.210 5.740  1.00 14.04 ? 637 LYS A CB  1 
ATOM 1952 C CG  . LYS A 1 241 ? 8.061  37.320 6.012  1.00 14.27 ? 637 LYS A CG  1 
ATOM 1953 C CD  . LYS A 1 241 ? 6.625  36.817 6.109  1.00 21.34 ? 637 LYS A CD  1 
ATOM 1954 C CE  . LYS A 1 241 ? 6.472  35.700 7.120  1.00 21.37 ? 637 LYS A CE  1 
ATOM 1955 N NZ  . LYS A 1 241 ? 6.679  34.358 6.495  1.00 22.42 ? 637 LYS A NZ  1 
ATOM 1956 N N   . ALA A 1 242 ? 11.190 33.665 7.116  1.00 12.71 ? 638 ALA A N   1 
ATOM 1957 C CA  . ALA A 1 242 ? 12.294 32.778 6.769  1.00 9.49  ? 638 ALA A CA  1 
ATOM 1958 C C   . ALA A 1 242 ? 12.574 32.621 5.270  1.00 12.33 ? 638 ALA A C   1 
ATOM 1959 O O   . ALA A 1 242 ? 13.724 32.764 4.840  1.00 9.51  ? 638 ALA A O   1 
ATOM 1960 C CB  . ALA A 1 242 ? 12.074 31.417 7.398  1.00 11.57 ? 638 ALA A CB  1 
ATOM 1961 N N   . ASP A 1 243 ? 11.526 32.378 4.475  1.00 11.12 ? 639 ASP A N   1 
ATOM 1962 C CA  . ASP A 1 243 ? 11.678 32.163 3.030  1.00 11.04 ? 639 ASP A CA  1 
ATOM 1963 C C   . ASP A 1 243 ? 12.074 33.366 2.185  1.00 10.51 ? 639 ASP A C   1 
ATOM 1964 O O   . ASP A 1 243 ? 12.206 33.258 0.962  1.00 3.89  ? 639 ASP A O   1 
ATOM 1965 C CB  . ASP A 1 243 ? 10.431 31.478 2.426  1.00 13.90 ? 639 ASP A CB  1 
ATOM 1966 C CG  . ASP A 1 243 ? 9.181  32.358 2.437  1.00 13.58 ? 639 ASP A CG  1 
ATOM 1967 O OD1 . ASP A 1 243 ? 9.270  33.586 2.626  1.00 15.17 ? 639 ASP A OD1 1 
ATOM 1968 O OD2 . ASP A 1 243 ? 8.081  31.808 2.235  1.00 15.41 ? 639 ASP A OD2 1 
ATOM 1969 N N   . GLU A 1 244 ? 12.203 34.517 2.836  1.00 10.52 ? 640 GLU A N   1 
ATOM 1970 C CA  . GLU A 1 244 ? 12.575 35.754 2.169  1.00 11.19 ? 640 GLU A CA  1 
ATOM 1971 C C   . GLU A 1 244 ? 14.030 36.074 2.496  1.00 9.22  ? 640 GLU A C   1 
ATOM 1972 O O   . GLU A 1 244 ? 14.556 37.117 2.120  1.00 10.28 ? 640 GLU A O   1 
ATOM 1973 C CB  . GLU A 1 244 ? 11.673 36.892 2.640  1.00 14.28 ? 640 GLU A CB  1 
ATOM 1974 C CG  . GLU A 1 244 ? 11.180 37.808 1.531  1.00 24.80 ? 640 GLU A CG  1 
ATOM 1975 C CD  . GLU A 1 244 ? 9.741  37.523 1.125  1.00 30.36 ? 640 GLU A CD  1 
ATOM 1976 O OE1 . GLU A 1 244 ? 9.499  37.238 -0.072 1.00 34.01 ? 640 GLU A OE1 1 
ATOM 1977 O OE2 . GLU A 1 244 ? 8.849  37.602 2.002  1.00 36.33 ? 640 GLU A OE2 1 
ATOM 1978 N N   . ARG A 1 245 ? 14.658 35.185 3.249  1.00 8.49  ? 641 ARG A N   1 
ATOM 1979 C CA  . ARG A 1 245 ? 16.048 35.343 3.626  1.00 10.21 ? 641 ARG A CA  1 
ATOM 1980 C C   . ARG A 1 245 ? 16.834 34.519 2.608  1.00 11.06 ? 641 ARG A C   1 
ATOM 1981 O O   . ARG A 1 245 ? 16.490 33.367 2.320  1.00 8.77  ? 641 ARG A O   1 
ATOM 1982 C CB  . ARG A 1 245 ? 16.256 34.861 5.069  1.00 8.41  ? 641 ARG A CB  1 
ATOM 1983 C CG  . ARG A 1 245 ? 15.151 35.391 5.991  1.00 10.60 ? 641 ARG A CG  1 
ATOM 1984 C CD  . ARG A 1 245 ? 15.623 35.692 7.392  1.00 13.17 ? 641 ARG A CD  1 
ATOM 1985 N NE  . ARG A 1 245 ? 15.831 34.497 8.189  1.00 18.11 ? 641 ARG A NE  1 
ATOM 1986 C CZ  . ARG A 1 245 ? 14.942 34.007 9.045  1.00 15.39 ? 641 ARG A CZ  1 
ATOM 1987 N NH1 . ARG A 1 245 ? 13.776 34.608 9.222  1.00 14.59 ? 641 ARG A NH1 1 
ATOM 1988 N NH2 . ARG A 1 245 ? 15.228 32.917 9.734  1.00 13.36 ? 641 ARG A NH2 1 
ATOM 1989 N N   . PRO A 1 246 ? 17.843 35.141 1.982  1.00 11.46 ? 642 PRO A N   1 
ATOM 1990 C CA  . PRO A 1 246 ? 18.733 34.573 0.961  1.00 13.85 ? 642 PRO A CA  1 
ATOM 1991 C C   . PRO A 1 246 ? 19.471 33.301 1.348  1.00 12.77 ? 642 PRO A C   1 
ATOM 1992 O O   . PRO A 1 246 ? 19.570 32.959 2.522  1.00 11.54 ? 642 PRO A O   1 
ATOM 1993 C CB  . PRO A 1 246 ? 19.725 35.710 0.721  1.00 16.79 ? 642 PRO A CB  1 
ATOM 1994 C CG  . PRO A 1 246 ? 18.897 36.914 0.967  1.00 15.67 ? 642 PRO A CG  1 
ATOM 1995 C CD  . PRO A 1 246 ? 18.197 36.544 2.242  1.00 10.26 ? 642 PRO A CD  1 
ATOM 1996 N N   . THR A 1 247 ? 19.977 32.597 0.342  1.00 11.30 ? 643 THR A N   1 
ATOM 1997 C CA  . THR A 1 247 ? 20.747 31.389 0.580  1.00 10.65 ? 643 THR A CA  1 
ATOM 1998 C C   . THR A 1 247 ? 22.201 31.829 0.778  1.00 10.25 ? 643 THR A C   1 
ATOM 1999 O O   . THR A 1 247 ? 22.545 32.983 0.520  1.00 13.36 ? 643 THR A O   1 
ATOM 2000 C CB  . THR A 1 247 ? 20.667 30.414 -0.614 1.00 6.97  ? 643 THR A CB  1 
ATOM 2001 O OG1 . THR A 1 247 ? 21.115 31.067 -1.807 1.00 10.04 ? 643 THR A OG1 1 
ATOM 2002 C CG2 . THR A 1 247 ? 19.255 29.934 -0.813 1.00 8.33  ? 643 THR A CG2 1 
ATOM 2003 N N   . PHE A 1 248 ? 23.044 30.920 1.255  1.00 9.85  ? 644 PHE A N   1 
ATOM 2004 C CA  . PHE A 1 248 ? 24.454 31.223 1.459  1.00 8.80  ? 644 PHE A CA  1 
ATOM 2005 C C   . PHE A 1 248 ? 25.175 31.387 0.136  1.00 6.83  ? 644 PHE A C   1 
ATOM 2006 O O   . PHE A 1 248 ? 26.132 32.146 0.042  1.00 6.14  ? 644 PHE A O   1 
ATOM 2007 C CB  . PHE A 1 248 ? 25.125 30.152 2.314  1.00 6.23  ? 644 PHE A CB  1 
ATOM 2008 C CG  . PHE A 1 248 ? 24.910 30.343 3.782  1.00 7.15  ? 644 PHE A CG  1 
ATOM 2009 C CD1 . PHE A 1 248 ? 25.331 31.515 4.405  1.00 9.73  ? 644 PHE A CD1 1 
ATOM 2010 C CD2 . PHE A 1 248 ? 24.268 29.367 4.543  1.00 4.29  ? 644 PHE A CD2 1 
ATOM 2011 C CE1 . PHE A 1 248 ? 25.117 31.715 5.766  1.00 9.97  ? 644 PHE A CE1 1 
ATOM 2012 C CE2 . PHE A 1 248 ? 24.048 29.554 5.900  1.00 2.00  ? 644 PHE A CE2 1 
ATOM 2013 C CZ  . PHE A 1 248 ? 24.473 30.732 6.515  1.00 8.09  ? 644 PHE A CZ  1 
ATOM 2014 N N   . LYS A 1 249 ? 24.679 30.703 -0.893 1.00 10.54 ? 645 LYS A N   1 
ATOM 2015 C CA  . LYS A 1 249 ? 25.247 30.791 -2.241 1.00 9.84  ? 645 LYS A CA  1 
ATOM 2016 C C   . LYS A 1 249 ? 24.976 32.179 -2.809 1.00 9.74  ? 645 LYS A C   1 
ATOM 2017 O O   . LYS A 1 249 ? 25.815 32.751 -3.512 1.00 11.66 ? 645 LYS A O   1 
ATOM 2018 C CB  . LYS A 1 249 ? 24.635 29.730 -3.150 1.00 14.63 ? 645 LYS A CB  1 
ATOM 2019 N N   . ILE A 1 250 ? 23.787 32.705 -2.534 1.00 10.19 ? 646 ILE A N   1 
ATOM 2020 C CA  . ILE A 1 250 ? 23.434 34.029 -3.015 1.00 9.44  ? 646 ILE A CA  1 
ATOM 2021 C C   . ILE A 1 250 ? 24.237 35.057 -2.234 1.00 8.64  ? 646 ILE A C   1 
ATOM 2022 O O   . ILE A 1 250 ? 24.792 35.987 -2.820 1.00 12.42 ? 646 ILE A O   1 
ATOM 2023 C CB  . ILE A 1 250 ? 21.912 34.306 -2.904 1.00 10.35 ? 646 ILE A CB  1 
ATOM 2024 C CG1 . ILE A 1 250 ? 21.163 33.467 -3.945 1.00 12.53 ? 646 ILE A CG1 1 
ATOM 2025 C CG2 . ILE A 1 250 ? 21.615 35.788 -3.117 1.00 9.73  ? 646 ILE A CG2 1 
ATOM 2026 C CD1 . ILE A 1 250 ? 19.749 33.935 -4.220 1.00 10.68 ? 646 ILE A CD1 1 
ATOM 2027 N N   . LEU A 1 251 ? 24.329 34.870 -0.923 1.00 5.16  ? 647 LEU A N   1 
ATOM 2028 C CA  . LEU A 1 251 ? 25.096 35.777 -0.076 1.00 5.21  ? 647 LEU A CA  1 
ATOM 2029 C C   . LEU A 1 251 ? 26.538 35.803 -0.538 1.00 4.59  ? 647 LEU A C   1 
ATOM 2030 O O   . LEU A 1 251 ? 27.151 36.859 -0.615 1.00 9.34  ? 647 LEU A O   1 
ATOM 2031 C CB  . LEU A 1 251 ? 25.049 35.331 1.383  1.00 6.62  ? 647 LEU A CB  1 
ATOM 2032 C CG  . LEU A 1 251 ? 23.782 35.668 2.152  1.00 2.00  ? 647 LEU A CG  1 
ATOM 2033 C CD1 . LEU A 1 251 ? 23.785 34.910 3.454  1.00 7.11  ? 647 LEU A CD1 1 
ATOM 2034 C CD2 . LEU A 1 251 ? 23.705 37.180 2.390  1.00 6.32  ? 647 LEU A CD2 1 
ATOM 2035 N N   . LEU A 1 252 ? 27.083 34.632 -0.838 1.00 6.10  ? 648 LEU A N   1 
ATOM 2036 C CA  . LEU A 1 252 ? 28.454 34.540 -1.307 1.00 7.56  ? 648 LEU A CA  1 
ATOM 2037 C C   . LEU A 1 252 ? 28.603 35.218 -2.662 1.00 7.15  ? 648 LEU A C   1 
ATOM 2038 O O   . LEU A 1 252 ? 29.619 35.860 -2.914 1.00 5.11  ? 648 LEU A O   1 
ATOM 2039 C CB  . LEU A 1 252 ? 28.901 33.087 -1.407 1.00 6.76  ? 648 LEU A CB  1 
ATOM 2040 C CG  . LEU A 1 252 ? 30.313 32.904 -1.953 1.00 5.57  ? 648 LEU A CG  1 
ATOM 2041 C CD1 . LEU A 1 252 ? 31.338 33.392 -0.951 1.00 8.87  ? 648 LEU A CD1 1 
ATOM 2042 C CD2 . LEU A 1 252 ? 30.531 31.456 -2.262 1.00 9.05  ? 648 LEU A CD2 1 
ATOM 2043 N N   . SER A 1 253 ? 27.606 35.079 -3.535 1.00 7.37  ? 649 SER A N   1 
ATOM 2044 C CA  . SER A 1 253 ? 27.684 35.715 -4.848 1.00 11.39 ? 649 SER A CA  1 
ATOM 2045 C C   . SER A 1 253 ? 27.588 37.226 -4.674 1.00 13.90 ? 649 SER A C   1 
ATOM 2046 O O   . SER A 1 253 ? 28.255 37.979 -5.384 1.00 14.33 ? 649 SER A O   1 
ATOM 2047 C CB  . SER A 1 253 ? 26.619 35.172 -5.826 1.00 13.66 ? 649 SER A CB  1 
ATOM 2048 O OG  . SER A 1 253 ? 25.352 35.803 -5.718 1.00 18.95 ? 649 SER A OG  1 
ATOM 2049 N N   . ASN A 1 254 ? 26.813 37.666 -3.685 1.00 15.59 ? 650 ASN A N   1 
ATOM 2050 C CA  . ASN A 1 254 ? 26.669 39.097 -3.418 1.00 14.80 ? 650 ASN A CA  1 
ATOM 2051 C C   . ASN A 1 254 ? 28.035 39.590 -2.975 1.00 16.71 ? 650 ASN A C   1 
ATOM 2052 O O   . ASN A 1 254 ? 28.627 40.461 -3.602 1.00 18.95 ? 650 ASN A O   1 
ATOM 2053 C CB  . ASN A 1 254 ? 25.655 39.351 -2.301 1.00 15.49 ? 650 ASN A CB  1 
ATOM 2054 C CG  . ASN A 1 254 ? 24.218 39.195 -2.758 1.00 13.88 ? 650 ASN A CG  1 
ATOM 2055 O OD1 . ASN A 1 254 ? 23.911 39.333 -3.941 1.00 16.71 ? 650 ASN A OD1 1 
ATOM 2056 N ND2 . ASN A 1 254 ? 23.323 38.920 -1.814 1.00 18.03 ? 650 ASN A ND2 1 
ATOM 2057 N N   . ILE A 1 255 ? 28.553 38.972 -1.920 1.00 17.37 ? 651 ILE A N   1 
ATOM 2058 C CA  . ILE A 1 255 ? 29.856 39.315 -1.368 1.00 16.71 ? 651 ILE A CA  1 
ATOM 2059 C C   . ILE A 1 255 ? 30.936 39.407 -2.441 1.00 17.88 ? 651 ILE A C   1 
ATOM 2060 O O   . ILE A 1 255 ? 31.730 40.340 -2.442 1.00 17.27 ? 651 ILE A O   1 
ATOM 2061 C CB  . ILE A 1 255 ? 30.300 38.269 -0.330 1.00 16.01 ? 651 ILE A CB  1 
ATOM 2062 C CG1 . ILE A 1 255 ? 29.397 38.333 0.902  1.00 18.86 ? 651 ILE A CG1 1 
ATOM 2063 C CG2 . ILE A 1 255 ? 31.766 38.473 0.049  1.00 16.81 ? 651 ILE A CG2 1 
ATOM 2064 C CD1 . ILE A 1 255 ? 29.787 37.353 1.998  1.00 18.13 ? 651 ILE A CD1 1 
ATOM 2065 N N   . LEU A 1 256 ? 30.979 38.425 -3.333 1.00 17.38 ? 652 LEU A N   1 
ATOM 2066 C CA  . LEU A 1 256 ? 31.988 38.410 -4.383 1.00 16.93 ? 652 LEU A CA  1 
ATOM 2067 C C   . LEU A 1 256 ? 31.864 39.593 -5.339 1.00 17.77 ? 652 LEU A C   1 
ATOM 2068 O O   . LEU A 1 256 ? 32.869 40.153 -5.775 1.00 14.19 ? 652 LEU A O   1 
ATOM 2069 C CB  . LEU A 1 256 ? 31.927 37.097 -5.174 1.00 16.89 ? 652 LEU A CB  1 
ATOM 2070 C CG  . LEU A 1 256 ? 32.426 35.821 -4.496 1.00 14.36 ? 652 LEU A CG  1 
ATOM 2071 C CD1 . LEU A 1 256 ? 32.223 34.644 -5.415 1.00 17.00 ? 652 LEU A CD1 1 
ATOM 2072 C CD2 . LEU A 1 256 ? 33.890 35.966 -4.155 1.00 17.94 ? 652 LEU A CD2 1 
ATOM 2073 N N   . ASP A 1 257 ? 30.626 39.958 -5.660 1.00 16.94 ? 653 ASP A N   1 
ATOM 2074 C CA  . ASP A 1 257 ? 30.338 41.052 -6.583 1.00 18.91 ? 653 ASP A CA  1 
ATOM 2075 C C   . ASP A 1 257 ? 30.743 42.397 -5.971 1.00 16.94 ? 653 ASP A C   1 
ATOM 2076 O O   . ASP A 1 257 ? 30.021 42.968 -5.153 1.00 18.07 ? 653 ASP A O   1 
ATOM 2077 C CB  . ASP A 1 257 ? 28.839 41.029 -6.933 1.00 22.19 ? 653 ASP A CB  1 
ATOM 2078 C CG  . ASP A 1 257 ? 28.511 41.768 -8.220 1.00 27.15 ? 653 ASP A CG  1 
ATOM 2079 O OD1 . ASP A 1 257 ? 28.383 43.014 -8.190 1.00 26.08 ? 653 ASP A OD1 1 
ATOM 2080 O OD2 . ASP A 1 257 ? 28.338 41.094 -9.261 1.00 29.58 ? 653 ASP A OD2 1 
ATOM 2081 N N   . VAL A 1 258 ? 31.910 42.883 -6.363 1.00 17.09 ? 654 VAL A N   1 
ATOM 2082 C CA  . VAL A 1 258 ? 32.448 44.156 -5.873 1.00 19.99 ? 654 VAL A CA  1 
ATOM 2083 C C   . VAL A 1 258 ? 33.831 44.409 -6.521 1.00 21.38 ? 654 VAL A C   1 
ATOM 2084 O O   . VAL A 1 258 ? 34.043 45.515 -7.073 1.00 20.29 ? 654 VAL A O   1 
ATOM 2085 C CB  . VAL A 1 258 ? 32.525 44.192 -4.285 1.00 15.42 ? 654 VAL A CB  1 
ATOM 2086 C CG1 . VAL A 1 258 ? 33.538 43.189 -3.741 1.00 19.20 ? 654 VAL A CG1 1 
ATOM 2087 C CG2 . VAL A 1 258 ? 32.836 45.587 -3.792 1.00 15.46 ? 654 VAL A CG2 1 
ATOM 2088 N N   . ILE B 1 1   ? 35.200 45.884 40.296 1.00 27.80 ? 397 ILE B N   1 
ATOM 2089 C CA  . ILE B 1 1   ? 35.647 45.461 41.653 1.00 29.30 ? 397 ILE B CA  1 
ATOM 2090 C C   . ILE B 1 1   ? 37.125 45.091 41.610 1.00 29.53 ? 397 ILE B C   1 
ATOM 2091 O O   . ILE B 1 1   ? 37.977 45.873 42.022 1.00 31.32 ? 397 ILE B O   1 
ATOM 2092 C CB  . ILE B 1 1   ? 34.822 44.259 42.166 1.00 28.06 ? 397 ILE B CB  1 
ATOM 2093 C CG1 . ILE B 1 1   ? 33.354 44.660 42.302 1.00 27.51 ? 397 ILE B CG1 1 
ATOM 2094 C CG2 . ILE B 1 1   ? 35.367 43.761 43.501 1.00 30.24 ? 397 ILE B CG2 1 
ATOM 2095 C CD1 . ILE B 1 1   ? 32.460 43.563 42.838 1.00 31.05 ? 397 ILE B CD1 1 
ATOM 2096 N N   . ASP B 1 2   ? 37.413 43.917 41.052 1.00 29.94 ? 398 ASP B N   1 
ATOM 2097 C CA  . ASP B 1 2   ? 38.771 43.396 40.924 1.00 28.21 ? 398 ASP B CA  1 
ATOM 2098 C C   . ASP B 1 2   ? 39.631 44.248 39.999 1.00 30.83 ? 398 ASP B C   1 
ATOM 2099 O O   . ASP B 1 2   ? 39.299 44.428 38.823 1.00 28.34 ? 398 ASP B O   1 
ATOM 2100 C CB  . ASP B 1 2   ? 38.711 41.951 40.409 1.00 27.14 ? 398 ASP B CB  1 
ATOM 2101 C CG  . ASP B 1 2   ? 40.055 41.431 39.939 1.00 28.88 ? 398 ASP B CG  1 
ATOM 2102 O OD1 . ASP B 1 2   ? 40.805 40.866 40.760 1.00 29.93 ? 398 ASP B OD1 1 
ATOM 2103 O OD2 . ASP B 1 2   ? 40.353 41.565 38.735 1.00 29.99 ? 398 ASP B OD2 1 
ATOM 2104 N N   . PRO B 1 3   ? 40.726 44.819 40.529 1.00 30.97 ? 399 PRO B N   1 
ATOM 2105 C CA  . PRO B 1 3   ? 41.633 45.654 39.735 1.00 30.72 ? 399 PRO B CA  1 
ATOM 2106 C C   . PRO B 1 3   ? 42.236 44.809 38.611 1.00 30.41 ? 399 PRO B C   1 
ATOM 2107 O O   . PRO B 1 3   ? 43.229 44.106 38.808 1.00 27.77 ? 399 PRO B O   1 
ATOM 2108 C CB  . PRO B 1 3   ? 42.689 46.073 40.760 1.00 33.06 ? 399 PRO B CB  1 
ATOM 2109 C CG  . PRO B 1 3   ? 41.908 46.118 42.044 1.00 32.66 ? 399 PRO B CG  1 
ATOM 2110 C CD  . PRO B 1 3   ? 41.104 44.844 41.953 1.00 29.33 ? 399 PRO B CD  1 
ATOM 2111 N N   . LYS B 1 4   ? 41.618 44.906 37.435 1.00 31.71 ? 400 LYS B N   1 
ATOM 2112 C CA  . LYS B 1 4   ? 41.991 44.169 36.225 1.00 32.73 ? 400 LYS B CA  1 
ATOM 2113 C C   . LYS B 1 4   ? 43.453 43.746 35.993 1.00 35.08 ? 400 LYS B C   1 
ATOM 2114 O O   . LYS B 1 4   ? 43.710 42.872 35.157 1.00 32.76 ? 400 LYS B O   1 
ATOM 2115 C CB  . LYS B 1 4   ? 41.466 44.913 34.992 1.00 31.73 ? 400 LYS B CB  1 
ATOM 2116 C CG  . LYS B 1 4   ? 41.243 44.014 33.789 1.00 31.68 ? 400 LYS B CG  1 
ATOM 2117 C CD  . LYS B 1 4   ? 40.893 44.804 32.545 1.00 29.01 ? 400 LYS B CD  1 
ATOM 2118 C CE  . LYS B 1 4   ? 40.459 43.882 31.409 1.00 27.04 ? 400 LYS B CE  1 
ATOM 2119 N NZ  . LYS B 1 4   ? 39.176 43.195 31.722 1.00 25.44 ? 400 LYS B NZ  1 
ATOM 2120 N N   . ASP B 1 5   ? 44.410 44.363 36.684 1.00 37.73 ? 401 ASP B N   1 
ATOM 2121 C CA  . ASP B 1 5   ? 45.807 43.987 36.493 1.00 38.72 ? 401 ASP B CA  1 
ATOM 2122 C C   . ASP B 1 5   ? 46.375 43.195 37.668 1.00 40.61 ? 401 ASP B C   1 
ATOM 2123 O O   . ASP B 1 5   ? 46.429 43.683 38.802 1.00 39.92 ? 401 ASP B O   1 
ATOM 2124 C CB  . ASP B 1 5   ? 46.682 45.209 36.209 1.00 38.08 ? 401 ASP B CB  1 
ATOM 2125 C CG  . ASP B 1 5   ? 48.080 44.824 35.748 1.00 38.22 ? 401 ASP B CG  1 
ATOM 2126 O OD1 . ASP B 1 5   ? 48.992 44.757 36.599 1.00 39.11 ? 401 ASP B OD1 1 
ATOM 2127 O OD2 . ASP B 1 5   ? 48.262 44.564 34.539 1.00 40.47 ? 401 ASP B OD2 1 
ATOM 2128 N N   . LEU B 1 6   ? 46.832 41.982 37.365 1.00 39.68 ? 402 LEU B N   1 
ATOM 2129 C CA  . LEU B 1 6   ? 47.412 41.076 38.347 1.00 35.79 ? 402 LEU B CA  1 
ATOM 2130 C C   . LEU B 1 6   ? 48.339 40.090 37.627 1.00 36.68 ? 402 LEU B C   1 
ATOM 2131 O O   . LEU B 1 6   ? 48.350 40.034 36.396 1.00 37.32 ? 402 LEU B O   1 
ATOM 2132 C CB  . LEU B 1 6   ? 46.300 40.318 39.083 1.00 30.36 ? 402 LEU B CB  1 
ATOM 2133 C CG  . LEU B 1 6   ? 45.296 39.475 38.286 1.00 25.43 ? 402 LEU B CG  1 
ATOM 2134 C CD1 . LEU B 1 6   ? 44.710 38.416 39.200 1.00 25.89 ? 402 LEU B CD1 1 
ATOM 2135 C CD2 . LEU B 1 6   ? 44.189 40.326 37.678 1.00 19.90 ? 402 LEU B CD2 1 
ATOM 2136 N N   . THR B 1 7   ? 49.128 39.332 38.385 1.00 38.28 ? 403 THR B N   1 
ATOM 2137 C CA  . THR B 1 7   ? 50.047 38.356 37.798 1.00 39.00 ? 403 THR B CA  1 
ATOM 2138 C C   . THR B 1 7   ? 49.258 37.270 37.050 1.00 41.52 ? 403 THR B C   1 
ATOM 2139 O O   . THR B 1 7   ? 48.103 36.993 37.392 1.00 43.01 ? 403 THR B O   1 
ATOM 2140 C CB  . THR B 1 7   ? 50.922 37.688 38.885 1.00 38.43 ? 403 THR B CB  1 
ATOM 2141 O OG1 . THR B 1 7   ? 51.318 38.666 39.857 1.00 39.19 ? 403 THR B OG1 1 
ATOM 2142 C CG2 . THR B 1 7   ? 52.165 37.073 38.262 1.00 34.76 ? 403 THR B CG2 1 
ATOM 2143 N N   . PHE B 1 8   ? 49.884 36.663 36.041 1.00 40.42 ? 404 PHE B N   1 
ATOM 2144 C CA  . PHE B 1 8   ? 49.262 35.613 35.226 1.00 38.98 ? 404 PHE B CA  1 
ATOM 2145 C C   . PHE B 1 8   ? 50.316 34.723 34.578 1.00 38.11 ? 404 PHE B C   1 
ATOM 2146 O O   . PHE B 1 8   ? 51.263 35.217 33.974 1.00 38.10 ? 404 PHE B O   1 
ATOM 2147 C CB  . PHE B 1 8   ? 48.349 36.210 34.143 1.00 38.33 ? 404 PHE B CB  1 
ATOM 2148 C CG  . PHE B 1 8   ? 48.701 37.620 33.748 1.00 39.41 ? 404 PHE B CG  1 
ATOM 2149 C CD1 . PHE B 1 8   ? 47.704 38.578 33.617 1.00 39.35 ? 404 PHE B CD1 1 
ATOM 2150 C CD2 . PHE B 1 8   ? 50.026 38.000 33.542 1.00 40.12 ? 404 PHE B CD2 1 
ATOM 2151 C CE1 . PHE B 1 8   ? 48.016 39.892 33.293 1.00 39.05 ? 404 PHE B CE1 1 
ATOM 2152 C CE2 . PHE B 1 8   ? 50.351 39.314 33.218 1.00 39.92 ? 404 PHE B CE2 1 
ATOM 2153 C CZ  . PHE B 1 8   ? 49.344 40.261 33.094 1.00 41.14 ? 404 PHE B CZ  1 
ATOM 2154 N N   . LEU B 1 9   ? 50.151 33.412 34.722 1.00 39.17 ? 405 LEU B N   1 
ATOM 2155 C CA  . LEU B 1 9   ? 51.096 32.450 34.168 1.00 38.13 ? 405 LEU B CA  1 
ATOM 2156 C C   . LEU B 1 9   ? 50.504 31.596 33.050 1.00 36.37 ? 405 LEU B C   1 
ATOM 2157 O O   . LEU B 1 9   ? 50.680 31.910 31.872 1.00 38.19 ? 405 LEU B O   1 
ATOM 2158 C CB  . LEU B 1 9   ? 51.676 31.575 35.285 1.00 39.62 ? 405 LEU B CB  1 
ATOM 2159 C CG  . LEU B 1 9   ? 52.874 32.193 36.020 1.00 42.57 ? 405 LEU B CG  1 
ATOM 2160 C CD1 . LEU B 1 9   ? 53.105 31.533 37.378 1.00 41.80 ? 405 LEU B CD1 1 
ATOM 2161 C CD2 . LEU B 1 9   ? 54.112 32.086 35.140 1.00 40.80 ? 405 LEU B CD2 1 
ATOM 2162 N N   . LYS B 1 10  ? 49.832 30.506 33.398 1.00 33.49 ? 406 LYS B N   1 
ATOM 2163 C CA  . LYS B 1 10  ? 49.229 29.657 32.379 1.00 31.11 ? 406 LYS B CA  1 
ATOM 2164 C C   . LYS B 1 10  ? 47.721 29.727 32.544 1.00 31.03 ? 406 LYS B C   1 
ATOM 2165 O O   . LYS B 1 10  ? 47.194 30.685 33.126 1.00 29.59 ? 406 LYS B O   1 
ATOM 2166 C CB  . LYS B 1 10  ? 49.715 28.201 32.487 1.00 32.83 ? 406 LYS B CB  1 
ATOM 2167 C CG  . LYS B 1 10  ? 49.155 27.413 33.671 1.00 31.89 ? 406 LYS B CG  1 
ATOM 2168 C CD  . LYS B 1 10  ? 49.709 25.994 33.712 1.00 29.73 ? 406 LYS B CD  1 
ATOM 2169 C CE  . LYS B 1 10  ? 49.132 25.197 34.874 1.00 25.18 ? 406 LYS B CE  1 
ATOM 2170 N NZ  . LYS B 1 10  ? 47.664 24.987 34.754 1.00 23.18 ? 406 LYS B NZ  1 
ATOM 2171 N N   . GLU B 1 11  ? 47.038 28.689 32.075 1.00 28.47 ? 407 GLU B N   1 
ATOM 2172 C CA  . GLU B 1 11  ? 45.592 28.615 32.145 1.00 24.70 ? 407 GLU B CA  1 
ATOM 2173 C C   . GLU B 1 11  ? 45.220 27.272 32.764 1.00 22.29 ? 407 GLU B C   1 
ATOM 2174 O O   . GLU B 1 11  ? 46.096 26.485 33.116 1.00 24.55 ? 407 GLU B O   1 
ATOM 2175 C CB  . GLU B 1 11  ? 45.028 28.721 30.723 1.00 25.09 ? 407 GLU B CB  1 
ATOM 2176 C CG  . GLU B 1 11  ? 43.575 29.148 30.632 1.00 27.67 ? 407 GLU B CG  1 
ATOM 2177 C CD  . GLU B 1 11  ? 42.666 28.087 30.062 1.00 28.92 ? 407 GLU B CD  1 
ATOM 2178 O OE1 . GLU B 1 11  ? 41.443 28.231 30.229 1.00 30.56 ? 407 GLU B OE1 1 
ATOM 2179 O OE2 . GLU B 1 11  ? 43.157 27.114 29.450 1.00 32.96 ? 407 GLU B OE2 1 
ATOM 2180 N N   . LEU B 1 12  ? 43.924 27.037 32.924 1.00 21.71 ? 408 LEU B N   1 
ATOM 2181 C CA  . LEU B 1 12  ? 43.411 25.787 33.470 1.00 21.08 ? 408 LEU B CA  1 
ATOM 2182 C C   . LEU B 1 12  ? 42.513 25.113 32.444 1.00 21.69 ? 408 LEU B C   1 
ATOM 2183 O O   . LEU B 1 12  ? 42.883 24.088 31.872 1.00 25.66 ? 408 LEU B O   1 
ATOM 2184 C CB  . LEU B 1 12  ? 42.611 26.020 34.751 1.00 20.12 ? 408 LEU B CB  1 
ATOM 2185 C CG  . LEU B 1 12  ? 43.312 25.979 36.104 1.00 17.11 ? 408 LEU B CG  1 
ATOM 2186 C CD1 . LEU B 1 12  ? 44.189 27.196 36.305 1.00 16.68 ? 408 LEU B CD1 1 
ATOM 2187 C CD2 . LEU B 1 12  ? 42.244 25.924 37.169 1.00 20.38 ? 408 LEU B CD2 1 
ATOM 2188 N N   . GLY B 1 13  ? 41.345 25.697 32.191 1.00 26.47 ? 409 GLY B N   1 
ATOM 2189 C CA  . GLY B 1 13  ? 40.426 25.099 31.233 1.00 30.31 ? 409 GLY B CA  1 
ATOM 2190 C C   . GLY B 1 13  ? 39.026 25.681 31.179 1.00 31.13 ? 409 GLY B C   1 
ATOM 2191 O O   . GLY B 1 13  ? 38.864 26.839 30.800 1.00 28.40 ? 409 GLY B O   1 
ATOM 2192 N N   . THR B 1 14  ? 38.023 24.897 31.586 1.00 34.19 ? 410 THR B N   1 
ATOM 2193 C CA  . THR B 1 14  ? 36.623 25.337 31.563 1.00 35.54 ? 410 THR B CA  1 
ATOM 2194 C C   . THR B 1 14  ? 35.758 24.713 32.673 1.00 34.43 ? 410 THR B C   1 
ATOM 2195 O O   . THR B 1 14  ? 36.028 23.601 33.141 1.00 31.80 ? 410 THR B O   1 
ATOM 2196 C CB  . THR B 1 14  ? 35.974 25.015 30.188 1.00 39.00 ? 410 THR B CB  1 
ATOM 2197 O OG1 . THR B 1 14  ? 36.807 25.525 29.140 1.00 42.12 ? 410 THR B OG1 1 
ATOM 2198 C CG2 . THR B 1 14  ? 34.576 25.635 30.069 1.00 36.90 ? 410 THR B CG2 1 
ATOM 2199 N N   . GLY B 1 15  ? 34.721 25.447 33.076 1.00 33.66 ? 411 GLY B N   1 
ATOM 2200 C CA  . GLY B 1 15  ? 33.801 24.986 34.102 1.00 32.04 ? 411 GLY B CA  1 
ATOM 2201 C C   . GLY B 1 15  ? 32.351 25.093 33.645 1.00 32.34 ? 411 GLY B C   1 
ATOM 2202 O O   . GLY B 1 15  ? 31.738 24.093 33.280 1.00 33.64 ? 411 GLY B O   1 
ATOM 2203 N N   . GLN B 1 16  ? 31.811 26.308 33.623 1.00 31.61 ? 412 GLN B N   1 
ATOM 2204 C CA  . GLN B 1 16  ? 30.426 26.513 33.207 1.00 28.88 ? 412 GLN B CA  1 
ATOM 2205 C C   . GLN B 1 16  ? 30.270 27.600 32.140 1.00 28.86 ? 412 GLN B C   1 
ATOM 2206 O O   . GLN B 1 16  ? 29.267 27.638 31.418 1.00 28.11 ? 412 GLN B O   1 
ATOM 2207 C CB  . GLN B 1 16  ? 29.567 26.874 34.418 1.00 30.03 ? 412 GLN B CB  1 
ATOM 2208 C CG  . GLN B 1 16  ? 28.212 26.192 34.445 1.00 31.90 ? 412 GLN B CG  1 
ATOM 2209 C CD  . GLN B 1 16  ? 28.294 24.745 34.891 1.00 31.28 ? 412 GLN B CD  1 
ATOM 2210 O OE1 . GLN B 1 16  ? 29.317 24.084 34.715 1.00 31.63 ? 412 GLN B OE1 1 
ATOM 2211 N NE2 . GLN B 1 16  ? 27.217 24.250 35.493 1.00 28.67 ? 412 GLN B NE2 1 
ATOM 2212 N N   . PHE B 1 17  ? 31.234 28.512 32.074 1.00 28.97 ? 413 PHE B N   1 
ATOM 2213 C CA  . PHE B 1 17  ? 31.188 29.593 31.097 1.00 28.08 ? 413 PHE B CA  1 
ATOM 2214 C C   . PHE B 1 17  ? 32.248 29.403 30.027 1.00 30.53 ? 413 PHE B C   1 
ATOM 2215 O O   . PHE B 1 17  ? 31.989 28.797 28.987 1.00 34.18 ? 413 PHE B O   1 
ATOM 2216 C CB  . PHE B 1 17  ? 31.388 30.954 31.773 1.00 28.79 ? 413 PHE B CB  1 
ATOM 2217 C CG  . PHE B 1 17  ? 30.221 31.403 32.594 1.00 26.11 ? 413 PHE B CG  1 
ATOM 2218 C CD1 . PHE B 1 17  ? 29.317 32.325 32.084 1.00 30.79 ? 413 PHE B CD1 1 
ATOM 2219 C CD2 . PHE B 1 17  ? 30.023 30.904 33.872 1.00 29.49 ? 413 PHE B CD2 1 
ATOM 2220 C CE1 . PHE B 1 17  ? 28.229 32.740 32.833 1.00 33.14 ? 413 PHE B CE1 1 
ATOM 2221 C CE2 . PHE B 1 17  ? 28.935 31.313 34.633 1.00 31.02 ? 413 PHE B CE2 1 
ATOM 2222 C CZ  . PHE B 1 17  ? 28.036 32.234 34.113 1.00 33.86 ? 413 PHE B CZ  1 
ATOM 2223 N N   . GLY B 1 18  ? 33.453 29.889 30.306 1.00 29.58 ? 414 GLY B N   1 
ATOM 2224 C CA  . GLY B 1 18  ? 34.527 29.781 29.343 1.00 29.36 ? 414 GLY B CA  1 
ATOM 2225 C C   . GLY B 1 18  ? 35.824 29.289 29.938 1.00 30.73 ? 414 GLY B C   1 
ATOM 2226 O O   . GLY B 1 18  ? 35.824 28.404 30.806 1.00 29.03 ? 414 GLY B O   1 
ATOM 2227 N N   . VAL B 1 19  ? 36.918 29.917 29.507 1.00 31.12 ? 415 VAL B N   1 
ATOM 2228 C CA  . VAL B 1 19  ? 38.273 29.569 29.930 1.00 29.86 ? 415 VAL B CA  1 
ATOM 2229 C C   . VAL B 1 19  ? 38.773 30.174 31.247 1.00 33.07 ? 415 VAL B C   1 
ATOM 2230 O O   . VAL B 1 19  ? 38.753 31.395 31.441 1.00 34.75 ? 415 VAL B O   1 
ATOM 2231 C CB  . VAL B 1 19  ? 39.292 29.895 28.818 1.00 28.63 ? 415 VAL B CB  1 
ATOM 2232 C CG1 . VAL B 1 19  ? 39.093 28.976 27.636 1.00 20.44 ? 415 VAL B CG1 1 
ATOM 2233 C CG2 . VAL B 1 19  ? 39.158 31.341 28.388 1.00 28.08 ? 415 VAL B CG2 1 
ATOM 2234 N N   . VAL B 1 20  ? 39.268 29.307 32.125 1.00 33.11 ? 416 VAL B N   1 
ATOM 2235 C CA  . VAL B 1 20  ? 39.792 29.716 33.426 1.00 33.57 ? 416 VAL B CA  1 
ATOM 2236 C C   . VAL B 1 20  ? 41.326 29.621 33.437 1.00 32.35 ? 416 VAL B C   1 
ATOM 2237 O O   . VAL B 1 20  ? 41.880 28.539 33.264 1.00 32.92 ? 416 VAL B O   1 
ATOM 2238 C CB  . VAL B 1 20  ? 39.158 28.867 34.561 1.00 36.44 ? 416 VAL B CB  1 
ATOM 2239 C CG1 . VAL B 1 20  ? 39.077 27.402 34.147 1.00 38.53 ? 416 VAL B CG1 1 
ATOM 2240 C CG2 . VAL B 1 20  ? 39.944 29.014 35.860 1.00 36.43 ? 416 VAL B CG2 1 
ATOM 2241 N N   . LYS B 1 21  ? 42.000 30.762 33.595 1.00 28.13 ? 417 LYS B N   1 
ATOM 2242 C CA  . LYS B 1 21  ? 43.470 30.834 33.601 1.00 22.76 ? 417 LYS B CA  1 
ATOM 2243 C C   . LYS B 1 21  ? 44.014 30.895 35.031 1.00 18.43 ? 417 LYS B C   1 
ATOM 2244 O O   . LYS B 1 21  ? 43.265 30.665 35.976 1.00 17.13 ? 417 LYS B O   1 
ATOM 2245 C CB  . LYS B 1 21  ? 43.920 32.071 32.810 1.00 21.32 ? 417 LYS B CB  1 
ATOM 2246 C CG  . LYS B 1 21  ? 43.060 32.342 31.574 1.00 24.74 ? 417 LYS B CG  1 
ATOM 2247 C CD  . LYS B 1 21  ? 43.513 33.567 30.806 1.00 23.99 ? 417 LYS B CD  1 
ATOM 2248 C CE  . LYS B 1 21  ? 42.534 33.946 29.710 1.00 15.58 ? 417 LYS B CE  1 
ATOM 2249 N NZ  . LYS B 1 21  ? 42.968 35.229 29.104 1.00 20.25 ? 417 LYS B NZ  1 
ATOM 2250 N N   . TYR B 1 22  ? 45.298 31.214 35.195 1.00 14.44 ? 418 TYR B N   1 
ATOM 2251 C CA  . TYR B 1 22  ? 45.898 31.301 36.533 1.00 18.16 ? 418 TYR B CA  1 
ATOM 2252 C C   . TYR B 1 22  ? 46.750 32.548 36.706 1.00 18.40 ? 418 TYR B C   1 
ATOM 2253 O O   . TYR B 1 22  ? 47.448 32.962 35.783 1.00 19.90 ? 418 TYR B O   1 
ATOM 2254 C CB  . TYR B 1 22  ? 46.737 30.057 36.834 1.00 18.21 ? 418 TYR B CB  1 
ATOM 2255 N N   . GLY B 1 23  ? 46.724 33.116 37.905 1.00 20.29 ? 419 GLY B N   1 
ATOM 2256 C CA  . GLY B 1 23  ? 47.507 34.308 38.176 1.00 20.56 ? 419 GLY B CA  1 
ATOM 2257 C C   . GLY B 1 23  ? 47.617 34.626 39.651 1.00 22.74 ? 419 GLY B C   1 
ATOM 2258 O O   . GLY B 1 23  ? 47.091 33.895 40.487 1.00 24.36 ? 419 GLY B O   1 
ATOM 2259 N N   . LYS B 1 24  ? 48.305 35.712 39.982 1.00 23.32 ? 420 LYS B N   1 
ATOM 2260 C CA  . LYS B 1 24  ? 48.460 36.110 41.378 1.00 23.35 ? 420 LYS B CA  1 
ATOM 2261 C C   . LYS B 1 24  ? 47.837 37.484 41.587 1.00 21.75 ? 420 LYS B C   1 
ATOM 2262 O O   . LYS B 1 24  ? 48.198 38.448 40.912 1.00 24.80 ? 420 LYS B O   1 
ATOM 2263 C CB  . LYS B 1 24  ? 49.927 36.125 41.774 1.00 23.90 ? 420 LYS B CB  1 
ATOM 2264 N N   . TRP B 1 25  ? 46.870 37.556 42.490 1.00 18.99 ? 421 TRP B N   1 
ATOM 2265 C CA  . TRP B 1 25  ? 46.184 38.800 42.789 1.00 19.16 ? 421 TRP B CA  1 
ATOM 2266 C C   . TRP B 1 25  ? 46.694 39.348 44.114 1.00 20.06 ? 421 TRP B C   1 
ATOM 2267 O O   . TRP B 1 25  ? 46.905 38.587 45.059 1.00 21.40 ? 421 TRP B O   1 
