data_1K34
# 
_entry.id   1K34 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.351 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1K34         pdb_00001k34 10.2210/pdb1k34/pdb 
RCSB  RCSB014500   ?            ?                   
WWPDB D_1000014500 ?            ?                   
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1K34 
_pdbx_database_related.details        'TRANSMEMBRANE GLYCOPROTEIN GP41 I642A mutation' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1K34 
_pdbx_database_status.recvd_initial_deposition_date   2001-10-01 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Shu, W.' 1 
'Lu, M.'  2 
# 
_citation.id                        primary 
_citation.title                     
'Interhelical interactions in the gp41 core: implications for activation of HIV-1 membrane fusion.' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            41 
_citation.page_first                7283 
_citation.page_last                 7292 
_citation.year                      2002 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12044159 
_citation.pdbx_database_id_DOI      10.1021/bi025648y 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Wang, S.'      1 ? 
primary 'York, J.'      2 ? 
primary 'Shu, W.'       3 ? 
primary 'Stoller, M.O.' 4 ? 
primary 'Nunberg, J.H.' 5 ? 
primary 'Lu, M.'        6 ? 
# 
_cell.entry_id           1K34 
_cell.length_a           52.214 
_cell.length_b           52.214 
_cell.length_c           60.904 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              9 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1K34 
_symmetry.space_group_name_H-M             'H 3' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                146 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Transmembrane glycoprotein GP41' 7837.673 1  ? I55A 'gp41 ectodomain core' 
'RESIDUES 1 - 34 AND 41 - 68 CONNECTED BY A SIX-RESIDUE LINKER (SER-GLY-GLY-ARG-GLY-GLY)' 
2 water   nat water                             18.015   74 ? ?    ?                      ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       SGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARSGGRGGWMEWDREINNYTSLAHSLIEESQNQQEK 
_entity_poly.pdbx_seq_one_letter_code_can   SGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARSGGRGGWMEWDREINNYTSLAHSLIEESQNQQEK 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  SER n 
1 2  GLY n 
1 3  ILE n 
1 4  VAL n 
1 5  GLN n 
1 6  GLN n 
1 7  GLN n 
1 8  ASN n 
1 9  ASN n 
1 10 LEU n 
1 11 LEU n 
1 12 ARG n 
1 13 ALA n 
1 14 ILE n 
1 15 GLU n 
1 16 ALA n 
1 17 GLN n 
1 18 GLN n 
1 19 HIS n 
1 20 LEU n 
1 21 LEU n 
1 22 GLN n 
1 23 LEU n 
1 24 THR n 
1 25 VAL n 
1 26 TRP n 
1 27 GLY n 
1 28 ILE n 
1 29 LYS n 
1 30 GLN n 
1 31 LEU n 
1 32 GLN n 
1 33 ALA n 
1 34 ARG n 
1 35 SER n 
1 36 GLY n 
1 37 GLY n 
1 38 ARG n 
1 39 GLY n 
1 40 GLY n 
1 41 TRP n 
1 42 MET n 
1 43 GLU n 
1 44 TRP n 
1 45 ASP n 
1 46 ARG n 
1 47 GLU n 
1 48 ILE n 
1 49 ASN n 
1 50 ASN n 
1 51 TYR n 
1 52 THR n 
1 53 SER n 
1 54 LEU n 
1 55 ALA n 
1 56 HIS n 
1 57 SER n 
1 58 LEU n 
1 59 ILE n 
1 60 GLU n 
1 61 GLU n 
1 62 SER n 
1 63 GLN n 
1 64 ASN n 
1 65 GLN n 
1 66 GLN n 
1 67 GLU n 
1 68 LYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? 1  34 ? Lentivirus ? ? ? ? ? ? ? 'Human immunodeficiency virus 1' 11676 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
1 2 sample ? 41 68 ? Lentivirus ? ? ? ? ? ? ? 'Human immunodeficiency virus 1' 11676 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ENV_HV1H2 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P04578 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1K34 A 1  ? 34 ? P04578 546 ? 579 ? 1  34 
2 1 1K34 A 41 ? 68 ? P04578 628 ? 655 ? 41 68 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1K34 SER A 35 ? UNP P04578 ?   ?   'SEE REMARK 999'      35 1 
1 1K34 GLY A 36 ? UNP P04578 ?   ?   'SEE REMARK 999'      36 2 
1 1K34 GLY A 37 ? UNP P04578 ?   ?   'SEE REMARK 999'      37 3 
1 1K34 ARG A 38 ? UNP P04578 ?   ?   'SEE REMARK 999'      38 4 
1 1K34 GLY A 39 ? UNP P04578 ?   ?   'SEE REMARK 999'      39 5 
1 1K34 GLY A 40 ? UNP P04578 ?   ?   'SEE REMARK 999'      40 6 
1 1K34 ALA A 55 ? UNP P04578 ILE 642 'engineered mutation' 55 7 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1K34 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.04 
_exptl_crystal.density_percent_sol   39.66 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_details    'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           95 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   2001-05-27 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Ni MIRROR + Ni FILTER' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     1K34 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            1.88 
_reflns.number_obs                   4977 
_reflns.number_all                   4977 
_reflns.percent_possible_obs         100 
_reflns.pdbx_Rmerge_I_obs            0.039 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        28.3 
_reflns.pdbx_redundancy              20.3 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.88 
_reflns_shell.d_res_low              1.95 
_reflns_shell.percent_possible_all   100 
_reflns_shell.Rmerge_I_obs           0.2 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        11.0 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1K34 
_refine.ls_number_reflns_obs                     4977 
_refine.ls_number_reflns_all                     4977 
_refine.pdbx_ls_sigma_I                          0.0 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               513688.56 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.ls_d_res_low                             26.11 
_refine.ls_d_res_high                            1.88 
_refine.ls_percent_reflns_obs                    98.7 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.197 
_refine.ls_R_factor_R_free                       0.216 
_refine.ls_R_factor_R_free_error                 0.010 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.4 
_refine.ls_number_reflns_R_free                  516 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               31.1 
_refine.aniso_B[1][1]                            -0.98 
_refine.aniso_B[2][2]                            -0.98 
_refine.aniso_B[3][3]                            1.95 
_refine.aniso_B[1][2]                            0.69 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.452328 
_refine.solvent_model_param_bsol                 102.662 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1K34 
_refine_analyze.Luzzati_coordinate_error_obs    0.20 
_refine_analyze.Luzzati_sigma_a_obs             0.13 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.24 
_refine_analyze.Luzzati_sigma_a_free            0.12 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        481 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             74 
_refine_hist.number_atoms_total               555 
_refine_hist.d_res_high                       1.88 
_refine_hist.d_res_low                        26.11 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.005 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             0.8   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      14.2  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.61  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.46  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            2.26  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             2.42  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            3.77  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       1.88 
_refine_ls_shell.d_res_low                        2.00 
_refine_ls_shell.number_reflns_R_work             718 
_refine_ls_shell.R_factor_R_work                  0.248 
_refine_ls_shell.percent_reflns_obs               94.9 
_refine_ls_shell.R_factor_R_free                  0.265 
