data_1K3A
# 
_entry.id   1K3A 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1K3A         
RCSB  RCSB014506   
WWPDB D_1000014506 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1K3A 
_pdbx_database_status.recvd_initial_deposition_date   2001-10-02 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Favelyukis, S.' 1 
'Till, J.H.'     2 
'Hubbard, S.R.'  3 
'Miller, W.T.'   4 
# 
_citation.id                        primary 
_citation.title                     'Structure and autoregulation of the insulin-like growth factor 1 receptor kinase.' 
_citation.journal_abbrev            Nat.Struct.Biol. 
_citation.journal_volume            8 
_citation.page_first                1058 
_citation.page_last                 1063 
_citation.year                      2001 
_citation.journal_id_ASTM           NSBIEW 
_citation.country                   US 
_citation.journal_id_ISSN           1072-8368 
_citation.journal_id_CSD            2024 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11694888 
_citation.pdbx_database_id_DOI      10.1038/nsb721 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Favelyukis, S.' 1 
primary 'Till, J.H.'     2 
primary 'Hubbard, S.R.'  3 
primary 'Miller, W.T.'   4 
# 
_cell.entry_id           1K3A 
_cell.length_a           80.624 
_cell.length_b           111.018 
_cell.length_c           93.297 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1K3A 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'insulin-like growth factor 1 receptor'        34410.199 1   2.7.1.112 ? 
'beta chain, kinase domain (residues 988-1286)' ? 
2 polymer     syn 'insulin receptor substrate 1'                 1598.818  1   ?         ? ? ? 
3 non-polymer syn 'PHOSPHOMETHYLPHOSPHONIC ACID ADENYLATE ESTER' 505.208   1   ?         ? ? ? 
4 water       nat water                                          18.015    158 ?         ? ? ? 
# 
_entity_name_com.entity_id   2 
_entity_name_com.name        IRS-1 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no yes 
;VPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLG
VVSQGQPTLVIMELMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDF
TVKIGDFGMTRDI(PTR)ETD(PTR)(PTR)RKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQG
LSNEQVLRFVMEGGLLDKPDNCPDMLLELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENK
;
;VPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLG
VVSQGQPTLVIMELMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDF
TVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVME
GGLLDKPDNCPDMLLELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENK
;
A ? 
2 'polypeptide(L)' no no  KKKSPGEYVNIEFG KKKSPGEYVNIEFG B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   VAL n 
1 2   PRO n 
1 3   ASP n 
1 4   GLU n 
1 5   TRP n 
1 6   GLU n 
1 7   VAL n 
1 8   ALA n 
1 9   ARG n 
1 10  GLU n 
1 11  LYS n 
1 12  ILE n 
1 13  THR n 
1 14  MET n 
1 15  SER n 
1 16  ARG n 
1 17  GLU n 
1 18  LEU n 
1 19  GLY n 
1 20  GLN n 
1 21  GLY n 
1 22  SER n 
1 23  PHE n 
1 24  GLY n 
1 25  MET n 
1 26  VAL n 
1 27  TYR n 
1 28  GLU n 
1 29  GLY n 
1 30  VAL n 
1 31  ALA n 
1 32  LYS n 
1 33  GLY n 
1 34  VAL n 
1 35  VAL n 
1 36  LYS n 
1 37  ASP n 
1 38  GLU n 
1 39  PRO n 
1 40  GLU n 
1 41  THR n 
1 42  ARG n 
1 43  VAL n 
1 44  ALA n 
1 45  ILE n 
1 46  LYS n 
1 47  THR n 
1 48  VAL n 
1 49  ASN n 
1 50  GLU n 
1 51  ALA n 
1 52  ALA n 
1 53  SER n 
1 54  MET n 
1 55  ARG n 
1 56  GLU n 
1 57  ARG n 
1 58  ILE n 
1 59  GLU n 
1 60  PHE n 
1 61  LEU n 
1 62  ASN n 
1 63  GLU n 
1 64  ALA n 
1 65  SER n 
1 66  VAL n 
1 67  MET n 
1 68  LYS n 
1 69  GLU n 
1 70  PHE n 
1 71  ASN n 
1 72  CYS n 
1 73  HIS n 
1 74  HIS n 
1 75  VAL n 
1 76  VAL n 
1 77  ARG n 
1 78  LEU n 
1 79  LEU n 
1 80  GLY n 
1 81  VAL n 
1 82  VAL n 
1 83  SER n 
1 84  GLN n 
1 85  GLY n 
1 86  GLN n 
1 87  PRO n 
1 88  THR n 
1 89  LEU n 
1 90  VAL n 
1 91  ILE n 
1 92  MET n 
1 93  GLU n 
1 94  LEU n 
1 95  MET n 
1 96  THR n 
1 97  ARG n 
1 98  GLY n 
1 99  ASP n 
1 100 LEU n 
1 101 LYS n 
1 102 SER n 
1 103 TYR n 
1 104 LEU n 
1 105 ARG n 
1 106 SER n 
1 107 LEU n 
1 108 ARG n 
1 109 PRO n 
1 110 GLU n 
1 111 MET n 
1 112 GLU n 
1 113 ASN n 
1 114 ASN n 
1 115 PRO n 
1 116 VAL n 
1 117 LEU n 
1 118 ALA n 
1 119 PRO n 
1 120 PRO n 
1 121 SER n 
1 122 LEU n 
1 123 SER n 
1 124 LYS n 
1 125 MET n 
1 126 ILE n 
1 127 GLN n 
1 128 MET n 
1 129 ALA n 
1 130 GLY n 
1 131 GLU n 
1 132 ILE n 
1 133 ALA n 
1 134 ASP n 
1 135 GLY n 
1 136 MET n 
1 137 ALA n 
1 138 TYR n 
1 139 LEU n 
1 140 ASN n 
1 141 ALA n 
1 142 ASN n 
1 143 LYS n 
1 144 PHE n 
1 145 VAL n 
1 146 HIS n 
1 147 ARG n 
1 148 ASP n 
1 149 LEU n 
1 150 ALA n 
1 151 ALA n 
1 152 ARG n 
1 153 ASN n 
1 154 CYS n 
1 155 MET n 
1 156 VAL n 
1 157 ALA n 
1 158 GLU n 
1 159 ASP n 
1 160 PHE n 
1 161 THR n 
1 162 VAL n 
1 163 LYS n 
1 164 ILE n 
1 165 GLY n 
1 166 ASP n 
1 167 PHE n 
1 168 GLY n 
1 169 MET n 
1 170 THR n 
1 171 ARG n 
1 172 ASP n 
1 173 ILE n 
1 174 PTR n 
1 175 GLU n 
1 176 THR n 
1 177 ASP n 
1 178 PTR n 
1 179 PTR n 
1 180 ARG n 
1 181 LYS n 
1 182 GLY n 
1 183 GLY n 
1 184 LYS n 
1 185 GLY n 
1 186 LEU n 
1 187 LEU n 
1 188 PRO n 
1 189 VAL n 
1 190 ARG n 
1 191 TRP n 
1 192 MET n 
1 193 SER n 
1 194 PRO n 
1 195 GLU n 
1 196 SER n 
1 197 LEU n 
1 198 LYS n 
1 199 ASP n 
1 200 GLY n 
1 201 VAL n 
1 202 PHE n 
1 203 THR n 
1 204 THR n 
1 205 TYR n 
1 206 SER n 
1 207 ASP n 
1 208 VAL n 
1 209 TRP n 
1 210 SER n 
1 211 PHE n 
1 212 GLY n 
1 213 VAL n 
1 214 VAL n 
1 215 LEU n 
1 216 TRP n 
1 217 GLU n 
1 218 ILE n 
1 219 ALA n 
1 220 THR n 
1 221 LEU n 
1 222 ALA n 
1 223 GLU n 
1 224 GLN n 
1 225 PRO n 
1 226 TYR n 
1 227 GLN n 
1 228 GLY n 
1 229 LEU n 
1 230 SER n 
1 231 ASN n 
1 232 GLU n 
1 233 GLN n 
1 234 VAL n 
1 235 LEU n 
1 236 ARG n 
1 237 PHE n 
1 238 VAL n 
1 239 MET n 
1 240 GLU n 
1 241 GLY n 
1 242 GLY n 
1 243 LEU n 
1 244 LEU n 
1 245 ASP n 
1 246 LYS n 
1 247 PRO n 
1 248 ASP n 
1 249 ASN n 
1 250 CYS n 
1 251 PRO n 
1 252 ASP n 
1 253 MET n 
1 254 LEU n 
1 255 LEU n 
1 256 GLU n 
1 257 LEU n 
1 258 MET n 
1 259 ARG n 
1 260 MET n 
1 261 CYS n 
1 262 TRP n 
1 263 GLN n 
1 264 TYR n 
1 265 ASN n 
1 266 PRO n 
1 267 LYS n 
1 268 MET n 
1 269 ARG n 
1 270 PRO n 
1 271 SER n 
1 272 PHE n 
1 273 LEU n 
1 274 GLU n 
1 275 ILE n 
1 276 ILE n 
1 277 SER n 
1 278 SER n 
1 279 ILE n 
1 280 LYS n 
1 281 GLU n 
1 282 GLU n 
1 283 MET n 
1 284 GLU n 
1 285 PRO n 
1 286 GLY n 
1 287 PHE n 
1 288 ARG n 
1 289 GLU n 
1 290 VAL n 
1 291 SER n 
1 292 PHE n 
1 293 TYR n 
1 294 TYR n 
1 295 SER n 
1 296 GLU n 
1 297 GLU n 
1 298 ASN n 
1 299 LYS n 
2 1   LYS n 
2 2   LYS n 
2 3   LYS n 
2 4   SER n 
2 5   PRO n 
2 6   GLY n 
2 7   GLU n 
2 8   TYR n 
2 9   VAL n 
2 10  ASN n 
2 11  ILE n 
2 12  GLU n 
2 13  PHE n 
2 14  GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'fall armyworm' 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     Spodoptera 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               Sf9 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          baculovirus 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pFast-Bac 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'Chemically synthesized' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP IGF1R_HUMAN 1 
;VPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLG
VVSQGQPTLVIMELMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDF
TVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVME
GGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENK
;
988 P08069 ? 
2 UNP IRS1_HUMAN  2 KSPGEYVNIEFG 891 P35568 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1K3A A 1 ? 299 ? P08069 988 ? 1286 ? 958 1256 
2 2 1K3A B 3 ? 14  ? P35568 891 ? 902  ? 3   14   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1K3A PTR A 174 ? UNP P08069 TYR 1161 'MODIFIED RESIDUE' 1131 1 
1 1K3A PTR A 178 ? UNP P08069 TYR 1165 'MODIFIED RESIDUE' 1135 2 
1 1K3A PTR A 179 ? UNP P08069 TYR 1166 'MODIFIED RESIDUE' 1136 3 
1 1K3A LEU A 255 ? UNP P08069 PHE 1242 VARIANT            1212 4 
2 1K3A LYS B 1   ? UNP P35568 ?   ?    'SEE REMARK 999'   1    5 
2 1K3A LYS B 2   ? UNP P35568 ?   ?    'SEE REMARK 999'   2    6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACP non-polymer         . 'PHOSPHOMETHYLPHOSPHONIC ACID ADENYLATE ESTER' 
;ADENOSINE-5'-[BETA, GAMMA-METHYLENE]TRIPHOSPHATE
;
'C11 H18 N5 O12 P3' 505.208 
ALA 'L-peptide linking' y ALANINE                                        ?                                                  
'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                       ?                                                  
'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                     ?                                                  
'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                ?                                                  
'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                                       ?                                                  
'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                                      ?                                                  
'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                ?                                                  
'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                        ?                                                  
'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                      ?                                                  
'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                          ?                                                  'H2 O' 
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                     ?                                                  
'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                        ?                                                  
'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                         ?                                                  
'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                     ?                                                  
'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                  ?                                                  
'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                        ?                                                  
'C5 H9 N O2'        115.130 
PTR 'L-peptide linking' n O-PHOSPHOTYROSINE                              PHOSPHONOTYROSINE                                  
'C9 H12 N O6 P'     261.168 
SER 'L-peptide linking' y SERINE                                         ?                                                  
'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                      ?                                                  
'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                     ?                                                  
'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                       ?                                                  
'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                         ?                                                  
'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          1K3A 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.90 
_exptl_crystal.density_percent_sol   57.55 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    'PEG 8000, sodium chloride, HEPES, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2001-05-22 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'silicon crystal' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97250 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X4A' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X4A 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97250 
# 
_reflns.entry_id                     1K3A 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.d_resolution_low             28.07 
_reflns.d_resolution_high            2.1 
_reflns.number_obs                   24941 
_reflns.number_all                   24941 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.0480000 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        22.3 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.1 
_reflns_shell.d_res_low              2.18 
_reflns_shell.percent_possible_all   100 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.2540000 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1K3A 
_refine.ls_number_reflns_obs                     24265 
_refine.ls_number_reflns_all                     24265 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               387254.78 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.ls_d_res_low                             28.07 
_refine.ls_d_res_high                            2.10 
_refine.ls_percent_reflns_obs                    99.9 
_refine.ls_R_factor_obs                          0.2120000 
_refine.ls_R_factor_all                          0.2120000 
_refine.ls_R_factor_R_work                       0.2120000 
_refine.ls_R_factor_R_free                       0.2510000 
_refine.ls_R_factor_R_free_error                 0.005 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 9.8 
_refine.ls_number_reflns_R_free                  2381 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               33.9 
_refine.aniso_B[1][1]                            2.00 
_refine.aniso_B[2][2]                            3.88 
_refine.aniso_B[3][3]                            -5.88 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.357892 
_refine.solvent_model_param_bsol                 46.8196 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1ir3 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1K3A 
_refine_analyze.Luzzati_coordinate_error_obs    0.25 
_refine_analyze.Luzzati_sigma_a_obs             0.15 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.31 
_refine_analyze.Luzzati_sigma_a_free            0.21 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2359 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         31 
_refine_hist.number_atoms_solvent             158 
_refine_hist.number_atoms_total               2548 
_refine_hist.d_res_high                       2.10 
_refine_hist.d_res_low                        28.07 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.006 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.3   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 22.0  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.71  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        0.99  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       1.68  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        5.11  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       6.69  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.10 
_refine_ls_shell.d_res_low                        2.23 
_refine_ls_shell.number_reflns_R_work             3533 
_refine_ls_shell.R_factor_R_work                  0.2310000 
_refine_ls_shell.percent_reflns_obs               96.1 
_refine_ls_shell.R_factor_R_free                  0.2750000 
_refine_ls_shell.R_factor_R_free_error            0.014 
_refine_ls_shell.percent_reflns_R_free            9.9 
_refine_ls_shell.number_reflns_R_free             390 
_refine_ls_shell.number_reflns_obs                3533 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM &_1_TOPOLOGY_INFILE_1 'X-RAY DIFFRACTION' 
2 DNA-RNA.PARAM     &_1_TOPOLOGY_INFILE_2 'X-RAY DIFFRACTION' 
3 WATER_REP.PARAM   &_1_TOPOLOGY_INFILE_3 'X-RAY DIFFRACTION' 
4 ION.PARAM         &_1_TOPOLOGY_INFILE_4 'X-RAY DIFFRACTION' 
5 PARAMCSDX.MISC    &_1_TOPOLOGY_INFILE_5 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1K3A 
_struct.title                     'Structure of the Insulin-like Growth Factor 1 Receptor Kinase' 
_struct.pdbx_descriptor           'INSULIN-LIKE GROWTH FACTOR 1 RECEPTOR (E.C.2.7.1.112)/INSULIN RECEPTOR SUBSTRATE-1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1K3A 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            
'protein kinase, tyrosine kinase, tyrosine phosphorylation, protein-substrate complex, Transferase' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               'tetramer of 2 alpha and 2 beta chains linked by disulfide bonds.' 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ALA A 8   ? GLU A 10  ? ALA A 965  GLU A 967  5 ? 3  
HELX_P HELX_P2  2  SER A 53  ? LYS A 68  ? SER A 1010 LYS A 1025 1 ? 16 
HELX_P HELX_P3  3  ASP A 99  ? SER A 106 ? ASP A 1056 SER A 1063 1 ? 8  
HELX_P HELX_P4  4  SER A 121 ? ASN A 142 ? SER A 1078 ASN A 1099 1 ? 22 
HELX_P HELX_P5  5  ALA A 150 ? ARG A 152 ? ALA A 1107 ARG A 1109 5 ? 3  
HELX_P HELX_P6  6  PRO A 188 ? MET A 192 ? PRO A 1145 MET A 1149 5 ? 5  
HELX_P HELX_P7  7  SER A 193 ? GLY A 200 ? SER A 1150 GLY A 1157 1 ? 8  
HELX_P HELX_P8  8  THR A 203 ? THR A 220 ? THR A 1160 THR A 1177 1 ? 18 
HELX_P HELX_P9  9  SER A 230 ? GLU A 240 ? SER A 1187 GLU A 1197 1 ? 11 
HELX_P HELX_P10 10 PRO A 251 ? TRP A 262 ? PRO A 1208 TRP A 1219 1 ? 12 
HELX_P HELX_P11 11 ASN A 265 ? ARG A 269 ? ASN A 1222 ARG A 1226 5 ? 5  
HELX_P HELX_P12 12 SER A 271 ? LYS A 280 ? SER A 1228 LYS A 1237 1 ? 10 
HELX_P HELX_P13 13 GLU A 281 ? MET A 283 ? GLU A 1238 MET A 1240 5 ? 3  
HELX_P HELX_P14 14 GLU A 284 ? PRO A 285 ? GLU A 1241 PRO A 1242 5 ? 2  
HELX_P HELX_P15 15 GLY A 286 ? SER A 291 ? GLY A 1243 SER A 1248 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? A ILE 173 C ? ? ? 1_555 A PTR 174 N ? ? A ILE 1130 A PTR 1131 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale2 covale ? ? A PTR 174 C ? ? ? 1_555 A GLU 175 N ? ? A PTR 1131 A GLU 1132 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale3 covale ? ? A ASP 177 C ? ? ? 1_555 A PTR 178 N ? ? A ASP 1134 A PTR 1135 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale4 covale ? ? A PTR 178 C ? ? ? 1_555 A PTR 179 N ? ? A PTR 1135 A PTR 1136 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale5 covale ? ? A PTR 179 C ? ? ? 1_555 A ARG 180 N ? ? A PTR 1136 A ARG 1137 1_555 ? ? ? ? ? ? ? 1.328 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLN 
_struct_mon_prot_cis.label_seq_id           86 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLN 
_struct_mon_prot_cis.auth_seq_id            1043 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    87 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     1044 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -0.31 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
E ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 12  ? GLN A 20  ? ILE A 969  GLN A 977  
A 2 MET A 25  ? VAL A 35  ? MET A 982  VAL A 992  
A 3 GLU A 38  ? VAL A 48  ? GLU A 995  VAL A 1005 
A 4 THR A 88  ? GLU A 93  ? THR A 1045 GLU A 1050 
A 5 LEU A 78  ? VAL A 82  ? LEU A 1035 VAL A 1039 
B 1 PHE A 144 ? VAL A 145 ? PHE A 1101 VAL A 1102 
B 2 ARG A 171 ? ASP A 172 ? ARG A 1128 ASP A 1129 
C 1 CYS A 154 ? VAL A 156 ? CYS A 1111 VAL A 1113 
C 2 VAL A 162 ? ILE A 164 ? VAL A 1119 ILE A 1121 
D 1 PTR A 179 ? ARG A 180 ? PTR A 1136 ARG A 1137 
D 2 VAL A 201 ? PHE A 202 ? VAL A 1158 PHE A 1159 
E 1 GLY A 183 ? LEU A 187 ? GLY A 1140 LEU A 1144 
E 2 VAL B 9   ? PHE B 13  ? VAL B 9    PHE B 13   
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG A 16  ? N ARG A 973  O GLU A 28  ? O GLU A 985  
A 2 3 N TYR A 27  ? N TYR A 984  O ILE A 45  ? O ILE A 1002 
A 3 4 N ALA A 44  ? N ALA A 1001 O MET A 92  ? O MET A 1049 
A 4 5 O LEU A 89  ? O LEU A 1046 N VAL A 82  ? N VAL A 1039 
B 1 2 N VAL A 145 ? N VAL A 1102 O ARG A 171 ? O ARG A 1128 
C 1 2 N MET A 155 ? N MET A 1112 O LYS A 163 ? O LYS A 1120 
D 1 2 N PTR A 179 ? N PTR A 1136 O PHE A 202 ? O PHE A 1159 
E 1 2 N LEU A 187 ? N LEU A 1144 O VAL B 9   ? O VAL B 9    
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    17 
_struct_site.details              'BINDING SITE FOR RESIDUE ACP A 300' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 17 HOH D .   ? HOH A 67   . ? 1_555 ? 
2  AC1 17 HOH D .   ? HOH A 87   . ? 1_555 ? 
3  AC1 17 HOH D .   ? HOH A 98   . ? 1_555 ? 
4  AC1 17 HOH D .   ? HOH A 101  . ? 1_555 ? 
5  AC1 17 HOH D .   ? HOH A 158  . ? 1_555 ? 
6  AC1 17 HOH D .   ? HOH A 164  . ? 1_555 ? 
7  AC1 17 LEU A 18  ? LEU A 975  . ? 1_555 ? 
8  AC1 17 GLN A 20  ? GLN A 977  . ? 1_555 ? 
9  AC1 17 GLY A 21  ? GLY A 978  . ? 1_555 ? 
10 AC1 17 SER A 22  ? SER A 979  . ? 1_555 ? 
11 AC1 17 VAL A 26  ? VAL A 983  . ? 1_555 ? 
12 AC1 17 ALA A 44  ? ALA A 1001 . ? 1_555 ? 
13 AC1 17 GLU A 93  ? GLU A 1050 . ? 1_555 ? 
14 AC1 17 MET A 95  ? MET A 1052 . ? 1_555 ? 
15 AC1 17 ASN A 153 ? ASN A 1110 . ? 1_555 ? 
16 AC1 17 MET A 155 ? MET A 1112 . ? 1_555 ? 
17 AC1 17 ASP A 166 ? ASP A 1123 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1K3A 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1K3A 
_atom_sites.fract_transf_matrix[1][1]   0.012403 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009008 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010718 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . VAL A 1 1   ? 1.657  20.877 69.207 1.00 51.05 ? 958  VAL A N     1 
ATOM   2    C CA    . VAL A 1 1   ? 1.775  19.689 68.313 1.00 50.75 ? 958  VAL A CA    1 
ATOM   3    C C     . VAL A 1 1   ? 3.224  19.326 67.993 1.00 49.74 ? 958  VAL A C     1 
ATOM   4    O O     . VAL A 1 1   ? 4.136  20.142 68.150 1.00 49.39 ? 958  VAL A O     1 
ATOM   5    C CB    . VAL A 1 1   ? 1.034  19.916 66.988 1.00 51.21 ? 958  VAL A CB    1 
ATOM   6    C CG1   . VAL A 1 1   ? -0.466 19.769 67.197 1.00 51.45 ? 958  VAL A CG1   1 
ATOM   7    C CG2   . VAL A 1 1   ? 1.368  21.292 66.454 1.00 51.73 ? 958  VAL A CG2   1 
ATOM   8    N N     . PRO A 1 2   ? 3.449  18.084 67.536 1.00 48.78 ? 959  PRO A N     1 
ATOM   9    C CA    . PRO A 1 2   ? 4.788  17.601 67.194 1.00 47.74 ? 959  PRO A CA    1 
ATOM   10   C C     . PRO A 1 2   ? 5.419  18.231 65.954 1.00 46.42 ? 959  PRO A C     1 
ATOM   11   O O     . PRO A 1 2   ? 4.728  18.671 65.031 1.00 46.17 ? 959  PRO A O     1 
ATOM   12   C CB    . PRO A 1 2   ? 4.572  16.098 67.028 1.00 47.99 ? 959  PRO A CB    1 
ATOM   13   C CG    . PRO A 1 2   ? 3.190  16.027 66.473 1.00 48.47 ? 959  PRO A CG    1 
ATOM   14   C CD    . PRO A 1 2   ? 2.451  17.013 67.355 1.00 49.08 ? 959  PRO A CD    1 
ATOM   15   N N     . ASP A 1 3   ? 6.746  18.269 65.954 1.00 44.87 ? 960  ASP A N     1 
ATOM   16   C CA    . ASP A 1 3   ? 7.511  18.796 64.836 1.00 43.06 ? 960  ASP A CA    1 
ATOM   17   C C     . ASP A 1 3   ? 7.304  17.778 63.718 1.00 41.33 ? 960  ASP A C     1 
ATOM   18   O O     . ASP A 1 3   ? 7.752  16.635 63.819 1.00 41.18 ? 960  ASP A O     1 
ATOM   19   C CB    . ASP A 1 3   ? 8.986  18.876 65.223 1.00 44.41 ? 960  ASP A CB    1 
ATOM   20   C CG    . ASP A 1 3   ? 9.857  19.411 64.110 1.00 45.65 ? 960  ASP A CG    1 
ATOM   21   O OD1   . ASP A 1 3   ? 11.083 19.504 64.324 1.00 45.96 ? 960  ASP A OD1   1 
ATOM   22   O OD2   . ASP A 1 3   ? 9.321  19.739 63.029 1.00 46.57 ? 960  ASP A OD2   1 
ATOM   23   N N     . GLU A 1 4   ? 6.621  18.193 62.657 1.00 38.80 ? 961  GLU A N     1 
ATOM   24   C CA    . GLU A 1 4   ? 6.329  17.299 61.544 1.00 36.15 ? 961  GLU A CA    1 
ATOM   25   C C     . GLU A 1 4   ? 7.550  16.803 60.784 1.00 34.19 ? 961  GLU A C     1 
ATOM   26   O O     . GLU A 1 4   ? 7.470  15.797 60.087 1.00 33.48 ? 961  GLU A O     1 
ATOM   27   C CB    . GLU A 1 4   ? 5.377  17.979 60.559 1.00 37.39 ? 961  GLU A CB    1 
ATOM   28   C CG    . GLU A 1 4   ? 5.955  19.231 59.949 1.00 37.84 ? 961  GLU A CG    1 
ATOM   29   C CD    . GLU A 1 4   ? 5.185  19.701 58.741 1.00 38.43 ? 961  GLU A CD    1 
ATOM   30   O OE1   . GLU A 1 4   ? 4.860  18.858 57.877 1.00 39.58 ? 961  GLU A OE1   1 
ATOM   31   O OE2   . GLU A 1 4   ? 4.921  20.916 58.645 1.00 36.87 ? 961  GLU A OE2   1 
ATOM   32   N N     . TRP A 1 5   ? 8.674  17.500 60.908 1.00 32.23 ? 962  TRP A N     1 
ATOM   33   C CA    . TRP A 1 5   ? 9.882  17.091 60.198 1.00 31.38 ? 962  TRP A CA    1 
ATOM   34   C C     . TRP A 1 5   ? 10.838 16.206 60.990 1.00 31.67 ? 962  TRP A C     1 
ATOM   35   O O     . TRP A 1 5   ? 11.694 15.540 60.408 1.00 32.08 ? 962  TRP A O     1 
ATOM   36   C CB    . TRP A 1 5   ? 10.635 18.319 59.687 1.00 30.26 ? 962  TRP A CB    1 
ATOM   37   C CG    . TRP A 1 5   ? 9.909  19.018 58.585 1.00 28.44 ? 962  TRP A CG    1 
ATOM   38   C CD1   . TRP A 1 5   ? 9.198  20.174 58.679 1.00 28.49 ? 962  TRP A CD1   1 
ATOM   39   C CD2   . TRP A 1 5   ? 9.791  18.580 57.227 1.00 27.71 ? 962  TRP A CD2   1 
ATOM   40   N NE1   . TRP A 1 5   ? 8.639  20.487 57.461 1.00 28.76 ? 962  TRP A NE1   1 
ATOM   41   C CE2   . TRP A 1 5   ? 8.989  19.525 56.552 1.00 28.16 ? 962  TRP A CE2   1 
ATOM   42   C CE3   . TRP A 1 5   ? 10.289 17.478 56.514 1.00 27.97 ? 962  TRP A CE3   1 
ATOM   43   C CZ2   . TRP A 1 5   ? 8.670  19.406 55.196 1.00 28.47 ? 962  TRP A CZ2   1 
ATOM   44   C CZ3   . TRP A 1 5   ? 9.974  17.358 55.165 1.00 28.60 ? 962  TRP A CZ3   1 
ATOM   45   C CH2   . TRP A 1 5   ? 9.171  18.318 54.519 1.00 28.84 ? 962  TRP A CH2   1 
ATOM   46   N N     . GLU A 1 6   ? 10.692 16.196 62.310 1.00 31.75 ? 963  GLU A N     1 
ATOM   47   C CA    . GLU A 1 6   ? 11.551 15.397 63.180 1.00 32.28 ? 963  GLU A CA    1 
ATOM   48   C C     . GLU A 1 6   ? 11.201 13.914 63.100 1.00 32.12 ? 963  GLU A C     1 
ATOM   49   O O     . GLU A 1 6   ? 10.031 13.548 63.155 1.00 32.21 ? 963  GLU A O     1 
ATOM   50   C CB    . GLU A 1 6   ? 11.407 15.871 64.630 1.00 33.07 ? 963  GLU A CB    1 
ATOM   51   C CG    . GLU A 1 6   ? 12.423 15.282 65.602 1.00 34.64 ? 963  GLU A CG    1 
ATOM   52   C CD    . GLU A 1 6   ? 13.843 15.759 65.322 1.00 35.13 ? 963  GLU A CD    1 
ATOM   53   O OE1   . GLU A 1 6   ? 14.015 16.957 65.035 1.00 34.62 ? 963  GLU A OE1   1 
ATOM   54   O OE2   . GLU A 1 6   ? 14.786 14.944 65.401 1.00 36.29 ? 963  GLU A OE2   1 
ATOM   55   N N     . VAL A 1 7   ? 12.212 13.062 62.967 1.00 31.49 ? 964  VAL A N     1 
ATOM   56   C CA    . VAL A 1 7   ? 11.972 11.625 62.908 1.00 31.57 ? 964  VAL A CA    1 
ATOM   57   C C     . VAL A 1 7   ? 12.844 10.916 63.947 1.00 31.83 ? 964  VAL A C     1 
ATOM   58   O O     . VAL A 1 7   ? 14.001 11.286 64.162 1.00 30.49 ? 964  VAL A O     1 
ATOM   59   C CB    . VAL A 1 7   ? 12.272 11.029 61.493 1.00 31.63 ? 964  VAL A CB    1 
ATOM   60   C CG1   . VAL A 1 7   ? 11.712 11.932 60.407 1.00 31.96 ? 964  VAL A CG1   1 
ATOM   61   C CG2   . VAL A 1 7   ? 13.751 10.823 61.305 1.00 32.42 ? 964  VAL A CG2   1 
ATOM   62   N N     . ALA A 1 8   ? 12.281 9.900  64.596 1.00 32.42 ? 965  ALA A N     1 
ATOM   63   C CA    . ALA A 1 8   ? 13.013 9.142  65.603 1.00 33.36 ? 965  ALA A CA    1 
ATOM   64   C C     . ALA A 1 8   ? 14.172 8.419  64.924 1.00 33.60 ? 965  ALA A C     1 
ATOM   65   O O     . ALA A 1 8   ? 13.985 7.746  63.913 1.00 34.41 ? 965  ALA A O     1 
ATOM   66   C CB    . ALA A 1 8   ? 12.083 8.136  66.285 1.00 34.27 ? 965  ALA A CB    1 
ATOM   67   N N     . ARG A 1 9   ? 15.370 8.564  65.481 1.00 33.82 ? 966  ARG A N     1 
ATOM   68   C CA    . ARG A 1 9   ? 16.561 7.935  64.922 1.00 34.27 ? 966  ARG A CA    1 
ATOM   69   C C     . ARG A 1 9   ? 16.383 6.440  64.638 1.00 35.21 ? 966  ARG A C     1 
ATOM   70   O O     . ARG A 1 9   ? 16.951 5.906  63.683 1.00 34.68 ? 966  ARG A O     1 
ATOM   71   C CB    . ARG A 1 9   ? 17.744 8.137  65.872 1.00 33.86 ? 966  ARG A CB    1 
ATOM   72   C CG    . ARG A 1 9   ? 19.074 7.617  65.340 1.00 34.14 ? 966  ARG A CG    1 
ATOM   73   C CD    . ARG A 1 9   ? 20.191 7.910  66.319 1.00 34.37 ? 966  ARG A CD    1 
ATOM   74   N NE    . ARG A 1 9   ? 20.358 9.346  66.548 1.00 33.10 ? 966  ARG A NE    1 
ATOM   75   C CZ    . ARG A 1 9   ? 20.989 10.167 65.718 1.00 33.10 ? 966  ARG A CZ    1 
ATOM   76   N NH1   . ARG A 1 9   ? 21.522 9.698  64.599 1.00 33.28 ? 966  ARG A NH1   1 
ATOM   77   N NH2   . ARG A 1 9   ? 21.086 11.460 66.004 1.00 31.88 ? 966  ARG A NH2   1 
ATOM   78   N N     . GLU A 1 10  ? 15.590 5.769  65.465 1.00 36.46 ? 967  GLU A N     1 
ATOM   79   C CA    . GLU A 1 10  ? 15.367 4.335  65.311 1.00 38.05 ? 967  GLU A CA    1 
ATOM   80   C C     . GLU A 1 10  ? 14.702 3.945  63.999 1.00 37.79 ? 967  GLU A C     1 
ATOM   81   O O     . GLU A 1 10  ? 14.895 2.831  63.518 1.00 37.62 ? 967  GLU A O     1 
ATOM   82   C CB    . GLU A 1 10  ? 14.534 3.799  66.481 1.00 39.72 ? 967  GLU A CB    1 
ATOM   83   C CG    . GLU A 1 10  ? 15.186 4.009  67.837 1.00 43.28 ? 967  GLU A CG    1 
ATOM   84   C CD    . GLU A 1 10  ? 15.189 5.468  68.267 1.00 45.34 ? 967  GLU A CD    1 
ATOM   85   O OE1   . GLU A 1 10  ? 15.988 5.828  69.163 1.00 47.06 ? 967  GLU A OE1   1 
ATOM   86   O OE2   . GLU A 1 10  ? 14.384 6.251  67.719 1.00 45.65 ? 967  GLU A OE2   1 
ATOM   87   N N     . LYS A 1 11  ? 13.925 4.854  63.420 1.00 37.65 ? 968  LYS A N     1 
ATOM   88   C CA    . LYS A 1 11  ? 13.234 4.563  62.164 1.00 38.34 ? 968  LYS A CA    1 
ATOM   89   C C     . LYS A 1 11  ? 14.100 4.682  60.914 1.00 37.66 ? 968  LYS A C     1 
ATOM   90   O O     . LYS A 1 11  ? 13.614 4.479  59.801 1.00 37.20 ? 968  LYS A O     1 
ATOM   91   C CB    . LYS A 1 11  ? 12.011 5.468  62.020 1.00 38.85 ? 968  LYS A CB    1 
ATOM   92   C CG    . LYS A 1 11  ? 10.955 5.242  63.091 1.00 41.18 ? 968  LYS A CG    1 
ATOM   93   C CD    . LYS A 1 11  ? 9.842  6.269  62.982 1.00 42.35 ? 968  LYS A CD    1 
ATOM   94   C CE    . LYS A 1 11  ? 8.866  6.158  64.142 1.00 44.13 ? 968  LYS A CE    1 
ATOM   95   N NZ    . LYS A 1 11  ? 7.876  7.279  64.136 1.00 45.27 ? 968  LYS A NZ    1 
ATOM   96   N N     . ILE A 1 12  ? 15.377 5.007  61.094 1.00 37.96 ? 969  ILE A N     1 
ATOM   97   C CA    . ILE A 1 12  ? 16.301 5.156  59.971 1.00 37.66 ? 969  ILE A CA    1 
ATOM   98   C C     . ILE A 1 12  ? 17.453 4.159  60.067 1.00 38.02 ? 969  ILE A C     1 
ATOM   99   O O     . ILE A 1 12  ? 18.046 3.996  61.129 1.00 38.38 ? 969  ILE A O     1 
ATOM   100  C CB    . ILE A 1 12  ? 16.897 6.597  59.918 1.00 38.15 ? 969  ILE A CB    1 
ATOM   101  C CG1   . ILE A 1 12  ? 15.826 7.605  59.491 1.00 38.62 ? 969  ILE A CG1   1 
ATOM   102  C CG2   . ILE A 1 12  ? 18.056 6.659  58.935 1.00 37.39 ? 969  ILE A CG2   1 
ATOM   103  C CD1   . ILE A 1 12  ? 14.737 7.817  60.507 1.00 40.32 ? 969  ILE A CD1   1 
ATOM   104  N N     . THR A 1 13  ? 17.767 3.496  58.956 1.00 37.97 ? 970  THR A N     1 
ATOM   105  C CA    . THR A 1 13  ? 18.865 2.530  58.921 1.00 38.62 ? 970  THR A CA    1 
ATOM   106  C C     . THR A 1 13  ? 19.811 2.866  57.773 1.00 38.86 ? 970  THR A C     1 
ATOM   107  O O     . THR A 1 13  ? 19.368 3.223  56.683 1.00 37.49 ? 970  THR A O     1 
ATOM   108  C CB    . THR A 1 13  ? 18.349 1.086  58.727 1.00 39.25 ? 970  THR A CB    1 
ATOM   109  O OG1   . THR A 1 13  ? 17.629 0.997  57.493 1.00 39.66 ? 970  THR A OG1   1 
ATOM   110  C CG2   . THR A 1 13  ? 17.424 0.687  59.871 1.00 39.57 ? 970  THR A CG2   1 
ATOM   111  N N     . MET A 1 14  ? 21.113 2.753  58.022 1.00 40.35 ? 971  MET A N     1 
ATOM   112  C CA    . MET A 1 14  ? 22.114 3.049  57.005 1.00 42.42 ? 971  MET A CA    1 
ATOM   113  C C     . MET A 1 14  ? 22.703 1.779  56.392 1.00 42.91 ? 971  MET A C     1 
ATOM   114  O O     . MET A 1 14  ? 23.467 1.056  57.032 1.00 43.50 ? 971  MET A O     1 
ATOM   115  C CB    . MET A 1 14  ? 23.225 3.917  57.601 1.00 44.50 ? 971  MET A CB    1 
ATOM   116  C CG    . MET A 1 14  ? 22.723 5.271  58.108 1.00 48.53 ? 971  MET A CG    1 
ATOM   117  S SD    . MET A 1 14  ? 23.991 6.326  58.857 1.00 53.04 ? 971  MET A SD    1 
ATOM   118  C CE    . MET A 1 14  ? 23.855 5.859  60.583 1.00 52.56 ? 971  MET A CE    1 
ATOM   119  N N     . SER A 1 15  ? 22.339 1.522  55.140 1.00 42.76 ? 972  SER A N     1 
ATOM   120  C CA    . SER A 1 15  ? 22.794 0.344  54.410 1.00 42.00 ? 972  SER A CA    1 
ATOM   121  C C     . SER A 1 15  ? 24.245 0.440  53.958 1.00 42.00 ? 972  SER A C     1 
ATOM   122  O O     . SER A 1 15  ? 25.031 -0.479 54.182 1.00 42.88 ? 972  SER A O     1 
ATOM   123  C CB    . SER A 1 15  ? 21.903 0.120  53.192 1.00 41.59 ? 972  SER A CB    1 
ATOM   124  O OG    . SER A 1 15  ? 20.536 0.149  53.558 1.00 40.07 ? 972  SER A OG    1 
ATOM   125  N N     . ARG A 1 16  ? 24.608 1.547  53.323 1.00 41.35 ? 973  ARG A N     1 
ATOM   126  C CA    . ARG A 1 16  ? 25.973 1.707  52.849 1.00 40.60 ? 973  ARG A CA    1 
ATOM   127  C C     . ARG A 1 16  ? 26.315 3.167  52.584 1.00 40.77 ? 973  ARG A C     1 
ATOM   128  O O     . ARG A 1 16  ? 25.434 4.029  52.558 1.00 40.69 ? 973  ARG A O     1 
ATOM   129  C CB    . ARG A 1 16  ? 26.174 0.886  51.571 1.00 40.64 ? 973  ARG A CB    1 
ATOM   130  C CG    . ARG A 1 16  ? 25.340 1.360  50.393 1.00 41.00 ? 973  ARG A CG    1 
ATOM   131  C CD    . ARG A 1 16  ? 25.292 0.318  49.280 1.00 41.18 ? 973  ARG A CD    1 
ATOM   132  N NE    . ARG A 1 16  ? 24.550 0.799  48.118 1.00 40.75 ? 973  ARG A NE    1 
ATOM   133  C CZ    . ARG A 1 16  ? 25.023 1.684  47.246 1.00 41.48 ? 973  ARG A CZ    1 
ATOM   134  N NH1   . ARG A 1 16  ? 26.242 2.183  47.399 1.00 41.63 ? 973  ARG A NH1   1 
ATOM   135  N NH2   . ARG A 1 16  ? 24.273 2.077  46.225 1.00 41.21 ? 973  ARG A NH2   1 
ATOM   136  N N     . GLU A 1 17  ? 27.600 3.438  52.387 1.00 40.00 ? 974  GLU A N     1 
ATOM   137  C CA    . GLU A 1 17  ? 28.053 4.795  52.122 1.00 40.68 ? 974  GLU A CA    1 
ATOM   138  C C     . GLU A 1 17  ? 27.873 5.141  50.651 1.00 40.66 ? 974  GLU A C     1 
ATOM   139  O O     . GLU A 1 17  ? 28.006 4.281  49.781 1.00 39.97 ? 974  GLU A O     1 
ATOM   140  C CB    . GLU A 1 17  ? 29.531 4.953  52.483 1.00 40.54 ? 974  GLU A CB    1 
ATOM   141  C CG    . GLU A 1 17  ? 29.936 4.327  53.800 1.00 41.79 ? 974  GLU A CG    1 
ATOM   142  C CD    . GLU A 1 17  ? 31.352 4.701  54.202 1.00 43.69 ? 974  GLU A CD    1 
ATOM   143  O OE1   . GLU A 1 17  ? 32.164 5.011  53.303 1.00 44.22 ? 974  GLU A OE1   1 