ATOM 2268 C CB  . TRP B 1 25  ? 44.683 38.548 42.875 1.00 21.71 ? 421 TRP B CB  1 
ATOM 2269 C CG  . TRP B 1 25  ? 43.869 39.797 42.944 1.00 23.50 ? 421 TRP B CG  1 
ATOM 2270 C CD1 . TRP B 1 25  ? 43.859 40.817 42.041 1.00 21.67 ? 421 TRP B CD1 1 
ATOM 2271 C CD2 . TRP B 1 25  ? 42.920 40.148 43.959 1.00 22.38 ? 421 TRP B CD2 1 
ATOM 2272 N NE1 . TRP B 1 25  ? 42.962 41.778 42.425 1.00 26.88 ? 421 TRP B NE1 1 
ATOM 2273 C CE2 . TRP B 1 25  ? 42.370 41.394 43.599 1.00 25.22 ? 421 TRP B CE2 1 
ATOM 2274 C CE3 . TRP B 1 25  ? 42.482 39.528 45.137 1.00 26.12 ? 421 TRP B CE3 1 
ATOM 2275 C CZ2 . TRP B 1 25  ? 41.402 42.036 44.372 1.00 26.92 ? 421 TRP B CZ2 1 
ATOM 2276 C CZ3 . TRP B 1 25  ? 41.521 40.166 45.907 1.00 27.03 ? 421 TRP B CZ3 1 
ATOM 2277 C CH2 . TRP B 1 25  ? 40.991 41.408 45.520 1.00 26.73 ? 421 TRP B CH2 1 
ATOM 2278 N N   . ARG B 1 26  ? 46.907 40.664 44.166 1.00 22.24 ? 422 ARG B N   1 
ATOM 2279 C CA  . ARG B 1 26  ? 47.394 41.358 45.366 1.00 24.43 ? 422 ARG B CA  1 
ATOM 2280 C C   . ARG B 1 26  ? 48.761 40.854 45.841 1.00 26.12 ? 422 ARG B C   1 
ATOM 2281 O O   . ARG B 1 26  ? 49.068 40.896 47.033 1.00 24.76 ? 422 ARG B O   1 
ATOM 2282 C CB  . ARG B 1 26  ? 46.387 41.228 46.520 1.00 25.85 ? 422 ARG B CB  1 
ATOM 2283 C CG  . ARG B 1 26  ? 44.960 41.672 46.222 1.00 27.33 ? 422 ARG B CG  1 
ATOM 2284 C CD  . ARG B 1 26  ? 44.832 43.176 46.095 1.00 29.62 ? 422 ARG B CD  1 
ATOM 2285 N NE  . ARG B 1 26  ? 43.473 43.622 46.388 1.00 29.09 ? 422 ARG B NE  1 
ATOM 2286 C CZ  . ARG B 1 26  ? 42.944 43.659 47.607 1.00 28.92 ? 422 ARG B CZ  1 
ATOM 2287 N NH1 . ARG B 1 26  ? 41.698 44.078 47.781 1.00 31.54 ? 422 ARG B NH1 1 
ATOM 2288 N NH2 . ARG B 1 26  ? 43.654 43.273 48.657 1.00 31.57 ? 422 ARG B NH2 1 
ATOM 2289 N N   . GLY B 1 27  ? 49.551 40.328 44.911 1.00 27.65 ? 423 GLY B N   1 
ATOM 2290 C CA  . GLY B 1 27  ? 50.879 39.826 45.235 1.00 27.28 ? 423 GLY B CA  1 
ATOM 2291 C C   . GLY B 1 27  ? 50.970 38.814 46.366 1.00 28.60 ? 423 GLY B C   1 
ATOM 2292 O O   . GLY B 1 27  ? 52.057 38.569 46.892 1.00 28.45 ? 423 GLY B O   1 
ATOM 2293 N N   . GLN B 1 28  ? 49.848 38.200 46.724 1.00 29.60 ? 424 GLN B N   1 
ATOM 2294 C CA  . GLN B 1 28  ? 49.841 37.216 47.800 1.00 27.82 ? 424 GLN B CA  1 
ATOM 2295 C C   . GLN B 1 28  ? 48.807 36.124 47.584 1.00 25.78 ? 424 GLN B C   1 
ATOM 2296 O O   . GLN B 1 28  ? 48.987 35.002 48.047 1.00 25.99 ? 424 GLN B O   1 
ATOM 2297 C CB  . GLN B 1 28  ? 49.602 37.902 49.142 1.00 30.88 ? 424 GLN B CB  1 
ATOM 2298 N N   . TYR B 1 29  ? 47.739 36.442 46.862 1.00 24.03 ? 425 TYR B N   1 
ATOM 2299 C CA  . TYR B 1 29  ? 46.677 35.476 46.604 1.00 24.48 ? 425 TYR B CA  1 
ATOM 2300 C C   . TYR B 1 29  ? 46.762 34.806 45.227 1.00 23.85 ? 425 TYR B C   1 
ATOM 2301 O O   . TYR B 1 29  ? 46.766 35.479 44.194 1.00 23.75 ? 425 TYR B O   1 
ATOM 2302 C CB  . TYR B 1 29  ? 45.313 36.151 46.782 1.00 20.10 ? 425 TYR B CB  1 
ATOM 2303 N N   . ASP B 1 30  ? 46.863 33.481 45.214 1.00 23.12 ? 426 ASP B N   1 
ATOM 2304 C CA  . ASP B 1 30  ? 46.907 32.739 43.955 1.00 22.00 ? 426 ASP B CA  1 
ATOM 2305 C C   . ASP B 1 30  ? 45.469 32.615 43.458 1.00 17.08 ? 426 ASP B C   1 
ATOM 2306 O O   . ASP B 1 30  ? 44.567 32.310 44.237 1.00 15.85 ? 426 ASP B O   1 
ATOM 2307 C CB  . ASP B 1 30  ? 47.540 31.360 44.162 1.00 27.54 ? 426 ASP B CB  1 
ATOM 2308 C CG  . ASP B 1 30  ? 49.016 31.443 44.531 1.00 28.92 ? 426 ASP B CG  1 
ATOM 2309 O OD1 . ASP B 1 30  ? 49.596 30.404 44.915 1.00 30.24 ? 426 ASP B OD1 1 
ATOM 2310 O OD2 . ASP B 1 30  ? 49.600 32.544 44.435 1.00 28.52 ? 426 ASP B OD2 1 
ATOM 2311 N N   . VAL B 1 31  ? 45.255 32.841 42.166 1.00 13.56 ? 427 VAL B N   1 
ATOM 2312 C CA  . VAL B 1 31  ? 43.909 32.810 41.603 1.00 12.45 ? 427 VAL B CA  1 
ATOM 2313 C C   . VAL B 1 31  ? 43.767 32.131 40.246 1.00 13.93 ? 427 VAL B C   1 
ATOM 2314 O O   . VAL B 1 31  ? 44.742 31.905 39.528 1.00 15.85 ? 427 VAL B O   1 
ATOM 2315 C CB  . VAL B 1 31  ? 43.340 34.246 41.418 1.00 10.01 ? 427 VAL B CB  1 
ATOM 2316 C CG1 . VAL B 1 31  ? 43.282 34.991 42.741 1.00 12.17 ? 427 VAL B CG1 1 
ATOM 2317 C CG2 . VAL B 1 31  ? 44.184 35.015 40.409 1.00 12.71 ? 427 VAL B CG2 1 
ATOM 2318 N N   . ALA B 1 32  ? 42.517 31.853 39.898 1.00 12.30 ? 428 ALA B N   1 
ATOM 2319 C CA  . ALA B 1 32  ? 42.152 31.245 38.631 1.00 12.30 ? 428 ALA B CA  1 
ATOM 2320 C C   . ALA B 1 32  ? 41.238 32.288 38.023 1.00 10.93 ? 428 ALA B C   1 
ATOM 2321 O O   . ALA B 1 32  ? 40.383 32.823 38.724 1.00 12.65 ? 428 ALA B O   1 
ATOM 2322 C CB  . ALA B 1 32  ? 41.386 29.957 38.871 1.00 10.91 ? 428 ALA B CB  1 
ATOM 2323 N N   . ILE B 1 33  ? 41.436 32.618 36.750 1.00 12.14 ? 429 ILE B N   1 
ATOM 2324 C CA  . ILE B 1 33  ? 40.597 33.622 36.110 1.00 14.63 ? 429 ILE B CA  1 
ATOM 2325 C C   . ILE B 1 33  ? 39.573 33.051 35.124 1.00 18.66 ? 429 ILE B C   1 
ATOM 2326 O O   . ILE B 1 33  ? 39.934 32.469 34.095 1.00 19.46 ? 429 ILE B O   1 
ATOM 2327 C CB  . ILE B 1 33  ? 41.441 34.832 35.525 1.00 13.45 ? 429 ILE B CB  1 
ATOM 2328 C CG1 . ILE B 1 33  ? 40.693 35.558 34.415 1.00 7.39  ? 429 ILE B CG1 1 
ATOM 2329 C CG2 . ILE B 1 33  ? 42.825 34.396 35.083 1.00 15.33 ? 429 ILE B CG2 1 
ATOM 2330 C CD1 . ILE B 1 33  ? 40.969 35.023 33.036 1.00 16.26 ? 429 ILE B CD1 1 
ATOM 2331 N N   . LYS B 1 34  ? 38.295 33.199 35.482 1.00 19.80 ? 430 LYS B N   1 
ATOM 2332 C CA  . LYS B 1 34  ? 37.161 32.726 34.689 1.00 21.31 ? 430 LYS B CA  1 
ATOM 2333 C C   . LYS B 1 34  ? 36.749 33.769 33.650 1.00 21.71 ? 430 LYS B C   1 
ATOM 2334 O O   . LYS B 1 34  ? 36.214 34.820 33.994 1.00 17.94 ? 430 LYS B O   1 
ATOM 2335 C CB  . LYS B 1 34  ? 35.978 32.421 35.606 1.00 20.55 ? 430 LYS B CB  1 
ATOM 2336 C CG  . LYS B 1 34  ? 34.755 31.868 34.901 1.00 25.20 ? 430 LYS B CG  1 
ATOM 2337 C CD  . LYS B 1 34  ? 34.992 30.445 34.442 1.00 29.40 ? 430 LYS B CD  1 
ATOM 2338 C CE  . LYS B 1 34  ? 33.692 29.770 34.064 1.00 29.23 ? 430 LYS B CE  1 
ATOM 2339 N NZ  . LYS B 1 34  ? 32.682 29.854 35.162 1.00 33.94 ? 430 LYS B NZ  1 
ATOM 2340 N N   . MET B 1 35  ? 36.968 33.438 32.382 1.00 24.22 ? 431 MET B N   1 
ATOM 2341 C CA  . MET B 1 35  ? 36.668 34.320 31.260 1.00 26.94 ? 431 MET B CA  1 
ATOM 2342 C C   . MET B 1 35  ? 35.339 33.992 30.575 1.00 30.22 ? 431 MET B C   1 
ATOM 2343 O O   . MET B 1 35  ? 34.966 32.823 30.447 1.00 32.27 ? 431 MET B O   1 
ATOM 2344 C CB  . MET B 1 35  ? 37.814 34.211 30.257 1.00 29.16 ? 431 MET B CB  1 
ATOM 2345 C CG  . MET B 1 35  ? 37.670 35.004 28.993 1.00 28.32 ? 431 MET B CG  1 
ATOM 2346 S SD  . MET B 1 35  ? 38.671 34.218 27.732 1.00 29.24 ? 431 MET B SD  1 
ATOM 2347 C CE  . MET B 1 35  ? 37.422 33.825 26.504 1.00 30.72 ? 431 MET B CE  1 
ATOM 2348 N N   . ILE B 1 36  ? 34.632 35.031 30.129 1.00 34.07 ? 432 ILE B N   1 
ATOM 2349 C CA  . ILE B 1 36  ? 33.343 34.858 29.452 1.00 35.28 ? 432 ILE B CA  1 
ATOM 2350 C C   . ILE B 1 36  ? 33.499 35.208 27.964 1.00 33.87 ? 432 ILE B C   1 
ATOM 2351 O O   . ILE B 1 36  ? 34.414 34.717 27.309 1.00 34.55 ? 432 ILE B O   1 
ATOM 2352 C CB  . ILE B 1 36  ? 32.218 35.740 30.089 1.00 34.75 ? 432 ILE B CB  1 
ATOM 2353 C CG1 . ILE B 1 36  ? 32.396 35.858 31.606 1.00 33.83 ? 432 ILE B CG1 1 
ATOM 2354 C CG2 . ILE B 1 36  ? 30.852 35.123 29.802 1.00 33.26 ? 432 ILE B CG2 1 
ATOM 2355 C CD1 . ILE B 1 36  ? 32.347 34.538 32.352 1.00 35.34 ? 432 ILE B CD1 1 
ATOM 2356 N N   . LYS B 1 37  ? 32.623 36.067 27.445 1.00 33.43 ? 433 LYS B N   1 
ATOM 2357 C CA  . LYS B 1 37  ? 32.646 36.499 26.045 1.00 31.18 ? 433 LYS B CA  1 
ATOM 2358 C C   . LYS B 1 37  ? 31.910 37.837 25.985 1.00 30.74 ? 433 LYS B C   1 
ATOM 2359 O O   . LYS B 1 37  ? 30.782 37.944 26.483 1.00 29.85 ? 433 LYS B O   1 
ATOM 2360 C CB  . LYS B 1 37  ? 31.888 35.507 25.146 1.00 27.65 ? 433 LYS B CB  1 
ATOM 2361 C CG  . LYS B 1 37  ? 32.416 34.073 25.107 1.00 24.55 ? 433 LYS B CG  1 
ATOM 2362 C CD  . LYS B 1 37  ? 33.793 33.983 24.475 1.00 27.10 ? 433 LYS B CD  1 
ATOM 2363 C CE  . LYS B 1 37  ? 33.807 34.598 23.094 1.00 24.68 ? 433 LYS B CE  1 
ATOM 2364 N NZ  . LYS B 1 37  ? 35.145 34.557 22.439 1.00 18.58 ? 433 LYS B NZ  1 
ATOM 2365 N N   . GLU B 1 38  ? 32.535 38.861 25.410 1.00 30.55 ? 434 GLU B N   1 
ATOM 2366 C CA  . GLU B 1 38  ? 31.863 40.153 25.300 1.00 29.48 ? 434 GLU B CA  1 
ATOM 2367 C C   . GLU B 1 38  ? 30.835 40.005 24.189 1.00 31.41 ? 434 GLU B C   1 
ATOM 2368 O O   . GLU B 1 38  ? 31.047 40.420 23.054 1.00 29.99 ? 434 GLU B O   1 
ATOM 2369 C CB  . GLU B 1 38  ? 32.850 41.282 24.994 1.00 29.95 ? 434 GLU B CB  1 
ATOM 2370 C CG  . GLU B 1 38  ? 32.215 42.691 24.991 1.00 26.07 ? 434 GLU B CG  1 
ATOM 2371 C CD  . GLU B 1 38  ? 33.233 43.829 24.915 1.00 21.62 ? 434 GLU B CD  1 
ATOM 2372 O OE1 . GLU B 1 38  ? 34.425 43.574 24.649 1.00 24.27 ? 434 GLU B OE1 1 
ATOM 2373 O OE2 . GLU B 1 38  ? 32.837 44.992 25.130 1.00 19.02 ? 434 GLU B OE2 1 
ATOM 2374 N N   . GLY B 1 39  ? 29.742 39.334 24.526 1.00 35.03 ? 435 GLY B N   1 
ATOM 2375 C CA  . GLY B 1 39  ? 28.671 39.085 23.581 1.00 37.48 ? 435 GLY B CA  1 
ATOM 2376 C C   . GLY B 1 39  ? 27.610 38.249 24.270 1.00 39.46 ? 435 GLY B C   1 
ATOM 2377 O O   . GLY B 1 39  ? 26.795 37.605 23.613 1.00 40.93 ? 435 GLY B O   1 
ATOM 2378 N N   . SER B 1 40  ? 27.626 38.257 25.603 1.00 37.43 ? 436 SER B N   1 
ATOM 2379 C CA  . SER B 1 40  ? 26.671 37.497 26.392 1.00 37.99 ? 436 SER B CA  1 
ATOM 2380 C C   . SER B 1 40  ? 26.560 38.083 27.799 1.00 39.64 ? 436 SER B C   1 
ATOM 2381 O O   . SER B 1 40  ? 25.600 38.789 28.110 1.00 41.69 ? 436 SER B O   1 
ATOM 2382 C CB  . SER B 1 40  ? 27.107 36.030 26.476 1.00 41.23 ? 436 SER B CB  1 
ATOM 2383 O OG  . SER B 1 40  ? 27.624 35.565 25.240 1.00 42.60 ? 436 SER B OG  1 
ATOM 2384 N N   . MET B 1 41  ? 27.555 37.798 28.640 1.00 39.73 ? 437 MET B N   1 
ATOM 2385 C CA  . MET B 1 41  ? 27.580 38.277 30.024 1.00 38.94 ? 437 MET B CA  1 
ATOM 2386 C C   . MET B 1 41  ? 27.923 39.767 30.095 1.00 39.09 ? 437 MET B C   1 
ATOM 2387 O O   . MET B 1 41  ? 28.389 40.353 29.114 1.00 36.63 ? 437 MET B O   1 
ATOM 2388 C CB  . MET B 1 41  ? 28.591 37.462 30.832 1.00 40.22 ? 437 MET B CB  1 
ATOM 2389 C CG  . MET B 1 41  ? 28.318 37.367 32.325 1.00 35.33 ? 437 MET B CG  1 
ATOM 2390 S SD  . MET B 1 41  ? 29.214 35.957 33.007 1.00 41.10 ? 437 MET B SD  1 
ATOM 2391 C CE  . MET B 1 41  ? 29.769 36.561 34.621 1.00 31.14 ? 437 MET B CE  1 
ATOM 2392 N N   . SER B 1 42  ? 27.723 40.367 31.267 1.00 39.27 ? 438 SER B N   1 
ATOM 2393 C CA  . SER B 1 42  ? 27.990 41.787 31.447 1.00 37.97 ? 438 SER B CA  1 
ATOM 2394 C C   . SER B 1 42  ? 28.150 42.199 32.906 1.00 36.36 ? 438 SER B C   1 
ATOM 2395 O O   . SER B 1 42  ? 27.639 41.529 33.805 1.00 34.72 ? 438 SER B O   1 
ATOM 2396 C CB  . SER B 1 42  ? 26.845 42.593 30.835 1.00 38.54 ? 438 SER B CB  1 
ATOM 2397 O OG  . SER B 1 42  ? 25.603 42.171 31.372 1.00 33.86 ? 438 SER B OG  1 
ATOM 2398 N N   . GLU B 1 43  ? 28.807 43.339 33.117 1.00 37.58 ? 439 GLU B N   1 
ATOM 2399 C CA  . GLU B 1 43  ? 29.034 43.904 34.452 1.00 37.09 ? 439 GLU B CA  1 
ATOM 2400 C C   . GLU B 1 43  ? 27.728 44.309 35.146 1.00 36.76 ? 439 GLU B C   1 
ATOM 2401 O O   . GLU B 1 43  ? 27.696 44.522 36.363 1.00 32.43 ? 439 GLU B O   1 
ATOM 2402 C CB  . GLU B 1 43  ? 29.945 45.139 34.361 1.00 37.29 ? 439 GLU B CB  1 
ATOM 2403 C CG  . GLU B 1 43  ? 29.372 46.302 33.537 1.00 37.02 ? 439 GLU B CG  1 
ATOM 2404 C CD  . GLU B 1 43  ? 30.217 47.572 33.606 1.00 36.40 ? 439 GLU B CD  1 
ATOM 2405 O OE1 . GLU B 1 43  ? 30.640 47.957 34.719 1.00 36.07 ? 439 GLU B OE1 1 
ATOM 2406 O OE2 . GLU B 1 43  ? 30.450 48.195 32.544 1.00 35.38 ? 439 GLU B OE2 1 
ATOM 2407 N N   . ASP B 1 44  ? 26.662 44.426 34.359 1.00 35.30 ? 440 ASP B N   1 
ATOM 2408 C CA  . ASP B 1 44  ? 25.362 44.826 34.867 1.00 32.48 ? 440 ASP B CA  1 
ATOM 2409 C C   . ASP B 1 44  ? 24.480 43.626 35.179 1.00 31.97 ? 440 ASP B C   1 
ATOM 2410 O O   . ASP B 1 44  ? 23.521 43.745 35.943 1.00 28.02 ? 440 ASP B O   1 
ATOM 2411 C CB  . ASP B 1 44  ? 24.662 45.730 33.848 1.00 36.16 ? 440 ASP B CB  1 
ATOM 2412 C CG  . ASP B 1 44  ? 25.592 46.775 33.253 1.00 40.98 ? 440 ASP B CG  1 
ATOM 2413 O OD1 . ASP B 1 44  ? 25.560 47.945 33.691 1.00 39.71 ? 440 ASP B OD1 1 
ATOM 2414 O OD2 . ASP B 1 44  ? 26.358 46.426 32.334 1.00 37.76 ? 440 ASP B OD2 1 
ATOM 2415 N N   . GLU B 1 45  ? 24.783 42.477 34.574 1.00 33.36 ? 441 GLU B N   1 
ATOM 2416 C CA  . GLU B 1 45  ? 23.978 41.278 34.815 1.00 33.34 ? 441 GLU B CA  1 
ATOM 2417 C C   . GLU B 1 45  ? 24.414 40.546 36.077 1.00 32.17 ? 441 GLU B C   1 
ATOM 2418 O O   . GLU B 1 45  ? 23.586 40.191 36.930 1.00 29.45 ? 441 GLU B O   1 
ATOM 2419 C CB  . GLU B 1 45  ? 24.000 40.317 33.601 1.00 33.19 ? 441 GLU B CB  1 
ATOM 2420 C CG  . GLU B 1 45  ? 25.090 39.216 33.599 1.00 34.36 ? 441 GLU B CG  1 
ATOM 2421 C CD  . GLU B 1 45  ? 24.702 37.934 34.361 1.00 36.00 ? 441 GLU B CD  1 
ATOM 2422 O OE1 . GLU B 1 45  ? 25.523 36.989 34.398 1.00 35.37 ? 441 GLU B OE1 1 
ATOM 2423 O OE2 . GLU B 1 45  ? 23.585 37.858 34.918 1.00 34.93 ? 441 GLU B OE2 1 
ATOM 2424 N N   . PHE B 1 46  ? 25.719 40.357 36.220 1.00 29.54 ? 442 PHE B N   1 
ATOM 2425 C CA  . PHE B 1 46  ? 26.202 39.631 37.366 1.00 31.35 ? 442 PHE B CA  1 
ATOM 2426 C C   . PHE B 1 46  ? 26.494 40.449 38.604 1.00 32.00 ? 442 PHE B C   1 
ATOM 2427 O O   . PHE B 1 46  ? 26.809 39.879 39.634 1.00 34.02 ? 442 PHE B O   1 
ATOM 2428 C CB  . PHE B 1 46  ? 27.382 38.730 36.988 1.00 28.63 ? 442 PHE B CB  1 
ATOM 2429 C CG  . PHE B 1 46  ? 28.708 39.424 36.944 1.00 22.65 ? 442 PHE B CG  1 
ATOM 2430 C CD1 . PHE B 1 46  ? 29.837 38.790 37.440 1.00 20.14 ? 442 PHE B CD1 1 
ATOM 2431 C CD2 . PHE B 1 46  ? 28.843 40.683 36.387 1.00 22.28 ? 442 PHE B CD2 1 
ATOM 2432 C CE1 . PHE B 1 46  ? 31.072 39.390 37.379 1.00 17.92 ? 442 PHE B CE1 1 
ATOM 2433 C CE2 . PHE B 1 46  ? 30.081 41.291 36.323 1.00 24.89 ? 442 PHE B CE2 1 
ATOM 2434 C CZ  . PHE B 1 46  ? 31.198 40.641 36.822 1.00 18.41 ? 442 PHE B CZ  1 
ATOM 2435 N N   . ILE B 1 47  ? 26.343 41.767 38.529 1.00 31.37 ? 443 ILE B N   1 
ATOM 2436 C CA  . ILE B 1 47  ? 26.608 42.613 39.689 1.00 34.20 ? 443 ILE B CA  1 
ATOM 2437 C C   . ILE B 1 47  ? 25.758 42.142 40.866 1.00 34.50 ? 443 ILE B C   1 
ATOM 2438 O O   . ILE B 1 47  ? 26.243 42.006 41.993 1.00 33.00 ? 443 ILE B O   1 
ATOM 2439 C CB  . ILE B 1 47  ? 26.334 44.114 39.393 1.00 35.12 ? 443 ILE B CB  1 
ATOM 2440 C CG1 . ILE B 1 47  ? 26.577 44.961 40.649 1.00 36.71 ? 443 ILE B CG1 1 
ATOM 2441 C CG2 . ILE B 1 47  ? 24.913 44.314 38.889 1.00 35.43 ? 443 ILE B CG2 1 
ATOM 2442 C CD1 . ILE B 1 47  ? 28.010 44.938 41.152 1.00 33.98 ? 443 ILE B CD1 1 
ATOM 2443 N N   . GLU B 1 48  ? 24.499 41.840 40.577 1.00 33.96 ? 444 GLU B N   1 
ATOM 2444 C CA  . GLU B 1 48  ? 23.576 41.364 41.593 1.00 33.66 ? 444 GLU B CA  1 
ATOM 2445 C C   . GLU B 1 48  ? 24.159 40.064 42.158 1.00 33.11 ? 444 GLU B C   1 
ATOM 2446 O O   . GLU B 1 48  ? 24.610 40.024 43.305 1.00 30.69 ? 444 GLU B O   1 
ATOM 2447 C CB  . GLU B 1 48  ? 22.199 41.122 40.955 1.00 34.83 ? 444 GLU B CB  1 
ATOM 2448 C CG  . GLU B 1 48  ? 21.019 41.072 41.920 1.00 34.28 ? 444 GLU B CG  1 
ATOM 2449 C CD  . GLU B 1 48  ? 20.937 39.782 42.712 1.00 35.97 ? 444 GLU B CD  1 
ATOM 2450 O OE1 . GLU B 1 48  ? 21.288 38.710 42.167 1.00 32.68 ? 444 GLU B OE1 1 
ATOM 2451 O OE2 . GLU B 1 48  ? 20.501 39.841 43.881 1.00 36.01 ? 444 GLU B OE2 1 
ATOM 2452 N N   . GLU B 1 49  ? 24.239 39.042 41.307 1.00 32.60 ? 445 GLU B N   1 
ATOM 2453 C CA  . GLU B 1 49  ? 24.752 37.731 41.688 1.00 30.53 ? 445 GLU B CA  1 
ATOM 2454 C C   . GLU B 1 49  ? 26.134 37.732 42.328 1.00 31.12 ? 445 GLU B C   1 
ATOM 2455 O O   . GLU B 1 49  ? 26.404 36.934 43.225 1.00 33.61 ? 445 GLU B O   1 
ATOM 2456 C CB  . GLU B 1 49  ? 24.753 36.784 40.486 1.00 31.01 ? 445 GLU B CB  1 
ATOM 2457 C CG  . GLU B 1 49  ? 23.366 36.338 40.032 1.00 28.32 ? 445 GLU B CG  1 
ATOM 2458 C CD  . GLU B 1 49  ? 23.382 35.007 39.296 1.00 28.84 ? 445 GLU B CD  1 
ATOM 2459 O OE1 . GLU B 1 49  ? 24.392 34.275 39.386 1.00 28.01 ? 445 GLU B OE1 1 
ATOM 2460 O OE2 . GLU B 1 49  ? 22.372 34.682 38.640 1.00 27.39 ? 445 GLU B OE2 1 
ATOM 2461 N N   . ALA B 1 50  ? 26.993 38.643 41.888 1.00 30.01 ? 446 ALA B N   1 
ATOM 2462 C CA  . ALA B 1 50  ? 28.351 38.739 42.410 1.00 29.17 ? 446 ALA B CA  1 
ATOM 2463 C C   . ALA B 1 50  ? 28.312 39.065 43.894 1.00 30.07 ? 446 ALA B C   1 
ATOM 2464 O O   . ALA B 1 50  ? 28.845 38.317 44.712 1.00 31.57 ? 446 ALA B O   1 
ATOM 2465 C CB  . ALA B 1 50  ? 29.145 39.800 41.655 1.00 27.22 ? 446 ALA B CB  1 
ATOM 2466 N N   . LYS B 1 51  ? 27.634 40.153 44.240 1.00 30.54 ? 447 LYS B N   1 
ATOM 2467 C CA  . LYS B 1 51  ? 27.525 40.574 45.631 1.00 29.93 ? 447 LYS B CA  1 
ATOM 2468 C C   . LYS B 1 51  ? 26.917 39.465 46.487 1.00 31.89 ? 447 LYS B C   1 
ATOM 2469 O O   . LYS B 1 51  ? 27.393 39.194 47.597 1.00 31.20 ? 447 LYS B O   1 
ATOM 2470 C CB  . LYS B 1 51  ? 26.676 41.847 45.742 1.00 29.51 ? 447 LYS B CB  1 
ATOM 2471 C CG  . LYS B 1 51  ? 27.176 43.023 44.906 1.00 27.76 ? 447 LYS B CG  1 
ATOM 2472 C CD  . LYS B 1 51  ? 28.634 43.362 45.198 1.00 24.63 ? 447 LYS B CD  1 
ATOM 2473 C CE  . LYS B 1 51  ? 28.846 43.812 46.635 1.00 23.47 ? 447 LYS B CE  1 
ATOM 2474 N NZ  . LYS B 1 51  ? 30.298 43.984 46.929 1.00 24.76 ? 447 LYS B NZ  1 
ATOM 2475 N N   . VAL B 1 52  ? 25.893 38.804 45.949 1.00 31.29 ? 448 VAL B N   1 
ATOM 2476 C CA  . VAL B 1 52  ? 25.207 37.725 46.651 1.00 30.04 ? 448 VAL B CA  1 
ATOM 2477 C C   . VAL B 1 52  ? 26.126 36.531 46.881 1.00 30.34 ? 448 VAL B C   1 
ATOM 2478 O O   . VAL B 1 52  ? 26.074 35.900 47.939 1.00 31.49 ? 448 VAL B O   1 
ATOM 2479 C CB  . VAL B 1 52  ? 23.958 37.250 45.882 1.00 29.87 ? 448 VAL B CB  1 
ATOM 2480 C CG1 . VAL B 1 52  ? 23.189 36.226 46.705 1.00 28.85 ? 448 VAL B CG1 1 
ATOM 2481 C CG2 . VAL B 1 52  ? 23.062 38.428 45.547 1.00 33.30 ? 448 VAL B CG2 1 
ATOM 2482 N N   . MET B 1 53  ? 26.963 36.215 45.897 1.00 29.17 ? 449 MET B N   1 
ATOM 2483 C CA  . MET B 1 53  ? 27.882 35.091 46.027 1.00 27.85 ? 449 MET B CA  1 
ATOM 2484 C C   . MET B 1 53  ? 28.994 35.425 46.997 1.00 29.13 ? 449 MET B C   1 
ATOM 2485 O O   . MET B 1 53  ? 29.497 34.551 47.694 1.00 32.51 ? 449 MET B O   1 
ATOM 2486 C CB  . MET B 1 53  ? 28.473 34.708 44.676 1.00 27.95 ? 449 MET B CB  1 
ATOM 2487 C CG  . MET B 1 53  ? 27.570 33.842 43.834 1.00 25.86 ? 449 MET B CG  1 
ATOM 2488 S SD  . MET B 1 53  ? 27.991 33.992 42.101 1.00 28.55 ? 449 MET B SD  1 
ATOM 2489 C CE  . MET B 1 53  ? 29.603 33.105 42.046 1.00 24.75 ? 449 MET B CE  1 
ATOM 2490 N N   . MET B 1 54  ? 29.376 36.696 47.046 1.00 27.71 ? 450 MET B N   1 
ATOM 2491 C CA  . MET B 1 54  ? 30.422 37.130 47.955 1.00 25.39 ? 450 MET B CA  1 
ATOM 2492 C C   . MET B 1 54  ? 29.883 37.103 49.381 1.00 27.55 ? 450 MET B C   1 
ATOM 2493 O O   . MET B 1 54  ? 30.627 37.257 50.351 1.00 28.08 ? 450 MET B O   1 
ATOM 2494 C CB  . MET B 1 54  ? 30.926 38.512 47.558 1.00 24.26 ? 450 MET B CB  1 
ATOM 2495 C CG  . MET B 1 54  ? 31.553 38.506 46.179 1.00 23.94 ? 450 MET B CG  1 
ATOM 2496 S SD  . MET B 1 54  ? 32.473 39.970 45.741 1.00 32.01 ? 450 MET B SD  1 
ATOM 2497 C CE  . MET B 1 54  ? 33.957 39.761 46.735 1.00 25.95 ? 450 MET B CE  1 
ATOM 2498 N N   . ASN B 1 55  ? 28.573 36.904 49.499 1.00 24.81 ? 451 ASN B N   1 
ATOM 2499 C CA  . ASN B 1 55  ? 27.919 36.800 50.796 1.00 23.63 ? 451 ASN B CA  1 
ATOM 2500 C C   . ASN B 1 55  ? 28.157 35.389 51.299 1.00 24.31 ? 451 ASN B C   1 
ATOM 2501 O O   . ASN B 1 55  ? 27.841 35.065 52.447 1.00 23.55 ? 451 ASN B O   1 
ATOM 2502 C CB  . ASN B 1 55  ? 26.414 37.017 50.662 1.00 22.42 ? 451 ASN B CB  1 
ATOM 2503 C CG  . ASN B 1 55  ? 25.999 38.446 50.915 1.00 20.08 ? 451 ASN B CG  1 
ATOM 2504 O OD1 . ASN B 1 55  ? 24.868 38.701 51.326 1.00 22.32 ? 451 ASN B OD1 1 
ATOM 2505 N ND2 . ASN B 1 55  ? 26.896 39.390 50.656 1.00 17.73 ? 451 ASN B ND2 1 
ATOM 2506 N N   . LEU B 1 56  ? 28.657 34.539 50.406 1.00 23.43 ? 452 LEU B N   1 
ATOM 2507 C CA  . LEU B 1 56  ? 28.946 33.146 50.714 1.00 21.56 ? 452 LEU B CA  1 
ATOM 2508 C C   . LEU B 1 56  ? 30.414 32.985 51.050 1.00 22.10 ? 452 LEU B C   1 
ATOM 2509 O O   . LEU B 1 56  ? 31.280 33.131 50.191 1.00 25.35 ? 452 LEU B O   1 
ATOM 2510 C CB  . LEU B 1 56  ? 28.585 32.255 49.522 1.00 21.06 ? 452 LEU B CB  1 
ATOM 2511 C CG  . LEU B 1 56  ? 27.138 31.762 49.400 1.00 20.32 ? 452 LEU B CG  1 
ATOM 2512 C CD1 . LEU B 1 56  ? 26.150 32.810 49.869 1.00 20.52 ? 452 LEU B CD1 1 
ATOM 2513 C CD2 . LEU B 1 56  ? 26.869 31.351 47.968 1.00 18.22 ? 452 LEU B CD2 1 
ATOM 2514 N N   . SER B 1 57  ? 30.688 32.718 52.317 1.00 22.10 ? 453 SER B N   1 
ATOM 2515 C CA  . SER B 1 57  ? 32.047 32.525 52.784 1.00 21.51 ? 453 SER B CA  1 
ATOM 2516 C C   . SER B 1 57  ? 32.051 31.314 53.690 1.00 20.26 ? 453 SER B C   1 
ATOM 2517 O O   . SER B 1 57  ? 31.201 31.182 54.576 1.00 21.49 ? 453 SER B O   1 
ATOM 2518 C CB  . SER B 1 57  ? 32.537 33.751 53.565 1.00 27.28 ? 453 SER B CB  1 
ATOM 2519 O OG  . SER B 1 57  ? 32.794 34.849 52.707 1.00 32.08 ? 453 SER B OG  1 
ATOM 2520 N N   . HIS B 1 58  ? 32.979 30.407 53.425 1.00 16.43 ? 454 HIS B N   1 
ATOM 2521 C CA  . HIS B 1 58  ? 33.134 29.195 54.203 1.00 14.23 ? 454 HIS B CA  1 
ATOM 2522 C C   . HIS B 1 58  ? 34.378 28.535 53.666 1.00 13.02 ? 454 HIS B C   1 
ATOM 2523 O O   . HIS B 1 58  ? 34.569 28.478 52.462 1.00 14.69 ? 454 HIS B O   1 
ATOM 2524 C CB  . HIS B 1 58  ? 31.930 28.256 54.025 1.00 13.19 ? 454 HIS B CB  1 
ATOM 2525 C CG  . HIS B 1 58  ? 31.921 27.100 54.982 1.00 12.78 ? 454 HIS B CG  1 
ATOM 2526 N ND1 . HIS B 1 58  ? 31.317 27.164 56.218 1.00 13.51 ? 454 HIS B ND1 1 
ATOM 2527 C CD2 . HIS B 1 58  ? 32.496 25.875 54.910 1.00 11.15 ? 454 HIS B CD2 1 
ATOM 2528 C CE1 . HIS B 1 58  ? 31.526 26.033 56.871 1.00 12.23 ? 454 HIS B CE1 1 
ATOM 2529 N NE2 . HIS B 1 58  ? 32.241 25.235 56.099 1.00 6.57  ? 454 HIS B NE2 1 
ATOM 2530 N N   . GLU B 1 59  ? 35.225 28.064 54.572 1.00 17.21 ? 455 GLU B N   1 
ATOM 2531 C CA  . GLU B 1 59  ? 36.472 27.373 54.247 1.00 19.94 ? 455 GLU B CA  1 
ATOM 2532 C C   . GLU B 1 59  ? 36.294 26.179 53.294 1.00 18.16 ? 455 GLU B C   1 
ATOM 2533 O O   . GLU B 1 59  ? 37.260 25.701 52.706 1.00 17.46 ? 455 GLU B O   1 
ATOM 2534 C CB  . GLU B 1 59  ? 37.152 26.954 55.569 1.00 25.60 ? 455 GLU B CB  1 
ATOM 2535 C CG  . GLU B 1 59  ? 37.914 25.623 55.594 1.00 26.02 ? 455 GLU B CG  1 
ATOM 2536 C CD  . GLU B 1 59  ? 39.213 25.637 54.816 1.00 23.62 ? 455 GLU B CD  1 
ATOM 2537 O OE1 . GLU B 1 59  ? 39.525 24.609 54.188 1.00 26.91 ? 455 GLU B OE1 1 
ATOM 2538 O OE2 . GLU B 1 59  ? 39.926 26.661 54.834 1.00 26.89 ? 455 GLU B OE2 1 
ATOM 2539 N N   . LYS B 1 60  ? 35.059 25.716 53.121 1.00 17.18 ? 456 LYS B N   1 
ATOM 2540 C CA  . LYS B 1 60  ? 34.791 24.581 52.239 1.00 15.92 ? 456 LYS B CA  1 
ATOM 2541 C C   . LYS B 1 60  ? 34.148 24.962 50.897 1.00 16.33 ? 456 LYS B C   1 
ATOM 2542 O O   . LYS B 1 60  ? 33.760 24.091 50.108 1.00 11.16 ? 456 LYS B O   1 
ATOM 2543 C CB  . LYS B 1 60  ? 33.958 23.528 52.970 1.00 18.08 ? 456 LYS B CB  1 
ATOM 2544 C CG  . LYS B 1 60  ? 34.661 22.920 54.182 1.00 15.32 ? 456 LYS B CG  1 
ATOM 2545 C CD  . LYS B 1 60  ? 35.909 22.160 53.764 1.00 16.08 ? 456 LYS B CD  1 
ATOM 2546 C CE  . LYS B 1 60  ? 36.628 21.511 54.935 1.00 14.75 ? 456 LYS B CE  1 
ATOM 2547 N NZ  . LYS B 1 60  ? 37.413 22.460 55.750 1.00 15.29 ? 456 LYS B NZ  1 
ATOM 2548 N N   . LEU B 1 61  ? 34.015 26.265 50.653 1.00 15.73 ? 457 LEU B N   1 
ATOM 2549 C CA  . LEU B 1 61  ? 33.454 26.774 49.404 1.00 14.51 ? 457 LEU B CA  1 
ATOM 2550 C C   . LEU B 1 61  ? 34.613 27.473 48.722 1.00 11.29 ? 457 LEU B C   1 
ATOM 2551 O O   . LEU B 1 61  ? 35.400 28.152 49.385 1.00 14.89 ? 457 LEU B O   1 
ATOM 2552 C CB  . LEU B 1 61  ? 32.349 27.809 49.658 1.00 14.58 ? 457 LEU B CB  1 
ATOM 2553 C CG  . LEU B 1 61  ? 30.948 27.463 50.169 1.00 11.43 ? 457 LEU B CG  1 
ATOM 2554 C CD1 . LEU B 1 61  ? 30.166 28.752 50.355 1.00 9.22  ? 457 LEU B CD1 1 
ATOM 2555 C CD2 . LEU B 1 61  ? 30.216 26.576 49.186 1.00 13.55 ? 457 LEU B CD2 1 
ATOM 2556 N N   . VAL B 1 62  ? 34.756 27.282 47.417 1.00 14.60 ? 458 VAL B N   1 
ATOM 2557 C CA  . VAL B 1 62  ? 35.831 27.945 46.690 1.00 13.47 ? 458 VAL B CA  1 
ATOM 2558 C C   . VAL B 1 62  ? 35.418 29.414 46.627 1.00 17.55 ? 458 VAL B C   1 
ATOM 2559 O O   . VAL B 1 62  ? 34.339 29.744 46.129 1.00 19.50 ? 458 VAL B O   1 
ATOM 2560 C CB  . VAL B 1 62  ? 36.015 27.338 45.292 1.00 10.95 ? 458 VAL B CB  1 
ATOM 2561 C CG1 . VAL B 1 62  ? 37.107 28.080 44.523 1.00 8.36  ? 458 VAL B CG1 1 
ATOM 2562 C CG2 . VAL B 1 62  ? 36.377 25.870 45.425 1.00 4.94  ? 458 VAL B CG2 1 
ATOM 2563 N N   . GLN B 1 63  ? 36.256 30.288 47.173 1.00 19.70 ? 459 GLN B N   1 
ATOM 2564 C CA  . GLN B 1 63  ? 35.930 31.710 47.231 1.00 22.06 ? 459 GLN B CA  1 
ATOM 2565 C C   . GLN B 1 63  ? 36.165 32.594 46.019 1.00 21.06 ? 459 GLN B C   1 
ATOM 2566 O O   . GLN B 1 63  ? 37.209 32.543 45.370 1.00 22.08 ? 459 GLN B O   1 
ATOM 2567 C CB  . GLN B 1 63  ? 36.572 32.360 48.461 1.00 22.66 ? 459 GLN B CB  1 
ATOM 2568 C CG  . GLN B 1 63  ? 38.082 32.441 48.427 1.00 29.48 ? 459 GLN B CG  1 
ATOM 2569 C CD  . GLN B 1 63  ? 38.657 32.969 49.727 1.00 31.10 ? 459 GLN B CD  1 
ATOM 2570 O OE1 . GLN B 1 63  ? 39.341 32.248 50.454 1.00 26.32 ? 459 GLN B OE1 1 
ATOM 2571 N NE2 . GLN B 1 63  ? 38.370 34.230 50.033 1.00 29.38 ? 459 GLN B NE2 1 
ATOM 2572 N N   . LEU B 1 64  ? 35.177 33.435 45.754 1.00 21.47 ? 460 LEU B N   1 
ATOM 2573 C CA  . LEU B 1 64  ? 35.224 34.395 44.665 1.00 23.95 ? 460 LEU B CA  1 
ATOM 2574 C C   . LEU B 1 64  ? 35.953 35.592 45.278 1.00 24.95 ? 460 LEU B C   1 
ATOM 2575 O O   . LEU B 1 64  ? 35.416 36.254 46.165 1.00 25.13 ? 460 LEU B O   1 
ATOM 2576 C CB  . LEU B 1 64  ? 33.786 34.778 44.269 1.00 22.50 ? 460 LEU B CB  1 
ATOM 2577 C CG  . LEU B 1 64  ? 33.466 35.635 43.034 1.00 22.00 ? 460 LEU B CG  1 
ATOM 2578 C CD1 . LEU B 1 64  ? 31.973 35.572 42.746 1.00 24.79 ? 460 LEU B CD1 1 
ATOM 2579 C CD2 . LEU B 1 64  ? 33.895 37.074 43.243 1.00 22.74 ? 460 LEU B CD2 1 
ATOM 2580 N N   . TYR B 1 65  ? 37.198 35.821 44.873 1.00 24.81 ? 461 TYR B N   1 
ATOM 2581 C CA  . TYR B 1 65  ? 37.966 36.943 45.411 1.00 25.17 ? 461 TYR B CA  1 
ATOM 2582 C C   . TYR B 1 65  ? 37.407 38.259 44.871 1.00 27.25 ? 461 TYR B C   1 
ATOM 2583 O O   . TYR B 1 65  ? 37.293 39.246 45.596 1.00 26.29 ? 461 TYR B O   1 
