data_1K4R
# 
_entry.id   1K4R 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.296 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1K4R         
RCSB  RCSB014559   
WWPDB D_1000014559 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1svb 
_pdbx_database_related.details        '1svb contains the structure of glycoprotein E of tick-borne encephalitis virus' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1K4R 
_pdbx_database_status.recvd_initial_deposition_date   2001-10-08 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kuhn, R.J.'       1  
'Zhang, W.'        2  
'Rossmann, M.G.'   3  
'Pletnev, S.V.'    4  
'Corver, J.'       5  
'Lenches, E.'      6  
'Jones, C.T.'      7  
'Mukhopadhyay, S.' 8  
'Chipman, P.R.'    9  
'Strauss, E.G.'    10 
'Baker, T.S.'      11 
'Strauss, J.H.'    12 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Structure of dengue virus: implications for flavivirus organization, maturation, and fusion.' 'Cell(Cambridge,Mass.)' 108 
717 725 2002 CELLB5 US 0092-8674 0998 ? 11893341 '10.1016/S0092-8674(02)00660-8' 
1       
;Virology. When It's Better to Lie Low
;
Nature                  375 275 276 1995 NATUAS UK 0028-0836 0006 ? ?        ?                               
2       'The Envelope Glycoprotein from Tick-borne Encephalitis Virus at 2 A Resolution'               Nature                  375 
291 298 1995 NATUAS UK 0028-0836 0006 ? ?        ?                               
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Kuhn, R.J.'       1  
primary 'Zhang, W.'        2  
primary 'Rossmann, M.G.'   3  
primary 'Pletnev, S.V.'    4  
primary 'Corver, J.'       5  
primary 'Lenches, E.'      6  
primary 'Jones, C.T.'      7  
primary 'Mukhopadhyay, S.' 8  
primary 'Chipman, P.R.'    9  
primary 'Strauss, E.G.'    10 
primary 'Baker, T.S.'      11 
primary 'Strauss, J.H.'    12 
1       'Kuhn, R.J.'       13 
1       'Rossmann, M.G.'   14 
2       'Rey, F.A.'        15 
2       'Heinz, F.X.'      16 
2       'Mandl, C.'        17 
2       'Kunz, C.'         18 
2       'Harrison, S.C.'   19 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 nat 
_entity.pdbx_description           'MAJOR ENVELOPE PROTEIN E' 
_entity.formula_weight             43231.145 
_entity.pdbx_number_of_molecules   3 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'UNP residues 284-678' 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SRCTHLENRDFVTGTQGTTRVTLVLELGGCVTITAEGKPSMDVWLDAIYQENPAKTREYCLHAKLSDTKVAARCPTMGPA
TLAEEHQGGTVCKRDQSDRGWGNHCGLFGKGSIVACVKAACEAKKKATGHVYDANKIVYTVKVEPHTGDYVAANETHSGR
KTASFTISSEKTILTMGEYGDVSLLCRVASGVDLAQTVILELDKTVEHLPTAWQVHRDWFNDLALPWKHEGAQNWNNAER
LVEFGAPHAVKMDVYNLGDQTGVLLKALAGVPVAHIEGTKYHLKSGHVTCEVGLEKLKMKGLTYTMCDKTKFTWKRAPTD
SGHDTVVMEVTFSGTKPCRIPVRAVAHGSPDVNVAMLITPNPTIENNGGGFIEMQLPPGDNIIYVGELSHQWFQK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SRCTHLENRDFVTGTQGTTRVTLVLELGGCVTITAEGKPSMDVWLDAIYQENPAKTREYCLHAKLSDTKVAARCPTMGPA
TLAEEHQGGTVCKRDQSDRGWGNHCGLFGKGSIVACVKAACEAKKKATGHVYDANKIVYTVKVEPHTGDYVAANETHSGR
KTASFTISSEKTILTMGEYGDVSLLCRVASGVDLAQTVILELDKTVEHLPTAWQVHRDWFNDLALPWKHEGAQNWNNAER
LVEFGAPHAVKMDVYNLGDQTGVLLKALAGVPVAHIEGTKYHLKSGHVTCEVGLEKLKMKGLTYTMCDKTKFTWKRAPTD
SGHDTVVMEVTFSGTKPCRIPVRAVAHGSPDVNVAMLITPNPTIENNGGGFIEMQLPPGDNIIYVGELSHQWFQK
;
_entity_poly.pdbx_strand_id                 A,B,C 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   ARG n 
1 3   CYS n 
1 4   THR n 
1 5   HIS n 
1 6   LEU n 
1 7   GLU n 
1 8   ASN n 
1 9   ARG n 
1 10  ASP n 
1 11  PHE n 
1 12  VAL n 
1 13  THR n 
1 14  GLY n 
1 15  THR n 
1 16  GLN n 
1 17  GLY n 
1 18  THR n 
1 19  THR n 
1 20  ARG n 
1 21  VAL n 
1 22  THR n 
1 23  LEU n 
1 24  VAL n 
1 25  LEU n 
1 26  GLU n 
1 27  LEU n 
1 28  GLY n 
1 29  GLY n 
1 30  CYS n 
1 31  VAL n 
1 32  THR n 
1 33  ILE n 
1 34  THR n 
1 35  ALA n 
1 36  GLU n 
1 37  GLY n 
1 38  LYS n 
1 39  PRO n 
1 40  SER n 
1 41  MET n 
1 42  ASP n 
1 43  VAL n 
1 44  TRP n 
1 45  LEU n 
1 46  ASP n 
1 47  ALA n 
1 48  ILE n 
1 49  TYR n 
1 50  GLN n 
1 51  GLU n 
1 52  ASN n 
1 53  PRO n 
1 54  ALA n 
1 55  LYS n 
1 56  THR n 
1 57  ARG n 
1 58  GLU n 
1 59  TYR n 
1 60  CYS n 
1 61  LEU n 
1 62  HIS n 
1 63  ALA n 
1 64  LYS n 
1 65  LEU n 
1 66  SER n 
1 67  ASP n 
1 68  THR n 
1 69  LYS n 
1 70  VAL n 
1 71  ALA n 
1 72  ALA n 
1 73  ARG n 
1 74  CYS n 
1 75  PRO n 
1 76  THR n 
1 77  MET n 
1 78  GLY n 
1 79  PRO n 
1 80  ALA n 
1 81  THR n 
1 82  LEU n 
1 83  ALA n 
1 84  GLU n 
1 85  GLU n 
1 86  HIS n 
1 87  GLN n 
1 88  GLY n 
1 89  GLY n 
1 90  THR n 
1 91  VAL n 
1 92  CYS n 
1 93  LYS n 
1 94  ARG n 
1 95  ASP n 
1 96  GLN n 
1 97  SER n 
1 98  ASP n 
1 99  ARG n 
1 100 GLY n 
1 101 TRP n 
1 102 GLY n 
1 103 ASN n 
1 104 HIS n 
1 105 CYS n 
1 106 GLY n 
1 107 LEU n 
1 108 PHE n 
1 109 GLY n 
1 110 LYS n 
1 111 GLY n 
1 112 SER n 
1 113 ILE n 
1 114 VAL n 
1 115 ALA n 
1 116 CYS n 
1 117 VAL n 
1 118 LYS n 
1 119 ALA n 
1 120 ALA n 
1 121 CYS n 
1 122 GLU n 
1 123 ALA n 
1 124 LYS n 
1 125 LYS n 
1 126 LYS n 
1 127 ALA n 
1 128 THR n 
1 129 GLY n 
1 130 HIS n 
1 131 VAL n 
1 132 TYR n 
1 133 ASP n 
1 134 ALA n 
1 135 ASN n 
1 136 LYS n 
1 137 ILE n 
1 138 VAL n 
1 139 TYR n 
1 140 THR n 
1 141 VAL n 
1 142 LYS n 
1 143 VAL n 
1 144 GLU n 
1 145 PRO n 
1 146 HIS n 
1 147 THR n 
1 148 GLY n 
1 149 ASP n 
1 150 TYR n 
1 151 VAL n 
1 152 ALA n 
1 153 ALA n 
1 154 ASN n 
1 155 GLU n 
1 156 THR n 
1 157 HIS n 
1 158 SER n 
1 159 GLY n 
1 160 ARG n 
1 161 LYS n 
1 162 THR n 
1 163 ALA n 
1 164 SER n 
1 165 PHE n 
1 166 THR n 
1 167 ILE n 
1 168 SER n 
1 169 SER n 
1 170 GLU n 
1 171 LYS n 
1 172 THR n 
1 173 ILE n 
1 174 LEU n 
1 175 THR n 
1 176 MET n 
1 177 GLY n 
1 178 GLU n 
1 179 TYR n 
1 180 GLY n 
1 181 ASP n 
1 182 VAL n 
1 183 SER n 
1 184 LEU n 
1 185 LEU n 
1 186 CYS n 
1 187 ARG n 
1 188 VAL n 
1 189 ALA n 
1 190 SER n 
1 191 GLY n 
1 192 VAL n 
1 193 ASP n 
1 194 LEU n 
1 195 ALA n 
1 196 GLN n 
1 197 THR n 
1 198 VAL n 
1 199 ILE n 
1 200 LEU n 
1 201 GLU n 
1 202 LEU n 
1 203 ASP n 
1 204 LYS n 
1 205 THR n 
1 206 VAL n 
1 207 GLU n 
1 208 HIS n 
1 209 LEU n 
1 210 PRO n 
1 211 THR n 
1 212 ALA n 
1 213 TRP n 
1 214 GLN n 
1 215 VAL n 
1 216 HIS n 
1 217 ARG n 
1 218 ASP n 
1 219 TRP n 
1 220 PHE n 
1 221 ASN n 
1 222 ASP n 
1 223 LEU n 
1 224 ALA n 
1 225 LEU n 
1 226 PRO n 
1 227 TRP n 
1 228 LYS n 
1 229 HIS n 
1 230 GLU n 
1 231 GLY n 
1 232 ALA n 
1 233 GLN n 
1 234 ASN n 
1 235 TRP n 
1 236 ASN n 
1 237 ASN n 
1 238 ALA n 
1 239 GLU n 
1 240 ARG n 
1 241 LEU n 
1 242 VAL n 
1 243 GLU n 
1 244 PHE n 
1 245 GLY n 
1 246 ALA n 
1 247 PRO n 
1 248 HIS n 
1 249 ALA n 
1 250 VAL n 
1 251 LYS n 
1 252 MET n 
1 253 ASP n 
1 254 VAL n 
1 255 TYR n 
1 256 ASN n 
1 257 LEU n 
1 258 GLY n 
1 259 ASP n 
1 260 GLN n 
1 261 THR n 
1 262 GLY n 
1 263 VAL n 
1 264 LEU n 
1 265 LEU n 
1 266 LYS n 
1 267 ALA n 
1 268 LEU n 
1 269 ALA n 
1 270 GLY n 
1 271 VAL n 
1 272 PRO n 
1 273 VAL n 
1 274 ALA n 
1 275 HIS n 
1 276 ILE n 
1 277 GLU n 
1 278 GLY n 
1 279 THR n 
1 280 LYS n 
1 281 TYR n 
1 282 HIS n 
1 283 LEU n 
1 284 LYS n 
1 285 SER n 
1 286 GLY n 
1 287 HIS n 
1 288 VAL n 
1 289 THR n 
1 290 CYS n 
1 291 GLU n 
1 292 VAL n 
1 293 GLY n 
1 294 LEU n 
1 295 GLU n 
1 296 LYS n 
1 297 LEU n 
1 298 LYS n 
1 299 MET n 
1 300 LYS n 
1 301 GLY n 
1 302 LEU n 
1 303 THR n 
1 304 TYR n 
1 305 THR n 
1 306 MET n 
1 307 CYS n 
1 308 ASP n 
1 309 LYS n 
1 310 THR n 
1 311 LYS n 
1 312 PHE n 
1 313 THR n 
1 314 TRP n 
1 315 LYS n 
1 316 ARG n 
1 317 ALA n 
1 318 PRO n 
1 319 THR n 
1 320 ASP n 
1 321 SER n 
1 322 GLY n 
1 323 HIS n 
1 324 ASP n 
1 325 THR n 
1 326 VAL n 
1 327 VAL n 
1 328 MET n 
1 329 GLU n 
1 330 VAL n 
1 331 THR n 
1 332 PHE n 
1 333 SER n 
1 334 GLY n 
1 335 THR n 
1 336 LYS n 
1 337 PRO n 
1 338 CYS n 
1 339 ARG n 
1 340 ILE n 
1 341 PRO n 
1 342 VAL n 
1 343 ARG n 
1 344 ALA n 
1 345 VAL n 
1 346 ALA n 
1 347 HIS n 
1 348 GLY n 
1 349 SER n 
1 350 PRO n 
1 351 ASP n 
1 352 VAL n 
1 353 ASN n 
1 354 VAL n 
1 355 ALA n 
1 356 MET n 
1 357 LEU n 
1 358 ILE n 
1 359 THR n 
1 360 PRO n 
1 361 ASN n 
1 362 PRO n 
1 363 THR n 
1 364 ILE n 
1 365 GLU n 
1 366 ASN n 
1 367 ASN n 
1 368 GLY n 
1 369 GLY n 
1 370 GLY n 
1 371 PHE n 
1 372 ILE n 
1 373 GLU n 
1 374 MET n 
1 375 GLN n 
1 376 LEU n 
1 377 PRO n 
1 378 PRO n 
1 379 GLY n 
1 380 ASP n 
1 381 ASN n 
1 382 ILE n 
1 383 ILE n 
1 384 TYR n 
1 385 VAL n 
1 386 GLY n 
1 387 GLU n 
1 388 LEU n 
1 389 SER n 
1 390 HIS n 
1 391 GLN n 
1 392 TRP n 
1 393 PHE n 
1 394 GLN n 
1 395 LYS n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                ? 
_entity_src_nat.pdbx_organism_scientific   'Chimeric Tick-borne encephalitis virus/Dengue virus 4' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      638787 
_entity_src_nat.genus                      Flavivirus 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    C3V005_9FLAV 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;SRCTHLENRDFVTGTQGTTRVTLVLELGGCVTITAEGKPSMDVWLDSIYQENPAKTREYCLHAKLSDTKVAARCPTMGPA
TLAEEHQSGTVCKRDQSDRGWGNHCGLFGKGSIVTCVKASCEAKKKATGHVYDANKIVYTVKVEPHTGDYVAANETHSGR
KTASFTVSSERTILTMGDYGDVSLLCRVASGVDLAQTVILELDKTSEHLPTAWQVHRDWFNDLALPWKHEGAQNWNNAER
LVEFGAPHAVKMDVYNLGDQTGVLLKSLAGVPVAHIDGTKYHLKSGHVTCEVGLEKLKMKGLTYTMCDKTKFTWKRIPTD
SGHDTVVMEVAFSGTKPCRIPVRAVAHGSPDVNVAMLMTPNPTIENNGGGFIEMQLPPGDNIIYVGELSHQWFQK
;
_struct_ref.pdbx_align_begin           284 
_struct_ref.pdbx_db_accession          C3V005 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1K4R A 1 ? 395 ? C3V005 284 ? 678 ? 1 395 
2 1 1K4R B 1 ? 395 ? C3V005 284 ? 678 ? 1 395 
3 1 1K4R C 1 ? 395 ? C3V005 284 ? 678 ? 1 395 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1K4R ALA A 47  ? UNP C3V005 SER 330 CONFLICT 47  1  
1 1K4R GLY A 88  ? UNP C3V005 SER 371 CONFLICT 88  2  
1 1K4R ALA A 115 ? UNP C3V005 THR 398 CONFLICT 115 3  
1 1K4R ALA A 120 ? UNP C3V005 SER 403 CONFLICT 120 4  
1 1K4R ILE A 167 ? UNP C3V005 VAL 450 CONFLICT 167 5  
1 1K4R LYS A 171 ? UNP C3V005 ARG 454 CONFLICT 171 6  
1 1K4R GLU A 178 ? UNP C3V005 ASP 461 CONFLICT 178 7  
1 1K4R VAL A 206 ? UNP C3V005 SER 489 CONFLICT 206 8  
1 1K4R ALA A 267 ? UNP C3V005 SER 550 CONFLICT 267 9  
1 1K4R GLU A 277 ? UNP C3V005 ASP 560 CONFLICT 277 10 
1 1K4R ALA A 317 ? UNP C3V005 ILE 600 CONFLICT 317 11 
1 1K4R THR A 331 ? UNP C3V005 ALA 614 CONFLICT 331 12 
1 1K4R ILE A 358 ? UNP C3V005 MET 641 CONFLICT 358 13 
2 1K4R ALA B 47  ? UNP C3V005 SER 330 CONFLICT 47  14 
2 1K4R GLY B 88  ? UNP C3V005 SER 371 CONFLICT 88  15 
2 1K4R ALA B 115 ? UNP C3V005 THR 398 CONFLICT 115 16 
2 1K4R ALA B 120 ? UNP C3V005 SER 403 CONFLICT 120 17 
2 1K4R ILE B 167 ? UNP C3V005 VAL 450 CONFLICT 167 18 
2 1K4R LYS B 171 ? UNP C3V005 ARG 454 CONFLICT 171 19 
2 1K4R GLU B 178 ? UNP C3V005 ASP 461 CONFLICT 178 20 
2 1K4R VAL B 206 ? UNP C3V005 SER 489 CONFLICT 206 21 
2 1K4R ALA B 267 ? UNP C3V005 SER 550 CONFLICT 267 22 
2 1K4R GLU B 277 ? UNP C3V005 ASP 560 CONFLICT 277 23 
2 1K4R ALA B 317 ? UNP C3V005 ILE 600 CONFLICT 317 24 
2 1K4R THR B 331 ? UNP C3V005 ALA 614 CONFLICT 331 25 
2 1K4R ILE B 358 ? UNP C3V005 MET 641 CONFLICT 358 26 
3 1K4R ALA C 47  ? UNP C3V005 SER 330 CONFLICT 47  27 
3 1K4R GLY C 88  ? UNP C3V005 SER 371 CONFLICT 88  28 
3 1K4R ALA C 115 ? UNP C3V005 THR 398 CONFLICT 115 29 
3 1K4R ALA C 120 ? UNP C3V005 SER 403 CONFLICT 120 30 
3 1K4R ILE C 167 ? UNP C3V005 VAL 450 CONFLICT 167 31 
3 1K4R LYS C 171 ? UNP C3V005 ARG 454 CONFLICT 171 32 
3 1K4R GLU C 178 ? UNP C3V005 ASP 461 CONFLICT 178 33 
3 1K4R VAL C 206 ? UNP C3V005 SER 489 CONFLICT 206 34 
3 1K4R ALA C 267 ? UNP C3V005 SER 550 CONFLICT 267 35 
3 1K4R GLU C 277 ? UNP C3V005 ASP 560 CONFLICT 277 36 
3 1K4R ALA C 317 ? UNP C3V005 ILE 600 CONFLICT 317 37 
3 1K4R THR C 331 ? UNP C3V005 ALA 614 CONFLICT 331 38 
3 1K4R ILE C 358 ? UNP C3V005 MET 641 CONFLICT 358 39 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1K4R 
_exptl.method            'ELECTRON MICROSCOPY' 
_exptl.crystals_number   ? 
# 
_reflns.entry_id                     1K4R 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             ? 
_reflns.d_resolution_high            24 
_reflns.number_obs                   ? 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 1K4R 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             ? 
_refine.ls_d_res_high                            24 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  
;Molecules of glycoprotein E of Tick-borne encephalitis virus 
were solved by using cryo-EM map of Dengue virus
;
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_refine_id                           'ELECTRON MICROSCOPY' 
_refine.pdbx_diffrn_id                           ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'ELECTRON MICROSCOPY' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        9084 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               9084 
_refine_hist.d_res_high                       24 
_refine_hist.d_res_low                        . 
# 
_struct.entry_id                  1K4R 
_struct.title                     'Structure of Dengue Virus' 
_struct.pdbx_descriptor           'MAJOR ENVELOPE PROTEIN E' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1K4R 
_struct_keywords.pdbx_keywords   VIRUS 
_struct_keywords.text            
'Flavivirus, Flaviviridae, Dengue virus, glycoprotein E from tick-borne encephalitis virus, Icosahedral virus, Virus' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 1   ? LEU A 6   ? SER A 1   LEU A 6   5 ? 6 
HELX_P HELX_P2  2  LEU A 82  ? GLN A 87  ? LEU A 82  GLN A 87  5 ? 6 
HELX_P HELX_P3  3  GLY A 100 ? HIS A 104 ? GLY A 100 HIS A 104 5 ? 5 
HELX_P HELX_P4  4  GLY A 177 ? TYR A 179 ? GLY A 177 TYR A 179 5 ? 3 
HELX_P HELX_P5  5  VAL A 188 ? GLY A 191 ? VAL A 188 GLY A 191 5 ? 4 
HELX_P HELX_P6  6  ARG A 217 ? ASP A 222 ? ARG A 217 ASP A 222 1 ? 6 
HELX_P HELX_P7  7  ASN A 237 ? ARG A 240 ? ASN A 237 ARG A 240 5 ? 4 
HELX_P HELX_P8  8  GLN A 260 ? LEU A 268 ? GLN A 260 LEU A 268 1 ? 9 
HELX_P HELX_P9  9  SER B 1   ? LEU B 6   ? SER B 1   LEU B 6   5 ? 6 
HELX_P HELX_P10 10 LEU B 82  ? GLN B 87  ? LEU B 82  GLN B 87  5 ? 6 
HELX_P HELX_P11 11 GLY B 100 ? HIS B 104 ? GLY B 100 HIS B 104 5 ? 5 
HELX_P HELX_P12 12 GLY B 177 ? TYR B 179 ? GLY B 177 TYR B 179 5 ? 3 
HELX_P HELX_P13 13 VAL B 188 ? GLY B 191 ? VAL B 188 GLY B 191 5 ? 4 
HELX_P HELX_P14 14 ARG B 217 ? ASP B 222 ? ARG B 217 ASP B 222 1 ? 6 
HELX_P HELX_P15 15 ASN B 237 ? ARG B 240 ? ASN B 237 ARG B 240 5 ? 4 
HELX_P HELX_P16 16 GLN B 260 ? LEU B 268 ? GLN B 260 LEU B 268 1 ? 9 
HELX_P HELX_P17 17 SER C 1   ? LEU C 6   ? SER C 1   LEU C 6   5 ? 6 
HELX_P HELX_P18 18 LEU C 82  ? GLN C 87  ? LEU C 82  GLN C 87  5 ? 6 
HELX_P HELX_P19 19 GLY C 100 ? HIS C 104 ? GLY C 100 HIS C 104 5 ? 5 
HELX_P HELX_P20 20 GLY C 177 ? TYR C 179 ? GLY C 177 TYR C 179 5 ? 3 
HELX_P HELX_P21 21 VAL C 188 ? GLY C 191 ? VAL C 188 GLY C 191 5 ? 4 
HELX_P HELX_P22 22 ARG C 217 ? ASP C 222 ? ARG C 217 ASP C 222 1 ? 6 
HELX_P HELX_P23 23 ASN C 237 ? ARG C 240 ? ASN C 237 ARG C 240 5 ? 4 
HELX_P HELX_P24 24 GLN C 260 ? LEU C 268 ? GLN C 260 LEU C 268 1 ? 9 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 3   SG ? ? ? 1_555 A CYS 30  SG ? ? A CYS 3   A CYS 30  1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf2  disulf ? ? A CYS 60  SG ? ? ? 1_555 A CYS 121 SG ? ? A CYS 60  A CYS 121 1_555 ? ? ? ? ? ? ? 2.025 ? 
disulf3  disulf ? ? A CYS 74  SG ? ? ? 1_555 A CYS 105 SG ? ? A CYS 74  A CYS 105 1_555 ? ? ? ? ? ? ? 2.024 ? 
disulf4  disulf ? ? A CYS 92  SG ? ? ? 1_555 A CYS 116 SG ? ? A CYS 92  A CYS 116 1_555 ? ? ? ? ? ? ? 2.028 ? 
disulf5  disulf ? ? A CYS 186 SG ? ? ? 1_555 A CYS 290 SG ? ? A CYS 186 A CYS 290 1_555 ? ? ? ? ? ? ? 2.028 ? 
disulf6  disulf ? ? A CYS 307 SG ? ? ? 1_555 A CYS 338 SG ? ? A CYS 307 A CYS 338 1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf7  disulf ? ? B CYS 3   SG ? ? ? 1_555 B CYS 30  SG ? ? B CYS 3   B CYS 30  1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf8  disulf ? ? B CYS 60  SG ? ? ? 1_555 B CYS 121 SG ? ? B CYS 60  B CYS 121 1_555 ? ? ? ? ? ? ? 2.025 ? 
disulf9  disulf ? ? B CYS 74  SG ? ? ? 1_555 B CYS 105 SG ? ? B CYS 74  B CYS 105 1_555 ? ? ? ? ? ? ? 2.024 ? 
disulf10 disulf ? ? B CYS 92  SG ? ? ? 1_555 B CYS 116 SG ? ? B CYS 92  B CYS 116 1_555 ? ? ? ? ? ? ? 2.028 ? 
disulf11 disulf ? ? B CYS 186 SG ? ? ? 1_555 B CYS 290 SG ? ? B CYS 186 B CYS 290 1_555 ? ? ? ? ? ? ? 2.026 ? 
disulf12 disulf ? ? B CYS 307 SG ? ? ? 1_555 B CYS 338 SG ? ? B CYS 307 B CYS 338 1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf13 disulf ? ? C CYS 3   SG ? ? ? 1_555 C CYS 30  SG ? ? C CYS 3   C CYS 30  1_555 ? ? ? ? ? ? ? 2.035 ? 
disulf14 disulf ? ? C CYS 60  SG ? ? ? 1_555 C CYS 121 SG ? ? C CYS 60  C CYS 121 1_555 ? ? ? ? ? ? ? 2.025 ? 
disulf15 disulf ? ? C CYS 74  SG ? ? ? 1_555 C CYS 105 SG ? ? C CYS 74  C CYS 105 1_555 ? ? ? ? ? ? ? 2.023 ? 
disulf16 disulf ? ? C CYS 92  SG ? ? ? 1_555 C CYS 116 SG ? ? C CYS 92  C CYS 116 1_555 ? ? ? ? ? ? ? 2.027 ? 
disulf17 disulf ? ? C CYS 186 SG ? ? ? 1_555 C CYS 290 SG ? ? C CYS 186 C CYS 290 1_555 ? ? ? ? ? ? ? 2.027 ? 
disulf18 disulf ? ? C CYS 307 SG ? ? ? 1_555 C CYS 338 SG ? ? C CYS 307 C CYS 338 1_555 ? ? ? ? ? ? ? 2.034 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LYS 336 A . ? LYS 336 A PRO 337 A ? PRO 337 A 1 0.20 
2 LYS 336 B . ? LYS 336 B PRO 337 B ? PRO 337 B 1 0.31 
3 LYS 336 C . ? LYS 336 C PRO 337 C ? PRO 337 C 1 0.26 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5  ? 
B ? 10 ? 
C ? 4  ? 
D ? 3  ? 
E ? 2  ? 
F ? 4  ? 
G ? 3  ? 
H ? 3  ? 
I ? 5  ? 
J ? 10 ? 
K ? 4  ? 
L ? 3  ? 
M ? 2  ? 
N ? 4  ? 
O ? 3  ? 
P ? 3  ? 
Q ? 5  ? 
R ? 10 ? 
S ? 4  ? 
T ? 3  ? 
U ? 2  ? 
V ? 4  ? 
W ? 3  ? 
X ? 3  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2  ? anti-parallel 
A 2 3  ? anti-parallel 
A 3 4  ? anti-parallel 
A 4 5  ? parallel      
B 1 2  ? anti-parallel 
B 2 3  ? anti-parallel 
B 3 4  ? anti-parallel 
B 4 5  ? anti-parallel 
B 5 6  ? anti-parallel 
B 6 7  ? anti-parallel 
B 7 8  ? anti-parallel 
B 8 9  ? anti-parallel 
B 9 10 ? anti-parallel 
C 1 2  ? anti-parallel 
C 2 3  ? anti-parallel 
C 3 4  ? anti-parallel 
D 1 2  ? anti-parallel 
D 2 3  ? anti-parallel 
E 1 2  ? anti-parallel 
F 1 2  ? anti-parallel 
F 2 3  ? anti-parallel 
F 3 4  ? anti-parallel 
G 1 2  ? anti-parallel 
G 2 3  ? anti-parallel 
H 1 2  ? anti-parallel 
H 2 3  ? anti-parallel 
I 1 2  ? anti-parallel 
I 2 3  ? anti-parallel 
I 3 4  ? anti-parallel 
I 4 5  ? parallel      
J 1 2  ? anti-parallel 
J 2 3  ? anti-parallel 
J 3 4  ? anti-parallel 
J 4 5  ? anti-parallel 
J 5 6  ? anti-parallel 
J 6 7  ? anti-parallel 
J 7 8  ? anti-parallel 
J 8 9  ? anti-parallel 
J 9 10 ? anti-parallel 
K 1 2  ? anti-parallel 
K 2 3  ? anti-parallel 
K 3 4  ? anti-parallel 
L 1 2  ? anti-parallel 
L 2 3  ? anti-parallel 
M 1 2  ? anti-parallel 
N 1 2  ? anti-parallel 
N 2 3  ? anti-parallel 
N 3 4  ? anti-parallel 
O 1 2  ? anti-parallel 
O 2 3  ? anti-parallel 
P 1 2  ? anti-parallel 
P 2 3  ? anti-parallel 
Q 1 2  ? anti-parallel 
Q 2 3  ? anti-parallel 
Q 3 4  ? anti-parallel 
Q 4 5  ? parallel      
R 1 2  ? anti-parallel 
R 2 3  ? anti-parallel 
R 3 4  ? anti-parallel 
R 4 5  ? anti-parallel 
R 5 6  ? anti-parallel 
R 6 7  ? anti-parallel 
R 7 8  ? anti-parallel 
R 8 9  ? anti-parallel 
R 9 10 ? anti-parallel 
S 1 2  ? anti-parallel 
S 2 3  ? anti-parallel 
S 3 4  ? anti-parallel 
T 1 2  ? anti-parallel 
T 2 3  ? anti-parallel 
U 1 2  ? anti-parallel 
V 1 2  ? anti-parallel 
V 2 3  ? anti-parallel 
V 3 4  ? anti-parallel 
W 1 2  ? anti-parallel 
W 2 3  ? anti-parallel 
X 1 2  ? anti-parallel 
X 2 3  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  LYS A 161 ? PHE A 165 ? LYS A 161 PHE A 165 
A 2  VAL A 138 ? PRO A 145 ? VAL A 138 PRO A 145 
A 3  LYS A 38  ? GLU A 51  ? LYS A 38  GLU A 51  
A 4  VAL A 31  ? ALA A 35  ? VAL A 31  ALA A 35  
A 5  ASP A 10  ? GLY A 14  ? ASP A 10  GLY A 14  
B 1  LYS A 161 ? PHE A 165 ? LYS A 161 PHE A 165 
B 2  VAL A 138 ? PRO A 145 ? VAL A 138 PRO A 145 
B 3  LYS A 38  ? GLU A 51  ? LYS A 38  GLU A 51  
B 4  LYS A 280 ? HIS A 282 ? LYS A 280 HIS A 282 
B 5  VAL A 273 ? GLU A 277 ? VAL A 273 GLU A 277 
B 6  ALA A 212 ? HIS A 216 ? ALA A 212 HIS A 216 
B 7  THR A 197 ? GLU A 201 ? THR A 197 GLU A 201 
B 8  LYS A 126 ? VAL A 131 ? LYS A 126 VAL A 131 
B 9  ALA A 54  ? CYS A 60  ? ALA A 54  CYS A 60  
B 10 TRP A 227 ? LYS A 228 ? TRP A 227 LYS A 228 
C 1  ARG A 20  ? GLU A 26  ? ARG A 20  GLU A 26  
C 2  HIS A 287 ? GLY A 293 ? HIS A 287 GLY A 293 
C 3  ASP A 181 ? ARG A 187 ? ASP A 181 ARG A 187 
C 4  LYS A 171 ? THR A 175 ? LYS A 171 THR A 175 
D 1  ALA A 63  ? ALA A 72  ? ALA A 63  ALA A 72  
D 2  GLY A 109 ? CYS A 121 ? GLY A 109 CYS A 121 
D 3  THR A 90  ? ARG A 99  ? THR A 90  ARG A 99  
E 1  VAL A 242 ? PHE A 244 ? VAL A 242 PHE A 244 
E 2  VAL A 254 ? ASN A 256 ? VAL A 254 ASN A 256 
F 1  PHE A 312 ? ASP A 320 ? PHE A 312 ASP A 320 
F 2  VAL A 326 ? PHE A 332 ? VAL A 326 PHE A 332 
F 3  PHE A 371 ? GLN A 375 ? PHE A 371 GLN A 375 
F 4  MET A 356 ? LEU A 357 ? MET A 356 LEU A 357 
G 1  CYS A 338 ? ARG A 339 ? CYS A 338 ARG A 339 
G 2  THR A 363 ? GLU A 365 ? THR A 363 GLU A 365 
G 3  GLY A 368 ? GLY A 369 ? GLY A 368 GLY A 369 
H 1  VAL A 342 ? ALA A 346 ? VAL A 342 ALA A 346 
H 2  GLY A 379 ? VAL A 385 ? GLY A 379 VAL A 385 
H 3  LEU A 388 ? GLN A 394 ? LEU A 388 GLN A 394 
I 1  LYS B 161 ? PHE B 165 ? LYS B 161 PHE B 165 
I 2  VAL B 138 ? PRO B 145 ? VAL B 138 PRO B 145 
I 3  LYS B 38  ? GLU B 51  ? LYS B 38  GLU B 51  
I 4  VAL B 31  ? ALA B 35  ? VAL B 31  ALA B 35  
I 5  ASP B 10  ? GLY B 14  ? ASP B 10  GLY B 14  
J 1  LYS B 161 ? PHE B 165 ? LYS B 161 PHE B 165 
J 2  VAL B 138 ? PRO B 145 ? VAL B 138 PRO B 145 
J 3  LYS B 38  ? GLU B 51  ? LYS B 38  GLU B 51  
J 4  LYS B 280 ? HIS B 282 ? LYS B 280 HIS B 282 
J 5  VAL B 273 ? GLU B 277 ? VAL B 273 GLU B 277 
J 6  ALA B 212 ? HIS B 216 ? ALA B 212 HIS B 216 
J 7  THR B 197 ? GLU B 201 ? THR B 197 GLU B 201 
J 8  LYS B 126 ? VAL B 131 ? LYS B 126 VAL B 131 
J 9  ALA B 54  ? CYS B 60  ? ALA B 54  CYS B 60  
J 10 TRP B 227 ? LYS B 228 ? TRP B 227 LYS B 228 
K 1  ARG B 20  ? GLU B 26  ? ARG B 20  GLU B 26  
K 2  HIS B 287 ? GLY B 293 ? HIS B 287 GLY B 293 
K 3  ASP B 181 ? ARG B 187 ? ASP B 181 ARG B 187 
K 4  LYS B 171 ? THR B 175 ? LYS B 171 THR B 175 
L 1  ALA B 63  ? ALA B 72  ? ALA B 63  ALA B 72  
L 2  GLY B 109 ? CYS B 121 ? GLY B 109 CYS B 121 
L 3  THR B 90  ? ARG B 99  ? THR B 90  ARG B 99  
M 1  VAL B 242 ? PHE B 244 ? VAL B 242 PHE B 244 
M 2  VAL B 254 ? ASN B 256 ? VAL B 254 ASN B 256 
N 1  PHE B 312 ? ASP B 320 ? PHE B 312 ASP B 320 
N 2  VAL B 326 ? PHE B 332 ? VAL B 326 PHE B 332 
N 3  PHE B 371 ? GLN B 375 ? PHE B 371 GLN B 375 
N 4  MET B 356 ? LEU B 357 ? MET B 356 LEU B 357 
O 1  CYS B 338 ? ARG B 339 ? CYS B 338 ARG B 339 
O 2  THR B 363 ? GLU B 365 ? THR B 363 GLU B 365 
O 3  GLY B 368 ? GLY B 369 ? GLY B 368 GLY B 369 
P 1  VAL B 342 ? ALA B 346 ? VAL B 342 ALA B 346 
P 2  GLY B 379 ? VAL B 385 ? GLY B 379 VAL B 385 
P 3  LEU B 388 ? GLN B 394 ? LEU B 388 GLN B 394 
Q 1  LYS C 161 ? PHE C 165 ? LYS C 161 PHE C 165 
Q 2  VAL C 138 ? PRO C 145 ? VAL C 138 PRO C 145 
Q 3  LYS C 38  ? GLU C 51  ? LYS C 38  GLU C 51  
Q 4  VAL C 31  ? ALA C 35  ? VAL C 31  ALA C 35  
Q 5  ASP C 10  ? GLY C 14  ? ASP C 10  GLY C 14  
R 1  LYS C 161 ? PHE C 165 ? LYS C 161 PHE C 165 
R 2  VAL C 138 ? PRO C 145 ? VAL C 138 PRO C 145 
R 3  LYS C 38  ? GLU C 51  ? LYS C 38  GLU C 51  
R 4  LYS C 280 ? HIS C 282 ? LYS C 280 HIS C 282 
R 5  VAL C 273 ? GLU C 277 ? VAL C 273 GLU C 277 
R 6  ALA C 212 ? HIS C 216 ? ALA C 212 HIS C 216 
R 7  THR C 197 ? GLU C 201 ? THR C 197 GLU C 201 
R 8  LYS C 126 ? VAL C 131 ? LYS C 126 VAL C 131 
R 9  ALA C 54  ? CYS C 60  ? ALA C 54  CYS C 60  
R 10 TRP C 227 ? LYS C 228 ? TRP C 227 LYS C 228 
S 1  ARG C 20  ? GLU C 26  ? ARG C 20  GLU C 26  
S 2  HIS C 287 ? GLY C 293 ? HIS C 287 GLY C 293 
S 3  ASP C 181 ? ARG C 187 ? ASP C 181 ARG C 187 
S 4  LYS C 171 ? THR C 175 ? LYS C 171 THR C 175 
T 1  ALA C 63  ? ALA C 72  ? ALA C 63  ALA C 72  
T 2  GLY C 109 ? CYS C 121 ? GLY C 109 CYS C 121 
T 3  THR C 90  ? ARG C 99  ? THR C 90  ARG C 99  
U 1  VAL C 242 ? PHE C 244 ? VAL C 242 PHE C 244 
U 2  VAL C 254 ? ASN C 256 ? VAL C 254 ASN C 256 
V 1  PHE C 312 ? ASP C 320 ? PHE C 312 ASP C 320 
V 2  VAL C 326 ? PHE C 332 ? VAL C 326 PHE C 332 
V 3  PHE C 371 ? GLN C 375 ? PHE C 371 GLN C 375 
V 4  MET C 356 ? LEU C 357 ? MET C 356 LEU C 357 
W 1  CYS C 338 ? ARG C 339 ? CYS C 338 ARG C 339 
W 2  THR C 363 ? GLU C 365 ? THR C 363 GLU C 365 
W 3  GLY C 368 ? GLY C 369 ? GLY C 368 GLY C 369 
X 1  VAL C 342 ? ALA C 346 ? VAL C 342 ALA C 346 
X 2  GLY C 379 ? VAL C 385 ? GLY C 379 VAL C 385 
X 3  LEU C 388 ? GLN C 394 ? LEU C 388 GLN C 394 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2  O ALA A 163 ? O ALA A 163 N VAL A 141 ? N VAL A 141 
A 2 3  O VAL A 138 ? O VAL A 138 N TYR A 49  ? N TYR A 49  
A 3 4  O MET A 41  ? O MET A 41  N ILE A 33  ? N ILE A 33  
A 4 5  O THR A 32  ? O THR A 32  N ASP A 10  ? N ASP A 10  
B 1 2  O ALA A 163 ? O ALA A 163 N VAL A 141 ? N VAL A 141 
B 2 3  O VAL A 138 ? O VAL A 138 N TYR A 49  ? N TYR A 49  
B 3 4  N GLN A 50  ? N GLN A 50  O TYR A 281 ? O TYR A 281 
B 4 5  O HIS A 282 ? O HIS A 282 N HIS A 275 ? N HIS A 275 
B 5 6  O ALA A 274 ? O ALA A 274 N ALA A 212 ? N ALA A 212 
B 6 7  O VAL A 215 ? O VAL A 215 N VAL A 198 ? N VAL A 198 
B 7 8  O GLU A 201 ? O GLU A 201 N THR A 128 ? N THR A 128 
B 8 9  O ALA A 127 ? O ALA A 127 N TYR A 59  ? N TYR A 59  
B 9 10 N GLU A 58  ? N GLU A 58  O LYS A 228 ? O LYS A 228 
C 1 2  N VAL A 21  ? N VAL A 21  O VAL A 292 ? O VAL A 292 
C 2 3  O GLY A 293 ? O GLY A 293 N SER A 183 ? N SER A 183 
C 3 4  O LEU A 184 ? O LEU A 184 N THR A 172 ? N THR A 172 
D 1 2  N SER A 66  ? N SER A 66  O LYS A 118 ? O LYS A 118 
D 2 3  O ILE A 113 ? O ILE A 113 N ASP A 95  ? N ASP A 95  
E 1 2  N GLU A 243 ? N GLU A 243 O TYR A 255 ? O TYR A 255 
F 1 2  N THR A 319 ? N THR A 319 O VAL A 327 ? O VAL A 327 
F 2 3  N VAL A 326 ? N VAL A 326 O MET A 374 ? O MET A 374 
F 3 4  O GLN A 375 ? O GLN A 375 N MET A 356 ? N MET A 356 
G 1 2  N CYS A 338 ? N CYS A 338 O ILE A 364 ? O ILE A 364 
G 2 3  N GLU A 365 ? N GLU A 365 O GLY A 368 ? O GLY A 368 
H 1 2  N ARG A 343 ? N ARG A 343 O TYR A 384 ? O TYR A 384 
H 2 3  N GLY A 379 ? N GLY A 379 O GLN A 394 ? O GLN A 394 
I 1 2  O ALA B 163 ? O ALA B 163 N VAL B 141 ? N VAL B 141 
I 2 3  O VAL B 138 ? O VAL B 138 N TYR B 49  ? N TYR B 49  
I 3 4  O MET B 41  ? O MET B 41  N ILE B 33  ? N ILE B 33  
I 4 5  O THR B 32  ? O THR B 32  N ASP B 10  ? N ASP B 10  
J 1 2  O ALA B 163 ? O ALA B 163 N VAL B 141 ? N VAL B 141 
J 2 3  O VAL B 138 ? O VAL B 138 N TYR B 49  ? N TYR B 49  
J 3 4  N GLN B 50  ? N GLN B 50  O TYR B 281 ? O TYR B 281 
J 4 5  O HIS B 282 ? O HIS B 282 N HIS B 275 ? N HIS B 275 
J 5 6  O ALA B 274 ? O ALA B 274 N ALA B 212 ? N ALA B 212 
J 6 7  O VAL B 215 ? O VAL B 215 N VAL B 198 ? N VAL B 198 
J 7 8  O GLU B 201 ? O GLU B 201 N THR B 128 ? N THR B 128 
J 8 9  O ALA B 127 ? O ALA B 127 N TYR B 59  ? N TYR B 59  
J 9 10 N GLU B 58  ? N GLU B 58  O LYS B 228 ? O LYS B 228 
K 1 2  N VAL B 21  ? N VAL B 21  O VAL B 292 ? O VAL B 292 
K 2 3  O GLY B 293 ? O GLY B 293 N SER B 183 ? N SER B 183 
K 3 4  O LEU B 184 ? O LEU B 184 N THR B 172 ? N THR B 172 
L 1 2  N SER B 66  ? N SER B 66  O LYS B 118 ? O LYS B 118 
L 2 3  O ILE B 113 ? O ILE B 113 N ASP B 95  ? N ASP B 95  
M 1 2  N GLU B 243 ? N GLU B 243 O TYR B 255 ? O TYR B 255 
N 1 2  N THR B 319 ? N THR B 319 O VAL B 327 ? O VAL B 327 
N 2 3  N VAL B 326 ? N VAL B 326 O MET B 374 ? O MET B 374 
N 3 4  O GLN B 375 ? O GLN B 375 N MET B 356 ? N MET B 356 
O 1 2  N CYS B 338 ? N CYS B 338 O ILE B 364 ? O ILE B 364 
O 2 3  N GLU B 365 ? N GLU B 365 O GLY B 368 ? O GLY B 368 
P 1 2  N ARG B 343 ? N ARG B 343 O TYR B 384 ? O TYR B 384 
P 2 3  N GLY B 379 ? N GLY B 379 O GLN B 394 ? O GLN B 394 
Q 1 2  O ALA C 163 ? O ALA C 163 N VAL C 141 ? N VAL C 141 
Q 2 3  O VAL C 138 ? O VAL C 138 N TYR C 49  ? N TYR C 49  
Q 3 4  O MET C 41  ? O MET C 41  N ILE C 33  ? N ILE C 33  
Q 4 5  O THR C 32  ? O THR C 32  N ASP C 10  ? N ASP C 10  
R 1 2  O ALA C 163 ? O ALA C 163 N VAL C 141 ? N VAL C 141 
R 2 3  O VAL C 138 ? O VAL C 138 N TYR C 49  ? N TYR C 49  
R 3 4  N GLN C 50  ? N GLN C 50  O TYR C 281 ? O TYR C 281 
R 4 5  O HIS C 282 ? O HIS C 282 N HIS C 275 ? N HIS C 275 
R 5 6  O ALA C 274 ? O ALA C 274 N ALA C 212 ? N ALA C 212 
R 6 7  O VAL C 215 ? O VAL C 215 N VAL C 198 ? N VAL C 198 
R 7 8  O GLU C 201 ? O GLU C 201 N THR C 128 ? N THR C 128 
R 8 9  O ALA C 127 ? O ALA C 127 N TYR C 59  ? N TYR C 59  
R 9 10 N GLU C 58  ? N GLU C 58  O LYS C 228 ? O LYS C 228 
S 1 2  N VAL C 21  ? N VAL C 21  O VAL C 292 ? O VAL C 292 
S 2 3  O GLY C 293 ? O GLY C 293 N SER C 183 ? N SER C 183 
S 3 4  O LEU C 184 ? O LEU C 184 N THR C 172 ? N THR C 172 
T 1 2  N SER C 66  ? N SER C 66  O LYS C 118 ? O LYS C 118 
T 2 3  O ILE C 113 ? O ILE C 113 N ASP C 95  ? N ASP C 95  
U 1 2  N GLU C 243 ? N GLU C 243 O TYR C 255 ? O TYR C 255 
V 1 2  N THR C 319 ? N THR C 319 O VAL C 327 ? O VAL C 327 
V 2 3  N VAL C 326 ? N VAL C 326 O MET C 374 ? O MET C 374 
V 3 4  O GLN C 375 ? O GLN C 375 N MET C 356 ? N MET C 356 
W 1 2  N CYS C 338 ? N CYS C 338 O ILE C 364 ? O ILE C 364 
W 2 3  N GLU C 365 ? N GLU C 365 O GLY C 368 ? O GLY C 368 
X 1 2  N ARG C 343 ? N ARG C 343 O TYR C 384 ? O TYR C 384 
X 2 3  N GLY C 379 ? N GLY C 379 O GLN C 394 ? O GLN C 394 
# 
_database_PDB_matrix.entry_id          1K4R 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1K4R 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N   . SER A 1 1   ? -42.732 -19.665 235.272 1.00 22.56  ? 1   SER A N   1 
ATOM 2    C CA  . SER A 1 1   ? -41.832 -20.531 234.522 1.00 22.01  ? 1   SER A CA  1 
ATOM 3    C C   . SER A 1 1   ? -40.476 -19.848 234.349 1.00 23.56  ? 1   SER A C   1 
ATOM 4    O O   . SER A 1 1   ? -40.419 -18.708 233.902 1.00 20.81  ? 1   SER A O   1 
ATOM 5    C CB  . SER A 1 1   ? -42.459 -20.770 233.172 1.00 29.68  ? 1   SER A CB  1 
ATOM 6    O OG  . SER A 1 1   ? -41.786 -21.773 232.499 1.00 11.99  ? 1   SER A OG  1 
ATOM 7    N N   . ARG A 1 2   ? -39.391 -20.558 234.642 1.00 20.85  ? 2   ARG A N   1 
ATOM 8    C CA  . ARG A 1 2   ? -38.057 -19.971 234.546 1.00 20.31  ? 2   ARG A CA  1 
ATOM 9    C C   . ARG A 1 2   ? -37.710 -19.352 233.192 1.00 17.71  ? 2   ARG A C   1 
ATOM 10   O O   . ARG A 1 2   ? -37.158 -18.261 233.145 1.00 19.33  ? 2   ARG A O   1 
ATOM 11   C CB  . ARG A 1 2   ? -36.995 -20.993 234.945 1.00 24.90  ? 2   ARG A CB  1 
ATOM 12   C CG  . ARG A 1 2   ? -35.661 -20.378 235.320 1.00 24.14  ? 2   ARG A CG  1 
ATOM 13   C CD  . ARG A 1 2   ? -34.764 -20.227 234.121 1.00 30.49  ? 2   ARG A CD  1 
ATOM 14   N NE  . ARG A 1 2   ? -33.577 -19.427 234.422 1.00 29.80  ? 2   ARG A NE  1 
ATOM 15   C CZ  . ARG A 1 2   ? -32.531 -19.321 233.608 1.00 36.04  ? 2   ARG A CZ  1 
ATOM 16   N NH1 . ARG A 1 2   ? -32.519 -19.976 232.447 1.00 34.38  ? 2   ARG A NH1 1 
ATOM 17   N NH2 . ARG A 1 2   ? -31.516 -18.524 233.928 1.00 29.18  ? 2   ARG A NH2 1 
ATOM 18   N N   . CYS A 1 3   ? -38.028 -20.029 232.098 1.00 17.12  ? 3   CYS A N   1 
ATOM 19   C CA  . CYS A 1 3   ? -37.719 -19.493 230.781 1.00 16.01  ? 3   CYS A CA  1 
ATOM 20   C C   . CYS A 1 3   ? -38.347 -18.131 230.486 1.00 22.29  ? 3   CYS A C   1 
ATOM 21   O O   . CYS A 1 3   ? -37.844 -17.403 229.623 1.00 24.35  ? 3   CYS A O   1 
ATOM 22   C CB  . CYS A 1 3   ? -38.094 -20.463 229.671 1.00 16.73  ? 3   CYS A CB  1 
ATOM 23   S SG  . CYS A 1 3   ? -37.048 -21.958 229.529 1.00 20.25  ? 3   CYS A SG  1 
ATOM 24   N N   . THR A 1 4   ? -39.415 -17.754 231.195 1.00 22.44  ? 4   THR A N   1 
ATOM 25   C CA  . THR A 1 4   ? -40.030 -16.449 230.952 1.00 22.61  ? 4   THR A CA  1 
ATOM 26   C C   . THR A 1 4   ? -39.151 -15.306 231.495 1.00 25.46  ? 4   THR A C   1 
ATOM 27   O O   . THR A 1 4   ? -39.421 -14.127 231.234 1.00 26.11  ? 4   THR A O   1 
ATOM 28   C CB  . THR A 1 4   ? -41.442 -16.345 231.584 1.00 20.99  ? 4   THR A CB  1 
ATOM 29   O OG1 . THR A 1 4   ? -41.344 -16.423 233.010 1.00 15.66  ? 4   THR A OG1 1 
ATOM 30   C CG2 . THR A 1 4   ? -42.356 -17.440 231.056 1.00 13.67  ? 4   THR A CG2 1 
ATOM 31   N N   . HIS A 1 5   ? -38.116 -15.655 232.265 1.00 24.41  ? 5   HIS A N   1 
ATOM 32   C CA  . HIS A 1 5   ? -37.208 -14.673 232.855 1.00 25.07  ? 5   HIS A CA  1 
ATOM 33   C C   . HIS A 1 5   ? -36.184 -14.111 231.867 1.00 28.86  ? 5   HIS A C   1 
ATOM 34   O O   . HIS A 1 5   ? -35.542 -13.086 232.156 1.00 28.44  ? 5   HIS A O   1 
ATOM 35   C CB  . HIS A 1 5   ? -36.417 -15.284 234.019 1.00 19.26  ? 5   HIS A CB  1 
ATOM 36   C CG  . HIS A 1 5   ? -37.253 -15.732 235.178 1.00 20.97  ? 5   HIS A CG  1 
ATOM 37   N ND1 . HIS A 1 5   ? -36.758 -16.541 236.183 1.00 21.79  ? 5   HIS A ND1 1 
ATOM 38   C CD2 . HIS A 1 5   ? -38.542 -15.471 235.509 1.00 18.18  ? 5   HIS A CD2 1 
ATOM 39   C CE1 . HIS A 1 5   ? -37.700 -16.759 237.079 1.00 22.06  ? 5   HIS A CE1 1 
ATOM 40   N NE2 . HIS A 1 5   ? -38.793 -16.124 236.697 1.00 23.52  ? 5   HIS A NE2 1 
ATOM 41   N N   . LEU A 1 6   ? -35.940 -14.814 230.765 1.00 28.80  ? 6   LEU A N   1 
ATOM 42   C CA  . LEU A 1 6   ? -34.949 -14.342 229.809 1.00 32.74  ? 6   LEU A CA  1 
ATOM 43   C C   . LEU A 1 6   ? -35.477 -14.072 228.420 1.00 34.95  ? 6   LEU A C   1 
ATOM 44   O O   . LEU A 1 6   ? -36.570 -14.498 228.063 1.00 36.22  ? 6   LEU A O   1 
ATOM 45   C CB  . LEU A 1 6   ? -33.744 -15.286 229.730 1.00 36.07  ? 6   LEU A CB  1 
ATOM 46   C CG  . LEU A 1 6   ? -33.767 -16.770 230.080 1.00 38.60  ? 6   LEU A CG  1 
ATOM 47   C CD1 . LEU A 1 6   ? -32.604 -17.454 229.429 1.00 40.14  ? 6   LEU A CD1 1 
ATOM 48   C CD2 . LEU A 1 6   ? -33.652 -16.940 231.558 1.00 37.47  ? 6   LEU A CD2 1 
ATOM 49   N N   . GLU A 1 7   ? -34.677 -13.353 227.641 1.00 37.12  ? 7   GLU A N   1 
ATOM 50   C CA  . GLU A 1 7   ? -35.030 -12.991 226.273 1.00 38.06  ? 7   GLU A CA  1 
ATOM 51   C C   . GLU A 1 7   ? -34.728 -14.158 225.333 1.00 37.04  ? 7   GLU A C   1 
ATOM 52   O O   . GLU A 1 7   ? -35.482 -14.422 224.388 1.00 38.14  ? 7   GLU A O   1 
ATOM 53   C CB  . GLU A 1 7   ? -34.254 -11.742 225.841 1.00 47.16  ? 7   GLU A CB  1 
ATOM 54   C CG  . GLU A 1 7   ? -34.665 -11.191 224.468 1.00 68.86  ? 7   GLU A CG  1 
ATOM 55   C CD  . GLU A 1 7   ? -33.678 -10.167 223.912 1.00 78.66  ? 7   GLU A CD  1 
ATOM 56   O OE1 . GLU A 1 7   ? -32.444 -10.398 224.001 1.00 79.08  ? 7   GLU A OE1 1 
ATOM 57   O OE2 . GLU A 1 7   ? -34.128 -9.129  223.359 1.00 80.27  ? 7   GLU A OE2 1 
ATOM 58   N N   . ASN A 1 8   ? -33.645 -14.875 225.612 1.00 33.92  ? 8   ASN A N   1 
ATOM 59   C CA  . ASN A 1 8   ? -33.249 -16.007 224.792 1.00 33.04  ? 8   ASN A CA  1 
ATOM 60   C C   . ASN A 1 8   ? -34.011 -17.276 225.201 1.00 31.86  ? 8   ASN A C   1 
ATOM 61   O O   . ASN A 1 8   ? -33.574 -18.011 226.085 1.00 34.65  ? 8   ASN A O   1 
ATOM 62   C CB  . ASN A 1 8   ? -31.734 -16.220 224.906 1.00 38.41  ? 8   ASN A CB  1 
ATOM 63   C CG  . ASN A 1 8   ? -31.208 -17.284 223.945 1.00 45.32  ? 8   ASN A CG  1 
ATOM 64   O OD1 . ASN A 1 8   ? -31.903 -17.707 223.010 1.00 44.72  ? 8   ASN A OD1 1 
ATOM 65   N ND2 . ASN A 1 8   ? -29.970 -17.717 224.168 1.00 47.59  ? 8   ASN A ND2 1 
ATOM 66   N N   . ARG A 1 9   ? -35.120 -17.555 224.519 1.00 27.57  ? 9   ARG A N   1 
ATOM 67   C CA  . ARG A 1 9   ? -35.940 -18.715 224.825 1.00 22.55  ? 9   ARG A CA  1 
ATOM 68   C C   . ARG A 1 9   ? -36.367 -19.442 223.563 1.00 23.83  ? 9   ARG A C   1 
ATOM 69   O O   . ARG A 1 9   ? -36.713 -18.805 222.576 1.00 25.38  ? 9   ARG A O   1 
ATOM 70   C CB  . ARG A 1 9   ? -37.188 -18.264 225.589 1.00 22.42  ? 9   ARG A CB  1 
ATOM 71   C CG  . ARG A 1 9   ? -38.171 -19.365 225.952 1.00 19.23  ? 9   ARG A CG  1 
ATOM 72   C CD  . ARG A 1 9   ? -39.407 -18.766 226.608 1.00 19.69  ? 9   ARG A CD  1 
ATOM 73   N NE  . ARG A 1 9   ? -40.316 -19.792 227.113 1.00 16.79  ? 9   ARG A NE  1 
ATOM 74   C CZ  . ARG A 1 9   ? -41.566 -19.557 227.505 1.00 20.58  ? 9   ARG A CZ  1 
ATOM 75   N NH1 . ARG A 1 9   ? -42.066 -18.333 227.434 1.00 16.24  ? 9   ARG A NH1 1 
ATOM 76   N NH2 . ARG A 1 9   ? -42.316 -20.540 227.983 1.00 12.79  ? 9   ARG A NH2 1 
ATOM 77   N N   . ASP A 1 10  ? -36.336 -20.772 223.589 1.00 23.10  ? 10  ASP A N   1 
ATOM 78   C CA  . ASP A 1 10  ? -36.761 -21.574 222.451 1.00 24.62  ? 10  ASP A CA  1 
ATOM 79   C C   . ASP A 1 10  ? -37.908 -22.442 222.896 1.00 26.76  ? 10  ASP A C   1 
ATOM 80   O O   . ASP A 1 10  ? -38.035 -22.753 224.083 1.00 29.99  ? 10  ASP A O   1 
ATOM 81   C CB  . ASP A 1 10  ? -35.643 -22.491 221.953 1.00 29.14  ? 10  ASP A CB  1 
ATOM 82   C CG  . ASP A 1 10  ? -34.488 -21.728 221.333 1.00 42.83  ? 10  ASP A CG  1 
ATOM 83   O OD1 . ASP A 1 10  ? -34.731 -20.792 220.529 1.00 45.29  ? 10  ASP A OD1 1 
ATOM 84   O OD2 . ASP A 1 10  ? -33.326 -22.073 221.647 1.00 52.37  ? 10  ASP A OD2 1 
ATOM 85   N N   . PHE A 1 11  ? -38.752 -22.828 221.949 1.00 26.78  ? 11  PHE A N   1 
ATOM 86   C CA  . PHE A 1 11  ? -39.881 -23.697 222.241 1.00 25.09  ? 11  PHE A CA  1 
ATOM 87   C C   . PHE A 1 11  ? -39.674 -24.981 221.427 1.00 29.00  ? 11  PHE A C   1 
ATOM 88   O O   . PHE A 1 11  ? -39.390 -24.933 220.219 1.00 27.04  ? 11  PHE A O   1 
ATOM 89   C CB  . PHE A 1 11  ? -41.216 -23.039 221.835 1.00 25.20  ? 11  PHE A CB  1 
ATOM 90   C CG  . PHE A 1 11  ? -41.636 -21.862 222.704 1.00 25.10  ? 11  PHE A CG  1 
ATOM 91   C CD1 . PHE A 1 11  ? -41.178 -20.568 222.430 1.00 21.74  ? 11  PHE A CD1 1 
ATOM 92   C CD2 . PHE A 1 11  ? -42.523 -22.041 223.767 1.00 24.84  ? 11  PHE A CD2 1 
ATOM 93   C CE1 . PHE A 1 11  ? -41.598 -19.470 223.202 1.00 21.87  ? 11  PHE A CE1 1 
ATOM 94   C CE2 . PHE A 1 11  ? -42.947 -20.943 224.545 1.00 21.12  ? 11  PHE A CE2 1 
ATOM 95   C CZ  . PHE A 1 11  ? -42.483 -19.662 224.257 1.00 22.83  ? 11  PHE A CZ  1 
ATOM 96   N N   . VAL A 1 12  ? -39.721 -26.122 222.106 1.00 30.42  ? 12  VAL A N   1 
ATOM 97   C CA  . VAL A 1 12  ? -39.578 -27.408 221.446 1.00 34.09  ? 12  VAL A CA  1 
ATOM 98   C C   . VAL A 1 12  ? -40.880 -28.127 221.700 1.00 39.46  ? 12  VAL A C   1 
ATOM 99   O O   . VAL A 1 12  ? -41.367 -28.161 222.829 1.00 41.20  ? 12  VAL A O   1 
ATOM 100  C CB  . VAL A 1 12  ? -38.408 -28.213 221.996 1.00 32.50  ? 12  VAL A CB  1 
ATOM 101  C CG1 . VAL A 1 12  ? -38.510 -29.641 221.529 1.00 29.52  ? 12  VAL A CG1 1 
ATOM 102  C CG2 . VAL A 1 12  ? -37.111 -27.617 221.490 1.00 26.88  ? 12  VAL A CG2 1 
ATOM 103  N N   . THR A 1 13  ? -41.437 -28.718 220.656 1.00 46.06  ? 13  THR A N   1 
ATOM 104  C CA  . THR A 1 13  ? -42.711 -29.384 220.790 1.00 53.74  ? 13  THR A CA  1 
ATOM 105  C C   . THR A 1 13  ? -42.752 -30.797 220.219 1.00 57.95  ? 13  THR A C   1 
ATOM 106  O O   . THR A 1 13  ? -42.389 -31.027 219.065 1.00 58.88  ? 13  THR A O   1 
ATOM 107  C CB  . THR A 1 13  ? -43.815 -28.506 220.162 1.00 56.00  ? 13  THR A CB  1 
ATOM 108  O OG1 . THR A 1 13  ? -45.098 -29.093 220.387 1.00 58.83  ? 13  THR A OG1 1 
ATOM 109  C CG2 . THR A 1 13  ? -43.580 -28.327 218.666 1.00 61.32  ? 13  THR A CG2 1 
ATOM 110  N N   . GLY A 1 14  ? -43.175 -31.742 221.049 1.00 63.49  ? 14  GLY A N   1 
ATOM 111  C CA  . GLY A 1 14  ? -43.292 -33.124 220.620 1.00 72.23  ? 14  GLY A CA  1 
ATOM 112  C C   . GLY A 1 14  ? -44.753 -33.434 220.323 1.00 77.68  ? 14  GLY A C   1 
ATOM 113  O O   . GLY A 1 14  ? -45.636 -33.104 221.126 1.00 78.05  ? 14  GLY A O   1 
ATOM 114  N N   . THR A 1 15  ? -45.028 -34.041 219.167 1.00 82.88  ? 15  THR A N   1 
ATOM 115  C CA  . THR A 1 15  ? -46.407 -34.377 218.788 1.00 88.26  ? 15  THR A CA  1 
ATOM 116  C C   . THR A 1 15  ? -46.829 -35.784 219.262 1.00 91.27  ? 15  THR A C   1 
ATOM 117  O O   . THR A 1 15  ? -46.395 -36.239 220.332 1.00 92.02  ? 15  THR A O   1 
ATOM 118  C CB  . THR A 1 15  ? -46.641 -34.215 217.246 1.00 89.13  ? 15  THR A CB  1 
ATOM 119  O OG1 . THR A 1 15  ? -45.573 -34.836 216.515 1.00 89.02  ? 15  THR A OG1 1 
ATOM 120  C CG2 . THR A 1 15  ? -46.743 -32.736 216.863 1.00 88.77  ? 15  THR A CG2 1 
ATOM 121  N N   . GLN A 1 16  ? -47.683 -36.454 218.484 1.00 93.31  ? 16  GLN A N   1 
ATOM 122  C CA  . GLN A 1 16  ? -48.156 -37.800 218.817 1.00 95.26  ? 16  GLN A CA  1 
ATOM 123  C C   . GLN A 1 16  ? -47.021 -38.826 218.645 1.00 95.12  ? 16  GLN A C   1 
ATOM 124  O O   . GLN A 1 16  ? -46.349 -38.853 217.607 1.00 94.06  ? 16  GLN A O   1 
ATOM 125  C CB  . GLN A 1 16  ? -49.365 -38.165 217.931 1.00 98.62  ? 16  GLN A CB  1 
ATOM 126  C CG  . GLN A 1 16  ? -50.060 -39.494 218.268 1.00 102.93 ? 16  GLN A CG  1 
ATOM 127  C CD  . GLN A 1 16  ? -50.680 -39.514 219.661 1.00 107.28 ? 16  GLN A CD  1 
ATOM 128  O OE1 . GLN A 1 16  ? -50.402 -40.406 220.462 1.00 106.78 ? 16  GLN A OE1 1 
ATOM 129  N NE2 . GLN A 1 16  ? -51.520 -38.528 219.954 1.00 107.92 ? 16  GLN A NE2 1 
ATOM 130  N N   . GLY A 1 17  ? -46.785 -39.626 219.686 1.00 95.51  ? 17  GLY A N   1 
ATOM 131  C CA  . GLY A 1 17  ? -45.741 -40.638 219.637 1.00 94.85  ? 17  GLY A CA  1 
ATOM 132  C C   . GLY A 1 17  ? -44.377 -40.154 220.102 1.00 93.93  ? 17  GLY A C   1 
ATOM 133  O O   . GLY A 1 17  ? -43.578 -40.951 220.613 1.00 94.49  ? 17  GLY A O   1 
ATOM 134  N N   . THR A 1 18  ? -44.102 -38.862 219.915 1.00 91.97  ? 18  THR A N   1 
ATOM 135  C CA  . THR A 1 18  ? -42.826 -38.270 220.319 1.00 88.41  ? 18  THR A CA  1 
ATOM 136  C C   . THR A 1 18  ? -42.619 -38.517 221.811 1.00 83.44  ? 18  THR A C   1 
ATOM 137  O O   . THR A 1 18  ? -43.320 -37.952 222.651 1.00 83.34  ? 18  THR A O   1 
ATOM 138  C CB  . THR A 1 18  ? -42.785 -36.740 220.038 1.00 91.92  ? 18  THR A CB  1 
ATOM 139  O OG1 . THR A 1 18  ? -43.080 -36.491 218.655 1.00 92.35  ? 18  THR A OG1 1 
ATOM 140  C CG2 . THR A 1 18  ? -41.406 -36.168 220.365 1.00 92.51  ? 18  THR A CG2 1 
ATOM 141  N N   . THR A 1 19  ? -41.683 -39.404 222.124 1.00 78.07  ? 19  THR A N   1 
ATOM 142  C CA  . THR A 1 19  ? -41.386 -39.755 223.504 1.00 72.87  ? 19  THR A CA  1 
ATOM 143  C C   . THR A 1 19  ? -40.020 -39.197 223.928 1.00 67.65  ? 19  THR A C   1 
ATOM 144  O O   . THR A 1 19  ? -39.782 -38.916 225.105 1.00 65.18  ? 19  THR A O   1 
ATOM 145  C CB  . THR A 1 19  ? -41.424 -41.302 223.668 1.00 75.75  ? 19  THR A CB  1 
ATOM 146  O OG1 . THR A 1 19  ? -41.372 -41.651 225.056 1.00 76.93  ? 19  THR A OG1 1 
ATOM 147  C CG2 . THR A 1 19  ? -40.266 -41.972 222.906 1.00 75.02  ? 19  THR A CG2 1 
ATOM 148  N N   . ARG A 1 20  ? -39.159 -38.984 222.937 1.00 63.44  ? 20  ARG A N   1 
ATOM 149  C CA  . ARG A 1 20  ? -37.806 -38.487 223.141 1.00 59.07  ? 20  ARG A CA  1 
ATOM 150  C C   . ARG A 1 20  ? -37.622 -37.160 222.398 1.00 53.59  ? 20  ARG A C   1 
ATOM 151  O O   . ARG A 1 20  ? -38.205 -36.953 221.332 1.00 54.28  ? 20  ARG A O   1 
ATOM 152  C CB  . ARG A 1 20  ? -36.827 -39.530 222.608 1.00 63.80  ? 20  ARG A CB  1 
ATOM 153  C CG  . ARG A 1 20  ? -35.431 -39.454 223.164 1.00 76.43  ? 20  ARG A CG  1 
ATOM 154  C CD  . ARG A 1 20  ? -35.012 -40.830 223.639 1.00 87.84  ? 20  ARG A CD  1 
ATOM 155  N NE  . ARG A 1 20  ? -33.582 -41.060 223.461 1.00 100.85 ? 20  ARG A NE  1 
ATOM 156  C CZ  . ARG A 1 20  ? -32.936 -42.144 223.889 1.00 108.03 ? 20  ARG A CZ  1 
ATOM 157  N NH1 . ARG A 1 20  ? -33.591 -43.107 224.532 1.00 110.37 ? 20  ARG A NH1 1 
ATOM 158  N NH2 . ARG A 1 20  ? -31.634 -42.277 223.656 1.00 111.60 ? 20  ARG A NH2 1 
ATOM 159  N N   . VAL A 1 21  ? -36.824 -36.262 222.964 1.00 47.44  ? 21  VAL A N   1 
ATOM 160  C CA  . VAL A 1 21  ? -36.574 -34.956 222.360 1.00 42.81  ? 21  VAL A CA  1 
ATOM 161  C C   . VAL A 1 21  ? -35.083 -34.607 222.437 1.00 39.45  ? 21  VAL A C   1 
ATOM 162  O O   . VAL A 1 21  ? -34.474 -34.733 223.498 1.00 38.92  ? 21  VAL A O   1 
ATOM 163  C CB  . VAL A 1 21  ? -37.411 -33.851 223.075 1.00 42.42  ? 21  VAL A CB  1 
ATOM 164  C CG1 . VAL A 1 21  ? -36.961 -32.493 222.642 1.00 44.27  ? 21  VAL A CG1 1 
ATOM 165  C CG2 . VAL A 1 21  ? -38.887 -34.008 222.751 1.00 44.60  ? 21  VAL A CG2 1 
ATOM 166  N N   . THR A 1 22  ? -34.498 -34.196 221.315 1.00 35.66  ? 22  THR A N   1 
ATOM 167  C CA  . THR A 1 22  ? -33.086 -33.826 221.274 1.00 35.02  ? 22  THR A CA  1 
ATOM 168  C C   . THR A 1 22  ? -32.986 -32.312 221.225 1.00 34.18  ? 22  THR A C   1 
ATOM 169  O O   . THR A 1 22  ? -33.544 -31.695 220.332 1.00 37.84  ? 22  THR A O   1 
ATOM 170  C CB  . THR A 1 22  ? -32.386 -34.436 220.044 1.00 36.30  ? 22  THR A CB  1 
ATOM 171  O OG1 . THR A 1 22  ? -32.514 -35.861 220.089 1.00 41.08  ? 22  THR A OG1 1 
ATOM 172  C CG2 . THR A 1 22  ? -30.903 -34.097 220.038 1.00 41.26  ? 22  THR A CG2 1 
ATOM 173  N N   . LEU A 1 23  ? -32.272 -31.718 222.176 1.00 31.03  ? 23  LEU A N   1 
ATOM 174  C CA  . LEU A 1 23  ? -32.127 -30.263 222.253 1.00 29.89  ? 23  LEU A CA  1 
ATOM 175  C C   . LEU A 1 23  ? -30.667 -29.837 222.254 1.00 29.55  ? 23  LEU A C   1 
ATOM 176  O O   . LEU A 1 23  ? -29.798 -30.579 222.710 1.00 30.52  ? 23  LEU A O   1 
ATOM 177  C CB  . LEU A 1 23  ? -32.692 -29.739 223.584 1.00 31.75  ? 23  LEU A CB  1 
ATOM 178  C CG  . LEU A 1 23  ? -33.979 -30.239 224.233 1.00 33.78  ? 23  LEU A CG  1 
ATOM 179  C CD1 . LEU A 1 23  ? -34.039 -29.806 225.700 1.00 39.72  ? 23  LEU A CD1 1 
ATOM 180  C CD2 . LEU A 1 23  ? -35.158 -29.702 223.478 1.00 39.06  ? 23  LEU A CD2 1 
ATOM 181  N N   . VAL A 1 24  ? -30.410 -28.616 221.795 1.00 28.16  ? 24  VAL A N   1 
ATOM 182  C CA  . VAL A 1 24  ? -29.071 -28.052 221.830 1.00 25.49  ? 24  VAL A CA  1 
ATOM 183  C C   . VAL A 1 24  ? -29.224 -26.901 222.809 1.00 26.51  ? 24  VAL A C   1 
ATOM 184  O O   . VAL A 1 24  ? -29.843 -25.875 222.501 1.00 28.84  ? 24  VAL A O   1 
ATOM 185  C CB  . VAL A 1 24  ? -28.593 -27.536 220.473 1.00 26.46  ? 24  VAL A CB  1 
ATOM 186  C CG1 . VAL A 1 24  ? -27.281 -26.786 220.646 1.00 29.34  ? 24  VAL A CG1 1 
ATOM 187  C CG2 . VAL A 1 24  ? -28.385 -28.706 219.531 1.00 24.03  ? 24  VAL A CG2 1 
ATOM 188  N N   . LEU A 1 25  ? -28.748 -27.138 224.026 1.00 24.02  ? 25  LEU A N   1 
ATOM 189  C CA  . LEU A 1 25  ? -28.824 -26.176 225.107 1.00 22.40  ? 25  LEU A CA  1 
ATOM 190  C C   . LEU A 1 25  ? -27.616 -25.285 225.063 1.00 22.81  ? 25  LEU A C   1 
ATOM 191  O O   . LEU A 1 25  ? -26.498 -25.770 224.875 1.00 25.51  ? 25  LEU A O   1 
ATOM 192  C CB  . LEU A 1 25  ? -28.851 -26.911 226.450 1.00 19.98  ? 25  LEU A CB  1 
ATOM 193  C CG  . LEU A 1 25  ? -30.038 -27.858 226.614 1.00 23.59  ? 25  LEU A CG  1 
ATOM 194  C CD1 . LEU A 1 25  ? -29.940 -28.618 227.939 1.00 20.45  ? 25  LEU A CD1 1 
ATOM 195  C CD2 . LEU A 1 25  ? -31.323 -27.047 226.543 1.00 18.14  ? 25  LEU A CD2 1 
ATOM 196  N N   . GLU A 1 26  ? -27.834 -23.986 225.213 1.00 21.34  ? 26  GLU A N   1 
ATOM 197  C CA  . GLU A 1 26  ? -26.729 -23.050 225.230 1.00 22.12  ? 26  GLU A CA  1 
ATOM 198  C C   . GLU A 1 26  ? -26.752 -22.193 226.490 1.00 20.87  ? 26  GLU A C   1 
ATOM 199  O O   . GLU A 1 26  ? -27.816 -21.904 227.046 1.00 19.71  ? 26  GLU A O   1 
ATOM 200  C CB  . GLU A 1 26  ? -26.701 -22.195 223.961 1.00 26.69  ? 26  GLU A CB  1 
ATOM 201  C CG  . GLU A 1 26  ? -27.914 -21.339 223.709 1.00 44.59  ? 26  GLU A CG  1 
ATOM 202  C CD  . GLU A 1 26  ? -27.930 -20.750 222.296 1.00 54.69  ? 26  GLU A CD  1 
ATOM 203  O OE1 . GLU A 1 26  ? -27.116 -21.181 221.443 1.00 48.58  ? 26  GLU A OE1 1 
ATOM 204  O OE2 . GLU A 1 26  ? -28.773 -19.858 222.039 1.00 59.96  ? 26  GLU A OE2 1 
ATOM 205  N N   . LEU A 1 27  ? -25.564 -21.872 226.986 1.00 19.78  ? 27  LEU A N   1 
ATOM 206  C CA  . LEU A 1 27  ? -25.408 -21.053 228.178 1.00 21.25  ? 27  LEU A CA  1 
ATOM 207  C C   . LEU A 1 27  ? -26.093 -19.710 227.878 1.00 21.56  ? 27  LEU A C   1 
ATOM 208  O O   . LEU A 1 27  ? -25.851 -19.104 226.835 1.00 22.13  ? 27  LEU A O   1 
ATOM 209  C CB  . LEU A 1 27  ? -23.913 -20.888 228.456 1.00 22.90  ? 27  LEU A CB  1 
ATOM 210  C CG  . LEU A 1 27  ? -23.354 -21.076 229.866 1.00 24.56  ? 27  LEU A CG  1 
ATOM 211  C CD1 . LEU A 1 27  ? -23.995 -22.236 230.553 1.00 21.99  ? 27  LEU A CD1 1 
ATOM 212  C CD2 . LEU A 1 27  ? -21.862 -21.305 229.782 1.00 18.62  ? 27  LEU A CD2 1 
ATOM 213  N N   . GLY A 1 28  ? -26.958 -19.262 228.781 1.00 19.79  ? 28  GLY A N   1 
ATOM 214  C CA  . GLY A 1 28  ? -27.705 -18.031 228.558 1.00 20.94  ? 28  GLY A CA  1 
ATOM 215  C C   . GLY A 1 28  ? -29.026 -18.238 227.799 1.00 21.90  ? 28  GLY A C   1 
ATOM 216  O O   . GLY A 1 28  ? -29.763 -17.288 227.521 1.00 23.08  ? 28  GLY A O   1 
ATOM 217  N N   . GLY A 1 29  ? -29.320 -19.475 227.425 1.00 20.55  ? 29  GLY A N   1 
ATOM 218  C CA  . GLY A 1 29  ? -30.554 -19.763 226.719 1.00 19.73  ? 29  GLY A CA  1 
ATOM 219  C C   . GLY A 1 29  ? -31.478 -20.529 227.648 1.00 20.19  ? 29  GLY A C   1 
ATOM 220  O O   . GLY A 1 29  ? -31.116 -20.800 228.802 1.00 19.39  ? 29  GLY A O   1 
ATOM 221  N N   . CYS A 1 30  ? -32.659 -20.891 227.159 1.00 20.17  ? 30  CYS A N   1 
ATOM 222  C CA  . CYS A 1 30  ? -33.631 -21.619 227.963 1.00 20.81  ? 30  CYS A CA  1 
ATOM 223  C C   . CYS A 1 30  ? -34.611 -22.262 226.991 1.00 20.33  ? 30  CYS A C   1 
ATOM 224  O O   . CYS A 1 30  ? -34.999 -21.638 226.004 1.00 19.07  ? 30  CYS A O   1 
ATOM 225  C CB  . CYS A 1 30  ? -34.368 -20.650 228.905 1.00 19.12  ? 30  CYS A CB  1 
ATOM 226  S SG  . CYS A 1 30  ? -35.245 -21.431 230.308 1.00 21.43  ? 30  CYS A SG  1 
ATOM 227  N N   . VAL A 1 31  ? -34.971 -23.520 227.236 1.00 19.03  ? 31  VAL A N   1 
ATOM 228  C CA  . VAL A 1 31  ? -35.908 -24.212 226.354 1.00 18.92  ? 31  VAL A CA  1 
ATOM 229  C C   . VAL A 1 31  ? -37.204 -24.644 227.048 1.00 21.64  ? 31  VAL A C   1 
ATOM 230  O O   . VAL A 1 31  ? -37.170 -25.257 228.129 1.00 19.80  ? 31  VAL A O   1 
ATOM 231  C CB  . VAL A 1 31  ? -35.261 -25.482 225.740 1.00 22.72  ? 31  VAL A CB  1 
ATOM 232  C CG1 . VAL A 1 31  ? -36.212 -26.128 224.726 1.00 16.96  ? 31  VAL A CG1 1 
ATOM 233  C CG2 . VAL A 1 31  ? -33.919 -25.135 225.085 1.00 23.91  ? 31  VAL A CG2 1 
ATOM 234  N N   . THR A 1 32  ? -38.346 -24.303 226.454 1.00 20.30  ? 32  THR A N   1 
ATOM 235  C CA  . THR A 1 32  ? -39.625 -24.743 227.002 1.00 20.60  ? 32  THR A CA  1 
ATOM 236  C C   . THR A 1 32  ? -40.074 -25.932 226.157 1.00 19.99  ? 32  THR A C   1 
ATOM 237  O O   . THR A 1 32  ? -40.190 -25.824 224.944 1.00 19.35  ? 32  THR A O   1 
ATOM 238  C CB  . THR A 1 32  ? -40.735 -23.650 226.954 1.00 21.67  ? 32  THR A CB  1 
ATOM 239  O OG1 . THR A 1 32  ? -40.400 -22.579 227.845 1.00 18.47  ? 32  THR A OG1 1 
ATOM 240  C CG2 . THR A 1 32  ? -42.080 -24.248 227.402 1.00 15.68  ? 32  THR A CG2 1 
ATOM 241  N N   . ILE A 1 33  ? -40.250 -27.082 226.786 1.00 18.44  ? 33  ILE A N   1 
ATOM 242  C CA  . ILE A 1 33  ? -40.700 -28.273 226.080 1.00 19.70  ? 33  ILE A CA  1 
ATOM 243  C C   . ILE A 1 33  ? -42.186 -28.512 226.384 1.00 22.15  ? 33  ILE A C   1 
ATOM 244  O O   . ILE A 1 33  ? -42.586 -28.566 227.555 1.00 22.00  ? 33  ILE A O   1 
ATOM 245  C CB  . ILE A 1 33  ? -39.951 -29.539 226.566 1.00 18.15  ? 33  ILE A CB  1 
ATOM 246  C CG1 . ILE A 1 33  ? -38.439 -29.360 226.467 1.00 19.08  ? 33  ILE A CG1 1 
ATOM 247  C CG2 . ILE A 1 33  ? -40.414 -30.755 225.773 1.00 20.35  ? 33  ILE A CG2 1 
ATOM 248  C CD1 . ILE A 1 33  ? -37.667 -30.548 227.028 1.00 23.45  ? 33  ILE A CD1 1 
ATOM 249  N N   . THR A 1 34  ? -42.992 -28.677 225.342 1.00 23.56  ? 34  THR A N   1 
ATOM 250  C CA  . THR A 1 34  ? -44.417 -28.968 225.505 1.00 27.52  ? 34  THR A CA  1 
ATOM 251  C C   . THR A 1 34  ? -44.681 -30.250 224.704 1.00 29.25  ? 34  THR A C   1 
ATOM 252  O O   . THR A 1 34  ? -44.037 -30.481 223.677 1.00 30.72  ? 34  THR A O   1 
ATOM 253  C CB  . THR A 1 34  ? -45.293 -27.831 224.940 1.00 29.90  ? 34  THR A CB  1 
ATOM 254  O OG1 . THR A 1 34  ? -44.996 -27.641 223.548 1.00 31.54  ? 34  THR A OG1 1 
ATOM 255  C CG2 . THR A 1 34  ? -45.027 -26.538 225.676 1.00 24.10  ? 34  THR A CG2 1 
ATOM 256  N N   . ALA A 1 35  ? -45.582 -31.101 225.178 1.00 30.94  ? 35  ALA A N   1 
ATOM 257  C CA  . ALA A 1 35  ? -45.904 -32.336 224.458 1.00 32.10  ? 35  ALA A CA  1 
ATOM 258  C C   . ALA A 1 35  ? -47.278 -32.819 224.896 1.00 32.79  ? 35  ALA A C   1 
ATOM 259  O O   . ALA A 1 35  ? -47.615 -32.714 226.078 1.00 32.72  ? 35  ALA A O   1 
ATOM 260  C CB  . ALA A 1 35  ? -44.845 -33.412 224.725 1.00 27.37  ? 35  ALA A CB  1 
ATOM 261  N N   . GLU A 1 36  ? -48.064 -33.326 223.944 1.00 35.34  ? 36  GLU A N   1 
ATOM 262  C CA  . GLU A 1 36  ? -49.417 -33.827 224.213 1.00 36.87  ? 36  GLU A CA  1 
ATOM 263  C C   . GLU A 1 36  ? -49.448 -34.830 225.357 1.00 34.80  ? 36  GLU A C   1 
ATOM 264  O O   . GLU A 1 36  ? -48.695 -35.806 225.360 1.00 34.49  ? 36  GLU A O   1 
ATOM 265  C CB  . GLU A 1 36  ? -50.003 -34.499 222.972 1.00 47.69  ? 36  GLU A CB  1 
ATOM 266  C CG  . GLU A 1 36  ? -50.340 -33.568 221.812 1.00 64.70  ? 36  GLU A CG  1 
ATOM 267  C CD  . GLU A 1 36  ? -50.561 -34.329 220.500 1.00 76.10  ? 36  GLU A CD  1 
ATOM 268  O OE1 . GLU A 1 36  ? -51.087 -35.469 220.543 1.00 82.15  ? 36  GLU A OE1 1 
ATOM 269  O OE2 . GLU A 1 36  ? -50.192 -33.793 219.427 1.00 75.31  ? 36  GLU A OE2 1 
ATOM 270  N N   . GLY A 1 37  ? -50.311 -34.571 226.332 1.00 33.45  ? 37  GLY A N   1 
ATOM 271  C CA  . GLY A 1 37  ? -50.446 -35.464 227.467 1.00 33.82  ? 37  GLY A CA  1 