ATOM   144  O OE2   . GLU A 1 17  ? 31.655 4.675  55.417 1.00 44.24 ? 974  GLU A OE2   1 
ATOM   145  N N     . LEU A 1 18  ? 27.572 6.408  50.381 1.00 40.52 ? 975  LEU A N     1 
ATOM   146  C CA    . LEU A 1 18  ? 27.398 6.885  49.016 1.00 40.32 ? 975  LEU A CA    1 
ATOM   147  C C     . LEU A 1 18  ? 28.586 7.760  48.656 1.00 41.01 ? 975  LEU A C     1 
ATOM   148  O O     . LEU A 1 18  ? 29.071 7.733  47.525 1.00 41.29 ? 975  LEU A O     1 
ATOM   149  C CB    . LEU A 1 18  ? 26.104 7.693  48.886 1.00 39.38 ? 975  LEU A CB    1 
ATOM   150  C CG    . LEU A 1 18  ? 24.799 6.896  48.896 1.00 38.21 ? 975  LEU A CG    1 
ATOM   151  C CD1   . LEU A 1 18  ? 23.611 7.840  48.828 1.00 37.29 ? 975  LEU A CD1   1 
ATOM   152  C CD2   . LEU A 1 18  ? 24.790 5.944  47.713 1.00 38.39 ? 975  LEU A CD2   1 
ATOM   153  N N     . GLY A 1 19  ? 29.052 8.534  49.631 1.00 41.22 ? 976  GLY A N     1 
ATOM   154  C CA    . GLY A 1 19  ? 30.187 9.410  49.402 1.00 41.29 ? 976  GLY A CA    1 
ATOM   155  C C     . GLY A 1 19  ? 30.262 10.540 50.413 1.00 41.93 ? 976  GLY A C     1 
ATOM   156  O O     . GLY A 1 19  ? 29.277 10.850 51.095 1.00 41.26 ? 976  GLY A O     1 
ATOM   157  N N     . GLN A 1 20  ? 31.432 11.160 50.509 1.00 41.62 ? 977  GLN A N     1 
ATOM   158  C CA    . GLN A 1 20  ? 31.643 12.260 51.444 1.00 42.16 ? 977  GLN A CA    1 
ATOM   159  C C     . GLN A 1 20  ? 30.937 13.524 50.956 1.00 42.04 ? 977  GLN A C     1 
ATOM   160  O O     . GLN A 1 20  ? 31.020 13.868 49.775 1.00 41.71 ? 977  GLN A O     1 
ATOM   161  C CB    . GLN A 1 20  ? 33.141 12.540 51.599 1.00 42.98 ? 977  GLN A CB    1 
ATOM   162  C CG    . GLN A 1 20  ? 33.478 13.479 52.749 1.00 44.48 ? 977  GLN A CG    1 
ATOM   163  C CD    . GLN A 1 20  ? 33.309 12.823 54.112 1.00 45.05 ? 977  GLN A CD    1 
ATOM   164  O OE1   . GLN A 1 20  ? 33.205 13.503 55.134 1.00 46.30 ? 977  GLN A OE1   1 
ATOM   165  N NE2   . GLN A 1 20  ? 33.293 11.498 54.132 1.00 45.57 ? 977  GLN A NE2   1 
ATOM   166  N N     . GLY A 1 21  ? 30.245 14.210 51.866 1.00 41.93 ? 978  GLY A N     1 
ATOM   167  C CA    . GLY A 1 21  ? 29.541 15.431 51.504 1.00 42.28 ? 978  GLY A CA    1 
ATOM   168  C C     . GLY A 1 21  ? 30.184 16.700 52.048 1.00 42.84 ? 978  GLY A C     1 
ATOM   169  O O     . GLY A 1 21  ? 31.322 16.681 52.515 1.00 41.43 ? 978  GLY A O     1 
ATOM   170  N N     . SER A 1 22  ? 29.454 17.813 51.987 1.00 43.33 ? 979  SER A N     1 
ATOM   171  C CA    . SER A 1 22  ? 29.958 19.093 52.484 1.00 43.50 ? 979  SER A CA    1 
ATOM   172  C C     . SER A 1 22  ? 30.268 19.080 53.971 1.00 43.21 ? 979  SER A C     1 
ATOM   173  O O     . SER A 1 22  ? 31.335 19.535 54.384 1.00 43.12 ? 979  SER A O     1 
ATOM   174  C CB    . SER A 1 22  ? 28.953 20.211 52.217 1.00 43.90 ? 979  SER A CB    1 
ATOM   175  O OG    . SER A 1 22  ? 28.965 20.588 50.856 1.00 44.70 ? 979  SER A OG    1 
ATOM   176  N N     . PHE A 1 23  ? 29.338 18.562 54.771 1.00 42.89 ? 980  PHE A N     1 
ATOM   177  C CA    . PHE A 1 23  ? 29.519 18.531 56.222 1.00 42.39 ? 980  PHE A CA    1 
ATOM   178  C C     . PHE A 1 23  ? 29.767 17.141 56.813 1.00 40.83 ? 980  PHE A C     1 
ATOM   179  O O     . PHE A 1 23  ? 30.003 17.005 58.017 1.00 40.68 ? 980  PHE A O     1 
ATOM   180  C CB    . PHE A 1 23  ? 28.300 19.156 56.921 1.00 43.82 ? 980  PHE A CB    1 
ATOM   181  C CG    . PHE A 1 23  ? 27.806 20.426 56.281 1.00 44.33 ? 980  PHE A CG    1 
ATOM   182  C CD1   . PHE A 1 23  ? 26.983 20.379 55.159 1.00 44.33 ? 980  PHE A CD1   1 
ATOM   183  C CD2   . PHE A 1 23  ? 28.171 21.668 56.791 1.00 44.40 ? 980  PHE A CD2   1 
ATOM   184  C CE1   . PHE A 1 23  ? 26.530 21.554 54.554 1.00 44.99 ? 980  PHE A CE1   1 
ATOM   185  C CE2   . PHE A 1 23  ? 27.724 22.845 56.194 1.00 44.26 ? 980  PHE A CE2   1 
ATOM   186  C CZ    . PHE A 1 23  ? 26.903 22.787 55.074 1.00 44.30 ? 980  PHE A CZ    1 
ATOM   187  N N     . GLY A 1 24  ? 29.714 16.110 55.977 1.00 39.45 ? 981  GLY A N     1 
ATOM   188  C CA    . GLY A 1 24  ? 29.929 14.764 56.475 1.00 37.15 ? 981  GLY A CA    1 
ATOM   189  C C     . GLY A 1 24  ? 29.562 13.686 55.470 1.00 36.28 ? 981  GLY A C     1 
ATOM   190  O O     . GLY A 1 24  ? 29.126 13.976 54.355 1.00 35.30 ? 981  GLY A O     1 
ATOM   191  N N     . MET A 1 25  ? 29.739 12.436 55.880 1.00 34.55 ? 982  MET A N     1 
ATOM   192  C CA    . MET A 1 25  ? 29.449 11.291 55.033 1.00 35.08 ? 982  MET A CA    1 
ATOM   193  C C     . MET A 1 25  ? 27.967 11.149 54.704 1.00 34.10 ? 982  MET A C     1 
ATOM   194  O O     . MET A 1 25  ? 27.105 11.301 55.578 1.00 33.48 ? 982  MET A O     1 
ATOM   195  C CB    . MET A 1 25  ? 29.942 10.011 55.715 1.00 36.21 ? 982  MET A CB    1 
ATOM   196  C CG    . MET A 1 25  ? 29.634 8.720  54.956 1.00 38.11 ? 982  MET A CG    1 
ATOM   197  S SD    . MET A 1 25  ? 30.444 8.608  53.343 1.00 41.33 ? 982  MET A SD    1 
ATOM   198  C CE    . MET A 1 25  ? 32.134 8.320  53.845 1.00 40.06 ? 982  MET A CE    1 
ATOM   199  N N     . VAL A 1 26  ? 27.685 10.859 53.435 1.00 32.54 ? 983  VAL A N     1 
ATOM   200  C CA    . VAL A 1 26  ? 26.320 10.647 52.964 1.00 31.45 ? 983  VAL A CA    1 
ATOM   201  C C     . VAL A 1 26  ? 26.132 9.139  52.773 1.00 31.57 ? 983  VAL A C     1 
ATOM   202  O O     . VAL A 1 26  ? 26.961 8.483  52.140 1.00 31.63 ? 983  VAL A O     1 
ATOM   203  C CB    . VAL A 1 26  ? 26.066 11.336 51.611 1.00 30.70 ? 983  VAL A CB    1 
ATOM   204  C CG1   . VAL A 1 26  ? 24.605 11.156 51.208 1.00 30.44 ? 983  VAL A CG1   1 
ATOM   205  C CG2   . VAL A 1 26  ? 26.425 12.808 51.697 1.00 30.70 ? 983  VAL A CG2   1 
ATOM   206  N N     . TYR A 1 27  ? 25.047 8.595  53.315 1.00 31.70 ? 984  TYR A N     1 
ATOM   207  C CA    . TYR A 1 27  ? 24.771 7.164  53.210 1.00 32.41 ? 984  TYR A CA    1 
ATOM   208  C C     . TYR A 1 27  ? 23.450 6.882  52.510 1.00 32.54 ? 984  TYR A C     1 
ATOM   209  O O     . TYR A 1 27  ? 22.579 7.748  52.441 1.00 32.44 ? 984  TYR A O     1 
ATOM   210  C CB    . TYR A 1 27  ? 24.658 6.532  54.597 1.00 33.06 ? 984  TYR A CB    1 
ATOM   211  C CG    . TYR A 1 27  ? 25.831 6.732  55.519 1.00 36.00 ? 984  TYR A CG    1 
ATOM   212  C CD1   . TYR A 1 27  ? 26.921 5.862  55.499 1.00 36.89 ? 984  TYR A CD1   1 
ATOM   213  C CD2   . TYR A 1 27  ? 25.827 7.764  56.457 1.00 36.24 ? 984  TYR A CD2   1 
ATOM   214  C CE1   . TYR A 1 27  ? 27.976 6.011  56.403 1.00 38.07 ? 984  TYR A CE1   1 
ATOM   215  C CE2   . TYR A 1 27  ? 26.870 7.923  57.359 1.00 38.11 ? 984  TYR A CE2   1 
ATOM   216  C CZ    . TYR A 1 27  ? 27.937 7.043  57.331 1.00 38.31 ? 984  TYR A CZ    1 
ATOM   217  O OH    . TYR A 1 27  ? 28.947 7.191  58.251 1.00 40.27 ? 984  TYR A OH    1 
ATOM   218  N N     . GLU A 1 28  ? 23.310 5.663  51.993 1.00 31.06 ? 985  GLU A N     1 
ATOM   219  C CA    . GLU A 1 28  ? 22.060 5.241  51.383 1.00 30.67 ? 985  GLU A CA    1 
ATOM   220  C C     . GLU A 1 28  ? 21.442 4.380  52.469 1.00 29.63 ? 985  GLU A C     1 
ATOM   221  O O     . GLU A 1 28  ? 22.153 3.648  53.156 1.00 29.69 ? 985  GLU A O     1 
ATOM   222  C CB    . GLU A 1 28  ? 22.271 4.375  50.144 1.00 31.31 ? 985  GLU A CB    1 
ATOM   223  C CG    . GLU A 1 28  ? 20.945 4.045  49.462 1.00 33.99 ? 985  GLU A CG    1 
ATOM   224  C CD    . GLU A 1 28  ? 21.046 2.920  48.449 1.00 34.56 ? 985  GLU A CD    1 
ATOM   225  O OE1   . GLU A 1 28  ? 21.997 2.922  47.642 1.00 34.97 ? 985  GLU A OE1   1 
ATOM   226  O OE2   . GLU A 1 28  ? 20.159 2.039  48.456 1.00 35.98 ? 985  GLU A OE2   1 
ATOM   227  N N     . GLY A 1 29  ? 20.131 4.460  52.634 1.00 28.39 ? 986  GLY A N     1 
ATOM   228  C CA    . GLY A 1 29  ? 19.496 3.669  53.666 1.00 27.98 ? 986  GLY A CA    1 
ATOM   229  C C     . GLY A 1 29  ? 18.004 3.549  53.472 1.00 28.55 ? 986  GLY A C     1 
ATOM   230  O O     . GLY A 1 29  ? 17.493 3.719  52.362 1.00 27.70 ? 986  GLY A O     1 
ATOM   231  N N     . VAL A 1 30  ? 17.307 3.260  54.568 1.00 28.71 ? 987  VAL A N     1 
ATOM   232  C CA    . VAL A 1 30  ? 15.861 3.096  54.565 1.00 29.21 ? 987  VAL A CA    1 
ATOM   233  C C     . VAL A 1 30  ? 15.253 3.807  55.772 1.00 30.19 ? 987  VAL A C     1 
ATOM   234  O O     . VAL A 1 30  ? 15.840 3.815  56.854 1.00 29.93 ? 987  VAL A O     1 
ATOM   235  C CB    . VAL A 1 30  ? 15.491 1.597  54.627 1.00 29.24 ? 987  VAL A CB    1 
ATOM   236  C CG1   . VAL A 1 30  ? 13.995 1.428  54.856 1.00 29.21 ? 987  VAL A CG1   1 
ATOM   237  C CG2   . VAL A 1 30  ? 15.922 0.908  53.341 1.00 28.19 ? 987  VAL A CG2   1 
ATOM   238  N N     . ALA A 1 31  ? 14.079 4.400  55.582 1.00 32.14 ? 988  ALA A N     1 
ATOM   239  C CA    . ALA A 1 31  ? 13.392 5.102  56.658 1.00 33.84 ? 988  ALA A CA    1 
ATOM   240  C C     . ALA A 1 31  ? 11.932 4.667  56.717 1.00 35.57 ? 988  ALA A C     1 
ATOM   241  O O     . ALA A 1 31  ? 11.296 4.487  55.684 1.00 36.23 ? 988  ALA A O     1 
ATOM   242  C CB    . ALA A 1 31  ? 13.482 6.605  56.438 1.00 33.15 ? 988  ALA A CB    1 
ATOM   243  N N     . LYS A 1 32  ? 11.405 4.502  57.927 1.00 37.47 ? 989  LYS A N     1 
ATOM   244  C CA    . LYS A 1 32  ? 10.016 4.087  58.110 1.00 39.73 ? 989  LYS A CA    1 
ATOM   245  C C     . LYS A 1 32  ? 9.055  5.244  58.382 1.00 40.95 ? 989  LYS A C     1 
ATOM   246  O O     . LYS A 1 32  ? 9.371  6.177  59.123 1.00 41.21 ? 989  LYS A O     1 
ATOM   247  C CB    . LYS A 1 32  ? 9.909  3.082  59.260 1.00 40.71 ? 989  LYS A CB    1 
ATOM   248  C CG    . LYS A 1 32  ? 10.467 1.702  58.950 1.00 42.22 ? 989  LYS A CG    1 
ATOM   249  C CD    . LYS A 1 32  ? 10.319 0.785  60.155 1.00 43.91 ? 989  LYS A CD    1 
ATOM   250  C CE    . LYS A 1 32  ? 10.635 -0.662 59.800 1.00 45.22 ? 989  LYS A CE    1 
ATOM   251  N NZ    . LYS A 1 32  ? 11.999 -0.809 59.218 1.00 45.44 ? 989  LYS A NZ    1 
ATOM   252  N N     . GLY A 1 33  ? 7.879  5.165  57.770 1.00 41.88 ? 990  GLY A N     1 
ATOM   253  C CA    . GLY A 1 33  ? 6.853  6.175  57.956 1.00 43.74 ? 990  GLY A CA    1 
ATOM   254  C C     . GLY A 1 33  ? 7.153  7.618  57.587 1.00 44.47 ? 990  GLY A C     1 
ATOM   255  O O     . GLY A 1 33  ? 6.676  8.527  58.264 1.00 45.15 ? 990  GLY A O     1 
ATOM   256  N N     . VAL A 1 34  ? 7.922  7.853  56.529 1.00 44.93 ? 991  VAL A N     1 
ATOM   257  C CA    . VAL A 1 34  ? 8.216  9.229  56.136 1.00 45.75 ? 991  VAL A CA    1 
ATOM   258  C C     . VAL A 1 34  ? 7.382  9.646  54.933 1.00 46.91 ? 991  VAL A C     1 
ATOM   259  O O     . VAL A 1 34  ? 7.274  10.834 54.622 1.00 46.90 ? 991  VAL A O     1 
ATOM   260  C CB    . VAL A 1 34  ? 9.715  9.436  55.811 1.00 45.26 ? 991  VAL A CB    1 
ATOM   261  C CG1   . VAL A 1 34  ? 10.539 9.290  57.080 1.00 44.24 ? 991  VAL A CG1   1 
ATOM   262  C CG2   . VAL A 1 34  ? 10.168 8.444  54.748 1.00 44.41 ? 991  VAL A CG2   1 
ATOM   263  N N     . VAL A 1 35  ? 6.795  8.665  54.258 1.00 47.70 ? 992  VAL A N     1 
ATOM   264  C CA    . VAL A 1 35  ? 5.949  8.937  53.105 1.00 49.09 ? 992  VAL A CA    1 
ATOM   265  C C     . VAL A 1 35  ? 4.592  8.293  53.344 1.00 49.93 ? 992  VAL A C     1 
ATOM   266  O O     . VAL A 1 35  ? 4.509  7.180  53.857 1.00 49.76 ? 992  VAL A O     1 
ATOM   267  C CB    . VAL A 1 35  ? 6.563  8.375  51.806 1.00 49.34 ? 992  VAL A CB    1 
ATOM   268  C CG1   . VAL A 1 35  ? 5.590  8.550  50.648 1.00 49.21 ? 992  VAL A CG1   1 
ATOM   269  C CG2   . VAL A 1 35  ? 7.871  9.092  51.503 1.00 49.10 ? 992  VAL A CG2   1 
ATOM   270  N N     . LYS A 1 36  ? 3.532  9.002  52.974 1.00 51.29 ? 993  LYS A N     1 
ATOM   271  C CA    . LYS A 1 36  ? 2.171  8.507  53.153 1.00 52.83 ? 993  LYS A CA    1 
ATOM   272  C C     . LYS A 1 36  ? 1.943  7.189  52.424 1.00 53.65 ? 993  LYS A C     1 
ATOM   273  O O     . LYS A 1 36  ? 2.507  6.953  51.357 1.00 54.07 ? 993  LYS A O     1 
ATOM   274  C CB    . LYS A 1 36  ? 1.163  9.545  52.653 1.00 51.97 ? 993  LYS A CB    1 
ATOM   275  N N     . ASP A 1 37  ? 1.112  6.333  53.010 1.00 54.94 ? 994  ASP A N     1 
ATOM   276  C CA    . ASP A 1 37  ? 0.786  5.042  52.412 1.00 55.97 ? 994  ASP A CA    1 
ATOM   277  C C     . ASP A 1 37  ? 2.040  4.267  52.034 1.00 55.80 ? 994  ASP A C     1 
ATOM   278  O O     . ASP A 1 37  ? 2.005  3.410  51.149 1.00 56.16 ? 994  ASP A O     1 
ATOM   279  C CB    . ASP A 1 37  ? -0.069 5.249  51.159 1.00 57.48 ? 994  ASP A CB    1 
ATOM   280  C CG    . ASP A 1 37  ? -1.325 6.051  51.435 1.00 59.05 ? 994  ASP A CG    1 
ATOM   281  O OD1   . ASP A 1 37  ? -2.045 6.372  50.463 1.00 60.59 ? 994  ASP A OD1   1 
ATOM   282  O OD2   . ASP A 1 37  ? -1.592 6.358  52.618 1.00 59.61 ? 994  ASP A OD2   1 
ATOM   283  N N     . GLU A 1 38  ? 3.147  4.566  52.702 1.00 55.41 ? 995  GLU A N     1 
ATOM   284  C CA    . GLU A 1 38  ? 4.403  3.893  52.404 1.00 54.70 ? 995  GLU A CA    1 
ATOM   285  C C     . GLU A 1 38  ? 5.076  3.466  53.706 1.00 54.06 ? 995  GLU A C     1 
ATOM   286  O O     . GLU A 1 38  ? 5.589  4.302  54.451 1.00 54.34 ? 995  GLU A O     1 
ATOM   287  C CB    . GLU A 1 38  ? 5.304  4.841  51.606 1.00 55.09 ? 995  GLU A CB    1 
ATOM   288  C CG    . GLU A 1 38  ? 6.446  4.174  50.865 1.00 55.71 ? 995  GLU A CG    1 
ATOM   289  C CD    . GLU A 1 38  ? 7.075  5.092  49.824 1.00 56.21 ? 995  GLU A CD    1 
ATOM   290  O OE1   . GLU A 1 38  ? 6.359  5.511  48.888 1.00 56.04 ? 995  GLU A OE1   1 
ATOM   291  O OE2   . GLU A 1 38  ? 8.281  5.397  49.941 1.00 55.75 ? 995  GLU A OE2   1 
ATOM   292  N N     . PRO A 1 39  ? 5.069  2.151  54.002 1.00 53.12 ? 996  PRO A N     1 
ATOM   293  C CA    . PRO A 1 39  ? 5.674  1.594  55.219 1.00 51.72 ? 996  PRO A CA    1 
ATOM   294  C C     . PRO A 1 39  ? 7.099  2.092  55.421 1.00 50.02 ? 996  PRO A C     1 
ATOM   295  O O     . PRO A 1 39  ? 7.408  2.740  56.423 1.00 50.22 ? 996  PRO A O     1 
ATOM   296  C CB    . PRO A 1 39  ? 5.616  0.088  54.971 1.00 51.90 ? 996  PRO A CB    1 
ATOM   297  C CG    . PRO A 1 39  ? 4.364  -0.061 54.169 1.00 52.61 ? 996  PRO A CG    1 
ATOM   298  C CD    . PRO A 1 39  ? 4.482  1.078  53.178 1.00 53.04 ? 996  PRO A CD    1 
ATOM   299  N N     . GLU A 1 40  ? 7.963  1.783  54.462 1.00 47.90 ? 997  GLU A N     1 
ATOM   300  C CA    . GLU A 1 40  ? 9.351  2.214  54.522 1.00 45.91 ? 997  GLU A CA    1 
ATOM   301  C C     . GLU A 1 40  ? 9.720  2.860  53.191 1.00 43.19 ? 997  GLU A C     1 
ATOM   302  O O     . GLU A 1 40  ? 9.071  2.611  52.178 1.00 43.01 ? 997  GLU A O     1 
ATOM   303  C CB    . GLU A 1 40  ? 10.265 1.023  54.817 1.00 47.52 ? 997  GLU A CB    1 
ATOM   304  C CG    . GLU A 1 40  ? 10.274 -0.047 53.742 1.00 49.68 ? 997  GLU A CG    1 
ATOM   305  C CD    . GLU A 1 40  ? 11.183 -1.212 54.099 1.00 51.52 ? 997  GLU A CD    1 
ATOM   306  O OE1   . GLU A 1 40  ? 11.441 -2.064 53.219 1.00 51.66 ? 997  GLU A OE1   1 
ATOM   307  O OE2   . GLU A 1 40  ? 11.635 -1.274 55.265 1.00 52.37 ? 997  GLU A OE2   1 
ATOM   308  N N     . THR A 1 41  ? 10.759 3.688  53.194 1.00 40.04 ? 998  THR A N     1 
ATOM   309  C CA    . THR A 1 41  ? 11.183 4.383  51.983 1.00 36.94 ? 998  THR A CA    1 
ATOM   310  C C     . THR A 1 41  ? 12.705 4.402  51.848 1.00 35.09 ? 998  THR A C     1 
ATOM   311  O O     . THR A 1 41  ? 13.419 4.554  52.834 1.00 34.34 ? 998  THR A O     1 
ATOM   312  C CB    . THR A 1 41  ? 10.679 5.852  51.993 1.00 36.96 ? 998  THR A CB    1 
ATOM   313  O OG1   . THR A 1 41  ? 9.257  5.876  52.193 1.00 35.71 ? 998  THR A OG1   1 
ATOM   314  C CG2   . THR A 1 41  ? 11.024 6.557  50.678 1.00 35.95 ? 998  THR A CG2   1 
ATOM   315  N N     . ARG A 1 42  ? 13.195 4.241  50.623 1.00 33.08 ? 999  ARG A N     1 
ATOM   316  C CA    . ARG A 1 42  ? 14.628 4.282  50.375 1.00 31.04 ? 999  ARG A CA    1 
ATOM   317  C C     . ARG A 1 42  ? 15.019 5.748  50.472 1.00 30.15 ? 999  ARG A C     1 
ATOM   318  O O     . ARG A 1 42  ? 14.330 6.619  49.938 1.00 30.07 ? 999  ARG A O     1 
ATOM   319  C CB    . ARG A 1 42  ? 14.951 3.734  48.991 1.00 30.92 ? 999  ARG A CB    1 
ATOM   320  C CG    . ARG A 1 42  ? 14.590 2.259  48.825 1.00 30.29 ? 999  ARG A CG    1 
ATOM   321  C CD    . ARG A 1 42  ? 15.050 1.751  47.479 1.00 28.63 ? 999  ARG A CD    1 
ATOM   322  N NE    . ARG A 1 42  ? 16.503 1.802  47.337 1.00 26.75 ? 999  ARG A NE    1 
ATOM   323  C CZ    . ARG A 1 42  ? 17.137 1.633  46.180 1.00 27.18 ? 999  ARG A CZ    1 
ATOM   324  N NH1   . ARG A 1 42  ? 16.437 1.405  45.074 1.00 27.39 ? 999  ARG A NH1   1 
ATOM   325  N NH2   . ARG A 1 42  ? 18.463 1.702  46.122 1.00 26.05 ? 999  ARG A NH2   1 
ATOM   326  N N     . VAL A 1 43  ? 16.123 6.026  51.148 1.00 28.18 ? 1000 VAL A N     1 
ATOM   327  C CA    . VAL A 1 43  ? 16.531 7.403  51.335 1.00 26.85 ? 1000 VAL A CA    1 
ATOM   328  C C     . VAL A 1 43  ? 18.030 7.618  51.271 1.00 26.53 ? 1000 VAL A C     1 
ATOM   329  O O     . VAL A 1 43  ? 18.820 6.676  51.341 1.00 25.04 ? 1000 VAL A O     1 
ATOM   330  C CB    . VAL A 1 43  ? 16.056 7.918  52.714 1.00 25.84 ? 1000 VAL A CB    1 
ATOM   331  C CG1   . VAL A 1 43  ? 14.544 7.838  52.816 1.00 25.72 ? 1000 VAL A CG1   1 
ATOM   332  C CG2   . VAL A 1 43  ? 16.701 7.081  53.824 1.00 26.38 ? 1000 VAL A CG2   1 
ATOM   333  N N     . ALA A 1 44  ? 18.401 8.885  51.129 1.00 25.56 ? 1001 ALA A N     1 
ATOM   334  C CA    . ALA A 1 44  ? 19.788 9.293  51.131 1.00 26.45 ? 1001 ALA A CA    1 
ATOM   335  C C     . ALA A 1 44  ? 19.913 9.884  52.537 1.00 27.13 ? 1001 ALA A C     1 
ATOM   336  O O     . ALA A 1 44  ? 19.026 10.607 52.992 1.00 28.04 ? 1001 ALA A O     1 
ATOM   337  C CB    . ALA A 1 44  ? 20.035 10.355 50.069 1.00 26.46 ? 1001 ALA A CB    1 
ATOM   338  N N     . ILE A 1 45  ? 20.994 9.575  53.235 1.00 27.93 ? 1002 ILE A N     1 
ATOM   339  C CA    . ILE A 1 45  ? 21.163 10.076 54.594 1.00 28.34 ? 1002 ILE A CA    1 
ATOM   340  C C     . ILE A 1 45  ? 22.404 10.941 54.690 1.00 28.81 ? 1002 ILE A C     1 
ATOM   341  O O     . ILE A 1 45  ? 23.526 10.434 54.632 1.00 28.83 ? 1002 ILE A O     1 
ATOM   342  C CB    . ILE A 1 45  ? 21.282 8.913  55.604 1.00 28.26 ? 1002 ILE A CB    1 
ATOM   343  C CG1   . ILE A 1 45  ? 20.051 8.012  55.499 1.00 27.61 ? 1002 ILE A CG1   1 
ATOM   344  C CG2   . ILE A 1 45  ? 21.418 9.460  57.022 1.00 28.65 ? 1002 ILE A CG2   1 
ATOM   345  C CD1   . ILE A 1 45  ? 20.205 6.670  56.181 1.00 28.21 ? 1002 ILE A CD1   1 
ATOM   346  N N     . LYS A 1 46  ? 22.193 12.247 54.829 1.00 27.96 ? 1003 LYS A N     1 
ATOM   347  C CA    . LYS A 1 46  ? 23.292 13.195 54.952 1.00 29.44 ? 1003 LYS A CA    1 
ATOM   348  C C     . LYS A 1 46  ? 23.563 13.427 56.433 1.00 29.61 ? 1003 LYS A C     1 
ATOM   349  O O     . LYS A 1 46  ? 22.646 13.722 57.201 1.00 28.96 ? 1003 LYS A O     1 
ATOM   350  C CB    . LYS A 1 46  ? 22.925 14.514 54.280 1.00 30.74 ? 1003 LYS A CB    1 
ATOM   351  C CG    . LYS A 1 46  ? 22.380 14.347 52.869 1.00 33.46 ? 1003 LYS A CG    1 
ATOM   352  C CD    . LYS A 1 46  ? 22.359 15.669 52.130 1.00 35.48 ? 1003 LYS A CD    1 
ATOM   353  C CE    . LYS A 1 46  ? 23.769 16.215 51.972 1.00 36.55 ? 1003 LYS A CE    1 
ATOM   354  N NZ    . LYS A 1 46  ? 23.797 17.520 51.249 1.00 37.55 ? 1003 LYS A NZ    1 
ATOM   355  N N     . THR A 1 47  ? 24.824 13.299 56.829 1.00 29.25 ? 1004 THR A N     1 
ATOM   356  C CA    . THR A 1 47  ? 25.199 13.476 58.225 1.00 31.12 ? 1004 THR A CA    1 
ATOM   357  C C     . THR A 1 47  ? 26.189 14.623 58.442 1.00 33.55 ? 1004 THR A C     1 
ATOM   358  O O     . THR A 1 47  ? 26.832 15.105 57.505 1.00 32.47 ? 1004 THR A O     1 
ATOM   359  C CB    . THR A 1 47  ? 25.858 12.198 58.780 1.00 30.01 ? 1004 THR A CB    1 
ATOM   360  O OG1   . THR A 1 47  ? 27.206 12.118 58.303 1.00 27.44 ? 1004 THR A OG1   1 
ATOM   361  C CG2   . THR A 1 47  ? 25.110 10.963 58.310 1.00 28.47 ? 1004 THR A CG2   1 
ATOM   362  N N     . VAL A 1 48  ? 26.302 15.053 59.696 1.00 36.03 ? 1005 VAL A N     1 
ATOM   363  C CA    . VAL A 1 48  ? 27.241 16.102 60.068 1.00 38.67 ? 1005 VAL A CA    1 
ATOM   364  C C     . VAL A 1 48  ? 28.238 15.463 61.029 1.00 40.30 ? 1005 VAL A C     1 
ATOM   365  O O     . VAL A 1 48  ? 27.836 14.841 62.010 1.00 41.08 ? 1005 VAL A O     1 
ATOM   366  C CB    . VAL A 1 48  ? 26.560 17.261 60.815 1.00 39.07 ? 1005 VAL A CB    1 
ATOM   367  C CG1   . VAL A 1 48  ? 27.571 18.364 61.095 1.00 38.86 ? 1005 VAL A CG1   1 
ATOM   368  C CG2   . VAL A 1 48  ? 25.423 17.796 60.007 1.00 39.63 ? 1005 VAL A CG2   1 
ATOM   369  N N     . ASN A 1 49  ? 29.529 15.612 60.746 1.00 42.46 ? 1006 ASN A N     1 
ATOM   370  C CA    . ASN A 1 49  ? 30.560 15.050 61.612 1.00 44.36 ? 1006 ASN A CA    1 
ATOM   371  C C     . ASN A 1 49  ? 30.299 15.509 63.048 1.00 45.44 ? 1006 ASN A C     1 
ATOM   372  O O     . ASN A 1 49  ? 30.086 16.698 63.300 1.00 46.18 ? 1006 ASN A O     1 
ATOM   373  C CB    . ASN A 1 49  ? 31.946 15.516 61.158 1.00 44.37 ? 1006 ASN A CB    1 
ATOM   374  N N     . GLU A 1 50  ? 30.310 14.565 63.984 1.00 45.88 ? 1007 GLU A N     1 
ATOM   375  C CA    . GLU A 1 50  ? 30.067 14.876 65.388 1.00 46.50 ? 1007 GLU A CA    1 
ATOM   376  C C     . GLU A 1 50  ? 31.098 15.867 65.918 1.00 46.58 ? 1007 GLU A C     1 
ATOM   377  O O     . GLU A 1 50  ? 30.961 16.390 67.028 1.00 47.16 ? 1007 GLU A O     1 
ATOM   378  C CB    . GLU A 1 50  ? 30.110 13.594 66.224 1.00 47.14 ? 1007 GLU A CB    1 
ATOM   379  N N     . ALA A 1 51  ? 32.128 16.120 65.117 1.00 45.76 ? 1008 ALA A N     1 
ATOM   380  C CA    . ALA A 1 51  ? 33.187 17.043 65.498 1.00 44.89 ? 1008 ALA A CA    1 
ATOM   381  C C     . ALA A 1 51  ? 33.037 18.395 64.811 1.00 44.18 ? 1008 ALA A C     1 
ATOM   382  O O     . ALA A 1 51  ? 33.836 19.304 65.038 1.00 44.39 ? 1008 ALA A O     1 
ATOM   383  C CB    . ALA A 1 51  ? 34.542 16.439 65.163 1.00 45.31 ? 1008 ALA A CB    1 
ATOM   384  N N     . ALA A 1 52  ? 32.015 18.528 63.972 1.00 42.56 ? 1009 ALA A N     1 
ATOM   385  C CA    . ALA A 1 52  ? 31.782 19.776 63.253 1.00 40.75 ? 1009 ALA A CA    1 
ATOM   386  C C     . ALA A 1 52  ? 31.551 20.937 64.211 1.00 39.88 ? 1009 ALA A C     1 
ATOM   387  O O     . ALA A 1 52  ? 31.125 20.743 65.351 1.00 39.38 ? 1009 ALA A O     1 
ATOM   388  C CB    . ALA A 1 52  ? 30.582 19.627 62.322 1.00 41.33 ? 1009 ALA A CB    1 
ATOM   389  N N     . SER A 1 53  ? 31.832 22.144 63.735 1.00 38.35 ? 1010 SER A N     1 
ATOM   390  C CA    . SER A 1 53  ? 31.659 23.348 64.538 1.00 37.55 ? 1010 SER A CA    1 
ATOM   391  C C     . SER A 1 53  ? 30.210 23.804 64.520 1.00 36.97 ? 1010 SER A C     1 
ATOM   392  O O     . SER A 1 53  ? 29.409 23.342 63.707 1.00 35.60 ? 1010 SER A O     1 
ATOM   393  C CB    . SER A 1 53  ? 32.535 24.475 63.992 1.00 37.35 ? 1010 SER A CB    1 
ATOM   394  O OG    . SER A 1 53  ? 32.130 24.842 62.684 1.00 37.89 ? 1010 SER A OG    1 
ATOM   395  N N     . MET A 1 54  ? 29.883 24.719 65.425 1.00 36.72 ? 1011 MET A N     1 
ATOM   396  C CA    . MET A 1 54  ? 28.540 25.263 65.505 1.00 36.44 ? 1011 MET A CA    1 
ATOM   397  C C     . MET A 1 54  ? 28.231 25.935 64.175 1.00 35.51 ? 1011 MET A C     1 
ATOM   398  O O     . MET A 1 54  ? 27.119 25.824 63.647 1.00 34.89 ? 1011 MET A O     1 
ATOM   399  C CB    . MET A 1 54  ? 28.458 26.284 66.642 1.00 38.74 ? 1011 MET A CB    1 
ATOM   400  C CG    . MET A 1 54  ? 27.121 26.996 66.749 1.00 39.78 ? 1011 MET A CG    1 
ATOM   401  S SD    . MET A 1 54  ? 27.083 28.091 68.184 1.00 43.32 ? 1011 MET A SD    1 
ATOM   402  C CE    . MET A 1 54  ? 26.780 26.880 69.449 1.00 40.68 ? 1011 MET A CE    1 
ATOM   403  N N     . ARG A 1 55  ? 29.227 26.631 63.635 1.00 33.97 ? 1012 ARG A N     1 
ATOM   404  C CA    . ARG A 1 55  ? 29.073 27.317 62.359 1.00 33.88 ? 1012 ARG A CA    1 
ATOM   405  C C     . ARG A 1 55  ? 28.614 26.351 61.265 1.00 33.25 ? 1012 ARG A C     1 
ATOM   406  O O     . ARG A 1 55  ? 27.675 26.637 60.525 1.00 31.65 ? 1012 ARG A O     1 
ATOM   407  C CB    . ARG A 1 55  ? 30.399 27.963 61.941 1.00 34.27 ? 1012 ARG A CB    1 
ATOM   408  N N     . GLU A 1 56  ? 29.286 25.210 61.170 1.00 33.17 ? 1013 GLU A N     1 
ATOM   409  C CA    . GLU A 1 56  ? 28.952 24.211 60.166 1.00 34.41 ? 1013 GLU A CA    1 
ATOM   410  C C     . GLU A 1 56  ? 27.591 23.582 60.428 1.00 33.95 ? 1013 GLU A C     1 
ATOM   411  O O     . GLU A 1 56  ? 26.789 23.404 59.504 1.00 34.15 ? 1013 GLU A O     1 
ATOM   412  C CB    . GLU A 1 56  ? 30.039 23.134 60.121 1.00 35.87 ? 1013 GLU A CB    1 
ATOM   413  C CG    . GLU A 1 56  ? 31.376 23.674 59.634 1.00 40.38 ? 1013 GLU A CG    1 
ATOM   414  C CD    . GLU A 1 56  ? 32.504 22.669 59.750 1.00 43.12 ? 1013 GLU A CD    1 
ATOM   415  O OE1   . GLU A 1 56  ? 32.845 22.274 60.888 1.00 44.34 ? 1013 GLU A OE1   1 
ATOM   416  O OE2   . GLU A 1 56  ? 33.052 22.275 58.698 1.00 45.74 ? 1013 GLU A OE2   1 
ATOM   417  N N     . ARG A 1 57  ? 27.329 23.247 61.687 1.00 33.08 ? 1014 ARG A N     1 
ATOM   418  C CA    . ARG A 1 57  ? 26.056 22.646 62.052 1.00 31.81 ? 1014 ARG A CA    1 
ATOM   419  C C     . ARG A 1 57  ? 24.908 23.582 61.709 1.00 29.76 ? 1014 ARG A C     1 
ATOM   420  O O     . ARG A 1 57  ? 23.851 23.141 61.263 1.00 28.31 ? 1014 ARG A O     1 
ATOM   421  C CB    . ARG A 1 57  ? 26.041 22.280 63.544 1.00 33.29 ? 1014 ARG A CB    1 
ATOM   422  C CG    . ARG A 1 57  ? 26.353 20.805 63.784 1.00 36.77 ? 1014 ARG A CG    1 
ATOM   423  C CD    . ARG A 1 57  ? 26.325 20.391 65.254 1.00 37.69 ? 1014 ARG A CD    1 
ATOM   424  N NE    . ARG A 1 57  ? 27.518 20.821 65.979 1.00 39.41 ? 1014 ARG A NE    1 
ATOM   425  C CZ    . ARG A 1 57  ? 27.577 21.883 66.776 1.00 40.59 ? 1014 ARG A CZ    1 
ATOM   426  N NH1   . ARG A 1 57  ? 26.504 22.642 66.966 1.00 40.66 ? 1014 ARG A NH1   1 
ATOM   427  N NH2   . ARG A 1 57  ? 28.716 22.189 67.384 1.00 41.03 ? 1014 ARG A NH2   1 
ATOM   428  N N     . ILE A 1 58  ? 25.115 24.877 61.911 1.00 28.79 ? 1015 ILE A N     1 
ATOM   429  C CA    . ILE A 1 58  ? 24.083 25.856 61.595 1.00 28.64 ? 1015 ILE A CA    1 
ATOM   430  C C     . ILE A 1 58  ? 23.818 25.888 60.083 1.00 28.72 ? 1015 ILE A C     1 
ATOM   431  O O     . ILE A 1 58  ? 22.666 25.889 59.647 1.00 29.03 ? 1015 ILE A O     1 
ATOM   432  C CB    . ILE A 1 58  ? 24.489 27.268 62.090 1.00 28.51 ? 1015 ILE A CB    1 
ATOM   433  C CG1   . ILE A 1 58  ? 24.441 27.306 63.623 1.00 29.00 ? 1015 ILE A CG1   1 
ATOM   434  C CG2   . ILE A 1 58  ? 23.572 28.330 61.483 1.00 28.32 ? 1015 ILE A CG2   1 
ATOM   435  C CD1   . ILE A 1 58  ? 24.747 28.671 64.224 1.00 29.26 ? 1015 ILE A CD1   1 
ATOM   436  N N     . GLU A 1 59  ? 24.882 25.914 59.283 1.00 28.77 ? 1016 GLU A N     1 
ATOM   437  C CA    . GLU A 1 59  ? 24.731 25.929 57.828 1.00 29.65 ? 1016 GLU A CA    1 
ATOM   438  C C     . GLU A 1 59  ? 24.030 24.654 57.365 1.00 28.59 ? 1016 GLU A C     1 
ATOM   439  O O     . GLU A 1 59  ? 23.146 24.688 56.513 1.00 28.32 ? 1016 GLU A O     1 
ATOM   440  C CB    . GLU A 1 59  ? 26.101 26.038 57.150 1.00 30.99 ? 1016 GLU A CB    1 
ATOM   441  C CG    . GLU A 1 59  ? 26.725 27.424 57.230 1.00 34.54 ? 1016 GLU A CG    1 
ATOM   442  C CD    . GLU A 1 59  ? 28.135 27.457 56.662 1.00 37.56 ? 1016 GLU A CD    1 
ATOM   443  O OE1   . GLU A 1 59  ? 28.673 28.570 56.480 1.00 38.68 ? 1016 GLU A OE1   1 
ATOM   444  O OE2   . GLU A 1 59  ? 28.707 26.369 56.405 1.00 37.28 ? 1016 GLU A OE2   1 
ATOM   445  N N     . PHE A 1 60  ? 24.430 23.525 57.933 1.00 28.67 ? 1017 PHE A N     1 
ATOM   446  C CA    . PHE A 1 60  ? 23.816 22.253 57.577 1.00 28.83 ? 1017 PHE A CA    1 
ATOM   447  C C     . PHE A 1 60  ? 22.305 22.284 57.822 1.00 28.43 ? 1017 PHE A C     1 
ATOM   448  O O     . PHE A 1 60  ? 21.509 21.950 56.939 1.00 28.30 ? 1017 PHE A O     1 
ATOM   449  C CB    . PHE A 1 60  ? 24.427 21.135 58.407 1.00 29.50 ? 1017 PHE A CB    1 
ATOM   450  C CG    . PHE A 1 60  ? 23.870 19.780 58.098 1.00 30.85 ? 1017 PHE A CG    1 
ATOM   451  C CD1   . PHE A 1 60  ? 24.367 19.036 57.034 1.00 31.10 ? 1017 PHE A CD1   1 
ATOM   452  C CD2   . PHE A 1 60  ? 22.865 19.232 58.890 1.00 30.55 ? 1017 PHE A CD2   1 
ATOM   453  C CE1   . PHE A 1 60  ? 23.879 17.760 56.767 1.00 32.40 ? 1017 PHE A CE1   1 
ATOM   454  C CE2   . PHE A 1 60  ? 22.372 17.961 58.632 1.00 32.09 ? 1017 PHE A CE2   1 
ATOM   455  C CZ    . PHE A 1 60  ? 22.881 17.221 57.567 1.00 32.24 ? 1017 PHE A CZ    1 
ATOM   456  N N     . LEU A 1 61  ? 21.914 22.687 59.028 1.00 27.78 ? 1018 LEU A N     1 
ATOM   457  C CA    . LEU A 1 61  ? 20.506 22.741 59.395 1.00 28.40 ? 1018 LEU A CA    1 
ATOM   458  C C     . LEU A 1 61  ? 19.736 23.815 58.633 1.00 28.48 ? 1018 LEU A C     1 
ATOM   459  O O     . LEU A 1 61  ? 18.550 23.635 58.333 1.00 28.25 ? 1018 LEU A O     1 
ATOM   460  C CB    . LEU A 1 61  ? 20.360 22.945 60.910 1.00 28.52 ? 1018 LEU A CB    1 
ATOM   461  C CG    . LEU A 1 61  ? 20.819 21.755 61.772 1.00 28.64 ? 1018 LEU A CG    1 
ATOM   462  C CD1   . LEU A 1 61  ? 20.736 22.106 63.258 1.00 29.37 ? 1018 LEU A CD1   1 
ATOM   463  C CD2   . LEU A 1 61  ? 19.946 20.547 61.474 1.00 28.69 ? 1018 LEU A CD2   1 
ATOM   464  N N     . ASN A 1 62  ? 20.399 24.925 58.315 1.00 27.61 ? 1019 ASN A N     1 
ATOM   465  C CA    . ASN A 1 62  ? 19.738 25.992 57.565 1.00 28.10 ? 1019 ASN A CA    1 
ATOM   466  C C     . ASN A 1 62  ? 19.342 25.482 56.180 1.00 27.59 ? 1019 ASN A C     1 
ATOM   467  O O     . ASN A 1 62  ? 18.292 25.849 55.662 1.00 28.59 ? 1019 ASN A O     1 
ATOM   468  C CB    . ASN A 1 62  ? 20.652 27.220 57.429 1.00 28.83 ? 1019 ASN A CB    1 
ATOM   469  C CG    . ASN A 1 62  ? 20.615 28.130 58.657 1.00 30.96 ? 1019 ASN A CG    1 
ATOM   470  O OD1   . ASN A 1 62  ? 21.354 29.114 58.735 1.00 33.38 ? 1019 ASN A OD1   1 
ATOM   471  N ND2   . ASN A 1 62  ? 19.751 27.813 59.610 1.00 30.20 ? 1019 ASN A ND2   1 
ATOM   472  N N     . GLU A 1 63  ? 20.174 24.636 55.577 1.00 28.93 ? 1020 GLU A N     1 
ATOM   473  C CA    . GLU A 1 63  ? 19.840 24.107 54.257 1.00 29.91 ? 1020 GLU A CA    1 
ATOM   474  C C     . GLU A 1 63  ? 18.603 23.226 54.368 1.00 29.33 ? 1020 GLU A C     1 
ATOM   475  O O     . GLU A 1 63  ? 17.754 23.221 53.479 1.00 28.45 ? 1020 GLU A O     1 
ATOM   476  C CB    . GLU A 1 63  ? 20.989 23.286 53.652 1.00 31.26 ? 1020 GLU A CB    1 
ATOM   477  C CG    . GLU A 1 63  ? 20.929 23.267 52.118 1.00 34.52 ? 1020 GLU A CG    1 
ATOM   478  C CD    . GLU A 1 63  ? 21.895 22.290 51.461 1.00 35.77 ? 1020 GLU A CD    1 
ATOM   479  O OE1   . GLU A 1 63  ? 23.046 22.172 51.941 1.00 36.35 ? 1020 GLU A OE1   1 
ATOM   480  O OE2   . GLU A 1 63  ? 21.499 21.657 50.448 1.00 34.94 ? 1020 GLU A OE2   1 
ATOM   481  N N     . ALA A 1 64  ? 18.503 22.480 55.464 1.00 29.92 ? 1021 ALA A N     1 
ATOM   482  C CA    . ALA A 1 64  ? 17.352 21.605 55.672 1.00 28.63 ? 1021 ALA A CA    1 
ATOM   483  C C     . ALA A 1 64  ? 16.105 22.454 55.847 1.00 28.13 ? 1021 ALA A C     1 
ATOM   484  O O     . ALA A 1 64  ? 15.050 22.145 55.292 1.00 27.78 ? 1021 ALA A O     1 
ATOM   485  C CB    . ALA A 1 64  ? 17.561 20.736 56.897 1.00 28.54 ? 1021 ALA A CB    1 
ATOM   486  N N     . SER A 1 65  ? 16.229 23.531 56.619 1.00 28.33 ? 1022 SER A N     1 
ATOM   487  C CA    . SER A 1 65  ? 15.095 24.408 56.863 1.00 30.00 ? 1022 SER A CA    1 
ATOM   488  C C     . SER A 1 65  ? 14.537 24.967 55.572 1.00 29.19 ? 1022 SER A C     1 
ATOM   489  O O     . SER A 1 65  ? 13.322 24.987 55.377 1.00 29.95 ? 1022 SER A O     1 
ATOM   490  C CB    . SER A 1 65  ? 15.486 25.554 57.796 1.00 30.68 ? 1022 SER A CB    1 
ATOM   491  O OG    . SER A 1 65  ? 15.634 25.072 59.118 1.00 35.71 ? 1022 SER A OG    1 
ATOM   492  N N     . VAL A 1 66  ? 15.422 25.426 54.694 1.00 28.82 ? 1023 VAL A N     1 
ATOM   493  C CA    . VAL A 1 66  ? 14.996 25.971 53.410 1.00 29.04 ? 1023 VAL A CA    1 
ATOM   494  C C     . VAL A 1 66  ? 14.229 24.909 52.616 1.00 28.36 ? 1023 VAL A C     1 
ATOM   495  O O     . VAL A 1 66  ? 13.214 25.205 51.988 1.00 27.63 ? 1023 VAL A O     1 
ATOM   496  C CB    . VAL A 1 66  ? 16.212 26.450 52.574 1.00 30.40 ? 1023 VAL A CB    1 
ATOM   497  C CG1   . VAL A 1 66  ? 15.757 26.926 51.211 1.00 32.10 ? 1023 VAL A CG1   1 
ATOM   498  C CG2   . VAL A 1 66  ? 16.923 27.585 53.295 1.00 32.26 ? 1023 VAL A CG2   1 
ATOM   499  N N     . MET A 1 67  ? 14.719 23.673 52.650 1.00 27.76 ? 1024 MET A N     1 
ATOM   500  C CA    . MET A 1 67  ? 14.086 22.578 51.919 1.00 27.18 ? 1024 MET A CA    1 
ATOM   501  C C     . MET A 1 67  ? 12.689 22.221 52.419 1.00 26.74 ? 1024 MET A C     1 
ATOM   502  O O     . MET A 1 67  ? 11.880 21.680 51.664 1.00 26.51 ? 1024 MET A O     1 
ATOM   503  C CB    . MET A 1 67  ? 14.978 21.330 51.960 1.00 27.59 ? 1024 MET A CB    1 
ATOM   504  C CG    . MET A 1 67  ? 16.279 21.473 51.183 1.00 29.37 ? 1024 MET A CG    1 
ATOM   505  S SD    . MET A 1 67  ? 17.257 19.952 51.179 1.00 31.09 ? 1024 MET A SD    1 
ATOM   506  C CE    . MET A 1 67  ? 16.304 18.975 50.036 1.00 32.26 ? 1024 MET A CE    1 
ATOM   507  N N     . LYS A 1 68  ? 12.401 22.518 53.684 1.00 26.06 ? 1025 LYS A N     1 
ATOM   508  C CA    . LYS A 1 68  ? 11.086 22.213 54.247 1.00 26.22 ? 1025 LYS A CA    1 
ATOM   509  C C     . LYS A 1 68  ? 9.986  22.947 53.480 1.00 26.76 ? 1025 LYS A C     1 
ATOM   510  O O     . LYS A 1 68  ? 8.817  22.558 53.519 1.00 26.79 ? 1025 LYS A O     1 
ATOM   511  C CB    . LYS A 1 68  ? 11.016 22.629 55.719 1.00 24.68 ? 1025 LYS A CB    1 
ATOM   512  C CG    . LYS A 1 68  ? 11.914 21.848 56.651 1.00 25.83 ? 1025 LYS A CG    1 
ATOM   513  C CD    . LYS A 1 68  ? 11.798 22.354 58.084 1.00 25.80 ? 1025 LYS A CD    1 
ATOM   514  C CE    . LYS A 1 68  ? 12.712 21.561 59.006 1.00 26.79 ? 1025 LYS A CE    1 
ATOM   515  N NZ    . LYS A 1 68  ? 12.829 22.161 60.369 1.00 27.33 ? 1025 LYS A NZ    1 
ATOM   516  N N     . GLU A 1 69  ? 10.370 24.009 52.784 1.00 27.26 ? 1026 GLU A N     1 
ATOM   517  C CA    . GLU A 1 69  ? 9.418  24.816 52.027 1.00 28.93 ? 1026 GLU A CA    1 
ATOM   518  C C     . GLU A 1 69  ? 9.116  24.278 50.632 1.00 28.15 ? 1026 GLU A C     1 
ATOM   519  O O     . GLU A 1 69  ? 8.174  24.732 49.987 1.00 29.37 ? 1026 GLU A O     1 
ATOM   520  C CB    . GLU A 1 69  ? 9.953  26.242 51.883 1.00 29.97 ? 1026 GLU A CB    1 
ATOM   521  C CG    . GLU A 1 69  ? 10.406 26.876 53.184 1.00 34.59 ? 1026 GLU A CG    1 
ATOM   522  C CD    . GLU A 1 69  ? 9.246  27.289 54.063 1.00 35.61 ? 1026 GLU A CD    1 