_refine_ls_shell.R_factor_R_free_error            0.029 
_refine_ls_shell.percent_reflns_R_free            10.3 
_refine_ls_shell.number_reflns_R_free             82 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 WATER_REP.PARAM   WATER.TOP   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1K34 
_struct.title                     'Crystal structure analysis of gp41 core mutant' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1K34 
_struct_keywords.pdbx_keywords   'VIRAL PROTEIN' 
_struct_keywords.text            'gp41, six-helix bundle, trimer-of-hairpins, membrane fusion, Viral protein' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLY A 2  ? GLN A 32 ? GLY A 2  GLN A 32 1 ? 31 
HELX_P HELX_P2 2 TRP A 41 ? GLN A 66 ? TRP A 41 GLN A 66 1 ? 26 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_database_PDB_matrix.entry_id          1K34 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1K34 
_atom_sites.fract_transf_matrix[1][1]   0.019152 
_atom_sites.fract_transf_matrix[1][2]   0.011057 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.022115 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.016419 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   N N   . GLY A 1 2  ? 1.446  -8.807  23.586  1.00 50.41 ? 2   GLY A N   1 
ATOM   2   C CA  . GLY A 1 2  ? 0.222  -7.961  23.578  1.00 48.53 ? 2   GLY A CA  1 
ATOM   3   C C   . GLY A 1 2  ? 0.243  -6.933  22.464  1.00 48.20 ? 2   GLY A C   1 
ATOM   4   O O   . GLY A 1 2  ? 0.342  -7.283  21.286  1.00 47.45 ? 2   GLY A O   1 
ATOM   5   N N   . ILE A 1 3  ? 0.154  -5.660  22.837  1.00 46.96 ? 3   ILE A N   1 
ATOM   6   C CA  . ILE A 1 3  ? 0.155  -4.577  21.862  1.00 46.50 ? 3   ILE A CA  1 
ATOM   7   C C   . ILE A 1 3  ? 1.495  -4.494  21.136  1.00 44.58 ? 3   ILE A C   1 
ATOM   8   O O   . ILE A 1 3  ? 1.558  -4.111  19.968  1.00 43.29 ? 3   ILE A O   1 
ATOM   9   C CB  . ILE A 1 3  ? -0.133 -3.214  22.536  1.00 47.29 ? 3   ILE A CB  1 
ATOM   10  C CG1 . ILE A 1 3  ? 1.076  -2.766  23.358  1.00 48.43 ? 3   ILE A CG1 1 
ATOM   11  C CG2 . ILE A 1 3  ? -1.351 -3.331  23.437  1.00 48.53 ? 3   ILE A CG2 1 
ATOM   12  C CD1 . ILE A 1 3  ? 0.900  -1.418  24.022  1.00 49.92 ? 3   ILE A CD1 1 
ATOM   13  N N   . VAL A 1 4  ? 2.566  -4.857  21.835  1.00 42.98 ? 4   VAL A N   1 
ATOM   14  C CA  . VAL A 1 4  ? 3.901  -4.823  21.255  1.00 41.27 ? 4   VAL A CA  1 
ATOM   15  C C   . VAL A 1 4  ? 4.004  -5.803  20.089  1.00 39.91 ? 4   VAL A C   1 
ATOM   16  O O   . VAL A 1 4  ? 4.492  -5.452  19.017  1.00 40.20 ? 4   VAL A O   1 
ATOM   17  C CB  . VAL A 1 4  ? 4.970  -5.163  22.314  1.00 40.85 ? 4   VAL A CB  1 
ATOM   18  C CG1 . VAL A 1 4  ? 6.340  -5.237  21.669  1.00 40.40 ? 4   VAL A CG1 1 
ATOM   19  C CG2 . VAL A 1 4  ? 4.965  -4.104  23.406  1.00 41.38 ? 4   VAL A CG2 1 
ATOM   20  N N   . GLN A 1 5  ? 3.540  -7.031  20.305  1.00 38.76 ? 5   GLN A N   1 
ATOM   21  C CA  . GLN A 1 5  ? 3.569  -8.056  19.267  1.00 38.56 ? 5   GLN A CA  1 
ATOM   22  C C   . GLN A 1 5  ? 2.687  -7.611  18.104  1.00 38.18 ? 5   GLN A C   1 
ATOM   23  O O   . GLN A 1 5  ? 2.993  -7.866  16.939  1.00 38.32 ? 5   GLN A O   1 
ATOM   24  C CB  . GLN A 1 5  ? 3.058  -9.389  19.821  1.00 39.47 ? 5   GLN A CB  1 
ATOM   25  C CG  . GLN A 1 5  ? 3.087  -10.405 18.830  1.00 40.87 ? 5   GLN A CG  1 
ATOM   26  N N   . GLN A 1 6  ? 1.591  -6.937  18.434  1.00 36.87 ? 6   GLN A N   1 
ATOM   27  C CA  . GLN A 1 6  ? 0.664  -6.447  17.428  1.00 35.59 ? 6   GLN A CA  1 
ATOM   28  C C   . GLN A 1 6  ? 1.327  -5.400  16.540  1.00 34.24 ? 6   GLN A C   1 
ATOM   29  O O   . GLN A 1 6  ? 1.200  -5.448  15.317  1.00 33.19 ? 6   GLN A O   1 
ATOM   30  C CB  . GLN A 1 6  ? -0.565 -5.844  18.102  1.00 37.79 ? 6   GLN A CB  1 
ATOM   31  C CG  . GLN A 1 6  ? -1.862 -6.511  17.713  1.00 40.19 ? 6   GLN A CG  1 
ATOM   32  C CD  . GLN A 1 6  ? -2.064 -6.537  16.216  1.00 39.99 ? 6   GLN A CD  1 
ATOM   33  O OE1 . GLN A 1 6  ? -1.436 -7.320  15.507  1.00 38.00 ? 6   GLN A OE1 1 
ATOM   34  N NE2 . GLN A 1 6  ? -2.935 -5.667  15.723  1.00 40.30 ? 6   GLN A NE2 1 
ATOM   35  N N   . GLN A 1 7  ? 2.033  -4.455  17.158  1.00 31.86 ? 7   GLN A N   1 
ATOM   36  C CA  . GLN A 1 7  ? 2.712  -3.407  16.407  1.00 32.03 ? 7   GLN A CA  1 
ATOM   37  C C   . GLN A 1 7  ? 3.778  -4.002  15.500  1.00 29.77 ? 7   GLN A C   1 
ATOM   38  O O   . GLN A 1 7  ? 3.997  -3.513  14.396  1.00 30.39 ? 7   GLN A O   1 
ATOM   39  C CB  . GLN A 1 7  ? 3.351  -2.383  17.349  1.00 33.69 ? 7   GLN A CB  1 
ATOM   40  C CG  . GLN A 1 7  ? 2.351  -1.665  18.230  1.00 38.40 ? 7   GLN A CG  1 
ATOM   41  C CD  . GLN A 1 7  ? 2.936  -0.449  18.902  1.00 38.18 ? 7   GLN A CD  1 
ATOM   42  O OE1 . GLN A 1 7  ? 4.058  -0.482  19.403  1.00 39.88 ? 7   GLN A OE1 1 
ATOM   43  N NE2 . GLN A 1 7  ? 2.171  0.635   18.928  1.00 41.69 ? 7   GLN A NE2 1 
ATOM   44  N N   . ASN A 1 8  ? 4.450  -5.050  15.968  1.00 26.84 ? 8   ASN A N   1 
ATOM   45  C CA  . ASN A 1 8  ? 5.466  -5.701  15.155  1.00 26.94 ? 8   ASN A CA  1 
ATOM   46  C C   . ASN A 1 8  ? 4.775  -6.318  13.940  1.00 25.78 ? 8   ASN A C   1 
ATOM   47  O O   . ASN A 1 8  ? 5.300  -6.263  12.827  1.00 23.85 ? 8   ASN A O   1 
ATOM   48  C CB  . ASN A 1 8  ? 6.196  -6.789  15.961  1.00 30.42 ? 8   ASN A CB  1 
ATOM   49  C CG  . ASN A 1 8  ? 7.115  -6.215  17.036  1.00 33.49 ? 8   ASN A CG  1 
ATOM   50  O OD1 . ASN A 1 8  ? 7.761  -6.962  17.777  1.00 36.91 ? 8   ASN A OD1 1 
ATOM   51  N ND2 . ASN A 1 8  ? 7.177  -4.888  17.127  1.00 33.39 ? 8   ASN A ND2 1 
ATOM   52  N N   . ASN A 1 9  ? 3.597  -6.905  14.164  1.00 22.37 ? 9   ASN A N   1 
ATOM   53  C CA  . ASN A 1 9  ? 2.808  -7.520  13.092  1.00 24.69 ? 9   ASN A CA  1 
ATOM   54  C C   . ASN A 1 9  ? 2.435  -6.458  12.057  1.00 23.58 ? 9   ASN A C   1 
ATOM   55  O O   . ASN A 1 9  ? 2.568  -6.668  10.850  1.00 22.42 ? 9   ASN A O   1 
ATOM   56  C CB  . ASN A 1 9  ? 1.498  -8.106  13.641  1.00 28.43 ? 9   ASN A CB  1 
ATOM   57  C CG  . ASN A 1 9  ? 1.711  -9.267  14.595  1.00 33.21 ? 9   ASN A CG  1 
ATOM   58  O OD1 . ASN A 1 9  ? 0.772  -9.698  15.277  1.00 36.32 ? 9   ASN A OD1 1 
ATOM   59  N ND2 . ASN A 1 9  ? 2.933  -9.787  14.646  1.00 33.42 ? 9   ASN A ND2 1 
ATOM   60  N N   . LEU A 1 10 ? 1.951  -5.321  12.545  1.00 21.53 ? 10  LEU A N   1 
ATOM   61  C CA  . LEU A 1 10 ? 1.538  -4.236  11.672  1.00 21.52 ? 10  LEU A CA  1 
ATOM   62  C C   . LEU A 1 10 ? 2.699  -3.679  10.854  1.00 21.85 ? 10  LEU A C   1 
ATOM   63  O O   . LEU A 1 10 ? 2.539  -3.397  9.667   1.00 20.96 ? 10  LEU A O   1 
ATOM   64  C CB  . LEU A 1 10 ? 0.872  -3.128  12.492  1.00 23.85 ? 10  LEU A CB  1 
ATOM   65  C CG  . LEU A 1 10 ? -0.438 -3.548  13.176  1.00 23.58 ? 10  LEU A CG  1 
ATOM   66  C CD1 . LEU A 1 10 ? -1.062 -2.349  13.851  1.00 26.30 ? 10  LEU A CD1 1 
ATOM   67  C CD2 . LEU A 1 10 ? -1.405 -4.143  12.146  1.00 26.40 ? 10  LEU A CD2 1 
ATOM   68  N N   . LEU A 1 11 ? 3.862  -3.521  11.482  1.00 19.13 ? 11  LEU A N   1 
ATOM   69  C CA  . LEU A 1 11 ? 5.026  -3.013  10.767  1.00 19.35 ? 11  LEU A CA  1 
ATOM   70  C C   . LEU A 1 11 ? 5.438  -3.977  9.660   1.00 18.07 ? 11  LEU A C   1 
ATOM   71  O O   . LEU A 1 11 ? 5.741  -3.550  8.543   1.00 16.23 ? 11  LEU A O   1 
ATOM   72  C CB  . LEU A 1 11 ? 6.203  -2.793  11.720  1.00 19.91 ? 11  LEU A CB  1 
ATOM   73  C CG  . LEU A 1 11 ? 7.521  -2.389  11.041  1.00 21.47 ? 11  LEU A CG  1 
ATOM   74  C CD1 . LEU A 1 11 ? 7.345  -1.087  10.260  1.00 20.88 ? 11  LEU A CD1 1 
ATOM   75  C CD2 . LEU A 1 11 ? 8.597  -2.227  12.107  1.00 22.16 ? 11  LEU A CD2 1 
ATOM   76  N N   . ARG A 1 12 ? 5.457  -5.274  9.964   1.00 16.39 ? 12  ARG A N   1 
ATOM   77  C CA  . ARG A 1 12 ? 5.826  -6.258  8.950   1.00 18.54 ? 12  ARG A CA  1 
ATOM   78  C C   . ARG A 1 12 ? 4.854  -6.239  7.776   1.00 16.57 ? 12  ARG A C   1 
ATOM   79  O O   . ARG A 1 12 ? 5.254  -6.426  6.624   1.00 15.76 ? 12  ARG A O   1 
ATOM   80  C CB  . ARG A 1 12 ? 5.888  -7.665  9.558   1.00 20.76 ? 12  ARG A CB  1 