ATOM 272  C C   . GLY A 1 37  ? -49.305 -35.460 228.469 1.00 35.24  ? 37  GLY A C   1 
ATOM 273  O O   . GLY A 1 37  ? -49.308 -36.261 229.407 1.00 35.52  ? 37  GLY A O   1 
ATOM 274  N N   . LYS A 1 38  ? -48.346 -34.551 228.302 1.00 34.83  ? 38  LYS A N   1 
ATOM 275  C CA  . LYS A 1 38  ? -47.207 -34.461 229.215 1.00 33.04  ? 38  LYS A CA  1 
ATOM 276  C C   . LYS A 1 38  ? -47.154 -33.089 229.876 1.00 31.39  ? 38  LYS A C   1 
ATOM 277  O O   . LYS A 1 38  ? -47.579 -32.088 229.288 1.00 29.47  ? 38  LYS A O   1 
ATOM 278  C CB  . LYS A 1 38  ? -45.889 -34.660 228.454 1.00 36.22  ? 38  LYS A CB  1 
ATOM 279  C CG  . LYS A 1 38  ? -45.735 -35.981 227.717 1.00 38.94  ? 38  LYS A CG  1 
ATOM 280  C CD  . LYS A 1 38  ? -45.661 -37.128 228.687 1.00 40.47  ? 38  LYS A CD  1 
ATOM 281  C CE  . LYS A 1 38  ? -45.429 -38.425 227.957 1.00 38.95  ? 38  LYS A CE  1 
ATOM 282  N NZ  . LYS A 1 38  ? -45.495 -39.539 228.931 1.00 46.24  ? 38  LYS A NZ  1 
ATOM 283  N N   . PRO A 1 39  ? -46.698 -33.031 231.137 1.00 28.59  ? 39  PRO A N   1 
ATOM 284  C CA  . PRO A 1 39  ? -46.618 -31.720 231.776 1.00 25.16  ? 39  PRO A CA  1 
ATOM 285  C C   . PRO A 1 39  ? -45.450 -31.005 231.079 1.00 24.64  ? 39  PRO A C   1 
ATOM 286  O O   . PRO A 1 39  ? -44.493 -31.659 230.670 1.00 24.46  ? 39  PRO A O   1 
ATOM 287  C CB  . PRO A 1 39  ? -46.290 -32.073 233.227 1.00 28.70  ? 39  PRO A CB  1 
ATOM 288  C CG  . PRO A 1 39  ? -45.533 -33.359 233.120 1.00 30.34  ? 39  PRO A CG  1 
ATOM 289  C CD  . PRO A 1 39  ? -46.306 -34.106 232.064 1.00 30.86  ? 39  PRO A CD  1 
ATOM 290  N N   . SER A 1 40  ? -45.558 -29.700 230.867 1.00 23.01  ? 40  SER A N   1 
ATOM 291  C CA  . SER A 1 40  ? -44.489 -28.946 230.210 1.00 21.11  ? 40  SER A CA  1 
ATOM 292  C C   . SER A 1 40  ? -43.258 -28.799 231.105 1.00 20.80  ? 40  SER A C   1 
ATOM 293  O O   . SER A 1 40  ? -43.382 -28.708 232.335 1.00 18.53  ? 40  SER A O   1 
ATOM 294  C CB  . SER A 1 40  ? -45.004 -27.582 229.760 1.00 20.24  ? 40  SER A CB  1 
ATOM 295  O OG  . SER A 1 40  ? -46.005 -27.740 228.771 1.00 24.60  ? 40  SER A OG  1 
ATOM 296  N N   . MET A 1 41  ? -42.080 -28.710 230.485 1.00 21.95  ? 41  MET A N   1 
ATOM 297  C CA  . MET A 1 41  ? -40.820 -28.615 231.222 1.00 23.96  ? 41  MET A CA  1 
ATOM 298  C C   . MET A 1 41  ? -39.904 -27.530 230.696 1.00 21.93  ? 41  MET A C   1 
ATOM 299  O O   . MET A 1 41  ? -39.831 -27.332 229.493 1.00 21.33  ? 41  MET A O   1 
ATOM 300  C CB  . MET A 1 41  ? -40.052 -29.945 231.104 1.00 28.83  ? 41  MET A CB  1 
ATOM 301  C CG  . MET A 1 41  ? -40.740 -31.158 231.712 1.00 35.71  ? 41  MET A CG  1 
ATOM 302  S SD  . MET A 1 41  ? -40.763 -31.151 233.546 1.00 43.20  ? 41  MET A SD  1 
ATOM 303  C CE  . MET A 1 41  ? -39.772 -32.578 233.870 1.00 58.70  ? 41  MET A CE  1 
ATOM 304  N N   . ASP A 1 42  ? -39.246 -26.799 231.599 1.00 19.78  ? 42  ASP A N   1 
ATOM 305  C CA  . ASP A 1 42  ? -38.261 -25.779 231.207 1.00 18.81  ? 42  ASP A CA  1 
ATOM 306  C C   . ASP A 1 42  ? -36.888 -26.398 231.505 1.00 19.53  ? 42  ASP A C   1 
ATOM 307  O O   . ASP A 1 42  ? -36.642 -26.881 232.624 1.00 19.37  ? 42  ASP A O   1 
ATOM 308  C CB  . ASP A 1 42  ? -38.434 -24.471 231.991 1.00 13.64  ? 42  ASP A CB  1 
ATOM 309  C CG  . ASP A 1 42  ? -39.451 -23.519 231.340 1.00 17.45  ? 42  ASP A CG  1 
ATOM 310  O OD1 . ASP A 1 42  ? -40.046 -23.853 230.297 1.00 16.23  ? 42  ASP A OD1 1 
ATOM 311  O OD2 . ASP A 1 42  ? -39.631 -22.409 231.860 1.00 19.41  ? 42  ASP A OD2 1 
ATOM 312  N N   . VAL A 1 43  ? -36.011 -26.403 230.505 1.00 17.52  ? 43  VAL A N   1 
ATOM 313  C CA  . VAL A 1 43  ? -34.684 -26.997 230.640 1.00 17.86  ? 43  VAL A CA  1 
ATOM 314  C C   . VAL A 1 43  ? -33.631 -26.017 230.161 1.00 18.01  ? 43  VAL A C   1 
ATOM 315  O O   . VAL A 1 43  ? -33.844 -25.318 229.164 1.00 18.32  ? 43  VAL A O   1 
ATOM 316  C CB  . VAL A 1 43  ? -34.580 -28.270 229.768 1.00 18.22  ? 43  VAL A CB  1 
ATOM 317  C CG1 . VAL A 1 43  ? -33.278 -28.982 230.027 1.00 20.46  ? 43  VAL A CG1 1 
ATOM 318  C CG2 . VAL A 1 43  ? -35.748 -29.203 230.059 1.00 19.72  ? 43  VAL A CG2 1 
ATOM 319  N N   . TRP A 1 44  ? -32.499 -25.954 230.855 1.00 15.02  ? 44  TRP A N   1 
ATOM 320  C CA  . TRP A 1 44  ? -31.442 -25.054 230.419 1.00 13.54  ? 44  TRP A CA  1 
ATOM 321  C C   . TRP A 1 44  ? -30.073 -25.459 230.922 1.00 17.78  ? 44  TRP A C   1 
ATOM 322  O O   . TRP A 1 44  ? -29.960 -26.091 231.983 1.00 17.05  ? 44  TRP A O   1 
ATOM 323  C CB  . TRP A 1 44  ? -31.739 -23.611 230.840 1.00 13.09  ? 44  TRP A CB  1 
ATOM 324  C CG  . TRP A 1 44  ? -31.703 -23.352 232.314 1.00 13.79  ? 44  TRP A CG  1 
ATOM 325  C CD1 . TRP A 1 44  ? -30.663 -22.817 233.032 1.00 11.98  ? 44  TRP A CD1 1 
ATOM 326  C CD2 . TRP A 1 44  ? -32.776 -23.552 233.252 1.00 14.40  ? 44  TRP A CD2 1 
ATOM 327  N NE1 . TRP A 1 44  ? -31.027 -22.669 234.353 1.00 14.47  ? 44  TRP A NE1 1 
ATOM 328  C CE2 . TRP A 1 44  ? -32.316 -23.114 234.513 1.00 15.32  ? 44  TRP A CE2 1 
ATOM 329  C CE3 . TRP A 1 44  ? -34.083 -24.053 233.144 1.00 16.89  ? 44  TRP A CE3 1 
ATOM 330  C CZ2 . TRP A 1 44  ? -33.124 -23.163 235.662 1.00 17.34  ? 44  TRP A CZ2 1 
ATOM 331  C CZ3 . TRP A 1 44  ? -34.886 -24.100 234.286 1.00 15.19  ? 44  TRP A CZ3 1 
ATOM 332  C CH2 . TRP A 1 44  ? -34.402 -23.659 235.525 1.00 16.33  ? 44  TRP A CH2 1 
ATOM 333  N N   . LEU A 1 45  ? -29.044 -25.137 230.133 1.00 16.87  ? 45  LEU A N   1 
ATOM 334  C CA  . LEU A 1 45  ? -27.662 -25.411 230.502 1.00 14.83  ? 45  LEU A CA  1 
ATOM 335  C C   . LEU A 1 45  ? -27.333 -24.262 231.449 1.00 16.68  ? 45  LEU A C   1 
ATOM 336  O O   . LEU A 1 45  ? -27.403 -23.092 231.079 1.00 17.58  ? 45  LEU A O   1 
ATOM 337  C CB  . LEU A 1 45  ? -26.762 -25.373 229.262 1.00 14.77  ? 45  LEU A CB  1 
ATOM 338  C CG  . LEU A 1 45  ? -25.250 -25.487 229.480 1.00 14.21  ? 45  LEU A CG  1 
ATOM 339  C CD1 . LEU A 1 45  ? -24.901 -26.761 230.250 1.00 9.80   ? 45  LEU A CD1 1 
ATOM 340  C CD2 . LEU A 1 45  ? -24.529 -25.423 228.130 1.00 11.81  ? 45  LEU A CD2 1 
ATOM 341  N N   . ASP A 1 46  ? -27.003 -24.594 232.684 1.00 16.55  ? 46  ASP A N   1 
ATOM 342  C CA  . ASP A 1 46  ? -26.727 -23.590 233.690 1.00 15.84  ? 46  ASP A CA  1 
ATOM 343  C C   . ASP A 1 46  ? -25.259 -23.182 233.887 1.00 15.70  ? 46  ASP A C   1 
ATOM 344  O O   . ASP A 1 46  ? -24.984 -22.047 234.263 1.00 15.94  ? 46  ASP A O   1 
ATOM 345  C CB  . ASP A 1 46  ? -27.316 -24.062 235.024 1.00 14.83  ? 46  ASP A CB  1 
ATOM 346  C CG  . ASP A 1 46  ? -27.480 -22.934 236.016 1.00 23.79  ? 46  ASP A CG  1 
ATOM 347  O OD1 . ASP A 1 46  ? -28.271 -22.011 235.738 1.00 28.29  ? 46  ASP A OD1 1 
ATOM 348  O OD2 . ASP A 1 46  ? -26.822 -22.965 237.073 1.00 25.91  ? 46  ASP A OD2 1 
ATOM 349  N N   . ALA A 1 47  ? -24.321 -24.104 233.693 1.00 14.82  ? 47  ALA A N   1 
ATOM 350  C CA  . ALA A 1 47  ? -22.899 -23.802 233.886 1.00 13.93  ? 47  ALA A CA  1 
ATOM 351  C C   . ALA A 1 47  ? -21.995 -24.819 233.190 1.00 15.26  ? 47  ALA A C   1 
ATOM 352  O O   . ALA A 1 47  ? -22.423 -25.933 232.870 1.00 13.15  ? 47  ALA A O   1 
ATOM 353  C CB  . ALA A 1 47  ? -22.552 -23.764 235.401 1.00 9.50   ? 47  ALA A CB  1 
ATOM 354  N N   . ILE A 1 48  ? -20.762 -24.397 232.909 1.00 16.50  ? 48  ILE A N   1 
ATOM 355  C CA  . ILE A 1 48  ? -19.732 -25.257 232.315 1.00 16.45  ? 48  ILE A CA  1 
ATOM 356  C C   . ILE A 1 48  ? -18.482 -24.827 233.071 1.00 16.79  ? 48  ILE A C   1 
ATOM 357  O O   . ILE A 1 48  ? -18.112 -23.640 233.049 1.00 17.61  ? 48  ILE A O   1 
ATOM 358  C CB  . ILE A 1 48  ? -19.506 -25.007 230.812 1.00 20.86  ? 48  ILE A CB  1 
ATOM 359  C CG1 . ILE A 1 48  ? -20.801 -25.206 230.025 1.00 24.85  ? 48  ILE A CG1 1 
ATOM 360  C CG2 . ILE A 1 48  ? -18.447 -25.977 230.286 1.00 21.50  ? 48  ILE A CG2 1 
ATOM 361  C CD1 . ILE A 1 48  ? -20.633 -24.930 228.557 1.00 20.55  ? 48  ILE A CD1 1 
ATOM 362  N N   . TYR A 1 49  ? -17.855 -25.759 233.777 1.00 13.87  ? 49  TYR A N   1 
ATOM 363  C CA  . TYR A 1 49  ? -16.673 -25.407 234.537 1.00 14.56  ? 49  TYR A CA  1 
ATOM 364  C C   . TYR A 1 49  ? -15.827 -26.606 234.884 1.00 16.80  ? 49  TYR A C   1 
ATOM 365  O O   . TYR A 1 49  ? -16.233 -27.753 234.701 1.00 15.81  ? 49  TYR A O   1 
ATOM 366  C CB  . TYR A 1 49  ? -17.094 -24.748 235.857 1.00 15.15  ? 49  TYR A CB  1 
ATOM 367  C CG  . TYR A 1 49  ? -17.823 -25.695 236.809 1.00 16.63  ? 49  TYR A CG  1 
ATOM 368  C CD1 . TYR A 1 49  ? -19.212 -25.851 236.744 1.00 20.90  ? 49  TYR A CD1 1 
ATOM 369  C CD2 . TYR A 1 49  ? -17.118 -26.455 237.749 1.00 15.60  ? 49  TYR A CD2 1 
ATOM 370  C CE1 . TYR A 1 49  ? -19.877 -26.745 237.584 1.00 17.12  ? 49  TYR A CE1 1 
ATOM 371  C CE2 . TYR A 1 49  ? -17.769 -27.349 238.597 1.00 17.32  ? 49  TYR A CE2 1 
ATOM 372  C CZ  . TYR A 1 49  ? -19.148 -27.490 238.508 1.00 26.82  ? 49  TYR A CZ  1 
ATOM 373  O OH  . TYR A 1 49  ? -19.783 -28.392 239.336 1.00 26.72  ? 49  TYR A OH  1 
ATOM 374  N N   . GLN A 1 50  ? -14.642 -26.326 235.403 1.00 14.83  ? 50  GLN A N   1 
ATOM 375  C CA  . GLN A 1 50  ? -13.776 -27.375 235.886 1.00 16.26  ? 50  GLN A CA  1 
ATOM 376  C C   . GLN A 1 50  ? -13.175 -26.837 237.179 1.00 16.03  ? 50  GLN A C   1 
ATOM 377  O O   . GLN A 1 50  ? -12.874 -25.639 237.275 1.00 17.71  ? 50  GLN A O   1 
ATOM 378  C CB  . GLN A 1 50  ? -12.670 -27.717 234.889 1.00 13.05  ? 50  GLN A CB  1 
ATOM 379  C CG  . GLN A 1 50  ? -11.821 -28.881 235.383 1.00 13.47  ? 50  GLN A CG  1 
ATOM 380  C CD  . GLN A 1 50  ? -10.629 -29.135 234.505 1.00 12.33  ? 50  GLN A CD  1 
ATOM 381  O OE1 . GLN A 1 50  ? -10.677 -28.877 233.312 1.00 14.95  ? 50  GLN A OE1 1 
ATOM 382  N NE2 . GLN A 1 50  ? -9.546  -29.629 235.088 1.00 12.66  ? 50  GLN A NE2 1 
ATOM 383  N N   . GLU A 1 51  ? -13.100 -27.675 238.201 1.00 14.97  ? 51  GLU A N   1 
ATOM 384  C CA  . GLU A 1 51  ? -12.492 -27.251 239.453 1.00 18.71  ? 51  GLU A CA  1 
ATOM 385  C C   . GLU A 1 51  ? -10.978 -27.438 239.365 1.00 20.16  ? 51  GLU A C   1 
ATOM 386  O O   . GLU A 1 51  ? -10.508 -28.447 238.844 1.00 18.90  ? 51  GLU A O   1 
ATOM 387  C CB  . GLU A 1 51  ? -13.003 -28.086 240.608 1.00 22.70  ? 51  GLU A CB  1 
ATOM 388  C CG  . GLU A 1 51  ? -14.422 -27.805 241.007 1.00 41.84  ? 51  GLU A CG  1 
ATOM 389  C CD  . GLU A 1 51  ? -14.755 -28.399 242.361 1.00 45.88  ? 51  GLU A CD  1 
ATOM 390  O OE1 . GLU A 1 51  ? -14.011 -28.136 243.335 1.00 46.15  ? 51  GLU A OE1 1 
ATOM 391  O OE2 . GLU A 1 51  ? -15.761 -29.129 242.445 1.00 49.93  ? 51  GLU A OE2 1 
ATOM 392  N N   . ASN A 1 52  ? -10.218 -26.474 239.872 1.00 19.84  ? 52  ASN A N   1 
ATOM 393  C CA  . ASN A 1 52  ? -8.757  -26.553 239.878 1.00 22.03  ? 52  ASN A CA  1 
ATOM 394  C C   . ASN A 1 52  ? -8.098  -26.997 238.573 1.00 20.51  ? 52  ASN A C   1 
ATOM 395  O O   . ASN A 1 52  ? -7.355  -27.970 238.554 1.00 20.49  ? 52  ASN A O   1 
ATOM 396  C CB  . ASN A 1 52  ? -8.268  -27.479 241.002 1.00 25.03  ? 52  ASN A CB  1 
ATOM 397  C CG  . ASN A 1 52  ? -8.901  -27.156 242.328 1.00 33.38  ? 52  ASN A CG  1 
ATOM 398  O OD1 . ASN A 1 52  ? -8.737  -26.055 242.856 1.00 42.80  ? 52  ASN A OD1 1 
ATOM 399  N ND2 . ASN A 1 52  ? -9.655  -28.104 242.869 1.00 36.11  ? 52  ASN A ND2 1 
ATOM 400  N N   . PRO A 1 53  ? -8.389  -26.316 237.464 1.00 18.22  ? 53  PRO A N   1 
ATOM 401  C CA  . PRO A 1 53  ? -7.741  -26.735 236.216 1.00 18.27  ? 53  PRO A CA  1 
ATOM 402  C C   . PRO A 1 53  ? -6.210  -26.584 236.342 1.00 20.68  ? 53  PRO A C   1 
ATOM 403  O O   . PRO A 1 53  ? -5.722  -25.813 237.173 1.00 20.71  ? 53  PRO A O   1 
ATOM 404  C CB  . PRO A 1 53  ? -8.319  -25.751 235.191 1.00 15.65  ? 53  PRO A CB  1 
ATOM 405  C CG  . PRO A 1 53  ? -8.668  -24.527 236.028 1.00 13.90  ? 53  PRO A CG  1 
ATOM 406  C CD  . PRO A 1 53  ? -9.278  -25.160 237.254 1.00 16.04  ? 53  PRO A CD  1 
ATOM 407  N N   . ALA A 1 54  ? -5.459  -27.293 235.508 1.00 18.56  ? 54  ALA A N   1 
ATOM 408  C CA  . ALA A 1 54  ? -4.001  -27.214 235.527 1.00 18.33  ? 54  ALA A CA  1 
ATOM 409  C C   . ALA A 1 54  ? -3.547  -25.815 235.126 1.00 20.67  ? 54  ALA A C   1 
ATOM 410  O O   . ALA A 1 54  ? -4.123  -25.188 234.226 1.00 19.28  ? 54  ALA A O   1 
ATOM 411  C CB  . ALA A 1 54  ? -3.406  -28.240 234.547 1.00 16.50  ? 54  ALA A CB  1 
ATOM 412  N N   . LYS A 1 55  ? -2.495  -25.332 235.774 1.00 22.05  ? 55  LYS A N   1 
ATOM 413  C CA  . LYS A 1 55  ? -1.968  -24.025 235.452 1.00 21.47  ? 55  LYS A CA  1 
ATOM 414  C C   . LYS A 1 55  ? -0.839  -24.194 234.471 1.00 24.75  ? 55  LYS A C   1 
ATOM 415  O O   . LYS A 1 55  ? -0.040  -25.129 234.578 1.00 26.93  ? 55  LYS A O   1 
ATOM 416  C CB  . LYS A 1 55  ? -1.393  -23.346 236.687 1.00 24.76  ? 55  LYS A CB  1 
ATOM 417  C CG  . LYS A 1 55  ? -2.376  -23.094 237.774 1.00 27.18  ? 55  LYS A CG  1 
ATOM 418  C CD  . LYS A 1 55  ? -1.729  -22.276 238.836 1.00 32.15  ? 55  LYS A CD  1 
ATOM 419  C CE  . LYS A 1 55  ? -2.748  -21.788 239.826 1.00 40.92  ? 55  LYS A CE  1 
ATOM 420  N NZ  . LYS A 1 55  ? -2.145  -20.702 240.638 1.00 48.48  ? 55  LYS A NZ  1 
ATOM 421  N N   . THR A 1 56  ? -0.812  -23.345 233.462 1.00 21.65  ? 56  THR A N   1 
ATOM 422  C CA  . THR A 1 56  ? 0.304   -23.372 232.541 1.00 27.53  ? 56  THR A CA  1 
ATOM 423  C C   . THR A 1 56  ? 1.224   -22.273 233.133 1.00 28.20  ? 56  THR A C   1 
ATOM 424  O O   . THR A 1 56  ? 1.363   -22.187 234.353 1.00 31.24  ? 56  THR A O   1 
ATOM 425  C CB  . THR A 1 56  ? -0.148  -23.082 231.104 1.00 27.00  ? 56  THR A CB  1 
ATOM 426  O OG1 . THR A 1 56  ? -1.037  -21.959 231.097 1.00 32.53  ? 56  THR A OG1 1 
ATOM 427  C CG2 . THR A 1 56  ? -0.862  -24.290 230.541 1.00 38.54  ? 56  THR A CG2 1 
ATOM 428  N N   . ARG A 1 57  ? 1.822   -21.424 232.315 1.00 28.89  ? 57  ARG A N   1 
ATOM 429  C CA  . ARG A 1 57  ? 2.698   -20.368 232.825 1.00 25.12  ? 57  ARG A CA  1 
ATOM 430  C C   . ARG A 1 57  ? 2.004   -19.286 233.630 1.00 21.45  ? 57  ARG A C   1 
ATOM 431  O O   . ARG A 1 57  ? 0.813   -19.030 233.472 1.00 19.97  ? 57  ARG A O   1 
ATOM 432  C CB  . ARG A 1 57  ? 3.332   -19.599 231.672 1.00 26.59  ? 57  ARG A CB  1 
ATOM 433  C CG  . ARG A 1 57  ? 4.090   -20.389 230.708 1.00 37.62  ? 57  ARG A CG  1 
ATOM 434  C CD  . ARG A 1 57  ? 4.437   -19.483 229.579 1.00 34.66  ? 57  ARG A CD  1 
ATOM 435  N NE  . ARG A 1 57  ? 5.249   -20.190 228.609 1.00 47.76  ? 57  ARG A NE  1 
ATOM 436  C CZ  . ARG A 1 57  ? 5.752   -19.627 227.522 1.00 58.00  ? 57  ARG A CZ  1 
ATOM 437  N NH1 . ARG A 1 57  ? 5.518   -18.346 227.270 1.00 59.05  ? 57  ARG A NH1 1 
ATOM 438  N NH2 . ARG A 1 57  ? 6.487   -20.349 226.685 1.00 69.24  ? 57  ARG A NH2 1 
ATOM 439  N N   . GLU A 1 58  ? 2.815   -18.599 234.422 1.00 20.19  ? 58  GLU A N   1 
ATOM 440  C CA  . GLU A 1 58  ? 2.408   -17.418 235.169 1.00 19.17  ? 58  GLU A CA  1 
ATOM 441  C C   . GLU A 1 58  ? 3.290   -16.340 234.523 1.00 17.79  ? 58  GLU A C   1 
ATOM 442  O O   . GLU A 1 58  ? 4.460   -16.595 234.204 1.00 16.27  ? 58  GLU A O   1 
ATOM 443  C CB  . GLU A 1 58  ? 2.818   -17.478 236.631 1.00 17.39  ? 58  GLU A CB  1 
ATOM 444  C CG  . GLU A 1 58  ? 2.068   -18.428 237.478 1.00 27.42  ? 58  GLU A CG  1 
ATOM 445  C CD  . GLU A 1 58  ? 2.514   -18.339 238.914 1.00 28.73  ? 58  GLU A CD  1 
ATOM 446  O OE1 . GLU A 1 58  ? 3.697   -18.002 239.163 1.00 28.30  ? 58  GLU A OE1 1 
ATOM 447  O OE2 . GLU A 1 58  ? 1.682   -18.609 239.797 1.00 37.74  ? 58  GLU A OE2 1 
ATOM 448  N N   . TYR A 1 59  ? 2.729   -15.165 234.294 1.00 15.66  ? 59  TYR A N   1 
ATOM 449  C CA  . TYR A 1 59  ? 3.485   -14.062 233.733 1.00 15.80  ? 59  TYR A CA  1 
ATOM 450  C C   . TYR A 1 59  ? 3.516   -12.960 234.791 1.00 15.97  ? 59  TYR A C   1 
ATOM 451  O O   . TYR A 1 59  ? 2.596   -12.859 235.614 1.00 17.25  ? 59  TYR A O   1 
ATOM 452  C CB  . TYR A 1 59  ? 2.791   -13.518 232.487 1.00 14.92  ? 59  TYR A CB  1 
ATOM 453  C CG  . TYR A 1 59  ? 2.987   -14.354 231.258 1.00 15.72  ? 59  TYR A CG  1 
ATOM 454  C CD1 . TYR A 1 59  ? 4.225   -14.407 230.631 1.00 13.05  ? 59  TYR A CD1 1 
ATOM 455  C CD2 . TYR A 1 59  ? 1.924   -15.049 230.680 1.00 14.72  ? 59  TYR A CD2 1 
ATOM 456  C CE1 . TYR A 1 59  ? 4.403   -15.129 229.447 1.00 18.46  ? 59  TYR A CE1 1 
ATOM 457  C CE2 . TYR A 1 59  ? 2.090   -15.768 229.499 1.00 16.81  ? 59  TYR A CE2 1 
ATOM 458  C CZ  . TYR A 1 59  ? 3.333   -15.799 228.884 1.00 16.29  ? 59  TYR A CZ  1 
ATOM 459  O OH  . TYR A 1 59  ? 3.509   -16.464 227.686 1.00 20.60  ? 59  TYR A OH  1 
ATOM 460  N N   . CYS A 1 60  ? 4.559   -12.139 234.778 1.00 15.14  ? 60  CYS A N   1 
ATOM 461  C CA  . CYS A 1 60  ? 4.644   -11.025 235.720 1.00 16.35  ? 60  CYS A CA  1 
ATOM 462  C C   . CYS A 1 60  ? 4.312   -9.713  234.986 1.00 15.64  ? 60  CYS A C   1 
ATOM 463  O O   . CYS A 1 60  ? 4.905   -9.409  233.948 1.00 15.64  ? 60  CYS A O   1 
ATOM 464  C CB  . CYS A 1 60  ? 6.032   -10.933 236.325 1.00 20.37  ? 60  CYS A CB  1 
ATOM 465  S SG  . CYS A 1 60  ? 6.108   -9.531  237.464 1.00 16.21  ? 60  CYS A SG  1 
ATOM 466  N N   . LEU A 1 61  ? 3.353   -8.950  235.505 1.00 15.64  ? 61  LEU A N   1 
ATOM 467  C CA  . LEU A 1 61  ? 2.943   -7.692  234.874 1.00 16.02  ? 61  LEU A CA  1 
ATOM 468  C C   . LEU A 1 61  ? 3.684   -6.483  235.441 1.00 16.09  ? 61  LEU A C   1 
ATOM 469  O O   . LEU A 1 61  ? 3.683   -5.403  234.846 1.00 16.69  ? 61  LEU A O   1 
ATOM 470  C CB  . LEU A 1 61  ? 1.423   -7.472  235.053 1.00 15.60  ? 61  LEU A CB  1 
ATOM 471  C CG  . LEU A 1 61  ? 0.473   -8.450  234.356 1.00 19.24  ? 61  LEU A CG  1 
ATOM 472  C CD1 . LEU A 1 61  ? -0.935  -8.317  234.917 1.00 17.23  ? 61  LEU A CD1 1 
ATOM 473  C CD2 . LEU A 1 61  ? 0.494   -8.181  232.856 1.00 17.47  ? 61  LEU A CD2 1 
ATOM 474  N N   . HIS A 1 62  ? 4.267   -6.640  236.616 1.00 14.24  ? 62  HIS A N   1 
ATOM 475  C CA  . HIS A 1 62  ? 4.958   -5.517  237.235 1.00 15.31  ? 62  HIS A CA  1 
ATOM 476  C C   . HIS A 1 62  ? 6.144   -6.012  238.047 1.00 14.21  ? 62  HIS A C   1 
ATOM 477  O O   . HIS A 1 62  ? 5.960   -6.632  239.095 1.00 16.09  ? 62  HIS A O   1 
ATOM 478  C CB  . HIS A 1 62  ? 3.982   -4.765  238.142 1.00 16.42  ? 62  HIS A CB  1 
ATOM 479  C CG  . HIS A 1 62  ? 4.485   -3.423  238.580 1.00 23.01  ? 62  HIS A CG  1 
ATOM 480  N ND1 . HIS A 1 62  ? 3.869   -2.686  239.568 1.00 21.20  ? 62  HIS A ND1 1 
ATOM 481  C CD2 . HIS A 1 62  ? 5.546   -2.694  238.166 1.00 18.34  ? 62  HIS A CD2 1 
ATOM 482  C CE1 . HIS A 1 62  ? 4.537   -1.557  239.746 1.00 20.34  ? 62  HIS A CE1 1 
ATOM 483  N NE2 . HIS A 1 62  ? 5.558   -1.544  238.905 1.00 20.76  ? 62  HIS A NE2 1 
ATOM 484  N N   . ALA A 1 63  ? 7.351   -5.747  237.558 1.00 14.33  ? 63  ALA A N   1 
ATOM 485  C CA  . ALA A 1 63  ? 8.563   -6.188  238.243 1.00 16.98  ? 63  ALA A CA  1 
ATOM 486  C C   . ALA A 1 63  ? 8.866   -5.361  239.487 1.00 19.59  ? 63  ALA A C   1 
ATOM 487  O O   . ALA A 1 63  ? 8.626   -4.154  239.516 1.00 18.31  ? 63  ALA A O   1 
ATOM 488  C CB  . ALA A 1 63  ? 9.758   -6.149  237.291 1.00 16.17  ? 63  ALA A CB  1 
ATOM 489  N N   . LYS A 1 64  ? 9.321   -6.048  240.527 1.00 20.03  ? 64  LYS A N   1 
ATOM 490  C CA  . LYS A 1 64  ? 9.721   -5.438  241.782 1.00 22.57  ? 64  LYS A CA  1 
ATOM 491  C C   . LYS A 1 64  ? 11.245  -5.611  241.774 1.00 25.26  ? 64  LYS A C   1 
ATOM 492  O O   . LYS A 1 64  ? 11.750  -6.742  241.847 1.00 26.18  ? 64  LYS A O   1 
ATOM 493  C CB  . LYS A 1 64  ? 9.122   -6.201  242.958 1.00 26.10  ? 64  LYS A CB  1 
ATOM 494  C CG  . LYS A 1 64  ? 9.535   -5.662  244.319 1.00 36.40  ? 64  LYS A CG  1 
ATOM 495  C CD  . LYS A 1 64  ? 8.890   -6.460  245.434 1.00 51.90  ? 64  LYS A CD  1 
ATOM 496  C CE  . LYS A 1 64  ? 9.164   -5.832  246.790 1.00 65.28  ? 64  LYS A CE  1 
ATOM 497  N NZ  . LYS A 1 64  ? 8.444   -6.550  247.892 1.00 71.17  ? 64  LYS A NZ  1 
ATOM 498  N N   . LEU A 1 65  ? 11.971  -4.512  241.593 1.00 26.28  ? 65  LEU A N   1 
ATOM 499  C CA  . LEU A 1 65  ? 13.432  -4.577  241.533 1.00 26.20  ? 65  LEU A CA  1 
ATOM 500  C C   . LEU A 1 65  ? 14.058  -4.115  242.819 1.00 27.01  ? 65  LEU A C   1 
ATOM 501  O O   . LEU A 1 65  ? 13.564  -3.189  243.455 1.00 29.92  ? 65  LEU A O   1 
ATOM 502  C CB  . LEU A 1 65  ? 13.958  -3.708  240.398 1.00 26.49  ? 65  LEU A CB  1 
ATOM 503  C CG  . LEU A 1 65  ? 13.349  -3.956  239.019 1.00 25.59  ? 65  LEU A CG  1 
ATOM 504  C CD1 . LEU A 1 65  ? 13.901  -2.920  238.054 1.00 19.90  ? 65  LEU A CD1 1 
ATOM 505  C CD2 . LEU A 1 65  ? 13.642  -5.388  238.544 1.00 19.88  ? 65  LEU A CD2 1 
ATOM 506  N N   . SER A 1 66  ? 15.160  -4.739  243.203 1.00 29.05  ? 66  SER A N   1 
ATOM 507  C CA  . SER A 1 66  ? 15.828  -4.333  244.422 1.00 29.72  ? 66  SER A CA  1 
ATOM 508  C C   . SER A 1 66  ? 17.284  -4.748  244.417 1.00 31.24  ? 66  SER A C   1 
ATOM 509  O O   . SER A 1 66  ? 17.731  -5.525  243.550 1.00 24.79  ? 66  SER A O   1 
ATOM 510  C CB  . SER A 1 66  ? 15.123  -4.916  245.645 1.00 28.69  ? 66  SER A CB  1 
ATOM 511  O OG  . SER A 1 66  ? 15.382  -6.306  245.762 1.00 34.55  ? 66  SER A OG  1 
ATOM 512  N N   . ASP A 1 67  ? 18.012  -4.181  245.383 1.00 35.79  ? 67  ASP A N   1 
ATOM 513  C CA  . ASP A 1 67  ? 19.440  -4.435  245.606 1.00 38.40  ? 67  ASP A CA  1 
ATOM 514  C C   . ASP A 1 67  ? 20.335  -4.276  244.386 1.00 35.66  ? 67  ASP A C   1 
ATOM 515  O O   . ASP A 1 67  ? 21.082  -5.200  244.032 1.00 33.66  ? 67  ASP A O   1 
ATOM 516  C CB  . ASP A 1 67  ? 19.650  -5.821  246.233 1.00 46.83  ? 67  ASP A CB  1 
ATOM 517  C CG  . ASP A 1 67  ? 19.037  -5.934  247.625 1.00 60.49  ? 67  ASP A CG  1 
ATOM 518  O OD1 . ASP A 1 67  ? 18.198  -5.073  248.011 1.00 66.20  ? 67  ASP A OD1 1 
ATOM 519  O OD2 . ASP A 1 67  ? 19.404  -6.897  248.336 1.00 67.90  ? 67  ASP A OD2 1 
ATOM 520  N N   . THR A 1 68  ? 20.247  -3.103  243.758 1.00 32.56  ? 68  THR A N   1 
ATOM 521  C CA  . THR A 1 68  ? 21.049  -2.772  242.582 1.00 33.72  ? 68  THR A CA  1 
ATOM 522  C C   . THR A 1 68  ? 22.538  -2.779  242.976 1.00 34.54  ? 68  THR A C   1 
ATOM 523  O O   . THR A 1 68  ? 22.925  -2.183  243.997 1.00 36.56  ? 68  THR A O   1 
ATOM 524  C CB  . THR A 1 68  ? 20.659  -1.369  242.045 1.00 31.38  ? 68  THR A CB  1 
ATOM 525  O OG1 . THR A 1 68  ? 19.233  -1.258  242.020 1.00 44.57  ? 68  THR A OG1 1 
ATOM 526  C CG2 . THR A 1 68  ? 21.203  -1.141  240.636 1.00 33.06  ? 68  THR A CG2 1 
ATOM 527  N N   . LYS A 1 69  ? 23.352  -3.508  242.218 1.00 33.74  ? 69  LYS A N   1 
ATOM 528  C CA  . LYS A 1 69  ? 24.783  -3.580  242.484 1.00 34.18  ? 69  LYS A CA  1 
ATOM 529  C C   . LYS A 1 69  ? 25.574  -3.324  241.216 1.00 32.72  ? 69  LYS A C   1 
ATOM 530  O O   . LYS A 1 69  ? 25.199  -3.787  240.137 1.00 32.09  ? 69  LYS A O   1 
ATOM 531  C CB  . LYS A 1 69  ? 25.159  -4.937  243.080 1.00 37.08  ? 69  LYS A CB  1 
ATOM 532  C CG  . LYS A 1 69  ? 24.584  -5.157  244.464 1.00 44.70  ? 69  LYS A CG  1 
ATOM 533  C CD  . LYS A 1 69  ? 25.099  -6.432  245.076 1.00 54.80  ? 69  LYS A CD  1 
ATOM 534  C CE  . LYS A 1 69  ? 24.412  -6.714  246.399 1.00 62.58  ? 69  LYS A CE  1 
ATOM 535  N NZ  . LYS A 1 69  ? 24.990  -7.916  247.073 1.00 64.15  ? 69  LYS A NZ  1 
ATOM 536  N N   . VAL A 1 70  ? 26.649  -2.550  241.348 1.00 32.07  ? 70  VAL A N   1 
ATOM 537  C CA  . VAL A 1 70  ? 27.520  -2.210  240.221 1.00 30.60  ? 70  VAL A CA  1 
ATOM 538  C C   . VAL A 1 70  ? 28.984  -2.508  240.566 1.00 32.04  ? 70  VAL A C   1 
ATOM 539  O O   . VAL A 1 70  ? 29.420  -2.310  241.704 1.00 34.25  ? 70  VAL A O   1 
ATOM 540  C CB  . VAL A 1 70  ? 27.406  -0.705  239.852 1.00 28.55  ? 70  VAL A CB  1 
ATOM 541  C CG1 . VAL A 1 70  ? 28.276  -0.385  238.653 1.00 27.59  ? 70  VAL A CG1 1 
ATOM 542  C CG2 . VAL A 1 70  ? 25.961  -0.331  239.554 1.00 28.46  ? 70  VAL A CG2 1 
ATOM 543  N N   . ALA A 1 71  ? 29.715  -3.050  239.602 1.00 31.10  ? 71  ALA A N   1 
ATOM 544  C CA  . ALA A 1 71  ? 31.135  -3.342  239.771 1.00 28.74  ? 71  ALA A CA  1 
ATOM 545  C C   . ALA A 1 71  ? 31.796  -2.755  238.519 1.00 28.73  ? 71  ALA A C   1 
ATOM 546  O O   . ALA A 1 71  ? 31.301  -2.941  237.398 1.00 26.61  ? 71  ALA A O   1 
ATOM 547  C CB  . ALA A 1 71  ? 31.370  -4.843  239.861 1.00 24.61  ? 71  ALA A CB  1 
ATOM 548  N N   . ALA A 1 72  ? 32.866  -1.985  238.712 1.00 26.62  ? 72  ALA A N   1 
ATOM 549  C CA  . ALA A 1 72  ? 33.570  -1.361  237.590 1.00 27.17  ? 72  ALA A CA  1 
ATOM 550  C C   . ALA A 1 72  ? 35.081  -1.520  237.763 1.00 26.15  ? 72  ALA A C   1 
ATOM 551  O O   . ALA A 1 72  ? 35.576  -1.478  238.882 1.00 26.80  ? 72  ALA A O   1 
ATOM 552  C CB  . ALA A 1 72  ? 33.198  0.113   237.511 1.00 22.34  ? 72  ALA A CB  1 
ATOM 553  N N   . ARG A 1 73  ? 35.808  -1.701  236.668 1.00 27.18  ? 73  ARG A N   1 
ATOM 554  C CA  . ARG A 1 73  ? 37.264  -1.866  236.728 1.00 28.49  ? 73  ARG A CA  1 
ATOM 555  C C   . ARG A 1 73  ? 37.933  -0.886  235.790 1.00 27.31  ? 73  ARG A C   1 
ATOM 556  O O   . ARG A 1 73  ? 37.411  -0.590  234.715 1.00 26.38  ? 73  ARG A O   1 
ATOM 557  C CB  . ARG A 1 73  ? 37.673  -3.261  236.262 1.00 36.50  ? 73  ARG A CB  1 
ATOM 558  C CG  . ARG A 1 73  ? 37.220  -4.394  237.128 1.00 40.82  ? 73  ARG A CG  1 
ATOM 559  C CD  . ARG A 1 73  ? 38.004  -4.471  238.395 1.00 49.42  ? 73  ARG A CD  1 
ATOM 560  N NE  . ARG A 1 73  ? 37.941  -5.830  238.910 1.00 65.12  ? 73  ARG A NE  1 
ATOM 561  C CZ  . ARG A 1 73  ? 38.963  -6.470  239.470 1.00 68.85  ? 73  ARG A CZ  1 
ATOM 562  N NH1 . ARG A 1 73  ? 40.142  -5.867  239.596 1.00 63.79  ? 73  ARG A NH1 1 
ATOM 563  N NH2 . ARG A 1 73  ? 38.813  -7.732  239.863 1.00 70.42  ? 73  ARG A NH2 1 
ATOM 564  N N   . CYS A 1 74  ? 39.123  -0.435  236.160 1.00 25.28  ? 74  CYS A N   1 
ATOM 565  C CA  . CYS A 1 74  ? 39.867  0.485   235.317 1.00 21.71  ? 74  CYS A CA  1 
ATOM 566  C C   . CYS A 1 74  ? 40.299  -0.261  234.061 1.00 20.61  ? 74  CYS A C   1 
ATOM 567  O O   . CYS A 1 74  ? 40.307  -1.489  234.051 1.00 21.03  ? 74  CYS A O   1 
ATOM 568  C CB  . CYS A 1 74  ? 41.065  1.031   236.092 1.00 19.90  ? 74  CYS A CB  1 
ATOM 569  S SG  . CYS A 1 74  ? 40.558  2.248   237.339 1.00 21.06  ? 74  CYS A SG  1 
ATOM 570  N N   . PRO A 1 75  ? 40.679  0.461   232.986 1.00 23.73  ? 75  PRO A N   1 
ATOM 571  C CA  . PRO A 1 75  ? 41.113  -0.124  231.712 1.00 26.80  ? 75  PRO A CA  1 
ATOM 572  C C   . PRO A 1 75  ? 42.125  -1.306  231.715 1.00 32.44  ? 75  PRO A C   1 
ATOM 573  O O   . PRO A 1 75  ? 42.083  -2.162  230.824 1.00 36.40  ? 75  PRO A O   1 
ATOM 574  C CB  . PRO A 1 75  ? 41.663  1.087   230.961 1.00 25.54  ? 75  PRO A CB  1 
ATOM 575  C CG  . PRO A 1 75  ? 40.808  2.191   231.441 1.00 22.09  ? 75  PRO A CG  1 
ATOM 576  C CD  . PRO A 1 75  ? 40.747  1.936   232.921 1.00 23.64  ? 75  PRO A CD  1 
ATOM 577  N N   . THR A 1 76  ? 43.039  -1.366  232.678 1.00 35.45  ? 76  THR A N   1 
ATOM 578  C CA  . THR A 1 76  ? 44.019  -2.474  232.709 1.00 37.13  ? 76  THR A CA  1 
ATOM 579  C C   . THR A 1 76  ? 43.708  -3.581  233.730 1.00 37.91  ? 76  THR A C   1 
ATOM 580  O O   . THR A 1 76  ? 44.349  -4.636  233.738 1.00 39.27  ? 76  THR A O   1 
ATOM 581  C CB  . THR A 1 76  ? 45.454  -1.941  233.006 1.00 32.09  ? 76  THR A CB  1 
ATOM 582  O OG1 . THR A 1 76  ? 45.450  -1.178  234.221 1.00 29.90  ? 76  THR A OG1 1 
ATOM 583  C CG2 . THR A 1 76  ? 45.940  -1.069  231.874 1.00 29.09  ? 76  THR A CG2 1 
ATOM 584  N N   . MET A 1 77  ? 42.711  -3.330  234.571 1.00 36.16  ? 77  MET A N   1 
ATOM 585  C CA  . MET A 1 77  ? 42.324  -4.235  235.638 1.00 32.47  ? 77  MET A CA  1 
ATOM 586  C C   . MET A 1 77  ? 41.436  -5.439  235.304 1.00 32.21  ? 77  MET A C   1 
ATOM 587  O O   . MET A 1 77  ? 40.991  -6.138  236.218 1.00 30.42  ? 77  MET A O   1 
ATOM 588  C CB  . MET A 1 77  ? 41.698  -3.420  236.772 1.00 37.36  ? 77  MET A CB  1 
ATOM 589  C CG  . MET A 1 77  ? 42.627  -2.354  237.365 1.00 42.94  ? 77  MET A CG  1 
ATOM 590  S SD  . MET A 1 77  ? 44.121  -3.052  238.129 1.00 45.12  ? 77  MET A SD  1 
ATOM 591  C CE  . MET A 1 77  ? 43.677  -3.041  239.905 1.00 39.14  ? 77  MET A CE  1 
ATOM 592  N N   . GLY A 1 78  ? 41.194  -5.704  234.023 1.00 29.93  ? 78  GLY A N   1 
ATOM 593  C CA  . GLY A 1 78  ? 40.356  -6.845  233.664 1.00 33.20  ? 78  GLY A CA  1 
ATOM 594  C C   . GLY A 1 78  ? 38.836  -6.688  233.795 1.00 34.68  ? 78  GLY A C   1 
ATOM 595  O O   . GLY A 1 78  ? 38.330  -5.592  234.066 1.00 32.62  ? 78  GLY A O   1 
ATOM 596  N N   . PRO A 1 79  ? 38.075  -7.789  233.624 1.00 36.67  ? 79  PRO A N   1 
ATOM 597  C CA  . PRO A 1 79  ? 36.604  -7.790  233.713 1.00 34.88  ? 79  PRO A CA  1 
ATOM 598  C C   . PRO A 1 79  ? 36.047  -7.521  235.092 1.00 32.68  ? 79  PRO A C   1 
ATOM 599  O O   . PRO A 1 79  ? 36.581  -7.984  236.102 1.00 33.10  ? 79  PRO A O   1 
ATOM 600  C CB  . PRO A 1 79  ? 36.235  -9.219  233.281 1.00 37.10  ? 79  PRO A CB  1 
ATOM 601  C CG  . PRO A 1 79  ? 37.434  -9.701  232.507 1.00 41.55  ? 79  PRO A CG  1 
ATOM 602  C CD  . PRO A 1 79  ? 38.569  -9.139  233.337 1.00 41.06  ? 79  PRO A CD  1 
ATOM 603  N N   . ALA A 1 80  ? 34.962  -6.757  235.134 1.00 30.76  ? 80  ALA A N   1 
ATOM 604  C CA  . ALA A 1 80  ? 34.296  -6.475  236.391 1.00 30.58  ? 80  ALA A CA  1 
ATOM 605  C C   . ALA A 1 80  ? 33.359  -7.670  236.574 1.00 30.16  ? 80  ALA A C   1 
ATOM 606  O O   . ALA A 1 80  ? 32.865  -8.226  235.589 1.00 29.03  ? 80  ALA A O   1 
ATOM 607  C CB  . ALA A 1 80  ? 33.492  -5.188  236.276 1.00 31.11  ? 80  ALA A CB  1 
ATOM 608  N N   . THR A 1 81  ? 33.162  -8.115  237.807 1.00 29.62  ? 81  THR A N   1 
ATOM 609  C CA  . THR A 1 81  ? 32.269  -9.239  238.049 1.00 31.46  ? 81  THR A CA  1 
ATOM 610  C C   . THR A 1 81  ? 31.506  -9.079  239.359 1.00 33.24  ? 81  THR A C   1 
ATOM 611  O O   . THR A 1 81  ? 31.974  -8.424  240.301 1.00 32.23  ? 81  THR A O   1 
ATOM 612  C CB  . THR A 1 81  ? 33.013  -10.605 238.082 1.00 33.41  ? 81  THR A CB  1 
ATOM 613  O OG1 . THR A 1 81  ? 33.951  -10.616 239.158 1.00 34.69  ? 81  THR A OG1 1 
ATOM 614  C CG2 . THR A 1 81  ? 33.740  -10.875 236.775 1.00 30.42  ? 81  THR A CG2 1 
ATOM 615  N N   . LEU A 1 82  ? 30.320  -9.679  239.398 1.00 34.44  ? 82  LEU A N   1 
ATOM 616  C CA  . LEU A 1 82  ? 29.446  -9.662  240.568 1.00 35.56  ? 82  LEU A CA  1 
ATOM 617  C C   . LEU A 1 82  ? 28.966  -11.090 240.763 1.00 36.23  ? 82  LEU A C   1 
ATOM 618  O O   . LEU A 1 82  ? 28.753  -11.817 239.783 1.00 36.54  ? 82  LEU A O   1 
ATOM 619  C CB  . LEU A 1 82  ? 28.239  -8.755  240.321 1.00 33.67  ? 82  LEU A CB  1 
ATOM 620  C CG  . LEU A 1 82  ? 28.484  -7.249  240.406 1.00 35.90  ? 82  LEU A CG  1 
ATOM 621  C CD1 . LEU A 1 82  ? 27.294  -6.476  239.872 1.00 33.81  ? 82  LEU A CD1 1 
ATOM 622  C CD2 . LEU A 1 82  ? 28.765  -6.890  241.854 1.00 32.78  ? 82  LEU A CD2 1 
ATOM 623  N N   . ALA A 1 83  ? 28.818  -11.506 242.014 1.00 37.04  ? 83  ALA A N   1 
ATOM 624  C CA  . ALA A 1 83  ? 28.334  -12.858 242.306 1.00 39.29  ? 83  ALA A CA  1 
ATOM 625  C C   . ALA A 1 83  ? 26.925  -13.043 241.707 1.00 40.36  ? 83  ALA A C   1 
ATOM 626  O O   . ALA A 1 83  ? 26.568  -14.136 241.238 1.00 41.68  ? 83  ALA A O   1 
ATOM 627  C CB  . ALA A 1 83  ? 28.303  -13.091 243.824 1.00 38.38  ? 83  ALA A CB  1 
ATOM 628  N N   . GLU A 1 84  ? 26.168  -11.943 241.658 1.00 37.72  ? 84  GLU A N   1 
ATOM 629  C CA  . GLU A 1 84  ? 24.805  -11.934 241.136 1.00 35.54  ? 84  GLU A CA  1 
ATOM 630  C C   . GLU A 1 84  ? 24.707  -12.359 239.684 1.00 34.21  ? 84  GLU A C   1 
ATOM 631  O O   . GLU A 1 84  ? 23.692  -12.899 239.275 1.00 35.03  ? 84  GLU A O   1 
ATOM 632  C CB  . GLU A 1 84  ? 24.163  -10.556 241.291 1.00 37.69  ? 84  GLU A CB  1 
ATOM 633  C CG  . GLU A 1 84  ? 23.787  -10.174 242.711 1.00 40.33  ? 84  GLU A CG  1 
ATOM 634  C CD  . GLU A 1 84  ? 24.978  -9.780  243.585 1.00 50.36  ? 84  GLU A CD  1 
ATOM 635  O OE1 . GLU A 1 84  ? 26.130  -9.694  243.088 1.00 44.76  ? 84  GLU A OE1 1 
ATOM 636  O OE2 . GLU A 1 84  ? 24.748  -9.540  244.788 1.00 50.11  ? 84  GLU A OE2 1 
ATOM 637  N N   . GLU A 1 85  ? 25.762  -12.154 238.905 1.00 32.59  ? 85  GLU A N   1 
ATOM 638  C CA  . GLU A 1 85  ? 25.729  -12.538 237.501 1.00 36.65  ? 85  GLU A CA  1 
ATOM 639  C C   . GLU A 1 85  ? 25.445  -14.027 237.318 1.00 40.09  ? 85  GLU A C   1 
ATOM 640  O O   . GLU A 1 85  ? 25.057  -14.470 236.233 1.00 39.05  ? 85  GLU A O   1 
ATOM 641  C CB  . GLU A 1 85  ? 27.070  -12.250 236.840 1.00 37.45  ? 85  GLU A CB  1 
ATOM 642  C CG  . GLU A 1 85  ? 27.410  -10.807 236.657 1.00 37.40  ? 85  GLU A CG  1 
ATOM 643  C CD  . GLU A 1 85  ? 28.639  -10.649 235.806 1.00 30.07  ? 85  GLU A CD  1 
ATOM 644  O OE1 . GLU A 1 85  ? 28.553  -10.858 234.576 1.00 27.21  ? 85  GLU A OE1 1 
ATOM 645  O OE2 . GLU A 1 85  ? 29.700  -10.346 236.376 1.00 35.74  ? 85  GLU A OE2 1 
ATOM 646  N N   . HIS A 1 86  ? 25.717  -14.807 238.359 1.00 42.79  ? 86  HIS A N   1 
ATOM 647  C CA  . HIS A 1 86  ? 25.534  -16.246 238.289 1.00 47.21  ? 86  HIS A CA  1 
ATOM 648  C C   . HIS A 1 86  ? 24.347  -16.760 239.058 1.00 48.62  ? 86  HIS A C   1 
ATOM 649  O O   . HIS A 1 86  ? 24.079  -17.959 239.053 1.00 50.45  ? 86  HIS A O   1 
ATOM 650  C CB  . HIS A 1 86  ? 26.809  -16.949 238.739 1.00 50.79  ? 86  HIS A CB  1 
ATOM 651  C CG  . HIS A 1 86  ? 28.004  -16.555 237.937 1.00 59.01  ? 86  HIS A CG  1 
ATOM 652  N ND1 . HIS A 1 86  ? 28.045  -16.687 236.562 1.00 60.94  ? 86  HIS A ND1 1 
ATOM 653  C CD2 . HIS A 1 86  ? 29.153  -15.936 238.293 1.00 60.48  ? 86  HIS A CD2 1 
ATOM 654  C CE1 . HIS A 1 86  ? 29.170  -16.160 236.108 1.00 62.83  ? 86  HIS A CE1 1 
ATOM 655  N NE2 . HIS A 1 86  ? 29.857  -15.697 237.139 1.00 67.81  ? 86  HIS A NE2 1 
ATOM 656  N N   . GLN A 1 87  ? 23.642  -15.866 239.736 1.00 47.18  ? 87  GLN A N   1 
ATOM 657  C CA  . GLN A 1 87  ? 22.471  -16.263 240.487 1.00 45.95  ? 87  GLN A CA  1 
ATOM 658  C C   . GLN A 1 87  ? 21.218  -16.122 239.620 1.00 44.88  ? 87  GLN A C   1 
ATOM 659  O O   . GLN A 1 87  ? 21.181  -15.329 238.666 1.00 45.25  ? 87  GLN A O   1 
ATOM 660  C CB  . GLN A 1 87  ? 22.341  -15.412 241.739 1.00 45.96  ? 87  GLN A CB  1 
ATOM 661  C CG  . GLN A 1 87  ? 23.501  -15.571 242.682 1.00 51.53  ? 87  GLN A CG  1 
ATOM 662  C CD  . GLN A 1 87  ? 23.530  -14.498 243.755 1.00 59.62  ? 87  GLN A CD  1 
ATOM 663  O OE1 . GLN A 1 87  ? 22.491  -14.023 244.213 1.00 61.85  ? 87  GLN A OE1 1 
ATOM 664  N NE2 . GLN A 1 87  ? 24.731  -14.102 244.155 1.00 65.63  ? 87  GLN A NE2 1 
ATOM 665  N N   . GLY A 1 88  ? 20.238  -16.978 239.884 1.00 41.90  ? 88  GLY A N   1 
ATOM 666  C CA  . GLY A 1 88  ? 18.988  -16.891 239.163 1.00 41.04  ? 88  GLY A CA  1 
ATOM 667  C C   . GLY A 1 88  ? 18.225  -15.816 239.922 1.00 40.30  ? 88  GLY A C   1 
ATOM 668  O O   . GLY A 1 88  ? 18.544  -15.513 241.091 1.00 41.06  ? 88  GLY A O   1 
ATOM 669  N N   . GLY A 1 89  ? 17.261  -15.189 239.269 1.00 36.72  ? 89  GLY A N   1 
ATOM 670  C CA  . GLY A 1 89  ? 16.507  -14.164 239.965 1.00 35.17  ? 89  GLY A CA  1 
ATOM 671  C C   . GLY A 1 89  ? 17.132  -12.782 239.952 1.00 32.47  ? 89  GLY A C   1 
ATOM 672  O O   . GLY A 1 89  ? 16.717  -11.919 240.730 1.00 32.29  ? 89  GLY A O   1 
ATOM 673  N N   . THR A 1 90  ? 18.116  -12.570 239.075 1.00 29.55  ? 90  THR A N   1 
ATOM 674  C CA  . THR A 1 90  ? 18.778  -11.274 238.932 1.00 27.12  ? 90  THR A CA  1 
ATOM 675  C C   . THR A 1 90  ? 18.849  -10.984 237.440 1.00 26.20  ? 90  THR A C   1 
ATOM 676  O O   . THR A 1 90  ? 18.798  -11.912 236.631 1.00 26.90  ? 90  THR A O   1 
ATOM 677  C CB  . THR A 1 90  ? 20.244  -11.277 239.474 1.00 26.29  ? 90  THR A CB  1 
ATOM 678  O OG1 . THR A 1 90  ? 21.023  -12.226 238.734 1.00 26.06  ? 90  THR A OG1 1 
ATOM 679  C CG2 . THR A 1 90  ? 20.288  -11.636 240.949 1.00 21.21  ? 90  THR A CG2 1 
ATOM 680  N N   . VAL A 1 91  ? 18.904  -9.703  237.077 1.00 24.80  ? 91  VAL A N   1 
ATOM 681  C CA  . VAL A 1 91  ? 19.026  -9.293  235.680 1.00 24.10  ? 91  VAL A CA  1 
ATOM 682  C C   . VAL A 1 91  ? 20.301  -8.444  235.676 1.00 23.97  ? 91  VAL A C   1 
ATOM 683  O O   . VAL A 1 91  ? 20.440  -7.539  236.507 1.00 23.44  ? 91  VAL A O   1 
ATOM 684  C CB  . VAL A 1 91  ? 17.820  -8.420  235.227 1.00 24.55  ? 91  VAL A CB  1 
ATOM 685  C CG1 . VAL A 1 91  ? 18.050  -7.892  233.808 1.00 22.55  ? 91  VAL A CG1 1 
ATOM 686  C CG2 . VAL A 1 91  ? 16.547  -9.233  235.271 1.00 25.57  ? 91  VAL A CG2 1 
ATOM 687  N N   . CYS A 1 92  ? 21.219  -8.724  234.761 1.00 22.23  ? 92  CYS A N   1 
ATOM 688  C CA  . CYS A 1 92  ? 22.479  -7.984  234.718 1.00 24.79  ? 92  CYS A CA  1 
ATOM 689  C C   . CYS A 1 92  ? 22.828  -7.522  233.327 1.00 26.85  ? 92  CYS A C   1 
ATOM 690  O O   . CYS A 1 92  ? 22.368  -8.109  232.344 1.00 28.41  ? 92  CYS A O   1 
ATOM 691  C CB  . CYS A 1 92  ? 23.640  -8.871  235.170 1.00 19.43  ? 92  CYS A CB  1 
ATOM 692  S SG  . CYS A 1 92  ? 23.493  -9.645  236.803 1.00 26.62  ? 92  CYS A SG  1 
ATOM 693  N N   . LYS A 1 93  ? 23.633  -6.463  233.241 1.00 26.32  ? 93  LYS A N   1 
ATOM 694  C CA  . LYS A 1 93  ? 24.117  -5.982  231.950 1.00 25.91  ? 93  LYS A CA  1 
ATOM 695  C C   . LYS A 1 93  ? 25.588  -5.606  232.106 1.00 27.24  ? 93  LYS A C   1 
ATOM 696  O O   . LYS A 1 93  ? 25.971  -4.942  233.075 1.00 29.36  ? 93  LYS A O   1 
ATOM 697  C CB  . LYS A 1 93  ? 23.339  -4.789  231.401 1.00 22.62  ? 93  LYS A CB  1 
ATOM 698  C CG  . LYS A 1 93  ? 23.594  -4.636  229.914 1.00 26.46  ? 93  LYS A CG  1 
ATOM 699  C CD  . LYS A 1 93  ? 23.130  -3.326  229.335 1.00 32.50  ? 93  LYS A CD  1 
ATOM 700  C CE  . LYS A 1 93  ? 23.416  -3.327  227.842 1.00 38.36  ? 93  LYS A CE  1 
ATOM 701  N NZ  . LYS A 1 93  ? 22.887  -2.118  227.150 1.00 50.12  ? 93  LYS A NZ  1 
ATOM 702  N N   . ARG A 1 94  ? 26.410  -6.127  231.205 1.00 25.57  ? 94  ARG A N   1 
ATOM 703  C CA  . ARG A 1 94  ? 27.832  -5.856  231.205 1.00 26.93  ? 94  ARG A CA  1 
ATOM 704  C C   . ARG A 1 94  ? 28.031  -4.850  230.084 1.00 27.73  ? 94  ARG A C   1 
ATOM 705  O O   . ARG A 1 94  ? 27.427  -4.987  229.012 1.00 28.15  ? 94  ARG A O   1 
ATOM 706  C CB  . ARG A 1 94  ? 28.623  -7.130  230.897 1.00 28.46  ? 94  ARG A CB  1 
ATOM 707  C CG  . ARG A 1 94  ? 28.382  -8.299  231.835 1.00 29.51  ? 94  ARG A CG  1 
ATOM 708  C CD  . ARG A 1 94  ? 29.369  -9.435  231.522 1.00 35.64  ? 94  ARG A CD  1 
ATOM 709  N NE  . ARG A 1 94  ? 30.752  -8.968  231.626 1.00 24.83  ? 94  ARG A NE  1 
ATOM 710  C CZ  . ARG A 1 94  ? 31.422  -8.848  232.770 1.00 26.99  ? 94  ARG A CZ  1 
ATOM 711  N NH1 . ARG A 1 94  ? 30.858  -9.172  233.930 1.00 21.26  ? 94  ARG A NH1 1 
ATOM 712  N NH2 . ARG A 1 94  ? 32.653  -8.356  232.762 1.00 25.70  ? 94  ARG A NH2 1 
ATOM 713  N N   . ASP A 1 95  ? 28.877  -3.849  230.313 1.00 27.16  ? 95  ASP A N   1 
ATOM 714  C CA  . ASP A 1 95  ? 29.124  -2.828  229.303 1.00 27.06  ? 95  ASP A CA  1 
ATOM 715  C C   . ASP A 1 95  ? 30.545  -2.281  229.534 1.00 29.82  ? 95  ASP A C   1 
ATOM 716  O O   . ASP A 1 95  ? 31.370  -2.920  230.195 1.00 28.70  ? 95  ASP A O   1 
ATOM 717  C CB  . ASP A 1 95  ? 28.052  -1.720  229.435 1.00 23.79  ? 95  ASP A CB  1 
ATOM 718  C CG  . ASP A 1 95  ? 27.760  -0.991  228.114 1.00 30.16  ? 95  ASP A CG  1 
ATOM 719  O OD1 . ASP A 1 95  ? 28.595  -1.003  227.178 1.00 33.72  ? 95  ASP A OD1 1 
ATOM 720  O OD2 . ASP A 1 95  ? 26.673  -0.382  228.015 1.00 31.93  ? 95  ASP A OD2 1 
ATOM 721  N N   . GLN A 1 96  ? 30.825  -1.101  228.992 1.00 31.84  ? 96  GLN A N   1 
ATOM 722  C CA  . GLN A 1 96  ? 32.124  -0.457  229.135 1.00 30.12  ? 96  GLN A CA  1 
ATOM 723  C C   . GLN A 1 96  ? 31.868  1.010   229.362 1.00 29.11  ? 96  GLN A C   1 
ATOM 724  O O   . GLN A 1 96  ? 31.008  1.593   228.705 1.00 28.76  ? 96  GLN A O   1 
ATOM 725  C CB  . GLN A 1 96  ? 32.922  -0.599  227.849 1.00 28.20  ? 96  GLN A CB  1 
ATOM 726  C CG  . GLN A 1 96  ? 33.508  -1.964  227.610 1.00 37.40  ? 96  GLN A CG  1 
ATOM 727  C CD  . GLN A 1 96  ? 34.409  -1.964  226.395 1.00 49.73  ? 96  GLN A CD  1 
ATOM 728  O OE1 . GLN A 1 96  ? 35.494  -2.544  226.415 1.00 53.01  ? 96  GLN A OE1 1 
ATOM 729  N NE2 . GLN A 1 96  ? 33.984  -1.269  225.338 1.00 49.52  ? 96  GLN A NE2 1 
ATOM 730  N N   . SER A 1 97  ? 32.590  1.602   230.298 1.00 27.66  ? 97  SER A N   1 
ATOM 731  C CA  . SER A 1 97  ? 32.441  3.020   230.568 1.00 27.74  ? 97  SER A CA  1 
ATOM 732  C C   . SER A 1 97  ? 33.772  3.705   230.290 1.00 26.31  ? 97  SER A C   1 
ATOM 733  O O   . SER A 1 97  ? 34.811  3.048   230.226 1.00 27.39  ? 97  SER A O   1 
ATOM 734  C CB  . SER A 1 97  ? 32.044  3.249   232.022 1.00 22.52  ? 97  SER A CB  1 
ATOM 735  O OG  . SER A 1 97  ? 32.993  2.656   232.877 1.00 25.89  ? 97  SER A OG  1 
ATOM 736  N N   . ASP A 1 98  ? 33.732  5.018   230.094 1.00 24.83  ? 98  ASP A N   1 
ATOM 737  C CA  . ASP A 1 98  ? 34.933  5.807   229.850 1.00 23.53  ? 98  ASP A CA  1 
ATOM 738  C C   . ASP A 1 98  ? 35.560  6.095   231.211 1.00 21.71  ? 98  ASP A C   1 
ATOM 739  O O   . ASP A 1 98  ? 34.882  6.548   232.131 1.00 21.20  ? 98  ASP A O   1 
ATOM 740  C CB  . ASP A 1 98  ? 34.574  7.111   229.144 1.00 25.60  ? 98  ASP A CB  1 
ATOM 741  C CG  . ASP A 1 98  ? 33.925  6.879   227.793 1.00 31.12  ? 98  ASP A CG  1 
ATOM 742  O OD1 . ASP A 1 98  ? 34.496  6.120   226.983 1.00 34.09  ? 98  ASP A OD1 1 
ATOM 743  O OD2 . ASP A 1 98  ? 32.846  7.458   227.545 1.00 40.34  ? 98  ASP A OD2 1 
ATOM 744  N N   . ARG A 1 99  ? 36.843  5.785   231.340 1.00 19.59  ? 99  ARG A N   1 
ATOM 745  C CA  . ARG A 1 99  ? 37.563  5.972   232.593 1.00 18.60  ? 99  ARG A CA  1 
ATOM 746  C C   . ARG A 1 99  ? 38.812  6.811   232.319 1.00 20.20  ? 99  ARG A C   1 
ATOM 747  O O   . ARG A 1 99  ? 39.229  6.951   231.169 1.00 19.46  ? 99  ARG A O   1 
ATOM 748  C CB  . ARG A 1 99  ? 37.985  4.604   233.157 1.00 20.58  ? 99  ARG A CB  1 
ATOM 749  C CG  . ARG A 1 99  ? 36.846  3.613   233.393 1.00 19.10  ? 99  ARG A CG  1 
ATOM 750  C CD  . ARG A 1 99  ? 35.827  4.166   234.368 1.00 18.49  ? 99  ARG A CD  1 
ATOM 751  N NE  . ARG A 1 99  ? 36.393  4.441   235.686 1.00 16.03  ? 99  ARG A NE  1 
ATOM 752  C CZ  . ARG A 1 99  ? 36.532  3.533   236.649 1.00 23.80  ? 99  ARG A CZ  1 
ATOM 753  N NH1 . ARG A 1 99  ? 36.146  2.275   236.463 1.00 17.94  ? 99  ARG A NH1 1 
ATOM 754  N NH2 . ARG A 1 99  ? 37.065  3.880   237.806 1.00 13.10  ? 99  ARG A NH2 1 
ATOM 755  N N   . GLY A 1 100 ? 39.422  7.339   233.374 1.00 20.97  ? 100 GLY A N   1 
ATOM 756  C CA  . GLY A 1 100 ? 40.618  8.154   233.223 1.00 18.97  ? 100 GLY A CA  1 
ATOM 757  C C   . GLY A 1 100 ? 41.019  8.655   234.587 1.00 19.85  ? 100 GLY A C   1 
ATOM 758  O O   . GLY A 1 100 ? 40.492  8.176   235.599 1.00 19.18  ? 100 GLY A O   1 
ATOM 759  N N   . TRP A 1 101 ? 41.919  9.629   234.641 1.00 18.81  ? 101 TRP A N   1 
ATOM 760  C CA  . TRP A 1 101 ? 42.353  10.172  235.929 1.00 18.04  ? 101 TRP A CA  1 
ATOM 761  C C   . TRP A 1 101 ? 41.199  10.778  236.731 1.00 19.15  ? 101 TRP A C   1 
ATOM 762  O O   . TRP A 1 101 ? 41.207  10.726  237.960 1.00 19.15  ? 101 TRP A O   1 
ATOM 763  C CB  . TRP A 1 101 ? 43.417  11.241  235.725 1.00 18.50  ? 101 TRP A CB  1 
ATOM 764  C CG  . TRP A 1 101 ? 44.745  10.729  235.270 1.00 21.63  ? 101 TRP A CG  1 
ATOM 765  C CD1 . TRP A 1 101 ? 45.059  9.458   234.883 1.00 19.18  ? 101 TRP A CD1 1 
ATOM 766  C CD2 . TRP A 1 101 ? 45.937  11.499  235.124 1.00 17.39  ? 101 TRP A CD2 1 
ATOM 767  N NE1 . TRP A 1 101 ? 46.375  9.393   234.496 1.00 17.46  ? 101 TRP A NE1 1 
ATOM 768  C CE2 . TRP A 1 101 ? 46.940  10.630  234.635 1.00 20.39  ? 101 TRP A CE2 1 
ATOM 769  C CE3 . TRP A 1 101 ? 46.254  12.848  235.348 1.00 17.30  ? 101 TRP A CE3 1 
ATOM 770  C CZ2 . TRP A 1 101 ? 48.242  11.064  234.368 1.00 20.68  ? 101 TRP A CZ2 1 
ATOM 771  C CZ3 . TRP A 1 101 ? 47.544  13.285  235.078 1.00 18.78  ? 101 TRP A CZ3 1 
ATOM 772  C CH2 . TRP A 1 101 ? 48.526  12.391  234.592 1.00 21.47  ? 101 TRP A CH2 1 
ATOM 773  N N   . GLY A 1 102 ? 40.214  11.336  236.029 1.00 18.83  ? 102 GLY A N   1 
ATOM 774  C CA  . GLY A 1 102 ? 39.068  11.959  236.675 1.00 17.92  ? 102 GLY A CA  1 
ATOM 775  C C   . GLY A 1 102 ? 38.279  11.030  237.570 1.00 20.01  ? 102 GLY A C   1 
ATOM 776  O O   . GLY A 1 102 ? 37.641  11.468  238.536 1.00 19.70  ? 102 GLY A O   1 
ATOM 777  N N   . ASN A 1 103 ? 38.294  9.743   237.257 1.00 20.46  ? 103 ASN A N   1 
ATOM 778  C CA  . ASN A 1 103 ? 37.590  8.774   238.083 1.00 22.41  ? 103 ASN A CA  1 
ATOM 779  C C   . ASN A 1 103 ? 38.543  7.709   238.629 1.00 25.30  ? 103 ASN A C   1 
ATOM 780  O O   . ASN A 1 103 ? 38.195  6.536   238.788 1.00 23.68  ? 103 ASN A O   1 
ATOM 781  C CB  . ASN A 1 103 ? 36.388  8.170   237.342 1.00 22.77  ? 103 ASN A CB  1 
ATOM 782  C CG  . ASN A 1 103 ? 36.685  7.898   235.903 1.00 20.84  ? 103 ASN A CG  1 
ATOM 783  O OD1 . ASN A 1 103 ? 37.482  7.028   235.592 1.00 23.09  ? 103 ASN A OD1 1 
ATOM 784  N ND2 . ASN A 1 103 ? 36.090  8.680   235.011 1.00 20.64  ? 103 ASN A ND2 1 
ATOM 785  N N   . HIS A 1 104 ? 39.772  8.141   238.883 1.00 24.58  ? 104 HIS A N   1 
ATOM 786  C CA  . HIS A 1 104 ? 40.797  7.312   239.491 1.00 24.45  ? 104 HIS A CA  1 
ATOM 787  C C   . HIS A 1 104 ? 41.372  6.088   238.813 1.00 23.49  ? 104 HIS A C   1 
ATOM 788  O O   . HIS A 1 104 ? 41.587  5.074   239.469 1.00 24.83  ? 104 HIS A O   1 
ATOM 789  C CB  . HIS A 1 104 ? 40.382  6.990   240.930 1.00 25.48  ? 104 HIS A CB  1 
ATOM 790  C CG  . HIS A 1 104 ? 40.023  8.214   241.701 1.00 28.70  ? 104 HIS A CG  1 
ATOM 791  N ND1 . HIS A 1 104 ? 38.749  8.742   241.701 1.00 31.88  ? 104 HIS A ND1 1 
ATOM 792  C CD2 . HIS A 1 104 ? 40.801  9.108   242.359 1.00 27.18  ? 104 HIS A CD2 1 
ATOM 793  C CE1 . HIS A 1 104 ? 38.759  9.914   242.310 1.00 29.49  ? 104 HIS A CE1 1 
ATOM 794  N NE2 . HIS A 1 104 ? 39.993  10.159  242.719 1.00 23.65  ? 104 HIS A NE2 1 
ATOM 795  N N   . CYS A 1 105 ? 41.640  6.185   237.515 1.00 21.19  ? 105 CYS A N   1 
ATOM 796  C CA  . CYS A 1 105 ? 42.281  5.101   236.784 1.00 21.64  ? 105 CYS A CA  1 
ATOM 797  C C   . CYS A 1 105 ? 43.609  5.657   236.262 1.00 24.14  ? 105 CYS A C   1 
ATOM 798  O O   . CYS A 1 105 ? 43.720  6.865   236.004 1.00 25.42  ? 105 CYS A O   1 
ATOM 799  C CB  . CYS A 1 105 ? 41.421  4.614   235.625 1.00 21.74  ? 105 CYS A CB  1 
ATOM 800  S SG  . CYS A 1 105 ? 39.909  3.781   236.188 1.00 21.87  ? 105 CYS A SG  1 
ATOM 801  N N   . GLY A 1 106 ? 44.615  4.795   236.135 1.00 23.41  ? 106 GLY A N   1 
ATOM 802  C CA  . GLY A 1 106 ? 45.913  5.240   235.650 1.00 22.45  ? 106 GLY A CA  1 
ATOM 803  C C   . GLY A 1 106 ? 45.900  5.628   234.183 1.00 23.49  ? 106 GLY A C   1 
ATOM 804  O O   . GLY A 1 106 ? 46.628  6.538   233.770 1.00 22.60  ? 106 GLY A O   1 
ATOM 805  N N   . LEU A 1 107 ? 45.103  4.906   233.391 1.00 23.09  ? 107 LEU A N   1 
ATOM 806  C CA  . LEU A 1 107 ? 44.966  5.160   231.957 1.00 21.59  ? 107 LEU A CA  1 
ATOM 807  C C   . LEU A 1 107 ? 43.601  5.736   231.622 1.00 22.99  ? 107 LEU A C   1 
ATOM 808  O O   . LEU A 1 107 ? 42.654  5.567   232.381 1.00 25.02  ? 107 LEU A O   1 
ATOM 809  C CB  . LEU A 1 107 ? 45.104  3.859   231.172 1.00 17.60  ? 107 LEU A CB  1 
ATOM 810  C CG  . LEU A 1 107 ? 46.488  3.236   231.108 1.00 27.17  ? 107 LEU A CG  1 
ATOM 811  C CD1 . LEU A 1 107 ? 46.433  1.920   230.357 1.00 31.04  ? 107 LEU A CD1 1 
ATOM 812  C CD2 . LEU A 1 107 ? 47.411  4.199   230.391 1.00 27.68  ? 107 LEU A CD2 1 
ATOM 813  N N   . PHE A 1 108 ? 43.521  6.421   230.486 1.00 23.16  ? 108 PHE A N   1 
ATOM 814  C CA  . PHE A 1 108 ? 42.280  6.991   229.967 1.00 23.83  ? 108 PHE A CA  1 
ATOM 815  C C   . PHE A 1 108 ? 41.855  5.987   228.893 1.00 26.27  ? 108 PHE A C   1 
ATOM 816  O O   . PHE A 1 108 ? 42.593  5.761   227.929 1.00 26.28  ? 108 PHE A O   1 
ATOM 817  C CB  . PHE A 1 108 ? 42.520  8.355   229.295 1.00 21.45  ? 108 PHE A CB  1 
ATOM 818  C CG  . PHE A 1 108 ? 42.792  9.475   230.260 1.00 23.95  ? 108 PHE A CG  1 
ATOM 819  C CD1 . PHE A 1 108 ? 44.017  9.573   230.911 1.00 23.00  ? 108 PHE A CD1 1 
ATOM 820  C CD2 . PHE A 1 108 ? 41.816  10.432  230.520 1.00 23.33  ? 108 PHE A CD2 1 
ATOM 821  C CE1 . PHE A 1 108 ? 44.271  10.604  231.806 1.00 25.54  ? 108 PHE A CE1 1 
ATOM 822  C CE2 . PHE A 1 108 ? 42.060  11.475  231.420 1.00 30.53  ? 108 PHE A CE2 1 
ATOM 823  C CZ  . PHE A 1 108 ? 43.297  11.559  232.065 1.00 24.22  ? 108 PHE A CZ  1 
ATOM 824  N N   . GLY A 1 109 ? 40.714  5.342   229.091 1.00 27.17  ? 109 GLY A N   1 
ATOM 825  C CA  . GLY A 1 109 ? 40.226  4.371   228.125 1.00 27.03  ? 109 GLY A CA  1 
ATOM 826  C C   . GLY A 1 109 ? 38.939  3.717   228.604 1.00 27.94  ? 109 GLY A C   1 
ATOM 827  O O   . GLY A 1 109 ? 38.295  4.192   229.548 1.00 27.13  ? 109 GLY A O   1 
ATOM 828  N N   . LYS A 1 110 ? 38.575  2.614   227.965 1.00 29.30  ? 110 LYS A N   1 
ATOM 829  C CA  . LYS A 1 110 ? 37.369  1.875   228.302 1.00 26.39  ? 110 LYS A CA  1 
ATOM 830  C C   . LYS A 1 110 ? 37.614  0.928   229.455 1.00 25.20  ? 110 LYS A C   1 
ATOM 831  O O   . LYS A 1 110 ? 38.611  0.199   229.477 1.00 27.48  ? 110 LYS A O   1 
ATOM 832  C CB  . LYS A 1 110 ? 36.890  1.082   227.088 1.00 26.62  ? 110 LYS A CB  1 
ATOM 833  C CG  . LYS A 1 110 ? 36.465  1.943   225.911 1.00 31.18  ? 110 LYS A CG  1 
ATOM 834  C CD  . LYS A 1 110 ? 35.184  2.711   226.211 1.00 37.72  ? 110 LYS A CD  1 
ATOM 835  C CE  . LYS A 1 110 ? 34.740  3.507   224.992 1.00 43.53  ? 110 LYS A CE  1 
ATOM 836  N NZ  . LYS A 1 110 ? 33.440  4.204   225.205 1.00 51.21  ? 110 LYS A NZ  1 
ATOM 837  N N   . GLY A 1 111 ? 36.719  0.966   230.429 1.00 23.94  ? 111 GLY A N   1 
ATOM 838  C CA  . GLY A 1 111 ? 36.827  0.091   231.582 1.00 24.11  ? 111 GLY A CA  1 
ATOM 839  C C   . GLY A 1 111 ? 35.577  -0.767  231.674 1.00 26.44  ? 111 GLY A C   1 
ATOM 840  O O   . GLY A 1 111 ? 34.483  -0.335  231.304 1.00 27.07  ? 111 GLY A O   1 
ATOM 841  N N   . SER A 1 112 ? 35.739  -1.996  232.136 1.00 26.56  ? 112 SER A N   1 
ATOM 842  C CA  . SER A 1 112 ? 34.621  -2.915  232.268 1.00 26.37  ? 112 SER A CA  1 
ATOM 843  C C   . SER A 1 112 ? 33.682  -2.509  233.415 1.00 26.27  ? 112 SER A C   1 
ATOM 844  O O   . SER A 1 112 ? 34.133  -2.121  234.504 1.00 26.00  ? 112 SER A O   1 
ATOM 845  C CB  . SER A 1 112 ? 35.174  -4.333  232.487 1.00 29.06  ? 112 SER A CB  1 
ATOM 846  O OG  . SER A 1 112 ? 34.209  -5.226  233.011 1.00 25.97  ? 112 SER A OG  1 
ATOM 847  N N   . ILE A 1 113 ? 32.377  -2.604  233.164 1.00 26.31  ? 113 ILE A N   1 
ATOM 848  C CA  . ILE A 1 113 ? 31.370  -2.289  234.178 1.00 23.64  ? 113 ILE A CA  1 
ATOM 849  C C   . ILE A 1 113 ? 30.212  -3.296  234.056 1.00 24.47  ? 113 ILE A C   1 
ATOM 850  O O   . ILE A 1 113 ? 29.881  -3.728  232.952 1.00 21.14  ? 113 ILE A O   1 
ATOM 851  C CB  . ILE A 1 113 ? 30.854  -0.827  234.023 1.00 23.69  ? 113 ILE A CB  1 
ATOM 852  C CG1 . ILE A 1 113 ? 29.896  -0.472  235.158 1.00 19.69  ? 113 ILE A CG1 1 
ATOM 853  C CG2 . ILE A 1 113 ? 30.212  -0.614  232.656 1.00 20.15  ? 113 ILE A CG2 1 
ATOM 854  C CD1 . ILE A 1 113 ? 29.609  1.011   235.265 1.00 22.86  ? 113 ILE A CD1 1 
ATOM 855  N N   . VAL A 1 114 ? 29.657  -3.717  235.188 1.00 23.06  ? 114 VAL A N   1 
ATOM 856  C CA  . VAL A 1 114 ? 28.540  -4.654  235.193 1.00 26.37  ? 114 VAL A CA  1 
ATOM 857  C C   . VAL A 1 114 ? 27.591  -4.233  236.309 1.00 25.69  ? 114 VAL A C   1 
ATOM 858  O O   . VAL A 1 114 ? 28.033  -3.862  237.392 1.00 25.31  ? 114 VAL A O   1 
ATOM 859  C CB  . VAL A 1 114 ? 28.994  -6.150  235.394 1.00 29.10  ? 114 VAL A CB  1 
ATOM 860  C CG1 . VAL A 1 114 ? 29.739  -6.341  236.706 1.00 25.77  ? 114 VAL A CG1 1 
ATOM 861  C CG2 . VAL A 1 114 ? 27.791  -7.065  235.367 1.00 29.00  ? 114 VAL A CG2 1 
ATOM 862  N N   . ALA A 1 115 ? 26.294  -4.209  236.010 1.00 25.76  ? 115 ALA A N   1 
ATOM 863  C CA  . ALA A 1 115 ? 25.271  -3.845  236.987 1.00 24.17  ? 115 ALA A CA  1 
ATOM 864  C C   . ALA A 1 115 ? 24.220  -4.958  237.020 1.00 25.18  ? 115 ALA A C   1 
ATOM 865  O O   . ALA A 1 115 ? 23.884  -5.523  235.974 1.00 23.01  ? 115 ALA A O   1 
ATOM 866  C CB  . ALA A 1 115 ? 24.622  -2.523  236.605 1.00 20.66  ? 115 ALA A CB  1 
ATOM 867  N N   . CYS A 1 116 ? 23.715  -5.267  238.214 1.00 25.37  ? 116 CYS A N   1 
ATOM 868  C CA  . CYS A 1 116 ? 22.700  -6.308  238.400 1.00 24.63  ? 116 CYS A CA  1 
ATOM 869  C C   . CYS A 1 116 ? 21.629  -5.861  239.374 1.00 25.79  ? 116 CYS A C   1 
ATOM 870  O O   . CYS A 1 116 ? 21.920  -5.093  240.294 1.00 26.54  ? 116 CYS A O   1 
ATOM 871  C CB  . CYS A 1 116 ? 23.307  -7.568  239.026 1.00 24.84  ? 116 CYS A CB  1 
ATOM 872  S SG  . CYS A 1 116 ? 24.554  -8.448  238.049 1.00 26.53  ? 116 CYS A SG  1 
ATOM 873  N N   . VAL A 1 117 ? 20.399  -6.343  239.174 1.00 25.41  ? 117 VAL A N   1 
ATOM 874  C CA  . VAL A 1 117 ? 19.292  -6.075  240.099 1.00 23.09  ? 117 VAL A CA  1 
ATOM 875  C C   . VAL A 1 117 ? 18.599  -7.392  240.347 1.00 22.01  ? 117 VAL A C   1 
ATOM 876  O O   . VAL A 1 117 ? 18.600  -8.271  239.480 1.00 21.66  ? 117 VAL A O   1 
ATOM 877  C CB  . VAL A 1 117 ? 18.170  -5.136  239.557 1.00 23.18  ? 117 VAL A CB  1 
ATOM 878  C CG1 . VAL A 1 117 ? 18.419  -3.725  239.979 1.00 27.49  ? 117 VAL A CG1 1 
ATOM 879  C CG2 . VAL A 1 117 ? 17.995  -5.277  238.046 1.00 16.70  ? 117 VAL A CG2 1 
ATOM 880  N N   . LYS A 1 118 ? 18.039  -7.539  241.535 1.00 19.74  ? 118 LYS A N   1 
ATOM 881  C CA  . LYS A 1 118 ? 17.270  -8.727  241.844 1.00 24.51  ? 118 LYS A CA  1 
ATOM 882  C C   . LYS A 1 118 ? 15.889  -8.402  241.279 1.00 24.62  ? 118 LYS A C   1 
ATOM 883  O O   . LYS A 1 118 ? 15.387  -7.290  241.456 1.00 23.36  ? 118 LYS A O   1 