ATOM   523  O OE1   . GLU A 1 69  ? 9.481  27.635 55.237 1.00 38.33 ? 1026 GLU A OE1   1 
ATOM   524  O OE2   . GLU A 1 69  ? 8.097  27.277 53.578 1.00 38.45 ? 1026 GLU A OE2   1 
ATOM   525  N N     . PHE A 1 70  ? 9.900  23.317 50.160 1.00 27.46 ? 1027 PHE A N     1 
ATOM   526  C CA    . PHE A 1 70  ? 9.693  22.806 48.813 1.00 27.10 ? 1027 PHE A CA    1 
ATOM   527  C C     . PHE A 1 70  ? 8.897  21.518 48.673 1.00 27.81 ? 1027 PHE A C     1 
ATOM   528  O O     . PHE A 1 70  ? 9.106  20.554 49.406 1.00 27.51 ? 1027 PHE A O     1 
ATOM   529  C CB    . PHE A 1 70  ? 11.034 22.606 48.098 1.00 26.07 ? 1027 PHE A CB    1 
ATOM   530  C CG    . PHE A 1 70  ? 11.996 23.749 48.255 1.00 26.22 ? 1027 PHE A CG    1 
ATOM   531  C CD1   . PHE A 1 70  ? 11.542 25.059 48.338 1.00 26.62 ? 1027 PHE A CD1   1 
ATOM   532  C CD2   . PHE A 1 70  ? 13.369 23.512 48.295 1.00 25.86 ? 1027 PHE A CD2   1 
ATOM   533  C CE1   . PHE A 1 70  ? 12.443 26.123 48.459 1.00 26.38 ? 1027 PHE A CE1   1 
ATOM   534  C CE2   . PHE A 1 70  ? 14.274 24.569 48.416 1.00 24.98 ? 1027 PHE A CE2   1 
ATOM   535  C CZ    . PHE A 1 70  ? 13.811 25.872 48.498 1.00 25.20 ? 1027 PHE A CZ    1 
ATOM   536  N N     . ASN A 1 71  ? 7.984  21.524 47.706 1.00 27.62 ? 1028 ASN A N     1 
ATOM   537  C CA    . ASN A 1 71  ? 7.169  20.363 47.387 1.00 29.09 ? 1028 ASN A CA    1 
ATOM   538  C C     . ASN A 1 71  ? 6.992  20.369 45.876 1.00 28.59 ? 1028 ASN A C     1 
ATOM   539  O O     . ASN A 1 71  ? 5.976  20.839 45.350 1.00 28.57 ? 1028 ASN A O     1 
ATOM   540  C CB    . ASN A 1 71  ? 5.802  20.429 48.070 1.00 31.22 ? 1028 ASN A CB    1 
ATOM   541  C CG    . ASN A 1 71  ? 4.955  19.212 47.764 1.00 33.69 ? 1028 ASN A CG    1 
ATOM   542  O OD1   . ASN A 1 71  ? 5.448  18.086 47.784 1.00 35.80 ? 1028 ASN A OD1   1 
ATOM   543  N ND2   . ASN A 1 71  ? 3.673  19.429 47.482 1.00 34.25 ? 1028 ASN A ND2   1 
ATOM   544  N N     . CYS A 1 72  ? 7.994  19.850 45.180 1.00 26.02 ? 1029 CYS A N     1 
ATOM   545  C CA    . CYS A 1 72  ? 7.959  19.817 43.726 1.00 25.87 ? 1029 CYS A CA    1 
ATOM   546  C C     . CYS A 1 72  ? 8.617  18.559 43.201 1.00 24.25 ? 1029 CYS A C     1 
ATOM   547  O O     . CYS A 1 72  ? 9.654  18.138 43.705 1.00 23.96 ? 1029 CYS A O     1 
ATOM   548  C CB    . CYS A 1 72  ? 8.671  21.050 43.151 1.00 24.18 ? 1029 CYS A CB    1 
ATOM   549  S SG    . CYS A 1 72  ? 8.765  21.083 41.349 1.00 25.38 ? 1029 CYS A SG    1 
ATOM   550  N N     . HIS A 1 73  ? 8.005  17.967 42.181 1.00 24.43 ? 1030 HIS A N     1 
ATOM   551  C CA    . HIS A 1 73  ? 8.513  16.744 41.569 1.00 24.24 ? 1030 HIS A CA    1 
ATOM   552  C C     . HIS A 1 73  ? 9.927  16.911 41.014 1.00 23.18 ? 1030 HIS A C     1 
ATOM   553  O O     . HIS A 1 73  ? 10.683 15.945 40.933 1.00 23.16 ? 1030 HIS A O     1 
ATOM   554  C CB    . HIS A 1 73  ? 7.574  16.301 40.439 1.00 24.97 ? 1030 HIS A CB    1 
ATOM   555  C CG    . HIS A 1 73  ? 7.961  15.003 39.801 1.00 25.96 ? 1030 HIS A CG    1 
ATOM   556  N ND1   . HIS A 1 73  ? 7.805  13.787 40.432 1.00 26.64 ? 1030 HIS A ND1   1 
ATOM   557  C CD2   . HIS A 1 73  ? 8.511  14.732 38.593 1.00 25.58 ? 1030 HIS A CD2   1 
ATOM   558  C CE1   . HIS A 1 73  ? 8.242  12.823 39.640 1.00 25.98 ? 1030 HIS A CE1   1 
ATOM   559  N NE2   . HIS A 1 73  ? 8.675  13.369 38.519 1.00 26.10 ? 1030 HIS A NE2   1 
ATOM   560  N N     . HIS A 1 74  ? 10.288 18.131 40.627 1.00 22.43 ? 1031 HIS A N     1 
ATOM   561  C CA    . HIS A 1 74  ? 11.616 18.363 40.072 1.00 21.21 ? 1031 HIS A CA    1 
ATOM   562  C C     . HIS A 1 74  ? 12.609 19.036 41.021 1.00 21.42 ? 1031 HIS A C     1 
ATOM   563  O O     . HIS A 1 74  ? 13.580 19.658 40.593 1.00 20.37 ? 1031 HIS A O     1 
ATOM   564  C CB    . HIS A 1 74  ? 11.494 19.138 38.764 1.00 22.26 ? 1031 HIS A CB    1 
ATOM   565  C CG    . HIS A 1 74  ? 10.789 18.370 37.687 1.00 22.62 ? 1031 HIS A CG    1 
ATOM   566  N ND1   . HIS A 1 74  ? 9.572  18.754 37.169 1.00 23.92 ? 1031 HIS A ND1   1 
ATOM   567  C CD2   . HIS A 1 74  ? 11.129 17.228 37.046 1.00 22.82 ? 1031 HIS A CD2   1 
ATOM   568  C CE1   . HIS A 1 74  ? 9.193  17.884 36.250 1.00 21.64 ? 1031 HIS A CE1   1 
ATOM   569  N NE2   . HIS A 1 74  ? 10.119 16.949 36.156 1.00 23.81 ? 1031 HIS A NE2   1 
ATOM   570  N N     . VAL A 1 75  ? 12.348 18.903 42.317 1.00 20.99 ? 1032 VAL A N     1 
ATOM   571  C CA    . VAL A 1 75  ? 13.242 19.413 43.349 1.00 20.52 ? 1032 VAL A CA    1 
ATOM   572  C C     . VAL A 1 75  ? 13.423 18.241 44.311 1.00 20.81 ? 1032 VAL A C     1 
ATOM   573  O O     . VAL A 1 75  ? 12.435 17.655 44.759 1.00 20.38 ? 1032 VAL A O     1 
ATOM   574  C CB    . VAL A 1 75  ? 12.638 20.614 44.104 1.00 20.38 ? 1032 VAL A CB    1 
ATOM   575  C CG1   . VAL A 1 75  ? 13.562 21.017 45.241 1.00 20.77 ? 1032 VAL A CG1   1 
ATOM   576  C CG2   . VAL A 1 75  ? 12.444 21.793 43.142 1.00 19.61 ? 1032 VAL A CG2   1 
ATOM   577  N N     . VAL A 1 76  ? 14.670 17.887 44.621 1.00 21.12 ? 1033 VAL A N     1 
ATOM   578  C CA    . VAL A 1 76  ? 14.932 16.769 45.530 1.00 21.57 ? 1033 VAL A CA    1 
ATOM   579  C C     . VAL A 1 76  ? 14.212 17.030 46.847 1.00 22.51 ? 1033 VAL A C     1 
ATOM   580  O O     . VAL A 1 76  ? 14.377 18.076 47.473 1.00 21.03 ? 1033 VAL A O     1 
ATOM   581  C CB    . VAL A 1 76  ? 16.434 16.587 45.765 1.00 22.42 ? 1033 VAL A CB    1 
ATOM   582  C CG1   . VAL A 1 76  ? 16.678 15.404 46.685 1.00 23.80 ? 1033 VAL A CG1   1 
ATOM   583  C CG2   . VAL A 1 76  ? 17.130 16.352 44.423 1.00 23.48 ? 1033 VAL A CG2   1 
ATOM   584  N N     . ARG A 1 77  ? 13.407 16.063 47.265 1.00 23.91 ? 1034 ARG A N     1 
ATOM   585  C CA    . ARG A 1 77  ? 12.587 16.216 48.460 1.00 25.04 ? 1034 ARG A CA    1 
ATOM   586  C C     . ARG A 1 77  ? 13.176 15.898 49.836 1.00 24.63 ? 1034 ARG A C     1 
ATOM   587  O O     . ARG A 1 77  ? 13.800 14.853 50.039 1.00 23.93 ? 1034 ARG A O     1 
ATOM   588  C CB    . ARG A 1 77  ? 11.292 15.427 48.230 1.00 28.33 ? 1034 ARG A CB    1 
ATOM   589  C CG    . ARG A 1 77  ? 10.480 15.112 49.464 1.00 34.98 ? 1034 ARG A CG    1 
ATOM   590  C CD    . ARG A 1 77  ? 9.022  14.864 49.091 1.00 39.09 ? 1034 ARG A CD    1 
ATOM   591  N NE    . ARG A 1 77  ? 8.257  16.105 49.172 1.00 43.55 ? 1034 ARG A NE    1 
ATOM   592  C CZ    . ARG A 1 77  ? 8.023  16.758 50.309 1.00 45.73 ? 1034 ARG A CZ    1 
ATOM   593  N NH1   . ARG A 1 77  ? 8.490  16.278 51.458 1.00 46.48 ? 1034 ARG A NH1   1 
ATOM   594  N NH2   . ARG A 1 77  ? 7.343  17.900 50.301 1.00 46.67 ? 1034 ARG A NH2   1 
ATOM   595  N N     . LEU A 1 78  ? 12.970 16.816 50.781 1.00 23.82 ? 1035 LEU A N     1 
ATOM   596  C CA    . LEU A 1 78  ? 13.428 16.624 52.158 1.00 23.93 ? 1035 LEU A CA    1 
ATOM   597  C C     . LEU A 1 78  ? 12.399 15.684 52.751 1.00 24.00 ? 1035 LEU A C     1 
ATOM   598  O O     . LEU A 1 78  ? 11.201 15.870 52.540 1.00 23.93 ? 1035 LEU A O     1 
ATOM   599  C CB    . LEU A 1 78  ? 13.408 17.938 52.951 1.00 22.50 ? 1035 LEU A CB    1 
ATOM   600  C CG    . LEU A 1 78  ? 13.690 17.765 54.451 1.00 20.93 ? 1035 LEU A CG    1 
ATOM   601  C CD1   . LEU A 1 78  ? 15.119 17.250 54.651 1.00 18.95 ? 1035 LEU A CD1   1 
ATOM   602  C CD2   . LEU A 1 78  ? 13.490 19.092 55.178 1.00 20.02 ? 1035 LEU A CD2   1 
ATOM   603  N N     . LEU A 1 79  ? 12.846 14.678 53.493 1.00 23.70 ? 1036 LEU A N     1 
ATOM   604  C CA    . LEU A 1 79  ? 11.903 13.725 54.058 1.00 23.90 ? 1036 LEU A CA    1 
ATOM   605  C C     . LEU A 1 79  ? 11.888 13.713 55.575 1.00 24.15 ? 1036 LEU A C     1 
ATOM   606  O O     . LEU A 1 79  ? 10.951 13.208 56.185 1.00 24.10 ? 1036 LEU A O     1 
ATOM   607  C CB    . LEU A 1 79  ? 12.201 12.321 53.526 1.00 24.31 ? 1036 LEU A CB    1 
ATOM   608  C CG    . LEU A 1 79  ? 11.856 12.106 52.047 1.00 23.87 ? 1036 LEU A CG    1 
ATOM   609  C CD1   . LEU A 1 79  ? 12.400 10.777 51.571 1.00 23.51 ? 1036 LEU A CD1   1 
ATOM   610  C CD2   . LEU A 1 79  ? 10.346 12.157 51.871 1.00 23.91 ? 1036 LEU A CD2   1 
ATOM   611  N N     . GLY A 1 80  ? 12.921 14.271 56.189 1.00 24.11 ? 1037 GLY A N     1 
ATOM   612  C CA    . GLY A 1 80  ? 12.964 14.285 57.634 1.00 23.68 ? 1037 GLY A CA    1 
ATOM   613  C C     . GLY A 1 80  ? 14.289 14.757 58.180 1.00 23.53 ? 1037 GLY A C     1 
ATOM   614  O O     . GLY A 1 80  ? 15.282 14.851 57.451 1.00 21.14 ? 1037 GLY A O     1 
ATOM   615  N N     . VAL A 1 81  ? 14.291 15.054 59.474 1.00 23.62 ? 1038 VAL A N     1 
ATOM   616  C CA    . VAL A 1 81  ? 15.474 15.534 60.162 1.00 25.35 ? 1038 VAL A CA    1 
ATOM   617  C C     . VAL A 1 81  ? 15.597 14.839 61.506 1.00 25.98 ? 1038 VAL A C     1 
ATOM   618  O O     . VAL A 1 81  ? 14.603 14.627 62.199 1.00 26.60 ? 1038 VAL A O     1 
ATOM   619  C CB    . VAL A 1 81  ? 15.379 17.052 60.443 1.00 26.56 ? 1038 VAL A CB    1 
ATOM   620  C CG1   . VAL A 1 81  ? 16.673 17.545 61.096 1.00 27.10 ? 1038 VAL A CG1   1 
ATOM   621  C CG2   . VAL A 1 81  ? 15.091 17.805 59.157 1.00 27.73 ? 1038 VAL A CG2   1 
ATOM   622  N N     . VAL A 1 82  ? 16.819 14.481 61.875 1.00 25.95 ? 1039 VAL A N     1 
ATOM   623  C CA    . VAL A 1 82  ? 17.056 13.852 63.165 1.00 26.21 ? 1039 VAL A CA    1 
ATOM   624  C C     . VAL A 1 82  ? 17.957 14.825 63.916 1.00 26.51 ? 1039 VAL A C     1 
ATOM   625  O O     . VAL A 1 82  ? 19.171 14.816 63.731 1.00 25.71 ? 1039 VAL A O     1 
ATOM   626  C CB    . VAL A 1 82  ? 17.765 12.493 63.011 1.00 25.90 ? 1039 VAL A CB    1 
ATOM   627  C CG1   . VAL A 1 82  ? 18.037 11.891 64.386 1.00 28.75 ? 1039 VAL A CG1   1 
ATOM   628  C CG2   . VAL A 1 82  ? 16.904 11.548 62.200 1.00 27.03 ? 1039 VAL A CG2   1 
ATOM   629  N N     . SER A 1 83  ? 17.365 15.671 64.755 1.00 27.50 ? 1040 SER A N     1 
ATOM   630  C CA    . SER A 1 83  ? 18.152 16.662 65.488 1.00 28.61 ? 1040 SER A CA    1 
ATOM   631  C C     . SER A 1 83  ? 18.339 16.337 66.964 1.00 29.07 ? 1040 SER A C     1 
ATOM   632  O O     . SER A 1 83  ? 18.714 17.203 67.756 1.00 29.61 ? 1040 SER A O     1 
ATOM   633  C CB    . SER A 1 83  ? 17.539 18.060 65.327 1.00 28.79 ? 1040 SER A CB    1 
ATOM   634  O OG    . SER A 1 83  ? 16.192 18.101 65.761 1.00 29.64 ? 1040 SER A OG    1 
ATOM   635  N N     . GLN A 1 84  ? 18.074 15.086 67.321 1.00 28.85 ? 1041 GLN A N     1 
ATOM   636  C CA    . GLN A 1 84  ? 18.249 14.608 68.685 1.00 28.59 ? 1041 GLN A CA    1 
ATOM   637  C C     . GLN A 1 84  ? 19.326 13.532 68.620 1.00 29.49 ? 1041 GLN A C     1 
ATOM   638  O O     . GLN A 1 84  ? 19.235 12.603 67.813 1.00 28.65 ? 1041 GLN A O     1 
ATOM   639  C CB    . GLN A 1 84  ? 16.953 13.998 69.227 1.00 28.47 ? 1041 GLN A CB    1 
ATOM   640  C CG    . GLN A 1 84  ? 15.878 14.999 69.645 1.00 28.81 ? 1041 GLN A CG    1 
ATOM   641  C CD    . GLN A 1 84  ? 16.233 15.767 70.914 1.00 29.03 ? 1041 GLN A CD    1 
ATOM   642  O OE1   . GLN A 1 84  ? 16.658 15.180 71.912 1.00 27.92 ? 1041 GLN A OE1   1 
ATOM   643  N NE2   . GLN A 1 84  ? 16.042 17.084 70.885 1.00 28.40 ? 1041 GLN A NE2   1 
ATOM   644  N N     . GLY A 1 85  ? 20.346 13.660 69.461 1.00 29.78 ? 1042 GLY A N     1 
ATOM   645  C CA    . GLY A 1 85  ? 21.416 12.681 69.473 1.00 30.56 ? 1042 GLY A CA    1 
ATOM   646  C C     . GLY A 1 85  ? 22.450 12.906 68.390 1.00 30.69 ? 1042 GLY A C     1 
ATOM   647  O O     . GLY A 1 85  ? 22.362 13.873 67.633 1.00 30.15 ? 1042 GLY A O     1 
ATOM   648  N N     . GLN A 1 86  ? 23.429 12.006 68.323 1.00 31.46 ? 1043 GLN A N     1 
ATOM   649  C CA    . GLN A 1 86  ? 24.515 12.079 67.346 1.00 32.43 ? 1043 GLN A CA    1 
ATOM   650  C C     . GLN A 1 86  ? 24.522 10.850 66.440 1.00 32.77 ? 1043 GLN A C     1 
ATOM   651  O O     . GLN A 1 86  ? 24.241 9.743  66.891 1.00 33.12 ? 1043 GLN A O     1 
ATOM   652  C CB    . GLN A 1 86  ? 25.866 12.151 68.059 1.00 34.00 ? 1043 GLN A CB    1 
ATOM   653  C CG    . GLN A 1 86  ? 26.148 13.442 68.812 1.00 37.12 ? 1043 GLN A CG    1 
ATOM   654  C CD    . GLN A 1 86  ? 26.205 14.644 67.900 1.00 39.01 ? 1043 GLN A CD    1 
ATOM   655  O OE1   . GLN A 1 86  ? 26.735 14.571 66.790 1.00 40.86 ? 1043 GLN A OE1   1 
ATOM   656  N NE2   . GLN A 1 86  ? 25.669 15.766 68.367 1.00 40.27 ? 1043 GLN A NE2   1 
ATOM   657  N N     . PRO A 1 87  ? 24.846 11.031 65.149 1.00 32.54 ? 1044 PRO A N     1 
ATOM   658  C CA    . PRO A 1 87  ? 25.186 12.322 64.549 1.00 32.39 ? 1044 PRO A CA    1 
ATOM   659  C C     . PRO A 1 87  ? 23.914 13.000 64.050 1.00 32.36 ? 1044 PRO A C     1 
ATOM   660  O O     . PRO A 1 87  ? 22.865 12.363 63.955 1.00 33.32 ? 1044 PRO A O     1 
ATOM   661  C CB    . PRO A 1 87  ? 26.110 11.928 63.408 1.00 33.13 ? 1044 PRO A CB    1 
ATOM   662  C CG    . PRO A 1 87  ? 25.473 10.668 62.920 1.00 32.65 ? 1044 PRO A CG    1 
ATOM   663  C CD    . PRO A 1 87  ? 25.155 9.930  64.215 1.00 32.82 ? 1044 PRO A CD    1 
ATOM   664  N N     . THR A 1 88  ? 24.001 14.287 63.736 1.00 31.62 ? 1045 THR A N     1 
ATOM   665  C CA    . THR A 1 88  ? 22.838 15.007 63.235 1.00 31.95 ? 1045 THR A CA    1 
ATOM   666  C C     . THR A 1 88  ? 22.611 14.528 61.807 1.00 32.04 ? 1045 THR A C     1 
ATOM   667  O O     . THR A 1 88  ? 23.544 14.512 61.009 1.00 31.50 ? 1045 THR A O     1 
ATOM   668  C CB    . THR A 1 88  ? 23.078 16.527 63.238 1.00 30.98 ? 1045 THR A CB    1 
ATOM   669  O OG1   . THR A 1 88  ? 23.368 16.951 64.574 1.00 32.60 ? 1045 THR A OG1   1 
ATOM   670  C CG2   . THR A 1 88  ? 21.843 17.267 62.734 1.00 30.05 ? 1045 THR A CG2   1 
ATOM   671  N N     . LEU A 1 89  ? 21.375 14.142 61.494 1.00 31.79 ? 1046 LEU A N     1 
ATOM   672  C CA    . LEU A 1 89  ? 21.040 13.620 60.171 1.00 31.21 ? 1046 LEU A CA    1 
ATOM   673  C C     . LEU A 1 89  ? 19.897 14.355 59.488 1.00 30.26 ? 1046 LEU A C     1 
ATOM   674  O O     . LEU A 1 89  ? 19.038 14.962 60.129 1.00 29.16 ? 1046 LEU A O     1 
ATOM   675  C CB    . LEU A 1 89  ? 20.624 12.146 60.268 1.00 31.56 ? 1046 LEU A CB    1 
ATOM   676  C CG    . LEU A 1 89  ? 21.428 11.113 61.055 1.00 32.73 ? 1046 LEU A CG    1 
ATOM   677  C CD1   . LEU A 1 89  ? 20.616 9.840  61.169 1.00 33.67 ? 1046 LEU A CD1   1 
ATOM   678  C CD2   . LEU A 1 89  ? 22.744 10.833 60.371 1.00 34.70 ? 1046 LEU A CD2   1 
ATOM   679  N N     . VAL A 1 90  ? 19.907 14.270 58.167 1.00 29.24 ? 1047 VAL A N     1 
ATOM   680  C CA    . VAL A 1 90  ? 18.879 14.842 57.320 1.00 28.54 ? 1047 VAL A CA    1 
ATOM   681  C C     . VAL A 1 90  ? 18.614 13.725 56.315 1.00 27.82 ? 1047 VAL A C     1 
ATOM   682  O O     . VAL A 1 90  ? 19.549 13.207 55.709 1.00 26.31 ? 1047 VAL A O     1 
ATOM   683  C CB    . VAL A 1 90  ? 19.396 16.111 56.609 1.00 29.50 ? 1047 VAL A CB    1 
ATOM   684  C CG1   . VAL A 1 90  ? 18.489 16.476 55.459 1.00 30.23 ? 1047 VAL A CG1   1 
ATOM   685  C CG2   . VAL A 1 90  ? 19.447 17.267 57.605 1.00 31.02 ? 1047 VAL A CG2   1 
ATOM   686  N N     . ILE A 1 91  ? 17.355 13.336 56.151 1.00 26.75 ? 1048 ILE A N     1 
ATOM   687  C CA    . ILE A 1 91  ? 17.027 12.276 55.206 1.00 27.52 ? 1048 ILE A CA    1 
ATOM   688  C C     . ILE A 1 91  ? 16.263 12.860 54.034 1.00 27.06 ? 1048 ILE A C     1 
ATOM   689  O O     . ILE A 1 91  ? 15.316 13.633 54.204 1.00 25.43 ? 1048 ILE A O     1 
ATOM   690  C CB    . ILE A 1 91  ? 16.203 11.127 55.847 1.00 29.73 ? 1048 ILE A CB    1 
ATOM   691  C CG1   . ILE A 1 91  ? 14.870 11.656 56.362 1.00 31.04 ? 1048 ILE A CG1   1 
ATOM   692  C CG2   . ILE A 1 91  ? 17.008 10.480 56.987 1.00 31.47 ? 1048 ILE A CG2   1 
ATOM   693  C CD1   . ILE A 1 91  ? 13.856 10.566 56.643 1.00 32.40 ? 1048 ILE A CD1   1 
ATOM   694  N N     . MET A 1 92  ? 16.694 12.478 52.842 1.00 26.59 ? 1049 MET A N     1 
ATOM   695  C CA    . MET A 1 92  ? 16.126 12.995 51.617 1.00 27.96 ? 1049 MET A CA    1 
ATOM   696  C C     . MET A 1 92  ? 15.826 11.925 50.583 1.00 27.54 ? 1049 MET A C     1 
ATOM   697  O O     . MET A 1 92  ? 16.293 10.788 50.678 1.00 26.92 ? 1049 MET A O     1 
ATOM   698  C CB    . MET A 1 92  ? 17.096 14.001 50.998 1.00 31.77 ? 1049 MET A CB    1 
ATOM   699  C CG    . MET A 1 92  ? 17.301 15.262 51.820 1.00 36.77 ? 1049 MET A CG    1 
ATOM   700  S SD    . MET A 1 92  ? 18.637 16.246 51.139 1.00 44.84 ? 1049 MET A SD    1 
ATOM   701  C CE    . MET A 1 92  ? 18.102 16.428 49.440 1.00 42.11 ? 1049 MET A CE    1 
ATOM   702  N N     . GLU A 1 93  ? 15.041 12.329 49.593 1.00 25.29 ? 1050 GLU A N     1 
ATOM   703  C CA    . GLU A 1 93  ? 14.658 11.485 48.484 1.00 25.13 ? 1050 GLU A CA    1 
ATOM   704  C C     . GLU A 1 93  ? 15.937 10.898 47.889 1.00 24.01 ? 1050 GLU A C     1 
ATOM   705  O O     . GLU A 1 93  ? 16.916 11.613 47.683 1.00 22.50 ? 1050 GLU A O     1 
ATOM   706  C CB    . GLU A 1 93  ? 13.933 12.340 47.443 1.00 24.45 ? 1050 GLU A CB    1 
ATOM   707  C CG    . GLU A 1 93  ? 13.500 11.605 46.200 1.00 25.49 ? 1050 GLU A CG    1 
ATOM   708  C CD    . GLU A 1 93  ? 12.879 12.529 45.170 1.00 25.10 ? 1050 GLU A CD    1 
ATOM   709  O OE1   . GLU A 1 93  ? 12.590 12.054 44.060 1.00 24.97 ? 1050 GLU A OE1   1 
ATOM   710  O OE2   . GLU A 1 93  ? 12.675 13.730 45.461 1.00 26.25 ? 1050 GLU A OE2   1 
ATOM   711  N N     . LEU A 1 94  ? 15.931 9.596  47.620 1.00 24.01 ? 1051 LEU A N     1 
ATOM   712  C CA    . LEU A 1 94  ? 17.104 8.941  47.047 1.00 23.23 ? 1051 LEU A CA    1 
ATOM   713  C C     . LEU A 1 94  ? 17.134 9.155  45.535 1.00 22.80 ? 1051 LEU A C     1 
ATOM   714  O O     . LEU A 1 94  ? 16.146 8.928  44.851 1.00 22.75 ? 1051 LEU A O     1 
ATOM   715  C CB    . LEU A 1 94  ? 17.079 7.437  47.360 1.00 24.45 ? 1051 LEU A CB    1 
ATOM   716  C CG    . LEU A 1 94  ? 18.263 6.594  46.863 1.00 22.72 ? 1051 LEU A CG    1 
ATOM   717  C CD1   . LEU A 1 94  ? 19.544 7.080  47.525 1.00 23.98 ? 1051 LEU A CD1   1 
ATOM   718  C CD2   . LEU A 1 94  ? 18.031 5.113  47.194 1.00 23.76 ? 1051 LEU A CD2   1 
ATOM   719  N N     . MET A 1 95  ? 18.277 9.598  45.026 1.00 23.22 ? 1052 MET A N     1 
ATOM   720  C CA    . MET A 1 95  ? 18.473 9.837  43.600 1.00 24.25 ? 1052 MET A CA    1 
ATOM   721  C C     . MET A 1 95  ? 19.578 8.854  43.216 1.00 24.98 ? 1052 MET A C     1 
ATOM   722  O O     . MET A 1 95  ? 20.767 9.181  43.293 1.00 23.42 ? 1052 MET A O     1 
ATOM   723  C CB    . MET A 1 95  ? 18.935 11.285 43.372 1.00 24.55 ? 1052 MET A CB    1 
ATOM   724  C CG    . MET A 1 95  ? 17.943 12.339 43.879 1.00 24.25 ? 1052 MET A CG    1 
ATOM   725  S SD    . MET A 1 95  ? 16.321 12.208 43.092 1.00 25.17 ? 1052 MET A SD    1 
ATOM   726  C CE    . MET A 1 95  ? 16.704 12.783 41.428 1.00 24.92 ? 1052 MET A CE    1 
ATOM   727  N N     . THR A 1 96  ? 19.181 7.649  42.805 1.00 26.09 ? 1053 THR A N     1 
ATOM   728  C CA    . THR A 1 96  ? 20.153 6.600  42.493 1.00 27.23 ? 1053 THR A CA    1 
ATOM   729  C C     . THR A 1 96  ? 21.257 6.900  41.480 1.00 27.85 ? 1053 THR A C     1 
ATOM   730  O O     . THR A 1 96  ? 22.354 6.363  41.606 1.00 27.93 ? 1053 THR A O     1 
ATOM   731  C CB    . THR A 1 96  ? 19.444 5.268  42.098 1.00 27.09 ? 1053 THR A CB    1 
ATOM   732  O OG1   . THR A 1 96  ? 18.581 5.478  40.974 1.00 27.57 ? 1053 THR A OG1   1 
ATOM   733  C CG2   . THR A 1 96  ? 18.614 4.744  43.276 1.00 27.54 ? 1053 THR A CG2   1 
ATOM   734  N N     . ARG A 1 97  ? 20.998 7.747  40.489 1.00 27.94 ? 1054 ARG A N     1 
ATOM   735  C CA    . ARG A 1 97  ? 22.031 8.056  39.499 1.00 28.48 ? 1054 ARG A CA    1 
ATOM   736  C C     . ARG A 1 97  ? 23.034 9.157  39.883 1.00 28.15 ? 1054 ARG A C     1 
ATOM   737  O O     . ARG A 1 97  ? 23.841 9.565  39.054 1.00 29.23 ? 1054 ARG A O     1 
ATOM   738  C CB    . ARG A 1 97  ? 21.399 8.413  38.150 1.00 30.54 ? 1054 ARG A CB    1 
ATOM   739  C CG    . ARG A 1 97  ? 21.108 7.238  37.216 1.00 32.85 ? 1054 ARG A CG    1 
ATOM   740  C CD    . ARG A 1 97  ? 19.916 6.431  37.657 1.00 34.31 ? 1054 ARG A CD    1 
ATOM   741  N NE    . ARG A 1 97  ? 19.282 5.705  36.550 1.00 35.72 ? 1054 ARG A NE    1 
ATOM   742  C CZ    . ARG A 1 97  ? 19.874 4.770  35.809 1.00 37.42 ? 1054 ARG A CZ    1 
ATOM   743  N NH1   . ARG A 1 97  ? 21.139 4.426  36.026 1.00 37.69 ? 1054 ARG A NH1   1 
ATOM   744  N NH2   . ARG A 1 97  ? 19.185 4.144  34.865 1.00 38.81 ? 1054 ARG A NH2   1 
ATOM   745  N N     . GLY A 1 98  ? 22.992 9.639  41.123 1.00 27.23 ? 1055 GLY A N     1 
ATOM   746  C CA    . GLY A 1 98  ? 23.937 10.660 41.550 1.00 25.42 ? 1055 GLY A CA    1 
ATOM   747  C C     . GLY A 1 98  ? 23.758 12.038 40.922 1.00 25.23 ? 1055 GLY A C     1 
ATOM   748  O O     . GLY A 1 98  ? 22.729 12.323 40.309 1.00 23.81 ? 1055 GLY A O     1 
ATOM   749  N N     . ASP A 1 99  ? 24.769 12.892 41.062 1.00 25.11 ? 1056 ASP A N     1 
ATOM   750  C CA    . ASP A 1 99  ? 24.684 14.246 40.510 1.00 26.01 ? 1056 ASP A CA    1 
ATOM   751  C C     . ASP A 1 99  ? 24.768 14.235 38.984 1.00 25.79 ? 1056 ASP A C     1 
ATOM   752  O O     . ASP A 1 99  ? 25.349 13.323 38.378 1.00 25.35 ? 1056 ASP A O     1 
ATOM   753  C CB    . ASP A 1 99  ? 25.781 15.142 41.095 1.00 26.20 ? 1056 ASP A CB    1 
ATOM   754  C CG    . ASP A 1 99  ? 27.164 14.777 40.596 1.00 28.11 ? 1056 ASP A CG    1 
ATOM   755  O OD1   . ASP A 1 99  ? 27.739 13.780 41.076 1.00 28.78 ? 1056 ASP A OD1   1 
ATOM   756  O OD2   . ASP A 1 99  ? 27.675 15.491 39.712 1.00 27.37 ? 1056 ASP A OD2   1 
ATOM   757  N N     . LEU A 1 100 ? 24.180 15.255 38.371 1.00 24.59 ? 1057 LEU A N     1 
ATOM   758  C CA    . LEU A 1 100 ? 24.146 15.368 36.921 1.00 24.01 ? 1057 LEU A CA    1 
ATOM   759  C C     . LEU A 1 100 ? 25.509 15.508 36.253 1.00 23.82 ? 1057 LEU A C     1 
ATOM   760  O O     . LEU A 1 100 ? 25.694 15.035 35.132 1.00 21.71 ? 1057 LEU A O     1 
ATOM   761  C CB    . LEU A 1 100 ? 23.259 16.544 36.500 1.00 23.32 ? 1057 LEU A CB    1 
ATOM   762  C CG    . LEU A 1 100 ? 23.153 16.728 34.981 1.00 22.90 ? 1057 LEU A CG    1 
ATOM   763  C CD1   . LEU A 1 100 ? 22.520 15.482 34.365 1.00 23.07 ? 1057 LEU A CD1   1 
ATOM   764  C CD2   . LEU A 1 100 ? 22.320 17.969 34.659 1.00 22.41 ? 1057 LEU A CD2   1 
ATOM   765  N N     . LYS A 1 101 ? 26.459 16.154 36.920 1.00 24.23 ? 1058 LYS A N     1 
ATOM   766  C CA    . LYS A 1 101 ? 27.774 16.313 36.309 1.00 27.06 ? 1058 LYS A CA    1 
ATOM   767  C C     . LYS A 1 101 ? 28.446 14.952 36.114 1.00 27.59 ? 1058 LYS A C     1 
ATOM   768  O O     . LYS A 1 101 ? 28.933 14.640 35.027 1.00 27.20 ? 1058 LYS A O     1 
ATOM   769  C CB    . LYS A 1 101 ? 28.684 17.207 37.157 1.00 27.89 ? 1058 LYS A CB    1 
ATOM   770  C CG    . LYS A 1 101 ? 30.057 17.358 36.504 1.00 29.99 ? 1058 LYS A CG    1 
ATOM   771  C CD    . LYS A 1 101 ? 31.050 18.151 37.324 1.00 31.64 ? 1058 LYS A CD    1 
ATOM   772  C CE    . LYS A 1 101 ? 32.395 18.185 36.591 1.00 33.30 ? 1058 LYS A CE    1 
ATOM   773  N NZ    . LYS A 1 101 ? 33.455 18.894 37.355 1.00 33.01 ? 1058 LYS A NZ    1 
ATOM   774  N N     . SER A 1 102 ? 28.469 14.149 37.174 1.00 28.77 ? 1059 SER A N     1 
ATOM   775  C CA    . SER A 1 102 ? 29.076 12.822 37.115 1.00 29.75 ? 1059 SER A CA    1 
ATOM   776  C C     . SER A 1 102 ? 28.340 11.948 36.111 1.00 30.79 ? 1059 SER A C     1 
ATOM   777  O O     . SER A 1 102 ? 28.956 11.160 35.400 1.00 31.10 ? 1059 SER A O     1 
ATOM   778  C CB    . SER A 1 102 ? 29.033 12.158 38.490 1.00 30.57 ? 1059 SER A CB    1 
ATOM   779  O OG    . SER A 1 102 ? 29.684 12.954 39.466 1.00 31.67 ? 1059 SER A OG    1 
ATOM   780  N N     . TYR A 1 103 ? 27.016 12.085 36.053 1.00 31.22 ? 1060 TYR A N     1 
ATOM   781  C CA    . TYR A 1 103 ? 26.219 11.291 35.126 1.00 31.33 ? 1060 TYR A CA    1 
ATOM   782  C C     . TYR A 1 103 ? 26.567 11.632 33.678 1.00 32.61 ? 1060 TYR A C     1 
ATOM   783  O O     . TYR A 1 103 ? 26.666 10.742 32.824 1.00 32.54 ? 1060 TYR A O     1 
ATOM   784  C CB    . TYR A 1 103 ? 24.724 11.522 35.364 1.00 30.63 ? 1060 TYR A CB    1 
ATOM   785  C CG    . TYR A 1 103 ? 23.856 10.868 34.318 1.00 30.43 ? 1060 TYR A CG    1 
ATOM   786  C CD1   . TYR A 1 103 ? 23.793 9.479  34.205 1.00 31.37 ? 1060 TYR A CD1   1 
ATOM   787  C CD2   . TYR A 1 103 ? 23.151 11.636 33.396 1.00 30.77 ? 1060 TYR A CD2   1 
ATOM   788  C CE1   . TYR A 1 103 ? 23.055 8.873  33.189 1.00 31.19 ? 1060 TYR A CE1   1 
ATOM   789  C CE2   . TYR A 1 103 ? 22.410 11.043 32.381 1.00 31.19 ? 1060 TYR A CE2   1 
ATOM   790  C CZ    . TYR A 1 103 ? 22.368 9.663  32.281 1.00 31.79 ? 1060 TYR A CZ    1 
ATOM   791  O OH    . TYR A 1 103 ? 21.652 9.082  31.263 1.00 32.50 ? 1060 TYR A OH    1 
ATOM   792  N N     . LEU A 1 104 ? 26.748 12.921 33.403 1.00 32.33 ? 1061 LEU A N     1 
ATOM   793  C CA    . LEU A 1 104 ? 27.100 13.368 32.061 1.00 32.62 ? 1061 LEU A CA    1 
ATOM   794  C C     . LEU A 1 104 ? 28.505 12.885 31.702 1.00 33.87 ? 1061 LEU A C     1 
ATOM   795  O O     . LEU A 1 104 ? 28.739 12.407 30.592 1.00 33.84 ? 1061 LEU A O     1 
ATOM   796  C CB    . LEU A 1 104 ? 27.027 14.896 31.974 1.00 30.76 ? 1061 LEU A CB    1 
ATOM   797  C CG    . LEU A 1 104 ? 25.627 15.518 32.075 1.00 30.20 ? 1061 LEU A CG    1 
ATOM   798  C CD1   . LEU A 1 104 ? 25.727 17.030 32.210 1.00 31.22 ? 1061 LEU A CD1   1 
ATOM   799  C CD2   . LEU A 1 104 ? 24.820 15.156 30.843 1.00 29.72 ? 1061 LEU A CD2   1 
ATOM   800  N N     . ARG A 1 105 ? 29.438 13.007 32.642 1.00 35.64 ? 1062 ARG A N     1 
ATOM   801  C CA    . ARG A 1 105 ? 30.810 12.568 32.401 1.00 38.37 ? 1062 ARG A CA    1 
ATOM   802  C C     . ARG A 1 105 ? 30.836 11.074 32.079 1.00 39.00 ? 1062 ARG A C     1 
ATOM   803  O O     . ARG A 1 105 ? 31.561 10.638 31.185 1.00 38.94 ? 1062 ARG A O     1 
ATOM   804  C CB    . ARG A 1 105 ? 31.695 12.828 33.630 1.00 38.58 ? 1062 ARG A CB    1 
ATOM   805  C CG    . ARG A 1 105 ? 31.898 14.295 33.991 1.00 41.31 ? 1062 ARG A CG    1 
ATOM   806  C CD    . ARG A 1 105 ? 32.698 15.048 32.937 1.00 42.21 ? 1062 ARG A CD    1 
ATOM   807  N NE    . ARG A 1 105 ? 34.030 14.483 32.727 1.00 44.06 ? 1062 ARG A NE    1 
ATOM   808  C CZ    . ARG A 1 105 ? 34.970 15.045 31.968 1.00 44.58 ? 1062 ARG A CZ    1 
ATOM   809  N NH1   . ARG A 1 105 ? 34.727 16.192 31.343 1.00 44.28 ? 1062 ARG A NH1   1 
ATOM   810  N NH2   . ARG A 1 105 ? 36.156 14.464 31.835 1.00 44.18 ? 1062 ARG A NH2   1 
ATOM   811  N N     . SER A 1 106 ? 30.037 10.299 32.809 1.00 40.20 ? 1063 SER A N     1 
ATOM   812  C CA    . SER A 1 106 ? 29.988 8.853  32.612 1.00 41.70 ? 1063 SER A CA    1 
ATOM   813  C C     . SER A 1 106 ? 29.549 8.474  31.202 1.00 42.85 ? 1063 SER A C     1 
ATOM   814  O O     . SER A 1 106 ? 29.748 7.338  30.773 1.00 43.24 ? 1063 SER A O     1 
ATOM   815  C CB    . SER A 1 106 ? 29.040 8.202  33.627 1.00 41.52 ? 1063 SER A CB    1 
ATOM   816  O OG    . SER A 1 106 ? 27.685 8.291  33.208 1.00 41.02 ? 1063 SER A OG    1 
ATOM   817  N N     . LEU A 1 107 ? 28.952 9.416  30.482 1.00 43.80 ? 1064 LEU A N     1 
ATOM   818  C CA    . LEU A 1 107 ? 28.492 9.137  29.126 1.00 45.47 ? 1064 LEU A CA    1 
ATOM   819  C C     . LEU A 1 107 ? 29.544 9.467  28.074 1.00 47.26 ? 1064 LEU A C     1 
ATOM   820  O O     . LEU A 1 107 ? 29.302 9.313  26.878 1.00 47.07 ? 1064 LEU A O     1 
ATOM   821  C CB    . LEU A 1 107 ? 27.212 9.916  28.820 1.00 44.46 ? 1064 LEU A CB    1 
ATOM   822  C CG    . LEU A 1 107 ? 26.023 9.692  29.756 1.00 43.90 ? 1064 LEU A CG    1 
ATOM   823  C CD1   . LEU A 1 107 ? 24.834 10.480 29.235 1.00 43.45 ? 1064 LEU A CD1   1 
ATOM   824  C CD2   . LEU A 1 107 ? 25.686 8.205  29.842 1.00 43.77 ? 1064 LEU A CD2   1 
ATOM   825  N N     . ARG A 1 108 ? 30.709 9.922  28.521 1.00 49.35 ? 1065 ARG A N     1 
ATOM   826  C CA    . ARG A 1 108 ? 31.783 10.263 27.601 1.00 52.09 ? 1065 ARG A CA    1 
ATOM   827  C C     . ARG A 1 108 ? 32.370 9.016  26.949 1.00 54.17 ? 1065 ARG A C     1 
ATOM   828  O O     . ARG A 1 108 ? 32.645 8.025  27.624 1.00 53.99 ? 1065 ARG A O     1 
ATOM   829  C CB    . ARG A 1 108 ? 32.886 11.020 28.337 1.00 52.42 ? 1065 ARG A CB    1 
ATOM   830  C CG    . ARG A 1 108 ? 32.592 12.489 28.550 1.00 52.70 ? 1065 ARG A CG    1 
ATOM   831  C CD    . ARG A 1 108 ? 33.639 13.120 29.442 1.00 52.80 ? 1065 ARG A CD    1 
ATOM   832  N NE    . ARG A 1 108 ? 33.543 14.575 29.433 1.00 53.49 ? 1065 ARG A NE    1 
ATOM   833  C CZ    . ARG A 1 108 ? 33.843 15.332 28.385 1.00 53.15 ? 1065 ARG A CZ    1 
ATOM   834  N NH1   . ARG A 1 108 ? 34.263 14.771 27.261 1.00 53.36 ? 1065 ARG A NH1   1 
ATOM   835  N NH2   . ARG A 1 108 ? 33.720 16.649 28.459 1.00 53.44 ? 1065 ARG A NH2   1 
ATOM   836  N N     . PRO A 1 109 ? 32.564 9.052  25.620 1.00 56.25 ? 1066 PRO A N     1 
ATOM   837  C CA    . PRO A 1 109 ? 33.124 7.925  24.867 1.00 57.98 ? 1066 PRO A CA    1 
ATOM   838  C C     . PRO A 1 109 ? 34.489 7.516  25.414 1.00 59.42 ? 1066 PRO A C     1 
ATOM   839  O O     . PRO A 1 109 ? 34.835 6.333  25.436 1.00 59.72 ? 1066 PRO A O     1 
ATOM   840  C CB    . PRO A 1 109 ? 33.214 8.474  23.446 1.00 57.80 ? 1066 PRO A CB    1 
ATOM   841  C CG    . PRO A 1 109 ? 32.049 9.415  23.385 1.00 57.81 ? 1066 PRO A CG    1 
ATOM   842  C CD    . PRO A 1 109 ? 32.167 10.140 24.708 1.00 56.81 ? 1066 PRO A CD    1 
ATOM   843  N N     . GLU A 1 110 ? 35.260 8.505  25.854 1.00 60.85 ? 1067 GLU A N     1 
ATOM   844  C CA    . GLU A 1 110 ? 36.585 8.253  26.408 1.00 62.41 ? 1067 GLU A CA    1 
ATOM   845  C C     . GLU A 1 110 ? 36.479 7.378  27.653 1.00 63.46 ? 1067 GLU A C     1 
ATOM   846  O O     . GLU A 1 110 ? 37.005 6.263  27.687 1.00 63.97 ? 1067 GLU A O     1 
ATOM   847  N N     . MET A 1 111 ? 35.794 7.890  28.671 1.00 64.16 ? 1068 MET A N     1 
ATOM   848  C CA    . MET A 1 111 ? 35.610 7.160  29.922 1.00 64.75 ? 1068 MET A CA    1 
ATOM   849  C C     . MET A 1 111 ? 34.508 6.111  29.793 1.00 65.31 ? 1068 MET A C     1 
ATOM   850  O O     . MET A 1 111 ? 33.320 6.423  29.900 1.00 65.66 ? 1068 MET A O     1 
ATOM   851  N N     . PRO A 1 120 ? 23.717 11.407 24.803 1.00 50.21 ? 1077 PRO A N     1 
ATOM   852  C CA    . PRO A 1 120 ? 22.259 11.525 24.908 1.00 49.31 ? 1077 PRO A CA    1 
ATOM   853  C C     . PRO A 1 120 ? 21.624 12.203 23.693 1.00 48.53 ? 1077 PRO A C     1 
ATOM   854  O O     . PRO A 1 120 ? 22.190 13.136 23.121 1.00 48.48 ? 1077 PRO A O     1 
ATOM   855  C CB    . PRO A 1 120 ? 22.073 12.326 26.196 1.00 49.44 ? 1077 PRO A CB    1 
ATOM   856  C CG    . PRO A 1 120 ? 23.272 13.215 26.204 1.00 50.26 ? 1077 PRO A CG    1 
ATOM   857  C CD    . PRO A 1 120 ? 24.386 12.271 25.793 1.00 50.38 ? 1077 PRO A CD    1 
ATOM   858  N N     . SER A 1 121 ? 20.445 11.724 23.307 1.00 47.25 ? 1078 SER A N     1 
ATOM   859  C CA    . SER A 1 121 ? 19.729 12.262 22.156 1.00 45.97 ? 1078 SER A CA    1 
ATOM   860  C C     . SER A 1 121 ? 19.218 13.677 22.394 1.00 45.53 ? 1078 SER A C     1 
ATOM   861  O O     . SER A 1 121 ? 19.163 14.151 23.526 1.00 45.17 ? 1078 SER A O     1 
ATOM   862  C CB    . SER A 1 121 ? 18.541 11.362 21.807 1.00 45.85 ? 1078 SER A CB    1 
ATOM   863  O OG    . SER A 1 121 ? 17.542 11.432 22.810 1.00 44.10 ? 1078 SER A OG    1 
ATOM   864  N N     . LEU A 1 122 ? 18.840 14.344 21.309 1.00 44.74 ? 1079 LEU A N     1 
ATOM   865  C CA    . LEU A 1 122 ? 18.319 15.696 21.387 1.00 44.11 ? 1079 LEU A CA    1 
ATOM   866  C C     . LEU A 1 122 ? 17.122 15.732 22.325 1.00 43.56 ? 1079 LEU A C     1 
ATOM   867  O O     . LEU A 1 122 ? 17.003 16.639 23.143 1.00 43.97 ? 1079 LEU A O     1 
ATOM   868  C CB    . LEU A 1 122 ? 17.899 16.184 20.001 1.00 44.85 ? 1079 LEU A CB    1 
ATOM   869  N N     . SER A 1 123 ? 16.237 14.746 22.202 1.00 42.66 ? 1080 SER A N     1 
ATOM   870  C CA    . SER A 1 123 ? 15.049 14.672 23.048 1.00 42.08 ? 1080 SER A CA    1 
ATOM   871  C C     . SER A 1 123 ? 15.380 14.468 24.520 1.00 40.47 ? 1080 SER A C     1 
ATOM   872  O O     . SER A 1 123 ? 14.743 15.063 25.391 1.00 39.95 ? 1080 SER A O     1 
ATOM   873  C CB    . SER A 1 123 ? 14.126 13.549 22.582 1.00 42.75 ? 1080 SER A CB    1 
ATOM   874  O OG    . SER A 1 123 ? 13.350 13.976 21.480 1.00 46.12 ? 1080 SER A OG    1 
ATOM   875  N N     . LYS A 1 124 ? 16.369 13.626 24.798 1.00 38.72 ? 1081 LYS A N     1 
ATOM   876  C CA    . LYS A 1 124 ? 16.770 13.377 26.173 1.00 37.03 ? 1081 LYS A CA    1 
ATOM   877  C C     . LYS A 1 124 ? 17.356 14.661 26.764 1.00 35.75 ? 1081 LYS A C     1 
ATOM   878  O O     . LYS A 1 124 ? 17.112 14.988 27.921 1.00 35.30 ? 1081 LYS A O     1 
ATOM   879  C CB    . LYS A 1 124 ? 17.803 12.248 26.233 1.00 37.18 ? 1081 LYS A CB    1 
ATOM   880  N N     . MET A 1 125 ? 18.127 15.389 25.963 1.00 34.22 ? 1082 MET A N     1 
ATOM   881  C CA    . MET A 1 125 ? 18.725 16.631 26.432 1.00 33.27 ? 1082 MET A CA    1 
ATOM   882  C C     . MET A 1 125 ? 17.668 17.688 26.718 1.00 31.88 ? 1082 MET A C     1 
ATOM   883  O O     . MET A 1 125 ? 17.744 18.399 27.718 1.00 31.22 ? 1082 MET A O     1 
ATOM   884  C CB    . MET A 1 125 ? 19.719 17.170 25.407 1.00 32.69 ? 1082 MET A CB    1 
ATOM   885  C CG    . MET A 1 125 ? 21.034 16.423 25.369 1.00 34.08 ? 1082 MET A CG    1 
ATOM   886  S SD    . MET A 1 125 ? 22.228 17.260 24.309 1.00 35.04 ? 1082 MET A SD    1 
ATOM   887  C CE    . MET A 1 125 ? 21.798 16.572 22.721 1.00 36.67 ? 1082 MET A CE    1 
ATOM   888  N N     . ILE A 1 126 ? 16.683 17.789 25.837 1.00 31.11 ? 1083 ILE A N     1 
ATOM   889  C CA    . ILE A 1 126 ? 15.613 18.762 26.008 1.00 31.70 ? 1083 ILE A CA    1 
ATOM   890  C C     . ILE A 1 126 ? 14.739 18.386 27.199 1.00 30.87 ? 1083 ILE A C     1 
ATOM   891  O O     . ILE A 1 126 ? 14.202 19.258 27.881 1.00 29.96 ? 1083 ILE A O     1 
ATOM   892  C CB    . ILE A 1 126 ? 14.729 18.849 24.750 1.00 32.09 ? 1083 ILE A CB    1 
ATOM   893  C CG1   . ILE A 1 126 ? 15.590 19.225 23.542 1.00 34.08 ? 1083 ILE A CG1   1 
ATOM   894  C CG2   . ILE A 1 126 ? 13.622 19.876 24.957 1.00 32.34 ? 1083 ILE A CG2   1 
ATOM   895  C CD1   . ILE A 1 126 ? 16.247 20.580 23.653 1.00 36.60 ? 1083 ILE A CD1   1 
ATOM   896  N N     . GLN A 1 127 ? 14.596 17.089 27.446 1.00 30.30 ? 1084 GLN A N     1 
ATOM   897  C CA    . GLN A 1 127 ? 13.790 16.630 28.571 1.00 30.80 ? 1084 GLN A CA    1 
ATOM   898  C C     . GLN A 1 127 ? 14.474 17.074 29.866 1.00 29.31 ? 1084 GLN A C     1 
ATOM   899  O O     . GLN A 1 127 ? 13.818 17.518 30.802 1.00 28.83 ? 1084 GLN A O     1 
ATOM   900  C CB    . GLN A 1 127 ? 13.649 15.099 28.539 1.00 30.73 ? 1084 GLN A CB    1 