ATOM 2584 C CB  . TYR B 1 65  ? 39.457 36.816 45.064 1.00 25.82 ? 461 TYR B CB  1 
ATOM 2585 C CG  . TYR B 1 65  ? 40.199 35.689 45.774 1.00 25.50 ? 461 TYR B CG  1 
ATOM 2586 C CD1 . TYR B 1 65  ? 40.773 34.643 45.050 1.00 26.73 ? 461 TYR B CD1 1 
ATOM 2587 C CD2 . TYR B 1 65  ? 40.347 35.682 47.161 1.00 25.96 ? 461 TYR B CD2 1 
ATOM 2588 C CE1 . TYR B 1 65  ? 41.476 33.618 45.682 1.00 24.71 ? 461 TYR B CE1 1 
ATOM 2589 C CE2 . TYR B 1 65  ? 41.050 34.659 47.807 1.00 25.37 ? 461 TYR B CE2 1 
ATOM 2590 C CZ  . TYR B 1 65  ? 41.612 33.631 47.058 1.00 25.30 ? 461 TYR B CZ  1 
ATOM 2591 O OH  . TYR B 1 65  ? 42.317 32.622 47.681 1.00 25.28 ? 461 TYR B OH  1 
ATOM 2592 N N   . GLY B 1 66  ? 37.041 38.262 43.596 1.00 27.06 ? 462 GLY B N   1 
ATOM 2593 C CA  . GLY B 1 66  ? 36.499 39.464 42.993 1.00 24.45 ? 462 GLY B CA  1 
ATOM 2594 C C   . GLY B 1 66  ? 36.196 39.275 41.523 1.00 22.73 ? 462 GLY B C   1 
ATOM 2595 O O   . GLY B 1 66  ? 36.553 38.262 40.935 1.00 20.21 ? 462 GLY B O   1 
ATOM 2596 N N   . VAL B 1 67  ? 35.527 40.253 40.930 1.00 24.33 ? 463 VAL B N   1 
ATOM 2597 C CA  . VAL B 1 67  ? 35.182 40.198 39.523 1.00 24.62 ? 463 VAL B CA  1 
ATOM 2598 C C   . VAL B 1 67  ? 35.478 41.528 38.861 1.00 24.47 ? 463 VAL B C   1 
ATOM 2599 O O   . VAL B 1 67  ? 35.418 42.584 39.504 1.00 24.70 ? 463 VAL B O   1 
ATOM 2600 C CB  . VAL B 1 67  ? 33.697 39.891 39.319 1.00 27.36 ? 463 VAL B CB  1 
ATOM 2601 C CG1 . VAL B 1 67  ? 33.368 38.519 39.854 1.00 33.31 ? 463 VAL B CG1 1 
ATOM 2602 C CG2 . VAL B 1 67  ? 32.843 40.935 40.011 1.00 30.70 ? 463 VAL B CG2 1 
ATOM 2603 N N   . CYS B 1 68  ? 35.829 41.473 37.584 1.00 27.38 ? 464 CYS B N   1 
ATOM 2604 C CA  . CYS B 1 68  ? 36.115 42.677 36.828 1.00 29.15 ? 464 CYS B CA  1 
ATOM 2605 C C   . CYS B 1 68  ? 34.779 43.162 36.302 1.00 29.60 ? 464 CYS B C   1 
ATOM 2606 O O   . CYS B 1 68  ? 34.321 42.744 35.238 1.00 27.69 ? 464 CYS B O   1 
ATOM 2607 C CB  . CYS B 1 68  ? 37.073 42.384 35.675 1.00 33.36 ? 464 CYS B CB  1 
ATOM 2608 S SG  . CYS B 1 68  ? 37.677 43.868 34.853 1.00 38.92 ? 464 CYS B SG  1 
ATOM 2609 N N   . THR B 1 69  ? 34.113 43.960 37.125 1.00 31.56 ? 465 THR B N   1 
ATOM 2610 C CA  . THR B 1 69  ? 32.815 44.528 36.807 1.00 30.98 ? 465 THR B CA  1 
ATOM 2611 C C   . THR B 1 69  ? 32.982 45.582 35.731 1.00 31.69 ? 465 THR B C   1 
ATOM 2612 O O   . THR B 1 69  ? 32.916 46.778 36.016 1.00 33.93 ? 465 THR B O   1 
ATOM 2613 C CB  . THR B 1 69  ? 32.208 45.184 38.058 1.00 31.96 ? 465 THR B CB  1 
ATOM 2614 O OG1 . THR B 1 69  ? 33.219 45.959 38.723 1.00 30.73 ? 465 THR B OG1 1 
ATOM 2615 C CG2 . THR B 1 69  ? 31.652 44.127 39.010 1.00 33.13 ? 465 THR B CG2 1 
ATOM 2616 N N   . LYS B 1 70  ? 33.238 45.138 34.508 1.00 32.07 ? 466 LYS B N   1 
ATOM 2617 C CA  . LYS B 1 70  ? 33.420 46.040 33.379 1.00 31.90 ? 466 LYS B CA  1 
ATOM 2618 C C   . LYS B 1 70  ? 32.844 45.326 32.162 1.00 35.07 ? 466 LYS B C   1 
ATOM 2619 O O   . LYS B 1 70  ? 32.073 44.374 32.314 1.00 35.06 ? 466 LYS B O   1 
ATOM 2620 C CB  . LYS B 1 70  ? 34.908 46.348 33.185 1.00 29.79 ? 466 LYS B CB  1 
ATOM 2621 C CG  . LYS B 1 70  ? 35.199 47.726 32.597 1.00 28.18 ? 466 LYS B CG  1 
ATOM 2622 C CD  . LYS B 1 70  ? 34.692 48.854 33.507 1.00 28.96 ? 466 LYS B CD  1 
ATOM 2623 C CE  . LYS B 1 70  ? 33.405 49.481 32.968 1.00 30.68 ? 466 LYS B CE  1 
ATOM 2624 N NZ  . LYS B 1 70  ? 32.784 50.444 33.929 1.00 29.32 ? 466 LYS B NZ  1 
ATOM 2625 N N   . GLN B 1 71  ? 33.184 45.770 30.956 1.00 39.06 ? 467 GLN B N   1 
ATOM 2626 C CA  . GLN B 1 71  ? 32.647 45.103 29.782 1.00 40.26 ? 467 GLN B CA  1 
ATOM 2627 C C   . GLN B 1 71  ? 33.672 44.568 28.805 1.00 40.30 ? 467 GLN B C   1 
ATOM 2628 O O   . GLN B 1 71  ? 34.461 45.314 28.224 1.00 41.34 ? 467 GLN B O   1 
ATOM 2629 C CB  . GLN B 1 71  ? 31.613 45.967 29.057 1.00 40.39 ? 467 GLN B CB  1 
ATOM 2630 C CG  . GLN B 1 71  ? 30.831 45.184 28.005 1.00 39.46 ? 467 GLN B CG  1 
ATOM 2631 C CD  . GLN B 1 71  ? 30.526 43.757 28.451 1.00 38.12 ? 467 GLN B CD  1 
ATOM 2632 O OE1 . GLN B 1 71  ? 31.174 42.807 28.017 1.00 31.06 ? 467 GLN B OE1 1 
ATOM 2633 N NE2 . GLN B 1 71  ? 29.560 43.608 29.344 1.00 37.49 ? 467 GLN B NE2 1 
ATOM 2634 N N   . ARG B 1 72  ? 33.591 43.255 28.632 1.00 40.07 ? 468 ARG B N   1 
ATOM 2635 C CA  . ARG B 1 72  ? 34.420 42.419 27.765 1.00 39.22 ? 468 ARG B CA  1 
ATOM 2636 C C   . ARG B 1 72  ? 34.370 41.078 28.502 1.00 38.55 ? 468 ARG B C   1 
ATOM 2637 O O   . ARG B 1 72  ? 33.602 40.937 29.462 1.00 40.13 ? 468 ARG B O   1 
ATOM 2638 C CB  . ARG B 1 72  ? 35.865 42.938 27.661 1.00 38.37 ? 468 ARG B CB  1 
ATOM 2639 C CG  . ARG B 1 72  ? 36.689 42.820 28.929 1.00 37.01 ? 468 ARG B CG  1 
ATOM 2640 C CD  . ARG B 1 72  ? 38.159 43.070 28.635 1.00 34.26 ? 468 ARG B CD  1 
ATOM 2641 N NE  . ARG B 1 72  ? 38.710 42.100 27.691 1.00 30.22 ? 468 ARG B NE  1 
ATOM 2642 C CZ  . ARG B 1 72  ? 38.997 40.835 27.989 1.00 33.17 ? 468 ARG B CZ  1 
ATOM 2643 N NH1 . ARG B 1 72  ? 38.778 40.370 29.209 1.00 34.06 ? 468 ARG B NH1 1 
ATOM 2644 N NH2 . ARG B 1 72  ? 39.537 40.043 27.073 1.00 32.25 ? 468 ARG B NH2 1 
ATOM 2645 N N   . PRO B 1 73  ? 35.103 40.049 28.027 1.00 36.71 ? 469 PRO B N   1 
ATOM 2646 C CA  . PRO B 1 73  ? 35.012 38.803 28.792 1.00 34.01 ? 469 PRO B CA  1 
ATOM 2647 C C   . PRO B 1 73  ? 35.277 39.133 30.259 1.00 34.23 ? 469 PRO B C   1 
ATOM 2648 O O   . PRO B 1 73  ? 36.312 39.718 30.592 1.00 34.40 ? 469 PRO B O   1 
ATOM 2649 C CB  . PRO B 1 73  ? 36.128 37.964 28.182 1.00 32.71 ? 469 PRO B CB  1 
ATOM 2650 C CG  . PRO B 1 73  ? 36.058 38.358 26.734 1.00 32.30 ? 469 PRO B CG  1 
ATOM 2651 C CD  . PRO B 1 73  ? 35.916 39.864 26.809 1.00 34.66 ? 469 PRO B CD  1 
ATOM 2652 N N   . ILE B 1 74  ? 34.279 38.884 31.101 1.00 33.52 ? 470 ILE B N   1 
ATOM 2653 C CA  . ILE B 1 74  ? 34.393 39.182 32.523 1.00 33.35 ? 470 ILE B CA  1 
ATOM 2654 C C   . ILE B 1 74  ? 35.489 38.369 33.187 1.00 34.04 ? 470 ILE B C   1 
ATOM 2655 O O   . ILE B 1 74  ? 35.424 37.145 33.247 1.00 36.53 ? 470 ILE B O   1 
ATOM 2656 C CB  . ILE B 1 74  ? 33.078 38.936 33.271 1.00 31.28 ? 470 ILE B CB  1 
ATOM 2657 C CG1 . ILE B 1 74  ? 31.945 39.779 32.669 1.00 31.65 ? 470 ILE B CG1 1 
ATOM 2658 C CG2 . ILE B 1 74  ? 33.265 39.263 34.737 1.00 32.57 ? 470 ILE B CG2 1 
ATOM 2659 C CD1 . ILE B 1 74  ? 32.076 41.265 32.915 1.00 29.56 ? 470 ILE B CD1 1 
ATOM 2660 N N   . PHE B 1 75  ? 36.511 39.064 33.662 1.00 33.94 ? 471 PHE B N   1 
ATOM 2661 C CA  . PHE B 1 75  ? 37.623 38.412 34.322 1.00 33.78 ? 471 PHE B CA  1 
ATOM 2662 C C   . PHE B 1 75  ? 37.301 38.186 35.792 1.00 34.09 ? 471 PHE B C   1 
ATOM 2663 O O   . PHE B 1 75  ? 37.641 39.016 36.648 1.00 34.23 ? 471 PHE B O   1 
ATOM 2664 C CB  . PHE B 1 75  ? 38.894 39.254 34.174 1.00 34.34 ? 471 PHE B CB  1 
ATOM 2665 C CG  . PHE B 1 75  ? 39.606 39.058 32.865 1.00 32.47 ? 471 PHE B CG  1 
ATOM 2666 C CD1 . PHE B 1 75  ? 39.345 37.942 32.072 1.00 35.03 ? 471 PHE B CD1 1 
ATOM 2667 C CD2 . PHE B 1 75  ? 40.573 39.962 32.448 1.00 29.92 ? 471 PHE B CD2 1 
ATOM 2668 C CE1 . PHE B 1 75  ? 40.039 37.728 30.893 1.00 31.59 ? 471 PHE B CE1 1 
ATOM 2669 C CE2 . PHE B 1 75  ? 41.272 39.755 31.270 1.00 31.32 ? 471 PHE B CE2 1 
ATOM 2670 C CZ  . PHE B 1 75  ? 41.005 38.632 30.491 1.00 30.64 ? 471 PHE B CZ  1 
ATOM 2671 N N   . ILE B 1 76  ? 36.580 37.102 36.069 1.00 31.42 ? 472 ILE B N   1 
ATOM 2672 C CA  . ILE B 1 76  ? 36.224 36.754 37.438 1.00 25.25 ? 472 ILE B CA  1 
ATOM 2673 C C   . ILE B 1 76  ? 37.442 36.058 38.021 1.00 24.31 ? 472 ILE B C   1 
ATOM 2674 O O   . ILE B 1 76  ? 38.127 35.307 37.321 1.00 21.85 ? 472 ILE B O   1 
ATOM 2675 C CB  . ILE B 1 76  ? 34.991 35.817 37.493 1.00 25.15 ? 472 ILE B CB  1 
ATOM 2676 C CG1 . ILE B 1 76  ? 33.795 36.493 36.816 1.00 23.77 ? 472 ILE B CG1 1 
ATOM 2677 C CG2 . ILE B 1 76  ? 34.630 35.487 38.947 1.00 19.45 ? 472 ILE B CG2 1 
ATOM 2678 C CD1 . ILE B 1 76  ? 32.512 35.683 36.860 1.00 27.24 ? 472 ILE B CD1 1 
ATOM 2679 N N   . ILE B 1 77  ? 37.734 36.346 39.284 1.00 24.30 ? 473 ILE B N   1 
ATOM 2680 C CA  . ILE B 1 77  ? 38.885 35.767 39.965 1.00 22.53 ? 473 ILE B CA  1 
ATOM 2681 C C   . ILE B 1 77  ? 38.478 34.914 41.168 1.00 22.23 ? 473 ILE B C   1 
ATOM 2682 O O   . ILE B 1 77  ? 37.846 35.401 42.112 1.00 18.66 ? 473 ILE B O   1 
ATOM 2683 C CB  . ILE B 1 77  ? 39.907 36.880 40.353 1.00 19.77 ? 473 ILE B CB  1 
ATOM 2684 C CG1 . ILE B 1 77  ? 41.050 36.916 39.337 1.00 19.04 ? 473 ILE B CG1 1 
ATOM 2685 C CG2 . ILE B 1 77  ? 40.447 36.702 41.771 1.00 21.00 ? 473 ILE B CG2 1 
ATOM 2686 C CD1 . ILE B 1 77  ? 40.677 37.512 38.014 1.00 11.67 ? 473 ILE B CD1 1 
ATOM 2687 N N   . THR B 1 78  ? 38.840 33.635 41.116 1.00 22.87 ? 474 THR B N   1 
ATOM 2688 C CA  . THR B 1 78  ? 38.517 32.699 42.179 1.00 20.65 ? 474 THR B CA  1 
ATOM 2689 C C   . THR B 1 78  ? 39.749 32.055 42.811 1.00 19.89 ? 474 THR B C   1 
ATOM 2690 O O   . THR B 1 78  ? 40.882 32.284 42.379 1.00 19.24 ? 474 THR B O   1 
ATOM 2691 C CB  . THR B 1 78  ? 37.578 31.586 41.668 1.00 21.70 ? 474 THR B CB  1 
ATOM 2692 O OG1 . THR B 1 78  ? 38.161 30.959 40.521 1.00 16.76 ? 474 THR B OG1 1 
ATOM 2693 C CG2 . THR B 1 78  ? 36.211 32.158 41.296 1.00 19.49 ? 474 THR B CG2 1 
ATOM 2694 N N   . GLU B 1 79  ? 39.499 31.234 43.826 1.00 17.71 ? 475 GLU B N   1 
ATOM 2695 C CA  . GLU B 1 79  ? 40.528 30.526 44.577 1.00 18.24 ? 475 GLU B CA  1 
ATOM 2696 C C   . GLU B 1 79  ? 41.199 29.425 43.742 1.00 19.31 ? 475 GLU B C   1 
ATOM 2697 O O   . GLU B 1 79  ? 40.538 28.495 43.271 1.00 21.47 ? 475 GLU B O   1 
ATOM 2698 C CB  . GLU B 1 79  ? 39.878 29.940 45.834 1.00 17.97 ? 475 GLU B CB  1 
ATOM 2699 C CG  . GLU B 1 79  ? 40.814 29.304 46.846 1.00 24.32 ? 475 GLU B CG  1 
ATOM 2700 C CD  . GLU B 1 79  ? 40.076 28.796 48.080 1.00 27.60 ? 475 GLU B CD  1 
ATOM 2701 O OE1 . GLU B 1 79  ? 40.701 28.726 49.160 1.00 28.93 ? 475 GLU B OE1 1 
ATOM 2702 O OE2 . GLU B 1 79  ? 38.872 28.468 47.972 1.00 29.54 ? 475 GLU B OE2 1 
ATOM 2703 N N   . TYR B 1 80  ? 42.508 29.548 43.537 1.00 18.96 ? 476 TYR B N   1 
ATOM 2704 C CA  . TYR B 1 80  ? 43.253 28.559 42.760 1.00 19.32 ? 476 TYR B CA  1 
ATOM 2705 C C   . TYR B 1 80  ? 43.329 27.242 43.524 1.00 20.78 ? 476 TYR B C   1 
ATOM 2706 O O   . TYR B 1 80  ? 43.758 27.208 44.678 1.00 21.62 ? 476 TYR B O   1 
ATOM 2707 C CB  . TYR B 1 80  ? 44.673 29.054 42.436 1.00 18.59 ? 476 TYR B CB  1 
ATOM 2708 C CG  . TYR B 1 80  ? 45.437 28.101 41.545 1.00 16.62 ? 476 TYR B CG  1 
ATOM 2709 C CD1 . TYR B 1 80  ? 45.097 27.963 40.204 1.00 16.76 ? 476 TYR B CD1 1 
ATOM 2710 C CD2 . TYR B 1 80  ? 46.419 27.259 42.064 1.00 18.86 ? 476 TYR B CD2 1 
ATOM 2711 C CE1 . TYR B 1 80  ? 45.703 27.000 39.396 1.00 17.33 ? 476 TYR B CE1 1 
ATOM 2712 C CE2 . TYR B 1 80  ? 47.031 26.286 41.262 1.00 20.19 ? 476 TYR B CE2 1 
ATOM 2713 C CZ  . TYR B 1 80  ? 46.660 26.164 39.929 1.00 18.14 ? 476 TYR B CZ  1 
ATOM 2714 O OH  . TYR B 1 80  ? 47.206 25.182 39.134 1.00 15.15 ? 476 TYR B OH  1 
ATOM 2715 N N   . MET B 1 81  ? 42.925 26.158 42.871 1.00 17.28 ? 477 MET B N   1 
ATOM 2716 C CA  . MET B 1 81  ? 42.947 24.844 43.499 1.00 13.93 ? 477 MET B CA  1 
ATOM 2717 C C   . MET B 1 81  ? 43.960 23.955 42.812 1.00 11.92 ? 477 MET B C   1 
ATOM 2718 O O   . MET B 1 81  ? 43.679 23.356 41.787 1.00 15.97 ? 477 MET B O   1 
ATOM 2719 C CB  . MET B 1 81  ? 41.552 24.232 43.458 1.00 10.54 ? 477 MET B CB  1 
ATOM 2720 C CG  . MET B 1 81  ? 40.506 25.096 44.152 1.00 13.09 ? 477 MET B CG  1 
ATOM 2721 S SD  . MET B 1 81  ? 40.797 25.261 45.909 1.00 14.13 ? 477 MET B SD  1 
ATOM 2722 C CE  . MET B 1 81  ? 39.882 23.854 46.522 1.00 10.24 ? 477 MET B CE  1 
ATOM 2723 N N   . ALA B 1 82  ? 45.131 23.851 43.425 1.00 12.80 ? 478 ALA B N   1 
ATOM 2724 C CA  . ALA B 1 82  ? 46.260 23.087 42.908 1.00 11.29 ? 478 ALA B CA  1 
ATOM 2725 C C   . ALA B 1 82  ? 46.042 21.673 42.382 1.00 12.60 ? 478 ALA B C   1 
ATOM 2726 O O   . ALA B 1 82  ? 46.767 21.239 41.479 1.00 11.34 ? 478 ALA B O   1 
ATOM 2727 C CB  . ALA B 1 82  ? 47.397 23.091 43.927 1.00 10.32 ? 478 ALA B CB  1 
ATOM 2728 N N   . ASN B 1 83  ? 45.075 20.946 42.934 1.00 12.61 ? 479 ASN B N   1 
ATOM 2729 C CA  . ASN B 1 83  ? 44.852 19.578 42.477 1.00 15.20 ? 479 ASN B CA  1 
ATOM 2730 C C   . ASN B 1 83  ? 43.714 19.367 41.494 1.00 14.96 ? 479 ASN B C   1 
ATOM 2731 O O   . ASN B 1 83  ? 43.370 18.230 41.181 1.00 16.66 ? 479 ASN B O   1 
ATOM 2732 C CB  . ASN B 1 83  ? 44.737 18.616 43.658 1.00 13.56 ? 479 ASN B CB  1 
ATOM 2733 C CG  . ASN B 1 83  ? 46.096 18.176 44.181 1.00 11.21 ? 479 ASN B CG  1 
ATOM 2734 O OD1 . ASN B 1 83  ? 46.963 17.763 43.418 1.00 11.71 ? 479 ASN B OD1 1 
ATOM 2735 N ND2 . ASN B 1 83  ? 46.284 18.265 45.484 1.00 13.16 ? 479 ASN B ND2 1 
ATOM 2736 N N   . GLY B 1 84  ? 43.160 20.467 40.985 1.00 16.33 ? 480 GLY B N   1 
ATOM 2737 C CA  . GLY B 1 84  ? 42.080 20.406 40.011 1.00 16.11 ? 480 GLY B CA  1 
ATOM 2738 C C   . GLY B 1 84  ? 40.744 19.930 40.535 1.00 15.18 ? 480 GLY B C   1 
ATOM 2739 O O   . GLY B 1 84  ? 40.427 20.112 41.705 1.00 16.02 ? 480 GLY B O   1 
ATOM 2740 N N   . CYS B 1 85  ? 39.954 19.318 39.660 1.00 15.40 ? 481 CYS B N   1 
ATOM 2741 C CA  . CYS B 1 85  ? 38.631 18.818 40.032 1.00 16.10 ? 481 CYS B CA  1 
ATOM 2742 C C   . CYS B 1 85  ? 38.663 17.440 40.706 1.00 13.33 ? 481 CYS B C   1 
ATOM 2743 O O   . CYS B 1 85  ? 39.484 16.586 40.359 1.00 9.78  ? 481 CYS B O   1 
ATOM 2744 C CB  . CYS B 1 85  ? 37.726 18.767 38.804 1.00 17.50 ? 481 CYS B CB  1 
ATOM 2745 S SG  . CYS B 1 85  ? 38.151 17.459 37.637 1.00 26.46 ? 481 CYS B SG  1 
ATOM 2746 N N   . LEU B 1 86  ? 37.716 17.218 41.620 1.00 12.03 ? 482 LEU B N   1 
ATOM 2747 C CA  . LEU B 1 86  ? 37.581 15.966 42.367 1.00 12.13 ? 482 LEU B CA  1 
ATOM 2748 C C   . LEU B 1 86  ? 37.439 14.740 41.461 1.00 10.56 ? 482 LEU B C   1 
ATOM 2749 O O   . LEU B 1 86  ? 38.066 13.714 41.714 1.00 11.00 ? 482 LEU B O   1 
ATOM 2750 C CB  . LEU B 1 86  ? 36.390 16.058 43.340 1.00 12.80 ? 482 LEU B CB  1 
ATOM 2751 C CG  . LEU B 1 86  ? 36.066 14.923 44.327 1.00 10.31 ? 482 LEU B CG  1 
ATOM 2752 C CD1 . LEU B 1 86  ? 37.227 14.696 45.280 1.00 12.16 ? 482 LEU B CD1 1 
ATOM 2753 C CD2 . LEU B 1 86  ? 34.792 15.233 45.114 1.00 12.14 ? 482 LEU B CD2 1 
ATOM 2754 N N   . LEU B 1 87  ? 36.649 14.849 40.394 1.00 10.48 ? 483 LEU B N   1 
ATOM 2755 C CA  . LEU B 1 87  ? 36.451 13.733 39.456 1.00 9.01  ? 483 LEU B CA  1 
ATOM 2756 C C   . LEU B 1 87  ? 37.763 13.170 38.925 1.00 13.13 ? 483 LEU B C   1 
ATOM 2757 O O   . LEU B 1 87  ? 37.927 11.957 38.815 1.00 15.11 ? 483 LEU B O   1 
ATOM 2758 C CB  . LEU B 1 87  ? 35.600 14.167 38.261 1.00 4.67  ? 483 LEU B CB  1 
ATOM 2759 C CG  . LEU B 1 87  ? 34.174 13.645 38.133 1.00 6.66  ? 483 LEU B CG  1 
ATOM 2760 C CD1 . LEU B 1 87  ? 33.737 13.825 36.691 1.00 7.76  ? 483 LEU B CD1 1 
ATOM 2761 C CD2 . LEU B 1 87  ? 34.097 12.179 38.517 1.00 6.83  ? 483 LEU B CD2 1 
ATOM 2762 N N   . ASN B 1 88  ? 38.679 14.064 38.562 1.00 15.95 ? 484 ASN B N   1 
ATOM 2763 C CA  . ASN B 1 88  ? 39.990 13.673 38.047 1.00 18.08 ? 484 ASN B CA  1 
ATOM 2764 C C   . ASN B 1 88  ? 40.867 13.194 39.184 1.00 16.80 ? 484 ASN B C   1 
ATOM 2765 O O   . ASN B 1 88  ? 41.790 12.415 38.977 1.00 16.25 ? 484 ASN B O   1 
ATOM 2766 C CB  . ASN B 1 88  ? 40.689 14.855 37.371 1.00 22.13 ? 484 ASN B CB  1 
ATOM 2767 C CG  . ASN B 1 88  ? 39.864 15.473 36.265 1.00 23.79 ? 484 ASN B CG  1 
ATOM 2768 O OD1 . ASN B 1 88  ? 40.012 16.657 35.964 1.00 28.81 ? 484 ASN B OD1 1 
ATOM 2769 N ND2 . ASN B 1 88  ? 38.991 14.682 35.651 1.00 29.42 ? 484 ASN B ND2 1 
ATOM 2770 N N   . TYR B 1 89  ? 40.597 13.696 40.382 1.00 16.90 ? 485 TYR B N   1 
ATOM 2771 C CA  . TYR B 1 89  ? 41.368 13.317 41.552 1.00 15.39 ? 485 TYR B CA  1 
ATOM 2772 C C   . TYR B 1 89  ? 41.059 11.881 41.943 1.00 16.45 ? 485 TYR B C   1 
ATOM 2773 O O   . TYR B 1 89  ? 41.957 11.066 42.096 1.00 20.72 ? 485 TYR B O   1 
ATOM 2774 C CB  . TYR B 1 89  ? 41.053 14.260 42.713 1.00 15.38 ? 485 TYR B CB  1 
ATOM 2775 C CG  . TYR B 1 89  ? 42.182 14.400 43.692 1.00 10.91 ? 485 TYR B CG  1 
ATOM 2776 C CD1 . TYR B 1 89  ? 43.446 14.782 43.263 1.00 10.29 ? 485 TYR B CD1 1 
ATOM 2777 C CD2 . TYR B 1 89  ? 41.989 14.166 45.050 1.00 13.87 ? 485 TYR B CD2 1 
ATOM 2778 C CE1 . TYR B 1 89  ? 44.496 14.935 44.160 1.00 9.78  ? 485 TYR B CE1 1 
ATOM 2779 C CE2 . TYR B 1 89  ? 43.032 14.316 45.957 1.00 13.73 ? 485 TYR B CE2 1 
ATOM 2780 C CZ  . TYR B 1 89  ? 44.284 14.704 45.501 1.00 14.21 ? 485 TYR B CZ  1 
ATOM 2781 O OH  . TYR B 1 89  ? 45.322 14.890 46.389 1.00 20.03 ? 485 TYR B OH  1 
ATOM 2782 N N   . LEU B 1 90  ? 39.779 11.566 42.067 1.00 16.22 ? 486 LEU B N   1 
ATOM 2783 C CA  . LEU B 1 90  ? 39.349 10.228 42.445 1.00 14.56 ? 486 LEU B CA  1 
ATOM 2784 C C   . LEU B 1 90  ? 39.935 9.123  41.561 1.00 17.58 ? 486 LEU B C   1 
ATOM 2785 O O   . LEU B 1 90  ? 40.287 8.037  42.042 1.00 17.82 ? 486 LEU B O   1 
ATOM 2786 C CB  . LEU B 1 90  ? 37.821 10.172 42.439 1.00 8.92  ? 486 LEU B CB  1 
ATOM 2787 C CG  . LEU B 1 90  ? 37.188 10.923 43.611 1.00 9.93  ? 486 LEU B CG  1 
ATOM 2788 C CD1 . LEU B 1 90  ? 35.698 11.154 43.365 1.00 6.93  ? 486 LEU B CD1 1 
ATOM 2789 C CD2 . LEU B 1 90  ? 37.444 10.155 44.911 1.00 2.28  ? 486 LEU B CD2 1 
ATOM 2790 N N   . ARG B 1 91  ? 40.054 9.413  40.272 1.00 22.23 ? 487 ARG B N   1 
ATOM 2791 C CA  . ARG B 1 91  ? 40.589 8.457  39.313 1.00 24.99 ? 487 ARG B CA  1 
ATOM 2792 C C   . ARG B 1 91  ? 42.117 8.481  39.297 1.00 25.69 ? 487 ARG B C   1 
ATOM 2793 O O   . ARG B 1 91  ? 42.738 7.695  38.582 1.00 27.68 ? 487 ARG B O   1 
ATOM 2794 C CB  . ARG B 1 91  ? 40.060 8.786  37.914 1.00 25.06 ? 487 ARG B CB  1 
ATOM 2795 C CG  . ARG B 1 91  ? 38.543 8.776  37.775 1.00 25.61 ? 487 ARG B CG  1 
ATOM 2796 C CD  . ARG B 1 91  ? 37.994 7.357  37.693 1.00 34.03 ? 487 ARG B CD  1 
ATOM 2797 N NE  . ARG B 1 91  ? 37.266 7.113  36.445 1.00 36.39 ? 487 ARG B NE  1 
ATOM 2798 C CZ  . ARG B 1 91  ? 36.565 6.009  36.184 1.00 33.29 ? 487 ARG B CZ  1 
ATOM 2799 N NH1 . ARG B 1 91  ? 36.492 5.034  37.083 1.00 31.06 ? 487 ARG B NH1 1 
ATOM 2800 N NH2 . ARG B 1 91  ? 35.926 5.886  35.026 1.00 32.25 ? 487 ARG B NH2 1 
ATOM 2801 N N   . GLU B 1 92  ? 42.713 9.341  40.121 1.00 29.95 ? 488 GLU B N   1 
ATOM 2802 C CA  . GLU B 1 92  ? 44.164 9.507  40.168 1.00 32.26 ? 488 GLU B CA  1 
ATOM 2803 C C   . GLU B 1 92  ? 44.967 8.234  40.046 1.00 35.02 ? 488 GLU B C   1 
ATOM 2804 O O   . GLU B 1 92  ? 44.680 7.234  40.704 1.00 36.27 ? 488 GLU B O   1 
ATOM 2805 C CB  . GLU B 1 92  ? 44.618 10.299 41.405 1.00 35.45 ? 488 GLU B CB  1 
ATOM 2806 C CG  . GLU B 1 92  ? 44.416 9.609  42.751 1.00 35.63 ? 488 GLU B CG  1 
ATOM 2807 C CD  . GLU B 1 92  ? 45.086 10.359 43.902 1.00 36.03 ? 488 GLU B CD  1 
ATOM 2808 O OE1 . GLU B 1 92  ? 45.854 9.725  44.657 1.00 34.00 ? 488 GLU B OE1 1 
ATOM 2809 O OE2 . GLU B 1 92  ? 44.857 11.578 44.050 1.00 30.65 ? 488 GLU B OE2 1 
ATOM 2810 N N   . MET B 1 93  ? 45.975 8.304  39.178 1.00 39.21 ? 489 MET B N   1 
ATOM 2811 C CA  . MET B 1 93  ? 46.892 7.209  38.881 1.00 40.20 ? 489 MET B CA  1 
ATOM 2812 C C   . MET B 1 93  ? 47.087 6.305  40.101 1.00 40.72 ? 489 MET B C   1 
ATOM 2813 O O   . MET B 1 93  ? 46.473 5.239  40.204 1.00 42.05 ? 489 MET B O   1 
ATOM 2814 C CB  . MET B 1 93  ? 48.243 7.779  38.437 1.00 40.38 ? 489 MET B CB  1 
ATOM 2815 C CG  . MET B 1 93  ? 48.173 9.022  37.536 1.00 41.55 ? 489 MET B CG  1 
ATOM 2816 S SD  . MET B 1 93  ? 47.548 8.779  35.843 1.00 43.59 ? 489 MET B SD  1 
ATOM 2817 C CE  . MET B 1 93  ? 46.615 10.283 35.628 1.00 40.20 ? 489 MET B CE  1 
ATOM 2818 N N   . ARG B 1 94  ? 47.930 6.744  41.028 1.00 40.79 ? 490 ARG B N   1 
ATOM 2819 C CA  . ARG B 1 94  ? 48.195 5.995  42.245 1.00 37.42 ? 490 ARG B CA  1 
ATOM 2820 C C   . ARG B 1 94  ? 46.983 6.127  43.156 1.00 37.49 ? 490 ARG B C   1 
ATOM 2821 O O   . ARG B 1 94  ? 46.884 7.076  43.933 1.00 33.88 ? 490 ARG B O   1 
ATOM 2822 C CB  . ARG B 1 94  ? 49.437 6.553  42.932 1.00 33.39 ? 490 ARG B CB  1 
ATOM 2823 C CG  . ARG B 1 94  ? 50.727 6.263  42.195 1.00 33.75 ? 490 ARG B CG  1 
ATOM 2824 C CD  . ARG B 1 94  ? 51.220 4.849  42.479 1.00 29.04 ? 490 ARG B CD  1 
ATOM 2825 N NE  . ARG B 1 94  ? 52.596 4.854  42.970 1.00 27.07 ? 490 ARG B NE  1 
ATOM 2826 C CZ  . ARG B 1 94  ? 52.969 5.326  44.159 1.00 25.71 ? 490 ARG B CZ  1 
ATOM 2827 N NH1 . ARG B 1 94  ? 52.067 5.827  44.996 1.00 21.84 ? 490 ARG B NH1 1 
ATOM 2828 N NH2 . ARG B 1 94  ? 54.255 5.355  44.487 1.00 21.92 ? 490 ARG B NH2 1 
ATOM 2829 N N   . HIS B 1 95  ? 46.063 5.172  43.047 1.00 37.72 ? 491 HIS B N   1 
ATOM 2830 C CA  . HIS B 1 95  ? 44.826 5.166  43.833 1.00 35.57 ? 491 HIS B CA  1 
ATOM 2831 C C   . HIS B 1 95  ? 45.068 4.915  45.327 1.00 33.29 ? 491 HIS B C   1 
ATOM 2832 O O   . HIS B 1 95  ? 44.479 4.007  45.913 1.00 34.31 ? 491 HIS B O   1 
ATOM 2833 C CB  . HIS B 1 95  ? 43.863 4.096  43.288 1.00 34.70 ? 491 HIS B CB  1 
ATOM 2834 C CG  . HIS B 1 95  ? 43.450 4.303  41.859 1.00 34.85 ? 491 HIS B CG  1 
ATOM 2835 N ND1 . HIS B 1 95  ? 44.312 4.133  40.797 1.00 34.49 ? 491 HIS B ND1 1 
ATOM 2836 C CD2 . HIS B 1 95  ? 42.253 4.634  41.321 1.00 33.61 ? 491 HIS B CD2 1 
ATOM 2837 C CE1 . HIS B 1 95  ? 43.664 4.348  39.665 1.00 32.88 ? 491 HIS B CE1 1 
ATOM 2838 N NE2 . HIS B 1 95  ? 42.413 4.654  39.956 1.00 33.96 ? 491 HIS B NE2 1 
ATOM 2839 N N   . ARG B 1 96  ? 45.921 5.723  45.948 1.00 31.88 ? 492 ARG B N   1 
ATOM 2840 C CA  . ARG B 1 96  ? 46.228 5.561  47.362 1.00 31.93 ? 492 ARG B CA  1 
ATOM 2841 C C   . ARG B 1 96  ? 45.123 6.221  48.165 1.00 33.93 ? 492 ARG B C   1 
ATOM 2842 O O   . ARG B 1 96  ? 45.323 7.295  48.730 1.00 36.87 ? 492 ARG B O   1 
ATOM 2843 C CB  . ARG B 1 96  ? 47.566 6.224  47.697 1.00 32.51 ? 492 ARG B CB  1 
ATOM 2844 C CG  . ARG B 1 96  ? 48.746 5.765  46.847 1.00 35.36 ? 492 ARG B CG  1 
ATOM 2845 C CD  . ARG B 1 96  ? 50.013 6.544  47.196 1.00 33.65 ? 492 ARG B CD  1 
ATOM 2846 N NE  . ARG B 1 96  ? 49.859 7.979  46.958 1.00 33.39 ? 492 ARG B NE  1 
ATOM 2847 C CZ  . ARG B 1 96  ? 50.807 8.886  47.169 1.00 29.63 ? 492 ARG B CZ  1 
ATOM 2848 N NH1 . ARG B 1 96  ? 51.994 8.525  47.626 1.00 22.52 ? 492 ARG B NH1 1 
ATOM 2849 N NH2 . ARG B 1 96  ? 50.559 10.163 46.941 1.00 28.36 ? 492 ARG B NH2 1 
ATOM 2850 N N   . PHE B 1 97  ? 43.953 5.591  48.201 1.00 32.16 ? 493 PHE B N   1 
ATOM 2851 C CA  . PHE B 1 97  ? 42.824 6.148  48.932 1.00 30.58 ? 493 PHE B CA  1 
ATOM 2852 C C   . PHE B 1 97  ? 42.256 5.207  49.976 1.00 30.49 ? 493 PHE B C   1 
ATOM 2853 O O   . PHE B 1 97  ? 41.858 4.079  49.676 1.00 30.95 ? 493 PHE B O   1 
ATOM 2854 C CB  . PHE B 1 97  ? 41.708 6.587  47.974 1.00 28.91 ? 493 PHE B CB  1 
ATOM 2855 C CG  . PHE B 1 97  ? 41.862 7.993  47.466 1.00 22.07 ? 493 PHE B CG  1 
ATOM 2856 C CD1 . PHE B 1 97  ? 42.001 8.247  46.110 1.00 23.04 ? 493 PHE B CD1 1 
ATOM 2857 C CD2 . PHE B 1 97  ? 41.880 9.062  48.352 1.00 20.91 ? 493 PHE B CD2 1 
ATOM 2858 C CE1 . PHE B 1 97  ? 42.159 9.549  45.642 1.00 21.21 ? 493 PHE B CE1 1 
ATOM 2859 C CE2 . PHE B 1 97  ? 42.037 10.361 47.898 1.00 18.07 ? 493 PHE B CE2 1 
ATOM 2860 C CZ  . PHE B 1 97  ? 42.178 10.606 46.536 1.00 23.31 ? 493 PHE B CZ  1 
ATOM 2861 N N   . GLN B 1 98  ? 42.240 5.679  51.213 1.00 29.40 ? 494 GLN B N   1 
ATOM 2862 C CA  . GLN B 1 98  ? 41.702 4.907  52.320 1.00 28.93 ? 494 GLN B CA  1 
ATOM 2863 C C   . GLN B 1 98  ? 40.337 5.499  52.660 1.00 26.79 ? 494 GLN B C   1 
ATOM 2864 O O   . GLN B 1 98  ? 40.132 6.707  52.516 1.00 30.22 ? 494 GLN B O   1 
ATOM 2865 C CB  . GLN B 1 98  ? 42.640 4.985  53.529 1.00 31.31 ? 494 GLN B CB  1 
ATOM 2866 C CG  . GLN B 1 98  ? 44.047 4.427  53.298 1.00 35.24 ? 494 GLN B CG  1 
ATOM 2867 C CD  . GLN B 1 98  ? 45.041 5.495  52.888 1.00 36.73 ? 494 GLN B CD  1 
ATOM 2868 O OE1 . GLN B 1 98  ? 44.778 6.289  51.984 1.00 36.12 ? 494 GLN B OE1 1 
ATOM 2869 N NE2 . GLN B 1 98  ? 46.184 5.529  53.559 1.00 34.99 ? 494 GLN B NE2 1 
ATOM 2870 N N   . THR B 1 99  ? 39.405 4.660  53.104 1.00 24.49 ? 495 THR B N   1 
ATOM 2871 C CA  . THR B 1 99  ? 38.059 5.107  53.453 1.00 18.71 ? 495 THR B CA  1 
ATOM 2872 C C   . THR B 1 99  ? 38.083 6.320  54.372 1.00 19.04 ? 495 THR B C   1 
ATOM 2873 O O   . THR B 1 99  ? 37.209 7.182  54.299 1.00 19.97 ? 495 THR B O   1 
ATOM 2874 C CB  . THR B 1 99  ? 37.261 3.983  54.136 1.00 15.78 ? 495 THR B CB  1 
ATOM 2875 O OG1 . THR B 1 99  ? 37.282 2.823  53.302 1.00 17.79 ? 495 THR B OG1 1 
ATOM 2876 C CG2 . THR B 1 99  ? 35.814 4.405  54.359 1.00 12.00 ? 495 THR B CG2 1 
ATOM 2877 N N   . GLN B 1 100 ? 39.112 6.393  55.207 1.00 20.71 ? 496 GLN B N   1 
ATOM 2878 C CA  . GLN B 1 100 ? 39.285 7.488  56.156 1.00 20.37 ? 496 GLN B CA  1 
ATOM 2879 C C   . GLN B 1 100 ? 39.282 8.825  55.419 1.00 18.15 ? 496 GLN B C   1 
ATOM 2880 O O   . GLN B 1 100 ? 38.519 9.725  55.748 1.00 18.72 ? 496 GLN B O   1 
ATOM 2881 C CB  . GLN B 1 100 ? 40.605 7.320  56.930 1.00 24.38 ? 496 GLN B CB  1 
ATOM 2882 C CG  . GLN B 1 100 ? 40.686 6.083  57.852 1.00 31.81 ? 496 GLN B CG  1 
ATOM 2883 C CD  . GLN B 1 100 ? 40.842 4.747  57.107 1.00 35.85 ? 496 GLN B CD  1 
ATOM 2884 O OE1 . GLN B 1 100 ? 41.121 4.714  55.909 1.00 33.78 ? 496 GLN B OE1 1 
ATOM 2885 N NE2 . GLN B 1 100 ? 40.660 3.643  57.825 1.00 34.70 ? 496 GLN B NE2 1 
ATOM 2886 N N   . GLN B 1 101 ? 40.114 8.935  54.393 1.00 18.73 ? 497 GLN B N   1 
ATOM 2887 C CA  . GLN B 1 101 ? 40.205 10.162 53.615 1.00 14.92 ? 497 GLN B CA  1 
ATOM 2888 C C   . GLN B 1 101 ? 39.031 10.315 52.647 1.00 11.54 ? 497 GLN B C   1 
ATOM 2889 O O   . GLN B 1 101 ? 38.656 11.425 52.272 1.00 10.10 ? 497 GLN B O   1 
ATOM 2890 C CB  . GLN B 1 101 ? 41.534 10.196 52.862 1.00 21.68 ? 497 GLN B CB  1 
ATOM 2891 C CG  . GLN B 1 101 ? 41.752 11.477 52.090 1.00 25.81 ? 497 GLN B CG  1 
ATOM 2892 C CD  . GLN B 1 101 ? 41.416 12.694 52.912 1.00 25.45 ? 497 GLN B CD  1 
ATOM 2893 O OE1 . GLN B 1 101 ? 41.984 12.911 53.985 1.00 30.13 ? 497 GLN B OE1 1 
ATOM 2894 N NE2 . GLN B 1 101 ? 40.462 13.480 52.434 1.00 22.53 ? 497 GLN B NE2 1 
ATOM 2895 N N   . LEU B 1 102 ? 38.463 9.189  52.240 1.00 9.12  ? 498 LEU B N   1 
ATOM 2896 C CA  . LEU B 1 102 ? 37.327 9.173  51.336 1.00 8.57  ? 498 LEU B CA  1 
ATOM 2897 C C   . LEU B 1 102 ? 36.167 9.868  52.043 1.00 10.48 ? 498 LEU B C   1 
ATOM 2898 O O   . LEU B 1 102 ? 35.469 10.702 51.458 1.00 11.51 ? 498 LEU B O   1 
ATOM 2899 C CB  . LEU B 1 102 ? 36.961 7.721  51.021 1.00 11.37 ? 498 LEU B CB  1 
ATOM 2900 C CG  . LEU B 1 102 ? 36.951 7.223  49.575 1.00 9.98  ? 498 LEU B CG  1 