ATOM 884  C CB  . LYS A 1 118 ? 17.239  -8.978  243.353 1.00 29.34  ? 118 LYS A CB  1 
ATOM 885  C CG  . LYS A 1 118 ? 18.439  -9.825  243.805 1.00 48.69  ? 118 LYS A CG  1 
ATOM 886  C CD  . LYS A 1 118 ? 18.887  -9.537  245.227 1.00 60.91  ? 118 LYS A CD  1 
ATOM 887  C CE  . LYS A 1 118 ? 17.778  -9.812  246.225 1.00 68.41  ? 118 LYS A CE  1 
ATOM 888  N NZ  . LYS A 1 118 ? 18.242  -9.547  247.611 1.00 71.77  ? 118 LYS A NZ  1 
ATOM 889  N N   . ALA A 1 119 ? 15.330  -9.336  240.522 1.00 23.43  ? 119 ALA A N   1 
ATOM 890  C CA  . ALA A 1 119 ? 14.033  -9.139  239.893 1.00 24.34  ? 119 ALA A CA  1 
ATOM 891  C C   . ALA A 1 119 ? 13.001  -10.123 240.421 1.00 25.58  ? 119 ALA A C   1 
ATOM 892  O O   . ALA A 1 119 ? 13.207  -11.334 240.393 1.00 28.29  ? 119 ALA A O   1 
ATOM 893  C CB  . ALA A 1 119 ? 14.168  -9.282  238.386 1.00 18.56  ? 119 ALA A CB  1 
ATOM 894  N N   . ALA A 1 120 ? 11.913  -9.591  240.952 1.00 23.57  ? 120 ALA A N   1 
ATOM 895  C CA  . ALA A 1 120 ? 10.824  -10.405 241.465 1.00 21.56  ? 120 ALA A CA  1 
ATOM 896  C C   . ALA A 1 120 ? 9.550   -9.778  240.900 1.00 21.11  ? 120 ALA A C   1 
ATOM 897  O O   . ALA A 1 120 ? 9.608   -8.885  240.037 1.00 20.77  ? 120 ALA A O   1 
ATOM 898  C CB  . ALA A 1 120 ? 10.805  -10.375 242.989 1.00 19.84  ? 120 ALA A CB  1 
ATOM 899  N N   . CYS A 1 121 ? 8.399   -10.211 241.395 1.00 18.11  ? 121 CYS A N   1 
ATOM 900  C CA  . CYS A 1 121 ? 7.144   -9.670  240.902 1.00 17.75  ? 121 CYS A CA  1 
ATOM 901  C C   . CYS A 1 121 ? 6.347   -9.053  242.040 1.00 15.29  ? 121 CYS A C   1 
ATOM 902  O O   . CYS A 1 121 ? 6.355   -9.564  243.153 1.00 18.16  ? 121 CYS A O   1 
ATOM 903  C CB  . CYS A 1 121 ? 6.331   -10.781 240.219 1.00 15.95  ? 121 CYS A CB  1 
ATOM 904  S SG  . CYS A 1 121 ? 5.057   -10.176 239.070 1.00 15.99  ? 121 CYS A SG  1 
ATOM 905  N N   . GLU A 1 122 ? 5.704   -7.922  241.774 1.00 16.64  ? 122 GLU A N   1 
ATOM 906  C CA  . GLU A 1 122 ? 4.883   -7.260  242.775 1.00 16.95  ? 122 GLU A CA  1 
ATOM 907  C C   . GLU A 1 122 ? 3.751   -8.189  243.190 1.00 18.85  ? 122 GLU A C   1 
ATOM 908  O O   . GLU A 1 122 ? 3.256   -8.981  242.379 1.00 17.98  ? 122 GLU A O   1 
ATOM 909  C CB  . GLU A 1 122 ? 4.288   -5.981  242.195 1.00 21.62  ? 122 GLU A CB  1 
ATOM 910  C CG  . GLU A 1 122 ? 5.257   -4.826  242.157 1.00 29.62  ? 122 GLU A CG  1 
ATOM 911  C CD  . GLU A 1 122 ? 5.623   -4.312  243.545 1.00 33.87  ? 122 GLU A CD  1 
ATOM 912  O OE1 . GLU A 1 122 ? 4.925   -4.649  244.534 1.00 36.07  ? 122 GLU A OE1 1 
ATOM 913  O OE2 . GLU A 1 122 ? 6.615   -3.560  243.636 1.00 31.62  ? 122 GLU A OE2 1 
ATOM 914  N N   . ALA A 1 123 ? 3.349   -8.100  244.455 1.00 20.85  ? 123 ALA A N   1 
ATOM 915  C CA  . ALA A 1 123 ? 2.263   -8.927  244.971 1.00 22.62  ? 123 ALA A CA  1 
ATOM 916  C C   . ALA A 1 123 ? 1.012   -8.643  244.139 1.00 25.11  ? 123 ALA A C   1 
ATOM 917  O O   . ALA A 1 123 ? 0.745   -7.487  243.784 1.00 26.84  ? 123 ALA A O   1 
ATOM 918  C CB  . ALA A 1 123 ? 1.995   -8.597  246.431 1.00 19.60  ? 123 ALA A CB  1 
ATOM 919  N N   . LYS A 1 124 ? 0.310   -9.704  243.754 1.00 22.68  ? 124 LYS A N   1 
ATOM 920  C CA  . LYS A 1 124 ? -0.922  -9.586  242.991 1.00 21.82  ? 124 LYS A CA  1 
ATOM 921  C C   . LYS A 1 124 ? -0.819  -8.968  241.606 1.00 19.10  ? 124 LYS A C   1 
ATOM 922  O O   . LYS A 1 124 ? -1.811  -8.477  241.060 1.00 17.82  ? 124 LYS A O   1 
ATOM 923  C CB  . LYS A 1 124 ? -1.989  -8.887  243.832 1.00 23.94  ? 124 LYS A CB  1 
ATOM 924  C CG  . LYS A 1 124 ? -2.385  -9.720  245.035 1.00 34.39  ? 124 LYS A CG  1 
ATOM 925  C CD  . LYS A 1 124 ? -3.495  -9.088  245.833 1.00 53.54  ? 124 LYS A CD  1 
ATOM 926  C CE  . LYS A 1 124 ? -3.996  -10.060 246.887 1.00 62.63  ? 124 LYS A CE  1 
ATOM 927  N NZ  . LYS A 1 124 ? -5.241  -9.556  247.532 1.00 69.19  ? 124 LYS A NZ  1 
ATOM 928  N N   . LYS A 1 125 ? 0.363   -9.077  241.007 1.00 16.71  ? 125 LYS A N   1 
ATOM 929  C CA  . LYS A 1 125 ? 0.595   -8.545  239.676 1.00 14.01  ? 125 LYS A CA  1 
ATOM 930  C C   . LYS A 1 125 ? 0.968   -9.637  238.672 1.00 15.90  ? 125 LYS A C   1 
ATOM 931  O O   . LYS A 1 125 ? 1.765   -9.418  237.739 1.00 14.72  ? 125 LYS A O   1 
ATOM 932  C CB  . LYS A 1 125 ? 1.650   -7.432  239.727 1.00 15.96  ? 125 LYS A CB  1 
ATOM 933  C CG  . LYS A 1 125 ? 1.137   -6.140  240.343 1.00 15.21  ? 125 LYS A CG  1 
ATOM 934  C CD  . LYS A 1 125 ? 0.094   -5.533  239.422 1.00 20.06  ? 125 LYS A CD  1 
ATOM 935  C CE  . LYS A 1 125 ? -0.736  -4.448  240.093 1.00 17.49  ? 125 LYS A CE  1 
ATOM 936  N NZ  . LYS A 1 125 ? -1.710  -3.879  239.095 1.00 17.05  ? 125 LYS A NZ  1 
ATOM 937  N N   . LYS A 1 126 ? 0.373   -10.816 238.846 1.00 15.12  ? 126 LYS A N   1 
ATOM 938  C CA  . LYS A 1 126 ? 0.618   -11.928 237.933 1.00 15.27  ? 126 LYS A CA  1 
ATOM 939  C C   . LYS A 1 126 ? -0.580  -12.113 237.012 1.00 15.79  ? 126 LYS A C   1 
ATOM 940  O O   . LYS A 1 126 ? -1.687  -11.689 237.335 1.00 15.69  ? 126 LYS A O   1 
ATOM 941  C CB  . LYS A 1 126 ? 0.777   -13.238 238.686 1.00 18.02  ? 126 LYS A CB  1 
ATOM 942  C CG  . LYS A 1 126 ? 1.922   -13.354 239.644 1.00 21.07  ? 126 LYS A CG  1 
ATOM 943  C CD  . LYS A 1 126 ? 1.957   -14.808 240.084 1.00 30.42  ? 126 LYS A CD  1 
ATOM 944  C CE  . LYS A 1 126 ? 2.767   -15.042 241.318 1.00 35.51  ? 126 LYS A CE  1 
ATOM 945  N NZ  . LYS A 1 126 ? 2.563   -16.447 241.763 1.00 37.82  ? 126 LYS A NZ  1 
ATOM 946  N N   . ALA A 1 127 ? -0.333  -12.735 235.864 1.00 16.03  ? 127 ALA A N   1 
ATOM 947  C CA  . ALA A 1 127 ? -1.362  -13.080 234.887 1.00 14.63  ? 127 ALA A CA  1 
ATOM 948  C C   . ALA A 1 127 ? -1.119  -14.586 234.737 1.00 16.07  ? 127 ALA A C   1 
ATOM 949  O O   . ALA A 1 127 ? -0.046  -14.986 234.279 1.00 14.48  ? 127 ALA A O   1 
ATOM 950  C CB  . ALA A 1 127 ? -1.111  -12.378 233.567 1.00 14.70  ? 127 ALA A CB  1 
ATOM 951  N N   . THR A 1 128 ? -2.056  -15.409 235.206 1.00 15.99  ? 128 THR A N   1 
ATOM 952  C CA  . THR A 1 128 ? -1.892  -16.862 235.164 1.00 17.90  ? 128 THR A CA  1 
ATOM 953  C C   . THR A 1 128 ? -2.840  -17.531 234.182 1.00 16.26  ? 128 THR A C   1 
ATOM 954  O O   . THR A 1 128 ? -4.012  -17.182 234.131 1.00 17.63  ? 128 THR A O   1 
ATOM 955  C CB  . THR A 1 128 ? -2.156  -17.473 236.552 1.00 16.40  ? 128 THR A CB  1 
ATOM 956  O OG1 . THR A 1 128 ? -1.286  -16.866 237.513 1.00 23.58  ? 128 THR A OG1 1 
ATOM 957  C CG2 . THR A 1 128 ? -1.882  -18.991 236.542 1.00 26.55  ? 128 THR A CG2 1 
ATOM 958  N N   . GLY A 1 129 ? -2.329  -18.495 233.410 1.00 16.34  ? 129 GLY A N   1 
ATOM 959  C CA  . GLY A 1 129 ? -3.172  -19.216 232.468 1.00 15.71  ? 129 GLY A CA  1 
ATOM 960  C C   . GLY A 1 129 ? -3.553  -20.596 232.990 1.00 17.09  ? 129 GLY A C   1 
ATOM 961  O O   . GLY A 1 129 ? -2.783  -21.220 233.732 1.00 20.14  ? 129 GLY A O   1 
ATOM 962  N N   . HIS A 1 130 ? -4.756  -21.055 232.649 1.00 18.00  ? 130 HIS A N   1 
ATOM 963  C CA  . HIS A 1 130 ? -5.258  -22.370 233.071 1.00 14.77  ? 130 HIS A CA  1 
ATOM 964  C C   . HIS A 1 130 ? -5.813  -23.103 231.857 1.00 15.52  ? 130 HIS A C   1 
ATOM 965  O O   . HIS A 1 130 ? -6.380  -22.471 230.956 1.00 15.65  ? 130 HIS A O   1 
ATOM 966  C CB  . HIS A 1 130 ? -6.380  -22.212 234.088 1.00 15.93  ? 130 HIS A CB  1 
ATOM 967  C CG  . HIS A 1 130 ? -6.009  -21.375 235.270 1.00 18.17  ? 130 HIS A CG  1 
ATOM 968  N ND1 . HIS A 1 130 ? -5.653  -21.920 236.487 1.00 25.44  ? 130 HIS A ND1 1 
ATOM 969  C CD2 . HIS A 1 130 ? -5.921  -20.031 235.417 1.00 13.17  ? 130 HIS A CD2 1 
ATOM 970  C CE1 . HIS A 1 130 ? -5.358  -20.947 237.330 1.00 20.82  ? 130 HIS A CE1 1 
ATOM 971  N NE2 . HIS A 1 130 ? -5.513  -19.793 236.704 1.00 22.14  ? 130 HIS A NE2 1 
ATOM 972  N N   . VAL A 1 131 ? -5.655  -24.426 231.829 1.00 15.94  ? 131 VAL A N   1 
ATOM 973  C CA  . VAL A 1 131 ? -6.149  -25.234 230.714 1.00 17.04  ? 131 VAL A CA  1 
ATOM 974  C C   . VAL A 1 131 ? -7.122  -26.290 231.208 1.00 17.05  ? 131 VAL A C   1 
ATOM 975  O O   . VAL A 1 131 ? -6.949  -26.856 232.290 1.00 17.32  ? 131 VAL A O   1 
ATOM 976  C CB  . VAL A 1 131 ? -5.018  -25.935 229.933 1.00 19.48  ? 131 VAL A CB  1 
ATOM 977  C CG1 . VAL A 1 131 ? -4.175  -24.913 229.224 1.00 23.88  ? 131 VAL A CG1 1 
ATOM 978  C CG2 . VAL A 1 131 ? -4.168  -26.795 230.874 1.00 17.10  ? 131 VAL A CG2 1 
ATOM 979  N N   . TYR A 1 132 ? -8.130  -26.568 230.391 1.00 15.41  ? 132 TYR A N   1 
ATOM 980  C CA  . TYR A 1 132 ? -9.152  -27.537 230.739 1.00 13.93  ? 132 TYR A CA  1 
ATOM 981  C C   . TYR A 1 132 ? -8.770  -28.948 230.320 1.00 16.98  ? 132 TYR A C   1 
ATOM 982  O O   . TYR A 1 132 ? -7.961  -29.150 229.409 1.00 17.99  ? 132 TYR A O   1 
ATOM 983  C CB  . TYR A 1 132 ? -10.465 -27.173 230.043 1.00 10.25  ? 132 TYR A CB  1 
ATOM 984  C CG  . TYR A 1 132 ? -11.199 -25.984 230.623 1.00 14.81  ? 132 TYR A CG  1 
ATOM 985  C CD1 . TYR A 1 132 ? -11.812 -26.066 231.872 1.00 16.07  ? 132 TYR A CD1 1 
ATOM 986  C CD2 . TYR A 1 132 ? -11.327 -24.789 229.899 1.00 9.49   ? 132 TYR A CD2 1 
ATOM 987  C CE1 . TYR A 1 132 ? -12.540 -24.986 232.389 1.00 16.11  ? 132 TYR A CE1 1 
ATOM 988  C CE2 . TYR A 1 132 ? -12.054 -23.709 230.405 1.00 13.66  ? 132 TYR A CE2 1 
ATOM 989  C CZ  . TYR A 1 132 ? -12.657 -23.816 231.653 1.00 18.73  ? 132 TYR A CZ  1 
ATOM 990  O OH  . TYR A 1 132 ? -13.379 -22.760 232.174 1.00 19.60  ? 132 TYR A OH  1 
ATOM 991  N N   . ASP A 1 133 ? -9.332  -29.912 231.029 1.00 14.09  ? 133 ASP A N   1 
ATOM 992  C CA  . ASP A 1 133 ? -9.151  -31.308 230.732 1.00 14.10  ? 133 ASP A CA  1 
ATOM 993  C C   . ASP A 1 133 ? -10.599 -31.731 230.396 1.00 15.75  ? 133 ASP A C   1 
ATOM 994  O O   . ASP A 1 133 ? -11.475 -31.686 231.261 1.00 15.80  ? 133 ASP A O   1 
ATOM 995  C CB  . ASP A 1 133 ? -8.643  -32.033 231.972 1.00 13.10  ? 133 ASP A CB  1 
ATOM 996  C CG  . ASP A 1 133 ? -8.460  -33.529 231.753 1.00 25.95  ? 133 ASP A CG  1 
ATOM 997  O OD1 . ASP A 1 133 ? -9.115  -34.113 230.870 1.00 21.15  ? 133 ASP A OD1 1 
ATOM 998  O OD2 . ASP A 1 133 ? -7.668  -34.143 232.486 1.00 25.20  ? 133 ASP A OD2 1 
ATOM 999  N N   . ALA A 1 134 ? -10.847 -32.117 229.146 1.00 16.07  ? 134 ALA A N   1 
ATOM 1000 C CA  . ALA A 1 134 ? -12.181 -32.525 228.688 1.00 18.96  ? 134 ALA A CA  1 
ATOM 1001 C C   . ALA A 1 134 ? -12.784 -33.615 229.550 1.00 19.82  ? 134 ALA A C   1 
ATOM 1002 O O   . ALA A 1 134 ? -13.991 -33.743 229.649 1.00 21.37  ? 134 ALA A O   1 
ATOM 1003 C CB  . ALA A 1 134 ? -12.125 -32.985 227.250 1.00 19.66  ? 134 ALA A CB  1 
ATOM 1004 N N   . ASN A 1 135 ? -11.930 -34.387 230.197 1.00 20.54  ? 135 ASN A N   1 
ATOM 1005 C CA  . ASN A 1 135 ? -12.390 -35.447 231.062 1.00 20.57  ? 135 ASN A CA  1 
ATOM 1006 C C   . ASN A 1 135 ? -12.773 -35.017 232.456 1.00 21.18  ? 135 ASN A C   1 
ATOM 1007 O O   . ASN A 1 135 ? -13.358 -35.799 233.205 1.00 23.67  ? 135 ASN A O   1 
ATOM 1008 C CB  . ASN A 1 135 ? -11.355 -36.553 231.131 1.00 25.88  ? 135 ASN A CB  1 
ATOM 1009 C CG  . ASN A 1 135 ? -11.483 -37.496 229.968 1.00 36.92  ? 135 ASN A CG  1 
ATOM 1010 O OD1 . ASN A 1 135 ? -12.305 -38.421 229.998 1.00 48.07  ? 135 ASN A OD1 1 
ATOM 1011 N ND2 . ASN A 1 135 ? -10.728 -37.233 228.900 1.00 33.03  ? 135 ASN A ND2 1 
ATOM 1012 N N   . LYS A 1 136 ? -12.496 -33.772 232.804 1.00 18.28  ? 136 LYS A N   1 
ATOM 1013 C CA  . LYS A 1 136 ? -12.825 -33.284 234.129 1.00 17.31  ? 136 LYS A CA  1 
ATOM 1014 C C   . LYS A 1 136 ? -13.825 -32.132 234.109 1.00 17.70  ? 136 LYS A C   1 
ATOM 1015 O O   . LYS A 1 136 ? -14.307 -31.706 235.164 1.00 16.49  ? 136 LYS A O   1 
ATOM 1016 C CB  . LYS A 1 136 ? -11.550 -32.866 234.851 1.00 17.06  ? 136 LYS A CB  1 
ATOM 1017 C CG  . LYS A 1 136 ? -10.678 -34.038 235.176 1.00 23.24  ? 136 LYS A CG  1 
ATOM 1018 C CD  . LYS A 1 136 ? -9.416  -33.597 235.834 1.00 32.12  ? 136 LYS A CD  1 
ATOM 1019 C CE  . LYS A 1 136 ? -8.551  -34.785 236.201 1.00 38.61  ? 136 LYS A CE  1 
ATOM 1020 N NZ  . LYS A 1 136 ? -7.269  -34.320 236.812 1.00 44.17  ? 136 LYS A NZ  1 
ATOM 1021 N N   . ILE A 1 137 ? -14.138 -31.636 232.916 1.00 15.27  ? 137 ILE A N   1 
ATOM 1022 C CA  . ILE A 1 137 ? -15.058 -30.522 232.788 1.00 17.36  ? 137 ILE A CA  1 
ATOM 1023 C C   . ILE A 1 137 ? -16.494 -30.986 233.127 1.00 18.68  ? 137 ILE A C   1 
ATOM 1024 O O   . ILE A 1 137 ? -16.873 -32.110 232.822 1.00 20.44  ? 137 ILE A O   1 
ATOM 1025 C CB  . ILE A 1 137 ? -14.928 -29.881 231.390 1.00 16.43  ? 137 ILE A CB  1 
ATOM 1026 C CG1 . ILE A 1 137 ? -15.565 -28.504 231.396 1.00 21.99  ? 137 ILE A CG1 1 
ATOM 1027 C CG2 . ILE A 1 137 ? -15.590 -30.749 230.323 1.00 18.74  ? 137 ILE A CG2 1 
ATOM 1028 C CD1 . ILE A 1 137 ? -15.065 -27.634 230.298 1.00 22.05  ? 137 ILE A CD1 1 
ATOM 1029 N N   . VAL A 1 138 ? -17.262 -30.139 233.804 1.00 17.18  ? 138 VAL A N   1 
ATOM 1030 C CA  . VAL A 1 138 ? -18.620 -30.469 234.233 1.00 16.08  ? 138 VAL A CA  1 
ATOM 1031 C C   . VAL A 1 138 ? -19.638 -29.541 233.578 1.00 16.49  ? 138 VAL A C   1 
ATOM 1032 O O   . VAL A 1 138 ? -19.413 -28.330 233.500 1.00 16.10  ? 138 VAL A O   1 
ATOM 1033 C CB  . VAL A 1 138 ? -18.755 -30.284 235.767 1.00 15.91  ? 138 VAL A CB  1 
ATOM 1034 C CG1 . VAL A 1 138 ? -20.166 -30.596 236.236 1.00 16.55  ? 138 VAL A CG1 1 
ATOM 1035 C CG2 . VAL A 1 138 ? -17.776 -31.146 236.483 1.00 12.64  ? 138 VAL A CG2 1 
ATOM 1036 N N   . TYR A 1 139 ? -20.737 -30.118 233.093 1.00 16.30  ? 139 TYR A N   1 
ATOM 1037 C CA  . TYR A 1 139 ? -21.836 -29.368 232.483 1.00 13.72  ? 139 TYR A CA  1 
ATOM 1038 C C   . TYR A 1 139 ? -23.037 -29.574 233.400 1.00 16.15  ? 139 TYR A C   1 
ATOM 1039 O O   . TYR A 1 139 ? -23.418 -30.713 233.678 1.00 17.93  ? 139 TYR A O   1 
ATOM 1040 C CB  . TYR A 1 139 ? -22.194 -29.928 231.111 1.00 13.55  ? 139 TYR A CB  1 
ATOM 1041 C CG  . TYR A 1 139 ? -21.276 -29.493 229.993 1.00 21.44  ? 139 TYR A CG  1 
ATOM 1042 C CD1 . TYR A 1 139 ? -19.932 -29.883 229.964 1.00 20.04  ? 139 TYR A CD1 1 
ATOM 1043 C CD2 . TYR A 1 139 ? -21.757 -28.711 228.945 1.00 19.83  ? 139 TYR A CD2 1 
ATOM 1044 C CE1 . TYR A 1 139 ? -19.091 -29.497 228.908 1.00 19.90  ? 139 TYR A CE1 1 
ATOM 1045 C CE2 . TYR A 1 139 ? -20.932 -28.329 227.889 1.00 24.14  ? 139 TYR A CE2 1 
ATOM 1046 C CZ  . TYR A 1 139 ? -19.602 -28.721 227.872 1.00 22.13  ? 139 TYR A CZ  1 
ATOM 1047 O OH  . TYR A 1 139 ? -18.793 -28.327 226.824 1.00 25.33  ? 139 TYR A OH  1 
ATOM 1048 N N   . THR A 1 140 ? -23.616 -28.481 233.873 1.00 15.49  ? 140 THR A N   1 
ATOM 1049 C CA  . THR A 1 140 ? -24.768 -28.535 234.772 1.00 15.76  ? 140 THR A CA  1 
ATOM 1050 C C   . THR A 1 140 ? -26.036 -28.122 234.035 1.00 16.89  ? 140 THR A C   1 
ATOM 1051 O O   . THR A 1 140 ? -26.087 -27.061 233.394 1.00 16.97  ? 140 THR A O   1 
ATOM 1052 C CB  . THR A 1 140 ? -24.549 -27.630 235.990 1.00 14.36  ? 140 THR A CB  1 
ATOM 1053 O OG1 . THR A 1 140 ? -23.410 -28.115 236.718 1.00 18.67  ? 140 THR A OG1 1 
ATOM 1054 C CG2 . THR A 1 140 ? -25.767 -27.631 236.900 1.00 17.39  ? 140 THR A CG2 1 
ATOM 1055 N N   . VAL A 1 141 ? -27.043 -28.984 234.101 1.00 17.49  ? 141 VAL A N   1 
ATOM 1056 C CA  . VAL A 1 141 ? -28.335 -28.758 233.445 1.00 18.20  ? 141 VAL A CA  1 
ATOM 1057 C C   . VAL A 1 141 ? -29.470 -28.712 234.481 1.00 19.58  ? 141 VAL A C   1 
ATOM 1058 O O   . VAL A 1 141 ? -29.489 -29.497 235.441 1.00 16.84  ? 141 VAL A O   1 
ATOM 1059 C CB  . VAL A 1 141 ? -28.616 -29.853 232.398 1.00 16.70  ? 141 VAL A CB  1 
ATOM 1060 C CG1 . VAL A 1 141 ? -29.986 -29.681 231.791 1.00 16.62  ? 141 VAL A CG1 1 
ATOM 1061 C CG2 . VAL A 1 141 ? -27.549 -29.806 231.309 1.00 12.04  ? 141 VAL A CG2 1 
ATOM 1062 N N   . LYS A 1 142 ? -30.344 -27.713 234.350 1.00 17.58  ? 142 LYS A N   1 
ATOM 1063 C CA  . LYS A 1 142 ? -31.467 -27.573 235.273 1.00 17.37  ? 142 LYS A CA  1 
ATOM 1064 C C   . LYS A 1 142 ? -32.794 -27.838 234.574 1.00 16.10  ? 142 LYS A C   1 
ATOM 1065 O O   . LYS A 1 142 ? -32.942 -27.579 233.376 1.00 18.66  ? 142 LYS A O   1 
ATOM 1066 C CB  . LYS A 1 142 ? -31.447 -26.217 235.985 1.00 15.62  ? 142 LYS A CB  1 
ATOM 1067 C CG  . LYS A 1 142 ? -30.314 -26.122 236.990 1.00 15.90  ? 142 LYS A CG  1 
ATOM 1068 C CD  . LYS A 1 142 ? -30.366 -24.835 237.727 1.00 27.32  ? 142 LYS A CD  1 
ATOM 1069 C CE  . LYS A 1 142 ? -29.117 -24.615 238.564 1.00 28.82  ? 142 LYS A CE  1 
ATOM 1070 N NZ  . LYS A 1 142 ? -29.081 -25.421 239.791 1.00 41.23  ? 142 LYS A NZ  1 
ATOM 1071 N N   . VAL A 1 143 ? -33.714 -28.451 235.312 1.00 17.35  ? 143 VAL A N   1 
ATOM 1072 C CA  . VAL A 1 143 ? -35.043 -28.799 234.810 1.00 17.23  ? 143 VAL A CA  1 
ATOM 1073 C C   . VAL A 1 143 ? -36.067 -28.301 235.822 1.00 18.08  ? 143 VAL A C   1 
ATOM 1074 O O   . VAL A 1 143 ? -35.876 -28.440 237.036 1.00 17.54  ? 143 VAL A O   1 
ATOM 1075 C CB  . VAL A 1 143 ? -35.206 -30.323 234.648 1.00 21.94  ? 143 VAL A CB  1 
ATOM 1076 C CG1 . VAL A 1 143 ? -36.559 -30.646 234.056 1.00 21.22  ? 143 VAL A CG1 1 
ATOM 1077 C CG2 . VAL A 1 143 ? -34.109 -30.873 233.752 1.00 17.36  ? 143 VAL A CG2 1 
ATOM 1078 N N   . GLU A 1 144 ? -37.154 -27.727 235.319 1.00 17.52  ? 144 GLU A N   1 
ATOM 1079 C CA  . GLU A 1 144 ? -38.207 -27.178 236.165 1.00 18.56  ? 144 GLU A CA  1 
ATOM 1080 C C   . GLU A 1 144 ? -39.557 -27.498 235.530 1.00 19.76  ? 144 GLU A C   1 
ATOM 1081 O O   . GLU A 1 144 ? -39.781 -27.234 234.342 1.00 18.41  ? 144 GLU A O   1 
ATOM 1082 C CB  . GLU A 1 144 ? -38.023 -25.672 236.245 1.00 21.15  ? 144 GLU A CB  1 
ATOM 1083 C CG  . GLU A 1 144 ? -39.009 -24.967 237.087 1.00 24.11  ? 144 GLU A CG  1 
ATOM 1084 C CD  . GLU A 1 144 ? -38.744 -23.497 237.118 1.00 29.75  ? 144 GLU A CD  1 
ATOM 1085 O OE1 . GLU A 1 144 ? -37.711 -23.094 237.690 1.00 23.68  ? 144 GLU A OE1 1 
ATOM 1086 O OE2 . GLU A 1 144 ? -39.569 -22.741 236.568 1.00 21.30  ? 144 GLU A OE2 1 
ATOM 1087 N N   . PRO A 1 145 ? -40.464 -28.115 236.298 1.00 21.42  ? 145 PRO A N   1 
ATOM 1088 C CA  . PRO A 1 145 ? -41.767 -28.435 235.714 1.00 22.62  ? 145 PRO A CA  1 
ATOM 1089 C C   . PRO A 1 145 ? -42.693 -27.204 235.727 1.00 22.71  ? 145 PRO A C   1 
ATOM 1090 O O   . PRO A 1 145 ? -42.492 -26.293 236.547 1.00 19.92  ? 145 PRO A O   1 
ATOM 1091 C CB  . PRO A 1 145 ? -42.277 -29.531 236.652 1.00 21.12  ? 145 PRO A CB  1 
ATOM 1092 C CG  . PRO A 1 145 ? -41.771 -29.080 237.985 1.00 22.35  ? 145 PRO A CG  1 
ATOM 1093 C CD  . PRO A 1 145 ? -40.363 -28.603 237.689 1.00 22.32  ? 145 PRO A CD  1 
ATOM 1094 N N   . HIS A 1 146 ? -43.643 -27.145 234.788 1.00 21.28  ? 146 HIS A N   1 
ATOM 1095 C CA  . HIS A 1 146 ? -44.633 -26.052 234.744 1.00 24.01  ? 146 HIS A CA  1 
ATOM 1096 C C   . HIS A 1 146 ? -45.730 -26.439 235.736 1.00 22.14  ? 146 HIS A C   1 
ATOM 1097 O O   . HIS A 1 146 ? -46.562 -27.303 235.454 1.00 24.74  ? 146 HIS A O   1 
ATOM 1098 C CB  . HIS A 1 146 ? -45.245 -25.908 233.349 1.00 21.53  ? 146 HIS A CB  1 
ATOM 1099 C CG  . HIS A 1 146 ? -44.350 -25.227 232.366 1.00 27.17  ? 146 HIS A CG  1 
ATOM 1100 N ND1 . HIS A 1 146 ? -44.811 -24.285 231.471 1.00 27.10  ? 146 HIS A ND1 1 
ATOM 1101 C CD2 . HIS A 1 146 ? -43.027 -25.360 232.123 1.00 23.07  ? 146 HIS A CD2 1 
ATOM 1102 C CE1 . HIS A 1 146 ? -43.812 -23.869 230.716 1.00 25.40  ? 146 HIS A CE1 1 
ATOM 1103 N NE2 . HIS A 1 146 ? -42.717 -24.505 231.091 1.00 24.35  ? 146 HIS A NE2 1 
ATOM 1104 N N   . THR A 1 147 ? -45.727 -25.812 236.900 1.00 21.19  ? 147 THR A N   1 
ATOM 1105 C CA  . THR A 1 147 ? -46.690 -26.148 237.930 1.00 22.67  ? 147 THR A CA  1 
ATOM 1106 C C   . THR A 1 147 ? -47.850 -25.159 238.083 1.00 24.68  ? 147 THR A C   1 
ATOM 1107 O O   . THR A 1 147 ? -48.650 -25.284 239.014 1.00 25.91  ? 147 THR A O   1 
ATOM 1108 C CB  . THR A 1 147 ? -45.977 -26.232 239.274 1.00 25.52  ? 147 THR A CB  1 
ATOM 1109 O OG1 . THR A 1 147 ? -45.392 -24.958 239.567 1.00 19.00  ? 147 THR A OG1 1 
ATOM 1110 C CG2 . THR A 1 147 ? -44.875 -27.286 239.233 1.00 24.73  ? 147 THR A CG2 1 
ATOM 1111 N N   . GLY A 1 148 ? -47.951 -24.181 237.186 1.00 22.34  ? 148 GLY A N   1 
ATOM 1112 C CA  . GLY A 1 148 ? -49.009 -23.196 237.308 1.00 19.96  ? 148 GLY A CA  1 
ATOM 1113 C C   . GLY A 1 148 ? -48.694 -22.200 238.417 1.00 22.34  ? 148 GLY A C   1 
ATOM 1114 O O   . GLY A 1 148 ? -49.588 -21.493 238.898 1.00 20.14  ? 148 GLY A O   1 
ATOM 1115 N N   . ASP A 1 149 ? -47.440 -22.172 238.875 1.00 20.90  ? 149 ASP A N   1 
ATOM 1116 C CA  . ASP A 1 149 ? -47.041 -21.208 239.915 1.00 22.67  ? 149 ASP A CA  1 
ATOM 1117 C C   . ASP A 1 149 ? -45.983 -20.309 239.316 1.00 20.20  ? 149 ASP A C   1 
ATOM 1118 O O   . ASP A 1 149 ? -45.013 -20.797 238.740 1.00 20.11  ? 149 ASP A O   1 
ATOM 1119 C CB  . ASP A 1 149 ? -46.408 -21.885 241.130 1.00 24.02  ? 149 ASP A CB  1 
ATOM 1120 C CG  . ASP A 1 149 ? -47.345 -22.823 241.829 1.00 31.30  ? 149 ASP A CG  1 
ATOM 1121 O OD1 . ASP A 1 149 ? -48.290 -22.329 242.471 1.00 28.78  ? 149 ASP A OD1 1 
ATOM 1122 O OD2 . ASP A 1 149 ? -47.124 -24.051 241.740 1.00 35.20  ? 149 ASP A OD2 1 
ATOM 1123 N N   . TYR A 1 150 ? -46.164 -19.004 239.448 1.00 18.43  ? 150 TYR A N   1 
ATOM 1124 C CA  . TYR A 1 150 ? -45.183 -18.082 238.932 1.00 17.39  ? 150 TYR A CA  1 
ATOM 1125 C C   . TYR A 1 150 ? -44.195 -17.712 240.039 1.00 20.16  ? 150 TYR A C   1 
ATOM 1126 O O   . TYR A 1 150 ? -44.578 -17.327 241.154 1.00 20.22  ? 150 TYR A O   1 
ATOM 1127 C CB  . TYR A 1 150 ? -45.838 -16.833 238.343 1.00 16.73  ? 150 TYR A CB  1 
ATOM 1128 C CG  . TYR A 1 150 ? -44.804 -15.965 237.671 1.00 19.62  ? 150 TYR A CG  1 
ATOM 1129 C CD1 . TYR A 1 150 ? -44.364 -16.258 236.376 1.00 17.46  ? 150 TYR A CD1 1 
ATOM 1130 C CD2 . TYR A 1 150 ? -44.145 -14.953 238.384 1.00 17.08  ? 150 TYR A CD2 1 
ATOM 1131 C CE1 . TYR A 1 150 ? -43.286 -15.587 235.821 1.00 25.17  ? 150 TYR A CE1 1 
ATOM 1132 C CE2 . TYR A 1 150 ? -43.068 -14.277 237.837 1.00 19.00  ? 150 TYR A CE2 1 
ATOM 1133 C CZ  . TYR A 1 150 ? -42.637 -14.606 236.568 1.00 24.61  ? 150 TYR A CZ  1 
ATOM 1134 O OH  . TYR A 1 150 ? -41.506 -14.009 236.091 1.00 33.00  ? 150 TYR A OH  1 
ATOM 1135 N N   . VAL A 1 151 ? -42.917 -17.824 239.704 1.00 19.08  ? 151 VAL A N   1 
ATOM 1136 C CA  . VAL A 1 151 ? -41.821 -17.536 240.615 1.00 20.29  ? 151 VAL A CA  1 
ATOM 1137 C C   . VAL A 1 151 ? -40.875 -16.541 239.932 1.00 19.98  ? 151 VAL A C   1 
ATOM 1138 O O   . VAL A 1 151 ? -40.495 -16.724 238.774 1.00 20.00  ? 151 VAL A O   1 
ATOM 1139 C CB  . VAL A 1 151 ? -41.057 -18.846 240.950 1.00 24.39  ? 151 VAL A CB  1 
ATOM 1140 C CG1 . VAL A 1 151 ? -39.801 -18.559 241.766 1.00 24.13  ? 151 VAL A CG1 1 
ATOM 1141 C CG2 . VAL A 1 151 ? -41.979 -19.790 241.718 1.00 23.62  ? 151 VAL A CG2 1 
ATOM 1142 N N   . ALA A 1 152 ? -40.539 -15.467 240.633 1.00 17.47  ? 152 ALA A N   1 
ATOM 1143 C CA  . ALA A 1 152 ? -39.646 -14.452 240.100 1.00 20.48  ? 152 ALA A CA  1 
ATOM 1144 C C   . ALA A 1 152 ? -38.210 -14.979 240.073 1.00 23.33  ? 152 ALA A C   1 
ATOM 1145 O O   . ALA A 1 152 ? -37.900 -15.999 240.704 1.00 23.61  ? 152 ALA A O   1 
ATOM 1146 C CB  . ALA A 1 152 ? -39.740 -13.184 240.938 1.00 18.76  ? 152 ALA A CB  1 
ATOM 1147 N N   . ALA A 1 153 ? -37.346 -14.280 239.342 1.00 23.26  ? 153 ALA A N   1 
ATOM 1148 C CA  . ALA A 1 153 ? -35.948 -14.664 239.190 1.00 25.58  ? 153 ALA A CA  1 
ATOM 1149 C C   . ALA A 1 153 ? -35.153 -14.729 240.509 1.00 28.16  ? 153 ALA A C   1 
ATOM 1150 O O   . ALA A 1 153 ? -34.274 -15.579 240.657 1.00 29.90  ? 153 ALA A O   1 
ATOM 1151 C CB  . ALA A 1 153 ? -35.251 -13.745 238.157 1.00 21.57  ? 153 ALA A CB  1 
ATOM 1152 N N   . ASN A 1 154 ? -35.462 -13.859 241.467 1.00 29.37  ? 154 ASN A N   1 
ATOM 1153 C CA  . ASN A 1 154 ? -34.752 -13.877 242.741 1.00 31.21  ? 154 ASN A CA  1 
ATOM 1154 C C   . ASN A 1 154 ? -35.350 -14.896 243.694 1.00 34.97  ? 154 ASN A C   1 
ATOM 1155 O O   . ASN A 1 154 ? -34.899 -15.012 244.822 1.00 37.66  ? 154 ASN A O   1 
ATOM 1156 C CB  . ASN A 1 154 ? -34.696 -12.475 243.398 1.00 29.85  ? 154 ASN A CB  1 
ATOM 1157 C CG  . ASN A 1 154 ? -36.025 -12.035 244.025 1.00 32.26  ? 154 ASN A CG  1 
ATOM 1158 O OD1 . ASN A 1 154 ? -37.091 -12.401 243.534 1.00 37.58  ? 154 ASN A OD1 1 
ATOM 1159 N ND2 . ASN A 1 154 ? -35.952 -11.225 245.090 1.00 33.05  ? 154 ASN A ND2 1 
ATOM 1160 N N   . GLU A 1 155 ? -36.354 -15.647 243.244 1.00 38.12  ? 155 GLU A N   1 
ATOM 1161 C CA  . GLU A 1 155 ? -37.004 -16.645 244.094 1.00 39.45  ? 155 GLU A CA  1 
ATOM 1162 C C   . GLU A 1 155 ? -36.647 -18.051 243.616 1.00 40.50  ? 155 GLU A C   1 
ATOM 1163 O O   . GLU A 1 155 ? -36.218 -18.246 242.478 1.00 40.13  ? 155 GLU A O   1 
ATOM 1164 C CB  . GLU A 1 155 ? -38.524 -16.437 244.098 1.00 45.12  ? 155 GLU A CB  1 
ATOM 1165 C CG  . GLU A 1 155 ? -38.998 -15.121 244.754 1.00 50.77  ? 155 GLU A CG  1 
ATOM 1166 C CD  . GLU A 1 155 ? -40.432 -14.675 244.339 1.00 58.94  ? 155 GLU A CD  1 
ATOM 1167 O OE1 . GLU A 1 155 ? -41.215 -15.488 243.780 1.00 50.42  ? 155 GLU A OE1 1 
ATOM 1168 O OE2 . GLU A 1 155 ? -40.774 -13.484 244.572 1.00 58.12  ? 155 GLU A OE2 1 
ATOM 1169 N N   . THR A 1 156 ? -36.824 -19.034 244.489 1.00 42.33  ? 156 THR A N   1 
ATOM 1170 C CA  . THR A 1 156 ? -36.494 -20.423 244.148 1.00 44.00  ? 156 THR A CA  1 
ATOM 1171 C C   . THR A 1 156 ? -37.725 -21.310 243.961 1.00 38.73  ? 156 THR A C   1 
ATOM 1172 O O   . THR A 1 156 ? -38.609 -21.360 244.827 1.00 39.77  ? 156 THR A O   1 
ATOM 1173 C CB  . THR A 1 156 ? -35.534 -21.056 245.207 1.00 54.34  ? 156 THR A CB  1 
ATOM 1174 O OG1 . THR A 1 156 ? -36.050 -20.832 246.535 1.00 55.41  ? 156 THR A OG1 1 
ATOM 1175 C CG2 . THR A 1 156 ? -34.114 -20.457 245.077 1.00 52.70  ? 156 THR A CG2 1 
ATOM 1176 N N   . HIS A 1 157 ? -37.810 -21.945 242.793 1.00 35.05  ? 157 HIS A N   1 
ATOM 1177 C CA  . HIS A 1 157 ? -38.933 -22.829 242.469 1.00 32.42  ? 157 HIS A CA  1 
ATOM 1178 C C   . HIS A 1 157 ? -38.679 -24.182 243.133 1.00 32.29  ? 157 HIS A C   1 
ATOM 1179 O O   . HIS A 1 157 ? -37.747 -24.887 242.752 1.00 31.47  ? 157 HIS A O   1 
ATOM 1180 C CB  . HIS A 1 157 ? -39.048 -22.999 240.948 1.00 32.29  ? 157 HIS A CB  1 
ATOM 1181 C CG  . HIS A 1 157 ? -40.289 -23.714 240.511 1.00 27.71  ? 157 HIS A CG  1 
ATOM 1182 N ND1 . HIS A 1 157 ? -40.550 -25.025 240.844 1.00 31.12  ? 157 HIS A ND1 1 
ATOM 1183 C CD2 . HIS A 1 157 ? -41.357 -23.289 239.795 1.00 29.47  ? 157 HIS A CD2 1 
ATOM 1184 C CE1 . HIS A 1 157 ? -41.732 -25.375 240.364 1.00 31.40  ? 157 HIS A CE1 1 
ATOM 1185 N NE2 . HIS A 1 157 ? -42.241 -24.339 239.723 1.00 30.69  ? 157 HIS A NE2 1 
ATOM 1186 N N   . SER A 1 158 ? -39.544 -24.573 244.063 1.00 31.14  ? 158 SER A N   1 
ATOM 1187 C CA  . SER A 1 158 ? -39.369 -25.826 244.798 1.00 30.42  ? 158 SER A CA  1 
ATOM 1188 C C   . SER A 1 158 ? -39.262 -27.096 243.947 1.00 29.01  ? 158 SER A C   1 
ATOM 1189 O O   . SER A 1 158 ? -38.722 -28.102 244.405 1.00 30.97  ? 158 SER A O   1 
ATOM 1190 C CB  . SER A 1 158 ? -40.464 -25.983 245.860 1.00 29.50  ? 158 SER A CB  1 
ATOM 1191 O OG  . SER A 1 158 ? -41.751 -25.927 245.263 1.00 38.56  ? 158 SER A OG  1 
ATOM 1192 N N   . GLY A 1 159 ? -39.756 -27.042 242.714 1.00 24.89  ? 159 GLY A N   1 
ATOM 1193 C CA  . GLY A 1 159 ? -39.699 -28.207 241.847 1.00 23.79  ? 159 GLY A CA  1 
ATOM 1194 C C   . GLY A 1 159 ? -38.506 -28.302 240.915 1.00 23.46  ? 159 GLY A C   1 
ATOM 1195 O O   . GLY A 1 159 ? -38.423 -29.232 240.126 1.00 21.75  ? 159 GLY A O   1 
ATOM 1196 N N   . ARG A 1 160 ? -37.589 -27.345 240.995 1.00 22.76  ? 160 ARG A N   1 
ATOM 1197 C CA  . ARG A 1 160 ? -36.409 -27.331 240.127 1.00 24.39  ? 160 ARG A CA  1 
ATOM 1198 C C   . ARG A 1 160 ? -35.363 -28.391 240.529 1.00 24.26  ? 160 ARG A C   1 
ATOM 1199 O O   . ARG A 1 160 ? -35.008 -28.507 241.708 1.00 25.12  ? 160 ARG A O   1 
ATOM 1200 C CB  . ARG A 1 160 ? -35.776 -25.935 240.144 1.00 22.10  ? 160 ARG A CB  1 
ATOM 1201 C CG  . ARG A 1 160 ? -34.664 -25.729 239.130 1.00 23.40  ? 160 ARG A CG  1 
ATOM 1202 C CD  . ARG A 1 160 ? -34.147 -24.303 239.183 1.00 20.91  ? 160 ARG A CD  1 
ATOM 1203 N NE  . ARG A 1 160 ? -35.197 -23.329 238.886 1.00 21.97  ? 160 ARG A NE  1 
ATOM 1204 C CZ  . ARG A 1 160 ? -35.094 -22.021 239.107 1.00 23.31  ? 160 ARG A CZ  1 
ATOM 1205 N NH1 . ARG A 1 160 ? -33.981 -21.517 239.629 1.00 18.23  ? 160 ARG A NH1 1 
ATOM 1206 N NH2 . ARG A 1 160 ? -36.118 -21.216 238.823 1.00 23.22  ? 160 ARG A NH2 1 
ATOM 1207 N N   . LYS A 1 161 ? -34.879 -29.148 239.546 1.00 23.49  ? 161 LYS A N   1 
ATOM 1208 C CA  . LYS A 1 161 ? -33.878 -30.205 239.753 1.00 23.67  ? 161 LYS A CA  1 
ATOM 1209 C C   . LYS A 1 161 ? -32.579 -29.887 238.987 1.00 23.91  ? 161 LYS A C   1 
ATOM 1210 O O   . LYS A 1 161 ? -32.607 -29.207 237.951 1.00 20.96  ? 161 LYS A O   1 
ATOM 1211 C CB  . LYS A 1 161 ? -34.429 -31.549 239.261 1.00 26.10  ? 161 LYS A CB  1 
ATOM 1212 C CG  . LYS A 1 161 ? -35.663 -32.039 239.998 1.00 40.06  ? 161 LYS A CG  1 
ATOM 1213 C CD  . LYS A 1 161 ? -35.340 -32.454 241.410 1.00 44.00  ? 161 LYS A CD  1 
ATOM 1214 C CE  . LYS A 1 161 ? -36.585 -32.937 242.107 1.00 55.23  ? 161 LYS A CE  1 
ATOM 1215 N NZ  . LYS A 1 161 ? -36.280 -33.411 243.475 1.00 63.91  ? 161 LYS A NZ  1 
ATOM 1216 N N   . THR A 1 162 ? -31.454 -30.400 239.476 1.00 20.43  ? 162 THR A N   1 
ATOM 1217 C CA  . THR A 1 162 ? -30.166 -30.166 238.843 1.00 21.03  ? 162 THR A CA  1 
ATOM 1218 C C   . THR A 1 162 ? -29.483 -31.480 238.457 1.00 21.41  ? 162 THR A C   1 
ATOM 1219 O O   . THR A 1 162 ? -29.544 -32.459 239.204 1.00 22.58  ? 162 THR A O   1 
ATOM 1220 C CB  . THR A 1 162 ? -29.253 -29.373 239.784 1.00 22.05  ? 162 THR A CB  1 
ATOM 1221 O OG1 . THR A 1 162 ? -29.888 -28.139 240.118 1.00 24.26  ? 162 THR A OG1 1 
ATOM 1222 C CG2 . THR A 1 162 ? -27.917 -29.073 239.125 1.00 23.07  ? 162 THR A CG2 1 
ATOM 1223 N N   . ALA A 1 163 ? -28.883 -31.518 237.272 1.00 18.92  ? 163 ALA A N   1 
ATOM 1224 C CA  . ALA A 1 163 ? -28.173 -32.703 236.801 1.00 20.17  ? 163 ALA A CA  1 
ATOM 1225 C C   . ALA A 1 163 ? -26.766 -32.294 236.331 1.00 21.29  ? 163 ALA A C   1 
ATOM 1226 O O   . ALA A 1 163 ? -26.612 -31.299 235.620 1.00 21.32  ? 163 ALA A O   1 
ATOM 1227 C CB  . ALA A 1 163 ? -28.937 -33.359 235.664 1.00 16.43  ? 163 ALA A CB  1 
ATOM 1228 N N   . SER A 1 164 ? -25.745 -33.034 236.756 1.00 19.79  ? 164 SER A N   1 
ATOM 1229 C CA  . SER A 1 164 ? -24.375 -32.742 236.358 1.00 20.33  ? 164 SER A CA  1 
ATOM 1230 C C   . SER A 1 164 ? -23.871 -33.826 235.441 1.00 18.97  ? 164 SER A C   1 
ATOM 1231 O O   . SER A 1 164 ? -24.189 -34.993 235.621 1.00 20.45  ? 164 SER A O   1 
ATOM 1232 C CB  . SER A 1 164 ? -23.468 -32.610 237.570 1.00 23.89  ? 164 SER A CB  1 
ATOM 1233 O OG  . SER A 1 164 ? -23.565 -31.295 238.096 1.00 38.10  ? 164 SER A OG  1 
ATOM 1234 N N   . PHE A 1 165 ? -23.117 -33.424 234.430 1.00 17.55  ? 165 PHE A N   1 
ATOM 1235 C CA  . PHE A 1 165 ? -22.589 -34.353 233.452 1.00 17.19  ? 165 PHE A CA  1 
ATOM 1236 C C   . PHE A 1 165 ? -21.097 -34.176 233.245 1.00 16.74  ? 165 PHE A C   1 
ATOM 1237 O O   . PHE A 1 165 ? -20.597 -33.051 233.306 1.00 14.40  ? 165 PHE A O   1 
ATOM 1238 C CB  . PHE A 1 165 ? -23.276 -34.134 232.110 1.00 15.43  ? 165 PHE A CB  1 
ATOM 1239 C CG  . PHE A 1 165 ? -24.751 -34.315 232.161 1.00 21.74  ? 165 PHE A CG  1 
ATOM 1240 C CD1 . PHE A 1 165 ? -25.311 -35.584 232.005 1.00 25.52  ? 165 PHE A CD1 1 
ATOM 1241 C CD2 . PHE A 1 165 ? -25.590 -33.230 232.397 1.00 17.98  ? 165 PHE A CD2 1 
ATOM 1242 C CE1 . PHE A 1 165 ? -26.697 -35.772 232.086 1.00 24.23  ? 165 PHE A CE1 1 
ATOM 1243 C CE2 . PHE A 1 165 ? -26.975 -33.408 232.481 1.00 19.03  ? 165 PHE A CE2 1 
ATOM 1244 C CZ  . PHE A 1 165 ? -27.529 -34.682 232.325 1.00 20.24  ? 165 PHE A CZ  1 
ATOM 1245 N N   . THR A 1 166 ? -20.402 -35.303 233.051 1.00 17.35  ? 166 THR A N   1 
ATOM 1246 C CA  . THR A 1 166 ? -18.966 -35.361 232.743 1.00 16.04  ? 166 THR A CA  1 
ATOM 1247 C C   . THR A 1 166 ? -18.923 -36.373 231.588 1.00 18.55  ? 166 THR A C   1 
ATOM 1248 O O   . THR A 1 166 ? -19.910 -37.062 231.336 1.00 16.06  ? 166 THR A O   1 
ATOM 1249 C CB  . THR A 1 166 ? -18.112 -35.874 233.923 1.00 16.09  ? 166 THR A CB  1 
ATOM 1250 O OG1 . THR A 1 166 ? -18.599 -37.150 234.358 1.00 21.94  ? 166 THR A OG1 1 
ATOM 1251 C CG2 . THR A 1 166 ? -18.155 -34.896 235.091 1.00 19.61  ? 166 THR A CG2 1 
ATOM 1252 N N   . ILE A 1 167 ? -17.826 -36.437 230.852 1.00 19.67  ? 167 ILE A N   1 
ATOM 1253 C CA  . ILE A 1 167 ? -17.720 -37.371 229.745 1.00 22.79  ? 167 ILE A CA  1 
ATOM 1254 C C   . ILE A 1 167 ? -17.948 -38.823 230.184 1.00 22.52  ? 167 ILE A C   1 
ATOM 1255 O O   . ILE A 1 167 ? -18.517 -39.619 229.444 1.00 25.86  ? 167 ILE A O   1 
ATOM 1256 C CB  . ILE A 1 167 ? -16.337 -37.219 229.035 1.00 29.41  ? 167 ILE A CB  1 
ATOM 1257 C CG1 . ILE A 1 167 ? -16.450 -36.224 227.883 1.00 29.88  ? 167 ILE A CG1 1 
ATOM 1258 C CG2 . ILE A 1 167 ? -15.821 -38.551 228.507 1.00 35.71  ? 167 ILE A CG2 1 
ATOM 1259 C CD1 . ILE A 1 167 ? -15.184 -36.114 227.050 1.00 31.05  ? 167 ILE A CD1 1 
ATOM 1260 N N   . SER A 1 168 ? -17.530 -39.173 231.391 1.00 22.01  ? 168 SER A N   1 
ATOM 1261 C CA  . SER A 1 168 ? -17.702 -40.547 231.849 1.00 24.82  ? 168 SER A CA  1 
ATOM 1262 C C   . SER A 1 168 ? -19.066 -40.847 232.485 1.00 26.88  ? 168 SER A C   1 
ATOM 1263 O O   . SER A 1 168 ? -19.322 -41.991 232.878 1.00 28.90  ? 168 SER A O   1 
ATOM 1264 C CB  . SER A 1 168 ? -16.587 -40.919 232.826 1.00 28.46  ? 168 SER A CB  1 
ATOM 1265 O OG  . SER A 1 168 ? -16.640 -40.116 233.995 1.00 40.79  ? 168 SER A OG  1 
ATOM 1266 N N   . SER A 1 169 ? -19.932 -39.835 232.592 1.00 24.25  ? 169 SER A N   1 
ATOM 1267 C CA  . SER A 1 169 ? -21.257 -40.002 233.197 1.00 21.99  ? 169 SER A CA  1 
ATOM 1268 C C   . SER A 1 169 ? -22.236 -39.111 232.434 1.00 19.96  ? 169 SER A C   1 
ATOM 1269 O O   . SER A 1 169 ? -22.551 -37.995 232.847 1.00 21.75  ? 169 SER A O   1 
ATOM 1270 C CB  . SER A 1 169 ? -21.193 -39.624 234.676 1.00 21.51  ? 169 SER A CB  1 
ATOM 1271 O OG  . SER A 1 169 ? -22.400 -39.952 235.331 1.00 31.34  ? 169 SER A OG  1 
ATOM 1272 N N   . GLU A 1 170 ? -22.709 -39.624 231.309 1.00 18.58  ? 170 GLU A N   1 
ATOM 1273 C CA  . GLU A 1 170 ? -23.595 -38.894 230.415 1.00 23.07  ? 170 GLU A CA  1 
ATOM 1274 C C   . GLU A 1 170 ? -25.104 -38.996 230.611 1.00 23.76  ? 170 GLU A C   1 
ATOM 1275 O O   . GLU A 1 170 ? -25.860 -38.292 229.940 1.00 25.30  ? 170 GLU A O   1 
ATOM 1276 C CB  . GLU A 1 170 ? -23.300 -39.336 228.997 1.00 29.62  ? 170 GLU A CB  1 
ATOM 1277 C CG  . GLU A 1 170 ? -23.631 -40.818 228.782 1.00 36.59  ? 170 GLU A CG  1 
ATOM 1278 C CD  . GLU A 1 170 ? -23.174 -41.350 227.434 1.00 44.39  ? 170 GLU A CD  1 
ATOM 1279 O OE1 . GLU A 1 170 ? -22.388 -40.650 226.746 1.00 45.20  ? 170 GLU A OE1 1 
ATOM 1280 O OE2 . GLU A 1 170 ? -23.603 -42.474 227.072 1.00 45.95  ? 170 GLU A OE2 1 
ATOM 1281 N N   . LYS A 1 171 ? -25.558 -39.914 231.450 1.00 23.40  ? 171 LYS A N   1 
ATOM 1282 C CA  . LYS A 1 171 ? -26.988 -40.064 231.643 1.00 21.88  ? 171 LYS A CA  1 
ATOM 1283 C C   . LYS A 1 171 ? -27.410 -39.939 233.100 1.00 23.45  ? 171 LYS A C   1 
ATOM 1284 O O   . LYS A 1 171 ? -26.723 -40.436 234.004 1.00 23.00  ? 171 LYS A O   1 
ATOM 1285 C CB  . LYS A 1 171 ? -27.445 -41.396 231.061 1.00 23.34  ? 171 LYS A CB  1 
ATOM 1286 C CG  . LYS A 1 171 ? -28.947 -41.524 230.901 1.00 27.40  ? 171 LYS A CG  1 
ATOM 1287 C CD  . LYS A 1 171 ? -29.279 -42.796 230.161 1.00 35.13  ? 171 LYS A CD  1 
ATOM 1288 C CE  . LYS A 1 171 ? -30.775 -42.941 229.952 1.00 43.88  ? 171 LYS A CE  1 
ATOM 1289 N NZ  . LYS A 1 171 ? -31.138 -44.279 229.390 1.00 44.72  ? 171 LYS A NZ  1 
ATOM 1290 N N   . THR A 1 172 ? -28.510 -39.219 233.319 1.00 21.06  ? 172 THR A N   1 
ATOM 1291 C CA  . THR A 1 172 ? -29.079 -39.006 234.652 1.00 24.51  ? 172 THR A CA  1 
ATOM 1292 C C   . THR A 1 172 ? -30.607 -39.186 234.560 1.00 24.81  ? 172 THR A C   1 
ATOM 1293 O O   . THR A 1 172 ? -31.202 -38.862 233.529 1.00 22.44  ? 172 THR A O   1 
ATOM 1294 C CB  . THR A 1 172 ? -28.801 -37.561 235.175 1.00 28.55  ? 172 THR A CB  1 
ATOM 1295 O OG1 . THR A 1 172 ? -27.397 -37.374 235.393 1.00 40.10  ? 172 THR A OG1 1 
ATOM 1296 C CG2 . THR A 1 172 ? -29.515 -37.323 236.488 1.00 39.40  ? 172 THR A CG2 1 
ATOM 1297 N N   . ILE A 1 173 ? -31.212 -39.759 235.601 1.00 23.75  ? 173 ILE A N   1 
ATOM 1298 C CA  . ILE A 1 173 ? -32.664 -39.943 235.674 1.00 25.56  ? 173 ILE A CA  1 
ATOM 1299 C C   . ILE A 1 173 ? -33.077 -39.022 236.831 1.00 27.14  ? 173 ILE A C   1 
ATOM 1300 O O   . ILE A 1 173 ? -32.563 -39.178 237.945 1.00 26.82  ? 173 ILE A O   1 
ATOM 1301 C CB  . ILE A 1 173 ? -33.071 -41.384 236.105 1.00 29.29  ? 173 ILE A CB  1 
ATOM 1302 C CG1 . ILE A 1 173 ? -32.379 -42.459 235.258 1.00 29.24  ? 173 ILE A CG1 1 
ATOM 1303 C CG2 . ILE A 1 173 ? -34.586 -41.536 236.029 1.00 26.46  ? 173 ILE A CG2 1 
ATOM 1304 C CD1 . ILE A 1 173 ? -32.951 -42.631 233.898 1.00 28.26  ? 173 ILE A CD1 1 
ATOM 1305 N N   . LEU A 1 174 ? -33.940 -38.040 236.581 1.00 25.54  ? 174 LEU A N   1 
ATOM 1306 C CA  . LEU A 1 174 ? -34.380 -37.136 237.645 1.00 25.02  ? 174 LEU A CA  1 
ATOM 1307 C C   . LEU A 1 174 ? -35.835 -37.403 238.001 1.00 25.32  ? 174 LEU A C   1 
ATOM 1308 O O   . LEU A 1 174 ? -36.650 -37.709 237.132 1.00 26.50  ? 174 LEU A O   1 
ATOM 1309 C CB  . LEU A 1 174 ? -34.254 -35.670 237.209 1.00 27.49  ? 174 LEU A CB  1 
ATOM 1310 C CG  . LEU A 1 174 ? -32.884 -35.050 236.931 1.00 28.60  ? 174 LEU A CG  1 
ATOM 1311 C CD1 . LEU A 1 174 ? -33.068 -33.704 236.257 1.00 26.22  ? 174 LEU A CD1 1 
ATOM 1312 C CD2 . LEU A 1 174 ? -32.092 -34.905 238.218 1.00 29.64  ? 174 LEU A CD2 1 
ATOM 1313 N N   . THR A 1 175 ? -36.150 -37.327 239.284 1.00 23.34  ? 175 THR A N   1 
ATOM 1314 C CA  . THR A 1 175 ? -37.524 -37.510 239.725 1.00 26.03  ? 175 THR A CA  1 
ATOM 1315 C C   . THR A 1 175 ? -38.122 -36.101 239.883 1.00 24.57  ? 175 THR A C   1 
ATOM 1316 O O   . THR A 1 175 ? -37.694 -35.324 240.750 1.00 25.21  ? 175 THR A O   1 
ATOM 1317 C CB  . THR A 1 175 ? -37.601 -38.317 241.064 1.00 28.02  ? 175 THR A CB  1 
ATOM 1318 O OG1 . THR A 1 175 ? -37.214 -39.676 240.824 1.00 24.65  ? 175 THR A OG1 1 
ATOM 1319 C CG2 . THR A 1 175 ? -39.031 -38.332 241.613 1.00 25.55  ? 175 THR A CG2 1 
ATOM 1320 N N   . MET A 1 176 ? -39.047 -35.750 238.993 1.00 22.79  ? 176 MET A N   1 
ATOM 1321 C CA  . MET A 1 176 ? -39.688 -34.432 239.020 1.00 24.87  ? 176 MET A CA  1 
ATOM 1322 C C   . MET A 1 176 ? -40.909 -34.405 239.959 1.00 25.70  ? 176 MET A C   1 
ATOM 1323 O O   . MET A 1 176 ? -42.043 -34.204 239.516 1.00 24.21  ? 176 MET A O   1 
ATOM 1324 C CB  . MET A 1 176 ? -40.110 -34.023 237.605 1.00 23.28  ? 176 MET A CB  1 
ATOM 1325 C CG  . MET A 1 176 ? -38.958 -34.010 236.599 1.00 26.95  ? 176 MET A CG  1 
ATOM 1326 S SD  . MET A 1 176 ? -37.507 -33.074 237.180 1.00 27.45  ? 176 MET A SD  1 
ATOM 1327 C CE  . MET A 1 176 ? -38.196 -31.444 237.433 1.00 22.04  ? 176 MET A CE  1 
ATOM 1328 N N   . GLY A 1 177 ? -40.668 -34.611 241.254 1.00 26.14  ? 177 GLY A N   1 
ATOM 1329 C CA  . GLY A 1 177 ? -41.748 -34.626 242.234 1.00 28.77  ? 177 GLY A CA  1 
ATOM 1330 C C   . GLY A 1 177 ? -42.826 -35.633 241.866 1.00 31.25  ? 177 GLY A C   1 
ATOM 1331 O O   . GLY A 1 177 ? -42.528 -36.802 241.598 1.00 32.41  ? 177 GLY A O   1 
ATOM 1332 N N   . GLU A 1 178 ? -44.075 -35.187 241.796 1.00 30.56  ? 178 GLU A N   1 
ATOM 1333 C CA  . GLU A 1 178 ? -45.168 -36.081 241.435 1.00 32.47  ? 178 GLU A CA  1 
ATOM 1334 C C   . GLU A 1 178 ? -45.406 -36.207 239.930 1.00 29.86  ? 178 GLU A C   1 
ATOM 1335 O O   . GLU A 1 178 ? -46.274 -36.961 239.501 1.00 28.86  ? 178 GLU A O   1 
ATOM 1336 C CB  . GLU A 1 178 ? -46.448 -35.645 242.154 1.00 41.68  ? 178 GLU A CB  1 
ATOM 1337 C CG  . GLU A 1 178 ? -46.357 -35.716 243.695 1.00 58.70  ? 178 GLU A CG  1 
ATOM 1338 C CD  . GLU A 1 178 ? -47.434 -34.881 244.392 1.00 73.33  ? 178 GLU A CD  1 
ATOM 1339 O OE1 . GLU A 1 178 ? -47.339 -33.631 244.360 1.00 78.14  ? 178 GLU A OE1 1 
ATOM 1340 O OE2 . GLU A 1 178 ? -48.373 -35.473 244.978 1.00 79.01  ? 178 GLU A OE2 1 
ATOM 1341 N N   . TYR A 1 179 ? -44.611 -35.503 239.130 1.00 29.75  ? 179 TYR A N   1 
ATOM 1342 C CA  . TYR A 1 179 ? -44.742 -35.583 237.674 1.00 28.58  ? 179 TYR A CA  1 
ATOM 1343 C C   . TYR A 1 179 ? -44.068 -36.793 237.032 1.00 29.89  ? 179 TYR A C   1 
ATOM 1344 O O   . TYR A 1 179 ? -44.158 -36.994 235.815 1.00 32.56  ? 179 TYR A O   1 
ATOM 1345 C CB  . TYR A 1 179 ? -44.222 -34.293 237.030 1.00 27.17  ? 179 TYR A CB  1 
ATOM 1346 C CG  . TYR A 1 179 ? -44.996 -33.065 237.400 1.00 23.23  ? 179 TYR A CG  1 
ATOM 1347 C CD1 . TYR A 1 179 ? -46.141 -32.710 236.690 1.00 25.49  ? 179 TYR A CD1 1 
ATOM 1348 C CD2 . TYR A 1 179 ? -44.611 -32.270 238.487 1.00 21.56  ? 179 TYR A CD2 1 
ATOM 1349 C CE1 . TYR A 1 179 ? -46.899 -31.587 237.058 1.00 24.09  ? 179 TYR A CE1 1 
ATOM 1350 C CE2 . TYR A 1 179 ? -45.371 -31.147 238.860 1.00 26.52  ? 179 TYR A CE2 1 
ATOM 1351 C CZ  . TYR A 1 179 ? -46.514 -30.817 238.141 1.00 20.83  ? 179 TYR A CZ  1 
ATOM 1352 O OH  . TYR A 1 179 ? -47.282 -29.735 238.517 1.00 27.71  ? 179 TYR A OH  1 
ATOM 1353 N N   . GLY A 1 180 ? -43.356 -37.582 237.826 1.00 27.07  ? 180 GLY A N   1 
ATOM 1354 C CA  . GLY A 1 180 ? -42.681 -38.738 237.270 1.00 26.73  ? 180 GLY A CA  1 
ATOM 1355 C C   . GLY A 1 180 ? -41.191 -38.524 237.054 1.00 24.54  ? 180 GLY A C   1 
ATOM 1356 O O   . GLY A 1 180 ? -40.598 -37.550 237.530 1.00 23.02  ? 180 GLY A O   1 
ATOM 1357 N N   . ASP A 1 181 ? -40.574 -39.453 236.346 1.00 24.65  ? 181 ASP A N   1 
ATOM 1358 C CA  . ASP A 1 181 ? -39.144 -39.376 236.103 1.00 25.23  ? 181 ASP A CA  1 
ATOM 1359 C C   . ASP A 1 181 ? -38.845 -38.903 234.693 1.00 25.41  ? 181 ASP A C   1 
ATOM 1360 O O   . ASP A 1 181 ? -39.594 -39.206 233.770 1.00 26.69  ? 181 ASP A O   1 
ATOM 1361 C CB  . ASP A 1 181 ? -38.503 -40.751 236.323 1.00 22.52  ? 181 ASP A CB  1 
ATOM 1362 C CG  . ASP A 1 181 ? -38.352 -41.110 237.792 1.00 27.60  ? 181 ASP A CG  1 
ATOM 1363 O OD1 . ASP A 1 181 ? -38.704 -40.302 238.678 1.00 27.37  ? 181 ASP A OD1 1 
ATOM 1364 O OD2 . ASP A 1 181 ? -37.845 -42.211 238.067 1.00 33.21  ? 181 ASP A OD2 1 
ATOM 1365 N N   . VAL A 1 182 ? -37.771 -38.126 234.546 1.00 25.13  ? 182 VAL A N   1 
ATOM 1366 C CA  . VAL A 1 182 ? -37.334 -37.632 233.245 1.00 24.32  ? 182 VAL A CA  1 
ATOM 1367 C C   . VAL A 1 182 ? -35.865 -38.096 233.079 1.00 23.85  ? 182 VAL A C   1 
ATOM 1368 O O   . VAL A 1 182 ? -35.101 -38.119 234.051 1.00 22.61  ? 182 VAL A O   1 
ATOM 1369 C CB  . VAL A 1 182 ? -37.455 -36.062 233.131 1.00 26.14  ? 182 VAL A CB  1 
ATOM 1370 C CG1 . VAL A 1 182 ? -36.565 -35.374 234.136 1.00 23.09  ? 182 VAL A CG1 1 
ATOM 1371 C CG2 . VAL A 1 182 ? -37.104 -35.605 231.729 1.00 25.95  ? 182 VAL A CG2 1 
ATOM 1372 N N   . SER A 1 183 ? -35.494 -38.562 231.890 1.00 23.62  ? 183 SER A N   1 
ATOM 1373 C CA  . SER A 1 183 ? -34.115 -38.992 231.681 1.00 25.11  ? 183 SER A CA  1 
ATOM 1374 C C   . SER A 1 183 ? -33.389 -37.962 230.832 1.00 24.96  ? 183 SER A C   1 
ATOM 1375 O O   . SER A 1 183 ? -33.969 -37.416 229.890 1.00 24.76  ? 183 SER A O   1 
ATOM 1376 C CB  . SER A 1 183 ? -34.040 -40.359 231.002 1.00 21.39  ? 183 SER A CB  1 
ATOM 1377 O OG  . SER A 1 183 ? -34.514 -40.301 229.668 1.00 27.56  ? 183 SER A OG  1 
ATOM 1378 N N   . LEU A 1 184 ? -32.142 -37.678 231.200 1.00 24.26  ? 184 LEU A N   1 
ATOM 1379 C CA  . LEU A 1 184 ? -31.309 -36.720 230.491 1.00 24.25  ? 184 LEU A CA  1 
ATOM 1380 C C   . LEU A 1 184 ? -30.005 -37.350 230.060 1.00 23.70  ? 184 LEU A C   1 
ATOM 1381 O O   . LEU A 1 184 ? -29.247 -37.848 230.895 1.00 24.44  ? 184 LEU A O   1 
ATOM 1382 C CB  . LEU A 1 184 ? -30.962 -35.533 231.387 1.00 27.06  ? 184 LEU A CB  1 
ATOM 1383 C CG  . LEU A 1 184 ? -31.965 -34.412 231.534 1.00 29.26  ? 184 LEU A CG  1 
ATOM 1384 C CD1 . LEU A 1 184 ? -31.446 -33.424 232.553 1.00 35.30  ? 184 LEU A CD1 1 
ATOM 1385 C CD2 . LEU A 1 184 ? -32.143 -33.757 230.190 1.00 28.20  ? 184 LEU A CD2 1 
ATOM 1386 N N   . LEU A 1 185 ? -29.750 -37.336 228.759 1.00 20.67  ? 185 LEU A N   1 
ATOM 1387 C CA  . LEU A 1 185 ? -28.506 -37.852 228.231 1.00 20.87  ? 185 LEU A CA  1 
ATOM 1388 C C   . LEU A 1 185 ? -27.846 -36.672 227.527 1.00 21.01  ? 185 LEU A C   1 
ATOM 1389 O O   . LEU A 1 185 ? -28.273 -36.260 226.453 1.00 22.91  ? 185 LEU A O   1 
ATOM 1390 C CB  . LEU A 1 185 ? -28.755 -38.990 227.240 1.00 24.62  ? 185 LEU A CB  1 
ATOM 1391 C CG  . LEU A 1 185 ? -27.569 -39.934 226.993 1.00 32.07  ? 185 LEU A CG  1 
ATOM 1392 C CD1 . LEU A 1 185 ? -28.031 -41.050 226.083 1.00 33.49  ? 185 LEU A CD1 1 
ATOM 1393 C CD2 . LEU A 1 185 ? -26.388 -39.212 226.376 1.00 27.11  ? 185 LEU A CD2 1 
ATOM 1394 N N   . CYS A 1 186 ? -26.827 -36.105 228.156 1.00 20.82  ? 186 CYS A N   1 
ATOM 1395 C CA  . CYS A 1 186 ? -26.112 -34.987 227.581 1.00 21.01  ? 186 CYS A CA  1 
ATOM 1396 C C   . CYS A 1 186 ? -24.688 -35.419 227.279 1.00 23.13  ? 186 CYS A C   1 
ATOM 1397 O O   . CYS A 1 186 ? -23.999 -35.939 228.151 1.00 23.82  ? 186 CYS A O   1 
ATOM 1398 C CB  . CYS A 1 186 ? -26.099 -33.832 228.566 1.00 22.41  ? 186 CYS A CB  1 
ATOM 1399 S SG  . CYS A 1 186 ? -27.761 -33.263 229.024 1.00 24.93  ? 186 CYS A SG  1 
ATOM 1400 N N   . ARG A 1 187 ? -24.228 -35.195 226.057 1.00 25.45  ? 187 ARG A N   1 
ATOM 1401 C CA  . ARG A 1 187 ? -22.871 -35.594 225.708 1.00 29.34  ? 187 ARG A CA  1 
ATOM 1402 C C   . ARG A 1 187 ? -21.878 -34.444 225.723 1.00 27.07  ? 187 ARG A C   1 
ATOM 1403 O O   . ARG A 1 187 ? -21.907 -33.571 224.858 1.00 26.56  ? 187 ARG A O   1 
ATOM 1404 C CB  . ARG A 1 187 ? -22.841 -36.308 224.357 1.00 34.50  ? 187 ARG A CB  1 
ATOM 1405 C CG  . ARG A 1 187 ? -23.515 -37.664 224.395 1.00 45.65  ? 187 ARG A CG  1 
ATOM 1406 C CD  . ARG A 1 187 ? -23.348 -38.425 223.087 1.00 50.34  ? 187 ARG A CD  1 
ATOM 1407 N NE  . ARG A 1 187 ? -24.117 -39.667 223.084 1.00 49.43  ? 187 ARG A NE  1 
ATOM 1408 C CZ  . ARG A 1 187 ? -25.425 -39.732 222.853 1.00 53.93  ? 187 ARG A CZ  1 
ATOM 1409 N NH1 . ARG A 1 187 ? -26.115 -38.622 222.598 1.00 46.30  ? 187 ARG A NH1 1 
ATOM 1410 N NH2 . ARG A 1 187 ? -26.048 -40.902 222.911 1.00 53.82  ? 187 ARG A NH2 1 
ATOM 1411 N N   . VAL A 1 188 ? -20.995 -34.457 226.713 1.00 28.19  ? 188 VAL A N   1 
ATOM 1412 C CA  . VAL A 1 188 ? -19.969 -33.424 226.868 1.00 30.94  ? 188 VAL A CA  1 
ATOM 1413 C C   . VAL A 1 188 ? -19.079 -33.343 225.605 1.00 30.53  ? 188 VAL A C   1 
ATOM 1414 O O   . VAL A 1 188 ? -18.617 -32.259 225.235 1.00 32.06  ? 188 VAL A O   1 
ATOM 1415 C CB  . VAL A 1 188 ? -19.142 -33.679 228.185 1.00 33.00  ? 188 VAL A CB  1 
ATOM 1416 C CG1 . VAL A 1 188 ? -17.865 -32.821 228.234 1.00 36.22  ? 188 VAL A CG1 1 
ATOM 1417 C CG2 . VAL A 1 188 ? -20.021 -33.385 229.408 1.00 33.14  ? 188 VAL A CG2 1 
ATOM 1418 N N   . ALA A 1 189 ? -18.905 -34.472 224.913 1.00 31.02  ? 189 ALA A N   1 
ATOM 1419 C CA  . ALA A 1 189 ? -18.105 -34.532 223.677 1.00 32.12  ? 189 ALA A CA  1 
ATOM 1420 C C   . ALA A 1 189 ? -18.720 -33.668 222.561 1.00 32.79  ? 189 ALA A C   1 
ATOM 1421 O O   . ALA A 1 189 ? -18.043 -33.275 221.605 1.00 33.14  ? 189 ALA A O   1 
ATOM 1422 C CB  . ALA A 1 189 ? -17.975 -35.985 223.208 1.00 33.03  ? 189 ALA A CB  1 
ATOM 1423 N N   . SER A 1 190 ? -20.016 -33.393 222.685 1.00 33.15  ? 190 SER A N   1 
ATOM 1424 C CA  . SER A 1 190 ? -20.739 -32.568 221.717 1.00 33.51  ? 190 SER A CA  1 
ATOM 1425 C C   . SER A 1 190 ? -20.599 -31.099 222.089 1.00 34.61  ? 190 SER A C   1 
ATOM 1426 O O   . SER A 1 190 ? -21.139 -30.222 221.402 1.00 34.91  ? 190 SER A O   1 
ATOM 1427 C CB  . SER A 1 190 ? -22.239 -32.936 221.707 1.00 36.03  ? 190 SER A CB  1 
ATOM 1428 O OG  . SER A 1 190 ? -22.958 -32.322 222.777 1.00 26.68  ? 190 SER A OG  1 
ATOM 1429 N N   . GLY A 1 191 ? -19.937 -30.845 223.217 1.00 34.79  ? 191 GLY A N   1 
ATOM 1430 C CA  . GLY A 1 191 ? -19.762 -29.488 223.691 1.00 35.73  ? 191 GLY A CA  1 
ATOM 1431 C C   . GLY A 1 191 ? -18.672 -28.704 222.987 1.00 37.29  ? 191 GLY A C   1 
ATOM 1432 O O   . GLY A 1 191 ? -18.208 -29.055 221.899 1.00 35.11  ? 191 GLY A O   1 
ATOM 1433 N N   . VAL A 1 192 ? -18.243 -27.646 223.660 1.00 40.74  ? 192 VAL A N   1 
ATOM 1434 C CA  . VAL A 1 192 ? -17.212 -26.732 223.183 1.00 43.41  ? 192 VAL A CA  1 
ATOM 1435 C C   . VAL A 1 192 ? -15.833 -27.397 223.108 1.00 41.73  ? 192 VAL A C   1 
ATOM 1436 O O   . VAL A 1 192 ? -15.447 -28.096 224.050 1.00 39.41  ? 192 VAL A O   1 
ATOM 1437 C CB  . VAL A 1 192 ? -17.113 -25.544 224.173 1.00 50.63  ? 192 VAL A CB  1 
ATOM 1438 C CG1 . VAL A 1 192 ? -16.055 -24.552 223.729 1.00 58.29  ? 192 VAL A CG1 1 
ATOM 1439 C CG2 . VAL A 1 192 ? -18.481 -24.880 224.331 1.00 52.24  ? 192 VAL A CG2 1 
ATOM 1440 N N   . ASP A 1 193 ? -15.114 -27.244 221.988 1.00 42.06  ? 193 ASP A N   1 
ATOM 1441 C CA  . ASP A 1 193 ? -13.758 -27.809 221.915 1.00 42.76  ? 193 ASP A CA  1 
ATOM 1442 C C   . ASP A 1 193 ? -12.864 -26.827 222.675 1.00 40.23  ? 193 ASP A C   1 
ATOM 1443 O O   . ASP A 1 193 ? -12.871 -25.626 222.389 1.00 40.53  ? 193 ASP A O   1 
ATOM 1444 C CB  . ASP A 1 193 ? -13.214 -27.977 220.493 1.00 51.36  ? 193 ASP A CB  1 
ATOM 1445 C CG  . ASP A 1 193 ? -11.760 -28.494 220.495 1.00 62.30  ? 193 ASP A CG  1 
ATOM 1446 O OD1 . ASP A 1 193 ? -11.522 -29.642 220.947 1.00 64.93  ? 193 ASP A OD1 1 
ATOM 1447 O OD2 . ASP A 1 193 ? -10.844 -27.731 220.115 1.00 71.53  ? 193 ASP A OD2 1 
ATOM 1448 N N   . LEU A 1 194 ? -12.059 -27.348 223.594 1.00 36.45  ? 194 LEU A N   1 
ATOM 1449 C CA  . LEU A 1 194 ? -11.222 -26.511 224.438 1.00 35.34  ? 194 LEU A CA  1 
ATOM 1450 C C   . LEU A 1 194 ? -9.726  -26.622 224.238 1.00 33.59  ? 194 LEU A C   1 
ATOM 1451 O O   . LEU A 1 194 ? -8.958  -26.106 225.043 1.00 33.98  ? 194 LEU A O   1 
ATOM 1452 C CB  . LEU A 1 194 ? -11.562 -26.814 225.895 1.00 36.71  ? 194 LEU A CB  1 
ATOM 1453 C CG  . LEU A 1 194 ? -13.058 -26.673 226.192 1.00 41.11  ? 194 LEU A CG  1 
ATOM 1454 C CD1 . LEU A 1 194 ? -13.416 -27.491 227.398 1.00 38.00  ? 194 LEU A CD1 1 
ATOM 1455 C CD2 . LEU A 1 194 ? -13.444 -25.199 226.348 1.00 40.43  ? 194 LEU A CD2 1 
ATOM 1456 N N   . ALA A 1 195 ? -9.308  -27.256 223.155 1.00 31.88  ? 195 ALA A N   1 
ATOM 1457 C CA  . ALA A 1 195 ? -7.882  -27.441 222.893 1.00 32.00  ? 195 ALA A CA  1 
ATOM 1458 C C   . ALA A 1 195 ? -7.055  -26.144 222.861 1.00 27.87  ? 195 ALA A C   1 
ATOM 1459 O O   . ALA A 1 195 ? -5.983  -26.074 223.441 1.00 28.19  ? 195 ALA A O   1 
ATOM 1460 C CB  . ALA A 1 195 ? -7.696  -28.224 221.587 1.00 35.29  ? 195 ALA A CB  1 
ATOM 1461 N N   . GLN A 1 196 ? -7.566  -25.123 222.192 1.00 26.44  ? 196 GLN A N   1 
ATOM 1462 C CA  . GLN A 1 196 ? -6.858  -23.854 222.076 1.00 27.39  ? 196 GLN A CA  1 
ATOM 1463 C C   . GLN A 1 196 ? -7.265  -22.788 223.104 1.00 24.99  ? 196 GLN A C   1 
ATOM 1464 O O   . GLN A 1 196 ? -6.896  -21.624 222.950 1.00 25.78  ? 196 GLN A O   1 
ATOM 1465 C CB  . GLN A 1 196 ? -7.035  -23.286 220.654 1.00 32.94  ? 196 GLN A CB  1 
ATOM 1466 C CG  . GLN A 1 196 ? -6.433  -24.141 219.535 1.00 41.57  ? 196 GLN A CG  1 
ATOM 1467 C CD  . GLN A 1 196 ? -4.922  -24.375 219.695 1.00 50.76  ? 196 GLN A CD  1 
ATOM 1468 O OE1 . GLN A 1 196 ? -4.497  -25.328 220.342 1.00 53.71  ? 196 GLN A OE1 1 
ATOM 1469 N NE2 . GLN A 1 196 ? -4.115  -23.521 219.076 1.00 55.72  ? 196 GLN A NE2 1 
ATOM 1470 N N   . THR A 1 197 ? -8.020  -23.171 224.130 1.00 21.18  ? 197 THR A N   1 
ATOM 1471 C CA  . THR A 1 197 ? -8.475  -22.230 225.155 1.00 19.61  ? 197 THR A CA  1 
ATOM 1472 C C   . THR A 1 197 ? -7.587  -22.193 226.400 1.00 19.02  ? 197 THR A C   1 
ATOM 1473 O O   . THR A 1 197 ? -7.063  -23.224 226.851 1.00 17.20  ? 197 THR A O   1 
ATOM 1474 C CB  . THR A 1 197 ? -9.950  -22.548 225.607 1.00 19.18  ? 197 THR A CB  1 
ATOM 1475 O OG1 . THR A 1 197 ? -10.855 -22.189 224.567 1.00 27.27  ? 197 THR A OG1 1 
ATOM 1476 C CG2 . THR A 1 197 ? -10.351 -21.779 226.859 1.00 16.91  ? 197 THR A CG2 1 
ATOM 1477 N N   . VAL A 1 198 ? -7.394  -20.981 226.913 1.00 18.47  ? 198 VAL A N   1 
ATOM 1478 C CA  . VAL A 1 198 ? -6.654  -20.737 228.137 1.00 17.51  ? 198 VAL A CA  1 
ATOM 1479 C C   . VAL A 1 198 ? -7.514  -19.753 228.926 1.00 15.37  ? 198 VAL A C   1 
ATOM 1480 O O   . VAL A 1 198 ? -8.031  -18.799 228.348 1.00 16.23  ? 198 VAL A O   1 
ATOM 1481 C CB  . VAL A 1 198 ? -5.292  -20.074 227.874 1.00 16.04  ? 198 VAL A CB  1 
ATOM 1482 C CG1 . VAL A 1 198 ? -4.641  -19.693 229.193 1.00 18.23  ? 198 VAL A CG1 1 
ATOM 1483 C CG2 . VAL A 1 198 ? -4.392  -21.014 227.122 1.00 15.76  ? 198 VAL A CG2 1 
ATOM 1484 N N   . ILE A 1 199 ? -7.776  -20.042 230.196 1.00 12.05  ? 199 ILE A N   1 
ATOM 1485 C CA  . ILE A 1 199 ? -8.532  -19.111 231.030 1.00 13.46  ? 199 ILE A CA  1 
ATOM 1486 C C   . ILE A 1 199 ? -7.459  -18.234 231.709 1.00 13.06  ? 199 ILE A C   1 
ATOM 1487 O O   . ILE A 1 199 ? -6.579  -18.744 232.410 1.00 11.76  ? 199 ILE A O   1 
ATOM 1488 C CB  . ILE A 1 199 ? -9.395  -19.830 232.109 1.00 17.20  ? 199 ILE A CB  1 
ATOM 1489 C CG1 . ILE A 1 199 ? -10.428 -20.751 231.446 1.00 16.89  ? 199 ILE A CG1 1 
ATOM 1490 C CG2 . ILE A 1 199 ? -10.114 -18.797 232.976 1.00 10.62  ? 199 ILE A CG2 1 
ATOM 1491 C CD1 . ILE A 1 199 ? -11.296 -20.074 230.383 1.00 16.11  ? 199 ILE A CD1 1 
ATOM 1492 N N   . LEU A 1 200 ? -7.473  -16.937 231.419 1.00 13.11  ? 200 LEU A N   1 
ATOM 1493 C CA  . LEU A 1 200 ? -6.485  -16.015 231.966 1.00 11.99  ? 200 LEU A CA  1 
ATOM 1494 C C   . LEU A 1 200 ? -7.029  -15.363 233.220 1.00 12.72  ? 200 LEU A C   1 