ATOM   901  C CG    . GLN A 1 127 ? 12.833 14.494 29.683 1.00 32.39 ? 1084 GLN A CG    1 
ATOM   902  C CD    . GLN A 1 127 ? 11.361 14.892 29.653 1.00 34.29 ? 1084 GLN A CD    1 
ATOM   903  O OE1   . GLN A 1 127 ? 10.754 15.003 28.586 1.00 35.55 ? 1084 GLN A OE1   1 
ATOM   904  N NE2   . GLN A 1 127 ? 10.777 15.090 30.831 1.00 34.50 ? 1084 GLN A NE2   1 
ATOM   905  N N     . MET A 1 128 ? 15.796 16.950 29.913 1.00 28.54 ? 1085 MET A N     1 
ATOM   906  C CA    . MET A 1 128 ? 16.548 17.351 31.098 1.00 28.16 ? 1085 MET A CA    1 
ATOM   907  C C     . MET A 1 128 ? 16.433 18.851 31.319 1.00 26.68 ? 1085 MET A C     1 
ATOM   908  O O     . MET A 1 128 ? 16.256 19.314 32.447 1.00 25.69 ? 1085 MET A O     1 
ATOM   909  C CB    . MET A 1 128 ? 18.020 16.971 30.957 1.00 29.48 ? 1085 MET A CB    1 
ATOM   910  C CG    . MET A 1 128 ? 18.262 15.476 30.997 1.00 31.03 ? 1085 MET A CG    1 
ATOM   911  S SD    . MET A 1 128 ? 19.989 15.097 31.283 1.00 35.66 ? 1085 MET A SD    1 
ATOM   912  C CE    . MET A 1 128 ? 20.646 15.318 29.654 1.00 34.45 ? 1085 MET A CE    1 
ATOM   913  N N     . ALA A 1 129 ? 16.531 19.605 30.231 1.00 25.68 ? 1086 ALA A N     1 
ATOM   914  C CA    . ALA A 1 129 ? 16.436 21.053 30.300 1.00 25.06 ? 1086 ALA A CA    1 
ATOM   915  C C     . ALA A 1 129 ? 15.079 21.459 30.859 1.00 24.78 ? 1086 ALA A C     1 
ATOM   916  O O     . ALA A 1 129 ? 14.977 22.373 31.676 1.00 24.75 ? 1086 ALA A O     1 
ATOM   917  C CB    . ALA A 1 129 ? 16.622 21.649 28.914 1.00 24.11 ? 1086 ALA A CB    1 
ATOM   918  N N     . GLY A 1 130 ? 14.034 20.773 30.411 1.00 24.46 ? 1087 GLY A N     1 
ATOM   919  C CA    . GLY A 1 130 ? 12.695 21.098 30.865 1.00 23.43 ? 1087 GLY A CA    1 
ATOM   920  C C     . GLY A 1 130 ? 12.463 20.798 32.329 1.00 22.99 ? 1087 GLY A C     1 
ATOM   921  O O     . GLY A 1 130 ? 11.788 21.559 33.024 1.00 23.28 ? 1087 GLY A O     1 
ATOM   922  N N     . GLU A 1 131 ? 13.013 19.683 32.799 1.00 22.82 ? 1088 GLU A N     1 
ATOM   923  C CA    . GLU A 1 131 ? 12.854 19.283 34.192 1.00 22.14 ? 1088 GLU A CA    1 
ATOM   924  C C     . GLU A 1 131 ? 13.580 20.263 35.117 1.00 22.13 ? 1088 GLU A C     1 
ATOM   925  O O     . GLU A 1 131 ? 13.031 20.686 36.136 1.00 20.88 ? 1088 GLU A O     1 
ATOM   926  C CB    . GLU A 1 131 ? 13.375 17.855 34.375 1.00 22.81 ? 1088 GLU A CB    1 
ATOM   927  C CG    . GLU A 1 131 ? 12.690 16.850 33.435 1.00 25.10 ? 1088 GLU A CG    1 
ATOM   928  C CD    . GLU A 1 131 ? 13.232 15.434 33.559 1.00 26.12 ? 1088 GLU A CD    1 
ATOM   929  O OE1   . GLU A 1 131 ? 14.452 15.277 33.769 1.00 25.99 ? 1088 GLU A OE1   1 
ATOM   930  O OE2   . GLU A 1 131 ? 12.438 14.476 33.424 1.00 25.70 ? 1088 GLU A OE2   1 
ATOM   931  N N     . ILE A 1 132 ? 14.806 20.627 34.753 1.00 20.22 ? 1089 ILE A N     1 
ATOM   932  C CA    . ILE A 1 132 ? 15.599 21.563 35.546 1.00 20.98 ? 1089 ILE A CA    1 
ATOM   933  C C     . ILE A 1 132 ? 14.917 22.927 35.600 1.00 21.22 ? 1089 ILE A C     1 
ATOM   934  O O     . ILE A 1 132 ? 14.838 23.554 36.663 1.00 22.10 ? 1089 ILE A O     1 
ATOM   935  C CB    . ILE A 1 132 ? 17.016 21.754 34.940 1.00 20.69 ? 1089 ILE A CB    1 
ATOM   936  C CG1   . ILE A 1 132 ? 17.795 20.433 35.011 1.00 20.64 ? 1089 ILE A CG1   1 
ATOM   937  C CG2   . ILE A 1 132 ? 17.749 22.866 35.681 1.00 18.72 ? 1089 ILE A CG2   1 
ATOM   938  C CD1   . ILE A 1 132 ? 19.100 20.431 34.215 1.00 19.57 ? 1089 ILE A CD1   1 
ATOM   939  N N     . ALA A 1 133 ? 14.429 23.377 34.447 1.00 19.87 ? 1090 ALA A N     1 
ATOM   940  C CA    . ALA A 1 133 ? 13.747 24.663 34.344 1.00 20.24 ? 1090 ALA A CA    1 
ATOM   941  C C     . ALA A 1 133 ? 12.449 24.646 35.152 1.00 19.68 ? 1090 ALA A C     1 
ATOM   942  O O     . ALA A 1 133 ? 12.062 25.660 35.728 1.00 20.08 ? 1090 ALA A O     1 
ATOM   943  C CB    . ALA A 1 133 ? 13.452 24.989 32.875 1.00 19.78 ? 1090 ALA A CB    1 
ATOM   944  N N     . ASP A 1 134 ? 11.781 23.497 35.200 1.00 20.03 ? 1091 ASP A N     1 
ATOM   945  C CA    . ASP A 1 134 ? 10.535 23.396 35.961 1.00 20.16 ? 1091 ASP A CA    1 
ATOM   946  C C     . ASP A 1 134 ? 10.836 23.518 37.457 1.00 19.57 ? 1091 ASP A C     1 
ATOM   947  O O     . ASP A 1 134 ? 10.134 24.215 38.186 1.00 19.64 ? 1091 ASP A O     1 
ATOM   948  C CB    . ASP A 1 134 ? 9.822  22.066 35.680 1.00 18.81 ? 1091 ASP A CB    1 
ATOM   949  C CG    . ASP A 1 134 ? 8.399  22.041 36.231 1.00 21.37 ? 1091 ASP A CG    1 
ATOM   950  O OD1   . ASP A 1 134 ? 7.581  22.884 35.807 1.00 21.94 ? 1091 ASP A OD1   1 
ATOM   951  O OD2   . ASP A 1 134 ? 8.094  21.189 37.091 1.00 22.30 ? 1091 ASP A OD2   1 
ATOM   952  N N     . GLY A 1 135 ? 11.884 22.838 37.913 1.00 18.41 ? 1092 GLY A N     1 
ATOM   953  C CA    . GLY A 1 135 ? 12.243 22.920 39.317 1.00 17.43 ? 1092 GLY A CA    1 
ATOM   954  C C     . GLY A 1 135 ? 12.625 24.346 39.673 1.00 17.88 ? 1092 GLY A C     1 
ATOM   955  O O     . GLY A 1 135 ? 12.257 24.853 40.740 1.00 17.91 ? 1092 GLY A O     1 
ATOM   956  N N     . MET A 1 136 ? 13.360 25.002 38.778 1.00 17.50 ? 1093 MET A N     1 
ATOM   957  C CA    . MET A 1 136 ? 13.785 26.379 39.008 1.00 18.03 ? 1093 MET A CA    1 
ATOM   958  C C     . MET A 1 136 ? 12.584 27.318 38.968 1.00 19.25 ? 1093 MET A C     1 
ATOM   959  O O     . MET A 1 136 ? 12.497 28.251 39.762 1.00 20.32 ? 1093 MET A O     1 
ATOM   960  C CB    . MET A 1 136 ? 14.820 26.800 37.967 1.00 17.76 ? 1093 MET A CB    1 
ATOM   961  C CG    . MET A 1 136 ? 16.170 26.087 38.113 1.00 19.10 ? 1093 MET A CG    1 
ATOM   962  S SD    . MET A 1 136 ? 16.909 26.353 39.738 1.00 20.39 ? 1093 MET A SD    1 
ATOM   963  C CE    . MET A 1 136 ? 17.132 28.154 39.709 1.00 21.07 ? 1093 MET A CE    1 
ATOM   964  N N     . ALA A 1 137 ? 11.654 27.074 38.048 1.00 19.76 ? 1094 ALA A N     1 
ATOM   965  C CA    . ALA A 1 137 ? 10.456 27.909 37.969 1.00 20.51 ? 1094 ALA A CA    1 
ATOM   966  C C     . ALA A 1 137 ? 9.725  27.831 39.311 1.00 21.07 ? 1094 ALA A C     1 
ATOM   967  O O     . ALA A 1 137 ? 9.256  28.844 39.834 1.00 21.81 ? 1094 ALA A O     1 
ATOM   968  C CB    . ALA A 1 137 ? 9.548  27.424 36.840 1.00 19.84 ? 1094 ALA A CB    1 
ATOM   969  N N     . TYR A 1 138 ? 9.639  26.622 39.865 1.00 21.19 ? 1095 TYR A N     1 
ATOM   970  C CA    . TYR A 1 138 ? 8.986  26.402 41.154 1.00 21.83 ? 1095 TYR A CA    1 
ATOM   971  C C     . TYR A 1 138 ? 9.698  27.224 42.229 1.00 23.46 ? 1095 TYR A C     1 
ATOM   972  O O     . TYR A 1 138 ? 9.068  27.957 43.002 1.00 22.56 ? 1095 TYR A O     1 
ATOM   973  C CB    . TYR A 1 138 ? 9.035  24.913 41.534 1.00 21.54 ? 1095 TYR A CB    1 
ATOM   974  C CG    . TYR A 1 138 ? 8.518  24.628 42.934 1.00 22.93 ? 1095 TYR A CG    1 
ATOM   975  C CD1   . TYR A 1 138 ? 7.149  24.607 43.207 1.00 23.33 ? 1095 TYR A CD1   1 
ATOM   976  C CD2   . TYR A 1 138 ? 9.400  24.436 43.996 1.00 23.82 ? 1095 TYR A CD2   1 
ATOM   977  C CE1   . TYR A 1 138 ? 6.672  24.405 44.505 1.00 23.48 ? 1095 TYR A CE1   1 
ATOM   978  C CE2   . TYR A 1 138 ? 8.934  24.232 45.301 1.00 24.47 ? 1095 TYR A CE2   1 
ATOM   979  C CZ    . TYR A 1 138 ? 7.568  24.219 45.544 1.00 24.72 ? 1095 TYR A CZ    1 
ATOM   980  O OH    . TYR A 1 138 ? 7.107  24.015 46.827 1.00 25.67 ? 1095 TYR A OH    1 
ATOM   981  N N     . LEU A 1 139 ? 11.019 27.093 42.272 1.00 23.30 ? 1096 LEU A N     1 
ATOM   982  C CA    . LEU A 1 139 ? 11.829 27.823 43.236 1.00 24.83 ? 1096 LEU A CA    1 
ATOM   983  C C     . LEU A 1 139 ? 11.595 29.332 43.129 1.00 24.52 ? 1096 LEU A C     1 
ATOM   984  O O     . LEU A 1 139 ? 11.273 29.988 44.120 1.00 24.89 ? 1096 LEU A O     1 
ATOM   985  C CB    . LEU A 1 139 ? 13.311 27.507 43.011 1.00 24.65 ? 1096 LEU A CB    1 
ATOM   986  C CG    . LEU A 1 139 ? 14.014 26.598 44.021 1.00 27.42 ? 1096 LEU A CG    1 
ATOM   987  C CD1   . LEU A 1 139 ? 13.142 25.417 44.390 1.00 27.26 ? 1096 LEU A CD1   1 
ATOM   988  C CD2   . LEU A 1 139 ? 15.342 26.142 43.434 1.00 27.69 ? 1096 LEU A CD2   1 
ATOM   989  N N     . ASN A 1 140 ? 11.754 29.877 41.926 1.00 25.01 ? 1097 ASN A N     1 
ATOM   990  C CA    . ASN A 1 140 ? 11.564 31.310 41.700 1.00 25.09 ? 1097 ASN A CA    1 
ATOM   991  C C     . ASN A 1 140 ? 10.128 31.760 42.022 1.00 26.02 ? 1097 ASN A C     1 
ATOM   992  O O     . ASN A 1 140 ? 9.914  32.864 42.532 1.00 25.13 ? 1097 ASN A O     1 
ATOM   993  C CB    . ASN A 1 140 ? 11.913 31.675 40.243 1.00 24.95 ? 1097 ASN A CB    1 
ATOM   994  C CG    . ASN A 1 140 ? 13.427 31.694 39.970 1.00 26.01 ? 1097 ASN A CG    1 
ATOM   995  O OD1   . ASN A 1 140 ? 13.856 31.926 38.839 1.00 24.41 ? 1097 ASN A OD1   1 
ATOM   996  N ND2   . ASN A 1 140 ? 14.232 31.458 41.004 1.00 23.19 ? 1097 ASN A ND2   1 
ATOM   997  N N     . ALA A 1 141 ? 9.152  30.904 41.727 1.00 26.74 ? 1098 ALA A N     1 
ATOM   998  C CA    . ALA A 1 141 ? 7.750  31.223 41.991 1.00 27.75 ? 1098 ALA A CA    1 
ATOM   999  C C     . ALA A 1 141 ? 7.509  31.376 43.492 1.00 29.50 ? 1098 ALA A C     1 
ATOM   1000 O O     . ALA A 1 141 ? 6.645  32.142 43.919 1.00 29.69 ? 1098 ALA A O     1 
ATOM   1001 C CB    . ALA A 1 141 ? 6.851  30.144 41.427 1.00 26.95 ? 1098 ALA A CB    1 
ATOM   1002 N N     . ASN A 1 142 ? 8.271  30.644 44.294 1.00 30.13 ? 1099 ASN A N     1 
ATOM   1003 C CA    . ASN A 1 142 ? 8.129  30.748 45.736 1.00 30.23 ? 1099 ASN A CA    1 
ATOM   1004 C C     . ASN A 1 142 ? 9.059  31.808 46.312 1.00 29.27 ? 1099 ASN A C     1 
ATOM   1005 O O     . ASN A 1 142 ? 9.296  31.857 47.518 1.00 28.65 ? 1099 ASN A O     1 
ATOM   1006 C CB    . ASN A 1 142 ? 8.377  29.397 46.397 1.00 32.56 ? 1099 ASN A CB    1 
ATOM   1007 C CG    . ASN A 1 142 ? 7.246  28.418 46.144 1.00 34.58 ? 1099 ASN A CG    1 
ATOM   1008 O OD1   . ASN A 1 142 ? 7.170  27.783 45.086 1.00 34.70 ? 1099 ASN A OD1   1 
ATOM   1009 N ND2   . ASN A 1 142 ? 6.343  28.310 47.109 1.00 35.43 ? 1099 ASN A ND2   1 
ATOM   1010 N N     . LYS A 1 143 ? 9.584  32.657 45.437 1.00 29.47 ? 1100 LYS A N     1 
ATOM   1011 C CA    . LYS A 1 143 ? 10.465 33.743 45.849 1.00 29.75 ? 1100 LYS A CA    1 
ATOM   1012 C C     . LYS A 1 143 ? 11.808 33.318 46.435 1.00 29.10 ? 1100 LYS A C     1 
ATOM   1013 O O     . LYS A 1 143 ? 12.260 33.857 47.450 1.00 28.76 ? 1100 LYS A O     1 
ATOM   1014 C CB    . LYS A 1 143 ? 9.728  34.660 46.836 1.00 32.12 ? 1100 LYS A CB    1 
ATOM   1015 C CG    . LYS A 1 143 ? 8.564  35.413 46.203 1.00 34.99 ? 1100 LYS A CG    1 
ATOM   1016 C CD    . LYS A 1 143 ? 9.064  36.316 45.079 1.00 36.91 ? 1100 LYS A CD    1 
ATOM   1017 C CE    . LYS A 1 143 ? 7.919  37.041 44.378 1.00 40.08 ? 1100 LYS A CE    1 
ATOM   1018 N NZ    . LYS A 1 143 ? 8.427  37.966 43.318 1.00 41.72 ? 1100 LYS A NZ    1 
ATOM   1019 N N     . PHE A 1 144 ? 12.443 32.346 45.792 1.00 27.72 ? 1101 PHE A N     1 
ATOM   1020 C CA    . PHE A 1 144 ? 13.756 31.888 46.220 1.00 26.30 ? 1101 PHE A CA    1 
ATOM   1021 C C     . PHE A 1 144 ? 14.692 31.990 45.028 1.00 25.67 ? 1101 PHE A C     1 
ATOM   1022 O O     . PHE A 1 144 ? 14.314 31.655 43.903 1.00 25.05 ? 1101 PHE A O     1 
ATOM   1023 C CB    . PHE A 1 144 ? 13.711 30.426 46.686 1.00 27.38 ? 1101 PHE A CB    1 
ATOM   1024 C CG    . PHE A 1 144 ? 13.132 30.237 48.060 1.00 28.93 ? 1101 PHE A CG    1 
ATOM   1025 C CD1   . PHE A 1 144 ? 13.920 30.418 49.191 1.00 28.95 ? 1101 PHE A CD1   1 
ATOM   1026 C CD2   . PHE A 1 144 ? 11.795 29.883 48.223 1.00 29.91 ? 1101 PHE A CD2   1 
ATOM   1027 C CE1   . PHE A 1 144 ? 13.388 30.248 50.472 1.00 29.44 ? 1101 PHE A CE1   1 
ATOM   1028 C CE2   . PHE A 1 144 ? 11.250 29.712 49.501 1.00 31.10 ? 1101 PHE A CE2   1 
ATOM   1029 C CZ    . PHE A 1 144 ? 12.055 29.896 50.627 1.00 29.58 ? 1101 PHE A CZ    1 
ATOM   1030 N N     . VAL A 1 145 ? 15.906 32.464 45.267 1.00 23.89 ? 1102 VAL A N     1 
ATOM   1031 C CA    . VAL A 1 145 ? 16.892 32.526 44.205 1.00 22.46 ? 1102 VAL A CA    1 
ATOM   1032 C C     . VAL A 1 145 ? 17.889 31.440 44.601 1.00 22.33 ? 1102 VAL A C     1 
ATOM   1033 O O     . VAL A 1 145 ? 18.403 31.437 45.725 1.00 20.73 ? 1102 VAL A O     1 
ATOM   1034 C CB    . VAL A 1 145 ? 17.568 33.918 44.118 1.00 22.76 ? 1102 VAL A CB    1 
ATOM   1035 C CG1   . VAL A 1 145 ? 18.166 34.316 45.463 1.00 22.31 ? 1102 VAL A CG1   1 
ATOM   1036 C CG2   . VAL A 1 145 ? 18.621 33.904 43.031 1.00 23.77 ? 1102 VAL A CG2   1 
ATOM   1037 N N     . HIS A 1 146 ? 18.151 30.512 43.685 1.00 20.22 ? 1103 HIS A N     1 
ATOM   1038 C CA    . HIS A 1 146 ? 19.051 29.404 43.976 1.00 20.83 ? 1103 HIS A CA    1 
ATOM   1039 C C     . HIS A 1 146 ? 20.514 29.825 44.153 1.00 20.79 ? 1103 HIS A C     1 
ATOM   1040 O O     . HIS A 1 146 ? 21.160 29.427 45.121 1.00 21.47 ? 1103 HIS A O     1 
ATOM   1041 C CB    . HIS A 1 146 ? 18.908 28.340 42.889 1.00 20.83 ? 1103 HIS A CB    1 
ATOM   1042 C CG    . HIS A 1 146 ? 19.588 27.049 43.222 1.00 21.83 ? 1103 HIS A CG    1 
ATOM   1043 N ND1   . HIS A 1 146 ? 20.956 26.895 43.175 1.00 22.48 ? 1103 HIS A ND1   1 
ATOM   1044 C CD2   . HIS A 1 146 ? 19.086 25.856 43.618 1.00 22.08 ? 1103 HIS A CD2   1 
ATOM   1045 C CE1   . HIS A 1 146 ? 21.270 25.658 43.525 1.00 21.60 ? 1103 HIS A CE1   1 
ATOM   1046 N NE2   . HIS A 1 146 ? 20.153 25.008 43.800 1.00 21.83 ? 1103 HIS A NE2   1 
ATOM   1047 N N     . ARG A 1 147 ? 21.024 30.627 43.220 1.00 21.21 ? 1104 ARG A N     1 
ATOM   1048 C CA    . ARG A 1 147 ? 22.392 31.154 43.262 1.00 21.05 ? 1104 ARG A CA    1 
ATOM   1049 C C     . ARG A 1 147 ? 23.539 30.191 42.966 1.00 20.65 ? 1104 ARG A C     1 
ATOM   1050 O O     . ARG A 1 147 ? 24.678 30.627 42.802 1.00 20.84 ? 1104 ARG A O     1 
ATOM   1051 C CB    . ARG A 1 147 ? 22.659 31.825 44.621 1.00 21.75 ? 1104 ARG A CB    1 
ATOM   1052 C CG    . ARG A 1 147 ? 21.754 33.017 44.925 1.00 24.07 ? 1104 ARG A CG    1 
ATOM   1053 C CD    . ARG A 1 147 ? 22.111 33.642 46.266 1.00 24.62 ? 1104 ARG A CD    1 
ATOM   1054 N NE    . ARG A 1 147 ? 23.485 34.123 46.265 1.00 24.77 ? 1104 ARG A NE    1 
ATOM   1055 C CZ    . ARG A 1 147 ? 24.370 33.886 47.229 1.00 25.33 ? 1104 ARG A CZ    1 
ATOM   1056 N NH1   . ARG A 1 147 ? 24.034 33.167 48.294 1.00 26.22 ? 1104 ARG A NH1   1 
ATOM   1057 N NH2   . ARG A 1 147 ? 25.599 34.363 47.118 1.00 24.33 ? 1104 ARG A NH2   1 
ATOM   1058 N N     . ASP A 1 148 ? 23.267 28.893 42.895 1.00 19.35 ? 1105 ASP A N     1 
ATOM   1059 C CA    . ASP A 1 148 ? 24.346 27.951 42.632 1.00 19.45 ? 1105 ASP A CA    1 
ATOM   1060 C C     . ASP A 1 148 ? 23.889 26.840 41.697 1.00 20.19 ? 1105 ASP A C     1 
ATOM   1061 O O     . ASP A 1 148 ? 24.210 25.667 41.893 1.00 19.31 ? 1105 ASP A O     1 
ATOM   1062 C CB    . ASP A 1 148 ? 24.869 27.382 43.964 1.00 20.07 ? 1105 ASP A CB    1 
ATOM   1063 C CG    . ASP A 1 148 ? 26.205 26.643 43.817 1.00 20.66 ? 1105 ASP A CG    1 
ATOM   1064 O OD1   . ASP A 1 148 ? 26.875 26.796 42.775 1.00 20.03 ? 1105 ASP A OD1   1 
ATOM   1065 O OD2   . ASP A 1 148 ? 26.594 25.919 44.757 1.00 20.30 ? 1105 ASP A OD2   1 
ATOM   1066 N N     . LEU A 1 149 ? 23.135 27.222 40.668 1.00 19.82 ? 1106 LEU A N     1 
ATOM   1067 C CA    . LEU A 1 149 ? 22.657 26.254 39.692 1.00 19.39 ? 1106 LEU A CA    1 
ATOM   1068 C C     . LEU A 1 149 ? 23.838 25.815 38.830 1.00 18.29 ? 1106 LEU A C     1 
ATOM   1069 O O     . LEU A 1 149 ? 24.543 26.639 38.250 1.00 17.57 ? 1106 LEU A O     1 
ATOM   1070 C CB    . LEU A 1 149 ? 21.555 26.860 38.819 1.00 18.64 ? 1106 LEU A CB    1 
ATOM   1071 C CG    . LEU A 1 149 ? 21.020 25.979 37.684 1.00 20.68 ? 1106 LEU A CG    1 
ATOM   1072 C CD1   . LEU A 1 149 ? 20.622 24.607 38.216 1.00 21.87 ? 1106 LEU A CD1   1 
ATOM   1073 C CD2   . LEU A 1 149 ? 19.828 26.670 37.032 1.00 20.55 ? 1106 LEU A CD2   1 
ATOM   1074 N N     . ALA A 1 150 ? 24.037 24.506 38.761 1.00 17.03 ? 1107 ALA A N     1 
ATOM   1075 C CA    . ALA A 1 150 ? 25.139 23.908 38.011 1.00 18.44 ? 1107 ALA A CA    1 
ATOM   1076 C C     . ALA A 1 150 ? 24.837 22.426 37.939 1.00 19.60 ? 1107 ALA A C     1 
ATOM   1077 O O     . ALA A 1 150 ? 24.084 21.911 38.763 1.00 20.20 ? 1107 ALA A O     1 
ATOM   1078 C CB    . ALA A 1 150 ? 26.462 24.125 38.753 1.00 16.52 ? 1107 ALA A CB    1 
ATOM   1079 N N     . ALA A 1 151 ? 25.418 21.736 36.964 1.00 20.79 ? 1108 ALA A N     1 
ATOM   1080 C CA    . ALA A 1 151 ? 25.172 20.309 36.833 1.00 20.95 ? 1108 ALA A CA    1 
ATOM   1081 C C     . ALA A 1 151 ? 25.508 19.567 38.130 1.00 21.25 ? 1108 ALA A C     1 
ATOM   1082 O O     . ALA A 1 151 ? 24.810 18.626 38.509 1.00 22.28 ? 1108 ALA A O     1 
ATOM   1083 C CB    . ALA A 1 151 ? 25.975 19.741 35.672 1.00 20.34 ? 1108 ALA A CB    1 
ATOM   1084 N N     . ARG A 1 152 ? 26.566 19.988 38.816 1.00 21.09 ? 1109 ARG A N     1 
ATOM   1085 C CA    . ARG A 1 152 ? 26.962 19.324 40.055 1.00 21.19 ? 1109 ARG A CA    1 
ATOM   1086 C C     . ARG A 1 152 ? 25.883 19.413 41.135 1.00 21.92 ? 1109 ARG A C     1 
ATOM   1087 O O     . ARG A 1 152 ? 25.891 18.629 42.086 1.00 21.98 ? 1109 ARG A O     1 
ATOM   1088 C CB    . ARG A 1 152 ? 28.263 19.929 40.599 1.00 22.23 ? 1109 ARG A CB    1 
ATOM   1089 C CG    . ARG A 1 152 ? 28.138 21.407 40.964 1.00 20.07 ? 1109 ARG A CG    1 
ATOM   1090 C CD    . ARG A 1 152 ? 29.361 21.943 41.695 1.00 18.83 ? 1109 ARG A CD    1 
ATOM   1091 N NE    . ARG A 1 152 ? 29.197 23.382 41.899 1.00 19.11 ? 1109 ARG A NE    1 
ATOM   1092 C CZ    . ARG A 1 152 ? 29.396 24.290 40.951 1.00 19.03 ? 1109 ARG A CZ    1 
ATOM   1093 N NH1   . ARG A 1 152 ? 29.788 23.904 39.741 1.00 16.64 ? 1109 ARG A NH1   1 
ATOM   1094 N NH2   . ARG A 1 152 ? 29.159 25.576 41.198 1.00 17.41 ? 1109 ARG A NH2   1 
ATOM   1095 N N     . ASN A 1 153 ? 24.954 20.356 40.995 1.00 21.57 ? 1110 ASN A N     1 
ATOM   1096 C CA    . ASN A 1 153 ? 23.917 20.519 42.005 1.00 21.89 ? 1110 ASN A CA    1 
ATOM   1097 C C     . ASN A 1 153 ? 22.544 19.968 41.644 1.00 22.65 ? 1110 ASN A C     1 
ATOM   1098 O O     . ASN A 1 153 ? 21.580 20.138 42.396 1.00 22.59 ? 1110 ASN A O     1 
ATOM   1099 C CB    . ASN A 1 153 ? 23.836 21.994 42.433 1.00 21.22 ? 1110 ASN A CB    1 
ATOM   1100 C CG    . ASN A 1 153 ? 25.051 22.416 43.249 1.00 21.91 ? 1110 ASN A CG    1 
ATOM   1101 O OD1   . ASN A 1 153 ? 25.549 21.640 44.054 1.00 20.62 ? 1110 ASN A OD1   1 
ATOM   1102 N ND2   . ASN A 1 153 ? 25.528 23.644 43.049 1.00 21.03 ? 1110 ASN A ND2   1 
ATOM   1103 N N     . CYS A 1 154 ? 22.468 19.306 40.492 1.00 22.41 ? 1111 CYS A N     1 
ATOM   1104 C CA    . CYS A 1 154 ? 21.242 18.664 40.035 1.00 22.34 ? 1111 CYS A CA    1 
ATOM   1105 C C     . CYS A 1 154 ? 21.507 17.180 40.255 1.00 22.82 ? 1111 CYS A C     1 
ATOM   1106 O O     . CYS A 1 154 ? 22.661 16.761 40.207 1.00 21.48 ? 1111 CYS A O     1 
ATOM   1107 C CB    . CYS A 1 154 ? 21.005 18.927 38.546 1.00 22.08 ? 1111 CYS A CB    1 
ATOM   1108 S SG    . CYS A 1 154 ? 20.684 20.664 38.138 1.00 22.48 ? 1111 CYS A SG    1 
ATOM   1109 N N     . MET A 1 155 ? 20.454 16.399 40.498 1.00 23.07 ? 1112 MET A N     1 
ATOM   1110 C CA    . MET A 1 155 ? 20.586 14.957 40.731 1.00 23.64 ? 1112 MET A CA    1 
ATOM   1111 C C     . MET A 1 155 ? 19.743 14.184 39.720 1.00 23.87 ? 1112 MET A C     1 
ATOM   1112 O O     . MET A 1 155 ? 18.804 14.729 39.139 1.00 22.59 ? 1112 MET A O     1 
ATOM   1113 C CB    . MET A 1 155 ? 20.123 14.591 42.144 1.00 24.75 ? 1112 MET A CB    1 
ATOM   1114 C CG    . MET A 1 155 ? 20.901 15.234 43.287 1.00 28.40 ? 1112 MET A CG    1 
ATOM   1115 S SD    . MET A 1 155 ? 22.628 14.708 43.397 1.00 33.90 ? 1112 MET A SD    1 
ATOM   1116 C CE    . MET A 1 155 ? 22.449 13.151 44.242 1.00 32.77 ? 1112 MET A CE    1 
ATOM   1117 N N     . VAL A 1 156 ? 20.077 12.912 39.519 1.00 23.78 ? 1113 VAL A N     1 
ATOM   1118 C CA    . VAL A 1 156 ? 19.355 12.072 38.567 1.00 24.23 ? 1113 VAL A CA    1 
ATOM   1119 C C     . VAL A 1 156 ? 18.743 10.855 39.263 1.00 24.40 ? 1113 VAL A C     1 
ATOM   1120 O O     . VAL A 1 156 ? 19.441 10.088 39.929 1.00 23.04 ? 1113 VAL A O     1 
ATOM   1121 C CB    . VAL A 1 156 ? 20.299 11.607 37.433 1.00 25.15 ? 1113 VAL A CB    1 
ATOM   1122 C CG1   . VAL A 1 156 ? 19.536 10.785 36.407 1.00 25.83 ? 1113 VAL A CG1   1 
ATOM   1123 C CG2   . VAL A 1 156 ? 20.935 12.826 36.770 1.00 25.48 ? 1113 VAL A CG2   1 
ATOM   1124 N N     . ALA A 1 157 ? 17.434 10.692 39.100 1.00 24.74 ? 1114 ALA A N     1 
ATOM   1125 C CA    . ALA A 1 157 ? 16.706 9.591  39.712 1.00 25.51 ? 1114 ALA A CA    1 
ATOM   1126 C C     . ALA A 1 157 ? 16.862 8.308  38.904 1.00 26.94 ? 1114 ALA A C     1 
ATOM   1127 O O     . ALA A 1 157 ? 17.408 8.319  37.794 1.00 27.03 ? 1114 ALA A O     1 
ATOM   1128 C CB    . ALA A 1 157 ? 15.222 9.955  39.837 1.00 24.11 ? 1114 ALA A CB    1 
ATOM   1129 N N     . GLU A 1 158 ? 16.380 7.200  39.463 1.00 28.23 ? 1115 GLU A N     1 
ATOM   1130 C CA    . GLU A 1 158 ? 16.470 5.913  38.780 1.00 29.39 ? 1115 GLU A CA    1 
ATOM   1131 C C     . GLU A 1 158 ? 15.940 6.005  37.351 1.00 29.85 ? 1115 GLU A C     1 
ATOM   1132 O O     . GLU A 1 158 ? 16.603 5.570  36.410 1.00 31.27 ? 1115 GLU A O     1 
ATOM   1133 C CB    . GLU A 1 158 ? 15.689 4.835  39.543 1.00 29.73 ? 1115 GLU A CB    1 
ATOM   1134 C CG    . GLU A 1 158 ? 15.680 3.486  38.832 1.00 31.53 ? 1115 GLU A CG    1 
ATOM   1135 C CD    . GLU A 1 158 ? 17.054 2.834  38.781 1.00 32.47 ? 1115 GLU A CD    1 
ATOM   1136 O OE1   . GLU A 1 158 ? 17.287 2.009  37.867 1.00 33.75 ? 1115 GLU A OE1   1 
ATOM   1137 O OE2   . GLU A 1 158 ? 17.895 3.131  39.659 1.00 32.29 ? 1115 GLU A OE2   1 
ATOM   1138 N N     . ASP A 1 159 ? 14.750 6.574  37.188 1.00 30.26 ? 1116 ASP A N     1 
ATOM   1139 C CA    . ASP A 1 159 ? 14.154 6.696  35.864 1.00 31.33 ? 1116 ASP A CA    1 
ATOM   1140 C C     . ASP A 1 159 ? 14.726 7.838  35.024 1.00 31.31 ? 1116 ASP A C     1 
ATOM   1141 O O     . ASP A 1 159 ? 14.110 8.253  34.044 1.00 31.61 ? 1116 ASP A O     1 
ATOM   1142 C CB    . ASP A 1 159 ? 12.630 6.847  35.975 1.00 32.10 ? 1116 ASP A CB    1 
ATOM   1143 C CG    . ASP A 1 159 ? 12.207 8.149  36.636 1.00 33.78 ? 1116 ASP A CG    1 
ATOM   1144 O OD1   . ASP A 1 159 ? 13.086 8.976  36.964 1.00 34.04 ? 1116 ASP A OD1   1 
ATOM   1145 O OD2   . ASP A 1 159 ? 10.985 8.344  36.827 1.00 33.69 ? 1116 ASP A OD2   1 
ATOM   1146 N N     . PHE A 1 160 ? 15.898 8.338  35.415 1.00 31.74 ? 1117 PHE A N     1 
ATOM   1147 C CA    . PHE A 1 160 ? 16.586 9.423  34.703 1.00 30.88 ? 1117 PHE A CA    1 
ATOM   1148 C C     . PHE A 1 160 ? 16.012 10.830 34.848 1.00 29.97 ? 1117 PHE A C     1 
ATOM   1149 O O     . PHE A 1 160 ? 16.469 11.765 34.183 1.00 30.59 ? 1117 PHE A O     1 
ATOM   1150 C CB    . PHE A 1 160 ? 16.713 9.073  33.218 1.00 31.73 ? 1117 PHE A CB    1 
ATOM   1151 C CG    . PHE A 1 160 ? 17.608 7.900  32.961 1.00 32.33 ? 1117 PHE A CG    1 
ATOM   1152 C CD1   . PHE A 1 160 ? 18.981 8.009  33.143 1.00 32.68 ? 1117 PHE A CD1   1 
ATOM   1153 C CD2   . PHE A 1 160 ? 17.076 6.676  32.577 1.00 33.60 ? 1117 PHE A CD2   1 
ATOM   1154 C CE1   . PHE A 1 160 ? 19.816 6.915  32.949 1.00 33.11 ? 1117 PHE A CE1   1 
ATOM   1155 C CE2   . PHE A 1 160 ? 17.901 5.571  32.380 1.00 33.23 ? 1117 PHE A CE2   1 
ATOM   1156 C CZ    . PHE A 1 160 ? 19.276 5.694  32.566 1.00 33.90 ? 1117 PHE A CZ    1 
ATOM   1157 N N     . THR A 1 161 ? 15.016 10.990 35.707 1.00 28.01 ? 1118 THR A N     1 
ATOM   1158 C CA    . THR A 1 161 ? 14.442 12.313 35.929 1.00 26.47 ? 1118 THR A CA    1 
ATOM   1159 C C     . THR A 1 161 ? 15.514 13.188 36.602 1.00 25.65 ? 1118 THR A C     1 
ATOM   1160 O O     . THR A 1 161 ? 16.201 12.741 37.520 1.00 24.72 ? 1118 THR A O     1 
ATOM   1161 C CB    . THR A 1 161 ? 13.218 12.243 36.860 1.00 26.29 ? 1118 THR A CB    1 
ATOM   1162 O OG1   . THR A 1 161 ? 12.186 11.460 36.242 1.00 26.39 ? 1118 THR A OG1   1 
ATOM   1163 C CG2   . THR A 1 161 ? 12.690 13.643 37.150 1.00 24.34 ? 1118 THR A CG2   1 
ATOM   1164 N N     . VAL A 1 162 ? 15.657 14.429 36.148 1.00 24.72 ? 1119 VAL A N     1 
ATOM   1165 C CA    . VAL A 1 162 ? 16.645 15.337 36.734 1.00 24.06 ? 1119 VAL A CA    1 
ATOM   1166 C C     . VAL A 1 162 ? 15.931 16.268 37.717 1.00 23.41 ? 1119 VAL A C     1 
ATOM   1167 O O     . VAL A 1 162 ? 14.821 16.723 37.447 1.00 23.73 ? 1119 VAL A O     1 
ATOM   1168 C CB    . VAL A 1 162 ? 17.352 16.190 35.644 1.00 24.07 ? 1119 VAL A CB    1 
ATOM   1169 C CG1   . VAL A 1 162 ? 18.417 17.080 36.287 1.00 24.18 ? 1119 VAL A CG1   1 
ATOM   1170 C CG2   . VAL A 1 162 ? 17.998 15.273 34.597 1.00 24.82 ? 1119 VAL A CG2   1 
ATOM   1171 N N     . LYS A 1 163 ? 16.563 16.544 38.854 1.00 23.15 ? 1120 LYS A N     1 
ATOM   1172 C CA    . LYS A 1 163 ? 15.971 17.419 39.867 1.00 23.75 ? 1120 LYS A CA    1 
ATOM   1173 C C     . LYS A 1 163 ? 17.011 18.320 40.526 1.00 24.39 ? 1120 LYS A C     1 
ATOM   1174 O O     . LYS A 1 163 ? 18.186 17.944 40.643 1.00 24.12 ? 1120 LYS A O     1 
ATOM   1175 C CB    . LYS A 1 163 ? 15.286 16.588 40.962 1.00 23.59 ? 1120 LYS A CB    1 
ATOM   1176 C CG    . LYS A 1 163 ? 14.268 15.572 40.450 1.00 23.89 ? 1120 LYS A CG    1 
ATOM   1177 C CD    . LYS A 1 163 ? 13.539 14.890 41.598 1.00 24.50 ? 1120 LYS A CD    1 
ATOM   1178 C CE    . LYS A 1 163 ? 12.626 13.796 41.063 1.00 25.14 ? 1120 LYS A CE    1 
ATOM   1179 N NZ    . LYS A 1 163 ? 11.696 13.274 42.092 1.00 24.84 ? 1120 LYS A NZ    1 
ATOM   1180 N N     . ILE A 1 164 ? 16.571 19.505 40.954 1.00 23.48 ? 1121 ILE A N     1 
ATOM   1181 C CA    . ILE A 1 164 ? 17.439 20.462 41.641 1.00 25.09 ? 1121 ILE A CA    1 
ATOM   1182 C C     . ILE A 1 164 ? 17.710 19.841 43.013 1.00 25.54 ? 1121 ILE A C     1 
ATOM   1183 O O     . ILE A 1 164 ? 16.764 19.509 43.730 1.00 24.51 ? 1121 ILE A O     1 
ATOM   1184 C CB    . ILE A 1 164 ? 16.721 21.813 41.834 1.00 24.80 ? 1121 ILE A CB    1 
ATOM   1185 C CG1   . ILE A 1 164 ? 16.148 22.289 40.495 1.00 24.18 ? 1121 ILE A CG1   1 
ATOM   1186 C CG2   . ILE A 1 164 ? 17.680 22.829 42.438 1.00 26.21 ? 1121 ILE A CG2   1 
ATOM   1187 C CD1   . ILE A 1 164 ? 17.146 22.305 39.342 1.00 24.02 ? 1121 ILE A CD1   1 
ATOM   1188 N N     . GLY A 1 165 ? 18.977 19.690 43.391 1.00 26.26 ? 1122 GLY A N     1 
ATOM   1189 C CA    . GLY A 1 165 ? 19.251 19.027 44.658 1.00 29.63 ? 1122 GLY A CA    1 
ATOM   1190 C C     . GLY A 1 165 ? 20.141 19.584 45.758 1.00 32.10 ? 1122 GLY A C     1 
ATOM   1191 O O     . GLY A 1 165 ? 20.239 18.955 46.823 1.00 35.77 ? 1122 GLY A O     1 
ATOM   1192 N N     . ASP A 1 166 ? 20.803 20.715 45.535 1.00 30.67 ? 1123 ASP A N     1 
ATOM   1193 C CA    . ASP A 1 166 ? 21.655 21.300 46.571 1.00 30.46 ? 1123 ASP A CA    1 
ATOM   1194 C C     . ASP A 1 166 ? 21.189 22.744 46.729 1.00 29.67 ? 1123 ASP A C     1 
ATOM   1195 O O     . ASP A 1 166 ? 21.030 23.444 45.737 1.00 31.35 ? 1123 ASP A O     1 
ATOM   1196 C CB    . ASP A 1 166 ? 23.132 21.273 46.150 1.00 31.20 ? 1123 ASP A CB    1 
ATOM   1197 C CG    . ASP A 1 166 ? 24.077 21.614 47.302 1.00 33.97 ? 1123 ASP A CG    1 
ATOM   1198 O OD1   . ASP A 1 166 ? 24.497 20.680 48.027 1.00 36.06 ? 1123 ASP A OD1   1 
ATOM   1199 O OD2   . ASP A 1 166 ? 24.391 22.811 47.498 1.00 32.13 ? 1123 ASP A OD2   1 
ATOM   1200 N N     . PHE A 1 167 ? 20.969 23.188 47.962 1.00 28.63 ? 1124 PHE A N     1 
ATOM   1201 C CA    . PHE A 1 167 ? 20.489 24.549 48.198 1.00 28.36 ? 1124 PHE A CA    1 
ATOM   1202 C C     . PHE A 1 167 ? 21.369 25.328 49.161 1.00 27.22 ? 1124 PHE A C     1 
ATOM   1203 O O     . PHE A 1 167 ? 20.891 26.202 49.880 1.00 26.52 ? 1124 PHE A O     1 
ATOM   1204 C CB    . PHE A 1 167 ? 19.056 24.486 48.728 1.00 29.29 ? 1124 PHE A CB    1 
ATOM   1205 C CG    . PHE A 1 167 ? 18.145 23.676 47.857 1.00 30.50 ? 1124 PHE A CG    1 
ATOM   1206 C CD1   . PHE A 1 167 ? 17.588 24.229 46.707 1.00 31.13 ? 1124 PHE A CD1   1 
ATOM   1207 C CD2   . PHE A 1 167 ? 17.914 22.334 48.135 1.00 30.08 ? 1124 PHE A CD2   1 
ATOM   1208 C CE1   . PHE A 1 167 ? 16.815 23.449 45.843 1.00 30.62 ? 1124 PHE A CE1   1 
ATOM   1209 C CE2   . PHE A 1 167 ? 17.148 21.550 47.279 1.00 30.60 ? 1124 PHE A CE2   1 
ATOM   1210 C CZ    . PHE A 1 167 ? 16.599 22.107 46.133 1.00 29.59 ? 1124 PHE A CZ    1 
ATOM   1211 N N     . GLY A 1 168 ? 22.658 25.010 49.158 1.00 26.48 ? 1125 GLY A N     1 
ATOM   1212 C CA    . GLY A 1 168 ? 23.588 25.671 50.053 1.00 27.04 ? 1125 GLY A CA    1 
ATOM   1213 C C     . GLY A 1 168 ? 23.627 27.184 49.958 1.00 27.00 ? 1125 GLY A C     1 
ATOM   1214 O O     . GLY A 1 168 ? 23.889 27.844 50.956 1.00 28.24 ? 1125 GLY A O     1 
ATOM   1215 N N     . MET A 1 169 ? 23.360 27.742 48.779 1.00 26.36 ? 1126 MET A N     1 
ATOM   1216 C CA    . MET A 1 169 ? 23.404 29.194 48.605 1.00 26.38 ? 1126 MET A CA    1 
ATOM   1217 C C     . MET A 1 169 ? 22.044 29.839 48.351 1.00 26.17 ? 1126 MET A C     1 
ATOM   1218 O O     . MET A 1 169 ? 21.961 31.047 48.120 1.00 25.93 ? 1126 MET A O     1 
ATOM   1219 C CB    . MET A 1 169 ? 24.362 29.544 47.457 1.00 26.71 ? 1126 MET A CB    1 
ATOM   1220 C CG    . MET A 1 169 ? 25.823 29.224 47.750 1.00 26.48 ? 1126 MET A CG    1 
ATOM   1221 S SD    . MET A 1 169 ? 26.935 29.516 46.352 1.00 25.11 ? 1126 MET A SD    1 
ATOM   1222 C CE    . MET A 1 169 ? 26.534 31.258 45.914 1.00 27.70 ? 1126 MET A CE    1 
ATOM   1223 N N     . THR A 1 170 ? 20.987 29.035 48.395 1.00 25.44 ? 1127 THR A N     1 
ATOM   1224 C CA    . THR A 1 170 ? 19.628 29.519 48.155 1.00 25.77 ? 1127 THR A CA    1 
ATOM   1225 C C     . THR A 1 170 ? 19.203 30.585 49.160 1.00 26.86 ? 1127 THR A C     1 
ATOM   1226 O O     . THR A 1 170 ? 19.430 30.448 50.365 1.00 26.41 ? 1127 THR A O     1 
ATOM   1227 C CB    . THR A 1 170 ? 18.616 28.350 48.196 1.00 24.49 ? 1127 THR A CB    1 
ATOM   1228 O OG1   . THR A 1 170 ? 18.958 27.390 47.187 1.00 23.51 ? 1127 THR A OG1   1 
ATOM   1229 C CG2   . THR A 1 170 ? 17.197 28.851 47.949 1.00 24.91 ? 1127 THR A CG2   1 
ATOM   1230 N N     . ARG A 1 171 ? 18.578 31.647 48.656 1.00 27.56 ? 1128 ARG A N     1 
ATOM   1231 C CA    . ARG A 1 171 ? 18.131 32.748 49.497 1.00 29.70 ? 1128 ARG A CA    1 
ATOM   1232 C C     . ARG A 1 171 ? 16.701 33.194 49.211 1.00 30.71 ? 1128 ARG A C     1 
ATOM   1233 O O     . ARG A 1 171 ? 16.251 33.224 48.067 1.00 28.23 ? 1128 ARG A O     1 
ATOM   1234 C CB    . ARG A 1 171 ? 19.056 33.956 49.317 1.00 30.44 ? 1128 ARG A CB    1 
ATOM   1235 C CG    . ARG A 1 171 ? 20.480 33.733 49.775 1.00 31.81 ? 1128 ARG A CG    1 
ATOM   1236 C CD    . ARG A 1 171 ? 20.565 33.720 51.297 1.00 34.73 ? 1128 ARG A CD    1 
ATOM   1237 N NE    . ARG A 1 171 ? 21.938 33.543 51.759 1.00 35.75 ? 1128 ARG A NE    1 
ATOM   1238 C CZ    . ARG A 1 171 ? 22.593 32.389 51.733 1.00 37.51 ? 1128 ARG A CZ    1 
ATOM   1239 N NH1   . ARG A 1 171 ? 21.999 31.297 51.273 1.00 37.95 ? 1128 ARG A NH1   1 
ATOM   1240 N NH2   . ARG A 1 171 ? 23.849 32.329 52.156 1.00 38.13 ? 1128 ARG A NH2   1 
ATOM   1241 N N     . ASP A 1 172 ? 15.993 33.549 50.272 1.00 32.00 ? 1129 ASP A N     1 
ATOM   1242 C CA    . ASP A 1 172 ? 14.629 34.028 50.142 1.00 34.71 ? 1129 ASP A CA    1 
ATOM   1243 C C     . ASP A 1 172 ? 14.685 35.470 49.626 1.00 34.74 ? 1129 ASP A C     1 
ATOM   1244 O O     . ASP A 1 172 ? 15.422 36.291 50.162 1.00 34.82 ? 1129 ASP A O     1 
ATOM   1245 C CB    . ASP A 1 172 ? 13.942 33.950 51.508 1.00 36.26 ? 1129 ASP A CB    1 
ATOM   1246 C CG    . ASP A 1 172 ? 12.658 34.733 51.559 1.00 38.18 ? 1129 ASP A CG    1 
ATOM   1247 O OD1   . ASP A 1 172 ? 11.850 34.629 50.613 1.00 38.45 ? 1129 ASP A OD1   1 
ATOM   1248 O OD2   . ASP A 1 172 ? 12.458 35.449 52.560 1.00 40.73 ? 1129 ASP A OD2   1 
ATOM   1249 N N     . ILE A 1 173 ? 13.921 35.772 48.579 1.00 35.41 ? 1130 ILE A N     1 
ATOM   1250 C CA    . ILE A 1 173 ? 13.897 37.122 48.006 1.00 36.11 ? 1130 ILE A CA    1 
ATOM   1251 C C     . ILE A 1 173 ? 12.477 37.691 47.982 1.00 37.60 ? 1130 ILE A C     1 
ATOM   1252 O O     . ILE A 1 173 ? 12.165 38.588 47.196 1.00 37.46 ? 1130 ILE A O     1 
ATOM   1253 C CB    . ILE A 1 173 ? 14.440 37.139 46.555 1.00 35.24 ? 1130 ILE A CB    1 
ATOM   1254 C CG1   . ILE A 1 173 ? 13.631 36.170 45.687 1.00 34.42 ? 1130 ILE A CG1   1 
ATOM   1255 C CG2   . ILE A 1 173 ? 15.921 36.788 46.546 1.00 34.41 ? 1130 ILE A CG2   1 
ATOM   1256 C CD1   . ILE A 1 173 ? 13.893 36.295 44.191 1.00 33.92 ? 1130 ILE A CD1   1 
HETATM 1257 N N     . PTR A 1 174 ? 11.623 37.159 48.845 1.00 39.53 ? 1131 PTR A N     1 
HETATM 1258 C CA    . PTR A 1 174 ? 10.237 37.596 48.927 1.00 42.03 ? 1131 PTR A CA    1 
HETATM 1259 C C     . PTR A 1 174 ? 10.094 39.112 49.040 1.00 42.46 ? 1131 PTR A C     1 
HETATM 1260 O O     . PTR A 1 174 ? 9.355  39.738 48.278 1.00 41.84 ? 1131 PTR A O     1 
HETATM 1261 C CB    . PTR A 1 174 ? 9.567  36.929 50.130 1.00 45.24 ? 1131 PTR A CB    1 
HETATM 1262 C CG    . PTR A 1 174 ? 8.171  37.424 50.425 1.00 49.18 ? 1131 PTR A CG    1 
HETATM 1263 C CD1   . PTR A 1 174 ? 7.139  37.257 49.503 1.00 51.15 ? 1131 PTR A CD1   1 
HETATM 1264 C CD2   . PTR A 1 174 ? 7.879  38.051 51.637 1.00 50.90 ? 1131 PTR A CD2   1 
HETATM 1265 C CE1   . PTR A 1 174 ? 5.846  37.702 49.781 1.00 53.14 ? 1131 PTR A CE1   1 
HETATM 1266 C CE2   . PTR A 1 174 ? 6.593  38.497 51.925 1.00 53.22 ? 1131 PTR A CE2   1 
HETATM 1267 C CZ    . PTR A 1 174 ? 5.581  38.320 50.996 1.00 54.72 ? 1131 PTR A CZ    1 
HETATM 1268 O OH    . PTR A 1 174 ? 4.311  38.762 51.305 1.00 58.56 ? 1131 PTR A OH    1 
HETATM 1269 P P     . PTR A 1 174 ? 2.960  38.800 50.371 1.00 61.12 ? 1131 PTR A P     1 
HETATM 1270 O O1P   . PTR A 1 174 ? 3.314  39.751 49.278 1.00 60.54 ? 1131 PTR A O1P   1 
HETATM 1271 O O2P   . PTR A 1 174 ? 1.955  39.295 51.345 1.00 60.74 ? 1131 PTR A O2P   1 
HETATM 1272 O O3P   . PTR A 1 174 ? 2.773  37.387 49.932 1.00 60.89 ? 1131 PTR A O3P   1 
ATOM   1273 N N     . GLU A 1 175 ? 10.808 39.697 49.992 1.00 42.33 ? 1132 GLU A N     1 
ATOM   1274 C CA    . GLU A 1 175 ? 10.731 41.131 50.225 1.00 43.58 ? 1132 GLU A CA    1 
ATOM   1275 C C     . GLU A 1 175 ? 11.323 42.044 49.150 1.00 43.59 ? 1132 GLU A C     1 
ATOM   1276 O O     . GLU A 1 175 ? 10.659 42.977 48.701 1.00 44.46 ? 1132 GLU A O     1 
ATOM   1277 C CB    . GLU A 1 175 ? 11.374 41.468 51.576 1.00 43.91 ? 1132 GLU A CB    1 
ATOM   1278 N N     . THR A 1 176 ? 12.558 41.780 48.731 1.00 42.98 ? 1133 THR A N     1 