ATOM 2901 C CD1 . LEU B 1 102 ? 38.079 7.838  48.767 1.00 8.19  ? 498 LEU B CD1 1 
ATOM 2902 C CD2 . LEU B 1 102 ? 37.050 5.711  49.570 1.00 7.91  ? 498 LEU B CD2 1 
ATOM 2903 N N   . LEU B 1 103 ? 36.016 9.569  53.331 1.00 12.46 ? 499 LEU B N   1 
ATOM 2904 C CA  . LEU B 1 103 ? 34.949 10.146 54.133 1.00 10.83 ? 499 LEU B CA  1 
ATOM 2905 C C   . LEU B 1 103 ? 35.229 11.622 54.365 1.00 7.37  ? 499 LEU B C   1 
ATOM 2906 O O   . LEU B 1 103 ? 34.327 12.449 54.275 1.00 10.84 ? 499 LEU B O   1 
ATOM 2907 C CB  . LEU B 1 103 ? 34.815 9.375  55.454 1.00 12.04 ? 499 LEU B CB  1 
ATOM 2908 C CG  . LEU B 1 103 ? 33.474 9.303  56.205 1.00 8.53  ? 499 LEU B CG  1 
ATOM 2909 C CD1 . LEU B 1 103 ? 33.416 10.349 57.280 1.00 8.11  ? 499 LEU B CD1 1 
ATOM 2910 C CD2 . LEU B 1 103 ? 32.286 9.415  55.263 1.00 5.87  ? 499 LEU B CD2 1 
ATOM 2911 N N   . GLU B 1 104 ? 36.491 11.960 54.607 1.00 8.33  ? 500 GLU B N   1 
ATOM 2912 C CA  . GLU B 1 104 ? 36.878 13.353 54.821 1.00 10.19 ? 500 GLU B CA  1 
ATOM 2913 C C   . GLU B 1 104 ? 36.377 14.220 53.679 1.00 10.00 ? 500 GLU B C   1 
ATOM 2914 O O   . GLU B 1 104 ? 35.914 15.328 53.898 1.00 12.10 ? 500 GLU B O   1 
ATOM 2915 C CB  . GLU B 1 104 ? 38.407 13.498 54.933 1.00 11.71 ? 500 GLU B CB  1 
ATOM 2916 C CG  . GLU B 1 104 ? 38.988 13.251 56.326 1.00 15.65 ? 500 GLU B CG  1 
ATOM 2917 C CD  . GLU B 1 104 ? 38.574 14.307 57.342 1.00 16.85 ? 500 GLU B CD  1 
ATOM 2918 O OE1 . GLU B 1 104 ? 38.534 13.992 58.550 1.00 17.26 ? 500 GLU B OE1 1 
ATOM 2919 O OE2 . GLU B 1 104 ? 38.290 15.454 56.940 1.00 21.13 ? 500 GLU B OE2 1 
ATOM 2920 N N   . MET B 1 105 ? 36.453 13.701 52.459 1.00 12.06 ? 501 MET B N   1 
ATOM 2921 C CA  . MET B 1 105 ? 36.009 14.434 51.284 1.00 11.31 ? 501 MET B CA  1 
ATOM 2922 C C   . MET B 1 105 ? 34.522 14.720 51.400 1.00 11.74 ? 501 MET B C   1 
ATOM 2923 O O   . MET B 1 105 ? 34.098 15.865 51.257 1.00 12.06 ? 501 MET B O   1 
ATOM 2924 C CB  . MET B 1 105 ? 36.314 13.637 50.015 1.00 10.59 ? 501 MET B CB  1 
ATOM 2925 C CG  . MET B 1 105 ? 37.792 13.351 49.803 1.00 11.63 ? 501 MET B CG  1 
ATOM 2926 S SD  . MET B 1 105 ? 38.095 12.353 48.335 1.00 16.64 ? 501 MET B SD  1 
ATOM 2927 C CE  . MET B 1 105 ? 39.512 13.180 47.631 1.00 19.96 ? 501 MET B CE  1 
ATOM 2928 N N   . CYS B 1 106 ? 33.740 13.685 51.707 1.00 11.26 ? 502 CYS B N   1 
ATOM 2929 C CA  . CYS B 1 106 ? 32.290 13.818 51.879 1.00 10.20 ? 502 CYS B CA  1 
ATOM 2930 C C   . CYS B 1 106 ? 31.986 14.848 52.976 1.00 9.69  ? 502 CYS B C   1 
ATOM 2931 O O   . CYS B 1 106 ? 30.976 15.549 52.923 1.00 7.12  ? 502 CYS B O   1 
ATOM 2932 C CB  . CYS B 1 106 ? 31.673 12.473 52.290 1.00 12.20 ? 502 CYS B CB  1 
ATOM 2933 S SG  . CYS B 1 106 ? 31.964 11.065 51.174 1.00 14.20 ? 502 CYS B SG  1 
ATOM 2934 N N   . LYS B 1 107 ? 32.872 14.924 53.967 1.00 11.41 ? 503 LYS B N   1 
ATOM 2935 C CA  . LYS B 1 107 ? 32.735 15.838 55.095 1.00 7.79  ? 503 LYS B CA  1 
ATOM 2936 C C   . LYS B 1 107 ? 32.993 17.280 54.656 1.00 7.32  ? 503 LYS B C   1 
ATOM 2937 O O   . LYS B 1 107 ? 32.235 18.185 54.997 1.00 9.67  ? 503 LYS B O   1 
ATOM 2938 C CB  . LYS B 1 107 ? 33.700 15.431 56.217 1.00 4.87  ? 503 LYS B CB  1 
ATOM 2939 C CG  . LYS B 1 107 ? 33.559 16.217 57.519 1.00 7.28  ? 503 LYS B CG  1 
ATOM 2940 C CD  . LYS B 1 107 ? 34.929 16.669 58.024 1.00 12.59 ? 503 LYS B CD  1 
ATOM 2941 C CE  . LYS B 1 107 ? 34.879 17.121 59.483 1.00 12.64 ? 503 LYS B CE  1 
ATOM 2942 N NZ  . LYS B 1 107 ? 36.120 17.842 59.917 1.00 16.35 ? 503 LYS B NZ  1 
ATOM 2943 N N   . ASP B 1 108 ? 34.051 17.484 53.883 1.00 4.47  ? 504 ASP B N   1 
ATOM 2944 C CA  . ASP B 1 108 ? 34.401 18.801 53.387 1.00 2.00  ? 504 ASP B CA  1 
ATOM 2945 C C   . ASP B 1 108 ? 33.244 19.350 52.566 1.00 6.17  ? 504 ASP B C   1 
ATOM 2946 O O   . ASP B 1 108 ? 32.857 20.512 52.723 1.00 4.62  ? 504 ASP B O   1 
ATOM 2947 C CB  . ASP B 1 108 ? 35.649 18.712 52.505 1.00 5.96  ? 504 ASP B CB  1 
ATOM 2948 C CG  . ASP B 1 108 ? 36.876 18.212 53.253 1.00 5.96  ? 504 ASP B CG  1 
ATOM 2949 O OD1 . ASP B 1 108 ? 36.861 18.172 54.500 1.00 6.58  ? 504 ASP B OD1 1 
ATOM 2950 O OD2 . ASP B 1 108 ? 37.863 17.856 52.580 1.00 11.77 ? 504 ASP B OD2 1 
ATOM 2951 N N   . VAL B 1 109 ? 32.680 18.499 51.705 1.00 8.12  ? 505 VAL B N   1 
ATOM 2952 C CA  . VAL B 1 109 ? 31.560 18.880 50.841 1.00 5.94  ? 505 VAL B CA  1 
ATOM 2953 C C   . VAL B 1 109 ? 30.294 19.109 51.652 1.00 7.08  ? 505 VAL B C   1 
ATOM 2954 O O   . VAL B 1 109 ? 29.560 20.069 51.415 1.00 9.90  ? 505 VAL B O   1 
ATOM 2955 C CB  . VAL B 1 109 ? 31.241 17.800 49.763 1.00 2.00  ? 505 VAL B CB  1 
ATOM 2956 C CG1 . VAL B 1 109 ? 30.116 18.283 48.867 1.00 3.28  ? 505 VAL B CG1 1 
ATOM 2957 C CG2 . VAL B 1 109 ? 32.466 17.495 48.918 1.00 5.68  ? 505 VAL B CG2 1 
ATOM 2958 N N   . CYS B 1 110 ? 30.050 18.235 52.622 1.00 8.09  ? 506 CYS B N   1 
ATOM 2959 C CA  . CYS B 1 110 ? 28.861 18.336 53.444 1.00 8.75  ? 506 CYS B CA  1 
ATOM 2960 C C   . CYS B 1 110 ? 28.856 19.621 54.257 1.00 8.23  ? 506 CYS B C   1 
ATOM 2961 O O   . CYS B 1 110 ? 27.822 20.272 54.378 1.00 10.16 ? 506 CYS B O   1 
ATOM 2962 C CB  . CYS B 1 110 ? 28.728 17.112 54.355 1.00 7.47  ? 506 CYS B CB  1 
ATOM 2963 S SG  . CYS B 1 110 ? 27.033 16.791 54.882 1.00 8.97  ? 506 CYS B SG  1 
ATOM 2964 N N   . GLU B 1 111 ? 30.010 20.000 54.796 1.00 8.06  ? 507 GLU B N   1 
ATOM 2965 C CA  . GLU B 1 111 ? 30.112 21.226 55.588 1.00 8.72  ? 507 GLU B CA  1 
ATOM 2966 C C   . GLU B 1 111 ? 29.727 22.422 54.730 1.00 9.87  ? 507 GLU B C   1 
ATOM 2967 O O   . GLU B 1 111 ? 28.948 23.286 55.152 1.00 14.35 ? 507 GLU B O   1 
ATOM 2968 C CB  . GLU B 1 111 ? 31.532 21.409 56.118 1.00 5.94  ? 507 GLU B CB  1 
ATOM 2969 C CG  . GLU B 1 111 ? 31.986 20.276 57.018 1.00 8.44  ? 507 GLU B CG  1 
ATOM 2970 C CD  . GLU B 1 111 ? 33.360 20.479 57.612 1.00 5.09  ? 507 GLU B CD  1 
ATOM 2971 O OE1 . GLU B 1 111 ? 34.090 21.392 57.197 1.00 12.55 ? 507 GLU B OE1 1 
ATOM 2972 O OE2 . GLU B 1 111 ? 33.714 19.708 58.514 1.00 12.74 ? 507 GLU B OE2 1 
ATOM 2973 N N   . ALA B 1 112 ? 30.272 22.460 53.518 1.00 10.59 ? 508 ALA B N   1 
ATOM 2974 C CA  . ALA B 1 112 ? 30.001 23.530 52.568 1.00 10.69 ? 508 ALA B CA  1 
ATOM 2975 C C   . ALA B 1 112 ? 28.521 23.542 52.183 1.00 10.30 ? 508 ALA B C   1 
ATOM 2976 O O   . ALA B 1 112 ? 27.885 24.597 52.110 1.00 7.78  ? 508 ALA B O   1 
ATOM 2977 C CB  . ALA B 1 112 ? 30.859 23.337 51.343 1.00 11.50 ? 508 ALA B CB  1 
ATOM 2978 N N   . MET B 1 113 ? 27.983 22.355 51.929 1.00 11.26 ? 509 MET B N   1 
ATOM 2979 C CA  . MET B 1 113 ? 26.582 22.212 51.556 1.00 13.26 ? 509 MET B CA  1 
ATOM 2980 C C   . MET B 1 113 ? 25.679 22.514 52.738 1.00 17.44 ? 509 MET B C   1 
ATOM 2981 O O   . MET B 1 113 ? 24.539 22.961 52.570 1.00 19.95 ? 509 MET B O   1 
ATOM 2982 C CB  . MET B 1 113 ? 26.301 20.796 51.053 1.00 12.49 ? 509 MET B CB  1 
ATOM 2983 C CG  . MET B 1 113 ? 26.833 20.504 49.671 1.00 9.20  ? 509 MET B CG  1 
ATOM 2984 S SD  . MET B 1 113 ? 26.595 21.913 48.607 1.00 9.16  ? 509 MET B SD  1 
ATOM 2985 C CE  . MET B 1 113 ? 24.812 21.976 48.456 1.00 5.81  ? 509 MET B CE  1 
ATOM 2986 N N   . GLU B 1 114 ? 26.198 22.251 53.932 1.00 18.37 ? 510 GLU B N   1 
ATOM 2987 C CA  . GLU B 1 114 ? 25.467 22.479 55.159 1.00 17.75 ? 510 GLU B CA  1 
ATOM 2988 C C   . GLU B 1 114 ? 25.293 23.981 55.335 1.00 19.15 ? 510 GLU B C   1 
ATOM 2989 O O   . GLU B 1 114 ? 24.178 24.446 55.579 1.00 21.52 ? 510 GLU B O   1 
ATOM 2990 C CB  . GLU B 1 114 ? 26.217 21.858 56.336 1.00 21.22 ? 510 GLU B CB  1 
ATOM 2991 C CG  . GLU B 1 114 ? 25.370 21.629 57.572 1.00 19.10 ? 510 GLU B CG  1 
ATOM 2992 C CD  . GLU B 1 114 ? 25.692 22.587 58.687 1.00 21.96 ? 510 GLU B CD  1 
ATOM 2993 O OE1 . GLU B 1 114 ? 26.774 22.452 59.296 1.00 20.26 ? 510 GLU B OE1 1 
ATOM 2994 O OE2 . GLU B 1 114 ? 24.859 23.472 58.958 1.00 24.99 ? 510 GLU B OE2 1 
ATOM 2995 N N   . TYR B 1 115 ? 26.368 24.751 55.169 1.00 19.18 ? 511 TYR B N   1 
ATOM 2996 C CA  . TYR B 1 115 ? 26.251 26.204 55.299 1.00 22.64 ? 511 TYR B CA  1 
ATOM 2997 C C   . TYR B 1 115 ? 25.441 26.838 54.168 1.00 20.77 ? 511 TYR B C   1 
ATOM 2998 O O   . TYR B 1 115 ? 24.824 27.881 54.353 1.00 19.57 ? 511 TYR B O   1 
ATOM 2999 C CB  . TYR B 1 115 ? 27.612 26.885 55.456 1.00 28.60 ? 511 TYR B CB  1 
ATOM 3000 C CG  . TYR B 1 115 ? 27.764 27.549 56.815 1.00 38.15 ? 511 TYR B CG  1 
ATOM 3001 C CD1 . TYR B 1 115 ? 27.179 26.988 57.958 1.00 38.05 ? 511 TYR B CD1 1 
ATOM 3002 C CD2 . TYR B 1 115 ? 28.469 28.745 56.958 1.00 37.94 ? 511 TYR B CD2 1 
ATOM 3003 C CE1 . TYR B 1 115 ? 27.291 27.597 59.199 1.00 39.84 ? 511 TYR B CE1 1 
ATOM 3004 C CE2 . TYR B 1 115 ? 28.589 29.365 58.206 1.00 38.73 ? 511 TYR B CE2 1 
ATOM 3005 C CZ  . TYR B 1 115 ? 27.995 28.786 59.319 1.00 40.24 ? 511 TYR B CZ  1 
ATOM 3006 O OH  . TYR B 1 115 ? 28.100 29.397 60.550 1.00 37.79 ? 511 TYR B OH  1 
ATOM 3007 N N   . LEU B 1 116 ? 25.460 26.223 52.991 1.00 21.25 ? 512 LEU B N   1 
ATOM 3008 C CA  . LEU B 1 116 ? 24.662 26.734 51.885 1.00 18.82 ? 512 LEU B CA  1 
ATOM 3009 C C   . LEU B 1 116 ? 23.217 26.473 52.271 1.00 19.11 ? 512 LEU B C   1 
ATOM 3010 O O   . LEU B 1 116 ? 22.354 27.328 52.097 1.00 23.50 ? 512 LEU B O   1 
ATOM 3011 C CB  . LEU B 1 116 ? 24.985 26.022 50.569 1.00 17.08 ? 512 LEU B CB  1 
ATOM 3012 C CG  . LEU B 1 116 ? 26.256 26.418 49.811 1.00 16.90 ? 512 LEU B CG  1 
ATOM 3013 C CD1 . LEU B 1 116 ? 26.165 25.864 48.375 1.00 10.52 ? 512 LEU B CD1 1 
ATOM 3014 C CD2 . LEU B 1 116 ? 26.414 27.937 49.783 1.00 10.86 ? 512 LEU B CD2 1 
ATOM 3015 N N   . GLU B 1 117 ? 22.972 25.306 52.851 1.00 19.26 ? 513 GLU B N   1 
ATOM 3016 C CA  . GLU B 1 117 ? 21.640 24.930 53.283 1.00 18.74 ? 513 GLU B CA  1 
ATOM 3017 C C   . GLU B 1 117 ? 21.123 25.962 54.269 1.00 22.83 ? 513 GLU B C   1 
ATOM 3018 O O   . GLU B 1 117 ? 20.033 26.514 54.079 1.00 26.96 ? 513 GLU B O   1 
ATOM 3019 C CB  . GLU B 1 117 ? 21.665 23.554 53.944 1.00 16.46 ? 513 GLU B CB  1 
ATOM 3020 C CG  . GLU B 1 117 ? 20.296 23.079 54.393 1.00 18.68 ? 513 GLU B CG  1 
ATOM 3021 C CD  . GLU B 1 117 ? 20.327 21.695 55.003 1.00 17.60 ? 513 GLU B CD  1 
ATOM 3022 O OE1 . GLU B 1 117 ? 19.879 20.746 54.322 1.00 17.80 ? 513 GLU B OE1 1 
ATOM 3023 O OE2 . GLU B 1 117 ? 20.792 21.561 56.159 1.00 12.10 ? 513 GLU B OE2 1 
ATOM 3024 N N   . SER B 1 118 ? 21.924 26.241 55.300 1.00 24.79 ? 514 SER B N   1 
ATOM 3025 C CA  . SER B 1 118 ? 21.573 27.212 56.338 1.00 24.05 ? 514 SER B CA  1 
ATOM 3026 C C   . SER B 1 118 ? 21.325 28.589 55.733 1.00 22.16 ? 514 SER B C   1 
ATOM 3027 O O   . SER B 1 118 ? 20.357 29.263 56.080 1.00 21.49 ? 514 SER B O   1 
ATOM 3028 C CB  . SER B 1 118 ? 22.693 27.314 57.376 1.00 23.79 ? 514 SER B CB  1 
ATOM 3029 O OG  . SER B 1 118 ? 23.886 27.829 56.799 1.00 22.03 ? 514 SER B OG  1 
ATOM 3030 N N   . LYS B 1 119 ? 22.195 28.974 54.805 1.00 21.78 ? 515 LYS B N   1 
ATOM 3031 C CA  . LYS B 1 119 ? 22.128 30.263 54.122 1.00 19.84 ? 515 LYS B CA  1 
ATOM 3032 C C   . LYS B 1 119 ? 21.008 30.302 53.072 1.00 20.47 ? 515 LYS B C   1 
ATOM 3033 O O   . LYS B 1 119 ? 20.769 31.325 52.433 1.00 22.75 ? 515 LYS B O   1 
ATOM 3034 C CB  . LYS B 1 119 ? 23.522 30.574 53.541 1.00 15.28 ? 515 LYS B CB  1 
ATOM 3035 C CG  . LYS B 1 119 ? 23.593 31.460 52.308 1.00 22.32 ? 515 LYS B CG  1 
ATOM 3036 C CD  . LYS B 1 119 ? 23.373 32.930 52.616 1.00 20.90 ? 515 LYS B CD  1 
ATOM 3037 C CE  . LYS B 1 119 ? 23.192 33.703 51.322 1.00 15.11 ? 515 LYS B CE  1 
ATOM 3038 N NZ  . LYS B 1 119 ? 22.035 33.175 50.535 1.00 9.55  ? 515 LYS B NZ  1 
ATOM 3039 N N   . GLN B 1 120 ? 20.267 29.206 52.956 1.00 19.94 ? 516 GLN B N   1 
ATOM 3040 C CA  . GLN B 1 120 ? 19.165 29.111 52.000 1.00 19.73 ? 516 GLN B CA  1 
ATOM 3041 C C   . GLN B 1 120 ? 19.658 29.287 50.554 1.00 17.78 ? 516 GLN B C   1 
ATOM 3042 O O   . GLN B 1 120 ? 19.000 29.935 49.733 1.00 15.79 ? 516 GLN B O   1 
ATOM 3043 C CB  . GLN B 1 120 ? 18.085 30.162 52.314 1.00 23.43 ? 516 GLN B CB  1 
ATOM 3044 C CG  . GLN B 1 120 ? 17.672 30.281 53.783 1.00 22.95 ? 516 GLN B CG  1 
ATOM 3045 C CD  . GLN B 1 120 ? 16.919 29.073 54.296 1.00 30.24 ? 516 GLN B CD  1 
ATOM 3046 O OE1 . GLN B 1 120 ? 15.719 28.929 54.063 1.00 32.30 ? 516 GLN B OE1 1 
ATOM 3047 N NE2 . GLN B 1 120 ? 17.612 28.212 55.026 1.00 32.64 ? 516 GLN B NE2 1 
ATOM 3048 N N   . PHE B 1 121 ? 20.788 28.669 50.231 1.00 13.90 ? 517 PHE B N   1 
ATOM 3049 C CA  . PHE B 1 121 ? 21.353 28.773 48.891 1.00 16.72 ? 517 PHE B CA  1 
ATOM 3050 C C   . PHE B 1 121 ? 21.477 27.412 48.197 1.00 17.18 ? 517 PHE B C   1 
ATOM 3051 O O   . PHE B 1 121 ? 22.222 26.540 48.658 1.00 20.28 ? 517 PHE B O   1 
ATOM 3052 C CB  . PHE B 1 121 ? 22.719 29.453 48.963 1.00 13.45 ? 517 PHE B CB  1 
ATOM 3053 C CG  . PHE B 1 121 ? 23.245 29.919 47.628 1.00 13.82 ? 517 PHE B CG  1 
ATOM 3054 C CD1 . PHE B 1 121 ? 23.067 31.246 47.220 1.00 11.73 ? 517 PHE B CD1 1 
ATOM 3055 C CD2 . PHE B 1 121 ? 23.957 29.049 46.800 1.00 12.17 ? 517 PHE B CD2 1 
ATOM 3056 C CE1 . PHE B 1 121 ? 23.596 31.699 46.002 1.00 11.02 ? 517 PHE B CE1 1 
ATOM 3057 C CE2 . PHE B 1 121 ? 24.491 29.486 45.584 1.00 9.71  ? 517 PHE B CE2 1 
ATOM 3058 C CZ  . PHE B 1 121 ? 24.312 30.815 45.183 1.00 13.73 ? 517 PHE B CZ  1 
ATOM 3059 N N   . LEU B 1 122 ? 20.749 27.242 47.093 1.00 15.31 ? 518 LEU B N   1 
ATOM 3060 C CA  . LEU B 1 122 ? 20.766 26.003 46.312 1.00 13.37 ? 518 LEU B CA  1 
ATOM 3061 C C   . LEU B 1 122 ? 21.936 25.979 45.334 1.00 13.97 ? 518 LEU B C   1 
ATOM 3062 O O   . LEU B 1 122 ? 22.236 26.979 44.692 1.00 19.55 ? 518 LEU B O   1 
ATOM 3063 C CB  . LEU B 1 122 ? 19.474 25.864 45.508 1.00 10.07 ? 518 LEU B CB  1 
ATOM 3064 C CG  . LEU B 1 122 ? 18.227 25.283 46.168 1.00 12.29 ? 518 LEU B CG  1 
ATOM 3065 C CD1 . LEU B 1 122 ? 17.018 25.488 45.274 1.00 9.13  ? 518 LEU B CD1 1 
ATOM 3066 C CD2 . LEU B 1 122 ? 18.455 23.817 46.434 1.00 14.04 ? 518 LEU B CD2 1 
ATOM 3067 N N   . HIS B 1 123 ? 22.557 24.820 45.165 1.00 13.91 ? 519 HIS B N   1 
ATOM 3068 C CA  . HIS B 1 123 ? 23.684 24.700 44.250 1.00 15.81 ? 519 HIS B CA  1 
ATOM 3069 C C   . HIS B 1 123 ? 23.256 24.396 42.811 1.00 18.77 ? 519 HIS B C   1 
ATOM 3070 O O   . HIS B 1 123 ? 23.987 24.714 41.877 1.00 19.63 ? 519 HIS B O   1 
ATOM 3071 C CB  . HIS B 1 123 ? 24.659 23.631 44.743 1.00 12.29 ? 519 HIS B CB  1 
ATOM 3072 C CG  . HIS B 1 123 ? 26.008 23.706 44.101 1.00 9.16  ? 519 HIS B CG  1 
ATOM 3073 N ND1 . HIS B 1 123 ? 26.198 23.578 42.741 1.00 7.69  ? 519 HIS B ND1 1 
ATOM 3074 C CD2 . HIS B 1 123 ? 27.239 23.881 44.637 1.00 9.86  ? 519 HIS B CD2 1 
ATOM 3075 C CE1 . HIS B 1 123 ? 27.489 23.664 42.468 1.00 8.06  ? 519 HIS B CE1 1 
ATOM 3076 N NE2 . HIS B 1 123 ? 28.142 23.850 43.602 1.00 9.01  ? 519 HIS B NE2 1 
ATOM 3077 N N   . ARG B 1 124 ? 22.116 23.724 42.645 1.00 21.67 ? 520 ARG B N   1 
ATOM 3078 C CA  . ARG B 1 124 ? 21.572 23.372 41.329 1.00 21.63 ? 520 ARG B CA  1 
ATOM 3079 C C   . ARG B 1 124 ? 22.295 22.232 40.582 1.00 23.98 ? 520 ARG B C   1 
ATOM 3080 O O   . ARG B 1 124 ? 21.646 21.366 39.987 1.00 23.54 ? 520 ARG B O   1 
ATOM 3081 C CB  . ARG B 1 124 ? 21.501 24.620 40.438 1.00 21.69 ? 520 ARG B CB  1 
ATOM 3082 C CG  . ARG B 1 124 ? 20.865 24.389 39.081 1.00 24.47 ? 520 ARG B CG  1 
ATOM 3083 C CD  . ARG B 1 124 ? 21.521 25.238 38.001 1.00 26.51 ? 520 ARG B CD  1 
ATOM 3084 N NE  . ARG B 1 124 ? 21.186 26.658 38.074 1.00 33.49 ? 520 ARG B NE  1 
ATOM 3085 C CZ  . ARG B 1 124 ? 20.034 27.185 37.667 1.00 32.52 ? 520 ARG B CZ  1 
ATOM 3086 N NH1 . ARG B 1 124 ? 19.078 26.412 37.169 1.00 35.39 ? 520 ARG B NH1 1 
ATOM 3087 N NH2 . ARG B 1 124 ? 19.870 28.502 37.675 1.00 36.18 ? 520 ARG B NH2 1 
ATOM 3088 N N   . ASP B 1 125 ? 23.625 22.221 40.629 1.00 21.56 ? 521 ASP B N   1 
ATOM 3089 C CA  . ASP B 1 125 ? 24.423 21.210 39.935 1.00 19.42 ? 521 ASP B CA  1 
ATOM 3090 C C   . ASP B 1 125 ? 25.533 20.709 40.872 1.00 17.08 ? 521 ASP B C   1 
ATOM 3091 O O   . ASP B 1 125 ? 26.655 21.199 40.830 1.00 19.34 ? 521 ASP B O   1 
ATOM 3092 C CB  . ASP B 1 125 ? 25.033 21.861 38.676 1.00 20.57 ? 521 ASP B CB  1 
ATOM 3093 C CG  . ASP B 1 125 ? 25.309 20.867 37.552 1.00 18.16 ? 521 ASP B CG  1 
ATOM 3094 O OD1 . ASP B 1 125 ? 26.470 20.777 37.099 1.00 19.83 ? 521 ASP B OD1 1 
ATOM 3095 O OD2 . ASP B 1 125 ? 24.359 20.205 37.092 1.00 21.97 ? 521 ASP B OD2 1 
ATOM 3096 N N   . LEU B 1 126 ? 25.206 19.781 41.763 1.00 14.72 ? 522 LEU B N   1 
ATOM 3097 C CA  . LEU B 1 126 ? 26.197 19.252 42.704 1.00 12.04 ? 522 LEU B CA  1 
ATOM 3098 C C   . LEU B 1 126 ? 26.724 17.892 42.249 1.00 11.47 ? 522 LEU B C   1 
ATOM 3099 O O   . LEU B 1 126 ? 25.991 16.902 42.200 1.00 8.58  ? 522 LEU B O   1 
ATOM 3100 C CB  . LEU B 1 126 ? 25.612 19.164 44.117 1.00 15.80 ? 522 LEU B CB  1 
ATOM 3101 C CG  . LEU B 1 126 ? 26.527 18.661 45.235 1.00 15.39 ? 522 LEU B CG  1 
ATOM 3102 C CD1 . LEU B 1 126 ? 27.670 19.639 45.486 1.00 14.85 ? 522 LEU B CD1 1 
ATOM 3103 C CD2 . LEU B 1 126 ? 25.709 18.455 46.490 1.00 14.89 ? 522 LEU B CD2 1 
ATOM 3104 N N   . ALA B 1 127 ? 28.015 17.851 41.949 1.00 9.69  ? 523 ALA B N   1 
ATOM 3105 C CA  . ALA B 1 127 ? 28.650 16.637 41.467 1.00 7.49  ? 523 ALA B CA  1 
ATOM 3106 C C   . ALA B 1 127 ? 30.150 16.780 41.677 1.00 3.64  ? 523 ALA B C   1 
ATOM 3107 O O   . ALA B 1 127 ? 30.643 17.892 41.858 1.00 5.50  ? 523 ALA B O   1 
ATOM 3108 C CB  . ALA B 1 127 ? 28.332 16.457 39.968 1.00 8.23  ? 523 ALA B CB  1 
ATOM 3109 N N   . ALA B 1 128 ? 30.880 15.671 41.609 1.00 2.00  ? 524 ALA B N   1 
ATOM 3110 C CA  . ALA B 1 128 ? 32.328 15.695 41.804 1.00 3.96  ? 524 ALA B CA  1 
ATOM 3111 C C   . ALA B 1 128 ? 33.040 16.533 40.753 1.00 3.94  ? 524 ALA B C   1 
ATOM 3112 O O   . ALA B 1 128 ? 34.159 16.994 40.974 1.00 2.00  ? 524 ALA B O   1 
ATOM 3113 C CB  . ALA B 1 128 ? 32.890 14.289 41.820 1.00 2.49  ? 524 ALA B CB  1 
ATOM 3114 N N   . ARG B 1 129 ? 32.409 16.696 39.596 1.00 6.91  ? 525 ARG B N   1 
ATOM 3115 C CA  . ARG B 1 129 ? 32.979 17.497 38.515 1.00 11.27 ? 525 ARG B CA  1 
ATOM 3116 C C   . ARG B 1 129 ? 33.002 18.983 38.891 1.00 11.79 ? 525 ARG B C   1 
ATOM 3117 O O   . ARG B 1 129 ? 33.802 19.760 38.376 1.00 11.27 ? 525 ARG B O   1 
ATOM 3118 C CB  . ARG B 1 129 ? 32.152 17.328 37.246 1.00 13.87 ? 525 ARG B CB  1 
ATOM 3119 C CG  . ARG B 1 129 ? 30.741 17.870 37.362 1.00 18.97 ? 525 ARG B CG  1 
ATOM 3120 C CD  . ARG B 1 129 ? 30.214 18.263 35.997 1.00 23.23 ? 525 ARG B CD  1 
ATOM 3121 N NE  . ARG B 1 129 ? 31.138 19.182 35.332 1.00 29.34 ? 525 ARG B NE  1 
ATOM 3122 C CZ  . ARG B 1 129 ? 30.855 20.439 35.010 1.00 30.92 ? 525 ARG B CZ  1 
ATOM 3123 N NH1 . ARG B 1 129 ? 29.662 20.956 35.283 1.00 31.96 ? 525 ARG B NH1 1 
ATOM 3124 N NH2 . ARG B 1 129 ? 31.773 21.183 34.412 1.00 28.24 ? 525 ARG B NH2 1 
ATOM 3125 N N   . ASN B 1 130 ? 32.099 19.364 39.785 1.00 11.62 ? 526 ASN B N   1 
ATOM 3126 C CA  . ASN B 1 130 ? 31.982 20.734 40.250 1.00 8.74  ? 526 ASN B CA  1 
ATOM 3127 C C   . ASN B 1 130 ? 32.698 20.956 41.585 1.00 5.24  ? 526 ASN B C   1 
ATOM 3128 O O   . ASN B 1 130 ? 32.471 21.956 42.255 1.00 4.05  ? 526 ASN B O   1 
ATOM 3129 C CB  . ASN B 1 130 ? 30.504 21.093 40.372 1.00 6.93  ? 526 ASN B CB  1 
ATOM 3130 C CG  . ASN B 1 130 ? 29.781 21.003 39.047 1.00 8.76  ? 526 ASN B CG  1 
ATOM 3131 O OD1 . ASN B 1 130 ? 28.796 20.275 38.909 1.00 13.72 ? 526 ASN B OD1 1 
ATOM 3132 N ND2 . ASN B 1 130 ? 30.283 21.725 38.051 1.00 11.51 ? 526 ASN B ND2 1 
ATOM 3133 N N   . CYS B 1 131 ? 33.549 20.013 41.977 1.00 7.78  ? 527 CYS B N   1 
ATOM 3134 C CA  . CYS B 1 131 ? 34.302 20.128 43.218 1.00 9.39  ? 527 CYS B CA  1 
ATOM 3135 C C   . CYS B 1 131 ? 35.777 20.186 42.865 1.00 6.94  ? 527 CYS B C   1 
ATOM 3136 O O   . CYS B 1 131 ? 36.225 19.505 41.942 1.00 9.40  ? 527 CYS B O   1 
ATOM 3137 C CB  . CYS B 1 131 ? 34.046 18.934 44.147 1.00 8.89  ? 527 CYS B CB  1 
ATOM 3138 S SG  . CYS B 1 131 ? 32.439 18.919 44.970 1.00 9.13  ? 527 CYS B SG  1 
ATOM 3139 N N   . LEU B 1 132 ? 36.520 21.006 43.600 1.00 10.86 ? 528 LEU B N   1 
ATOM 3140 C CA  . LEU B 1 132 ? 37.953 21.176 43.376 1.00 12.73 ? 528 LEU B CA  1 
ATOM 3141 C C   . LEU B 1 132 ? 38.734 20.710 44.591 1.00 12.40 ? 528 LEU B C   1 
ATOM 3142 O O   . LEU B 1 132 ? 38.197 20.638 45.696 1.00 14.00 ? 528 LEU B O   1 
ATOM 3143 C CB  . LEU B 1 132 ? 38.276 22.646 43.097 1.00 12.37 ? 528 LEU B CB  1 
ATOM 3144 C CG  . LEU B 1 132 ? 37.598 23.307 41.892 1.00 12.90 ? 528 LEU B CG  1 
ATOM 3145 C CD1 . LEU B 1 132 ? 37.402 24.781 42.185 1.00 19.16 ? 528 LEU B CD1 1 
ATOM 3146 C CD2 . LEU B 1 132 ? 38.419 23.099 40.614 1.00 17.35 ? 528 LEU B CD2 1 
ATOM 3147 N N   . VAL B 1 133 ? 40.009 20.405 44.381 1.00 13.66 ? 529 VAL B N   1 
ATOM 3148 C CA  . VAL B 1 133 ? 40.884 19.939 45.446 1.00 16.38 ? 529 VAL B CA  1 
ATOM 3149 C C   . VAL B 1 133 ? 42.122 20.820 45.442 1.00 17.99 ? 529 VAL B C   1 
ATOM 3150 O O   . VAL B 1 133 ? 42.673 21.120 44.381 1.00 19.19 ? 529 VAL B O   1 
ATOM 3151 C CB  . VAL B 1 133 ? 41.324 18.477 45.205 1.00 13.16 ? 529 VAL B CB  1 
ATOM 3152 C CG1 . VAL B 1 133 ? 42.156 17.971 46.387 1.00 7.91  ? 529 VAL B CG1 1 
ATOM 3153 C CG2 . VAL B 1 133 ? 40.105 17.586 44.943 1.00 15.41 ? 529 VAL B CG2 1 
ATOM 3154 N N   . ASN B 1 134 ? 42.549 21.276 46.612 1.00 18.86 ? 530 ASN B N   1 
ATOM 3155 C CA  . ASN B 1 134 ? 43.741 22.109 46.653 1.00 18.14 ? 530 ASN B CA  1 
ATOM 3156 C C   . ASN B 1 134 ? 44.977 21.294 47.024 1.00 17.68 ? 530 ASN B C   1 
ATOM 3157 O O   . ASN B 1 134 ? 44.895 20.080 47.213 1.00 18.38 ? 530 ASN B O   1 
ATOM 3158 C CB  . ASN B 1 134 ? 43.551 23.328 47.570 1.00 17.83 ? 530 ASN B CB  1 
ATOM 3159 C CG  . ASN B 1 134 ? 43.511 22.976 49.043 1.00 13.97 ? 530 ASN B CG  1 
ATOM 3160 O OD1 . ASN B 1 134 ? 43.831 21.862 49.446 1.00 14.33 ? 530 ASN B OD1 1 
ATOM 3161 N ND2 . ASN B 1 134 ? 43.137 23.946 49.860 1.00 11.50 ? 530 ASN B ND2 1 
ATOM 3162 N N   . ASP B 1 135 ? 46.119 21.964 47.104 1.00 20.29 ? 531 ASP B N   1 
ATOM 3163 C CA  . ASP B 1 135 ? 47.392 21.329 47.433 1.00 24.52 ? 531 ASP B CA  1 
ATOM 3164 C C   . ASP B 1 135 ? 47.412 20.465 48.693 1.00 24.27 ? 531 ASP B C   1 
ATOM 3165 O O   . ASP B 1 135 ? 48.269 19.596 48.838 1.00 28.06 ? 531 ASP B O   1 
ATOM 3166 C CB  . ASP B 1 135 ? 48.498 22.388 47.520 1.00 26.76 ? 531 ASP B CB  1 
ATOM 3167 C CG  . ASP B 1 135 ? 47.956 23.787 47.753 1.00 26.59 ? 531 ASP B CG  1 
ATOM 3168 O OD1 . ASP B 1 135 ? 47.289 24.012 48.788 1.00 26.97 ? 531 ASP B OD1 1 
ATOM 3169 O OD2 . ASP B 1 135 ? 48.180 24.652 46.879 1.00 28.82 ? 531 ASP B OD2 1 
ATOM 3170 N N   . GLN B 1 136 ? 46.471 20.699 49.597 1.00 25.23 ? 532 GLN B N   1 
ATOM 3171 C CA  . GLN B 1 136 ? 46.406 19.951 50.846 1.00 23.53 ? 532 GLN B CA  1 
ATOM 3172 C C   . GLN B 1 136 ? 45.556 18.686 50.772 1.00 22.38 ? 532 GLN B C   1 
ATOM 3173 O O   . GLN B 1 136 ? 45.635 17.837 51.659 1.00 24.02 ? 532 GLN B O   1 
ATOM 3174 C CB  . GLN B 1 136 ? 45.856 20.846 51.953 1.00 25.74 ? 532 GLN B CB  1 
ATOM 3175 C CG  . GLN B 1 136 ? 46.669 20.828 53.233 1.00 28.15 ? 532 GLN B CG  1 
ATOM 3176 C CD  . GLN B 1 136 ? 47.984 21.563 53.089 1.00 28.65 ? 532 GLN B CD  1 
ATOM 3177 O OE1 . GLN B 1 136 ? 48.062 22.769 53.342 1.00 29.05 ? 532 GLN B OE1 1 
ATOM 3178 N NE2 . GLN B 1 136 ? 49.027 20.846 52.679 1.00 30.50 ? 532 GLN B NE2 1 
ATOM 3179 N N   . GLY B 1 137 ? 44.751 18.557 49.722 1.00 18.67 ? 533 GLY B N   1 
ATOM 3180 C CA  . GLY B 1 137 ? 43.877 17.402 49.601 1.00 13.49 ? 533 GLY B CA  1 
ATOM 3181 C C   . GLY B 1 137 ? 42.471 17.764 50.054 1.00 12.87 ? 533 GLY B C   1 
ATOM 3182 O O   . GLY B 1 137 ? 41.574 16.915 50.094 1.00 13.75 ? 533 GLY B O   1 
ATOM 3183 N N   . VAL B 1 138 ? 42.282 19.034 50.412 1.00 10.21 ? 534 VAL B N   1 
ATOM 3184 C CA  . VAL B 1 138 ? 40.987 19.536 50.852 1.00 9.08  ? 534 VAL B CA  1 
ATOM 3185 C C   . VAL B 1 138 ? 40.062 19.712 49.655 1.00 8.68  ? 534 VAL B C   1 
ATOM 3186 O O   . VAL B 1 138 ? 40.432 20.320 48.646 1.00 11.10 ? 534 VAL B O   1 
ATOM 3187 C CB  . VAL B 1 138 ? 41.117 20.895 51.588 1.00 8.03  ? 534 VAL B CB  1 
ATOM 3188 C CG1 . VAL B 1 138 ? 39.739 21.465 51.918 1.00 9.23  ? 534 VAL B CG1 1 
ATOM 3189 C CG2 . VAL B 1 138 ? 41.923 20.731 52.872 1.00 6.92  ? 534 VAL B CG2 1 
ATOM 3190 N N   . VAL B 1 139 ? 38.860 19.158 49.777 1.00 10.57 ? 535 VAL B N   1 
ATOM 3191 C CA  . VAL B 1 139 ? 37.848 19.239 48.732 1.00 9.29  ? 535 VAL B CA  1 
ATOM 3192 C C   . VAL B 1 139 ? 36.900 20.385 49.071 1.00 9.08  ? 535 VAL B C   1 
ATOM 3193 O O   . VAL B 1 139 ? 36.415 20.493 50.200 1.00 9.32  ? 535 VAL B O   1 
ATOM 3194 C CB  . VAL B 1 139 ? 37.058 17.918 48.622 1.00 8.60  ? 535 VAL B CB  1 
ATOM 3195 C CG1 . VAL B 1 139 ? 36.015 18.001 47.522 1.00 8.21  ? 535 VAL B CG1 1 
ATOM 3196 C CG2 . VAL B 1 139 ? 38.002 16.776 48.351 1.00 4.73  ? 535 VAL B CG2 1 
ATOM 3197 N N   . LYS B 1 140 ? 36.709 21.281 48.109 1.00 10.56 ? 536 LYS B N   1 
ATOM 3198 C CA  . LYS B 1 140 ? 35.829 22.432 48.279 1.00 6.61  ? 536 LYS B CA  1 
ATOM 3199 C C   . LYS B 1 140 ? 34.878 22.511 47.092 1.00 5.48  ? 536 LYS B C   1 
ATOM 3200 O O   . LYS B 1 140 ? 35.288 22.309 45.942 1.00 3.48  ? 536 LYS B O   1 
ATOM 3201 C CB  . LYS B 1 140 ? 36.640 23.722 48.326 1.00 5.90  ? 536 LYS B CB  1 
ATOM 3202 C CG  . LYS B 1 140 ? 37.657 23.823 49.437 1.00 5.31  ? 536 LYS B CG  1 
ATOM 3203 C CD  . LYS B 1 140 ? 38.204 25.241 49.517 1.00 6.28  ? 536 LYS B CD  1 
ATOM 3204 C CE  . LYS B 1 140 ? 39.257 25.356 50.607 1.00 7.99  ? 536 LYS B CE  1 
ATOM 3205 N NZ  . LYS B 1 140 ? 39.577 26.769 50.898 1.00 2.74  ? 536 LYS B NZ  1 
ATOM 3206 N N   . VAL B 1 141 ? 33.615 22.818 47.367 1.00 7.47  ? 537 VAL B N   1 
ATOM 3207 C CA  . VAL B 1 141 ? 32.619 22.927 46.314 1.00 8.81  ? 537 VAL B CA  1 
ATOM 3208 C C   . VAL B 1 141 ? 32.700 24.273 45.616 1.00 9.66  ? 537 VAL B C   1 
ATOM 3209 O O   . VAL B 1 141 ? 32.947 25.305 46.243 1.00 8.25  ? 537 VAL B O   1 
ATOM 3210 C CB  . VAL B 1 141 ? 31.188 22.635 46.835 1.00 8.72  ? 537 VAL B CB  1 
ATOM 3211 C CG1 . VAL B 1 141 ? 30.952 23.324 48.142 1.00 11.64 ? 537 VAL B CG1 1 
ATOM 3212 C CG2 . VAL B 1 141 ? 30.137 23.054 45.813 1.00 8.15  ? 537 VAL B CG2 1 
ATOM 3213 N N   . SER B 1 142 ? 32.524 24.233 44.302 1.00 15.29 ? 538 SER B N   1 
ATOM 3214 C CA  . SER B 1 142 ? 32.588 25.410 43.456 1.00 20.41 ? 538 SER B CA  1 
ATOM 3215 C C   . SER B 1 142 ? 31.478 25.310 42.407 1.00 20.96 ? 538 SER B C   1 
ATOM 3216 O O   . SER B 1 142 ? 30.516 24.555 42.573 1.00 20.92 ? 538 SER B O   1 