ATOM 1495 O O   . LEU A 1 200 ? -8.109  -14.800 233.193 1.00 14.81  ? 200 LEU A O   1 
ATOM 1496 C CB  . LEU A 1 200 ? -6.151  -14.938 230.938 1.00 15.35  ? 200 LEU A CB  1 
ATOM 1497 C CG  . LEU A 1 200 ? -5.167  -13.847 231.373 1.00 21.12  ? 200 LEU A CG  1 
ATOM 1498 C CD1 . LEU A 1 200 ? -3.790  -14.438 231.459 1.00 16.91  ? 200 LEU A CD1 1 
ATOM 1499 C CD2 . LEU A 1 200 ? -5.176  -12.680 230.382 1.00 25.29  ? 200 LEU A CD2 1 
ATOM 1500 N N   . GLU A 1 201 ? -6.254  -15.408 234.297 1.00 11.18  ? 201 GLU A N   1 
ATOM 1501 C CA  . GLU A 1 201 ? -6.648  -14.829 235.574 1.00 12.98  ? 201 GLU A CA  1 
ATOM 1502 C C   . GLU A 1 201 ? -5.618  -13.795 236.012 1.00 15.70  ? 201 GLU A C   1 
ATOM 1503 O O   . GLU A 1 201 ? -4.413  -14.039 235.919 1.00 15.13  ? 201 GLU A O   1 
ATOM 1504 C CB  . GLU A 1 201 ? -6.687  -15.929 236.620 1.00 14.10  ? 201 GLU A CB  1 
ATOM 1505 C CG  . GLU A 1 201 ? -6.988  -15.431 238.022 1.00 15.19  ? 201 GLU A CG  1 
ATOM 1506 C CD  . GLU A 1 201 ? -6.945  -16.549 239.040 1.00 21.65  ? 201 GLU A CD  1 
ATOM 1507 O OE1 . GLU A 1 201 ? -6.694  -17.708 238.642 1.00 17.07  ? 201 GLU A OE1 1 
ATOM 1508 O OE2 . GLU A 1 201 ? -7.170  -16.270 240.236 1.00 19.04  ? 201 GLU A OE2 1 
ATOM 1509 N N   . LEU A 1 202 ? -6.078  -12.626 236.440 1.00 14.32  ? 202 LEU A N   1 
ATOM 1510 C CA  . LEU A 1 202 ? -5.156  -11.600 236.913 1.00 16.20  ? 202 LEU A CA  1 
ATOM 1511 C C   . LEU A 1 202 ? -5.278  -11.637 238.427 1.00 17.53  ? 202 LEU A C   1 
ATOM 1512 O O   . LEU A 1 202 ? -4.807  -12.580 239.060 1.00 20.72  ? 202 LEU A O   1 
ATOM 1513 C CB  . LEU A 1 202 ? -5.518  -10.224 236.348 1.00 17.12  ? 202 LEU A CB  1 
ATOM 1514 C CG  . LEU A 1 202 ? -5.472  -10.037 234.826 1.00 21.79  ? 202 LEU A CG  1 
ATOM 1515 C CD1 . LEU A 1 202 ? -5.431  -8.552  234.510 1.00 19.82  ? 202 LEU A CD1 1 
ATOM 1516 C CD2 . LEU A 1 202 ? -4.273  -10.724 234.217 1.00 23.36  ? 202 LEU A CD2 1 
ATOM 1517 N N   . ASP A 1 203 ? -5.867  -10.610 239.017 1.00 17.78  ? 203 ASP A N   1 
ATOM 1518 C CA  . ASP A 1 203 ? -6.085  -10.595 240.455 1.00 19.22  ? 203 ASP A CA  1 
ATOM 1519 C C   . ASP A 1 203 ? -7.617  -10.563 240.586 1.00 21.13  ? 203 ASP A C   1 
ATOM 1520 O O   . ASP A 1 203 ? -8.239  -9.506  240.458 1.00 21.86  ? 203 ASP A O   1 
ATOM 1521 C CB  . ASP A 1 203 ? -5.442  -9.361  241.089 1.00 18.76  ? 203 ASP A CB  1 
ATOM 1522 C CG  . ASP A 1 203 ? -5.788  -9.204  242.567 1.00 25.35  ? 203 ASP A CG  1 
ATOM 1523 O OD1 . ASP A 1 203 ? -6.414  -10.104 243.152 1.00 27.16  ? 203 ASP A OD1 1 
ATOM 1524 O OD2 . ASP A 1 203 ? -5.431  -8.169  243.152 1.00 25.34  ? 203 ASP A OD2 1 
ATOM 1525 N N   . LYS A 1 204 ? -8.215  -11.728 240.830 1.00 21.47  ? 204 LYS A N   1 
ATOM 1526 C CA  . LYS A 1 204 ? -9.669  -11.862 240.945 1.00 23.08  ? 204 LYS A CA  1 
ATOM 1527 C C   . LYS A 1 204 ? -10.325 -11.075 242.084 1.00 23.97  ? 204 LYS A C   1 
ATOM 1528 O O   . LYS A 1 204 ? -11.557 -10.999 242.143 1.00 25.24  ? 204 LYS A O   1 
ATOM 1529 C CB  . LYS A 1 204 ? -10.076 -13.343 241.021 1.00 17.89  ? 204 LYS A CB  1 
ATOM 1530 C CG  . LYS A 1 204 ? -9.703  -14.017 242.325 1.00 18.05  ? 204 LYS A CG  1 
ATOM 1531 C CD  . LYS A 1 204 ? -10.099 -15.485 242.307 1.00 21.50  ? 204 LYS A CD  1 
ATOM 1532 C CE  . LYS A 1 204 ? -9.720  -16.184 243.608 1.00 24.17  ? 204 LYS A CE  1 
ATOM 1533 N NZ  . LYS A 1 204 ? -10.140 -17.606 243.543 1.00 23.98  ? 204 LYS A NZ  1 
ATOM 1534 N N   . THR A 1 205 ? -9.520  -10.503 242.982 1.00 23.72  ? 205 THR A N   1 
ATOM 1535 C CA  . THR A 1 205 ? -10.064 -9.701  244.083 1.00 25.88  ? 205 THR A CA  1 
ATOM 1536 C C   . THR A 1 205 ? -10.289 -8.225  243.690 1.00 25.75  ? 205 THR A C   1 
ATOM 1537 O O   . THR A 1 205 ? -10.871 -7.463  244.460 1.00 25.55  ? 205 THR A O   1 
ATOM 1538 C CB  . THR A 1 205 ? -9.208  -9.806  245.389 1.00 26.32  ? 205 THR A CB  1 
ATOM 1539 O OG1 . THR A 1 205 ? -7.911  -9.221  245.202 1.00 32.85  ? 205 THR A OG1 1 
ATOM 1540 C CG2 . THR A 1 205 ? -9.031  -11.254 245.775 1.00 27.25  ? 205 THR A CG2 1 
ATOM 1541 N N   . VAL A 1 206 ? -9.817  -7.819  242.509 1.00 26.28  ? 206 VAL A N   1 
ATOM 1542 C CA  . VAL A 1 206 ? -10.012 -6.441  242.028 1.00 30.15  ? 206 VAL A CA  1 
ATOM 1543 C C   . VAL A 1 206 ? -11.502 -6.304  241.705 1.00 31.54  ? 206 VAL A C   1 
ATOM 1544 O O   . VAL A 1 206 ? -12.068 -7.091  240.935 1.00 28.52  ? 206 VAL A O   1 
ATOM 1545 C CB  . VAL A 1 206 ? -9.135  -6.109  240.768 1.00 30.73  ? 206 VAL A CB  1 
ATOM 1546 C CG1 . VAL A 1 206 ? -9.570  -4.794  240.134 1.00 29.81  ? 206 VAL A CG1 1 
ATOM 1547 C CG2 . VAL A 1 206 ? -7.677  -6.001  241.165 1.00 23.48  ? 206 VAL A CG2 1 
ATOM 1548 N N   . GLU A 1 207 ? -12.126 -5.276  242.264 1.00 34.12  ? 207 GLU A N   1 
ATOM 1549 C CA  . GLU A 1 207 ? -13.558 -5.096  242.089 1.00 35.17  ? 207 GLU A CA  1 
ATOM 1550 C C   . GLU A 1 207 ? -14.113 -4.608  240.754 1.00 32.27  ? 207 GLU A C   1 
ATOM 1551 O O   . GLU A 1 207 ? -15.209 -5.036  240.351 1.00 30.94  ? 207 GLU A O   1 
ATOM 1552 C CB  . GLU A 1 207 ? -14.121 -4.245  243.221 1.00 42.13  ? 207 GLU A CB  1 
ATOM 1553 C CG  . GLU A 1 207 ? -15.601 -4.488  243.425 1.00 59.92  ? 207 GLU A CG  1 
ATOM 1554 C CD  . GLU A 1 207 ? -16.182 -3.650  244.534 1.00 75.04  ? 207 GLU A CD  1 
ATOM 1555 O OE1 . GLU A 1 207 ? -15.562 -3.592  245.626 1.00 81.02  ? 207 GLU A OE1 1 
ATOM 1556 O OE2 . GLU A 1 207 ? -17.262 -3.054  244.307 1.00 80.72  ? 207 GLU A OE2 1 
ATOM 1557 N N   . HIS A 1 208 ? -13.384 -3.734  240.063 1.00 26.52  ? 208 HIS A N   1 
ATOM 1558 C CA  . HIS A 1 208 ? -13.899 -3.210  238.805 1.00 25.12  ? 208 HIS A CA  1 
ATOM 1559 C C   . HIS A 1 208 ? -13.353 -3.857  237.553 1.00 24.18  ? 208 HIS A C   1 
ATOM 1560 O O   . HIS A 1 208 ? -13.081 -3.187  236.568 1.00 25.70  ? 208 HIS A O   1 
ATOM 1561 C CB  . HIS A 1 208 ? -13.742 -1.697  238.760 1.00 25.94  ? 208 HIS A CB  1 
ATOM 1562 C CG  . HIS A 1 208 ? -14.466 -1.003  239.870 1.00 29.40  ? 208 HIS A CG  1 
ATOM 1563 N ND1 . HIS A 1 208 ? -15.841 -0.897  239.909 1.00 32.74  ? 208 HIS A ND1 1 
ATOM 1564 C CD2 . HIS A 1 208 ? -14.010 -0.433  241.011 1.00 26.89  ? 208 HIS A CD2 1 
ATOM 1565 C CE1 . HIS A 1 208 ? -16.202 -0.297  241.029 1.00 26.97  ? 208 HIS A CE1 1 
ATOM 1566 N NE2 . HIS A 1 208 ? -15.111 -0.005  241.715 1.00 30.19  ? 208 HIS A NE2 1 
ATOM 1567 N N   . LEU A 1 209 ? -13.284 -5.181  237.579 1.00 23.80  ? 209 LEU A N   1 
ATOM 1568 C CA  . LEU A 1 209 ? -12.795 -5.966  236.450 1.00 23.03  ? 209 LEU A CA  1 
ATOM 1569 C C   . LEU A 1 209 ? -13.418 -7.351  236.483 1.00 23.25  ? 209 LEU A C   1 
ATOM 1570 O O   . LEU A 1 209 ? -13.835 -7.832  237.553 1.00 21.31  ? 209 LEU A O   1 
ATOM 1571 C CB  . LEU A 1 209 ? -11.282 -6.170  236.554 1.00 22.90  ? 209 LEU A CB  1 
ATOM 1572 C CG  . LEU A 1 209 ? -10.324 -5.072  236.109 1.00 22.55  ? 209 LEU A CG  1 
ATOM 1573 C CD1 . LEU A 1 209 ? -8.884  -5.570  236.217 1.00 21.87  ? 209 LEU A CD1 1 
ATOM 1574 C CD2 . LEU A 1 209 ? -10.650 -4.697  234.691 1.00 19.45  ? 209 LEU A CD2 1 
ATOM 1575 N N   . PRO A 1 210 ? -13.551 -7.986  235.305 1.00 20.90  ? 210 PRO A N   1 
ATOM 1576 C CA  . PRO A 1 210 ? -14.109 -9.342  235.221 1.00 20.53  ? 210 PRO A CA  1 
ATOM 1577 C C   . PRO A 1 210 ? -13.060 -10.204 235.962 1.00 17.59  ? 210 PRO A C   1 
ATOM 1578 O O   . PRO A 1 210 ? -11.878 -9.821  236.029 1.00 14.52  ? 210 PRO A O   1 
ATOM 1579 C CB  . PRO A 1 210 ? -14.055 -9.644  233.716 1.00 23.97  ? 210 PRO A CB  1 
ATOM 1580 C CG  . PRO A 1 210 ? -14.122 -8.300  233.080 1.00 24.28  ? 210 PRO A CG  1 
ATOM 1581 C CD  . PRO A 1 210 ? -13.271 -7.438  233.967 1.00 21.20  ? 210 PRO A CD  1 
ATOM 1582 N N   . THR A 1 211 ? -13.457 -11.356 236.500 1.00 18.18  ? 211 THR A N   1 
ATOM 1583 C CA  . THR A 1 211 ? -12.501 -12.199 237.223 1.00 17.27  ? 211 THR A CA  1 
ATOM 1584 C C   . THR A 1 211 ? -11.592 -13.055 236.330 1.00 17.54  ? 211 THR A C   1 
ATOM 1585 O O   . THR A 1 211 ? -10.609 -13.615 236.813 1.00 18.81  ? 211 THR A O   1 
ATOM 1586 C CB  . THR A 1 211 ? -13.221 -13.112 238.255 1.00 19.47  ? 211 THR A CB  1 
ATOM 1587 O OG1 . THR A 1 211 ? -14.166 -13.960 237.580 1.00 18.57  ? 211 THR A OG1 1 
ATOM 1588 C CG2 . THR A 1 211 ? -13.973 -12.263 239.277 1.00 17.23  ? 211 THR A CG2 1 
ATOM 1589 N N   . ALA A 1 212 ? -11.903 -13.145 235.036 1.00 16.68  ? 212 ALA A N   1 
ATOM 1590 C CA  . ALA A 1 212 ? -11.112 -13.963 234.110 1.00 15.42  ? 212 ALA A CA  1 
ATOM 1591 C C   . ALA A 1 212 ? -11.504 -13.717 232.661 1.00 15.85  ? 212 ALA A C   1 
ATOM 1592 O O   . ALA A 1 212 ? -12.560 -13.141 232.370 1.00 14.57  ? 212 ALA A O   1 
ATOM 1593 C CB  . ALA A 1 212 ? -11.278 -15.469 234.443 1.00 15.32  ? 212 ALA A CB  1 
ATOM 1594 N N   . TRP A 1 213 ? -10.654 -14.172 231.750 1.00 15.16  ? 213 TRP A N   1 
ATOM 1595 C CA  . TRP A 1 213 ? -10.901 -14.015 230.324 1.00 17.95  ? 213 TRP A CA  1 
ATOM 1596 C C   . TRP A 1 213 ? -10.634 -15.348 229.655 1.00 18.53  ? 213 TRP A C   1 
ATOM 1597 O O   . TRP A 1 213 ? -9.859  -16.161 230.158 1.00 16.75  ? 213 TRP A O   1 
ATOM 1598 C CB  . TRP A 1 213 ? -9.966  -12.955 229.708 1.00 18.06  ? 213 TRP A CB  1 
ATOM 1599 C CG  . TRP A 1 213 ? -10.272 -11.530 230.127 1.00 17.15  ? 213 TRP A CG  1 
ATOM 1600 C CD1 . TRP A 1 213 ? -10.979 -10.603 229.415 1.00 13.02  ? 213 TRP A CD1 1 
ATOM 1601 C CD2 . TRP A 1 213 ? -9.882  -10.884 231.353 1.00 16.07  ? 213 TRP A CD2 1 
ATOM 1602 N NE1 . TRP A 1 213 ? -11.058 -9.421  230.118 1.00 13.21  ? 213 TRP A NE1 1 
ATOM 1603 C CE2 . TRP A 1 213 ? -10.392 -9.561  231.308 1.00 21.26  ? 213 TRP A CE2 1 
ATOM 1604 C CE3 . TRP A 1 213 ? -9.144  -11.291 232.482 1.00 17.50  ? 213 TRP A CE3 1 
ATOM 1605 C CZ2 . TRP A 1 213 ? -10.195 -8.642  232.349 1.00 16.14  ? 213 TRP A CZ2 1 
ATOM 1606 C CZ3 . TRP A 1 213 ? -8.947  -10.383 233.516 1.00 18.97  ? 213 TRP A CZ3 1 
ATOM 1607 C CH2 . TRP A 1 213 ? -9.471  -9.066  233.440 1.00 22.87  ? 213 TRP A CH2 1 
ATOM 1608 N N   . GLN A 1 214 ? -11.289 -15.573 228.529 1.00 16.40  ? 214 GLN A N   1 
ATOM 1609 C CA  . GLN A 1 214 ? -11.095 -16.791 227.773 1.00 17.70  ? 214 GLN A CA  1 
ATOM 1610 C C   . GLN A 1 214 ? -10.244 -16.340 226.604 1.00 18.25  ? 214 GLN A C   1 
ATOM 1611 O O   . GLN A 1 214 ? -10.724 -15.577 225.773 1.00 20.82  ? 214 GLN A O   1 
ATOM 1612 C CB  . GLN A 1 214 ? -12.441 -17.300 227.265 1.00 23.03  ? 214 GLN A CB  1 
ATOM 1613 C CG  . GLN A 1 214 ? -12.320 -18.585 226.496 1.00 25.37  ? 214 GLN A CG  1 
ATOM 1614 C CD  . GLN A 1 214 ? -13.645 -19.086 225.964 1.00 31.83  ? 214 GLN A CD  1 
ATOM 1615 O OE1 . GLN A 1 214 ? -13.672 -20.020 225.170 1.00 31.90  ? 214 GLN A OE1 1 
ATOM 1616 N NE2 . GLN A 1 214 ? -14.748 -18.498 226.417 1.00 23.15  ? 214 GLN A NE2 1 
ATOM 1617 N N   . VAL A 1 215 ? -8.984  -16.756 226.557 1.00 17.01  ? 215 VAL A N   1 
ATOM 1618 C CA  . VAL A 1 215 ? -8.094  -16.331 225.478 1.00 18.54  ? 215 VAL A CA  1 
ATOM 1619 C C   . VAL A 1 215 ? -7.535  -17.490 224.673 1.00 19.13  ? 215 VAL A C   1 
ATOM 1620 O O   . VAL A 1 215 ? -7.606  -18.646 225.102 1.00 20.78  ? 215 VAL A O   1 
ATOM 1621 C CB  . VAL A 1 215 ? -6.897  -15.476 226.023 1.00 15.71  ? 215 VAL A CB  1 
ATOM 1622 C CG1 . VAL A 1 215 ? -7.421  -14.297 226.831 1.00 17.63  ? 215 VAL A CG1 1 
ATOM 1623 C CG2 . VAL A 1 215 ? -5.960  -16.329 226.878 1.00 12.16  ? 215 VAL A CG2 1 
ATOM 1624 N N   . HIS A 1 216 ? -6.981  -17.177 223.500 1.00 20.28  ? 216 HIS A N   1 
ATOM 1625 C CA  . HIS A 1 216 ? -6.379  -18.190 222.637 1.00 19.37  ? 216 HIS A CA  1 
ATOM 1626 C C   . HIS A 1 216 ? -4.987  -18.600 223.134 1.00 20.62  ? 216 HIS A C   1 
ATOM 1627 O O   . HIS A 1 216 ? -4.138  -17.746 223.410 1.00 19.16  ? 216 HIS A O   1 
ATOM 1628 C CB  . HIS A 1 216 ? -6.273  -17.668 221.203 1.00 22.01  ? 216 HIS A CB  1 
ATOM 1629 C CG  . HIS A 1 216 ? -5.967  -18.742 220.208 1.00 31.22  ? 216 HIS A CG  1 
ATOM 1630 N ND1 . HIS A 1 216 ? -4.701  -19.269 220.044 1.00 31.04  ? 216 HIS A ND1 1 
ATOM 1631 C CD2 . HIS A 1 216 ? -6.774  -19.435 219.369 1.00 30.81  ? 216 HIS A CD2 1 
ATOM 1632 C CE1 . HIS A 1 216 ? -4.747  -20.250 219.160 1.00 28.31  ? 216 HIS A CE1 1 
ATOM 1633 N NE2 . HIS A 1 216 ? -5.991  -20.369 218.733 1.00 32.77  ? 216 HIS A NE2 1 
ATOM 1634 N N   . ARG A 1 217 ? -4.735  -19.904 223.170 1.00 19.66  ? 217 ARG A N   1 
ATOM 1635 C CA  . ARG A 1 217 ? -3.465  -20.455 223.623 1.00 24.44  ? 217 ARG A CA  1 
ATOM 1636 C C   . ARG A 1 217 ? -2.220  -19.862 222.954 1.00 25.59  ? 217 ARG A C   1 
ATOM 1637 O O   . ARG A 1 217 ? -1.218  -19.621 223.616 1.00 24.79  ? 217 ARG A O   1 
ATOM 1638 C CB  . ARG A 1 217 ? -3.467  -21.962 223.414 1.00 28.64  ? 217 ARG A CB  1 
ATOM 1639 C CG  . ARG A 1 217 ? -2.208  -22.640 223.875 1.00 31.36  ? 217 ARG A CG  1 
ATOM 1640 C CD  . ARG A 1 217 ? -2.186  -24.062 223.387 1.00 46.57  ? 217 ARG A CD  1 
ATOM 1641 N NE  . ARG A 1 217 ? -0.828  -24.554 223.155 1.00 59.57  ? 217 ARG A NE  1 
ATOM 1642 C CZ  . ARG A 1 217 ? 0.013   -24.938 224.114 1.00 61.98  ? 217 ARG A CZ  1 
ATOM 1643 N NH1 . ARG A 1 217 ? -0.346  -24.892 225.392 1.00 64.99  ? 217 ARG A NH1 1 
ATOM 1644 N NH2 . ARG A 1 217 ? 1.223   -25.371 223.791 1.00 59.99  ? 217 ARG A NH2 1 
ATOM 1645 N N   . ASP A 1 218 ? -2.260  -19.672 221.638 1.00 26.42  ? 218 ASP A N   1 
ATOM 1646 C CA  . ASP A 1 218 ? -1.102  -19.118 220.927 1.00 28.29  ? 218 ASP A CA  1 
ATOM 1647 C C   . ASP A 1 218 ? -0.808  -17.666 221.301 1.00 27.59  ? 218 ASP A C   1 
ATOM 1648 O O   . ASP A 1 218 ? 0.352   -17.264 221.393 1.00 29.49  ? 218 ASP A O   1 
ATOM 1649 C CB  . ASP A 1 218 ? -1.244  -19.300 219.412 1.00 29.24  ? 218 ASP A CB  1 
ATOM 1650 C CG  . ASP A 1 218 ? -1.171  -20.769 218.991 1.00 30.77  ? 218 ASP A CG  1 
ATOM 1651 O OD1 . ASP A 1 218 ? -0.480  -21.572 219.657 1.00 35.55  ? 218 ASP A OD1 1 
ATOM 1652 O OD2 . ASP A 1 218 ? -1.822  -21.127 217.998 1.00 40.94  ? 218 ASP A OD2 1 
ATOM 1653 N N   . TRP A 1 219 ? -1.858  -16.886 221.537 1.00 25.91  ? 219 TRP A N   1 
ATOM 1654 C CA  . TRP A 1 219 ? -1.699  -15.499 221.961 1.00 23.83  ? 219 TRP A CA  1 
ATOM 1655 C C   . TRP A 1 219 ? -1.068  -15.491 223.365 1.00 25.14  ? 219 TRP A C   1 
ATOM 1656 O O   . TRP A 1 219 ? -0.077  -14.805 223.611 1.00 26.21  ? 219 TRP A O   1 
ATOM 1657 C CB  . TRP A 1 219 ? -3.065  -14.804 221.994 1.00 22.67  ? 219 TRP A CB  1 
ATOM 1658 C CG  . TRP A 1 219 ? -3.031  -13.399 222.534 1.00 27.38  ? 219 TRP A CG  1 
ATOM 1659 C CD1 . TRP A 1 219 ? -2.742  -12.252 221.835 1.00 30.54  ? 219 TRP A CD1 1 
ATOM 1660 C CD2 . TRP A 1 219 ? -3.312  -12.980 223.886 1.00 26.55  ? 219 TRP A CD2 1 
ATOM 1661 N NE1 . TRP A 1 219 ? -2.830  -11.152 222.666 1.00 27.64  ? 219 TRP A NE1 1 
ATOM 1662 C CE2 . TRP A 1 219 ? -3.178  -11.570 223.924 1.00 26.39  ? 219 TRP A CE2 1 
ATOM 1663 C CE3 . TRP A 1 219 ? -3.659  -13.666 225.062 1.00 22.28  ? 219 TRP A CE3 1 
ATOM 1664 C CZ2 . TRP A 1 219 ? -3.385  -10.823 225.100 1.00 26.26  ? 219 TRP A CZ2 1 
ATOM 1665 C CZ3 . TRP A 1 219 ? -3.864  -12.924 226.235 1.00 23.49  ? 219 TRP A CZ3 1 
ATOM 1666 C CH2 . TRP A 1 219 ? -3.726  -11.515 226.240 1.00 25.46  ? 219 TRP A CH2 1 
ATOM 1667 N N   . PHE A 1 220 ? -1.623  -16.295 224.268 1.00 24.67  ? 220 PHE A N   1 
ATOM 1668 C CA  . PHE A 1 220 ? -1.123  -16.387 225.633 1.00 21.83  ? 220 PHE A CA  1 
ATOM 1669 C C   . PHE A 1 220 ? 0.348   -16.805 225.665 1.00 23.99  ? 220 PHE A C   1 
ATOM 1670 O O   . PHE A 1 220 ? 1.152   -16.218 226.394 1.00 22.10  ? 220 PHE A O   1 
ATOM 1671 C CB  . PHE A 1 220 ? -1.977  -17.370 226.451 1.00 19.34  ? 220 PHE A CB  1 
ATOM 1672 C CG  . PHE A 1 220 ? -1.478  -17.594 227.860 1.00 17.56  ? 220 PHE A CG  1 
ATOM 1673 C CD1 . PHE A 1 220 ? -1.723  -16.654 228.860 1.00 17.73  ? 220 PHE A CD1 1 
ATOM 1674 C CD2 . PHE A 1 220 ? -0.743  -18.738 228.181 1.00 18.21  ? 220 PHE A CD2 1 
ATOM 1675 C CE1 . PHE A 1 220 ? -1.241  -16.852 230.166 1.00 16.83  ? 220 PHE A CE1 1 
ATOM 1676 C CE2 . PHE A 1 220 ? -0.256  -18.948 229.478 1.00 17.31  ? 220 PHE A CE2 1 
ATOM 1677 C CZ  . PHE A 1 220 ? -0.506  -18.001 230.472 1.00 15.14  ? 220 PHE A CZ  1 
ATOM 1678 N N   . ASN A 1 221 ? 0.711   -17.810 224.874 1.00 22.48  ? 221 ASN A N   1 
ATOM 1679 C CA  . ASN A 1 221 ? 2.094   -18.279 224.873 1.00 24.96  ? 221 ASN A CA  1 
ATOM 1680 C C   . ASN A 1 221 ? 3.109   -17.302 224.297 1.00 26.53  ? 221 ASN A C   1 
ATOM 1681 O O   . ASN A 1 221 ? 4.316   -17.454 224.513 1.00 30.46  ? 221 ASN A O   1 
ATOM 1682 C CB  . ASN A 1 221 ? 2.217   -19.640 224.187 1.00 26.22  ? 221 ASN A CB  1 
ATOM 1683 C CG  . ASN A 1 221 ? 1.698   -20.783 225.062 1.00 35.12  ? 221 ASN A CG  1 
ATOM 1684 O OD1 . ASN A 1 221 ? 1.122   -21.741 224.555 1.00 43.57  ? 221 ASN A OD1 1 
ATOM 1685 N ND2 . ASN A 1 221 ? 1.898   -20.682 226.379 1.00 34.10  ? 221 ASN A ND2 1 
ATOM 1686 N N   . ASP A 1 222 ? 2.621   -16.277 223.606 1.00 25.84  ? 222 ASP A N   1 
ATOM 1687 C CA  . ASP A 1 222 ? 3.491   -15.279 222.996 1.00 28.33  ? 222 ASP A CA  1 
ATOM 1688 C C   . ASP A 1 222 ? 3.602   -13.959 223.758 1.00 28.46  ? 222 ASP A C   1 
ATOM 1689 O O   . ASP A 1 222 ? 4.184   -13.007 223.248 1.00 30.95  ? 222 ASP A O   1 
ATOM 1690 C CB  . ASP A 1 222 ? 3.026   -14.992 221.568 1.00 34.10  ? 222 ASP A CB  1 
ATOM 1691 C CG  . ASP A 1 222 ? 3.712   -15.879 220.537 1.00 47.92  ? 222 ASP A CG  1 
ATOM 1692 O OD1 . ASP A 1 222 ? 3.758   -17.122 220.713 1.00 49.91  ? 222 ASP A OD1 1 
ATOM 1693 O OD2 . ASP A 1 222 ? 4.204   -15.316 219.537 1.00 57.92  ? 222 ASP A OD2 1 
ATOM 1694 N N   . LEU A 1 223 ? 3.036   -13.874 224.955 1.00 26.67  ? 223 LEU A N   1 
ATOM 1695 C CA  . LEU A 1 223 ? 3.112   -12.631 225.709 1.00 26.75  ? 223 LEU A CA  1 
ATOM 1696 C C   . LEU A 1 223 ? 4.561   -12.316 226.020 1.00 25.73  ? 223 LEU A C   1 
ATOM 1697 O O   . LEU A 1 223 ? 5.303   -13.178 226.487 1.00 23.65  ? 223 LEU A O   1 
ATOM 1698 C CB  . LEU A 1 223 ? 2.276   -12.698 226.994 1.00 25.16  ? 223 LEU A CB  1 
ATOM 1699 C CG  . LEU A 1 223 ? 0.768   -12.763 226.755 1.00 27.23  ? 223 LEU A CG  1 
ATOM 1700 C CD1 . LEU A 1 223 ? 0.057   -12.742 228.083 1.00 26.35  ? 223 LEU A CD1 1 
ATOM 1701 C CD2 . LEU A 1 223 ? 0.323   -11.596 225.893 1.00 27.18  ? 223 LEU A CD2 1 
ATOM 1702 N N   . ALA A 1 224 ? 4.953   -11.076 225.749 1.00 25.39  ? 224 ALA A N   1 
ATOM 1703 C CA  . ALA A 1 224 ? 6.326   -10.631 225.978 1.00 24.60  ? 224 ALA A CA  1 
ATOM 1704 C C   . ALA A 1 224 ? 6.484   -10.137 227.402 1.00 23.16  ? 224 ALA A C   1 
ATOM 1705 O O   . ALA A 1 224 ? 6.695   -8.951  227.642 1.00 23.87  ? 224 ALA A O   1 
ATOM 1706 C CB  . ALA A 1 224 ? 6.691   -9.532  224.994 1.00 22.49  ? 224 ALA A CB  1 
ATOM 1707 N N   . LEU A 1 225 ? 6.385   -11.056 228.350 1.00 20.41  ? 225 LEU A N   1 
ATOM 1708 C CA  . LEU A 1 225 ? 6.490   -10.711 229.756 1.00 20.87  ? 225 LEU A CA  1 
ATOM 1709 C C   . LEU A 1 225 ? 7.336   -11.756 230.456 1.00 18.72  ? 225 LEU A C   1 
ATOM 1710 O O   . LEU A 1 225 ? 7.578   -12.828 229.905 1.00 18.65  ? 225 LEU A O   1 
ATOM 1711 C CB  . LEU A 1 225 ? 5.097   -10.718 230.386 1.00 18.73  ? 225 LEU A CB  1 
ATOM 1712 C CG  . LEU A 1 225 ? 4.078   -9.687  229.907 1.00 25.12  ? 225 LEU A CG  1 
ATOM 1713 C CD1 . LEU A 1 225 ? 2.734   -10.018 230.520 1.00 22.23  ? 225 LEU A CD1 1 
ATOM 1714 C CD2 . LEU A 1 225 ? 4.514   -8.273  230.314 1.00 17.01  ? 225 LEU A CD2 1 
ATOM 1715 N N   . PRO A 1 226 ? 7.863   -11.432 231.645 1.00 16.91  ? 226 PRO A N   1 
ATOM 1716 C CA  . PRO A 1 226 ? 8.669   -12.427 232.361 1.00 17.15  ? 226 PRO A CA  1 
ATOM 1717 C C   . PRO A 1 226 ? 7.685   -13.557 232.714 1.00 19.58  ? 226 PRO A C   1 
ATOM 1718 O O   . PRO A 1 226 ? 6.512   -13.280 233.008 1.00 16.93  ? 226 PRO A O   1 
ATOM 1719 C CB  . PRO A 1 226 ? 9.093   -11.673 233.627 1.00 14.03  ? 226 PRO A CB  1 
ATOM 1720 C CG  . PRO A 1 226 ? 9.103   -10.245 233.188 1.00 12.73  ? 226 PRO A CG  1 
ATOM 1721 C CD  . PRO A 1 226 ? 7.857   -10.146 232.352 1.00 14.98  ? 226 PRO A CD  1 
ATOM 1722 N N   . TRP A 1 227 ? 8.150   -14.804 232.745 1.00 18.73  ? 227 TRP A N   1 
ATOM 1723 C CA  . TRP A 1 227 ? 7.259   -15.925 233.061 1.00 18.27  ? 227 TRP A CA  1 
ATOM 1724 C C   . TRP A 1 227 ? 7.946   -16.995 233.895 1.00 17.79  ? 227 TRP A C   1 
ATOM 1725 O O   . TRP A 1 227 ? 9.169   -17.030 233.982 1.00 18.88  ? 227 TRP A O   1 
ATOM 1726 C CB  . TRP A 1 227 ? 6.751   -16.565 231.765 1.00 18.68  ? 227 TRP A CB  1 
ATOM 1727 C CG  . TRP A 1 227 ? 7.851   -17.236 230.957 1.00 25.80  ? 227 TRP A CG  1 
ATOM 1728 C CD1 . TRP A 1 227 ? 8.710   -16.638 230.066 1.00 22.11  ? 227 TRP A CD1 1 
ATOM 1729 C CD2 . TRP A 1 227 ? 8.217   -18.628 230.993 1.00 30.39  ? 227 TRP A CD2 1 
ATOM 1730 N NE1 . TRP A 1 227 ? 9.582   -17.571 229.557 1.00 30.23  ? 227 TRP A NE1 1 
ATOM 1731 C CE2 . TRP A 1 227 ? 9.303   -18.797 230.106 1.00 30.26  ? 227 TRP A CE2 1 
ATOM 1732 C CE3 . TRP A 1 227 ? 7.730   -19.747 231.690 1.00 30.07  ? 227 TRP A CE3 1 
ATOM 1733 C CZ2 . TRP A 1 227 ? 9.910   -20.040 229.898 1.00 32.09  ? 227 TRP A CZ2 1 
ATOM 1734 C CZ3 . TRP A 1 227 ? 8.336   -20.983 231.480 1.00 31.83  ? 227 TRP A CZ3 1 
ATOM 1735 C CH2 . TRP A 1 227 ? 9.414   -21.117 230.593 1.00 27.20  ? 227 TRP A CH2 1 
ATOM 1736 N N   . LYS A 1 228 ? 7.155   -17.858 234.518 1.00 16.43  ? 228 LYS A N   1 
ATOM 1737 C CA  . LYS A 1 228 ? 7.692   -18.966 235.301 1.00 18.97  ? 228 LYS A CA  1 
ATOM 1738 C C   . LYS A 1 228 ? 6.580   -19.983 235.527 1.00 20.88  ? 228 LYS A C   1 
ATOM 1739 O O   . LYS A 1 228 ? 5.426   -19.755 235.153 1.00 18.93  ? 228 LYS A O   1 
ATOM 1740 C CB  . LYS A 1 228 ? 8.250   -18.488 236.641 1.00 15.77  ? 228 LYS A CB  1 
ATOM 1741 C CG  . LYS A 1 228 ? 7.211   -18.090 237.675 1.00 13.25  ? 228 LYS A CG  1 
ATOM 1742 C CD  . LYS A 1 228 ? 7.921   -17.626 238.932 1.00 23.52  ? 228 LYS A CD  1 
ATOM 1743 C CE  . LYS A 1 228 ? 6.946   -17.362 240.065 1.00 21.61  ? 228 LYS A CE  1 
ATOM 1744 N NZ  . LYS A 1 228 ? 6.164   -18.581 240.424 1.00 26.86  ? 228 LYS A NZ  1 
ATOM 1745 N N   . HIS A 1 229 ? 6.936   -21.134 236.076 1.00 21.56  ? 229 HIS A N   1 
ATOM 1746 C CA  . HIS A 1 229 ? 5.947   -22.147 236.383 1.00 22.11  ? 229 HIS A CA  1 
ATOM 1747 C C   . HIS A 1 229 ? 5.501   -21.820 237.777 1.00 23.56  ? 229 HIS A C   1 
ATOM 1748 O O   . HIS A 1 229 ? 6.278   -21.236 238.537 1.00 22.75  ? 229 HIS A O   1 
ATOM 1749 C CB  . HIS A 1 229 ? 6.592   -23.530 236.414 1.00 21.41  ? 229 HIS A CB  1 
ATOM 1750 C CG  . HIS A 1 229 ? 7.000   -24.018 235.069 1.00 21.56  ? 229 HIS A CG  1 
ATOM 1751 N ND1 . HIS A 1 229 ? 6.095   -24.156 234.047 1.00 26.30  ? 229 HIS A ND1 1 
ATOM 1752 C CD2 . HIS A 1 229 ? 8.215   -24.316 234.547 1.00 27.50  ? 229 HIS A CD2 1 
ATOM 1753 C CE1 . HIS A 1 229 ? 6.728   -24.504 232.942 1.00 24.77  ? 229 HIS A CE1 1 
ATOM 1754 N NE2 . HIS A 1 229 ? 8.017   -24.611 233.217 1.00 33.51  ? 229 HIS A NE2 1 
ATOM 1755 N N   . GLU A 1 230 ? 4.254   -22.148 238.114 1.00 25.41  ? 230 GLU A N   1 
ATOM 1756 C CA  . GLU A 1 230 ? 3.776   -21.939 239.483 1.00 29.63  ? 230 GLU A CA  1 
ATOM 1757 C C   . GLU A 1 230 ? 4.771   -22.740 240.320 1.00 31.44  ? 230 GLU A C   1 
ATOM 1758 O O   . GLU A 1 230 ? 5.287   -23.759 239.859 1.00 33.28  ? 230 GLU A O   1 
ATOM 1759 C CB  . GLU A 1 230 ? 2.382   -22.562 239.673 1.00 30.59  ? 230 GLU A CB  1 
ATOM 1760 C CG  . GLU A 1 230 ? 1.983   -22.685 241.151 1.00 39.17  ? 230 GLU A CG  1 
ATOM 1761 C CD  . GLU A 1 230 ? 0.783   -23.593 241.393 1.00 54.43  ? 230 GLU A CD  1 
ATOM 1762 O OE1 . GLU A 1 230 ? 0.689   -24.672 240.754 1.00 52.32  ? 230 GLU A OE1 1 
ATOM 1763 O OE2 . GLU A 1 230 ? -0.064  -23.228 242.242 1.00 59.96  ? 230 GLU A OE2 1 
ATOM 1764 N N   . GLY A 1 231 ? 5.084   -22.299 241.525 1.00 33.69  ? 231 GLY A N   1 
ATOM 1765 C CA  . GLY A 1 231 ? 6.026   -23.090 242.308 1.00 32.52  ? 231 GLY A CA  1 
ATOM 1766 C C   . GLY A 1 231 ? 7.491   -22.751 242.075 1.00 31.17  ? 231 GLY A C   1 
ATOM 1767 O O   . GLY A 1 231 ? 8.290   -22.896 242.999 1.00 31.56  ? 231 GLY A O   1 
ATOM 1768 N N   . ALA A 1 232 ? 7.864   -22.358 240.855 1.00 28.18  ? 232 ALA A N   1 
ATOM 1769 C CA  . ALA A 1 232 ? 9.251   -21.972 240.585 1.00 26.38  ? 232 ALA A CA  1 
ATOM 1770 C C   . ALA A 1 232 ? 9.517   -20.687 241.383 1.00 28.87  ? 232 ALA A C   1 
ATOM 1771 O O   . ALA A 1 232 ? 8.604   -19.884 241.632 1.00 28.67  ? 232 ALA A O   1 
ATOM 1772 C CB  . ALA A 1 232 ? 9.489   -21.746 239.094 1.00 20.99  ? 232 ALA A CB  1 
ATOM 1773 N N   . GLN A 1 233 ? 10.762  -20.509 241.798 1.00 30.68  ? 233 GLN A N   1 
ATOM 1774 C CA  . GLN A 1 233 ? 11.139  -19.357 242.605 1.00 34.46  ? 233 GLN A CA  1 
ATOM 1775 C C   . GLN A 1 233 ? 11.480  -18.117 241.781 1.00 31.53  ? 233 GLN A C   1 
ATOM 1776 O O   . GLN A 1 233 ? 11.102  -17.014 242.157 1.00 32.67  ? 233 GLN A O   1 
ATOM 1777 C CB  . GLN A 1 233 ? 12.320  -19.737 243.506 1.00 44.81  ? 233 GLN A CB  1 
ATOM 1778 C CG  . GLN A 1 233 ? 12.617  -18.766 244.639 1.00 57.20  ? 233 GLN A CG  1 
ATOM 1779 C CD  . GLN A 1 233 ? 13.937  -19.087 245.343 1.00 67.07  ? 233 GLN A CD  1 
ATOM 1780 O OE1 . GLN A 1 233 ? 14.364  -20.246 245.403 1.00 69.57  ? 233 GLN A OE1 1 
ATOM 1781 N NE2 . GLN A 1 233 ? 14.603  -18.054 245.851 1.00 71.72  ? 233 GLN A NE2 1 
ATOM 1782 N N   . ASN A 1 234 ? 12.146  -18.305 240.647 1.00 26.58  ? 234 ASN A N   1 
ATOM 1783 C CA  . ASN A 1 234 ? 12.561  -17.183 239.818 1.00 27.12  ? 234 ASN A CA  1 
ATOM 1784 C C   . ASN A 1 234 ? 11.828  -17.043 238.489 1.00 27.08  ? 234 ASN A C   1 
ATOM 1785 O O   . ASN A 1 234 ? 11.220  -17.991 237.997 1.00 28.33  ? 234 ASN A O   1 
ATOM 1786 C CB  . ASN A 1 234 ? 14.074  -17.256 239.572 1.00 28.72  ? 234 ASN A CB  1 
ATOM 1787 C CG  . ASN A 1 234 ? 14.871  -17.303 240.868 1.00 31.41  ? 234 ASN A CG  1 
ATOM 1788 O OD1 . ASN A 1 234 ? 14.574  -16.588 241.836 1.00 29.84  ? 234 ASN A OD1 1 
ATOM 1789 N ND2 . ASN A 1 234 ? 15.884  -18.152 240.898 1.00 30.16  ? 234 ASN A ND2 1 
ATOM 1790 N N   . TRP A 1 235 ? 11.958  -15.865 237.890 1.00 24.53  ? 235 TRP A N   1 
ATOM 1791 C CA  . TRP A 1 235 ? 11.323  -15.545 236.625 1.00 22.02  ? 235 TRP A CA  1 
ATOM 1792 C C   . TRP A 1 235 ? 12.273  -15.687 235.451 1.00 23.05  ? 235 TRP A C   1 
ATOM 1793 O O   . TRP A 1 235 ? 13.449  -15.352 235.553 1.00 24.36  ? 235 TRP A O   1 
ATOM 1794 C CB  . TRP A 1 235 ? 10.798  -14.109 236.679 1.00 20.73  ? 235 TRP A CB  1 
ATOM 1795 C CG  . TRP A 1 235 ? 9.737   -13.929 237.710 1.00 16.94  ? 235 TRP A CG  1 
ATOM 1796 C CD1 . TRP A 1 235 ? 9.916   -13.624 239.031 1.00 16.16  ? 235 TRP A CD1 1 
ATOM 1797 C CD2 . TRP A 1 235 ? 8.327   -14.137 237.526 1.00 16.06  ? 235 TRP A CD2 1 
ATOM 1798 N NE1 . TRP A 1 235 ? 8.700   -13.640 239.686 1.00 20.02  ? 235 TRP A NE1 1 
ATOM 1799 C CE2 . TRP A 1 235 ? 7.714   -13.951 238.788 1.00 14.13  ? 235 TRP A CE2 1 
ATOM 1800 C CE3 . TRP A 1 235 ? 7.530   -14.465 236.423 1.00 18.23  ? 235 TRP A CE3 1 
ATOM 1801 C CZ2 . TRP A 1 235 ? 6.330   -14.087 238.970 1.00 14.39  ? 235 TRP A CZ2 1 
ATOM 1802 C CZ3 . TRP A 1 235 ? 6.151   -14.598 236.608 1.00 13.73  ? 235 TRP A CZ3 1 
ATOM 1803 C CH2 . TRP A 1 235 ? 5.570   -14.406 237.873 1.00 15.33  ? 235 TRP A CH2 1 
ATOM 1804 N N   . ASN A 1 236 ? 11.762  -16.192 234.338 1.00 20.29  ? 236 ASN A N   1 
ATOM 1805 C CA  . ASN A 1 236 ? 12.549  -16.336 233.123 1.00 20.84  ? 236 ASN A CA  1 
ATOM 1806 C C   . ASN A 1 236 ? 12.289  -15.067 232.344 1.00 21.04  ? 236 ASN A C   1 
ATOM 1807 O O   . ASN A 1 236 ? 11.189  -14.514 232.409 1.00 21.03  ? 236 ASN A O   1 
ATOM 1808 C CB  . ASN A 1 236 ? 12.075  -17.519 232.266 1.00 25.20  ? 236 ASN A CB  1 
ATOM 1809 C CG  . ASN A 1 236 ? 12.152  -18.840 232.987 1.00 28.72  ? 236 ASN A CG  1 
ATOM 1810 O OD1 . ASN A 1 236 ? 11.166  -19.572 233.056 1.00 31.38  ? 236 ASN A OD1 1 
ATOM 1811 N ND2 . ASN A 1 236 ? 13.319  -19.155 233.536 1.00 27.60  ? 236 ASN A ND2 1 
ATOM 1812 N N   . ASN A 1 237 ? 13.299  -14.599 231.622 1.00 19.06  ? 237 ASN A N   1 
ATOM 1813 C CA  . ASN A 1 237 ? 13.173  -13.396 230.812 1.00 16.72  ? 237 ASN A CA  1 
ATOM 1814 C C   . ASN A 1 237 ? 12.734  -12.158 231.591 1.00 17.08  ? 237 ASN A C   1 
ATOM 1815 O O   . ASN A 1 237 ? 11.977  -11.336 231.075 1.00 18.64  ? 237 ASN A O   1 
ATOM 1816 C CB  . ASN A 1 237 ? 12.205  -13.643 229.652 1.00 21.68  ? 237 ASN A CB  1 
ATOM 1817 C CG  . ASN A 1 237 ? 12.637  -14.792 228.772 1.00 30.47  ? 237 ASN A CG  1 
ATOM 1818 O OD1 . ASN A 1 237 ? 11.906  -15.764 228.610 1.00 38.67  ? 237 ASN A OD1 1 
ATOM 1819 N ND2 . ASN A 1 237 ? 13.832  -14.695 228.202 1.00 30.74  ? 237 ASN A ND2 1 
ATOM 1820 N N   . ALA A 1 238 ? 13.230  -11.999 232.816 1.00 15.17  ? 238 ALA A N   1 
ATOM 1821 C CA  . ALA A 1 238 ? 12.871  -10.850 233.630 1.00 18.28  ? 238 ALA A CA  1 
ATOM 1822 C C   . ALA A 1 238 ? 13.331  -9.548  232.970 1.00 20.69  ? 238 ALA A C   1 
ATOM 1823 O O   . ALA A 1 238 ? 12.765  -8.479  233.203 1.00 22.75  ? 238 ALA A O   1 
ATOM 1824 C CB  . ALA A 1 238 ? 13.459  -10.984 235.023 1.00 17.92  ? 238 ALA A CB  1 
ATOM 1825 N N   . GLU A 1 239 ? 14.334  -9.646  232.108 1.00 21.22  ? 239 GLU A N   1 
ATOM 1826 C CA  . GLU A 1 239 ? 14.848  -8.471  231.417 1.00 19.97  ? 239 GLU A CA  1 
ATOM 1827 C C   . GLU A 1 239 ? 13.789  -7.803  230.556 1.00 21.37  ? 239 GLU A C   1 
ATOM 1828 O O   . GLU A 1 239 ? 13.954  -6.657  230.174 1.00 20.82  ? 239 GLU A O   1 
ATOM 1829 C CB  . GLU A 1 239 ? 16.092  -8.798  230.579 1.00 19.33  ? 239 GLU A CB  1 
ATOM 1830 C CG  . GLU A 1 239 ? 15.848  -9.662  229.350 1.00 23.39  ? 239 GLU A CG  1 
ATOM 1831 C CD  . GLU A 1 239 ? 15.741  -11.170 229.650 1.00 36.74  ? 239 GLU A CD  1 
ATOM 1832 O OE1 . GLU A 1 239 ? 16.118  -11.625 230.760 1.00 30.49  ? 239 GLU A OE1 1 
ATOM 1833 O OE2 . GLU A 1 239 ? 15.285  -11.909 228.746 1.00 39.01  ? 239 GLU A OE2 1 
ATOM 1834 N N   . ARG A 1 240 ? 12.691  -8.493  230.263 1.00 20.70  ? 240 ARG A N   1 
ATOM 1835 C CA  . ARG A 1 240 ? 11.633  -7.886  229.455 1.00 21.65  ? 240 ARG A CA  1 
ATOM 1836 C C   . ARG A 1 240 ? 10.998  -6.652  230.097 1.00 19.40  ? 240 ARG A C   1 
ATOM 1837 O O   . ARG A 1 240 ? 10.376  -5.861  229.398 1.00 21.32  ? 240 ARG A O   1 
ATOM 1838 C CB  . ARG A 1 240 ? 10.543  -8.911  229.108 1.00 22.82  ? 240 ARG A CB  1 
ATOM 1839 C CG  . ARG A 1 240 ? 10.981  -9.894  228.043 1.00 34.11  ? 240 ARG A CG  1 
ATOM 1840 C CD  . ARG A 1 240 ? 9.992   -11.019 227.894 1.00 43.30  ? 240 ARG A CD  1 
ATOM 1841 N NE  . ARG A 1 240 ? 10.453  -12.028 226.942 1.00 41.35  ? 240 ARG A NE  1 
ATOM 1842 C CZ  . ARG A 1 240 ? 9.911   -13.238 226.803 1.00 40.28  ? 240 ARG A CZ  1 
ATOM 1843 N NH1 . ARG A 1 240 ? 8.873   -13.613 227.549 1.00 31.54  ? 240 ARG A NH1 1 
ATOM 1844 N NH2 . ARG A 1 240 ? 10.430  -14.093 225.929 1.00 42.47  ? 240 ARG A NH2 1 
ATOM 1845 N N   . LEU A 1 241 ? 11.142  -6.483  231.413 1.00 17.81  ? 241 LEU A N   1 
ATOM 1846 C CA  . LEU A 1 241 ? 10.565  -5.321  232.100 1.00 20.49  ? 241 LEU A CA  1 
ATOM 1847 C C   . LEU A 1 241 ? 11.640  -4.415  232.706 1.00 23.41  ? 241 LEU A C   1 
ATOM 1848 O O   . LEU A 1 241 ? 11.336  -3.532  233.512 1.00 22.97  ? 241 LEU A O   1 
ATOM 1849 C CB  . LEU A 1 241 ? 9.603   -5.760  233.212 1.00 19.66  ? 241 LEU A CB  1 
ATOM 1850 C CG  . LEU A 1 241 ? 8.334   -6.519  232.805 1.00 23.80  ? 241 LEU A CG  1 
ATOM 1851 C CD1 . LEU A 1 241 ? 7.495   -6.758  234.034 1.00 21.21  ? 241 LEU A CD1 1 
ATOM 1852 C CD2 . LEU A 1 241 ? 7.535   -5.748  231.777 1.00 15.42  ? 241 LEU A CD2 1 
ATOM 1853 N N   . VAL A 1 242 ? 12.888  -4.623  232.295 1.00 26.67  ? 242 VAL A N   1 
ATOM 1854 C CA  . VAL A 1 242 ? 14.015  -3.855  232.818 1.00 26.35  ? 242 VAL A CA  1 
ATOM 1855 C C   . VAL A 1 242 ? 14.879  -3.262  231.710 1.00 28.41  ? 242 VAL A C   1 
ATOM 1856 O O   . VAL A 1 242 ? 15.161  -3.911  230.705 1.00 30.62  ? 242 VAL A O   1 
ATOM 1857 C CB  . VAL A 1 242 ? 14.896  -4.740  233.704 1.00 28.61  ? 242 VAL A CB  1 
ATOM 1858 C CG1 . VAL A 1 242 ? 16.053  -3.940  234.258 1.00 31.74  ? 242 VAL A CG1 1 
ATOM 1859 C CG2 . VAL A 1 242 ? 14.069  -5.334  234.832 1.00 22.05  ? 242 VAL A CG2 1 
ATOM 1860 N N   . GLU A 1 243 ? 15.311  -2.025  231.904 1.00 28.51  ? 243 GLU A N   1 
ATOM 1861 C CA  . GLU A 1 243 ? 16.151  -1.354  230.921 1.00 30.41  ? 243 GLU A CA  1 
ATOM 1862 C C   . GLU A 1 243 ? 17.344  -0.807  231.683 1.00 29.38  ? 243 GLU A C   1 
ATOM 1863 O O   . GLU A 1 243 ? 17.230  -0.479  232.867 1.00 28.70  ? 243 GLU A O   1 
ATOM 1864 C CB  . GLU A 1 243 ? 15.395  -0.193  230.266 1.00 36.58  ? 243 GLU A CB  1 
ATOM 1865 C CG  . GLU A 1 243 ? 15.711  0.017   228.795 1.00 52.36  ? 243 GLU A CG  1 
ATOM 1866 C CD  . GLU A 1 243 ? 15.233  -1.143  227.928 1.00 61.87  ? 243 GLU A CD  1 
ATOM 1867 O OE1 . GLU A 1 243 ? 14.050  -1.133  227.524 1.00 68.42  ? 243 GLU A OE1 1 
ATOM 1868 O OE2 . GLU A 1 243 ? 16.034  -2.063  227.648 1.00 67.96  ? 243 GLU A OE2 1 
ATOM 1869 N N   . PHE A 1 244 ? 18.495  -0.776  231.025 1.00 26.81  ? 244 PHE A N   1 
ATOM 1870 C CA  . PHE A 1 244 ? 19.715  -0.257  231.629 1.00 27.24  ? 244 PHE A CA  1 
ATOM 1871 C C   . PHE A 1 244 ? 20.138  1.014   230.905 1.00 27.14  ? 244 PHE A C   1 
ATOM 1872 O O   . PHE A 1 244 ? 20.020  1.101   229.683 1.00 25.73  ? 244 PHE A O   1 
ATOM 1873 C CB  . PHE A 1 244 ? 20.830  -1.307  231.574 1.00 24.35  ? 244 PHE A CB  1 
ATOM 1874 C CG  . PHE A 1 244 ? 20.668  -2.418  232.584 1.00 26.46  ? 244 PHE A CG  1 
ATOM 1875 C CD1 . PHE A 1 244 ? 21.112  -2.255  233.896 1.00 27.31  ? 244 PHE A CD1 1 
ATOM 1876 C CD2 . PHE A 1 244 ? 20.067  -3.627  232.227 1.00 24.42  ? 244 PHE A CD2 1 
ATOM 1877 C CE1 . PHE A 1 244 ? 20.960  -3.280  234.837 1.00 31.70  ? 244 PHE A CE1 1 
ATOM 1878 C CE2 . PHE A 1 244 ? 19.913  -4.656  233.167 1.00 21.13  ? 244 PHE A CE2 1 
ATOM 1879 C CZ  . PHE A 1 244 ? 20.360  -4.478  234.468 1.00 25.11  ? 244 PHE A CZ  1 
ATOM 1880 N N   . GLY A 1 245 ? 20.557  2.025   231.663 1.00 26.73  ? 245 GLY A N   1 
ATOM 1881 C CA  . GLY A 1 245 ? 20.994  3.269   231.050 1.00 27.10  ? 245 GLY A CA  1 
ATOM 1882 C C   . GLY A 1 245 ? 22.436  3.165   230.570 1.00 28.46  ? 245 GLY A C   1 
ATOM 1883 O O   . GLY A 1 245 ? 23.137  2.199   230.897 1.00 26.42  ? 245 GLY A O   1 
ATOM 1884 N N   . ALA A 1 246 ? 22.873  4.119   229.750 1.00 28.88  ? 246 ALA A N   1 
ATOM 1885 C CA  . ALA A 1 246 ? 24.251  4.118   229.267 1.00 27.56  ? 246 ALA A CA  1 
ATOM 1886 C C   . ALA A 1 246 ? 25.103  4.341   230.519 1.00 27.59  ? 246 ALA A C   1 
ATOM 1887 O O   . ALA A 1 246 ? 24.722  5.116   231.411 1.00 27.90  ? 246 ALA A O   1 
ATOM 1888 C CB  . ALA A 1 246 ? 24.460  5.240   228.257 1.00 21.94  ? 246 ALA A CB  1 
ATOM 1889 N N   . PRO A 1 247 ? 26.227  3.623   230.644 1.00 27.66  ? 247 PRO A N   1 
ATOM 1890 C CA  . PRO A 1 247 ? 27.052  3.816   231.837 1.00 29.83  ? 247 PRO A CA  1 
ATOM 1891 C C   . PRO A 1 247 ? 27.873  5.094   231.784 1.00 31.32  ? 247 PRO A C   1 
ATOM 1892 O O   . PRO A 1 247 ? 28.172  5.594   230.707 1.00 30.92  ? 247 PRO A O   1 
ATOM 1893 C CB  . PRO A 1 247 ? 27.949  2.584   231.817 1.00 32.30  ? 247 PRO A CB  1 
ATOM 1894 C CG  . PRO A 1 247 ? 28.195  2.397   230.346 1.00 27.59  ? 247 PRO A CG  1 
ATOM 1895 C CD  . PRO A 1 247 ? 26.828  2.635   229.729 1.00 28.75  ? 247 PRO A CD  1 
ATOM 1896 N N   . HIS A 1 248 ? 28.158  5.661   232.948 1.00 35.77  ? 248 HIS A N   1 
ATOM 1897 C CA  . HIS A 1 248 ? 29.018  6.846   233.039 1.00 42.89  ? 248 HIS A CA  1 
ATOM 1898 C C   . HIS A 1 248 ? 29.917  6.681   234.257 1.00 44.17  ? 248 HIS A C   1 
ATOM 1899 O O   . HIS A 1 248 ? 29.453  6.696   235.405 1.00 47.82  ? 248 HIS A O   1 
ATOM 1900 C CB  . HIS A 1 248 ? 28.254  8.197   233.030 1.00 51.99  ? 248 HIS A CB  1 
ATOM 1901 C CG  . HIS A 1 248 ? 26.988  8.218   233.839 1.00 65.28  ? 248 HIS A CG  1 
ATOM 1902 N ND1 . HIS A 1 248 ? 26.781  7.414   234.943 1.00 71.77  ? 248 HIS A ND1 1 
ATOM 1903 C CD2 . HIS A 1 248 ? 25.856  8.951   233.693 1.00 66.00  ? 248 HIS A CD2 1 
ATOM 1904 C CE1 . HIS A 1 248 ? 25.576  7.650   235.439 1.00 68.97  ? 248 HIS A CE1 1 
ATOM 1905 N NE2 . HIS A 1 248 ? 24.996  8.578   234.699 1.00 69.60  ? 248 HIS A NE2 1 
ATOM 1906 N N   . ALA A 1 249 ? 31.198  6.450   233.980 1.00 41.42  ? 249 ALA A N   1 
ATOM 1907 C CA  . ALA A 1 249 ? 32.220  6.225   235.002 1.00 38.08  ? 249 ALA A CA  1 
ATOM 1908 C C   . ALA A 1 249 ? 31.972  4.918   235.757 1.00 34.32  ? 249 ALA A C   1 
ATOM 1909 O O   . ALA A 1 249 ? 32.078  3.850   235.168 1.00 32.97  ? 249 ALA A O   1 
ATOM 1910 C CB  . ALA A 1 249 ? 32.326  7.410   235.963 1.00 38.10  ? 249 ALA A CB  1 
ATOM 1911 N N   . VAL A 1 250 ? 31.597  5.000   237.030 1.00 31.14  ? 250 VAL A N   1 
ATOM 1912 C CA  . VAL A 1 250 ? 31.383  3.789   237.828 1.00 30.58  ? 250 VAL A CA  1 
ATOM 1913 C C   . VAL A 1 250 ? 29.903  3.540   238.138 1.00 31.09  ? 250 VAL A C   1 
ATOM 1914 O O   . VAL A 1 250 ? 29.573  2.813   239.091 1.00 30.13  ? 250 VAL A O   1 
ATOM 1915 C CB  . VAL A 1 250 ? 32.189  3.835   239.177 1.00 32.96  ? 250 VAL A CB  1 
ATOM 1916 C CG1 . VAL A 1 250 ? 33.684  4.030   238.909 1.00 34.59  ? 250 VAL A CG1 1 
ATOM 1917 C CG2 . VAL A 1 250 ? 31.697  4.961   240.081 1.00 33.96  ? 250 VAL A CG2 1 
ATOM 1918 N N   . LYS A 1 251 ? 29.011  4.108   237.329 1.00 31.24  ? 251 LYS A N   1 
ATOM 1919 C CA  . LYS A 1 251 ? 27.577  3.957   237.564 1.00 30.73  ? 251 LYS A CA  1 
ATOM 1920 C C   . LYS A 1 251 ? 26.819  3.608   236.307 1.00 27.78  ? 251 LYS A C   1 
ATOM 1921 O O   . LYS A 1 251 ? 27.198  4.004   235.205 1.00 28.20  ? 251 LYS A O   1 
ATOM 1922 C CB  . LYS A 1 251 ? 26.998  5.254   238.129 1.00 35.13  ? 251 LYS A CB  1 
ATOM 1923 C CG  . LYS A 1 251 ? 27.504  5.625   239.503 1.00 48.96  ? 251 LYS A CG  1 
ATOM 1924 C CD  . LYS A 1 251 ? 26.962  6.968   239.941 1.00 62.73  ? 251 LYS A CD  1 
ATOM 1925 C CE  . LYS A 1 251 ? 27.486  7.361   241.308 1.00 72.88  ? 251 LYS A CE  1 
ATOM 1926 N NZ  . LYS A 1 251 ? 26.926  8.664   241.740 1.00 81.26  ? 251 LYS A NZ  1 
ATOM 1927 N N   . MET A 1 252 ? 25.707  2.909   236.495 1.00 27.01  ? 252 MET A N   1 
ATOM 1928 C CA  . MET A 1 252 ? 24.819  2.509   235.405 1.00 27.10  ? 252 MET A CA  1 
ATOM 1929 C C   . MET A 1 252 ? 23.402  2.408   236.003 1.00 26.47  ? 252 MET A C   1 
ATOM 1930 O O   . MET A 1 252 ? 23.190  1.717   237.009 1.00 24.95  ? 252 MET A O   1 
ATOM 1931 C CB  . MET A 1 252 ? 25.266  1.170   234.815 1.00 25.88  ? 252 MET A CB  1 
ATOM 1932 C CG  . MET A 1 252 ? 24.474  0.742   233.602 1.00 30.26  ? 252 MET A CG  1 
ATOM 1933 S SD  . MET A 1 252 ? 25.341  -0.467  232.585 1.00 43.84  ? 252 MET A SD  1 
ATOM 1934 C CE  . MET A 1 252 ? 25.933  -1.604  233.791 1.00 37.25  ? 252 MET A CE  1 
ATOM 1935 N N   . ASP A 1 253 ? 22.476  3.201   235.468 1.00 26.09  ? 253 ASP A N   1 
ATOM 1936 C CA  . ASP A 1 253 ? 21.092  3.236   235.959 1.00 26.51  ? 253 ASP A CA  1 
ATOM 1937 C C   . ASP A 1 253 ? 20.236  2.043   235.490 1.00 25.40  ? 253 ASP A C   1 
ATOM 1938 O O   . ASP A 1 253 ? 20.368  1.541   234.371 1.00 24.41  ? 253 ASP A O   1 
ATOM 1939 C CB  . ASP A 1 253 ? 20.393  4.526   235.499 1.00 26.37  ? 253 ASP A CB  1 
ATOM 1940 C CG  . ASP A 1 253 ? 21.003  5.791   236.091 1.00 39.75  ? 253 ASP A CG  1 
ATOM 1941 O OD1 . ASP A 1 253 ? 21.339  5.803   237.302 1.00 39.45  ? 253 ASP A OD1 1 
ATOM 1942 O OD2 . ASP A 1 253 ? 21.116  6.782   235.331 1.00 43.18  ? 253 ASP A OD2 1 
ATOM 1943 N N   . VAL A 1 254 ? 19.318  1.638   236.348 1.00 26.61  ? 254 VAL A N   1 
ATOM 1944 C CA  . VAL A 1 254 ? 18.406  0.551   236.049 1.00 26.47  ? 254 VAL A CA  1 
ATOM 1945 C C   . VAL A 1 254 ? 16.999  1.148   236.039 1.00 23.22  ? 254 VAL A C   1 
ATOM 1946 O O   . VAL A 1 254 ? 16.587  1.806   237.000 1.00 22.58  ? 254 VAL A O   1 
ATOM 1947 C CB  . VAL A 1 254 ? 18.489  -0.544  237.118 1.00 29.09  ? 254 VAL A CB  1 
ATOM 1948 C CG1 . VAL A 1 254 ? 17.558  -1.680  236.767 1.00 29.42  ? 254 VAL A CG1 1 
ATOM 1949 C CG2 . VAL A 1 254 ? 19.918  -1.045  237.209 1.00 36.23  ? 254 VAL A CG2 1 
ATOM 1950 N N   . TYR A 1 255 ? 16.277  0.917   234.950 1.00 23.27  ? 255 TYR A N   1 
ATOM 1951 C CA  . TYR A 1 255 ? 14.913  1.420   234.784 1.00 24.37  ? 255 TYR A CA  1 
ATOM 1952 C C   . TYR A 1 255 ? 13.859  0.307   234.764 1.00 24.36  ? 255 TYR A C   1 
ATOM 1953 O O   . TYR A 1 255 ? 14.058  -0.754  234.174 1.00 22.89  ? 255 TYR A O   1 
ATOM 1954 C CB  . TYR A 1 255 ? 14.820  2.226   233.493 1.00 26.86  ? 255 TYR A CB  1 
ATOM 1955 C CG  . TYR A 1 255 ? 15.822  3.350   233.443 1.00 35.32  ? 255 TYR A CG  1 
ATOM 1956 C CD1 . TYR A 1 255 ? 15.845  4.340   234.437 1.00 32.39  ? 255 TYR A CD1 1 
ATOM 1957 C CD2 . TYR A 1 255 ? 16.754  3.427   232.413 1.00 33.12  ? 255 TYR A CD2 1 
ATOM 1958 C CE1 . TYR A 1 255 ? 16.772  5.376   234.398 1.00 31.78  ? 255 TYR A CE1 1 
ATOM 1959 C CE2 . TYR A 1 255 ? 17.688  4.460   232.367 1.00 33.81  ? 255 TYR A CE2 1 
ATOM 1960 C CZ  . TYR A 1 255 ? 17.692  5.430   233.360 1.00 36.75  ? 255 TYR A CZ  1 
ATOM 1961 O OH  . TYR A 1 255 ? 18.618  6.452   233.312 1.00 40.22  ? 255 TYR A OH  1 
ATOM 1962 N N   . ASN A 1 256 ? 12.738  0.562   235.416 1.00 21.66  ? 256 ASN A N   1 
ATOM 1963 C CA  . ASN A 1 256 ? 11.651  -0.397  235.465 1.00 21.16  ? 256 ASN A CA  1 
ATOM 1964 C C   . ASN A 1 256 ? 10.613  0.079   234.466 1.00 19.96  ? 256 ASN A C   1 
ATOM 1965 O O   . ASN A 1 256 ? 10.230  1.242   234.500 1.00 20.33  ? 256 ASN A O   1 
ATOM 1966 C CB  . ASN A 1 256 ? 11.060  -0.404  236.867 1.00 17.45  ? 256 ASN A CB  1 
ATOM 1967 C CG  . ASN A 1 256 ? 10.016  -1.465  237.047 1.00 19.06  ? 256 ASN A CG  1 
ATOM 1968 O OD1 . ASN A 1 256 ? 9.277   -1.797  236.115 1.00 17.72  ? 256 ASN A OD1 1 
ATOM 1969 N ND2 . ASN A 1 256 ? 9.942   -2.010  238.249 1.00 12.53  ? 256 ASN A ND2 1 
ATOM 1970 N N   . LEU A 1 257 ? 10.157  -0.802  233.582 1.00 18.10  ? 257 LEU A N   1 
ATOM 1971 C CA  . LEU A 1 257 ? 9.157   -0.413  232.593 1.00 16.30  ? 257 LEU A CA  1 
ATOM 1972 C C   . LEU A 1 257 ? 7.717   -0.215  233.116 1.00 17.78  ? 257 LEU A C   1 
ATOM 1973 O O   . LEU A 1 257 ? 6.804   0.058   232.329 1.00 15.23  ? 257 LEU A O   1 
ATOM 1974 C CB  . LEU A 1 257 ? 9.176   -1.356  231.392 1.00 20.43  ? 257 LEU A CB  1 
ATOM 1975 C CG  . LEU A 1 257 ? 10.477  -1.301  230.592 1.00 22.88  ? 257 LEU A CG  1 
ATOM 1976 C CD1 . LEU A 1 257 ? 10.321  -2.111  229.328 1.00 22.32  ? 257 LEU A CD1 1 
ATOM 1977 C CD2 . LEU A 1 257 ? 10.813  0.138   230.266 1.00 27.35  ? 257 LEU A CD2 1 
ATOM 1978 N N   . GLY A 1 258 ? 7.528   -0.344  234.430 1.00 15.34  ? 258 GLY A N   1 
ATOM 1979 C CA  . GLY A 1 258 ? 6.231   -0.126  235.035 1.00 15.82  ? 258 GLY A CA  1 
ATOM 1980 C C   . GLY A 1 258 ? 5.216   -1.238  234.883 1.00 17.18  ? 258 GLY A C   1 
ATOM 1981 O O   . GLY A 1 258 ? 5.458   -2.263  234.221 1.00 18.03  ? 258 GLY A O   1 
ATOM 1982 N N   . ASP A 1 259 ? 4.058   -0.999  235.489 1.00 14.84  ? 259 ASP A N   1 
ATOM 1983 C CA  . ASP A 1 259 ? 2.941   -1.936  235.505 1.00 13.85  ? 259 ASP A CA  1 
ATOM 1984 C C   . ASP A 1 259 ? 2.336   -2.092  234.111 1.00 15.53  ? 259 ASP A C   1 
ATOM 1985 O O   . ASP A 1 259 ? 1.840   -1.120  233.529 1.00 16.54  ? 259 ASP A O   1 
ATOM 1986 C CB  . ASP A 1 259 ? 1.890   -1.444  236.510 1.00 15.41  ? 259 ASP A CB  1 
ATOM 1987 C CG  . ASP A 1 259 ? 0.761   -2.449  236.735 1.00 21.23  ? 259 ASP A CG  1 
ATOM 1988 O OD1 . ASP A 1 259 ? 0.699   -3.479  236.033 1.00 20.25  ? 259 ASP A OD1 1 
ATOM 1989 O OD2 . ASP A 1 259 ? -0.061  -2.208  237.631 1.00 18.40  ? 259 ASP A OD2 1 
ATOM 1990 N N   . GLN A 1 260 ? 2.365   -3.322  233.599 1.00 15.01  ? 260 GLN A N   1 
ATOM 1991 C CA  . GLN A 1 260 ? 1.838   -3.653  232.276 1.00 15.13  ? 260 GLN A CA  1 
ATOM 1992 C C   . GLN A 1 260 ? 0.338   -4.005  232.237 1.00 12.96  ? 260 GLN A C   1 
ATOM 1993 O O   . GLN A 1 260 ? -0.207  -4.296  231.182 1.00 16.21  ? 260 GLN A O   1 
ATOM 1994 C CB  . GLN A 1 260 ? 2.660   -4.800  231.672 1.00 14.32  ? 260 GLN A CB  1 
ATOM 1995 C CG  . GLN A 1 260 ? 4.146   -4.494  231.577 1.00 17.17  ? 260 GLN A CG  1 
ATOM 1996 C CD  . GLN A 1 260 ? 4.425   -3.276  230.691 1.00 24.86  ? 260 GLN A CD  1 
ATOM 1997 O OE1 . GLN A 1 260 ? 4.113   -3.276  229.493 1.00 14.60  ? 260 GLN A OE1 1 
ATOM 1998 N NE2 . GLN A 1 260 ? 4.997   -2.230  231.280 1.00 15.43  ? 260 GLN A NE2 1 
ATOM 1999 N N   . THR A 1 261 ? -0.330  -3.941  233.373 1.00 13.42  ? 261 THR A N   1 
ATOM 2000 C CA  . THR A 1 261 ? -1.752  -4.269  233.451 1.00 14.45  ? 261 THR A CA  1 
ATOM 2001 C C   . THR A 1 261 ? -2.601  -3.468  232.456 1.00 16.24  ? 261 THR A C   1 
ATOM 2002 O O   . THR A 1 261 ? -3.427  -4.041  231.719 1.00 16.88  ? 261 THR A O   1 
ATOM 2003 C CB  . THR A 1 261 ? -2.275  -4.050  234.880 1.00 15.00  ? 261 THR A CB  1 
ATOM 2004 O OG1 . THR A 1 261 ? -1.521  -4.875  235.780 1.00 14.63  ? 261 THR A OG1 1 
ATOM 2005 C CG2 . THR A 1 261 ? -3.779  -4.401  234.977 1.00 20.23  ? 261 THR A CG2 1 
ATOM 2006 N N   . GLY A 1 262 ? -2.366  -2.156  232.408 1.00 11.74  ? 262 GLY A N   1 
ATOM 2007 C CA  . GLY A 1 262 ? -3.115  -1.303  231.499 1.00 11.14  ? 262 GLY A CA  1 
ATOM 2008 C C   . GLY A 1 262 ? -2.913  -1.716  230.054 1.00 14.53  ? 262 GLY A C   1 
ATOM 2009 O O   . GLY A 1 262 ? -3.850  -1.704  229.250 1.00 16.62  ? 262 GLY A O   1 
ATOM 2010 N N   . VAL A 1 263 ? -1.685  -2.109  229.730 1.00 13.81  ? 263 VAL A N   1 
ATOM 2011 C CA  . VAL A 1 263 ? -1.335  -2.551  228.392 1.00 15.00  ? 263 VAL A CA  1 
ATOM 2012 C C   . VAL A 1 263 ? -2.083  -3.852  228.088 1.00 18.13  ? 263 VAL A C   1 
ATOM 2013 O O   . VAL A 1 263 ? -2.655  -4.003  227.007 1.00 19.89  ? 263 VAL A O   1 
ATOM 2014 C CB  . VAL A 1 263 ? 0.185   -2.837  228.273 1.00 17.67  ? 263 VAL A CB  1 
ATOM 2015 C CG1 . VAL A 1 263 ? 0.509   -3.454  226.908 1.00 14.95  ? 263 VAL A CG1 1 
ATOM 2016 C CG2 . VAL A 1 263 ? 0.987   -1.557  228.511 1.00 16.22  ? 263 VAL A CG2 1 
ATOM 2017 N N   . LEU A 1 264 ? -2.070  -4.790  229.033 1.00 15.48  ? 264 LEU A N   1 
ATOM 2018 C CA  . LEU A 1 264 ? -2.752  -6.070  228.826 1.00 18.85  ? 264 LEU A CA  1 
ATOM 2019 C C   . LEU A 1 264 ? -4.257  -5.876  228.649 1.00 17.64  ? 264 LEU A C   1 
ATOM 2020 O O   . LEU A 1 264 ? -4.852  -6.435  227.732 1.00 16.76  ? 264 LEU A O   1 
ATOM 2021 C CB  . LEU A 1 264 ? -2.508  -7.013  230.013 1.00 20.53  ? 264 LEU A CB  1 
ATOM 2022 C CG  . LEU A 1 264 ? -2.945  -8.455  229.774 1.00 19.36  ? 264 LEU A CG  1 
ATOM 2023 C CD1 . LEU A 1 264 ? -2.143  -9.044  228.635 1.00 23.14  ? 264 LEU A CD1 1 
ATOM 2024 C CD2 . LEU A 1 264 ? -2.723  -9.261  231.027 1.00 25.40  ? 264 LEU A CD2 1 
ATOM 2025 N N   . LEU A 1 265 ? -4.853  -5.050  229.507 1.00 17.09  ? 265 LEU A N   1 
ATOM 2026 C CA  . LEU A 1 265 ? -6.285  -4.785  229.463 1.00 19.68  ? 265 LEU A CA  1 
ATOM 2027 C C   . LEU A 1 265 ? -6.768  -4.230  228.118 1.00 22.21  ? 265 LEU A C   1 
ATOM 2028 O O   . LEU A 1 265 ? -7.905  -4.514  227.715 1.00 21.27  ? 265 LEU A O   1 
ATOM 2029 C CB  . LEU A 1 265 ? -6.710  -3.880  230.631 1.00 18.05  ? 265 LEU A CB  1 
ATOM 2030 C CG  . LEU A 1 265 ? -6.671  -4.536  232.017 1.00 20.62  ? 265 LEU A CG  1 
ATOM 2031 C CD1 . LEU A 1 265 ? -7.038  -3.529  233.088 1.00 19.02  ? 265 LEU A CD1 1 
ATOM 2032 C CD2 . LEU A 1 265 ? -7.630  -5.708  232.074 1.00 18.15  ? 265 LEU A CD2 1 
ATOM 2033 N N   . LYS A 1 266 ? -5.912  -3.465  227.425 1.00 21.39  ? 266 LYS A N   1 
ATOM 2034 C CA  . LYS A 1 266 ? -6.255  -2.911  226.111 1.00 23.21  ? 266 LYS A CA  1 
ATOM 2035 C C   . LYS A 1 266 ? -6.294  -4.058  225.128 1.00 24.47  ? 266 LYS A C   1 
ATOM 2036 O O   . LYS A 1 266 ? -7.158  -4.114  224.269 1.00 26.41  ? 266 LYS A O   1 
ATOM 2037 C CB  . LYS A 1 266 ? -5.232  -1.876  225.635 1.00 26.73  ? 266 LYS A CB  1 
ATOM 2038 C CG  . LYS A 1 266 ? -5.226  -0.596  226.450 1.00 39.02  ? 266 LYS A CG  1 
ATOM 2039 C CD  . LYS A 1 266 ? -4.435  0.527   225.769 1.00 48.09  ? 266 LYS A CD  1 
ATOM 2040 C CE  . LYS A 1 266 ? -4.687  1.867   226.473 1.00 52.18  ? 266 LYS A CE  1 
ATOM 2041 N NZ  . LYS A 1 266 ? -4.197  3.032   225.678 1.00 60.19  ? 266 LYS A NZ  1 
ATOM 2042 N N   . ALA A 1 267 ? -5.358  -4.987  225.267 1.00 26.49  ? 267 ALA A N   1 
ATOM 2043 C CA  . ALA A 1 267 ? -5.318  -6.160  224.402 1.00 27.07  ? 267 ALA A CA  1 
ATOM 2044 C C   . ALA A 1 267 ? -6.531  -7.058  224.653 1.00 28.40  ? 267 ALA A C   1 
ATOM 2045 O O   . ALA A 1 267 ? -7.027  -7.695  223.736 1.00 31.03  ? 267 ALA A O   1 
ATOM 2046 C CB  . ALA A 1 267 ? -4.037  -6.945  224.650 1.00 27.61  ? 267 ALA A CB  1 
ATOM 2047 N N   . LEU A 1 268 ? -7.014  -7.087  225.895 1.00 29.82  ? 268 LEU A N   1 
ATOM 2048 C CA  . LEU A 1 268 ? -8.149  -7.928  226.296 1.00 29.14  ? 268 LEU A CA  1 
ATOM 2049 C C   . LEU A 1 268 ? -9.545  -7.381  226.000 1.00 33.37  ? 268 LEU A C   1 
ATOM 2050 O O   . LEU A 1 268 ? -10.545 -8.037  226.298 1.00 33.46  ? 268 LEU A O   1 
ATOM 2051 C CB  . LEU A 1 268 ? -8.063  -8.262  227.789 1.00 20.35  ? 268 LEU A CB  1 
ATOM 2052 C CG  . LEU A 1 268 ? -6.886  -9.106  228.283 1.00 24.38  ? 268 LEU A CG  1 
ATOM 2053 C CD1 . LEU A 1 268 ? -6.939  -9.210  229.800 1.00 18.59  ? 268 LEU A CD1 1 
ATOM 2054 C CD2 . LEU A 1 268 ? -6.914  -10.480 227.644 1.00 19.59  ? 268 LEU A CD2 1 
ATOM 2055 N N   . ALA A 1 269 ? -9.634  -6.157  225.495 1.00 36.77  ? 269 ALA A N   1 
ATOM 2056 C CA  . ALA A 1 269 ? -10.943 -5.598  225.169 1.00 38.89  ? 269 ALA A CA  1 
ATOM 2057 C C   . ALA A 1 269 ? -11.439 -6.413  223.978 1.00 38.92  ? 269 ALA A C   1 
ATOM 2058 O O   . ALA A 1 269 ? -10.655 -6.777  223.093 1.00 42.08  ? 269 ALA A O   1 
ATOM 2059 C CB  . ALA A 1 269 ? -10.819 -4.133  224.797 1.00 37.77  ? 269 ALA A CB  1 
ATOM 2060 N N   . GLY A 1 270 ? -12.709 -6.782  223.984 1.00 38.79  ? 270 GLY A N   1 
ATOM 2061 C CA  . GLY A 1 270 ? -13.210 -7.563  222.863 1.00 38.81  ? 270 GLY A CA  1 
ATOM 2062 C C   . GLY A 1 270 ? -12.964 -9.058  222.992 1.00 37.04  ? 270 GLY A C   1 
ATOM 2063 O O   . GLY A 1 270 ? -13.436 -9.835  222.160 1.00 40.79  ? 270 GLY A O   1 
ATOM 2064 N N   . VAL A 1 271 ? -12.178 -9.465  223.983 1.00 31.15  ? 271 VAL A N   1 
ATOM 2065 C CA  . VAL A 1 271 ? -11.932 -10.882 224.232 1.00 28.33  ? 271 VAL A CA  1 
ATOM 2066 C C   . VAL A 1 271 ? -13.089 -11.318 225.158 1.00 24.94  ? 271 VAL A C   1 
ATOM 2067 O O   . VAL A 1 271 ? -13.563 -10.529 225.979 1.00 23.50  ? 271 VAL A O   1 
ATOM 2068 C CB  . VAL A 1 271 ? -10.572 -11.079 224.948 1.00 30.54  ? 271 VAL A CB  1 
ATOM 2069 C CG1 . VAL A 1 271 ? -10.500 -12.431 225.608 1.00 24.00  ? 271 VAL A CG1 1 
ATOM 2070 C CG2 . VAL A 1 271 ? -9.434  -10.925 223.956 1.00 24.77  ? 271 VAL A CG2 1 
ATOM 2071 N N   . PRO A 1 272 ? -13.616 -12.539 224.978 1.00 23.60  ? 272 PRO A N   1 
ATOM 2072 C CA  . PRO A 1 272 ? -14.717 -12.943 225.869 1.00 21.48  ? 272 PRO A CA  1 
ATOM 2073 C C   . PRO A 1 272 ? -14.316 -13.158 227.335 1.00 20.62  ? 272 PRO A C   1 
ATOM 2074 O O   . PRO A 1 272 ? -13.216 -13.651 227.631 1.00 19.85  ? 272 PRO A O   1 
ATOM 2075 C CB  . PRO A 1 272 ? -15.241 -14.231 225.214 1.00 20.96  ? 272 PRO A CB  1 
ATOM 2076 C CG  . PRO A 1 272 ? -14.074 -14.750 224.407 1.00 25.78  ? 272 PRO A CG  1 
ATOM 2077 C CD  . PRO A 1 272 ? -13.440 -13.494 223.865 1.00 24.34  ? 272 PRO A CD  1 
ATOM 2078 N N   . VAL A 1 273 ? -15.186 -12.753 228.260 1.00 19.37  ? 273 VAL A N   1 
ATOM 2079 C CA  . VAL A 1 273 ? -14.890 -12.944 229.673 1.00 19.68  ? 273 VAL A CA  1 
ATOM 2080 C C   . VAL A 1 273 ? -15.241 -14.377 230.098 1.00 20.98  ? 273 VAL A C   1 
ATOM 2081 O O   . VAL A 1 273 ? -15.944 -15.114 229.378 1.00 18.57  ? 273 VAL A O   1 
ATOM 2082 C CB  . VAL A 1 273 ? -15.649 -11.938 230.591 1.00 21.28  ? 273 VAL A CB  1 
ATOM 2083 C CG1 . VAL A 1 273 ? -15.278 -10.504 230.229 1.00 21.51  ? 273 VAL A CG1 1 
ATOM 2084 C CG2 . VAL A 1 273 ? -17.146 -12.135 230.491 1.00 21.81  ? 273 VAL A CG2 1 
ATOM 2085 N N   . ALA A 1 274 ? -14.690 -14.775 231.240 1.00 17.33  ? 274 ALA A N   1 
ATOM 2086 C CA  . ALA A 1 274 ? -14.930 -16.075 231.833 1.00 16.71  ? 274 ALA A CA  1 
ATOM 2087 C C   . ALA A 1 274 ? -15.216 -15.704 233.287 1.00 16.52  ? 274 ALA A C   1 
ATOM 2088 O O   . ALA A 1 274 ? -15.300 -14.522 233.607 1.00 15.41  ? 274 ALA A O   1 
ATOM 2089 C CB  . ALA A 1 274 ? -13.683 -16.968 231.720 1.00 12.02  ? 274 ALA A CB  1 
ATOM 2090 N N   . HIS A 1 275 ? -15.333 -16.676 234.179 1.00 16.56  ? 275 HIS A N   1 
ATOM 2091 C CA  . HIS A 1 275 ? -15.614 -16.354 235.573 1.00 17.39  ? 275 HIS A CA  1 
ATOM 2092 C C   . HIS A 1 275 ? -15.016 -17.404 236.504 1.00 19.78  ? 275 HIS A C   1 
ATOM 2093 O O   . HIS A 1 275 ? -15.018 -18.586 236.178 1.00 20.90  ? 275 HIS A O   1 
ATOM 2094 C CB  . HIS A 1 275 ? -17.126 -16.278 235.773 1.00 18.47  ? 275 HIS A CB  1 
ATOM 2095 C CG  . HIS A 1 275 ? -17.535 -15.978 237.181 1.00 27.27  ? 275 HIS A CG  1 
ATOM 2096 N ND1 . HIS A 1 275 ? -17.168 -14.820 237.837 1.00 28.42  ? 275 HIS A ND1 1 
ATOM 2097 C CD2 . HIS A 1 275 ? -18.276 -16.692 238.062 1.00 28.10  ? 275 HIS A CD2 1 
ATOM 2098 C CE1 . HIS A 1 275 ? -17.667 -14.833 239.060 1.00 26.00  ? 275 HIS A CE1 1 
ATOM 2099 N NE2 . HIS A 1 275 ? -18.343 -15.957 239.222 1.00 29.74  ? 275 HIS A NE2 1 
ATOM 2100 N N   . ILE A 1 276 ? -14.502 -16.967 237.649 1.00 18.76  ? 276 ILE A N   1 
ATOM 2101 C CA  . ILE A 1 276 ? -13.925 -17.861 238.646 1.00 17.40  ? 276 ILE A CA  1 
ATOM 2102 C C   . ILE A 1 276 ? -14.737 -17.714 239.923 1.00 20.34  ? 276 ILE A C   1 
ATOM 2103 O O   . ILE A 1 276 ? -15.004 -16.597 240.353 1.00 22.08  ? 276 ILE A O   1 
ATOM 2104 C CB  . ILE A 1 276 ? -12.474 -17.473 238.976 1.00 19.30  ? 276 ILE A CB  1 
ATOM 2105 C CG1 . ILE A 1 276 ? -11.625 -17.505 237.709 1.00 18.95  ? 276 ILE A CG1 1 