ATOM   81  C CG  . ARG A 1 12 ? 6.996  -7.815  10.601  1.00 24.29 ? 12  ARG A CG  1 
ATOM   82  C CD  . ARG A 1 12 ? 7.255  -9.268  10.952  1.00 28.28 ? 12  ARG A CD  1 
ATOM   83  N NE  . ARG A 1 12 ? 8.270  -9.395  11.994  1.00 33.20 ? 12  ARG A NE  1 
ATOM   84  C CZ  . ARG A 1 12 ? 8.028  -9.332  13.302  1.00 35.91 ? 12  ARG A CZ  1 
ATOM   85  N NH1 . ARG A 1 12 ? 9.029  -9.452  14.166  1.00 39.72 ? 12  ARG A NH1 1 
ATOM   86  N NH2 . ARG A 1 12 ? 6.795  -9.164  13.749  1.00 35.98 ? 12  ARG A NH2 1 
ATOM   87  N N   . ALA A 1 13 ? 3.575  -6.023  8.064   1.00 17.71 ? 13  ALA A N   1 
ATOM   88  C CA  . ALA A 1 13 ? 2.565  -5.977  7.002   1.00 16.85 ? 13  ALA A CA  1 
ATOM   89  C C   . ALA A 1 13 ? 2.842  -4.765  6.116   1.00 15.76 ? 13  ALA A C   1 
ATOM   90  O O   . ALA A 1 13 ? 2.764  -4.840  4.890   1.00 15.47 ? 13  ALA A O   1 
ATOM   91  C CB  . ALA A 1 13 ? 1.165  -5.888  7.612   1.00 15.35 ? 13  ALA A CB  1 
ATOM   92  N N   . ILE A 1 14 ? 3.186  -3.649  6.746   1.00 15.52 ? 14  ILE A N   1 
ATOM   93  C CA  . ILE A 1 14 ? 3.499  -2.427  6.017   1.00 16.17 ? 14  ILE A CA  1 
ATOM   94  C C   . ILE A 1 14 ? 4.769  -2.613  5.182   1.00 15.34 ? 14  ILE A C   1 
ATOM   95  O O   . ILE A 1 14 ? 4.889  -2.077  4.076   1.00 14.81 ? 14  ILE A O   1 
ATOM   96  C CB  . ILE A 1 14 ? 3.696  -1.249  7.001   1.00 18.55 ? 14  ILE A CB  1 
ATOM   97  C CG1 . ILE A 1 14 ? 2.356  -0.876  7.632   1.00 20.71 ? 14  ILE A CG1 1 
ATOM   98  C CG2 . ILE A 1 14 ? 4.305  -0.054  6.279   1.00 21.07 ? 14  ILE A CG2 1 
ATOM   99  C CD1 . ILE A 1 14 ? 2.483  0.114   8.799   1.00 22.43 ? 14  ILE A CD1 1 
ATOM   100 N N   . GLU A 1 15 ? 5.723  -3.372  5.710   1.00 15.34 ? 15  GLU A N   1 
ATOM   101 C CA  . GLU A 1 15 ? 6.970  -3.620  4.988   1.00 15.43 ? 15  GLU A CA  1 
ATOM   102 C C   . GLU A 1 15 ? 6.705  -4.480  3.743   1.00 16.66 ? 15  GLU A C   1 
ATOM   103 O O   . GLU A 1 15 ? 7.296  -4.263  2.679   1.00 14.74 ? 15  GLU A O   1 
ATOM   104 C CB  . GLU A 1 15 ? 7.974  -4.328  5.907   1.00 18.32 ? 15  GLU A CB  1 
ATOM   105 C CG  . GLU A 1 15 ? 8.336  -3.526  7.146   1.00 24.65 ? 15  GLU A CG  1 
ATOM   106 C CD  . GLU A 1 15 ? 9.303  -4.266  8.063   1.00 29.43 ? 15  GLU A CD  1 
ATOM   107 O OE1 . GLU A 1 15 ? 9.205  -5.511  8.161   1.00 30.28 ? 15  GLU A OE1 1 
ATOM   108 O OE2 . GLU A 1 15 ? 10.148 -3.597  8.694   1.00 30.74 ? 15  GLU A OE2 1 
ATOM   109 N N   . ALA A 1 16 ? 5.818  -5.461  3.882   1.00 14.87 ? 16  ALA A N   1 
ATOM   110 C CA  . ALA A 1 16 ? 5.476  -6.331  2.766   1.00 15.33 ? 16  ALA A CA  1 
ATOM   111 C C   . ALA A 1 16 ? 4.723  -5.527  1.716   1.00 16.90 ? 16  ALA A C   1 
ATOM   112 O O   . ALA A 1 16 ? 4.909  -5.720  0.512   1.00 16.84 ? 16  ALA A O   1 
ATOM   113 C CB  . ALA A 1 16 ? 4.622  -7.480  3.246   1.00 15.96 ? 16  ALA A CB  1 
ATOM   114 N N   . GLN A 1 17 ? 3.859  -4.629  2.169   1.00 15.78 ? 17  GLN A N   1 
ATOM   115 C CA  . GLN A 1 17 ? 3.102  -3.802  1.238   1.00 16.61 ? 17  GLN A CA  1 
ATOM   116 C C   . GLN A 1 17 ? 4.006  -2.780  0.537   1.00 16.83 ? 17  GLN A C   1 
ATOM   117 O O   . GLN A 1 17 ? 3.743  -2.385  -0.603  1.00 16.26 ? 17  GLN A O   1 
ATOM   118 C CB  . GLN A 1 17 ? 1.938  -3.138  1.978   1.00 16.41 ? 17  GLN A CB  1 
ATOM   119 C CG  . GLN A 1 17 ? 0.859  -4.169  2.344   1.00 20.39 ? 17  GLN A CG  1 
ATOM   120 C CD  . GLN A 1 17 ? -0.391 -3.567  2.961   1.00 24.24 ? 17  GLN A CD  1 
ATOM   121 O OE1 . GLN A 1 17 ? -1.489 -4.108  2.813   1.00 28.31 ? 17  GLN A OE1 1 
ATOM   122 N NE2 . GLN A 1 17 ? -0.231 -2.463  3.666   1.00 21.61 ? 17  GLN A NE2 1 
ATOM   123 N N   . GLN A 1 18 ? 5.082  -2.367  1.203   1.00 16.59 ? 18  GLN A N   1 
ATOM   124 C CA  . GLN A 1 18 ? 6.023  -1.419  0.596   1.00 17.10 ? 18  GLN A CA  1 
ATOM   125 C C   . GLN A 1 18 ? 6.699  -2.114  -0.591  1.00 17.12 ? 18  GLN A C   1 
ATOM   126 O O   . GLN A 1 18 ? 6.964  -1.497  -1.625  1.00 15.46 ? 18  GLN A O   1 
ATOM   127 C CB  . GLN A 1 18 ? 7.076  -0.984  1.613   1.00 17.21 ? 18  GLN A CB  1 
ATOM   128 C CG  . GLN A 1 18 ? 8.096  0.009   1.074   1.00 24.25 ? 18  GLN A CG  1 
ATOM   129 C CD  . GLN A 1 18 ? 7.528  1.407   0.841   1.00 28.25 ? 18  GLN A CD  1 
ATOM   130 O OE1 . GLN A 1 18 ? 8.233  2.294   0.357   1.00 34.69 ? 18  GLN A OE1 1 
ATOM   131 N NE2 . GLN A 1 18 ? 6.265  1.608   1.188   1.00 27.40 ? 18  GLN A NE2 1 
ATOM   132 N N   . HIS A 1 19 ? 6.976  -3.405  -0.440  1.00 16.52 ? 19  HIS A N   1 
ATOM   133 C CA  . HIS A 1 19 ? 7.575  -4.170  -1.525  1.00 15.76 ? 19  HIS A CA  1 
ATOM   134 C C   . HIS A 1 19 ? 6.602  -4.270  -2.698  1.00 17.34 ? 19  HIS A C   1 
ATOM   135 O O   . HIS A 1 19 ? 6.998  -4.126  -3.853  1.00 16.81 ? 19  HIS A O   1 
ATOM   136 C CB  . HIS A 1 19 ? 7.960  -5.570  -1.047  1.00 21.39 ? 19  HIS A CB  1 
ATOM   137 C CG  . HIS A 1 19 ? 9.307  -5.628  -0.404  1.00 20.72 ? 19  HIS A CG  1 
ATOM   138 N ND1 . HIS A 1 19 ? 9.480  -5.798  0.952   1.00 23.51 ? 19  HIS A ND1 1 
ATOM   139 C CD2 . HIS A 1 19 ? 10.548 -5.484  -0.927  1.00 23.11 ? 19  HIS A CD2 1 
ATOM   140 C CE1 . HIS A 1 19 ? 10.769 -5.753  1.237   1.00 24.65 ? 19  HIS A CE1 1 
ATOM   141 N NE2 . HIS A 1 19 ? 11.440 -5.563  0.114   1.00 25.86 ? 19  HIS A NE2 1 
ATOM   142 N N   . LEU A 1 20 ? 5.328  -4.525  -2.402  1.00 17.05 ? 20  LEU A N   1 
ATOM   143 C CA  . LEU A 1 20 ? 4.316  -4.617  -3.453  1.00 16.51 ? 20  LEU A CA  1 
ATOM   144 C C   . LEU A 1 20 ? 4.199  -3.290  -4.191  1.00 15.40 ? 20  LEU A C   1 
ATOM   145 O O   . LEU A 1 20 ? 4.054  -3.261  -5.414  1.00 15.13 ? 20  LEU A O   1 
ATOM   146 C CB  . LEU A 1 20 ? 2.954  -4.989  -2.859  1.00 17.23 ? 20  LEU A CB  1 
ATOM   147 C CG  . LEU A 1 20 ? 2.807  -6.427  -2.368  1.00 17.65 ? 20  LEU A CG  1 
ATOM   148 C CD1 . LEU A 1 20 ? 1.466  -6.598  -1.649  1.00 18.38 ? 20  LEU A CD1 1 
ATOM   149 C CD2 . LEU A 1 20 ? 2.893  -7.369  -3.562  1.00 18.00 ? 20  LEU A CD2 1 
ATOM   150 N N   . LEU A 1 21 ? 4.248  -2.194  -3.442  1.00 14.68 ? 21  LEU A N   1 
ATOM   151 C CA  . LEU A 1 21 ? 4.168  -0.863  -4.035  1.00 16.25 ? 21  LEU A CA  1 
ATOM   152 C C   . LEU A 1 21 ? 5.341  -0.650  -4.979  1.00 17.97 ? 21  LEU A C   1 
ATOM   153 O O   . LEU A 1 21 ? 5.165  -0.160  -6.097  1.00 18.23 ? 21  LEU A O   1 
ATOM   154 C CB  . LEU A 1 21 ? 4.161  0.207   -2.937  1.00 15.13 ? 21  LEU A CB  1 
ATOM   155 C CG  . LEU A 1 21 ? 2.780  0.483   -2.342  1.00 16.81 ? 21  LEU A CG  1 
ATOM   156 C CD1 . LEU A 1 21 ? 2.870  1.476   -1.186  1.00 16.25 ? 21  LEU A CD1 1 
ATOM   157 C CD2 . LEU A 1 21 ? 1.889  1.031   -3.449  1.00 18.89 ? 21  LEU A CD2 1 
ATOM   158 N N   . GLN A 1 22 ? 6.536  -1.027  -4.532  1.00 18.06 ? 22  GLN A N   1 
ATOM   159 C CA  . GLN A 1 22 ? 7.732  -0.892  -5.361  1.00 17.69 ? 22  GLN A CA  1 
ATOM   160 C C   . GLN A 1 22 ? 7.563  -1.700  -6.653  1.00 19.45 ? 22  GLN A C   1 
ATOM   161 O O   . GLN A 1 22 ? 7.935  -1.241  -7.739  1.00 20.01 ? 22  GLN A O   1 
ATOM   162 C CB  . GLN A 1 22 ? 8.953  -1.379  -4.593  1.00 23.56 ? 22  GLN A CB  1 
ATOM   163 N N   . LEU A 1 23 ? 7.004  -2.902  -6.536  1.00 15.86 ? 23  LEU A N   1 
ATOM   164 C CA  . LEU A 1 23 ? 6.795  -3.751  -7.700  1.00 16.51 ? 23  LEU A CA  1 
ATOM   165 C C   . LEU A 1 23 ? 5.766  -3.168  -8.671  1.00 17.81 ? 23  LEU A C   1 
ATOM   166 O O   . LEU A 1 23 ? 5.985  -3.192  -9.882  1.00 18.11 ? 23  LEU A O   1 
ATOM   167 C CB  . LEU A 1 23 ? 6.379  -5.164  -7.267  1.00 16.16 ? 23  LEU A CB  1 
ATOM   168 C CG  . LEU A 1 23 ? 7.477  -6.000  -6.587  1.00 16.46 ? 23  LEU A CG  1 
ATOM   169 C CD1 . LEU A 1 23 ? 6.864  -7.245  -5.967  1.00 18.70 ? 23  LEU A CD1 1 
ATOM   170 C CD2 . LEU A 1 23 ? 8.555  -6.380  -7.599  1.00 20.27 ? 23  LEU A CD2 1 
ATOM   171 N N   . THR A 1 24 ? 4.648  -2.649  -8.163  1.00 16.03 ? 24  THR A N   1 
ATOM   172 C CA  . THR A 1 24 ? 3.647  -2.082  -9.064  1.00 15.16 ? 24  THR A CA  1 
ATOM   173 C C   . THR A 1 24 ? 4.190  -0.832  -9.741  1.00 16.63 ? 24  THR A C   1 
ATOM   174 O O   . THR A 1 24 ? 3.896  -0.579  -10.903 1.00 16.53 ? 24  THR A O   1 