ATOM 3217 C CB  . SER B 1 142 ? 33.965 25.468 42.779 1.00 25.58 ? 538 SER B CB  1 
ATOM 3218 O OG  . SER B 1 142 ? 34.210 26.711 42.133 1.00 28.06 ? 538 SER B OG  1 
ATOM 3219 N N   . ASP B 1 143 ? 31.613 26.075 41.330 1.00 21.84 ? 539 ASP B N   1 
ATOM 3220 C CA  . ASP B 1 143 ? 30.625 26.092 40.255 1.00 26.29 ? 539 ASP B CA  1 
ATOM 3221 C C   . ASP B 1 143 ? 29.236 26.497 40.719 1.00 25.45 ? 539 ASP B C   1 
ATOM 3222 O O   . ASP B 1 143 ? 28.232 26.073 40.142 1.00 28.05 ? 539 ASP B O   1 
ATOM 3223 C CB  . ASP B 1 143 ? 30.569 24.750 39.531 1.00 29.26 ? 539 ASP B CB  1 
ATOM 3224 C CG  . ASP B 1 143 ? 31.510 24.691 38.352 1.00 32.89 ? 539 ASP B CG  1 
ATOM 3225 O OD1 . ASP B 1 143 ? 31.014 24.523 37.217 1.00 32.96 ? 539 ASP B OD1 1 
ATOM 3226 O OD2 . ASP B 1 143 ? 32.738 24.820 38.556 1.00 31.54 ? 539 ASP B OD2 1 
ATOM 3227 N N   . PHE B 1 144 ? 29.187 27.276 41.793 1.00 23.51 ? 540 PHE B N   1 
ATOM 3228 C CA  . PHE B 1 144 ? 27.931 27.777 42.318 1.00 22.85 ? 540 PHE B CA  1 
ATOM 3229 C C   . PHE B 1 144 ? 27.912 29.244 41.902 1.00 24.94 ? 540 PHE B C   1 
ATOM 3230 O O   . PHE B 1 144 ? 28.964 29.811 41.600 1.00 26.86 ? 540 PHE B O   1 
ATOM 3231 C CB  . PHE B 1 144 ? 27.860 27.612 43.846 1.00 17.06 ? 540 PHE B CB  1 
ATOM 3232 C CG  . PHE B 1 144 ? 28.988 28.269 44.586 1.00 14.42 ? 540 PHE B CG  1 
ATOM 3233 C CD1 . PHE B 1 144 ? 30.168 27.581 44.822 1.00 16.97 ? 540 PHE B CD1 1 
ATOM 3234 C CD2 . PHE B 1 144 ? 28.878 29.583 45.030 1.00 16.54 ? 540 PHE B CD2 1 
ATOM 3235 C CE1 . PHE B 1 144 ? 31.227 28.190 45.487 1.00 16.68 ? 540 PHE B CE1 1 
ATOM 3236 C CE2 . PHE B 1 144 ? 29.928 30.197 45.694 1.00 17.48 ? 540 PHE B CE2 1 
ATOM 3237 C CZ  . PHE B 1 144 ? 31.107 29.498 45.922 1.00 15.86 ? 540 PHE B CZ  1 
ATOM 3238 N N   . GLY B 1 145 ? 26.733 29.849 41.844 1.00 25.65 ? 541 GLY B N   1 
ATOM 3239 C CA  . GLY B 1 145 ? 26.643 31.243 41.437 1.00 30.15 ? 541 GLY B CA  1 
ATOM 3240 C C   . GLY B 1 145 ? 25.289 31.471 40.809 1.00 32.87 ? 541 GLY B C   1 
ATOM 3241 O O   . GLY B 1 145 ? 24.421 32.123 41.387 1.00 34.13 ? 541 GLY B O   1 
ATOM 3242 N N   . LEU B 1 146 ? 25.108 30.932 39.608 1.00 33.81 ? 542 LEU B N   1 
ATOM 3243 C CA  . LEU B 1 146 ? 23.824 31.022 38.929 1.00 34.85 ? 542 LEU B CA  1 
ATOM 3244 C C   . LEU B 1 146 ? 22.935 29.998 39.648 1.00 36.33 ? 542 LEU B C   1 
ATOM 3245 O O   . LEU B 1 146 ? 21.762 29.819 39.318 1.00 36.07 ? 542 LEU B O   1 
ATOM 3246 C CB  . LEU B 1 146 ? 23.973 30.692 37.439 1.00 33.89 ? 542 LEU B CB  1 
ATOM 3247 C CG  . LEU B 1 146 ? 24.372 29.277 37.014 1.00 31.57 ? 542 LEU B CG  1 
ATOM 3248 C CD1 . LEU B 1 146 ? 23.136 28.530 36.552 1.00 30.77 ? 542 LEU B CD1 1 
ATOM 3249 C CD2 . LEU B 1 146 ? 25.400 29.340 35.884 1.00 31.85 ? 542 LEU B CD2 1 
ATOM 3250 N N   . SER B 1 147 ? 23.547 29.300 40.605 1.00 36.24 ? 543 SER B N   1 
ATOM 3251 C CA  . SER B 1 147 ? 22.895 28.316 41.450 1.00 34.49 ? 543 SER B CA  1 
ATOM 3252 C C   . SER B 1 147 ? 21.837 29.077 42.230 1.00 36.96 ? 543 SER B C   1 
ATOM 3253 O O   . SER B 1 147 ? 22.137 30.058 42.908 1.00 39.90 ? 543 SER B O   1 
ATOM 3254 C CB  . SER B 1 147 ? 23.929 27.733 42.393 1.00 31.44 ? 543 SER B CB  1 
ATOM 3255 O OG  . SER B 1 147 ? 25.053 27.284 41.653 1.00 26.36 ? 543 SER B OG  1 
ATOM 3256 N N   . ARG B 1 148 ? 20.601 28.614 42.128 1.00 38.02 ? 544 ARG B N   1 
ATOM 3257 C CA  . ARG B 1 148 ? 19.478 29.279 42.758 1.00 40.54 ? 544 ARG B CA  1 
ATOM 3258 C C   . ARG B 1 148 ? 19.399 29.478 44.265 1.00 43.19 ? 544 ARG B C   1 
ATOM 3259 O O   . ARG B 1 148 ? 20.208 28.975 45.047 1.00 41.34 ? 544 ARG B O   1 
ATOM 3260 C CB  . ARG B 1 148 ? 18.172 28.682 42.241 1.00 38.19 ? 544 ARG B CB  1 
ATOM 3261 C CG  . ARG B 1 148 ? 17.913 28.975 40.773 1.00 39.29 ? 544 ARG B CG  1 
ATOM 3262 C CD  . ARG B 1 148 ? 17.874 30.471 40.482 1.00 37.23 ? 544 ARG B CD  1 
ATOM 3263 N NE  . ARG B 1 148 ? 19.173 30.999 40.068 1.00 34.52 ? 544 ARG B NE  1 
ATOM 3264 C CZ  . ARG B 1 148 ? 19.810 32.003 40.668 1.00 33.10 ? 544 ARG B CZ  1 
ATOM 3265 N NH1 . ARG B 1 148 ? 19.288 32.605 41.729 1.00 31.47 ? 544 ARG B NH1 1 
ATOM 3266 N NH2 . ARG B 1 148 ? 20.965 32.431 40.183 1.00 33.04 ? 544 ARG B NH2 1 
ATOM 3267 N N   . TYR B 1 149 ? 18.407 30.285 44.630 1.00 46.71 ? 545 TYR B N   1 
ATOM 3268 C CA  . TYR B 1 149 ? 18.074 30.644 46.001 1.00 47.03 ? 545 TYR B CA  1 
ATOM 3269 C C   . TYR B 1 149 ? 16.722 29.937 46.170 1.00 46.78 ? 545 TYR B C   1 
ATOM 3270 O O   . TYR B 1 149 ? 16.490 28.886 45.570 1.00 46.40 ? 545 TYR B O   1 
ATOM 3271 C CB  . TYR B 1 149 ? 17.896 32.176 46.075 1.00 47.74 ? 545 TYR B CB  1 
ATOM 3272 C CG  . TYR B 1 149 ? 18.059 32.828 47.440 1.00 46.83 ? 545 TYR B CG  1 
ATOM 3273 C CD1 . TYR B 1 149 ? 17.606 32.210 48.606 1.00 47.23 ? 545 TYR B CD1 1 
ATOM 3274 C CD2 . TYR B 1 149 ? 18.653 34.085 47.557 1.00 48.20 ? 545 TYR B CD2 1 
ATOM 3275 C CE1 . TYR B 1 149 ? 17.742 32.829 49.853 1.00 49.06 ? 545 TYR B CE1 1 
ATOM 3276 C CE2 . TYR B 1 149 ? 18.794 34.712 48.796 1.00 48.88 ? 545 TYR B CE2 1 
ATOM 3277 C CZ  . TYR B 1 149 ? 18.338 34.080 49.937 1.00 48.87 ? 545 TYR B CZ  1 
ATOM 3278 O OH  . TYR B 1 149 ? 18.491 34.695 51.158 1.00 49.33 ? 545 TYR B OH  1 
ATOM 3279 N N   . VAL B 1 150 ? 15.818 30.542 46.928 1.00 46.89 ? 546 VAL B N   1 
ATOM 3280 C CA  . VAL B 1 150 ? 14.487 29.994 47.154 1.00 47.78 ? 546 VAL B CA  1 
ATOM 3281 C C   . VAL B 1 150 ? 13.555 31.180 47.374 1.00 47.25 ? 546 VAL B C   1 
ATOM 3282 O O   . VAL B 1 150 ? 13.997 32.331 47.375 1.00 46.90 ? 546 VAL B O   1 
ATOM 3283 C CB  . VAL B 1 150 ? 14.440 29.047 48.385 1.00 48.44 ? 546 VAL B CB  1 
ATOM 3284 C CG1 . VAL B 1 150 ? 15.047 27.696 48.038 1.00 49.26 ? 546 VAL B CG1 1 
ATOM 3285 C CG2 . VAL B 1 150 ? 15.174 29.668 49.569 1.00 49.28 ? 546 VAL B CG2 1 
ATOM 3286 N N   . LEU B 1 151 ? 12.269 30.908 47.546 1.00 47.06 ? 547 LEU B N   1 
ATOM 3287 C CA  . LEU B 1 151 ? 11.291 31.964 47.764 1.00 47.07 ? 547 LEU B CA  1 
ATOM 3288 C C   . LEU B 1 151 ? 10.169 31.363 48.602 1.00 48.24 ? 547 LEU B C   1 
ATOM 3289 O O   . LEU B 1 151 ? 10.439 30.733 49.623 1.00 48.69 ? 547 LEU B O   1 
ATOM 3290 C CB  . LEU B 1 151 ? 10.767 32.492 46.419 1.00 46.14 ? 547 LEU B CB  1 
ATOM 3291 C CG  . LEU B 1 151 ? 9.916  33.768 46.428 1.00 46.13 ? 547 LEU B CG  1 
ATOM 3292 C CD1 . LEU B 1 151 ? 10.754 34.945 46.906 1.00 47.63 ? 547 LEU B CD1 1 
ATOM 3293 C CD2 . LEU B 1 151 ? 9.359  34.035 45.035 1.00 47.76 ? 547 LEU B CD2 1 
ATOM 3294 N N   . ASP B 1 152 ? 8.927  31.495 48.141 1.00 48.47 ? 548 ASP B N   1 
ATOM 3295 C CA  . ASP B 1 152 ? 7.786  30.966 48.871 1.00 47.63 ? 548 ASP B CA  1 
ATOM 3296 C C   . ASP B 1 152 ? 7.907  29.451 49.017 1.00 46.66 ? 548 ASP B C   1 
ATOM 3297 O O   . ASP B 1 152 ? 8.000  28.944 50.131 1.00 45.89 ? 548 ASP B O   1 
ATOM 3298 C CB  . ASP B 1 152 ? 6.480  31.345 48.164 1.00 47.12 ? 548 ASP B CB  1 
ATOM 3299 C CG  . ASP B 1 152 ? 5.272  31.257 49.078 1.00 47.82 ? 548 ASP B CG  1 
ATOM 3300 O OD1 . ASP B 1 152 ? 4.251  30.681 48.653 1.00 47.08 ? 548 ASP B OD1 1 
ATOM 3301 O OD2 . ASP B 1 152 ? 5.335  31.775 50.216 1.00 48.07 ? 548 ASP B OD2 1 
ATOM 3302 N N   . ASP B 1 153 ? 7.954  28.735 47.896 1.00 47.04 ? 549 ASP B N   1 
ATOM 3303 C CA  . ASP B 1 153 ? 8.064  27.278 47.937 1.00 45.92 ? 549 ASP B CA  1 
ATOM 3304 C C   . ASP B 1 153 ? 8.787  26.633 46.755 1.00 46.60 ? 549 ASP B C   1 
ATOM 3305 O O   . ASP B 1 153 ? 9.179  25.470 46.835 1.00 48.82 ? 549 ASP B O   1 
ATOM 3306 C CB  . ASP B 1 153 ? 6.683  26.643 48.100 1.00 44.19 ? 549 ASP B CB  1 
ATOM 3307 C CG  . ASP B 1 153 ? 6.155  26.745 49.517 1.00 43.52 ? 549 ASP B CG  1 
ATOM 3308 O OD1 . ASP B 1 153 ? 5.403  27.697 49.809 1.00 39.96 ? 549 ASP B OD1 1 
ATOM 3309 O OD2 . ASP B 1 153 ? 6.494  25.870 50.340 1.00 43.98 ? 549 ASP B OD2 1 
ATOM 3310 N N   . GLU B 1 154 ? 8.931  27.366 45.653 1.00 46.02 ? 550 GLU B N   1 
ATOM 3311 C CA  . GLU B 1 154 ? 9.611  26.852 44.459 1.00 44.77 ? 550 GLU B CA  1 
ATOM 3312 C C   . GLU B 1 154 ? 9.775  27.931 43.389 1.00 45.63 ? 550 GLU B C   1 
ATOM 3313 O O   . GLU B 1 154 ? 9.743  29.123 43.701 1.00 42.92 ? 550 GLU B O   1 
ATOM 3314 C CB  . GLU B 1 154 ? 8.867  25.635 43.881 1.00 44.82 ? 550 GLU B CB  1 
ATOM 3315 C CG  . GLU B 1 154 ? 7.334  25.707 43.878 1.00 40.66 ? 550 GLU B CG  1 
ATOM 3316 C CD  . GLU B 1 154 ? 6.772  26.820 43.009 1.00 39.18 ? 550 GLU B CD  1 
ATOM 3317 O OE1 . GLU B 1 154 ? 6.074  27.701 43.554 1.00 38.17 ? 550 GLU B OE1 1 
ATOM 3318 O OE2 . GLU B 1 154 ? 7.016  26.810 41.784 1.00 38.80 ? 550 GLU B OE2 1 
ATOM 3319 N N   . TYR B 1 155 ? 9.969  27.509 42.141 1.00 45.07 ? 551 TYR B N   1 
ATOM 3320 C CA  . TYR B 1 155 ? 10.119 28.427 41.016 1.00 46.80 ? 551 TYR B CA  1 
ATOM 3321 C C   . TYR B 1 155 ? 10.061 27.697 39.665 1.00 47.92 ? 551 TYR B C   1 
ATOM 3322 O O   . TYR B 1 155 ? 9.575  26.567 39.583 1.00 48.34 ? 551 TYR B O   1 
ATOM 3323 C CB  . TYR B 1 155 ? 11.410 29.243 41.147 1.00 47.58 ? 551 TYR B CB  1 
ATOM 3324 C CG  . TYR B 1 155 ? 12.684 28.433 41.176 1.00 46.34 ? 551 TYR B CG  1 
ATOM 3325 C CD1 . TYR B 1 155 ? 13.471 28.303 40.035 1.00 44.53 ? 551 TYR B CD1 1 
ATOM 3326 C CD2 . TYR B 1 155 ? 13.126 27.831 42.354 1.00 46.94 ? 551 TYR B CD2 1 
ATOM 3327 C CE1 . TYR B 1 155 ? 14.668 27.596 40.063 1.00 45.32 ? 551 TYR B CE1 1 
ATOM 3328 C CE2 . TYR B 1 155 ? 14.324 27.120 42.394 1.00 46.70 ? 551 TYR B CE2 1 
ATOM 3329 C CZ  . TYR B 1 155 ? 15.090 27.008 41.244 1.00 46.98 ? 551 TYR B CZ  1 
ATOM 3330 O OH  . TYR B 1 155 ? 16.275 26.309 41.268 1.00 47.08 ? 551 TYR B OH  1 
ATOM 3331 N N   . THR B 1 156 ? 10.539 28.344 38.606 1.00 47.56 ? 552 THR B N   1 
ATOM 3332 C CA  . THR B 1 156 ? 10.519 27.736 37.279 1.00 47.33 ? 552 THR B CA  1 
ATOM 3333 C C   . THR B 1 156 ? 11.823 27.975 36.521 1.00 48.87 ? 552 THR B C   1 
ATOM 3334 O O   . THR B 1 156 ? 12.474 27.030 36.080 1.00 49.47 ? 552 THR B O   1 
ATOM 3335 C CB  . THR B 1 156 ? 9.352  28.283 36.436 1.00 44.44 ? 552 THR B CB  1 
ATOM 3336 O OG1 . THR B 1 156 ? 8.153  28.291 37.219 1.00 43.39 ? 552 THR B OG1 1 
ATOM 3337 C CG2 . THR B 1 156 ? 9.139  27.423 35.204 1.00 43.18 ? 552 THR B CG2 1 
ATOM 3338 N N   . SER B 1 157 ? 12.203 29.242 36.382 1.00 50.63 ? 553 SER B N   1 
ATOM 3339 C CA  . SER B 1 157 ? 13.425 29.614 35.674 1.00 51.18 ? 553 SER B CA  1 
ATOM 3340 C C   . SER B 1 157 ? 13.395 29.148 34.210 1.00 51.91 ? 553 SER B C   1 
ATOM 3341 O O   . SER B 1 157 ? 12.331 29.148 33.584 1.00 52.66 ? 553 SER B O   1 
ATOM 3342 C CB  . SER B 1 157 ? 14.655 29.070 36.414 1.00 48.79 ? 553 SER B CB  1 
ATOM 3343 O OG  . SER B 1 157 ? 14.750 29.635 37.713 1.00 43.88 ? 553 SER B OG  1 
ATOM 3344 N N   . SER B 1 158 ? 14.552 28.772 33.667 1.00 50.57 ? 554 SER B N   1 
ATOM 3345 C CA  . SER B 1 158 ? 14.656 28.321 32.283 1.00 48.71 ? 554 SER B CA  1 
ATOM 3346 C C   . SER B 1 158 ? 13.811 27.086 31.977 1.00 47.80 ? 554 SER B C   1 
ATOM 3347 O O   . SER B 1 158 ? 14.228 25.955 32.228 1.00 49.68 ? 554 SER B O   1 
ATOM 3348 C CB  . SER B 1 158 ? 16.121 28.056 31.928 1.00 49.93 ? 554 SER B CB  1 
ATOM 3349 O OG  . SER B 1 158 ? 16.904 29.219 32.142 1.00 48.05 ? 554 SER B OG  1 
ATOM 3350 N N   . VAL B 1 159 ? 12.624 27.319 31.427 1.00 45.84 ? 555 VAL B N   1 
ATOM 3351 C CA  . VAL B 1 159 ? 11.702 26.247 31.067 1.00 42.92 ? 555 VAL B CA  1 
ATOM 3352 C C   . VAL B 1 159 ? 12.319 25.381 29.969 1.00 43.08 ? 555 VAL B C   1 
ATOM 3353 O O   . VAL B 1 159 ? 12.798 25.904 28.963 1.00 45.11 ? 555 VAL B O   1 
ATOM 3354 C CB  . VAL B 1 159 ? 10.362 26.821 30.570 1.00 38.45 ? 555 VAL B CB  1 
ATOM 3355 C CG1 . VAL B 1 159 ? 9.363  25.703 30.345 1.00 41.05 ? 555 VAL B CG1 1 
ATOM 3356 C CG2 . VAL B 1 159 ? 9.819  27.822 31.577 1.00 38.78 ? 555 VAL B CG2 1 
ATOM 3357 N N   . GLY B 1 160 ? 12.284 24.062 30.157 1.00 40.17 ? 556 GLY B N   1 
ATOM 3358 C CA  . GLY B 1 160 ? 12.860 23.144 29.185 1.00 36.28 ? 556 GLY B CA  1 
ATOM 3359 C C   . GLY B 1 160 ? 14.375 23.211 29.259 1.00 34.46 ? 556 GLY B C   1 
ATOM 3360 O O   . GLY B 1 160 ? 14.937 24.302 29.258 1.00 34.17 ? 556 GLY B O   1 
ATOM 3361 N N   . SER B 1 161 ? 15.042 22.065 29.357 1.00 37.09 ? 557 SER B N   1 
ATOM 3362 C CA  . SER B 1 161 ? 16.501 22.047 29.451 1.00 39.60 ? 557 SER B CA  1 
ATOM 3363 C C   . SER B 1 161 ? 17.084 20.634 29.581 1.00 39.69 ? 557 SER B C   1 
ATOM 3364 O O   . SER B 1 161 ? 16.355 19.635 29.559 1.00 37.28 ? 557 SER B O   1 
ATOM 3365 C CB  . SER B 1 161 ? 16.959 22.896 30.650 1.00 42.29 ? 557 SER B CB  1 
ATOM 3366 O OG  . SER B 1 161 ? 18.341 23.216 30.573 1.00 42.78 ? 557 SER B OG  1 
ATOM 3367 N N   . LYS B 1 162 ? 18.408 20.572 29.710 1.00 38.88 ? 558 LYS B N   1 
ATOM 3368 C CA  . LYS B 1 162 ? 19.131 19.317 29.861 1.00 38.70 ? 558 LYS B CA  1 
ATOM 3369 C C   . LYS B 1 162 ? 19.883 19.350 31.188 1.00 38.02 ? 558 LYS B C   1 
ATOM 3370 O O   . LYS B 1 162 ? 20.904 20.019 31.327 1.00 38.61 ? 558 LYS B O   1 
ATOM 3371 C CB  . LYS B 1 162 ? 20.122 19.107 28.711 1.00 40.51 ? 558 LYS B CB  1 
ATOM 3372 C CG  . LYS B 1 162 ? 19.507 19.185 27.328 1.00 39.86 ? 558 LYS B CG  1 
ATOM 3373 C CD  . LYS B 1 162 ? 19.318 20.630 26.895 1.00 40.70 ? 558 LYS B CD  1 
ATOM 3374 C CE  . LYS B 1 162 ? 18.358 20.719 25.736 1.00 38.88 ? 558 LYS B CE  1 
ATOM 3375 N NZ  . LYS B 1 162 ? 17.034 20.178 26.138 1.00 36.01 ? 558 LYS B NZ  1 
ATOM 3376 N N   . PHE B 1 163 ? 19.342 18.648 32.171 1.00 35.11 ? 559 PHE B N   1 
ATOM 3377 C CA  . PHE B 1 163 ? 19.935 18.570 33.499 1.00 32.80 ? 559 PHE B CA  1 
ATOM 3378 C C   . PHE B 1 163 ? 20.947 17.423 33.473 1.00 30.75 ? 559 PHE B C   1 
ATOM 3379 O O   . PHE B 1 163 ? 20.919 16.597 32.556 1.00 30.59 ? 559 PHE B O   1 
ATOM 3380 C CB  . PHE B 1 163 ? 18.836 18.268 34.530 1.00 35.42 ? 559 PHE B CB  1 
ATOM 3381 C CG  . PHE B 1 163 ? 17.431 18.422 33.991 1.00 38.43 ? 559 PHE B CG  1 
ATOM 3382 C CD1 . PHE B 1 163 ? 16.647 17.302 33.728 1.00 35.87 ? 559 PHE B CD1 1 
ATOM 3383 C CD2 . PHE B 1 163 ? 16.902 19.685 33.730 1.00 35.45 ? 559 PHE B CD2 1 
ATOM 3384 C CE1 . PHE B 1 163 ? 15.360 17.434 33.212 1.00 38.06 ? 559 PHE B CE1 1 
ATOM 3385 C CE2 . PHE B 1 163 ? 15.616 19.827 33.214 1.00 33.30 ? 559 PHE B CE2 1 
ATOM 3386 C CZ  . PHE B 1 163 ? 14.843 18.696 32.954 1.00 36.08 ? 559 PHE B CZ  1 
ATOM 3387 N N   . PRO B 1 164 ? 21.843 17.341 34.478 1.00 27.32 ? 560 PRO B N   1 
ATOM 3388 C CA  . PRO B 1 164 ? 22.832 16.255 34.503 1.00 23.53 ? 560 PRO B CA  1 
ATOM 3389 C C   . PRO B 1 164 ? 22.166 14.872 34.563 1.00 23.08 ? 560 PRO B C   1 
ATOM 3390 O O   . PRO B 1 164 ? 22.778 13.857 34.212 1.00 21.72 ? 560 PRO B O   1 
ATOM 3391 C CB  . PRO B 1 164 ? 23.640 16.561 35.765 1.00 20.79 ? 560 PRO B CB  1 
ATOM 3392 C CG  . PRO B 1 164 ? 22.668 17.275 36.631 1.00 19.96 ? 560 PRO B CG  1 
ATOM 3393 C CD  . PRO B 1 164 ? 22.005 18.208 35.658 1.00 23.09 ? 560 PRO B CD  1 
ATOM 3394 N N   . VAL B 1 165 ? 20.921 14.846 35.037 1.00 22.54 ? 561 VAL B N   1 
ATOM 3395 C CA  . VAL B 1 165 ? 20.118 13.629 35.138 1.00 21.12 ? 561 VAL B CA  1 
ATOM 3396 C C   . VAL B 1 165 ? 20.510 12.666 36.259 1.00 18.16 ? 561 VAL B C   1 
ATOM 3397 O O   . VAL B 1 165 ? 19.709 12.404 37.162 1.00 18.62 ? 561 VAL B O   1 
ATOM 3398 C CB  . VAL B 1 165 ? 20.065 12.847 33.786 1.00 24.08 ? 561 VAL B CB  1 
ATOM 3399 C CG1 . VAL B 1 165 ? 19.095 11.656 33.890 1.00 22.39 ? 561 VAL B CG1 1 
ATOM 3400 C CG2 . VAL B 1 165 ? 19.654 13.778 32.641 1.00 24.23 ? 561 VAL B CG2 1 
ATOM 3401 N N   . ARG B 1 166 ? 21.729 12.141 36.210 1.00 13.44 ? 562 ARG B N   1 
ATOM 3402 C CA  . ARG B 1 166 ? 22.182 11.192 37.221 1.00 14.89 ? 562 ARG B CA  1 
ATOM 3403 C C   . ARG B 1 166 ? 22.129 11.748 38.639 1.00 14.76 ? 562 ARG B C   1 
ATOM 3404 O O   . ARG B 1 166 ? 21.745 11.051 39.584 1.00 15.25 ? 562 ARG B O   1 
ATOM 3405 C CB  . ARG B 1 166 ? 23.606 10.726 36.919 1.00 18.46 ? 562 ARG B CB  1 
ATOM 3406 C CG  . ARG B 1 166 ? 23.764 9.858  35.677 1.00 20.23 ? 562 ARG B CG  1 
ATOM 3407 C CD  . ARG B 1 166 ? 23.654 10.637 34.387 1.00 19.70 ? 562 ARG B CD  1 
ATOM 3408 N NE  . ARG B 1 166 ? 24.262 9.895  33.284 1.00 26.34 ? 562 ARG B NE  1 
ATOM 3409 C CZ  . ARG B 1 166 ? 23.614 9.045  32.495 1.00 23.35 ? 562 ARG B CZ  1 
ATOM 3410 N NH1 . ARG B 1 166 ? 22.320 8.821  32.670 1.00 25.49 ? 562 ARG B NH1 1 
ATOM 3411 N NH2 . ARG B 1 166 ? 24.277 8.394  31.549 1.00 20.77 ? 562 ARG B NH2 1 
ATOM 3412 N N   . TRP B 1 167 ? 22.510 13.012 38.769 1.00 13.56 ? 563 TRP B N   1 
ATOM 3413 C CA  . TRP B 1 167 ? 22.544 13.707 40.050 1.00 15.17 ? 563 TRP B CA  1 
ATOM 3414 C C   . TRP B 1 167 ? 21.236 14.431 40.346 1.00 16.25 ? 563 TRP B C   1 
ATOM 3415 O O   . TRP B 1 167 ? 21.202 15.361 41.157 1.00 15.08 ? 563 TRP B O   1 
ATOM 3416 C CB  . TRP B 1 167 ? 23.680 14.733 40.021 1.00 17.58 ? 563 TRP B CB  1 
ATOM 3417 C CG  . TRP B 1 167 ? 25.024 14.120 39.845 1.00 16.68 ? 563 TRP B CG  1 
ATOM 3418 C CD1 . TRP B 1 167 ? 25.924 13.848 40.830 1.00 12.29 ? 563 TRP B CD1 1 
ATOM 3419 C CD2 . TRP B 1 167 ? 25.614 13.658 38.619 1.00 18.94 ? 563 TRP B CD2 1 
ATOM 3420 N NE1 . TRP B 1 167 ? 27.028 13.233 40.300 1.00 18.47 ? 563 TRP B NE1 1 
ATOM 3421 C CE2 . TRP B 1 167 ? 26.870 13.106 38.945 1.00 19.94 ? 563 TRP B CE2 1 
ATOM 3422 C CE3 . TRP B 1 167 ? 25.202 13.651 37.280 1.00 18.43 ? 563 TRP B CE3 1 
ATOM 3423 C CZ2 . TRP B 1 167 ? 27.724 12.552 37.979 1.00 20.36 ? 563 TRP B CZ2 1 
ATOM 3424 C CZ3 . TRP B 1 167 ? 26.056 13.097 36.314 1.00 17.95 ? 563 TRP B CZ3 1 
ATOM 3425 C CH2 . TRP B 1 167 ? 27.298 12.555 36.674 1.00 17.39 ? 563 TRP B CH2 1 
ATOM 3426 N N   . SER B 1 168 ? 20.153 13.979 39.728 1.00 16.15 ? 564 SER B N   1 
ATOM 3427 C CA  . SER B 1 168 ? 18.877 14.647 39.894 1.00 15.25 ? 564 SER B CA  1 
ATOM 3428 C C   . SER B 1 168 ? 17.732 13.812 40.466 1.00 18.06 ? 564 SER B C   1 
ATOM 3429 O O   . SER B 1 168 ? 17.643 12.604 40.245 1.00 18.41 ? 564 SER B O   1 
ATOM 3430 C CB  . SER B 1 168 ? 18.450 15.226 38.540 1.00 12.15 ? 564 SER B CB  1 
ATOM 3431 O OG  . SER B 1 168 ? 19.456 16.046 37.961 1.00 15.22 ? 564 SER B OG  1 
ATOM 3432 N N   . PRO B 1 169 ? 16.852 14.453 41.250 1.00 19.48 ? 565 PRO B N   1 
ATOM 3433 C CA  . PRO B 1 169 ? 15.699 13.784 41.854 1.00 20.89 ? 565 PRO B CA  1 
ATOM 3434 C C   . PRO B 1 169 ? 14.678 13.499 40.748 1.00 24.06 ? 565 PRO B C   1 
ATOM 3435 O O   . PRO B 1 169 ? 14.578 14.260 39.778 1.00 25.01 ? 565 PRO B O   1 
ATOM 3436 C CB  . PRO B 1 169 ? 15.154 14.852 42.801 1.00 20.19 ? 565 PRO B CB  1 
ATOM 3437 C CG  . PRO B 1 169 ? 16.331 15.681 43.117 1.00 16.32 ? 565 PRO B CG  1 
ATOM 3438 C CD  . PRO B 1 169 ? 17.013 15.807 41.805 1.00 16.11 ? 565 PRO B CD  1 
ATOM 3439 N N   . PRO B 1 170 ? 13.878 12.433 40.892 1.00 25.49 ? 566 PRO B N   1 
ATOM 3440 C CA  . PRO B 1 170 ? 12.887 12.126 39.853 1.00 27.84 ? 566 PRO B CA  1 
ATOM 3441 C C   . PRO B 1 170 ? 11.985 13.330 39.585 1.00 29.05 ? 566 PRO B C   1 
ATOM 3442 O O   . PRO B 1 170 ? 11.516 13.537 38.465 1.00 31.25 ? 566 PRO B O   1 
ATOM 3443 C CB  . PRO B 1 170 ? 12.114 10.966 40.470 1.00 26.01 ? 566 PRO B CB  1 
ATOM 3444 C CG  . PRO B 1 170 ? 13.169 10.267 41.256 1.00 28.12 ? 566 PRO B CG  1 
ATOM 3445 C CD  . PRO B 1 170 ? 13.859 11.410 41.947 1.00 24.25 ? 566 PRO B CD  1 
ATOM 3446 N N   . GLU B 1 171 ? 11.805 14.151 40.613 1.00 30.57 ? 567 GLU B N   1 
ATOM 3447 C CA  . GLU B 1 171 ? 10.982 15.348 40.518 1.00 31.66 ? 567 GLU B CA  1 
ATOM 3448 C C   . GLU B 1 171 ? 11.483 16.253 39.394 1.00 29.70 ? 567 GLU B C   1 
ATOM 3449 O O   . GLU B 1 171 ? 10.723 16.629 38.494 1.00 30.08 ? 567 GLU B O   1 
ATOM 3450 C CB  . GLU B 1 171 ? 11.006 16.119 41.841 1.00 30.30 ? 567 GLU B CB  1 
ATOM 3451 C CG  . GLU B 1 171 ? 10.491 15.346 43.051 1.00 31.92 ? 567 GLU B CG  1 
ATOM 3452 C CD  . GLU B 1 171 ? 11.493 14.337 43.594 1.00 30.79 ? 567 GLU B CD  1 
ATOM 3453 O OE1 . GLU B 1 171 ? 12.348 14.722 44.424 1.00 29.93 ? 567 GLU B OE1 1 
ATOM 3454 O OE2 . GLU B 1 171 ? 11.412 13.156 43.200 1.00 33.30 ? 567 GLU B OE2 1 
ATOM 3455 N N   . VAL B 1 172 ? 12.779 16.553 39.421 1.00 30.70 ? 568 VAL B N   1 
ATOM 3456 C CA  . VAL B 1 172 ? 13.382 17.422 38.419 1.00 30.50 ? 568 VAL B CA  1 
ATOM 3457 C C   . VAL B 1 172 ? 13.553 16.767 37.052 1.00 31.05 ? 568 VAL B C   1 
ATOM 3458 O O   . VAL B 1 172 ? 13.494 17.444 36.028 1.00 33.18 ? 568 VAL B O   1 
ATOM 3459 C CB  . VAL B 1 172 ? 14.737 17.976 38.885 1.00 30.30 ? 568 VAL B CB  1 
ATOM 3460 C CG1 . VAL B 1 172 ? 14.584 18.738 40.177 1.00 28.02 ? 568 VAL B CG1 1 
ATOM 3461 C CG2 . VAL B 1 172 ? 15.718 16.866 39.048 1.00 24.92 ? 568 VAL B CG2 1 
ATOM 3462 N N   . LEU B 1 173 ? 13.746 15.454 37.039 1.00 33.44 ? 569 LEU B N   1 
ATOM 3463 C CA  . LEU B 1 173 ? 13.924 14.711 35.791 1.00 34.63 ? 569 LEU B CA  1 
ATOM 3464 C C   . LEU B 1 173 ? 12.687 14.733 34.899 1.00 36.45 ? 569 LEU B C   1 
ATOM 3465 O O   . LEU B 1 173 ? 12.741 14.313 33.745 1.00 36.82 ? 569 LEU B O   1 
ATOM 3466 C CB  . LEU B 1 173 ? 14.322 13.266 36.091 1.00 32.99 ? 569 LEU B CB  1 
ATOM 3467 C CG  . LEU B 1 173 ? 15.657 13.167 36.828 1.00 31.76 ? 569 LEU B CG  1 
ATOM 3468 C CD1 . LEU B 1 173 ? 15.945 11.733 37.268 1.00 26.25 ? 569 LEU B CD1 1 
ATOM 3469 C CD2 . LEU B 1 173 ? 16.742 13.705 35.902 1.00 28.56 ? 569 LEU B CD2 1 
ATOM 3470 N N   . MET B 1 174 ? 11.568 15.192 35.451 1.00 39.88 ? 570 MET B N   1 
ATOM 3471 C CA  . MET B 1 174 ? 10.325 15.276 34.700 1.00 39.46 ? 570 MET B CA  1 
ATOM 3472 C C   . MET B 1 174 ? 9.831  16.719 34.592 1.00 40.77 ? 570 MET B C   1 
ATOM 3473 O O   . MET B 1 174 ? 9.802  17.287 33.499 1.00 41.26 ? 570 MET B O   1 
ATOM 3474 C CB  . MET B 1 174 ? 9.255  14.381 35.332 1.00 39.18 ? 570 MET B CB  1 
ATOM 3475 C CG  . MET B 1 174 ? 9.607  12.895 35.325 1.00 38.41 ? 570 MET B CG  1 
ATOM 3476 S SD  . MET B 1 174 ? 8.311  11.837 36.007 1.00 37.44 ? 570 MET B SD  1 
ATOM 3477 C CE  . MET B 1 174 ? 8.698  11.878 37.754 1.00 37.14 ? 570 MET B CE  1 
ATOM 3478 N N   . TYR B 1 175 ? 9.493  17.327 35.727 1.00 42.07 ? 571 TYR B N   1 
ATOM 3479 C CA  . TYR B 1 175 ? 8.985  18.703 35.739 1.00 43.90 ? 571 TYR B CA  1 
ATOM 3480 C C   . TYR B 1 175 ? 9.886  19.698 36.469 1.00 42.72 ? 571 TYR B C   1 
ATOM 3481 O O   . TYR B 1 175 ? 9.411  20.690 37.014 1.00 42.57 ? 571 TYR B O   1 
ATOM 3482 C CB  . TYR B 1 175 ? 7.560  18.741 36.322 1.00 44.93 ? 571 TYR B CB  1 
ATOM 3483 C CG  . TYR B 1 175 ? 7.386  17.933 37.593 1.00 45.07 ? 571 TYR B CG  1 
ATOM 3484 C CD1 . TYR B 1 175 ? 6.986  16.595 37.542 1.00 45.70 ? 571 TYR B CD1 1 
ATOM 3485 C CD2 . TYR B 1 175 ? 7.653  18.493 38.842 1.00 46.94 ? 571 TYR B CD2 1 
ATOM 3486 C CE1 . TYR B 1 175 ? 6.863  15.833 38.706 1.00 46.81 ? 571 TYR B CE1 1 
ATOM 3487 C CE2 . TYR B 1 175 ? 7.531  17.740 40.011 1.00 46.48 ? 571 TYR B CE2 1 
ATOM 3488 C CZ  . TYR B 1 175 ? 7.139  16.412 39.937 1.00 46.81 ? 571 TYR B CZ  1 
ATOM 3489 O OH  . TYR B 1 175 ? 7.043  15.662 41.089 1.00 45.30 ? 571 TYR B OH  1 
ATOM 3490 N N   . SER B 1 176 ? 11.183 19.410 36.490 1.00 42.42 ? 572 SER B N   1 
ATOM 3491 C CA  . SER B 1 176 ? 12.181 20.260 37.136 1.00 40.33 ? 572 SER B CA  1 
ATOM 3492 C C   . SER B 1 176 ? 11.803 20.849 38.500 1.00 37.82 ? 572 SER B C   1 
ATOM 3493 O O   . SER B 1 176 ? 11.843 22.062 38.693 1.00 36.53 ? 572 SER B O   1 
ATOM 3494 C CB  . SER B 1 176 ? 12.616 21.368 36.175 1.00 41.33 ? 572 SER B CB  1 
ATOM 3495 O OG  . SER B 1 176 ? 13.136 20.813 34.978 1.00 43.33 ? 572 SER B OG  1 
ATOM 3496 N N   . LYS B 1 177 ? 11.481 19.980 39.454 1.00 36.19 ? 573 LYS B N   1 
ATOM 3497 C CA  . LYS B 1 177 ? 11.116 20.421 40.798 1.00 34.19 ? 573 LYS B CA  1 
ATOM 3498 C C   . LYS B 1 177 ? 12.335 20.550 41.720 1.00 35.59 ? 573 LYS B C   1 
ATOM 3499 O O   . LYS B 1 177 ? 12.666 19.636 42.481 1.00 33.63 ? 573 LYS B O   1 
ATOM 3500 C CB  . LYS B 1 177 ? 10.084 19.476 41.406 1.00 31.01 ? 573 LYS B CB  1 
ATOM 3501 C CG  . LYS B 1 177 ? 9.519  19.960 42.718 1.00 33.03 ? 573 LYS B CG  1 
ATOM 3502 C CD  . LYS B 1 177 ? 8.828  21.296 42.551 1.00 26.52 ? 573 LYS B CD  1 
ATOM 3503 C CE  . LYS B 1 177 ? 9.322  22.299 43.578 1.00 24.03 ? 573 LYS B CE  1 
ATOM 3504 N NZ  . LYS B 1 177 ? 10.709 22.745 43.291 1.00 17.04 ? 573 LYS B NZ  1 
ATOM 3505 N N   . PHE B 1 178 ? 13.001 21.696 41.620 1.00 38.79 ? 574 PHE B N   1 
ATOM 3506 C CA  . PHE B 1 178 ? 14.198 22.030 42.404 1.00 36.81 ? 574 PHE B CA  1 
ATOM 3507 C C   . PHE B 1 178 ? 13.865 22.573 43.785 1.00 34.93 ? 574 PHE B C   1 
ATOM 3508 O O   . PHE B 1 178 ? 13.125 23.546 43.917 1.00 35.39 ? 574 PHE B O   1 
ATOM 3509 C CB  . PHE B 1 178 ? 15.061 23.057 41.657 1.00 37.78 ? 574 PHE B CB  1 
ATOM 3510 C CG  . PHE B 1 178 ? 14.330 23.776 40.555 1.00 36.05 ? 574 PHE B CG  1 
ATOM 3511 C CD1 . PHE B 1 178 ? 13.099 24.384 40.792 1.00 37.69 ? 574 PHE B CD1 1 
ATOM 3512 C CD2 . PHE B 1 178 ? 14.856 23.811 39.269 1.00 38.01 ? 574 PHE B CD2 1 
ATOM 3513 C CE1 . PHE B 1 178 ? 12.405 25.007 39.768 1.00 37.96 ? 574 PHE B CE1 1 
ATOM 3514 C CE2 . PHE B 1 178 ? 14.168 24.435 38.236 1.00 38.31 ? 574 PHE B CE2 1 
ATOM 3515 C CZ  . PHE B 1 178 ? 12.938 25.034 38.487 1.00 39.59 ? 574 PHE B CZ  1 
ATOM 3516 N N   . SER B 1 179 ? 14.473 21.988 44.806 1.00 32.93 ? 575 SER B N   1 
ATOM 3517 C CA  . SER B 1 179 ? 14.229 22.405 46.178 1.00 31.78 ? 575 SER B CA  1 
ATOM 3518 C C   . SER B 1 179 ? 15.459 22.157 47.040 1.00 32.41 ? 575 SER B C   1 
ATOM 3519 O O   . SER B 1 179 ? 16.492 21.704 46.542 1.00 32.95 ? 575 SER B O   1 
ATOM 3520 C CB  . SER B 1 179 ? 13.053 21.607 46.740 1.00 30.36 ? 575 SER B CB  1 
ATOM 3521 O OG  . SER B 1 179 ? 13.264 20.216 46.563 1.00 31.46 ? 575 SER B OG  1 
ATOM 3522 N N   . SER B 1 180 ? 15.338 22.453 48.333 1.00 31.52 ? 576 SER B N   1 
ATOM 3523 C CA  . SER B 1 180 ? 16.414 22.242 49.297 1.00 26.86 ? 576 SER B CA  1 
ATOM 3524 C C   . SER B 1 180 ? 16.827 20.772 49.275 1.00 23.09 ? 576 SER B C   1 
ATOM 3525 O O   . SER B 1 180 ? 18.003 20.432 49.457 1.00 18.87 ? 576 SER B O   1 
ATOM 3526 C CB  . SER B 1 180 ? 15.917 22.607 50.695 1.00 30.38 ? 576 SER B CB  1 
ATOM 3527 O OG  . SER B 1 180 ? 14.621 22.070 50.923 1.00 33.61 ? 576 SER B OG  1 
ATOM 3528 N N   . LYS B 1 181 ? 15.840 19.913 49.036 1.00 19.70 ? 577 LYS B N   1 
ATOM 3529 C CA  . LYS B 1 181 ? 16.048 18.477 48.973 1.00 15.88 ? 577 LYS B CA  1 
ATOM 3530 C C   . LYS B 1 181 ? 16.627 17.985 47.659 1.00 15.31 ? 577 LYS B C   1 
ATOM 3531 O O   . LYS B 1 181 ? 16.966 16.815 47.550 1.00 18.88 ? 577 LYS B O   1 
ATOM 3532 C CB  . LYS B 1 181 ? 14.753 17.732 49.286 1.00 15.45 ? 577 LYS B CB  1 