ATOM 2106 C CG2 . ILE A 1 276 ? -11.889 -18.414 240.049 1.00 14.54  ? 276 ILE A CG2 1 
ATOM 2107 C CD1 . ILE A 1 276 ? -10.262 -16.963 237.934 1.00 19.38  ? 276 ILE A CD1 1 
ATOM 2108 N N   . GLU A 1 277 ? -15.161 -18.834 240.493 1.00 21.14  ? 277 GLU A N   1 
ATOM 2109 C CA  . GLU A 1 277 ? -15.928 -18.880 241.740 1.00 22.33  ? 277 GLU A CA  1 
ATOM 2110 C C   . GLU A 1 277 ? -15.181 -19.854 242.665 1.00 22.79  ? 277 GLU A C   1 
ATOM 2111 O O   . GLU A 1 277 ? -15.384 -21.071 242.609 1.00 21.62  ? 277 GLU A O   1 
ATOM 2112 C CB  . GLU A 1 277 ? -17.344 -19.397 241.467 1.00 26.87  ? 277 GLU A CB  1 
ATOM 2113 C CG  . GLU A 1 277 ? -18.312 -19.234 242.636 1.00 42.89  ? 277 GLU A CG  1 
ATOM 2114 C CD  . GLU A 1 277 ? -18.453 -17.774 243.083 1.00 60.34  ? 277 GLU A CD  1 
ATOM 2115 O OE1 . GLU A 1 277 ? -18.810 -16.905 242.244 1.00 62.71  ? 277 GLU A OE1 1 
ATOM 2116 O OE2 . GLU A 1 277 ? -18.203 -17.494 244.280 1.00 65.73  ? 277 GLU A OE2 1 
ATOM 2117 N N   . GLY A 1 278 ? -14.250 -19.325 243.450 1.00 23.46  ? 278 GLY A N   1 
ATOM 2118 C CA  . GLY A 1 278 ? -13.475 -20.167 244.343 1.00 22.34  ? 278 GLY A CA  1 
ATOM 2119 C C   . GLY A 1 278 ? -12.511 -20.997 243.524 1.00 24.79  ? 278 GLY A C   1 
ATOM 2120 O O   . GLY A 1 278 ? -11.593 -20.448 242.900 1.00 23.72  ? 278 GLY A O   1 
ATOM 2121 N N   . THR A 1 279 ? -12.733 -22.310 243.493 1.00 23.47  ? 279 THR A N   1 
ATOM 2122 C CA  . THR A 1 279 ? -11.876 -23.219 242.735 1.00 22.85  ? 279 THR A CA  1 
ATOM 2123 C C   . THR A 1 279 ? -12.503 -23.573 241.371 1.00 20.42  ? 279 THR A C   1 
ATOM 2124 O O   . THR A 1 279 ? -11.901 -24.298 240.577 1.00 19.45  ? 279 THR A O   1 
ATOM 2125 C CB  . THR A 1 279 ? -11.605 -24.538 243.534 1.00 24.84  ? 279 THR A CB  1 
ATOM 2126 O OG1 . THR A 1 279 ? -12.848 -25.196 243.810 1.00 26.83  ? 279 THR A OG1 1 
ATOM 2127 C CG2 . THR A 1 279 ? -10.910 -24.243 244.850 1.00 23.14  ? 279 THR A CG2 1 
ATOM 2128 N N   . LYS A 1 280 ? -13.711 -23.083 241.109 1.00 18.64  ? 280 LYS A N   1 
ATOM 2129 C CA  . LYS A 1 280 ? -14.389 -23.385 239.848 1.00 18.08  ? 280 LYS A CA  1 
ATOM 2130 C C   . LYS A 1 280 ? -14.111 -22.367 238.759 1.00 17.29  ? 280 LYS A C   1 
ATOM 2131 O O   . LYS A 1 280 ? -14.348 -21.173 238.943 1.00 15.62  ? 280 LYS A O   1 
ATOM 2132 C CB  . LYS A 1 280 ? -15.895 -23.509 240.055 1.00 17.33  ? 280 LYS A CB  1 
ATOM 2133 C CG  . LYS A 1 280 ? -16.272 -24.695 240.922 1.00 25.98  ? 280 LYS A CG  1 
ATOM 2134 C CD  . LYS A 1 280 ? -17.767 -24.768 241.214 1.00 35.69  ? 280 LYS A CD  1 
ATOM 2135 C CE  . LYS A 1 280 ? -18.037 -25.916 242.180 1.00 42.71  ? 280 LYS A CE  1 
ATOM 2136 N NZ  . LYS A 1 280 ? -19.415 -25.881 242.723 1.00 51.57  ? 280 LYS A NZ  1 
ATOM 2137 N N   . TYR A 1 281 ? -13.583 -22.836 237.637 1.00 17.32  ? 281 TYR A N   1 
ATOM 2138 C CA  . TYR A 1 281 ? -13.290 -21.960 236.505 1.00 16.58  ? 281 TYR A CA  1 
ATOM 2139 C C   . TYR A 1 281 ? -14.362 -22.180 235.449 1.00 14.93  ? 281 TYR A C   1 
ATOM 2140 O O   . TYR A 1 281 ? -14.383 -23.221 234.794 1.00 17.07  ? 281 TYR A O   1 
ATOM 2141 C CB  . TYR A 1 281 ? -11.889 -22.254 235.963 1.00 11.73  ? 281 TYR A CB  1 
ATOM 2142 C CG  . TYR A 1 281 ? -10.804 -21.707 236.868 1.00 19.67  ? 281 TYR A CG  1 
ATOM 2143 C CD1 . TYR A 1 281 ? -10.642 -22.187 238.166 1.00 14.17  ? 281 TYR A CD1 1 
ATOM 2144 C CD2 . TYR A 1 281 ? -9.970  -20.679 236.442 1.00 17.30  ? 281 TYR A CD2 1 
ATOM 2145 C CE1 . TYR A 1 281 ? -9.686  -21.652 239.014 1.00 18.35  ? 281 TYR A CE1 1 
ATOM 2146 C CE2 . TYR A 1 281 ? -9.007  -20.135 237.291 1.00 17.53  ? 281 TYR A CE2 1 
ATOM 2147 C CZ  . TYR A 1 281 ? -8.874  -20.629 238.573 1.00 17.06  ? 281 TYR A CZ  1 
ATOM 2148 O OH  . TYR A 1 281 ? -7.935  -20.093 239.419 1.00 18.39  ? 281 TYR A OH  1 
ATOM 2149 N N   . HIS A 1 282 ? -15.255 -21.204 235.321 1.00 15.49  ? 282 HIS A N   1 
ATOM 2150 C CA  . HIS A 1 282 ? -16.407 -21.250 234.403 1.00 16.96  ? 282 HIS A CA  1 
ATOM 2151 C C   . HIS A 1 282 ? -16.237 -20.613 233.042 1.00 18.77  ? 282 HIS A C   1 
ATOM 2152 O O   . HIS A 1 282 ? -15.649 -19.532 232.918 1.00 19.30  ? 282 HIS A O   1 
ATOM 2153 C CB  . HIS A 1 282 ? -17.601 -20.465 234.989 1.00 15.96  ? 282 HIS A CB  1 
ATOM 2154 C CG  . HIS A 1 282 ? -18.136 -21.001 236.278 1.00 16.06  ? 282 HIS A CG  1 
ATOM 2155 N ND1 . HIS A 1 282 ? -19.329 -21.690 236.350 1.00 13.11  ? 282 HIS A ND1 1 
ATOM 2156 C CD2 . HIS A 1 282 ? -17.662 -20.930 237.544 1.00 16.39  ? 282 HIS A CD2 1 
ATOM 2157 C CE1 . HIS A 1 282 ? -19.561 -22.028 237.605 1.00 15.07  ? 282 HIS A CE1 1 
ATOM 2158 N NE2 . HIS A 1 282 ? -18.567 -21.577 238.350 1.00 18.02  ? 282 HIS A NE2 1 
ATOM 2159 N N   . LEU A 1 283 ? -16.870 -21.220 232.048 1.00 19.21  ? 283 LEU A N   1 
ATOM 2160 C CA  . LEU A 1 283 ? -16.924 -20.637 230.713 1.00 22.98  ? 283 LEU A CA  1 
ATOM 2161 C C   . LEU A 1 283 ? -18.235 -19.830 230.794 1.00 23.66  ? 283 LEU A C   1 
ATOM 2162 O O   . LEU A 1 283 ? -19.125 -20.186 231.577 1.00 24.92  ? 283 LEU A O   1 
ATOM 2163 C CB  . LEU A 1 283 ? -17.057 -21.716 229.645 1.00 15.37  ? 283 LEU A CB  1 
ATOM 2164 C CG  . LEU A 1 283 ? -15.738 -22.392 229.339 1.00 20.87  ? 283 LEU A CG  1 
ATOM 2165 C CD1 . LEU A 1 283 ? -15.986 -23.543 228.406 1.00 21.70  ? 283 LEU A CD1 1 
ATOM 2166 C CD2 . LEU A 1 283 ? -14.782 -21.369 228.724 1.00 15.59  ? 283 LEU A CD2 1 
ATOM 2167 N N   . LYS A 1 284 ? -18.333 -18.714 230.077 1.00 23.20  ? 284 LYS A N   1 
ATOM 2168 C CA  . LYS A 1 284 ? -19.560 -17.914 230.101 1.00 22.70  ? 284 LYS A CA  1 
ATOM 2169 C C   . LYS A 1 284 ? -20.303 -18.081 228.784 1.00 23.11  ? 284 LYS A C   1 
ATOM 2170 O O   . LYS A 1 284 ? -21.353 -17.478 228.561 1.00 21.90  ? 284 LYS A O   1 
ATOM 2171 C CB  . LYS A 1 284 ? -19.289 -16.423 230.354 1.00 24.10  ? 284 LYS A CB  1 
ATOM 2172 C CG  . LYS A 1 284 ? -18.700 -16.089 231.720 1.00 38.72  ? 284 LYS A CG  1 
ATOM 2173 C CD  . LYS A 1 284 ? -19.521 -16.650 232.880 1.00 44.75  ? 284 LYS A CD  1 
ATOM 2174 C CE  . LYS A 1 284 ? -20.832 -15.916 233.105 1.00 52.70  ? 284 LYS A CE  1 
ATOM 2175 N NZ  . LYS A 1 284 ? -21.597 -16.560 234.228 1.00 58.28  ? 284 LYS A NZ  1 
ATOM 2176 N N   . SER A 1 285 ? -19.756 -18.912 227.913 1.00 19.91  ? 285 SER A N   1 
ATOM 2177 C CA  . SER A 1 285 ? -20.394 -19.158 226.647 1.00 22.42  ? 285 SER A CA  1 
ATOM 2178 C C   . SER A 1 285 ? -20.113 -20.615 226.309 1.00 21.53  ? 285 SER A C   1 
ATOM 2179 O O   . SER A 1 285 ? -19.018 -21.119 226.597 1.00 23.03  ? 285 SER A O   1 
ATOM 2180 C CB  . SER A 1 285 ? -19.813 -18.217 225.596 1.00 28.86  ? 285 SER A CB  1 
ATOM 2181 O OG  . SER A 1 285 ? -20.562 -18.286 224.403 1.00 48.10  ? 285 SER A OG  1 
ATOM 2182 N N   . GLY A 1 286 ? -21.101 -21.308 225.751 1.00 18.79  ? 286 GLY A N   1 
ATOM 2183 C CA  . GLY A 1 286 ? -20.910 -22.709 225.413 1.00 20.20  ? 286 GLY A CA  1 
ATOM 2184 C C   . GLY A 1 286 ? -22.241 -23.381 225.177 1.00 22.11  ? 286 GLY A C   1 
ATOM 2185 O O   . GLY A 1 286 ? -23.278 -22.773 225.449 1.00 23.59  ? 286 GLY A O   1 
ATOM 2186 N N   . HIS A 1 287 ? -22.215 -24.640 224.737 1.00 23.47  ? 287 HIS A N   1 
ATOM 2187 C CA  . HIS A 1 287 ? -23.439 -25.396 224.425 1.00 24.53  ? 287 HIS A CA  1 
ATOM 2188 C C   . HIS A 1 287 ? -23.198 -26.896 224.549 1.00 25.29  ? 287 HIS A C   1 
ATOM 2189 O O   . HIS A 1 287 ? -22.048 -27.351 224.509 1.00 25.45  ? 287 HIS A O   1 
ATOM 2190 C CB  . HIS A 1 287 ? -23.843 -25.130 222.975 1.00 28.20  ? 287 HIS A CB  1 
ATOM 2191 C CG  . HIS A 1 287 ? -22.821 -25.604 221.987 1.00 34.05  ? 287 HIS A CG  1 
ATOM 2192 N ND1 . HIS A 1 287 ? -21.737 -24.834 221.611 1.00 33.21  ? 287 HIS A ND1 1 
ATOM 2193 C CD2 . HIS A 1 287 ? -22.653 -26.810 221.392 1.00 32.19  ? 287 HIS A CD2 1 
ATOM 2194 C CE1 . HIS A 1 287 ? -20.937 -25.553 220.842 1.00 36.57  ? 287 HIS A CE1 1 
ATOM 2195 N NE2 . HIS A 1 287 ? -21.471 -26.754 220.694 1.00 38.29  ? 287 HIS A NE2 1 
ATOM 2196 N N   . VAL A 1 288 ? -24.291 -27.659 224.580 1.00 24.64  ? 288 VAL A N   1 
ATOM 2197 C CA  . VAL A 1 288 ? -24.228 -29.117 224.682 1.00 21.46  ? 288 VAL A CA  1 
ATOM 2198 C C   . VAL A 1 288 ? -25.561 -29.670 224.156 1.00 22.28  ? 288 VAL A C   1 
ATOM 2199 O O   . VAL A 1 288 ? -26.591 -28.993 224.243 1.00 21.47  ? 288 VAL A O   1 
ATOM 2200 C CB  . VAL A 1 288 ? -23.984 -29.571 226.175 1.00 19.14  ? 288 VAL A CB  1 
ATOM 2201 C CG1 . VAL A 1 288 ? -25.221 -29.355 227.020 1.00 10.31  ? 288 VAL A CG1 1 
ATOM 2202 C CG2 . VAL A 1 288 ? -23.555 -31.027 226.239 1.00 19.54  ? 288 VAL A CG2 1 
ATOM 2203 N N   . THR A 1 289 ? -25.542 -30.845 223.531 1.00 19.77  ? 289 THR A N   1 
ATOM 2204 C CA  . THR A 1 289 ? -26.788 -31.429 223.054 1.00 22.44  ? 289 THR A CA  1 
ATOM 2205 C C   . THR A 1 289 ? -27.223 -32.530 224.035 1.00 23.23  ? 289 THR A C   1 
ATOM 2206 O O   . THR A 1 289 ? -26.397 -33.320 224.523 1.00 22.12  ? 289 THR A O   1 
ATOM 2207 C CB  . THR A 1 289 ? -26.676 -31.982 221.597 1.00 24.60  ? 289 THR A CB  1 
ATOM 2208 O OG1 . THR A 1 289 ? -25.772 -33.078 221.565 1.00 43.79  ? 289 THR A OG1 1 
ATOM 2209 C CG2 . THR A 1 289 ? -26.121 -30.943 220.668 1.00 20.88  ? 289 THR A CG2 1 
ATOM 2210 N N   . CYS A 1 290 ? -28.504 -32.533 224.382 1.00 22.76  ? 290 CYS A N   1 
ATOM 2211 C CA  . CYS A 1 290 ? -29.045 -33.523 225.301 1.00 24.38  ? 290 CYS A CA  1 
ATOM 2212 C C   . CYS A 1 290 ? -30.249 -34.186 224.671 1.00 24.09  ? 290 CYS A C   1 
ATOM 2213 O O   . CYS A 1 290 ? -30.870 -33.630 223.768 1.00 23.77  ? 290 CYS A O   1 
ATOM 2214 C CB  . CYS A 1 290 ? -29.522 -32.866 226.595 1.00 18.65  ? 290 CYS A CB  1 
ATOM 2215 S SG  . CYS A 1 290 ? -28.260 -31.979 227.536 1.00 23.43  ? 290 CYS A SG  1 
ATOM 2216 N N   . GLU A 1 291 ? -30.546 -35.391 225.137 1.00 25.53  ? 291 GLU A N   1 
ATOM 2217 C CA  . GLU A 1 291 ? -31.715 -36.148 224.707 1.00 26.47  ? 291 GLU A CA  1 
ATOM 2218 C C   . GLU A 1 291 ? -32.558 -36.215 225.979 1.00 26.21  ? 291 GLU A C   1 
ATOM 2219 O O   . GLU A 1 291 ? -32.047 -36.585 227.046 1.00 26.15  ? 291 GLU A O   1 
ATOM 2220 C CB  . GLU A 1 291 ? -31.343 -37.563 224.251 1.00 27.88  ? 291 GLU A CB  1 
ATOM 2221 C CG  . GLU A 1 291 ? -30.542 -37.609 222.957 1.00 47.12  ? 291 GLU A CG  1 
ATOM 2222 C CD  . GLU A 1 291 ? -30.378 -39.019 222.415 1.00 56.14  ? 291 GLU A CD  1 
ATOM 2223 O OE1 . GLU A 1 291 ? -31.401 -39.661 222.083 1.00 61.51  ? 291 GLU A OE1 1 
ATOM 2224 O OE2 . GLU A 1 291 ? -29.226 -39.481 222.306 1.00 54.87  ? 291 GLU A OE2 1 
ATOM 2225 N N   . VAL A 1 292 ? -33.806 -35.768 225.890 1.00 24.34  ? 292 VAL A N   1 
ATOM 2226 C CA  . VAL A 1 292 ? -34.710 -35.763 227.031 1.00 25.34  ? 292 VAL A CA  1 
ATOM 2227 C C   . VAL A 1 292 ? -35.771 -36.848 226.832 1.00 26.23  ? 292 VAL A C   1 
ATOM 2228 O O   . VAL A 1 292 ? -36.452 -36.879 225.801 1.00 25.68  ? 292 VAL A O   1 
ATOM 2229 C CB  . VAL A 1 292 ? -35.412 -34.390 227.183 1.00 27.31  ? 292 VAL A CB  1 
ATOM 2230 C CG1 . VAL A 1 292 ? -36.206 -34.352 228.468 1.00 26.74  ? 292 VAL A CG1 1 
ATOM 2231 C CG2 . VAL A 1 292 ? -34.404 -33.261 227.151 1.00 30.47  ? 292 VAL A CG2 1 
ATOM 2232 N N   . GLY A 1 293 ? -35.881 -37.753 227.800 1.00 24.98  ? 293 GLY A N   1 
ATOM 2233 C CA  . GLY A 1 293 ? -36.854 -38.831 227.719 1.00 26.18  ? 293 GLY A CA  1 
ATOM 2234 C C   . GLY A 1 293 ? -38.068 -38.421 228.517 1.00 28.36  ? 293 GLY A C   1 
ATOM 2235 O O   . GLY A 1 293 ? -37.964 -38.199 229.737 1.00 27.09  ? 293 GLY A O   1 
ATOM 2236 N N   . LEU A 1 294 ? -39.217 -38.363 227.843 1.00 28.73  ? 294 LEU A N   1 
ATOM 2237 C CA  . LEU A 1 294 ? -40.467 -37.923 228.462 1.00 30.88  ? 294 LEU A CA  1 
ATOM 2238 C C   . LEU A 1 294 ? -41.486 -39.005 228.825 1.00 32.68  ? 294 LEU A C   1 
ATOM 2239 O O   . LEU A 1 294 ? -42.442 -38.741 229.564 1.00 31.16  ? 294 LEU A O   1 
ATOM 2240 C CB  . LEU A 1 294 ? -41.135 -36.892 227.546 1.00 32.84  ? 294 LEU A CB  1 
ATOM 2241 C CG  . LEU A 1 294 ? -40.312 -35.669 227.119 1.00 28.71  ? 294 LEU A CG  1 
ATOM 2242 C CD1 . LEU A 1 294 ? -41.069 -34.912 226.071 1.00 26.15  ? 294 LEU A CD1 1 
ATOM 2243 C CD2 . LEU A 1 294 ? -40.020 -34.780 228.316 1.00 26.14  ? 294 LEU A CD2 1 
ATOM 2244 N N   . GLU A 1 295 ? -41.264 -40.224 228.344 1.00 33.62  ? 295 GLU A N   1 
ATOM 2245 C CA  . GLU A 1 295 ? -42.184 -41.332 228.577 1.00 34.96  ? 295 GLU A CA  1 
ATOM 2246 C C   . GLU A 1 295 ? -42.668 -41.594 229.999 1.00 32.73  ? 295 GLU A C   1 
ATOM 2247 O O   . GLU A 1 295 ? -43.796 -42.036 230.172 1.00 33.20  ? 295 GLU A O   1 
ATOM 2248 C CB  . GLU A 1 295 ? -41.693 -42.631 227.902 1.00 40.71  ? 295 GLU A CB  1 
ATOM 2249 C CG  . GLU A 1 295 ? -40.301 -43.146 228.304 1.00 54.69  ? 295 GLU A CG  1 
ATOM 2250 C CD  . GLU A 1 295 ? -39.140 -42.245 227.853 1.00 64.08  ? 295 GLU A CD  1 
ATOM 2251 O OE1 . GLU A 1 295 ? -39.062 -41.877 226.654 1.00 63.70  ? 295 GLU A OE1 1 
ATOM 2252 O OE2 . GLU A 1 295 ? -38.294 -41.911 228.714 1.00 69.19  ? 295 GLU A OE2 1 
ATOM 2253 N N   . LYS A 1 296 ? -41.860 -41.294 231.011 1.00 32.49  ? 296 LYS A N   1 
ATOM 2254 C CA  . LYS A 1 296 ? -42.280 -41.526 232.402 1.00 35.37  ? 296 LYS A CA  1 
ATOM 2255 C C   . LYS A 1 296 ? -42.981 -40.328 233.069 1.00 36.05  ? 296 LYS A C   1 
ATOM 2256 O O   . LYS A 1 296 ? -43.318 -40.384 234.257 1.00 37.25  ? 296 LYS A O   1 
ATOM 2257 C CB  . LYS A 1 296 ? -41.096 -41.956 233.282 1.00 37.21  ? 296 LYS A CB  1 
ATOM 2258 C CG  . LYS A 1 296 ? -40.386 -43.216 232.842 1.00 44.61  ? 296 LYS A CG  1 
ATOM 2259 C CD  . LYS A 1 296 ? -41.324 -44.402 232.822 1.00 55.34  ? 296 LYS A CD  1 
ATOM 2260 C CE  . LYS A 1 296 ? -40.687 -45.584 232.111 1.00 63.56  ? 296 LYS A CE  1 
ATOM 2261 N NZ  . LYS A 1 296 ? -41.652 -46.700 231.929 1.00 68.01  ? 296 LYS A NZ  1 
ATOM 2262 N N   . LEU A 1 297 ? -43.172 -39.238 232.330 1.00 34.35  ? 297 LEU A N   1 
ATOM 2263 C CA  . LEU A 1 297 ? -43.831 -38.066 232.899 1.00 34.88  ? 297 LEU A CA  1 
ATOM 2264 C C   . LEU A 1 297 ? -45.359 -38.184 232.820 1.00 34.86  ? 297 LEU A C   1 
ATOM 2265 O O   . LEU A 1 297 ? -45.912 -38.603 231.807 1.00 36.65  ? 297 LEU A O   1 
ATOM 2266 C CB  . LEU A 1 297 ? -43.334 -36.768 232.231 1.00 32.59  ? 297 LEU A CB  1 
ATOM 2267 C CG  . LEU A 1 297 ? -41.871 -36.356 232.483 1.00 26.10  ? 297 LEU A CG  1 
ATOM 2268 C CD1 . LEU A 1 297 ? -41.554 -35.150 231.666 1.00 22.47  ? 297 LEU A CD1 1 
ATOM 2269 C CD2 . LEU A 1 297 ? -41.602 -36.088 233.957 1.00 24.19  ? 297 LEU A CD2 1 
ATOM 2270 N N   . LYS A 1 298 ? -46.028 -37.786 233.894 1.00 34.13  ? 298 LYS A N   1 
ATOM 2271 C CA  . LYS A 1 298 ? -47.489 -37.842 233.993 1.00 33.60  ? 298 LYS A CA  1 
ATOM 2272 C C   . LYS A 1 298 ? -48.053 -36.474 234.427 1.00 31.03  ? 298 LYS A C   1 
ATOM 2273 O O   . LYS A 1 298 ? -47.418 -35.750 235.202 1.00 30.27  ? 298 LYS A O   1 
ATOM 2274 C CB  . LYS A 1 298 ? -47.883 -38.938 235.006 1.00 38.11  ? 298 LYS A CB  1 
ATOM 2275 C CG  . LYS A 1 298 ? -47.120 -38.832 236.338 1.00 44.16  ? 298 LYS A CG  1 
ATOM 2276 C CD  . LYS A 1 298 ? -47.303 -40.027 237.297 1.00 48.53  ? 298 LYS A CD  1 
ATOM 2277 C CE  . LYS A 1 298 ? -46.408 -39.832 238.547 1.00 48.93  ? 298 LYS A CE  1 
ATOM 2278 N NZ  . LYS A 1 298 ? -46.422 -40.912 239.581 1.00 52.51  ? 298 LYS A NZ  1 
ATOM 2279 N N   . MET A 1 299 ? -49.214 -36.096 233.893 1.00 30.16  ? 299 MET A N   1 
ATOM 2280 C CA  . MET A 1 299 ? -49.838 -34.815 234.245 1.00 31.14  ? 299 MET A CA  1 
ATOM 2281 C C   . MET A 1 299 ? -50.477 -34.868 235.625 1.00 30.15  ? 299 MET A C   1 
ATOM 2282 O O   . MET A 1 299 ? -50.807 -35.940 236.130 1.00 30.14  ? 299 MET A O   1 
ATOM 2283 C CB  . MET A 1 299 ? -50.886 -34.408 233.221 1.00 32.74  ? 299 MET A CB  1 
ATOM 2284 C CG  . MET A 1 299 ? -50.328 -34.016 231.882 1.00 36.86  ? 299 MET A CG  1 
ATOM 2285 S SD  . MET A 1 299 ? -51.642 -33.296 230.918 1.00 46.08  ? 299 MET A SD  1 
ATOM 2286 C CE  . MET A 1 299 ? -50.773 -32.039 229.999 1.00 57.19  ? 299 MET A CE  1 
ATOM 2287 N N   . LYS A 1 300 ? -50.706 -33.705 236.211 1.00 28.76  ? 300 LYS A N   1 
ATOM 2288 C CA  . LYS A 1 300 ? -51.294 -33.648 237.540 1.00 29.82  ? 300 LYS A CA  1 
ATOM 2289 C C   . LYS A 1 300 ? -52.705 -33.041 237.520 1.00 30.79  ? 300 LYS A C   1 
ATOM 2290 O O   . LYS A 1 300 ? -52.969 -32.096 236.775 1.00 32.11  ? 300 LYS A O   1 
ATOM 2291 C CB  . LYS A 1 300 ? -50.371 -32.837 238.467 1.00 29.79  ? 300 LYS A CB  1 
ATOM 2292 C CG  . LYS A 1 300 ? -50.710 -32.900 239.952 1.00 43.37  ? 300 LYS A CG  1 
ATOM 2293 C CD  . LYS A 1 300 ? -49.755 -32.047 240.774 1.00 48.40  ? 300 LYS A CD  1 
ATOM 2294 C CE  . LYS A 1 300 ? -50.192 -31.976 242.227 1.00 59.01  ? 300 LYS A CE  1 
ATOM 2295 N NZ  . LYS A 1 300 ? -49.338 -31.042 243.010 1.00 62.12  ? 300 LYS A NZ  1 
ATOM 2296 N N   . GLY A 1 301 ? -53.609 -33.641 238.294 1.00 29.90  ? 301 GLY A N   1 
ATOM 2297 C CA  . GLY A 1 301 ? -54.967 -33.147 238.424 1.00 30.30  ? 301 GLY A CA  1 
ATOM 2298 C C   . GLY A 1 301 ? -55.990 -33.445 237.353 1.00 30.49  ? 301 GLY A C   1 
ATOM 2299 O O   . GLY A 1 301 ? -57.021 -32.769 237.302 1.00 32.12  ? 301 GLY A O   1 
ATOM 2300 N N   . LEU A 1 302 ? -55.759 -34.469 236.540 1.00 30.45  ? 302 LEU A N   1 
ATOM 2301 C CA  . LEU A 1 302 ? -56.702 -34.836 235.477 1.00 33.38  ? 302 LEU A CA  1 
ATOM 2302 C C   . LEU A 1 302 ? -58.083 -35.341 235.939 1.00 33.83  ? 302 LEU A C   1 
ATOM 2303 O O   . LEU A 1 302 ? -59.053 -35.297 235.183 1.00 35.69  ? 302 LEU A O   1 
ATOM 2304 C CB  . LEU A 1 302 ? -56.078 -35.876 234.545 1.00 34.50  ? 302 LEU A CB  1 
ATOM 2305 C CG  . LEU A 1 302 ? -54.977 -35.434 233.583 1.00 36.23  ? 302 LEU A CG  1 
ATOM 2306 C CD1 . LEU A 1 302 ? -54.436 -36.652 232.863 1.00 35.26  ? 302 LEU A CD1 1 
ATOM 2307 C CD2 . LEU A 1 302 ? -55.528 -34.440 232.577 1.00 39.67  ? 302 LEU A CD2 1 
ATOM 2308 N N   . THR A 1 303 ? -58.184 -35.822 237.167 1.00 32.90  ? 303 THR A N   1 
ATOM 2309 C CA  . THR A 1 303 ? -59.457 -36.330 237.638 1.00 33.77  ? 303 THR A CA  1 
ATOM 2310 C C   . THR A 1 303 ? -60.186 -35.376 238.591 1.00 35.90  ? 303 THR A C   1 
ATOM 2311 O O   . THR A 1 303 ? -61.135 -35.780 239.277 1.00 35.15  ? 303 THR A O   1 
ATOM 2312 C CB  . THR A 1 303 ? -59.271 -37.697 238.300 1.00 34.77  ? 303 THR A CB  1 
ATOM 2313 O OG1 . THR A 1 303 ? -58.577 -37.531 239.546 1.00 31.30  ? 303 THR A OG1 1 
ATOM 2314 C CG2 . THR A 1 303 ? -58.473 -38.611 237.386 1.00 28.72  ? 303 THR A CG2 1 
ATOM 2315 N N   . TYR A 1 304 ? -59.720 -34.131 238.687 1.00 33.66  ? 304 TYR A N   1 
ATOM 2316 C CA  . TYR A 1 304 ? -60.391 -33.160 239.553 1.00 31.77  ? 304 TYR A CA  1 
ATOM 2317 C C   . TYR A 1 304 ? -61.644 -32.711 238.812 1.00 29.72  ? 304 TYR A C   1 
ATOM 2318 O O   . TYR A 1 304 ? -61.739 -32.891 237.594 1.00 25.71  ? 304 TYR A O   1 
ATOM 2319 C CB  . TYR A 1 304 ? -59.545 -31.906 239.716 1.00 32.72  ? 304 TYR A CB  1 
ATOM 2320 C CG  . TYR A 1 304 ? -58.231 -32.058 240.426 1.00 39.25  ? 304 TYR A CG  1 
ATOM 2321 C CD1 . TYR A 1 304 ? -57.932 -33.196 241.177 1.00 38.59  ? 304 TYR A CD1 1 
ATOM 2322 C CD2 . TYR A 1 304 ? -57.293 -31.020 240.383 1.00 36.88  ? 304 TYR A CD2 1 
ATOM 2323 C CE1 . TYR A 1 304 ? -56.732 -33.292 241.874 1.00 37.01  ? 304 TYR A CE1 1 
ATOM 2324 C CE2 . TYR A 1 304 ? -56.101 -31.103 241.068 1.00 35.06  ? 304 TYR A CE2 1 
ATOM 2325 C CZ  . TYR A 1 304 ? -55.821 -32.236 241.815 1.00 38.99  ? 304 TYR A CZ  1 
ATOM 2326 O OH  . TYR A 1 304 ? -54.635 -32.293 242.510 1.00 30.89  ? 304 TYR A OH  1 
ATOM 2327 N N   . THR A 1 305 ? -62.601 -32.123 239.522 1.00 30.33  ? 305 THR A N   1 
ATOM 2328 C CA  . THR A 1 305 ? -63.771 -31.593 238.827 1.00 32.22  ? 305 THR A CA  1 
ATOM 2329 C C   . THR A 1 305 ? -63.383 -30.199 238.360 1.00 30.75  ? 305 THR A C   1 
ATOM 2330 O O   . THR A 1 305 ? -62.388 -29.628 238.832 1.00 29.47  ? 305 THR A O   1 
ATOM 2331 C CB  . THR A 1 305 ? -65.012 -31.429 239.725 1.00 33.33  ? 305 THR A CB  1 
ATOM 2332 O OG1 . THR A 1 305 ? -64.628 -30.898 241.001 1.00 36.55  ? 305 THR A OG1 1 
ATOM 2333 C CG2 . THR A 1 305 ? -65.762 -32.738 239.867 1.00 44.06  ? 305 THR A CG2 1 
ATOM 2334 N N   . MET A 1 306 ? -64.174 -29.646 237.448 1.00 30.26  ? 306 MET A N   1 
ATOM 2335 C CA  . MET A 1 306 ? -63.935 -28.300 236.947 1.00 30.75  ? 306 MET A CA  1 
ATOM 2336 C C   . MET A 1 306 ? -64.184 -27.322 238.077 1.00 29.63  ? 306 MET A C   1 
ATOM 2337 O O   . MET A 1 306 ? -65.046 -27.549 238.934 1.00 30.66  ? 306 MET A O   1 
ATOM 2338 C CB  . MET A 1 306 ? -64.888 -27.962 235.798 1.00 34.02  ? 306 MET A CB  1 
ATOM 2339 C CG  . MET A 1 306 ? -64.683 -28.783 234.536 1.00 39.71  ? 306 MET A CG  1 
ATOM 2340 S SD  . MET A 1 306 ? -63.016 -28.639 233.864 1.00 54.97  ? 306 MET A SD  1 
ATOM 2341 C CE  . MET A 1 306 ? -62.822 -26.900 233.829 1.00 37.31  ? 306 MET A CE  1 
ATOM 2342 N N   . CYS A 1 307 ? -63.390 -26.264 238.113 1.00 27.17  ? 307 CYS A N   1 
ATOM 2343 C CA  . CYS A 1 307 ? -63.557 -25.237 239.125 1.00 27.77  ? 307 CYS A CA  1 
ATOM 2344 C C   . CYS A 1 307 ? -64.875 -24.512 238.867 1.00 26.00  ? 307 CYS A C   1 
ATOM 2345 O O   . CYS A 1 307 ? -65.339 -24.424 237.728 1.00 23.41  ? 307 CYS A O   1 
ATOM 2346 C CB  . CYS A 1 307 ? -62.422 -24.212 239.042 1.00 30.45  ? 307 CYS A CB  1 
ATOM 2347 S SG  . CYS A 1 307 ? -60.776 -24.864 239.433 1.00 27.12  ? 307 CYS A SG  1 
ATOM 2348 N N   . ASP A 1 308 ? -65.470 -24.005 239.936 1.00 26.18  ? 308 ASP A N   1 
ATOM 2349 C CA  . ASP A 1 308 ? -66.707 -23.235 239.858 1.00 27.79  ? 308 ASP A CA  1 
ATOM 2350 C C   . ASP A 1 308 ? -66.405 -22.035 238.936 1.00 27.42  ? 308 ASP A C   1 
ATOM 2351 O O   . ASP A 1 308 ? -65.600 -21.161 239.300 1.00 25.65  ? 308 ASP A O   1 
ATOM 2352 C CB  . ASP A 1 308 ? -67.041 -22.753 241.281 1.00 30.56  ? 308 ASP A CB  1 
ATOM 2353 C CG  . ASP A 1 308 ? -68.347 -21.981 241.370 1.00 36.66  ? 308 ASP A CG  1 
ATOM 2354 O OD1 . ASP A 1 308 ? -68.714 -21.276 240.406 1.00 28.98  ? 308 ASP A OD1 1 
ATOM 2355 O OD2 . ASP A 1 308 ? -68.991 -22.058 242.442 1.00 41.98  ? 308 ASP A OD2 1 
ATOM 2356 N N   . LYS A 1 309 ? -67.090 -21.969 237.790 1.00 27.32  ? 309 LYS A N   1 
ATOM 2357 C CA  . LYS A 1 309 ? -66.903 -20.901 236.786 1.00 29.67  ? 309 LYS A CA  1 
ATOM 2358 C C   . LYS A 1 309 ? -67.184 -19.473 237.260 1.00 29.13  ? 309 LYS A C   1 
ATOM 2359 O O   . LYS A 1 309 ? -66.846 -18.503 236.586 1.00 29.23  ? 309 LYS A O   1 
ATOM 2360 C CB  . LYS A 1 309 ? -67.766 -21.192 235.558 1.00 35.52  ? 309 LYS A CB  1 
ATOM 2361 C CG  . LYS A 1 309 ? -67.348 -22.431 234.798 1.00 48.17  ? 309 LYS A CG  1 
ATOM 2362 C CD  . LYS A 1 309 ? -68.313 -22.742 233.661 1.00 66.08  ? 309 LYS A CD  1 
ATOM 2363 C CE  . LYS A 1 309 ? -67.871 -23.973 232.862 1.00 67.43  ? 309 LYS A CE  1 
ATOM 2364 N NZ  . LYS A 1 309 ? -68.943 -24.418 231.912 1.00 72.70  ? 309 LYS A NZ  1 
ATOM 2365 N N   . THR A 1 310 ? -67.767 -19.366 238.441 1.00 28.86  ? 310 THR A N   1 
ATOM 2366 C CA  . THR A 1 310 ? -68.162 -18.109 239.064 1.00 30.45  ? 310 THR A CA  1 
ATOM 2367 C C   . THR A 1 310 ? -67.164 -17.484 240.043 1.00 28.69  ? 310 THR A C   1 
ATOM 2368 O O   . THR A 1 310 ? -67.308 -16.314 240.413 1.00 26.65  ? 310 THR A O   1 
ATOM 2369 C CB  . THR A 1 310 ? -69.475 -18.398 239.843 1.00 32.56  ? 310 THR A CB  1 
ATOM 2370 O OG1 . THR A 1 310 ? -70.552 -18.476 238.908 1.00 38.74  ? 310 THR A OG1 1 
ATOM 2371 C CG2 . THR A 1 310 ? -69.757 -17.401 240.946 1.00 38.83  ? 310 THR A CG2 1 
ATOM 2372 N N   . LYS A 1 311 ? -66.147 -18.242 240.442 1.00 27.40  ? 311 LYS A N   1 
ATOM 2373 C CA  . LYS A 1 311 ? -65.224 -17.754 241.467 1.00 27.27  ? 311 LYS A CA  1 
ATOM 2374 C C   . LYS A 1 311 ? -63.805 -17.301 241.098 1.00 25.36  ? 311 LYS A C   1 
ATOM 2375 O O   . LYS A 1 311 ? -62.927 -17.277 241.970 1.00 24.91  ? 311 LYS A O   1 
ATOM 2376 C CB  . LYS A 1 311 ? -65.143 -18.793 242.584 1.00 29.50  ? 311 LYS A CB  1 
ATOM 2377 C CG  . LYS A 1 311 ? -66.457 -19.460 242.915 1.00 36.80  ? 311 LYS A CG  1 
ATOM 2378 C CD  . LYS A 1 311 ? -67.110 -18.825 244.103 1.00 49.62  ? 311 LYS A CD  1 
ATOM 2379 C CE  . LYS A 1 311 ? -68.112 -19.785 244.720 1.00 56.58  ? 311 LYS A CE  1 
ATOM 2380 N NZ  . LYS A 1 311 ? -68.347 -19.476 246.158 1.00 63.30  ? 311 LYS A NZ  1 
ATOM 2381 N N   . PHE A 1 312 ? -63.573 -16.936 239.841 1.00 24.04  ? 312 PHE A N   1 
ATOM 2382 C CA  . PHE A 1 312 ? -62.250 -16.466 239.420 1.00 19.91  ? 312 PHE A CA  1 
ATOM 2383 C C   . PHE A 1 312 ? -62.157 -14.945 239.324 1.00 21.37  ? 312 PHE A C   1 
ATOM 2384 O O   . PHE A 1 312 ? -63.144 -14.269 239.019 1.00 20.09  ? 312 PHE A O   1 
ATOM 2385 C CB  . PHE A 1 312 ? -61.878 -17.049 238.059 1.00 20.71  ? 312 PHE A CB  1 
ATOM 2386 C CG  . PHE A 1 312 ? -61.561 -18.514 238.098 1.00 23.74  ? 312 PHE A CG  1 
ATOM 2387 C CD1 . PHE A 1 312 ? -60.291 -18.955 238.474 1.00 17.58  ? 312 PHE A CD1 1 
ATOM 2388 C CD2 . PHE A 1 312 ? -62.527 -19.458 237.749 1.00 22.68  ? 312 PHE A CD2 1 
ATOM 2389 C CE1 . PHE A 1 312 ? -59.983 -20.315 238.502 1.00 21.10  ? 312 PHE A CE1 1 
ATOM 2390 C CE2 . PHE A 1 312 ? -62.226 -20.831 237.771 1.00 28.07  ? 312 PHE A CE2 1 
ATOM 2391 C CZ  . PHE A 1 312 ? -60.952 -21.258 238.149 1.00 23.63  ? 312 PHE A CZ  1 
ATOM 2392 N N   . THR A 1 313 ? -60.993 -14.407 239.674 1.00 17.90  ? 313 THR A N   1 
ATOM 2393 C CA  . THR A 1 313 ? -60.709 -12.981 239.549 1.00 16.91  ? 313 THR A CA  1 
ATOM 2394 C C   . THR A 1 313 ? -59.276 -12.883 239.009 1.00 17.91  ? 313 THR A C   1 
ATOM 2395 O O   . THR A 1 313 ? -58.516 -13.861 239.097 1.00 18.32  ? 313 THR A O   1 
ATOM 2396 C CB  . THR A 1 313 ? -60.818 -12.246 240.873 1.00 14.37  ? 313 THR A CB  1 
ATOM 2397 O OG1 . THR A 1 313 ? -60.117 -12.973 241.884 1.00 18.07  ? 313 THR A OG1 1 
ATOM 2398 C CG2 . THR A 1 313 ? -62.276 -12.099 241.265 1.00 16.63  ? 313 THR A CG2 1 
ATOM 2399 N N   . TRP A 1 314 ? -58.916 -11.751 238.408 1.00 15.14  ? 314 TRP A N   1 
ATOM 2400 C CA  . TRP A 1 314 ? -57.561 -11.582 237.872 1.00 15.80  ? 314 TRP A CA  1 
ATOM 2401 C C   . TRP A 1 314 ? -56.590 -11.050 238.925 1.00 17.36  ? 314 TRP A C   1 
ATOM 2402 O O   . TRP A 1 314 ? -56.840 -9.988  239.500 1.00 19.47  ? 314 TRP A O   1 
ATOM 2403 C CB  . TRP A 1 314 ? -57.537 -10.581 236.703 1.00 17.17  ? 314 TRP A CB  1 
ATOM 2404 C CG  . TRP A 1 314 ? -58.310 -10.970 235.494 1.00 17.63  ? 314 TRP A CG  1 
ATOM 2405 C CD1 . TRP A 1 314 ? -59.486 -10.431 235.071 1.00 15.87  ? 314 TRP A CD1 1 
ATOM 2406 C CD2 . TRP A 1 314 ? -57.976 -11.997 234.554 1.00 19.84  ? 314 TRP A CD2 1 
ATOM 2407 N NE1 . TRP A 1 314 ? -59.915 -11.063 233.931 1.00 19.48  ? 314 TRP A NE1 1 
ATOM 2408 C CE2 . TRP A 1 314 ? -59.012 -12.032 233.592 1.00 20.49  ? 314 TRP A CE2 1 
ATOM 2409 C CE3 . TRP A 1 314 ? -56.906 -12.899 234.436 1.00 14.49  ? 314 TRP A CE3 1 
ATOM 2410 C CZ2 . TRP A 1 314 ? -59.011 -12.929 232.525 1.00 18.23  ? 314 TRP A CZ2 1 
ATOM 2411 C CZ3 . TRP A 1 314 ? -56.905 -13.789 233.376 1.00 15.60  ? 314 TRP A CZ3 1 
ATOM 2412 C CH2 . TRP A 1 314 ? -57.952 -13.803 232.436 1.00 15.54  ? 314 TRP A CH2 1 
ATOM 2413 N N   . LYS A 1 315 ? -55.511 -11.785 239.198 1.00 16.86  ? 315 LYS A N   1 
ATOM 2414 C CA  . LYS A 1 315 ? -54.487 -11.308 240.131 1.00 17.56  ? 315 LYS A CA  1 
ATOM 2415 C C   . LYS A 1 315 ? -53.511 -10.491 239.265 1.00 17.80  ? 315 LYS A C   1 
ATOM 2416 O O   . LYS A 1 315 ? -52.986 -9.454  239.692 1.00 18.04  ? 315 LYS A O   1 
ATOM 2417 C CB  . LYS A 1 315 ? -53.744 -12.466 240.807 1.00 22.13  ? 315 LYS A CB  1 
ATOM 2418 C CG  . LYS A 1 315 ? -52.667 -11.979 241.781 1.00 30.89  ? 315 LYS A CG  1 
ATOM 2419 C CD  . LYS A 1 315 ? -53.019 -12.280 243.232 1.00 51.34  ? 315 LYS A CD  1 
ATOM 2420 C CE  . LYS A 1 315 ? -52.888 -13.779 243.533 1.00 64.55  ? 315 LYS A CE  1 
ATOM 2421 N NZ  . LYS A 1 315 ? -53.319 -14.172 244.915 1.00 69.91  ? 315 LYS A NZ  1 
ATOM 2422 N N   . ARG A 1 316 ? -53.233 -10.995 238.062 1.00 16.13  ? 316 ARG A N   1 
ATOM 2423 C CA  . ARG A 1 316 ? -52.371 -10.298 237.107 1.00 17.05  ? 316 ARG A CA  1 
ATOM 2424 C C   . ARG A 1 316 ? -53.074 -10.442 235.777 1.00 17.08  ? 316 ARG A C   1 
ATOM 2425 O O   . ARG A 1 316 ? -53.215 -11.560 235.258 1.00 16.30  ? 316 ARG A O   1 
ATOM 2426 C CB  . ARG A 1 316 ? -50.977 -10.927 237.024 1.00 20.79  ? 316 ARG A CB  1 
ATOM 2427 C CG  . ARG A 1 316 ? -50.173 -10.811 238.300 1.00 27.41  ? 316 ARG A CG  1 
ATOM 2428 C CD  . ARG A 1 316 ? -48.714 -10.981 238.001 1.00 33.74  ? 316 ARG A CD  1 
ATOM 2429 N NE  . ARG A 1 316 ? -48.093 -11.904 238.936 1.00 37.05  ? 316 ARG A NE  1 
ATOM 2430 C CZ  . ARG A 1 316 ? -46.803 -11.888 239.255 1.00 34.65  ? 316 ARG A CZ  1 
ATOM 2431 N NH1 . ARG A 1 316 ? -45.994 -10.989 238.715 1.00 24.92  ? 316 ARG A NH1 1 
ATOM 2432 N NH2 . ARG A 1 316 ? -46.329 -12.769 240.121 1.00 37.60  ? 316 ARG A NH2 1 
ATOM 2433 N N   . ALA A 1 317 ? -53.578 -9.322  235.264 1.00 15.76  ? 317 ALA A N   1 
ATOM 2434 C CA  . ALA A 1 317 ? -54.309 -9.307  234.008 1.00 16.80  ? 317 ALA A CA  1 
ATOM 2435 C C   . ALA A 1 317 ? -53.402 -9.779  232.886 1.00 17.10  ? 317 ALA A C   1 
ATOM 2436 O O   . ALA A 1 317 ? -52.183 -9.672  232.996 1.00 17.51  ? 317 ALA A O   1 
ATOM 2437 C CB  . ALA A 1 317 ? -54.826 -7.891  233.727 1.00 15.33  ? 317 ALA A CB  1 
ATOM 2438 N N   . PRO A 1 318 ? -53.979 -10.326 231.799 1.00 17.13  ? 318 PRO A N   1 
ATOM 2439 C CA  . PRO A 1 318 ? -53.185 -10.808 230.654 1.00 18.71  ? 318 PRO A CA  1 
ATOM 2440 C C   . PRO A 1 318 ? -52.161 -9.766  230.193 1.00 21.77  ? 318 PRO A C   1 
ATOM 2441 O O   . PRO A 1 318 ? -52.463 -8.569  230.060 1.00 19.45  ? 318 PRO A O   1 
ATOM 2442 C CB  . PRO A 1 318 ? -54.240 -11.054 229.581 1.00 13.90  ? 318 PRO A CB  1 
ATOM 2443 C CG  . PRO A 1 318 ? -55.429 -11.528 230.415 1.00 18.72  ? 318 PRO A CG  1 
ATOM 2444 C CD  . PRO A 1 318 ? -55.419 -10.557 231.589 1.00 13.02  ? 318 PRO A CD  1 
ATOM 2445 N N   . THR A 1 319 ? -50.932 -10.218 229.994 1.00 21.92  ? 319 THR A N   1 
ATOM 2446 C CA  . THR A 1 319 ? -49.879 -9.329  229.563 1.00 23.47  ? 319 THR A CA  1 
ATOM 2447 C C   . THR A 1 319 ? -48.957 -10.046 228.593 1.00 22.21  ? 319 THR A C   1 
ATOM 2448 O O   . THR A 1 319 ? -48.828 -11.278 228.603 1.00 19.26  ? 319 THR A O   1 
ATOM 2449 C CB  . THR A 1 319 ? -49.086 -8.738  230.763 1.00 29.92  ? 319 THR A CB  1 
ATOM 2450 O OG1 . THR A 1 319 ? -48.260 -7.667  230.297 1.00 48.12  ? 319 THR A OG1 1 
ATOM 2451 C CG2 . THR A 1 319 ? -48.188 -9.761  231.393 1.00 36.70  ? 319 THR A CG2 1 
ATOM 2452 N N   . ASP A 1 320 ? -48.371 -9.252  227.712 1.00 21.57  ? 320 ASP A N   1 
ATOM 2453 C CA  . ASP A 1 320 ? -47.453 -9.724  226.695 1.00 24.77  ? 320 ASP A CA  1 
ATOM 2454 C C   . ASP A 1 320 ? -46.164 -10.241 227.348 1.00 21.96  ? 320 ASP A C   1 
ATOM 2455 O O   . ASP A 1 320 ? -45.517 -9.507  228.101 1.00 19.92  ? 320 ASP A O   1 
ATOM 2456 C CB  . ASP A 1 320 ? -47.140 -8.555  225.777 1.00 33.13  ? 320 ASP A CB  1 
ATOM 2457 C CG  . ASP A 1 320 ? -46.897 -8.989  224.382 1.00 47.08  ? 320 ASP A CG  1 
ATOM 2458 O OD1 . ASP A 1 320 ? -45.846 -9.632  224.140 1.00 46.85  ? 320 ASP A OD1 1 
ATOM 2459 O OD2 . ASP A 1 320 ? -47.780 -8.709  223.540 1.00 58.38  ? 320 ASP A OD2 1 
ATOM 2460 N N   . SER A 1 321 ? -45.784 -11.484 227.058 1.00 18.91  ? 321 SER A N   1 
ATOM 2461 C CA  . SER A 1 321 ? -44.580 -12.054 227.667 1.00 20.77  ? 321 SER A CA  1 
ATOM 2462 C C   . SER A 1 321 ? -43.287 -11.658 226.971 1.00 23.72  ? 321 SER A C   1 
ATOM 2463 O O   . SER A 1 321 ? -42.204 -11.784 227.540 1.00 25.16  ? 321 SER A O   1 
ATOM 2464 C CB  . SER A 1 321 ? -44.648 -13.572 227.661 1.00 13.99  ? 321 SER A CB  1 
ATOM 2465 O OG  . SER A 1 321 ? -44.442 -14.055 226.341 1.00 14.81  ? 321 SER A OG  1 
ATOM 2466 N N   . GLY A 1 322 ? -43.386 -11.213 225.729 1.00 25.79  ? 322 GLY A N   1 
ATOM 2467 C CA  . GLY A 1 322 ? -42.174 -10.886 225.002 1.00 29.27  ? 322 GLY A CA  1 
ATOM 2468 C C   . GLY A 1 322 ? -41.710 -12.081 224.167 1.00 31.35  ? 322 GLY A C   1 
ATOM 2469 O O   . GLY A 1 322 ? -40.708 -11.989 223.458 1.00 34.50  ? 322 GLY A O   1 
ATOM 2470 N N   . HIS A 1 323 ? -42.433 -13.201 224.250 1.00 29.21  ? 323 HIS A N   1 
ATOM 2471 C CA  . HIS A 1 323 ? -42.119 -14.404 223.477 1.00 25.29  ? 323 HIS A CA  1 
ATOM 2472 C C   . HIS A 1 323 ? -43.308 -14.780 222.607 1.00 26.68  ? 323 HIS A C   1 
ATOM 2473 O O   . HIS A 1 323 ? -43.457 -15.946 222.212 1.00 25.00  ? 323 HIS A O   1 
ATOM 2474 C CB  . HIS A 1 323 ? -41.815 -15.566 224.409 1.00 22.59  ? 323 HIS A CB  1 
ATOM 2475 C CG  . HIS A 1 323 ? -40.566 -15.378 225.200 1.00 23.02  ? 323 HIS A CG  1 
ATOM 2476 N ND1 . HIS A 1 323 ? -40.569 -15.229 226.571 1.00 26.25  ? 323 HIS A ND1 1 
ATOM 2477 C CD2 . HIS A 1 323 ? -39.271 -15.295 224.811 1.00 24.30  ? 323 HIS A CD2 1 
ATOM 2478 C CE1 . HIS A 1 323 ? -39.327 -15.064 226.993 1.00 26.66  ? 323 HIS A CE1 1 
ATOM 2479 N NE2 . HIS A 1 323 ? -38.523 -15.100 225.946 1.00 26.03  ? 323 HIS A NE2 1 
ATOM 2480 N N   . ASP A 1 324 ? -44.154 -13.788 222.321 1.00 25.40  ? 324 ASP A N   1 
ATOM 2481 C CA  . ASP A 1 324 ? -45.362 -13.976 221.530 1.00 27.11  ? 324 ASP A CA  1 
ATOM 2482 C C   . ASP A 1 324 ? -46.395 -14.880 222.202 1.00 26.54  ? 324 ASP A C   1 
ATOM 2483 O O   . ASP A 1 324 ? -47.143 -15.614 221.538 1.00 27.66  ? 324 ASP A O   1 
ATOM 2484 C CB  . ASP A 1 324 ? -45.010 -14.458 220.128 1.00 31.46  ? 324 ASP A CB  1 
ATOM 2485 C CG  . ASP A 1 324 ? -44.234 -13.415 219.362 1.00 42.51  ? 324 ASP A CG  1 
ATOM 2486 O OD1 . ASP A 1 324 ? -44.602 -12.224 219.471 1.00 44.63  ? 324 ASP A OD1 1 
ATOM 2487 O OD2 . ASP A 1 324 ? -43.234 -13.771 218.699 1.00 50.82  ? 324 ASP A OD2 1 
ATOM 2488 N N   . THR A 1 325 ? -46.390 -14.850 223.531 1.00 21.60  ? 325 THR A N   1 
ATOM 2489 C CA  . THR A 1 325 ? -47.334 -15.618 224.327 1.00 19.97  ? 325 THR A CA  1 
ATOM 2490 C C   . THR A 1 325 ? -47.956 -14.618 225.286 1.00 18.92  ? 325 THR A C   1 
ATOM 2491 O O   . THR A 1 325 ? -47.471 -13.484 225.414 1.00 18.07  ? 325 THR A O   1 
ATOM 2492 C CB  . THR A 1 325 ? -46.657 -16.744 225.143 1.00 20.48  ? 325 THR A CB  1 
ATOM 2493 O OG1 . THR A 1 325 ? -45.718 -16.181 226.063 1.00 16.06  ? 325 THR A OG1 1 
ATOM 2494 C CG2 . THR A 1 325 ? -45.975 -17.722 224.234 1.00 16.58  ? 325 THR A CG2 1 
ATOM 2495 N N   . VAL A 1 326 ? -49.016 -15.033 225.967 1.00 17.80  ? 326 VAL A N   1 
ATOM 2496 C CA  . VAL A 1 326 ? -49.703 -14.168 226.912 1.00 16.29  ? 326 VAL A CA  1 
ATOM 2497 C C   . VAL A 1 326 ? -49.597 -14.861 228.267 1.00 17.23  ? 326 VAL A C   1 
ATOM 2498 O O   . VAL A 1 326 ? -49.741 -16.093 228.342 1.00 15.48  ? 326 VAL A O   1 
ATOM 2499 C CB  . VAL A 1 326 ? -51.205 -14.011 226.520 1.00 20.38  ? 326 VAL A CB  1 
ATOM 2500 C CG1 . VAL A 1 326 ? -51.860 -12.919 227.347 1.00 22.13  ? 326 VAL A CG1 1 
ATOM 2501 C CG2 . VAL A 1 326 ? -51.342 -13.700 225.043 1.00 21.89  ? 326 VAL A CG2 1 
ATOM 2502 N N   . VAL A 1 327 ? -49.232 -14.103 229.306 1.00 15.49  ? 327 VAL A N   1 
ATOM 2503 C CA  . VAL A 1 327 ? -49.135 -14.648 230.651 1.00 14.03  ? 327 VAL A CA  1 
ATOM 2504 C C   . VAL A 1 327 ? -50.174 -13.934 231.510 1.00 16.54  ? 327 VAL A C   1 
ATOM 2505 O O   . VAL A 1 327 ? -50.551 -12.792 231.222 1.00 17.39  ? 327 VAL A O   1 
ATOM 2506 C CB  . VAL A 1 327 ? -47.698 -14.542 231.263 1.00 18.13  ? 327 VAL A CB  1 
ATOM 2507 C CG1 . VAL A 1 327 ? -46.737 -15.471 230.515 1.00 15.78  ? 327 VAL A CG1 1 
ATOM 2508 C CG2 . VAL A 1 327 ? -47.192 -13.105 231.245 1.00 14.22  ? 327 VAL A CG2 1 
ATOM 2509 N N   . MET A 1 328 ? -50.668 -14.614 232.538 1.00 16.29  ? 328 MET A N   1 
ATOM 2510 C CA  . MET A 1 328 ? -51.697 -14.055 233.407 1.00 15.41  ? 328 MET A CA  1 
ATOM 2511 C C   . MET A 1 328 ? -51.744 -14.905 234.656 1.00 19.05  ? 328 MET A C   1 
ATOM 2512 O O   . MET A 1 328 ? -51.161 -16.000 234.696 1.00 18.83  ? 328 MET A O   1 
ATOM 2513 C CB  . MET A 1 328 ? -53.062 -14.164 232.719 1.00 14.75  ? 328 MET A CB  1 
ATOM 2514 C CG  . MET A 1 328 ? -53.512 -15.624 232.491 1.00 12.55  ? 328 MET A CG  1 
ATOM 2515 S SD  . MET A 1 328 ? -54.577 -15.786 231.054 1.00 19.20  ? 328 MET A SD  1 
ATOM 2516 C CE  . MET A 1 328 ? -53.395 -15.625 229.731 1.00 17.21  ? 328 MET A CE  1 
ATOM 2517 N N   . GLU A 1 329 ? -52.434 -14.410 235.675 1.00 17.22  ? 329 GLU A N   1 
ATOM 2518 C CA  . GLU A 1 329 ? -52.574 -15.170 236.892 1.00 17.26  ? 329 GLU A CA  1 
ATOM 2519 C C   . GLU A 1 329 ? -53.946 -14.883 237.500 1.00 19.00  ? 329 GLU A C   1 
ATOM 2520 O O   . GLU A 1 329 ? -54.355 -13.720 237.647 1.00 16.06  ? 329 GLU A O   1 
ATOM 2521 C CB  . GLU A 1 329 ? -51.466 -14.825 237.882 1.00 18.33  ? 329 GLU A CB  1 
ATOM 2522 C CG  . GLU A 1 329 ? -51.488 -15.720 239.098 1.00 26.82  ? 329 GLU A CG  1 
ATOM 2523 C CD  . GLU A 1 329 ? -50.529 -15.295 240.192 1.00 35.48  ? 329 GLU A CD  1 
ATOM 2524 O OE1 . GLU A 1 329 ? -49.712 -14.379 239.968 1.00 31.47  ? 329 GLU A OE1 1 
ATOM 2525 O OE2 . GLU A 1 329 ? -50.603 -15.887 241.293 1.00 38.08  ? 329 GLU A OE2 1 
ATOM 2526 N N   . VAL A 1 330 ? -54.667 -15.945 237.825 1.00 17.07  ? 330 VAL A N   1 
ATOM 2527 C CA  . VAL A 1 330 ? -55.981 -15.799 238.428 1.00 20.60  ? 330 VAL A CA  1 
ATOM 2528 C C   . VAL A 1 330 ? -56.015 -16.261 239.893 1.00 22.97  ? 330 VAL A C   1 
ATOM 2529 O O   . VAL A 1 330 ? -55.121 -16.968 240.361 1.00 22.32  ? 330 VAL A O   1 
ATOM 2530 C CB  . VAL A 1 330 ? -57.058 -16.572 237.631 1.00 17.77  ? 330 VAL A CB  1 
ATOM 2531 C CG1 . VAL A 1 330 ? -57.172 -16.015 236.223 1.00 15.88  ? 330 VAL A CG1 1 
ATOM 2532 C CG2 . VAL A 1 330 ? -56.752 -18.084 237.616 1.00 15.94  ? 330 VAL A CG2 1 
ATOM 2533 N N   . THR A 1 331 ? -57.028 -15.807 240.620 1.00 22.69  ? 331 THR A N   1 
ATOM 2534 C CA  . THR A 1 331 ? -57.238 -16.195 242.012 1.00 24.54  ? 331 THR A CA  1 
ATOM 2535 C C   . THR A 1 331 ? -58.599 -16.896 241.998 1.00 26.03  ? 331 THR A C   1 
ATOM 2536 O O   . THR A 1 331 ? -59.493 -16.489 241.248 1.00 25.65  ? 331 THR A O   1 
ATOM 2537 C CB  . THR A 1 331 ? -57.301 -14.972 242.928 1.00 23.62  ? 331 THR A CB  1 
ATOM 2538 O OG1 . THR A 1 331 ? -56.058 -14.269 242.845 1.00 26.29  ? 331 THR A OG1 1 
ATOM 2539 C CG2 . THR A 1 331 ? -57.548 -15.378 244.372 1.00 24.63  ? 331 THR A CG2 1 
ATOM 2540 N N   . PHE A 1 332 ? -58.737 -17.965 242.777 1.00 24.77  ? 332 PHE A N   1 
ATOM 2541 C CA  . PHE A 1 332 ? -59.976 -18.738 242.837 1.00 25.98  ? 332 PHE A CA  1 
ATOM 2542 C C   . PHE A 1 332 ? -60.452 -18.779 244.282 1.00 28.50  ? 332 PHE A C   1 
ATOM 2543 O O   . PHE A 1 332 ? -59.674 -19.105 245.188 1.00 29.83  ? 332 PHE A O   1 
ATOM 2544 C CB  . PHE A 1 332 ? -59.719 -20.152 242.329 1.00 21.40  ? 332 PHE A CB  1 
ATOM 2545 C CG  . PHE A 1 332 ? -60.925 -21.031 242.339 1.00 23.37  ? 332 PHE A CG  1 
ATOM 2546 C CD1 . PHE A 1 332 ? -61.957 -20.826 241.430 1.00 28.10  ? 332 PHE A CD1 1 
ATOM 2547 C CD2 . PHE A 1 332 ? -61.012 -22.105 243.231 1.00 22.74  ? 332 PHE A CD2 1 
ATOM 2548 C CE1 . PHE A 1 332 ? -63.069 -21.683 241.391 1.00 28.42  ? 332 PHE A CE1 1 
ATOM 2549 C CE2 . PHE A 1 332 ? -62.110 -22.964 243.204 1.00 24.48  ? 332 PHE A CE2 1 
ATOM 2550 C CZ  . PHE A 1 332 ? -63.145 -22.751 242.275 1.00 29.26  ? 332 PHE A CZ  1 
ATOM 2551 N N   . SER A 1 333 ? -61.729 -18.463 244.499 1.00 30.40  ? 333 SER A N   1 
ATOM 2552 C CA  . SER A 1 333 ? -62.283 -18.432 245.850 1.00 31.56  ? 333 SER A CA  1 
ATOM 2553 C C   . SER A 1 333 ? -63.193 -19.596 246.189 1.00 32.07  ? 333 SER A C   1 
ATOM 2554 O O   . SER A 1 333 ? -63.847 -19.578 247.223 1.00 36.50  ? 333 SER A O   1 
ATOM 2555 C CB  . SER A 1 333 ? -63.039 -17.123 246.075 1.00 33.99  ? 333 SER A CB  1 
ATOM 2556 O OG  . SER A 1 333 ? -64.063 -16.967 245.103 1.00 37.24  ? 333 SER A OG  1 
ATOM 2557 N N   . GLY A 1 334 ? -63.258 -20.589 245.313 1.00 30.40  ? 334 GLY A N   1 
ATOM 2558 C CA  . GLY A 1 334 ? -64.104 -21.739 245.569 1.00 32.33  ? 334 GLY A CA  1 
ATOM 2559 C C   . GLY A 1 334 ? -63.344 -22.869 246.238 1.00 34.77  ? 334 GLY A C   1 
ATOM 2560 O O   . GLY A 1 334 ? -62.256 -22.653 246.792 1.00 33.88  ? 334 GLY A O   1 
ATOM 2561 N N   . THR A 1 335 ? -63.901 -24.078 246.166 1.00 35.49  ? 335 THR A N   1 
ATOM 2562 C CA  . THR A 1 335 ? -63.266 -25.242 246.781 1.00 36.88  ? 335 THR A CA  1 
ATOM 2563 C C   . THR A 1 335 ? -62.219 -25.903 245.888 1.00 36.05  ? 335 THR A C   1 
ATOM 2564 O O   . THR A 1 335 ? -62.455 -26.183 244.697 1.00 34.56  ? 335 THR A O   1 
ATOM 2565 C CB  . THR A 1 335 ? -64.306 -26.288 247.278 1.00 42.68  ? 335 THR A CB  1 
ATOM 2566 O OG1 . THR A 1 335 ? -65.281 -26.536 246.257 1.00 41.85  ? 335 THR A OG1 1 
ATOM 2567 C CG2 . THR A 1 335 ? -65.006 -25.785 248.548 1.00 48.87  ? 335 THR A CG2 1 
ATOM 2568 N N   . LYS A 1 336 ? -61.067 -26.160 246.490 1.00 35.00  ? 336 LYS A N   1 
ATOM 2569 C CA  . LYS A 1 336 ? -59.929 -26.757 245.805 1.00 36.01  ? 336 LYS A CA  1 
ATOM 2570 C C   . LYS A 1 336 ? -59.774 -28.234 246.177 1.00 36.59  ? 336 LYS A C   1 
ATOM 2571 O O   . LYS A 1 336 ? -60.218 -28.663 247.248 1.00 38.81  ? 336 LYS A O   1 
ATOM 2572 C CB  . LYS A 1 336 ? -58.673 -25.968 246.198 1.00 38.27  ? 336 LYS A CB  1 
ATOM 2573 C CG  . LYS A 1 336 ? -58.829 -24.473 245.981 1.00 38.59  ? 336 LYS A CG  1 
ATOM 2574 C CD  . LYS A 1 336 ? -57.843 -23.667 246.785 1.00 45.46  ? 336 LYS A CD  1 
ATOM 2575 C CE  . LYS A 1 336 ? -58.143 -22.187 246.627 1.00 51.35  ? 336 LYS A CE  1 
ATOM 2576 N NZ  . LYS A 1 336 ? -57.210 -21.345 247.420 1.00 57.61  ? 336 LYS A NZ  1 
ATOM 2577 N N   . PRO A 1 337 ? -59.087 -29.026 245.336 1.00 34.06  ? 337 PRO A N   1 
ATOM 2578 C CA  . PRO A 1 337 ? -58.451 -28.630 244.077 1.00 34.17  ? 337 PRO A CA  1 
ATOM 2579 C C   . PRO A 1 337 ? -59.436 -28.795 242.927 1.00 33.89  ? 337 PRO A C   1 
ATOM 2580 O O   . PRO A 1 337 ? -60.419 -29.536 243.061 1.00 34.78  ? 337 PRO A O   1 
ATOM 2581 C CB  . PRO A 1 337 ? -57.309 -29.635 243.968 1.00 37.32  ? 337 PRO A CB  1 
ATOM 2582 C CG  . PRO A 1 337 ? -57.972 -30.897 244.445 1.00 32.60  ? 337 PRO A CG  1 
ATOM 2583 C CD  . PRO A 1 337 ? -58.781 -30.432 245.658 1.00 33.47  ? 337 PRO A CD  1 
ATOM 2584 N N   . CYS A 1 338 ? -59.153 -28.161 241.789 1.00 29.97  ? 338 CYS A N   1 
ATOM 2585 C CA  . CYS A 1 338 ? -60.034 -28.256 240.621 1.00 27.42  ? 338 CYS A CA  1 
ATOM 2586 C C   . CYS A 1 338 ? -59.334 -27.821 239.330 1.00 26.41  ? 338 CYS A C   1 
ATOM 2587 O O   . CYS A 1 338 ? -58.265 -27.204 239.366 1.00 25.90  ? 338 CYS A O   1 
ATOM 2588 C CB  . CYS A 1 338 ? -61.311 -27.430 240.861 1.00 25.57  ? 338 CYS A CB  1 
ATOM 2589 S SG  . CYS A 1 338 ? -61.011 -25.676 241.283 1.00 27.60  ? 338 CYS A SG  1 
ATOM 2590 N N   . ARG A 1 339 ? -59.897 -28.201 238.192 1.00 24.50  ? 339 ARG A N   1 
ATOM 2591 C CA  . ARG A 1 339 ? -59.327 -27.837 236.905 1.00 25.78  ? 339 ARG A CA  1 
ATOM 2592 C C   . ARG A 1 339 ? -59.856 -26.472 236.471 1.00 27.84  ? 339 ARG A C   1 
ATOM 2593 O O   . ARG A 1 339 ? -61.053 -26.201 236.578 1.00 29.14  ? 339 ARG A O   1 
ATOM 2594 C CB  . ARG A 1 339 ? -59.656 -28.899 235.865 1.00 25.70  ? 339 ARG A CB  1 
ATOM 2595 C CG  . ARG A 1 339 ? -58.762 -30.115 235.978 1.00 33.70  ? 339 ARG A CG  1 
ATOM 2596 C CD  . ARG A 1 339 ? -59.506 -31.380 235.649 1.00 36.01  ? 339 ARG A CD  1 
ATOM 2597 N NE  . ARG A 1 339 ? -59.960 -31.413 234.265 1.00 48.30  ? 339 ARG A NE  1 
ATOM 2598 C CZ  . ARG A 1 339 ? -61.144 -31.883 233.883 1.00 52.12  ? 339 ARG A CZ  1 
ATOM 2599 N NH1 . ARG A 1 339 ? -61.999 -32.358 234.784 1.00 45.84  ? 339 ARG A NH1 1 
ATOM 2600 N NH2 . ARG A 1 339 ? -61.468 -31.892 232.595 1.00 52.14  ? 339 ARG A NH2 1 
ATOM 2601 N N   . ILE A 1 340 ? -58.960 -25.605 236.009 1.00 25.74  ? 340 ILE A N   1 
ATOM 2602 C CA  . ILE A 1 340 ? -59.349 -24.266 235.573 1.00 24.82  ? 340 ILE A CA  1 
ATOM 2603 C C   . ILE A 1 340 ? -59.947 -24.319 234.167 1.00 23.54  ? 340 ILE A C   1 
ATOM 2604 O O   . ILE A 1 340 ? -59.348 -24.889 233.260 1.00 22.10  ? 340 ILE A O   1 
ATOM 2605 C CB  . ILE A 1 340 ? -58.131 -23.284 235.564 1.00 21.98  ? 340 ILE A CB  1 
ATOM 2606 C CG1 . ILE A 1 340 ? -57.495 -23.204 236.957 1.00 17.13  ? 340 ILE A CG1 1 
ATOM 2607 C CG2 . ILE A 1 340 ? -58.582 -21.882 235.131 1.00 20.73  ? 340 ILE A CG2 1 
ATOM 2608 C CD1 . ILE A 1 340 ? -56.280 -22.300 237.025 1.00 20.33  ? 340 ILE A CD1 1 
ATOM 2609 N N   . PRO A 1 341 ? -61.174 -23.797 233.991 1.00 25.01  ? 341 PRO A N   1 
ATOM 2610 C CA  . PRO A 1 341 ? -61.838 -23.783 232.681 1.00 25.40  ? 341 PRO A CA  1 
ATOM 2611 C C   . PRO A 1 341 ? -61.378 -22.564 231.860 1.00 27.68  ? 341 PRO A C   1 
ATOM 2612 O O   . PRO A 1 341 ? -62.037 -21.516 231.856 1.00 32.21  ? 341 PRO A O   1 
ATOM 2613 C CB  . PRO A 1 341 ? -63.314 -23.692 233.056 1.00 22.01  ? 341 PRO A CB  1 
ATOM 2614 C CG  . PRO A 1 341 ? -63.287 -22.879 234.317 1.00 25.13  ? 341 PRO A CG  1 
ATOM 2615 C CD  . PRO A 1 341 ? -62.118 -23.447 235.072 1.00 25.47  ? 341 PRO A CD  1 
ATOM 2616 N N   . VAL A 1 342 ? -60.253 -22.712 231.168 1.00 25.67  ? 342 VAL A N   1 
ATOM 2617 C CA  . VAL A 1 342 ? -59.668 -21.640 230.359 1.00 23.71  ? 342 VAL A CA  1 
ATOM 2618 C C   . VAL A 1 342 ? -59.927 -21.860 228.888 1.00 23.70  ? 342 VAL A C   1 
ATOM 2619 O O   . VAL A 1 342 ? -59.790 -22.979 228.401 1.00 26.53  ? 342 VAL A O   1 
ATOM 2620 C CB  . VAL A 1 342 ? -58.116 -21.629 230.415 1.00 27.59  ? 342 VAL A CB  1 
ATOM 2621 C CG1 . VAL A 1 342 ? -57.591 -20.209 230.303 1.00 22.63  ? 342 VAL A CG1 1 
ATOM 2622 C CG2 . VAL A 1 342 ? -57.585 -22.375 231.612 1.00 21.92  ? 342 VAL A CG2 1 
ATOM 2623 N N   . ARG A 1 343 ? -60.174 -20.779 228.163 1.00 21.74  ? 343 ARG A N   1 
ATOM 2624 C CA  . ARG A 1 343 ? -60.377 -20.845 226.720 1.00 21.55  ? 343 ARG A CA  1 
ATOM 2625 C C   . ARG A 1 343 ? -60.327 -19.415 226.234 1.00 21.44  ? 343 ARG A C   1 
ATOM 2626 O O   . ARG A 1 343 ? -60.277 -18.477 227.039 1.00 21.53  ? 343 ARG A O   1 
ATOM 2627 C CB  . ARG A 1 343 ? -61.728 -21.469 226.356 1.00 26.96  ? 343 ARG A CB  1 
ATOM 2628 C CG  . ARG A 1 343 ? -62.907 -20.597 226.715 1.00 27.03  ? 343 ARG A CG  1 
ATOM 2629 C CD  . ARG A 1 343 ? -64.243 -21.304 226.521 1.00 38.88  ? 343 ARG A CD  1 
ATOM 2630 N NE  . ARG A 1 343 ? -65.294 -20.503 227.146 1.00 41.83  ? 343 ARG A NE  1 
ATOM 2631 C CZ  . ARG A 1 343 ? -66.103 -19.671 226.492 1.00 39.61  ? 343 ARG A CZ  1 
ATOM 2632 N NH1 . ARG A 1 343 ? -66.010 -19.542 225.166 1.00 34.27  ? 343 ARG A NH1 1 
ATOM 2633 N NH2 . ARG A 1 343 ? -66.926 -18.882 227.186 1.00 32.68  ? 343 ARG A NH2 1 
ATOM 2634 N N   . ALA A 1 344 ? -60.313 -19.245 224.921 1.00 19.97  ? 344 ALA A N   1 
ATOM 2635 C CA  . ALA A 1 344 ? -60.282 -17.918 224.336 1.00 21.26  ? 344 ALA A CA  1 
ATOM 2636 C C   . ALA A 1 344 ? -60.946 -18.037 222.980 1.00 24.03  ? 344 ALA A C   1 
ATOM 2637 O O   . ALA A 1 344 ? -60.874 -19.101 222.342 1.00 22.07  ? 344 ALA A O   1 
ATOM 2638 C CB  . ALA A 1 344 ? -58.845 -17.426 224.189 1.00 14.45  ? 344 ALA A CB  1 
ATOM 2639 N N   . VAL A 1 345 ? -61.628 -16.970 222.564 1.00 24.71  ? 345 VAL A N   1 
ATOM 2640 C CA  . VAL A 1 345 ? -62.308 -16.950 221.275 1.00 23.00  ? 345 VAL A CA  1 
ATOM 2641 C C   . VAL A 1 345 ? -61.918 -15.691 220.537 1.00 23.51  ? 345 VAL A C   1 
ATOM 2642 O O   . VAL A 1 345 ? -61.541 -14.682 221.151 1.00 23.17  ? 345 VAL A O   1 
ATOM 2643 C CB  . VAL A 1 345 ? -63.852 -16.952 221.428 1.00 21.85  ? 345 VAL A CB  1 
ATOM 2644 C CG1 . VAL A 1 345 ? -64.315 -18.176 222.217 1.00 16.85  ? 345 VAL A CG1 1 
ATOM 2645 C CG2 . VAL A 1 345 ? -64.319 -15.665 222.104 1.00 23.93  ? 345 VAL A CG2 1 
ATOM 2646 N N   . ALA A 1 346 ? -61.983 -15.759 219.214 1.00 23.95  ? 346 ALA A N   1 
ATOM 2647 C CA  . ALA A 1 346 ? -61.684 -14.609 218.388 1.00 23.90  ? 346 ALA A CA  1 
ATOM 2648 C C   . ALA A 1 346 ? -62.960 -13.750 218.419 1.00 25.99  ? 346 ALA A C   1 
ATOM 2649 O O   . ALA A 1 346 ? -64.078 -14.280 218.464 1.00 23.56  ? 346 ALA A O   1 
ATOM 2650 C CB  . ALA A 1 346 ? -61.370 -15.045 216.965 1.00 24.29  ? 346 ALA A CB  1 
ATOM 2651 N N   . HIS A 1 347 ? -62.783 -12.436 218.476 1.00 26.61  ? 347 HIS A N   1 
ATOM 2652 C CA  . HIS A 1 347 ? -63.897 -11.495 218.491 1.00 30.53  ? 347 HIS A CA  1 
ATOM 2653 C C   . HIS A 1 347 ? -64.813 -11.843 217.288 1.00 31.97  ? 347 HIS A C   1 
ATOM 2654 O O   . HIS A 1 347 ? -64.350 -11.898 216.146 1.00 31.12  ? 347 HIS A O   1 
ATOM 2655 C CB  . HIS A 1 347 ? -63.314 -10.074 218.378 1.00 32.71  ? 347 HIS A CB  1 
ATOM 2656 C CG  . HIS A 1 347 ? -64.330 -8.977  218.455 1.00 50.84  ? 347 HIS A CG  1 
ATOM 2657 N ND1 . HIS A 1 347 ? -65.431 -8.914  217.624 1.00 59.71  ? 347 HIS A ND1 1 
ATOM 2658 C CD2 . HIS A 1 347 ? -64.406 -7.891  219.260 1.00 56.80  ? 347 HIS A CD2 1 
ATOM 2659 C CE1 . HIS A 1 347 ? -66.142 -7.839  217.917 1.00 61.89  ? 347 HIS A CE1 1 
ATOM 2660 N NE2 . HIS A 1 347 ? -65.543 -7.201  218.905 1.00 62.47  ? 347 HIS A NE2 1 
ATOM 2661 N N   . GLY A 1 348 ? -66.085 -12.146 217.548 1.00 32.41  ? 348 GLY A N   1 
ATOM 2662 C CA  . GLY A 1 348 ? -66.998 -12.482 216.465 1.00 32.20  ? 348 GLY A CA  1 
ATOM 2663 C C   . GLY A 1 348 ? -67.296 -13.968 216.270 1.00 35.55  ? 348 GLY A C   1 
ATOM 2664 O O   . GLY A 1 348 ? -68.279 -14.312 215.611 1.00 35.19  ? 348 GLY A O   1 
ATOM 2665 N N   . SER A 1 349 ? -66.454 -14.852 216.806 1.00 34.08  ? 349 SER A N   1 
ATOM 2666 C CA  . SER A 1 349 ? -66.669 -16.297 216.689 1.00 34.66  ? 349 SER A CA  1 
ATOM 2667 C C   . SER A 1 349 ? -66.622 -16.900 218.087 1.00 35.36  ? 349 SER A C   1 
ATOM 2668 O O   . SER A 1 349 ? -65.640 -17.527 218.472 1.00 36.01  ? 349 SER A O   1 
ATOM 2669 C CB  . SER A 1 349 ? -65.579 -16.936 215.830 1.00 32.21  ? 349 SER A CB  1 
ATOM 2670 O OG  . SER A 1 349 ? -65.370 -16.193 214.648 1.00 37.85  ? 349 SER A OG  1 
ATOM 2671 N N   . PRO A 1 350 ? -67.701 -16.755 218.860 1.00 36.43  ? 350 PRO A N   1 
ATOM 2672 C CA  . PRO A 1 350 ? -67.731 -17.294 220.221 1.00 35.73  ? 350 PRO A CA  1 
ATOM 2673 C C   . PRO A 1 350 ? -67.682 -18.814 220.369 1.00 36.68  ? 350 PRO A C   1 
ATOM 2674 O O   . PRO A 1 350 ? -67.492 -19.323 221.472 1.00 37.25  ? 350 PRO A O   1 
ATOM 2675 C CB  . PRO A 1 350 ? -69.033 -16.722 220.771 1.00 33.12  ? 350 PRO A CB  1 
ATOM 2676 C CG  . PRO A 1 350 ? -69.904 -16.672 219.566 1.00 33.36  ? 350 PRO A CG  1 
ATOM 2677 C CD  . PRO A 1 350 ? -68.980 -16.106 218.520 1.00 36.22  ? 350 PRO A CD  1 
ATOM 2678 N N   . ASP A 1 351 ? -67.837 -19.537 219.267 1.00 39.04  ? 351 ASP A N   1 
ATOM 2679 C CA  . ASP A 1 351 ? -67.848 -21.002 219.304 1.00 43.40  ? 351 ASP A CA  1 
ATOM 2680 C C   . ASP A 1 351 ? -66.515 -21.744 219.203 1.00 44.09  ? 351 ASP A C   1 
ATOM 2681 O O   . ASP A 1 351 ? -66.379 -22.857 219.730 1.00 47.32  ? 351 ASP A O   1 
ATOM 2682 C CB  . ASP A 1 351 ? -68.805 -21.541 218.233 1.00 50.70  ? 351 ASP A CB  1 
ATOM 2683 C CG  . ASP A 1 351 ? -70.255 -21.202 218.523 1.00 59.82  ? 351 ASP A CG  1 
ATOM 2684 O OD1 . ASP A 1 351 ? -70.730 -21.526 219.639 1.00 58.83  ? 351 ASP A OD1 1 
ATOM 2685 O OD2 . ASP A 1 351 ? -70.913 -20.616 217.631 1.00 67.35  ? 351 ASP A OD2 1 
ATOM 2686 N N   . VAL A 1 352 ? -65.544 -21.147 218.521 1.00 41.59  ? 352 VAL A N   1 
ATOM 2687 C CA  . VAL A 1 352 ? -64.233 -21.769 218.333 1.00 37.86  ? 352 VAL A CA  1 
ATOM 2688 C C   . VAL A 1 352 ? -63.193 -21.356 219.390 1.00 34.32  ? 352 VAL A C   1 
ATOM 2689 O O   . VAL A 1 352 ? -62.873 -20.169 219.507 1.00 30.06  ? 352 VAL A O   1 
ATOM 2690 C CB  . VAL A 1 352 ? -63.660 -21.393 216.949 1.00 37.91  ? 352 VAL A CB  1 
ATOM 2691 C CG1 . VAL A 1 352 ? -62.405 -22.189 216.656 1.00 38.38  ? 352 VAL A CG1 1 
ATOM 2692 C CG2 . VAL A 1 352 ? -64.711 -21.589 215.875 1.00 41.43  ? 352 VAL A CG2 1 
ATOM 2693 N N   . ASN A 1 353 ? -62.676 -22.325 220.147 1.00 29.97  ? 353 ASN A N   1 
ATOM 2694 C CA  . ASN A 1 353 ? -61.639 -22.060 221.144 1.00 29.18  ? 353 ASN A CA  1 
ATOM 2695 C C   . ASN A 1 353 ? -60.340 -21.884 220.345 1.00 29.80  ? 353 ASN A C   1 
ATOM 2696 O O   . ASN A 1 353 ? -59.979 -22.757 219.555 1.00 30.99  ? 353 ASN A O   1 
ATOM 2697 C CB  . ASN A 1 353 ? -61.498 -23.244 222.100 1.00 28.57  ? 353 ASN A CB  1 
ATOM 2698 C CG  . ASN A 1 353 ? -60.419 -23.030 223.164 1.00 33.69  ? 353 ASN A CG  1 
ATOM 2699 O OD1 . ASN A 1 353 ? -59.716 -22.015 223.177 1.00 31.24  ? 353 ASN A OD1 1 
ATOM 2700 N ND2 . ASN A 1 353 ? -60.309 -23.979 224.082 1.00 34.50  ? 353 ASN A ND2 1 
ATOM 2701 N N   . VAL A 1 354 ? -59.673 -20.743 220.498 1.00 27.85  ? 354 VAL A N   1 
ATOM 2702 C CA  . VAL A 1 354 ? -58.436 -20.483 219.766 1.00 25.94  ? 354 VAL A CA  1 
ATOM 2703 C C   . VAL A 1 354 ? -57.179 -20.472 220.654 1.00 28.09  ? 354 VAL A C   1 
ATOM 2704 O O   . VAL A 1 354 ? -56.077 -20.196 220.167 1.00 29.65  ? 354 VAL A O   1 
ATOM 2705 C CB  . VAL A 1 354 ? -58.510 -19.150 218.964 1.00 24.66  ? 354 VAL A CB  1 
ATOM 2706 C CG1 . VAL A 1 354 ? -59.622 -19.199 217.942 1.00 25.27  ? 354 VAL A CG1 1 
ATOM 2707 C CG2 . VAL A 1 354 ? -58.712 -17.975 219.898 1.00 24.92  ? 354 VAL A CG2 1 
ATOM 2708 N N   . ALA A 1 355 ? -57.342 -20.800 221.936 1.00 26.62  ? 355 ALA A N   1 
ATOM 2709 C CA  . ALA A 1 355 ? -56.226 -20.808 222.885 1.00 27.21  ? 355 ALA A CA  1 
ATOM 2710 C C   . ALA A 1 355 ? -55.349 -22.064 222.803 1.00 28.52  ? 355 ALA A C   1 
ATOM 2711 O O   . ALA A 1 355 ? -55.863 -23.196 222.818 1.00 28.89  ? 355 ALA A O   1 
ATOM 2712 C CB  . ALA A 1 355 ? -56.755 -20.638 224.309 1.00 20.34  ? 355 ALA A CB  1 
ATOM 2713 N N   . MET A 1 356 ? -54.036 -21.856 222.691 1.00 27.70  ? 356 MET A N   1 
ATOM 2714 C CA  . MET A 1 356 ? -53.056 -22.953 222.654 1.00 25.95  ? 356 MET A CA  1 
ATOM 2715 C C   . MET A 1 356 ? -52.303 -22.799 223.971 1.00 23.20  ? 356 MET A C   1 
ATOM 2716 O O   . MET A 1 356 ? -51.523 -21.861 224.142 1.00 22.60  ? 356 MET A O   1 
ATOM 2717 C CB  . MET A 1 356 ? -52.110 -22.796 221.466 1.00 27.81  ? 356 MET A CB  1 