ATOM   175 C CB  . THR A 1 24 ? 2.304  -1.760  -8.352  1.00 14.79 ? 24  THR A CB  1 
ATOM   176 O OG1 . THR A 1 24 ? 2.521  -0.846  -7.271  1.00 17.89 ? 24  THR A OG1 1 
ATOM   177 C CG2 . THR A 1 24 ? 1.659  -3.040  -7.825  1.00 15.02 ? 24  THR A CG2 1 
ATOM   178 N N   . VAL A 1 25 ? 4.977  -0.043  -9.012  1.00 17.64 ? 25  VAL A N   1 
ATOM   179 C CA  . VAL A 1 25 ? 5.583  1.151   -9.590  1.00 19.05 ? 25  VAL A CA  1 
ATOM   180 C C   . VAL A 1 25 ? 6.497  0.693   -10.737 1.00 20.26 ? 25  VAL A C   1 
ATOM   181 O O   . VAL A 1 25 ? 6.457  1.232   -11.846 1.00 19.43 ? 25  VAL A O   1 
ATOM   182 C CB  . VAL A 1 25 ? 6.416  1.916   -8.520  1.00 18.81 ? 25  VAL A CB  1 
ATOM   183 C CG1 . VAL A 1 25 ? 7.340  2.926   -9.191  1.00 20.85 ? 25  VAL A CG1 1 
ATOM   184 C CG2 . VAL A 1 25 ? 5.479  2.623   -7.544  1.00 18.25 ? 25  VAL A CG2 1 
ATOM   185 N N   . TRP A 1 26 ? 7.308  -0.324  -10.468 1.00 19.68 ? 26  TRP A N   1 
ATOM   186 C CA  . TRP A 1 26 ? 8.223  -0.848  -11.478 1.00 22.50 ? 26  TRP A CA  1 
ATOM   187 C C   . TRP A 1 26 ? 7.449  -1.326  -12.708 1.00 22.57 ? 26  TRP A C   1 
ATOM   188 O O   . TRP A 1 26 ? 7.847  -1.065  -13.846 1.00 23.41 ? 26  TRP A O   1 
ATOM   189 C CB  . TRP A 1 26 ? 9.032  -2.009  -10.893 1.00 24.87 ? 26  TRP A CB  1 
ATOM   190 C CG  . TRP A 1 26 ? 10.086 -2.506  -11.820 1.00 28.68 ? 26  TRP A CG  1 
ATOM   191 C CD1 . TRP A 1 26 ? 11.304 -1.939  -12.055 1.00 30.54 ? 26  TRP A CD1 1 
ATOM   192 C CD2 . TRP A 1 26 ? 9.985  -3.628  -12.703 1.00 30.91 ? 26  TRP A CD2 1 
ATOM   193 N NE1 . TRP A 1 26 ? 11.970 -2.639  -13.038 1.00 32.67 ? 26  TRP A NE1 1 
ATOM   194 C CE2 . TRP A 1 26 ? 11.181 -3.679  -13.454 1.00 32.25 ? 26  TRP A CE2 1 
ATOM   195 C CE3 . TRP A 1 26 ? 8.997  -4.595  -12.937 1.00 32.43 ? 26  TRP A CE3 1 
ATOM   196 C CZ2 . TRP A 1 26 ? 11.417 -4.663  -14.425 1.00 32.04 ? 26  TRP A CZ2 1 
ATOM   197 C CZ3 . TRP A 1 26 ? 9.231  -5.573  -13.901 1.00 32.34 ? 26  TRP A CZ3 1 
ATOM   198 C CH2 . TRP A 1 26 ? 10.433 -5.596  -14.633 1.00 31.49 ? 26  TRP A CH2 1 
ATOM   199 N N   . GLY A 1 27 ? 6.338  -2.018  -12.474 1.00 22.74 ? 27  GLY A N   1 
ATOM   200 C CA  . GLY A 1 27 ? 5.529  -2.522  -13.572 1.00 23.59 ? 27  GLY A CA  1 
ATOM   201 C C   . GLY A 1 27 ? 4.948  -1.411  -14.430 1.00 24.73 ? 27  GLY A C   1 
ATOM   202 O O   . GLY A 1 27 ? 4.922  -1.501  -15.662 1.00 24.99 ? 27  GLY A O   1 
ATOM   203 N N   . ILE A 1 28 ? 4.471  -0.358  -13.779 1.00 22.09 ? 28  ILE A N   1 
ATOM   204 C CA  . ILE A 1 28 ? 3.904  0.773   -14.500 1.00 22.38 ? 28  ILE A CA  1 
ATOM   205 C C   . ILE A 1 28 ? 4.982  1.439   -15.366 1.00 22.56 ? 28  ILE A C   1 
ATOM   206 O O   . ILE A 1 28 ? 4.725  1.813   -16.513 1.00 22.95 ? 28  ILE A O   1 
ATOM   207 C CB  . ILE A 1 28 ? 3.302  1.796   -13.512 1.00 22.25 ? 28  ILE A CB  1 
ATOM   208 C CG1 . ILE A 1 28 ? 2.059  1.179   -12.856 1.00 22.30 ? 28  ILE A CG1 1 
ATOM   209 C CG2 . ILE A 1 28 ? 2.980  3.106   -14.233 1.00 21.02 ? 28  ILE A CG2 1 
ATOM   210 C CD1 . ILE A 1 28 ? 1.501  1.971   -11.690 1.00 19.62 ? 28  ILE A CD1 1 
ATOM   211 N N   . LYS A 1 29 ? 6.184  1.586   -14.818 1.00 22.70 ? 29  LYS A N   1 
ATOM   212 C CA  . LYS A 1 29 ? 7.273  2.197   -15.575 1.00 26.35 ? 29  LYS A CA  1 
ATOM   213 C C   . LYS A 1 29 ? 7.593  1.369   -16.817 1.00 27.53 ? 29  LYS A C   1 
ATOM   214 O O   . LYS A 1 29 ? 7.917  1.913   -17.873 1.00 28.53 ? 29  LYS A O   1 
ATOM   215 C CB  . LYS A 1 29 ? 8.519  2.350   -14.700 1.00 26.34 ? 29  LYS A CB  1 
ATOM   216 C CG  . LYS A 1 29 ? 8.381  3.443   -13.655 1.00 30.31 ? 29  LYS A CG  1 
ATOM   217 C CD  . LYS A 1 29 ? 9.668  3.645   -12.874 1.00 33.01 ? 29  LYS A CD  1 
ATOM   218 C CE  . LYS A 1 29 ? 9.508  4.762   -11.851 1.00 35.46 ? 29  LYS A CE  1 
ATOM   219 N NZ  . LYS A 1 29 ? 10.748 4.965   -11.056 1.00 37.88 ? 29  LYS A NZ  1 
ATOM   220 N N   . GLN A 1 30 ? 7.487  0.051   -16.695 1.00 28.16 ? 30  GLN A N   1 
ATOM   221 C CA  . GLN A 1 30 ? 7.753  -0.837  -17.824 1.00 30.93 ? 30  GLN A CA  1 
ATOM   222 C C   . GLN A 1 30 ? 6.688  -0.678  -18.912 1.00 31.60 ? 30  GLN A C   1 
ATOM   223 O O   . GLN A 1 30 ? 6.987  -0.744  -20.105 1.00 31.19 ? 30  GLN A O   1 
ATOM   224 C CB  . GLN A 1 30 ? 7.794  -2.292  -17.349 1.00 31.86 ? 30  GLN A CB  1 
ATOM   225 C CG  . GLN A 1 30 ? 9.012  -2.646  -16.504 1.00 35.52 ? 30  GLN A CG  1 
ATOM   226 C CD  . GLN A 1 30 ? 10.267 -2.816  -17.338 1.00 37.80 ? 30  GLN A CD  1 
ATOM   227 O OE1 . GLN A 1 30 ? 10.313 -3.647  -18.250 1.00 42.19 ? 30  GLN A OE1 1 
ATOM   228 N NE2 . GLN A 1 30 ? 11.292 -2.034  -17.032 1.00 38.45 ? 30  GLN A NE2 1 
ATOM   229 N N   . LEU A 1 31 ? 5.445  -0.456  -18.500 1.00 32.20 ? 31  LEU A N   1 
ATOM   230 C CA  . LEU A 1 31 ? 4.350  -0.303  -19.452 1.00 34.51 ? 31  LEU A CA  1 
ATOM   231 C C   . LEU A 1 31 ? 4.357  1.020   -20.216 1.00 37.21 ? 31  LEU A C   1 
ATOM   232 O O   . LEU A 1 31 ? 3.969  1.068   -21.385 1.00 37.11 ? 31  LEU A O   1 
ATOM   233 C CB  . LEU A 1 31 ? 3.006  -0.478  -18.742 1.00 32.84 ? 31  LEU A CB  1 
ATOM   234 C CG  . LEU A 1 31 ? 2.738  -1.868  -18.158 1.00 32.47 ? 31  LEU A CG  1 
ATOM   235 C CD1 . LEU A 1 31 ? 1.430  -1.854  -17.388 1.00 31.25 ? 31  LEU A CD1 1 
ATOM   236 C CD2 . LEU A 1 31 ? 2.703  -2.899  -19.275 1.00 32.41 ? 31  LEU A CD2 1 
ATOM   237 N N   . GLN A 1 32 ? 4.795  2.094   -19.571 1.00 40.17 ? 32  GLN A N   1 
ATOM   238 C CA  . GLN A 1 32 ? 4.823  3.391   -20.236 1.00 44.52 ? 32  GLN A CA  1 
ATOM   239 C C   . GLN A 1 32 ? 5.867  3.432   -21.346 1.00 47.00 ? 32  GLN A C   1 
ATOM   240 O O   . GLN A 1 32 ? 6.313  4.502   -21.758 1.00 47.94 ? 32  GLN A O   1 
ATOM   241 C CB  . GLN A 1 32 ? 5.080  4.499   -19.215 1.00 45.09 ? 32  GLN A CB  1 
ATOM   242 C CG  . GLN A 1 32 ? 6.138  4.172   -18.203 1.00 46.57 ? 32  GLN A CG  1 
ATOM   243 C CD  . GLN A 1 32 ? 6.212  5.202   -17.097 1.00 46.08 ? 32  GLN A CD  1 
ATOM   244 O OE1 . GLN A 1 32 ? 5.221  5.469   -16.413 1.00 46.31 ? 32  GLN A OE1 1 
ATOM   245 N NE2 . GLN A 1 32 ? 7.390  5.787   -16.913 1.00 46.46 ? 32  GLN A NE2 1 
ATOM   246 N N   . ALA A 1 33 ? 6.240  2.251   -21.830 1.00 48.37 ? 33  ALA A N   1 
ATOM   247 C CA  . ALA A 1 33 ? 7.221  2.112   -22.895 1.00 49.78 ? 33  ALA A CA  1 
ATOM   248 C C   . ALA A 1 33 ? 7.210  0.672   -23.398 1.00 50.45 ? 33  ALA A C   1 
ATOM   249 O O   . ALA A 1 33 ? 6.170  0.160   -23.817 1.00 50.65 ? 33  ALA A O   1 
ATOM   250 C CB  . ALA A 1 33 ? 8.608  2.481   -22.381 1.00 50.05 ? 33  ALA A CB  1 
ATOM   251 N N   . GLY A 1 39 ? 9.095  11.404  -20.456 1.00 42.81 ? 39  GLY A N   1 
ATOM   252 C CA  . GLY A 1 39 ? 8.383  12.374  -21.269 1.00 41.77 ? 39  GLY A CA  1 
ATOM   253 C C   . GLY A 1 39 ? 6.942  12.540  -20.826 1.00 40.97 ? 39  GLY A C   1 
ATOM   254 O O   . GLY A 1 39 ? 6.074  11.759  -21.216 1.00 41.88 ? 39  GLY A O   1 
ATOM   255 N N   . GLY A 1 40 ? 6.682  13.558  -20.012 1.00 39.39 ? 40  GLY A N   1 
ATOM   256 C CA  . GLY A 1 40 ? 5.331  13.789  -19.533 1.00 36.77 ? 40  GLY A CA  1 
ATOM   257 C C   . GLY A 1 40 ? 5.065  13.218  -18.147 1.00 35.28 ? 40  GLY A C   1 
ATOM   258 O O   . GLY A 1 40 ? 4.117  13.640  -17.477 1.00 33.45 ? 40  GLY A O   1 
ATOM   259 N N   . TRP A 1 41 ? 5.895  12.260  -17.724 1.00 33.33 ? 41  TRP A N   1 
ATOM   260 C CA  . TRP A 1 41 ? 5.763  11.616  -16.410 1.00 32.47 ? 41  TRP A CA  1 
ATOM   261 C C   . TRP A 1 41 ? 6.735  12.180  -15.374 1.00 32.01 ? 41  TRP A C   1 
ATOM   262 O O   . TRP A 1 41 ? 6.917  11.585  -14.307 1.00 30.28 ? 41  TRP A O   1 
ATOM   263 C CB  . TRP A 1 41 ? 6.035  10.108  -16.498 1.00 32.53 ? 41  TRP A CB  1 
ATOM   264 C CG  . TRP A 1 41 ? 5.089  9.314   -17.342 1.00 34.14 ? 41  TRP A CG  1 
ATOM   265 C CD1 . TRP A 1 41 ? 5.188  9.074   -18.684 1.00 32.66 ? 41  TRP A CD1 1 
ATOM   266 C CD2 . TRP A 1 41 ? 3.908  8.633   -16.897 1.00 34.60 ? 41  TRP A CD2 1 
ATOM   267 N NE1 . TRP A 1 41 ? 4.143  8.283   -19.102 1.00 33.95 ? 41  TRP A NE1 1 
ATOM   268 C CE2 . TRP A 1 41 ? 3.341  8.000   -18.026 1.00 34.53 ? 41  TRP A CE2 1 