ATOM   1279 C CA    . THR A 1 176 ? 13.220 42.647 47.760 1.00 42.14 ? 1133 THR A CA    1 
ATOM   1280 C C     . THR A 1 176 ? 13.437 42.143 46.334 1.00 41.86 ? 1133 THR A C     1 
ATOM   1281 O O     . THR A 1 176 ? 13.878 42.907 45.480 1.00 41.49 ? 1133 THR A O     1 
ATOM   1282 C CB    . THR A 1 176 ? 14.594 43.084 48.291 1.00 42.52 ? 1133 THR A CB    1 
ATOM   1283 O OG1   . THR A 1 176 ? 15.448 41.938 48.389 1.00 42.13 ? 1133 THR A OG1   1 
ATOM   1284 C CG2   . THR A 1 176 ? 14.457 43.718 49.668 1.00 42.30 ? 1133 THR A CG2   1 
ATOM   1285 N N     . ASP A 1 177 ? 13.143 40.874 46.070 1.00 41.46 ? 1134 ASP A N     1 
ATOM   1286 C CA    . ASP A 1 177 ? 13.336 40.322 44.730 1.00 41.09 ? 1134 ASP A CA    1 
ATOM   1287 C C     . ASP A 1 177 ? 14.797 40.169 44.323 1.00 40.14 ? 1134 ASP A C     1 
ATOM   1288 O O     . ASP A 1 177 ? 15.094 39.918 43.153 1.00 38.86 ? 1134 ASP A O     1 
ATOM   1289 C CB    . ASP A 1 177 ? 12.627 41.181 43.681 1.00 42.10 ? 1134 ASP A CB    1 
ATOM   1290 C CG    . ASP A 1 177 ? 11.215 40.717 43.405 1.00 42.65 ? 1134 ASP A CG    1 
ATOM   1291 O OD1   . ASP A 1 177 ? 10.504 41.418 42.657 1.00 43.77 ? 1134 ASP A OD1   1 
ATOM   1292 O OD2   . ASP A 1 177 ? 10.820 39.651 43.927 1.00 44.33 ? 1134 ASP A OD2   1 
HETATM 1293 N N     . PTR A 1 178 ? 15.711 40.325 45.272 1.00 39.19 ? 1135 PTR A N     1 
HETATM 1294 C CA    . PTR A 1 178 ? 17.123 40.169 44.959 1.00 39.21 ? 1135 PTR A CA    1 
HETATM 1295 C C     . PTR A 1 178 ? 17.918 39.888 46.214 1.00 39.09 ? 1135 PTR A C     1 
HETATM 1296 O O     . PTR A 1 178 ? 17.431 40.089 47.327 1.00 37.71 ? 1135 PTR A O     1 
HETATM 1297 C CB    . PTR A 1 178 ? 17.671 41.423 44.256 1.00 40.73 ? 1135 PTR A CB    1 
HETATM 1298 C CG    . PTR A 1 178 ? 17.998 42.595 45.169 1.00 42.86 ? 1135 PTR A CG    1 
HETATM 1299 C CD1   . PTR A 1 178 ? 19.220 42.665 45.839 1.00 43.96 ? 1135 PTR A CD1   1 
HETATM 1300 C CD2   . PTR A 1 178 ? 17.085 43.631 45.361 1.00 44.31 ? 1135 PTR A CD2   1 
HETATM 1301 C CE1   . PTR A 1 178 ? 19.527 43.742 46.680 1.00 45.50 ? 1135 PTR A CE1   1 
HETATM 1302 C CE2   . PTR A 1 178 ? 17.379 44.711 46.199 1.00 45.17 ? 1135 PTR A CE2   1 
HETATM 1303 C CZ    . PTR A 1 178 ? 18.600 44.760 46.855 1.00 45.89 ? 1135 PTR A CZ    1 
HETATM 1304 O OH    . PTR A 1 178 ? 18.887 45.826 47.690 1.00 47.29 ? 1135 PTR A OH    1 
HETATM 1305 P P     . PTR A 1 178 ? 20.096 46.933 47.510 1.00 47.95 ? 1135 PTR A P     1 
HETATM 1306 O O1P   . PTR A 1 178 ? 21.238 46.297 48.213 1.00 46.60 ? 1135 PTR A O1P   1 
HETATM 1307 O O2P   . PTR A 1 178 ? 19.528 48.125 48.200 1.00 48.05 ? 1135 PTR A O2P   1 
HETATM 1308 O O3P   . PTR A 1 178 ? 20.249 47.089 46.043 1.00 46.43 ? 1135 PTR A O3P   1 
HETATM 1309 N N     . PTR A 1 179 ? 19.143 39.411 46.022 1.00 38.73 ? 1136 PTR A N     1 
HETATM 1310 C CA    . PTR A 1 179 ? 20.042 39.127 47.128 1.00 39.15 ? 1136 PTR A CA    1 
HETATM 1311 C C     . PTR A 1 179 ? 21.402 39.693 46.762 1.00 39.90 ? 1136 PTR A C     1 
HETATM 1312 O O     . PTR A 1 179 ? 21.923 39.423 45.680 1.00 39.58 ? 1136 PTR A O     1 
HETATM 1313 C CB    . PTR A 1 179 ? 20.173 37.621 47.377 1.00 38.50 ? 1136 PTR A CB    1 
HETATM 1314 C CG    . PTR A 1 179 ? 21.263 37.299 48.381 1.00 38.40 ? 1136 PTR A CG    1 
HETATM 1315 C CD1   . PTR A 1 179 ? 21.028 37.389 49.755 1.00 38.33 ? 1136 PTR A CD1   1 
HETATM 1316 C CD2   . PTR A 1 179 ? 22.549 36.965 47.955 1.00 37.94 ? 1136 PTR A CD2   1 
HETATM 1317 C CE1   . PTR A 1 179 ? 22.053 37.157 50.677 1.00 39.61 ? 1136 PTR A CE1   1 
HETATM 1318 C CE2   . PTR A 1 179 ? 23.572 36.734 48.862 1.00 39.51 ? 1136 PTR A CE2   1 
HETATM 1319 C CZ    . PTR A 1 179 ? 23.323 36.831 50.221 1.00 40.38 ? 1136 PTR A CZ    1 
HETATM 1320 O OH    . PTR A 1 179 ? 24.364 36.618 51.100 1.00 42.88 ? 1136 PTR A OH    1 
HETATM 1321 P P     . PTR A 1 179 ? 24.436 36.484 52.729 1.00 45.09 ? 1136 PTR A P     1 
HETATM 1322 O O1P   . PTR A 1 179 ? 23.834 37.747 53.238 1.00 43.98 ? 1136 PTR A O1P   1 
HETATM 1323 O O2P   . PTR A 1 179 ? 25.906 36.362 52.888 1.00 44.77 ? 1136 PTR A O2P   1 
HETATM 1324 O O3P   . PTR A 1 179 ? 23.663 35.270 53.070 1.00 44.10 ? 1136 PTR A O3P   1 
ATOM   1325 N N     . ARG A 1 180 ? 21.974 40.484 47.662 1.00 40.96 ? 1137 ARG A N     1 
ATOM   1326 C CA    . ARG A 1 180 ? 23.284 41.074 47.421 1.00 42.17 ? 1137 ARG A CA    1 
ATOM   1327 C C     . ARG A 1 180 ? 24.293 40.457 48.381 1.00 42.46 ? 1137 ARG A C     1 
ATOM   1328 O O     . ARG A 1 180 ? 24.097 40.462 49.598 1.00 42.30 ? 1137 ARG A O     1 
ATOM   1329 C CB    . ARG A 1 180 ? 23.245 42.593 47.623 1.00 42.73 ? 1137 ARG A CB    1 
ATOM   1330 C CG    . ARG A 1 180 ? 24.573 43.290 47.324 1.00 44.62 ? 1137 ARG A CG    1 
ATOM   1331 C CD    . ARG A 1 180 ? 24.535 44.765 47.715 1.00 45.62 ? 1137 ARG A CD    1 
ATOM   1332 N NE    . ARG A 1 180 ? 23.571 45.523 46.923 1.00 45.60 ? 1137 ARG A NE    1 
ATOM   1333 C CZ    . ARG A 1 180 ? 23.775 45.912 45.670 1.00 46.03 ? 1137 ARG A CZ    1 
ATOM   1334 N NH1   . ARG A 1 180 ? 24.915 45.622 45.060 1.00 46.49 ? 1137 ARG A NH1   1 
ATOM   1335 N NH2   . ARG A 1 180 ? 22.836 46.589 45.023 1.00 46.81 ? 1137 ARG A NH2   1 
ATOM   1336 N N     . LYS A 1 181 ? 25.371 39.917 47.827 1.00 42.70 ? 1138 LYS A N     1 
ATOM   1337 C CA    . LYS A 1 181 ? 26.409 39.302 48.641 1.00 42.66 ? 1138 LYS A CA    1 
ATOM   1338 C C     . LYS A 1 181 ? 27.364 40.376 49.144 1.00 42.78 ? 1138 LYS A C     1 
ATOM   1339 O O     . LYS A 1 181 ? 27.872 41.181 48.364 1.00 41.86 ? 1138 LYS A O     1 
ATOM   1340 C CB    . LYS A 1 181 ? 27.181 38.268 47.818 1.00 42.89 ? 1138 LYS A CB    1 
ATOM   1341 C CG    . LYS A 1 181 ? 28.347 37.632 48.556 1.00 43.04 ? 1138 LYS A CG    1 
ATOM   1342 C CD    . LYS A 1 181 ? 27.878 36.875 49.786 1.00 44.05 ? 1138 LYS A CD    1 
ATOM   1343 C CE    . LYS A 1 181 ? 29.066 36.382 50.601 1.00 45.08 ? 1138 LYS A CE    1 
ATOM   1344 N NZ    . LYS A 1 181 ? 28.634 35.641 51.812 1.00 45.65 ? 1138 LYS A NZ    1 
ATOM   1345 N N     . GLY A 1 182 ? 27.603 40.388 50.450 1.00 43.27 ? 1139 GLY A N     1 
ATOM   1346 C CA    . GLY A 1 182 ? 28.506 41.370 51.021 1.00 44.63 ? 1139 GLY A CA    1 
ATOM   1347 C C     . GLY A 1 182 ? 29.804 40.756 51.517 1.00 45.15 ? 1139 GLY A C     1 
ATOM   1348 O O     . GLY A 1 182 ? 29.813 39.642 52.047 1.00 45.65 ? 1139 GLY A O     1 
ATOM   1349 N N     . GLY A 1 183 ? 30.907 41.477 51.335 1.00 45.78 ? 1140 GLY A N     1 
ATOM   1350 C CA    . GLY A 1 183 ? 32.196 40.986 51.793 1.00 45.89 ? 1140 GLY A CA    1 
ATOM   1351 C C     . GLY A 1 183 ? 32.851 39.950 50.898 1.00 46.07 ? 1140 GLY A C     1 
ATOM   1352 O O     . GLY A 1 183 ? 32.688 39.967 49.675 1.00 46.07 ? 1140 GLY A O     1 
ATOM   1353 N N     . LYS A 1 184 ? 33.599 39.043 51.518 1.00 45.30 ? 1141 LYS A N     1 
ATOM   1354 C CA    . LYS A 1 184 ? 34.296 37.987 50.792 1.00 44.44 ? 1141 LYS A CA    1 
ATOM   1355 C C     . LYS A 1 184 ? 33.475 36.704 50.795 1.00 42.66 ? 1141 LYS A C     1 
ATOM   1356 O O     . LYS A 1 184 ? 32.599 36.520 51.642 1.00 42.95 ? 1141 LYS A O     1 
ATOM   1357 C CB    . LYS A 1 184 ? 35.651 37.700 51.443 1.00 45.50 ? 1141 LYS A CB    1 
ATOM   1358 C CG    . LYS A 1 184 ? 36.554 38.909 51.590 1.00 47.72 ? 1141 LYS A CG    1 
ATOM   1359 C CD    . LYS A 1 184 ? 37.865 38.522 52.258 1.00 49.40 ? 1141 LYS A CD    1 
ATOM   1360 C CE    . LYS A 1 184 ? 38.715 39.744 52.565 1.00 50.57 ? 1141 LYS A CE    1 
ATOM   1361 N NZ    . LYS A 1 184 ? 39.983 39.370 53.254 1.00 52.71 ? 1141 LYS A NZ    1 
ATOM   1362 N N     . GLY A 1 185 ? 33.767 35.821 49.846 1.00 40.74 ? 1142 GLY A N     1 
ATOM   1363 C CA    . GLY A 1 185 ? 33.058 34.558 49.769 1.00 38.78 ? 1142 GLY A CA    1 
ATOM   1364 C C     . GLY A 1 185 ? 33.561 33.670 48.647 1.00 37.54 ? 1142 GLY A C     1 
ATOM   1365 O O     . GLY A 1 185 ? 34.132 34.150 47.666 1.00 37.38 ? 1142 GLY A O     1 
ATOM   1366 N N     . LEU A 1 186 ? 33.373 32.365 48.800 1.00 35.89 ? 1143 LEU A N     1 
ATOM   1367 C CA    . LEU A 1 186 ? 33.784 31.416 47.772 1.00 34.26 ? 1143 LEU A CA    1 
ATOM   1368 C C     . LEU A 1 186 ? 32.541 31.229 46.906 1.00 33.66 ? 1143 LEU A C     1 
ATOM   1369 O O     . LEU A 1 186 ? 31.576 30.579 47.318 1.00 32.21 ? 1143 LEU A O     1 
ATOM   1370 C CB    . LEU A 1 186 ? 34.209 30.089 48.405 1.00 33.34 ? 1143 LEU A CB    1 
ATOM   1371 C CG    . LEU A 1 186 ? 35.381 30.151 49.394 1.00 33.48 ? 1143 LEU A CG    1 
ATOM   1372 C CD1   . LEU A 1 186 ? 35.719 28.738 49.864 1.00 33.87 ? 1143 LEU A CD1   1 
ATOM   1373 C CD2   . LEU A 1 186 ? 36.593 30.782 48.730 1.00 32.08 ? 1143 LEU A CD2   1 
ATOM   1374 N N     . LEU A 1 187 ? 32.568 31.810 45.711 1.00 32.55 ? 1144 LEU A N     1 
ATOM   1375 C CA    . LEU A 1 187 ? 31.427 31.744 44.807 1.00 31.61 ? 1144 LEU A CA    1 
ATOM   1376 C C     . LEU A 1 187 ? 31.738 31.041 43.500 1.00 29.52 ? 1144 LEU A C     1 
ATOM   1377 O O     . LEU A 1 187 ? 32.880 31.043 43.041 1.00 28.87 ? 1144 LEU A O     1 
ATOM   1378 C CB    . LEU A 1 187 ? 30.916 33.160 44.524 1.00 32.42 ? 1144 LEU A CB    1 
ATOM   1379 C CG    . LEU A 1 187 ? 30.440 33.915 45.766 1.00 33.65 ? 1144 LEU A CG    1 
ATOM   1380 C CD1   . LEU A 1 187 ? 30.035 35.338 45.399 1.00 34.15 ? 1144 LEU A CD1   1 
ATOM   1381 C CD2   . LEU A 1 187 ? 29.275 33.172 46.383 1.00 34.78 ? 1144 LEU A CD2   1 
ATOM   1382 N N     . PRO A 1 188 ? 30.711 30.430 42.883 1.00 28.32 ? 1145 PRO A N     1 
ATOM   1383 C CA    . PRO A 1 188 ? 30.807 29.697 41.617 1.00 27.00 ? 1145 PRO A CA    1 
ATOM   1384 C C     . PRO A 1 188 ? 30.961 30.638 40.428 1.00 27.28 ? 1145 PRO A C     1 
ATOM   1385 O O     . PRO A 1 188 ? 30.061 30.759 39.592 1.00 26.30 ? 1145 PRO A O     1 
ATOM   1386 C CB    . PRO A 1 188 ? 29.501 28.913 41.583 1.00 26.78 ? 1145 PRO A CB    1 
ATOM   1387 C CG    . PRO A 1 188 ? 28.539 29.875 42.228 1.00 27.57 ? 1145 PRO A CG    1 
ATOM   1388 C CD    . PRO A 1 188 ? 29.332 30.378 43.412 1.00 27.18 ? 1145 PRO A CD    1 
ATOM   1389 N N     . VAL A 1 189 ? 32.119 31.294 40.366 1.00 25.54 ? 1146 VAL A N     1 
ATOM   1390 C CA    . VAL A 1 189 ? 32.440 32.252 39.314 1.00 26.17 ? 1146 VAL A CA    1 
ATOM   1391 C C     . VAL A 1 189 ? 32.111 31.863 37.873 1.00 25.07 ? 1146 VAL A C     1 
ATOM   1392 O O     . VAL A 1 189 ? 31.586 32.685 37.122 1.00 26.03 ? 1146 VAL A O     1 
ATOM   1393 C CB    . VAL A 1 189 ? 33.941 32.646 39.376 1.00 26.12 ? 1146 VAL A CB    1 
ATOM   1394 C CG1   . VAL A 1 189 ? 34.366 33.302 38.077 1.00 25.69 ? 1146 VAL A CG1   1 
ATOM   1395 C CG2   . VAL A 1 189 ? 34.174 33.597 40.541 1.00 26.52 ? 1146 VAL A CG2   1 
ATOM   1396 N N     . ARG A 1 190 ? 32.417 30.628 37.482 1.00 24.22 ? 1147 ARG A N     1 
ATOM   1397 C CA    . ARG A 1 190 ? 32.165 30.185 36.110 1.00 23.21 ? 1147 ARG A CA    1 
ATOM   1398 C C     . ARG A 1 190 ? 30.701 29.933 35.766 1.00 22.32 ? 1147 ARG A C     1 
ATOM   1399 O O     . ARG A 1 190 ? 30.383 29.599 34.632 1.00 21.76 ? 1147 ARG A O     1 
ATOM   1400 C CB    . ARG A 1 190 ? 32.993 28.933 35.798 1.00 24.37 ? 1147 ARG A CB    1 
ATOM   1401 C CG    . ARG A 1 190 ? 34.501 29.196 35.798 1.00 24.78 ? 1147 ARG A CG    1 
ATOM   1402 C CD    . ARG A 1 190 ? 35.329 27.916 35.716 1.00 26.53 ? 1147 ARG A CD    1 
ATOM   1403 N NE    . ARG A 1 190 ? 36.729 28.177 36.064 1.00 28.56 ? 1147 ARG A NE    1 
ATOM   1404 C CZ    . ARG A 1 190 ? 37.713 28.353 35.187 1.00 28.84 ? 1147 ARG A CZ    1 
ATOM   1405 N NH1   . ARG A 1 190 ? 37.471 28.288 33.888 1.00 29.87 ? 1147 ARG A NH1   1 
ATOM   1406 N NH2   . ARG A 1 190 ? 38.942 28.618 35.612 1.00 30.97 ? 1147 ARG A NH2   1 
ATOM   1407 N N     . TRP A 1 191 ? 29.816 30.101 36.742 1.00 22.02 ? 1148 TRP A N     1 
ATOM   1408 C CA    . TRP A 1 191 ? 28.379 29.892 36.535 1.00 22.03 ? 1148 TRP A CA    1 
ATOM   1409 C C     . TRP A 1 191 ? 27.602 31.191 36.805 1.00 22.08 ? 1148 TRP A C     1 
ATOM   1410 O O     . TRP A 1 191 ? 26.384 31.242 36.636 1.00 22.40 ? 1148 TRP A O     1 
ATOM   1411 C CB    . TRP A 1 191 ? 27.870 28.781 37.475 1.00 21.28 ? 1148 TRP A CB    1 
ATOM   1412 C CG    . TRP A 1 191 ? 28.182 27.364 37.015 1.00 21.41 ? 1148 TRP A CG    1 
ATOM   1413 C CD1   . TRP A 1 191 ? 27.359 26.536 36.303 1.00 19.85 ? 1148 TRP A CD1   1 
ATOM   1414 C CD2   . TRP A 1 191 ? 29.423 26.654 37.170 1.00 21.72 ? 1148 TRP A CD2   1 
ATOM   1415 N NE1   . TRP A 1 191 ? 28.007 25.364 35.999 1.00 22.04 ? 1148 TRP A NE1   1 
ATOM   1416 C CE2   . TRP A 1 191 ? 29.275 25.409 36.516 1.00 21.25 ? 1148 TRP A CE2   1 
ATOM   1417 C CE3   . TRP A 1 191 ? 30.645 26.952 37.789 1.00 21.59 ? 1148 TRP A CE3   1 
ATOM   1418 C CZ2   . TRP A 1 191 ? 30.306 24.460 36.465 1.00 21.60 ? 1148 TRP A CZ2   1 
ATOM   1419 C CZ3   . TRP A 1 191 ? 31.671 26.003 37.735 1.00 21.09 ? 1148 TRP A CZ3   1 
ATOM   1420 C CH2   . TRP A 1 191 ? 31.492 24.775 37.078 1.00 21.30 ? 1148 TRP A CH2   1 
ATOM   1421 N N     . MET A 1 192 ? 28.313 32.236 37.220 1.00 21.95 ? 1149 MET A N     1 
ATOM   1422 C CA    . MET A 1 192 ? 27.696 33.518 37.559 1.00 21.21 ? 1149 MET A CA    1 
ATOM   1423 C C     . MET A 1 192 ? 27.503 34.517 36.423 1.00 20.65 ? 1149 MET A C     1 
ATOM   1424 O O     . MET A 1 192 ? 28.342 34.649 35.542 1.00 19.63 ? 1149 MET A O     1 
ATOM   1425 C CB    . MET A 1 192 ? 28.492 34.177 38.685 1.00 21.34 ? 1149 MET A CB    1 
ATOM   1426 C CG    . MET A 1 192 ? 28.245 33.556 40.057 1.00 23.81 ? 1149 MET A CG    1 
ATOM   1427 S SD    . MET A 1 192 ? 29.563 33.946 41.227 1.00 24.28 ? 1149 MET A SD    1 
ATOM   1428 C CE    . MET A 1 192 ? 29.232 35.680 41.536 1.00 22.44 ? 1149 MET A CE    1 
ATOM   1429 N N     . SER A 1 193 ? 26.383 35.229 36.459 1.00 20.62 ? 1150 SER A N     1 
ATOM   1430 C CA    . SER A 1 193 ? 26.077 36.221 35.433 1.00 21.91 ? 1150 SER A CA    1 
ATOM   1431 C C     . SER A 1 193 ? 27.050 37.398 35.535 1.00 23.22 ? 1150 SER A C     1 
ATOM   1432 O O     . SER A 1 193 ? 27.753 37.558 36.536 1.00 23.28 ? 1150 SER A O     1 
ATOM   1433 C CB    . SER A 1 193 ? 24.648 36.746 35.614 1.00 21.94 ? 1150 SER A CB    1 
ATOM   1434 O OG    . SER A 1 193 ? 24.567 37.582 36.757 1.00 20.51 ? 1150 SER A OG    1 
ATOM   1435 N N     . PRO A 1 194 ? 27.108 38.231 34.489 1.00 23.80 ? 1151 PRO A N     1 
ATOM   1436 C CA    . PRO A 1 194 ? 27.998 39.393 34.488 1.00 24.00 ? 1151 PRO A CA    1 
ATOM   1437 C C     . PRO A 1 194 ? 27.698 40.346 35.646 1.00 24.99 ? 1151 PRO A C     1 
ATOM   1438 O O     . PRO A 1 194 ? 28.615 40.821 36.322 1.00 24.78 ? 1151 PRO A O     1 
ATOM   1439 C CB    . PRO A 1 194 ? 27.724 40.026 33.129 1.00 24.25 ? 1151 PRO A CB    1 
ATOM   1440 C CG    . PRO A 1 194 ? 27.457 38.830 32.270 1.00 23.52 ? 1151 PRO A CG    1 
ATOM   1441 C CD    . PRO A 1 194 ? 26.538 38.011 33.146 1.00 23.44 ? 1151 PRO A CD    1 
ATOM   1442 N N     . GLU A 1 195 ? 26.418 40.621 35.882 1.00 26.35 ? 1152 GLU A N     1 
ATOM   1443 C CA    . GLU A 1 195 ? 26.044 41.534 36.962 1.00 27.19 ? 1152 GLU A CA    1 
ATOM   1444 C C     . GLU A 1 195 ? 26.393 40.978 38.342 1.00 27.86 ? 1152 GLU A C     1 
ATOM   1445 O O     . GLU A 1 195 ? 26.744 41.738 39.251 1.00 27.76 ? 1152 GLU A O     1 
ATOM   1446 C CB    . GLU A 1 195 ? 24.546 41.861 36.907 1.00 27.85 ? 1152 GLU A CB    1 
ATOM   1447 C CG    . GLU A 1 195 ? 23.627 40.684 37.224 1.00 27.45 ? 1152 GLU A CG    1 
ATOM   1448 C CD    . GLU A 1 195 ? 23.235 39.891 35.998 1.00 27.50 ? 1152 GLU A CD    1 
ATOM   1449 O OE1   . GLU A 1 195 ? 23.916 40.020 34.957 1.00 28.04 ? 1152 GLU A OE1   1 
ATOM   1450 O OE2   . GLU A 1 195 ? 22.249 39.129 36.078 1.00 26.69 ? 1152 GLU A OE2   1 
ATOM   1451 N N     . SER A 1 196 ? 26.290 39.657 38.502 1.00 27.90 ? 1153 SER A N     1 
ATOM   1452 C CA    . SER A 1 196 ? 26.611 39.014 39.776 1.00 28.81 ? 1153 SER A CA    1 
ATOM   1453 C C     . SER A 1 196 ? 28.112 39.096 40.015 1.00 29.24 ? 1153 SER A C     1 
ATOM   1454 O O     . SER A 1 196 ? 28.560 39.363 41.124 1.00 29.44 ? 1153 SER A O     1 
ATOM   1455 C CB    . SER A 1 196 ? 26.187 37.537 39.773 1.00 28.63 ? 1153 SER A CB    1 
ATOM   1456 O OG    . SER A 1 196 ? 24.779 37.400 39.738 1.00 27.87 ? 1153 SER A OG    1 
ATOM   1457 N N     . LEU A 1 197 ? 28.887 38.857 38.965 1.00 31.33 ? 1154 LEU A N     1 
ATOM   1458 C CA    . LEU A 1 197 ? 30.333 38.918 39.082 1.00 32.30 ? 1154 LEU A CA    1 
ATOM   1459 C C     . LEU A 1 197 ? 30.764 40.343 39.415 1.00 34.21 ? 1154 LEU A C     1 
ATOM   1460 O O     . LEU A 1 197 ? 31.722 40.553 40.158 1.00 34.22 ? 1154 LEU A O     1 
ATOM   1461 C CB    . LEU A 1 197 ? 30.994 38.483 37.773 1.00 31.82 ? 1154 LEU A CB    1 
ATOM   1462 C CG    . LEU A 1 197 ? 30.936 37.012 37.353 1.00 31.01 ? 1154 LEU A CG    1 
ATOM   1463 C CD1   . LEU A 1 197 ? 31.453 36.882 35.937 1.00 30.51 ? 1154 LEU A CD1   1 
ATOM   1464 C CD2   . LEU A 1 197 ? 31.760 36.155 38.309 1.00 31.14 ? 1154 LEU A CD2   1 
ATOM   1465 N N     . LYS A 1 198 ? 30.046 41.321 38.871 1.00 35.41 ? 1155 LYS A N     1 
ATOM   1466 C CA    . LYS A 1 198 ? 30.396 42.718 39.092 1.00 37.26 ? 1155 LYS A CA    1 
ATOM   1467 C C     . LYS A 1 198 ? 30.067 43.282 40.474 1.00 37.90 ? 1155 LYS A C     1 
ATOM   1468 O O     . LYS A 1 198 ? 30.910 43.930 41.088 1.00 39.01 ? 1155 LYS A O     1 
ATOM   1469 C CB    . LYS A 1 198 ? 29.759 43.599 38.012 1.00 38.43 ? 1155 LYS A CB    1 
ATOM   1470 C CG    . LYS A 1 198 ? 30.502 44.917 37.819 1.00 42.06 ? 1155 LYS A CG    1 
ATOM   1471 C CD    . LYS A 1 198 ? 29.870 45.811 36.758 1.00 43.61 ? 1155 LYS A CD    1 
ATOM   1472 C CE    . LYS A 1 198 ? 28.624 46.501 37.285 1.00 46.15 ? 1155 LYS A CE    1 
ATOM   1473 N NZ    . LYS A 1 198 ? 28.123 47.538 36.335 1.00 46.94 ? 1155 LYS A NZ    1 
ATOM   1474 N N     . ASP A 1 199 ? 28.858 43.050 40.974 1.00 38.49 ? 1156 ASP A N     1 
ATOM   1475 C CA    . ASP A 1 199 ? 28.502 43.581 42.287 1.00 39.27 ? 1156 ASP A CA    1 
ATOM   1476 C C     . ASP A 1 199 ? 27.768 42.629 43.227 1.00 38.06 ? 1156 ASP A C     1 
ATOM   1477 O O     . ASP A 1 199 ? 27.036 43.064 44.120 1.00 37.93 ? 1156 ASP A O     1 
ATOM   1478 C CB    . ASP A 1 199 ? 27.703 44.879 42.126 1.00 41.62 ? 1156 ASP A CB    1 
ATOM   1479 C CG    . ASP A 1 199 ? 26.924 44.922 40.835 1.00 44.42 ? 1156 ASP A CG    1 
ATOM   1480 O OD1   . ASP A 1 199 ? 26.005 44.091 40.666 1.00 47.33 ? 1156 ASP A OD1   1 
ATOM   1481 O OD2   . ASP A 1 199 ? 27.240 45.783 39.984 1.00 45.06 ? 1156 ASP A OD2   1 
ATOM   1482 N N     . GLY A 1 200 ? 27.968 41.331 43.020 1.00 36.85 ? 1157 GLY A N     1 
ATOM   1483 C CA    . GLY A 1 200 ? 27.353 40.331 43.878 1.00 35.19 ? 1157 GLY A CA    1 
ATOM   1484 C C     . GLY A 1 200 ? 25.843 40.336 44.027 1.00 33.92 ? 1157 GLY A C     1 
ATOM   1485 O O     . GLY A 1 200 ? 25.327 39.908 45.059 1.00 33.36 ? 1157 GLY A O     1 
ATOM   1486 N N     . VAL A 1 201 ? 25.127 40.804 43.008 1.00 32.96 ? 1158 VAL A N     1 
ATOM   1487 C CA    . VAL A 1 201 ? 23.668 40.825 43.066 1.00 32.37 ? 1158 VAL A CA    1 
ATOM   1488 C C     . VAL A 1 201 ? 23.104 39.576 42.378 1.00 30.55 ? 1158 VAL A C     1 
ATOM   1489 O O     . VAL A 1 201 ? 23.466 39.256 41.243 1.00 30.52 ? 1158 VAL A O     1 
ATOM   1490 C CB    . VAL A 1 201 ? 23.099 42.104 42.394 1.00 33.85 ? 1158 VAL A CB    1 
ATOM   1491 C CG1   . VAL A 1 201 ? 23.366 42.081 40.902 1.00 34.94 ? 1158 VAL A CG1   1 
ATOM   1492 C CG2   . VAL A 1 201 ? 21.617 42.225 42.674 1.00 35.56 ? 1158 VAL A CG2   1 
ATOM   1493 N N     . PHE A 1 202 ? 22.222 38.867 43.076 1.00 29.06 ? 1159 PHE A N     1 
ATOM   1494 C CA    . PHE A 1 202 ? 21.616 37.654 42.539 1.00 27.66 ? 1159 PHE A CA    1 
ATOM   1495 C C     . PHE A 1 202 ? 20.103 37.799 42.414 1.00 26.79 ? 1159 PHE A C     1 
ATOM   1496 O O     . PHE A 1 202 ? 19.435 38.200 43.359 1.00 25.96 ? 1159 PHE A O     1 
ATOM   1497 C CB    . PHE A 1 202 ? 21.942 36.451 43.435 1.00 25.78 ? 1159 PHE A CB    1 
ATOM   1498 C CG    . PHE A 1 202 ? 23.409 36.099 43.480 1.00 26.78 ? 1159 PHE A CG    1 
ATOM   1499 C CD1   . PHE A 1 202 ? 24.306 36.869 44.213 1.00 26.61 ? 1159 PHE A CD1   1 
ATOM   1500 C CD2   . PHE A 1 202 ? 23.892 34.993 42.789 1.00 25.51 ? 1159 PHE A CD2   1 
ATOM   1501 C CE1   . PHE A 1 202 ? 25.663 36.542 44.256 1.00 25.91 ? 1159 PHE A CE1   1 
ATOM   1502 C CE2   . PHE A 1 202 ? 25.244 34.658 42.825 1.00 26.91 ? 1159 PHE A CE2   1 
ATOM   1503 C CZ    . PHE A 1 202 ? 26.135 35.435 43.562 1.00 25.20 ? 1159 PHE A CZ    1 
ATOM   1504 N N     . THR A 1 203 ? 19.577 37.459 41.241 1.00 25.52 ? 1160 THR A N     1 
ATOM   1505 C CA    . THR A 1 203 ? 18.146 37.555 40.964 1.00 25.74 ? 1160 THR A CA    1 
ATOM   1506 C C     . THR A 1 203 ? 17.698 36.305 40.221 1.00 24.38 ? 1160 THR A C     1 
ATOM   1507 O O     . THR A 1 203 ? 18.516 35.461 39.881 1.00 24.42 ? 1160 THR A O     1 
ATOM   1508 C CB    . THR A 1 203 ? 17.846 38.728 40.028 1.00 25.44 ? 1160 THR A CB    1 
ATOM   1509 O OG1   . THR A 1 203 ? 18.443 38.458 38.758 1.00 26.76 ? 1160 THR A OG1   1 
ATOM   1510 C CG2   . THR A 1 203 ? 18.422 40.034 40.573 1.00 25.40 ? 1160 THR A CG2   1 
ATOM   1511 N N     . THR A 1 204 ? 16.397 36.190 39.964 1.00 24.58 ? 1161 THR A N     1 
ATOM   1512 C CA    . THR A 1 204 ? 15.901 35.054 39.204 1.00 24.19 ? 1161 THR A CA    1 
ATOM   1513 C C     . THR A 1 204 ? 16.585 35.134 37.836 1.00 23.61 ? 1161 THR A C     1 
ATOM   1514 O O     . THR A 1 204 ? 16.790 34.113 37.180 1.00 22.54 ? 1161 THR A O     1 
ATOM   1515 C CB    . THR A 1 204 ? 14.367 35.105 39.003 1.00 25.24 ? 1161 THR A CB    1 
ATOM   1516 O OG1   . THR A 1 204 ? 14.015 36.276 38.255 1.00 26.83 ? 1161 THR A OG1   1 
ATOM   1517 C CG2   . THR A 1 204 ? 13.655 35.139 40.345 1.00 25.51 ? 1161 THR A CG2   1 
ATOM   1518 N N     . TYR A 1 205 ? 16.944 36.352 37.420 1.00 22.79 ? 1162 TYR A N     1 
ATOM   1519 C CA    . TYR A 1 205 ? 17.611 36.558 36.132 1.00 23.33 ? 1162 TYR A CA    1 
ATOM   1520 C C     . TYR A 1 205 ? 18.991 35.914 36.121 1.00 21.37 ? 1162 TYR A C     1 
ATOM   1521 O O     . TYR A 1 205 ? 19.388 35.324 35.125 1.00 19.55 ? 1162 TYR A O     1 
ATOM   1522 C CB    . TYR A 1 205 ? 17.799 38.048 35.811 1.00 26.24 ? 1162 TYR A CB    1 
ATOM   1523 C CG    . TYR A 1 205 ? 16.588 38.920 36.012 1.00 31.15 ? 1162 TYR A CG    1 
ATOM   1524 C CD1   . TYR A 1 205 ? 15.338 38.546 35.517 1.00 32.33 ? 1162 TYR A CD1   1 
ATOM   1525 C CD2   . TYR A 1 205 ? 16.700 40.140 36.683 1.00 32.29 ? 1162 TYR A CD2   1 
ATOM   1526 C CE1   . TYR A 1 205 ? 14.220 39.372 35.686 1.00 35.37 ? 1162 TYR A CE1   1 
ATOM   1527 C CE2   . TYR A 1 205 ? 15.595 40.972 36.856 1.00 35.36 ? 1162 TYR A CE2   1 
ATOM   1528 C CZ    . TYR A 1 205 ? 14.359 40.584 36.356 1.00 36.14 ? 1162 TYR A CZ    1 
ATOM   1529 O OH    . TYR A 1 205 ? 13.274 41.415 36.524 1.00 38.51 ? 1162 TYR A OH    1 
ATOM   1530 N N     . SER A 1 206 ? 19.729 36.032 37.221 1.00 20.36 ? 1163 SER A N     1 
ATOM   1531 C CA    . SER A 1 206 ? 21.053 35.425 37.252 1.00 20.66 ? 1163 SER A CA    1 
ATOM   1532 C C     . SER A 1 206 ? 20.925 33.910 37.364 1.00 19.20 ? 1163 SER A C     1 
ATOM   1533 O O     . SER A 1 206 ? 21.821 33.193 36.963 1.00 20.57 ? 1163 SER A O     1 
ATOM   1534 C CB    . SER A 1 206 ? 21.913 36.009 38.388 1.00 20.41 ? 1163 SER A CB    1 
ATOM   1535 O OG    . SER A 1 206 ? 21.261 35.950 39.638 1.00 20.56 ? 1163 SER A OG    1 
ATOM   1536 N N     . ASP A 1 207 ? 19.809 33.421 37.904 1.00 19.83 ? 1164 ASP A N     1 
ATOM   1537 C CA    . ASP A 1 207 ? 19.584 31.975 37.994 1.00 18.38 ? 1164 ASP A CA    1 
ATOM   1538 C C     . ASP A 1 207 ? 19.384 31.483 36.553 1.00 18.45 ? 1164 ASP A C     1 
ATOM   1539 O O     . ASP A 1 207 ? 19.806 30.386 36.183 1.00 17.16 ? 1164 ASP A O     1 
ATOM   1540 C CB    . ASP A 1 207 ? 18.316 31.653 38.797 1.00 18.06 ? 1164 ASP A CB    1 
ATOM   1541 C CG    . ASP A 1 207 ? 18.572 31.457 40.287 1.00 18.68 ? 1164 ASP A CG    1 
ATOM   1542 O OD1   . ASP A 1 207 ? 19.745 31.451 40.725 1.00 18.00 ? 1164 ASP A OD1   1 
ATOM   1543 O OD2   . ASP A 1 207 ? 17.572 31.297 41.025 1.00 17.03 ? 1164 ASP A OD2   1 
ATOM   1544 N N     . VAL A 1 208 ? 18.735 32.303 35.735 1.00 18.36 ? 1165 VAL A N     1 
ATOM   1545 C CA    . VAL A 1 208 ? 18.497 31.926 34.347 1.00 17.43 ? 1165 VAL A CA    1 
ATOM   1546 C C     . VAL A 1 208 ? 19.826 31.879 33.592 1.00 18.58 ? 1165 VAL A C     1 
ATOM   1547 O O     . VAL A 1 208 ? 20.013 31.043 32.706 1.00 18.39 ? 1165 VAL A O     1 
ATOM   1548 C CB    . VAL A 1 208 ? 17.504 32.902 33.670 1.00 17.29 ? 1165 VAL A CB    1 
ATOM   1549 C CG1   . VAL A 1 208 ? 17.495 32.693 32.160 1.00 16.72 ? 1165 VAL A CG1   1 
ATOM   1550 C CG2   . VAL A 1 208 ? 16.095 32.657 34.223 1.00 14.96 ? 1165 VAL A CG2   1 
ATOM   1551 N N     . TRP A 1 209 ? 20.748 32.773 33.946 1.00 17.75 ? 1166 TRP A N     1 
ATOM   1552 C CA    . TRP A 1 209 ? 22.067 32.776 33.316 1.00 18.72 ? 1166 TRP A CA    1 
ATOM   1553 C C     . TRP A 1 209 ? 22.749 31.436 33.592 1.00 18.21 ? 1166 TRP A C     1 
ATOM   1554 O O     . TRP A 1 209 ? 23.264 30.791 32.677 1.00 18.45 ? 1166 TRP A O     1 
ATOM   1555 C CB    . TRP A 1 209 ? 22.939 33.906 33.874 1.00 18.75 ? 1166 TRP A CB    1 
ATOM   1556 C CG    . TRP A 1 209 ? 24.350 33.875 33.352 1.00 20.20 ? 1166 TRP A CG    1 
ATOM   1557 C CD1   . TRP A 1 209 ? 25.360 33.041 33.754 1.00 20.58 ? 1166 TRP A CD1   1 
ATOM   1558 C CD2   . TRP A 1 209 ? 24.884 34.663 32.283 1.00 20.50 ? 1166 TRP A CD2   1 
ATOM   1559 N NE1   . TRP A 1 209 ? 26.484 33.262 32.996 1.00 20.05 ? 1166 TRP A NE1   1 
ATOM   1560 C CE2   . TRP A 1 209 ? 26.220 34.253 32.087 1.00 21.51 ? 1166 TRP A CE2   1 
ATOM   1561 C CE3   . TRP A 1 209 ? 24.361 35.680 31.469 1.00 20.80 ? 1166 TRP A CE3   1 
ATOM   1562 C CZ2   . TRP A 1 209 ? 27.047 34.822 31.107 1.00 21.96 ? 1166 TRP A CZ2   1 
ATOM   1563 C CZ3   . TRP A 1 209 ? 25.179 36.246 30.496 1.00 22.00 ? 1166 TRP A CZ3   1 
ATOM   1564 C CH2   . TRP A 1 209 ? 26.509 35.813 30.324 1.00 22.50 ? 1166 TRP A CH2   1 
ATOM   1565 N N     . SER A 1 210 ? 22.753 31.030 34.860 1.00 17.58 ? 1167 SER A N     1 
ATOM   1566 C CA    . SER A 1 210 ? 23.370 29.764 35.266 1.00 17.66 ? 1167 SER A CA    1 
ATOM   1567 C C     . SER A 1 210 ? 22.712 28.584 34.570 1.00 17.54 ? 1167 SER A C     1 
ATOM   1568 O O     . SER A 1 210 ? 23.379 27.614 34.226 1.00 17.89 ? 1167 SER A O     1 
ATOM   1569 C CB    . SER A 1 210 ? 23.273 29.585 36.780 1.00 17.37 ? 1167 SER A CB    1 
ATOM   1570 O OG    . SER A 1 210 ? 23.954 30.631 37.444 1.00 20.33 ? 1167 SER A OG    1 
ATOM   1571 N N     . PHE A 1 211 ? 21.399 28.659 34.369 1.00 17.45 ? 1168 PHE A N     1 
ATOM   1572 C CA    . PHE A 1 211 ? 20.687 27.587 33.674 1.00 18.21 ? 1168 PHE A CA    1 
ATOM   1573 C C     . PHE A 1 211 ? 21.314 27.457 32.280 1.00 18.08 ? 1168 PHE A C     1 
ATOM   1574 O O     . PHE A 1 211 ? 21.484 26.354 31.757 1.00 17.75 ? 1168 PHE A O     1 
ATOM   1575 C CB    . PHE A 1 211 ? 19.198 27.934 33.561 1.00 19.12 ? 1168 PHE A CB    1 
ATOM   1576 C CG    . PHE A 1 211 ? 18.402 26.965 32.723 1.00 20.24 ? 1168 PHE A CG    1 
ATOM   1577 C CD1   . PHE A 1 211 ? 18.062 25.711 33.213 1.00 20.78 ? 1168 PHE A CD1   1 
ATOM   1578 C CD2   . PHE A 1 211 ? 17.976 27.321 31.445 1.00 20.98 ? 1168 PHE A CD2   1 
ATOM   1579 C CE1   . PHE A 1 211 ? 17.301 24.823 32.442 1.00 19.86 ? 1168 PHE A CE1   1 
ATOM   1580 C CE2   . PHE A 1 211 ? 17.215 26.436 30.666 1.00 20.47 ? 1168 PHE A CE2   1 
ATOM   1581 C CZ    . PHE A 1 211 ? 16.880 25.194 31.169 1.00 21.49 ? 1168 PHE A CZ    1 
ATOM   1582 N N     . GLY A 1 212 ? 21.664 28.592 31.680 1.00 18.86 ? 1169 GLY A N     1 
ATOM   1583 C CA    . GLY A 1 212 ? 22.287 28.559 30.368 1.00 17.80 ? 1169 GLY A CA    1 
ATOM   1584 C C     . GLY A 1 212 ? 23.582 27.772 30.434 1.00 19.15 ? 1169 GLY A C     1 
ATOM   1585 O O     . GLY A 1 212 ? 23.900 26.983 29.538 1.00 19.60 ? 1169 GLY A O     1 
ATOM   1586 N N     . VAL A 1 213 ? 24.342 27.972 31.505 1.00 18.68 ? 1170 VAL A N     1 
ATOM   1587 C CA    . VAL A 1 213 ? 25.598 27.246 31.639 1.00 20.58 ? 1170 VAL A CA    1 
ATOM   1588 C C     . VAL A 1 213 ? 25.339 25.751 31.808 1.00 20.77 ? 1170 VAL A C     1 
ATOM   1589 O O     . VAL A 1 213 ? 26.080 24.924 31.269 1.00 20.63 ? 1170 VAL A O     1 
ATOM   1590 C CB    . VAL A 1 213 ? 26.426 27.768 32.817 1.00 20.58 ? 1170 VAL A CB    1 
ATOM   1591 C CG1   . VAL A 1 213 ? 27.751 26.993 32.898 1.00 21.16 ? 1170 VAL A CG1   1 
ATOM   1592 C CG2   . VAL A 1 213 ? 26.707 29.265 32.615 1.00 19.95 ? 1170 VAL A CG2   1 
ATOM   1593 N N     . VAL A 1 214 ? 24.288 25.406 32.548 1.00 20.40 ? 1171 VAL A N     1 
ATOM   1594 C CA    . VAL A 1 214 ? 23.944 24.000 32.756 1.00 19.79 ? 1171 VAL A CA    1 
ATOM   1595 C C     . VAL A 1 214 ? 23.602 23.363 31.405 1.00 20.48 ? 1171 VAL A C     1 
ATOM   1596 O O     . VAL A 1 214 ? 23.968 22.219 31.147 1.00 21.21 ? 1171 VAL A O     1 
ATOM   1597 C CB    . VAL A 1 214 ? 22.761 23.851 33.741 1.00 19.08 ? 1171 VAL A CB    1 
ATOM   1598 C CG1   . VAL A 1 214 ? 22.314 22.394 33.827 1.00 19.15 ? 1171 VAL A CG1   1 
ATOM   1599 C CG2   . VAL A 1 214 ? 23.178 24.338 35.117 1.00 17.80 ? 1171 VAL A CG2   1 
ATOM   1600 N N     . LEU A 1 215 ? 22.905 24.100 30.542 1.00 21.04 ? 1172 LEU A N     1 
ATOM   1601 C CA    . LEU A 1 215 ? 22.575 23.583 29.216 1.00 21.60 ? 1172 LEU A CA    1 
ATOM   1602 C C     . LEU A 1 215 ? 23.879 23.289 28.475 1.00 21.76 ? 1172 LEU A C     1 
ATOM   1603 O O     . LEU A 1 215 ? 24.012 22.258 27.818 1.00 21.18 ? 1172 LEU A O     1 
ATOM   1604 C CB    . LEU A 1 215 ? 21.752 24.597 28.415 1.00 22.42 ? 1172 LEU A CB    1 
ATOM   1605 C CG    . LEU A 1 215 ? 20.328 24.868 28.907 1.00 20.90 ? 1172 LEU A CG    1 
ATOM   1606 C CD1   . LEU A 1 215 ? 19.589 25.707 27.873 1.00 21.75 ? 1172 LEU A CD1   1 
ATOM   1607 C CD2   . LEU A 1 215 ? 19.602 23.543 29.125 1.00 23.30 ? 1172 LEU A CD2   1 
ATOM   1608 N N     . TRP A 1 216 ? 24.839 24.201 28.585 1.00 22.28 ? 1173 TRP A N     1 
ATOM   1609 C CA    . TRP A 1 216 ? 26.139 24.015 27.938 1.00 23.36 ? 1173 TRP A CA    1 
ATOM   1610 C C     . TRP A 1 216 ? 26.803 22.747 28.498 1.00 22.64 ? 1173 TRP A C     1 
ATOM   1611 O O     . TRP A 1 216 ? 27.355 21.940 27.755 1.00 24.20 ? 1173 TRP A O     1 
ATOM   1612 C CB    . TRP A 1 216 ? 27.038 25.222 28.208 1.00 22.87 ? 1173 TRP A CB    1 
ATOM   1613 C CG    . TRP A 1 216 ? 28.352 25.200 27.464 1.00 24.86 ? 1173 TRP A CG    1 
ATOM   1614 C CD1   . TRP A 1 216 ? 28.586 25.652 26.193 1.00 25.62 ? 1173 TRP A CD1   1 
ATOM   1615 C CD2   . TRP A 1 216 ? 29.610 24.718 27.954 1.00 25.24 ? 1173 TRP A CD2   1 
ATOM   1616 N NE1   . TRP A 1 216 ? 29.911 25.488 25.866 1.00 24.24 ? 1173 TRP A NE1   1 
ATOM   1617 C CE2   . TRP A 1 216 ? 30.562 24.918 26.927 1.00 26.69 ? 1173 TRP A CE2   1 
ATOM   1618 C CE3   . TRP A 1 216 ? 30.026 24.142 29.161 1.00 26.90 ? 1173 TRP A CE3   1 
ATOM   1619 C CZ2   . TRP A 1 216 ? 31.911 24.556 27.072 1.00 26.56 ? 1173 TRP A CZ2   1 
ATOM   1620 C CZ3   . TRP A 1 216 ? 31.365 23.785 29.305 1.00 26.67 ? 1173 TRP A CZ3   1 
ATOM   1621 C CH2   . TRP A 1 216 ? 32.291 23.995 28.265 1.00 26.69 ? 1173 TRP A CH2   1 
ATOM   1622 N N     . GLU A 1 217 ? 26.745 22.572 29.813 1.00 22.84 ? 1174 GLU A N     1 
ATOM   1623 C CA    . GLU A 1 217 ? 27.343 21.400 30.438 1.00 22.69 ? 1174 GLU A CA    1 
ATOM   1624 C C     . GLU A 1 217 ? 26.702 20.125 29.899 1.00 23.15 ? 1174 GLU A C     1 
ATOM   1625 O O     . GLU A 1 217 ? 27.375 19.121 29.666 1.00 21.87 ? 1174 GLU A O     1 
ATOM   1626 C CB    . GLU A 1 217 ? 27.163 21.453 31.952 1.00 23.39 ? 1174 GLU A CB    1 
ATOM   1627 C CG    . GLU A 1 217 ? 28.076 22.433 32.671 1.00 23.69 ? 1174 GLU A CG    1 
ATOM   1628 C CD    . GLU A 1 217 ? 27.889 22.369 34.175 1.00 24.63 ? 1174 GLU A CD    1 
ATOM   1629 O OE1   . GLU A 1 217 ? 26.871 22.901 34.670 1.00 23.59 ? 1174 GLU A OE1   1 
ATOM   1630 O OE2   . GLU A 1 217 ? 28.753 21.774 34.861 1.00 24.00 ? 1174 GLU A OE2   1 
ATOM   1631 N N     . ILE A 1 218 ? 25.393 20.164 29.702 1.00 22.76 ? 1175 ILE A N     1 
ATOM   1632 C CA    . ILE A 1 218 ? 24.698 18.997 29.182 1.00 24.36 ? 1175 ILE A CA    1 
ATOM   1633 C C     . ILE A 1 218 ? 25.169 18.670 27.761 1.00 24.95 ? 1175 ILE A C     1 
ATOM   1634 O O     . ILE A 1 218 ? 25.516 17.530 27.469 1.00 25.29 ? 1175 ILE A O     1 
ATOM   1635 C CB    . ILE A 1 218 ? 23.179 19.227 29.190 1.00 23.89 ? 1175 ILE A CB    1 
ATOM   1636 C CG1   . ILE A 1 218 ? 22.688 19.292 30.640 1.00 23.04 ? 1175 ILE A CG1   1 
ATOM   1637 C CG2   . ILE A 1 218 ? 22.474 18.136 28.387 1.00 24.11 ? 1175 ILE A CG2   1 
ATOM   1638 C CD1   . ILE A 1 218 ? 21.185 19.531 30.788 1.00 23.37 ? 1175 ILE A CD1   1 
ATOM   1639 N N     . ALA A 1 219 ? 25.186 19.675 26.889 1.00 25.64 ? 1176 ALA A N     1 
ATOM   1640 C CA    . ALA A 1 219 ? 25.600 19.482 25.498 1.00 26.86 ? 1176 ALA A CA    1 
ATOM   1641 C C     . ALA A 1 219 ? 27.072 19.112 25.299 1.00 27.84 ? 1176 ALA A C     1 
ATOM   1642 O O     . ALA A 1 219 ? 27.424 18.578 24.253 1.00 28.96 ? 1176 ALA A O     1 
ATOM   1643 C CB    . ALA A 1 219 ? 25.275 20.727 24.675 1.00 25.07 ? 1176 ALA A CB    1 
ATOM   1644 N N     . THR A 1 220 ? 27.926 19.397 26.283 1.00 27.35 ? 1177 THR A N     1 
ATOM   1645 C CA    . THR A 1 220 ? 29.351 19.071 26.173 1.00 29.06 ? 1177 THR A CA    1 
ATOM   1646 C C     . THR A 1 220 ? 29.733 17.883 27.055 1.00 29.00 ? 1177 THR A C     1 
ATOM   1647 O O     . THR A 1 220 ? 30.912 17.544 27.165 1.00 28.67 ? 1177 THR A O     1 
ATOM   1648 C CB    . THR A 1 220 ? 30.253 20.254 26.611 1.00 28.15 ? 1177 THR A CB    1 
ATOM   1649 O OG1   . THR A 1 220 ? 29.969 20.582 27.977 1.00 29.36 ? 1177 THR A OG1   1 
ATOM   1650 C CG2   . THR A 1 220 ? 30.017 21.477 25.739 1.00 28.44 ? 1177 THR A CG2   1 
ATOM   1651 N N     . LEU A 1 221 ? 28.741 17.256 27.681 1.00 30.07 ? 1178 LEU A N     1 
ATOM   1652 C CA    . LEU A 1 221 ? 28.992 16.133 28.580 1.00 30.49 ? 1178 LEU A CA    1 
ATOM   1653 C C     . LEU A 1 221 ? 29.897 16.558 29.729 1.00 30.81 ? 1178 LEU A C     1 
ATOM   1654 O O     . LEU A 1 221 ? 30.914 15.919 30.017 1.00 31.06 ? 1178 LEU A O     1 
ATOM   1655 C CB    . LEU A 1 221 ? 29.615 14.948 27.832 1.00 30.85 ? 1178 LEU A CB    1 
ATOM   1656 C CG    . LEU A 1 221 ? 28.714 14.291 26.781 1.00 32.12 ? 1178 LEU A CG    1 