ATOM 3533 C CG  . LYS B 1 181 ? 14.598 17.347 50.748 1.00 14.36 ? 577 LYS B CG  1 
ATOM 3534 C CD  . LYS B 1 181 ? 14.604 18.548 51.663 1.00 10.74 ? 577 LYS B CD  1 
ATOM 3535 C CE  . LYS B 1 181 ? 14.692 18.116 53.102 1.00 8.91  ? 577 LYS B CE  1 
ATOM 3536 N NZ  . LYS B 1 181 ? 15.888 17.272 53.339 1.00 13.99 ? 577 LYS B NZ  1 
ATOM 3537 N N   . SER B 1 182 ? 16.737 18.855 46.660 1.00 15.22 ? 578 SER B N   1 
ATOM 3538 C CA  . SER B 1 182 ? 17.316 18.453 45.382 1.00 14.59 ? 578 SER B CA  1 
ATOM 3539 C C   . SER B 1 182 ? 18.821 18.282 45.557 1.00 15.07 ? 578 SER B C   1 
ATOM 3540 O O   . SER B 1 182 ? 19.398 17.307 45.075 1.00 16.57 ? 578 SER B O   1 
ATOM 3541 C CB  . SER B 1 182 ? 17.043 19.491 44.290 1.00 18.56 ? 578 SER B CB  1 
ATOM 3542 O OG  . SER B 1 182 ? 15.680 19.499 43.903 1.00 23.33 ? 578 SER B OG  1 
ATOM 3543 N N   . ASP B 1 183 ? 19.448 19.220 46.267 1.00 15.79 ? 579 ASP B N   1 
ATOM 3544 C CA  . ASP B 1 183 ? 20.888 19.162 46.517 1.00 15.96 ? 579 ASP B CA  1 
ATOM 3545 C C   . ASP B 1 183 ? 21.218 17.955 47.378 1.00 18.59 ? 579 ASP B C   1 
ATOM 3546 O O   . ASP B 1 183 ? 22.329 17.422 47.313 1.00 20.19 ? 579 ASP B O   1 
ATOM 3547 C CB  . ASP B 1 183 ? 21.387 20.432 47.217 1.00 15.23 ? 579 ASP B CB  1 
ATOM 3548 C CG  . ASP B 1 183 ? 21.587 21.610 46.261 1.00 16.89 ? 579 ASP B CG  1 
ATOM 3549 O OD1 . ASP B 1 183 ? 21.403 22.748 46.724 1.00 14.46 ? 579 ASP B OD1 1 
ATOM 3550 O OD2 . ASP B 1 183 ? 21.953 21.414 45.075 1.00 17.09 ? 579 ASP B OD2 1 
ATOM 3551 N N   . ILE B 1 184 ? 20.255 17.532 48.194 1.00 18.03 ? 580 ILE B N   1 
ATOM 3552 C CA  . ILE B 1 184 ? 20.447 16.373 49.054 1.00 17.50 ? 580 ILE B CA  1 
ATOM 3553 C C   . ILE B 1 184 ? 20.620 15.127 48.193 1.00 19.53 ? 580 ILE B C   1 
ATOM 3554 O O   . ILE B 1 184 ? 21.548 14.353 48.411 1.00 26.22 ? 580 ILE B O   1 
ATOM 3555 C CB  . ILE B 1 184 ? 19.272 16.189 50.035 1.00 15.12 ? 580 ILE B CB  1 
ATOM 3556 C CG1 . ILE B 1 184 ? 19.274 17.327 51.057 1.00 13.57 ? 580 ILE B CG1 1 
ATOM 3557 C CG2 . ILE B 1 184 ? 19.377 14.837 50.760 1.00 14.16 ? 580 ILE B CG2 1 
ATOM 3558 C CD1 . ILE B 1 184 ? 20.508 17.347 51.943 1.00 12.21 ? 580 ILE B CD1 1 
ATOM 3559 N N   . TRP B 1 185 ? 19.754 14.960 47.194 1.00 16.88 ? 581 TRP B N   1 
ATOM 3560 C CA  . TRP B 1 185 ? 19.838 13.815 46.291 1.00 11.89 ? 581 TRP B CA  1 
ATOM 3561 C C   . TRP B 1 185 ? 21.206 13.785 45.625 1.00 10.29 ? 581 TRP B C   1 
ATOM 3562 O O   . TRP B 1 185 ? 21.909 12.770 45.678 1.00 11.92 ? 581 TRP B O   1 
ATOM 3563 C CB  . TRP B 1 185 ? 18.753 13.885 45.217 1.00 8.40  ? 581 TRP B CB  1 
ATOM 3564 C CG  . TRP B 1 185 ? 18.746 12.692 44.284 1.00 7.47  ? 581 TRP B CG  1 
ATOM 3565 C CD1 . TRP B 1 185 ? 19.675 12.386 43.329 1.00 5.91  ? 581 TRP B CD1 1 
ATOM 3566 C CD2 . TRP B 1 185 ? 17.741 11.675 44.201 1.00 6.04  ? 581 TRP B CD2 1 
ATOM 3567 N NE1 . TRP B 1 185 ? 19.310 11.247 42.654 1.00 4.72  ? 581 TRP B NE1 1 
ATOM 3568 C CE2 . TRP B 1 185 ? 18.130 10.788 43.165 1.00 6.60  ? 581 TRP B CE2 1 
ATOM 3569 C CE3 . TRP B 1 185 ? 16.547 11.429 44.890 1.00 9.89  ? 581 TRP B CE3 1 
ATOM 3570 C CZ2 . TRP B 1 185 ? 17.362 9.676  42.805 1.00 7.81  ? 581 TRP B CZ2 1 
ATOM 3571 C CZ3 . TRP B 1 185 ? 15.783 10.324 44.532 1.00 6.46  ? 581 TRP B CZ3 1 
ATOM 3572 C CH2 . TRP B 1 185 ? 16.195 9.462  43.498 1.00 13.07 ? 581 TRP B CH2 1 
ATOM 3573 N N   . ALA B 1 186 ? 21.590 14.911 45.022 1.00 10.55 ? 582 ALA B N   1 
ATOM 3574 C CA  . ALA B 1 186 ? 22.872 15.023 44.341 1.00 4.48  ? 582 ALA B CA  1 
ATOM 3575 C C   . ALA B 1 186 ? 24.058 14.758 45.261 1.00 6.67  ? 582 ALA B C   1 
ATOM 3576 O O   . ALA B 1 186 ? 25.056 14.185 44.835 1.00 8.34  ? 582 ALA B O   1 
ATOM 3577 C CB  . ALA B 1 186 ? 23.003 16.387 43.684 1.00 4.04  ? 582 ALA B CB  1 
ATOM 3578 N N   . PHE B 1 187 ? 23.943 15.132 46.531 1.00 9.39  ? 583 PHE B N   1 
ATOM 3579 C CA  . PHE B 1 187 ? 25.038 14.908 47.478 1.00 8.21  ? 583 PHE B CA  1 
ATOM 3580 C C   . PHE B 1 187 ? 25.295 13.424 47.682 1.00 9.03  ? 583 PHE B C   1 
ATOM 3581 O O   . PHE B 1 187 ? 26.435 13.005 47.927 1.00 3.30  ? 583 PHE B O   1 
ATOM 3582 C CB  . PHE B 1 187 ? 24.742 15.558 48.833 1.00 10.48 ? 583 PHE B CB  1 
ATOM 3583 C CG  . PHE B 1 187 ? 25.754 15.223 49.901 1.00 8.42  ? 583 PHE B CG  1 
ATOM 3584 C CD1 . PHE B 1 187 ? 27.045 15.745 49.847 1.00 7.25  ? 583 PHE B CD1 1 
ATOM 3585 C CD2 . PHE B 1 187 ? 25.425 14.361 50.936 1.00 7.08  ? 583 PHE B CD2 1 
ATOM 3586 C CE1 . PHE B 1 187 ? 27.995 15.408 50.807 1.00 4.56  ? 583 PHE B CE1 1 
ATOM 3587 C CE2 . PHE B 1 187 ? 26.361 14.020 51.895 1.00 6.14  ? 583 PHE B CE2 1 
ATOM 3588 C CZ  . PHE B 1 187 ? 27.654 14.543 51.830 1.00 8.80  ? 583 PHE B CZ  1 
ATOM 3589 N N   . GLY B 1 188 ? 24.225 12.640 47.618 1.00 10.23 ? 584 GLY B N   1 
ATOM 3590 C CA  . GLY B 1 188 ? 24.340 11.203 47.786 1.00 9.17  ? 584 GLY B CA  1 
ATOM 3591 C C   . GLY B 1 188 ? 25.042 10.597 46.593 1.00 7.39  ? 584 GLY B C   1 
ATOM 3592 O O   . GLY B 1 188 ? 25.857 9.690  46.735 1.00 10.68 ? 584 GLY B O   1 
ATOM 3593 N N   . VAL B 1 189 ? 24.728 11.112 45.408 1.00 9.02  ? 585 VAL B N   1 
ATOM 3594 C CA  . VAL B 1 189 ? 25.350 10.624 44.186 1.00 7.71  ? 585 VAL B CA  1 
ATOM 3595 C C   . VAL B 1 189 ? 26.818 11.010 44.211 1.00 7.83  ? 585 VAL B C   1 
ATOM 3596 O O   . VAL B 1 189 ? 27.665 10.264 43.720 1.00 10.87 ? 585 VAL B O   1 
ATOM 3597 C CB  . VAL B 1 189 ? 24.658 11.184 42.925 1.00 6.04  ? 585 VAL B CB  1 
ATOM 3598 C CG1 . VAL B 1 189 ? 25.359 10.699 41.669 1.00 4.31  ? 585 VAL B CG1 1 
ATOM 3599 C CG2 . VAL B 1 189 ? 23.208 10.747 42.896 1.00 6.37  ? 585 VAL B CG2 1 
ATOM 3600 N N   . LEU B 1 190 ? 27.112 12.183 44.778 1.00 7.00  ? 586 LEU B N   1 
ATOM 3601 C CA  . LEU B 1 190 ? 28.484 12.670 44.899 1.00 4.53  ? 586 LEU B CA  1 
ATOM 3602 C C   . LEU B 1 190 ? 29.247 11.724 45.812 1.00 5.96  ? 586 LEU B C   1 
ATOM 3603 O O   . LEU B 1 190 ? 30.365 11.323 45.493 1.00 8.74  ? 586 LEU B O   1 
ATOM 3604 C CB  . LEU B 1 190 ? 28.522 14.102 45.455 1.00 2.00  ? 586 LEU B CB  1 
ATOM 3605 C CG  . LEU B 1 190 ? 29.880 14.670 45.894 1.00 2.12  ? 586 LEU B CG  1 
ATOM 3606 C CD1 . LEU B 1 190 ? 30.010 16.106 45.440 1.00 7.20  ? 586 LEU B CD1 1 
ATOM 3607 C CD2 . LEU B 1 190 ? 30.029 14.602 47.413 1.00 4.41  ? 586 LEU B CD2 1 
ATOM 3608 N N   . MET B 1 191 ? 28.625 11.339 46.924 1.00 6.85  ? 587 MET B N   1 
ATOM 3609 C CA  . MET B 1 191 ? 29.250 10.419 47.872 1.00 8.03  ? 587 MET B CA  1 
ATOM 3610 C C   . MET B 1 191 ? 29.559 9.139  47.130 1.00 8.01  ? 587 MET B C   1 
ATOM 3611 O O   . MET B 1 191 ? 30.618 8.534  47.314 1.00 9.09  ? 587 MET B O   1 
ATOM 3612 C CB  . MET B 1 191 ? 28.314 10.108 49.042 1.00 7.46  ? 587 MET B CB  1 
ATOM 3613 C CG  . MET B 1 191 ? 28.255 11.188 50.097 1.00 11.21 ? 587 MET B CG  1 
ATOM 3614 S SD  . MET B 1 191 ? 27.548 10.557 51.621 1.00 9.37  ? 587 MET B SD  1 
ATOM 3615 C CE  . MET B 1 191 ? 25.884 10.932 51.370 1.00 7.42  ? 587 MET B CE  1 
ATOM 3616 N N   . TRP B 1 192 ? 28.613 8.733  46.290 1.00 6.67  ? 588 TRP B N   1 
ATOM 3617 C CA  . TRP B 1 192 ? 28.754 7.532  45.484 1.00 4.52  ? 588 TRP B CA  1 
ATOM 3618 C C   . TRP B 1 192 ? 29.955 7.700  44.542 1.00 5.71  ? 588 TRP B C   1 
ATOM 3619 O O   . TRP B 1 192 ? 30.785 6.780  44.407 1.00 2.00  ? 588 TRP B O   1 
ATOM 3620 C CB  . TRP B 1 192 ? 27.460 7.282  44.706 1.00 2.40  ? 588 TRP B CB  1 
ATOM 3621 C CG  . TRP B 1 192 ? 27.421 5.979  44.025 1.00 4.75  ? 588 TRP B CG  1 
ATOM 3622 C CD1 . TRP B 1 192 ? 27.059 4.787  44.566 1.00 4.69  ? 588 TRP B CD1 1 
ATOM 3623 C CD2 . TRP B 1 192 ? 27.806 5.713  42.674 1.00 7.11  ? 588 TRP B CD2 1 
ATOM 3624 N NE1 . TRP B 1 192 ? 27.204 3.786  43.641 1.00 6.93  ? 588 TRP B NE1 1 
ATOM 3625 C CE2 . TRP B 1 192 ? 27.660 4.323  42.468 1.00 6.92  ? 588 TRP B CE2 1 
ATOM 3626 C CE3 . TRP B 1 192 ? 28.264 6.509  41.618 1.00 8.00  ? 588 TRP B CE3 1 
ATOM 3627 C CZ2 . TRP B 1 192 ? 27.956 3.711  41.252 1.00 11.08 ? 588 TRP B CZ2 1 
ATOM 3628 C CZ3 . TRP B 1 192 ? 28.563 5.904  40.409 1.00 10.43 ? 588 TRP B CZ3 1 
ATOM 3629 C CH2 . TRP B 1 192 ? 28.406 4.511  40.235 1.00 14.47 ? 588 TRP B CH2 1 
ATOM 3630 N N   . GLU B 1 193 ? 30.085 8.893  43.951 1.00 6.18  ? 589 GLU B N   1 
ATOM 3631 C CA  . GLU B 1 193 ? 31.198 9.194  43.050 1.00 9.53  ? 589 GLU B CA  1 
ATOM 3632 C C   . GLU B 1 193 ? 32.507 9.070  43.823 1.00 11.10 ? 589 GLU B C   1 
ATOM 3633 O O   . GLU B 1 193 ? 33.519 8.622  43.280 1.00 15.09 ? 589 GLU B O   1 
ATOM 3634 C CB  . GLU B 1 193 ? 31.105 10.614 42.497 1.00 6.96  ? 589 GLU B CB  1 
ATOM 3635 C CG  . GLU B 1 193 ? 29.917 10.879 41.608 1.00 10.53 ? 589 GLU B CG  1 
ATOM 3636 C CD  . GLU B 1 193 ? 29.935 12.283 41.037 1.00 10.94 ? 589 GLU B CD  1 
ATOM 3637 O OE1 . GLU B 1 193 ? 29.344 13.189 41.665 1.00 11.25 ? 589 GLU B OE1 1 
ATOM 3638 O OE2 . GLU B 1 193 ? 30.537 12.479 39.959 1.00 15.70 ? 589 GLU B OE2 1 
ATOM 3639 N N   . ILE B 1 194 ? 32.485 9.475  45.087 1.00 9.46  ? 590 ILE B N   1 
ATOM 3640 C CA  . ILE B 1 194 ? 33.668 9.413  45.928 1.00 8.87  ? 590 ILE B CA  1 
ATOM 3641 C C   . ILE B 1 194 ? 34.078 7.960  46.194 1.00 12.45 ? 590 ILE B C   1 
ATOM 3642 O O   . ILE B 1 194 ? 35.167 7.525  45.780 1.00 11.72 ? 590 ILE B O   1 
ATOM 3643 C CB  . ILE B 1 194 ? 33.453 10.208 47.246 1.00 3.55  ? 590 ILE B CB  1 
ATOM 3644 C CG1 . ILE B 1 194 ? 33.296 11.696 46.913 1.00 2.10  ? 590 ILE B CG1 1 
ATOM 3645 C CG2 . ILE B 1 194 ? 34.623 10.013 48.187 1.00 2.00  ? 590 ILE B CG2 1 
ATOM 3646 C CD1 . ILE B 1 194 ? 32.967 12.585 48.066 1.00 2.00  ? 590 ILE B CD1 1 
ATOM 3647 N N   . TYR B 1 195 ? 33.184 7.192  46.816 1.00 15.34 ? 591 TYR B N   1 
ATOM 3648 C CA  . TYR B 1 195 ? 33.461 5.791  47.111 1.00 13.05 ? 591 TYR B CA  1 
ATOM 3649 C C   . TYR B 1 195 ? 33.585 4.938  45.850 1.00 12.23 ? 591 TYR B C   1 
ATOM 3650 O O   . TYR B 1 195 ? 34.024 3.790  45.909 1.00 17.98 ? 591 TYR B O   1 
ATOM 3651 C CB  . TYR B 1 195 ? 32.425 5.230  48.090 1.00 12.55 ? 591 TYR B CB  1 
ATOM 3652 C CG  . TYR B 1 195 ? 32.669 5.737  49.488 1.00 10.68 ? 591 TYR B CG  1 
ATOM 3653 C CD1 . TYR B 1 195 ? 32.075 6.918  49.936 1.00 9.88  ? 591 TYR B CD1 1 
ATOM 3654 C CD2 . TYR B 1 195 ? 33.598 5.110  50.321 1.00 13.54 ? 591 TYR B CD2 1 
ATOM 3655 C CE1 . TYR B 1 195 ? 32.415 7.474  51.175 1.00 8.76  ? 591 TYR B CE1 1 
ATOM 3656 C CE2 . TYR B 1 195 ? 33.940 5.653  51.564 1.00 10.89 ? 591 TYR B CE2 1 
ATOM 3657 C CZ  . TYR B 1 195 ? 33.349 6.836  51.978 1.00 9.81  ? 591 TYR B CZ  1 
ATOM 3658 O OH  . TYR B 1 195 ? 33.712 7.402  53.171 1.00 9.51  ? 591 TYR B OH  1 
ATOM 3659 N N   . SER B 1 196 ? 33.185 5.499  44.713 1.00 11.77 ? 592 SER B N   1 
ATOM 3660 C CA  . SER B 1 196 ? 33.290 4.803  43.438 1.00 11.46 ? 592 SER B CA  1 
ATOM 3661 C C   . SER B 1 196 ? 34.589 5.180  42.739 1.00 12.26 ? 592 SER B C   1 
ATOM 3662 O O   . SER B 1 196 ? 34.888 4.685  41.654 1.00 11.21 ? 592 SER B O   1 
ATOM 3663 C CB  . SER B 1 196 ? 32.104 5.134  42.543 1.00 9.01  ? 592 SER B CB  1 
ATOM 3664 O OG  . SER B 1 196 ? 30.947 4.504  43.038 1.00 12.06 ? 592 SER B OG  1 
ATOM 3665 N N   . LEU B 1 197 ? 35.342 6.075  43.367 1.00 11.73 ? 593 LEU B N   1 
ATOM 3666 C CA  . LEU B 1 197 ? 36.608 6.528  42.835 1.00 13.65 ? 593 LEU B CA  1 
ATOM 3667 C C   . LEU B 1 197 ? 36.494 7.086  41.422 1.00 14.18 ? 593 LEU B C   1 
ATOM 3668 O O   . LEU B 1 197 ? 37.319 6.795  40.554 1.00 16.11 ? 593 LEU B O   1 
ATOM 3669 C CB  . LEU B 1 197 ? 37.646 5.408  42.919 1.00 14.04 ? 593 LEU B CB  1 
ATOM 3670 C CG  . LEU B 1 197 ? 38.563 5.446  44.143 1.00 15.85 ? 593 LEU B CG  1 
ATOM 3671 C CD1 . LEU B 1 197 ? 37.764 5.702  45.398 1.00 12.60 ? 593 LEU B CD1 1 
ATOM 3672 C CD2 . LEU B 1 197 ? 39.346 4.161  44.251 1.00 12.99 ? 593 LEU B CD2 1 
ATOM 3673 N N   . GLY B 1 198 ? 35.464 7.899  41.200 1.00 14.51 ? 594 GLY B N   1 
ATOM 3674 C CA  . GLY B 1 198 ? 35.274 8.508  39.897 1.00 13.72 ? 594 GLY B CA  1 
ATOM 3675 C C   . GLY B 1 198 ? 34.316 7.825  38.946 1.00 14.52 ? 594 GLY B C   1 
ATOM 3676 O O   . GLY B 1 198 ? 34.060 8.347  37.868 1.00 16.91 ? 594 GLY B O   1 
ATOM 3677 N N   . LYS B 1 199 ? 33.794 6.662  39.321 1.00 13.58 ? 595 LYS B N   1 
ATOM 3678 C CA  . LYS B 1 199 ? 32.846 5.947  38.470 1.00 13.97 ? 595 LYS B CA  1 
ATOM 3679 C C   . LYS B 1 199 ? 31.644 6.812  38.144 1.00 14.65 ? 595 LYS B C   1 
ATOM 3680 O O   . LYS B 1 199 ? 31.032 7.404  39.031 1.00 17.03 ? 595 LYS B O   1 
ATOM 3681 C CB  . LYS B 1 199 ? 32.358 4.663  39.138 1.00 13.75 ? 595 LYS B CB  1 
ATOM 3682 C CG  . LYS B 1 199 ? 33.049 3.412  38.664 1.00 13.60 ? 595 LYS B CG  1 
ATOM 3683 C CD  . LYS B 1 199 ? 32.338 2.180  39.200 1.00 17.92 ? 595 LYS B CD  1 
ATOM 3684 C CE  . LYS B 1 199 ? 32.493 2.037  40.711 1.00 17.12 ? 595 LYS B CE  1 
ATOM 3685 N NZ  . LYS B 1 199 ? 31.791 0.819  41.230 1.00 20.68 ? 595 LYS B NZ  1 
ATOM 3686 N N   . MET B 1 200 ? 31.300 6.865  36.866 1.00 17.91 ? 596 MET B N   1 
ATOM 3687 C CA  . MET B 1 200 ? 30.170 7.656  36.406 1.00 18.99 ? 596 MET B CA  1 
ATOM 3688 C C   . MET B 1 200 ? 28.908 6.942  36.856 1.00 18.04 ? 596 MET B C   1 
ATOM 3689 O O   . MET B 1 200 ? 28.785 5.731  36.683 1.00 17.78 ? 596 MET B O   1 
ATOM 3690 C CB  . MET B 1 200 ? 30.204 7.773  34.877 1.00 20.77 ? 596 MET B CB  1 
ATOM 3691 C CG  . MET B 1 200 ? 29.765 9.127  34.318 1.00 27.47 ? 596 MET B CG  1 
ATOM 3692 S SD  . MET B 1 200 ? 28.020 9.269  33.847 1.00 36.00 ? 596 MET B SD  1 
ATOM 3693 C CE  . MET B 1 200 ? 27.936 8.063  32.504 1.00 33.44 ? 596 MET B CE  1 
ATOM 3694 N N   . PRO B 1 201 ? 27.968 7.677  37.469 1.00 16.14 ? 597 PRO B N   1 
ATOM 3695 C CA  . PRO B 1 201 ? 26.712 7.101  37.947 1.00 15.23 ? 597 PRO B CA  1 
ATOM 3696 C C   . PRO B 1 201 ? 25.866 6.546  36.811 1.00 16.15 ? 597 PRO B C   1 
ATOM 3697 O O   . PRO B 1 201 ? 25.801 7.123  35.726 1.00 17.62 ? 597 PRO B O   1 
ATOM 3698 C CB  . PRO B 1 201 ? 26.015 8.295  38.602 1.00 15.62 ? 597 PRO B CB  1 
ATOM 3699 C CG  . PRO B 1 201 ? 27.134 9.181  39.007 1.00 17.68 ? 597 PRO B CG  1 
ATOM 3700 C CD  . PRO B 1 201 ? 28.043 9.106  37.815 1.00 17.99 ? 597 PRO B CD  1 
ATOM 3701 N N   . TYR B 1 202 ? 25.222 5.417  37.081 1.00 15.61 ? 598 TYR B N   1 
ATOM 3702 C CA  . TYR B 1 202 ? 24.338 4.759  36.126 1.00 15.98 ? 598 TYR B CA  1 
ATOM 3703 C C   . TYR B 1 202 ? 24.985 4.381  34.801 1.00 19.01 ? 598 TYR B C   1 
ATOM 3704 O O   . TYR B 1 202 ? 24.347 4.425  33.757 1.00 23.02 ? 598 TYR B O   1 
ATOM 3705 C CB  . TYR B 1 202 ? 23.083 5.610  35.896 1.00 15.24 ? 598 TYR B CB  1 
ATOM 3706 C CG  . TYR B 1 202 ? 22.397 5.998  37.185 1.00 14.48 ? 598 TYR B CG  1 
ATOM 3707 C CD1 . TYR B 1 202 ? 21.945 5.028  38.073 1.00 13.82 ? 598 TYR B CD1 1 
ATOM 3708 C CD2 . TYR B 1 202 ? 22.261 7.332  37.551 1.00 14.46 ? 598 TYR B CD2 1 
ATOM 3709 C CE1 . TYR B 1 202 ? 21.387 5.377  39.290 1.00 11.98 ? 598 TYR B CE1 1 
ATOM 3710 C CE2 . TYR B 1 202 ? 21.701 7.685  38.766 1.00 10.83 ? 598 TYR B CE2 1 
ATOM 3711 C CZ  . TYR B 1 202 ? 21.267 6.704  39.629 1.00 5.19  ? 598 TYR B CZ  1 
ATOM 3712 O OH  . TYR B 1 202 ? 20.703 7.054  40.837 1.00 8.13  ? 598 TYR B OH  1 
ATOM 3713 N N   . GLU B 1 203 ? 26.262 4.022  34.847 1.00 21.18 ? 599 GLU B N   1 
ATOM 3714 C CA  . GLU B 1 203 ? 26.990 3.602  33.653 1.00 20.51 ? 599 GLU B CA  1 
ATOM 3715 C C   . GLU B 1 203 ? 26.245 2.417  33.071 1.00 21.77 ? 599 GLU B C   1 
ATOM 3716 O O   . GLU B 1 203 ? 25.609 1.661  33.806 1.00 21.45 ? 599 GLU B O   1 
ATOM 3717 C CB  . GLU B 1 203 ? 28.421 3.189  34.006 1.00 25.07 ? 599 GLU B CB  1 
ATOM 3718 C CG  . GLU B 1 203 ? 28.524 2.125  35.102 1.00 30.47 ? 599 GLU B CG  1 
ATOM 3719 C CD  . GLU B 1 203 ? 28.319 2.690  36.504 1.00 26.36 ? 599 GLU B CD  1 
ATOM 3720 O OE1 . GLU B 1 203 ? 29.312 3.160  37.099 1.00 28.29 ? 599 GLU B OE1 1 
ATOM 3721 O OE2 . GLU B 1 203 ? 27.171 2.665  37.008 1.00 27.77 ? 599 GLU B OE2 1 
ATOM 3722 N N   . ARG B 1 204 ? 26.332 2.250  31.757 1.00 24.08 ? 600 ARG B N   1 
ATOM 3723 C CA  . ARG B 1 204 ? 25.637 1.164  31.062 1.00 27.74 ? 600 ARG B CA  1 
ATOM 3724 C C   . ARG B 1 204 ? 24.165 1.520  30.860 1.00 27.26 ? 600 ARG B C   1 
ATOM 3725 O O   . ARG B 1 204 ? 23.356 0.679  30.479 1.00 25.64 ? 600 ARG B O   1 
ATOM 3726 C CB  . ARG B 1 204 ? 25.784 -0.179 31.806 1.00 31.38 ? 600 ARG B CB  1 
ATOM 3727 C CG  . ARG B 1 204 ? 26.892 -1.065 31.269 1.00 33.68 ? 600 ARG B CG  1 
ATOM 3728 C CD  . ARG B 1 204 ? 26.456 -1.680 29.954 1.00 34.17 ? 600 ARG B CD  1 
ATOM 3729 N NE  . ARG B 1 204 ? 27.570 -1.896 29.039 1.00 38.49 ? 600 ARG B NE  1 
ATOM 3730 C CZ  . ARG B 1 204 ? 27.804 -1.145 27.968 1.00 37.73 ? 600 ARG B CZ  1 
ATOM 3731 N NH1 . ARG B 1 204 ? 28.841 -1.413 27.179 1.00 37.45 ? 600 ARG B NH1 1 
ATOM 3732 N NH2 . ARG B 1 204 ? 27.001 -0.123 27.685 1.00 39.50 ? 600 ARG B NH2 1 
ATOM 3733 N N   . PHE B 1 205 ? 23.830 2.775  31.133 1.00 27.59 ? 601 PHE B N   1 
ATOM 3734 C CA  . PHE B 1 205 ? 22.479 3.289  30.962 1.00 26.40 ? 601 PHE B CA  1 
ATOM 3735 C C   . PHE B 1 205 ? 22.617 4.534  30.105 1.00 28.08 ? 601 PHE B C   1 
ATOM 3736 O O   . PHE B 1 205 ? 23.705 5.111  30.011 1.00 28.57 ? 601 PHE B O   1 
ATOM 3737 C CB  . PHE B 1 205 ? 21.869 3.704  32.302 1.00 23.15 ? 601 PHE B CB  1 
ATOM 3738 C CG  . PHE B 1 205 ? 21.279 2.576  33.091 1.00 17.15 ? 601 PHE B CG  1 
ATOM 3739 C CD1 . PHE B 1 205 ? 19.961 2.190  32.887 1.00 20.02 ? 601 PHE B CD1 1 
ATOM 3740 C CD2 . PHE B 1 205 ? 22.017 1.944  34.083 1.00 19.77 ? 601 PHE B CD2 1 
ATOM 3741 C CE1 . PHE B 1 205 ? 19.381 1.194  33.665 1.00 17.60 ? 601 PHE B CE1 1 
ATOM 3742 C CE2 . PHE B 1 205 ? 21.449 0.951  34.864 1.00 16.15 ? 601 PHE B CE2 1 
ATOM 3743 C CZ  . PHE B 1 205 ? 20.126 0.575  34.655 1.00 20.16 ? 601 PHE B CZ  1 
ATOM 3744 N N   . THR B 1 206 ? 21.534 4.915  29.436 1.00 30.07 ? 602 THR B N   1 
ATOM 3745 C CA  . THR B 1 206 ? 21.530 6.116  28.610 1.00 30.13 ? 602 THR B CA  1 
ATOM 3746 C C   . THR B 1 206 ? 20.820 7.140  29.476 1.00 31.17 ? 602 THR B C   1 
ATOM 3747 O O   . THR B 1 206 ? 20.274 6.785  30.524 1.00 32.73 ? 602 THR B O   1 
ATOM 3748 C CB  . THR B 1 206 ? 20.733 5.924  27.293 1.00 28.51 ? 602 THR B CB  1 
ATOM 3749 O OG1 . THR B 1 206 ? 19.384 5.543  27.592 1.00 27.73 ? 602 THR B OG1 1 
ATOM 3750 C CG2 . THR B 1 206 ? 21.379 4.867  26.417 1.00 32.12 ? 602 THR B CG2 1 
ATOM 3751 N N   . ASN B 1 207 ? 20.787 8.394  29.042 1.00 30.48 ? 603 ASN B N   1 
ATOM 3752 C CA  . ASN B 1 207 ? 20.117 9.419  29.827 1.00 30.44 ? 603 ASN B CA  1 
ATOM 3753 C C   . ASN B 1 207 ? 18.623 9.167  29.925 1.00 29.48 ? 603 ASN B C   1 
ATOM 3754 O O   . ASN B 1 207 ? 18.041 9.265  31.009 1.00 24.85 ? 603 ASN B O   1 
ATOM 3755 C CB  . ASN B 1 207 ? 20.389 10.807 29.261 1.00 32.39 ? 603 ASN B CB  1 
ATOM 3756 C CG  . ASN B 1 207 ? 21.239 11.644 30.186 1.00 30.79 ? 603 ASN B CG  1 
ATOM 3757 O OD1 . ASN B 1 207 ? 21.885 11.123 31.095 1.00 31.05 ? 603 ASN B OD1 1 
ATOM 3758 N ND2 . ASN B 1 207 ? 21.238 12.950 29.968 1.00 32.87 ? 603 ASN B ND2 1 
ATOM 3759 N N   . SER B 1 208 ? 18.011 8.817  28.797 1.00 29.99 ? 604 SER B N   1 
ATOM 3760 C CA  . SER B 1 208 ? 16.578 8.537  28.755 1.00 31.56 ? 604 SER B CA  1 
ATOM 3761 C C   . SER B 1 208 ? 16.245 7.270  29.545 1.00 32.01 ? 604 SER B C   1 
ATOM 3762 O O   . SER B 1 208 ? 15.194 7.182  30.181 1.00 34.74 ? 604 SER B O   1 
ATOM 3763 C CB  . SER B 1 208 ? 16.102 8.397  27.304 1.00 32.42 ? 604 SER B CB  1 
ATOM 3764 O OG  . SER B 1 208 ? 16.425 9.551  26.541 1.00 31.79 ? 604 SER B OG  1 
ATOM 3765 N N   . GLU B 1 209 ? 17.158 6.303  29.533 1.00 31.68 ? 605 GLU B N   1 
ATOM 3766 C CA  . GLU B 1 209 ? 16.954 5.052  30.252 1.00 29.12 ? 605 GLU B CA  1 
ATOM 3767 C C   . GLU B 1 209 ? 17.148 5.256  31.753 1.00 29.75 ? 605 GLU B C   1 
ATOM 3768 O O   . GLU B 1 209 ? 16.421 4.677  32.565 1.00 32.16 ? 605 GLU B O   1 
ATOM 3769 C CB  . GLU B 1 209 ? 17.914 3.982  29.734 1.00 30.98 ? 605 GLU B CB  1 
ATOM 3770 C CG  . GLU B 1 209 ? 17.561 2.565  30.172 1.00 35.34 ? 605 GLU B CG  1 
ATOM 3771 C CD  . GLU B 1 209 ? 18.487 1.517  29.576 1.00 36.90 ? 605 GLU B CD  1 
ATOM 3772 O OE1 . GLU B 1 209 ? 19.699 1.805  29.453 1.00 38.25 ? 605 GLU B OE1 1 
ATOM 3773 O OE2 . GLU B 1 209 ? 18.005 0.412  29.231 1.00 34.49 ? 605 GLU B OE2 1 
ATOM 3774 N N   . THR B 1 210 ? 18.131 6.074  32.116 1.00 26.59 ? 606 THR B N   1 
ATOM 3775 C CA  . THR B 1 210 ? 18.422 6.373  33.512 1.00 20.20 ? 606 THR B CA  1 
ATOM 3776 C C   . THR B 1 210 ? 17.233 7.103  34.139 1.00 20.29 ? 606 THR B C   1 
ATOM 3777 O O   . THR B 1 210 ? 16.828 6.813  35.274 1.00 20.04 ? 606 THR B O   1 
ATOM 3778 C CB  . THR B 1 210 ? 19.691 7.243  33.621 1.00 18.39 ? 606 THR B CB  1 
ATOM 3779 O OG1 . THR B 1 210 ? 20.802 6.526  33.066 1.00 16.50 ? 606 THR B OG1 1 
ATOM 3780 C CG2 . THR B 1 210 ? 19.987 7.603  35.079 1.00 13.19 ? 606 THR B CG2 1 
ATOM 3781 N N   . ALA B 1 211 ? 16.663 8.029  33.371 1.00 22.46 ? 607 ALA B N   1 
ATOM 3782 C CA  . ALA B 1 211 ? 15.510 8.816  33.801 1.00 22.03 ? 607 ALA B CA  1 
ATOM 3783 C C   . ALA B 1 211 ? 14.291 7.932  34.108 1.00 21.12 ? 607 ALA B C   1 
ATOM 3784 O O   . ALA B 1 211 ? 13.614 8.121  35.123 1.00 21.53 ? 607 ALA B O   1 
ATOM 3785 C CB  . ALA B 1 211 ? 15.165 9.859  32.730 1.00 21.28 ? 607 ALA B CB  1 
ATOM 3786 N N   . GLU B 1 212 ? 14.036 6.950  33.247 1.00 21.20 ? 608 GLU B N   1 
ATOM 3787 C CA  . GLU B 1 212 ? 12.897 6.052  33.439 1.00 22.97 ? 608 GLU B CA  1 
ATOM 3788 C C   . GLU B 1 212 ? 13.096 5.136  34.651 1.00 23.05 ? 608 GLU B C   1 
ATOM 3789 O O   . GLU B 1 212 ? 12.171 4.902  35.445 1.00 21.90 ? 608 GLU B O   1 
ATOM 3790 C CB  . GLU B 1 212 ? 12.661 5.208  32.176 1.00 23.32 ? 608 GLU B CB  1 
ATOM 3791 C CG  . GLU B 1 212 ? 11.367 4.380  32.194 1.00 27.71 ? 608 GLU B CG  1 
ATOM 3792 C CD  . GLU B 1 212 ? 11.607 2.865  32.186 1.00 30.68 ? 608 GLU B CD  1 
ATOM 3793 O OE1 . GLU B 1 212 ? 12.115 2.334  31.172 1.00 33.86 ? 608 GLU B OE1 1 
ATOM 3794 O OE2 . GLU B 1 212 ? 11.273 2.203  33.195 1.00 29.86 ? 608 GLU B OE2 1 
ATOM 3795 N N   . HIS B 1 213 ? 14.316 4.633  34.789 1.00 20.59 ? 609 HIS B N   1 
ATOM 3796 C CA  . HIS B 1 213 ? 14.652 3.729  35.870 1.00 18.86 ? 609 HIS B CA  1 
ATOM 3797 C C   . HIS B 1 213 ? 14.602 4.306  37.281 1.00 16.90 ? 609 HIS B C   1 
ATOM 3798 O O   . HIS B 1 213 ? 14.136 3.629  38.199 1.00 21.44 ? 609 HIS B O   1 
ATOM 3799 C CB  . HIS B 1 213 ? 15.996 3.060  35.595 1.00 21.17 ? 609 HIS B CB  1 
ATOM 3800 C CG  . HIS B 1 213 ? 15.908 1.918  34.634 1.00 23.56 ? 609 HIS B CG  1 
ATOM 3801 N ND1 . HIS B 1 213 ? 16.253 2.032  33.306 1.00 27.89 ? 609 HIS B ND1 1 
ATOM 3802 C CD2 . HIS B 1 213 ? 15.503 0.640  34.810 1.00 28.37 ? 609 HIS B CD2 1 
ATOM 3803 C CE1 . HIS B 1 213 ? 16.064 0.872  32.702 1.00 30.83 ? 609 HIS B CE1 1 
ATOM 3804 N NE2 . HIS B 1 213 ? 15.610 0.010  33.594 1.00 30.60 ? 609 HIS B NE2 1 
ATOM 3805 N N   . ILE B 1 214 ? 15.061 5.541  37.466 1.00 15.25 ? 610 ILE B N   1 
ATOM 3806 C CA  . ILE B 1 214 ? 15.039 6.149  38.795 1.00 10.99 ? 610 ILE B CA  1 
ATOM 3807 C C   . ILE B 1 214 ? 13.608 6.244  39.312 1.00 11.94 ? 610 ILE B C   1 
ATOM 3808 O O   . ILE B 1 214 ? 13.335 5.926  40.462 1.00 15.24 ? 610 ILE B O   1 
ATOM 3809 C CB  . ILE B 1 214 ? 15.687 7.562  38.817 1.00 10.27 ? 610 ILE B CB  1 
ATOM 3810 C CG1 . ILE B 1 214 ? 17.131 7.499  38.329 1.00 9.01  ? 610 ILE B CG1 1 
ATOM 3811 C CG2 . ILE B 1 214 ? 15.697 8.115  40.226 1.00 10.71 ? 610 ILE B CG2 1 
ATOM 3812 C CD1 . ILE B 1 214 ? 17.972 6.524  39.067 1.00 13.90 ? 610 ILE B CD1 1 
ATOM 3813 N N   . ALA B 1 215 ? 12.690 6.638  38.442 1.00 15.61 ? 611 ALA B N   1 
ATOM 3814 C CA  . ALA B 1 215 ? 11.291 6.767  38.823 1.00 18.54 ? 611 ALA B CA  1 
ATOM 3815 C C   . ALA B 1 215 ? 10.697 5.431  39.270 1.00 21.52 ? 611 ALA B C   1 
ATOM 3816 O O   . ALA B 1 215 ? 9.972  5.365  40.267 1.00 24.49 ? 611 ALA B O   1 
ATOM 3817 C CB  . ALA B 1 215 ? 10.484 7.345  37.668 1.00 18.01 ? 611 ALA B CB  1 
ATOM 3818 N N   . GLN B 1 216 ? 11.023 4.366  38.546 1.00 23.83 ? 612 GLN B N   1 
ATOM 3819 C CA  . GLN B 1 216 ? 10.507 3.038  38.865 1.00 22.70 ? 612 GLN B CA  1 
ATOM 3820 C C   . GLN B 1 216 ? 11.084 2.453  40.151 1.00 21.66 ? 612 GLN B C   1 
ATOM 3821 O O   . GLN B 1 216 ? 10.501 1.541  40.741 1.00 23.34 ? 612 GLN B O   1 
ATOM 3822 C CB  . GLN B 1 216 ? 10.736 2.091  37.691 1.00 26.14 ? 612 GLN B CB  1 
ATOM 3823 C CG  . GLN B 1 216 ? 10.119 2.574  36.374 1.00 29.22 ? 612 GLN B CG  1 
ATOM 3824 C CD  . GLN B 1 216 ? 8.597  2.714  36.418 1.00 34.44 ? 612 GLN B CD  1 
ATOM 3825 O OE1 . GLN B 1 216 ? 7.956  2.447  37.434 1.00 32.43 ? 612 GLN B OE1 1 
ATOM 3826 N NE2 . GLN B 1 216 ? 8.017  3.128  35.299 1.00 33.12 ? 612 GLN B NE2 1 
ATOM 3827 N N   . GLY B 1 217 ? 12.224 2.975  40.593 1.00 20.85 ? 613 GLY B N   1 
ATOM 3828 C CA  . GLY B 1 217 ? 12.816 2.488  41.824 1.00 17.52 ? 613 GLY B CA  1 
ATOM 3829 C C   . GLY B 1 217 ? 14.300 2.188  41.764 1.00 17.19 ? 613 GLY B C   1 
ATOM 3830 O O   . GLY B 1 217 ? 14.892 1.783  42.769 1.00 16.74 ? 613 GLY B O   1 
ATOM 3831 N N   . LEU B 1 218 ? 14.902 2.366  40.594 1.00 14.38 ? 614 LEU B N   1 
ATOM 3832 C CA  . LEU B 1 218 ? 16.327 2.105  40.427 1.00 13.63 ? 614 LEU B CA  1 
ATOM 3833 C C   . LEU B 1 218 ? 17.183 3.065  41.248 1.00 13.27 ? 614 LEU B C   1 
ATOM 3834 O O   . LEU B 1 218 ? 16.938 4.274  41.278 1.00 11.31 ? 614 LEU B O   1 
ATOM 3835 C CB  . LEU B 1 218 ? 16.701 2.152  38.947 1.00 11.11 ? 614 LEU B CB  1 
ATOM 3836 C CG  . LEU B 1 218 ? 18.127 1.939  38.433 1.00 10.02 ? 614 LEU B CG  1 
ATOM 3837 C CD1 . LEU B 1 218 ? 18.886 3.239  38.427 1.00 8.37  ? 614 LEU B CD1 1 
ATOM 3838 C CD2 . LEU B 1 218 ? 18.842 0.853  39.211 1.00 13.13 ? 614 LEU B CD2 1 
ATOM 3839 N N   . ARG B 1 219 ? 18.206 2.502  41.889 1.00 13.39 ? 615 ARG B N   1 
ATOM 3840 C CA  . ARG B 1 219 ? 19.130 3.240  42.735 1.00 11.32 ? 615 ARG B CA  1 
ATOM 3841 C C   . ARG B 1 219 ? 20.564 2.773  42.501 1.00 12.33 ? 615 ARG B C   1 
ATOM 3842 O O   . ARG B 1 219 ? 20.807 1.751  41.850 1.00 14.35 ? 615 ARG B O   1 
ATOM 3843 C CB  . ARG B 1 219 ? 18.781 3.016  44.206 1.00 13.75 ? 615 ARG B CB  1 
ATOM 3844 C CG  . ARG B 1 219 ? 17.381 3.443  44.614 1.00 14.44 ? 615 ARG B CG  1 
ATOM 3845 C CD  . ARG B 1 219 ? 17.228 4.946  44.642 1.00 12.94 ? 615 ARG B CD  1 
ATOM 3846 N NE  . ARG B 1 219 ? 15.899 5.303  45.124 1.00 11.71 ? 615 ARG B NE  1 
ATOM 3847 C CZ  . ARG B 1 219 ? 14.893 5.685  44.345 1.00 11.61 ? 615 ARG B CZ  1 
ATOM 3848 N NH1 . ARG B 1 219 ? 15.058 5.772  43.036 1.00 13.30 ? 615 ARG B NH1 1 
ATOM 3849 N NH2 . ARG B 1 219 ? 13.708 5.949  44.876 1.00 16.80 ? 615 ARG B NH2 1 