ATOM   269 C CE3 . TRP A 1 41 ? 3.272  8.499   -15.654 1.00 36.50 ? 41  TRP A CE3 1 
ATOM   270 C CZ2 . TRP A 1 41 ? 2.168  7.237   -17.949 1.00 35.20 ? 41  TRP A CZ2 1 
ATOM   271 C CZ3 . TRP A 1 41 ? 2.102  7.739   -15.579 1.00 37.38 ? 41  TRP A CZ3 1 
ATOM   272 C CH2 . TRP A 1 41 ? 1.564  7.121   -16.721 1.00 37.22 ? 41  TRP A CH2 1 
ATOM   273 N N   . MET A 1 42 ? 7.364  13.311  -15.678 1.00 31.11 ? 42  MET A N   1 
ATOM   274 C CA  . MET A 1 42 ? 8.330  13.897  -14.754 1.00 31.08 ? 42  MET A CA  1 
ATOM   275 C C   . MET A 1 42 ? 7.799  14.157  -13.350 1.00 29.02 ? 42  MET A C   1 
ATOM   276 O O   . MET A 1 42 ? 8.467  13.832  -12.371 1.00 28.36 ? 42  MET A O   1 
ATOM   277 C CB  . MET A 1 42 ? 8.895  15.198  -15.317 1.00 32.36 ? 42  MET A CB  1 
ATOM   278 C CG  . MET A 1 42 ? 9.910  15.852  -14.393 1.00 35.29 ? 42  MET A CG  1 
ATOM   279 S SD  . MET A 1 42 ? 10.592 17.360  -15.097 1.00 40.71 ? 42  MET A SD  1 
ATOM   280 C CE  . MET A 1 42 ? 11.660 16.655  -16.337 1.00 40.42 ? 42  MET A CE  1 
ATOM   281 N N   . GLU A 1 43 ? 6.616  14.755  -13.247 1.00 28.39 ? 43  GLU A N   1 
ATOM   282 C CA  . GLU A 1 43 ? 6.036  15.038  -11.937 1.00 28.65 ? 43  GLU A CA  1 
ATOM   283 C C   . GLU A 1 43 ? 5.663  13.728  -11.242 1.00 28.06 ? 43  GLU A C   1 
ATOM   284 O O   . GLU A 1 43 ? 5.912  13.561  -10.049 1.00 27.21 ? 43  GLU A O   1 
ATOM   285 C CB  . GLU A 1 43 ? 4.802  15.936  -12.070 1.00 26.92 ? 43  GLU A CB  1 
ATOM   286 C CG  . GLU A 1 43 ? 4.109  16.264  -10.745 1.00 27.15 ? 43  GLU A CG  1 
ATOM   287 C CD  . GLU A 1 43 ? 5.001  16.999  -9.761  1.00 25.81 ? 43  GLU A CD  1 
ATOM   288 O OE1 . GLU A 1 43 ? 6.164  17.287  -10.101 1.00 26.45 ? 43  GLU A OE1 1 
ATOM   289 O OE2 . GLU A 1 43 ? 4.536  17.294  -8.640  1.00 27.62 ? 43  GLU A OE2 1 
ATOM   290 N N   . TRP A 1 44 ? 5.077  12.798  -11.993 1.00 27.67 ? 44  TRP A N   1 
ATOM   291 C CA  . TRP A 1 44 ? 4.704  11.503  -11.424 1.00 24.79 ? 44  TRP A CA  1 
ATOM   292 C C   . TRP A 1 44 ? 5.949  10.861  -10.802 1.00 24.21 ? 44  TRP A C   1 
ATOM   293 O O   . TRP A 1 44 ? 5.915  10.409  -9.661  1.00 20.98 ? 44  TRP A O   1 
ATOM   294 C CB  . TRP A 1 44 ? 4.132  10.586  -12.510 1.00 23.83 ? 44  TRP A CB  1 
ATOM   295 C CG  . TRP A 1 44 ? 3.567  9.304   -11.985 1.00 24.03 ? 44  TRP A CG  1 
ATOM   296 C CD1 . TRP A 1 44 ? 2.350  9.127   -11.380 1.00 24.93 ? 44  TRP A CD1 1 
ATOM   297 C CD2 . TRP A 1 44 ? 4.185  8.011   -12.027 1.00 23.05 ? 44  TRP A CD2 1 
ATOM   298 N NE1 . TRP A 1 44 ? 2.172  7.802   -11.052 1.00 23.05 ? 44  TRP A NE1 1 
ATOM   299 C CE2 . TRP A 1 44 ? 3.281  7.094   -11.439 1.00 24.65 ? 44  TRP A CE2 1 
ATOM   300 C CE3 . TRP A 1 44 ? 5.411  7.535   -12.513 1.00 24.89 ? 44  TRP A CE3 1 
ATOM   301 C CZ2 . TRP A 1 44 ? 3.570  5.724   -11.316 1.00 25.45 ? 44  TRP A CZ2 1 
ATOM   302 C CZ3 . TRP A 1 44 ? 5.700  6.170   -12.392 1.00 28.00 ? 44  TRP A CZ3 1 
ATOM   303 C CH2 . TRP A 1 44 ? 4.779  5.283   -11.801 1.00 26.43 ? 44  TRP A CH2 1 
ATOM   304 N N   . ASP A 1 45 ? 7.045  10.830  -11.560 1.00 25.29 ? 45  ASP A N   1 
ATOM   305 C CA  . ASP A 1 45 ? 8.306  10.255  -11.087 1.00 25.13 ? 45  ASP A CA  1 
ATOM   306 C C   . ASP A 1 45 ? 8.775  10.940  -9.808  1.00 24.14 ? 45  ASP A C   1 
ATOM   307 O O   . ASP A 1 45 ? 9.189  10.282  -8.850  1.00 22.55 ? 45  ASP A O   1 
ATOM   308 C CB  . ASP A 1 45 ? 9.397  10.401  -12.157 1.00 27.94 ? 45  ASP A CB  1 
ATOM   309 C CG  . ASP A 1 45 ? 9.229  9.422   -13.308 1.00 32.64 ? 45  ASP A CG  1 
ATOM   310 O OD1 . ASP A 1 45 ? 9.841  9.651   -14.374 1.00 34.74 ? 45  ASP A OD1 1 
ATOM   311 O OD2 . ASP A 1 45 ? 8.502  8.420   -13.151 1.00 33.63 ? 45  ASP A OD2 1 
ATOM   312 N N   . ARG A 1 46 ? 8.718  12.267  -9.808  1.00 22.37 ? 46  ARG A N   1 
ATOM   313 C CA  . ARG A 1 46 ? 9.130  13.059  -8.654  1.00 24.25 ? 46  ARG A CA  1 
ATOM   314 C C   . ARG A 1 46 ? 8.329  12.697  -7.405  1.00 22.12 ? 46  ARG A C   1 
ATOM   315 O O   . ARG A 1 46 ? 8.899  12.484  -6.328  1.00 21.13 ? 46  ARG A O   1 
ATOM   316 C CB  . ARG A 1 46 ? 8.962  14.557  -8.959  1.00 27.09 ? 46  ARG A CB  1 
ATOM   317 C CG  . ARG A 1 46 ? 9.249  15.461  -7.777  1.00 30.51 ? 46  ARG A CG  1 
ATOM   318 C CD  . ARG A 1 46 ? 9.015  16.923  -8.118  1.00 35.25 ? 46  ARG A CD  1 
ATOM   319 N NE  . ARG A 1 46 ? 9.230  17.777  -6.958  1.00 39.92 ? 46  ARG A NE  1 
ATOM   320 C CZ  . ARG A 1 46 ? 8.422  17.822  -5.905  1.00 42.38 ? 46  ARG A CZ  1 
ATOM   321 N NH1 . ARG A 1 46 ? 7.338  17.066  -5.868  1.00 44.12 ? 46  ARG A NH1 1 
ATOM   322 N NH2 . ARG A 1 46 ? 8.709  18.607  -4.877  1.00 45.10 ? 46  ARG A NH2 1 
ATOM   323 N N   . GLU A 1 47 ? 7.008  12.632  -7.550  1.00 20.25 ? 47  GLU A N   1 
ATOM   324 C CA  . GLU A 1 47 ? 6.131  12.302  -6.427  1.00 20.96 ? 47  GLU A CA  1 
ATOM   325 C C   . GLU A 1 47 ? 6.355  10.877  -5.937  1.00 19.77 ? 47  GLU A C   1 
ATOM   326 O O   . GLU A 1 47 ? 6.426  10.631  -4.731  1.00 18.80 ? 47  GLU A O   1 
ATOM   327 C CB  . GLU A 1 47 ? 4.666  12.484  -6.823  1.00 23.74 ? 47  GLU A CB  1 
ATOM   328 C CG  . GLU A 1 47 ? 4.282  13.917  -7.142  1.00 29.24 ? 47  GLU A CG  1 
ATOM   329 C CD  . GLU A 1 47 ? 4.673  14.885  -6.045  1.00 32.14 ? 47  GLU A CD  1 
ATOM   330 O OE1 . GLU A 1 47 ? 4.293  14.660  -4.879  1.00 34.15 ? 47  GLU A OE1 1 
ATOM   331 O OE2 . GLU A 1 47 ? 5.359  15.880  -6.352  1.00 37.38 ? 47  GLU A OE2 1 
ATOM   332 N N   . ILE A 1 48 ? 6.448  9.936   -6.872  1.00 18.59 ? 48  ILE A N   1 
ATOM   333 C CA  . ILE A 1 48 ? 6.699  8.541   -6.517  1.00 19.56 ? 48  ILE A CA  1 
ATOM   334 C C   . ILE A 1 48 ? 8.003  8.462   -5.715  1.00 21.53 ? 48  ILE A C   1 
ATOM   335 O O   . ILE A 1 48 ? 8.054  7.851   -4.649  1.00 19.61 ? 48  ILE A O   1 
ATOM   336 C CB  . ILE A 1 48 ? 6.838  7.655   -7.783  1.00 19.60 ? 48  ILE A CB  1 
ATOM   337 C CG1 . ILE A 1 48 ? 5.467  7.448   -8.440  1.00 19.11 ? 48  ILE A CG1 1 
ATOM   338 C CG2 . ILE A 1 48 ? 7.489  6.323   -7.421  1.00 22.15 ? 48  ILE A CG2 1 
ATOM   339 C CD1 . ILE A 1 48 ? 4.497  6.574   -7.630  1.00 16.32 ? 48  ILE A CD1 1 
ATOM   340 N N   . ASN A 1 49 ? 9.057  9.089   -6.226  1.00 21.95 ? 49  ASN A N   1 
ATOM   341 C CA  . ASN A 1 49 ? 10.342 9.065   -5.533  1.00 23.49 ? 49  ASN A CA  1 
ATOM   342 C C   . ASN A 1 49 ? 10.259 9.668   -4.133  1.00 22.79 ? 49  ASN A C   1 
ATOM   343 O O   . ASN A 1 49 ? 10.787 9.102   -3.173  1.00 20.87 ? 49  ASN A O   1 
ATOM   344 C CB  . ASN A 1 49 ? 11.410 9.803   -6.347  1.00 26.32 ? 49  ASN A CB  1 
ATOM   345 C CG  . ASN A 1 49 ? 11.775 9.075   -7.624  1.00 29.03 ? 49  ASN A CG  1 
ATOM   346 O OD1 . ASN A 1 49 ? 11.599 7.858   -7.734  1.00 31.78 ? 49  ASN A OD1 1 
ATOM   347 N ND2 . ASN A 1 49 ? 12.302 9.814   -8.595  1.00 31.07 ? 49  ASN A ND2 1 
ATOM   348 N N   . ASN A 1 50 ? 9.590  10.810  -4.013  1.00 21.04 ? 50  ASN A N   1 
ATOM   349 C CA  . ASN A 1 50 ? 9.466  11.458  -2.718  1.00 23.30 ? 50  ASN A CA  1 
ATOM   350 C C   . ASN A 1 50 ? 8.655  10.641  -1.719  1.00 20.86 ? 50  ASN A C   1 
ATOM   351 O O   . ASN A 1 50 ? 9.071  10.471  -0.577  1.00 18.99 ? 50  ASN A O   1 
ATOM   352 C CB  . ASN A 1 50 ? 8.851  12.855  -2.866  1.00 25.91 ? 50  ASN A CB  1 
ATOM   353 C CG  . ASN A 1 50 ? 9.804  13.840  -3.527  1.00 30.03 ? 50  ASN A CG  1 
ATOM   354 O OD1 . ASN A 1 50 ? 11.020 13.645  -3.513  1.00 29.53 ? 50  ASN A OD1 1 
ATOM   355 N ND2 . ASN A 1 50 ? 9.257  14.910  -4.096  1.00 29.72 ? 50  ASN A ND2 1 
ATOM   356 N N   . TYR A 1 51 ? 7.504  10.129  -2.136  1.00 18.88 ? 51  TYR A N   1 
ATOM   357 C CA  . TYR A 1 51 ? 6.699  9.348   -1.204  1.00 19.69 ? 51  TYR A CA  1 
ATOM   358 C C   . TYR A 1 51 ? 7.312  7.985   -0.894  1.00 18.72 ? 51  TYR A C   1 
ATOM   359 O O   . TYR A 1 51 ? 7.059  7.425   0.172   1.00 19.96 ? 51  TYR A O   1 
ATOM   360 C CB  . TYR A 1 51 ? 5.269  9.200   -1.719  1.00 18.99 ? 51  TYR A CB  1 
ATOM   361 C CG  . TYR A 1 51 ? 4.447  10.449  -1.496  1.00 20.08 ? 51  TYR A CG  1 
ATOM   362 C CD1 . TYR A 1 51 ? 4.083  10.844  -0.206  1.00 21.62 ? 51  TYR A CD1 1 