ATOM 2718 C CG  . MET A 1 356 ? -52.829 -22.815 220.114 1.00 53.69  ? 356 MET A CG  1 
ATOM 2719 S SD  . MET A 1 356 ? -51.969 -21.942 218.742 1.00 72.54  ? 356 MET A SD  1 
ATOM 2720 C CE  . MET A 1 356 ? -52.899 -20.325 218.650 1.00 58.47  ? 356 MET A CE  1 
ATOM 2721 N N   . LEU A 1 357 ? -52.608 -23.660 224.934 1.00 21.22  ? 357 LEU A N   1 
ATOM 2722 C CA  . LEU A 1 357 ? -51.984 -23.583 226.252 1.00 22.84  ? 357 LEU A CA  1 
ATOM 2723 C C   . LEU A 1 357 ? -50.555 -24.103 226.317 1.00 22.75  ? 357 LEU A C   1 
ATOM 2724 O O   . LEU A 1 357 ? -50.239 -25.134 225.741 1.00 20.00  ? 357 LEU A O   1 
ATOM 2725 C CB  . LEU A 1 357 ? -52.839 -24.328 227.285 1.00 21.41  ? 357 LEU A CB  1 
ATOM 2726 C CG  . LEU A 1 357 ? -54.243 -23.789 227.566 1.00 22.62  ? 357 LEU A CG  1 
ATOM 2727 C CD1 . LEU A 1 357 ? -54.945 -24.694 228.544 1.00 20.10  ? 357 LEU A CD1 1 
ATOM 2728 C CD2 . LEU A 1 357 ? -54.169 -22.378 228.133 1.00 26.08  ? 357 LEU A CD2 1 
ATOM 2729 N N   . ILE A 1 358 ? -49.689 -23.349 226.983 1.00 23.00  ? 358 ILE A N   1 
ATOM 2730 C CA  . ILE A 1 358 ? -48.303 -23.756 227.184 1.00 22.95  ? 358 ILE A CA  1 
ATOM 2731 C C   . ILE A 1 358 ? -48.352 -24.482 228.540 1.00 23.16  ? 358 ILE A C   1 
ATOM 2732 O O   . ILE A 1 358 ? -47.760 -25.543 228.707 1.00 21.25  ? 358 ILE A O   1 
ATOM 2733 C CB  . ILE A 1 358 ? -47.336 -22.537 227.309 1.00 23.90  ? 358 ILE A CB  1 
ATOM 2734 C CG1 . ILE A 1 358 ? -47.295 -21.726 226.008 1.00 16.81  ? 358 ILE A CG1 1 
ATOM 2735 C CG2 . ILE A 1 358 ? -45.946 -23.010 227.718 1.00 20.80  ? 358 ILE A CG2 1 
ATOM 2736 C CD1 . ILE A 1 358 ? -46.679 -22.439 224.876 1.00 22.97  ? 358 ILE A CD1 1 
ATOM 2737 N N   . THR A 1 359 ? -49.034 -23.873 229.512 1.00 20.29  ? 359 THR A N   1 
ATOM 2738 C CA  . THR A 1 359 ? -49.198 -24.463 230.841 1.00 23.54  ? 359 THR A CA  1 
ATOM 2739 C C   . THR A 1 359 ? -50.137 -25.675 230.687 1.00 27.58  ? 359 THR A C   1 
ATOM 2740 O O   . THR A 1 359 ? -51.275 -25.539 230.221 1.00 23.84  ? 359 THR A O   1 
ATOM 2741 C CB  . THR A 1 359 ? -49.835 -23.460 231.824 1.00 21.73  ? 359 THR A CB  1 
ATOM 2742 O OG1 . THR A 1 359 ? -49.186 -22.188 231.695 1.00 24.05  ? 359 THR A OG1 1 
ATOM 2743 C CG2 . THR A 1 359 ? -49.701 -23.949 233.270 1.00 21.00  ? 359 THR A CG2 1 
ATOM 2744 N N   . PRO A 1 360 ? -49.664 -26.879 231.074 1.00 32.65  ? 360 PRO A N   1 
ATOM 2745 C CA  . PRO A 1 360 ? -50.465 -28.107 230.967 1.00 32.75  ? 360 PRO A CA  1 
ATOM 2746 C C   . PRO A 1 360 ? -51.551 -28.184 232.043 1.00 29.99  ? 360 PRO A C   1 
ATOM 2747 O O   . PRO A 1 360 ? -51.329 -27.767 233.204 1.00 27.46  ? 360 PRO A O   1 
ATOM 2748 C CB  . PRO A 1 360 ? -49.417 -29.202 231.195 1.00 34.69  ? 360 PRO A CB  1 
ATOM 2749 C CG  . PRO A 1 360 ? -48.559 -28.576 232.313 1.00 34.27  ? 360 PRO A CG  1 
ATOM 2750 C CD  . PRO A 1 360 ? -48.384 -27.141 231.786 1.00 30.76  ? 360 PRO A CD  1 
ATOM 2751 N N   . ASN A 1 361 ? -52.717 -28.695 231.643 1.00 27.58  ? 361 ASN A N   1 
ATOM 2752 C CA  . ASN A 1 361 ? -53.867 -28.894 232.533 1.00 25.29  ? 361 ASN A CA  1 
ATOM 2753 C C   . ASN A 1 361 ? -53.895 -27.933 233.730 1.00 23.83  ? 361 ASN A C   1 
ATOM 2754 O O   . ASN A 1 361 ? -53.741 -28.355 234.890 1.00 25.33  ? 361 ASN A O   1 
ATOM 2755 C CB  . ASN A 1 361 ? -53.866 -30.348 233.020 1.00 26.22  ? 361 ASN A CB  1 
ATOM 2756 C CG  . ASN A 1 361 ? -55.115 -30.696 233.801 1.00 30.35  ? 361 ASN A CG  1 
ATOM 2757 O OD1 . ASN A 1 361 ? -56.227 -30.520 233.314 1.00 33.02  ? 361 ASN A OD1 1 
ATOM 2758 N ND2 . ASN A 1 361 ? -54.937 -31.182 235.021 1.00 32.15  ? 361 ASN A ND2 1 
ATOM 2759 N N   . PRO A 1 362 ? -54.138 -26.634 233.473 1.00 22.06  ? 362 PRO A N   1 
ATOM 2760 C CA  . PRO A 1 362 ? -54.165 -25.646 234.560 1.00 20.50  ? 362 PRO A CA  1 
ATOM 2761 C C   . PRO A 1 362 ? -55.118 -26.054 235.675 1.00 21.19  ? 362 PRO A C   1 
ATOM 2762 O O   . PRO A 1 362 ? -56.283 -26.383 235.426 1.00 20.87  ? 362 PRO A O   1 
ATOM 2763 C CB  . PRO A 1 362 ? -54.605 -24.349 233.850 1.00 20.78  ? 362 PRO A CB  1 
ATOM 2764 C CG  . PRO A 1 362 ? -54.145 -24.563 232.411 1.00 22.76  ? 362 PRO A CG  1 
ATOM 2765 C CD  . PRO A 1 362 ? -54.495 -26.018 232.181 1.00 20.12  ? 362 PRO A CD  1 
ATOM 2766 N N   . THR A 1 363 ? -54.618 -26.037 236.902 1.00 20.70  ? 363 THR A N   1 
ATOM 2767 C CA  . THR A 1 363 ? -55.411 -26.423 238.054 1.00 23.03  ? 363 THR A CA  1 
ATOM 2768 C C   . THR A 1 363 ? -55.150 -25.490 239.208 1.00 25.39  ? 363 THR A C   1 
ATOM 2769 O O   . THR A 1 363 ? -54.127 -24.804 239.241 1.00 28.13  ? 363 THR A O   1 
ATOM 2770 C CB  . THR A 1 363 ? -55.040 -27.853 238.554 1.00 25.71  ? 363 THR A CB  1 
ATOM 2771 O OG1 . THR A 1 363 ? -53.629 -27.926 238.812 1.00 26.20  ? 363 THR A OG1 1 
ATOM 2772 C CG2 . THR A 1 363 ? -55.425 -28.919 237.523 1.00 29.11  ? 363 THR A CG2 1 
ATOM 2773 N N   . ILE A 1 364 ? -56.110 -25.416 240.116 1.00 24.22  ? 364 ILE A N   1 
ATOM 2774 C CA  . ILE A 1 364 ? -55.949 -24.625 241.315 1.00 26.27  ? 364 ILE A CA  1 
ATOM 2775 C C   . ILE A 1 364 ? -55.785 -25.709 242.384 1.00 28.73  ? 364 ILE A C   1 
ATOM 2776 O O   . ILE A 1 364 ? -56.705 -26.504 242.618 1.00 27.78  ? 364 ILE A O   1 
ATOM 2777 C CB  . ILE A 1 364 ? -57.194 -23.798 241.627 1.00 26.21  ? 364 ILE A CB  1 
ATOM 2778 C CG1 . ILE A 1 364 ? -57.454 -22.774 240.518 1.00 26.28  ? 364 ILE A CG1 1 
ATOM 2779 C CG2 . ILE A 1 364 ? -57.036 -23.140 242.993 1.00 20.41  ? 364 ILE A CG2 1 
ATOM 2780 C CD1 . ILE A 1 364 ? -56.500 -21.608 240.537 1.00 22.52  ? 364 ILE A CD1 1 
ATOM 2781 N N   . GLU A 1 365 ? -54.579 -25.831 242.927 1.00 30.30  ? 365 GLU A N   1 
ATOM 2782 C CA  . GLU A 1 365 ? -54.302 -26.829 243.960 1.00 32.90  ? 365 GLU A CA  1 
ATOM 2783 C C   . GLU A 1 365 ? -54.651 -26.206 245.303 1.00 36.81  ? 365 GLU A C   1 
ATOM 2784 O O   . GLU A 1 365 ? -55.097 -25.051 245.364 1.00 38.66  ? 365 GLU A O   1 
ATOM 2785 C CB  . GLU A 1 365 ? -52.828 -27.241 243.942 1.00 28.16  ? 365 GLU A CB  1 
ATOM 2786 C CG  . GLU A 1 365 ? -52.336 -27.806 242.609 1.00 31.49  ? 365 GLU A CG  1 
ATOM 2787 C CD  . GLU A 1 365 ? -52.933 -29.170 242.246 1.00 38.79  ? 365 GLU A CD  1 
ATOM 2788 O OE1 . GLU A 1 365 ? -53.535 -29.824 243.128 1.00 41.75  ? 365 GLU A OE1 1 
ATOM 2789 O OE2 . GLU A 1 365 ? -52.779 -29.598 241.075 1.00 37.79  ? 365 GLU A OE2 1 
ATOM 2790 N N   . ASN A 1 366 ? -54.466 -26.958 246.381 1.00 39.87  ? 366 ASN A N   1 
ATOM 2791 C CA  . ASN A 1 366 ? -54.785 -26.431 247.702 1.00 44.33  ? 366 ASN A CA  1 
ATOM 2792 C C   . ASN A 1 366 ? -53.862 -25.279 248.099 1.00 45.44  ? 366 ASN A C   1 
ATOM 2793 O O   . ASN A 1 366 ? -54.260 -24.393 248.865 1.00 46.73  ? 366 ASN A O   1 
ATOM 2794 C CB  . ASN A 1 366 ? -54.763 -27.544 248.768 1.00 48.08  ? 366 ASN A CB  1 
ATOM 2795 C CG  . ASN A 1 366 ? -56.024 -28.416 248.743 1.00 50.98  ? 366 ASN A CG  1 
ATOM 2796 O OD1 . ASN A 1 366 ? -55.946 -29.635 248.570 1.00 53.50  ? 366 ASN A OD1 1 
ATOM 2797 N ND2 . ASN A 1 366 ? -57.186 -27.793 248.920 1.00 53.56  ? 366 ASN A ND2 1 
ATOM 2798 N N   . ASN A 1 367 ? -52.663 -25.246 247.520 1.00 44.58  ? 367 ASN A N   1 
ATOM 2799 C CA  . ASN A 1 367 ? -51.682 -24.206 247.840 1.00 45.89  ? 367 ASN A CA  1 
ATOM 2800 C C   . ASN A 1 367 ? -50.872 -23.755 246.620 1.00 42.13  ? 367 ASN A C   1 
ATOM 2801 O O   . ASN A 1 367 ? -49.691 -23.419 246.739 1.00 43.61  ? 367 ASN A O   1 
ATOM 2802 C CB  . ASN A 1 367 ? -50.724 -24.733 248.917 1.00 54.82  ? 367 ASN A CB  1 
ATOM 2803 C CG  . ASN A 1 367 ? -50.070 -26.066 248.519 1.00 68.93  ? 367 ASN A CG  1 
ATOM 2804 O OD1 . ASN A 1 367 ? -50.447 -26.697 247.509 1.00 69.83  ? 367 ASN A OD1 1 
ATOM 2805 N ND2 . ASN A 1 367 ? -49.095 -26.505 249.312 1.00 75.05  ? 367 ASN A ND2 1 
ATOM 2806 N N   . GLY A 1 368 ? -51.507 -23.723 245.457 1.00 38.16  ? 368 GLY A N   1 
ATOM 2807 C CA  . GLY A 1 368 ? -50.803 -23.314 244.260 1.00 33.38  ? 368 GLY A CA  1 
ATOM 2808 C C   . GLY A 1 368 ? -51.698 -23.281 243.046 1.00 30.57  ? 368 GLY A C   1 
ATOM 2809 O O   . GLY A 1 368 ? -52.902 -23.516 243.158 1.00 30.20  ? 368 GLY A O   1 
ATOM 2810 N N   . GLY A 1 369 ? -51.099 -23.045 241.881 1.00 26.90  ? 369 GLY A N   1 
ATOM 2811 C CA  . GLY A 1 369 ? -51.854 -22.977 240.643 1.00 24.14  ? 369 GLY A CA  1 
ATOM 2812 C C   . GLY A 1 369 ? -52.357 -21.567 240.386 1.00 21.81  ? 369 GLY A C   1 
ATOM 2813 O O   . GLY A 1 369 ? -52.314 -20.716 241.282 1.00 24.33  ? 369 GLY A O   1 
ATOM 2814 N N   . GLY A 1 370 ? -52.800 -21.298 239.164 1.00 18.26  ? 370 GLY A N   1 
ATOM 2815 C CA  . GLY A 1 370 ? -53.308 -19.976 238.871 1.00 16.84  ? 370 GLY A CA  1 
ATOM 2816 C C   . GLY A 1 370 ? -52.583 -19.233 237.770 1.00 20.25  ? 370 GLY A C   1 
ATOM 2817 O O   . GLY A 1 370 ? -53.173 -18.345 237.136 1.00 18.96  ? 370 GLY A O   1 
ATOM 2818 N N   . PHE A 1 371 ? -51.298 -19.537 237.582 1.00 18.70  ? 371 PHE A N   1 
ATOM 2819 C CA  . PHE A 1 371 ? -50.504 -18.905 236.533 1.00 16.77  ? 371 PHE A CA  1 
ATOM 2820 C C   . PHE A 1 371 ? -50.727 -19.687 235.250 1.00 15.06  ? 371 PHE A C   1 
ATOM 2821 O O   . PHE A 1 371 ? -50.677 -20.917 235.243 1.00 16.90  ? 371 PHE A O   1 
ATOM 2822 C CB  . PHE A 1 371 ? -49.009 -18.866 236.911 1.00 15.92  ? 371 PHE A CB  1 
ATOM 2823 C CG  . PHE A 1 371 ? -48.099 -18.566 235.753 1.00 17.98  ? 371 PHE A CG  1 
ATOM 2824 C CD1 . PHE A 1 371 ? -48.074 -17.306 235.176 1.00 17.91  ? 371 PHE A CD1 1 
ATOM 2825 C CD2 . PHE A 1 371 ? -47.278 -19.556 235.228 1.00 14.63  ? 371 PHE A CD2 1 
ATOM 2826 C CE1 . PHE A 1 371 ? -47.243 -17.034 234.088 1.00 19.03  ? 371 PHE A CE1 1 
ATOM 2827 C CE2 . PHE A 1 371 ? -46.438 -19.295 234.136 1.00 20.07  ? 371 PHE A CE2 1 
ATOM 2828 C CZ  . PHE A 1 371 ? -46.424 -18.031 233.567 1.00 16.41  ? 371 PHE A CZ  1 
ATOM 2829 N N   . ILE A 1 372 ? -51.001 -18.971 234.166 1.00 16.67  ? 372 ILE A N   1 
ATOM 2830 C CA  . ILE A 1 372 ? -51.257 -19.594 232.874 1.00 17.63  ? 372 ILE A CA  1 
ATOM 2831 C C   . ILE A 1 372 ? -50.528 -18.830 231.784 1.00 17.43  ? 372 ILE A C   1 
ATOM 2832 O O   . ILE A 1 372 ? -50.494 -17.599 231.797 1.00 15.23  ? 372 ILE A O   1 
ATOM 2833 C CB  . ILE A 1 372 ? -52.772 -19.545 232.487 1.00 17.81  ? 372 ILE A CB  1 
ATOM 2834 C CG1 . ILE A 1 372 ? -53.638 -20.222 233.546 1.00 16.22  ? 372 ILE A CG1 1 
ATOM 2835 C CG2 . ILE A 1 372 ? -52.999 -20.189 231.123 1.00 15.75  ? 372 ILE A CG2 1 
ATOM 2836 C CD1 . ILE A 1 372 ? -55.114 -19.913 233.385 1.00 20.68  ? 372 ILE A CD1 1 
ATOM 2837 N N   . GLU A 1 373 ? -49.905 -19.575 230.877 1.00 15.52  ? 373 GLU A N   1 
ATOM 2838 C CA  . GLU A 1 373 ? -49.236 -18.981 229.736 1.00 15.55  ? 373 GLU A CA  1 
ATOM 2839 C C   . GLU A 1 373 ? -49.879 -19.641 228.517 1.00 17.73  ? 373 GLU A C   1 
ATOM 2840 O O   . GLU A 1 373 ? -50.010 -20.868 228.464 1.00 16.09  ? 373 GLU A O   1 
ATOM 2841 C CB  . GLU A 1 373 ? -47.733 -19.253 229.734 1.00 15.18  ? 373 GLU A CB  1 
ATOM 2842 C CG  . GLU A 1 373 ? -47.049 -18.689 228.472 1.00 11.62  ? 373 GLU A CG  1 
ATOM 2843 C CD  . GLU A 1 373 ? -45.537 -18.901 228.425 1.00 19.85  ? 373 GLU A CD  1 
ATOM 2844 O OE1 . GLU A 1 373 ? -44.998 -19.829 229.075 1.00 17.37  ? 373 GLU A OE1 1 
ATOM 2845 O OE2 . GLU A 1 373 ? -44.877 -18.139 227.702 1.00 15.40  ? 373 GLU A OE2 1 
ATOM 2846 N N   . MET A 1 374 ? -50.278 -18.841 227.538 1.00 16.97  ? 374 MET A N   1 
ATOM 2847 C CA  . MET A 1 374 ? -50.911 -19.374 226.343 1.00 17.12  ? 374 MET A CA  1 
ATOM 2848 C C   . MET A 1 374 ? -50.526 -18.547 225.130 1.00 17.14  ? 374 MET A C   1 
ATOM 2849 O O   . MET A 1 374 ? -49.952 -17.460 225.259 1.00 17.66  ? 374 MET A O   1 
ATOM 2850 C CB  . MET A 1 374 ? -52.441 -19.348 226.500 1.00 18.70  ? 374 MET A CB  1 
ATOM 2851 C CG  . MET A 1 374 ? -53.014 -17.922 226.645 1.00 25.44  ? 374 MET A CG  1 
ATOM 2852 S SD  . MET A 1 374 ? -54.825 -17.828 226.532 1.00 23.85  ? 374 MET A SD  1 
ATOM 2853 C CE  . MET A 1 374 ? -55.287 -18.631 228.031 1.00 17.83  ? 374 MET A CE  1 
ATOM 2854 N N   . GLN A 1 375 ? -50.811 -19.091 223.954 1.00 17.35  ? 375 GLN A N   1 
ATOM 2855 C CA  . GLN A 1 375 ? -50.555 -18.400 222.704 1.00 22.05  ? 375 GLN A CA  1 
ATOM 2856 C C   . GLN A 1 375 ? -51.922 -18.192 222.039 1.00 23.85  ? 375 GLN A C   1 
ATOM 2857 O O   . GLN A 1 375 ? -52.799 -19.065 222.107 1.00 24.08  ? 375 GLN A O   1 
ATOM 2858 C CB  . GLN A 1 375 ? -49.648 -19.225 221.805 1.00 21.56  ? 375 GLN A CB  1 
ATOM 2859 C CG  . GLN A 1 375 ? -49.273 -18.518 220.529 1.00 36.87  ? 375 GLN A CG  1 
ATOM 2860 C CD  . GLN A 1 375 ? -48.226 -19.276 219.738 1.00 45.54  ? 375 GLN A CD  1 
ATOM 2861 O OE1 . GLN A 1 375 ? -48.269 -20.505 219.635 1.00 52.73  ? 375 GLN A OE1 1 
ATOM 2862 N NE2 . GLN A 1 375 ? -47.267 -18.547 219.186 1.00 52.31  ? 375 GLN A NE2 1 
ATOM 2863 N N   . LEU A 1 376 ? -52.102 -17.035 221.416 1.00 23.40  ? 376 LEU A N   1 
ATOM 2864 C CA  . LEU A 1 376 ? -53.354 -16.692 220.768 1.00 24.12  ? 376 LEU A CA  1 
ATOM 2865 C C   . LEU A 1 376 ? -53.048 -16.204 219.374 1.00 25.05  ? 376 LEU A C   1 
ATOM 2866 O O   . LEU A 1 376 ? -51.940 -15.738 219.115 1.00 24.73  ? 376 LEU A O   1 
ATOM 2867 C CB  . LEU A 1 376 ? -54.036 -15.557 221.534 1.00 25.36  ? 376 LEU A CB  1 
ATOM 2868 C CG  . LEU A 1 376 ? -54.614 -15.876 222.904 1.00 28.16  ? 376 LEU A CG  1 
ATOM 2869 C CD1 . LEU A 1 376 ? -55.014 -14.603 223.612 1.00 21.56  ? 376 LEU A CD1 1 
ATOM 2870 C CD2 . LEU A 1 376 ? -55.809 -16.800 222.700 1.00 30.77  ? 376 LEU A CD2 1 
ATOM 2871 N N   . PRO A 1 377 ? -54.011 -16.341 218.443 1.00 27.32  ? 377 PRO A N   1 
ATOM 2872 C CA  . PRO A 1 377 ? -53.801 -15.882 217.069 1.00 28.13  ? 377 PRO A CA  1 
ATOM 2873 C C   . PRO A 1 377 ? -53.873 -14.355 217.042 1.00 29.37  ? 377 PRO A C   1 
ATOM 2874 O O   . PRO A 1 377 ? -54.438 -13.734 217.952 1.00 27.25  ? 377 PRO A O   1 
ATOM 2875 C CB  . PRO A 1 377 ? -54.958 -16.543 216.308 1.00 27.43  ? 377 PRO A CB  1 
ATOM 2876 C CG  . PRO A 1 377 ? -56.028 -16.654 217.329 1.00 30.93  ? 377 PRO A CG  1 
ATOM 2877 C CD  . PRO A 1 377 ? -55.270 -17.103 218.555 1.00 30.75  ? 377 PRO A CD  1 
ATOM 2878 N N   . PRO A 1 378 ? -53.236 -13.726 216.037 1.00 31.88  ? 378 PRO A N   1 
ATOM 2879 C CA  . PRO A 1 378 ? -53.223 -12.264 215.897 1.00 31.04  ? 378 PRO A CA  1 
ATOM 2880 C C   . PRO A 1 378 ? -54.638 -11.706 215.804 1.00 30.43  ? 378 PRO A C   1 
ATOM 2881 O O   . PRO A 1 378 ? -55.536 -12.367 215.271 1.00 31.45  ? 378 PRO A O   1 
ATOM 2882 C CB  . PRO A 1 378 ? -52.471 -12.055 214.581 1.00 29.94  ? 378 PRO A CB  1 
ATOM 2883 C CG  . PRO A 1 378 ? -51.558 -13.251 214.508 1.00 33.30  ? 378 PRO A CG  1 
ATOM 2884 C CD  . PRO A 1 378 ? -52.479 -14.365 214.944 1.00 33.80  ? 378 PRO A CD  1 
ATOM 2885 N N   . GLY A 1 379 ? -54.832 -10.498 216.329 1.00 31.05  ? 379 GLY A N   1 
ATOM 2886 C CA  . GLY A 1 379 ? -56.148 -9.874  216.287 1.00 31.04  ? 379 GLY A CA  1 
ATOM 2887 C C   . GLY A 1 379 ? -56.817 -9.727  217.644 1.00 30.86  ? 379 GLY A C   1 
ATOM 2888 O O   . GLY A 1 379 ? -56.180 -9.921  218.686 1.00 29.48  ? 379 GLY A O   1 
ATOM 2889 N N   . ASP A 1 380 ? -58.106 -9.389  217.627 1.00 29.00  ? 380 ASP A N   1 
ATOM 2890 C CA  . ASP A 1 380 ? -58.884 -9.199  218.849 1.00 26.52  ? 380 ASP A CA  1 
ATOM 2891 C C   . ASP A 1 380 ? -59.445 -10.525 219.331 1.00 23.57  ? 380 ASP A C   1 
ATOM 2892 O O   . ASP A 1 380 ? -60.115 -11.232 218.577 1.00 24.64  ? 380 ASP A O   1 
ATOM 2893 C CB  . ASP A 1 380 ? -60.039 -8.229  218.602 1.00 29.72  ? 380 ASP A CB  1 
ATOM 2894 C CG  . ASP A 1 380 ? -59.570 -6.850  218.192 1.00 33.45  ? 380 ASP A CG  1 
ATOM 2895 O OD1 . ASP A 1 380 ? -59.077 -6.102  219.066 1.00 36.19  ? 380 ASP A OD1 1 
ATOM 2896 O OD2 . ASP A 1 380 ? -59.704 -6.517  216.994 1.00 44.02  ? 380 ASP A OD2 1 
ATOM 2897 N N   . ASN A 1 381 ? -59.227 -10.823 220.605 1.00 18.66  ? 381 ASN A N   1 
ATOM 2898 C CA  . ASN A 1 381 ? -59.690 -12.071 221.202 1.00 16.62  ? 381 ASN A CA  1 
ATOM 2899 C C   . ASN A 1 381 ? -60.268 -11.732 222.565 1.00 17.25  ? 381 ASN A C   1 
ATOM 2900 O O   . ASN A 1 381 ? -60.101 -10.621 223.060 1.00 17.30  ? 381 ASN A O   1 
ATOM 2901 C CB  . ASN A 1 381 ? -58.503 -13.031 221.452 1.00 18.48  ? 381 ASN A CB  1 
ATOM 2902 C CG  . ASN A 1 381 ? -57.680 -13.341 220.190 1.00 21.32  ? 381 ASN A CG  1 
ATOM 2903 O OD1 . ASN A 1 381 ? -57.993 -14.265 219.442 1.00 23.78  ? 381 ASN A OD1 1 
ATOM 2904 N ND2 . ASN A 1 381 ? -56.591 -12.606 219.994 1.00 23.96  ? 381 ASN A ND2 1 
ATOM 2905 N N   . ILE A 1 382 ? -60.949 -12.693 223.175 1.00 18.48  ? 382 ILE A N   1 
ATOM 2906 C CA  . ILE A 1 382 ? -61.484 -12.509 224.519 1.00 19.09  ? 382 ILE A CA  1 
ATOM 2907 C C   . ILE A 1 382 ? -61.052 -13.774 225.249 1.00 19.38  ? 382 ILE A C   1 
ATOM 2908 O O   . ILE A 1 382 ? -61.236 -14.892 224.754 1.00 18.91  ? 382 ILE A O   1 
ATOM 2909 C CB  . ILE A 1 382 ? -63.045 -12.377 224.582 1.00 18.71  ? 382 ILE A CB  1 
ATOM 2910 C CG1 . ILE A 1 382 ? -63.529 -11.130 223.837 1.00 19.56  ? 382 ILE A CG1 1 
ATOM 2911 C CG2 . ILE A 1 382 ? -63.488 -12.239 226.025 1.00 17.97  ? 382 ILE A CG2 1 
ATOM 2912 C CD1 . ILE A 1 382 ? -63.888 -11.386 222.396 1.00 29.27  ? 382 ILE A CD1 1 
ATOM 2913 N N   . ILE A 1 383 ? -60.401 -13.592 226.385 1.00 19.47  ? 383 ILE A N   1 
ATOM 2914 C CA  . ILE A 1 383 ? -59.932 -14.713 227.170 1.00 19.35  ? 383 ILE A CA  1 
ATOM 2915 C C   . ILE A 1 383 ? -60.974 -14.965 228.253 1.00 20.47  ? 383 ILE A C   1 
ATOM 2916 O O   . ILE A 1 383 ? -61.500 -14.015 228.861 1.00 18.55  ? 383 ILE A O   1 
ATOM 2917 C CB  . ILE A 1 383 ? -58.537 -14.393 227.811 1.00 21.19  ? 383 ILE A CB  1 
ATOM 2918 C CG1 . ILE A 1 383 ? -57.484 -14.209 226.712 1.00 19.26  ? 383 ILE A CG1 1 
ATOM 2919 C CG2 . ILE A 1 383 ? -58.119 -15.496 228.789 1.00 15.48  ? 383 ILE A CG2 1 
ATOM 2920 C CD1 . ILE A 1 383 ? -56.198 -13.557 227.182 1.00 20.72  ? 383 ILE A CD1 1 
ATOM 2921 N N   . TYR A 1 384 ? -61.313 -16.238 228.442 1.00 18.65  ? 384 TYR A N   1 
ATOM 2922 C CA  . TYR A 1 384 ? -62.272 -16.645 229.461 1.00 19.13  ? 384 TYR A CA  1 
ATOM 2923 C C   . TYR A 1 384 ? -61.677 -17.658 230.431 1.00 20.96  ? 384 TYR A C   1 
ATOM 2924 O O   . TYR A 1 384 ? -61.039 -18.641 230.031 1.00 22.91  ? 384 TYR A O   1 
ATOM 2925 C CB  . TYR A 1 384 ? -63.507 -17.293 228.826 1.00 20.94  ? 384 TYR A CB  1 
ATOM 2926 C CG  . TYR A 1 384 ? -64.409 -16.349 228.073 1.00 22.98  ? 384 TYR A CG  1 
ATOM 2927 C CD1 . TYR A 1 384 ? -65.365 -15.590 228.749 1.00 27.09  ? 384 TYR A CD1 1 
ATOM 2928 C CD2 . TYR A 1 384 ? -64.347 -16.252 226.682 1.00 21.70  ? 384 TYR A CD2 1 
ATOM 2929 C CE1 . TYR A 1 384 ? -66.242 -14.761 228.064 1.00 23.41  ? 384 TYR A CE1 1 
ATOM 2930 C CE2 . TYR A 1 384 ? -65.225 -15.428 225.983 1.00 25.75  ? 384 TYR A CE2 1 
ATOM 2931 C CZ  . TYR A 1 384 ? -66.171 -14.688 226.686 1.00 29.25  ? 384 TYR A CZ  1 
ATOM 2932 O OH  . TYR A 1 384 ? -67.057 -13.884 226.017 1.00 36.47  ? 384 TYR A OH  1 
ATOM 2933 N N   . VAL A 1 385 ? -61.876 -17.404 231.710 1.00 19.42  ? 385 VAL A N   1 
ATOM 2934 C CA  . VAL A 1 385 ? -61.450 -18.316 232.755 1.00 21.43  ? 385 VAL A CA  1 
ATOM 2935 C C   . VAL A 1 385 ? -62.808 -18.471 233.453 1.00 22.74  ? 385 VAL A C   1 
ATOM 2936 O O   . VAL A 1 385 ? -63.184 -17.684 234.338 1.00 22.32  ? 385 VAL A O   1 
ATOM 2937 C CB  . VAL A 1 385 ? -60.362 -17.675 233.656 1.00 23.34  ? 385 VAL A CB  1 
ATOM 2938 C CG1 . VAL A 1 385 ? -60.008 -18.608 234.801 1.00 20.28  ? 385 VAL A CG1 1 
ATOM 2939 C CG2 . VAL A 1 385 ? -59.113 -17.396 232.816 1.00 17.09  ? 385 VAL A CG2 1 
ATOM 2940 N N   . GLY A 1 386 ? -63.598 -19.413 232.946 1.00 21.96  ? 386 GLY A N   1 
ATOM 2941 C CA  . GLY A 1 386 ? -64.942 -19.599 233.462 1.00 20.46  ? 386 GLY A CA  1 
ATOM 2942 C C   . GLY A 1 386 ? -65.738 -18.402 232.952 1.00 21.31  ? 386 GLY A C   1 
ATOM 2943 O O   . GLY A 1 386 ? -65.731 -18.116 231.757 1.00 20.94  ? 386 GLY A O   1 
ATOM 2944 N N   . GLU A 1 387 ? -66.386 -17.670 233.849 1.00 23.69  ? 387 GLU A N   1 
ATOM 2945 C CA  . GLU A 1 387 ? -67.151 -16.496 233.444 1.00 24.82  ? 387 GLU A CA  1 
ATOM 2946 C C   . GLU A 1 387 ? -66.310 -15.231 233.474 1.00 23.47  ? 387 GLU A C   1 
ATOM 2947 O O   . GLU A 1 387 ? -66.752 -14.172 233.013 1.00 23.32  ? 387 GLU A O   1 
ATOM 2948 C CB  . GLU A 1 387 ? -68.397 -16.352 234.309 1.00 25.07  ? 387 GLU A CB  1 
ATOM 2949 C CG  . GLU A 1 387 ? -69.339 -17.527 234.085 1.00 31.79  ? 387 GLU A CG  1 
ATOM 2950 C CD  . GLU A 1 387 ? -70.694 -17.353 234.738 1.00 42.56  ? 387 GLU A CD  1 
ATOM 2951 O OE1 . GLU A 1 387 ? -70.842 -16.465 235.614 1.00 47.49  ? 387 GLU A OE1 1 
ATOM 2952 O OE2 . GLU A 1 387 ? -71.617 -18.115 234.368 1.00 48.81  ? 387 GLU A OE2 1 
ATOM 2953 N N   . LEU A 1 388 ? -65.115 -15.339 234.053 1.00 19.63  ? 388 LEU A N   1 
ATOM 2954 C CA  . LEU A 1 388 ? -64.202 -14.214 234.107 1.00 17.68  ? 388 LEU A CA  1 
ATOM 2955 C C   . LEU A 1 388 ? -63.690 -14.013 232.678 1.00 17.27  ? 388 LEU A C   1 
ATOM 2956 O O   . LEU A 1 388 ? -63.271 -14.968 232.016 1.00 17.84  ? 388 LEU A O   1 
ATOM 2957 C CB  . LEU A 1 388 ? -63.042 -14.528 235.053 1.00 14.73  ? 388 LEU A CB  1 
ATOM 2958 C CG  . LEU A 1 388 ? -61.965 -13.447 235.156 1.00 18.80  ? 388 LEU A CG  1 
ATOM 2959 C CD1 . LEU A 1 388 ? -62.562 -12.222 235.845 1.00 14.48  ? 388 LEU A CD1 1 
ATOM 2960 C CD2 . LEU A 1 388 ? -60.741 -13.990 235.910 1.00 14.71  ? 388 LEU A CD2 1 
ATOM 2961 N N   . SER A 1 389 ? -63.721 -12.779 232.195 1.00 17.80  ? 389 SER A N   1 
ATOM 2962 C CA  . SER A 1 389 ? -63.290 -12.508 230.830 1.00 16.86  ? 389 SER A CA  1 
ATOM 2963 C C   . SER A 1 389 ? -62.281 -11.384 230.743 1.00 17.88  ? 389 SER A C   1 
ATOM 2964 O O   . SER A 1 389 ? -62.146 -10.584 231.675 1.00 17.70  ? 389 SER A O   1 
ATOM 2965 C CB  . SER A 1 389 ? -64.506 -12.104 229.991 1.00 23.14  ? 389 SER A CB  1 
ATOM 2966 O OG  . SER A 1 389 ? -64.990 -10.824 230.385 1.00 21.17  ? 389 SER A OG  1 
ATOM 2967 N N   . HIS A 1 390 ? -61.599 -11.296 229.607 1.00 17.10  ? 390 HIS A N   1 
ATOM 2968 C CA  . HIS A 1 390 ? -60.656 -10.210 229.392 1.00 18.59  ? 390 HIS A CA  1 
ATOM 2969 C C   . HIS A 1 390 ? -60.409 -10.003 227.912 1.00 19.50  ? 390 HIS A C   1 
ATOM 2970 O O   . HIS A 1 390 ? -60.166 -10.965 227.181 1.00 21.56  ? 390 HIS A O   1 
ATOM 2971 C CB  . HIS A 1 390 ? -59.318 -10.458 230.109 1.00 19.11  ? 390 HIS A CB  1 
ATOM 2972 C CG  . HIS A 1 390 ? -58.586 -9.196  230.440 1.00 18.15  ? 390 HIS A CG  1 
ATOM 2973 N ND1 . HIS A 1 390 ? -57.984 -8.408  229.482 1.00 14.85  ? 390 HIS A ND1 1 
ATOM 2974 C CD2 . HIS A 1 390 ? -58.453 -8.527  231.613 1.00 16.85  ? 390 HIS A CD2 1 
ATOM 2975 C CE1 . HIS A 1 390 ? -57.524 -7.303  230.042 1.00 17.29  ? 390 HIS A CE1 1 
ATOM 2976 N NE2 . HIS A 1 390 ? -57.801 -7.350  231.333 1.00 15.37  ? 390 HIS A NE2 1 
ATOM 2977 N N   . GLN A 1 391 ? -60.507 -8.759  227.459 1.00 17.41  ? 391 GLN A N   1 
ATOM 2978 C CA  . GLN A 1 391 ? -60.235 -8.453  226.052 1.00 21.31  ? 391 GLN A CA  1 
ATOM 2979 C C   . GLN A 1 391 ? -58.735 -8.627  225.830 1.00 20.15  ? 391 GLN A C   1 
ATOM 2980 O O   . GLN A 1 391 ? -57.950 -8.411  226.740 1.00 21.27  ? 391 GLN A O   1 
ATOM 2981 C CB  . GLN A 1 391 ? -60.588 -6.992  225.721 1.00 22.15  ? 391 GLN A CB  1 
ATOM 2982 C CG  . GLN A 1 391 ? -62.056 -6.658  225.844 1.00 27.90  ? 391 GLN A CG  1 
ATOM 2983 C CD  . GLN A 1 391 ? -62.915 -7.529  224.946 1.00 36.24  ? 391 GLN A CD  1 
ATOM 2984 O OE1 . GLN A 1 391 ? -62.711 -7.578  223.729 1.00 36.12  ? 391 GLN A OE1 1 
ATOM 2985 N NE2 . GLN A 1 391 ? -63.881 -8.227  225.544 1.00 34.03  ? 391 GLN A NE2 1 
ATOM 2986 N N   . TRP A 1 392 ? -58.332 -9.058  224.650 1.00 20.90  ? 392 TRP A N   1 
ATOM 2987 C CA  . TRP A 1 392 ? -56.915 -9.174  224.367 1.00 22.47  ? 392 TRP A CA  1 
ATOM 2988 C C   . TRP A 1 392 ? -56.610 -8.959  222.896 1.00 22.95  ? 392 TRP A C   1 
ATOM 2989 O O   . TRP A 1 392 ? -57.093 -9.700  222.051 1.00 24.47  ? 392 TRP A O   1 
ATOM 2990 C CB  . TRP A 1 392 ? -56.344 -10.534 224.781 1.00 18.99  ? 392 TRP A CB  1 
ATOM 2991 C CG  . TRP A 1 392 ? -54.862 -10.609 224.491 1.00 21.34  ? 392 TRP A CG  1 
ATOM 2992 C CD1 . TRP A 1 392 ? -54.243 -11.313 223.486 1.00 18.22  ? 392 TRP A CD1 1 
ATOM 2993 C CD2 . TRP A 1 392 ? -53.831 -9.854  225.139 1.00 16.32  ? 392 TRP A CD2 1 
ATOM 2994 N NE1 . TRP A 1 392 ? -52.894 -11.031 223.466 1.00 16.29  ? 392 TRP A NE1 1 
ATOM 2995 C CE2 . TRP A 1 392 ? -52.614 -10.140 224.468 1.00 17.78  ? 392 TRP A CE2 1 
ATOM 2996 C CE3 . TRP A 1 392 ? -53.818 -8.959  226.220 1.00 21.87  ? 392 TRP A CE3 1 
ATOM 2997 C CZ2 . TRP A 1 392 ? -51.396 -9.554  224.836 1.00 17.00  ? 392 TRP A CZ2 1 
ATOM 2998 C CZ3 . TRP A 1 392 ? -52.600 -8.375  226.588 1.00 24.28  ? 392 TRP A CZ3 1 
ATOM 2999 C CH2 . TRP A 1 392 ? -51.407 -8.680  225.896 1.00 21.93  ? 392 TRP A CH2 1 
ATOM 3000 N N   . PHE A 1 393 ? -55.859 -7.916  222.579 1.00 24.31  ? 393 PHE A N   1 
ATOM 3001 C CA  . PHE A 1 393 ? -55.452 -7.716  221.200 1.00 24.89  ? 393 PHE A CA  1 
ATOM 3002 C C   . PHE A 1 393 ? -54.062 -8.361  221.046 1.00 25.75  ? 393 PHE A C   1 
ATOM 3003 O O   . PHE A 1 393 ? -53.104 -7.977  221.740 1.00 23.00  ? 393 PHE A O   1 
ATOM 3004 C CB  . PHE A 1 393 ? -55.399 -6.231  220.820 1.00 27.55  ? 393 PHE A CB  1 
ATOM 3005 C CG  . PHE A 1 393 ? -54.851 -5.999  219.431 1.00 31.40  ? 393 PHE A CG  1 
ATOM 3006 C CD1 . PHE A 1 393 ? -55.583 -6.393  218.305 1.00 31.75  ? 393 PHE A CD1 1 
ATOM 3007 C CD2 . PHE A 1 393 ? -53.559 -5.502  219.253 1.00 34.18  ? 393 PHE A CD2 1 
ATOM 3008 C CE1 . PHE A 1 393 ? -55.035 -6.309  217.024 1.00 32.77  ? 393 PHE A CE1 1 
ATOM 3009 C CE2 . PHE A 1 393 ? -52.997 -5.413  217.976 1.00 34.19  ? 393 PHE A CE2 1 
ATOM 3010 C CZ  . PHE A 1 393 ? -53.734 -5.819  216.859 1.00 32.06  ? 393 PHE A CZ  1 
ATOM 3011 N N   . GLN A 1 394 ? -53.964 -9.363  220.175 1.00 27.68  ? 394 GLN A N   1 
ATOM 3012 C CA  . GLN A 1 394 ? -52.704 -10.064 219.941 1.00 29.58  ? 394 GLN A CA  1 
ATOM 3013 C C   . GLN A 1 394 ? -51.885 -9.468  218.800 1.00 33.84  ? 394 GLN A C   1 
ATOM 3014 O O   . GLN A 1 394 ? -52.364 -9.365  217.667 1.00 32.91  ? 394 GLN A O   1 
ATOM 3015 C CB  . GLN A 1 394 ? -52.963 -11.547 219.663 1.00 25.04  ? 394 GLN A CB  1 
ATOM 3016 C CG  . GLN A 1 394 ? -51.700 -12.377 219.409 1.00 26.35  ? 394 GLN A CG  1 
ATOM 3017 C CD  . GLN A 1 394 ? -50.662 -12.263 220.527 1.00 33.73  ? 394 GLN A CD  1 
ATOM 3018 O OE1 . GLN A 1 394 ? -50.957 -12.475 221.707 1.00 35.29  ? 394 GLN A OE1 1 
ATOM 3019 N NE2 . GLN A 1 394 ? -49.440 -11.910 220.155 1.00 29.57  ? 394 GLN A NE2 1 
ATOM 3020 N N   . LYS A 1 395 ? -50.634 -9.139  219.128 1.00 40.18  ? 395 LYS A N   1 
ATOM 3021 C CA  . LYS A 1 395 ? -49.609 -8.571  218.240 1.00 43.37  ? 395 LYS A CA  1 
ATOM 3022 C C   . LYS A 1 395 ? -49.447 -7.080  218.428 1.00 45.84  ? 395 LYS A C   1 
ATOM 3023 O O   . LYS A 1 395 ? -48.470 -6.640  219.032 1.00 48.70  ? 395 LYS A O   1 
ATOM 3024 C CB  . LYS A 1 395 ? -49.858 -8.874  216.770 1.00 45.65  ? 395 LYS A CB  1 
ATOM 3025 C CG  . LYS A 1 395 ? -48.945 -9.888  216.187 1.00 47.63  ? 395 LYS A CG  1 
ATOM 3026 C CD  . LYS A 1 395 ? -49.073 -9.790  214.694 1.00 61.07  ? 395 LYS A CD  1 
ATOM 3027 C CE  . LYS A 1 395 ? -48.314 -10.885 213.984 1.00 73.42  ? 395 LYS A CE  1 
ATOM 3028 N NZ  . LYS A 1 395 ? -48.766 -10.963 212.555 1.00 78.63  ? 395 LYS A NZ  1 
ATOM 3029 N N   . SER B 1 1   ? 7.320   -54.050 230.405 1.00 22.56  ? 1   SER B N   1 
ATOM 3030 C CA  . SER B 1 1   ? 8.026   -54.779 229.359 1.00 22.01  ? 1   SER B CA  1 
ATOM 3031 C C   . SER B 1 1   ? 9.325   -54.056 229.006 1.00 23.56  ? 1   SER B C   1 
ATOM 3032 O O   . SER B 1 1   ? 9.305   -52.860 228.734 1.00 20.81  ? 1   SER B O   1 
ATOM 3033 C CB  . SER B 1 1   ? 7.123   -54.822 228.153 1.00 29.68  ? 1   SER B CB  1 
ATOM 3034 O OG  . SER B 1 1   ? 7.621   -55.701 227.209 1.00 11.99  ? 1   SER B OG  1 
ATOM 3035 N N   . ARG B 1 2   ? 10.436  -54.784 228.952 1.00 20.85  ? 2   ARG B N   1 
ATOM 3036 C CA  . ARG B 1 2   ? 11.729  -54.167 228.664 1.00 20.31  ? 2   ARG B CA  1 
ATOM 3037 C C   . ARG B 1 2   ? 11.789  -53.347 227.376 1.00 17.71  ? 2   ARG B C   1 
ATOM 3038 O O   . ARG B 1 2   ? 12.337  -52.252 227.377 1.00 19.33  ? 2   ARG B O   1 
ATOM 3039 C CB  . ARG B 1 2   ? 12.834  -55.220 228.670 1.00 24.90  ? 2   ARG B CB  1 
ATOM 3040 C CG  . ARG B 1 2   ? 14.227  -54.648 228.841 1.00 24.14  ? 2   ARG B CG  1 
ATOM 3041 C CD  . ARG B 1 2   ? 14.851  -54.303 227.515 1.00 30.49  ? 2   ARG B CD  1 
ATOM 3042 N NE  . ARG B 1 2   ? 16.088  -53.538 227.673 1.00 29.80  ? 2   ARG B NE  1 
ATOM 3043 C CZ  . ARG B 1 2   ? 16.939  -53.294 226.681 1.00 36.04  ? 2   ARG B CZ  1 
ATOM 3044 N NH1 . ARG B 1 2   ? 16.692  -53.767 225.459 1.00 34.38  ? 2   ARG B NH1 1 
ATOM 3045 N NH2 . ARG B 1 2   ? 18.011  -52.538 226.894 1.00 29.18  ? 2   ARG B NH2 1 
ATOM 3046 N N   . CYS B 1 3   ? 11.235  -53.856 226.285 1.00 17.12  ? 3   CYS B N   1 
ATOM 3047 C CA  . CYS B 1 3   ? 11.265  -53.124 225.029 1.00 16.01  ? 3   CYS B CA  1 
ATOM 3048 C C   . CYS B 1 3   ? 10.611  -51.743 225.082 1.00 22.29  ? 3   CYS B C   1 
ATOM 3049 O O   . CYS B 1 3   ? 10.932  -50.886 224.251 1.00 24.35  ? 3   CYS B O   1 
ATOM 3050 C CB  . CYS B 1 3   ? 10.648  -53.922 223.891 1.00 16.73  ? 3   CYS B CB  1 
ATOM 3051 S SG  . CYS B 1 3   ? 11.615  -55.361 223.307 1.00 20.25  ? 3   CYS B SG  1 
ATOM 3052 N N   . THR B 1 4   ? 9.725   -51.495 226.050 1.00 22.44  ? 4   THR B N   1 
ATOM 3053 C CA  . THR B 1 4   ? 9.094   -50.178 226.142 1.00 22.61  ? 4   THR B CA  1 
ATOM 3054 C C   . THR B 1 4   ? 10.087  -49.116 226.652 1.00 25.46  ? 4   THR B C   1 
ATOM 3055 O O   . THR B 1 4   ? 9.787   -47.916 226.635 1.00 26.11  ? 4   THR B O   1 
ATOM 3056 C CB  . THR B 1 4   ? 7.850   -50.193 227.069 1.00 20.99  ? 4   THR B CB  1 
ATOM 3057 O OG1 . THR B 1 4   ? 8.248   -50.483 228.413 1.00 15.66  ? 4   THR B OG1 1 
ATOM 3058 C CG2 . THR B 1 4   ? 6.827   -51.211 226.588 1.00 13.67  ? 4   THR B CG2 1 
ATOM 3059 N N   . HIS B 1 5   ? 11.256  -49.559 227.123 1.00 24.41  ? 5   HIS B N   1 
ATOM 3060 C CA  . HIS B 1 5   ? 12.284  -48.662 227.647 1.00 25.07  ? 5   HIS B CA  1 
ATOM 3061 C C   . HIS B 1 5   ? 13.084  -47.941 226.560 1.00 28.86  ? 5   HIS B C   1 
ATOM 3062 O O   . HIS B 1 5   ? 13.789  -46.962 226.856 1.00 28.44  ? 5   HIS B O   1 
ATOM 3063 C CB  . HIS B 1 5   ? 13.295  -49.428 228.511 1.00 19.26  ? 5   HIS B CB  1 
ATOM 3064 C CG  . HIS B 1 5   ? 12.717  -50.059 229.740 1.00 20.97  ? 5   HIS B CG  1 
ATOM 3065 N ND1 . HIS B 1 5   ? 13.402  -51.002 230.484 1.00 21.79  ? 5   HIS B ND1 1 
ATOM 3066 C CD2 . HIS B 1 5   ? 11.533  -49.872 230.373 1.00 18.18  ? 5   HIS B CD2 1 
ATOM 3067 C CE1 . HIS B 1 5   ? 12.668  -51.368 231.516 1.00 22.06  ? 5   HIS B CE1 1 
ATOM 3068 N NE2 . HIS B 1 5   ? 11.529  -50.700 231.476 1.00 23.52  ? 5   HIS B NE2 1 
ATOM 3069 N N   . LEU B 1 6   ? 13.077  -48.467 225.338 1.00 28.80  ? 6   LEU B N   1 
ATOM 3070 C CA  . LEU B 1 6   ? 13.849  -47.841 224.275 1.00 32.74  ? 6   LEU B CA  1 
ATOM 3071 C C   . LEU B 1 6   ? 13.042  -47.373 223.088 1.00 34.95  ? 6   LEU B C   1 
ATOM 3072 O O   . LEU B 1 6   ? 11.892  -47.759 222.911 1.00 36.22  ? 6   LEU B O   1 
ATOM 3073 C CB  . LEU B 1 6   ? 14.995  -48.742 223.801 1.00 36.07  ? 6   LEU B CB  1 
ATOM 3074 C CG  . LEU B 1 6   ? 15.022  -50.262 223.921 1.00 38.60  ? 6   LEU B CG  1 
ATOM 3075 C CD1 . LEU B 1 6   ? 16.009  -50.822 222.943 1.00 40.14  ? 6   LEU B CD1 1 
ATOM 3076 C CD2 . LEU B 1 6   ? 15.446  -50.651 225.298 1.00 37.47  ? 6   LEU B CD2 1 
ATOM 3077 N N   . GLU B 1 7   ? 13.670  -46.533 222.273 1.00 37.12  ? 7   GLU B N   1 
ATOM 3078 C CA  . GLU B 1 7   ? 13.041  -45.975 221.082 1.00 38.06  ? 7   GLU B CA  1 
ATOM 3079 C C   . GLU B 1 7   ? 13.117  -46.982 219.935 1.00 37.04  ? 7   GLU B C   1 
ATOM 3080 O O   . GLU B 1 7   ? 12.175  -47.114 219.143 1.00 38.14  ? 7   GLU B O   1 
ATOM 3081 C CB  . GLU B 1 7   ? 13.727  -44.663 220.688 1.00 47.16  ? 7   GLU B CB  1 
ATOM 3082 C CG  . GLU B 1 7   ? 13.043  -43.918 219.532 1.00 68.86  ? 7   GLU B CG  1 
ATOM 3083 C CD  . GLU B 1 7   ? 13.905  -42.807 218.939 1.00 78.66  ? 7   GLU B CD  1 
ATOM 3084 O OE1 . GLU B 1 7   ? 15.126  -43.028 218.728 1.00 79.08  ? 7   GLU B OE1 1 
ATOM 3085 O OE2 . GLU B 1 7   ? 13.365  -41.705 218.658 1.00 80.27  ? 7   GLU B OE2 1 
ATOM 3086 N N   . ASN B 1 8   ? 14.223  -47.716 219.866 1.00 33.92  ? 8   ASN B N   1 
ATOM 3087 C CA  . ASN B 1 8   ? 14.416  -48.704 218.820 1.00 33.04  ? 8   ASN B CA  1 
ATOM 3088 C C   . ASN B 1 8   ? 13.738  -50.033 219.186 1.00 31.86  ? 8   ASN B C   1 
ATOM 3089 O O   . ASN B 1 8   ? 14.342  -50.885 219.836 1.00 34.65  ? 8   ASN B O   1 
ATOM 3090 C CB  . ASN B 1 8   ? 15.917  -48.908 218.576 1.00 38.41  ? 8   ASN B CB  1 
ATOM 3091 C CG  . ASN B 1 8   ? 16.210  -49.807 217.377 1.00 45.32  ? 8   ASN B CG  1 
ATOM 3092 O OD1 . ASN B 1 8   ? 15.325  -50.095 216.558 1.00 44.72  ? 8   ASN B OD1 1 
ATOM 3093 N ND2 . ASN B 1 8   ? 17.459  -50.248 217.263 1.00 47.59  ? 8   ASN B ND2 1 
ATOM 3094 N N   . ARG B 1 9   ? 12.506  -50.224 218.722 1.00 27.57  ? 9   ARG B N   1 
ATOM 3095 C CA  . ARG B 1 9   ? 11.751  -51.431 219.017 1.00 22.55  ? 9   ARG B CA  1 
ATOM 3096 C C   . ARG B 1 9   ? 11.054  -51.966 217.780 1.00 23.83  ? 9   ARG B C   1 
ATOM 3097 O O   . ARG B 1 9   ? 10.516  -51.194 216.996 1.00 25.38  ? 9   ARG B O   1 
ATOM 3098 C CB  . ARG B 1 9   ? 10.701  -51.120 220.087 1.00 22.42  ? 9   ARG B CB  1 
ATOM 3099 C CG  . ARG B 1 9   ? 9.800   -52.278 220.481 1.00 19.23  ? 9   ARG B CG  1 
ATOM 3100 C CD  . ARG B 1 9   ? 8.741   -51.805 221.468 1.00 19.69  ? 9   ARG B CD  1 
ATOM 3101 N NE  . ARG B 1 9   ? 7.944   -52.910 221.995 1.00 16.79  ? 9   ARG B NE  1 
ATOM 3102 C CZ  . ARG B 1 9   ? 6.810   -52.757 222.674 1.00 20.58  ? 9   ARG B CZ  1 
ATOM 3103 N NH1 . ARG B 1 9   ? 6.327   -51.544 222.896 1.00 16.24  ? 9   ARG B NH1 1 
ATOM 3104 N NH2 . ARG B 1 9   ? 6.162   -53.812 223.147 1.00 12.79  ? 9   ARG B NH2 1 
ATOM 3105 N N   . ASP B 1 10  ? 11.067  -53.284 217.598 1.00 23.10  ? 10  ASP B N   1 
ATOM 3106 C CA  . ASP B 1 10  ? 10.397  -53.913 216.470 1.00 24.62  ? 10  ASP B CA  1 
ATOM 3107 C C   . ASP B 1 10  ? 9.357   -54.856 217.013 1.00 26.76  ? 10  ASP B C   1 
ATOM 3108 O O   . ASP B 1 10  ? 9.481   -55.344 218.139 1.00 29.99  ? 10  ASP B O   1 
ATOM 3109 C CB  . ASP B 1 10  ? 11.369  -54.726 215.613 1.00 29.14  ? 10  ASP B CB  1 
ATOM 3110 C CG  . ASP B 1 10  ? 12.378  -53.860 214.883 1.00 42.83  ? 10  ASP B CG  1 
ATOM 3111 O OD1 . ASP B 1 10  ? 11.984  -52.818 214.300 1.00 45.29  ? 10  ASP B OD1 1 
ATOM 3112 O OD2 . ASP B 1 10  ? 13.574  -54.229 214.888 1.00 52.37  ? 10  ASP B OD2 1 
ATOM 3113 N N   . PHE B 1 11  ? 8.325   -55.110 216.220 1.00 26.78  ? 11  PHE B N   1 
ATOM 3114 C CA  . PHE B 1 11  ? 7.269   -56.030 216.611 1.00 25.09  ? 11  PHE B CA  1 
ATOM 3115 C C   . PHE B 1 11  ? 7.278   -57.174 215.588 1.00 29.00  ? 11  PHE B C   1 
ATOM 3116 O O   . PHE B 1 11  ? 7.300   -56.940 214.368 1.00 27.04  ? 11  PHE B O   1 
ATOM 3117 C CB  . PHE B 1 11  ? 5.890   -55.341 216.602 1.00 25.20  ? 11  PHE B CB  1 
ATOM 3118 C CG  . PHE B 1 11  ? 5.684   -54.315 217.707 1.00 25.10  ? 11  PHE B CG  1 
ATOM 3119 C CD1 . PHE B 1 11  ? 6.094   -52.987 217.539 1.00 21.74  ? 11  PHE B CD1 1 
ATOM 3120 C CD2 . PHE B 1 11  ? 5.040   -54.666 218.895 1.00 24.84  ? 11  PHE B CD2 1 
ATOM 3121 C CE1 . PHE B 1 11  ? 5.865   -52.024 218.540 1.00 21.87  ? 11  PHE B CE1 1 
ATOM 3122 C CE2 . PHE B 1 11  ? 4.809   -53.705 219.901 1.00 21.12  ? 11  PHE B CE2 1 
ATOM 3123 C CZ  . PHE B 1 11  ? 5.222   -52.388 219.717 1.00 22.83  ? 11  PHE B CZ  1 
ATOM 3124 N N   . VAL B 1 12  ? 7.358   -58.405 216.082 1.00 30.42  ? 12  VAL B N   1 
ATOM 3125 C CA  . VAL B 1 12  ? 7.336   -59.574 215.222 1.00 34.09  ? 12  VAL B CA  1 
ATOM 3126 C C   . VAL B 1 12  ? 6.107   -60.345 215.635 1.00 39.46  ? 12  VAL B C   1 
ATOM 3127 O O   . VAL B 1 12  ? 5.871   -60.556 216.823 1.00 41.20  ? 12  VAL B O   1 
ATOM 3128 C CB  . VAL B 1 12  ? 8.583   -60.434 215.382 1.00 32.50  ? 12  VAL B CB  1 
ATOM 3129 C CG1 . VAL B 1 12  ? 8.361   -61.777 214.738 1.00 29.52  ? 12  VAL B CG1 1 
ATOM 3130 C CG2 . VAL B 1 12  ? 9.753   -59.748 214.708 1.00 26.88  ? 12  VAL B CG2 1 
ATOM 3131 N N   . THR B 1 13  ? 5.331   -60.780 214.657 1.00 46.06  ? 13  THR B N   1 
ATOM 3132 C CA  . THR B 1 13  ? 4.104   -61.481 214.957 1.00 53.74  ? 13  THR B CA  1 
ATOM 3133 C C   . THR B 1 13  ? 3.920   -62.792 214.201 1.00 57.95  ? 13  THR B C   1 
ATOM 3134 O O   . THR B 1 13  ? 4.025   -62.840 212.975 1.00 58.88  ? 13  THR B O   1 
ATOM 3135 C CB  . THR B 1 13  ? 2.906   -60.535 214.717 1.00 56.00  ? 13  THR B CB  1 
ATOM 3136 O OG1 . THR B 1 13  ? 1.690   -61.171 215.119 1.00 58.83  ? 13  THR B OG1 1 
ATOM 3137 C CG2 . THR B 1 13  ? 2.821   -60.130 213.249 1.00 61.32  ? 13  THR B CG2 1 
ATOM 3138 N N   . GLY B 1 14  ? 3.668   -63.858 214.951 1.00 63.49  ? 14  GLY B N   1 
ATOM 3139 C CA  . GLY B 1 14  ? 3.439   -65.161 214.354 1.00 72.23  ? 14  GLY B CA  1 
ATOM 3140 C C   . GLY B 1 14  ? 1.943   -65.447 214.331 1.00 77.68  ? 14  GLY B C   1 
ATOM 3141 O O   . GLY B 1 14  ? 1.257   -65.255 215.344 1.00 78.05  ? 14  GLY B O   1 
ATOM 3142 N N   . THR B 1 15  ? 1.420   -65.877 213.182 1.00 82.88  ? 15  THR B N   1 
ATOM 3143 C CA  . THR B 1 15  ? -0.014  -66.174 213.059 1.00 88.26  ? 15  THR B CA  1 
ATOM 3144 C C   . THR B 1 15  ? -0.348  -67.644 213.395 1.00 91.27  ? 15  THR B C   1 
ATOM 3145 O O   . THR B 1 15  ? 0.295   -68.247 214.267 1.00 92.02  ? 15  THR B O   1 
ATOM 3146 C CB  . THR B 1 15  ? -0.568  -65.787 211.644 1.00 89.13  ? 15  THR B CB  1 
ATOM 3147 O OG1 . THR B 1 15  ? 0.310   -66.274 210.618 1.00 89.02  ? 15  THR B OG1 1 
ATOM 3148 C CG2 . THR B 1 15  ? -0.725  -64.268 211.518 1.00 88.77  ? 15  THR B CG2 1 
ATOM 3149 N N   . GLN B 1 16  ? -1.359  -68.203 212.725 1.00 93.31  ? 16  GLN B N   1 
ATOM 3150 C CA  . GLN B 1 16  ? -1.772  -69.591 212.945 1.00 95.26  ? 16  GLN B CA  1 
ATOM 3151 C C   . GLN B 1 16  ? -0.717  -70.561 212.383 1.00 95.12  ? 16  GLN B C   1 
ATOM 3152 O O   . GLN B 1 16  ? -0.281  -70.421 211.234 1.00 94.06  ? 16  GLN B O   1 
ATOM 3153 C CB  . GLN B 1 16  ? -3.147  -69.839 212.291 1.00 98.62  ? 16  GLN B CB  1 
ATOM 3154 C CG  . GLN B 1 16  ? -3.777  -71.215 212.564 1.00 102.93 ? 16  GLN B CG  1 
ATOM 3155 C CD  . GLN B 1 16  ? -4.087  -71.453 214.039 1.00 107.28 ? 16  GLN B CD  1 
ATOM 3156 O OE1 . GLN B 1 16  ? -3.659  -72.451 214.619 1.00 106.78 ? 16  GLN B OE1 1 
ATOM 3157 N NE2 . GLN B 1 16  ? -4.829  -70.537 214.648 1.00 107.92 ? 16  GLN B NE2 1 
ATOM 3158 N N   . GLY B 1 17  ? -0.278  -71.504 213.218 1.00 95.51  ? 17  GLY B N   1 
ATOM 3159 C CA  . GLY B 1 17  ? 0.716   -72.480 212.796 1.00 94.85  ? 17  GLY B CA  1 
ATOM 3160 C C   . GLY B 1 17  ? 2.154   -72.050 213.028 1.00 93.93  ? 17  GLY B C   1 
ATOM 3161 O O   . GLY B 1 17  ? 3.031   -72.901 213.231 1.00 94.49  ? 17  GLY B O   1 
ATOM 3162 N N   . THR B 1 18  ? 2.405   -70.740 212.983 1.00 91.97  ? 18  THR B N   1 
ATOM 3163 C CA  . THR B 1 18  ? 3.747   -70.195 213.191 1.00 88.41  ? 18  THR B CA  1 
ATOM 3164 C C   . THR B 1 18  ? 4.262   -70.660 214.550 1.00 83.44  ? 18  THR B C   1 
ATOM 3165 O O   . THR B 1 18  ? 3.765   -70.239 215.595 1.00 83.34  ? 18  THR B O   1 
ATOM 3166 C CB  . THR B 1 18  ? 3.752   -68.639 213.141 1.00 91.92  ? 18  THR B CB  1 
ATOM 3167 O OG1 . THR B 1 18  ? 3.173   -68.190 211.905 1.00 92.35  ? 18  THR B OG1 1 
ATOM 3168 C CG2 . THR B 1 18  ? 5.178   -68.101 213.249 1.00 92.51  ? 18  THR B CG2 1 
ATOM 3169 N N   . THR B 1 19  ? 5.228   -71.568 214.520 1.00 78.07  ? 19  THR B N   1 
ATOM 3170 C CA  . THR B 1 19  ? 5.806   -72.118 215.737 1.00 72.87  ? 19  THR B CA  1 
ATOM 3171 C C   . THR B 1 19  ? 7.240   -71.609 215.940 1.00 67.65  ? 19  THR B C   1 
ATOM 3172 O O   . THR B 1 19  ? 7.728   -71.503 217.067 1.00 65.18  ? 19  THR B O   1 
ATOM 3173 C CB  . THR B 1 19  ? 5.779   -73.673 215.670 1.00 75.75  ? 19  THR B CB  1 
ATOM 3174 O OG1 . THR B 1 19  ? 6.119   -74.225 216.947 1.00 76.93  ? 19  THR B OG1 1 
ATOM 3175 C CG2 . THR B 1 19  ? 6.738   -74.202 214.588 1.00 75.02  ? 19  THR B CG2 1 
ATOM 3176 N N   . ARG B 1 20  ? 7.874   -71.235 214.832 1.00 63.44  ? 20  ARG B N   1 
ATOM 3177 C CA  . ARG B 1 20  ? 9.248   -70.752 214.816 1.00 59.07  ? 20  ARG B CA  1 
ATOM 3178 C C   . ARG B 1 20  ? 9.291   -69.326 214.259 1.00 53.59  ? 20  ARG B C   1 
ATOM 3179 O O   . ARG B 1 20  ? 8.498   -68.971 213.384 1.00 54.28  ? 20  ARG B O   1 
ATOM 3180 C CB  . ARG B 1 20  ? 10.074  -71.687 213.936 1.00 63.80  ? 20  ARG B CB  1 
ATOM 3181 C CG  . ARG B 1 20  ? 11.557  -71.672 214.187 1.00 76.43  ? 20  ARG B CG  1 
ATOM 3182 C CD  . ARG B 1 20  ? 12.045  -73.097 214.351 1.00 87.84  ? 20  ARG B CD  1 
ATOM 3183 N NE  . ARG B 1 20  ? 13.401  -73.275 213.840 1.00 100.85 ? 20  ARG B NE  1 
ATOM 3184 C CZ  . ARG B 1 20  ? 14.105  -74.400 213.953 1.00 108.03 ? 20  ARG B CZ  1 
ATOM 3185 N NH1 . ARG B 1 20  ? 13.587  -75.459 214.568 1.00 110.37 ? 20  ARG B NH1 1 
ATOM 3186 N NH2 . ARG B 1 20  ? 15.326  -74.476 213.432 1.00 111.60 ? 20  ARG B NH2 1 
ATOM 3187 N N   . VAL B 1 21  ? 10.206  -68.510 214.771 1.00 47.44  ? 21  VAL B N   1 
ATOM 3188 C CA  . VAL B 1 21  ? 10.343  -67.125 214.331 1.00 42.81  ? 21  VAL B CA  1 
ATOM 3189 C C   . VAL B 1 21  ? 11.822  -66.766 214.140 1.00 39.45  ? 21  VAL B C   1 
ATOM 3190 O O   . VAL B 1 21  ? 12.640  -67.040 215.016 1.00 38.92  ? 21  VAL B O   1 
ATOM 3191 C CB  . VAL B 1 21  ? 9.695   -66.152 215.364 1.00 42.42  ? 21  VAL B CB  1 
ATOM 3192 C CG1 . VAL B 1 21  ? 10.064  -64.738 215.055 1.00 44.27  ? 21  VAL B CG1 1 
ATOM 3193 C CG2 . VAL B 1 21  ? 8.182   -66.283 215.342 1.00 44.60  ? 21  VAL B CG2 1 
ATOM 3194 N N   . THR B 1 22  ? 12.161  -66.183 212.995 1.00 35.66  ? 22  THR B N   1 
ATOM 3195 C CA  . THR B 1 22  ? 13.538  -65.787 212.710 1.00 35.02  ? 22  THR B CA  1 
ATOM 3196 C C   . THR B 1 22  ? 13.650  -64.282 212.870 1.00 34.18  ? 22  THR B C   1 
ATOM 3197 O O   . THR B 1 22  ? 12.925  -63.547 212.218 1.00 37.84  ? 22  THR B O   1 
ATOM 3198 C CB  . THR B 1 22  ? 13.950  -66.194 211.282 1.00 36.30  ? 22  THR B CB  1 
ATOM 3199 O OG1 . THR B 1 22  ? 13.812  -67.611 211.139 1.00 41.08  ? 22  THR B OG1 1 
ATOM 3200 C CG2 . THR B 1 22  ? 15.404  -65.834 211.012 1.00 41.26  ? 22  THR B CG2 1 
ATOM 3201 N N   . LEU B 1 23  ? 14.560  -63.826 213.725 1.00 31.03  ? 23  LEU B N   1 
ATOM 3202 C CA  . LEU B 1 23  ? 14.741  -62.397 213.987 1.00 29.89  ? 23  LEU B CA  1 
ATOM 3203 C C   . LEU B 1 23  ? 16.175  -61.952 213.742 1.00 29.55  ? 23  LEU B C   1 
ATOM 3204 O O   . LEU B 1 23  ? 17.109  -62.740 213.885 1.00 30.52  ? 23  LEU B O   1 
ATOM 3205 C CB  . LEU B 1 23  ? 14.480  -62.088 215.471 1.00 31.75  ? 23  LEU B CB  1 
ATOM 3206 C CG  . LEU B 1 23  ? 13.353  -62.700 216.296 1.00 33.78  ? 23  LEU B CG  1 
ATOM 3207 C CD1 . LEU B 1 23  ? 13.613  -62.495 217.791 1.00 39.72  ? 23  LEU B CD1 1 
ATOM 3208 C CD2 . LEU B 1 23  ? 12.050  -62.076 215.899 1.00 39.06  ? 23  LEU B CD2 1 
ATOM 3209 N N   . VAL B 1 24  ? 16.349  -60.672 213.428 1.00 28.16  ? 24  VAL B N   1 
ATOM 3210 C CA  . VAL B 1 24  ? 17.672  -60.098 213.261 1.00 25.49  ? 24  VAL B CA  1 
ATOM 3211 C C   . VAL B 1 24  ? 17.751  -59.110 214.412 1.00 26.51  ? 24  VAL B C   1 
ATOM 3212 O O   . VAL B 1 24  ? 17.097  -58.060 214.401 1.00 28.84  ? 24  VAL B O   1 
ATOM 3213 C CB  . VAL B 1 24  ? 17.859  -59.376 211.927 1.00 26.46  ? 24  VAL B CB  1 
ATOM 3214 C CG1 . VAL B 1 24  ? 19.191  -58.639 211.928 1.00 29.34  ? 24  VAL B CG1 1 
ATOM 3215 C CG2 . VAL B 1 24  ? 17.844  -60.388 210.797 1.00 24.03  ? 24  VAL B CG2 1 
ATOM 3216 N N   . LEU B 1 25  ? 18.470  -59.519 215.451 1.00 24.02  ? 25  LEU B N   1 
ATOM 3217 C CA  . LEU B 1 25  ? 18.641  -58.732 216.655 1.00 22.40  ? 25  LEU B CA  1 
ATOM 3218 C C   . LEU B 1 25  ? 19.827  -57.825 216.489 1.00 22.81  ? 25  LEU B C   1 
ATOM 3219 O O   . LEU B 1 25  ? 20.871  -58.258 215.997 1.00 25.51  ? 25  LEU B O   1 
ATOM 3220 C CB  . LEU B 1 25  ? 18.889  -59.661 217.847 1.00 19.98  ? 25  LEU B CB  1 
ATOM 3221 C CG  . LEU B 1 25  ? 17.748  -60.641 218.115 1.00 23.59  ? 25  LEU B CG  1 
ATOM 3222 C CD1 . LEU B 1 25  ? 18.113  -61.590 219.259 1.00 20.45  ? 25  LEU B CD1 1 
ATOM 3223 C CD2 . LEU B 1 25  ? 16.491  -59.850 218.442 1.00 18.14  ? 25  LEU B CD2 1 
ATOM 3224 N N   . GLU B 1 26  ? 19.667  -56.568 216.875 1.00 21.34  ? 26  GLU B N   1 
ATOM 3225 C CA  . GLU B 1 26  ? 20.765  -55.626 216.798 1.00 22.12  ? 26  GLU B CA  1 
ATOM 3226 C C   . GLU B 1 26  ? 21.025  -54.969 218.148 1.00 20.87  ? 26  GLU B C   1 
ATOM 3227 O O   . GLU B 1 26  ? 20.108  -54.785 218.955 1.00 19.71  ? 26  GLU B O   1 
ATOM 3228 C CB  . GLU B 1 26  ? 20.537  -54.590 215.695 1.00 26.69  ? 26  GLU B CB  1 
ATOM 3229 C CG  . GLU B 1 26  ? 19.312  -53.726 215.839 1.00 44.59  ? 26  GLU B CG  1 
ATOM 3230 C CD  . GLU B 1 26  ? 19.005  -52.931 214.567 1.00 54.69  ? 26  GLU B CD  1 
ATOM 3231 O OE1 . GLU B 1 26  ? 19.613  -53.216 213.505 1.00 48.58  ? 26  GLU B OE1 1 
ATOM 3232 O OE2 . GLU B 1 26  ? 18.142  -52.025 214.631 1.00 59.96  ? 26  GLU B OE2 1 
ATOM 3233 N N   . LEU B 1 27  ? 22.296  -54.707 218.423 1.00 19.78  ? 27  LEU B N   1 
ATOM 3234 C CA  . LEU B 1 27  ? 22.715  -54.074 219.664 1.00 21.25  ? 27  LEU B CA  1 
ATOM 3235 C C   . LEU B 1 27  ? 22.004  -52.713 219.722 1.00 21.56  ? 27  LEU B C   1 
ATOM 3236 O O   . LEU B 1 27  ? 22.029  -51.953 218.754 1.00 22.13  ? 27  LEU B O   1 
ATOM 3237 C CB  . LEU B 1 27  ? 24.238  -53.928 219.639 1.00 22.90  ? 27  LEU B CB  1 
ATOM 3238 C CG  . LEU B 1 27  ? 25.081  -54.318 220.853 1.00 24.56  ? 27  LEU B CG  1 
ATOM 3239 C CD1 . LEU B 1 27  ? 24.581  -55.578 221.479 1.00 21.99  ? 27  LEU B CD1 1 
ATOM 3240 C CD2 . LEU B 1 27  ? 26.517  -54.506 220.421 1.00 18.62  ? 27  LEU B CD2 1 
ATOM 3241 N N   . GLY B 1 28  ? 21.358  -52.419 220.844 1.00 19.79  ? 28  GLY B N   1 
ATOM 3242 C CA  . GLY B 1 28  ? 20.600  -51.181 220.973 1.00 20.94  ? 28  GLY B CA  1 
ATOM 3243 C C   . GLY B 1 28  ? 19.145  -51.293 220.490 1.00 21.90  ? 28  GLY B C   1 
ATOM 3244 O O   . GLY B 1 28  ? 18.382  -50.325 220.521 1.00 23.08  ? 28  GLY B O   1 
ATOM 3245 N N   . GLY B 1 29  ? 18.759  -52.465 220.006 1.00 20.55  ? 29  GLY B N   1 
ATOM 3246 C CA  . GLY B 1 29  ? 17.398  -52.664 219.543 1.00 19.73  ? 29  GLY B CA  1 
ATOM 3247 C C   . GLY B 1 29  ? 16.681  -53.575 220.522 1.00 20.19  ? 29  GLY B C   1 
ATOM 3248 O O   . GLY B 1 29  ? 17.275  -54.011 221.517 1.00 19.39  ? 29  GLY B O   1 
ATOM 3249 N N   . CYS B 1 30  ? 15.417  -53.879 220.246 1.00 20.17  ? 30  CYS B N   1 
ATOM 3250 C CA  . CYS B 1 30  ? 14.626  -54.735 221.119 1.00 20.81  ? 30  CYS B CA  1 
ATOM 3251 C C   . CYS B 1 30  ? 13.452  -55.241 220.292 1.00 20.33  ? 30  CYS B C   1 
ATOM 3252 O O   . CYS B 1 30  ? 12.873  -54.482 219.516 1.00 19.07  ? 30  CYS B O   1 
ATOM 3253 C CB  . CYS B 1 30  ? 14.123  -53.931 222.331 1.00 19.12  ? 30  CYS B CB  1 
ATOM 3254 S SG  . CYS B 1 30  ? 13.551  -54.928 223.755 1.00 21.43  ? 30  CYS B SG  1 
ATOM 3255 N N   . VAL B 1 31  ? 13.132  -56.527 220.416 1.00 19.03  ? 31  VAL B N   1 
ATOM 3256 C CA  . VAL B 1 31  ? 12.017  -57.093 219.660 1.00 18.92  ? 31  VAL B CA  1 
ATOM 3257 C C   . VAL B 1 31  ? 10.891  -57.646 220.541 1.00 21.64  ? 31  VAL B C   1 
ATOM 3258 O O   . VAL B 1 31  ? 11.144  -58.413 221.485 1.00 19.80  ? 31  VAL B O   1 
ATOM 3259 C CB  . VAL B 1 31  ? 12.499  -58.246 218.739 1.00 22.72  ? 31  VAL B CB  1 
ATOM 3260 C CG1 . VAL B 1 31  ? 11.343  -58.747 217.865 1.00 16.96  ? 31  VAL B CG1 1 
ATOM 3261 C CG2 . VAL B 1 31  ? 13.676  -57.782 217.874 1.00 23.91  ? 31  VAL B CG2 1 
ATOM 3262 N N   . THR B 1 32  ? 9.656   -57.238 220.261 1.00 20.30  ? 32  THR B N   1 
ATOM 3263 C CA  . THR B 1 32  ? 8.515   -57.776 220.996 1.00 20.60  ? 32  THR B CA  1 
ATOM 3264 C C   . THR B 1 32  ? 7.878   -58.832 220.097 1.00 19.99  ? 32  THR B C   1 
ATOM 3265 O O   . THR B 1 32  ? 7.508   -58.545 218.967 1.00 19.35  ? 32  THR B O   1 
ATOM 3266 C CB  . THR B 1 32  ? 7.438   -56.707 221.350 1.00 21.67  ? 32  THR B CB  1 
ATOM 3267 O OG1 . THR B 1 32  ? 7.972   -55.777 222.300 1.00 18.47  ? 32  THR B OG1 1 
ATOM 3268 C CG2 . THR B 1 32  ? 6.209   -57.387 221.979 1.00 15.68  ? 32  THR B CG2 1 
ATOM 3269 N N   . ILE B 1 33  ? 7.821   -60.066 220.569 1.00 18.44  ? 33  ILE B N   1 
ATOM 3270 C CA  . ILE B 1 33  ? 7.211   -61.144 219.804 1.00 19.70  ? 33  ILE B CA  1 
ATOM 3271 C C   . ILE B 1 33  ? 5.820   -61.450 220.377 1.00 22.15  ? 33  ILE B C   1 
ATOM 3272 O O   . ILE B 1 33  ? 5.677   -61.686 221.585 1.00 22.00  ? 33  ILE B O   1 
ATOM 3273 C CB  . ILE B 1 33  ? 8.026   -62.457 219.923 1.00 18.15  ? 33  ILE B CB  1 
ATOM 3274 C CG1 . ILE B 1 33  ? 9.485   -62.240 219.533 1.00 19.08  ? 33  ILE B CG1 1 
ATOM 3275 C CG2 . ILE B 1 33  ? 7.385   -63.547 219.073 1.00 20.35  ? 33  ILE B CG2 1 
ATOM 3276 C CD1 . ILE B 1 33  ? 10.339  -63.486 219.732 1.00 23.45  ? 33  ILE B CD1 1 
ATOM 3277 N N   . THR B 1 34  ? 4.808   -61.470 219.517 1.00 23.56  ? 34  THR B N   1 
ATOM 3278 C CA  . THR B 1 34  ? 3.446   -61.805 219.934 1.00 27.52  ? 34  THR B CA  1 
ATOM 3279 C C   . THR B 1 34  ? 2.997   -62.957 219.025 1.00 29.25  ? 34  THR B C   1 
ATOM 3280 O O   . THR B 1 34  ? 3.404   -63.020 217.862 1.00 30.72  ? 34  THR B O   1 
ATOM 3281 C CB  . THR B 1 34  ? 2.489   -60.610 219.746 1.00 29.90  ? 34  THR B CB  1 
ATOM 3282 O OG1 . THR B 1 34  ? 2.486   -60.209 218.368 1.00 31.54  ? 34  THR B OG1 1 
ATOM 3283 C CG2 . THR B 1 34  ? 2.926   -59.439 220.594 1.00 24.10  ? 34  THR B CG2 1 
ATOM 3284 N N   . ALA B 1 35  ? 2.204   -63.883 219.546 1.00 30.94  ? 35  ALA B N   1 
ATOM 3285 C CA  . ALA B 1 35  ? 1.716   -65.001 218.733 1.00 32.10  ? 35  ALA B CA  1 
ATOM 3286 C C   . ALA B 1 35  ? 0.459   -65.567 219.376 1.00 32.79  ? 35  ALA B C   1 
ATOM 3287 O O   . ALA B 1 35  ? 0.383   -65.646 220.605 1.00 32.72  ? 35  ALA B O   1 
ATOM 3288 C CB  . ALA B 1 35  ? 2.790   -66.088 218.604 1.00 27.37  ? 35  ALA B CB  1 
ATOM 3289 N N   . GLU B 1 36  ? -0.519  -65.938 218.547 1.00 35.34  ? 36  GLU B N   1 
ATOM 3290 C CA  . GLU B 1 36  ? -1.793  -66.496 219.020 1.00 36.87  ? 36  GLU B CA  1 
ATOM 3291 C C   . GLU B 1 36  ? -1.596  -67.660 219.980 1.00 34.80  ? 36  GLU B C   1 
ATOM 3292 O O   . GLU B 1 36  ? -0.875  -68.613 219.676 1.00 34.49  ? 36  GLU B O   1 
ATOM 3293 C CB  . GLU B 1 36  ? -2.640  -66.983 217.844 1.00 47.69  ? 36  GLU B CB  1 
ATOM 3294 C CG  . GLU B 1 36  ? -3.200  -65.894 216.937 1.00 64.70  ? 36  GLU B CG  1 
ATOM 3295 C CD  . GLU B 1 36  ? -3.708  -66.452 215.603 1.00 76.10  ? 36  GLU B CD  1 
ATOM 3296 O OE1 . GLU B 1 36  ? -4.231  -67.595 215.584 1.00 82.15  ? 36  GLU B OE1 1 
ATOM 3297 O OE2 . GLU B 1 36  ? -3.567  -65.755 214.568 1.00 75.31  ? 36  GLU B OE2 1 
ATOM 3298 N N   . GLY B 1 37  ? -2.228  -67.564 221.144 1.00 33.45  ? 37  GLY B N   1 
ATOM 3299 C CA  . GLY B 1 37  ? -2.132  -68.620 222.134 1.00 33.82  ? 37  GLY B CA  1 
ATOM 3300 C C   . GLY B 1 37  ? -0.805  -68.748 222.859 1.00 35.24  ? 37  GLY B C   1 
ATOM 3301 O O   . GLY B 1 37  ? -0.621  -69.681 223.646 1.00 35.52  ? 37  GLY B O   1 
ATOM 3302 N N   . LYS B 1 38  ? 0.111   -67.809 222.631 1.00 34.83  ? 38  LYS B N   1 
ATOM 3303 C CA  . LYS B 1 38  ? 1.420   -67.838 223.284 1.00 33.04  ? 38  LYS B CA  1 
ATOM 3304 C C   . LYS B 1 38  ? 1.634   -66.581 224.117 1.00 31.39  ? 38  LYS B C   1 
ATOM 3305 O O   . LYS B 1 38  ? 1.110   -65.509 223.790 1.00 29.47  ? 38  LYS B O   1 
ATOM 3306 C CB  . LYS B 1 38  ? 2.543   -67.899 222.239 1.00 36.22  ? 38  LYS B CB  1 
ATOM 3307 C CG  . LYS B 1 38  ? 2.515   -69.091 221.296 1.00 38.94  ? 38  LYS B CG  1 
ATOM 3308 C CD  . LYS B 1 38  ? 2.775   -70.370 222.044 1.00 40.47  ? 38  LYS B CD  1 
ATOM 3309 C CE  . LYS B 1 38  ? 2.825   -71.538 221.095 1.00 38.95  ? 38  LYS B CE  1 
ATOM 3310 N NZ  . LYS B 1 38  ? 2.950   -72.787 221.882 1.00 46.24  ? 38  LYS B NZ  1 
ATOM 3311 N N   . PRO B 1 39  ? 2.348   -66.706 225.246 1.00 28.59  ? 39  PRO B N   1 
ATOM 3312 C CA  . PRO B 1 39  ? 2.584   -65.504 226.043 1.00 25.16  ? 39  PRO B CA  1 
ATOM 3313 C C   . PRO B 1 39  ? 3.589   -64.674 225.229 1.00 24.64  ? 39  PRO B C   1 
ATOM 3314 O O   . PRO B 1 39  ? 4.426   -65.243 224.532 1.00 24.46  ? 39  PRO B O   1 
ATOM 3315 C CB  . PRO B 1 39  ? 3.207   -66.066 227.322 1.00 28.70  ? 39  PRO B CB  1 
ATOM 3316 C CG  . PRO B 1 39  ? 3.903   -67.309 226.864 1.00 30.34  ? 39  PRO B CG  1 
ATOM 3317 C CD  . PRO B 1 39  ? 2.912   -67.901 225.897 1.00 30.86  ? 39  PRO B CD  1 
ATOM 3318 N N   . SER B 1 40  ? 3.459   -63.353 225.244 1.00 23.01  ? 40  SER B N   1 
ATOM 3319 C CA  . SER B 1 40  ? 4.376   -62.492 224.496 1.00 21.11  ? 40  SER B CA  1 
ATOM 3320 C C   . SER B 1 40  ? 5.771   -62.461 225.120 1.00 20.80  ? 40  SER B C   1 
ATOM 3321 O O   . SER B 1 40  ? 5.914   -62.558 226.347 1.00 18.53  ? 40  SER B O   1 
ATOM 3322 C CB  . SER B 1 40  ? 3.800   -61.084 224.376 1.00 20.24  ? 40  SER B CB  1 
ATOM 3323 O OG  . SER B 1 40  ? 2.609   -61.108 223.610 1.00 24.60  ? 40  SER B OG  1 
ATOM 3324 N N   . MET B 1 41  ? 6.792   -62.261 224.284 1.00 21.95  ? 41  MET B N   1 
ATOM 3325 C CA  . MET B 1 41  ? 8.182   -62.258 224.742 1.00 23.96  ? 41  MET B CA  1 
ATOM 3326 C C   . MET B 1 41  ? 8.982   -61.091 224.203 1.00 21.93  ? 41  MET B C   1 
ATOM 3327 O O   . MET B 1 41  ? 8.801   -60.713 223.056 1.00 21.33  ? 41  MET B O   1 
ATOM 3328 C CB  . MET B 1 41  ? 8.885   -63.542 224.266 1.00 28.83  ? 41  MET B CB  1 