ATOM 3850 N N   . LEU B 1 220 ? 21.504 3.526  43.066 1.00 17.12 ? 616 LEU B N   1 
ATOM 3851 C CA  . LEU B 1 220 ? 22.936 3.251  42.967 1.00 13.55 ? 616 LEU B CA  1 
ATOM 3852 C C   . LEU B 1 220 ? 23.337 2.177  43.961 1.00 12.84 ? 616 LEU B C   1 
ATOM 3853 O O   . LEU B 1 220 ? 22.963 2.234  45.135 1.00 11.91 ? 616 LEU B O   1 
ATOM 3854 C CB  . LEU B 1 220 ? 23.730 4.525  43.258 1.00 12.49 ? 616 LEU B CB  1 
ATOM 3855 C CG  . LEU B 1 220 ? 24.452 5.273  42.132 1.00 15.47 ? 616 LEU B CG  1 
ATOM 3856 C CD1 . LEU B 1 220 ? 24.288 4.570  40.788 1.00 20.12 ? 616 LEU B CD1 1 
ATOM 3857 C CD2 . LEU B 1 220 ? 23.990 6.720  42.086 1.00 11.52 ? 616 LEU B CD2 1 
ATOM 3858 N N   . TYR B 1 221 ? 24.100 1.200  43.483 1.00 12.87 ? 617 TYR B N   1 
ATOM 3859 C CA  . TYR B 1 221 ? 24.561 0.109  44.322 1.00 8.22  ? 617 TYR B CA  1 
ATOM 3860 C C   . TYR B 1 221 ? 25.679 0.600  45.239 1.00 8.77  ? 617 TYR B C   1 
ATOM 3861 O O   . TYR B 1 221 ? 26.286 1.631  44.990 1.00 7.36  ? 617 TYR B O   1 
ATOM 3862 C CB  . TYR B 1 221 ? 25.037 -1.067 43.453 1.00 7.64  ? 617 TYR B CB  1 
ATOM 3863 C CG  . TYR B 1 221 ? 26.116 -0.724 42.444 1.00 4.38  ? 617 TYR B CG  1 
ATOM 3864 C CD1 . TYR B 1 221 ? 27.400 -0.394 42.852 1.00 5.18  ? 617 TYR B CD1 1 
ATOM 3865 C CD2 . TYR B 1 221 ? 25.843 -0.722 41.082 1.00 6.41  ? 617 TYR B CD2 1 
ATOM 3866 C CE1 . TYR B 1 221 ? 28.382 -0.065 41.935 1.00 5.80  ? 617 TYR B CE1 1 
ATOM 3867 C CE2 . TYR B 1 221 ? 26.827 -0.395 40.148 1.00 7.22  ? 617 TYR B CE2 1 
ATOM 3868 C CZ  . TYR B 1 221 ? 28.092 -0.070 40.584 1.00 7.64  ? 617 TYR B CZ  1 
ATOM 3869 O OH  . TYR B 1 221 ? 29.082 0.223  39.674 1.00 9.96  ? 617 TYR B OH  1 
ATOM 3870 N N   . ARG B 1 222 ? 25.952 -0.147 46.295 1.00 8.18  ? 618 ARG B N   1 
ATOM 3871 C CA  . ARG B 1 222 ? 27.001 0.219  47.229 1.00 8.36  ? 618 ARG B CA  1 
ATOM 3872 C C   . ARG B 1 222 ? 28.383 0.013  46.616 1.00 8.62  ? 618 ARG B C   1 
ATOM 3873 O O   . ARG B 1 222 ? 28.688 -1.062 46.086 1.00 10.77 ? 618 ARG B O   1 
ATOM 3874 C CB  . ARG B 1 222 ? 26.879 -0.618 48.511 1.00 6.48  ? 618 ARG B CB  1 
ATOM 3875 C CG  . ARG B 1 222 ? 27.967 -0.360 49.527 1.00 6.90  ? 618 ARG B CG  1 
ATOM 3876 C CD  . ARG B 1 222 ? 27.593 -0.867 50.907 1.00 9.82  ? 618 ARG B CD  1 
ATOM 3877 N NE  . ARG B 1 222 ? 27.871 -2.281 51.118 1.00 14.88 ? 618 ARG B NE  1 
ATOM 3878 C CZ  . ARG B 1 222 ? 28.894 -2.735 51.835 1.00 13.15 ? 618 ARG B CZ  1 
ATOM 3879 N NH1 . ARG B 1 222 ? 29.733 -1.888 52.394 1.00 14.59 ? 618 ARG B NH1 1 
ATOM 3880 N NH2 . ARG B 1 222 ? 29.052 -4.033 52.047 1.00 13.61 ? 618 ARG B NH2 1 
ATOM 3881 N N   . PRO B 1 223 ? 29.220 1.057  46.623 1.00 6.53  ? 619 PRO B N   1 
ATOM 3882 C CA  . PRO B 1 223 ? 30.553 0.869  46.051 1.00 8.75  ? 619 PRO B CA  1 
ATOM 3883 C C   . PRO B 1 223 ? 31.382 -0.040 46.962 1.00 11.49 ? 619 PRO B C   1 
ATOM 3884 O O   . PRO B 1 223 ? 31.251 -0.002 48.188 1.00 8.13  ? 619 PRO B O   1 
ATOM 3885 C CB  . PRO B 1 223 ? 31.116 2.286  46.032 1.00 5.78  ? 619 PRO B CB  1 
ATOM 3886 C CG  . PRO B 1 223 ? 29.882 3.142  45.874 1.00 5.70  ? 619 PRO B CG  1 
ATOM 3887 C CD  . PRO B 1 223 ? 28.936 2.487  46.840 1.00 3.47  ? 619 PRO B CD  1 
ATOM 3888 N N   . HIS B 1 224 ? 32.192 -0.896 46.351 1.00 13.39 ? 620 HIS B N   1 
ATOM 3889 C CA  . HIS B 1 224 ? 33.058 -1.805 47.090 1.00 16.43 ? 620 HIS B CA  1 
ATOM 3890 C C   . HIS B 1 224 ? 33.804 -1.148 48.267 1.00 15.65 ? 620 HIS B C   1 
ATOM 3891 O O   . HIS B 1 224 ? 33.963 -1.764 49.328 1.00 14.45 ? 620 HIS B O   1 
ATOM 3892 C CB  . HIS B 1 224 ? 34.061 -2.507 46.145 1.00 23.71 ? 620 HIS B CB  1 
ATOM 3893 C CG  . HIS B 1 224 ? 34.288 -1.798 44.833 1.00 29.79 ? 620 HIS B CG  1 
ATOM 3894 N ND1 . HIS B 1 224 ? 34.719 -2.464 43.704 1.00 31.86 ? 620 HIS B ND1 1 
ATOM 3895 C CD2 . HIS B 1 224 ? 34.138 -0.503 44.468 1.00 31.60 ? 620 HIS B CD2 1 
ATOM 3896 C CE1 . HIS B 1 224 ? 34.820 -1.607 42.699 1.00 33.57 ? 620 HIS B CE1 1 
ATOM 3897 N NE2 . HIS B 1 224 ? 34.471 -0.411 43.140 1.00 35.83 ? 620 HIS B NE2 1 
ATOM 3898 N N   . LEU B 1 225 ? 34.235 0.100  48.080 1.00 11.67 ? 621 LEU B N   1 
ATOM 3899 C CA  . LEU B 1 225 ? 34.974 0.834  49.103 1.00 9.74  ? 621 LEU B CA  1 
ATOM 3900 C C   . LEU B 1 225 ? 34.155 1.404  50.261 1.00 10.03 ? 621 LEU B C   1 
ATOM 3901 O O   . LEU B 1 225 ? 34.717 1.801  51.284 1.00 10.92 ? 621 LEU B O   1 
ATOM 3902 C CB  . LEU B 1 225 ? 35.792 1.955  48.464 1.00 12.10 ? 621 LEU B CB  1 
ATOM 3903 C CG  . LEU B 1 225 ? 36.869 1.540  47.459 1.00 10.83 ? 621 LEU B CG  1 
ATOM 3904 C CD1 . LEU B 1 225 ? 36.318 1.644  46.047 1.00 12.43 ? 621 LEU B CD1 1 
ATOM 3905 C CD2 . LEU B 1 225 ? 38.078 2.426  47.601 1.00 13.18 ? 621 LEU B CD2 1 
ATOM 3906 N N   . ALA B 1 226 ? 32.836 1.436  50.101 1.00 10.32 ? 622 ALA B N   1 
ATOM 3907 C CA  . ALA B 1 226 ? 31.944 1.964  51.120 1.00 11.25 ? 622 ALA B CA  1 
ATOM 3908 C C   . ALA B 1 226 ? 31.536 0.862  52.085 1.00 13.04 ? 622 ALA B C   1 
ATOM 3909 O O   . ALA B 1 226 ? 31.502 -0.307 51.719 1.00 15.23 ? 622 ALA B O   1 
ATOM 3910 C CB  . ALA B 1 226 ? 30.700 2.563  50.460 1.00 12.08 ? 622 ALA B CB  1 
ATOM 3911 N N   . SER B 1 227 ? 31.279 1.230  53.332 1.00 14.15 ? 623 SER B N   1 
ATOM 3912 C CA  . SER B 1 227 ? 30.837 0.270  54.325 1.00 11.19 ? 623 SER B CA  1 
ATOM 3913 C C   . SER B 1 227 ? 29.312 0.331  54.349 1.00 10.40 ? 623 SER B C   1 
ATOM 3914 O O   . SER B 1 227 ? 28.702 1.234  53.768 1.00 14.47 ? 623 SER B O   1 
ATOM 3915 C CB  . SER B 1 227 ? 31.416 0.611  55.696 1.00 9.54  ? 623 SER B CB  1 
ATOM 3916 O OG  . SER B 1 227 ? 30.949 1.864  56.170 1.00 8.50  ? 623 SER B OG  1 
ATOM 3917 N N   . GLU B 1 228 ? 28.692 -0.651 54.985 1.00 10.03 ? 624 GLU B N   1 
ATOM 3918 C CA  . GLU B 1 228 ? 27.238 -0.714 55.093 1.00 10.70 ? 624 GLU B CA  1 
ATOM 3919 C C   . GLU B 1 228 ? 26.660 0.605  55.612 1.00 10.33 ? 624 GLU B C   1 
ATOM 3920 O O   . GLU B 1 228 ? 25.627 1.078  55.124 1.00 12.18 ? 624 GLU B O   1 
ATOM 3921 C CB  . GLU B 1 228 ? 26.869 -1.867 56.027 1.00 15.43 ? 624 GLU B CB  1 
ATOM 3922 C CG  . GLU B 1 228 ? 25.423 -1.946 56.491 1.00 15.78 ? 624 GLU B CG  1 
ATOM 3923 C CD  . GLU B 1 228 ? 25.244 -2.977 57.601 1.00 19.80 ? 624 GLU B CD  1 
ATOM 3924 O OE1 . GLU B 1 228 ? 26.105 -3.060 58.503 1.00 22.20 ? 624 GLU B OE1 1 
ATOM 3925 O OE2 . GLU B 1 228 ? 24.240 -3.709 57.574 1.00 22.73 ? 624 GLU B OE2 1 
ATOM 3926 N N   . LYS B 1 229 ? 27.335 1.202  56.591 1.00 13.68 ? 625 LYS B N   1 
ATOM 3927 C CA  . LYS B 1 229 ? 26.886 2.461  57.172 1.00 13.17 ? 625 LYS B CA  1 
ATOM 3928 C C   . LYS B 1 229 ? 27.007 3.608  56.175 1.00 12.94 ? 625 LYS B C   1 
ATOM 3929 O O   . LYS B 1 229 ? 26.074 4.393  56.023 1.00 17.08 ? 625 LYS B O   1 
ATOM 3930 C CB  . LYS B 1 229 ? 27.641 2.761  58.470 1.00 13.89 ? 625 LYS B CB  1 
ATOM 3931 C CG  . LYS B 1 229 ? 26.960 3.806  59.351 1.00 19.82 ? 625 LYS B CG  1 
ATOM 3932 C CD  . LYS B 1 229 ? 27.145 3.522  60.843 1.00 21.52 ? 625 LYS B CD  1 
ATOM 3933 C CE  . LYS B 1 229 ? 26.398 2.261  61.281 1.00 24.13 ? 625 LYS B CE  1 
ATOM 3934 N NZ  . LYS B 1 229 ? 26.554 1.946  62.735 1.00 26.73 ? 625 LYS B NZ  1 
ATOM 3935 N N   . VAL B 1 230 ? 28.118 3.671  55.446 1.00 13.16 ? 626 VAL B N   1 
ATOM 3936 C CA  . VAL B 1 230 ? 28.310 4.726  54.445 1.00 10.56 ? 626 VAL B CA  1 
ATOM 3937 C C   . VAL B 1 230 ? 27.221 4.653  53.368 1.00 8.76  ? 626 VAL B C   1 
ATOM 3938 O O   . VAL B 1 230 ? 26.757 5.681  52.870 1.00 6.95  ? 626 VAL B O   1 
ATOM 3939 C CB  . VAL B 1 230 ? 29.698 4.646  53.758 1.00 10.58 ? 626 VAL B CB  1 
ATOM 3940 C CG1 . VAL B 1 230 ? 29.775 5.671  52.634 1.00 13.96 ? 626 VAL B CG1 1 
ATOM 3941 C CG2 . VAL B 1 230 ? 30.802 4.904  54.763 1.00 6.81  ? 626 VAL B CG2 1 
ATOM 3942 N N   . TYR B 1 231 ? 26.827 3.438  53.001 1.00 7.31  ? 627 TYR B N   1 
ATOM 3943 C CA  . TYR B 1 231 ? 25.780 3.243  52.001 1.00 7.99  ? 627 TYR B CA  1 
ATOM 3944 C C   . TYR B 1 231 ? 24.429 3.715  52.518 1.00 9.39  ? 627 TYR B C   1 
ATOM 3945 O O   . TYR B 1 231 ? 23.599 4.187  51.754 1.00 11.16 ? 627 TYR B O   1 
ATOM 3946 C CB  . TYR B 1 231 ? 25.674 1.773  51.598 1.00 2.15  ? 627 TYR B CB  1 
ATOM 3947 C CG  . TYR B 1 231 ? 24.723 1.544  50.454 1.00 4.61  ? 627 TYR B CG  1 
ATOM 3948 C CD1 . TYR B 1 231 ? 24.718 2.400  49.352 1.00 10.72 ? 627 TYR B CD1 1 
ATOM 3949 C CD2 . TYR B 1 231 ? 23.828 0.482  50.468 1.00 5.07  ? 627 TYR B CD2 1 
ATOM 3950 C CE1 . TYR B 1 231 ? 23.845 2.201  48.298 1.00 9.43  ? 627 TYR B CE1 1 
ATOM 3951 C CE2 . TYR B 1 231 ? 22.946 0.273  49.410 1.00 6.61  ? 627 TYR B CE2 1 
ATOM 3952 C CZ  . TYR B 1 231 ? 22.962 1.139  48.334 1.00 5.55  ? 627 TYR B CZ  1 
ATOM 3953 O OH  . TYR B 1 231 ? 22.092 0.961  47.297 1.00 11.16 ? 627 TYR B OH  1 
ATOM 3954 N N   . THR B 1 232 ? 24.201 3.546  53.813 1.00 9.89  ? 628 THR B N   1 
ATOM 3955 C CA  . THR B 1 232 ? 22.961 3.976  54.447 1.00 9.04  ? 628 THR B CA  1 
ATOM 3956 C C   . THR B 1 232 ? 22.868 5.490  54.289 1.00 7.33  ? 628 THR B C   1 
ATOM 3957 O O   . THR B 1 232 ? 21.856 6.023  53.853 1.00 6.66  ? 628 THR B O   1 
ATOM 3958 C CB  . THR B 1 232 ? 22.989 3.636  55.961 1.00 10.10 ? 628 THR B CB  1 
ATOM 3959 O OG1 . THR B 1 232 ? 23.201 2.229  56.132 1.00 13.62 ? 628 THR B OG1 1 
ATOM 3960 C CG2 . THR B 1 232 ? 21.691 4.033  56.633 1.00 6.51  ? 628 THR B CG2 1 
ATOM 3961 N N   . ILE B 1 233 ? 23.967 6.167  54.589 1.00 6.78  ? 629 ILE B N   1 
ATOM 3962 C CA  . ILE B 1 233 ? 24.031 7.617  54.493 1.00 8.03  ? 629 ILE B CA  1 
ATOM 3963 C C   . ILE B 1 233 ? 23.690 8.120  53.085 1.00 12.02 ? 629 ILE B C   1 
ATOM 3964 O O   . ILE B 1 233 ? 22.702 8.842  52.900 1.00 13.66 ? 629 ILE B O   1 
ATOM 3965 C CB  . ILE B 1 233 ? 25.417 8.151  54.964 1.00 6.17  ? 629 ILE B CB  1 
ATOM 3966 C CG1 . ILE B 1 233 ? 25.593 7.854  56.459 1.00 5.15  ? 629 ILE B CG1 1 
ATOM 3967 C CG2 . ILE B 1 233 ? 25.531 9.649  54.709 1.00 5.05  ? 629 ILE B CG2 1 
ATOM 3968 C CD1 . ILE B 1 233 ? 26.999 8.035  56.969 1.00 2.34  ? 629 ILE B CD1 1 
ATOM 3969 N N   . MET B 1 234 ? 24.439 7.676  52.085 1.00 11.42 ? 630 MET B N   1 
ATOM 3970 C CA  . MET B 1 234 ? 24.185 8.124  50.727 1.00 7.89  ? 630 MET B CA  1 
ATOM 3971 C C   . MET B 1 234 ? 22.798 7.766  50.246 1.00 6.76  ? 630 MET B C   1 
ATOM 3972 O O   . MET B 1 234 ? 22.164 8.542  49.525 1.00 9.02  ? 630 MET B O   1 
ATOM 3973 C CB  . MET B 1 234 ? 25.249 7.600  49.756 1.00 11.44 ? 630 MET B CB  1 
ATOM 3974 C CG  . MET B 1 234 ? 25.288 6.095  49.574 1.00 14.27 ? 630 MET B CG  1 
ATOM 3975 S SD  . MET B 1 234 ? 26.438 5.613  48.277 1.00 14.21 ? 630 MET B SD  1 
ATOM 3976 C CE  . MET B 1 234 ? 27.987 5.700  49.104 1.00 3.93  ? 630 MET B CE  1 
ATOM 3977 N N   . TYR B 1 235 ? 22.303 6.618  50.696 1.00 9.53  ? 631 TYR B N   1 
ATOM 3978 C CA  . TYR B 1 235 ? 20.981 6.143  50.301 1.00 9.62  ? 631 TYR B CA  1 
ATOM 3979 C C   . TYR B 1 235 ? 19.844 6.937  50.950 1.00 7.30  ? 631 TYR B C   1 
ATOM 3980 O O   . TYR B 1 235 ? 18.719 6.932  50.451 1.00 11.12 ? 631 TYR B O   1 
ATOM 3981 C CB  . TYR B 1 235 ? 20.837 4.637  50.583 1.00 7.23  ? 631 TYR B CB  1 
ATOM 3982 C CG  . TYR B 1 235 ? 19.708 3.978  49.819 1.00 9.49  ? 631 TYR B CG  1 
ATOM 3983 C CD1 . TYR B 1 235 ? 18.385 4.120  50.232 1.00 12.76 ? 631 TYR B CD1 1 
ATOM 3984 C CD2 . TYR B 1 235 ? 19.962 3.233  48.670 1.00 8.23  ? 631 TYR B CD2 1 
ATOM 3985 C CE1 . TYR B 1 235 ? 17.343 3.539  49.518 1.00 12.89 ? 631 TYR B CE1 1 
ATOM 3986 C CE2 . TYR B 1 235 ? 18.929 2.646  47.951 1.00 11.55 ? 631 TYR B CE2 1 
ATOM 3987 C CZ  . TYR B 1 235 ? 17.625 2.803  48.381 1.00 13.98 ? 631 TYR B CZ  1 
ATOM 3988 O OH  . TYR B 1 235 ? 16.598 2.225  47.683 1.00 16.12 ? 631 TYR B OH  1 
ATOM 3989 N N   . SER B 1 236 ? 20.119 7.635  52.048 1.00 9.61  ? 632 SER B N   1 
ATOM 3990 C CA  . SER B 1 236 ? 19.067 8.423  52.678 1.00 9.92  ? 632 SER B CA  1 
ATOM 3991 C C   . SER B 1 236 ? 18.759 9.642  51.800 1.00 10.16 ? 632 SER B C   1 
ATOM 3992 O O   . SER B 1 236 ? 17.648 10.189 51.820 1.00 8.62  ? 632 SER B O   1 
ATOM 3993 C CB  . SER B 1 236 ? 19.446 8.838  54.108 1.00 7.09  ? 632 SER B CB  1 
ATOM 3994 O OG  . SER B 1 236 ? 20.592 9.664  54.130 1.00 8.65  ? 632 SER B OG  1 
ATOM 3995 N N   . CYS B 1 237 ? 19.734 10.013 50.979 1.00 13.59 ? 633 CYS B N   1 
ATOM 3996 C CA  . CYS B 1 237 ? 19.606 11.146 50.065 1.00 13.01 ? 633 CYS B CA  1 
ATOM 3997 C C   . CYS B 1 237 ? 18.688 10.861 48.869 1.00 11.24 ? 633 CYS B C   1 
ATOM 3998 O O   . CYS B 1 237 ? 18.167 11.785 48.264 1.00 11.58 ? 633 CYS B O   1 
ATOM 3999 C CB  . CYS B 1 237 ? 20.988 11.537 49.522 1.00 9.51  ? 633 CYS B CB  1 
ATOM 4000 S SG  . CYS B 1 237 ? 22.269 11.873 50.748 1.00 10.09 ? 633 CYS B SG  1 
ATOM 4001 N N   . TRP B 1 238 ? 18.448 9.590  48.565 1.00 12.35 ? 634 TRP B N   1 
ATOM 4002 C CA  . TRP B 1 238 ? 17.649 9.225  47.396 1.00 16.45 ? 634 TRP B CA  1 
ATOM 4003 C C   . TRP B 1 238 ? 16.171 8.881  47.541 1.00 20.48 ? 634 TRP B C   1 
ATOM 4004 O O   . TRP B 1 238 ? 15.588 8.288  46.633 1.00 24.09 ? 634 TRP B O   1 
ATOM 4005 C CB  . TRP B 1 238 ? 18.354 8.109  46.629 1.00 14.41 ? 634 TRP B CB  1 
ATOM 4006 C CG  . TRP B 1 238 ? 19.803 8.397  46.406 1.00 16.37 ? 634 TRP B CG  1 
ATOM 4007 C CD1 . TRP B 1 238 ? 20.361 9.604  46.101 1.00 12.67 ? 634 TRP B CD1 1 
ATOM 4008 C CD2 . TRP B 1 238 ? 20.885 7.465  46.489 1.00 13.01 ? 634 TRP B CD2 1 
ATOM 4009 N NE1 . TRP B 1 238 ? 21.717 9.482  45.987 1.00 11.33 ? 634 TRP B NE1 1 
ATOM 4010 C CE2 . TRP B 1 238 ? 22.067 8.178  46.219 1.00 13.10 ? 634 TRP B CE2 1 
ATOM 4011 C CE3 . TRP B 1 238 ? 20.965 6.095  46.765 1.00 12.84 ? 634 TRP B CE3 1 
ATOM 4012 C CZ2 . TRP B 1 238 ? 23.325 7.566  46.214 1.00 10.17 ? 634 TRP B CZ2 1 
ATOM 4013 C CZ3 . TRP B 1 238 ? 22.213 5.490  46.761 1.00 12.02 ? 634 TRP B CZ3 1 
ATOM 4014 C CH2 . TRP B 1 238 ? 23.376 6.227  46.486 1.00 4.94  ? 634 TRP B CH2 1 
ATOM 4015 N N   . HIS B 1 239 ? 15.550 9.253  48.654 1.00 22.92 ? 635 HIS B N   1 
ATOM 4016 C CA  . HIS B 1 239 ? 14.128 8.968  48.833 1.00 24.53 ? 635 HIS B CA  1 
ATOM 4017 C C   . HIS B 1 239 ? 13.361 9.805  47.810 1.00 24.66 ? 635 HIS B C   1 
ATOM 4018 O O   . HIS B 1 239 ? 13.551 11.016 47.734 1.00 23.32 ? 635 HIS B O   1 
ATOM 4019 C CB  . HIS B 1 239 ? 13.670 9.356  50.234 1.00 25.26 ? 635 HIS B CB  1 
ATOM 4020 C CG  . HIS B 1 239 ? 14.517 8.796  51.331 1.00 34.35 ? 635 HIS B CG  1 
ATOM 4021 N ND1 . HIS B 1 239 ? 15.373 7.731  51.144 1.00 40.01 ? 635 HIS B ND1 1 
ATOM 4022 C CD2 . HIS B 1 239 ? 14.645 9.161  52.628 1.00 37.85 ? 635 HIS B CD2 1 
ATOM 4023 C CE1 . HIS B 1 239 ? 15.990 7.465  52.282 1.00 41.13 ? 635 HIS B CE1 1 
ATOM 4024 N NE2 . HIS B 1 239 ? 15.567 8.319  53.198 1.00 40.19 ? 635 HIS B NE2 1 
ATOM 4025 N N   . GLU B 1 240 ? 12.488 9.179  47.031 1.00 26.44 ? 636 GLU B N   1 
ATOM 4026 C CA  . GLU B 1 240 ? 11.734 9.939  46.043 1.00 26.89 ? 636 GLU B CA  1 
ATOM 4027 C C   . GLU B 1 240 ? 10.831 10.959 46.753 1.00 27.63 ? 636 GLU B C   1 
ATOM 4028 O O   . GLU B 1 240 ? 10.420 11.954 46.156 1.00 30.62 ? 636 GLU B O   1 
ATOM 4029 C CB  . GLU B 1 240 ? 10.949 9.006  45.110 1.00 28.33 ? 636 GLU B CB  1 
ATOM 4030 C CG  . GLU B 1 240 ? 10.700 9.603  43.709 1.00 28.10 ? 636 GLU B CG  1 
ATOM 4031 C CD  . GLU B 1 240 ? 10.649 8.559  42.592 1.00 22.86 ? 636 GLU B CD  1 
ATOM 4032 O OE1 . GLU B 1 240 ? 9.696  8.602  41.786 1.00 21.50 ? 636 GLU B OE1 1 
ATOM 4033 O OE2 . GLU B 1 240 ? 11.572 7.715  42.501 1.00 21.58 ? 636 GLU B OE2 1 
ATOM 4034 N N   . LYS B 1 241 ? 10.529 10.714 48.026 1.00 25.98 ? 637 LYS B N   1 
ATOM 4035 C CA  . LYS B 1 241 ? 9.724  11.642 48.817 1.00 26.32 ? 637 LYS B CA  1 
ATOM 4036 C C   . LYS B 1 241 ? 10.701 12.606 49.485 1.00 26.98 ? 637 LYS B C   1 
ATOM 4037 O O   . LYS B 1 241 ? 11.212 12.330 50.575 1.00 26.07 ? 637 LYS B O   1 
ATOM 4038 C CB  . LYS B 1 241 ? 8.924  10.898 49.896 1.00 28.32 ? 637 LYS B CB  1 
ATOM 4039 C CG  . LYS B 1 241 ? 8.125  11.800 50.857 1.00 29.37 ? 637 LYS B CG  1 
ATOM 4040 C CD  . LYS B 1 241 ? 6.661  11.997 50.426 1.00 31.37 ? 637 LYS B CD  1 
ATOM 4041 C CE  . LYS B 1 241 ? 6.512  12.837 49.155 1.00 33.19 ? 637 LYS B CE  1 
ATOM 4042 N NZ  . LYS B 1 241 ? 5.123  12.793 48.607 1.00 32.03 ? 637 LYS B NZ  1 
ATOM 4043 N N   . ALA B 1 242 ? 10.960 13.729 48.825 1.00 28.49 ? 638 ALA B N   1 
ATOM 4044 C CA  . ALA B 1 242 ? 11.879 14.746 49.333 1.00 28.72 ? 638 ALA B CA  1 
ATOM 4045 C C   . ALA B 1 242 ? 11.779 14.985 50.844 1.00 28.22 ? 638 ALA B C   1 
ATOM 4046 O O   . ALA B 1 242 ? 12.791 15.134 51.529 1.00 25.48 ? 638 ALA B O   1 
ATOM 4047 C CB  . ALA B 1 242 ? 11.658 16.048 48.586 1.00 31.16 ? 638 ALA B CB  1 
ATOM 4048 N N   . ASP B 1 243 ? 10.554 15.003 51.355 1.00 29.23 ? 639 ASP B N   1 
ATOM 4049 C CA  . ASP B 1 243 ? 10.295 15.234 52.774 1.00 28.43 ? 639 ASP B CA  1 
ATOM 4050 C C   . ASP B 1 243 ? 10.970 14.230 53.718 1.00 28.45 ? 639 ASP B C   1 
ATOM 4051 O O   . ASP B 1 243 ? 11.329 14.574 54.848 1.00 25.09 ? 639 ASP B O   1 
ATOM 4052 C CB  . ASP B 1 243 ? 8.779  15.248 53.031 1.00 31.75 ? 639 ASP B CB  1 
ATOM 4053 C CG  . ASP B 1 243 ? 8.058  16.380 52.288 1.00 34.13 ? 639 ASP B CG  1 
ATOM 4054 O OD1 . ASP B 1 243 ? 6.951  16.765 52.735 1.00 33.09 ? 639 ASP B OD1 1 
ATOM 4055 O OD2 . ASP B 1 243 ? 8.586  16.881 51.266 1.00 36.59 ? 639 ASP B OD2 1 
ATOM 4056 N N   . GLU B 1 244 ? 11.146 12.996 53.244 1.00 24.72 ? 640 GLU B N   1 
ATOM 4057 C CA  . GLU B 1 244 ? 11.754 11.931 54.038 1.00 18.61 ? 640 GLU B CA  1 
ATOM 4058 C C   . GLU B 1 244 ? 13.276 12.021 54.030 1.00 18.11 ? 640 GLU B C   1 
ATOM 4059 O O   . GLU B 1 244 ? 13.950 11.266 54.734 1.00 19.30 ? 640 GLU B O   1 
ATOM 4060 C CB  . GLU B 1 244 ? 11.297 10.563 53.513 1.00 20.35 ? 640 GLU B CB  1 
ATOM 4061 C CG  . GLU B 1 244 ? 11.609 9.361  54.422 1.00 22.93 ? 640 GLU B CG  1 
ATOM 4062 C CD  . GLU B 1 244 ? 11.329 8.007  53.762 1.00 21.79 ? 640 GLU B CD  1 
ATOM 4063 O OE1 . GLU B 1 244 ? 10.997 7.043  54.486 1.00 26.11 ? 640 GLU B OE1 1 
ATOM 4064 O OE2 . GLU B 1 244 ? 11.465 7.895  52.522 1.00 15.76 ? 640 GLU B OE2 1 
ATOM 4065 N N   . ARG B 1 245 ? 13.821 12.935 53.233 1.00 16.37 ? 641 ARG B N   1 
ATOM 4066 C CA  . ARG B 1 245 ? 15.273 13.108 53.155 1.00 14.52 ? 641 ARG B CA  1 
ATOM 4067 C C   . ARG B 1 245 ? 15.825 13.988 54.279 1.00 14.27 ? 641 ARG B C   1 
ATOM 4068 O O   . ARG B 1 245 ? 15.198 14.964 54.692 1.00 16.92 ? 641 ARG B O   1 
ATOM 4069 C CB  . ARG B 1 245 ? 15.682 13.695 51.803 1.00 12.65 ? 641 ARG B CB  1 
ATOM 4070 C CG  . ARG B 1 245 ? 15.358 12.831 50.610 1.00 8.88  ? 641 ARG B CG  1 
ATOM 4071 C CD  . ARG B 1 245 ? 15.886 13.474 49.360 1.00 11.30 ? 641 ARG B CD  1 
ATOM 4072 N NE  . ARG B 1 245 ? 15.231 12.947 48.171 1.00 11.72 ? 641 ARG B NE  1 
ATOM 4073 C CZ  . ARG B 1 245 ? 14.731 13.710 47.206 1.00 13.82 ? 641 ARG B CZ  1 
ATOM 4074 N NH1 . ARG B 1 245 ? 14.827 15.031 47.288 1.00 12.20 ? 641 ARG B NH1 1 
ATOM 4075 N NH2 . ARG B 1 245 ? 14.071 13.160 46.198 1.00 16.65 ? 641 ARG B NH2 1 
ATOM 4076 N N   . PRO B 1 246 ? 17.017 13.642 54.787 1.00 11.73 ? 642 PRO B N   1 
ATOM 4077 C CA  . PRO B 1 246 ? 17.706 14.357 55.863 1.00 11.49 ? 642 PRO B CA  1 
ATOM 4078 C C   . PRO B 1 246 ? 18.313 15.686 55.423 1.00 12.59 ? 642 PRO B C   1 
ATOM 4079 O O   . PRO B 1 246 ? 18.396 15.982 54.235 1.00 14.26 ? 642 PRO B O   1 
ATOM 4080 C CB  . PRO B 1 246 ? 18.793 13.371 56.269 1.00 10.83 ? 642 PRO B CB  1 
ATOM 4081 C CG  . PRO B 1 246 ? 19.134 12.705 54.949 1.00 11.19 ? 642 PRO B CG  1 
ATOM 4082 C CD  . PRO B 1 246 ? 17.769 12.438 54.386 1.00 8.97  ? 642 PRO B CD  1 
ATOM 4083 N N   . THR B 1 247 ? 18.687 16.513 56.391 1.00 13.95 ? 643 THR B N   1 
ATOM 4084 C CA  . THR B 1 247 ? 19.310 17.790 56.081 1.00 11.71 ? 643 THR B CA  1 
ATOM 4085 C C   . THR B 1 247 ? 20.815 17.574 56.032 1.00 9.69  ? 643 THR B C   1 
ATOM 4086 O O   . THR B 1 247 ? 21.310 16.524 56.455 1.00 10.98 ? 643 THR B O   1 
ATOM 4087 C CB  . THR B 1 247 ? 19.003 18.856 57.151 1.00 9.31  ? 643 THR B CB  1 
ATOM 4088 O OG1 . THR B 1 247 ? 19.178 18.295 58.453 1.00 13.11 ? 643 THR B OG1 1 
ATOM 4089 C CG2 . THR B 1 247 ? 17.585 19.370 57.013 1.00 16.43 ? 643 THR B CG2 1 
ATOM 4090 N N   . PHE B 1 248 ? 21.542 18.544 55.489 1.00 8.04  ? 644 PHE B N   1 
ATOM 4091 C CA  . PHE B 1 248 ? 22.994 18.461 55.430 1.00 7.60  ? 644 PHE B CA  1 
ATOM 4092 C C   . PHE B 1 248 ? 23.524 18.508 56.866 1.00 8.95  ? 644 PHE B C   1 
ATOM 4093 O O   . PHE B 1 248 ? 24.601 17.996 57.163 1.00 10.35 ? 644 PHE B O   1 
ATOM 4094 C CB  . PHE B 1 248 ? 23.564 19.613 54.593 1.00 9.27  ? 644 PHE B CB  1 
ATOM 4095 C CG  . PHE B 1 248 ? 23.518 19.373 53.106 1.00 11.88 ? 644 PHE B CG  1 
ATOM 4096 C CD1 . PHE B 1 248 ? 24.271 18.353 52.530 1.00 10.79 ? 644 PHE B CD1 1 
ATOM 4097 C CD2 . PHE B 1 248 ? 22.749 20.185 52.275 1.00 17.35 ? 644 PHE B CD2 1 
ATOM 4098 C CE1 . PHE B 1 248 ? 24.262 18.145 51.147 1.00 15.55 ? 644 PHE B CE1 1 
ATOM 4099 C CE2 . PHE B 1 248 ? 22.733 19.984 50.885 1.00 14.48 ? 644 PHE B CE2 1 
ATOM 4100 C CZ  . PHE B 1 248 ? 23.495 18.959 50.324 1.00 11.64 ? 644 PHE B CZ  1 
ATOM 4101 N N   . LYS B 1 249 ? 22.736 19.096 57.760 1.00 10.75 ? 645 LYS B N   1 
ATOM 4102 C CA  . LYS B 1 249 ? 23.098 19.189 59.168 1.00 14.25 ? 645 LYS B CA  1 
ATOM 4103 C C   . LYS B 1 249 ? 23.121 17.795 59.784 1.00 12.92 ? 645 LYS B C   1 
ATOM 4104 O O   . LYS B 1 249 ? 24.061 17.433 60.491 1.00 16.72 ? 645 LYS B O   1 
ATOM 4105 C CB  . LYS B 1 249 ? 22.094 20.076 59.914 1.00 20.40 ? 645 LYS B CB  1 
ATOM 4106 C CG  . LYS B 1 249 ? 22.396 20.305 61.404 1.00 19.51 ? 645 LYS B CG  1 
ATOM 4107 C CD  . LYS B 1 249 ? 23.765 20.942 61.644 1.00 21.82 ? 645 LYS B CD  1 
ATOM 4108 C CE  . LYS B 1 249 ? 24.857 19.891 61.826 1.00 18.46 ? 645 LYS B CE  1 
ATOM 4109 N NZ  . LYS B 1 249 ? 26.212 20.491 61.891 1.00 19.87 ? 645 LYS B NZ  1 
ATOM 4110 N N   . ILE B 1 250 ? 22.067 17.027 59.528 1.00 12.66 ? 646 ILE B N   1 
ATOM 4111 C CA  . ILE B 1 250 ? 21.949 15.658 60.026 1.00 12.65 ? 646 ILE B CA  1 
ATOM 4112 C C   . ILE B 1 250 ? 22.996 14.806 59.305 1.00 14.43 ? 646 ILE B C   1 
ATOM 4113 O O   . ILE B 1 250 ? 23.772 14.089 59.946 1.00 13.14 ? 646 ILE B O   1 
ATOM 4114 C CB  . ILE B 1 250 ? 20.527 15.115 59.763 1.00 16.20 ? 646 ILE B CB  1 
ATOM 4115 C CG1 . ILE B 1 250 ? 19.536 15.781 60.726 1.00 16.13 ? 646 ILE B CG1 1 
ATOM 4116 C CG2 . ILE B 1 250 ? 20.494 13.594 59.881 1.00 18.66 ? 646 ILE B CG2 1 
ATOM 4117 C CD1 . ILE B 1 250 ? 18.071 15.534 60.391 1.00 16.31 ? 646 ILE B CD1 1 
ATOM 4118 N N   . LEU B 1 251 ? 23.054 14.957 57.979 1.00 14.30 ? 647 LEU B N   1 
ATOM 4119 C CA  . LEU B 1 251 ? 24.006 14.254 57.113 1.00 14.73 ? 647 LEU B CA  1 
ATOM 4120 C C   . LEU B 1 251 ? 25.427 14.468 57.633 1.00 12.35 ? 647 LEU B C   1 
ATOM 4121 O O   . LEU B 1 251 ? 26.247 13.556 57.613 1.00 10.67 ? 647 LEU B O   1 
ATOM 4122 C CB  . LEU B 1 251 ? 23.879 14.795 55.682 1.00 16.19 ? 647 LEU B CB  1 
ATOM 4123 C CG  . LEU B 1 251 ? 23.584 13.896 54.473 1.00 13.29 ? 647 LEU B CG  1 
ATOM 4124 C CD1 . LEU B 1 251 ? 22.737 12.680 54.829 1.00 12.13 ? 647 LEU B CD1 1 
ATOM 4125 C CD2 . LEU B 1 251 ? 22.884 14.734 53.433 1.00 9.14  ? 647 LEU B CD2 1 
ATOM 4126 N N   . LEU B 1 252 ? 25.692 15.666 58.142 1.00 11.64 ? 648 LEU B N   1 
ATOM 4127 C CA  . LEU B 1 252 ? 26.996 15.998 58.702 1.00 12.42 ? 648 LEU B CA  1 
ATOM 4128 C C   . LEU B 1 252 ? 27.269 15.241 60.009 1.00 13.83 ? 648 LEU B C   1 
ATOM 4129 O O   . LEU B 1 252 ? 28.369 14.729 60.210 1.00 12.04 ? 648 LEU B O   1 
ATOM 4130 C CB  . LEU B 1 252 ? 27.125 17.515 58.914 1.00 9.53  ? 648 LEU B CB  1 
ATOM 4131 C CG  . LEU B 1 252 ? 28.505 18.085 59.272 1.00 10.27 ? 648 LEU B CG  1 
ATOM 4132 C CD1 . LEU B 1 252 ? 29.570 17.603 58.313 1.00 9.87  ? 648 LEU B CD1 1 
ATOM 4133 C CD2 . LEU B 1 252 ? 28.441 19.577 59.254 1.00 7.44  ? 648 LEU B CD2 1 
ATOM 4134 N N   . SER B 1 253 ? 26.271 15.152 60.886 1.00 13.67 ? 649 SER B N   1 
ATOM 4135 C CA  . SER B 1 253 ? 26.439 14.440 62.158 1.00 11.87 ? 649 SER B CA  1 
ATOM 4136 C C   . SER B 1 253 ? 26.711 12.958 61.910 1.00 11.53 ? 649 SER B C   1 
ATOM 4137 O O   . SER B 1 253 ? 27.719 12.413 62.366 1.00 14.67 ? 649 SER B O   1 
ATOM 4138 C CB  . SER B 1 253 ? 25.187 14.575 63.035 1.00 10.55 ? 649 SER B CB  1 
ATOM 4139 O OG  . SER B 1 253 ? 24.887 15.929 63.307 1.00 12.87 ? 649 SER B OG  1 
ATOM 4140 N N   . ASN B 1 254 ? 25.808 12.317 61.175 1.00 12.17 ? 650 ASN B N   1 
ATOM 4141 C CA  . ASN B 1 254 ? 25.918 10.897 60.849 1.00 10.92 ? 650 ASN B CA  1 
ATOM 4142 C C   . ASN B 1 254 ? 27.280 10.549 60.272 1.00 11.25 ? 650 ASN B C   1 
ATOM 4143 O O   . ASN B 1 254 ? 27.843 9.516  60.592 1.00 11.41 ? 650 ASN B O   1 
ATOM 4144 C CB  . ASN B 1 254 ? 24.804 10.487 59.880 1.00 11.30 ? 650 ASN B CB  1 
ATOM 4145 C CG  . ASN B 1 254 ? 23.414 10.618 60.498 1.00 14.31 ? 650 ASN B CG  1 
ATOM 4146 O OD1 . ASN B 1 254 ? 23.236 11.298 61.506 1.00 16.85 ? 650 ASN B OD1 1 
ATOM 4147 N ND2 . ASN B 1 254 ? 22.429 9.962  59.902 1.00 15.42 ? 650 ASN B ND2 1 
ATOM 4148 N N   . ILE B 1 255 ? 27.809 11.425 59.425 1.00 11.24 ? 651 ILE B N   1 
ATOM 4149 C CA  . ILE B 1 255 ? 29.119 11.227 58.823 1.00 11.82 ? 651 ILE B CA  1 
ATOM 4150 C C   . ILE B 1 255 ? 30.214 11.306 59.884 1.00 15.31 ? 651 ILE B C   1 
ATOM 4151 O O   . ILE B 1 255 ? 31.166 10.527 59.854 1.00 17.19 ? 651 ILE B O   1 
ATOM 4152 C CB  . ILE B 1 255 ? 29.364 12.262 57.707 1.00 10.65 ? 651 ILE B CB  1 
ATOM 4153 C CG1 . ILE B 1 255 ? 28.933 11.679 56.358 1.00 9.82  ? 651 ILE B CG1 1 
ATOM 4154 C CG2 . ILE B 1 255 ? 30.825 12.736 57.688 1.00 13.31 ? 651 ILE B CG2 1 
ATOM 4155 C CD1 . ILE B 1 255 ? 28.910 12.690 55.219 1.00 9.11  ? 651 ILE B CD1 1 
ATOM 4156 N N   . LEU B 1 256 ? 30.069 12.230 60.831 1.00 17.10 ? 652 LEU B N   1 
ATOM 4157 C CA  . LEU B 1 256 ? 31.059 12.394 61.888 1.00 14.72 ? 652 LEU B CA  1 
ATOM 4158 C C   . LEU B 1 256 ? 31.233 11.180 62.790 1.00 16.01 ? 652 LEU B C   1 
ATOM 4159 O O   . LEU B 1 256 ? 32.285 11.022 63.398 1.00 16.51 ? 652 LEU B O   1 
ATOM 4160 C CB  . LEU B 1 256 ? 30.796 13.654 62.717 1.00 13.15 ? 652 LEU B CB  1 
ATOM 4161 C CG  . LEU B 1 256 ? 31.745 14.827 62.444 1.00 8.61  ? 652 LEU B CG  1 
ATOM 4162 C CD1 . LEU B 1 256 ? 32.998 14.338 61.694 1.00 10.58 ? 652 LEU B CD1 1 
ATOM 4163 C CD2 . LEU B 1 256 ? 31.041 15.927 61.663 1.00 9.95  ? 652 LEU B CD2 1 
ATOM 4164 N N   . ASP B 1 257 ? 30.209 10.345 62.920 1.00 21.54 ? 653 ASP B N   1 
ATOM 4165 C CA  . ASP B 1 257 ? 30.356 9.145  63.732 1.00 24.79 ? 653 ASP B CA  1 