ATOM   363 C CD2 . TYR A 1 51 ? 4.072  11.263  -2.563  1.00 20.92 ? 51  TYR A CD2 1 
ATOM   364 C CE1 . TYR A 1 51 ? 3.374  12.020  0.016   1.00 24.26 ? 51  TYR A CE1 1 
ATOM   365 C CE2 . TYR A 1 51 ? 3.359  12.439  -2.356  1.00 24.55 ? 51  TYR A CE2 1 
ATOM   366 C CZ  . TYR A 1 51 ? 3.015  12.814  -1.065  1.00 26.05 ? 51  TYR A CZ  1 
ATOM   367 O OH  . TYR A 1 51 ? 2.315  13.980  -0.860  1.00 30.42 ? 51  TYR A OH  1 
ATOM   368 N N   . THR A 1 52 ? 8.111  7.457   -1.818  1.00 18.29 ? 52  THR A N   1 
ATOM   369 C CA  . THR A 1 52 ? 8.769  6.174   -1.596  1.00 19.86 ? 52  THR A CA  1 
ATOM   370 C C   . THR A 1 52 ? 9.873  6.385   -0.567  1.00 21.18 ? 52  THR A C   1 
ATOM   371 O O   . THR A 1 52 ? 10.045 5.573   0.344   1.00 21.27 ? 52  THR A O   1 
ATOM   372 C CB  . THR A 1 52 ? 9.372  5.607   -2.895  1.00 16.73 ? 52  THR A CB  1 
ATOM   373 O OG1 . THR A 1 52 ? 8.312  5.225   -3.785  1.00 17.24 ? 52  THR A OG1 1 
ATOM   374 C CG2 . THR A 1 52 ? 10.229 4.379   -2.594  1.00 20.67 ? 52  THR A CG2 1 
ATOM   375 N N   . SER A 1 53 ? 10.616 7.482   -0.711  1.00 22.57 ? 53  SER A N   1 
ATOM   376 C CA  . SER A 1 53 ? 11.684 7.805   0.237   1.00 23.50 ? 53  SER A CA  1 
ATOM   377 C C   . SER A 1 53 ? 11.074 8.122   1.601   1.00 22.65 ? 53  SER A C   1 
ATOM   378 O O   . SER A 1 53 ? 11.617 7.738   2.636   1.00 23.14 ? 53  SER A O   1 
ATOM   379 C CB  . SER A 1 53 ? 12.500 9.006   -0.251  1.00 24.57 ? 53  SER A CB  1 
ATOM   380 O OG  . SER A 1 53 ? 13.214 8.686   -1.431  1.00 29.70 ? 53  SER A OG  1 
ATOM   381 N N   . LEU A 1 54 ? 9.948  8.829   1.604   1.00 21.58 ? 54  LEU A N   1 
ATOM   382 C CA  . LEU A 1 54 ? 9.284  9.171   2.859   1.00 20.86 ? 54  LEU A CA  1 
ATOM   383 C C   . LEU A 1 54 ? 8.883  7.895   3.585   1.00 21.12 ? 54  LEU A C   1 
ATOM   384 O O   . LEU A 1 54 ? 9.203  7.709   4.756   1.00 20.21 ? 54  LEU A O   1 
ATOM   385 C CB  . LEU A 1 54 ? 8.035  10.026  2.603   1.00 19.11 ? 54  LEU A CB  1 
ATOM   386 C CG  . LEU A 1 54 ? 7.235  10.449  3.844   1.00 18.95 ? 54  LEU A CG  1 
ATOM   387 C CD1 . LEU A 1 54 ? 8.168  11.129  4.844   1.00 20.03 ? 54  LEU A CD1 1 
ATOM   388 C CD2 . LEU A 1 54 ? 6.102  11.399  3.442   1.00 19.63 ? 54  LEU A CD2 1 
ATOM   389 N N   . ALA A 1 55 ? 8.185  7.014   2.872   1.00 20.59 ? 55  ALA A N   1 
ATOM   390 C CA  . ALA A 1 55 ? 7.734  5.751   3.440   1.00 18.90 ? 55  ALA A CA  1 
ATOM   391 C C   . ALA A 1 55 ? 8.926  4.954   3.967   1.00 18.44 ? 55  ALA A C   1 
ATOM   392 O O   . ALA A 1 55 ? 8.886  4.420   5.077   1.00 18.67 ? 55  ALA A O   1 
ATOM   393 C CB  . ALA A 1 55 ? 6.979  4.942   2.374   1.00 16.31 ? 55  ALA A CB  1 
ATOM   394 N N   . HIS A 1 56 ? 9.983  4.870   3.163   1.00 19.93 ? 56  HIS A N   1 
ATOM   395 C CA  . HIS A 1 56 ? 11.181 4.138   3.556   1.00 21.49 ? 56  HIS A CA  1 
ATOM   396 C C   . HIS A 1 56 ? 11.723 4.662   4.878   1.00 20.86 ? 56  HIS A C   1 
ATOM   397 O O   . HIS A 1 56 ? 12.023 3.882   5.785   1.00 20.19 ? 56  HIS A O   1 
ATOM   398 C CB  . HIS A 1 56 ? 12.272 4.262   2.483   1.00 26.53 ? 56  HIS A CB  1 
ATOM   399 C CG  . HIS A 1 56 ? 12.144 3.283   1.355   1.00 31.00 ? 56  HIS A CG  1 
ATOM   400 N ND1 . HIS A 1 56 ? 13.041 3.235   0.309   1.00 34.26 ? 56  HIS A ND1 1 
ATOM   401 C CD2 . HIS A 1 56 ? 11.233 2.308   1.116   1.00 33.55 ? 56  HIS A CD2 1 
ATOM   402 C CE1 . HIS A 1 56 ? 12.689 2.273   -0.527  1.00 33.56 ? 56  HIS A CE1 1 
ATOM   403 N NE2 . HIS A 1 56 ? 11.596 1.696   -0.060  1.00 32.85 ? 56  HIS A NE2 1 
ATOM   404 N N   . SER A 1 57 ? 11.839 5.982   4.991   1.00 19.64 ? 57  SER A N   1 
ATOM   405 C CA  . SER A 1 57 ? 12.374 6.589   6.205   1.00 20.67 ? 57  SER A CA  1 
ATOM   406 C C   . SER A 1 57 ? 11.495 6.265   7.411   1.00 21.30 ? 57  SER A C   1 
ATOM   407 O O   . SER A 1 57 ? 12.005 6.003   8.499   1.00 21.14 ? 57  SER A O   1 
ATOM   408 C CB  . SER A 1 57 ? 12.511 8.108   6.030   1.00 21.22 ? 57  SER A CB  1 
ATOM   409 O OG  . SER A 1 57 ? 11.260 8.756   6.109   1.00 19.73 ? 57  SER A OG  1 
ATOM   410 N N   . LEU A 1 58 ? 10.179 6.260   7.215   1.00 19.72 ? 58  LEU A N   1 
ATOM   411 C CA  . LEU A 1 58 ? 9.260  5.948   8.301   1.00 21.50 ? 58  LEU A CA  1 
ATOM   412 C C   . LEU A 1 58 ? 9.400  4.482   8.690   1.00 21.13 ? 58  LEU A C   1 
ATOM   413 O O   . LEU A 1 58 ? 9.383  4.146   9.878   1.00 21.22 ? 58  LEU A O   1 
ATOM   414 C CB  . LEU A 1 58 ? 7.820  6.271   7.888   1.00 21.92 ? 58  LEU A CB  1 
ATOM   415 C CG  . LEU A 1 58 ? 7.523  7.773   7.925   1.00 21.50 ? 58  LEU A CG  1 
ATOM   416 C CD1 . LEU A 1 58 ? 6.372  8.109   6.982   1.00 22.84 ? 58  LEU A CD1 1 
ATOM   417 C CD2 . LEU A 1 58 ? 7.215  8.183   9.364   1.00 22.96 ? 58  LEU A CD2 1 
ATOM   418 N N   . ILE A 1 59 ? 9.561  3.610   7.697   1.00 21.06 ? 59  ILE A N   1 
ATOM   419 C CA  . ILE A 1 59 ? 9.728  2.183   7.980   1.00 23.42 ? 59  ILE A CA  1 
ATOM   420 C C   . ILE A 1 59 ? 11.004 1.955   8.779   1.00 24.99 ? 59  ILE A C   1 
ATOM   421 O O   . ILE A 1 59 ? 10.990 1.293   9.814   1.00 24.55 ? 59  ILE A O   1 
ATOM   422 C CB  . ILE A 1 59 ? 9.829  1.334   6.685   1.00 24.25 ? 59  ILE A CB  1 
ATOM   423 C CG1 . ILE A 1 59 ? 8.518  1.412   5.900   1.00 25.87 ? 59  ILE A CG1 1 
ATOM   424 C CG2 . ILE A 1 59 ? 10.137 -0.122  7.034   1.00 25.06 ? 59  ILE A CG2 1 
ATOM   425 C CD1 . ILE A 1 59 ? 7.317  1.084   6.717   1.00 29.83 ? 59  ILE A CD1 1 
ATOM   426 N N   . GLU A 1 60 ? 12.112 2.500   8.288   1.00 25.53 ? 60  GLU A N   1 
ATOM   427 C CA  . GLU A 1 60 ? 13.389 2.324   8.967   1.00 28.31 ? 60  GLU A CA  1 
ATOM   428 C C   . GLU A 1 60 ? 13.330 2.841   10.397  1.00 26.73 ? 60  GLU A C   1 
ATOM   429 O O   . GLU A 1 60 ? 13.872 2.222   11.312  1.00 26.04 ? 60  GLU A O   1 
ATOM   430 C CB  . GLU A 1 60 ? 14.504 3.013   8.174   1.00 30.70 ? 60  GLU A CB  1 
ATOM   431 C CG  . GLU A 1 60 ? 14.844 2.279   6.880   1.00 36.68 ? 60  GLU A CG  1 
ATOM   432 C CD  . GLU A 1 60 ? 15.902 2.984   6.054   1.00 41.37 ? 60  GLU A CD  1 
ATOM   433 O OE1 . GLU A 1 60 ? 16.979 3.291   6.609   1.00 43.38 ? 60  GLU A OE1 1 
ATOM   434 O OE2 . GLU A 1 60 ? 15.656 3.224   4.848   1.00 44.19 ? 60  GLU A OE2 1 
ATOM   435 N N   . GLU A 1 61 ? 12.650 3.965   10.590  1.00 26.31 ? 61  GLU A N   1 
ATOM   436 C CA  . GLU A 1 61 ? 12.497 4.555   11.914  1.00 27.97 ? 61  GLU A CA  1 
ATOM   437 C C   . GLU A 1 61 ? 11.687 3.628   12.826  1.00 27.91 ? 61  GLU A C   1 
ATOM   438 O O   . GLU A 1 61 ? 11.989 3.489   14.011  1.00 27.69 ? 61  GLU A O   1 
ATOM   439 C CB  . GLU A 1 61 ? 11.798 5.911   11.806  1.00 29.98 ? 61  GLU A CB  1 
ATOM   440 C CG  . GLU A 1 61 ? 11.552 6.585   13.143  1.00 32.93 ? 61  GLU A CG  1 
ATOM   441 C CD  . GLU A 1 61 ? 10.825 7.903   13.003  1.00 36.20 ? 61  GLU A CD  1 
ATOM   442 O OE1 . GLU A 1 61 ? 10.526 8.534   14.040  1.00 38.17 ? 61  GLU A OE1 1 
ATOM   443 O OE2 . GLU A 1 61 ? 10.551 8.309   11.853  1.00 37.81 ? 61  GLU A OE2 1 
ATOM   444 N N   . SER A 1 62 ? 10.658 2.994   12.269  1.00 27.59 ? 62  SER A N   1 
ATOM   445 C CA  . SER A 1 62 ? 9.817  2.078   13.038  1.00 27.70 ? 62  SER A CA  1 
ATOM   446 C C   . SER A 1 62 ? 10.592 0.805   13.388  1.00 29.16 ? 62  SER A C   1 
ATOM   447 O O   . SER A 1 62 ? 10.491 0.292   14.504  1.00 29.90 ? 62  SER A O   1 
ATOM   448 C CB  . SER A 1 62 ? 8.555  1.714   12.243  1.00 27.90 ? 62  SER A CB  1 
ATOM   449 O OG  . SER A 1 62 ? 7.782  2.870   11.953  1.00 28.62 ? 62  SER A OG  1 
ATOM   450 N N   . GLN A 1 63 ? 11.362 0.298   12.432  1.00 29.82 ? 63  GLN A N   1 
ATOM   451 C CA  . GLN A 1 63 ? 12.155 -0.910  12.650  1.00 33.84 ? 63  GLN A CA  1 
ATOM   452 C C   . GLN A 1 63 ? 13.152 -0.693  13.778  1.00 36.81 ? 63  GLN A C   1 
ATOM   453 O O   . GLN A 1 63 ? 13.333 -1.554  14.643  1.00 34.45 ? 63  GLN A O   1 
ATOM   454 C CB  . GLN A 1 63 ? 12.930 -1.283  11.388  1.00 34.16 ? 63  GLN A CB  1 
ATOM   455 C CG  . GLN A 1 63 ? 12.082 -1.655  10.195  1.00 35.33 ? 63  GLN A CG  1 
ATOM   456 C CD  . GLN A 1 63 ? 12.937 -1.960  8.987   1.00 37.35 ? 63  GLN A CD  1 