ATOM   1657 C CD1   . LEU A 1 221 ? 29.386 13.028 26.256 1.00 31.80 ? 1178 LEU A CD1   1 
ATOM   1658 C CD2   . LEU A 1 221 ? 27.355 13.946 27.397 1.00 31.79 ? 1178 LEU A CD2   1 
ATOM   1659 N N     . ALA A 1 222 ? 29.506 17.652 30.375 1.00 30.26 ? 1179 ALA A N     1 
ATOM   1660 C CA    . ALA A 1 222 ? 30.207 18.208 31.525 1.00 30.16 ? 1179 ALA A CA    1 
ATOM   1661 C C     . ALA A 1 222 ? 31.652 18.639 31.321 1.00 31.33 ? 1179 ALA A C     1 
ATOM   1662 O O     . ALA A 1 222 ? 32.527 18.283 32.107 1.00 30.33 ? 1179 ALA A O     1 
ATOM   1663 C CB    . ALA A 1 222 ? 30.125 17.240 32.706 1.00 30.30 ? 1179 ALA A CB    1 
ATOM   1664 N N     . GLU A 1 223 ? 31.908 19.407 30.271 1.00 32.25 ? 1180 GLU A N     1 
ATOM   1665 C CA    . GLU A 1 223 ? 33.255 19.910 30.052 1.00 34.21 ? 1180 GLU A CA    1 
ATOM   1666 C C     . GLU A 1 223 ? 33.341 21.026 31.088 1.00 33.67 ? 1180 GLU A C     1 
ATOM   1667 O O     . GLU A 1 223 ? 32.311 21.503 31.556 1.00 33.21 ? 1180 GLU A O     1 
ATOM   1668 C CB    . GLU A 1 223 ? 33.393 20.495 28.642 1.00 36.10 ? 1180 GLU A CB    1 
ATOM   1669 C CG    . GLU A 1 223 ? 34.828 20.573 28.148 1.00 40.32 ? 1180 GLU A CG    1 
ATOM   1670 C CD    . GLU A 1 223 ? 35.426 19.194 27.924 1.00 41.89 ? 1180 GLU A CD    1 
ATOM   1671 O OE1   . GLU A 1 223 ? 34.966 18.495 26.995 1.00 43.51 ? 1180 GLU A OE1   1 
ATOM   1672 O OE2   . GLU A 1 223 ? 36.343 18.803 28.680 1.00 43.58 ? 1180 GLU A OE2   1 
ATOM   1673 N N     . GLN A 1 224 ? 34.545 21.440 31.460 1.00 33.14 ? 1181 GLN A N     1 
ATOM   1674 C CA    . GLN A 1 224 ? 34.682 22.519 32.432 1.00 34.15 ? 1181 GLN A CA    1 
ATOM   1675 C C     . GLN A 1 224 ? 34.403 23.839 31.717 1.00 33.39 ? 1181 GLN A C     1 
ATOM   1676 O O     . GLN A 1 224 ? 34.995 24.117 30.668 1.00 32.59 ? 1181 GLN A O     1 
ATOM   1677 C CB    . GLN A 1 224 ? 36.098 22.541 33.009 1.00 36.27 ? 1181 GLN A CB    1 
ATOM   1678 C CG    . GLN A 1 224 ? 36.380 23.736 33.907 1.00 40.12 ? 1181 GLN A CG    1 
ATOM   1679 C CD    . GLN A 1 224 ? 35.654 23.659 35.237 1.00 42.74 ? 1181 GLN A CD    1 
ATOM   1680 O OE1   . GLN A 1 224 ? 35.803 24.537 36.089 1.00 45.31 ? 1181 GLN A OE1   1 
ATOM   1681 N NE2   . GLN A 1 224 ? 34.868 22.602 35.427 1.00 43.77 ? 1181 GLN A NE2   1 
ATOM   1682 N N     . PRO A 1 225 ? 33.490 24.665 32.260 1.00 32.32 ? 1182 PRO A N     1 
ATOM   1683 C CA    . PRO A 1 225 ? 33.181 25.947 31.616 1.00 31.77 ? 1182 PRO A CA    1 
ATOM   1684 C C     . PRO A 1 225 ? 34.419 26.837 31.529 1.00 31.38 ? 1182 PRO A C     1 
ATOM   1685 O O     . PRO A 1 225 ? 35.154 26.976 32.502 1.00 31.14 ? 1182 PRO A O     1 
ATOM   1686 C CB    . PRO A 1 225 ? 32.115 26.548 32.530 1.00 31.59 ? 1182 PRO A CB    1 
ATOM   1687 C CG    . PRO A 1 225 ? 31.445 25.341 33.117 1.00 32.69 ? 1182 PRO A CG    1 
ATOM   1688 C CD    . PRO A 1 225 ? 32.617 24.443 33.426 1.00 32.06 ? 1182 PRO A CD    1 
ATOM   1689 N N     . TYR A 1 226 ? 34.640 27.434 30.361 1.00 31.71 ? 1183 TYR A N     1 
ATOM   1690 C CA    . TYR A 1 226 ? 35.784 28.319 30.145 1.00 32.02 ? 1183 TYR A CA    1 
ATOM   1691 C C     . TYR A 1 226 ? 37.086 27.585 30.455 1.00 33.65 ? 1183 TYR A C     1 
ATOM   1692 O O     . TYR A 1 226 ? 37.983 28.130 31.105 1.00 33.43 ? 1183 TYR A O     1 
ATOM   1693 C CB    . TYR A 1 226 ? 35.674 29.558 31.038 1.00 30.45 ? 1183 TYR A CB    1 
ATOM   1694 C CG    . TYR A 1 226 ? 34.327 30.249 30.981 1.00 28.66 ? 1183 TYR A CG    1 
ATOM   1695 C CD1   . TYR A 1 226 ? 33.974 31.070 29.904 1.00 27.81 ? 1183 TYR A CD1   1 
ATOM   1696 C CD2   . TYR A 1 226 ? 33.396 30.066 32.004 1.00 27.87 ? 1183 TYR A CD2   1 
ATOM   1697 C CE1   . TYR A 1 226 ? 32.714 31.694 29.852 1.00 27.64 ? 1183 TYR A CE1   1 
ATOM   1698 C CE2   . TYR A 1 226 ? 32.145 30.680 31.964 1.00 27.39 ? 1183 TYR A CE2   1 
ATOM   1699 C CZ    . TYR A 1 226 ? 31.809 31.488 30.890 1.00 27.82 ? 1183 TYR A CZ    1 
ATOM   1700 O OH    . TYR A 1 226 ? 30.563 32.066 30.866 1.00 28.42 ? 1183 TYR A OH    1 
ATOM   1701 N N     . GLN A 1 227 ? 37.182 26.347 29.987 1.00 35.15 ? 1184 GLN A N     1 
ATOM   1702 C CA    . GLN A 1 227 ? 38.369 25.535 30.210 1.00 38.12 ? 1184 GLN A CA    1 
ATOM   1703 C C     . GLN A 1 227 ? 39.600 26.176 29.584 1.00 38.26 ? 1184 GLN A C     1 
ATOM   1704 O O     . GLN A 1 227 ? 39.595 26.542 28.410 1.00 37.98 ? 1184 GLN A O     1 
ATOM   1705 C CB    . GLN A 1 227 ? 38.160 24.140 29.626 1.00 40.97 ? 1184 GLN A CB    1 
ATOM   1706 C CG    . GLN A 1 227 ? 39.376 23.239 29.725 1.00 45.31 ? 1184 GLN A CG    1 
ATOM   1707 C CD    . GLN A 1 227 ? 39.004 21.771 29.655 1.00 48.16 ? 1184 GLN A CD    1 
ATOM   1708 O OE1   . GLN A 1 227 ? 38.232 21.273 30.482 1.00 50.21 ? 1184 GLN A OE1   1 
ATOM   1709 N NE2   . GLN A 1 227 ? 39.547 21.067 28.666 1.00 49.52 ? 1184 GLN A NE2   1 
ATOM   1710 N N     . GLY A 1 228 ? 40.659 26.309 30.372 1.00 38.45 ? 1185 GLY A N     1 
ATOM   1711 C CA    . GLY A 1 228 ? 41.872 26.913 29.854 1.00 38.60 ? 1185 GLY A CA    1 
ATOM   1712 C C     . GLY A 1 228 ? 42.040 28.331 30.361 1.00 38.43 ? 1185 GLY A C     1 
ATOM   1713 O O     . GLY A 1 228 ? 43.140 28.883 30.324 1.00 39.31 ? 1185 GLY A O     1 
ATOM   1714 N N     . LEU A 1 229 ? 40.948 28.929 30.829 1.00 37.69 ? 1186 LEU A N     1 
ATOM   1715 C CA    . LEU A 1 229 ? 40.998 30.284 31.360 1.00 36.66 ? 1186 LEU A CA    1 
ATOM   1716 C C     . LEU A 1 229 ? 41.107 30.239 32.878 1.00 36.55 ? 1186 LEU A C     1 
ATOM   1717 O O     . LEU A 1 229 ? 40.409 29.466 33.535 1.00 36.44 ? 1186 LEU A O     1 
ATOM   1718 C CB    . LEU A 1 229 ? 39.741 31.071 30.971 1.00 36.43 ? 1186 LEU A CB    1 
ATOM   1719 C CG    . LEU A 1 229 ? 39.601 31.533 29.520 1.00 36.99 ? 1186 LEU A CG    1 
ATOM   1720 C CD1   . LEU A 1 229 ? 38.334 32.360 29.342 1.00 36.82 ? 1186 LEU A CD1   1 
ATOM   1721 C CD2   . LEU A 1 229 ? 40.807 32.366 29.158 1.00 38.03 ? 1186 LEU A CD2   1 
ATOM   1722 N N     . SER A 1 230 ? 41.986 31.062 33.436 1.00 35.34 ? 1187 SER A N     1 
ATOM   1723 C CA    . SER A 1 230 ? 42.136 31.114 34.880 1.00 35.18 ? 1187 SER A CA    1 
ATOM   1724 C C     . SER A 1 230 ? 40.884 31.819 35.390 1.00 35.63 ? 1187 SER A C     1 
ATOM   1725 O O     . SER A 1 230 ? 40.159 32.439 34.608 1.00 35.88 ? 1187 SER A O     1 
ATOM   1726 C CB    . SER A 1 230 ? 43.366 31.933 35.261 1.00 34.55 ? 1187 SER A CB    1 
ATOM   1727 O OG    . SER A 1 230 ? 43.177 33.283 34.890 1.00 32.41 ? 1187 SER A OG    1 
ATOM   1728 N N     . ASN A 1 231 ? 40.630 31.730 36.689 1.00 34.98 ? 1188 ASN A N     1 
ATOM   1729 C CA    . ASN A 1 231 ? 39.455 32.370 37.262 1.00 35.62 ? 1188 ASN A CA    1 
ATOM   1730 C C     . ASN A 1 231 ? 39.439 33.855 36.910 1.00 35.61 ? 1188 ASN A C     1 
ATOM   1731 O O     . ASN A 1 231 ? 38.384 34.431 36.641 1.00 34.31 ? 1188 ASN A O     1 
ATOM   1732 C CB    . ASN A 1 231 ? 39.437 32.181 38.781 1.00 34.56 ? 1188 ASN A CB    1 
ATOM   1733 C CG    . ASN A 1 231 ? 39.387 30.718 39.178 1.00 35.92 ? 1188 ASN A CG    1 
ATOM   1734 O OD1   . ASN A 1 231 ? 38.721 29.917 38.524 1.00 35.19 ? 1188 ASN A OD1   1 
ATOM   1735 N ND2   . ASN A 1 231 ? 40.080 30.364 40.259 1.00 35.78 ? 1188 ASN A ND2   1 
ATOM   1736 N N     . GLU A 1 232 ? 40.624 34.458 36.912 1.00 36.09 ? 1189 GLU A N     1 
ATOM   1737 C CA    . GLU A 1 232 ? 40.788 35.871 36.592 1.00 36.71 ? 1189 GLU A CA    1 
ATOM   1738 C C     . GLU A 1 232 ? 40.323 36.206 35.185 1.00 35.48 ? 1189 GLU A C     1 
ATOM   1739 O O     . GLU A 1 232 ? 39.588 37.171 34.976 1.00 35.09 ? 1189 GLU A O     1 
ATOM   1740 C CB    . GLU A 1 232 ? 42.257 36.273 36.732 1.00 39.67 ? 1189 GLU A CB    1 
ATOM   1741 C CG    . GLU A 1 232 ? 42.610 36.813 38.095 1.00 42.50 ? 1189 GLU A CG    1 
ATOM   1742 C CD    . GLU A 1 232 ? 41.675 37.927 38.505 1.00 44.59 ? 1189 GLU A CD    1 
ATOM   1743 O OE1   . GLU A 1 232 ? 41.312 38.743 37.626 1.00 44.64 ? 1189 GLU A OE1   1 
ATOM   1744 O OE2   . GLU A 1 232 ? 41.309 37.987 39.699 1.00 45.54 ? 1189 GLU A OE2   1 
ATOM   1745 N N     . GLN A 1 233 ? 40.765 35.405 34.223 1.00 33.88 ? 1190 GLN A N     1 
ATOM   1746 C CA    . GLN A 1 233 ? 40.400 35.610 32.833 1.00 34.12 ? 1190 GLN A CA    1 
ATOM   1747 C C     . GLN A 1 233 ? 38.904 35.387 32.635 1.00 34.04 ? 1190 GLN A C     1 
ATOM   1748 O O     . GLN A 1 233 ? 38.282 36.026 31.783 1.00 32.68 ? 1190 GLN A O     1 
ATOM   1749 C CB    . GLN A 1 233 ? 41.200 34.662 31.934 1.00 34.86 ? 1190 GLN A CB    1 
ATOM   1750 C CG    . GLN A 1 233 ? 42.700 34.950 31.914 1.00 35.71 ? 1190 GLN A CG    1 
ATOM   1751 C CD    . GLN A 1 233 ? 43.482 33.904 31.150 1.00 36.69 ? 1190 GLN A CD    1 
ATOM   1752 O OE1   . GLN A 1 233 ? 43.489 32.727 31.518 1.00 37.31 ? 1190 GLN A OE1   1 
ATOM   1753 N NE2   . GLN A 1 233 ? 44.147 34.325 30.078 1.00 35.94 ? 1190 GLN A NE2   1 
ATOM   1754 N N     . VAL A 1 234 ? 38.327 34.478 33.420 1.00 33.55 ? 1191 VAL A N     1 
ATOM   1755 C CA    . VAL A 1 234 ? 36.898 34.204 33.318 1.00 32.93 ? 1191 VAL A CA    1 
ATOM   1756 C C     . VAL A 1 234 ? 36.131 35.445 33.725 1.00 33.19 ? 1191 VAL A C     1 
ATOM   1757 O O     . VAL A 1 234 ? 35.226 35.885 33.019 1.00 33.68 ? 1191 VAL A O     1 
ATOM   1758 C CB    . VAL A 1 234 ? 36.475 33.031 34.226 1.00 32.45 ? 1191 VAL A CB    1 
ATOM   1759 C CG1   . VAL A 1 234 ? 34.952 32.994 34.353 1.00 32.10 ? 1191 VAL A CG1   1 
ATOM   1760 C CG2   . VAL A 1 234 ? 36.981 31.723 33.637 1.00 30.99 ? 1191 VAL A CG2   1 
ATOM   1761 N N     . LEU A 1 235 ? 36.504 36.006 34.869 1.00 34.12 ? 1192 LEU A N     1 
ATOM   1762 C CA    . LEU A 1 235 ? 35.866 37.206 35.388 1.00 35.32 ? 1192 LEU A CA    1 
ATOM   1763 C C     . LEU A 1 235 ? 35.866 38.311 34.332 1.00 35.55 ? 1192 LEU A C     1 
ATOM   1764 O O     . LEU A 1 235 ? 34.844 38.960 34.096 1.00 35.01 ? 1192 LEU A O     1 
ATOM   1765 C CB    . LEU A 1 235 ? 36.611 37.689 36.635 1.00 37.17 ? 1192 LEU A CB    1 
ATOM   1766 C CG    . LEU A 1 235 ? 35.805 37.887 37.923 1.00 39.16 ? 1192 LEU A CG    1 
ATOM   1767 C CD1   . LEU A 1 235 ? 34.719 38.927 37.692 1.00 40.74 ? 1192 LEU A CD1   1 
ATOM   1768 C CD2   . LEU A 1 235 ? 35.197 36.560 38.360 1.00 39.96 ? 1192 LEU A CD2   1 
ATOM   1769 N N     . ARG A 1 236 ? 37.015 38.515 33.695 1.00 35.01 ? 1193 ARG A N     1 
ATOM   1770 C CA    . ARG A 1 236 ? 37.152 39.549 32.673 1.00 35.31 ? 1193 ARG A CA    1 
ATOM   1771 C C     . ARG A 1 236 ? 36.423 39.194 31.383 1.00 33.90 ? 1193 ARG A C     1 
ATOM   1772 O O     . ARG A 1 236 ? 35.741 40.029 30.797 1.00 33.16 ? 1193 ARG A O     1 
ATOM   1773 C CB    . ARG A 1 236 ? 38.631 39.789 32.355 1.00 36.67 ? 1193 ARG A CB    1 
ATOM   1774 C CG    . ARG A 1 236 ? 39.470 40.165 33.560 1.00 39.06 ? 1193 ARG A CG    1 
ATOM   1775 C CD    . ARG A 1 236 ? 40.921 40.385 33.162 1.00 41.64 ? 1193 ARG A CD    1 
ATOM   1776 N NE    . ARG A 1 236 ? 41.783 40.580 34.323 1.00 43.71 ? 1193 ARG A NE    1 
ATOM   1777 C CZ    . ARG A 1 236 ? 43.059 40.946 34.250 1.00 45.34 ? 1193 ARG A CZ    1 
ATOM   1778 N NH1   . ARG A 1 236 ? 43.625 41.161 33.067 1.00 45.29 ? 1193 ARG A NH1   1 
ATOM   1779 N NH2   . ARG A 1 236 ? 43.770 41.093 35.360 1.00 46.07 ? 1193 ARG A NH2   1 
ATOM   1780 N N     . PHE A 1 237 ? 36.580 37.951 30.944 1.00 32.63 ? 1194 PHE A N     1 
ATOM   1781 C CA    . PHE A 1 237 ? 35.950 37.481 29.718 1.00 32.35 ? 1194 PHE A CA    1 
ATOM   1782 C C     . PHE A 1 237 ? 34.435 37.665 29.747 1.00 32.22 ? 1194 PHE A C     1 
ATOM   1783 O O     . PHE A 1 237 ? 33.846 38.211 28.809 1.00 31.58 ? 1194 PHE A O     1 
ATOM   1784 C CB    . PHE A 1 237 ? 36.273 35.999 29.500 1.00 31.66 ? 1194 PHE A CB    1 
ATOM   1785 C CG    . PHE A 1 237 ? 35.744 35.445 28.207 1.00 32.46 ? 1194 PHE A CG    1 
ATOM   1786 C CD1   . PHE A 1 237 ? 36.161 35.971 26.984 1.00 31.29 ? 1194 PHE A CD1   1 
ATOM   1787 C CD2   . PHE A 1 237 ? 34.834 34.392 28.209 1.00 31.60 ? 1194 PHE A CD2   1 
ATOM   1788 C CE1   . PHE A 1 237 ? 35.682 35.457 25.786 1.00 31.74 ? 1194 PHE A CE1   1 
ATOM   1789 C CE2   . PHE A 1 237 ? 34.346 33.869 27.015 1.00 31.40 ? 1194 PHE A CE2   1 
ATOM   1790 C CZ    . PHE A 1 237 ? 34.771 34.401 25.799 1.00 32.67 ? 1194 PHE A CZ    1 
ATOM   1791 N N     . VAL A 1 238 ? 33.811 37.208 30.827 1.00 31.38 ? 1195 VAL A N     1 
ATOM   1792 C CA    . VAL A 1 238 ? 32.360 37.295 30.967 1.00 31.01 ? 1195 VAL A CA    1 
ATOM   1793 C C     . VAL A 1 238 ? 31.830 38.713 31.175 1.00 31.46 ? 1195 VAL A C     1 
ATOM   1794 O O     . VAL A 1 238 ? 30.838 39.105 30.560 1.00 30.89 ? 1195 VAL A O     1 
ATOM   1795 C CB    . VAL A 1 238 ? 31.864 36.407 32.132 1.00 29.97 ? 1195 VAL A CB    1 
ATOM   1796 C CG1   . VAL A 1 238 ? 30.363 36.585 32.322 1.00 29.10 ? 1195 VAL A CG1   1 
ATOM   1797 C CG2   . VAL A 1 238 ? 32.178 34.949 31.837 1.00 28.84 ? 1195 VAL A CG2   1 
ATOM   1798 N N     . MET A 1 239 ? 32.485 39.480 32.037 1.00 32.36 ? 1196 MET A N     1 
ATOM   1799 C CA    . MET A 1 239 ? 32.037 40.837 32.302 1.00 34.20 ? 1196 MET A CA    1 
ATOM   1800 C C     . MET A 1 239 ? 32.186 41.746 31.092 1.00 34.32 ? 1196 MET A C     1 
ATOM   1801 O O     . MET A 1 239 ? 31.535 42.783 31.008 1.00 34.68 ? 1196 MET A O     1 
ATOM   1802 C CB    . MET A 1 239 ? 32.778 41.422 33.507 1.00 35.34 ? 1196 MET A CB    1 
ATOM   1803 C CG    . MET A 1 239 ? 32.141 41.045 34.836 1.00 36.88 ? 1196 MET A CG    1 
ATOM   1804 S SD    . MET A 1 239 ? 33.015 41.665 36.284 1.00 40.41 ? 1196 MET A SD    1 
ATOM   1805 C CE    . MET A 1 239 ? 32.869 43.439 36.046 1.00 41.79 ? 1196 MET A CE    1 
ATOM   1806 N N     . GLU A 1 240 ? 33.037 41.355 30.152 1.00 34.94 ? 1197 GLU A N     1 
ATOM   1807 C CA    . GLU A 1 240 ? 33.235 42.149 28.950 1.00 36.46 ? 1197 GLU A CA    1 
ATOM   1808 C C     . GLU A 1 240 ? 32.321 41.723 27.805 1.00 35.47 ? 1197 GLU A C     1 
ATOM   1809 O O     . GLU A 1 240 ? 32.364 42.305 26.727 1.00 35.30 ? 1197 GLU A O     1 
ATOM   1810 C CB    . GLU A 1 240 ? 34.697 42.088 28.508 1.00 38.52 ? 1197 GLU A CB    1 
ATOM   1811 C CG    . GLU A 1 240 ? 35.612 42.975 29.339 1.00 42.80 ? 1197 GLU A CG    1 
ATOM   1812 C CD    . GLU A 1 240 ? 37.069 42.857 28.933 1.00 45.45 ? 1197 GLU A CD    1 
ATOM   1813 O OE1   . GLU A 1 240 ? 37.362 42.972 27.723 1.00 48.18 ? 1197 GLU A OE1   1 
ATOM   1814 O OE2   . GLU A 1 240 ? 37.922 42.655 29.823 1.00 47.47 ? 1197 GLU A OE2   1 
ATOM   1815 N N     . GLY A 1 241 ? 31.490 40.710 28.038 1.00 34.57 ? 1198 GLY A N     1 
ATOM   1816 C CA    . GLY A 1 241 ? 30.573 40.267 26.999 1.00 32.04 ? 1198 GLY A CA    1 
ATOM   1817 C C     . GLY A 1 241 ? 30.889 38.938 26.339 1.00 31.11 ? 1198 GLY A C     1 
ATOM   1818 O O     . GLY A 1 241 ? 30.192 38.530 25.410 1.00 31.81 ? 1198 GLY A O     1 
ATOM   1819 N N     . GLY A 1 242 ? 31.930 38.258 26.809 1.00 29.92 ? 1199 GLY A N     1 
ATOM   1820 C CA    . GLY A 1 242 ? 32.290 36.972 26.232 1.00 29.02 ? 1199 GLY A CA    1 
ATOM   1821 C C     . GLY A 1 242 ? 31.331 35.869 26.644 1.00 28.59 ? 1199 GLY A C     1 
ATOM   1822 O O     . GLY A 1 242 ? 30.657 35.982 27.669 1.00 26.96 ? 1199 GLY A O     1 
ATOM   1823 N N     . LEU A 1 243 ? 31.276 34.804 25.845 1.00 29.10 ? 1200 LEU A N     1 
ATOM   1824 C CA    . LEU A 1 243 ? 30.391 33.667 26.107 1.00 29.42 ? 1200 LEU A CA    1 
ATOM   1825 C C     . LEU A 1 243 ? 31.074 32.332 25.829 1.00 30.27 ? 1200 LEU A C     1 
ATOM   1826 O O     . LEU A 1 243 ? 32.061 32.263 25.094 1.00 29.94 ? 1200 LEU A O     1 
ATOM   1827 C CB    . LEU A 1 243 ? 29.147 33.745 25.213 1.00 29.18 ? 1200 LEU A CB    1 
ATOM   1828 C CG    . LEU A 1 243 ? 28.255 34.985 25.288 1.00 29.96 ? 1200 LEU A CG    1 
ATOM   1829 C CD1   . LEU A 1 243 ? 27.207 34.918 24.190 1.00 29.66 ? 1200 LEU A CD1   1 
ATOM   1830 C CD2   . LEU A 1 243 ? 27.611 35.072 26.663 1.00 28.31 ? 1200 LEU A CD2   1 
ATOM   1831 N N     . LEU A 1 244 ? 30.536 31.272 26.420 1.00 30.53 ? 1201 LEU A N     1 
ATOM   1832 C CA    . LEU A 1 244 ? 31.054 29.926 26.195 1.00 31.33 ? 1201 LEU A CA    1 
ATOM   1833 C C     . LEU A 1 244 ? 30.753 29.609 24.731 1.00 33.51 ? 1201 LEU A C     1 
ATOM   1834 O O     . LEU A 1 244 ? 29.834 30.189 24.153 1.00 32.70 ? 1201 LEU A O     1 
ATOM   1835 C CB    . LEU A 1 244 ? 30.338 28.931 27.111 1.00 29.71 ? 1201 LEU A CB    1 
ATOM   1836 C CG    . LEU A 1 244 ? 30.666 29.073 28.598 1.00 27.86 ? 1201 LEU A CG    1 
ATOM   1837 C CD1   . LEU A 1 244 ? 29.534 28.518 29.447 1.00 27.69 ? 1201 LEU A CD1   1 
ATOM   1838 C CD2   . LEU A 1 244 ? 31.990 28.353 28.890 1.00 28.03 ? 1201 LEU A CD2   1 
ATOM   1839 N N     . ASP A 1 245 ? 31.516 28.699 24.128 1.00 36.00 ? 1202 ASP A N     1 
ATOM   1840 C CA    . ASP A 1 245 ? 31.299 28.360 22.725 1.00 37.82 ? 1202 ASP A CA    1 
ATOM   1841 C C     . ASP A 1 245 ? 30.035 27.544 22.476 1.00 38.71 ? 1202 ASP A C     1 
ATOM   1842 O O     . ASP A 1 245 ? 29.352 27.120 23.408 1.00 38.16 ? 1202 ASP A O     1 
ATOM   1843 C CB    . ASP A 1 245 ? 32.502 27.597 22.151 1.00 39.73 ? 1202 ASP A CB    1 
ATOM   1844 C CG    . ASP A 1 245 ? 32.713 26.238 22.812 1.00 42.66 ? 1202 ASP A CG    1 
ATOM   1845 O OD1   . ASP A 1 245 ? 31.734 25.650 23.324 1.00 43.54 ? 1202 ASP A OD1   1 
ATOM   1846 O OD2   . ASP A 1 245 ? 33.863 25.745 22.802 1.00 43.89 ? 1202 ASP A OD2   1 
ATOM   1847 N N     . LYS A 1 246 ? 29.735 27.334 21.200 1.00 39.24 ? 1203 LYS A N     1 
ATOM   1848 C CA    . LYS A 1 246 ? 28.577 26.556 20.798 1.00 40.74 ? 1203 LYS A CA    1 
ATOM   1849 C C     . LYS A 1 246 ? 29.048 25.111 20.680 1.00 41.02 ? 1203 LYS A C     1 
ATOM   1850 O O     . LYS A 1 246 ? 29.826 24.775 19.785 1.00 40.89 ? 1203 LYS A O     1 
ATOM   1851 C CB    . LYS A 1 246 ? 28.052 27.059 19.451 1.00 42.04 ? 1203 LYS A CB    1 
ATOM   1852 C CG    . LYS A 1 246 ? 27.666 28.535 19.458 1.00 43.47 ? 1203 LYS A CG    1 
ATOM   1853 C CD    . LYS A 1 246 ? 27.251 29.015 18.068 1.00 45.47 ? 1203 LYS A CD    1 
ATOM   1854 C CE    . LYS A 1 246 ? 26.832 30.483 18.099 1.00 46.18 ? 1203 LYS A CE    1 
ATOM   1855 N NZ    . LYS A 1 246 ? 26.525 31.024 16.738 1.00 47.55 ? 1203 LYS A NZ    1 
ATOM   1856 N N     . PRO A 1 247 ? 28.590 24.238 21.593 1.00 40.85 ? 1204 PRO A N     1 
ATOM   1857 C CA    . PRO A 1 247 ? 28.983 22.827 21.576 1.00 41.16 ? 1204 PRO A CA    1 
ATOM   1858 C C     . PRO A 1 247 ? 28.721 22.185 20.220 1.00 42.18 ? 1204 PRO A C     1 
ATOM   1859 O O     . PRO A 1 247 ? 27.693 22.440 19.591 1.00 41.48 ? 1204 PRO A O     1 
ATOM   1860 C CB    . PRO A 1 247 ? 28.114 22.216 22.674 1.00 41.00 ? 1204 PRO A CB    1 
ATOM   1861 C CG    . PRO A 1 247 ? 27.901 23.360 23.620 1.00 40.26 ? 1204 PRO A CG    1 
ATOM   1862 C CD    . PRO A 1 247 ? 27.618 24.493 22.669 1.00 39.94 ? 1204 PRO A CD    1 
ATOM   1863 N N     . ASP A 1 248 ? 29.651 21.352 19.773 1.00 43.81 ? 1205 ASP A N     1 
ATOM   1864 C CA    . ASP A 1 248 ? 29.497 20.672 18.496 1.00 46.22 ? 1205 ASP A CA    1 
ATOM   1865 C C     . ASP A 1 248 ? 28.286 19.750 18.526 1.00 46.55 ? 1205 ASP A C     1 
ATOM   1866 O O     . ASP A 1 248 ? 28.021 19.091 19.532 1.00 47.44 ? 1205 ASP A O     1 
ATOM   1867 C CB    . ASP A 1 248 ? 30.755 19.863 18.171 1.00 48.03 ? 1205 ASP A CB    1 
ATOM   1868 C CG    . ASP A 1 248 ? 31.937 20.742 17.806 1.00 49.94 ? 1205 ASP A CG    1 
ATOM   1869 O OD1   . ASP A 1 248 ? 31.861 21.438 16.769 1.00 51.31 ? 1205 ASP A OD1   1 
ATOM   1870 O OD2   . ASP A 1 248 ? 32.939 20.742 18.553 1.00 51.46 ? 1205 ASP A OD2   1 
ATOM   1871 N N     . ASN A 1 249 ? 27.551 19.713 17.422 1.00 46.56 ? 1206 ASN A N     1 
ATOM   1872 C CA    . ASN A 1 249 ? 26.375 18.859 17.307 1.00 47.20 ? 1206 ASN A CA    1 
ATOM   1873 C C     . ASN A 1 249 ? 25.323 19.103 18.387 1.00 46.57 ? 1206 ASN A C     1 
ATOM   1874 O O     . ASN A 1 249 ? 24.619 18.179 18.791 1.00 47.30 ? 1206 ASN A O     1 
ATOM   1875 C CB    . ASN A 1 249 ? 26.801 17.389 17.343 1.00 48.65 ? 1206 ASN A CB    1 
ATOM   1876 C CG    . ASN A 1 249 ? 27.840 17.058 16.288 1.00 50.01 ? 1206 ASN A CG    1 
ATOM   1877 O OD1   . ASN A 1 249 ? 28.431 15.977 16.302 1.00 51.30 ? 1206 ASN A OD1   1 
ATOM   1878 N ND2   . ASN A 1 249 ? 28.066 17.987 15.364 1.00 50.10 ? 1206 ASN A ND2   1 
ATOM   1879 N N     . CYS A 1 250 ? 25.214 20.340 18.857 1.00 45.44 ? 1207 CYS A N     1 
ATOM   1880 C CA    . CYS A 1 250 ? 24.226 20.665 19.879 1.00 43.21 ? 1207 CYS A CA    1 
ATOM   1881 C C     . CYS A 1 250 ? 22.892 20.998 19.212 1.00 42.07 ? 1207 CYS A C     1 
ATOM   1882 O O     . CYS A 1 250 ? 22.852 21.667 18.182 1.00 41.48 ? 1207 CYS A O     1 
ATOM   1883 C CB    . CYS A 1 250 ? 24.695 21.864 20.711 1.00 42.90 ? 1207 CYS A CB    1 
ATOM   1884 S SG    . CYS A 1 250 ? 23.540 22.385 22.012 1.00 40.80 ? 1207 CYS A SG    1 
ATOM   1885 N N     . PRO A 1 251 ? 21.782 20.515 19.785 1.00 41.16 ? 1208 PRO A N     1 
ATOM   1886 C CA    . PRO A 1 251 ? 20.445 20.772 19.240 1.00 40.17 ? 1208 PRO A CA    1 
ATOM   1887 C C     . PRO A 1 251 ? 20.184 22.275 19.118 1.00 39.10 ? 1208 PRO A C     1 
ATOM   1888 O O     . PRO A 1 251 ? 20.482 23.033 20.041 1.00 38.01 ? 1208 PRO A O     1 
ATOM   1889 C CB    . PRO A 1 251 ? 19.530 20.115 20.267 1.00 41.04 ? 1208 PRO A CB    1 
ATOM   1890 C CG    . PRO A 1 251 ? 20.353 18.945 20.732 1.00 41.37 ? 1208 PRO A CG    1 
ATOM   1891 C CD    . PRO A 1 251 ? 21.718 19.569 20.913 1.00 41.67 ? 1208 PRO A CD    1 
ATOM   1892 N N     . ASP A 1 252 ? 19.631 22.701 17.984 1.00 38.15 ? 1209 ASP A N     1 
ATOM   1893 C CA    . ASP A 1 252 ? 19.348 24.118 17.764 1.00 37.21 ? 1209 ASP A CA    1 
ATOM   1894 C C     . ASP A 1 252 ? 18.560 24.777 18.889 1.00 35.77 ? 1209 ASP A C     1 
ATOM   1895 O O     . ASP A 1 252 ? 18.852 25.911 19.260 1.00 35.30 ? 1209 ASP A O     1 
ATOM   1896 C CB    . ASP A 1 252 ? 18.603 24.330 16.440 1.00 37.83 ? 1209 ASP A CB    1 
ATOM   1897 C CG    . ASP A 1 252 ? 19.509 24.181 15.233 1.00 39.14 ? 1209 ASP A CG    1 
ATOM   1898 O OD1   . ASP A 1 252 ? 20.738 24.316 15.397 1.00 41.17 ? 1209 ASP A OD1   1 
ATOM   1899 O OD2   . ASP A 1 252 ? 18.997 23.946 14.120 1.00 40.41 ? 1209 ASP A OD2   1 
ATOM   1900 N N     . MET A 1 253 ? 17.564 24.081 19.432 1.00 34.61 ? 1210 MET A N     1 
ATOM   1901 C CA    . MET A 1 253 ? 16.761 24.656 20.511 1.00 34.65 ? 1210 MET A CA    1 
ATOM   1902 C C     . MET A 1 253 ? 17.595 24.988 21.744 1.00 33.41 ? 1210 MET A C     1 
ATOM   1903 O O     . MET A 1 253 ? 17.330 25.973 22.435 1.00 32.22 ? 1210 MET A O     1 
ATOM   1904 C CB    . MET A 1 253 ? 15.622 23.715 20.912 1.00 36.25 ? 1210 MET A CB    1 
ATOM   1905 C CG    . MET A 1 253 ? 14.504 23.622 19.892 1.00 39.39 ? 1210 MET A CG    1 
ATOM   1906 S SD    . MET A 1 253 ? 13.065 22.747 20.541 1.00 43.20 ? 1210 MET A SD    1 
ATOM   1907 C CE    . MET A 1 253 ? 11.969 24.119 20.947 1.00 42.21 ? 1210 MET A CE    1 
ATOM   1908 N N     . LEU A 1 254 ? 18.601 24.169 22.023 1.00 32.23 ? 1211 LEU A N     1 
ATOM   1909 C CA    . LEU A 1 254 ? 19.454 24.420 23.177 1.00 32.42 ? 1211 LEU A CA    1 
ATOM   1910 C C     . LEU A 1 254 ? 20.426 25.565 22.897 1.00 31.06 ? 1211 LEU A C     1 
ATOM   1911 O O     . LEU A 1 254 ? 20.749 26.340 23.793 1.00 30.39 ? 1211 LEU A O     1 
ATOM   1912 C CB    . LEU A 1 254 ? 20.208 23.145 23.568 1.00 33.87 ? 1211 LEU A CB    1 
ATOM   1913 C CG    . LEU A 1 254 ? 19.297 22.014 24.059 1.00 35.27 ? 1211 LEU A CG    1 
ATOM   1914 C CD1   . LEU A 1 254 ? 20.142 20.834 24.497 1.00 36.95 ? 1211 LEU A CD1   1 
ATOM   1915 C CD2   . LEU A 1 254 ? 18.440 22.499 25.214 1.00 34.89 ? 1211 LEU A CD2   1 
ATOM   1916 N N     . LEU A 1 255 ? 20.891 25.681 21.657 1.00 30.08 ? 1212 LEU A N     1 
ATOM   1917 C CA    . LEU A 1 255 ? 21.794 26.776 21.311 1.00 29.34 ? 1212 LEU A CA    1 
ATOM   1918 C C     . LEU A 1 255 ? 21.034 28.089 21.465 1.00 28.41 ? 1212 LEU A C     1 
ATOM   1919 O O     . LEU A 1 255 ? 21.568 29.073 21.978 1.00 27.96 ? 1212 LEU A O     1 
ATOM   1920 C CB    . LEU A 1 255 ? 22.290 26.640 19.866 1.00 30.52 ? 1212 LEU A CB    1 
ATOM   1921 C CG    . LEU A 1 255 ? 23.305 25.528 19.578 1.00 32.56 ? 1212 LEU A CG    1 
ATOM   1922 C CD1   . LEU A 1 255 ? 23.548 25.417 18.080 1.00 31.88 ? 1212 LEU A CD1   1 
ATOM   1923 C CD2   . LEU A 1 255 ? 24.609 25.825 20.313 1.00 31.93 ? 1212 LEU A CD2   1 
ATOM   1924 N N     . GLU A 1 256 ? 19.779 28.094 21.019 1.00 27.36 ? 1213 GLU A N     1 
ATOM   1925 C CA    . GLU A 1 256 ? 18.944 29.288 21.099 1.00 26.61 ? 1213 GLU A CA    1 
ATOM   1926 C C     . GLU A 1 256 ? 18.624 29.621 22.554 1.00 25.99 ? 1213 GLU A C     1 
ATOM   1927 O O     . GLU A 1 256 ? 18.670 30.782 22.947 1.00 26.32 ? 1213 GLU A O     1 
ATOM   1928 C CB    . GLU A 1 256 ? 17.659 29.081 20.286 1.00 25.91 ? 1213 GLU A CB    1 
ATOM   1929 C CG    . GLU A 1 256 ? 16.638 30.210 20.361 1.00 25.41 ? 1213 GLU A CG    1 
ATOM   1930 C CD    . GLU A 1 256 ? 17.186 31.577 19.965 1.00 26.64 ? 1213 GLU A CD    1 
ATOM   1931 O OE1   . GLU A 1 256 ? 18.334 31.674 19.475 1.00 25.47 ? 1213 GLU A OE1   1 
ATOM   1932 O OE2   . GLU A 1 256 ? 16.449 32.568 20.144 1.00 25.53 ? 1213 GLU A OE2   1 
ATOM   1933 N N     . LEU A 1 257 ? 18.301 28.607 23.352 1.00 25.84 ? 1214 LEU A N     1 
ATOM   1934 C CA    . LEU A 1 257 ? 18.008 28.832 24.768 1.00 24.94 ? 1214 LEU A CA    1 
ATOM   1935 C C     . LEU A 1 257 ? 19.241 29.441 25.431 1.00 24.53 ? 1214 LEU A C     1 
ATOM   1936 O O     . LEU A 1 257 ? 19.137 30.376 26.232 1.00 23.74 ? 1214 LEU A O     1 
ATOM   1937 C CB    . LEU A 1 257 ? 17.632 27.516 25.467 1.00 24.02 ? 1214 LEU A CB    1 
ATOM   1938 C CG    . LEU A 1 257 ? 16.222 26.992 25.184 1.00 26.60 ? 1214 LEU A CG    1 
ATOM   1939 C CD1   . LEU A 1 257 ? 15.978 25.709 25.965 1.00 26.30 ? 1214 LEU A CD1   1 
ATOM   1940 C CD2   . LEU A 1 257 ? 15.192 28.050 25.575 1.00 25.76 ? 1214 LEU A CD2   1 
ATOM   1941 N N     . MET A 1 258 ? 20.412 28.910 25.093 1.00 24.05 ? 1215 MET A N     1 
ATOM   1942 C CA    . MET A 1 258 ? 21.649 29.437 25.651 1.00 25.08 ? 1215 MET A CA    1 
ATOM   1943 C C     . MET A 1 258 ? 21.785 30.904 25.277 1.00 24.95 ? 1215 MET A C     1 
ATOM   1944 O O     . MET A 1 258 ? 22.050 31.744 26.134 1.00 24.69 ? 1215 MET A O     1 
ATOM   1945 C CB    . MET A 1 258 ? 22.861 28.650 25.137 1.00 26.28 ? 1215 MET A CB    1 
ATOM   1946 C CG    . MET A 1 258 ? 23.079 27.318 25.845 1.00 26.95 ? 1215 MET A CG    1 
ATOM   1947 S SD    . MET A 1 258 ? 24.641 26.512 25.393 1.00 28.82 ? 1215 MET A SD    1 
ATOM   1948 C CE    . MET A 1 258 ? 24.066 25.184 24.368 1.00 25.56 ? 1215 MET A CE    1 
ATOM   1949 N N     . ARG A 1 259 ? 21.599 31.211 23.993 1.00 25.68 ? 1216 ARG A N     1 
ATOM   1950 C CA    . ARG A 1 259 ? 21.696 32.587 23.520 1.00 25.60 ? 1216 ARG A CA    1 
ATOM   1951 C C     . ARG A 1 259 ? 20.780 33.496 24.336 1.00 25.17 ? 1216 ARG A C     1 
ATOM   1952 O O     . ARG A 1 259 ? 21.164 34.603 24.714 1.00 24.03 ? 1216 ARG A O     1 
ATOM   1953 C CB    . ARG A 1 259 ? 21.304 32.685 22.038 1.00 26.08 ? 1216 ARG A CB    1 
ATOM   1954 C CG    . ARG A 1 259 ? 21.494 34.092 21.456 1.00 28.88 ? 1216 ARG A CG    1 
ATOM   1955 C CD    . ARG A 1 259 ? 20.999 34.207 20.012 1.00 27.63 ? 1216 ARG A CD    1 
ATOM   1956 N NE    . ARG A 1 259 ? 19.544 34.192 19.938 1.00 29.46 ? 1216 ARG A NE    1 
ATOM   1957 C CZ    . ARG A 1 259 ? 18.765 35.208 20.286 1.00 30.06 ? 1216 ARG A CZ    1 
ATOM   1958 N NH1   . ARG A 1 259 ? 19.296 36.340 20.728 1.00 32.37 ? 1216 ARG A NH1   1 
ATOM   1959 N NH2   . ARG A 1 259 ? 17.448 35.090 20.204 1.00 31.76 ? 1216 ARG A NH2   1 
ATOM   1960 N N     . MET A 1 260 ? 19.566 33.017 24.596 1.00 24.62 ? 1217 MET A N     1 
ATOM   1961 C CA    . MET A 1 260 ? 18.575 33.772 25.356 1.00 24.56 ? 1217 MET A CA    1 
ATOM   1962 C C     . MET A 1 260 ? 18.991 33.937 26.820 1.00 23.69 ? 1217 MET A C     1 
ATOM   1963 O O     . MET A 1 260 ? 18.897 35.033 27.375 1.00 23.64 ? 1217 MET A O     1 
ATOM   1964 C CB    . MET A 1 260 ? 17.206 33.069 25.291 1.00 26.04 ? 1217 MET A CB    1 
ATOM   1965 C CG    . MET A 1 260 ? 16.579 32.968 23.890 1.00 28.51 ? 1217 MET A CG    1 
ATOM   1966 S SD    . MET A 1 260 ? 15.232 31.725 23.766 1.00 33.04 ? 1217 MET A SD    1 
ATOM   1967 C CE    . MET A 1 260 ? 13.860 32.567 24.621 1.00 32.84 ? 1217 MET A CE    1 
ATOM   1968 N N     . CYS A 1 261 ? 19.446 32.850 27.442 1.00 23.38 ? 1218 CYS A N     1 
ATOM   1969 C CA    . CYS A 1 261 ? 19.858 32.891 28.849 1.00 23.43 ? 1218 CYS A CA    1 
ATOM   1970 C C     . CYS A 1 261 ? 21.089 33.743 29.071 1.00 23.69 ? 1218 CYS A C     1 
ATOM   1971 O O     . CYS A 1 261 ? 21.308 34.250 30.176 1.00 22.98 ? 1218 CYS A O     1 
ATOM   1972 C CB    . CYS A 1 261 ? 20.137 31.480 29.382 1.00 23.54 ? 1218 CYS A CB    1 
ATOM   1973 S SG    . CYS A 1 261 ? 18.684 30.420 29.454 1.00 25.79 ? 1218 CYS A SG    1 
ATOM   1974 N N     . TRP A 1 262 ? 21.894 33.902 28.023 1.00 23.19 ? 1219 TRP A N     1 
ATOM   1975 C CA    . TRP A 1 262 ? 23.114 34.684 28.143 1.00 23.68 ? 1219 TRP A CA    1 
ATOM   1976 C C     . TRP A 1 262 ? 23.045 36.110 27.598 1.00 24.33 ? 1219 TRP A C     1 
ATOM   1977 O O     . TRP A 1 262 ? 24.054 36.659 27.152 1.00 23.35 ? 1219 TRP A O     1 
ATOM   1978 C CB    . TRP A 1 262 ? 24.288 33.947 27.499 1.00 22.27 ? 1219 TRP A CB    1 
ATOM   1979 C CG    . TRP A 1 262 ? 24.613 32.640 28.160 1.00 22.76 ? 1219 TRP A CG    1 
ATOM   1980 C CD1   . TRP A 1 262 ? 24.380 32.297 29.463 1.00 22.68 ? 1219 TRP A CD1   1 
ATOM   1981 C CD2   . TRP A 1 262 ? 25.258 31.514 27.556 1.00 23.13 ? 1219 TRP A CD2   1 
ATOM   1982 N NE1   . TRP A 1 262 ? 24.838 31.021 29.706 1.00 23.55 ? 1219 TRP A NE1   1 
ATOM   1983 C CE2   . TRP A 1 262 ? 25.383 30.519 28.553 1.00 24.41 ? 1219 TRP A CE2   1 
ATOM   1984 C CE3   . TRP A 1 262 ? 25.746 31.248 26.268 1.00 23.54 ? 1219 TRP A CE3   1 
ATOM   1985 C CZ2   . TRP A 1 262 ? 25.975 29.274 28.300 1.00 24.69 ? 1219 TRP A CZ2   1 
ATOM   1986 C CZ3   . TRP A 1 262 ? 26.336 30.007 26.017 1.00 25.12 ? 1219 TRP A CZ3   1 
ATOM   1987 C CH2   . TRP A 1 262 ? 26.443 29.037 27.033 1.00 23.61 ? 1219 TRP A CH2   1 
ATOM   1988 N N     . GLN A 1 263 ? 21.859 36.705 27.631 1.00 25.40 ? 1220 GLN A N     1 
ATOM   1989 C CA    . GLN A 1 263 ? 21.711 38.095 27.199 1.00 25.57 ? 1220 GLN A CA    1 
ATOM   1990 C C     . GLN A 1 263 ? 22.449 38.898 28.266 1.00 26.10 ? 1220 GLN A C     1 
ATOM   1991 O O     . GLN A 1 263 ? 22.258 38.658 29.458 1.00 26.80 ? 1220 GLN A O     1 
ATOM   1992 C CB    . GLN A 1 263 ? 20.231 38.483 27.168 1.00 24.03 ? 1220 GLN A CB    1 
ATOM   1993 C CG    . GLN A 1 263 ? 19.490 37.916 25.974 1.00 23.69 ? 1220 GLN A CG    1 
ATOM   1994 C CD    . GLN A 1 263 ? 20.011 38.486 24.672 1.00 26.12 ? 1220 GLN A CD    1 
ATOM   1995 O OE1   . GLN A 1 263 ? 19.894 39.689 24.421 1.00 25.83 ? 1220 GLN A OE1   1 
ATOM   1996 N NE2   . GLN A 1 263 ? 20.612 37.632 23.842 1.00 25.90 ? 1220 GLN A NE2   1 
ATOM   1997 N N     . TYR A 1 264 ? 23.293 39.841 27.860 1.00 26.78 ? 1221 TYR A N     1 
ATOM   1998 C CA    . TYR A 1 264 ? 24.043 40.623 28.841 1.00 27.48 ? 1221 TYR A CA    1 
ATOM   1999 C C     . TYR A 1 264 ? 23.094 41.393 29.760 1.00 27.89 ? 1221 TYR A C     1 
ATOM   2000 O O     . TYR A 1 264 ? 23.331 41.534 30.960 1.00 27.30 ? 1221 TYR A O     1 
ATOM   2001 C CB    . TYR A 1 264 ? 24.981 41.604 28.137 1.00 27.98 ? 1221 TYR A CB    1 
ATOM   2002 C CG    . TYR A 1 264 ? 26.073 42.125 29.037 1.00 28.11 ? 1221 TYR A CG    1 
ATOM   2003 C CD1   . TYR A 1 264 ? 27.231 41.381 29.259 1.00 28.75 ? 1221 TYR A CD1   1 
ATOM   2004 C CD2   . TYR A 1 264 ? 25.941 43.350 29.689 1.00 29.08 ? 1221 TYR A CD2   1 
ATOM   2005 C CE1   . TYR A 1 264 ? 28.233 41.842 30.109 1.00 29.67 ? 1221 TYR A CE1   1 
ATOM   2006 C CE2   . TYR A 1 264 ? 26.936 43.821 30.542 1.00 30.30 ? 1221 TYR A CE2   1 
ATOM   2007 C CZ    . TYR A 1 264 ? 28.080 43.062 30.747 1.00 30.27 ? 1221 TYR A CZ    1 
ATOM   2008 O OH    . TYR A 1 264 ? 29.065 43.519 31.590 1.00 31.23 ? 1221 TYR A OH    1 
ATOM   2009 N N     . ASN A 1 265 ? 22.014 41.893 29.176 1.00 28.43 ? 1222 ASN A N     1 
ATOM   2010 C CA    . ASN A 1 265 ? 21.017 42.652 29.916 1.00 28.57 ? 1222 ASN A CA    1 
ATOM   2011 C C     . ASN A 1 265 ? 20.092 41.634 30.576 1.00 28.81 ? 1222 ASN A C     1 
ATOM   2012 O O     . ASN A 1 265 ? 19.325 40.958 29.897 1.00 28.32 ? 1222 ASN A O     1 
ATOM   2013 C CB    . ASN A 1 265 ? 20.247 43.540 28.936 1.00 29.64 ? 1222 ASN A CB    1 
ATOM   2014 C CG    . ASN A 1 265 ? 19.158 44.346 29.600 1.00 30.31 ? 1222 ASN A CG    1 
ATOM   2015 O OD1   . ASN A 1 265 ? 18.490 45.156 28.947 1.00 33.54 ? 1222 ASN A OD1   1 
ATOM   2016 N ND2   . ASN A 1 265 ? 18.964 44.137 30.893 1.00 28.43 ? 1222 ASN A ND2   1 
ATOM   2017 N N     . PRO A 1 266 ? 20.149 41.517 31.913 1.00 29.24 ? 1223 PRO A N     1 
ATOM   2018 C CA    . PRO A 1 266 ? 19.291 40.547 32.596 1.00 29.21 ? 1223 PRO A CA    1 
ATOM   2019 C C     . PRO A 1 266 ? 17.822 40.617 32.226 1.00 29.78 ? 1223 PRO A C     1 
ATOM   2020 O O     . PRO A 1 266 ? 17.145 39.588 32.170 1.00 27.87 ? 1223 PRO A O     1 
ATOM   2021 C CB    . PRO A 1 266 ? 19.546 40.835 34.077 1.00 29.91 ? 1223 PRO A CB    1 
ATOM   2022 C CG    . PRO A 1 266 ? 19.979 42.264 34.087 1.00 30.06 ? 1223 PRO A CG    1 
ATOM   2023 C CD    . PRO A 1 266 ? 20.875 42.346 32.887 1.00 29.18 ? 1223 PRO A CD    1 
ATOM   2024 N N     . LYS A 1 267 ? 17.336 41.830 31.969 1.00 29.51 ? 1224 LYS A N     1 
ATOM   2025 C CA    . LYS A 1 267 ? 15.940 42.032 31.620 1.00 30.12 ? 1224 LYS A CA    1 
ATOM   2026 C C     . LYS A 1 267 ? 15.603 41.442 30.253 1.00 30.43 ? 1224 LYS A C     1 
ATOM   2027 O O     . LYS A 1 267 ? 14.431 41.276 29.920 1.00 31.09 ? 1224 LYS A O     1 
ATOM   2028 C CB    . LYS A 1 267 ? 15.604 43.530 31.640 1.00 30.51 ? 1224 LYS A CB    1 
ATOM   2029 N N     . MET A 1 268 ? 16.629 41.127 29.464 1.00 29.86 ? 1225 MET A N     1 
ATOM   2030 C CA    . MET A 1 268 ? 16.418 40.550 28.139 1.00 29.89 ? 1225 MET A CA    1 
ATOM   2031 C C     . MET A 1 268 ? 16.343 39.027 28.192 1.00 29.07 ? 1225 MET A C     1 
ATOM   2032 O O     . MET A 1 268 ? 15.973 38.378 27.217 1.00 28.07 ? 1225 MET A O     1 
ATOM   2033 C CB    . MET A 1 268 ? 17.542 40.972 27.189 1.00 31.78 ? 1225 MET A CB    1 
ATOM   2034 C CG    . MET A 1 268 ? 17.511 42.441 26.790 1.00 34.00 ? 1225 MET A CG    1 
ATOM   2035 S SD    . MET A 1 268 ? 16.076 42.830 25.774 1.00 39.69 ? 1225 MET A SD    1 