ATOM 3329 C CG  . MET B 1 41  ? 8.323   -64.843 224.816 1.00 35.71  ? 41  MET B CG  1 
ATOM 3330 S SD  . MET B 1 41  ? 8.690   -65.113 226.593 1.00 43.20  ? 41  MET B SD  1 
ATOM 3331 C CE  . MET B 1 41  ? 9.704   -66.555 226.481 1.00 58.70  ? 41  MET B CE  1 
ATOM 3332 N N   . ASP B 1 42  ? 9.829   -60.494 225.045 1.00 19.78  ? 42  ASP B N   1 
ATOM 3333 C CA  . ASP B 1 42  ? 10.725  -59.410 224.611 1.00 18.81  ? 42  ASP B CA  1 
ATOM 3334 C C   . ASP B 1 42  ? 12.119  -60.045 224.513 1.00 19.53  ? 42  ASP B C   1 
ATOM 3335 O O   . ASP B 1 42  ? 12.589  -60.686 225.469 1.00 19.37  ? 42  ASP B O   1 
ATOM 3336 C CB  . ASP B 1 42  ? 10.743  -58.238 225.601 1.00 13.64  ? 42  ASP B CB  1 
ATOM 3337 C CG  . ASP B 1 42  ? 9.627   -57.216 225.332 1.00 17.45  ? 42  ASP B CG  1 
ATOM 3338 O OD1 . ASP B 1 42  ? 8.818   -57.399 224.401 1.00 16.23  ? 42  ASP B OD1 1 
ATOM 3339 O OD2 . ASP B 1 42  ? 9.580   -56.199 226.038 1.00 19.41  ? 42  ASP B OD2 1 
ATOM 3340 N N   . VAL B 1 43  ? 12.763  -59.885 223.360 1.00 17.52  ? 43  VAL B N   1 
ATOM 3341 C CA  . VAL B 1 43  ? 14.079  -60.471 223.119 1.00 17.86  ? 43  VAL B CA  1 
ATOM 3342 C C   . VAL B 1 43  ? 15.022  -59.413 222.580 1.00 18.01  ? 43  VAL B C   1 
ATOM 3343 O O   . VAL B 1 43  ? 14.613  -58.575 221.768 1.00 18.32  ? 43  VAL B O   1 
ATOM 3344 C CB  . VAL B 1 43  ? 13.975  -61.597 222.064 1.00 18.22  ? 43  VAL B CB  1 
ATOM 3345 C CG1 . VAL B 1 43  ? 15.290  -62.318 221.930 1.00 20.46  ? 43  VAL B CG1 1 
ATOM 3346 C CG2 . VAL B 1 43  ? 12.880  -62.581 222.453 1.00 19.72  ? 43  VAL B CG2 1 
ATOM 3347 N N   . TRP B 1 44  ? 16.277  -59.437 223.019 1.00 15.02  ? 44  TRP B N   1 
ATOM 3348 C CA  . TRP B 1 44  ? 17.232  -58.465 222.509 1.00 13.54  ? 44  TRP B CA  1 
ATOM 3349 C C   . TRP B 1 44  ? 18.669  -58.918 222.643 1.00 17.78  ? 44  TRP B C   1 
ATOM 3350 O O   . TRP B 1 44  ? 18.995  -59.701 223.548 1.00 17.05  ? 44  TRP B O   1 
ATOM 3351 C CB  . TRP B 1 44  ? 17.054  -57.106 223.196 1.00 13.09  ? 44  TRP B CB  1 
ATOM 3352 C CG  . TRP B 1 44  ? 17.407  -57.071 224.650 1.00 13.79  ? 44  TRP B CG  1 
ATOM 3353 C CD1 . TRP B 1 44  ? 18.584  -56.633 225.202 1.00 11.98  ? 44  TRP B CD1 1 
ATOM 3354 C CD2 . TRP B 1 44  ? 16.555  -57.427 225.753 1.00 14.40  ? 44  TRP B CD2 1 
ATOM 3355 N NE1 . TRP B 1 44  ? 18.512  -56.691 226.577 1.00 14.47  ? 44  TRP B NE1 1 
ATOM 3356 C CE2 . TRP B 1 44  ? 17.279  -57.176 226.939 1.00 15.32  ? 44  TRP B CE2 1 
ATOM 3357 C CE3 . TRP B 1 44  ? 15.247  -57.927 225.852 1.00 16.89  ? 44  TRP B CE3 1 
ATOM 3358 C CZ2 . TRP B 1 44  ? 16.733  -57.410 228.213 1.00 17.34  ? 44  TRP B CZ2 1 
ATOM 3359 C CZ3 . TRP B 1 44  ? 14.704  -58.158 227.118 1.00 15.19  ? 44  TRP B CZ3 1 
ATOM 3360 C CH2 . TRP B 1 44  ? 15.447  -57.901 228.278 1.00 16.33  ? 44  TRP B CH2 1 
ATOM 3361 N N   . LEU B 1 45  ? 19.512  -58.464 221.711 1.00 16.87  ? 45  LEU B N   1 
ATOM 3362 C CA  . LEU B 1 45  ? 20.936  -58.768 221.732 1.00 14.83  ? 45  LEU B CA  1 
ATOM 3363 C C   . LEU B 1 45  ? 21.478  -57.769 222.749 1.00 16.68  ? 45  LEU B C   1 
ATOM 3364 O O   . LEU B 1 45  ? 21.350  -56.558 222.582 1.00 17.58  ? 45  LEU B O   1 
ATOM 3365 C CB  . LEU B 1 45  ? 21.552  -58.530 220.349 1.00 14.77  ? 45  LEU B CB  1 
ATOM 3366 C CG  . LEU B 1 45  ? 23.074  -58.650 220.221 1.00 14.21  ? 45  LEU B CG  1 
ATOM 3367 C CD1 . LEU B 1 45  ? 23.558  -60.019 220.699 1.00 9.80   ? 45  LEU B CD1 1 
ATOM 3368 C CD2 . LEU B 1 45  ? 23.492  -58.373 218.773 1.00 11.81  ? 45  LEU B CD2 1 
ATOM 3369 N N   . ASP B 1 46  ? 22.057  -58.278 223.821 1.00 16.55  ? 46  ASP B N   1 
ATOM 3370 C CA  . ASP B 1 46  ? 22.557  -57.432 224.885 1.00 15.84  ? 46  ASP B CA  1 
ATOM 3371 C C   . ASP B 1 46  ? 24.040  -57.034 224.824 1.00 15.70  ? 46  ASP B C   1 
ATOM 3372 O O   . ASP B 1 46  ? 24.407  -55.965 225.300 1.00 15.94  ? 46  ASP B O   1 
ATOM 3373 C CB  . ASP B 1 46  ? 22.257  -58.109 226.227 1.00 14.83  ? 46  ASP B CB  1 
ATOM 3374 C CG  . ASP B 1 46  ? 22.326  -57.146 227.389 1.00 23.79  ? 46  ASP B CG  1 
ATOM 3375 O OD1 . ASP B 1 46  ? 21.509  -56.204 227.427 1.00 28.29  ? 46  ASP B OD1 1 
ATOM 3376 O OD2 . ASP B 1 46  ? 23.194  -57.324 228.266 1.00 25.91  ? 46  ASP B OD2 1 
ATOM 3377 N N   . ALA B 1 47  ? 24.900  -57.902 224.299 1.00 14.82  ? 47  ALA B N   1 
ATOM 3378 C CA  . ALA B 1 47  ? 26.335  -57.609 224.228 1.00 13.93  ? 47  ALA B CA  1 
ATOM 3379 C C   . ALA B 1 47  ? 27.053  -58.495 223.211 1.00 15.26  ? 47  ALA B C   1 
ATOM 3380 O O   . ALA B 1 47  ? 26.550  -59.555 222.826 1.00 13.15  ? 47  ALA B O   1 
ATOM 3381 C CB  . ALA B 1 47  ? 26.997  -57.793 225.623 1.00 9.50   ? 47  ALA B CB  1 
ATOM 3382 N N   . ILE B 1 48  ? 28.206  -58.015 222.742 1.00 16.50  ? 48  ILE B N   1 
ATOM 3383 C CA  . ILE B 1 48  ? 29.071  -58.760 221.819 1.00 16.45  ? 48  ILE B CA  1 
ATOM 3384 C C   . ILE B 1 48  ? 30.460  -58.428 222.348 1.00 16.79  ? 48  ILE B C   1 
ATOM 3385 O O   . ILE B 1 48  ? 30.837  -57.245 222.427 1.00 17.61  ? 48  ILE B O   1 
ATOM 3386 C CB  . ILE B 1 48  ? 28.977  -58.283 220.358 1.00 20.86  ? 48  ILE B CB  1 
ATOM 3387 C CG1 . ILE B 1 48  ? 27.541  -58.382 219.843 1.00 24.85  ? 48  ILE B CG1 1 
ATOM 3388 C CG2 . ILE B 1 48  ? 29.884  -59.145 219.479 1.00 21.50  ? 48  ILE B CG2 1 
ATOM 3389 C CD1 . ILE B 1 48  ? 27.398  -57.886 218.431 1.00 20.55  ? 48  ILE B CD1 1 
ATOM 3390 N N   . TYR B 1 49  ? 31.208  -59.445 222.756 1.00 13.87  ? 49  TYR B N   1 
ATOM 3391 C CA  . TYR B 1 49  ? 32.530  -59.193 223.292 1.00 14.56  ? 49  TYR B CA  1 
ATOM 3392 C C   . TYR B 1 49  ? 33.411  -60.415 223.267 1.00 16.80  ? 49  TYR B C   1 
ATOM 3393 O O   . TYR B 1 49  ? 32.957  -61.529 223.004 1.00 15.81  ? 49  TYR B O   1 
ATOM 3394 C CB  . TYR B 1 49  ? 32.411  -58.746 224.755 1.00 15.15  ? 49  TYR B CB  1 
ATOM 3395 C CG  . TYR B 1 49  ? 31.885  -59.837 225.686 1.00 16.63  ? 49  TYR B CG  1 
ATOM 3396 C CD1 . TYR B 1 49  ? 30.511  -60.004 225.896 1.00 20.90  ? 49  TYR B CD1 1 
ATOM 3397 C CD2 . TYR B 1 49  ? 32.762  -60.719 226.330 1.00 15.60  ? 49  TYR B CD2 1 
ATOM 3398 C CE1 . TYR B 1 49  ? 30.026  -61.025 226.714 1.00 17.12  ? 49  TYR B CE1 1 
ATOM 3399 C CE2 . TYR B 1 49  ? 32.291  -61.740 227.153 1.00 17.32  ? 49  TYR B CE2 1 
ATOM 3400 C CZ  . TYR B 1 49  ? 30.923  -61.889 227.339 1.00 26.82  ? 49  TYR B CZ  1 
ATOM 3401 O OH  . TYR B 1 49  ? 30.464  -62.915 228.137 1.00 26.72  ? 49  TYR B OH  1 
ATOM 3402 N N   . GLN B 1 50  ? 34.683  -60.198 223.559 1.00 14.83  ? 50  GLN B N   1 
ATOM 3403 C CA  . GLN B 1 50  ? 35.615  -61.294 223.683 1.00 16.26  ? 50  GLN B CA  1 
ATOM 3404 C C   . GLN B 1 50  ? 36.487  -60.946 224.885 1.00 16.03  ? 50  GLN B C   1 
ATOM 3405 O O   . GLN B 1 50  ? 36.820  -59.771 225.093 1.00 17.71  ? 50  GLN B O   1 
ATOM 3406 C CB  . GLN B 1 50  ? 36.478  -61.463 222.433 1.00 13.05  ? 50  GLN B CB  1 
ATOM 3407 C CG  . GLN B 1 50  ? 37.394  -62.675 222.556 1.00 13.47  ? 50  GLN B CG  1 
ATOM 3408 C CD  . GLN B 1 50  ? 38.368  -62.774 221.415 1.00 12.33  ? 50  GLN B CD  1 
ATOM 3409 O OE1 . GLN B 1 50  ? 38.072  -62.340 220.313 1.00 14.95  ? 50  GLN B OE1 1 
ATOM 3410 N NE2 . GLN B 1 50  ? 39.542  -63.333 221.675 1.00 12.66  ? 50  GLN B NE2 1 
ATOM 3411 N N   . GLU B 1 51  ? 36.763  -61.927 225.730 1.00 14.97  ? 51  GLU B N   1 
ATOM 3412 C CA  . GLU B 1 51  ? 37.630  -61.686 226.873 1.00 18.71  ? 51  GLU B CA  1 
ATOM 3413 C C   . GLU B 1 51  ? 39.087  -61.833 226.438 1.00 20.16  ? 51  GLU B C   1 
ATOM 3414 O O   . GLU B 1 51  ? 39.419  -62.744 225.683 1.00 18.90  ? 51  GLU B O   1 
ATOM 3415 C CB  . GLU B 1 51  ? 37.363  -62.693 227.971 1.00 22.70  ? 51  GLU B CB  1 
ATOM 3416 C CG  . GLU B 1 51  ? 36.066  -62.499 228.700 1.00 41.84  ? 51  GLU B CG  1 
ATOM 3417 C CD  . GLU B 1 51  ? 36.019  -63.295 229.989 1.00 45.88  ? 51  GLU B CD  1 
ATOM 3418 O OE1 . GLU B 1 51  ? 36.957  -63.169 230.810 1.00 46.15  ? 51  GLU B OE1 1 
ATOM 3419 O OE2 . GLU B 1 51  ? 35.042  -64.045 230.174 1.00 49.93  ? 51  GLU B OE2 1 
ATOM 3420 N N   . ASN B 1 52  ? 39.954  -60.944 226.911 1.00 19.84  ? 52  ASN B N   1 
ATOM 3421 C CA  . ASN B 1 52  ? 41.381  -60.999 226.594 1.00 22.03  ? 52  ASN B CA  1 
ATOM 3422 C C   . ASN B 1 52  ? 41.740  -61.231 225.127 1.00 20.51  ? 52  ASN B C   1 
ATOM 3423 O O   . ASN B 1 52  ? 42.446  -62.178 224.804 1.00 20.49  ? 52  ASN B O   1 
ATOM 3424 C CB  . ASN B 1 52  ? 42.082  -62.076 227.436 1.00 25.03  ? 52  ASN B CB  1 
ATOM 3425 C CG  . ASN B 1 52  ? 41.751  -61.966 228.899 1.00 33.38  ? 52  ASN B CG  1 
ATOM 3426 O OD1 . ASN B 1 52  ? 42.042  -60.954 229.539 1.00 42.80  ? 52  ASN B OD1 1 
ATOM 3427 N ND2 . ASN B 1 52  ? 41.114  -62.997 229.439 1.00 36.11  ? 52  ASN B ND2 1 
ATOM 3428 N N   . PRO B 1 53  ? 41.232  -60.396 224.221 1.00 18.22  ? 53  PRO B N   1 
ATOM 3429 C CA  . PRO B 1 53  ? 41.592  -60.612 222.815 1.00 18.27  ? 53  PRO B CA  1 
ATOM 3430 C C   . PRO B 1 53  ? 43.118  -60.456 222.633 1.00 20.68  ? 53  PRO B C   1 
ATOM 3431 O O   . PRO B 1 53  ? 43.783  -59.812 223.448 1.00 20.71  ? 53  PRO B O   1 
ATOM 3432 C CB  . PRO B 1 53  ? 40.825  -59.495 222.096 1.00 15.65  ? 53  PRO B CB  1 
ATOM 3433 C CG  . PRO B 1 53  ? 40.682  -58.416 223.163 1.00 13.90  ? 53  PRO B CG  1 
ATOM 3434 C CD  . PRO B 1 53  ? 40.337  -59.237 224.380 1.00 16.04  ? 53  PRO B CD  1 
ATOM 3435 N N   . ALA B 1 54  ? 43.662  -61.020 221.562 1.00 18.56  ? 54  ALA B N   1 
ATOM 3436 C CA  . ALA B 1 54  ? 45.092  -60.922 221.283 1.00 18.33  ? 54  ALA B CA  1 
ATOM 3437 C C   . ALA B 1 54  ? 45.473  -59.471 221.009 1.00 20.67  ? 54  ALA B C   1 
ATOM 3438 O O   . ALA B 1 54  ? 44.729  -58.725 220.356 1.00 19.28  ? 54  ALA B O   1 
ATOM 3439 C CB  . ALA B 1 54  ? 45.448  -61.778 220.055 1.00 16.50  ? 54  ALA B CB  1 
ATOM 3440 N N   . LYS B 1 55  ? 46.647  -59.073 221.484 1.00 22.05  ? 55  LYS B N   1 
ATOM 3441 C CA  . LYS B 1 55  ? 47.114  -57.725 221.257 1.00 21.47  ? 55  LYS B CA  1 
ATOM 3442 C C   . LYS B 1 55  ? 48.006  -57.725 220.045 1.00 24.75  ? 55  LYS B C   1 
ATOM 3443 O O   . LYS B 1 55  ? 48.794  -58.654 219.838 1.00 26.93  ? 55  LYS B O   1 
ATOM 3444 C CB  . LYS B 1 55  ? 47.949  -57.230 222.430 1.00 24.76  ? 55  LYS B CB  1 
ATOM 3445 C CG  . LYS B 1 55  ? 47.224  -57.160 223.726 1.00 27.18  ? 55  LYS B CG  1 
ATOM 3446 C CD  . LYS B 1 55  ? 48.096  -56.501 224.737 1.00 32.15  ? 55  LYS B CD  1 
ATOM 3447 C CE  . LYS B 1 55  ? 47.318  -56.183 225.983 1.00 40.92  ? 55  LYS B CE  1 
ATOM 3448 N NZ  . LYS B 1 55  ? 48.097  -55.222 226.801 1.00 48.48  ? 55  LYS B NZ  1 
ATOM 3449 N N   . THR B 1 56  ? 47.832  -56.735 219.193 1.00 21.65  ? 56  THR B N   1 
ATOM 3450 C CA  . THR B 1 56  ? 48.725  -56.604 218.062 1.00 27.53  ? 56  THR B CA  1 
ATOM 3451 C C   . THR B 1 56  ? 49.769  -55.592 218.603 1.00 28.20  ? 56  THR B C   1 
ATOM 3452 O O   . THR B 1 56  ? 50.164  -55.688 219.764 1.00 31.24  ? 56  THR B O   1 
ATOM 3453 C CB  . THR B 1 56  ? 47.984  -56.109 216.814 1.00 27.00  ? 56  THR B CB  1 
ATOM 3454 O OG1 . THR B 1 56  ? 47.131  -55.013 217.165 1.00 32.53  ? 56  THR B OG1 1 
ATOM 3455 C CG2 . THR B 1 56  ? 47.146  -57.230 216.241 1.00 38.54  ? 56  THR B CG2 1 
ATOM 3456 N N   . ARG B 1 57  ? 50.192  -54.620 217.813 1.00 28.89  ? 57  ARG B N   1 
ATOM 3457 C CA  . ARG B 1 57  ? 51.174  -53.639 218.279 1.00 25.12  ? 57  ARG B CA  1 
ATOM 3458 C C   . ARG B 1 57  ? 50.685  -52.701 219.365 1.00 21.45  ? 57  ARG B C   1 
ATOM 3459 O O   . ARG B 1 57  ? 49.492  -52.444 219.505 1.00 19.97  ? 57  ARG B O   1 
ATOM 3460 C CB  . ARG B 1 57  ? 51.560  -52.695 217.146 1.00 26.59  ? 57  ARG B CB  1 
ATOM 3461 C CG  . ARG B 1 57  ? 52.083  -53.318 215.935 1.00 37.62  ? 57  ARG B CG  1 
ATOM 3462 C CD  . ARG B 1 57  ? 52.197  -52.247 214.908 1.00 34.66  ? 57  ARG B CD  1 
ATOM 3463 N NE  . ARG B 1 57  ? 52.773  -52.788 213.693 1.00 47.76  ? 57  ARG B NE  1 
ATOM 3464 C CZ  . ARG B 1 57  ? 53.042  -52.060 212.620 1.00 58.00  ? 57  ARG B CZ  1 
ATOM 3465 N NH1 . ARG B 1 57  ? 52.781  -50.759 212.619 1.00 59.05  ? 57  ARG B NH1 1 
ATOM 3466 N NH2 . ARG B 1 57  ? 53.571  -52.635 211.548 1.00 69.24  ? 57  ARG B NH2 1 
ATOM 3467 N N   . GLU B 1 58  ? 51.657  -52.128 220.061 1.00 20.19  ? 58  GLU B N   1 
ATOM 3468 C CA  . GLU B 1 58  ? 51.437  -51.080 221.047 1.00 19.17  ? 58  GLU B CA  1 
ATOM 3469 C C   . GLU B 1 58  ? 52.178  -49.903 220.398 1.00 17.79  ? 58  GLU B C   1 
ATOM 3470 O O   . GLU B 1 58  ? 53.249  -50.087 219.803 1.00 16.27  ? 58  GLU B O   1 
ATOM 3471 C CB  . GLU B 1 58  ? 52.148  -51.352 222.362 1.00 17.39  ? 58  GLU B CB  1 
ATOM 3472 C CG  . GLU B 1 58  ? 51.579  -52.431 223.196 1.00 27.42  ? 58  GLU B CG  1 
ATOM 3473 C CD  . GLU B 1 58  ? 52.322  -52.551 224.502 1.00 28.73  ? 58  GLU B CD  1 
ATOM 3474 O OE1 . GLU B 1 58  ? 53.536  -52.237 224.541 1.00 28.30  ? 58  GLU B OE1 1 
ATOM 3475 O OE2 . GLU B 1 58  ? 51.692  -52.964 225.491 1.00 37.74  ? 58  GLU B OE2 1 
ATOM 3476 N N   . TYR B 1 59  ? 51.601  -48.716 220.472 1.00 15.66  ? 59  TYR B N   1 
ATOM 3477 C CA  . TYR B 1 59  ? 52.238  -47.529 219.936 1.00 15.80  ? 59  TYR B CA  1 
ATOM 3478 C C   . TYR B 1 59  ? 52.511  -46.598 221.116 1.00 15.97  ? 59  TYR B C   1 
ATOM 3479 O O   . TYR B 1 59  ? 51.789  -46.637 222.122 1.00 17.25  ? 59  TYR B O   1 
ATOM 3480 C CB  . TYR B 1 59  ? 51.304  -46.815 218.962 1.00 14.92  ? 59  TYR B CB  1 
ATOM 3481 C CG  . TYR B 1 59  ? 51.221  -47.454 217.609 1.00 15.72  ? 59  TYR B CG  1 
ATOM 3482 C CD1 . TYR B 1 59  ? 52.297  -47.392 216.731 1.00 13.05  ? 59  TYR B CD1 1 
ATOM 3483 C CD2 . TYR B 1 59  ? 50.048  -48.071 217.172 1.00 14.72  ? 59  TYR B CD2 1 
ATOM 3484 C CE1 . TYR B 1 59  ? 52.207  -47.924 215.442 1.00 18.46  ? 59  TYR B CE1 1 
ATOM 3485 C CE2 . TYR B 1 59  ? 49.948  -48.601 215.888 1.00 16.81  ? 59  TYR B CE2 1 
ATOM 3486 C CZ  . TYR B 1 59  ? 51.030  -48.520 215.026 1.00 16.29  ? 59  TYR B CZ  1 
ATOM 3487 O OH  . TYR B 1 59  ? 50.937  -48.994 213.732 1.00 20.60  ? 59  TYR B OH  1 
ATOM 3488 N N   . CYS B 1 60  ? 53.541  -45.767 221.005 1.00 15.14  ? 60  CYS B N   1 
ATOM 3489 C CA  . CYS B 1 60  ? 53.842  -44.807 222.065 1.00 16.35  ? 60  CYS B CA  1 
ATOM 3490 C C   . CYS B 1 60  ? 53.383  -43.405 221.624 1.00 15.64  ? 60  CYS B C   1 
ATOM 3491 O O   . CYS B 1 60  ? 53.747  -42.938 220.542 1.00 15.64  ? 60  CYS B O   1 
ATOM 3492 C CB  . CYS B 1 60  ? 55.329  -44.784 222.367 1.00 20.37  ? 60  CYS B CB  1 
ATOM 3493 S SG  . CYS B 1 60  ? 55.668  -43.568 223.662 1.00 16.21  ? 60  CYS B SG  1 
ATOM 3494 N N   . LEU B 1 61  ? 52.570  -42.744 222.443 1.00 15.64  ? 61  LEU B N   1 
ATOM 3495 C CA  . LEU B 1 61  ? 52.055  -41.412 222.110 1.00 16.02  ? 61  LEU B CA  1 
ATOM 3496 C C   . LEU B 1 61  ? 52.919  -40.291 222.682 1.00 16.09  ? 61  LEU B C   1 
ATOM 3497 O O   . LEU B 1 61  ? 52.809  -39.133 222.270 1.00 16.69  ? 61  LEU B O   1 
ATOM 3498 C CB  . LEU B 1 61  ? 50.612  -41.246 222.639 1.00 15.60  ? 61  LEU B CB  1 
ATOM 3499 C CG  . LEU B 1 61  ? 49.520  -42.124 222.022 1.00 19.24  ? 61  LEU B CG  1 
ATOM 3500 C CD1 . LEU B 1 61  ? 48.265  -42.100 222.882 1.00 17.23  ? 61  LEU B CD1 1 
ATOM 3501 C CD2 . LEU B 1 61  ? 49.225  -41.632 220.609 1.00 17.47  ? 61  LEU B CD2 1 
ATOM 3502 N N   . HIS B 1 62  ? 53.736  -40.613 223.669 1.00 14.24  ? 62  HIS B N   1 
ATOM 3503 C CA  . HIS B 1 62  ? 54.561  -39.585 224.289 1.00 15.31  ? 62  HIS B CA  1 
ATOM 3504 C C   . HIS B 1 62  ? 55.884  -40.177 224.746 1.00 14.21  ? 62  HIS B C   1 
ATOM 3505 O O   . HIS B 1 62  ? 55.918  -40.950 225.704 1.00 16.09  ? 62  HIS B O   1 
ATOM 3506 C CB  . HIS B 1 62  ? 53.813  -38.993 225.484 1.00 16.42  ? 62  HIS B CB  1 
ATOM 3507 C CG  . HIS B 1 62  ? 54.419  -37.725 226.002 1.00 23.01  ? 62  HIS B CG  1 
ATOM 3508 N ND1 . HIS B 1 62  ? 54.039  -37.155 227.198 1.00 21.20  ? 62  HIS B ND1 1 
ATOM 3509 C CD2 . HIS B 1 62  ? 55.379  -36.924 225.487 1.00 18.34  ? 62  HIS B CD2 1 
ATOM 3510 C CE1 . HIS B 1 62  ? 54.747  -36.055 227.398 1.00 20.34  ? 62  HIS B CE1 1 
ATOM 3511 N NE2 . HIS B 1 62  ? 55.567  -35.898 226.371 1.00 20.76  ? 62  HIS B NE2 1 
ATOM 3512 N N   . ALA B 1 63  ? 56.964  -39.822 224.057 1.00 14.33  ? 63  ALA B N   1 
ATOM 3513 C CA  . ALA B 1 63  ? 58.286  -40.341 224.395 1.00 16.98  ? 63  ALA B CA  1 
ATOM 3514 C C   . ALA B 1 63  ? 58.860  -39.705 225.656 1.00 19.59  ? 63  ALA B C   1 
ATOM 3515 O O   . ALA B 1 63  ? 58.651  -38.521 225.916 1.00 18.31  ? 63  ALA B O   1 
ATOM 3516 C CB  . ALA B 1 63  ? 59.253  -40.140 223.227 1.00 16.17  ? 63  ALA B CB  1 
ATOM 3517 N N   . LYS B 1 64  ? 59.515  -40.534 226.460 1.00 20.03  ? 64  LYS B N   1 
ATOM 3518 C CA  . LYS B 1 64  ? 60.182  -40.113 227.678 1.00 22.57  ? 64  LYS B CA  1 
ATOM 3519 C C   . LYS B 1 64  ? 61.667  -40.257 227.321 1.00 25.26  ? 64  LYS B C   1 
ATOM 3520 O O   . LYS B 1 64  ? 62.157  -41.379 227.113 1.00 26.18  ? 64  LYS B O   1 
ATOM 3521 C CB  . LYS B 1 64  ? 59.834  -41.054 228.826 1.00 26.10  ? 64  LYS B CB  1 
ATOM 3522 C CG  . LYS B 1 64  ? 60.537  -40.719 230.134 1.00 36.40  ? 64  LYS B CG  1 
ATOM 3523 C CD  . LYS B 1 64  ? 60.131  -41.685 231.227 1.00 51.90  ? 64  LYS B CD  1 
ATOM 3524 C CE  . LYS B 1 64  ? 60.696  -41.264 232.573 1.00 65.28  ? 64  LYS B CE  1 
ATOM 3525 N NZ  . LYS B 1 64  ? 60.215  -42.152 233.681 1.00 71.17  ? 64  LYS B NZ  1 
ATOM 3526 N N   . LEU B 1 65  ? 62.356  -39.133 227.157 1.00 26.28  ? 65  LEU B N   1 
ATOM 3527 C CA  . LEU B 1 65  ? 63.770  -39.163 226.778 1.00 26.20  ? 65  LEU B CA  1 
ATOM 3528 C C   . LEU B 1 65  ? 64.662  -38.891 227.956 1.00 27.01  ? 65  LEU B C   1 
ATOM 3529 O O   . LEU B 1 65  ? 64.329  -38.079 228.814 1.00 29.92  ? 65  LEU B O   1 
ATOM 3530 C CB  . LEU B 1 65  ? 64.056  -38.126 225.701 1.00 26.49  ? 65  LEU B CB  1 
ATOM 3531 C CG  . LEU B 1 65  ? 63.164  -38.174 224.462 1.00 25.59  ? 65  LEU B CG  1 
ATOM 3532 C CD1 . LEU B 1 65  ? 63.514  -36.995 223.568 1.00 19.90  ? 65  LEU B CD1 1 
ATOM 3533 C CD2 . LEU B 1 65  ? 63.325  -39.513 223.726 1.00 19.88  ? 65  LEU B CD2 1 
ATOM 3534 N N   . SER B 1 66  ? 65.809  -39.547 227.999 1.00 29.05  ? 66  SER B N   1 
ATOM 3535 C CA  . SER B 1 66  ? 66.728  -39.318 229.095 1.00 29.72  ? 66  SER B CA  1 
ATOM 3536 C C   . SER B 1 66  ? 68.143  -39.704 228.718 1.00 31.24  ? 66  SER B C   1 
ATOM 3537 O O   . SER B 1 66  ? 68.383  -40.334 227.669 1.00 24.79  ? 66  SER B O   1 
ATOM 3538 C CB  . SER B 1 66  ? 66.290  -40.089 230.338 1.00 28.69  ? 66  SER B CB  1 
ATOM 3539 O OG  . SER B 1 66  ? 66.545  -41.477 230.187 1.00 34.55  ? 66  SER B OG  1 
ATOM 3540 N N   . ASP B 1 67  ? 69.068  -39.277 229.581 1.00 35.79  ? 67  ASP B N   1 
ATOM 3541 C CA  . ASP B 1 67  ? 70.507  -39.538 229.455 1.00 38.40  ? 67  ASP B CA  1 
ATOM 3542 C C   . ASP B 1 67  ? 71.124  -39.183 228.111 1.00 35.66  ? 67  ASP B C   1 
ATOM 3543 O O   . ASP B 1 67  ? 71.764  -40.031 227.471 1.00 33.66  ? 67  ASP B O   1 
ATOM 3544 C CB  . ASP B 1 67  ? 70.823  -40.999 229.807 1.00 46.83  ? 67  ASP B CB  1 
ATOM 3545 C CG  . ASP B 1 67  ? 70.518  -41.330 231.264 1.00 60.49  ? 67  ASP B CG  1 
ATOM 3546 O OD1 . ASP B 1 67  ? 69.794  -40.551 231.945 1.00 66.20  ? 67  ASP B OD1 1 
ATOM 3547 O OD2 . ASP B 1 67  ? 71.012  -42.383 231.728 1.00 67.90  ? 67  ASP B OD2 1 
ATOM 3548 N N   . THR B 1 68  ? 70.924  -37.930 227.699 1.00 32.56  ? 68  THR B N   1 
ATOM 3549 C CA  . THR B 1 68  ? 71.463  -37.413 226.443 1.00 33.72  ? 68  THR B CA  1 
ATOM 3550 C C   . THR B 1 68  ? 73.001  -37.456 226.506 1.00 34.54  ? 68  THR B C   1 
ATOM 3551 O O   . THR B 1 68  ? 73.606  -37.014 227.499 1.00 36.56  ? 68  THR B O   1 
ATOM 3552 C CB  . THR B 1 68  ? 70.991  -35.953 226.219 1.00 31.38  ? 68  THR B CB  1 
ATOM 3553 O OG1 . THR B 1 68  ? 69.594  -35.862 226.514 1.00 44.57  ? 68  THR B OG1 1 
ATOM 3554 C CG2 . THR B 1 68  ? 71.226  -35.507 224.776 1.00 33.06  ? 68  THR B CG2 1 
ATOM 3555 N N   . LYS B 1 69  ? 73.624  -38.049 225.491 1.00 33.74  ? 69  LYS B N   1 
ATOM 3556 C CA  . LYS B 1 69  ? 75.077  -38.137 225.433 1.00 34.18  ? 69  LYS B CA  1 
ATOM 3557 C C   . LYS B 1 69  ? 75.585  -37.680 224.079 1.00 32.72  ? 69  LYS B C   1 
ATOM 3558 O O   . LYS B 1 69  ? 74.982  -37.982 223.047 1.00 32.09  ? 69  LYS B O   1 
ATOM 3559 C CB  . LYS B 1 69  ? 75.549  -39.561 225.725 1.00 37.08  ? 69  LYS B CB  1 
ATOM 3560 C CG  . LYS B 1 69  ? 75.278  -39.996 227.150 1.00 44.70  ? 69  LYS B CG  1 
ATOM 3561 C CD  . LYS B 1 69  ? 75.890  -41.340 227.439 1.00 54.80  ? 69  LYS B CD  1 
ATOM 3562 C CE  . LYS B 1 69  ? 75.496  -41.829 228.821 1.00 62.58  ? 69  LYS B CE  1 
ATOM 3563 N NZ  . LYS B 1 69  ? 76.185  -43.110 229.168 1.00 64.15  ? 69  LYS B NZ  1 
ATOM 3564 N N   . VAL B 1 70  ? 76.676  -36.917 224.094 1.00 32.07  ? 70  VAL B N   1 
ATOM 3565 C CA  . VAL B 1 70  ? 77.293  -36.398 222.872 1.00 30.60  ? 70  VAL B CA  1 
ATOM 3566 C C   . VAL B 1 70  ? 78.791  -36.720 222.850 1.00 32.04  ? 70  VAL B C   1 
ATOM 3567 O O   . VAL B 1 70  ? 79.463  -36.688 223.886 1.00 34.25  ? 70  VAL B O   1 
ATOM 3568 C CB  . VAL B 1 70  ? 77.128  -34.856 222.766 1.00 28.55  ? 70  VAL B CB  1 
ATOM 3569 C CG1 . VAL B 1 70  ? 77.728  -34.346 221.472 1.00 27.59  ? 70  VAL B CG1 1 
ATOM 3570 C CG2 . VAL B 1 70  ? 75.659  -34.466 222.842 1.00 28.46  ? 70  VAL B CG2 1 
ATOM 3571 N N   . ALA B 1 71  ? 79.292  -37.100 221.681 1.00 31.10  ? 71  ALA B N   1 
ATOM 3572 C CA  . ALA B 1 71  ? 80.710  -37.390 221.500 1.00 28.74  ? 71  ALA B CA  1 
ATOM 3573 C C   . ALA B 1 71  ? 81.100  -36.611 220.238 1.00 28.73  ? 71  ALA B C   1 
ATOM 3574 O O   . ALA B 1 71  ? 80.374  -36.634 219.233 1.00 26.61  ? 71  ALA B O   1 
ATOM 3575 C CB  . ALA B 1 71  ? 80.935  -38.884 221.310 1.00 24.61  ? 71  ALA B CB  1 
ATOM 3576 N N   . ALA B 1 72  ? 82.199  -35.862 220.312 1.00 26.62  ? 72  ALA B N   1 
ATOM 3577 C CA  . ALA B 1 72  ? 82.658  -35.065 219.174 1.00 27.17  ? 72  ALA B CA  1 
ATOM 3578 C C   . ALA B 1 72  ? 84.169  -35.223 218.996 1.00 26.15  ? 72  ALA B C   1 
ATOM 3579 O O   . ALA B 1 72  ? 84.891  -35.342 219.977 1.00 26.80  ? 72  ALA B O   1 
ATOM 3580 C CB  . ALA B 1 72  ? 82.302  -33.602 219.398 1.00 22.34  ? 72  ALA B CB  1 
ATOM 3581 N N   . ARG B 1 73  ? 84.643  -35.225 217.757 1.00 27.18  ? 73  ARG B N   1 
ATOM 3582 C CA  . ARG B 1 73  ? 86.076  -35.374 217.480 1.00 28.49  ? 73  ARG B CA  1 
ATOM 3583 C C   . ARG B 1 73  ? 86.546  -34.254 216.579 1.00 27.31  ? 73  ARG B C   1 
ATOM 3584 O O   . ARG B 1 73  ? 85.812  -33.808 215.697 1.00 26.38  ? 73  ARG B O   1 
ATOM 3585 C CB  . ARG B 1 73  ? 86.353  -36.676 216.733 1.00 36.50  ? 73  ARG B CB  1 
ATOM 3586 C CG  . ARG B 1 73  ? 86.077  -37.934 217.496 1.00 40.82  ? 73  ARG B CG  1 
ATOM 3587 C CD  . ARG B 1 73  ? 87.110  -38.188 218.541 1.00 49.42  ? 73  ARG B CD  1 
ATOM 3588 N NE  . ARG B 1 73  ? 87.137  -39.610 218.847 1.00 65.12  ? 73  ARG B NE  1 
ATOM 3589 C CZ  . ARG B 1 73  ? 88.243  -40.310 219.074 1.00 68.85  ? 73  ARG B CZ  1 
ATOM 3590 N NH1 . ARG B 1 73  ? 89.432  -39.714 219.036 1.00 63.79  ? 73  ARG B NH1 1 
ATOM 3591 N NH2 . ARG B 1 73  ? 88.160  -41.619 219.296 1.00 70.42  ? 73  ARG B NH2 1 
ATOM 3592 N N   . CYS B 1 74  ? 87.795  -33.844 216.752 1.00 25.28  ? 74  CYS B N   1 
ATOM 3593 C CA  . CYS B 1 74  ? 88.357  -32.796 215.918 1.00 21.71  ? 74  CYS B CA  1 
ATOM 3594 C C   . CYS B 1 74  ? 88.500  -33.337 214.501 1.00 20.61  ? 74  CYS B C   1 
ATOM 3595 O O   . CYS B 1 74  ? 88.485  -34.549 214.305 1.00 21.03  ? 74  CYS B O   1 
ATOM 3596 C CB  . CYS B 1 74  ? 89.701  -32.353 216.493 1.00 19.90  ? 74  CYS B CB  1 
ATOM 3597 S SG  . CYS B 1 74  ? 89.491  -31.346 217.988 1.00 21.06  ? 74  CYS B SG  1 
ATOM 3598 N N   . PRO B 1 75  ? 88.654  -32.456 213.491 1.00 23.73  ? 75  PRO B N   1 
ATOM 3599 C CA  . PRO B 1 75  ? 88.799  -32.835 212.080 1.00 26.80  ? 75  PRO B CA  1 
ATOM 3600 C C   . PRO B 1 75  ? 89.768  -33.988 211.691 1.00 32.44  ? 75  PRO B C   1 
ATOM 3601 O O   . PRO B 1 75  ? 89.524  -34.701 210.710 1.00 36.40  ? 75  PRO B O   1 
ATOM 3602 C CB  . PRO B 1 75  ? 89.195  -31.517 211.421 1.00 25.54  ? 75  PRO B CB  1 
ATOM 3603 C CG  . PRO B 1 75  ? 88.480  -30.511 212.232 1.00 22.09  ? 75  PRO B CG  1 
ATOM 3604 C CD  . PRO B 1 75  ? 88.731  -30.987 213.635 1.00 23.64  ? 75  PRO B CD  1 
ATOM 3605 N N   . THR B 1 76  ? 90.865  -34.177 212.418 1.00 35.45  ? 76  THR B N   1 
ATOM 3606 C CA  . THR B 1 76  ? 91.811  -35.262 212.073 1.00 37.13  ? 76  THR B CA  1 
ATOM 3607 C C   . THR B 1 76  ? 91.707  -36.514 212.958 1.00 37.91  ? 76  THR B C   1 
ATOM 3608 O O   . THR B 1 76  ? 92.317  -37.548 212.670 1.00 39.27  ? 76  THR B O   1 
ATOM 3609 C CB  . THR B 1 76  ? 93.285  -34.756 212.134 1.00 32.09  ? 76  THR B CB  1 
ATOM 3610 O OG1 . THR B 1 76  ? 93.551  -34.184 213.423 1.00 29.90  ? 76  THR B OG1 1 
ATOM 3611 C CG2 . THR B 1 76  ? 93.533  -33.716 211.069 1.00 29.09  ? 76  THR B CG2 1 
ATOM 3612 N N   . MET B 1 77  ? 90.915  -36.408 214.020 1.00 36.16  ? 77  MET B N   1 
ATOM 3613 C CA  . MET B 1 77  ? 90.750  -37.470 214.996 1.00 32.47  ? 77  MET B CA  1 
ATOM 3614 C C   . MET B 1 77  ? 89.791  -38.624 214.681 1.00 32.21  ? 77  MET B C   1 
ATOM 3615 O O   . MET B 1 77  ? 89.539  -39.460 215.553 1.00 30.42  ? 77  MET B O   1 
ATOM 3616 C CB  . MET B 1 77  ? 90.392  -36.845 216.347 1.00 37.36  ? 77  MET B CB  1 
ATOM 3617 C CG  . MET B 1 77  ? 91.443  -35.865 216.882 1.00 42.94  ? 77  MET B CG  1 
ATOM 3618 S SD  . MET B 1 77  ? 93.053  -36.646 217.197 1.00 45.12  ? 77  MET B SD  1 
ATOM 3619 C CE  . MET B 1 77  ? 92.997  -36.909 219.007 1.00 39.14  ? 77  MET B CE  1 
ATOM 3620 N N   . GLY B 1 78  ? 89.277  -38.697 213.456 1.00 29.93  ? 78  GLY B N   1 
ATOM 3621 C CA  . GLY B 1 78  ? 88.364  -39.785 213.116 1.00 33.20  ? 78  GLY B CA  1 
ATOM 3622 C C   . GLY B 1 78  ? 86.910  -39.674 213.589 1.00 34.68  ? 78  GLY B C   1 
ATOM 3623 O O   . GLY B 1 78  ? 86.491  -38.640 214.123 1.00 32.62  ? 78  GLY B O   1 
ATOM 3624 N N   . PRO B 1 79  ? 86.112  -40.750 213.421 1.00 36.67  ? 79  PRO B N   1 
ATOM 3625 C CA  . PRO B 1 79  ? 84.693  -40.788 213.818 1.00 34.88  ? 79  PRO B CA  1 
ATOM 3626 C C   . PRO B 1 79  ? 84.447  -40.738 215.309 1.00 32.68  ? 79  PRO B C   1 
ATOM 3627 O O   . PRO B 1 79  ? 85.176  -41.339 216.101 1.00 33.10  ? 79  PRO B O   1 
ATOM 3628 C CB  . PRO B 1 79  ? 84.218  -42.142 213.266 1.00 37.10  ? 79  PRO B CB  1 
ATOM 3629 C CG  . PRO B 1 79  ? 85.218  -42.482 212.191 1.00 41.55  ? 79  PRO B CG  1 
ATOM 3630 C CD  . PRO B 1 79  ? 86.512  -42.033 212.835 1.00 41.06  ? 79  PRO B CD  1 
ATOM 3631 N N   . ALA B 1 80  ? 83.408  -40.007 215.695 1.00 30.76  ? 80  ALA B N   1 
ATOM 3632 C CA  . ALA B 1 80  ? 83.029  -39.927 217.092 1.00 30.58  ? 80  ALA B CA  1 
ATOM 3633 C C   . ALA B 1 80  ? 82.133  -41.152 217.289 1.00 30.16  ? 80  ALA B C   1 
ATOM 3634 O O   . ALA B 1 80  ? 81.432  -41.561 216.359 1.00 29.03  ? 80  ALA B O   1 
ATOM 3635 C CB  . ALA B 1 80  ? 82.240  -38.651 217.346 1.00 31.11  ? 80  ALA B CB  1 
ATOM 3636 N N   . THR B 1 81  ? 82.196  -41.781 218.454 1.00 29.62  ? 81  THR B N   1 
ATOM 3637 C CA  . THR B 1 81  ? 81.357  -42.942 218.709 1.00 31.46  ? 81  THR B CA  1 
ATOM 3638 C C   . THR B 1 81  ? 80.892  -42.993 220.160 1.00 33.24  ? 81  THR B C   1 
ATOM 3639 O O   . THR B 1 81  ? 81.561  -42.480 221.068 1.00 32.23  ? 81  THR B O   1 
ATOM 3640 C CB  . THR B 1 81  ? 82.068  -44.285 218.377 1.00 33.41  ? 81  THR B CB  1 
ATOM 3641 O OG1 . THR B 1 81  ? 83.213  -44.443 219.215 1.00 34.69  ? 81  THR B OG1 1 
ATOM 3642 C CG2 . THR B 1 81  ? 82.496  -44.344 216.920 1.00 30.42  ? 81  THR B CG2 1 
ATOM 3643 N N   . LEU B 1 82  ? 79.732  -43.612 220.360 1.00 34.44  ? 82  LEU B N   1 
ATOM 3644 C CA  . LEU B 1 82  ? 79.127  -43.785 221.678 1.00 35.56  ? 82  LEU B CA  1 
ATOM 3645 C C   . LEU B 1 82  ? 78.676  -45.234 221.754 1.00 36.23  ? 82  LEU B C   1 
ATOM 3646 O O   . LEU B 1 82  ? 78.248  -45.809 220.743 1.00 36.54  ? 82  LEU B O   1 
ATOM 3647 C CB  . LEU B 1 82  ? 77.910  -42.871 221.832 1.00 33.67  ? 82  LEU B CB  1 
ATOM 3648 C CG  . LEU B 1 82  ? 78.192  -41.391 222.088 1.00 35.90  ? 82  LEU B CG  1 
ATOM 3649 C CD1 . LEU B 1 82  ? 76.928  -40.566 221.942 1.00 33.81  ? 82  LEU B CD1 1 
ATOM 3650 C CD2 . LEU B 1 82  ? 78.780  -41.249 223.481 1.00 32.78  ? 82  LEU B CD2 1 
ATOM 3651 N N   . ALA B 1 83  ? 78.791  -45.835 222.930 1.00 37.04  ? 83  ALA B N   1 
ATOM 3652 C CA  . ALA B 1 83  ? 78.358  -47.223 223.111 1.00 39.29  ? 83  ALA B CA  1 
ATOM 3653 C C   . ALA B 1 83  ? 76.852  -47.339 222.805 1.00 40.36  ? 83  ALA B C   1 
ATOM 3654 O O   . ALA B 1 83  ? 76.385  -48.355 222.264 1.00 41.68  ? 83  ALA B O   1 
ATOM 3655 C CB  . ALA B 1 83  ? 78.646  -47.682 224.549 1.00 38.38  ? 83  ALA B CB  1 
ATOM 3656 N N   . GLU B 1 84  ? 76.119  -46.257 223.084 1.00 37.72  ? 84  GLU B N   1 
ATOM 3657 C CA  . GLU B 1 84  ? 74.677  -46.191 222.871 1.00 35.54  ? 84  GLU B CA  1 
ATOM 3658 C C   . GLU B 1 84  ? 74.266  -46.395 221.426 1.00 34.21  ? 84  GLU B C   1 
ATOM 3659 O O   . GLU B 1 84  ? 73.178  -46.884 221.166 1.00 35.03  ? 84  GLU B O   1 
ATOM 3660 C CB  . GLU B 1 84  ? 74.105  -44.863 223.365 1.00 37.69  ? 84  GLU B CB  1 
ATOM 3661 C CG  . GLU B 1 84  ? 74.045  -44.705 224.873 1.00 40.33  ? 84  GLU B CG  1 
ATOM 3662 C CD  . GLU B 1 84  ? 75.401  -44.428 225.522 1.00 50.36  ? 84  GLU B CD  1 
ATOM 3663 O OE1 . GLU B 1 84  ? 76.422  -44.249 224.811 1.00 44.76  ? 84  GLU B OE1 1 
ATOM 3664 O OE2 . GLU B 1 84  ? 75.436  -44.375 226.769 1.00 50.11  ? 84  GLU B OE2 1 
ATOM 3665 N N   . GLU B 1 85  ? 75.134  -46.058 220.481 1.00 32.59  ? 85  GLU B N   1 
ATOM 3666 C CA  . GLU B 1 85  ? 74.797  -46.228 219.075 1.00 36.65  ? 85  GLU B CA  1 
ATOM 3667 C C   . GLU B 1 85  ? 74.456  -47.677 218.735 1.00 40.09  ? 85  GLU B C   1 
ATOM 3668 O O   . GLU B 1 85  ? 73.839  -47.958 217.702 1.00 39.05  ? 85  GLU B O   1 
ATOM 3669 C CB  . GLU B 1 85  ? 75.971  -45.822 218.194 1.00 37.45  ? 85  GLU B CB  1 
ATOM 3670 C CG  . GLU B 1 85  ? 76.288  -44.362 218.163 1.00 37.40  ? 85  GLU B CG  1 
ATOM 3671 C CD  . GLU B 1 85  ? 77.311  -44.058 217.103 1.00 30.07  ? 85  GLU B CD  1 
ATOM 3672 O OE1 . GLU B 1 85  ? 76.961  -44.081 215.903 1.00 27.21  ? 85  GLU B OE1 1 
ATOM 3673 O OE2 . GLU B 1 85  ? 78.473  -43.827 217.473 1.00 35.74  ? 85  GLU B OE2 1 
ATOM 3674 N N   . HIS B 1 86  ? 74.931  -48.599 219.564 1.00 42.79  ? 86  HIS B N   1 
ATOM 3675 C CA  . HIS B 1 86  ? 74.713  -50.014 219.319 1.00 47.21  ? 86  HIS B CA  1 
ATOM 3676 C C   . HIS B 1 86  ? 73.708  -50.658 220.237 1.00 48.62  ? 86  HIS B C   1 
ATOM 3677 O O   . HIS B 1 86  ? 73.426  -51.846 220.108 1.00 50.45  ? 86  HIS B O   1 
ATOM 3678 C CB  . HIS B 1 86  ? 76.043  -50.756 219.377 1.00 50.79  ? 86  HIS B CB  1 
ATOM 3679 C CG  . HIS B 1 86  ? 77.047  -50.226 218.408 1.00 59.01  ? 86  HIS B CG  1 
ATOM 3680 N ND1 . HIS B 1 86  ? 76.792  -50.150 217.052 1.00 60.94  ? 86  HIS B ND1 1 
ATOM 3681 C CD2 . HIS B 1 86  ? 78.255  -49.649 218.600 1.00 60.48  ? 86  HIS B CD2 1 
ATOM 3682 C CE1 . HIS B 1 86  ? 77.803  -49.542 216.454 1.00 62.83  ? 86  HIS B CE1 1 
ATOM 3683 N NE2 . HIS B 1 86  ? 78.701  -49.228 217.372 1.00 67.81  ? 86  HIS B NE2 1 
ATOM 3684 N N   . GLN B 1 87  ? 73.178  -49.887 221.175 1.00 47.18  ? 87  GLN B N   1 
ATOM 3685 C CA  . GLN B 1 87  ? 72.187  -50.412 222.090 1.00 45.95  ? 87  GLN B CA  1 
ATOM 3686 C C   . GLN B 1 87  ? 70.782  -50.162 221.541 1.00 44.88  ? 87  GLN B C   1 
ATOM 3687 O O   . GLN B 1 87  ? 70.556  -49.235 220.746 1.00 45.25  ? 87  GLN B O   1 
ATOM 3688 C CB  . GLN B 1 87  ? 72.341  -49.760 223.455 1.00 45.96  ? 87  GLN B CB  1 
ATOM 3689 C CG  . GLN B 1 87  ? 73.672  -50.040 224.094 1.00 51.53  ? 87  GLN B CG  1 
ATOM 3690 C CD  . GLN B 1 87  ? 73.946  -49.140 225.285 1.00 59.62  ? 87  GLN B CD  1 
ATOM 3691 O OE1 . GLN B 1 87  ? 73.036  -48.756 226.020 1.00 61.85  ? 87  GLN B OE1 1 
ATOM 3692 N NE2 . GLN B 1 87  ? 75.210  -48.790 225.476 1.00 65.63  ? 87  GLN B NE2 1 
ATOM 3693 N N   . GLY B 1 88  ? 69.867  -51.064 221.875 1.00 41.90  ? 88  GLY B N   1 
ATOM 3694 C CA  . GLY B 1 88  ? 68.493  -50.889 221.458 1.00 41.04  ? 88  GLY B CA  1 
ATOM 3695 C C   . GLY B 1 88  ? 67.926  -49.954 222.515 1.00 40.30  ? 88  GLY B C   1 
ATOM 3696 O O   . GLY B 1 88  ? 68.492  -49.825 223.621 1.00 41.06  ? 88  GLY B O   1 
ATOM 3697 N N   . GLY B 1 89  ? 66.856  -49.251 222.183 1.00 36.72  ? 89  GLY B N   1 
ATOM 3698 C CA  . GLY B 1 89  ? 66.285  -48.355 223.169 1.00 35.17  ? 89  GLY B CA  1 
ATOM 3699 C C   . GLY B 1 89  ? 66.914  -46.977 223.232 1.00 32.47  ? 89  GLY B C   1 
ATOM 3700 O O   . GLY B 1 89  ? 66.689  -46.247 224.201 1.00 32.29  ? 89  GLY B O   1 
ATOM 3701 N N   . THR B 1 90  ? 67.693  -46.619 222.208 1.00 29.55  ? 90  THR B N   1 
ATOM 3702 C CA  . THR B 1 90  ? 68.330  -45.306 222.123 1.00 27.12  ? 90  THR B CA  1 
ATOM 3703 C C   . THR B 1 90  ? 68.087  -44.794 220.711 1.00 26.20  ? 90  THR B C   1 
ATOM 3704 O O   . THR B 1 90  ? 67.851  -45.590 219.801 1.00 26.90  ? 90  THR B O   1 
ATOM 3705 C CB  . THR B 1 90  ? 69.878  -45.367 222.335 1.00 26.29  ? 90  THR B CB  1 
ATOM 3706 O OG1 . THR B 1 90  ? 70.466  -46.181 221.312 1.00 26.06  ? 90  THR B OG1 1 
ATOM 3707 C CG2 . THR B 1 90  ? 70.229  -45.942 223.695 1.00 21.21  ? 90  THR B CG2 1 
ATOM 3708 N N   . VAL B 1 91  ? 68.085  -43.472 220.542 1.00 24.80  ? 91  VAL B N   1 
ATOM 3709 C CA  . VAL B 1 91  ? 67.913  -42.855 219.229 1.00 24.10  ? 91  VAL B CA  1 
ATOM 3710 C C   . VAL B 1 91  ? 69.172  -41.994 219.082 1.00 23.97  ? 91  VAL B C   1 
ATOM 3711 O O   . VAL B 1 91  ? 69.499  -41.222 219.990 1.00 23.44  ? 91  VAL B O   1 
ATOM 3712 C CB  . VAL B 1 91  ? 66.654  -41.944 219.179 1.00 24.55  ? 91  VAL B CB  1 
ATOM 3713 C CG1 . VAL B 1 91  ? 66.585  -41.205 217.840 1.00 22.55  ? 91  VAL B CG1 1 
ATOM 3714 C CG2 . VAL B 1 91  ? 65.405  -42.774 219.370 1.00 25.57  ? 91  VAL B CG2 1 
ATOM 3715 N N   . CYS B 1 92  ? 69.870  -42.119 217.961 1.00 22.23  ? 92  CYS B N   1 
ATOM 3716 C CA  . CYS B 1 92  ? 71.104  -41.361 217.763 1.00 24.79  ? 92  CYS B CA  1 
ATOM 3717 C C   . CYS B 1 92  ? 71.156  -40.689 216.415 1.00 26.85  ? 92  CYS B C   1 
ATOM 3718 O O   . CYS B 1 92  ? 70.489  -41.128 215.475 1.00 28.41  ? 92  CYS B O   1 
ATOM 3719 C CB  . CYS B 1 92  ? 72.320  -42.286 217.819 1.00 19.43  ? 92  CYS B CB  1 
ATOM 3720 S SG  . CYS B 1 92  ? 72.511  -43.299 219.310 1.00 26.62  ? 92  CYS B SG  1 
ATOM 3721 N N   . LYS B 1 93  ? 71.942  -39.615 216.320 1.00 26.32  ? 93  LYS B N   1 
ATOM 3722 C CA  . LYS B 1 93  ? 72.149  -38.939 215.043 1.00 25.91  ? 93  LYS B CA  1 
ATOM 3723 C C   . LYS B 1 93  ? 73.625  -38.566 214.938 1.00 27.24  ? 93  LYS B C   1 
ATOM 3724 O O   . LYS B 1 93  ? 74.215  -38.049 215.891 1.00 29.36  ? 93  LYS B O   1 
ATOM 3725 C CB  . LYS B 1 93  ? 71.291  -37.689 214.858 1.00 22.62  ? 93  LYS B CB  1 
ATOM 3726 C CG  . LYS B 1 93  ? 71.226  -37.310 213.391 1.00 26.46  ? 93  LYS B CG  1 
ATOM 3727 C CD  . LYS B 1 93  ? 70.671  -35.936 213.128 1.00 32.50  ? 93  LYS B CD  1 
ATOM 3728 C CE  . LYS B 1 93  ? 70.634  -35.708 211.625 1.00 38.36  ? 93  LYS B CE  1 
ATOM 3729 N NZ  . LYS B 1 93  ? 69.989  -34.418 211.251 1.00 50.12  ? 93  LYS B NZ  1 
ATOM 3730 N N   . ARG B 1 94  ? 74.228  -38.932 213.814 1.00 25.57  ? 94  ARG B N   1 
ATOM 3731 C CA  . ARG B 1 94  ? 75.622  -38.642 213.553 1.00 26.93  ? 94  ARG B CA  1 
ATOM 3732 C C   . ARG B 1 94  ? 75.594  -37.475 212.579 1.00 27.73  ? 94  ARG B C   1 
ATOM 3733 O O   . ARG B 1 94  ? 74.774  -37.459 211.652 1.00 28.15  ? 94  ARG B O   1 
ATOM 3734 C CB  . ARG B 1 94  ? 76.308  -39.842 212.896 1.00 28.46  ? 94  ARG B CB  1 
ATOM 3735 C CG  . ARG B 1 94  ? 76.253  -41.142 213.677 1.00 29.51  ? 94  ARG B CG  1 
ATOM 3736 C CD  . ARG B 1 94  ? 77.133  -42.202 212.994 1.00 35.64  ? 94  ARG B CD  1 
ATOM 3737 N NE  . ARG B 1 94  ? 78.513  -41.733 212.871 1.00 24.83  ? 94  ARG B NE  1 
ATOM 3738 C CZ  . ARG B 1 94  ? 79.413  -41.776 213.851 1.00 26.99  ? 94  ARG B CZ  1 
ATOM 3739 N NH1 . ARG B 1 94  ? 79.103  -42.280 215.042 1.00 21.26  ? 94  ARG B NH1 1 
ATOM 3740 N NH2 . ARG B 1 94  ? 80.622  -41.268 213.655 1.00 25.70  ? 94  ARG B NH2 1 
ATOM 3741 N N   . ASP B 1 95  ? 76.485  -36.507 212.771 1.00 27.16  ? 95  ASP B N   1 
ATOM 3742 C CA  . ASP B 1 95  ? 76.529  -35.342 211.896 1.00 27.06  ? 95  ASP B CA  1 
ATOM 3743 C C   . ASP B 1 95  ? 77.975  -34.812 211.901 1.00 29.82  ? 95  ASP B C   1 
ATOM 3744 O O   . ASP B 1 95  ? 78.912  -35.530 212.267 1.00 28.70  ? 95  ASP B O   1 
ATOM 3745 C CB  . ASP B 1 95  ? 75.528  -34.283 212.419 1.00 23.79  ? 95  ASP B CB  1 
ATOM 3746 C CG  . ASP B 1 95  ? 74.974  -33.368 211.315 1.00 30.16  ? 95  ASP B CG  1 
ATOM 3747 O OD1 . ASP B 1 95  ? 75.589  -33.226 210.232 1.00 33.72  ? 95  ASP B OD1 1 
ATOM 3748 O OD2 . ASP B 1 95  ? 73.900  -32.769 211.542 1.00 31.93  ? 95  ASP B OD2 1 
ATOM 3749 N N   . GLN B 1 96  ? 78.152  -33.560 211.495 1.00 31.84  ? 96  GLN B N   1 
ATOM 3750 C CA  . GLN B 1 96  ? 79.462  -32.924 211.453 1.00 30.12  ? 96  GLN B CA  1 
ATOM 3751 C C   . GLN B 1 96  ? 79.285  -31.512 211.947 1.00 29.11  ? 96  GLN B C   1 
ATOM 3752 O O   . GLN B 1 96  ? 78.314  -30.851 211.584 1.00 28.76  ? 96  GLN B O   1 
ATOM 3753 C CB  . GLN B 1 96  ? 79.966  -32.857 210.020 1.00 28.20  ? 96  GLN B CB  1 
ATOM 3754 C CG  . GLN B 1 96  ? 80.466  -34.162 209.460 1.00 37.40  ? 96  GLN B CG  1 
ATOM 3755 C CD  . GLN B 1 96  ? 81.088  -33.965 208.095 1.00 49.73  ? 96  GLN B CD  1 
ATOM 3756 O OE1 . GLN B 1 96  ? 82.143  -34.523 207.797 1.00 53.01  ? 96  GLN B OE1 1 
ATOM 3757 N NE2 . GLN B 1 96  ? 80.460  -33.125 207.269 1.00 49.52  ? 96  GLN B NE2 1 
ATOM 3758 N N   . SER B 1 97  ? 80.198  -31.055 212.787 1.00 27.66  ? 97  SER B N   1 
ATOM 3759 C CA  . SER B 1 97  ? 80.134  -29.696 213.292 1.00 27.74  ? 97  SER B CA  1 
ATOM 3760 C C   . SER B 1 97  ? 81.386  -28.956 212.844 1.00 26.31  ? 97  SER B C   1 
ATOM 3761 O O   . SER B 1 97  ? 82.377  -29.579 212.462 1.00 27.39  ? 97  SER B O   1 
ATOM 3762 C CB  . SER B 1 97  ? 80.059  -29.696 214.815 1.00 22.52  ? 97  SER B CB  1 
ATOM 3763 O OG  . SER B 1 97  ? 81.158  -30.394 215.349 1.00 25.89  ? 97  SER B OG  1 
ATOM 3764 N N   . ASP B 1 98  ? 81.327  -27.629 212.860 1.00 24.83  ? 98  ASP B N   1 
ATOM 3765 C CA  . ASP B 1 98  ? 82.461  -26.794 212.488 1.00 23.53  ? 98  ASP B CA  1 
ATOM 3766 C C   . ASP B 1 98  ? 83.368  -26.703 213.712 1.00 21.71  ? 98  ASP B C   1 
ATOM 3767 O O   . ASP B 1 98  ? 82.908  -26.405 214.813 1.00 21.20  ? 98  ASP B O   1 
ATOM 3768 C CB  . ASP B 1 98  ? 81.981  -25.404 212.079 1.00 25.60  ? 98  ASP B CB  1 
ATOM 3769 C CG  . ASP B 1 98  ? 81.057  -25.441 210.878 1.00 31.12  ? 98  ASP B CG  1 
ATOM 3770 O OD1 . ASP B 1 98  ? 81.429  -26.060 209.860 1.00 34.09  ? 98  ASP B OD1 1 
ATOM 3771 O OD2 . ASP B 1 98  ? 79.959  -24.849 210.955 1.00 40.34  ? 98  ASP B OD2 1 
ATOM 3772 N N   . ARG B 1 99  ? 84.644  -27.008 213.517 1.00 19.59  ? 99  ARG B N   1 
ATOM 3773 C CA  . ARG B 1 99  ? 85.616  -27.000 214.602 1.00 18.60  ? 99  ARG B CA  1 
ATOM 3774 C C   . ARG B 1 99  ? 86.792  -26.109 214.198 1.00 20.20  ? 99  ARG B C   1 
ATOM 3775 O O   . ARG B 1 99  ? 86.957  -25.791 213.020 1.00 19.46  ? 99  ARG B O   1 
ATOM 3776 C CB  . ARG B 1 99  ? 86.127  -28.430 214.851 1.00 20.58  ? 99  ARG B CB  1 
ATOM 3777 C CG  . ARG B 1 99  ? 85.047  -29.463 215.173 1.00 19.10  ? 99  ARG B CG  1 
ATOM 3778 C CD  . ARG B 1 99  ? 84.268  -29.080 216.414 1.00 18.49  ? 99  ARG B CD  1 
ATOM 3779 N NE  . ARG B 1 99  ? 85.106  -28.997 217.607 1.00 16.03  ? 99  ARG B NE  1 
ATOM 3780 C CZ  . ARG B 1 99  ? 85.431  -30.037 218.371 1.00 23.80  ? 99  ARG B CZ  1 
ATOM 3781 N NH1 . ARG B 1 99  ? 84.994  -31.259 218.084 1.00 17.94  ? 99  ARG B NH1 1 
ATOM 3782 N NH2 . ARG B 1 99  ? 86.204  -29.860 219.427 1.00 13.10  ? 99  ARG B NH2 1 
ATOM 3783 N N   . GLY B 1 100 ? 87.621  -25.735 215.167 1.00 20.97  ? 100 GLY B N   1 
ATOM 3784 C CA  . GLY B 1 100 ? 88.771  -24.888 214.889 1.00 18.97  ? 100 GLY B CA  1 
ATOM 3785 C C   . GLY B 1 100 ? 89.460  -24.591 216.197 1.00 19.85  ? 100 GLY B C   1 
ATOM 3786 O O   . GLY B 1 100 ? 89.153  -25.225 217.213 1.00 19.18  ? 100 GLY B O   1 
ATOM 3787 N N   . TRP B 1 101 ? 90.367  -23.622 216.204 1.00 18.81  ? 101 TRP B N   1 
ATOM 3788 C CA  . TRP B 1 101 ? 91.073  -23.272 217.436 1.00 18.04  ? 101 TRP B CA  1 
ATOM 3789 C C   . TRP B 1 101 ? 90.126  -22.812 218.547 1.00 19.15  ? 101 TRP B C   1 
ATOM 3790 O O   . TRP B 1 101 ? 90.395  -23.048 219.724 1.00 19.15  ? 101 TRP B O   1 
ATOM 3791 C CB  . TRP B 1 101 ? 92.087  -22.167 217.173 1.00 18.50  ? 101 TRP B CB  1 
ATOM 3792 C CG  . TRP B 1 101 ? 93.280  -22.583 216.375 1.00 21.63  ? 101 TRP B CG  1 
ATOM 3793 C CD1 . TRP B 1 101 ? 93.483  -23.777 215.743 1.00 19.18  ? 101 TRP B CD1 1 
ATOM 3794 C CD2 . TRP B 1 101 ? 94.425  -21.780 216.097 1.00 17.39  ? 101 TRP B CD2 1 
ATOM 3795 N NE1 . TRP B 1 101 ? 94.685  -23.761 215.081 1.00 17.46  ? 101 TRP B NE1 1 
ATOM 3796 C CE2 . TRP B 1 101 ? 95.287  -22.550 215.281 1.00 20.39  ? 101 TRP B CE2 1 
ATOM 3797 C CE3 . TRP B 1 101 ? 94.805  -20.476 216.449 1.00 17.30  ? 101 TRP B CE3 1 
ATOM 3798 C CZ2 . TRP B 1 101 ? 96.510  -22.059 214.811 1.00 20.68  ? 101 TRP B CZ2 1 
ATOM 3799 C CZ3 . TRP B 1 101 ? 96.015  -19.983 215.979 1.00 18.78  ? 101 TRP B CZ3 1 
ATOM 3800 C CH2 . TRP B 1 101 ? 96.856  -20.777 215.167 1.00 21.47  ? 101 TRP B CH2 1 
ATOM 3801 N N   . GLY B 1 102 ? 89.024  -22.171 218.163 1.00 18.83  ? 102 GLY B N   1 
ATOM 3802 C CA  . GLY B 1 102 ? 88.052  -21.671 219.123 1.00 17.92  ? 102 GLY B CA  1 
ATOM 3803 C C   . GLY B 1 102 ? 87.456  -22.737 220.016 1.00 20.01  ? 102 GLY B C   1 
ATOM 3804 O O   . GLY B 1 102 ? 87.045  -22.459 221.150 1.00 19.70  ? 102 GLY B O   1 
ATOM 3805 N N   . ASN B 1 103 ? 87.383  -23.962 219.517 1.00 20.46  ? 103 ASN B N   1 
ATOM 3806 C CA  . ASN B 1 103 ? 86.855  -25.055 220.318 1.00 22.41  ? 103 ASN B CA  1 
ATOM 3807 C C   . ASN B 1 103 ? 87.885  -26.174 220.483 1.00 25.30  ? 103 ASN B C   1 
ATOM 3808 O O   . ASN B 1 103 ? 87.559  -27.363 220.534 1.00 23.68  ? 103 ASN B O   1 
ATOM 3809 C CB  . ASN B 1 103 ? 85.514  -25.560 219.767 1.00 22.77  ? 103 ASN B CB  1 
ATOM 3810 C CG  . ASN B 1 103 ? 85.494  -25.608 218.274 1.00 20.84  ? 103 ASN B CG  1 
ATOM 3811 O OD1 . ASN B 1 103 ? 86.192  -26.408 217.674 1.00 23.09  ? 103 ASN B OD1 1 
ATOM 3812 N ND2 . ASN B 1 103 ? 84.735  -24.711 217.657 1.00 20.64  ? 103 ASN B ND2 1 
ATOM 3813 N N   . HIS B 1 104 ? 89.147  -25.765 220.531 1.00 24.58  ? 104 HIS B N   1 
ATOM 3814 C CA  . HIS B 1 104 ? 90.264  -26.659 220.777 1.00 24.45  ? 104 HIS B CA  1 
ATOM 3815 C C   . HIS B 1 104 ? 90.661  -27.759 219.815 1.00 23.49  ? 104 HIS B C   1 
ATOM 3816 O O   . HIS B 1 104 ? 90.995  -28.855 220.251 1.00 24.83  ? 104 HIS B O   1 
ATOM 3817 C CB  . HIS B 1 104 ? 90.159  -27.202 222.206 1.00 25.48  ? 104 HIS B CB  1 
ATOM 3818 C CG  . HIS B 1 104 ? 89.993  -26.113 223.211 1.00 28.70  ? 104 HIS B CG  1 
ATOM 3819 N ND1 . HIS B 1 104 ? 88.756  -25.612 223.561 1.00 31.88  ? 104 HIS B ND1 1 
ATOM 3820 C CD2 . HIS B 1 104 ? 90.907  -25.316 223.815 1.00 27.18  ? 104 HIS B CD2 1 
ATOM 3821 C CE1 . HIS B 1 104 ? 88.915  -24.545 224.323 1.00 29.49  ? 104 HIS B CE1 1 
ATOM 3822 N NE2 . HIS B 1 104 ? 90.211  -24.344 224.492 1.00 23.65  ? 104 HIS B NE2 1 
ATOM 3823 N N   . CYS B 1 105 ? 90.649  -27.464 218.520 1.00 21.19  ? 105 CYS B N   1 
ATOM 3824 C CA  . CYS B 1 105 ? 91.103  -28.414 217.515 1.00 21.64  ? 105 CYS B CA  1 
ATOM 3825 C C   . CYS B 1 105 ? 92.299  -27.764 216.812 1.00 24.14  ? 105 CYS B C   1 
ATOM 3826 O O   . CYS B 1 105 ? 92.372  -26.530 216.721 1.00 25.42  ? 105 CYS B O   1 
ATOM 3827 C CB  . CYS B 1 105 ? 90.008  -28.735 216.506 1.00 21.74  ? 105 CYS B CB  1 
ATOM 3828 S SG  . CYS B 1 105 ? 88.637  -29.668 217.245 1.00 21.87  ? 105 CYS B SG  1 
ATOM 3829 N N   . GLY B 1 106 ? 93.240  -28.582 216.346 1.00 23.41  ? 106 GLY B N   1 
ATOM 3830 C CA  . GLY B 1 106 ? 94.412  -28.047 215.669 1.00 22.45  ? 106 GLY B CA  1 
ATOM 3831 C C   . GLY B 1 106 ? 94.093  -27.444 214.313 1.00 23.49  ? 106 GLY B C   1 
ATOM 3832 O O   . GLY B 1 106 ? 94.733  -26.470 213.896 1.00 22.60  ? 106 GLY B O   1 
ATOM 3833 N N   . LEU B 1 107 ? 93.136  -28.051 213.610 1.00 23.09  ? 107 LEU B N   1 
ATOM 3834 C CA  . LEU B 1 107 ? 92.701  -27.587 212.292 1.00 21.59  ? 107 LEU B CA  1 
ATOM 3835 C C   . LEU B 1 107 ? 91.305  -26.990 212.346 1.00 22.99  ? 107 LEU B C   1 
ATOM 3836 O O   . LEU B 1 107 ? 90.538  -27.286 213.254 1.00 25.02  ? 107 LEU B O   1 
ATOM 3837 C CB  . LEU B 1 107 ? 92.648  -28.752 211.309 1.00 17.60  ? 107 LEU B CB  1 
ATOM 3838 C CG  . LEU B 1 107 ? 93.975  -29.336 210.860 1.00 27.17  ? 107 LEU B CG  1 
ATOM 3839 C CD1 . LEU B 1 107 ? 93.741  -30.525 209.948 1.00 31.04  ? 107 LEU B CD1 1 
ATOM 3840 C CD2 . LEU B 1 107 ? 94.741  -28.261 210.116 1.00 27.68  ? 107 LEU B CD2 1 
ATOM 3841 N N   . PHE B 1 108 ? 90.997  -26.143 211.369 1.00 23.16  ? 108 PHE B N   1 
ATOM 3842 C CA  . PHE B 1 108 ? 89.683  -25.522 211.218 1.00 23.83  ? 108 PHE B CA  1 
ATOM 3843 C C   . PHE B 1 108 ? 89.024  -26.359 210.120 1.00 26.27  ? 108 PHE B C   1 
ATOM 3844 O O   . PHE B 1 108 ? 89.535  -26.426 208.998 1.00 26.28  ? 108 PHE B O   1 
ATOM 3845 C CB  . PHE B 1 108 ? 89.797  -24.068 210.723 1.00 21.45  ? 108 PHE B CB  1 
ATOM 3846 C CG  . PHE B 1 108 ? 90.286  -23.102 211.765 1.00 23.95  ? 108 PHE B CG  1 
ATOM 3847 C CD1 . PHE B 1 108 ? 91.623  -23.083 212.148 1.00 23.00  ? 108 PHE B CD1 1 
ATOM 3848 C CD2 . PHE B 1 108 ? 89.403  -22.210 212.367 1.00 23.33  ? 108 PHE B CD2 1 
ATOM 3849 C CE1 . PHE B 1 108 ? 92.078  -22.194 213.112 1.00 25.54  ? 108 PHE B CE1 1 
ATOM 3850 C CE2 . PHE B 1 108 ? 89.849  -21.311 213.341 1.00 30.53  ? 108 PHE B CE2 1 
ATOM 3851 C CZ  . PHE B 1 108 ? 91.197  -21.305 213.713 1.00 24.22  ? 108 PHE B CZ  1 
ATOM 3852 N N   . GLY B 1 109 ? 87.940  -27.045 210.457 1.00 27.17  ? 109 GLY B N   1 
ATOM 3853 C CA  . GLY B 1 109 ? 87.242  -27.868 209.482 1.00 27.03  ? 109 GLY B CA  1 
ATOM 3854 C C   . GLY B 1 109 ? 86.076  -28.607 210.119 1.00 27.94  ? 109 GLY B C   1 
ATOM 3855 O O   . GLY B 1 109 ? 85.655  -28.290 211.239 1.00 27.13  ? 109 GLY B O   1 
ATOM 3856 N N   . LYS B 1 110 ? 85.566  -29.607 209.414 1.00 29.30  ? 110 LYS B N   1 
ATOM 3857 C CA  . LYS B 1 110 ? 84.448  -30.408 209.884 1.00 26.39  ? 110 LYS B CA  1 
ATOM 3858 C C   . LYS B 1 110 ? 84.917  -31.513 210.804 1.00 25.20  ? 110 LYS B C   1 
ATOM 3859 O O   . LYS B 1 110 ? 85.884  -32.221 210.503 1.00 27.48  ? 110 LYS B O   1 
ATOM 3860 C CB  . LYS B 1 110 ? 83.709  -31.017 208.695 1.00 26.62  ? 110 LYS B CB  1 
ATOM 3861 C CG  . LYS B 1 110 ? 83.057  -29.996 207.778 1.00 31.18  ? 110 LYS B CG  1 
ATOM 3862 C CD  . LYS B 1 110 ? 81.882  -29.303 208.456 1.00 37.72  ? 110 LYS B CD  1 
ATOM 3863 C CE  . LYS B 1 110 ? 81.202  -28.340 207.493 1.00 43.53  ? 110 LYS B CE  1 
ATOM 3864 N NZ  . LYS B 1 110 ? 79.989  -27.704 208.080 1.00 51.21  ? 110 LYS B NZ  1 
ATOM 3865 N N   . GLY B 1 111 ? 84.251  -31.637 211.940 1.00 23.94  ? 111 GLY B N   1 
ATOM 3866 C CA  . GLY B 1 111 ? 84.587  -32.673 212.899 1.00 24.11  ? 111 GLY B CA  1 
ATOM 3867 C C   . GLY B 1 111 ? 83.371  -33.555 213.124 1.00 26.44  ? 111 GLY B C   1 
ATOM 3868 O O   . GLY B 1 111 ? 82.230  -33.091 213.064 1.00 27.07  ? 111 GLY B O   1 
ATOM 3869 N N   . SER B 1 112 ? 83.607  -34.838 213.351 1.00 26.56  ? 112 SER B N   1 
ATOM 3870 C CA  . SER B 1 112 ? 82.529  -35.784 213.578 1.00 26.37  ? 112 SER B CA  1 
ATOM 3871 C C   . SER B 1 112 ? 81.861  -35.570 214.946 1.00 26.27  ? 112 SER B C   1 
ATOM 3872 O O   . SER B 1 112 ? 82.539  -35.343 215.960 1.00 26.00  ? 112 SER B O   1 
ATOM 3873 C CB  . SER B 1 112 ? 83.092  -37.209 213.459 1.00 29.06  ? 112 SER B CB  1 
ATOM 3874 O OG  . SER B 1 112 ? 82.246  -38.186 214.035 1.00 25.97  ? 112 SER B OG  1 
ATOM 3875 N N   . ILE B 1 113 ? 80.532  -35.648 214.967 1.00 26.31  ? 113 ILE B N   1 
ATOM 3876 C CA  . ILE B 1 113 ? 79.768  -35.505 216.207 1.00 23.64  ? 113 ILE B CA  1 
ATOM 3877 C C   . ILE B 1 113 ? 78.595  -36.501 216.184 1.00 24.47  ? 113 ILE B C   1 
ATOM 3878 O O   . ILE B 1 113 ? 78.030  -36.767 215.124 1.00 21.14  ? 113 ILE B O   1 
ATOM 3879 C CB  . ILE B 1 113 ? 79.255  -34.045 216.387 1.00 23.69  ? 113 ILE B CB  1 
ATOM 3880 C CG1 . ILE B 1 113 ? 78.566  -33.880 217.740 1.00 19.69  ? 113 ILE B CG1 1 
ATOM 3881 C CG2 . ILE B 1 113 ? 78.341  -33.640 215.235 1.00 20.15  ? 113 ILE B CG2 1 
ATOM 3882 C CD1 . ILE B 1 113 ? 78.333  -32.435 218.127 1.00 22.86  ? 113 ILE B CD1 1 
ATOM 3883 N N   . VAL B 1 114 ? 78.286  -37.096 217.332 1.00 23.06  ? 114 VAL B N   1 
ATOM 3884 C CA  . VAL B 1 114 ? 77.180  -38.041 217.434 1.00 26.37  ? 114 VAL B CA  1 
ATOM 3885 C C   . VAL B 1 114 ? 76.497  -37.808 218.776 1.00 25.69  ? 114 VAL B C   1 
ATOM 3886 O O   . VAL B 1 114 ? 77.166  -37.597 219.783 1.00 25.31  ? 114 VAL B O   1 
ATOM 3887 C CB  . VAL B 1 114 ? 77.642  -39.543 217.306 1.00 29.10  ? 114 VAL B CB  1 
ATOM 3888 C CG1 . VAL B 1 114 ? 78.646  -39.917 218.385 1.00 25.77  ? 114 VAL B CG1 1 
ATOM 3889 C CG2 . VAL B 1 114 ? 76.447  -40.463 217.398 1.00 29.00  ? 114 VAL B CG2 1 
ATOM 3890 N N   . ALA B 1 115 ? 75.167  -37.761 218.767 1.00 25.76  ? 115 ALA B N   1 
ATOM 3891 C CA  . ALA B 1 115 ? 74.381  -37.564 219.982 1.00 24.17  ? 115 ALA B CA  1 
ATOM 3892 C C   . ALA B 1 115 ? 73.344  -38.687 220.070 1.00 25.18  ? 115 ALA B C   1 
ATOM 3893 O O   . ALA B 1 115 ? 72.783  -39.093 219.046 1.00 23.01  ? 115 ALA B O   1 
ATOM 3894 C CB  . ALA B 1 115 ? 73.687  -36.211 219.950 1.00 20.66  ? 115 ALA B CB  1 
ATOM 3895 N N   . CYS B 1 116 ? 73.099  -39.180 221.284 1.00 25.37  ? 116 CYS B N   1 
ATOM 3896 C CA  . CYS B 1 116 ? 72.129  -40.254 221.523 1.00 24.63  ? 116 CYS B CA  1 
ATOM 3897 C C   . CYS B 1 116 ? 71.298  -39.975 222.758 1.00 25.79  ? 116 CYS B C   1 
ATOM 3898 O O   . CYS B 1 116 ? 71.790  -39.349 223.700 1.00 26.54  ? 116 CYS B O   1 
ATOM 3899 C CB  . CYS B 1 116 ? 72.835  -41.583 221.808 1.00 24.84  ? 116 CYS B CB  1 
ATOM 3900 S SG  . CYS B 1 116 ? 73.832  -42.286 220.468 1.00 26.53  ? 116 CYS B SG  1 
ATOM 3901 N N   . VAL B 1 117 ? 70.046  -40.441 222.754 1.00 25.41  ? 117 VAL B N   1 
ATOM 3902 C CA  . VAL B 1 117 ? 69.165  -40.333 223.923 1.00 23.09  ? 117 VAL B CA  1 
ATOM 3903 C C   . VAL B 1 117 ? 68.520  -41.684 224.111 1.00 22.01  ? 117 VAL B C   1 
ATOM 3904 O O   . VAL B 1 117 ? 68.321  -42.422 223.142 1.00 21.66  ? 117 VAL B O   1 
ATOM 3905 C CB  . VAL B 1 117 ? 67.969  -39.343 223.779 1.00 23.18  ? 117 VAL B CB  1 
ATOM 3906 C CG1 . VAL B 1 117 ? 68.325  -38.007 224.346 1.00 27.49  ? 117 VAL B CG1 1 
ATOM 3907 C CG2 . VAL B 1 117 ? 67.474  -39.258 222.336 1.00 16.70  ? 117 VAL B CG2 1 
ATOM 3908 N N   . LYS B 1 118 ? 68.222  -42.017 225.355 1.00 19.74  ? 118 LYS B N   1 
ATOM 3909 C CA  . LYS B 1 118 ? 67.517  -43.250 225.639 1.00 24.51  ? 118 LYS B CA  1 
ATOM 3910 C C   . LYS B 1 118 ? 66.054  -42.867 225.436 1.00 24.62  ? 118 LYS B C   1 
ATOM 3911 O O   . LYS B 1 118 ? 65.619  -41.802 225.880 1.00 23.36  ? 118 LYS B O   1 
ATOM 3912 C CB  . LYS B 1 118 ? 67.804  -43.726 227.064 1.00 29.34  ? 118 LYS B CB  1 
ATOM 3913 C CG  . LYS B 1 118 ? 69.058  -44.611 227.118 1.00 48.69  ? 118 LYS B CG  1 
ATOM 3914 C CD  . LYS B 1 118 ? 69.803  -44.533 228.440 1.00 60.91  ? 118 LYS B CD  1 
ATOM 3915 C CE  . LYS B 1 118 ? 68.927  -44.973 229.598 1.00 68.41  ? 118 LYS B CE  1 
ATOM 3916 N NZ  . LYS B 1 118 ? 69.680  -44.913 230.877 1.00 71.77  ? 118 LYS B NZ  1 
ATOM 3917 N N   . ALA B 1 119 ? 65.331  -43.686 224.683 1.00 23.43  ? 119 ALA B N   1 
ATOM 3918 C CA  . ALA B 1 119 ? 63.934  -43.417 224.381 1.00 24.34  ? 119 ALA B CA  1 
ATOM 3919 C C   . ALA B 1 119 ? 63.022  -44.486 224.962 1.00 25.58  ? 119 ALA B C   1 
ATOM 3920 O O   . ALA B 1 119 ? 63.197  -45.675 224.710 1.00 28.29  ? 119 ALA B O   1 
ATOM 3921 C CB  . ALA B 1 119 ? 63.743  -43.330 222.876 1.00 18.56  ? 119 ALA B CB  1 
ATOM 3922 N N   . ALA B 1 120 ? 62.080  -44.058 225.786 1.00 23.57  ? 120 ALA B N   1 
ATOM 3923 C CA  . ALA B 1 120 ? 61.111  -44.956 226.390 1.00 21.56  ? 120 ALA B CA  1 
ATOM 3924 C C   . ALA B 1 120 ? 59.757  -44.273 226.210 1.00 21.11  ? 120 ALA B C   1 
ATOM 3925 O O   . ALA B 1 120 ? 59.645  -43.260 225.499 1.00 20.77  ? 120 ALA B O   1 
ATOM 3926 C CB  . ALA B 1 120 ? 61.418  -45.156 227.870 1.00 19.84  ? 120 ALA B CB  1 
ATOM 3927 N N   . CYS B 1 121 ? 58.731  -44.795 226.868 1.00 18.11  ? 121 CYS B N   1 
ATOM 3928 C CA  . CYS B 1 121 ? 57.409  -44.206 226.740 1.00 17.75  ? 121 CYS B CA  1 
ATOM 3929 C C   . CYS B 1 121 ? 56.882  -43.780 228.101 1.00 15.29  ? 121 CYS B C   1 
ATOM 3930 O O   . CYS B 1 121 ? 57.118  -44.452 229.097 1.00 18.16  ? 121 CYS B O   1 
ATOM 3931 C CB  . CYS B 1 121 ? 56.451  -45.214 226.086 1.00 15.95  ? 121 CYS B CB  1 
ATOM 3932 S SG  . CYS B 1 121 ? 54.972  -44.464 225.339 1.00 15.99  ? 121 CYS B SG  1 
ATOM 3933 N N   . GLU B 1 122 ? 56.216  -42.632 228.151 1.00 16.64  ? 122 GLU B N   1 
ATOM 3934 C CA  . GLU B 1 122 ? 55.637  -42.142 229.391 1.00 16.95  ? 122 GLU B CA  1 
ATOM 3935 C C   . GLU B 1 122 ? 54.604  -43.140 229.894 1.00 18.85  ? 122 GLU B C   1 
ATOM 3936 O O   . GLU B 1 122 ? 53.935  -43.810 229.096 1.00 17.98  ? 122 GLU B O   1 
ATOM 3937 C CB  . GLU B 1 122 ? 54.953  -40.800 229.150 1.00 21.62  ? 122 GLU B CB  1 
ATOM 3938 C CG  . GLU B 1 122 ? 55.910  -39.637 229.081 1.00 29.62  ? 122 GLU B CG  1 
ATOM 3939 C CD  . GLU B 1 122 ? 56.572  -39.331 230.421 1.00 33.87  ? 122 GLU B CD  1 