ATOM   457 O OE1 . GLN A 1 63 ? 13.828 -1.187  8.639   1.00 39.99 ? 63  GLN A OE1 1 
ATOM   458 N NE2 . GLN A 1 63 ? 12.674 -3.089  8.339   1.00 39.89 ? 63  GLN A NE2 1 
ATOM   459 N N   . ASN A 1 64 ? 13.811 0.460   13.752  1.00 39.17 ? 64  ASN A N   1 
ATOM   460 C CA  . ASN A 1 64 ? 14.796 0.790   14.768  1.00 43.25 ? 64  ASN A CA  1 
ATOM   461 C C   . ASN A 1 64 ? 14.114 1.006   16.111  1.00 44.90 ? 64  ASN A C   1 
ATOM   462 O O   . ASN A 1 64 ? 14.637 0.617   17.154  1.00 46.10 ? 64  ASN A O   1 
ATOM   463 C CB  . ASN A 1 64 ? 15.573 2.044   14.357  1.00 43.85 ? 64  ASN A CB  1 
ATOM   464 C CG  . ASN A 1 64 ? 16.643 2.423   15.363  1.00 46.19 ? 64  ASN A CG  1 
ATOM   465 O OD1 . ASN A 1 64 ? 16.341 2.894   16.460  1.00 47.24 ? 64  ASN A OD1 1 
ATOM   466 N ND2 . ASN A 1 64 ? 17.903 2.210   14.996  1.00 46.86 ? 64  ASN A ND2 1 
ATOM   467 N N   . GLN A 1 65 ? 12.937 1.619   16.078  1.00 46.78 ? 65  GLN A N   1 
ATOM   468 C CA  . GLN A 1 65 ? 12.182 1.884   17.296  1.00 50.14 ? 65  GLN A CA  1 
ATOM   469 C C   . GLN A 1 65 ? 11.672 0.598   17.947  1.00 52.03 ? 65  GLN A C   1 
ATOM   470 O O   . GLN A 1 65 ? 11.687 0.466   19.171  1.00 52.32 ? 65  GLN A O   1 
ATOM   471 C CB  . GLN A 1 65 ? 11.000 2.805   16.987  1.00 49.94 ? 65  GLN A CB  1 
ATOM   472 C CG  . GLN A 1 65 ? 10.235 3.052   18.150  1.00 51.92 ? 65  GLN A CG  1 
ATOM   473 N N   . GLN A 1 66 ? 11.218 -0.342  17.123  1.00 54.06 ? 66  GLN A N   1 
ATOM   474 C CA  . GLN A 1 66 ? 10.699 -1.616  17.614  1.00 55.69 ? 66  GLN A CA  1 
ATOM   475 C C   . GLN A 1 66 ? 11.798 -2.602  17.992  1.00 56.74 ? 66  GLN A C   1 
ATOM   476 O O   . GLN A 1 66 ? 11.663 -3.246  19.053  1.00 57.60 ? 66  GLN A O   1 
ATOM   477 C CB  . GLN A 1 66 ? 9.777  -2.254  16.572  1.00 56.03 ? 66  GLN A CB  1 
ATOM   478 C CG  . GLN A 1 66 ? 8.390  -1.634  16.509  1.00 57.30 ? 66  GLN A CG  1 
ATOM   479 C CD  . GLN A 1 66 ? 7.434  -2.432  15.641  1.00 58.40 ? 66  GLN A CD  1 
ATOM   480 O OE1 . GLN A 1 66 ? 6.234  -2.162  15.605  1.00 59.42 ? 66  GLN A OE1 1 
ATOM   481 N NE2 . GLN A 1 66 ? 7.965  -3.422  14.934  1.00 60.39 ? 66  GLN A NE2 1 
HETATM 482 O O   . HOH B 2 .  ? 8.636  -7.790  3.601   1.00 25.90 ? 100 HOH A O   1 
HETATM 483 O O   . HOH B 2 .  ? 4.080  13.736  -14.786 1.00 27.25 ? 101 HOH A O   1 
HETATM 484 O O   . HOH B 2 .  ? 7.501  15.064  -18.102 1.00 36.37 ? 102 HOH A O   1 
HETATM 485 O O   . HOH B 2 .  ? 7.552  2.671   -4.414  1.00 25.67 ? 103 HOH A O   1 
HETATM 486 O O   . HOH B 2 .  ? 7.258  -8.184  6.019   1.00 24.88 ? 104 HOH A O   1 
HETATM 487 O O   . HOH B 2 .  ? 8.138  17.764  -11.525 1.00 33.52 ? 105 HOH A O   1 
HETATM 488 O O   . HOH B 2 .  ? 12.700 6.745   -3.623  1.00 41.07 ? 106 HOH A O   1 
HETATM 489 O O   . HOH B 2 .  ? 9.883  0.734   -8.246  1.00 22.67 ? 107 HOH A O   1 
HETATM 490 O O   . HOH B 2 .  ? 10.005 -2.706  3.159   1.00 36.53 ? 108 HOH A O   1 
HETATM 491 O O   . HOH B 2 .  ? 9.308  -6.615  -18.250 1.00 41.89 ? 109 HOH A O   1 
HETATM 492 O O   . HOH B 2 .  ? 14.417 7.227   2.584   1.00 39.55 ? 110 HOH A O   1 
HETATM 493 O O   . HOH B 2 .  ? 12.907 12.452  -8.104  1.00 40.97 ? 111 HOH A O   1 
HETATM 494 O O   . HOH B 2 .  ? 11.941 5.570   -5.979  1.00 43.49 ? 112 HOH A O   1 
HETATM 495 O O   . HOH B 2 .  ? 11.128 -6.295  4.109   1.00 44.30 ? 113 HOH A O   1 
HETATM 496 O O   . HOH B 2 .  ? 11.075 1.351   -10.473 1.00 40.17 ? 114 HOH A O   1 
HETATM 497 O O   . HOH B 2 .  ? 13.485 -6.518  2.460   1.00 53.16 ? 115 HOH A O   1 
HETATM 498 O O   . HOH B 2 .  ? 10.914 18.624  -3.550  1.00 44.34 ? 116 HOH A O   1 
HETATM 499 O O   . HOH B 2 .  ? 19.012 3.779   12.597  1.00 54.67 ? 117 HOH A O   1 
HETATM 500 O O   . HOH B 2 .  ? 1.907  2.695   -23.101 1.00 50.63 ? 118 HOH A O   1 
HETATM 501 O O   . HOH B 2 .  ? 9.868  -5.200  14.336  1.00 58.19 ? 119 HOH A O   1 
HETATM 502 O O   . HOH B 2 .  ? 10.164 -5.273  11.195  1.00 40.01 ? 120 HOH A O   1 
HETATM 503 O O   . HOH B 2 .  ? 12.749 4.948   -13.137 1.00 51.12 ? 121 HOH A O   1 
HETATM 504 O O   . HOH B 2 .  ? 12.616 2.881   20.996  1.00 61.35 ? 122 HOH A O   1 
HETATM 505 O O   . HOH B 2 .  ? 0.001  0.000   -6.380  0.33 14.07 ? 123 HOH A O   1 
HETATM 506 O O   . HOH B 2 .  ? 0.000  -0.001  2.860   0.33 27.35 ? 124 HOH A O   1 
HETATM 507 O O   . HOH B 2 .  ? 10.368 -9.851  3.251   1.00 37.36 ? 125 HOH A O   1 
HETATM 508 O O   . HOH B 2 .  ? 10.184 0.673   -2.108  1.00 33.31 ? 126 HOH A O   1 
HETATM 509 O O   . HOH B 2 .  ? 10.119 2.823   -6.087  1.00 44.14 ? 127 HOH A O   1 
HETATM 510 O O   . HOH B 2 .  ? 0.056  -11.515 17.259  1.00 43.33 ? 128 HOH A O   1 
HETATM 511 O O   . HOH B 2 .  ? 4.940  -10.489 16.306  1.00 51.34 ? 129 HOH A O   1 
HETATM 512 O O   . HOH B 2 .  ? 17.080 5.488   11.787  1.00 41.66 ? 130 HOH A O   1 
HETATM 513 O O   . HOH B 2 .  ? 16.120 0.545   11.406  1.00 55.95 ? 131 HOH A O   1 
HETATM 514 O O   . HOH B 2 .  ? 7.701  18.534  -2.339  1.00 61.53 ? 132 HOH A O   1 
HETATM 515 O O   . HOH B 2 .  ? 1.284  13.973  -4.891  1.00 40.45 ? 133 HOH A O   1 
HETATM 516 O O   . HOH B 2 .  ? 11.297 -1.994  21.198  1.00 55.66 ? 134 HOH A O   1 
HETATM 517 O O   . HOH B 2 .  ? 6.972  -0.061  20.026  1.00 44.22 ? 135 HOH A O   1 
HETATM 518 O O   . HOH B 2 .  ? 11.508 12.457  -15.014 1.00 54.58 ? 136 HOH A O   1 
HETATM 519 O O   . HOH B 2 .  ? 7.427  5.359   -24.292 1.00 64.96 ? 137 HOH A O   1 
HETATM 520 O O   . HOH B 2 .  ? 10.188 -9.757  9.950   1.00 55.87 ? 138 HOH A O   1 
HETATM 521 O O   . HOH B 2 .  ? 14.673 0.786   20.976  1.00 62.53 ? 139 HOH A O   1 
HETATM 522 O O   . HOH B 2 .  ? 15.774 12.654  -6.798  1.00 54.20 ? 140 HOH A O   1 
HETATM 523 O O   . HOH B 2 .  ? 14.116 -1.505  -18.655 1.00 59.31 ? 141 HOH A O   1 
HETATM 524 O O   . HOH B 2 .  ? 12.174 -5.727  6.388   1.00 54.55 ? 142 HOH A O   1 
HETATM 525 O O   . HOH B 2 .  ? 8.296  -10.143 7.334   1.00 34.02 ? 143 HOH A O   1 
HETATM 526 O O   . HOH B 2 .  ? 7.764  1.251   -2.017  1.00 36.20 ? 144 HOH A O   1 
HETATM 527 O O   . HOH B 2 .  ? -0.352 11.850  -4.056  1.00 37.08 ? 145 HOH A O   1 
HETATM 528 O O   . HOH B 2 .  ? 10.692 -1.957  -0.754  1.00 43.86 ? 146 HOH A O   1 
HETATM 529 O O   . HOH B 2 .  ? 16.443 4.499   18.779  1.00 58.09 ? 147 HOH A O   1 
HETATM 530 O O   . HOH B 2 .  ? 11.926 1.327   -4.491  1.00 47.72 ? 148 HOH A O   1 
HETATM 531 O O   . HOH B 2 .  ? 3.910  -8.970  24.166  1.00 51.89 ? 149 HOH A O   1 
HETATM 532 O O   . HOH B 2 .  ? 7.602  9.459   -21.912 1.00 63.52 ? 150 HOH A O   1 
HETATM 533 O O   . HOH B 2 .  ? -0.086 -5.917  26.122  1.00 52.76 ? 151 HOH A O   1 
HETATM 534 O O   . HOH B 2 .  ? 2.788  6.940   -21.497 1.00 50.40 ? 152 HOH A O   1 
HETATM 535 O O   . HOH B 2 .  ? 2.774  -11.630 22.641  1.00 51.97 ? 153 HOH A O   1 
HETATM 536 O O   . HOH B 2 .  ? 4.178  4.226   -25.177 1.00 56.70 ? 154 HOH A O   1 
HETATM 537 O O   . HOH B 2 .  ? 14.472 8.743   9.784   1.00 41.30 ? 155 HOH A O   1 
HETATM 538 O O   . HOH B 2 .  ? 9.263  16.950  -18.478 1.00 41.64 ? 156 HOH A O   1 
HETATM 539 O O   . HOH B 2 .  ? 8.574  7.369   -15.356 1.00 51.97 ? 157 HOH A O   1 
HETATM 540 O O   . HOH B 2 .  ? -3.389 11.494  -4.425  1.00 51.90 ? 158 HOH A O   1 
HETATM 541 O O   . HOH B 2 .  ? 13.663 -3.494  2.228   1.00 59.18 ? 159 HOH A O   1 
HETATM 542 O O   . HOH B 2 .  ? 4.773  -13.044 21.364  1.00 54.68 ? 160 HOH A O   1 
HETATM 543 O O   . HOH B 2 .  ? 12.616 -9.127  11.816  1.00 56.65 ? 161 HOH A O   1 
HETATM 544 O O   . HOH B 2 .  ? 8.877  6.868   -19.824 1.00 55.26 ? 162 HOH A O   1 
HETATM 545 O O   . HOH B 2 .  ? 14.034 -0.772  5.042   1.00 60.43 ? 163 HOH A O   1 
HETATM 546 O O   . HOH B 2 .  ? 5.510  2.607   -27.037 1.00 63.16 ? 164 HOH A O   1 
HETATM 547 O O   . HOH B 2 .  ? 13.669 -6.363  9.755   1.00 61.94 ? 165 HOH A O   1 
HETATM 548 O O   . HOH B 2 .  ? 6.186  -8.445  23.053  1.00 59.04 ? 166 HOH A O   1 
HETATM 549 O O   . HOH B 2 .  ? 2.005  15.236  1.476   1.00 45.21 ? 167 HOH A O   1 
HETATM 550 O O   . HOH B 2 .  ? 9.662  17.275  -21.443 1.00 57.64 ? 168 HOH A O   1 