ATOM   2036 C CE    . MET A 1 268 ? 15.115 43.856 26.901 1.00 38.38 ? 1225 MET A CE    1 
ATOM   2037 N N     . ARG A 1 269 ? 16.698 38.453 29.332 1.00 27.36 ? 1226 ARG A N     1 
ATOM   2038 C CA    . ARG A 1 269 ? 16.657 37.005 29.469 1.00 25.66 ? 1226 ARG A CA    1 
ATOM   2039 C C     . ARG A 1 269 ? 15.236 36.527 29.695 1.00 25.25 ? 1226 ARG A C     1 
ATOM   2040 O O     . ARG A 1 269 ? 14.404 37.254 30.228 1.00 25.75 ? 1226 ARG A O     1 
ATOM   2041 C CB    . ARG A 1 269 ? 17.533 36.557 30.638 1.00 24.15 ? 1226 ARG A CB    1 
ATOM   2042 C CG    . ARG A 1 269 ? 18.999 36.898 30.461 1.00 21.97 ? 1226 ARG A CG    1 
ATOM   2043 C CD    . ARG A 1 269 ? 19.819 36.607 31.714 1.00 21.87 ? 1226 ARG A CD    1 
ATOM   2044 N NE    . ARG A 1 269 ? 21.045 37.396 31.690 1.00 21.18 ? 1226 ARG A NE    1 
ATOM   2045 C CZ    . ARG A 1 269 ? 21.680 37.841 32.771 1.00 21.83 ? 1226 ARG A CZ    1 
ATOM   2046 N NH1   . ARG A 1 269 ? 21.218 37.567 33.989 1.00 20.36 ? 1226 ARG A NH1   1 
ATOM   2047 N NH2   . ARG A 1 269 ? 22.748 38.615 32.627 1.00 22.05 ? 1226 ARG A NH2   1 
ATOM   2048 N N     . PRO A 1 270 ? 14.932 35.293 29.275 1.00 25.03 ? 1227 PRO A N     1 
ATOM   2049 C CA    . PRO A 1 270 ? 13.586 34.752 29.466 1.00 24.47 ? 1227 PRO A CA    1 
ATOM   2050 C C     . PRO A 1 270 ? 13.457 34.295 30.916 1.00 25.04 ? 1227 PRO A C     1 
ATOM   2051 O O     . PRO A 1 270 ? 14.459 34.168 31.621 1.00 24.30 ? 1227 PRO A O     1 
ATOM   2052 C CB    . PRO A 1 270 ? 13.557 33.574 28.502 1.00 24.69 ? 1227 PRO A CB    1 
ATOM   2053 C CG    . PRO A 1 270 ? 14.977 33.053 28.603 1.00 23.19 ? 1227 PRO A CG    1 
ATOM   2054 C CD    . PRO A 1 270 ? 15.775 34.351 28.517 1.00 23.48 ? 1227 PRO A CD    1 
ATOM   2055 N N     . SER A 1 271 ? 12.225 34.056 31.355 1.00 24.28 ? 1228 SER A N     1 
ATOM   2056 C CA    . SER A 1 271 ? 11.971 33.569 32.709 1.00 23.53 ? 1228 SER A CA    1 
ATOM   2057 C C     . SER A 1 271 ? 11.936 32.060 32.553 1.00 22.77 ? 1228 SER A C     1 
ATOM   2058 O O     . SER A 1 271 ? 11.834 31.559 31.432 1.00 23.50 ? 1228 SER A O     1 
ATOM   2059 C CB    . SER A 1 271 ? 10.603 34.044 33.198 1.00 23.34 ? 1228 SER A CB    1 
ATOM   2060 O OG    . SER A 1 271 ? 9.590  33.413 32.437 1.00 24.24 ? 1228 SER A OG    1 
ATOM   2061 N N     . PHE A 1 272 ? 12.015 31.321 33.654 1.00 22.08 ? 1229 PHE A N     1 
ATOM   2062 C CA    . PHE A 1 272 ? 11.975 29.872 33.539 1.00 21.69 ? 1229 PHE A CA    1 
ATOM   2063 C C     . PHE A 1 272 ? 10.647 29.409 32.942 1.00 22.19 ? 1229 PHE A C     1 
ATOM   2064 O O     . PHE A 1 272 ? 10.597 28.414 32.206 1.00 20.79 ? 1229 PHE A O     1 
ATOM   2065 C CB    . PHE A 1 272 ? 12.249 29.225 34.900 1.00 20.85 ? 1229 PHE A CB    1 
ATOM   2066 C CG    . PHE A 1 272 ? 13.712 29.219 35.269 1.00 19.61 ? 1229 PHE A CG    1 
ATOM   2067 C CD1   . PHE A 1 272 ? 14.620 28.477 34.523 1.00 18.45 ? 1229 PHE A CD1   1 
ATOM   2068 C CD2   . PHE A 1 272 ? 14.184 29.970 36.341 1.00 20.35 ? 1229 PHE A CD2   1 
ATOM   2069 C CE1   . PHE A 1 272 ? 15.972 28.482 34.834 1.00 18.37 ? 1229 PHE A CE1   1 
ATOM   2070 C CE2   . PHE A 1 272 ? 15.540 29.980 36.662 1.00 19.26 ? 1229 PHE A CE2   1 
ATOM   2071 C CZ    . PHE A 1 272 ? 16.437 29.235 35.907 1.00 17.48 ? 1229 PHE A CZ    1 
ATOM   2072 N N     . LEU A 1 273 ? 9.572  30.131 33.247 1.00 23.62 ? 1230 LEU A N     1 
ATOM   2073 C CA    . LEU A 1 273 ? 8.269  29.785 32.686 1.00 24.61 ? 1230 LEU A CA    1 
ATOM   2074 C C     . LEU A 1 273 ? 8.312  29.981 31.172 1.00 24.68 ? 1230 LEU A C     1 
ATOM   2075 O O     . LEU A 1 273 ? 7.830  29.138 30.421 1.00 25.74 ? 1230 LEU A O     1 
ATOM   2076 C CB    . LEU A 1 273 ? 7.165  30.653 33.297 1.00 24.86 ? 1230 LEU A CB    1 
ATOM   2077 C CG    . LEU A 1 273 ? 6.873  30.359 34.769 1.00 24.52 ? 1230 LEU A CG    1 
ATOM   2078 C CD1   . LEU A 1 273 ? 5.808  31.330 35.291 1.00 26.64 ? 1230 LEU A CD1   1 
ATOM   2079 C CD2   . LEU A 1 273 ? 6.411  28.909 34.911 1.00 25.36 ? 1230 LEU A CD2   1 
ATOM   2080 N N     . GLU A 1 274 ? 8.889  31.089 30.721 1.00 25.85 ? 1231 GLU A N     1 
ATOM   2081 C CA    . GLU A 1 274 ? 8.992  31.342 29.283 1.00 26.93 ? 1231 GLU A CA    1 
ATOM   2082 C C     . GLU A 1 274 ? 9.856  30.265 28.624 1.00 26.75 ? 1231 GLU A C     1 
ATOM   2083 O O     . GLU A 1 274 ? 9.584  29.836 27.499 1.00 27.76 ? 1231 GLU A O     1 
ATOM   2084 C CB    . GLU A 1 274 ? 9.579  32.734 29.020 1.00 28.66 ? 1231 GLU A CB    1 
ATOM   2085 C CG    . GLU A 1 274 ? 8.700  33.861 29.559 1.00 32.64 ? 1231 GLU A CG    1 
ATOM   2086 C CD    . GLU A 1 274 ? 9.271  35.248 29.309 1.00 33.20 ? 1231 GLU A CD    1 
ATOM   2087 O OE1   . GLU A 1 274 ? 10.496 35.436 29.461 1.00 33.48 ? 1231 GLU A OE1   1 
ATOM   2088 O OE2   . GLU A 1 274 ? 8.486  36.161 28.976 1.00 36.08 ? 1231 GLU A OE2   1 
ATOM   2089 N N     . ILE A 1 275 ? 10.894 29.820 29.327 1.00 25.89 ? 1232 ILE A N     1 
ATOM   2090 C CA    . ILE A 1 275 ? 11.771 28.780 28.796 1.00 23.97 ? 1232 ILE A CA    1 
ATOM   2091 C C     . ILE A 1 275 ? 10.991 27.480 28.605 1.00 24.30 ? 1232 ILE A C     1 
ATOM   2092 O O     . ILE A 1 275 ? 11.063 26.843 27.554 1.00 22.92 ? 1232 ILE A O     1 
ATOM   2093 C CB    . ILE A 1 275 ? 12.967 28.526 29.746 1.00 23.67 ? 1232 ILE A CB    1 
ATOM   2094 C CG1   . ILE A 1 275 ? 13.957 29.697 29.647 1.00 23.41 ? 1232 ILE A CG1   1 
ATOM   2095 C CG2   . ILE A 1 275 ? 13.626 27.197 29.403 1.00 21.51 ? 1232 ILE A CG2   1 
ATOM   2096 C CD1   . ILE A 1 275 ? 15.007 29.734 30.739 1.00 23.55 ? 1232 ILE A CD1   1 
ATOM   2097 N N     . ILE A 1 276 ? 10.245 27.091 29.630 1.00 25.00 ? 1233 ILE A N     1 
ATOM   2098 C CA    . ILE A 1 276 ? 9.450  25.871 29.578 1.00 26.21 ? 1233 ILE A CA    1 
ATOM   2099 C C     . ILE A 1 276 ? 8.410  25.974 28.466 1.00 27.62 ? 1233 ILE A C     1 
ATOM   2100 O O     . ILE A 1 276 ? 8.208  25.039 27.689 1.00 27.64 ? 1233 ILE A O     1 
ATOM   2101 C CB    . ILE A 1 276 ? 8.735  25.626 30.928 1.00 26.36 ? 1233 ILE A CB    1 
ATOM   2102 C CG1   . ILE A 1 276 ? 9.777  25.322 32.009 1.00 25.34 ? 1233 ILE A CG1   1 
ATOM   2103 C CG2   . ILE A 1 276 ? 7.738  24.467 30.799 1.00 25.70 ? 1233 ILE A CG2   1 
ATOM   2104 C CD1   . ILE A 1 276 ? 9.232  25.372 33.414 1.00 24.91 ? 1233 ILE A CD1   1 
ATOM   2105 N N     . SER A 1 277 ? 7.755  27.125 28.399 1.00 28.85 ? 1234 SER A N     1 
ATOM   2106 C CA    . SER A 1 277 ? 6.734  27.363 27.391 1.00 30.83 ? 1234 SER A CA    1 
ATOM   2107 C C     . SER A 1 277 ? 7.270  27.103 25.983 1.00 31.46 ? 1234 SER A C     1 
ATOM   2108 O O     . SER A 1 277 ? 6.614  26.453 25.170 1.00 30.79 ? 1234 SER A O     1 
ATOM   2109 C CB    . SER A 1 277 ? 6.243  28.803 27.498 1.00 30.85 ? 1234 SER A CB    1 
ATOM   2110 O OG    . SER A 1 277 ? 5.253  29.070 26.533 1.00 36.36 ? 1234 SER A OG    1 
ATOM   2111 N N     . SER A 1 278 ? 8.470  27.603 25.703 1.00 30.79 ? 1235 SER A N     1 
ATOM   2112 C CA    . SER A 1 278 ? 9.066  27.446 24.381 1.00 31.12 ? 1235 SER A CA    1 
ATOM   2113 C C     . SER A 1 278 ? 9.444  26.023 23.976 1.00 30.72 ? 1235 SER A C     1 
ATOM   2114 O O     . SER A 1 278 ? 9.570  25.740 22.786 1.00 31.73 ? 1235 SER A O     1 
ATOM   2115 C CB    . SER A 1 278 ? 10.301 28.344 24.252 1.00 30.68 ? 1235 SER A CB    1 
ATOM   2116 O OG    . SER A 1 278 ? 11.358 27.861 25.060 1.00 32.75 ? 1235 SER A OG    1 
ATOM   2117 N N     . ILE A 1 279 ? 9.626  25.125 24.941 1.00 29.62 ? 1236 ILE A N     1 
ATOM   2118 C CA    . ILE A 1 279 ? 10.006 23.748 24.618 1.00 29.15 ? 1236 ILE A CA    1 
ATOM   2119 C C     . ILE A 1 279 ? 9.008  22.695 25.088 1.00 30.05 ? 1236 ILE A C     1 
ATOM   2120 O O     . ILE A 1 279 ? 9.264  21.502 24.961 1.00 29.14 ? 1236 ILE A O     1 
ATOM   2121 C CB    . ILE A 1 279 ? 11.374 23.380 25.248 1.00 29.37 ? 1236 ILE A CB    1 
ATOM   2122 C CG1   . ILE A 1 279 ? 11.281 23.487 26.777 1.00 29.40 ? 1236 ILE A CG1   1 
ATOM   2123 C CG2   . ILE A 1 279 ? 12.466 24.290 24.701 1.00 28.70 ? 1236 ILE A CG2   1 
ATOM   2124 C CD1   . ILE A 1 279 ? 12.555 23.093 27.519 1.00 29.57 ? 1236 ILE A CD1   1 
ATOM   2125 N N     . LYS A 1 280 ? 7.879  23.131 25.628 1.00 31.86 ? 1237 LYS A N     1 
ATOM   2126 C CA    . LYS A 1 280 ? 6.881  22.207 26.157 1.00 34.62 ? 1237 LYS A CA    1 
ATOM   2127 C C     . LYS A 1 280 ? 6.377  21.118 25.220 1.00 35.38 ? 1237 LYS A C     1 
ATOM   2128 O O     . LYS A 1 280 ? 6.024  20.027 25.677 1.00 36.10 ? 1237 LYS A O     1 
ATOM   2129 C CB    . LYS A 1 280 ? 5.690  22.987 26.713 1.00 35.75 ? 1237 LYS A CB    1 
ATOM   2130 C CG    . LYS A 1 280 ? 4.982  23.865 25.706 1.00 37.84 ? 1237 LYS A CG    1 
ATOM   2131 C CD    . LYS A 1 280 ? 3.859  24.619 26.386 1.00 39.51 ? 1237 LYS A CD    1 
ATOM   2132 C CE    . LYS A 1 280 ? 3.277  25.688 25.483 1.00 41.71 ? 1237 LYS A CE    1 
ATOM   2133 N NZ    . LYS A 1 280 ? 2.257  26.479 26.224 1.00 44.31 ? 1237 LYS A NZ    1 
ATOM   2134 N N     . GLU A 1 281 ? 6.339  21.392 23.919 1.00 35.40 ? 1238 GLU A N     1 
ATOM   2135 C CA    . GLU A 1 281 ? 5.861  20.388 22.977 1.00 35.84 ? 1238 GLU A CA    1 
ATOM   2136 C C     . GLU A 1 281 ? 6.873  19.256 22.814 1.00 36.19 ? 1238 GLU A C     1 
ATOM   2137 O O     . GLU A 1 281 ? 6.537  18.179 22.319 1.00 37.25 ? 1238 GLU A O     1 
ATOM   2138 C CB    . GLU A 1 281 ? 5.562  21.029 21.617 1.00 35.09 ? 1238 GLU A CB    1 
ATOM   2139 N N     . GLU A 1 282 ? 8.110  19.498 23.241 1.00 36.08 ? 1239 GLU A N     1 
ATOM   2140 C CA    . GLU A 1 282 ? 9.173  18.501 23.129 1.00 35.81 ? 1239 GLU A CA    1 
ATOM   2141 C C     . GLU A 1 282 ? 9.297  17.632 24.376 1.00 35.66 ? 1239 GLU A C     1 
ATOM   2142 O O     . GLU A 1 282 ? 10.051 16.657 24.388 1.00 35.29 ? 1239 GLU A O     1 
ATOM   2143 C CB    . GLU A 1 282 ? 10.510 19.197 22.870 1.00 37.07 ? 1239 GLU A CB    1 
ATOM   2144 C CG    . GLU A 1 282 ? 10.425 20.305 21.841 1.00 38.99 ? 1239 GLU A CG    1 
ATOM   2145 C CD    . GLU A 1 282 ? 10.020 19.803 20.469 1.00 40.84 ? 1239 GLU A CD    1 
ATOM   2146 O OE1   . GLU A 1 282 ? 9.413  20.590 19.710 1.00 42.64 ? 1239 GLU A OE1   1 
ATOM   2147 O OE2   . GLU A 1 282 ? 10.314 18.630 20.145 1.00 40.55 ? 1239 GLU A OE2   1 
ATOM   2148 N N     . MET A 1 283 ? 8.559  17.985 25.424 1.00 35.58 ? 1240 MET A N     1 
ATOM   2149 C CA    . MET A 1 283 ? 8.601  17.228 26.675 1.00 35.95 ? 1240 MET A CA    1 
ATOM   2150 C C     . MET A 1 283 ? 7.781  15.938 26.588 1.00 37.40 ? 1240 MET A C     1 
ATOM   2151 O O     . MET A 1 283 ? 6.808  15.866 25.836 1.00 38.23 ? 1240 MET A O     1 
ATOM   2152 C CB    . MET A 1 283 ? 8.066  18.091 27.822 1.00 33.51 ? 1240 MET A CB    1 
ATOM   2153 C CG    . MET A 1 283 ? 8.839  19.385 28.056 1.00 31.62 ? 1240 MET A CG    1 
ATOM   2154 S SD    . MET A 1 283 ? 10.583 19.085 28.446 1.00 29.26 ? 1240 MET A SD    1 
ATOM   2155 C CE    . MET A 1 283 ? 10.442 18.390 30.070 1.00 29.87 ? 1240 MET A CE    1 
ATOM   2156 N N     . GLU A 1 284 ? 8.171  14.923 27.356 1.00 38.68 ? 1241 GLU A N     1 
ATOM   2157 C CA    . GLU A 1 284 ? 7.440  13.658 27.362 1.00 40.33 ? 1241 GLU A CA    1 
ATOM   2158 C C     . GLU A 1 284 ? 6.023  13.902 27.878 1.00 40.09 ? 1241 GLU A C     1 
ATOM   2159 O O     . GLU A 1 284 ? 5.765  14.891 28.560 1.00 39.84 ? 1241 GLU A O     1 
ATOM   2160 C CB    . GLU A 1 284 ? 8.147  12.625 28.241 1.00 41.70 ? 1241 GLU A CB    1 
ATOM   2161 C CG    . GLU A 1 284 ? 9.587  12.376 27.839 1.00 44.98 ? 1241 GLU A CG    1 
ATOM   2162 C CD    . GLU A 1 284 ? 10.222 11.239 28.613 1.00 47.13 ? 1241 GLU A CD    1 
ATOM   2163 O OE1   . GLU A 1 284 ? 9.838  11.025 29.782 1.00 48.69 ? 1241 GLU A OE1   1 
ATOM   2164 O OE2   . GLU A 1 284 ? 11.119 10.569 28.056 1.00 49.28 ? 1241 GLU A OE2   1 
ATOM   2165 N N     . PRO A 1 285 ? 5.086  12.994 27.557 1.00 40.03 ? 1242 PRO A N     1 
ATOM   2166 C CA    . PRO A 1 285 ? 3.682  13.094 27.968 1.00 39.72 ? 1242 PRO A CA    1 
ATOM   2167 C C     . PRO A 1 285 ? 3.440  13.361 29.454 1.00 38.89 ? 1242 PRO A C     1 
ATOM   2168 O O     . PRO A 1 285 ? 2.685  14.266 29.817 1.00 38.63 ? 1242 PRO A O     1 
ATOM   2169 C CB    . PRO A 1 285 ? 3.099  11.749 27.528 1.00 39.66 ? 1242 PRO A CB    1 
ATOM   2170 C CG    . PRO A 1 285 ? 3.936  11.396 26.333 1.00 40.44 ? 1242 PRO A CG    1 
ATOM   2171 C CD    . PRO A 1 285 ? 5.319  11.742 26.813 1.00 40.20 ? 1242 PRO A CD    1 
ATOM   2172 N N     . GLY A 1 286 ? 4.085  12.568 30.304 1.00 38.08 ? 1243 GLY A N     1 
ATOM   2173 C CA    . GLY A 1 286 ? 3.909  12.707 31.738 1.00 37.23 ? 1243 GLY A CA    1 
ATOM   2174 C C     . GLY A 1 286 ? 4.357  14.008 32.380 1.00 36.38 ? 1243 GLY A C     1 
ATOM   2175 O O     . GLY A 1 286 ? 4.154  14.195 33.582 1.00 36.22 ? 1243 GLY A O     1 
ATOM   2176 N N     . PHE A 1 287 ? 4.960  14.903 31.601 1.00 35.38 ? 1244 PHE A N     1 
ATOM   2177 C CA    . PHE A 1 287 ? 5.426  16.181 32.134 1.00 34.51 ? 1244 PHE A CA    1 
ATOM   2178 C C     . PHE A 1 287 ? 4.234  17.016 32.596 1.00 35.25 ? 1244 PHE A C     1 
ATOM   2179 O O     . PHE A 1 287 ? 4.302  17.720 33.605 1.00 33.57 ? 1244 PHE A O     1 
ATOM   2180 C CB    . PHE A 1 287 ? 6.206  16.953 31.062 1.00 33.30 ? 1244 PHE A CB    1 
ATOM   2181 C CG    . PHE A 1 287 ? 6.821  18.235 31.559 1.00 30.43 ? 1244 PHE A CG    1 
ATOM   2182 C CD1   . PHE A 1 287 ? 7.876  18.212 32.467 1.00 29.71 ? 1244 PHE A CD1   1 
ATOM   2183 C CD2   . PHE A 1 287 ? 6.337  19.468 31.129 1.00 30.80 ? 1244 PHE A CD2   1 
ATOM   2184 C CE1   . PHE A 1 287 ? 8.445  19.401 32.944 1.00 27.55 ? 1244 PHE A CE1   1 
ATOM   2185 C CE2   . PHE A 1 287 ? 6.900  20.664 31.599 1.00 30.08 ? 1244 PHE A CE2   1 
ATOM   2186 C CZ    . PHE A 1 287 ? 7.960  20.622 32.512 1.00 27.60 ? 1244 PHE A CZ    1 
ATOM   2187 N N     . ARG A 1 288 ? 3.142  16.927 31.849 1.00 36.28 ? 1245 ARG A N     1 
ATOM   2188 C CA    . ARG A 1 288 ? 1.930  17.673 32.159 1.00 38.25 ? 1245 ARG A CA    1 
ATOM   2189 C C     . ARG A 1 288 ? 1.310  17.222 33.483 1.00 38.04 ? 1245 ARG A C     1 
ATOM   2190 O O     . ARG A 1 288 ? 0.634  17.994 34.156 1.00 38.57 ? 1245 ARG A O     1 
ATOM   2191 C CB    . ARG A 1 288 ? 0.921  17.495 31.018 1.00 41.21 ? 1245 ARG A CB    1 
ATOM   2192 C CG    . ARG A 1 288 ? 1.568  17.569 29.630 1.00 44.94 ? 1245 ARG A CG    1 
ATOM   2193 C CD    . ARG A 1 288 ? 0.582  17.345 28.477 1.00 47.83 ? 1245 ARG A CD    1 
ATOM   2194 N NE    . ARG A 1 288 ? -0.155 18.558 28.123 1.00 50.26 ? 1245 ARG A NE    1 
ATOM   2195 C CZ    . ARG A 1 288 ? -1.163 19.061 28.830 1.00 51.42 ? 1245 ARG A CZ    1 
ATOM   2196 N NH1   . ARG A 1 288 ? -1.572 18.454 29.937 1.00 51.49 ? 1245 ARG A NH1   1 
ATOM   2197 N NH2   . ARG A 1 288 ? -1.754 20.183 28.435 1.00 51.61 ? 1245 ARG A NH2   1 
ATOM   2198 N N     . GLU A 1 289 ? 1.554  15.971 33.854 1.00 38.27 ? 1246 GLU A N     1 
ATOM   2199 C CA    . GLU A 1 289 ? 0.999  15.407 35.080 1.00 38.26 ? 1246 GLU A CA    1 
ATOM   2200 C C     . GLU A 1 289 ? 1.800  15.687 36.351 1.00 36.86 ? 1246 GLU A C     1 
ATOM   2201 O O     . GLU A 1 289 ? 1.226  15.821 37.431 1.00 37.18 ? 1246 GLU A O     1 
ATOM   2202 C CB    . GLU A 1 289 ? 0.849  13.891 34.926 1.00 40.55 ? 1246 GLU A CB    1 
ATOM   2203 C CG    . GLU A 1 289 ? -0.034 13.457 33.756 1.00 44.85 ? 1246 GLU A CG    1 
ATOM   2204 C CD    . GLU A 1 289 ? -0.045 11.947 33.554 1.00 46.95 ? 1246 GLU A CD    1 
ATOM   2205 O OE1   . GLU A 1 289 ? 0.971  11.397 33.069 1.00 47.55 ? 1246 GLU A OE1   1 
ATOM   2206 O OE2   . GLU A 1 289 ? -1.072 11.309 33.886 1.00 48.83 ? 1246 GLU A OE2   1 
ATOM   2207 N N     . VAL A 1 290 ? 3.120  15.776 36.229 1.00 34.12 ? 1247 VAL A N     1 
ATOM   2208 C CA    . VAL A 1 290 ? 3.966  15.989 37.399 1.00 32.43 ? 1247 VAL A CA    1 
ATOM   2209 C C     . VAL A 1 290 ? 4.665  17.341 37.518 1.00 31.40 ? 1247 VAL A C     1 
ATOM   2210 O O     . VAL A 1 290 ? 5.228  17.656 38.567 1.00 32.16 ? 1247 VAL A O     1 
ATOM   2211 C CB    . VAL A 1 290 ? 5.063  14.921 37.463 1.00 32.30 ? 1247 VAL A CB    1 
ATOM   2212 C CG1   . VAL A 1 290 ? 4.442  13.526 37.472 1.00 31.52 ? 1247 VAL A CG1   1 
ATOM   2213 C CG2   . VAL A 1 290 ? 6.001  15.089 36.275 1.00 32.05 ? 1247 VAL A CG2   1 
ATOM   2214 N N     . SER A 1 291 ? 4.631  18.140 36.461 1.00 29.37 ? 1248 SER A N     1 
ATOM   2215 C CA    . SER A 1 291 ? 5.322  19.418 36.470 1.00 28.45 ? 1248 SER A CA    1 
ATOM   2216 C C     . SER A 1 291 ? 4.661  20.559 37.225 1.00 28.46 ? 1248 SER A C     1 
ATOM   2217 O O     . SER A 1 291 ? 3.435  20.618 37.358 1.00 27.77 ? 1248 SER A O     1 
ATOM   2218 C CB    . SER A 1 291 ? 5.576  19.878 35.034 1.00 28.85 ? 1248 SER A CB    1 
ATOM   2219 O OG    . SER A 1 291 ? 4.361  20.229 34.397 1.00 29.35 ? 1248 SER A OG    1 
ATOM   2220 N N     . PHE A 1 292 ? 5.491  21.470 37.726 1.00 26.51 ? 1249 PHE A N     1 
ATOM   2221 C CA    . PHE A 1 292 ? 4.978  22.651 38.410 1.00 26.75 ? 1249 PHE A CA    1 
ATOM   2222 C C     . PHE A 1 292 ? 4.331  23.533 37.336 1.00 26.82 ? 1249 PHE A C     1 
ATOM   2223 O O     . PHE A 1 292 ? 3.327  24.214 37.582 1.00 27.57 ? 1249 PHE A O     1 
ATOM   2224 C CB    . PHE A 1 292 ? 6.117  23.428 39.070 1.00 24.98 ? 1249 PHE A CB    1 
ATOM   2225 C CG    . PHE A 1 292 ? 5.774  24.859 39.379 1.00 26.52 ? 1249 PHE A CG    1 
ATOM   2226 C CD1   . PHE A 1 292 ? 4.952  25.175 40.452 1.00 25.76 ? 1249 PHE A CD1   1 
ATOM   2227 C CD2   . PHE A 1 292 ? 6.270  25.892 38.589 1.00 25.81 ? 1249 PHE A CD2   1 
ATOM   2228 C CE1   . PHE A 1 292 ? 4.629  26.507 40.743 1.00 26.71 ? 1249 PHE A CE1   1 
ATOM   2229 C CE2   . PHE A 1 292 ? 5.953  27.220 38.871 1.00 26.73 ? 1249 PHE A CE2   1 
ATOM   2230 C CZ    . PHE A 1 292 ? 5.131  27.525 39.951 1.00 25.90 ? 1249 PHE A CZ    1 
ATOM   2231 N N     . TYR A 1 293 ? 4.920  23.509 36.143 1.00 25.68 ? 1250 TYR A N     1 
ATOM   2232 C CA    . TYR A 1 293 ? 4.432  24.305 35.022 1.00 26.44 ? 1250 TYR A CA    1 
ATOM   2233 C C     . TYR A 1 293 ? 2.942  24.097 34.745 1.00 26.31 ? 1250 TYR A C     1 
ATOM   2234 O O     . TYR A 1 293 ? 2.197  25.060 34.624 1.00 25.05 ? 1250 TYR A O     1 
ATOM   2235 C CB    . TYR A 1 293 ? 5.222  23.977 33.750 1.00 26.67 ? 1250 TYR A CB    1 
ATOM   2236 C CG    . TYR A 1 293 ? 4.863  24.856 32.573 1.00 28.60 ? 1250 TYR A CG    1 
ATOM   2237 C CD1   . TYR A 1 293 ? 5.351  26.159 32.473 1.00 27.57 ? 1250 TYR A CD1   1 
ATOM   2238 C CD2   . TYR A 1 293 ? 3.996  24.396 31.577 1.00 28.82 ? 1250 TYR A CD2   1 
ATOM   2239 C CE1   . TYR A 1 293 ? 4.982  26.986 31.405 1.00 29.72 ? 1250 TYR A CE1   1 
ATOM   2240 C CE2   . TYR A 1 293 ? 3.619  25.214 30.511 1.00 29.09 ? 1250 TYR A CE2   1 
ATOM   2241 C CZ    . TYR A 1 293 ? 4.112  26.503 30.431 1.00 29.89 ? 1250 TYR A CZ    1 
ATOM   2242 O OH    . TYR A 1 293 ? 3.728  27.308 29.385 1.00 32.31 ? 1250 TYR A OH    1 
ATOM   2243 N N     . TYR A 1 294 ? 2.513  22.844 34.642 1.00 27.48 ? 1251 TYR A N     1 
ATOM   2244 C CA    . TYR A 1 294 ? 1.107  22.552 34.359 1.00 29.90 ? 1251 TYR A CA    1 
ATOM   2245 C C     . TYR A 1 294 ? 0.205  22.421 35.590 1.00 30.89 ? 1251 TYR A C     1 
ATOM   2246 O O     . TYR A 1 294 ? -0.973 22.080 35.459 1.00 31.00 ? 1251 TYR A O     1 
ATOM   2247 C CB    . TYR A 1 294 ? 0.988  21.273 33.525 1.00 30.84 ? 1251 TYR A CB    1 
ATOM   2248 C CG    . TYR A 1 294 ? 1.347  21.441 32.066 1.00 32.97 ? 1251 TYR A CG    1 
ATOM   2249 C CD1   . TYR A 1 294 ? 2.590  21.036 31.575 1.00 33.92 ? 1251 TYR A CD1   1 
ATOM   2250 C CD2   . TYR A 1 294 ? 0.431  21.990 31.169 1.00 33.69 ? 1251 TYR A CD2   1 
ATOM   2251 C CE1   . TYR A 1 294 ? 2.910  21.168 30.213 1.00 34.66 ? 1251 TYR A CE1   1 
ATOM   2252 C CE2   . TYR A 1 294 ? 0.739  22.133 29.816 1.00 35.57 ? 1251 TYR A CE2   1 
ATOM   2253 C CZ    . TYR A 1 294 ? 1.975  21.718 29.344 1.00 35.59 ? 1251 TYR A CZ    1 
ATOM   2254 O OH    . TYR A 1 294 ? 2.258  21.849 28.003 1.00 36.47 ? 1251 TYR A OH    1 
ATOM   2255 N N     . SER A 1 295 ? 0.749  22.688 36.776 1.00 30.78 ? 1252 SER A N     1 
ATOM   2256 C CA    . SER A 1 295 ? -0.028 22.581 38.006 1.00 31.50 ? 1252 SER A CA    1 
ATOM   2257 C C     . SER A 1 295 ? -0.923 23.797 38.211 1.00 33.77 ? 1252 SER A C     1 
ATOM   2258 O O     . SER A 1 295 ? -0.703 24.856 37.622 1.00 32.63 ? 1252 SER A O     1 
ATOM   2259 C CB    . SER A 1 295 ? 0.898  22.446 39.214 1.00 28.47 ? 1252 SER A CB    1 
ATOM   2260 O OG    . SER A 1 295 ? 1.443  23.708 39.556 1.00 25.98 ? 1252 SER A OG    1 
ATOM   2261 N N     . GLU A 1 296 ? -1.936 23.648 39.057 1.00 38.13 ? 1253 GLU A N     1 
ATOM   2262 C CA    . GLU A 1 296 ? -2.832 24.762 39.326 1.00 41.85 ? 1253 GLU A CA    1 
ATOM   2263 C C     . GLU A 1 296 ? -2.134 25.859 40.129 1.00 43.22 ? 1253 GLU A C     1 
ATOM   2264 O O     . GLU A 1 296 ? -2.536 27.019 40.078 1.00 44.08 ? 1253 GLU A O     1 
ATOM   2265 C CB    . GLU A 1 296 ? -4.084 24.273 40.058 1.00 44.10 ? 1253 GLU A CB    1 
ATOM   2266 C CG    . GLU A 1 296 ? -5.021 23.471 39.169 1.00 47.20 ? 1253 GLU A CG    1 
ATOM   2267 C CD    . GLU A 1 296 ? -6.372 23.223 39.806 1.00 49.62 ? 1253 GLU A CD    1 
ATOM   2268 O OE1   . GLU A 1 296 ? -6.419 22.586 40.882 1.00 51.56 ? 1253 GLU A OE1   1 
ATOM   2269 O OE2   . GLU A 1 296 ? -7.389 23.666 39.230 1.00 51.17 ? 1253 GLU A OE2   1 
ATOM   2270 N N     . GLU A 1 297 ? -1.085 25.502 40.865 1.00 45.08 ? 1254 GLU A N     1 
ATOM   2271 C CA    . GLU A 1 297 ? -0.363 26.500 41.650 1.00 47.25 ? 1254 GLU A CA    1 
ATOM   2272 C C     . GLU A 1 297 ? 0.278  27.562 40.763 1.00 48.14 ? 1254 GLU A C     1 
ATOM   2273 O O     . GLU A 1 297 ? 0.554  28.673 41.219 1.00 48.85 ? 1254 GLU A O     1 
ATOM   2274 C CB    . GLU A 1 297 ? 0.716  25.848 42.522 1.00 48.10 ? 1254 GLU A CB    1 
ATOM   2275 C CG    . GLU A 1 297 ? 0.174  25.151 43.756 1.00 49.67 ? 1254 GLU A CG    1 
ATOM   2276 C CD    . GLU A 1 297 ? 0.017  23.658 43.565 1.00 51.38 ? 1254 GLU A CD    1 
ATOM   2277 O OE1   . GLU A 1 297 ? -0.521 23.235 42.515 1.00 51.36 ? 1254 GLU A OE1   1 
ATOM   2278 O OE2   . GLU A 1 297 ? 0.430  22.907 44.476 1.00 52.89 ? 1254 GLU A OE2   1 
ATOM   2279 N N     . ASN A 1 298 ? 0.514  27.221 39.499 1.00 48.72 ? 1255 ASN A N     1 
ATOM   2280 C CA    . ASN A 1 298 ? 1.115  28.161 38.560 1.00 49.06 ? 1255 ASN A CA    1 
ATOM   2281 C C     . ASN A 1 298 ? 0.071  28.805 37.650 1.00 49.93 ? 1255 ASN A C     1 
ATOM   2282 O O     . ASN A 1 298 ? -0.331 28.225 36.639 1.00 50.04 ? 1255 ASN A O     1 
ATOM   2283 C CB    . ASN A 1 298 ? 2.170  27.465 37.700 1.00 47.46 ? 1255 ASN A CB    1 
ATOM   2284 C CG    . ASN A 1 298 ? 2.689  28.359 36.598 1.00 46.80 ? 1255 ASN A CG    1 
ATOM   2285 O OD1   . ASN A 1 298 ? 3.088  29.495 36.848 1.00 45.76 ? 1255 ASN A OD1   1 
ATOM   2286 N ND2   . ASN A 1 298 ? 2.685  27.856 35.370 1.00 45.96 ? 1255 ASN A ND2   1 
ATOM   2287 N N     . LYS A 1 299 ? -0.361 30.007 38.018 1.00 51.06 ? 1256 LYS A N     1 
ATOM   2288 C CA    . LYS A 1 299 ? -1.358 30.739 37.241 1.00 51.71 ? 1256 LYS A CA    1 
ATOM   2289 C C     . LYS A 1 299 ? -1.141 32.241 37.380 1.00 51.87 ? 1256 LYS A C     1 
ATOM   2290 O O     . LYS A 1 299 ? -0.266 32.607 38.194 1.00 52.38 ? 1256 LYS A O     1 
ATOM   2291 C CB    . LYS A 1 299 ? -2.769 30.374 37.713 1.00 51.43 ? 1256 LYS A CB    1 
ATOM   2292 N N     . GLY B 2 6   ? 39.036 24.284 41.107 1.00 40.82 ? 6    GLY B N     1 
ATOM   2293 C CA    . GLY B 2 6   ? 37.941 24.473 42.100 1.00 40.78 ? 6    GLY B CA    1 
ATOM   2294 C C     . GLY B 2 6   ? 36.802 25.287 41.518 1.00 40.77 ? 6    GLY B C     1 
ATOM   2295 O O     . GLY B 2 6   ? 37.032 26.231 40.762 1.00 41.04 ? 6    GLY B O     1 
ATOM   2296 N N     . GLU B 2 7   ? 35.571 24.936 41.877 1.00 40.15 ? 7    GLU B N     1 
ATOM   2297 C CA    . GLU B 2 7   ? 34.406 25.645 41.363 1.00 39.17 ? 7    GLU B CA    1 
ATOM   2298 C C     . GLU B 2 7   ? 34.047 26.896 42.152 1.00 37.83 ? 7    GLU B C     1 
ATOM   2299 O O     . GLU B 2 7   ? 33.410 27.801 41.621 1.00 37.19 ? 7    GLU B O     1 
ATOM   2300 C CB    . GLU B 2 7   ? 33.190 24.719 41.322 1.00 41.31 ? 7    GLU B CB    1 
ATOM   2301 C CG    . GLU B 2 7   ? 33.283 23.603 40.304 1.00 44.38 ? 7    GLU B CG    1 
ATOM   2302 C CD    . GLU B 2 7   ? 34.086 22.428 40.808 1.00 45.85 ? 7    GLU B CD    1 
ATOM   2303 O OE1   . GLU B 2 7   ? 33.692 21.853 41.845 1.00 48.19 ? 7    GLU B OE1   1 
ATOM   2304 O OE2   . GLU B 2 7   ? 35.103 22.079 40.169 1.00 46.91 ? 7    GLU B OE2   1 
ATOM   2305 N N     . TYR B 2 8   ? 34.444 26.948 43.418 1.00 35.85 ? 8    TYR B N     1 
ATOM   2306 C CA    . TYR B 2 8   ? 34.138 28.111 44.236 1.00 35.08 ? 8    TYR B CA    1 
ATOM   2307 C C     . TYR B 2 8   ? 35.409 28.911 44.475 1.00 35.80 ? 8    TYR B C     1 
ATOM   2308 O O     . TYR B 2 8   ? 36.367 28.421 45.071 1.00 36.07 ? 8    TYR B O     1 
ATOM   2309 C CB    . TYR B 2 8   ? 33.491 27.679 45.551 1.00 32.23 ? 8    TYR B CB    1 
ATOM   2310 C CG    . TYR B 2 8   ? 32.208 26.906 45.331 1.00 30.79 ? 8    TYR B CG    1 
ATOM   2311 C CD1   . TYR B 2 8   ? 32.233 25.536 45.069 1.00 29.80 ? 8    TYR B CD1   1 
ATOM   2312 C CD2   . TYR B 2 8   ? 30.972 27.556 45.325 1.00 29.27 ? 8    TYR B CD2   1 
ATOM   2313 C CE1   . TYR B 2 8   ? 31.057 24.827 44.804 1.00 28.38 ? 8    TYR B CE1   1 
ATOM   2314 C CE2   . TYR B 2 8   ? 29.791 26.858 45.059 1.00 28.51 ? 8    TYR B CE2   1 
ATOM   2315 C CZ    . TYR B 2 8   ? 29.842 25.495 44.800 1.00 27.67 ? 8    TYR B CZ    1 
ATOM   2316 O OH    . TYR B 2 8   ? 28.680 24.803 44.532 1.00 25.85 ? 8    TYR B OH    1 
ATOM   2317 N N     . VAL B 2 9   ? 35.396 30.148 43.994 1.00 35.98 ? 9    VAL B N     1 
ATOM   2318 C CA    . VAL B 2 9   ? 36.537 31.048 44.079 1.00 36.82 ? 9    VAL B CA    1 
ATOM   2319 C C     . VAL B 2 9   ? 36.235 32.253 44.946 1.00 37.49 ? 9    VAL B C     1 
ATOM   2320 O O     . VAL B 2 9   ? 35.115 32.757 44.956 1.00 36.73 ? 9    VAL B O     1 
ATOM   2321 C CB    . VAL B 2 9   ? 36.920 31.565 42.674 1.00 37.23 ? 9    VAL B CB    1 
ATOM   2322 C CG1   . VAL B 2 9   ? 38.233 32.339 42.741 1.00 37.93 ? 9    VAL B CG1   1 
ATOM   2323 C CG2   . VAL B 2 9   ? 37.015 30.404 41.701 1.00 35.96 ? 9    VAL B CG2   1 
ATOM   2324 N N     . ASN B 2 10  ? 37.241 32.726 45.672 1.00 39.29 ? 10   ASN B N     1 
ATOM   2325 C CA    . ASN B 2 10  ? 37.043 33.884 46.524 1.00 41.20 ? 10   ASN B CA    1 
ATOM   2326 C C     . ASN B 2 10  ? 36.815 35.125 45.668 1.00 41.65 ? 10   ASN B C     1 
ATOM   2327 O O     . ASN B 2 10  ? 37.458 35.318 44.638 1.00 41.69 ? 10   ASN B O     1 
ATOM   2328 C CB    . ASN B 2 10  ? 38.251 34.096 47.434 1.00 42.91 ? 10   ASN B CB    1 
ATOM   2329 C CG    . ASN B 2 10  ? 37.977 35.105 48.528 1.00 45.62 ? 10   ASN B CG    1 
ATOM   2330 O OD1   . ASN B 2 10  ? 37.842 36.305 48.268 1.00 47.21 ? 10   ASN B OD1   1 
ATOM   2331 N ND2   . ASN B 2 10  ? 37.881 34.623 49.763 1.00 47.32 ? 10   ASN B ND2   1 
ATOM   2332 N N     . ILE B 2 11  ? 35.883 35.960 46.106 1.00 42.19 ? 11   ILE B N     1 
ATOM   2333 C CA    . ILE B 2 11  ? 35.550 37.189 45.408 1.00 43.33 ? 11   ILE B CA    1 
ATOM   2334 C C     . ILE B 2 11  ? 34.988 38.107 46.483 1.00 43.91 ? 11   ILE B C     1 
ATOM   2335 O O     . ILE B 2 11  ? 34.255 37.661 47.366 1.00 44.07 ? 11   ILE B O     1 
ATOM   2336 C CB    . ILE B 2 11  ? 34.498 36.927 44.289 1.00 43.84 ? 11   ILE B CB    1 
ATOM   2337 C CG1   . ILE B 2 11  ? 34.243 38.206 43.492 1.00 43.89 ? 11   ILE B CG1   1 
ATOM   2338 C CG2   . ILE B 2 11  ? 33.202 36.414 44.897 1.00 43.79 ? 11   ILE B CG2   1 
ATOM   2339 C CD1   . ILE B 2 11  ? 33.405 37.987 42.244 1.00 43.43 ? 11   ILE B CD1   1 
ATOM   2340 N N     . GLU B 2 12  ? 35.331 39.385 46.419 1.00 44.77 ? 12   GLU B N     1 
ATOM   2341 C CA    . GLU B 2 12  ? 34.872 40.324 47.431 1.00 45.90 ? 12   GLU B CA    1 
ATOM   2342 C C     . GLU B 2 12  ? 34.130 41.518 46.847 1.00 45.85 ? 12   GLU B C     1 
ATOM   2343 O O     . GLU B 2 12  ? 34.518 42.055 45.813 1.00 46.02 ? 12   GLU B O     1 
ATOM   2344 C CB    . GLU B 2 12  ? 36.073 40.815 48.238 1.00 46.73 ? 12   GLU B CB    1 
ATOM   2345 C CG    . GLU B 2 12  ? 35.720 41.604 49.482 1.00 48.46 ? 12   GLU B CG    1 
ATOM   2346 C CD    . GLU B 2 12  ? 36.952 42.170 50.153 1.00 49.29 ? 12   GLU B CD    1 
ATOM   2347 O OE1   . GLU B 2 12  ? 37.972 41.450 50.208 1.00 49.56 ? 12   GLU B OE1   1 
ATOM   2348 O OE2   . GLU B 2 12  ? 36.901 43.325 50.626 1.00 50.18 ? 12   GLU B OE2   1 
ATOM   2349 N N     . PHE B 2 13  ? 33.063 41.931 47.521 1.00 46.52 ? 13   PHE B N     1 
ATOM   2350 C CA    . PHE B 2 13  ? 32.274 43.069 47.071 1.00 47.14 ? 13   PHE B CA    1 
ATOM   2351 C C     . PHE B 2 13  ? 32.220 44.169 48.132 1.00 47.84 ? 13   PHE B C     1 
ATOM   2352 O O     . PHE B 2 13  ? 31.914 43.830 49.298 1.00 48.52 ? 13   PHE B O     1 
ATOM   2353 C CB    . PHE B 2 13  ? 30.856 42.618 46.715 1.00 46.83 ? 13   PHE B CB    1 
ATOM   2354 C CG    . PHE B 2 13  ? 30.811 41.516 45.692 1.00 46.45 ? 13   PHE B CG    1 
ATOM   2355 C CD1   . PHE B 2 13  ? 30.698 40.187 46.084 1.00 46.19 ? 13   PHE B CD1   1 
ATOM   2356 C CD2   . PHE B 2 13  ? 30.910 41.808 44.336 1.00 46.29 ? 13   PHE B CD2   1 
ATOM   2357 C CE1   . PHE B 2 13  ? 30.684 39.163 45.139 1.00 45.84 ? 13   PHE B CE1   1 
ATOM   2358 C CE2   . PHE B 2 13  ? 30.898 40.791 43.385 1.00 45.77 ? 13   PHE B CE2   1 
ATOM   2359 C CZ    . PHE B 2 13  ? 30.784 39.468 43.787 1.00 45.64 ? 13   PHE B CZ    1 
HETATM 2360 P PG    . ACP C 3 .   ? 28.187 20.375 47.993 1.00 90.63 ? 300  ACP A PG    1 
HETATM 2361 O O1G   . ACP C 3 .   ? 27.263 21.059 48.936 1.00 90.58 ? 300  ACP A O1G   1 
HETATM 2362 O O2G   . ACP C 3 .   ? 29.614 20.704 48.227 1.00 90.46 ? 300  ACP A O2G   1 
HETATM 2363 O O3G   . ACP C 3 .   ? 27.759 20.368 46.575 1.00 90.51 ? 300  ACP A O3G   1 
HETATM 2364 P PB    . ACP C 3 .   ? 28.989 17.539 47.592 1.00 88.83 ? 300  ACP A PB    1 
HETATM 2365 O O1B   . ACP C 3 .   ? 29.314 17.993 46.216 1.00 88.99 ? 300  ACP A O1B   1 
HETATM 2366 O O2B   . ACP C 3 .   ? 30.106 17.095 48.465 1.00 89.01 ? 300  ACP A O2B   1 
HETATM 2367 C C3B   . ACP C 3 .   ? 28.121 18.761 48.386 1.00 89.61 ? 300  ACP A C3B   1 
HETATM 2368 P PA    . ACP C 3 .   ? 26.836 16.029 48.383 1.00 84.52 ? 300  ACP A PA    1 
HETATM 2369 O O1A   . ACP C 3 .   ? 27.121 16.421 49.782 1.00 84.49 ? 300  ACP A O1A   1 
HETATM 2370 O O2A   . ACP C 3 .   ? 25.591 16.500 47.731 1.00 84.46 ? 300  ACP A O2A   1 
HETATM 2371 O O3A   . ACP C 3 .   ? 28.029 16.357 47.492 1.00 86.79 ? 300  ACP A O3A   1 
HETATM 2372 O "O5'" . ACP C 3 .   ? 26.834 14.426 48.328 1.00 82.72 ? 300  ACP A "O5'" 1 
HETATM 2373 C "C5'" . ACP C 3 .   ? 27.992 13.572 48.283 1.00 79.58 ? 300  ACP A "C5'" 1 
HETATM 2374 C "C4'" . ACP C 3 .   ? 27.603 12.316 47.539 1.00 77.81 ? 300  ACP A "C4'" 1 
HETATM 2375 O "O4'" . ACP C 3 .   ? 26.473 11.705 48.213 1.00 76.39 ? 300  ACP A "O4'" 1 
HETATM 2376 C "C3'" . ACP C 3 .   ? 27.130 12.537 46.110 1.00 77.47 ? 300  ACP A "C3'" 1 
HETATM 2377 O "O3'" . ACP C 3 .   ? 28.231 12.527 45.208 1.00 78.23 ? 300  ACP A "O3'" 1 
HETATM 2378 C "C2'" . ACP C 3 .   ? 26.209 11.347 45.874 1.00 76.55 ? 300  ACP A "C2'" 1 
HETATM 2379 O "O2'" . ACP C 3 .   ? 26.910 10.172 45.515 1.00 77.33 ? 300  ACP A "O2'" 1 
HETATM 2380 C "C1'" . ACP C 3 .   ? 25.572 11.174 47.255 1.00 75.12 ? 300  ACP A "C1'" 1 
HETATM 2381 N N9    . ACP C 3 .   ? 24.276 11.839 47.415 1.00 72.80 ? 300  ACP A N9    1 
HETATM 2382 C C8    . ACP C 3 .   ? 24.015 13.074 47.962 1.00 72.08 ? 300  ACP A C8    1 
HETATM 2383 N N7    . ACP C 3 .   ? 22.741 13.386 47.982 1.00 71.07 ? 300  ACP A N7    1 
HETATM 2384 C C5    . ACP C 3 .   ? 22.118 12.287 47.406 1.00 70.69 ? 300  ACP A C5    1 
HETATM 2385 C C6    . ACP C 3 .   ? 20.766 11.996 47.133 1.00 69.98 ? 300  ACP A C6    1 
HETATM 2386 N N6    . ACP C 3 .   ? 19.753 12.819 47.426 1.00 68.35 ? 300  ACP A N6    1 
HETATM 2387 N N1    . ACP C 3 .   ? 20.485 10.812 46.547 1.00 69.31 ? 300  ACP A N1    1 
HETATM 2388 C C2    . ACP C 3 .   ? 21.497 9.986  46.254 1.00 70.12 ? 300  ACP A C2    1 
HETATM 2389 N N3    . ACP C 3 .   ? 22.804 10.144 46.460 1.00 70.45 ? 300  ACP A N3    1 
HETATM 2390 C C4    . ACP C 3 .   ? 23.052 11.329 47.045 1.00 71.44 ? 300  ACP A C4    1 
HETATM 2391 O O     . HOH D 4 .   ? 22.137 29.987 39.997 1.00 24.25 ? 1    HOH A O     1 
HETATM 2392 O O     . HOH D 4 .   ? 28.502 21.379 37.559 1.00 17.51 ? 2    HOH A O     1 
HETATM 2393 O O     . HOH D 4 .   ? 21.920 26.909 46.424 1.00 18.07 ? 3    HOH A O     1 
HETATM 2394 O O     . HOH D 4 .   ? 25.752 30.702 40.361 1.00 25.78 ? 4    HOH A O     1 
HETATM 2395 O O     . HOH D 4 .   ? 24.945 34.730 39.083 1.00 23.79 ? 5    HOH A O     1 
HETATM 2396 O O     . HOH D 4 .   ? 29.279 31.851 33.168 1.00 21.31 ? 6    HOH A O     1 
HETATM 2397 O O     . HOH D 4 .   ? 31.143 21.585 38.763 1.00 23.45 ? 7    HOH A O     1 
HETATM 2398 O O     . HOH D 4 .   ? 26.341 38.277 27.657 1.00 25.42 ? 8    HOH A O     1 
HETATM 2399 O O     . HOH D 4 .   ? 14.537 38.179 41.151 1.00 28.18 ? 9    HOH A O     1 
HETATM 2400 O O     . HOH D 4 .   ? 9.520  12.415 36.226 1.00 25.47 ? 10   HOH A O     1 
HETATM 2401 O O     . HOH D 4 .   ? 21.571 33.423 40.575 1.00 26.47 ? 11   HOH A O     1 
HETATM 2402 O O     . HOH D 4 .   ? 9.808  31.932 36.081 1.00 24.12 ? 12   HOH A O     1 
HETATM 2403 O O     . HOH D 4 .   ? 10.251 18.911 46.584 1.00 20.34 ? 13   HOH A O     1 
HETATM 2404 O O     . HOH D 4 .   ? 29.036 37.929 28.766 1.00 23.81 ? 14   HOH A O     1 
HETATM 2405 O O     . HOH D 4 .   ? 13.398 8.179  48.098 1.00 24.75 ? 15   HOH A O     1 
HETATM 2406 O O     . HOH D 4 .   ? 10.832 15.265 44.323 1.00 21.60 ? 16   HOH A O     1 
HETATM 2407 O O     . HOH D 4 .   ? 15.665 13.459 32.157 1.00 28.24 ? 17   HOH A O     1 
HETATM 2408 O O     . HOH D 4 .   ? 26.572 27.947 40.217 1.00 21.83 ? 18   HOH A O     1 
HETATM 2409 O O     . HOH D 4 .   ? 23.836 32.387 39.546 1.00 20.61 ? 19   HOH A O     1 
HETATM 2410 O O     . HOH D 4 .   ? 30.537 33.584 34.558 1.00 27.88 ? 20   HOH A O     1 
HETATM 2411 O O     . HOH D 4 .   ? 28.581 31.986 28.493 1.00 25.64 ? 21   HOH A O     1 
HETATM 2412 O O     . HOH D 4 .   ? 9.993  14.732 34.653 1.00 22.34 ? 22   HOH A O     1 
HETATM 2413 O O     . HOH D 4 .   ? 14.882 12.725 66.433 1.00 30.60 ? 23   HOH A O     1 