ATOM 4166 C C   . ASP B 1 257 ? 29.989 7.854  62.996 1.00 29.44 ? 653 ASP B C   1 
ATOM 4167 O O   . ASP B 1 257 ? 28.983 7.207  63.287 1.00 31.02 ? 653 ASP B O   1 
ATOM 4168 C CB  . ASP B 1 257 ? 29.651 9.264  65.099 1.00 28.24 ? 653 ASP B CB  1 
ATOM 4169 C CG  . ASP B 1 257 ? 28.171 9.543  64.990 1.00 24.00 ? 653 ASP B CG  1 
ATOM 4170 O OD1 . ASP B 1 257 ? 27.389 8.597  64.778 1.00 22.42 ? 653 ASP B OD1 1 
ATOM 4171 O OD2 . ASP B 1 257 ? 27.780 10.711 65.170 1.00 31.86 ? 653 ASP B OD2 1 
ATOM 4172 N N   . VAL B 1 258 ? 30.804 7.508  62.006 1.00 33.61 ? 654 VAL B N   1 
ATOM 4173 C CA  . VAL B 1 258 ? 30.603 6.289  61.233 1.00 34.38 ? 654 VAL B CA  1 
ATOM 4174 C C   . VAL B 1 258 ? 31.766 5.368  61.580 1.00 37.78 ? 654 VAL B C   1 
ATOM 4175 O O   . VAL B 1 258 ? 31.521 4.332  62.236 1.00 39.69 ? 654 VAL B O   1 
ATOM 4176 C CB  . VAL B 1 258 ? 30.615 6.548  59.700 1.00 33.33 ? 654 VAL B CB  1 
ATOM 4177 C CG1 . VAL B 1 258 ? 30.247 5.284  58.958 1.00 31.87 ? 654 VAL B CG1 1 
ATOM 4178 C CG2 . VAL B 1 258 ? 29.668 7.660  59.331 1.00 28.22 ? 654 VAL B CG2 1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ILE 1   397 397 ILE ILE A . n 
A 1 2   ASP 2   398 398 ASP ASP A . n 
A 1 3   PRO 3   399 399 PRO PRO A . n 
A 1 4   LYS 4   400 400 LYS LYS A . n 
A 1 5   ASP 5   401 401 ASP ASP A . n 
A 1 6   LEU 6   402 402 LEU LEU A . n 
A 1 7   THR 7   403 403 THR THR A . n 
A 1 8   PHE 8   404 404 PHE PHE A . n 
A 1 9   LEU 9   405 405 LEU LEU A . n 
A 1 10  LYS 10  406 406 LYS LYS A . n 
A 1 11  GLU 11  407 407 GLU GLU A . n 
A 1 12  LEU 12  408 408 LEU LEU A . n 
A 1 13  GLY 13  409 409 GLY GLY A . n 
A 1 14  THR 14  410 410 THR THR A . n 
A 1 15  GLY 15  411 411 GLY GLY A . n 
A 1 16  GLN 16  412 412 GLN GLN A . n 
A 1 17  PHE 17  413 413 PHE PHE A . n 
A 1 18  GLY 18  414 414 GLY GLY A . n 
A 1 19  VAL 19  415 415 VAL VAL A . n 
A 1 20  VAL 20  416 416 VAL VAL A . n 
A 1 21  LYS 21  417 417 LYS LYS A . n 
A 1 22  TYR 22  418 418 TYR ALA A . n 
A 1 23  GLY 23  419 419 GLY GLY A . n 
A 1 24  LYS 24  420 420 LYS ALA A . n 
A 1 25  TRP 25  421 421 TRP TRP A . n 
A 1 26  ARG 26  422 422 ARG ARG A . n 
A 1 27  GLY 27  423 423 GLY GLY A . n 
A 1 28  GLN 28  424 424 GLN ALA A . n 
A 1 29  TYR 29  425 425 TYR ALA A . n 
A 1 30  ASP 30  426 426 ASP ASP A . n 
A 1 31  VAL 31  427 427 VAL VAL A . n 
A 1 32  ALA 32  428 428 ALA ALA A . n 
A 1 33  ILE 33  429 429 ILE ILE A . n 
A 1 34  LYS 34  430 430 LYS LYS A . n 
A 1 35  MET 35  431 431 MET MET A . n 
A 1 36  ILE 36  432 432 ILE ILE A . n 
A 1 37  LYS 37  433 433 LYS LYS A . n 
A 1 38  GLU 38  434 434 GLU GLU A . n 
A 1 39  GLY 39  435 435 GLY GLY A . n 
A 1 40  SER 40  436 436 SER SER A . n 
A 1 41  MET 41  437 437 MET MET A . n 
A 1 42  SER 42  438 438 SER SER A . n 
A 1 43  GLU 43  439 439 GLU GLU A . n 
A 1 44  ASP 44  440 440 ASP ASP A . n 
A 1 45  GLU 45  441 441 GLU GLU A . n 
A 1 46  PHE 46  442 442 PHE PHE A . n 
A 1 47  ILE 47  443 443 ILE ILE A . n 
A 1 48  GLU 48  444 444 GLU GLU A . n 
A 1 49  GLU 49  445 445 GLU GLU A . n 
A 1 50  ALA 50  446 446 ALA ALA A . n 
A 1 51  LYS 51  447 447 LYS LYS A . n 
A 1 52  VAL 52  448 448 VAL VAL A . n 
A 1 53  MET 53  449 449 MET MET A . n 
A 1 54  MET 54  450 450 MET MET A . n 
A 1 55  ASN 55  451 451 ASN ASN A . n 
A 1 56  LEU 56  452 452 LEU LEU A . n 
A 1 57  SER 57  453 453 SER SER A . n 
A 1 58  HIS 58  454 454 HIS HIS A . n 
A 1 59  GLU 59  455 455 GLU GLU A . n 
A 1 60  LYS 60  456 456 LYS LYS A . n 
A 1 61  LEU 61  457 457 LEU LEU A . n 
A 1 62  VAL 62  458 458 VAL VAL A . n 
A 1 63  GLN 63  459 459 GLN GLN A . n 
A 1 64  LEU 64  460 460 LEU LEU A . n 
A 1 65  TYR 65  461 461 TYR TYR A . n 
A 1 66  GLY 66  462 462 GLY GLY A . n 
A 1 67  VAL 67  463 463 VAL VAL A . n 
A 1 68  CYS 68  464 464 CYS CYS A . n 
A 1 69  THR 69  465 465 THR THR A . n 
A 1 70  LYS 70  466 466 LYS LYS A . n 
A 1 71  GLN 71  467 467 GLN GLN A . n 
A 1 72  ARG 72  468 468 ARG ARG A . n 
A 1 73  PRO 73  469 469 PRO PRO A . n 
A 1 74  ILE 74  470 470 ILE ILE A . n 
A 1 75  PHE 75  471 471 PHE PHE A . n 
A 1 76  ILE 76  472 472 ILE ILE A . n 
A 1 77  ILE 77  473 473 ILE ILE A . n 
A 1 78  THR 78  474 474 THR THR A . n 
A 1 79  GLU 79  475 475 GLU GLU A . n 
A 1 80  TYR 80  476 476 TYR TYR A . n 
A 1 81  MET 81  477 477 MET MET A . n 
A 1 82  ALA 82  478 478 ALA ALA A . n 
A 1 83  ASN 83  479 479 ASN ASN A . n 
A 1 84  GLY 84  480 480 GLY GLY A . n 
A 1 85  CYS 85  481 481 CYS CYS A . n 
A 1 86  LEU 86  482 482 LEU LEU A . n 
A 1 87  LEU 87  483 483 LEU LEU A . n 
A 1 88  ASN 88  484 484 ASN ASN A . n 
A 1 89  TYR 89  485 485 TYR TYR A . n 
A 1 90  LEU 90  486 486 LEU LEU A . n 
A 1 91  ARG 91  487 487 ARG ARG A . n 
A 1 92  GLU 92  488 488 GLU GLU A . n 
A 1 93  MET 93  489 489 MET MET A . n 
A 1 94  ARG 94  490 490 ARG ARG A . n 
A 1 95  HIS 95  491 491 HIS HIS A . n 
A 1 96  ARG 96  492 492 ARG ARG A . n 
A 1 97  PHE 97  493 493 PHE PHE A . n 
A 1 98  GLN 98  494 494 GLN GLN A . n 
A 1 99  THR 99  495 495 THR THR A . n 
A 1 100 GLN 100 496 496 GLN GLN A . n 
A 1 101 GLN 101 497 497 GLN GLN A . n 
A 1 102 LEU 102 498 498 LEU LEU A . n 
A 1 103 LEU 103 499 499 LEU LEU A . n 
A 1 104 GLU 104 500 500 GLU GLU A . n 
A 1 105 MET 105 501 501 MET MET A . n 
A 1 106 CYS 106 502 502 CYS CYS A . n 
A 1 107 LYS 107 503 503 LYS LYS A . n 
A 1 108 ASP 108 504 504 ASP ASP A . n 
A 1 109 VAL 109 505 505 VAL VAL A . n 
A 1 110 CYS 110 506 506 CYS CYS A . n 
A 1 111 GLU 111 507 507 GLU GLU A . n 
A 1 112 ALA 112 508 508 ALA ALA A . n 
A 1 113 MET 113 509 509 MET MET A . n 
A 1 114 GLU 114 510 510 GLU GLU A . n 
A 1 115 TYR 115 511 511 TYR TYR A . n 
A 1 116 LEU 116 512 512 LEU LEU A . n 
A 1 117 GLU 117 513 513 GLU GLU A . n 
A 1 118 SER 118 514 514 SER SER A . n 
A 1 119 LYS 119 515 515 LYS LYS A . n 
A 1 120 GLN 120 516 516 GLN GLN A . n 
A 1 121 PHE 121 517 517 PHE PHE A . n 
A 1 122 LEU 122 518 518 LEU LEU A . n 
A 1 123 HIS 123 519 519 HIS HIS A . n 
A 1 124 ARG 124 520 520 ARG ARG A . n 
A 1 125 ASP 125 521 521 ASP ASP A . n 
A 1 126 LEU 126 522 522 LEU LEU A . n 
A 1 127 ALA 127 523 523 ALA ALA A . n 
A 1 128 ALA 128 524 524 ALA ALA A . n 
A 1 129 ARG 129 525 525 ARG ARG A . n 
A 1 130 ASN 130 526 526 ASN ASN A . n 
A 1 131 CYS 131 527 527 CYS CYS A . n 
A 1 132 LEU 132 528 528 LEU LEU A . n 
A 1 133 VAL 133 529 529 VAL VAL A . n 
A 1 134 ASN 134 530 530 ASN ASN A . n 
A 1 135 ASP 135 531 531 ASP ASP A . n 
A 1 136 GLN 136 532 532 GLN GLN A . n 
A 1 137 GLY 137 533 533 GLY GLY A . n 
A 1 138 VAL 138 534 534 VAL VAL A . n 
A 1 139 VAL 139 535 535 VAL VAL A . n 
A 1 140 LYS 140 536 536 LYS LYS A . n 
A 1 141 VAL 141 537 537 VAL VAL A . n 
A 1 142 SER 142 538 538 SER SER A . n 
A 1 143 ASP 143 539 539 ASP ASP A . n 
A 1 144 PHE 144 540 540 PHE PHE A . n 
A 1 145 GLY 145 541 541 GLY GLY A . n 
A 1 146 LEU 146 542 542 LEU LEU A . n 
A 1 147 SER 147 543 543 SER SER A . n 
A 1 148 ARG 148 544 544 ARG ARG A . n 
A 1 149 TYR 149 545 545 TYR TYR A . n 
A 1 150 VAL 150 546 546 VAL VAL A . n 
A 1 151 LEU 151 547 547 LEU LEU A . n 
A 1 152 ASP 152 548 548 ASP ASP A . n 
A 1 153 ASP 153 549 549 ASP ASP A . n 
A 1 154 GLU 154 550 550 GLU GLU A . n 
A 1 155 TYR 155 551 551 TYR TYR A . n 
A 1 156 THR 156 552 552 THR THR A . n 
A 1 157 SER 157 553 553 SER SER A . n 
A 1 158 SER 158 554 554 SER SER A . n 
A 1 159 VAL 159 555 555 VAL VAL A . n 
A 1 160 GLY 160 556 556 GLY GLY A . n 
A 1 161 SER 161 557 557 SER SER A . n 
A 1 162 LYS 162 558 558 LYS LYS A . n 
A 1 163 PHE 163 559 559 PHE PHE A . n 
A 1 164 PRO 164 560 560 PRO PRO A . n 
A 1 165 VAL 165 561 561 VAL VAL A . n 
A 1 166 ARG 166 562 562 ARG ARG A . n 
A 1 167 TRP 167 563 563 TRP TRP A . n 
A 1 168 SER 168 564 564 SER SER A . n 
A 1 169 PRO 169 565 565 PRO PRO A . n 
A 1 170 PRO 170 566 566 PRO PRO A . n 
A 1 171 GLU 171 567 567 GLU GLU A . n 
A 1 172 VAL 172 568 568 VAL VAL A . n 
A 1 173 LEU 173 569 569 LEU LEU A . n 
A 1 174 MET 174 570 570 MET MET A . n 
A 1 175 TYR 175 571 571 TYR TYR A . n 
A 1 176 SER 176 572 572 SER SER A . n 
A 1 177 LYS 177 573 573 LYS LYS A . n 
A 1 178 PHE 178 574 574 PHE PHE A . n 
A 1 179 SER 179 575 575 SER SER A . n 
A 1 180 SER 180 576 576 SER SER A . n 
A 1 181 LYS 181 577 577 LYS LYS A . n 
A 1 182 SER 182 578 578 SER SER A . n 
A 1 183 ASP 183 579 579 ASP ASP A . n 
A 1 184 ILE 184 580 580 ILE ILE A . n 
A 1 185 TRP 185 581 581 TRP TRP A . n 
A 1 186 ALA 186 582 582 ALA ALA A . n 
A 1 187 PHE 187 583 583 PHE PHE A . n 
A 1 188 GLY 188 584 584 GLY GLY A . n 
A 1 189 VAL 189 585 585 VAL VAL A . n 
A 1 190 LEU 190 586 586 LEU LEU A . n 
A 1 191 MET 191 587 587 MET MET A . n 
A 1 192 TRP 192 588 588 TRP TRP A . n 
A 1 193 GLU 193 589 589 GLU GLU A . n 
A 1 194 ILE 194 590 590 ILE ILE A . n 
A 1 195 TYR 195 591 591 TYR TYR A . n 
A 1 196 SER 196 592 592 SER SER A . n 
A 1 197 LEU 197 593 593 LEU LEU A . n 
A 1 198 GLY 198 594 594 GLY GLY A . n 
A 1 199 LYS 199 595 595 LYS LYS A . n 
A 1 200 MET 200 596 596 MET MET A . n 
A 1 201 PRO 201 597 597 PRO PRO A . n 
A 1 202 TYR 202 598 598 TYR TYR A . n 
A 1 203 GLU 203 599 599 GLU GLU A . n 
A 1 204 ARG 204 600 600 ARG ARG A . n 
A 1 205 PHE 205 601 601 PHE PHE A . n 
A 1 206 THR 206 602 602 THR THR A . n 
A 1 207 ASN 207 603 603 ASN ASN A . n 
A 1 208 SER 208 604 604 SER SER A . n 
A 1 209 GLU 209 605 605 GLU GLU A . n 
A 1 210 THR 210 606 606 THR THR A . n 
A 1 211 ALA 211 607 607 ALA ALA A . n 
A 1 212 GLU 212 608 608 GLU GLU A . n 
A 1 213 HIS 213 609 609 HIS HIS A . n 
A 1 214 ILE 214 610 610 ILE ILE A . n 
A 1 215 ALA 215 611 611 ALA ALA A . n 
A 1 216 GLN 216 612 612 GLN GLN A . n 
A 1 217 GLY 217 613 613 GLY GLY A . n 
A 1 218 LEU 218 614 614 LEU LEU A . n 
A 1 219 ARG 219 615 615 ARG ARG A . n 
A 1 220 LEU 220 616 616 LEU LEU A . n 
A 1 221 TYR 221 617 617 TYR TYR A . n 
A 1 222 ARG 222 618 618 ARG ARG A . n 
A 1 223 PRO 223 619 619 PRO PRO A . n 
A 1 224 HIS 224 620 620 HIS HIS A . n 
A 1 225 LEU 225 621 621 LEU LEU A . n 
A 1 226 ALA 226 622 622 ALA ALA A . n 
A 1 227 SER 227 623 623 SER SER A . n 
A 1 228 GLU 228 624 624 GLU GLU A . n 
A 1 229 LYS 229 625 625 LYS LYS A . n 
A 1 230 VAL 230 626 626 VAL VAL A . n 
A 1 231 TYR 231 627 627 TYR TYR A . n 
A 1 232 THR 232 628 628 THR THR A . n 
A 1 233 ILE 233 629 629 ILE ILE A . n 
A 1 234 MET 234 630 630 MET MET A . n 
A 1 235 TYR 235 631 631 TYR TYR A . n 
A 1 236 SER 236 632 632 SER SER A . n 
A 1 237 CYS 237 633 633 CYS CYS A . n 
A 1 238 TRP 238 634 634 TRP TRP A . n 
A 1 239 HIS 239 635 635 HIS HIS A . n 
A 1 240 GLU 240 636 636 GLU GLU A . n 
A 1 241 LYS 241 637 637 LYS LYS A . n 
A 1 242 ALA 242 638 638 ALA ALA A . n 
A 1 243 ASP 243 639 639 ASP ASP A . n 
A 1 244 GLU 244 640 640 GLU GLU A . n 
A 1 245 ARG 245 641 641 ARG ARG A . n 
A 1 246 PRO 246 642 642 PRO PRO A . n 
A 1 247 THR 247 643 643 THR THR A . n 
A 1 248 PHE 248 644 644 PHE PHE A . n 
A 1 249 LYS 249 645 645 LYS ALA A . n 
A 1 250 ILE 250 646 646 ILE ILE A . n 
A 1 251 LEU 251 647 647 LEU LEU A . n 
A 1 252 LEU 252 648 648 LEU LEU A . n 
A 1 253 SER 253 649 649 SER SER A . n 
A 1 254 ASN 254 650 650 ASN ASN A . n 
A 1 255 ILE 255 651 651 ILE ILE A . n 
A 1 256 LEU 256 652 652 LEU LEU A . n 
A 1 257 ASP 257 653 653 ASP ASP A . n 
A 1 258 VAL 258 654 654 VAL VAL A . n 
A 1 259 MET 259 655 ?   ?   ?   A . n 
A 1 260 ASP 260 656 ?   ?   ?   A . n 
A 1 261 GLU 261 657 ?   ?   ?   A . n 
A 1 262 GLU 262 658 ?   ?   ?   A . n 
A 1 263 SER 263 659 ?   ?   ?   A . n 
B 1 1   ILE 1   397 397 ILE ILE B . n 
B 1 2   ASP 2   398 398 ASP ASP B . n 
B 1 3   PRO 3   399 399 PRO PRO B . n 
B 1 4   LYS 4   400 400 LYS LYS B . n 
B 1 5   ASP 5   401 401 ASP ASP B . n 
B 1 6   LEU 6   402 402 LEU LEU B . n 
B 1 7   THR 7   403 403 THR THR B . n 
B 1 8   PHE 8   404 404 PHE PHE B . n 
B 1 9   LEU 9   405 405 LEU LEU B . n 
B 1 10  LYS 10  406 406 LYS LYS B . n 
B 1 11  GLU 11  407 407 GLU GLU B . n 
B 1 12  LEU 12  408 408 LEU LEU B . n 
B 1 13  GLY 13  409 409 GLY GLY B . n 
B 1 14  THR 14  410 410 THR THR B . n 
B 1 15  GLY 15  411 411 GLY GLY B . n 
B 1 16  GLN 16  412 412 GLN GLN B . n 
B 1 17  PHE 17  413 413 PHE PHE B . n 
B 1 18  GLY 18  414 414 GLY GLY B . n 
B 1 19  VAL 19  415 415 VAL VAL B . n 
B 1 20  VAL 20  416 416 VAL VAL B . n 
B 1 21  LYS 21  417 417 LYS LYS B . n 
B 1 22  TYR 22  418 418 TYR ALA B . n 
B 1 23  GLY 23  419 419 GLY GLY B . n 
B 1 24  LYS 24  420 420 LYS ALA B . n 
B 1 25  TRP 25  421 421 TRP TRP B . n 
B 1 26  ARG 26  422 422 ARG ARG B . n 
B 1 27  GLY 27  423 423 GLY GLY B . n 
B 1 28  GLN 28  424 424 GLN ALA B . n 
B 1 29  TYR 29  425 425 TYR ALA B . n 
B 1 30  ASP 30  426 426 ASP ASP B . n 
B 1 31  VAL 31  427 427 VAL VAL B . n 
B 1 32  ALA 32  428 428 ALA ALA B . n 
B 1 33  ILE 33  429 429 ILE ILE B . n 
B 1 34  LYS 34  430 430 LYS LYS B . n 
B 1 35  MET 35  431 431 MET MET B . n 
B 1 36  ILE 36  432 432 ILE ILE B . n 
B 1 37  LYS 37  433 433 LYS LYS B . n 
B 1 38  GLU 38  434 434 GLU GLU B . n 
B 1 39  GLY 39  435 435 GLY GLY B . n 
B 1 40  SER 40  436 436 SER SER B . n 
B 1 41  MET 41  437 437 MET MET B . n 
B 1 42  SER 42  438 438 SER SER B . n 
B 1 43  GLU 43  439 439 GLU GLU B . n 
B 1 44  ASP 44  440 440 ASP ASP B . n 
B 1 45  GLU 45  441 441 GLU GLU B . n 
B 1 46  PHE 46  442 442 PHE PHE B . n 
B 1 47  ILE 47  443 443 ILE ILE B . n 
B 1 48  GLU 48  444 444 GLU GLU B . n 
B 1 49  GLU 49  445 445 GLU GLU B . n 
B 1 50  ALA 50  446 446 ALA ALA B . n 
B 1 51  LYS 51  447 447 LYS LYS B . n 
B 1 52  VAL 52  448 448 VAL VAL B . n 
B 1 53  MET 53  449 449 MET MET B . n 
B 1 54  MET 54  450 450 MET MET B . n 
B 1 55  ASN 55  451 451 ASN ASN B . n 
B 1 56  LEU 56  452 452 LEU LEU B . n 
B 1 57  SER 57  453 453 SER SER B . n 
B 1 58  HIS 58  454 454 HIS HIS B . n 
B 1 59  GLU 59  455 455 GLU GLU B . n 
B 1 60  LYS 60  456 456 LYS LYS B . n 
B 1 61  LEU 61  457 457 LEU LEU B . n 
B 1 62  VAL 62  458 458 VAL VAL B . n 
B 1 63  GLN 63  459 459 GLN GLN B . n 
B 1 64  LEU 64  460 460 LEU LEU B . n 
B 1 65  TYR 65  461 461 TYR TYR B . n 
B 1 66  GLY 66  462 462 GLY GLY B . n 
B 1 67  VAL 67  463 463 VAL VAL B . n 
B 1 68  CYS 68  464 464 CYS CYS B . n 
B 1 69  THR 69  465 465 THR THR B . n 
B 1 70  LYS 70  466 466 LYS LYS B . n 
B 1 71  GLN 71  467 467 GLN GLN B . n 
B 1 72  ARG 72  468 468 ARG ARG B . n 
B 1 73  PRO 73  469 469 PRO PRO B . n 
B 1 74  ILE 74  470 470 ILE ILE B . n 
B 1 75  PHE 75  471 471 PHE PHE B . n 
B 1 76  ILE 76  472 472 ILE ILE B . n 
B 1 77  ILE 77  473 473 ILE ILE B . n 
B 1 78  THR 78  474 474 THR THR B . n 
B 1 79  GLU 79  475 475 GLU GLU B . n 
B 1 80  TYR 80  476 476 TYR TYR B . n 
B 1 81  MET 81  477 477 MET MET B . n 
B 1 82  ALA 82  478 478 ALA ALA B . n 
B 1 83  ASN 83  479 479 ASN ASN B . n 
B 1 84  GLY 84  480 480 GLY GLY B . n 
B 1 85  CYS 85  481 481 CYS CYS B . n 
B 1 86  LEU 86  482 482 LEU LEU B . n 
B 1 87  LEU 87  483 483 LEU LEU B . n 
B 1 88  ASN 88  484 484 ASN ASN B . n 
B 1 89  TYR 89  485 485 TYR TYR B . n 
B 1 90  LEU 90  486 486 LEU LEU B . n 
B 1 91  ARG 91  487 487 ARG ARG B . n 
B 1 92  GLU 92  488 488 GLU GLU B . n 
B 1 93  MET 93  489 489 MET MET B . n 
B 1 94  ARG 94  490 490 ARG ARG B . n 
B 1 95  HIS 95  491 491 HIS HIS B . n 
B 1 96  ARG 96  492 492 ARG ARG B . n 
B 1 97  PHE 97  493 493 PHE PHE B . n 
B 1 98  GLN 98  494 494 GLN GLN B . n 
B 1 99  THR 99  495 495 THR THR B . n 
B 1 100 GLN 100 496 496 GLN GLN B . n 
B 1 101 GLN 101 497 497 GLN GLN B . n 
B 1 102 LEU 102 498 498 LEU LEU B . n 
B 1 103 LEU 103 499 499 LEU LEU B . n 
B 1 104 GLU 104 500 500 GLU GLU B . n 
B 1 105 MET 105 501 501 MET MET B . n 
B 1 106 CYS 106 502 502 CYS CYS B . n 
B 1 107 LYS 107 503 503 LYS LYS B . n 
B 1 108 ASP 108 504 504 ASP ASP B . n 
B 1 109 VAL 109 505 505 VAL VAL B . n 
B 1 110 CYS 110 506 506 CYS CYS B . n 
B 1 111 GLU 111 507 507 GLU GLU B . n 
B 1 112 ALA 112 508 508 ALA ALA B . n 
B 1 113 MET 113 509 509 MET MET B . n 
B 1 114 GLU 114 510 510 GLU GLU B . n 
B 1 115 TYR 115 511 511 TYR TYR B . n 
B 1 116 LEU 116 512 512 LEU LEU B . n 
B 1 117 GLU 117 513 513 GLU GLU B . n 
B 1 118 SER 118 514 514 SER SER B . n 
B 1 119 LYS 119 515 515 LYS LYS B . n 
B 1 120 GLN 120 516 516 GLN GLN B . n 
B 1 121 PHE 121 517 517 PHE PHE B . n 
B 1 122 LEU 122 518 518 LEU LEU B . n 
B 1 123 HIS 123 519 519 HIS HIS B . n 
B 1 124 ARG 124 520 520 ARG ARG B . n 
B 1 125 ASP 125 521 521 ASP ASP B . n 
B 1 126 LEU 126 522 522 LEU LEU B . n 
B 1 127 ALA 127 523 523 ALA ALA B . n 
B 1 128 ALA 128 524 524 ALA ALA B . n 
B 1 129 ARG 129 525 525 ARG ARG B . n 
B 1 130 ASN 130 526 526 ASN ASN B . n 
B 1 131 CYS 131 527 527 CYS CYS B . n 
B 1 132 LEU 132 528 528 LEU LEU B . n 
B 1 133 VAL 133 529 529 VAL VAL B . n 
B 1 134 ASN 134 530 530 ASN ASN B . n 
B 1 135 ASP 135 531 531 ASP ASP B . n 
B 1 136 GLN 136 532 532 GLN GLN B . n 
B 1 137 GLY 137 533 533 GLY GLY B . n 
B 1 138 VAL 138 534 534 VAL VAL B . n 
B 1 139 VAL 139 535 535 VAL VAL B . n 
B 1 140 LYS 140 536 536 LYS LYS B . n 
B 1 141 VAL 141 537 537 VAL VAL B . n 
B 1 142 SER 142 538 538 SER SER B . n 
B 1 143 ASP 143 539 539 ASP ASP B . n 
B 1 144 PHE 144 540 540 PHE PHE B . n 
B 1 145 GLY 145 541 541 GLY GLY B . n 
B 1 146 LEU 146 542 542 LEU LEU B . n 
B 1 147 SER 147 543 543 SER SER B . n 
B 1 148 ARG 148 544 544 ARG ARG B . n 
B 1 149 TYR 149 545 545 TYR TYR B . n 
B 1 150 VAL 150 546 546 VAL VAL B . n 
B 1 151 LEU 151 547 547 LEU LEU B . n 
B 1 152 ASP 152 548 548 ASP ASP B . n 
B 1 153 ASP 153 549 549 ASP ASP B . n 
B 1 154 GLU 154 550 550 GLU GLU B . n 
B 1 155 TYR 155 551 551 TYR TYR B . n 
B 1 156 THR 156 552 552 THR THR B . n 
B 1 157 SER 157 553 553 SER SER B . n 
B 1 158 SER 158 554 554 SER SER B . n 
B 1 159 VAL 159 555 555 VAL VAL B . n 
B 1 160 GLY 160 556 556 GLY GLY B . n 
B 1 161 SER 161 557 557 SER SER B . n 
B 1 162 LYS 162 558 558 LYS LYS B . n 
B 1 163 PHE 163 559 559 PHE PHE B . n 
B 1 164 PRO 164 560 560 PRO PRO B . n 
B 1 165 VAL 165 561 561 VAL VAL B . n 
B 1 166 ARG 166 562 562 ARG ARG B . n 
B 1 167 TRP 167 563 563 TRP TRP B . n 
B 1 168 SER 168 564 564 SER SER B . n 
B 1 169 PRO 169 565 565 PRO PRO B . n 
B 1 170 PRO 170 566 566 PRO PRO B . n 
B 1 171 GLU 171 567 567 GLU GLU B . n 
B 1 172 VAL 172 568 568 VAL VAL B . n 
B 1 173 LEU 173 569 569 LEU LEU B . n 
B 1 174 MET 174 570 570 MET MET B . n 
B 1 175 TYR 175 571 571 TYR TYR B . n 
B 1 176 SER 176 572 572 SER SER B . n 
B 1 177 LYS 177 573 573 LYS LYS B . n 
B 1 178 PHE 178 574 574 PHE PHE B . n 
B 1 179 SER 179 575 575 SER SER B . n 
B 1 180 SER 180 576 576 SER SER B . n 
B 1 181 LYS 181 577 577 LYS LYS B . n 
B 1 182 SER 182 578 578 SER SER B . n 
B 1 183 ASP 183 579 579 ASP ASP B . n 
B 1 184 ILE 184 580 580 ILE ILE B . n 
B 1 185 TRP 185 581 581 TRP TRP B . n 
B 1 186 ALA 186 582 582 ALA ALA B . n 
B 1 187 PHE 187 583 583 PHE PHE B . n 
B 1 188 GLY 188 584 584 GLY GLY B . n 
B 1 189 VAL 189 585 585 VAL VAL B . n 
B 1 190 LEU 190 586 586 LEU LEU B . n 
B 1 191 MET 191 587 587 MET MET B . n 
B 1 192 TRP 192 588 588 TRP TRP B . n 
B 1 193 GLU 193 589 589 GLU GLU B . n 
B 1 194 ILE 194 590 590 ILE ILE B . n 
B 1 195 TYR 195 591 591 TYR TYR B . n 
B 1 196 SER 196 592 592 SER SER B . n 
B 1 197 LEU 197 593 593 LEU LEU B . n 
B 1 198 GLY 198 594 594 GLY GLY B . n 
B 1 199 LYS 199 595 595 LYS LYS B . n 
B 1 200 MET 200 596 596 MET MET B . n 
B 1 201 PRO 201 597 597 PRO PRO B . n 
B 1 202 TYR 202 598 598 TYR TYR B . n 
B 1 203 GLU 203 599 599 GLU GLU B . n 
B 1 204 ARG 204 600 600 ARG ARG B . n 
B 1 205 PHE 205 601 601 PHE PHE B . n 
B 1 206 THR 206 602 602 THR THR B . n 
B 1 207 ASN 207 603 603 ASN ASN B . n 
B 1 208 SER 208 604 604 SER SER B . n 
B 1 209 GLU 209 605 605 GLU GLU B . n 
B 1 210 THR 210 606 606 THR THR B . n 
B 1 211 ALA 211 607 607 ALA ALA B . n 
B 1 212 GLU 212 608 608 GLU GLU B . n 
B 1 213 HIS 213 609 609 HIS HIS B . n 
B 1 214 ILE 214 610 610 ILE ILE B . n 
B 1 215 ALA 215 611 611 ALA ALA B . n 
B 1 216 GLN 216 612 612 GLN GLN B . n 
B 1 217 GLY 217 613 613 GLY GLY B . n 
B 1 218 LEU 218 614 614 LEU LEU B . n 
B 1 219 ARG 219 615 615 ARG ARG B . n 
B 1 220 LEU 220 616 616 LEU LEU B . n 
B 1 221 TYR 221 617 617 TYR TYR B . n 
B 1 222 ARG 222 618 618 ARG ARG B . n 
B 1 223 PRO 223 619 619 PRO PRO B . n 
B 1 224 HIS 224 620 620 HIS HIS B . n 
B 1 225 LEU 225 621 621 LEU LEU B . n 
B 1 226 ALA 226 622 622 ALA ALA B . n 
B 1 227 SER 227 623 623 SER SER B . n 
B 1 228 GLU 228 624 624 GLU GLU B . n 
B 1 229 LYS 229 625 625 LYS LYS B . n 
B 1 230 VAL 230 626 626 VAL VAL B . n 
B 1 231 TYR 231 627 627 TYR TYR B . n 
B 1 232 THR 232 628 628 THR THR B . n 
B 1 233 ILE 233 629 629 ILE ILE B . n 
B 1 234 MET 234 630 630 MET MET B . n 
B 1 235 TYR 235 631 631 TYR TYR B . n 
B 1 236 SER 236 632 632 SER SER B . n 
B 1 237 CYS 237 633 633 CYS CYS B . n 
B 1 238 TRP 238 634 634 TRP TRP B . n 
B 1 239 HIS 239 635 635 HIS HIS B . n 
B 1 240 GLU 240 636 636 GLU GLU B . n 
B 1 241 LYS 241 637 637 LYS LYS B . n 
B 1 242 ALA 242 638 638 ALA ALA B . n 
B 1 243 ASP 243 639 639 ASP ASP B . n 
B 1 244 GLU 244 640 640 GLU GLU B . n 
B 1 245 ARG 245 641 641 ARG ARG B . n 
B 1 246 PRO 246 642 642 PRO PRO B . n 
B 1 247 THR 247 643 643 THR THR B . n 
B 1 248 PHE 248 644 644 PHE PHE B . n 
B 1 249 LYS 249 645 645 LYS LYS B . n 
B 1 250 ILE 250 646 646 ILE ILE B . n 
B 1 251 LEU 251 647 647 LEU LEU B . n 
B 1 252 LEU 252 648 648 LEU LEU B . n 
B 1 253 SER 253 649 649 SER SER B . n 
B 1 254 ASN 254 650 650 ASN ASN B . n 
B 1 255 ILE 255 651 651 ILE ILE B . n 
B 1 256 LEU 256 652 652 LEU LEU B . n 
B 1 257 ASP 257 653 653 ASP ASP B . n 
B 1 258 VAL 258 654 654 VAL VAL B . n 
B 1 259 MET 259 655 ?   ?   ?   B . n 
B 1 260 ASP 260 656 ?   ?   ?   B . n 
B 1 261 GLU 261 657 ?   ?   ?   B . n 
B 1 262 GLU 262 658 ?   ?   ?   B . n 
B 1 263 SER 263 659 ?   ?   ?   B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-06-26 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MLPHARE   phasing          .   ? 1 
X-PLOR    refinement       3.1 ? 2 
DENZO     'data reduction' .   ? 3 
SCALEPACK 'data scaling'   .   ? 4 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 OG1 A THR 628 ? ? 1_555 OE2 B GLU 624 ? ? 3_655 1.52 
2 1 CA  A HIS 620 ? ? 1_555 OH  B TYR 631 ? ? 3_655 2.16 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LYS A 400 ? ? -59.96  81.79   
2  1 ASP A 401 ? ? -108.64 50.67   
3  1 THR A 403 ? ? -105.68 -117.28 
4  1 PHE A 404 ? ? -177.05 149.97  
5  1 LEU A 405 ? ? -148.65 -102.01 
6  1 GLU A 407 ? ? -45.25  157.14  
7  1 GLN A 412 ? ? -59.11  -6.77   
8  1 LYS A 433 ? ? 115.21  -171.74 
9  1 SER A 436 ? ? -14.76  -64.19  
10 1 LYS A 466 ? ? -61.55  79.31   
11 1 GLN A 467 ? ? 49.38   -72.70  
12 1 PRO A 469 ? ? -10.95  117.69  
13 1 GLU A 488 ? ? -64.41  -160.16 
14 1 HIS A 491 ? ? -38.72  -36.53  
15 1 PHE A 493 ? ? -95.05  -140.63 
16 1 GLN A 494 ? ? -178.80 149.01  
17 1 ASP A 521 ? ? -151.03 68.09   
18 1 VAL A 555 ? ? 58.41   152.53  
19 1 SER A 557 ? ? 67.22   -66.93  
20 1 TYR A 571 ? ? -159.46 37.34   
21 1 SER A 575 ? ? -161.58 -160.38 
22 1 ARG A 615 ? ? -126.13 -164.01 
23 1 GLU A 636 ? ? 90.43   -67.48  
24 1 ASP A 653 ? ? -68.13  99.17   
25 1 PRO B 399 ? ? -61.85  96.27   
26 1 LYS B 400 ? ? -29.14  -18.64  
27 1 LEU B 405 ? ? -113.53 -85.09  
28 1 LYS B 406 ? ? -114.30 -155.80 
29 1 PHE B 413 ? ? -109.78 -86.23  
30 1 GLN B 424 ? ? -148.00 -27.19  
31 1 ILE B 432 ? ? -109.89 -129.21 
32 1 SER B 436 ? ? -158.21 -76.90  
33 1 HIS B 454 ? ? -174.00 135.34  
34 1 ARG B 468 ? ? 151.89  -176.21 
35 1 GLU B 488 ? ? -39.51  132.85  
36 1 MET B 489 ? ? -30.72  -79.61  
37 1 HIS B 491 ? ? -68.55  54.84   
38 1 ARG B 520 ? ? 73.87   -41.31  
39 1 TYR B 545 ? ? -111.77 -145.39 
40 1 LEU B 547 ? ? -151.14 -127.15 
41 1 ASP B 549 ? ? -150.41 -17.45  
42 1 GLU B 550 ? ? -173.96 -158.98 
43 1 TYR B 551 ? ? -169.07 -162.20 
44 1 THR B 552 ? ? -137.45 -55.35  
45 1 SER B 553 ? ? 60.22   -145.81 
46 1 SER B 554 ? ? -60.15  96.99   
47 1 SER B 557 ? ? 179.01  -178.07 
48 1 VAL B 561 ? ? 73.96   -61.99  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A TYR 418 ? CG  ? A TYR 22  CG  
2  1 Y 1 A TYR 418 ? CD1 ? A TYR 22  CD1 
3  1 Y 1 A TYR 418 ? CD2 ? A TYR 22  CD2 
4  1 Y 1 A TYR 418 ? CE1 ? A TYR 22  CE1 
5  1 Y 1 A TYR 418 ? CE2 ? A TYR 22  CE2 
6  1 Y 1 A TYR 418 ? CZ  ? A TYR 22  CZ  
7  1 Y 1 A TYR 418 ? OH  ? A TYR 22  OH  
8  1 Y 1 A LYS 420 ? CG  ? A LYS 24  CG  
9  1 Y 1 A LYS 420 ? CD  ? A LYS 24  CD  
10 1 Y 1 A LYS 420 ? CE  ? A LYS 24  CE  
11 1 Y 1 A LYS 420 ? NZ  ? A LYS 24  NZ  
12 1 Y 1 A GLN 424 ? CG  ? A GLN 28  CG  
13 1 Y 1 A GLN 424 ? CD  ? A GLN 28  CD  
14 1 Y 1 A GLN 424 ? OE1 ? A GLN 28  OE1 
15 1 Y 1 A GLN 424 ? NE2 ? A GLN 28  NE2 
16 1 Y 1 A TYR 425 ? CG  ? A TYR 29  CG  
17 1 Y 1 A TYR 425 ? CD1 ? A TYR 29  CD1 
18 1 Y 1 A TYR 425 ? CD2 ? A TYR 29  CD2 
19 1 Y 1 A TYR 425 ? CE1 ? A TYR 29  CE1 
20 1 Y 1 A TYR 425 ? CE2 ? A TYR 29  CE2 
21 1 Y 1 A TYR 425 ? CZ  ? A TYR 29  CZ  
22 1 Y 1 A TYR 425 ? OH  ? A TYR 29  OH  
23 1 Y 1 A LYS 645 ? CG  ? A LYS 249 CG  
24 1 Y 1 A LYS 645 ? CD  ? A LYS 249 CD  
25 1 Y 1 A LYS 645 ? CE  ? A LYS 249 CE  
26 1 Y 1 A LYS 645 ? NZ  ? A LYS 249 NZ  
27 1 Y 1 B TYR 418 ? CG  ? B TYR 22  CG  
28 1 Y 1 B TYR 418 ? CD1 ? B TYR 22  CD1 
29 1 Y 1 B TYR 418 ? CD2 ? B TYR 22  CD2 
30 1 Y 1 B TYR 418 ? CE1 ? B TYR 22  CE1 
31 1 Y 1 B TYR 418 ? CE2 ? B TYR 22  CE2 
32 1 Y 1 B TYR 418 ? CZ  ? B TYR 22  CZ  
33 1 Y 1 B TYR 418 ? OH  ? B TYR 22  OH  
34 1 Y 1 B LYS 420 ? CG  ? B LYS 24  CG  
35 1 Y 1 B LYS 420 ? CD  ? B LYS 24  CD  
36 1 Y 1 B LYS 420 ? CE  ? B LYS 24  CE  
37 1 Y 1 B LYS 420 ? NZ  ? B LYS 24  NZ  
38 1 Y 1 B GLN 424 ? CG  ? B GLN 28  CG  
39 1 Y 1 B GLN 424 ? CD  ? B GLN 28  CD  
40 1 Y 1 B GLN 424 ? OE1 ? B GLN 28  OE1 
41 1 Y 1 B GLN 424 ? NE2 ? B GLN 28  NE2 
42 1 Y 1 B TYR 425 ? CG  ? B TYR 29  CG  
43 1 Y 1 B TYR 425 ? CD1 ? B TYR 29  CD1 
44 1 Y 1 B TYR 425 ? CD2 ? B TYR 29  CD2 
45 1 Y 1 B TYR 425 ? CE1 ? B TYR 29  CE1 
46 1 Y 1 B TYR 425 ? CE2 ? B TYR 29  CE2 
47 1 Y 1 B TYR 425 ? CZ  ? B TYR 29  CZ  
48 1 Y 1 B TYR 425 ? OH  ? B TYR 29  OH  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 655 ? A MET 259 
2  1 Y 1 A ASP 656 ? A ASP 260 
3  1 Y 1 A GLU 657 ? A GLU 261 
4  1 Y 1 A GLU 658 ? A GLU 262 
5  1 Y 1 A SER 659 ? A SER 263 
6  1 Y 1 B MET 655 ? B MET 259 
7  1 Y 1 B ASP 656 ? B ASP 260 
8  1 Y 1 B GLU 657 ? B GLU 261 
9  1 Y 1 B GLU 658 ? B GLU 262 
10 1 Y 1 B SER 659 ? B SER 263 
#