HETATM 551 O O   . HOH B 2 .  ? 11.874 0.765   -13.041 1.00 63.54 ? 169 HOH A O   1 
HETATM 552 O O   . HOH B 2 .  ? 13.161 3.331   -11.034 1.00 61.13 ? 170 HOH A O   1 
HETATM 553 O O   . HOH B 2 .  ? 8.231  -7.174  -21.036 1.00 63.55 ? 171 HOH A O   1 
HETATM 554 O O   . HOH B 2 .  ? 12.289 11.675  -20.870 1.00 63.37 ? 172 HOH A O   1 
HETATM 555 O O   . HOH B 2 .  ? 12.669 11.903  -11.209 1.00 63.72 ? 173 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  SER 1  1  ?  ?   ?   A . n 
A 1 2  GLY 2  2  2  GLY GLY A . n 
A 1 3  ILE 3  3  3  ILE ILE A . n 
A 1 4  VAL 4  4  4  VAL VAL A . n 
A 1 5  GLN 5  5  5  GLN SER A . n 
A 1 6  GLN 6  6  6  GLN GLN A . n 
A 1 7  GLN 7  7  7  GLN GLN A . n 
A 1 8  ASN 8  8  8  ASN ASN A . n 
A 1 9  ASN 9  9  9  ASN ASN A . n 
A 1 10 LEU 10 10 10 LEU LEU A . n 
A 1 11 LEU 11 11 11 LEU LEU A . n 
A 1 12 ARG 12 12 12 ARG ARG A . n 
A 1 13 ALA 13 13 13 ALA ALA A . n 
A 1 14 ILE 14 14 14 ILE ILE A . n 
A 1 15 GLU 15 15 15 GLU GLU A . n 
A 1 16 ALA 16 16 16 ALA ALA A . n 
A 1 17 GLN 17 17 17 GLN GLN A . n 
A 1 18 GLN 18 18 18 GLN GLN A . n 
A 1 19 HIS 19 19 19 HIS HIS A . n 
A 1 20 LEU 20 20 20 LEU LEU A . n 
A 1 21 LEU 21 21 21 LEU LEU A . n 
A 1 22 GLN 22 22 22 GLN ALA A . n 
A 1 23 LEU 23 23 23 LEU LEU A . n 
A 1 24 THR 24 24 24 THR THR A . n 
A 1 25 VAL 25 25 25 VAL VAL A . n 
A 1 26 TRP 26 26 26 TRP TRP A . n 
A 1 27 GLY 27 27 27 GLY GLY A . n 
A 1 28 ILE 28 28 28 ILE ILE A . n 
A 1 29 LYS 29 29 29 LYS LYS A . n 
A 1 30 GLN 30 30 30 GLN GLN A . n 
A 1 31 LEU 31 31 31 LEU LEU A . n 
A 1 32 GLN 32 32 32 GLN GLN A . n 
A 1 33 ALA 33 33 33 ALA ALA A . n 
A 1 34 ARG 34 34 ?  ?   ?   A . n 
A 1 35 SER 35 35 ?  ?   ?   A . n 
A 1 36 GLY 36 36 ?  ?   ?   A . n 
A 1 37 GLY 37 37 ?  ?   ?   A . n 
A 1 38 ARG 38 38 ?  ?   ?   A . n 
A 1 39 GLY 39 39 39 GLY GLY A . n 
A 1 40 GLY 40 40 40 GLY GLY A . n 
A 1 41 TRP 41 41 41 TRP TRP A . n 
A 1 42 MET 42 42 42 MET MET A . n 
A 1 43 GLU 43 43 43 GLU GLU A . n 
A 1 44 TRP 44 44 44 TRP TRP A . n 
A 1 45 ASP 45 45 45 ASP ASP A . n 
A 1 46 ARG 46 46 46 ARG ARG A . n 
A 1 47 GLU 47 47 47 GLU GLU A . n 
A 1 48 ILE 48 48 48 ILE ILE A . n 
A 1 49 ASN 49 49 49 ASN ASN A . n 
A 1 50 ASN 50 50 50 ASN ASN A . n 
A 1 51 TYR 51 51 51 TYR TYR A . n 
A 1 52 THR 52 52 52 THR THR A . n 
A 1 53 SER 53 53 53 SER SER A . n 
A 1 54 LEU 54 54 54 LEU LEU A . n 
A 1 55 ALA 55 55 55 ALA ALA A . n 
A 1 56 HIS 56 56 56 HIS HIS A . n 
A 1 57 SER 57 57 57 SER SER A . n 
A 1 58 LEU 58 58 58 LEU LEU A . n 
A 1 59 ILE 59 59 59 ILE ILE A . n 
A 1 60 GLU 60 60 60 GLU GLU A . n 
A 1 61 GLU 61 61 61 GLU GLU A . n 
A 1 62 SER 62 62 62 SER SER A . n 
A 1 63 GLN 63 63 63 GLN GLN A . n 
A 1 64 ASN 64 64 64 ASN ASN A . n 
A 1 65 GLN 65 65 65 GLN SER A . n 
A 1 66 GLN 66 66 66 GLN GLN A . n 
A 1 67 GLU 67 67 ?  ?   ?   A . n 
A 1 68 LYS 68 68 ?  ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1  100 100 HOH HOH A . 
B 2 HOH 2  101 101 HOH HOH A . 
B 2 HOH 3  102 102 HOH HOH A . 
B 2 HOH 4  103 103 HOH HOH A . 
B 2 HOH 5  104 104 HOH HOH A . 
B 2 HOH 6  105 105 HOH HOH A . 
B 2 HOH 7  106 106 HOH HOH A . 
B 2 HOH 8  107 107 HOH HOH A . 
B 2 HOH 9  108 108 HOH HOH A . 
B 2 HOH 10 109 109 HOH HOH A . 
B 2 HOH 11 110 110 HOH HOH A . 
B 2 HOH 12 111 111 HOH HOH A . 
B 2 HOH 13 112 112 HOH HOH A . 
B 2 HOH 14 113 113 HOH HOH A . 
B 2 HOH 15 114 114 HOH HOH A . 
B 2 HOH 16 115 115 HOH HOH A . 
B 2 HOH 17 116 116 HOH HOH A . 
B 2 HOH 18 117 117 HOH HOH A . 
B 2 HOH 19 118 118 HOH HOH A . 
B 2 HOH 20 119 119 HOH HOH A . 
B 2 HOH 21 120 120 HOH HOH A . 
B 2 HOH 22 121 121 HOH HOH A . 
B 2 HOH 23 122 122 HOH HOH A . 
B 2 HOH 24 123 123 HOH HOH A . 
B 2 HOH 25 124 124 HOH HOH A . 
B 2 HOH 26 125 125 HOH HOH A . 
B 2 HOH 27 126 126 HOH HOH A . 
B 2 HOH 28 127 127 HOH HOH A . 
B 2 HOH 29 128 128 HOH HOH A . 
B 2 HOH 30 129 129 HOH HOH A . 
B 2 HOH 31 130 130 HOH HOH A . 
B 2 HOH 32 131 131 HOH HOH A . 
B 2 HOH 33 132 132 HOH HOH A . 
B 2 HOH 34 133 133 HOH HOH A . 
B 2 HOH 35 134 134 HOH HOH A . 
B 2 HOH 36 135 135 HOH HOH A . 
B 2 HOH 37 136 136 HOH HOH A . 
B 2 HOH 38 137 137 HOH HOH A . 
B 2 HOH 39 138 138 HOH HOH A . 
B 2 HOH 40 139 139 HOH HOH A . 
B 2 HOH 41 140 140 HOH HOH A . 
B 2 HOH 42 141 141 HOH HOH A . 
B 2 HOH 43 142 142 HOH HOH A . 
B 2 HOH 44 143 143 HOH HOH A . 
B 2 HOH 45 144 144 HOH HOH A . 
B 2 HOH 46 145 145 HOH HOH A . 
B 2 HOH 47 146 146 HOH HOH A . 
B 2 HOH 48 147 147 HOH HOH A . 
B 2 HOH 49 148 148 HOH HOH A . 
B 2 HOH 50 149 149 HOH HOH A . 
B 2 HOH 51 150 150 HOH HOH A . 
B 2 HOH 52 151 151 HOH HOH A . 
B 2 HOH 53 152 152 HOH HOH A . 
B 2 HOH 54 153 153 HOH HOH A . 
B 2 HOH 55 154 154 HOH HOH A . 
B 2 HOH 56 155 155 HOH HOH A . 
B 2 HOH 57 156 156 HOH HOH A . 
B 2 HOH 58 157 157 HOH HOH A . 
B 2 HOH 59 158 158 HOH HOH A . 
B 2 HOH 60 159 159 HOH HOH A . 
B 2 HOH 61 160 160 HOH HOH A . 
B 2 HOH 62 161 161 HOH HOH A . 
B 2 HOH 63 162 162 HOH HOH A . 
B 2 HOH 64 163 163 HOH HOH A . 
B 2 HOH 65 164 164 HOH HOH A . 
B 2 HOH 66 165 165 HOH HOH A . 
B 2 HOH 67 166 166 HOH HOH A . 
B 2 HOH 68 167 167 HOH HOH A . 
B 2 HOH 69 168 168 HOH HOH A . 
B 2 HOH 70 169 169 HOH HOH A . 
B 2 HOH 71 170 170 HOH HOH A . 
B 2 HOH 72 171 171 HOH HOH A . 
B 2 HOH 73 172 172 HOH HOH A . 
B 2 HOH 74 173 173 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA,PQS 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2,3 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 6110 ? 
1 MORE         -63  ? 
1 'SSA (A^2)'  9200 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z     1.0000000000  0.0000000000  0.0000000000 0.0000000000 0.0000000000  1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 2_555 -y,x-y,z  -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 0.8660254038  -0.5000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
3 'crystal symmetry operation' 3_555 -x+y,-x,z -0.5000000000 0.8660254038  0.0000000000 0.0000000000 -0.8660254038 -0.5000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 123 ? B HOH . 
2 1 A HOH 124 ? B HOH . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2001-10-10 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-08-09 
5 'Structure model' 1 4 2021-10-27 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Refinement description'    
5 4 'Structure model' 'Source and taxonomy'       
6 5 'Structure model' 'Database references'       
7 5 'Structure model' 'Refinement description'    
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' entity_src_gen     
2 4 'Structure model' software           
3 5 'Structure model' database_2         
4 5 'Structure model' software           
5 5 'Structure model' struct_ref_seq_dif 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 5 'Structure model' '_database_2.pdbx_DOI'                
2 5 'Structure model' '_database_2.pdbx_database_accession' 
3 5 'Structure model' '_struct_ref_seq_dif.details'         
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
AMoRE phasing    .   ? 1 
CNS   refinement 1.0 ? 2 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    GLN 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     32 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -68.62 
_pdbx_validate_torsion.psi             21.60 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLN 5  ? CD  ? A GLN 5  CD  
2  1 Y 1 A GLN 5  ? OE1 ? A GLN 5  OE1 
3  1 Y 1 A GLN 5  ? NE2 ? A GLN 5  NE2 
4  1 Y 1 A GLN 22 ? CG  ? A GLN 22 CG  
5  1 Y 1 A GLN 22 ? CD  ? A GLN 22 CD  
6  1 Y 1 A GLN 22 ? OE1 ? A GLN 22 OE1 
7  1 Y 1 A GLN 22 ? NE2 ? A GLN 22 NE2 
8  1 Y 1 A GLN 65 ? CD  ? A GLN 65 CD  
9  1 Y 1 A GLN 65 ? OE1 ? A GLN 65 OE1 
10 1 Y 1 A GLN 65 ? NE2 ? A GLN 65 NE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A SER 1  ? A SER 1  
2 1 Y 1 A ARG 34 ? A ARG 34 
3 1 Y 1 A SER 35 ? A SER 35 
4 1 Y 1 A GLY 36 ? A GLY 36 
5 1 Y 1 A GLY 37 ? A GLY 37 
6 1 Y 1 A ARG 38 ? A ARG 38 
7 1 Y 1 A GLU 67 ? A GLU 67 
8 1 Y 1 A LYS 68 ? A LYS 68 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#