HETATM 2414 O O     . HOH D 4 .   ? 14.789 38.625 32.433 1.00 34.28 ? 24   HOH A O     1 
HETATM 2415 O O     . HOH D 4 .   ? 25.435 26.484 53.022 1.00 31.27 ? 25   HOH A O     1 
HETATM 2416 O O     . HOH D 4 .   ? 30.141 16.575 40.620 1.00 33.77 ? 26   HOH A O     1 
HETATM 2417 O O     . HOH D 4 .   ? 31.749 25.342 67.897 1.00 30.69 ? 28   HOH A O     1 
HETATM 2418 O O     . HOH D 4 .   ? 14.812 35.957 33.696 1.00 30.39 ? 29   HOH A O     1 
HETATM 2419 O O     . HOH D 4 .   ? 16.288 7.376  42.312 1.00 23.93 ? 30   HOH A O     1 
HETATM 2420 O O     . HOH D 4 .   ? 1.206  19.282 36.921 1.00 26.84 ? 31   HOH A O     1 
HETATM 2421 O O     . HOH D 4 .   ? 8.011  14.500 32.548 1.00 42.67 ? 32   HOH A O     1 
HETATM 2422 O O     . HOH D 4 .   ? 26.860 11.491 42.483 1.00 36.55 ? 33   HOH A O     1 
HETATM 2423 O O     . HOH D 4 .   ? 16.020 10.404 67.594 1.00 31.11 ? 34   HOH A O     1 
HETATM 2424 O O     . HOH D 4 .   ? 21.459 41.899 26.285 1.00 29.09 ? 35   HOH A O     1 
HETATM 2425 O O     . HOH D 4 .   ? 18.492 9.954  68.741 1.00 33.40 ? 36   HOH A O     1 
HETATM 2426 O O     . HOH D 4 .   ? 6.597  16.223 56.219 1.00 52.42 ? 37   HOH A O     1 
HETATM 2427 O O     . HOH D 4 .   ? -2.101 20.541 39.799 1.00 31.64 ? 38   HOH A O     1 
HETATM 2428 O O     . HOH D 4 .   ? 12.508 32.800 36.316 1.00 25.89 ? 39   HOH A O     1 
HETATM 2429 O O     . HOH D 4 .   ? 8.498  30.990 38.113 1.00 25.67 ? 40   HOH A O     1 
HETATM 2430 O O     . HOH D 4 .   ? 15.184 18.895 68.516 1.00 40.91 ? 41   HOH A O     1 
HETATM 2431 O O     . HOH D 4 .   ? 7.785  5.814  54.761 1.00 35.37 ? 43   HOH A O     1 
HETATM 2432 O O     . HOH D 4 .   ? 19.506 45.472 25.833 1.00 30.04 ? 44   HOH A O     1 
HETATM 2433 O O     . HOH D 4 .   ? 17.722 8.373  29.609 1.00 39.92 ? 45   HOH A O     1 
HETATM 2434 O O     . HOH D 4 .   ? 5.664  19.223 40.690 1.00 30.95 ? 47   HOH A O     1 
HETATM 2435 O O     . HOH D 4 .   ? 43.007 33.486 38.592 1.00 36.20 ? 48   HOH A O     1 
HETATM 2436 O O     . HOH D 4 .   ? 12.056 38.191 39.710 1.00 37.31 ? 49   HOH A O     1 
HETATM 2437 O O     . HOH D 4 .   ? 12.933 6.960  39.622 1.00 34.19 ? 50   HOH A O     1 
HETATM 2438 O O     . HOH D 4 .   ? 21.443 15.806 66.124 1.00 38.62 ? 52   HOH A O     1 
HETATM 2439 O O     . HOH D 4 .   ? 13.432 24.781 60.537 1.00 41.23 ? 53   HOH A O     1 
HETATM 2440 O O     . HOH D 4 .   ? 13.350 35.437 35.840 1.00 29.54 ? 54   HOH A O     1 
HETATM 2441 O O     . HOH D 4 .   ? 4.164  19.389 27.476 1.00 41.74 ? 55   HOH A O     1 
HETATM 2442 O O     . HOH D 4 .   ? 31.249 20.911 34.186 1.00 27.10 ? 56   HOH A O     1 
HETATM 2443 O O     . HOH D 4 .   ? 19.746 28.049 17.447 1.00 39.48 ? 57   HOH A O     1 
HETATM 2444 O O     . HOH D 4 .   ? 42.843 30.393 38.039 1.00 47.83 ? 58   HOH A O     1 
HETATM 2445 O O     . HOH D 4 .   ? 31.592 27.673 64.845 1.00 43.83 ? 59   HOH A O     1 
HETATM 2446 O O     . HOH D 4 .   ? 12.318 19.740 48.429 1.00 38.12 ? 60   HOH A O     1 
HETATM 2447 O O     . HOH D 4 .   ? 12.451 8.944  41.374 1.00 40.43 ? 61   HOH A O     1 
HETATM 2448 O O     . HOH D 4 .   ? 4.219  26.852 44.487 1.00 38.88 ? 62   HOH A O     1 
HETATM 2449 O O     . HOH D 4 .   ? 26.219 10.703 38.752 1.00 28.12 ? 63   HOH A O     1 
HETATM 2450 O O     . HOH D 4 .   ? 7.405  34.791 33.154 1.00 34.07 ? 64   HOH A O     1 
HETATM 2451 O O     . HOH D 4 .   ? 11.515 26.327 56.838 1.00 31.08 ? 65   HOH A O     1 
HETATM 2452 O O     . HOH D 4 .   ? 17.297 33.563 52.871 1.00 43.41 ? 66   HOH A O     1 
HETATM 2453 O O     . HOH D 4 .   ? 24.267 8.457  44.546 1.00 38.80 ? 67   HOH A O     1 
HETATM 2454 O O     . HOH D 4 .   ? 11.432 4.072  48.149 1.00 35.05 ? 69   HOH A O     1 
HETATM 2455 O O     . HOH D 4 .   ? 10.772 11.020 40.667 1.00 37.02 ? 70   HOH A O     1 
HETATM 2456 O O     . HOH D 4 .   ? 24.997 3.953  44.283 1.00 43.64 ? 71   HOH A O     1 
HETATM 2457 O O     . HOH D 4 .   ? 23.451 6.060  35.463 1.00 45.73 ? 72   HOH A O     1 
HETATM 2458 O O     . HOH D 4 .   ? 32.220 14.620 38.020 1.00 37.33 ? 73   HOH A O     1 
HETATM 2459 O O     . HOH D 4 .   ? 13.693 1.406  44.713 1.00 48.16 ? 74   HOH A O     1 
HETATM 2460 O O     . HOH D 4 .   ? 22.511 6.538  30.501 1.00 42.94 ? 75   HOH A O     1 
HETATM 2461 O O     . HOH D 4 .   ? 24.836 42.218 33.193 1.00 32.38 ? 76   HOH A O     1 
HETATM 2462 O O     . HOH D 4 .   ? 25.981 28.233 22.712 1.00 29.46 ? 77   HOH A O     1 
HETATM 2463 O O     . HOH D 4 .   ? 32.320 22.917 23.374 1.00 48.86 ? 78   HOH A O     1 
HETATM 2464 O O     . HOH D 4 .   ? 16.510 12.998 29.553 1.00 34.25 ? 79   HOH A O     1 
HETATM 2465 O O     . HOH D 4 .   ? 45.514 30.182 32.390 1.00 44.39 ? 80   HOH A O     1 
HETATM 2466 O O     . HOH D 4 .   ? 18.649 0.766  42.899 1.00 47.59 ? 81   HOH A O     1 
HETATM 2467 O O     . HOH D 4 .   ? 26.554 14.855 54.851 1.00 30.76 ? 82   HOH A O     1 
HETATM 2468 O O     . HOH D 4 .   ? 6.818  22.741 55.460 1.00 45.68 ? 83   HOH A O     1 
HETATM 2469 O O     . HOH D 4 .   ? 24.057 29.805 21.544 1.00 35.34 ? 84   HOH A O     1 
HETATM 2470 O O     . HOH D 4 .   ? 24.932 7.469  37.185 1.00 46.73 ? 85   HOH A O     1 
HETATM 2471 O O     . HOH D 4 .   ? 27.606 30.708 22.713 1.00 35.85 ? 86   HOH A O     1 
HETATM 2472 O O     . HOH D 4 .   ? 26.976 23.102 51.189 1.00 39.11 ? 87   HOH A O     1 
HETATM 2473 O O     . HOH D 4 .   ? 9.637  10.018 38.354 1.00 35.11 ? 88   HOH A O     1 
HETATM 2474 O O     . HOH D 4 .   ? 12.916 -4.328 51.504 1.00 45.03 ? 89   HOH A O     1 
HETATM 2475 O O     . HOH D 4 .   ? 3.786  30.704 39.114 1.00 44.49 ? 90   HOH A O     1 
HETATM 2476 O O     . HOH D 4 .   ? 18.854 11.664 32.681 1.00 40.60 ? 91   HOH A O     1 
HETATM 2477 O O     . HOH D 4 .   ? 13.377 9.630  43.738 1.00 34.97 ? 92   HOH A O     1 
HETATM 2478 O O     . HOH D 4 .   ? 26.928 29.602 60.404 1.00 49.22 ? 93   HOH A O     1 
HETATM 2479 O O     . HOH D 4 .   ? 23.211 24.862 45.756 1.00 43.49 ? 94   HOH A O     1 
HETATM 2480 O O     . HOH D 4 .   ? 24.506 23.885 52.760 1.00 42.23 ? 95   HOH A O     1 
HETATM 2481 O O     . HOH D 4 .   ? 26.929 17.398 53.963 1.00 53.66 ? 97   HOH A O     1 
HETATM 2482 O O     . HOH D 4 .   ? 26.377 18.429 51.202 1.00 49.22 ? 98   HOH A O     1 
HETATM 2483 O O     . HOH D 4 .   ? 24.321 17.340 43.977 1.00 42.11 ? 100  HOH A O     1 
HETATM 2484 O O     . HOH D 4 .   ? 24.964 20.989 50.603 1.00 63.81 ? 101  HOH A O     1 
HETATM 2485 O O     . HOH D 4 .   ? 26.108 25.416 47.344 1.00 54.19 ? 102  HOH A O     1 
HETATM 2486 O O     . HOH D 4 .   ? 23.111 26.758 54.643 1.00 39.22 ? 103  HOH A O     1 
HETATM 2487 O O     . HOH D 4 .   ? 5.052  20.803 55.640 1.00 37.86 ? 104  HOH A O     1 
HETATM 2488 O O     . HOH D 4 .   ? 11.313 19.059 50.627 1.00 33.05 ? 105  HOH A O     1 
HETATM 2489 O O     . HOH D 4 .   ? 13.990 39.942 39.438 1.00 52.24 ? 106  HOH A O     1 
HETATM 2490 O O     . HOH D 4 .   ? 27.194 32.974 49.723 1.00 31.57 ? 107  HOH A O     1 
HETATM 2491 O O     . HOH D 4 .   ? 21.058 36.732 54.272 1.00 47.71 ? 108  HOH A O     1 
HETATM 2492 O O     . HOH D 4 .   ? 18.121 1.998  49.995 1.00 29.42 ? 109  HOH A O     1 
HETATM 2493 O O     . HOH D 4 .   ? 6.193  22.676 60.202 1.00 54.23 ? 110  HOH A O     1 
HETATM 2494 O O     . HOH D 4 .   ? 16.261 21.710 17.961 1.00 55.38 ? 111  HOH A O     1 
HETATM 2495 O O     . HOH D 4 .   ? 15.057 -4.883 50.272 1.00 39.14 ? 112  HOH A O     1 
HETATM 2496 O O     . HOH D 4 .   ? 27.054 43.687 34.078 1.00 36.69 ? 113  HOH A O     1 
HETATM 2497 O O     . HOH D 4 .   ? 12.294 11.767 33.039 1.00 35.68 ? 114  HOH A O     1 
HETATM 2498 O O     . HOH D 4 .   ? 15.067 21.595 67.590 1.00 37.18 ? 116  HOH A O     1 
HETATM 2499 O O     . HOH D 4 .   ? 32.656 21.284 36.411 1.00 45.07 ? 117  HOH A O     1 
HETATM 2500 O O     . HOH D 4 .   ? 20.381 40.057 37.939 1.00 41.60 ? 118  HOH A O     1 
HETATM 2501 O O     . HOH D 4 .   ? 29.326 1.277  52.677 1.00 45.29 ? 119  HOH A O     1 
HETATM 2502 O O     . HOH D 4 .   ? 33.859 27.702 25.719 1.00 39.14 ? 121  HOH A O     1 
HETATM 2503 O O     . HOH D 4 .   ? 16.017 3.348  34.593 1.00 39.15 ? 122  HOH A O     1 
HETATM 2504 O O     . HOH D 4 .   ? 23.977 5.637  32.473 1.00 42.29 ? 123  HOH A O     1 
HETATM 2505 O O     . HOH D 4 .   ? 23.155 30.578 18.925 1.00 43.77 ? 124  HOH A O     1 
HETATM 2506 O O     . HOH D 4 .   ? 25.217 31.856 22.671 1.00 37.23 ? 126  HOH A O     1 
HETATM 2507 O O     . HOH D 4 .   ? 2.659  22.591 41.848 1.00 43.18 ? 127  HOH A O     1 
HETATM 2508 O O     . HOH D 4 .   ? 27.050 30.876 62.822 1.00 43.57 ? 128  HOH A O     1 
HETATM 2509 O O     . HOH D 4 .   ? 34.139 39.714 54.500 1.00 42.22 ? 129  HOH A O     1 
HETATM 2510 O O     . HOH D 4 .   ? 9.664  22.256 61.236 1.00 43.83 ? 130  HOH A O     1 
HETATM 2511 O O     . HOH D 4 .   ? 12.664 13.436 71.519 1.00 43.94 ? 131  HOH A O     1 
HETATM 2512 O O     . HOH D 4 .   ? 20.327 41.282 49.889 1.00 45.31 ? 132  HOH A O     1 
HETATM 2513 O O     . HOH D 4 .   ? 31.509 37.374 48.793 1.00 46.23 ? 133  HOH A O     1 
HETATM 2514 O O     . HOH D 4 .   ? 9.354  13.811 58.712 1.00 43.10 ? 134  HOH A O     1 
HETATM 2515 O O     . HOH D 4 .   ? 8.605  7.368  47.689 1.00 46.66 ? 135  HOH A O     1 
HETATM 2516 O O     . HOH D 4 .   ? 5.029  33.683 31.890 1.00 48.57 ? 136  HOH A O     1 
HETATM 2517 O O     . HOH D 4 .   ? 35.485 27.292 21.198 1.00 46.51 ? 137  HOH A O     1 
HETATM 2518 O O     . HOH D 4 .   ? 8.022  34.150 35.973 1.00 46.38 ? 138  HOH A O     1 
HETATM 2519 O O     . HOH D 4 .   ? 18.323 44.117 35.949 1.00 43.47 ? 139  HOH A O     1 
HETATM 2520 O O     . HOH D 4 .   ? 12.199 3.278  45.740 1.00 43.53 ? 140  HOH A O     1 
HETATM 2521 O O     . HOH D 4 .   ? 11.674 38.458 29.581 1.00 48.58 ? 141  HOH A O     1 
HETATM 2522 O O     . HOH D 4 .   ? 21.078 19.793 55.157 1.00 41.59 ? 142  HOH A O     1 
HETATM 2523 O O     . HOH D 4 .   ? 25.520 45.197 36.030 1.00 42.70 ? 143  HOH A O     1 
HETATM 2524 O O     . HOH D 4 .   ? 24.067 -2.119 57.839 1.00 47.84 ? 144  HOH A O     1 
HETATM 2525 O O     . HOH D 4 .   ? 13.817 1.093  42.142 1.00 45.12 ? 145  HOH A O     1 
HETATM 2526 O O     . HOH D 4 .   ? 22.117 7.414  63.254 1.00 36.34 ? 146  HOH A O     1 
HETATM 2527 O O     . HOH D 4 .   ? 16.334 10.543 72.822 1.00 43.60 ? 147  HOH A O     1 
HETATM 2528 O O     . HOH D 4 .   ? 38.999 24.750 33.957 1.00 59.12 ? 148  HOH A O     1 
HETATM 2529 O O     . HOH D 4 .   ? 18.797 11.077 71.789 1.00 37.85 ? 149  HOH A O     1 
HETATM 2530 O O     . HOH D 4 .   ? 8.548  12.865 55.304 1.00 35.43 ? 150  HOH A O     1 
HETATM 2531 O O     . HOH D 4 .   ? 4.308  6.026  56.071 1.00 49.56 ? 151  HOH A O     1 
HETATM 2532 O O     . HOH D 4 .   ? 5.097  23.151 50.408 1.00 56.67 ? 152  HOH A O     1 
HETATM 2533 O O     . HOH D 4 .   ? 14.236 5.016  45.399 1.00 36.39 ? 153  HOH A O     1 
HETATM 2534 O O     . HOH D 4 .   ? 13.623 7.565  45.484 1.00 45.30 ? 154  HOH A O     1 
HETATM 2535 O O     . HOH D 4 .   ? 18.351 10.762 30.241 1.00 37.76 ? 155  HOH A O     1 
HETATM 2536 O O     . HOH D 4 .   ? 14.282 39.792 49.638 1.00 44.76 ? 156  HOH A O     1 
HETATM 2537 O O     . HOH D 4 .   ? 20.304 30.492 18.431 1.00 34.66 ? 157  HOH A O     1 
HETATM 2538 O O     . HOH D 4 .   ? 28.549 22.226 45.041 1.00 43.12 ? 158  HOH A O     1 
HETATM 2539 O O     . HOH D 4 .   ? 8.058  20.451 52.200 1.00 55.46 ? 159  HOH A O     1 
HETATM 2540 O O     . HOH D 4 .   ? 41.352 32.088 42.084 1.00 52.59 ? 160  HOH A O     1 
HETATM 2541 O O     . HOH D 4 .   ? 25.927 18.489 45.653 1.00 60.51 ? 164  HOH A O     1 
HETATM 2542 O O     . HOH E 4 .   ? 36.625 28.028 38.866 1.00 28.39 ? 27   HOH B O     1 
HETATM 2543 O O     . HOH E 4 .   ? 33.849 28.516 39.086 1.00 22.93 ? 42   HOH B O     1 
HETATM 2544 O O     . HOH E 4 .   ? 36.441 34.000 51.717 1.00 74.17 ? 51   HOH B O     1 
HETATM 2545 O O     . HOH E 4 .   ? 29.721 25.703 49.289 1.00 62.96 ? 96   HOH B O     1 
HETATM 2546 O O     . HOH E 4 .   ? 31.721 19.360 40.533 1.00 37.77 ? 99   HOH B O     1 
HETATM 2547 O O     . HOH E 4 .   ? 39.847 31.335 45.674 1.00 41.98 ? 115  HOH B O     1 
HETATM 2548 O O     . HOH E 4 .   ? 35.930 24.489 44.770 1.00 44.28 ? 125  HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   VAL 1   958  958  VAL VAL A . n 
A 1 2   PRO 2   959  959  PRO PRO A . n 
A 1 3   ASP 3   960  960  ASP ASP A . n 
A 1 4   GLU 4   961  961  GLU GLU A . n 
A 1 5   TRP 5   962  962  TRP TRP A . n 
A 1 6   GLU 6   963  963  GLU GLU A . n 
A 1 7   VAL 7   964  964  VAL VAL A . n 
A 1 8   ALA 8   965  965  ALA ALA A . n 
A 1 9   ARG 9   966  966  ARG ARG A . n 
A 1 10  GLU 10  967  967  GLU GLU A . n 
A 1 11  LYS 11  968  968  LYS LYS A . n 
A 1 12  ILE 12  969  969  ILE ILE A . n 
A 1 13  THR 13  970  970  THR THR A . n 
A 1 14  MET 14  971  971  MET MET A . n 
A 1 15  SER 15  972  972  SER SER A . n 
A 1 16  ARG 16  973  973  ARG ARG A . n 
A 1 17  GLU 17  974  974  GLU GLU A . n 
A 1 18  LEU 18  975  975  LEU LEU A . n 
A 1 19  GLY 19  976  976  GLY GLY A . n 
A 1 20  GLN 20  977  977  GLN GLN A . n 
A 1 21  GLY 21  978  978  GLY GLY A . n 
A 1 22  SER 22  979  979  SER SER A . n 
A 1 23  PHE 23  980  980  PHE PHE A . n 
A 1 24  GLY 24  981  981  GLY GLY A . n 
A 1 25  MET 25  982  982  MET MET A . n 
A 1 26  VAL 26  983  983  VAL VAL A . n 
A 1 27  TYR 27  984  984  TYR TYR A . n 
A 1 28  GLU 28  985  985  GLU GLU A . n 
A 1 29  GLY 29  986  986  GLY GLY A . n 
A 1 30  VAL 30  987  987  VAL VAL A . n 
A 1 31  ALA 31  988  988  ALA ALA A . n 
A 1 32  LYS 32  989  989  LYS LYS A . n 
A 1 33  GLY 33  990  990  GLY GLY A . n 
A 1 34  VAL 34  991  991  VAL VAL A . n 
A 1 35  VAL 35  992  992  VAL VAL A . n 
A 1 36  LYS 36  993  993  LYS LYS A . n 
A 1 37  ASP 37  994  994  ASP ASP A . n 
A 1 38  GLU 38  995  995  GLU GLU A . n 
A 1 39  PRO 39  996  996  PRO PRO A . n 
A 1 40  GLU 40  997  997  GLU GLU A . n 
A 1 41  THR 41  998  998  THR THR A . n 
A 1 42  ARG 42  999  999  ARG ARG A . n 
A 1 43  VAL 43  1000 1000 VAL VAL A . n 
A 1 44  ALA 44  1001 1001 ALA ALA A . n 
A 1 45  ILE 45  1002 1002 ILE ILE A . n 
A 1 46  LYS 46  1003 1003 LYS LYS A . n 
A 1 47  THR 47  1004 1004 THR THR A . n 
A 1 48  VAL 48  1005 1005 VAL VAL A . n 
A 1 49  ASN 49  1006 1006 ASN ASN A . n 
A 1 50  GLU 50  1007 1007 GLU GLU A . n 
A 1 51  ALA 51  1008 1008 ALA ALA A . n 
A 1 52  ALA 52  1009 1009 ALA ALA A . n 
A 1 53  SER 53  1010 1010 SER SER A . n 
A 1 54  MET 54  1011 1011 MET MET A . n 
A 1 55  ARG 55  1012 1012 ARG ARG A . n 
A 1 56  GLU 56  1013 1013 GLU GLU A . n 
A 1 57  ARG 57  1014 1014 ARG ARG A . n 
A 1 58  ILE 58  1015 1015 ILE ILE A . n 
A 1 59  GLU 59  1016 1016 GLU GLU A . n 
A 1 60  PHE 60  1017 1017 PHE PHE A . n 
A 1 61  LEU 61  1018 1018 LEU LEU A . n 
A 1 62  ASN 62  1019 1019 ASN ASN A . n 
A 1 63  GLU 63  1020 1020 GLU GLU A . n 
A 1 64  ALA 64  1021 1021 ALA ALA A . n 
A 1 65  SER 65  1022 1022 SER SER A . n 
A 1 66  VAL 66  1023 1023 VAL VAL A . n 
A 1 67  MET 67  1024 1024 MET MET A . n 
A 1 68  LYS 68  1025 1025 LYS LYS A . n 
A 1 69  GLU 69  1026 1026 GLU GLU A . n 
A 1 70  PHE 70  1027 1027 PHE PHE A . n 
A 1 71  ASN 71  1028 1028 ASN ASN A . n 
A 1 72  CYS 72  1029 1029 CYS CYS A . n 
A 1 73  HIS 73  1030 1030 HIS HIS A . n 
A 1 74  HIS 74  1031 1031 HIS HIS A . n 
A 1 75  VAL 75  1032 1032 VAL VAL A . n 
A 1 76  VAL 76  1033 1033 VAL VAL A . n 
A 1 77  ARG 77  1034 1034 ARG ARG A . n 
A 1 78  LEU 78  1035 1035 LEU LEU A . n 
A 1 79  LEU 79  1036 1036 LEU LEU A . n 
A 1 80  GLY 80  1037 1037 GLY GLY A . n 
A 1 81  VAL 81  1038 1038 VAL VAL A . n 
A 1 82  VAL 82  1039 1039 VAL VAL A . n 
A 1 83  SER 83  1040 1040 SER SER A . n 
A 1 84  GLN 84  1041 1041 GLN GLN A . n 
A 1 85  GLY 85  1042 1042 GLY GLY A . n 
A 1 86  GLN 86  1043 1043 GLN GLN A . n 
A 1 87  PRO 87  1044 1044 PRO PRO A . n 
A 1 88  THR 88  1045 1045 THR THR A . n 
A 1 89  LEU 89  1046 1046 LEU LEU A . n 
A 1 90  VAL 90  1047 1047 VAL VAL A . n 
A 1 91  ILE 91  1048 1048 ILE ILE A . n 
A 1 92  MET 92  1049 1049 MET MET A . n 
A 1 93  GLU 93  1050 1050 GLU GLU A . n 
A 1 94  LEU 94  1051 1051 LEU LEU A . n 
A 1 95  MET 95  1052 1052 MET MET A . n 
A 1 96  THR 96  1053 1053 THR THR A . n 
A 1 97  ARG 97  1054 1054 ARG ARG A . n 
A 1 98  GLY 98  1055 1055 GLY GLY A . n 
A 1 99  ASP 99  1056 1056 ASP ASP A . n 
A 1 100 LEU 100 1057 1057 LEU LEU A . n 
A 1 101 LYS 101 1058 1058 LYS LYS A . n 
A 1 102 SER 102 1059 1059 SER SER A . n 
A 1 103 TYR 103 1060 1060 TYR TYR A . n 
A 1 104 LEU 104 1061 1061 LEU LEU A . n 
A 1 105 ARG 105 1062 1062 ARG ARG A . n 
A 1 106 SER 106 1063 1063 SER SER A . n 
A 1 107 LEU 107 1064 1064 LEU LEU A . n 
A 1 108 ARG 108 1065 1065 ARG ARG A . n 
A 1 109 PRO 109 1066 1066 PRO PRO A . n 
A 1 110 GLU 110 1067 1067 GLU GLU A . n 
A 1 111 MET 111 1068 1068 MET MET A . n 
A 1 112 GLU 112 1069 ?    ?   ?   A . n 
A 1 113 ASN 113 1070 ?    ?   ?   A . n 
A 1 114 ASN 114 1071 ?    ?   ?   A . n 
A 1 115 PRO 115 1072 ?    ?   ?   A . n 
A 1 116 VAL 116 1073 ?    ?   ?   A . n 
A 1 117 LEU 117 1074 ?    ?   ?   A . n 
A 1 118 ALA 118 1075 ?    ?   ?   A . n 
A 1 119 PRO 119 1076 ?    ?   ?   A . n 
A 1 120 PRO 120 1077 1077 PRO PRO A . n 
A 1 121 SER 121 1078 1078 SER SER A . n 
A 1 122 LEU 122 1079 1079 LEU LEU A . n 
A 1 123 SER 123 1080 1080 SER SER A . n 
A 1 124 LYS 124 1081 1081 LYS LYS A . n 
A 1 125 MET 125 1082 1082 MET MET A . n 
A 1 126 ILE 126 1083 1083 ILE ILE A . n 
A 1 127 GLN 127 1084 1084 GLN GLN A . n 
A 1 128 MET 128 1085 1085 MET MET A . n 
A 1 129 ALA 129 1086 1086 ALA ALA A . n 
A 1 130 GLY 130 1087 1087 GLY GLY A . n 
A 1 131 GLU 131 1088 1088 GLU GLU A . n 
A 1 132 ILE 132 1089 1089 ILE ILE A . n 
A 1 133 ALA 133 1090 1090 ALA ALA A . n 
A 1 134 ASP 134 1091 1091 ASP ASP A . n 
A 1 135 GLY 135 1092 1092 GLY GLY A . n 
A 1 136 MET 136 1093 1093 MET MET A . n 
A 1 137 ALA 137 1094 1094 ALA ALA A . n 
A 1 138 TYR 138 1095 1095 TYR TYR A . n 
A 1 139 LEU 139 1096 1096 LEU LEU A . n 
A 1 140 ASN 140 1097 1097 ASN ASN A . n 
A 1 141 ALA 141 1098 1098 ALA ALA A . n 
A 1 142 ASN 142 1099 1099 ASN ASN A . n 
A 1 143 LYS 143 1100 1100 LYS LYS A . n 
A 1 144 PHE 144 1101 1101 PHE PHE A . n 
A 1 145 VAL 145 1102 1102 VAL VAL A . n 
A 1 146 HIS 146 1103 1103 HIS HIS A . n 
A 1 147 ARG 147 1104 1104 ARG ARG A . n 
A 1 148 ASP 148 1105 1105 ASP ASP A . n 
A 1 149 LEU 149 1106 1106 LEU LEU A . n 
A 1 150 ALA 150 1107 1107 ALA ALA A . n 
A 1 151 ALA 151 1108 1108 ALA ALA A . n 
A 1 152 ARG 152 1109 1109 ARG ARG A . n 
A 1 153 ASN 153 1110 1110 ASN ASN A . n 
A 1 154 CYS 154 1111 1111 CYS CYS A . n 
A 1 155 MET 155 1112 1112 MET MET A . n 
A 1 156 VAL 156 1113 1113 VAL VAL A . n 
A 1 157 ALA 157 1114 1114 ALA ALA A . n 
A 1 158 GLU 158 1115 1115 GLU GLU A . n 
A 1 159 ASP 159 1116 1116 ASP ASP A . n 
A 1 160 PHE 160 1117 1117 PHE PHE A . n 
A 1 161 THR 161 1118 1118 THR THR A . n 
A 1 162 VAL 162 1119 1119 VAL VAL A . n 
A 1 163 LYS 163 1120 1120 LYS LYS A . n 
A 1 164 ILE 164 1121 1121 ILE ILE A . n 
A 1 165 GLY 165 1122 1122 GLY GLY A . n 
A 1 166 ASP 166 1123 1123 ASP ASP A . n 
A 1 167 PHE 167 1124 1124 PHE PHE A . n 
A 1 168 GLY 168 1125 1125 GLY GLY A . n 
A 1 169 MET 169 1126 1126 MET MET A . n 
A 1 170 THR 170 1127 1127 THR THR A . n 
A 1 171 ARG 171 1128 1128 ARG ARG A . n 
A 1 172 ASP 172 1129 1129 ASP ASP A . n 
A 1 173 ILE 173 1130 1130 ILE ILE A . n 
A 1 174 PTR 174 1131 1131 PTR PTR A . n 
A 1 175 GLU 175 1132 1132 GLU GLU A . n 
A 1 176 THR 176 1133 1133 THR THR A . n 
A 1 177 ASP 177 1134 1134 ASP ASP A . n 
A 1 178 PTR 178 1135 1135 PTR PTR A . n 
A 1 179 PTR 179 1136 1136 PTR PTR A . n 
A 1 180 ARG 180 1137 1137 ARG ARG A . n 
A 1 181 LYS 181 1138 1138 LYS LYS A . n 
A 1 182 GLY 182 1139 1139 GLY GLY A . n 
A 1 183 GLY 183 1140 1140 GLY GLY A . n 
A 1 184 LYS 184 1141 1141 LYS LYS A . n 
A 1 185 GLY 185 1142 1142 GLY GLY A . n 
A 1 186 LEU 186 1143 1143 LEU LEU A . n 
A 1 187 LEU 187 1144 1144 LEU LEU A . n 
A 1 188 PRO 188 1145 1145 PRO PRO A . n 
A 1 189 VAL 189 1146 1146 VAL VAL A . n 
A 1 190 ARG 190 1147 1147 ARG ARG A . n 
A 1 191 TRP 191 1148 1148 TRP TRP A . n 
A 1 192 MET 192 1149 1149 MET MET A . n 
A 1 193 SER 193 1150 1150 SER SER A . n 
A 1 194 PRO 194 1151 1151 PRO PRO A . n 
A 1 195 GLU 195 1152 1152 GLU GLU A . n 
A 1 196 SER 196 1153 1153 SER SER A . n 
A 1 197 LEU 197 1154 1154 LEU LEU A . n 
A 1 198 LYS 198 1155 1155 LYS LYS A . n 
A 1 199 ASP 199 1156 1156 ASP ASP A . n 
A 1 200 GLY 200 1157 1157 GLY GLY A . n 
A 1 201 VAL 201 1158 1158 VAL VAL A . n 
A 1 202 PHE 202 1159 1159 PHE PHE A . n 
A 1 203 THR 203 1160 1160 THR THR A . n 
A 1 204 THR 204 1161 1161 THR THR A . n 
A 1 205 TYR 205 1162 1162 TYR TYR A . n 
A 1 206 SER 206 1163 1163 SER SER A . n 
A 1 207 ASP 207 1164 1164 ASP ASP A . n 
A 1 208 VAL 208 1165 1165 VAL VAL A . n 
A 1 209 TRP 209 1166 1166 TRP TRP A . n 
A 1 210 SER 210 1167 1167 SER SER A . n 
A 1 211 PHE 211 1168 1168 PHE PHE A . n 
A 1 212 GLY 212 1169 1169 GLY GLY A . n 
A 1 213 VAL 213 1170 1170 VAL VAL A . n 
A 1 214 VAL 214 1171 1171 VAL VAL A . n 
A 1 215 LEU 215 1172 1172 LEU LEU A . n 
A 1 216 TRP 216 1173 1173 TRP TRP A . n 
A 1 217 GLU 217 1174 1174 GLU GLU A . n 
A 1 218 ILE 218 1175 1175 ILE ILE A . n 
A 1 219 ALA 219 1176 1176 ALA ALA A . n 
A 1 220 THR 220 1177 1177 THR THR A . n 
A 1 221 LEU 221 1178 1178 LEU LEU A . n 
A 1 222 ALA 222 1179 1179 ALA ALA A . n 
A 1 223 GLU 223 1180 1180 GLU GLU A . n 
A 1 224 GLN 224 1181 1181 GLN GLN A . n 
A 1 225 PRO 225 1182 1182 PRO PRO A . n 
A 1 226 TYR 226 1183 1183 TYR TYR A . n 
A 1 227 GLN 227 1184 1184 GLN GLN A . n 
A 1 228 GLY 228 1185 1185 GLY GLY A . n 
A 1 229 LEU 229 1186 1186 LEU LEU A . n 
A 1 230 SER 230 1187 1187 SER SER A . n 
A 1 231 ASN 231 1188 1188 ASN ASN A . n 
A 1 232 GLU 232 1189 1189 GLU GLU A . n 
A 1 233 GLN 233 1190 1190 GLN GLN A . n 
A 1 234 VAL 234 1191 1191 VAL VAL A . n 
A 1 235 LEU 235 1192 1192 LEU LEU A . n 
A 1 236 ARG 236 1193 1193 ARG ARG A . n 
A 1 237 PHE 237 1194 1194 PHE PHE A . n 
A 1 238 VAL 238 1195 1195 VAL VAL A . n 
A 1 239 MET 239 1196 1196 MET MET A . n 
A 1 240 GLU 240 1197 1197 GLU GLU A . n 
A 1 241 GLY 241 1198 1198 GLY GLY A . n 
A 1 242 GLY 242 1199 1199 GLY GLY A . n 
A 1 243 LEU 243 1200 1200 LEU LEU A . n 
A 1 244 LEU 244 1201 1201 LEU LEU A . n 
A 1 245 ASP 245 1202 1202 ASP ASP A . n 
A 1 246 LYS 246 1203 1203 LYS LYS A . n 
A 1 247 PRO 247 1204 1204 PRO PRO A . n 
A 1 248 ASP 248 1205 1205 ASP ASP A . n 
A 1 249 ASN 249 1206 1206 ASN ASN A . n 
A 1 250 CYS 250 1207 1207 CYS CYS A . n 
A 1 251 PRO 251 1208 1208 PRO PRO A . n 
A 1 252 ASP 252 1209 1209 ASP ASP A . n 
A 1 253 MET 253 1210 1210 MET MET A . n 
A 1 254 LEU 254 1211 1211 LEU LEU A . n 
A 1 255 LEU 255 1212 1212 LEU LEU A . n 
A 1 256 GLU 256 1213 1213 GLU GLU A . n 
A 1 257 LEU 257 1214 1214 LEU LEU A . n 
A 1 258 MET 258 1215 1215 MET MET A . n 
A 1 259 ARG 259 1216 1216 ARG ARG A . n 
A 1 260 MET 260 1217 1217 MET MET A . n 
A 1 261 CYS 261 1218 1218 CYS CYS A . n 
A 1 262 TRP 262 1219 1219 TRP TRP A . n 
A 1 263 GLN 263 1220 1220 GLN GLN A . n 
A 1 264 TYR 264 1221 1221 TYR TYR A . n 
A 1 265 ASN 265 1222 1222 ASN ASN A . n 
A 1 266 PRO 266 1223 1223 PRO PRO A . n 
A 1 267 LYS 267 1224 1224 LYS LYS A . n 
A 1 268 MET 268 1225 1225 MET MET A . n 
A 1 269 ARG 269 1226 1226 ARG ARG A . n 
A 1 270 PRO 270 1227 1227 PRO PRO A . n 
A 1 271 SER 271 1228 1228 SER SER A . n 
A 1 272 PHE 272 1229 1229 PHE PHE A . n 
A 1 273 LEU 273 1230 1230 LEU LEU A . n 
A 1 274 GLU 274 1231 1231 GLU GLU A . n 
A 1 275 ILE 275 1232 1232 ILE ILE A . n 
A 1 276 ILE 276 1233 1233 ILE ILE A . n 
A 1 277 SER 277 1234 1234 SER SER A . n 
A 1 278 SER 278 1235 1235 SER SER A . n 
A 1 279 ILE 279 1236 1236 ILE ILE A . n 
A 1 280 LYS 280 1237 1237 LYS LYS A . n 
A 1 281 GLU 281 1238 1238 GLU GLU A . n 
A 1 282 GLU 282 1239 1239 GLU GLU A . n 
A 1 283 MET 283 1240 1240 MET MET A . n 
A 1 284 GLU 284 1241 1241 GLU GLU A . n 
A 1 285 PRO 285 1242 1242 PRO PRO A . n 
A 1 286 GLY 286 1243 1243 GLY GLY A . n 
A 1 287 PHE 287 1244 1244 PHE PHE A . n 
A 1 288 ARG 288 1245 1245 ARG ARG A . n 
A 1 289 GLU 289 1246 1246 GLU GLU A . n 
A 1 290 VAL 290 1247 1247 VAL VAL A . n 
A 1 291 SER 291 1248 1248 SER SER A . n 
A 1 292 PHE 292 1249 1249 PHE PHE A . n 
A 1 293 TYR 293 1250 1250 TYR TYR A . n 
A 1 294 TYR 294 1251 1251 TYR TYR A . n 
A 1 295 SER 295 1252 1252 SER SER A . n 
A 1 296 GLU 296 1253 1253 GLU GLU A . n 
A 1 297 GLU 297 1254 1254 GLU GLU A . n 
A 1 298 ASN 298 1255 1255 ASN ASN A . n 
A 1 299 LYS 299 1256 1256 LYS LYS A . n 
B 2 1   LYS 1   1    ?    ?   ?   B . n 
B 2 2   LYS 2   2    ?    ?   ?   B . n 
B 2 3   LYS 3   3    ?    ?   ?   B . n 
B 2 4   SER 4   4    ?    ?   ?   B . n 
B 2 5   PRO 5   5    ?    ?   ?   B . n 
B 2 6   GLY 6   6    6    GLY GLY B . n 
B 2 7   GLU 7   7    7    GLU GLU B . n 
B 2 8   TYR 8   8    8    TYR TYR B . n 
B 2 9   VAL 9   9    9    VAL VAL B . n 
B 2 10  ASN 10  10   10   ASN ASN B . n 
B 2 11  ILE 11  11   11   ILE ILE B . n 
B 2 12  GLU 12  12   12   GLU GLU B . n 
B 2 13  PHE 13  13   13   PHE PHE B . n 
B 2 14  GLY 14  14   ?    ?   ?   B . n 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A PTR 174 A PTR 1131 ? TYR O-PHOSPHOTYROSINE 
2 A PTR 178 A PTR 1135 ? TYR O-PHOSPHOTYROSINE 
3 A PTR 179 A PTR 1136 ? TYR O-PHOSPHOTYROSINE 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2010  ? 
1 MORE         -5    ? 
1 'SSA (A^2)'  14630 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2001-11-28 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
AMoRE     phasing          .   ? 1 
CNS       refinement       1.0 ? 2 
DENZO     'data reduction' .   ? 3 
SCALEPACK 'data scaling'   .   ? 4 
# 
_pdbx_database_remark.id     999 
_pdbx_database_remark.text   
;SEQUENCE
THE RESIDUE CORRESPONDS TO RESIDUE FROM
A SYNTHETIC PEPTIDE. IT WAS ADDED TO
MODIFY THE SEQUENCE TO BE SUITABLE FOR
ACTIVITY ASSAYS
;
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 GLU A 1007 ? ? -59.71  -9.63  
2 1 ARG A 1104 ? ? 72.95   -10.46 
3 1 ASP A 1105 ? ? -140.89 42.16  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 993  ? CG  ? A LYS 36  CG  
2  1 Y 1 A LYS 993  ? CD  ? A LYS 36  CD  
3  1 Y 1 A LYS 993  ? CE  ? A LYS 36  CE  
4  1 Y 1 A LYS 993  ? NZ  ? A LYS 36  NZ  
5  1 Y 1 A ASN 1006 ? CG  ? A ASN 49  CG  
6  1 Y 1 A ASN 1006 ? OD1 ? A ASN 49  OD1 
7  1 Y 1 A ASN 1006 ? ND2 ? A ASN 49  ND2 
8  1 Y 1 A GLU 1007 ? CG  ? A GLU 50  CG  
9  1 Y 1 A GLU 1007 ? CD  ? A GLU 50  CD  
10 1 Y 1 A GLU 1007 ? OE1 ? A GLU 50  OE1 
11 1 Y 1 A GLU 1007 ? OE2 ? A GLU 50  OE2 
12 1 Y 1 A ARG 1012 ? CG  ? A ARG 55  CG  
13 1 Y 1 A ARG 1012 ? CD  ? A ARG 55  CD  
14 1 Y 1 A ARG 1012 ? NE  ? A ARG 55  NE  
15 1 Y 1 A ARG 1012 ? CZ  ? A ARG 55  CZ  
16 1 Y 1 A ARG 1012 ? NH1 ? A ARG 55  NH1 
17 1 Y 1 A ARG 1012 ? NH2 ? A ARG 55  NH2 
18 1 Y 1 A GLU 1067 ? CB  ? A GLU 110 CB  
19 1 Y 1 A GLU 1067 ? CG  ? A GLU 110 CG  
20 1 Y 1 A GLU 1067 ? CD  ? A GLU 110 CD  
21 1 Y 1 A GLU 1067 ? OE1 ? A GLU 110 OE1 
22 1 Y 1 A GLU 1067 ? OE2 ? A GLU 110 OE2 
23 1 Y 1 A MET 1068 ? CB  ? A MET 111 CB  
24 1 Y 1 A MET 1068 ? CG  ? A MET 111 CG  
25 1 Y 1 A MET 1068 ? SD  ? A MET 111 SD  
26 1 Y 1 A MET 1068 ? CE  ? A MET 111 CE  
27 1 Y 1 A LEU 1079 ? CG  ? A LEU 122 CG  
28 1 Y 1 A LEU 1079 ? CD1 ? A LEU 122 CD1 
29 1 Y 1 A LEU 1079 ? CD2 ? A LEU 122 CD2 
30 1 Y 1 A LYS 1081 ? CG  ? A LYS 124 CG  
31 1 Y 1 A LYS 1081 ? CD  ? A LYS 124 CD  
32 1 Y 1 A LYS 1081 ? CE  ? A LYS 124 CE  
33 1 Y 1 A LYS 1081 ? NZ  ? A LYS 124 NZ  
34 1 Y 1 A GLU 1132 ? CG  ? A GLU 175 CG  
35 1 Y 1 A GLU 1132 ? CD  ? A GLU 175 CD  
36 1 Y 1 A GLU 1132 ? OE1 ? A GLU 175 OE1 
37 1 Y 1 A GLU 1132 ? OE2 ? A GLU 175 OE2 
38 1 Y 1 A LYS 1224 ? CG  ? A LYS 267 CG  
39 1 Y 1 A LYS 1224 ? CD  ? A LYS 267 CD  
40 1 Y 1 A LYS 1224 ? CE  ? A LYS 267 CE  
41 1 Y 1 A LYS 1224 ? NZ  ? A LYS 267 NZ  
42 1 Y 1 A GLU 1238 ? CG  ? A GLU 281 CG  
43 1 Y 1 A GLU 1238 ? CD  ? A GLU 281 CD  
44 1 Y 1 A GLU 1238 ? OE1 ? A GLU 281 OE1 
45 1 Y 1 A GLU 1238 ? OE2 ? A GLU 281 OE2 
46 1 Y 1 A LYS 1256 ? CG  ? A LYS 299 CG  
47 1 Y 1 A LYS 1256 ? CD  ? A LYS 299 CD  
48 1 Y 1 A LYS 1256 ? CE  ? A LYS 299 CE  
49 1 Y 1 A LYS 1256 ? NZ  ? A LYS 299 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLU 1069 ? A GLU 112 
2  1 Y 1 A ASN 1070 ? A ASN 113 
3  1 Y 1 A ASN 1071 ? A ASN 114 
4  1 Y 1 A PRO 1072 ? A PRO 115 
5  1 Y 1 A VAL 1073 ? A VAL 116 
6  1 Y 1 A LEU 1074 ? A LEU 117 
7  1 Y 1 A ALA 1075 ? A ALA 118 
8  1 Y 1 A PRO 1076 ? A PRO 119 
9  1 Y 1 B LYS 1    ? B LYS 1   
10 1 Y 1 B LYS 2    ? B LYS 2   
11 1 Y 1 B LYS 3    ? B LYS 3   
12 1 Y 1 B SER 4    ? B SER 4   
13 1 Y 1 B PRO 5    ? B PRO 5   
14 1 Y 1 B GLY 14   ? B GLY 14  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'PHOSPHOMETHYLPHOSPHONIC ACID ADENYLATE ESTER' ACP 
4 water                                          HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 ACP 1   300 300 ACP ACP A . 
D 4 HOH 1   1   1   HOH HOH A . 
D 4 HOH 2   2   2   HOH HOH A . 
D 4 HOH 3   3   3   HOH HOH A . 
D 4 HOH 4   4   4   HOH HOH A . 
D 4 HOH 5   5   5   HOH HOH A . 
D 4 HOH 6   6   6   HOH HOH A . 
D 4 HOH 7   7   7   HOH HOH A . 
D 4 HOH 8   8   8   HOH HOH A . 
D 4 HOH 9   9   9   HOH HOH A . 
D 4 HOH 10  10  10  HOH HOH A . 
D 4 HOH 11  11  11  HOH HOH A . 
D 4 HOH 12  12  12  HOH HOH A . 
D 4 HOH 13  13  13  HOH HOH A . 
D 4 HOH 14  14  14  HOH HOH A . 
D 4 HOH 15  15  15  HOH HOH A . 
D 4 HOH 16  16  16  HOH HOH A . 
D 4 HOH 17  17  17  HOH HOH A . 
D 4 HOH 18  18  18  HOH HOH A . 
D 4 HOH 19  19  19  HOH HOH A . 
D 4 HOH 20  20  20  HOH HOH A . 
D 4 HOH 21  21  21  HOH HOH A . 
D 4 HOH 22  22  22  HOH HOH A . 
D 4 HOH 23  23  23  HOH HOH A . 
D 4 HOH 24  24  24  HOH HOH A . 
D 4 HOH 25  25  25  HOH HOH A . 
D 4 HOH 26  26  26  HOH HOH A . 
D 4 HOH 27  28  28  HOH HOH A . 
D 4 HOH 28  29  29  HOH HOH A . 
D 4 HOH 29  30  30  HOH HOH A . 
D 4 HOH 30  31  31  HOH HOH A . 
D 4 HOH 31  32  32  HOH HOH A . 
D 4 HOH 32  33  33  HOH HOH A . 
D 4 HOH 33  34  34  HOH HOH A . 
D 4 HOH 34  35  35  HOH HOH A . 
D 4 HOH 35  36  36  HOH HOH A . 
D 4 HOH 36  37  37  HOH HOH A . 
D 4 HOH 37  38  38  HOH HOH A . 
D 4 HOH 38  39  39  HOH HOH A . 
D 4 HOH 39  40  40  HOH HOH A . 
D 4 HOH 40  41  41  HOH HOH A . 
D 4 HOH 41  43  43  HOH HOH A . 
D 4 HOH 42  44  44  HOH HOH A . 
D 4 HOH 43  45  45  HOH HOH A . 
D 4 HOH 44  47  47  HOH HOH A . 
D 4 HOH 45  48  48  HOH HOH A . 
D 4 HOH 46  49  49  HOH HOH A . 
D 4 HOH 47  50  50  HOH HOH A . 
D 4 HOH 48  52  52  HOH HOH A . 
D 4 HOH 49  53  53  HOH HOH A . 
D 4 HOH 50  54  54  HOH HOH A . 
D 4 HOH 51  55  55  HOH HOH A . 
D 4 HOH 52  56  56  HOH HOH A . 
D 4 HOH 53  57  57  HOH HOH A . 
D 4 HOH 54  58  58  HOH HOH A . 
D 4 HOH 55  59  59  HOH HOH A . 
D 4 HOH 56  60  60  HOH HOH A . 
D 4 HOH 57  61  61  HOH HOH A . 
D 4 HOH 58  62  62  HOH HOH A . 
D 4 HOH 59  63  63  HOH HOH A . 
D 4 HOH 60  64  64  HOH HOH A . 
D 4 HOH 61  65  65  HOH HOH A . 
D 4 HOH 62  66  66  HOH HOH A . 
D 4 HOH 63  67  67  HOH HOH A . 
D 4 HOH 64  69  69  HOH HOH A . 
D 4 HOH 65  70  70  HOH HOH A . 
D 4 HOH 66  71  71  HOH HOH A . 
D 4 HOH 67  72  72  HOH HOH A . 
D 4 HOH 68  73  73  HOH HOH A . 
D 4 HOH 69  74  74  HOH HOH A . 
D 4 HOH 70  75  75  HOH HOH A . 
D 4 HOH 71  76  76  HOH HOH A . 
D 4 HOH 72  77  77  HOH HOH A . 
D 4 HOH 73  78  78  HOH HOH A . 
D 4 HOH 74  79  79  HOH HOH A . 
D 4 HOH 75  80  80  HOH HOH A . 
D 4 HOH 76  81  81  HOH HOH A . 
D 4 HOH 77  82  82  HOH HOH A . 
D 4 HOH 78  83  83  HOH HOH A . 
D 4 HOH 79  84  84  HOH HOH A . 
D 4 HOH 80  85  85  HOH HOH A . 
D 4 HOH 81  86  86  HOH HOH A . 
D 4 HOH 82  87  87  HOH HOH A . 
D 4 HOH 83  88  88  HOH HOH A . 
D 4 HOH 84  89  89  HOH HOH A . 
D 4 HOH 85  90  90  HOH HOH A . 
D 4 HOH 86  91  91  HOH HOH A . 
D 4 HOH 87  92  92  HOH HOH A . 
D 4 HOH 88  93  93  HOH HOH A . 
D 4 HOH 89  94  94  HOH HOH A . 
D 4 HOH 90  95  95  HOH HOH A . 
D 4 HOH 91  97  97  HOH HOH A . 
D 4 HOH 92  98  98  HOH HOH A . 
D 4 HOH 93  100 100 HOH HOH A . 
D 4 HOH 94  101 101 HOH HOH A . 
D 4 HOH 95  102 102 HOH HOH A . 
D 4 HOH 96  103 103 HOH HOH A . 
D 4 HOH 97  104 104 HOH HOH A . 
D 4 HOH 98  105 105 HOH HOH A . 
D 4 HOH 99  106 106 HOH HOH A . 
D 4 HOH 100 107 107 HOH HOH A . 
D 4 HOH 101 108 108 HOH HOH A . 
D 4 HOH 102 109 109 HOH HOH A . 
D 4 HOH 103 110 110 HOH HOH A . 
D 4 HOH 104 111 111 HOH HOH A . 
D 4 HOH 105 112 112 HOH HOH A . 
D 4 HOH 106 113 113 HOH HOH A . 
D 4 HOH 107 114 114 HOH HOH A . 
D 4 HOH 108 116 116 HOH HOH A . 
D 4 HOH 109 117 117 HOH HOH A . 
D 4 HOH 110 118 118 HOH HOH A . 
D 4 HOH 111 119 119 HOH HOH A . 
D 4 HOH 112 121 121 HOH HOH A . 
D 4 HOH 113 122 122 HOH HOH A . 
D 4 HOH 114 123 123 HOH HOH A . 
D 4 HOH 115 124 124 HOH HOH A . 
D 4 HOH 116 126 126 HOH HOH A . 
D 4 HOH 117 127 127 HOH HOH A . 
D 4 HOH 118 128 128 HOH HOH A . 
D 4 HOH 119 129 129 HOH HOH A . 
D 4 HOH 120 130 130 HOH HOH A . 
D 4 HOH 121 131 131 HOH HOH A . 
D 4 HOH 122 132 132 HOH HOH A . 
D 4 HOH 123 133 133 HOH HOH A . 
D 4 HOH 124 134 134 HOH HOH A . 
D 4 HOH 125 135 135 HOH HOH A . 
D 4 HOH 126 136 136 HOH HOH A . 
D 4 HOH 127 137 137 HOH HOH A . 
D 4 HOH 128 138 138 HOH HOH A . 
D 4 HOH 129 139 139 HOH HOH A . 
D 4 HOH 130 140 140 HOH HOH A . 
D 4 HOH 131 141 141 HOH HOH A . 
D 4 HOH 132 142 142 HOH HOH A . 
D 4 HOH 133 143 143 HOH HOH A . 
D 4 HOH 134 144 144 HOH HOH A . 
D 4 HOH 135 145 145 HOH HOH A . 
D 4 HOH 136 146 146 HOH HOH A . 
D 4 HOH 137 147 147 HOH HOH A . 
D 4 HOH 138 148 148 HOH HOH A . 
D 4 HOH 139 149 149 HOH HOH A . 
D 4 HOH 140 150 150 HOH HOH A . 
D 4 HOH 141 151 151 HOH HOH A . 
D 4 HOH 142 152 152 HOH HOH A . 
D 4 HOH 143 153 153 HOH HOH A . 
D 4 HOH 144 154 154 HOH HOH A . 
D 4 HOH 145 155 155 HOH HOH A . 
D 4 HOH 146 156 156 HOH HOH A . 
D 4 HOH 147 157 157 HOH HOH A . 
D 4 HOH 148 158 158 HOH HOH A . 
D 4 HOH 149 159 159 HOH HOH A . 
D 4 HOH 150 160 160 HOH HOH A . 
D 4 HOH 151 164 164 HOH HOH A . 
E 4 HOH 1   27  27  HOH HOH B . 
E 4 HOH 2   42  42  HOH HOH B . 
E 4 HOH 3   51  51  HOH HOH B . 
E 4 HOH 4   96  96  HOH HOH B . 
E 4 HOH 5   99  99  HOH HOH B . 
E 4 HOH 6   115 115 HOH HOH B . 
E 4 HOH 7   125 125 HOH HOH B . 
#