ATOM 3940 O OE1 . GLU B 1 122 ? 56.095  -39.825 231.473 1.00 36.07  ? 122 GLU B OE1 1 
ATOM 3941 O OE2 . GLU B 1 122 ? 57.573  -38.586 230.410 1.00 31.62  ? 122 GLU B OE2 1 
ATOM 3942 N N   . ALA B 1 123 ? 54.482  -43.249 231.213 1.00 20.85  ? 123 ALA B N   1 
ATOM 3943 C CA  . ALA B 1 123 ? 53.517  -44.162 231.818 1.00 22.62  ? 123 ALA B CA  1 
ATOM 3944 C C   . ALA B 1 123 ? 52.122  -43.777 231.323 1.00 25.11  ? 123 ALA B C   1 
ATOM 3945 O O   . ALA B 1 123 ? 51.805  -42.585 231.211 1.00 26.84  ? 123 ALA B O   1 
ATOM 3946 C CB  . ALA B 1 123 ? 53.570  -44.059 233.334 1.00 19.60  ? 123 ALA B CB  1 
ATOM 3947 N N   . LYS B 1 124 ? 51.337  -44.779 230.942 1.00 22.68  ? 124 LYS B N   1 
ATOM 3948 C CA  . LYS B 1 124 ? 49.973  -44.568 230.485 1.00 21.82  ? 124 LYS B CA  1 
ATOM 3949 C C   . LYS B 1 124 ? 49.790  -43.747 229.218 1.00 19.10  ? 124 LYS B C   1 
ATOM 3950 O O   . LYS B 1 124 ? 48.713  -43.196 228.975 1.00 17.82  ? 124 LYS B O   1 
ATOM 3951 C CB  . LYS B 1 124 ? 49.122  -44.020 231.628 1.00 23.94  ? 124 LYS B CB  1 
ATOM 3952 C CG  . LYS B 1 124 ? 48.977  -45.031 232.748 1.00 34.39  ? 124 LYS B CG  1 
ATOM 3953 C CD  . LYS B 1 124 ? 48.072  -44.545 233.850 1.00 53.54  ? 124 LYS B CD  1 
ATOM 3954 C CE  . LYS B 1 124 ? 47.791  -45.672 234.828 1.00 62.63  ? 124 LYS B CE  1 
ATOM 3955 N NZ  . LYS B 1 124 ? 46.720  -45.291 235.791 1.00 69.19  ? 124 LYS B NZ  1 
ATOM 3956 N N   . LYS B 1 125 ? 50.816  -43.745 228.372 1.00 16.71  ? 125 LYS B N   1 
ATOM 3957 C CA  . LYS B 1 125 ? 50.768  -43.015 227.118 1.00 14.01  ? 125 LYS B CA  1 
ATOM 3958 C C   . LYS B 1 125 ? 50.902  -43.938 225.905 1.00 15.90  ? 125 LYS B C   1 
ATOM 3959 O O   . LYS B 1 125 ? 51.485  -43.569 224.867 1.00 14.72  ? 125 LYS B O   1 
ATOM 3960 C CB  . LYS B 1 125 ? 51.828  -41.906 227.110 1.00 15.96  ? 125 LYS B CB  1 
ATOM 3961 C CG  . LYS B 1 125 ? 51.478  -40.730 228.008 1.00 15.21  ? 125 LYS B CG  1 
ATOM 3962 C CD  . LYS B 1 125 ? 50.273  -40.009 227.432 1.00 20.06  ? 125 LYS B CD  1 
ATOM 3963 C CE  . LYS B 1 125 ? 49.623  -39.050 228.419 1.00 17.49  ? 125 LYS B CE  1 
ATOM 3964 N NZ  . LYS B 1 125 ? 48.468  -38.354 227.748 1.00 17.05  ? 125 LYS B NZ  1 
ATOM 3965 N N   . LYS B 1 126 ? 50.338  -45.140 226.023 1.00 15.12  ? 126 LYS B N   1 
ATOM 3966 C CA  . LYS B 1 126 ? 50.365  -46.098 224.921 1.00 15.27  ? 126 LYS B CA  1 
ATOM 3967 C C   . LYS B 1 126 ? 48.996  -46.161 224.259 1.00 15.79  ? 126 LYS B C   1 
ATOM 3968 O O   . LYS B 1 126 ? 47.989  -45.808 224.870 1.00 15.69  ? 126 LYS B O   1 
ATOM 3969 C CB  . LYS B 1 126 ? 50.659  -47.503 225.417 1.00 18.02  ? 126 LYS B CB  1 
ATOM 3970 C CG  . LYS B 1 126 ? 51.980  -47.743 226.082 1.00 21.07  ? 126 LYS B CG  1 
ATOM 3971 C CD  . LYS B 1 126 ? 52.084  -49.246 226.280 1.00 30.42  ? 126 LYS B CD  1 
ATOM 3972 C CE  . LYS B 1 126 ? 53.134  -49.649 227.264 1.00 35.51  ? 126 LYS B CE  1 
ATOM 3973 N NZ  . LYS B 1 126 ? 53.006  -51.108 227.526 1.00 37.82  ? 126 LYS B NZ  1 
ATOM 3974 N N   . ALA B 1 127 ? 48.983  -46.600 223.004 1.00 16.03  ? 127 ALA B N   1 
ATOM 3975 C CA  . ALA B 1 127 ? 47.764  -46.811 222.228 1.00 14.63  ? 127 ALA B CA  1 
ATOM 3976 C C   . ALA B 1 127 ? 47.945  -48.272 221.805 1.00 16.07  ? 127 ALA B C   1 
ATOM 3977 O O   . ALA B 1 127 ? 48.890  -48.582 221.075 1.00 14.48  ? 127 ALA B O   1 
ATOM 3978 C CB  . ALA B 1 127 ? 47.740  -45.914 221.006 1.00 14.70  ? 127 ALA B CB  1 
ATOM 3979 N N   . THR B 1 128 ? 47.115  -49.172 222.333 1.00 15.99  ? 128 THR B N   1 
ATOM 3980 C CA  . THR B 1 128 ? 47.243  -50.599 222.040 1.00 17.90  ? 128 THR B CA  1 
ATOM 3981 C C   . THR B 1 128 ? 46.098  -51.129 221.193 1.00 16.26  ? 128 THR B C   1 
ATOM 3982 O O   . THR B 1 128 ? 44.948  -50.795 221.445 1.00 17.63  ? 128 THR B O   1 
ATOM 3983 C CB  . THR B 1 128 ? 47.271  -51.416 223.345 1.00 16.40  ? 128 THR B CB  1 
ATOM 3984 O OG1 . THR B 1 128 ? 48.335  -50.947 224.179 1.00 23.58  ? 128 THR B OG1 1 
ATOM 3985 C CG2 . THR B 1 128 ? 47.512  -52.911 223.048 1.00 26.55  ? 128 THR B CG2 1 
ATOM 3986 N N   . GLY B 1 129 ? 46.417  -51.957 220.194 1.00 16.34  ? 129 GLY B N   1 
ATOM 3987 C CA  . GLY B 1 129 ? 45.382  -52.542 219.355 1.00 15.71  ? 129 GLY B CA  1 
ATOM 3988 C C   . GLY B 1 129 ? 45.098  -53.990 219.732 1.00 17.09  ? 129 GLY B C   1 
ATOM 3989 O O   . GLY B 1 129 ? 45.998  -54.706 220.191 1.00 20.14  ? 129 GLY B O   1 
ATOM 3990 N N   . HIS B 1 130 ? 43.843  -54.412 219.590 1.00 18.00  ? 130 HIS B N   1 
ATOM 3991 C CA  . HIS B 1 130 ? 43.421  -55.784 219.906 1.00 14.77  ? 130 HIS B CA  1 
ATOM 3992 C C   . HIS B 1 130 ? 42.609  -56.335 218.742 1.00 15.52  ? 130 HIS B C   1 
ATOM 3993 O O   . HIS B 1 130 ? 41.873  -55.584 218.088 1.00 15.65  ? 130 HIS B O   1 
ATOM 3994 C CB  . HIS B 1 130 ? 42.543  -55.799 221.151 1.00 15.93  ? 130 HIS B CB  1 
ATOM 3995 C CG  . HIS B 1 130 ? 43.171  -55.144 222.339 1.00 18.17  ? 130 HIS B CG  1 
ATOM 3996 N ND1 . HIS B 1 130 ? 43.768  -55.859 223.357 1.00 25.44  ? 130 HIS B ND1 1 
ATOM 3997 C CD2 . HIS B 1 130 ? 43.309  -53.835 222.664 1.00 13.17  ? 130 HIS B CD2 1 
ATOM 3998 C CE1 . HIS B 1 130 ? 44.251  -55.019 224.254 1.00 20.82  ? 130 HIS B CE1 1 
ATOM 3999 N NE2 . HIS B 1 130 ? 43.986  -53.787 223.856 1.00 22.14  ? 130 HIS B NE2 1 
ATOM 4000 N N   . VAL B 1 131 ? 42.735  -57.636 218.482 1.00 15.94  ? 131 VAL B N   1 
ATOM 4001 C CA  . VAL B 1 131 ? 42.002  -58.275 217.390 1.00 17.04  ? 131 VAL B CA  1 
ATOM 4002 C C   . VAL B 1 131 ? 41.140  -59.409 217.915 1.00 17.05  ? 131 VAL B C   1 
ATOM 4003 O O   . VAL B 1 131 ? 41.529  -60.129 218.838 1.00 17.32  ? 131 VAL B O   1 
ATOM 4004 C CB  . VAL B 1 131 ? 42.930  -58.832 216.290 1.00 19.48  ? 131 VAL B CB  1 
ATOM 4005 C CG1 . VAL B 1 131 ? 43.620  -57.702 215.580 1.00 23.88  ? 131 VAL B CG1 1 
ATOM 4006 C CG2 . VAL B 1 131 ? 43.947  -59.810 216.889 1.00 17.10  ? 131 VAL B CG2 1 
ATOM 4007 N N   . TYR B 1 132 ? 39.976  -59.578 217.299 1.00 15.41  ? 132 TYR B N   1 
ATOM 4008 C CA  . TYR B 1 132 ? 39.036  -60.604 217.706 1.00 13.93  ? 132 TYR B CA  1 
ATOM 4009 C C   . TYR B 1 132 ? 39.298  -61.930 217.009 1.00 16.98  ? 132 TYR B C   1 
ATOM 4010 O O   . TYR B 1 132 ? 39.891  -61.980 215.926 1.00 17.99  ? 132 TYR B O   1 
ATOM 4011 C CB  . TYR B 1 132 ? 37.611  -60.161 217.368 1.00 10.25  ? 132 TYR B CB  1 
ATOM 4012 C CG  . TYR B 1 132 ? 37.037  -59.085 218.262 1.00 14.81  ? 132 TYR B CG  1 
ATOM 4013 C CD1 . TYR B 1 132 ? 36.702  -59.363 219.586 1.00 16.07  ? 132 TYR B CD1 1 
ATOM 4014 C CD2 . TYR B 1 132 ? 36.777  -57.797 217.770 1.00 9.49   ? 132 TYR B CD2 1 
ATOM 4015 C CE1 . TYR B 1 132 ? 36.118  -58.386 220.403 1.00 16.11  ? 132 TYR B CE1 1 
ATOM 4016 C CE2 . TYR B 1 132 ? 36.192  -56.818 218.576 1.00 13.66  ? 132 TYR B CE2 1 
ATOM 4017 C CZ  . TYR B 1 132 ? 35.867  -57.121 219.893 1.00 18.73  ? 132 TYR B CZ  1 
ATOM 4018 O OH  . TYR B 1 132 ? 35.290  -56.167 220.709 1.00 19.60  ? 132 TYR B OH  1 
ATOM 4019 N N   . ASP B 1 133 ? 38.884  -62.998 217.668 1.00 14.09  ? 133 ASP B N   1 
ATOM 4020 C CA  . ASP B 1 133 ? 38.975  -64.331 217.132 1.00 14.10  ? 133 ASP B CA  1 
ATOM 4021 C C   . ASP B 1 133 ? 37.482  -64.723 217.052 1.00 15.75  ? 133 ASP B C   1 
ATOM 4022 O O   . ASP B 1 133 ? 36.811  -64.822 218.080 1.00 15.80  ? 133 ASP B O   1 
ATOM 4023 C CB  . ASP B 1 133 ? 39.723  -65.226 218.113 1.00 13.10  ? 133 ASP B CB  1 
ATOM 4024 C CG  . ASP B 1 133 ? 39.831  -66.669 217.637 1.00 25.95  ? 133 ASP B CG  1 
ATOM 4025 O OD1 . ASP B 1 133 ? 38.993  -67.124 216.836 1.00 21.15  ? 133 ASP B OD1 1 
ATOM 4026 O OD2 . ASP B 1 133 ? 40.750  -67.373 218.084 1.00 25.20  ? 133 ASP B OD2 1 
ATOM 4027 N N   . ALA B 1 134 ? 36.967  -64.920 215.840 1.00 16.07  ? 134 ALA B N   1 
ATOM 4028 C CA  . ALA B 1 134 ? 35.559  -65.276 215.620 1.00 18.96  ? 134 ALA B CA  1 
ATOM 4029 C C   . ALA B 1 134 ? 35.137  -66.493 216.417 1.00 19.82  ? 134 ALA B C   1 
ATOM 4030 O O   . ALA B 1 134 ? 33.976  -66.654 216.749 1.00 21.37  ? 134 ALA B O   1 
ATOM 4031 C CB  . ALA B 1 134 ? 35.301  -65.513 214.150 1.00 19.66  ? 134 ALA B CB  1 
ATOM 4032 N N   . ASN B 1 135 ? 36.096  -67.339 216.744 1.00 20.54  ? 135 ASN B N   1 
ATOM 4033 C CA  . ASN B 1 135 ? 35.813  -68.525 217.518 1.00 20.57  ? 135 ASN B CA  1 
ATOM 4034 C C   . ASN B 1 135 ? 35.742  -68.316 219.009 1.00 21.18  ? 135 ASN B C   1 
ATOM 4035 O O   . ASN B 1 135 ? 35.317  -69.211 219.740 1.00 23.67  ? 135 ASN B O   1 
ATOM 4036 C CB  . ASN B 1 135 ? 36.820  -69.612 217.197 1.00 25.88  ? 135 ASN B CB  1 
ATOM 4037 C CG  . ASN B 1 135 ? 36.433  -70.370 215.960 1.00 36.92  ? 135 ASN B CG  1 
ATOM 4038 O OD1 . ASN B 1 135 ? 35.622  -71.303 216.025 1.00 48.07  ? 135 ASN B OD1 1 
ATOM 4039 N ND2 . ASN B 1 135 ? 36.948  -69.939 214.808 1.00 33.03  ? 135 ASN B ND2 1 
ATOM 4040 N N   . LYS B 1 136 ? 36.107  -67.132 219.473 1.00 18.28  ? 136 LYS B N   1 
ATOM 4041 C CA  . LYS B 1 136 ? 36.075  -66.855 220.896 1.00 17.31  ? 136 LYS B CA  1 
ATOM 4042 C C   . LYS B 1 136 ? 35.112  -65.729 221.263 1.00 17.70  ? 136 LYS B C   1 
ATOM 4043 O O   . LYS B 1 136 ? 34.873  -65.475 222.448 1.00 16.49  ? 136 LYS B O   1 
ATOM 4044 C CB  . LYS B 1 136 ? 37.481  -66.529 221.385 1.00 17.06  ? 136 LYS B CB  1 
ATOM 4045 C CG  . LYS B 1 136 ? 38.383  -67.722 221.337 1.00 23.24  ? 136 LYS B CG  1 
ATOM 4046 C CD  . LYS B 1 136 ? 39.763  -67.365 221.771 1.00 32.12  ? 136 LYS B CD  1 
ATOM 4047 C CE  . LYS B 1 136 ? 40.666  -68.580 221.763 1.00 38.61  ? 136 LYS B CE  1 
ATOM 4048 N NZ  . LYS B 1 136 ? 42.056  -68.192 222.150 1.00 44.17  ? 136 LYS B NZ  1 
ATOM 4049 N N   . ILE B 1 137 ? 34.561  -65.065 220.252 1.00 15.27  ? 137 ILE B N   1 
ATOM 4050 C CA  . ILE B 1 137 ? 33.654  -63.959 220.491 1.00 17.36  ? 137 ILE B CA  1 
ATOM 4051 C C   . ILE B 1 137 ? 32.314  -64.492 221.054 1.00 18.68  ? 137 ILE B C   1 
ATOM 4052 O O   . ILE B 1 137 ? 31.861  -65.564 220.671 1.00 20.44  ? 137 ILE B O   1 
ATOM 4053 C CB  . ILE B 1 137 ? 33.493  -63.113 219.211 1.00 16.43  ? 137 ILE B CB  1 
ATOM 4054 C CG1 . ILE B 1 137 ? 32.894  -61.763 219.558 1.00 21.99  ? 137 ILE B CG1 1 
ATOM 4055 C CG2 . ILE B 1 137 ? 32.606  -63.822 218.190 1.00 18.74  ? 137 ILE B CG2 1 
ATOM 4056 C CD1 . ILE B 1 137 ? 33.164  -60.730 218.522 1.00 22.05  ? 137 ILE B CD1 1 
ATOM 4057 N N   . VAL B 1 138 ? 31.722  -63.769 221.999 1.00 17.18  ? 138 VAL B N   1 
ATOM 4058 C CA  . VAL B 1 138 ? 30.481  -64.182 222.652 1.00 16.08  ? 138 VAL B CA  1 
ATOM 4059 C C   . VAL B 1 138 ? 29.362  -63.183 222.376 1.00 16.49  ? 138 VAL B C   1 
ATOM 4060 O O   . VAL B 1 138 ? 29.585  -61.970 222.434 1.00 16.10  ? 138 VAL B O   1 
ATOM 4061 C CB  . VAL B 1 138 ? 30.678  -64.232 224.189 1.00 15.91  ? 138 VAL B CB  1 
ATOM 4062 C CG1 . VAL B 1 138 ? 29.394  -64.634 224.895 1.00 16.55  ? 138 VAL B CG1 1 
ATOM 4063 C CG2 . VAL B 1 138 ? 31.773  -65.176 224.543 1.00 12.64  ? 138 VAL B CG2 1 
ATOM 4064 N N   . TYR B 1 139 ? 28.177  -63.698 222.054 1.00 16.30  ? 139 TYR B N   1 
ATOM 4065 C CA  . TYR B 1 139 ? 26.984  -62.883 221.811 1.00 13.72  ? 139 TYR B CA  1 
ATOM 4066 C C   . TYR B 1 139 ? 26.003  -63.244 222.921 1.00 16.15  ? 139 TYR B C   1 
ATOM 4067 O O   . TYR B 1 139 ? 25.671  -64.417 223.099 1.00 17.93  ? 139 TYR B O   1 
ATOM 4068 C CB  . TYR B 1 139 ? 26.335  -63.235 220.479 1.00 13.55  ? 139 TYR B CB  1 
ATOM 4069 C CG  . TYR B 1 139 ? 27.001  -62.623 219.269 1.00 21.44  ? 139 TYR B CG  1 
ATOM 4070 C CD1 . TYR B 1 139 ? 28.301  -62.982 218.897 1.00 20.04  ? 139 TYR B CD1 1 
ATOM 4071 C CD2 . TYR B 1 139 ? 26.321  -61.701 218.477 1.00 19.83  ? 139 TYR B CD2 1 
ATOM 4072 C CE1 . TYR B 1 139 ? 28.905  -62.428 217.757 1.00 19.90  ? 139 TYR B CE1 1 
ATOM 4073 C CE2 . TYR B 1 139 ? 26.908  -61.150 217.339 1.00 24.14  ? 139 TYR B CE2 1 
ATOM 4074 C CZ  . TYR B 1 139 ? 28.198  -61.514 216.982 1.00 22.13  ? 139 TYR B CZ  1 
ATOM 4075 O OH  . TYR B 1 139 ? 28.772  -60.954 215.857 1.00 25.33  ? 139 TYR B OH  1 
ATOM 4076 N N   . THR B 1 140 ? 25.556  -62.244 223.665 1.00 15.49  ? 140 THR B N   1 
ATOM 4077 C CA  . THR B 1 140 ? 24.620  -62.452 224.770 1.00 15.76  ? 140 THR B CA  1 
ATOM 4078 C C   . THR B 1 140 ? 23.232  -61.952 224.390 1.00 16.89  ? 140 THR B C   1 
ATOM 4079 O O   . THR B 1 140 ? 23.063  -60.809 223.941 1.00 16.97  ? 140 THR B O   1 
ATOM 4080 C CB  . THR B 1 140 ? 25.108  -61.736 226.035 1.00 14.36  ? 140 THR B CB  1 
ATOM 4081 O OG1 . THR B 1 140 ? 26.367  -62.306 226.423 1.00 18.67  ? 140 THR B OG1 1 
ATOM 4082 C CG2 . THR B 1 140 ? 24.112  -61.893 227.172 1.00 17.39  ? 140 THR B CG2 1 
ATOM 4083 N N   . VAL B 1 141 ? 22.248  -62.831 224.538 1.00 17.49  ? 141 VAL B N   1 
ATOM 4084 C CA  . VAL B 1 141 ? 20.849  -62.530 224.213 1.00 18.20  ? 141 VAL B CA  1 
ATOM 4085 C C   . VAL B 1 141 ? 19.962  -62.659 225.462 1.00 19.58  ? 141 VAL B C   1 
ATOM 4086 O O   . VAL B 1 141 ? 20.135  -63.580 226.275 1.00 16.84  ? 141 VAL B O   1 
ATOM 4087 C CB  . VAL B 1 141 ? 20.335  -63.460 223.097 1.00 16.70  ? 141 VAL B CB  1 
ATOM 4088 C CG1 . VAL B 1 141 ? 18.870  -63.220 222.829 1.00 16.62  ? 141 VAL B CG1 1 
ATOM 4089 C CG2 . VAL B 1 141 ? 21.147  -63.232 221.826 1.00 12.04  ? 141 VAL B CG2 1 
ATOM 4090 N N   . LYS B 1 142 ? 19.096  -61.666 225.671 1.00 17.58  ? 142 LYS B N   1 
ATOM 4091 C CA  . LYS B 1 142 ? 18.198  -61.684 226.822 1.00 17.37  ? 142 LYS B CA  1 
ATOM 4092 C C   . LYS B 1 142 ? 16.749  -61.863 226.389 1.00 16.10  ? 142 LYS B C   1 
ATOM 4093 O O   . LYS B 1 142 ? 16.353  -61.429 225.303 1.00 18.66  ? 142 LYS B O   1 
ATOM 4094 C CB  . LYS B 1 142 ? 18.391  -60.450 227.709 1.00 15.62  ? 142 LYS B CB  1 
ATOM 4095 C CG  . LYS B 1 142 ? 19.713  -60.489 228.452 1.00 15.90  ? 142 LYS B CG  1 
ATOM 4096 C CD  . LYS B 1 142 ? 19.840  -59.329 229.369 1.00 27.32  ? 142 LYS B CD  1 
ATOM 4097 C CE  . LYS B 1 142 ? 21.242  -59.217 229.945 1.00 28.82  ? 142 LYS B CE  1 
ATOM 4098 N NZ  . LYS B 1 142 ? 21.525  -60.197 231.000 1.00 41.23  ? 142 LYS B NZ  1 
ATOM 4099 N N   . VAL B 1 143 ? 15.997  -62.595 227.206 1.00 17.35  ? 143 VAL B N   1 
ATOM 4100 C CA  . VAL B 1 143 ? 14.586  -62.885 226.951 1.00 17.23  ? 143 VAL B CA  1 
ATOM 4101 C C   . VAL B 1 143 ? 13.808  -62.561 228.221 1.00 18.08  ? 143 VAL B C   1 
ATOM 4102 O O   . VAL B 1 143 ? 14.251  -62.878 229.331 1.00 17.54  ? 143 VAL B O   1 
ATOM 4103 C CB  . VAL B 1 143 ? 14.367  -64.370 226.600 1.00 21.94  ? 143 VAL B CB  1 
ATOM 4104 C CG1 . VAL B 1 143 ? 12.914  -64.622 226.268 1.00 21.22  ? 143 VAL B CG1 1 
ATOM 4105 C CG2 . VAL B 1 143 ? 15.240  -64.761 225.419 1.00 17.36  ? 143 VAL B CG2 1 
ATOM 4106 N N   . GLU B 1 144 ? 12.649  -61.936 228.053 1.00 17.52  ? 144 GLU B N   1 
ATOM 4107 C CA  . GLU B 1 144 ? 11.808  -61.538 229.175 1.00 18.56  ? 144 GLU B CA  1 
ATOM 4108 C C   . GLU B 1 144 ? 10.350  -61.781 228.802 1.00 19.76  ? 144 GLU B C   1 
ATOM 4109 O O   . GLU B 1 144 ? 9.882   -61.345 227.741 1.00 18.41  ? 144 GLU B O   1 
ATOM 4110 C CB  . GLU B 1 144 ? 12.030  -60.057 229.440 1.00 21.15  ? 144 GLU B CB  1 
ATOM 4111 C CG  . GLU B 1 144 ? 11.258  -59.504 230.569 1.00 24.11  ? 144 GLU B CG  1 
ATOM 4112 C CD  . GLU B 1 144 ? 11.546  -58.051 230.763 1.00 29.75  ? 144 GLU B CD  1 
ATOM 4113 O OE1 . GLU B 1 144 ? 12.684  -57.722 231.157 1.00 23.68  ? 144 GLU B OE1 1 
ATOM 4114 O OE2 . GLU B 1 144 ? 10.636  -57.234 230.522 1.00 21.30  ? 144 GLU B OE2 1 
ATOM 4115 N N   . PRO B 1 145 ? 9.617   -62.520 229.643 1.00 21.42  ? 145 PRO B N   1 
ATOM 4116 C CA  . PRO B 1 145 ? 8.214   -62.770 229.308 1.00 22.62  ? 145 PRO B CA  1 
ATOM 4117 C C   . PRO B 1 145 ? 7.332   -61.571 229.703 1.00 22.71  ? 145 PRO B C   1 
ATOM 4118 O O   . PRO B 1 145 ? 7.718   -60.790 230.589 1.00 19.92  ? 145 PRO B O   1 
ATOM 4119 C CB  . PRO B 1 145 ? 7.898   -64.003 230.157 1.00 21.12  ? 145 PRO B CB  1 
ATOM 4120 C CG  . PRO B 1 145 ? 8.683   -63.749 231.404 1.00 22.35  ? 145 PRO B CG  1 
ATOM 4121 C CD  . PRO B 1 145 ? 10.003  -63.210 230.891 1.00 22.32  ? 145 PRO B CD  1 
ATOM 4122 N N   . HIS B 1 146 ? 6.206   -61.386 229.006 1.00 21.28  ? 146 HIS B N   1 
ATOM 4123 C CA  . HIS B 1 146 ? 5.247   -60.315 229.339 1.00 24.01  ? 146 HIS B CA  1 
ATOM 4124 C C   . HIS B 1 146 ? 4.380   -60.864 230.472 1.00 22.14  ? 146 HIS B C   1 
ATOM 4125 O O   . HIS B 1 146 ? 3.492   -61.690 230.247 1.00 24.74  ? 146 HIS B O   1 
ATOM 4126 C CB  . HIS B 1 146 ? 4.354   -59.973 228.144 1.00 21.53  ? 146 HIS B CB  1 
ATOM 4127 C CG  . HIS B 1 146 ? 5.031   -59.138 227.107 1.00 27.17  ? 146 HIS B CG  1 
ATOM 4128 N ND1 . HIS B 1 146 ? 4.405   -58.080 226.482 1.00 27.10  ? 146 HIS B ND1 1 
ATOM 4129 C CD2 . HIS B 1 146 ? 6.269   -59.211 226.571 1.00 23.07  ? 146 HIS B CD2 1 
ATOM 4130 C CE1 . HIS B 1 146 ? 5.228   -57.539 225.604 1.00 25.40  ? 146 HIS B CE1 1 
ATOM 4131 N NE2 . HIS B 1 146 ? 6.367   -58.206 225.637 1.00 24.35  ? 146 HIS B NE2 1 
ATOM 4132 N N   . THR B 1 147 ? 4.640   -60.420 231.689 1.00 21.19  ? 147 THR B N   1 
ATOM 4133 C CA  . THR B 1 147 ? 3.913   -60.923 232.838 1.00 22.67  ? 147 THR B CA  1 
ATOM 4134 C C   . THR B 1 147 ? 2.828   -59.987 233.381 1.00 24.68  ? 147 THR B C   1 
ATOM 4135 O O   . THR B 1 147 ? 2.242   -60.263 234.431 1.00 25.91  ? 147 THR B O   1 
ATOM 4136 C CB  . THR B 1 147 ? 4.893   -61.196 233.971 1.00 25.52  ? 147 THR B CB  1 
ATOM 4137 O OG1 . THR B 1 147 ? 5.548   -59.971 234.322 1.00 19.00  ? 147 THR B OG1 1 
ATOM 4138 C CG2 . THR B 1 147 ? 5.944   -62.214 233.540 1.00 24.73  ? 147 THR B CG2 1 
ATOM 4139 N N   . GLY B 1 148 ? 2.555   -58.887 232.684 1.00 22.34  ? 148 GLY B N   1 
ATOM 4140 C CA  . GLY B 1 148 ? 1.563   -57.948 233.174 1.00 19.96  ? 148 GLY B CA  1 
ATOM 4141 C C   . GLY B 1 148 ? 2.122   -57.126 234.328 1.00 22.34  ? 148 GLY B C   1 
ATOM 4142 O O   . GLY B 1 148 ? 1.363   -56.513 235.088 1.00 20.14  ? 148 GLY B O   1 
ATOM 4143 N N   . ASP B 1 149 ? 3.445   -57.146 234.508 1.00 20.90  ? 149 ASP B N   1 
ATOM 4144 C CA  . ASP B 1 149 ? 4.072   -56.343 235.572 1.00 22.67  ? 149 ASP B CA  1 
ATOM 4145 C C   . ASP B 1 149 ? 4.993   -55.347 234.904 1.00 20.20  ? 149 ASP B C   1 
ATOM 4146 O O   . ASP B 1 149 ? 5.810   -55.728 234.068 1.00 20.11  ? 149 ASP B O   1 
ATOM 4147 C CB  . ASP B 1 149 ? 4.937   -57.185 236.508 1.00 24.02  ? 149 ASP B CB  1 
ATOM 4148 C CG  . ASP B 1 149 ? 4.156   -58.232 237.241 1.00 31.30  ? 149 ASP B CG  1 
ATOM 4149 O OD1 . ASP B 1 149 ? 3.377   -57.856 238.137 1.00 28.78  ? 149 ASP B OD1 1 
ATOM 4150 O OD2 . ASP B 1 149 ? 4.333   -59.429 236.924 1.00 35.20  ? 149 ASP B OD2 1 
ATOM 4151 N N   . TYR B 1 150 ? 4.866   -54.080 235.265 1.00 18.43  ? 150 TYR B N   1 
ATOM 4152 C CA  . TYR B 1 150 ? 5.729   -53.075 234.697 1.00 17.39  ? 150 TYR B CA  1 
ATOM 4153 C C   . TYR B 1 150 ? 6.936   -52.860 235.612 1.00 20.16  ? 150 TYR B C   1 
ATOM 4154 O O   . TYR B 1 150 ? 6.805   -52.654 236.828 1.00 20.22  ? 150 TYR B O   1 
ATOM 4155 C CB  . TYR B 1 150 ? 4.984   -51.762 234.456 1.00 16.73  ? 150 TYR B CB  1 
ATOM 4156 C CG  . TYR B 1 150 ? 5.866   -50.787 233.717 1.00 19.62  ? 150 TYR B CG  1 
ATOM 4157 C CD1 . TYR B 1 150 ? 6.015   -50.875 232.329 1.00 17.46  ? 150 TYR B CD1 1 
ATOM 4158 C CD2 . TYR B 1 150 ? 6.677   -49.883 234.418 1.00 17.08  ? 150 TYR B CD2 1 
ATOM 4159 C CE1 . TYR B 1 150 ? 6.962   -50.111 231.666 1.00 25.17  ? 150 TYR B CE1 1 
ATOM 4160 C CE2 . TYR B 1 150 ? 7.625   -49.115 233.762 1.00 19.00  ? 150 TYR B CE2 1 
ATOM 4161 C CZ  . TYR B 1 150 ? 7.770   -49.242 232.397 1.00 24.61  ? 150 TYR B CZ  1 
ATOM 4162 O OH  . TYR B 1 150 ? 8.784   -48.562 231.785 1.00 33.00  ? 150 TYR B OH  1 
ATOM 4163 N N   . VAL B 1 151 ? 8.111   -52.900 235.000 1.00 19.08  ? 151 VAL B N   1 
ATOM 4164 C CA  . VAL B 1 151 ? 9.381   -52.734 235.689 1.00 20.29  ? 151 VAL B CA  1 
ATOM 4165 C C   . VAL B 1 151 ? 10.175  -51.633 234.979 1.00 19.98  ? 151 VAL B C   1 
ATOM 4166 O O   . VAL B 1 151 ? 10.298  -51.633 233.752 1.00 20.00  ? 151 VAL B O   1 
ATOM 4167 C CB  . VAL B 1 151 ? 10.177  -54.066 235.654 1.00 24.39  ? 151 VAL B CB  1 
ATOM 4168 C CG1 . VAL B 1 151 ? 11.582  -53.885 236.218 1.00 24.13  ? 151 VAL B CG1 1 
ATOM 4169 C CG2 . VAL B 1 151 ? 9.424   -55.130 236.450 1.00 23.62  ? 151 VAL B CG2 1 
ATOM 4170 N N   . ALA B 1 152 ? 10.671  -50.671 235.746 1.00 17.47  ? 152 ALA B N   1 
ATOM 4171 C CA  . ALA B 1 152 ? 11.446  -49.573 235.193 1.00 20.48  ? 152 ALA B CA  1 
ATOM 4172 C C   . ALA B 1 152 ? 12.835  -50.067 234.783 1.00 23.33  ? 152 ALA B C   1 
ATOM 4173 O O   . ALA B 1 152 ? 13.256  -51.164 235.173 1.00 23.61  ? 152 ALA B O   1 
ATOM 4174 C CB  . ALA B 1 152 ? 11.554  -48.447 236.214 1.00 18.76  ? 152 ALA B CB  1 
ATOM 4175 N N   . ALA B 1 153 ? 13.535  -49.251 233.998 1.00 23.26  ? 153 ALA B N   1 
ATOM 4176 C CA  . ALA B 1 153 ? 14.862  -49.585 233.497 1.00 25.58  ? 153 ALA B CA  1 
ATOM 4177 C C   . ALA B 1 153 ? 15.919  -49.835 234.592 1.00 28.16  ? 153 ALA B C   1 
ATOM 4178 O O   . ALA B 1 153 ? 16.795  -50.683 234.420 1.00 29.90  ? 153 ALA B O   1 
ATOM 4179 C CB  . ALA B 1 153 ? 15.338  -48.511 232.490 1.00 21.57  ? 153 ALA B CB  1 
ATOM 4180 N N   . ASN B 1 154 ? 15.834  -49.124 235.714 1.00 29.37  ? 154 ASN B N   1 
ATOM 4181 C CA  . ASN B 1 154 ? 16.798  -49.322 236.789 1.00 31.21  ? 154 ASN B CA  1 
ATOM 4182 C C   . ASN B 1 154 ? 16.400  -50.482 237.684 1.00 34.97  ? 154 ASN B C   1 
ATOM 4183 O O   . ASN B 1 154 ? 17.079  -50.759 238.660 1.00 37.66  ? 154 ASN B O   1 
ATOM 4184 C CB  . ASN B 1 154 ? 17.016  -48.034 237.623 1.00 29.85  ? 154 ASN B CB  1 
ATOM 4185 C CG  . ASN B 1 154 ? 15.858  -47.715 238.577 1.00 32.26  ? 154 ASN B CG  1 
ATOM 4186 O OD1 . ASN B 1 154 ? 14.706  -48.020 238.274 1.00 37.58  ? 154 ASN B OD1 1 
ATOM 4187 N ND2 . ASN B 1 154 ? 16.168  -47.073 239.712 1.00 33.05  ? 154 ASN B ND2 1 
ATOM 4188 N N   . GLU B 1 155 ? 15.311  -51.173 237.350 1.00 38.12  ? 155 GLU B N   1 
ATOM 4189 C CA  . GLU B 1 155 ? 14.841  -52.298 238.159 1.00 39.45  ? 155 GLU B CA  1 
ATOM 4190 C C   . GLU B 1 155 ? 15.066  -53.610 237.410 1.00 40.50  ? 155 GLU B C   1 
ATOM 4191 O O   . GLU B 1 155 ? 15.239  -53.625 236.190 1.00 40.13  ? 155 GLU B O   1 
ATOM 4192 C CB  . GLU B 1 155 ? 13.360  -52.117 238.517 1.00 45.12  ? 155 GLU B CB  1 
ATOM 4193 C CG  . GLU B 1 155 ? 13.058  -50.923 239.449 1.00 50.77  ? 155 GLU B CG  1 
ATOM 4194 C CD  . GLU B 1 155 ? 11.576  -50.443 239.421 1.00 58.94  ? 155 GLU B CD  1 
ATOM 4195 O OE1 . GLU B 1 155 ? 10.679  -51.176 238.925 1.00 50.42  ? 155 GLU B OE1 1 
ATOM 4196 O OE2 . GLU B 1 155 ? 11.310  -49.306 239.897 1.00 58.12  ? 155 GLU B OE2 1 
ATOM 4197 N N   . THR B 1 156 ? 15.062  -54.716 238.143 1.00 42.33  ? 156 THR B N   1 
ATOM 4198 C CA  . THR B 1 156 ? 15.289  -56.032 237.535 1.00 44.00  ? 156 THR B CA  1 
ATOM 4199 C C   . THR B 1 156 ? 14.032  -56.901 237.482 1.00 38.73  ? 156 THR B C   1 
ATOM 4200 O O   . THR B 1 156 ? 13.352  -57.095 238.499 1.00 39.77  ? 156 THR B O   1 
ATOM 4201 C CB  . THR B 1 156 ? 16.442  -56.802 238.258 1.00 54.34  ? 156 THR B CB  1 
ATOM 4202 O OG1 . THR B 1 156 ? 16.224  -56.788 239.683 1.00 55.41  ? 156 THR B OG1 1 
ATOM 4203 C CG2 . THR B 1 156 ? 17.811  -56.167 237.921 1.00 52.70  ? 156 THR B CG2 1 
ATOM 4204 N N   . HIS B 1 157 ? 13.690  -57.355 236.277 1.00 35.05  ? 157 HIS B N   1 
ATOM 4205 C CA  . HIS B 1 157 ? 12.510  -58.198 236.070 1.00 32.42  ? 157 HIS B CA  1 
ATOM 4206 C C   . HIS B 1 157 ? 12.877  -59.631 236.454 1.00 32.29  ? 157 HIS B C   1 
ATOM 4207 O O   . HIS B 1 157 ? 13.696  -60.256 235.782 1.00 31.47  ? 157 HIS B O   1 
ATOM 4208 C CB  . HIS B 1 157 ? 12.072  -58.139 234.600 1.00 32.29  ? 157 HIS B CB  1 
ATOM 4209 C CG  . HIS B 1 157 ? 10.755  -58.800 234.335 1.00 27.71  ? 157 HIS B CG  1 
ATOM 4210 N ND1 . HIS B 1 157 ? 10.549  -60.151 234.515 1.00 31.12  ? 157 HIS B ND1 1 
ATOM 4211 C CD2 . HIS B 1 157 ? 9.566   -58.290 233.935 1.00 29.47  ? 157 HIS B CD2 1 
ATOM 4212 C CE1 . HIS B 1 157 ? 9.287   -60.444 234.250 1.00 31.40  ? 157 HIS B CE1 1 
ATOM 4213 N NE2 . HIS B 1 157 ? 8.670   -59.332 233.895 1.00 30.69  ? 157 HIS B NE2 1 
ATOM 4214 N N   . SER B 1 158 ? 12.223  -60.172 237.477 1.00 31.14  ? 158 SER B N   1 
ATOM 4215 C CA  . SER B 1 158 ? 12.531  -61.518 237.961 1.00 30.42  ? 158 SER B CA  1 
ATOM 4216 C C   . SER B 1 158 ? 12.433  -62.644 236.926 1.00 29.01  ? 158 SER B C   1 
ATOM 4217 O O   . SER B 1 158 ? 13.042  -63.698 237.101 1.00 30.97  ? 158 SER B O   1 
ATOM 4218 C CB  . SER B 1 158 ? 11.684  -61.850 239.195 1.00 29.50  ? 158 SER B CB  1 
ATOM 4219 O OG  . SER B 1 158 ? 10.300  -61.726 238.902 1.00 38.56  ? 158 SER B OG  1 
ATOM 4220 N N   . GLY B 1 159 ? 11.690  -62.413 235.849 1.00 24.89  ? 159 GLY B N   1 
ATOM 4221 C CA  . GLY B 1 159 ? 11.542  -63.433 234.824 1.00 23.79  ? 159 GLY B CA  1 
ATOM 4222 C C   . GLY B 1 159 ? 12.508  -63.368 233.656 1.00 23.46  ? 159 GLY B C   1 
ATOM 4223 O O   . GLY B 1 159 ? 12.406  -64.167 232.738 1.00 21.75  ? 159 GLY B O   1 
ATOM 4224 N N   . ARG B 1 160 ? 13.437  -62.419 233.683 1.00 22.76  ? 160 ARG B N   1 
ATOM 4225 C CA  . ARG B 1 160 ? 14.405  -62.255 232.596 1.00 24.39  ? 160 ARG B CA  1 
ATOM 4226 C C   . ARG B 1 160 ? 15.495  -63.347 232.603 1.00 24.26  ? 160 ARG B C   1 
ATOM 4227 O O   . ARG B 1 160 ? 16.091  -63.632 233.648 1.00 25.12  ? 160 ARG B O   1 
ATOM 4228 C CB  . ARG B 1 160 ? 15.050  -60.867 232.687 1.00 22.10  ? 160 ARG B CB  1 
ATOM 4229 C CG  . ARG B 1 160 ? 15.924  -60.493 231.503 1.00 23.40  ? 160 ARG B CG  1 
ATOM 4230 C CD  . ARG B 1 160 ? 16.464  -59.083 231.659 1.00 20.91  ? 160 ARG B CD  1 
ATOM 4231 N NE  . ARG B 1 160 ? 15.390  -58.093 231.741 1.00 21.97  ? 160 ARG B NE  1 
ATOM 4232 C CZ  . ARG B 1 160 ? 15.559  -56.832 232.129 1.00 23.31  ? 160 ARG B CZ  1 
ATOM 4233 N NH1 . ARG B 1 160 ? 16.766  -56.394 232.472 1.00 18.23  ? 160 ARG B NH1 1 
ATOM 4234 N NH2 . ARG B 1 160 ? 14.512  -56.010 232.194 1.00 23.22  ? 160 ARG B NH2 1 
ATOM 4235 N N   . LYS B 1 161 ? 15.747  -63.939 231.436 1.00 23.49  ? 161 LYS B N   1 
ATOM 4236 C CA  . LYS B 1 161 ? 16.752  -64.999 231.265 1.00 23.67  ? 161 LYS B CA  1 
ATOM 4237 C C   . LYS B 1 161 ? 17.863  -64.548 230.296 1.00 23.91  ? 161 LYS B C   1 
ATOM 4238 O O   . LYS B 1 161 ? 17.626  -63.721 229.405 1.00 20.96  ? 161 LYS B O   1 
ATOM 4239 C CB  . LYS B 1 161 ? 16.087  -66.262 230.704 1.00 26.10  ? 161 LYS B CB  1 
ATOM 4240 C CG  . LYS B 1 161 ? 15.030  -66.877 231.604 1.00 40.06  ? 161 LYS B CG  1 
ATOM 4241 C CD  . LYS B 1 161 ? 15.639  -67.495 232.837 1.00 44.00  ? 161 LYS B CD  1 
ATOM 4242 C CE  . LYS B 1 161 ? 14.563  -68.097 233.703 1.00 55.23  ? 161 LYS B CE  1 
ATOM 4243 N NZ  . LYS B 1 161 ? 15.144  -68.766 234.887 1.00 63.91  ? 161 LYS B NZ  1 
ATOM 4244 N N   . THR B 1 162 ? 19.058  -65.110 230.452 1.00 20.43  ? 162 THR B N   1 
ATOM 4245 C CA  . THR B 1 162 ? 20.185  -64.763 229.603 1.00 21.03  ? 162 THR B CA  1 
ATOM 4246 C C   . THR B 1 162 ? 20.750  -65.992 228.887 1.00 21.41  ? 162 THR B C   1 
ATOM 4247 O O   . THR B 1 162 ? 20.833  -67.073 229.474 1.00 22.58  ? 162 THR B O   1 
ATOM 4248 C CB  . THR B 1 162 ? 21.290  -64.106 230.436 1.00 22.05  ? 162 THR B CB  1 
ATOM 4249 O OG1 . THR B 1 162 ? 20.762  -62.946 231.080 1.00 24.26  ? 162 THR B OG1 1 
ATOM 4250 C CG2 . THR B 1 162 ? 22.460  -63.688 229.561 1.00 23.07  ? 162 THR B CG2 1 
ATOM 4251 N N   . ALA B 1 163 ? 21.083  -65.842 227.610 1.00 18.92  ? 163 ALA B N   1 
ATOM 4252 C CA  . ALA B 1 163 ? 21.657  -66.932 226.826 1.00 20.17  ? 163 ALA B CA  1 
ATOM 4253 C C   . ALA B 1 163 ? 22.939  -66.434 226.134 1.00 21.29  ? 163 ALA B C   1 
ATOM 4254 O O   . ALA B 1 163 ? 22.954  -65.341 225.565 1.00 21.32  ? 163 ALA B O   1 
ATOM 4255 C CB  . ALA B 1 163 ? 20.658  -67.422 225.792 1.00 16.43  ? 163 ALA B CB  1 
ATOM 4256 N N   . SER B 1 164 ? 24.015  -67.212 226.216 1.00 19.79  ? 164 SER B N   1 
ATOM 4257 C CA  . SER B 1 164 ? 25.273  -66.842 225.585 1.00 20.33  ? 164 SER B CA  1 
ATOM 4258 C C   . SER B 1 164 ? 25.553  -67.767 224.429 1.00 18.97  ? 164 SER B C   1 
ATOM 4259 O O   . SER B 1 164 ? 25.262  -68.953 224.496 1.00 20.45  ? 164 SER B O   1 
ATOM 4260 C CB  . SER B 1 164 ? 26.419  -66.879 226.582 1.00 23.89  ? 164 SER B CB  1 
ATOM 4261 O OG  . SER B 1 164 ? 26.457  -65.660 227.309 1.00 38.10  ? 164 SER B OG  1 
ATOM 4262 N N   . PHE B 1 165 ? 26.081  -67.206 223.353 1.00 17.55  ? 165 PHE B N   1 
ATOM 4263 C CA  . PHE B 1 165 ? 26.375  -67.969 222.158 1.00 17.19  ? 165 PHE B CA  1 
ATOM 4264 C C   . PHE B 1 165 ? 27.791  -67.738 221.667 1.00 16.74  ? 165 PHE B C   1 
ATOM 4265 O O   . PHE B 1 165 ? 28.310  -66.627 221.789 1.00 14.40  ? 165 PHE B O   1 
ATOM 4266 C CB  . PHE B 1 165 ? 25.421  -67.561 221.041 1.00 15.43  ? 165 PHE B CB  1 
ATOM 4267 C CG  . PHE B 1 165 ? 23.989  -67.772 221.377 1.00 21.74  ? 165 PHE B CG  1 
ATOM 4268 C CD1 . PHE B 1 165 ? 23.387  -69.012 221.154 1.00 25.52  ? 165 PHE B CD1 1 
ATOM 4269 C CD2 . PHE B 1 165 ? 23.236  -66.748 221.946 1.00 17.98  ? 165 PHE B CD2 1 
ATOM 4270 C CE1 . PHE B 1 165 ? 22.047  -69.233 221.498 1.00 24.23  ? 165 PHE B CE1 1 
ATOM 4271 C CE2 . PHE B 1 165 ? 21.898  -66.959 222.294 1.00 19.03  ? 165 PHE B CE2 1 
ATOM 4272 C CZ  . PHE B 1 165 ? 21.303  -68.204 222.070 1.00 20.24  ? 165 PHE B CZ  1 
ATOM 4273 N N   . THR B 1 166 ? 28.410  -68.812 221.162 1.00 17.35  ? 166 THR B N   1 
ATOM 4274 C CA  . THR B 1 166 ? 29.746  -68.799 220.551 1.00 16.04  ? 166 THR B CA  1 
ATOM 4275 C C   . THR B 1 166 ? 29.526  -69.626 219.274 1.00 18.55  ? 166 THR B C   1 
ATOM 4276 O O   . THR B 1 166 ? 28.498  -70.285 219.137 1.00 16.06  ? 166 THR B O   1 
ATOM 4277 C CB  . THR B 1 166 ? 30.824  -69.469 221.432 1.00 16.09  ? 166 THR B CB  1 
ATOM 4278 O OG1 . THR B 1 166 ? 30.420  -70.804 221.763 1.00 21.94  ? 166 THR B OG1 1 
ATOM 4279 C CG2 . THR B 1 166 ? 31.045  -68.679 222.716 1.00 19.61  ? 166 THR B CG2 1 
ATOM 4280 N N   . ILE B 1 167 ? 30.441  -69.560 218.321 1.00 19.67  ? 167 ILE B N   1 
ATOM 4281 C CA  . ILE B 1 167 ? 30.294  -70.315 217.089 1.00 22.79  ? 167 ILE B CA  1 
ATOM 4282 C C   . ILE B 1 167 ? 30.142  -71.821 217.344 1.00 22.52  ? 167 ILE B C   1 
ATOM 4283 O O   . ILE B 1 167 ? 29.415  -72.505 216.631 1.00 25.86  ? 167 ILE B O   1 
ATOM 4284 C CB  . ILE B 1 167 ? 31.497  -70.036 216.133 1.00 29.41  ? 167 ILE B CB  1 
ATOM 4285 C CG1 . ILE B 1 167 ? 31.158  -68.881 215.194 1.00 29.88  ? 167 ILE B CG1 1 
ATOM 4286 C CG2 . ILE B 1 167 ? 31.867  -71.264 215.313 1.00 35.71  ? 167 ILE B CG2 1 
ATOM 4287 C CD1 . ILE B 1 167 ? 32.219  -68.627 214.137 1.00 31.05  ? 167 ILE B CD1 1 
ATOM 4288 N N   . SER B 1 168 ? 30.800  -72.340 218.367 1.00 22.01  ? 168 SER B N   1 
ATOM 4289 C CA  . SER B 1 168 ? 30.707  -73.771 218.640 1.00 24.82  ? 168 SER B CA  1 
ATOM 4290 C C   . SER B 1 168 ? 29.505  -74.185 219.499 1.00 26.88  ? 168 SER B C   1 
ATOM 4291 O O   . SER B 1 168 ? 29.320  -75.379 219.760 1.00 28.90  ? 168 SER B O   1 
ATOM 4292 C CB  . SER B 1 168 ? 31.998  -74.267 219.290 1.00 28.46  ? 168 SER B CB  1 
ATOM 4293 O OG  . SER B 1 168 ? 32.209  -73.650 220.551 1.00 40.79  ? 168 SER B OG  1 
ATOM 4294 N N   . SER B 1 169 ? 28.698  -73.215 219.938 1.00 24.25  ? 169 SER B N   1 
ATOM 4295 C CA  . SER B 1 169 ? 27.529  -73.493 220.779 1.00 21.99  ? 169 SER B CA  1 
ATOM 4296 C C   . SER B 1 169 ? 26.425  -72.513 220.384 1.00 19.96  ? 169 SER B C   1 
ATOM 4297 O O   . SER B 1 169 ? 26.223  -71.477 221.018 1.00 21.75  ? 169 SER B O   1 
ATOM 4298 C CB  . SER B 1 169 ? 27.913  -73.340 222.250 1.00 21.51  ? 169 SER B CB  1 
ATOM 4299 O OG  . SER B 1 169 ? 26.867  -73.782 223.090 1.00 31.34  ? 169 SER B OG  1 
ATOM 4300 N N   . GLU B 1 170 ? 25.715  -72.859 219.322 1.00 18.58  ? 170 GLU B N   1 
ATOM 4301 C CA  . GLU B 1 170 ? 24.672  -72.017 218.757 1.00 23.07  ? 170 GLU B CA  1 
ATOM 4302 C C   . GLU B 1 170 ? 23.238  -72.172 219.251 1.00 23.76  ? 170 GLU B C   1 
ATOM 4303 O O   . GLU B 1 170 ? 22.368  -71.387 218.869 1.00 25.30  ? 170 GLU B O   1 
ATOM 4304 C CB  . GLU B 1 170 ? 24.651  -72.236 217.258 1.00 29.62  ? 170 GLU B CB  1 
ATOM 4305 C CG  . GLU B 1 170 ? 24.258  -73.674 216.899 1.00 36.59  ? 170 GLU B CG  1 
ATOM 4306 C CD  . GLU B 1 170 ? 24.410  -73.989 215.419 1.00 44.39  ? 170 GLU B CD  1 
ATOM 4307 O OE1 . GLU B 1 170 ? 25.043  -73.181 214.693 1.00 45.20  ? 170 GLU B OE1 1 
ATOM 4308 O OE2 . GLU B 1 170 ? 23.895  -75.053 214.992 1.00 45.95  ? 170 GLU B OE2 1 
ATOM 4309 N N   . LYS B 1 171 ? 22.957  -73.213 220.019 1.00 23.40  ? 171 LYS B N   1 
ATOM 4310 C CA  . LYS B 1 171 ? 21.599  -73.413 220.487 1.00 21.88  ? 171 LYS B CA  1 
ATOM 4311 C C   . LYS B 1 171 ? 21.498  -73.516 222.003 1.00 23.45  ? 171 LYS B C   1 
ATOM 4312 O O   . LYS B 1 171 ? 22.353  -74.132 222.654 1.00 23.00  ? 171 LYS B O   1 
ATOM 4313 C CB  . LYS B 1 171 ? 21.007  -74.650 219.822 1.00 23.34  ? 171 LYS B CB  1 
ATOM 4314 C CG  . LYS B 1 171 ? 19.504  -74.777 219.968 1.00 27.40  ? 171 LYS B CG  1 
ATOM 4315 C CD  . LYS B 1 171 ? 19.001  -75.928 219.133 1.00 35.13  ? 171 LYS B CD  1 
ATOM 4316 C CE  . LYS B 1 171 ? 17.493  -76.065 219.227 1.00 43.88  ? 171 LYS B CE  1 
ATOM 4317 N NZ  . LYS B 1 171 ? 16.997  -77.309 218.560 1.00 44.72  ? 171 LYS B NZ  1 
ATOM 4318 N N   . THR B 1 172 ? 20.482  -72.855 222.556 1.00 21.06  ? 172 THR B N   1 
ATOM 4319 C CA  . THR B 1 172 ? 20.212  -72.854 223.996 1.00 24.51  ? 172 THR B CA  1 
ATOM 4320 C C   . THR B 1 172 ? 18.698  -73.042 224.205 1.00 24.81  ? 172 THR B C   1 
ATOM 4321 O O   . THR B 1 172 ? 17.902  -72.577 223.385 1.00 22.44  ? 172 THR B O   1 
ATOM 4322 C CB  . THR B 1 172 ? 20.619  -71.499 224.659 1.00 28.55  ? 172 THR B CB  1 
ATOM 4323 O OG1 . THR B 1 172 ? 22.040  -71.325 224.600 1.00 40.10  ? 172 THR B OG1 1 
ATOM 4324 C CG2 . THR B 1 172 ? 20.205  -71.473 226.115 1.00 39.40  ? 172 THR B CG2 1 
ATOM 4325 N N   . ILE B 1 173 ? 18.318  -73.776 225.253 1.00 23.75  ? 173 ILE B N   1 
ATOM 4326 C CA  . ILE B 1 173 ? 16.913  -73.991 225.605 1.00 25.56  ? 173 ILE B CA  1 
ATOM 4327 C C   . ILE B 1 173 ? 16.770  -73.262 226.948 1.00 27.14  ? 173 ILE B C   1 
ATOM 4328 O O   . ILE B 1 173 ? 17.506  -73.575 227.891 1.00 26.82  ? 173 ILE B O   1 
ATOM 4329 C CB  . ILE B 1 173 ? 16.583  -75.488 225.890 1.00 29.29  ? 173 ILE B CB  1 
ATOM 4330 C CG1 . ILE B 1 173 ? 17.061  -76.411 224.764 1.00 29.24  ? 173 ILE B CG1 1 
ATOM 4331 C CG2 . ILE B 1 173 ? 15.084  -75.652 226.116 1.00 26.46  ? 173 ILE B CG2 1 
ATOM 4332 C CD1 . ILE B 1 173 ? 16.210  -76.386 223.546 1.00 28.26  ? 173 ILE B CD1 1 
ATOM 4333 N N   . LEU B 1 174 ? 15.889  -72.268 227.037 1.00 25.54  ? 174 LEU B N   1 
ATOM 4334 C CA  . LEU B 1 174 ? 15.700  -71.541 228.295 1.00 25.02  ? 174 LEU B CA  1 
ATOM 4335 C C   . LEU B 1 174 ? 14.350  -71.882 228.907 1.00 25.32  ? 174 LEU B C   1 
ATOM 4336 O O   . LEU B 1 174 ? 13.364  -72.068 228.195 1.00 26.50  ? 174 LEU B O   1 
ATOM 4337 C CB  . LEU B 1 174 ? 15.755  -70.025 228.067 1.00 27.49  ? 174 LEU B CB  1 
ATOM 4338 C CG  . LEU B 1 174 ? 17.044  -69.347 227.600 1.00 28.60  ? 174 LEU B CG  1 
ATOM 4339 C CD1 . LEU B 1 174 ? 16.743  -67.918 227.191 1.00 26.22  ? 174 LEU B CD1 1 
ATOM 4340 C CD2 . LEU B 1 174 ? 18.094  -69.385 228.697 1.00 29.64  ? 174 LEU B CD2 1 
ATOM 4341 N N   . THR B 1 175 ? 14.317  -72.005 230.224 1.00 23.34  ? 175 THR B N   1 
ATOM 4342 C CA  . THR B 1 175 ? 13.065  -72.274 230.915 1.00 26.03  ? 175 THR B CA  1 
ATOM 4343 C C   . THR B 1 175 ? 12.537  -70.916 231.406 1.00 24.57  ? 175 THR B C   1 
ATOM 4344 O O   . THR B 1 175 ? 13.152  -70.270 232.269 1.00 25.21  ? 175 THR B O   1 
ATOM 4345 C CB  . THR B 1 175 ? 13.261  -73.275 232.103 1.00 28.02  ? 175 THR B CB  1 
ATOM 4346 O OG1 . THR B 1 175 ? 13.567  -74.576 231.584 1.00 24.65  ? 175 THR B OG1 1 
ATOM 4347 C CG2 . THR B 1 175 ? 11.981  -73.395 232.934 1.00 25.55  ? 175 THR B CG2 1 
ATOM 4348 N N   . MET B 1 176 ? 11.450  -70.450 230.796 1.00 22.79  ? 176 MET B N   1 
ATOM 4349 C CA  . MET B 1 176 ? 10.851  -69.161 231.157 1.00 24.87  ? 176 MET B CA  1 
ATOM 4350 C C   . MET B 1 176 ? 9.858   -69.296 232.327 1.00 25.70  ? 176 MET B C   1 
ATOM 4351 O O   . MET B 1 176 ? 8.659   -69.048 232.171 1.00 24.21  ? 176 MET B O   1 
ATOM 4352 C CB  . MET B 1 176 ? 10.144  -68.551 229.942 1.00 23.28  ? 176 MET B CB  1 
ATOM 4353 C CG  . MET B 1 176 ? 11.056  -68.368 228.727 1.00 26.95  ? 176 MET B CG  1 
ATOM 4354 S SD  . MET B 1 176 ? 12.612  -67.507 229.120 1.00 27.45  ? 176 MET B SD  1 
ATOM 4355 C CE  . MET B 1 176 ? 12.019  -65.945 229.757 1.00 22.04  ? 176 MET B CE  1 
ATOM 4356 N N   . GLY B 1 177 ? 10.365  -69.690 233.495 1.00 26.14  ? 177 GLY B N   1 
ATOM 4357 C CA  . GLY B 1 177 ? 9.518   -69.870 234.669 1.00 28.77  ? 177 GLY B CA  1 
ATOM 4358 C C   . GLY B 1 177 ? 8.370   -70.828 234.391 1.00 31.25  ? 177 GLY B C   1 
ATOM 4359 O O   . GLY B 1 177 ? 8.585   -71.937 233.893 1.00 32.41  ? 177 GLY B O   1 
ATOM 4360 N N   . GLU B 1 178 ? 7.143   -70.396 234.656 1.00 30.56  ? 178 GLU B N   1 
ATOM 4361 C CA  . GLU B 1 178 ? 5.983   -71.243 234.406 1.00 32.47  ? 178 GLU B CA  1 
ATOM 4362 C C   . GLU B 1 178 ? 5.429   -71.146 232.984 1.00 29.86  ? 178 GLU B C   1 
ATOM 4363 O O   . GLU B 1 178 ? 4.478   -71.841 232.641 1.00 28.86  ? 178 GLU B O   1 
ATOM 4364 C CB  . GLU B 1 178 ? 4.892   -70.941 235.437 1.00 41.68  ? 178 GLU B CB  1 
ATOM 4365 C CG  . GLU B 1 178 ? 5.308   -71.242 236.894 1.00 58.70  ? 178 GLU B CG  1 
ATOM 4366 C CD  . GLU B 1 178 ? 4.417   -70.539 237.923 1.00 73.33  ? 178 GLU B CD  1 
ATOM 4367 O OE1 . GLU B 1 178 ? 4.523   -69.296 238.059 1.00 78.14  ? 178 GLU B OE1 1 
ATOM 4368 O OE2 . GLU B 1 178 ? 3.616   -71.228 238.599 1.00 79.01  ? 178 GLU B OE2 1 
ATOM 4369 N N   . TYR B 1 179 ? 6.047   -70.316 232.148 1.00 29.75  ? 179 TYR B N   1 
ATOM 4370 C CA  . TYR B 1 179 ? 5.608   -70.179 230.758 1.00 28.58  ? 179 TYR B CA  1 
ATOM 4371 C C   . TYR B 1 179 ? 6.110   -71.267 229.813 1.00 29.89  ? 179 TYR B C   1 
ATOM 4372 O O   . TYR B 1 179 ? 5.761   -71.285 228.628 1.00 32.56  ? 179 TYR B O   1 
ATOM 4373 C CB  . TYR B 1 179 ? 6.000   -68.798 230.220 1.00 27.17  ? 179 TYR B CB  1 
ATOM 4374 C CG  . TYR B 1 179 ? 5.343   -67.652 230.926 1.00 23.23  ? 179 TYR B CG  1 
ATOM 4375 C CD1 . TYR B 1 179 ? 4.079   -67.214 230.538 1.00 25.49  ? 179 TYR B CD1 1 
ATOM 4376 C CD2 . TYR B 1 179 ? 5.962   -67.024 232.013 1.00 21.56  ? 179 TYR B CD2 1 
ATOM 4377 C CE1 . TYR B 1 179 ? 3.434   -66.171 231.223 1.00 24.09  ? 179 TYR B CE1 1 
ATOM 4378 C CE2 . TYR B 1 179 ? 5.317   -65.983 232.704 1.00 26.52  ? 179 TYR B CE2 1 
ATOM 4379 C CZ  . TYR B 1 179 ? 4.053   -65.567 232.302 1.00 20.83  ? 179 TYR B CZ  1 
ATOM 4380 O OH  . TYR B 1 179 ? 3.401   -64.566 232.992 1.00 27.71  ? 179 TYR B OH  1 
ATOM 4381 N N   . GLY B 1 180 ? 6.962   -72.155 230.311 1.00 27.07  ? 180 GLY B N   1 
ATOM 4382 C CA  . GLY B 1 180 ? 7.484   -73.204 229.456 1.00 26.73  ? 180 GLY B CA  1 
ATOM 4383 C C   . GLY B 1 180 ? 8.898   -72.936 228.963 1.00 24.54  ? 180 GLY B C   1 
ATOM 4384 O O   . GLY B 1 180 ? 9.595   -72.034 229.442 1.00 23.02  ? 180 GLY B O   1 
ATOM 4385 N N   . ASP B 1 181 ? 9.335   -73.737 228.008 1.00 24.65  ? 181 ASP B N   1 
ATOM 4386 C CA  . ASP B 1 181 ? 10.681  -73.601 227.481 1.00 25.23  ? 181 ASP B CA  1 
ATOM 4387 C C   . ASP B 1 181 ? 10.682  -72.916 226.128 1.00 25.41  ? 181 ASP B C   1 
ATOM 4388 O O   . ASP B 1 181 ? 9.749   -73.090 225.350 1.00 26.69  ? 181 ASP B O   1 
ATOM 4389 C CB  . ASP B 1 181 ? 11.333  -74.983 227.350 1.00 22.52  ? 181 ASP B CB  1 
ATOM 4390 C CG  . ASP B 1 181 ? 11.787  -75.556 228.683 1.00 27.60  ? 181 ASP B CG  1 
ATOM 4391 O OD1 . ASP B 1 181 ? 11.643  -74.896 229.735 1.00 27.37  ? 181 ASP B OD1 1 
ATOM 4392 O OD2 . ASP B 1 181 ? 12.323  -76.677 228.675 1.00 33.21  ? 181 ASP B OD2 1 
ATOM 4393 N N   . VAL B 1 182 ? 11.712  -72.109 225.874 1.00 25.13  ? 182 VAL B N   1 
ATOM 4394 C CA  . VAL B 1 182 ? 11.871  -71.418 224.599 1.00 24.32  ? 182 VAL B CA  1 
ATOM 4395 C C   . VAL B 1 182 ? 13.263  -71.828 224.056 1.00 23.85  ? 182 VAL B C   1 
ATOM 4396 O O   . VAL B 1 182 ? 14.216  -71.985 224.830 1.00 22.61  ? 182 VAL B O   1 
ATOM 4397 C CB  . VAL B 1 182 ? 11.754  -69.851 224.751 1.00 26.14  ? 182 VAL B CB  1 
ATOM 4398 C CG1 . VAL B 1 182 ? 12.848  -69.307 225.635 1.00 23.09  ? 182 VAL B CG1 1 
ATOM 4399 C CG2 . VAL B 1 182 ? 11.807  -69.183 223.392 1.00 25.95  ? 182 VAL B CG2 1 
ATOM 4400 N N   . SER B 1 183 ? 13.365  -72.104 222.760 1.00 23.62  ? 183 SER B N   1 
ATOM 4401 C CA  . SER B 1 183 ? 14.661  -72.475 222.200 1.00 25.11  ? 183 SER B CA  1 
ATOM 4402 C C   . SER B 1 183 ? 15.207  -71.318 221.381 1.00 24.96  ? 183 SER B C   1 
ATOM 4403 O O   . SER B 1 183 ? 14.449  -70.646 220.677 1.00 24.76  ? 183 SER B O   1 
ATOM 4404 C CB  . SER B 1 183 ? 14.568  -73.723 221.324 1.00 21.39  ? 183 SER B CB  1 
ATOM 4405 O OG  . SER B 1 183 ? 13.822  -73.473 220.145 1.00 27.56  ? 183 SER B OG  1 
ATOM 4406 N N   . LEU B 1 184 ? 16.508  -71.072 221.514 1.00 24.26  ? 184 LEU B N   1 
ATOM 4407 C CA  . LEU B 1 184 ? 17.186  -70.005 220.796 1.00 24.25  ? 184 LEU B CA  1 
ATOM 4408 C C   . LEU B 1 184 ? 18.358  -70.542 220.008 1.00 23.70  ? 184 LEU B C   1 
ATOM 4409 O O   . LEU B 1 184 ? 19.268  -71.147 220.579 1.00 24.44  ? 184 LEU B O   1 
ATOM 4410 C CB  . LEU B 1 184 ? 17.736  -68.960 221.766 1.00 27.06  ? 184 LEU B CB  1 
ATOM 4411 C CG  . LEU B 1 184 ? 16.805  -67.891 222.290 1.00 29.26  ? 184 LEU B CG  1 
ATOM 4412 C CD1 . LEU B 1 184 ? 17.545  -67.059 223.312 1.00 35.30  ? 184 LEU B CD1 1 
ATOM 4413 C CD2 . LEU B 1 184 ? 16.356  -67.044 221.128 1.00 28.20  ? 184 LEU B CD2 1 
ATOM 4414 N N   . LEU B 1 185 ? 18.331  -70.328 218.700 1.00 20.67  ? 185 LEU B N   1 
ATOM 4415 C CA  . LEU B 1 185 ? 19.427  -70.739 217.848 1.00 20.87  ? 185 LEU B CA  1 
ATOM 4416 C C   . LEU B 1 185 ? 19.941  -69.455 217.205 1.00 21.01  ? 185 LEU B C   1 
ATOM 4417 O O   . LEU B 1 185 ? 19.302  -68.893 216.321 1.00 22.91  ? 185 LEU B O   1 
ATOM 4418 C CB  . LEU B 1 185 ? 18.955  -71.718 216.774 1.00 24.62  ? 185 LEU B CB  1 
ATOM 4419 C CG  . LEU B 1 185 ? 20.045  -72.595 216.142 1.00 32.07  ? 185 LEU B CG  1 
ATOM 4420 C CD1 . LEU B 1 185 ? 19.382  -73.569 215.193 1.00 33.49  ? 185 LEU B CD1 1 
ATOM 4421 C CD2 . LEU B 1 185 ? 21.079  -71.770 215.403 1.00 27.11  ? 185 LEU B CD2 1 
ATOM 4422 N N   . CYS B 1 186 ? 21.079  -68.973 217.682 1.00 20.82  ? 186 CYS B N   1 
ATOM 4423 C CA  . CYS B 1 186 ? 21.674  -67.769 217.143 1.00 21.01  ? 186 CYS B CA  1 
ATOM 4424 C C   . CYS B 1 186 ? 22.994  -68.128 216.484 1.00 23.13  ? 186 CYS B C   1 
ATOM 4425 O O   . CYS B 1 186 ? 23.844  -68.762 217.101 1.00 23.82  ? 186 CYS B O   1 
ATOM 4426 C CB  . CYS B 1 186 ? 21.915  -66.776 218.264 1.00 22.41  ? 186 CYS B CB  1 
ATOM 4427 S SG  . CYS B 1 186 ? 20.397  -66.309 219.145 1.00 24.93  ? 186 CYS B SG  1 
ATOM 4428 N N   . ARG B 1 187 ? 23.187  -67.716 215.239 1.00 25.45  ? 187 ARG B N   1 
ATOM 4429 C CA  . ARG B 1 187 ? 24.433  -68.035 214.554 1.00 29.34  ? 187 ARG B CA  1 
ATOM 4430 C C   . ARG B 1 187 ? 25.424  -66.885 214.530 1.00 27.07  ? 187 ARG B C   1 
ATOM 4431 O O   . ARG B 1 187 ? 25.226  -65.893 213.833 1.00 26.56  ? 187 ARG B O   1 
ATOM 4432 C CB  . ARG B 1 187 ? 24.162  -68.538 213.136 1.00 34.50  ? 187 ARG B CB  1 
ATOM 4433 C CG  . ARG B 1 187 ? 23.490  -69.894 213.112 1.00 45.65  ? 187 ARG B CG  1 
ATOM 4434 C CD  . ARG B 1 187 ? 23.363  -70.448 211.699 1.00 50.34  ? 187 ARG B CD  1 
ATOM 4435 N NE  . ARG B 1 187 ? 22.591  -71.687 211.673 1.00 49.43  ? 187 ARG B NE  1 
ATOM 4436 C CZ  . ARG B 1 187 ? 21.263  -71.738 211.718 1.00 53.93  ? 187 ARG B CZ  1 
ATOM 4437 N NH1 . ARG B 1 187 ? 20.553  -70.614 211.785 1.00 46.30  ? 187 ARG B NH1 1 
ATOM 4438 N NH2 . ARG B 1 187 ? 20.647  -72.914 211.731 1.00 53.82  ? 187 ARG B NH2 1 
ATOM 4439 N N   . VAL B 1 188 ? 26.497  -67.032 215.296 1.00 28.19  ? 188 VAL B N   1 
ATOM 4440 C CA  . VAL B 1 188 ? 27.550  -66.018 215.383 1.00 30.94  ? 188 VAL B CA  1 
ATOM 4441 C C   . VAL B 1 188 ? 28.152  -65.733 213.986 1.00 30.53  ? 188 VAL B C   1 
ATOM 4442 O O   . VAL B 1 188 ? 28.542  -64.599 213.694 1.00 32.06  ? 188 VAL B O   1 
ATOM 4443 C CB  . VAL B 1 188 ? 28.634  -66.454 216.441 1.00 33.00  ? 188 VAL B CB  1 
ATOM 4444 C CG1 . VAL B 1 188 ? 29.905  -65.593 216.345 1.00 36.22  ? 188 VAL B CG1 1 
ATOM 4445 C CG2 . VAL B 1 188 ? 28.039  -66.362 217.853 1.00 33.14  ? 188 VAL B CG2 1 
ATOM 4446 N N   . ALA B 1 189 ? 28.156  -66.742 213.112 1.00 31.02  ? 189 ALA B N   1 
ATOM 4447 C CA  . ALA B 1 189 ? 28.674  -66.603 211.740 1.00 32.12  ? 189 ALA B CA  1 
ATOM 4448 C C   . ALA B 1 189 ? 27.850  -65.591 210.923 1.00 32.79  ? 189 ALA B C   1 
ATOM 4449 O O   . ALA B 1 189 ? 28.315  -65.048 209.915 1.00 33.14  ? 189 ALA B O   1 
ATOM 4450 C CB  . ALA B 1 189 ? 28.678  -67.967 211.041 1.00 33.03  ? 189 ALA B CB  1 
ATOM 4451 N N   . SER B 1 190 ? 26.615  -65.359 211.359 1.00 33.15  ? 190 SER B N   1 
ATOM 4452 C CA  . SER B 1 190 ? 25.716  -64.410 210.702 1.00 33.51  ? 190 SER B CA  1 
ATOM 4453 C C   . SER B 1 190 ? 25.956  -63.011 211.253 1.00 34.61  ? 190 SER B C   1 
ATOM 4454 O O   . SER B 1 190 ? 25.296  -62.050 210.836 1.00 34.91  ? 190 SER B O   1 
ATOM 4455 C CB  . SER B 1 190 ? 24.242  -64.796 210.957 1.00 36.03  ? 190 SER B CB  1 
ATOM 4456 O OG  . SER B 1 190 ? 23.777  -64.362 212.234 1.00 26.68  ? 190 SER B OG  1 
ATOM 4457 N N   . GLY B 1 191 ? 26.847  -62.919 212.239 1.00 34.79  ? 191 GLY B N   1 
ATOM 4458 C CA  . GLY B 1 191 ? 27.141  -61.646 212.864 1.00 35.73  ? 191 GLY B CA  1 
ATOM 4459 C C   . GLY B 1 191 ? 28.068  -60.747 212.070 1.00 37.29  ? 191 GLY B C   1 
ATOM 4460 O O   . GLY B 1 191 ? 28.284  -60.923 210.868 1.00 35.11  ? 191 GLY B O   1 
ATOM 4461 N N   . VAL B 1 192 ? 28.648  -59.796 212.787 1.00 40.74  ? 192 VAL B N   1 
ATOM 4462 C CA  . VAL B 1 192 ? 29.568  -58.804 212.245 1.00 43.41  ? 192 VAL B CA  1 
ATOM 4463 C C   . VAL B 1 192 ? 30.889  -59.428 211.780 1.00 41.73  ? 192 VAL B C   1 
ATOM 4464 O O   . VAL B 1 192 ? 31.455  -60.254 212.502 1.00 39.41  ? 192 VAL B O   1 
ATOM 4465 C CB  . VAL B 1 192 ? 29.894  -57.776 213.358 1.00 50.63  ? 192 VAL B CB  1 
ATOM 4466 C CG1 . VAL B 1 192 ? 30.851  -56.712 212.854 1.00 58.29  ? 192 VAL B CG1 1 
ATOM 4467 C CG2 . VAL B 1 192 ? 28.602  -57.166 213.902 1.00 52.24  ? 192 VAL B CG2 1 
ATOM 4468 N N   . ASP B 1 193 ? 31.355  -59.096 210.568 1.00 42.06  ? 193 ASP B N   1 
ATOM 4469 C CA  . ASP B 1 193 ? 32.656  -59.622 210.125 1.00 42.76  ? 193 ASP B CA  1 
ATOM 4470 C C   . ASP B 1 193 ? 33.707  -58.751 210.816 1.00 40.23  ? 193 ASP B C   1 
ATOM 4471 O O   . ASP B 1 193 ? 33.659  -57.521 210.722 1.00 40.53  ? 193 ASP B O   1 
ATOM 4472 C CB  . ASP B 1 193 ? 32.882  -59.565 208.611 1.00 51.36  ? 193 ASP B CB  1 
ATOM 4473 C CG  . ASP B 1 193 ? 34.295  -60.052 208.226 1.00 62.30  ? 193 ASP B CG  1 
ATOM 4474 O OD1 . ASP B 1 193 ? 34.605  -61.251 208.440 1.00 64.93  ? 193 ASP B OD1 1 
ATOM 4475 O OD2 . ASP B 1 193 ? 35.121  -59.226 207.779 1.00 71.53  ? 193 ASP B OD2 1 
ATOM 4476 N N   . LEU B 1 194 ? 34.681  -59.391 211.454 1.00 36.45  ? 194 LEU B N   1 
ATOM 4477 C CA  . LEU B 1 194 ? 35.691  -58.677 212.217 1.00 35.34  ? 194 LEU B CA  1 
ATOM 4478 C C   . LEU B 1 194 ? 37.108  -58.732 211.689 1.00 33.59  ? 194 LEU B C   1 
ATOM 4479 O O   . LEU B 1 194 ? 38.038  -58.331 212.381 1.00 33.98  ? 194 LEU B O   1 
ATOM 4480 C CB  . LEU B 1 194 ? 35.663  -59.201 213.651 1.00 36.71  ? 194 LEU B CB  1 
ATOM 4481 C CG  . LEU B 1 194 ? 34.268  -59.131 214.276 1.00 41.11  ? 194 LEU B CG  1 
ATOM 4482 C CD1 . LEU B 1 194 ? 34.161  -60.126 215.394 1.00 38.00  ? 194 LEU B CD1 1 
ATOM 4483 C CD2 . LEU B 1 194 ? 33.947  -57.703 214.731 1.00 40.43  ? 194 LEU B CD2 1 
ATOM 4484 N N   . ALA B 1 195 ? 37.276  -59.189 210.459 1.00 31.88  ? 195 ALA B N   1 
ATOM 4485 C CA  . ALA B 1 195 ? 38.610  -59.310 209.875 1.00 32.00  ? 195 ALA B CA  1 
ATOM 4486 C C   . ALA B 1 195 ? 39.433  -58.009 209.864 1.00 27.87  ? 195 ALA B C   1 
ATOM 4487 O O   . ALA B 1 195 ? 40.605  -58.009 210.206 1.00 28.19  ? 195 ALA B O   1 
ATOM 4488 C CB  . ALA B 1 195 ? 38.502  -59.884 208.457 1.00 35.29  ? 195 ALA B CB  1 
ATOM 4489 N N   . GLN B 1 196 ? 38.808  -56.908 209.480 1.00 26.44  ? 196 GLN B N   1 
ATOM 4490 C CA  . GLN B 1 196 ? 39.495  -55.624 209.407 1.00 27.39  ? 196 GLN B CA  1 
ATOM 4491 C C   . GLN B 1 196 ? 39.334  -54.731 210.647 1.00 24.99  ? 196 GLN B C   1 
ATOM 4492 O O   . GLN B 1 196 ? 39.681  -53.552 210.595 1.00 25.78  ? 196 GLN B O   1 
ATOM 4493 C CB  . GLN B 1 196 ? 39.030  -54.852 208.158 1.00 32.94  ? 196 GLN B CB  1 
ATOM 4494 C CG  . GLN B 1 196 ? 39.366  -55.519 206.821 1.00 41.57  ? 196 GLN B CG  1 
ATOM 4495 C CD  . GLN B 1 196 ? 40.873  -55.750 206.619 1.00 50.76  ? 196 GLN B CD  1 
ATOM 4496 O OE1 . GLN B 1 196 ? 41.410  -56.782 207.010 1.00 53.71  ? 196 GLN B OE1 1 
ATOM 4497 N NE2 . GLN B 1 196 ? 41.543  -54.799 205.978 1.00 55.72  ? 196 GLN B NE2 1 
ATOM 4498 N N   . THR B 1 197 ? 38.808  -55.277 211.740 1.00 21.18  ? 197 THR B N   1 
ATOM 4499 C CA  . THR B 1 197 ? 38.597  -54.508 212.968 1.00 19.61  ? 197 THR B CA  1 
ATOM 4500 C C   . THR B 1 197 ? 39.730  -54.644 213.987 1.00 19.02  ? 197 THR B C   1 
ATOM 4501 O O   . THR B 1 197 ? 40.321  -55.722 214.156 1.00 17.20  ? 197 THR B O   1 
ATOM 4502 C CB  . THR B 1 197 ? 37.247  -54.914 213.671 1.00 19.18  ? 197 THR B CB  1 
ATOM 4503 O OG1 . THR B 1 197 ? 36.147  -54.417 212.913 1.00 27.27  ? 197 THR B OG1 1 
ATOM 4504 C CG2 . THR B 1 197 ? 37.134  -54.349 215.081 1.00 16.91  ? 197 THR B CG2 1 
ATOM 4505 N N   . VAL B 1 198 ? 40.047  -53.520 214.624 1.00 18.47  ? 198 VAL B N   1 
ATOM 4506 C CA  . VAL B 1 198 ? 41.034  -53.451 215.685 1.00 17.51  ? 198 VAL B CA  1 
ATOM 4507 C C   . VAL B 1 198 ? 40.377  -52.610 216.778 1.00 15.37  ? 198 VAL B C   1 
ATOM 4508 O O   . VAL B 1 198 ? 39.765  -51.589 216.473 1.00 16.23  ? 198 VAL B O   1 
ATOM 4509 C CB  . VAL B 1 198 ? 42.320  -52.734 215.241 1.00 16.04  ? 198 VAL B CB  1 
ATOM 4510 C CG1 . VAL B 1 198 ? 43.242  -52.545 216.433 1.00 18.23  ? 198 VAL B CG1 1 
ATOM 4511 C CG2 . VAL B 1 198 ? 43.024  -53.536 214.182 1.00 15.76  ? 198 VAL B CG2 1 
ATOM 4512 N N   . ILE B 1 199 ? 40.387  -53.091 218.016 1.00 12.05  ? 199 ILE B N   1 
ATOM 4513 C CA  . ILE B 1 199 ? 39.841  -52.309 219.122 1.00 13.46  ? 199 ILE B CA  1 
ATOM 4514 C C   . ILE B 1 199 ? 41.048  -51.527 219.681 1.00 13.06  ? 199 ILE B C   1 
ATOM 4515 O O   . ILE B 1 199 ? 42.049  -52.122 220.094 1.00 11.76  ? 199 ILE B O   1 
ATOM 4516 C CB  . ILE B 1 199 ? 39.216  -53.196 220.239 1.00 17.20  ? 199 ILE B CB  1 
ATOM 4517 C CG1 . ILE B 1 199 ? 38.051  -54.023 219.680 1.00 16.89  ? 199 ILE B CG1 1 
ATOM 4518 C CG2 . ILE B 1 199 ? 38.714  -52.317 221.384 1.00 10.62  ? 199 ILE B CG2 1 
ATOM 4519 C CD1 . ILE B 1 199 ? 36.987  -53.209 218.940 1.00 16.11  ? 199 ILE B CD1 1 
ATOM 4520 N N   . LEU B 1 200 ? 40.994  -50.201 219.599 1.00 13.11  ? 200 LEU B N   1 
ATOM 4521 C CA  . LEU B 1 200 ? 42.090  -49.356 220.056 1.00 11.99  ? 200 LEU B CA  1 
ATOM 4522 C C   . LEU B 1 200 ? 41.835  -48.909 221.480 1.00 12.72  ? 200 LEU B C   1 
ATOM 4523 O O   . LEU B 1 200 ? 40.784  -48.366 221.768 1.00 14.81  ? 200 LEU B O   1 
ATOM 4524 C CB  . LEU B 1 200 ? 42.216  -48.131 219.154 1.00 15.35  ? 200 LEU B CB  1 
ATOM 4525 C CG  . LEU B 1 200 ? 43.287  -47.102 219.529 1.00 21.12  ? 200 LEU B CG  1 
ATOM 4526 C CD1 . LEU B 1 200 ? 44.641  -47.677 219.230 1.00 16.91  ? 200 LEU B CD1 1 
ATOM 4527 C CD2 . LEU B 1 200 ? 43.087  -45.799 218.750 1.00 25.29  ? 200 LEU B CD2 1 
ATOM 4528 N N   . GLU B 1 201 ? 42.821  -49.102 222.349 1.00 11.18  ? 201 GLU B N   1 
ATOM 4529 C CA  . GLU B 1 201 ? 42.717  -48.728 223.752 1.00 12.98  ? 201 GLU B CA  1 
ATOM 4530 C C   . GLU B 1 201 ? 43.834  -47.756 224.112 1.00 15.70  ? 201 GLU B C   1 
ATOM 4531 O O   . GLU B 1 201 ? 44.987  -47.963 223.729 1.00 15.13  ? 201 GLU B O   1 
ATOM 4532 C CB  . GLU B 1 201 ? 42.883  -49.974 224.605 1.00 14.10  ? 201 GLU B CB  1 
ATOM 4533 C CG  . GLU B 1 201 ? 42.896  -49.697 226.098 1.00 15.19  ? 201 GLU B CG  1 
ATOM 4534 C CD  . GLU B 1 201 ? 43.136  -50.955 226.903 1.00 21.65  ? 201 GLU B CD  1 
ATOM 4535 O OE1 . GLU B 1 201 ? 43.277  -52.036 226.292 1.00 17.07  ? 201 GLU B OE1 1 
ATOM 4536 O OE2 . GLU B 1 201 ? 43.175  -50.863 228.148 1.00 19.04  ? 201 GLU B OE2 1 
ATOM 4537 N N   . LEU B 1 202 ? 43.495  -46.672 224.798 1.00 14.32  ? 202 LEU B N   1 
ATOM 4538 C CA  . LEU B 1 202 ? 44.512  -45.714 225.214 1.00 16.20  ? 202 LEU B CA  1 
ATOM 4539 C C   . LEU B 1 202 ? 44.714  -45.980 226.696 1.00 17.53  ? 202 LEU B C   1 
ATOM 4540 O O   . LEU B 1 202 ? 45.294  -46.999 227.065 1.00 20.72  ? 202 LEU B O   1 
ATOM 4541 C CB  . LEU B 1 202 ? 44.061  -44.274 224.951 1.00 17.12  ? 202 LEU B CB  1 
ATOM 4542 C CG  . LEU B 1 202 ? 43.785  -43.860 223.500 1.00 21.79  ? 202 LEU B CG  1 
ATOM 4543 C CD1 . LEU B 1 202 ? 43.782  -42.344 223.410 1.00 19.82  ? 202 LEU B CD1 1 
ATOM 4544 C CD2 . LEU B 1 202 ? 44.815  -44.428 222.554 1.00 23.36  ? 202 LEU B CD2 1 
ATOM 4545 N N   . ASP B 1 203 ? 44.280  -45.063 227.545 1.00 17.78  ? 203 ASP B N   1 
ATOM 4546 C CA  . ASP B 1 203 ? 44.374  -45.268 228.981 1.00 19.22  ? 203 ASP B CA  1 
ATOM 4547 C C   . ASP B 1 203 ? 42.905  -45.281 229.439 1.00 21.13  ? 203 ASP B C   1 
ATOM 4548 O O   . ASP B 1 203 ? 42.287  -44.227 229.606 1.00 21.86  ? 203 ASP B O   1 
ATOM 4549 C CB  . ASP B 1 203 ? 45.157  -44.133 229.643 1.00 18.76  ? 203 ASP B CB  1 
ATOM 4550 C CG  . ASP B 1 203 ? 45.135  -44.206 231.167 1.00 25.35  ? 203 ASP B CG  1 
ATOM 4551 O OD1 . ASP B 1 203 ? 44.634  -45.193 231.730 1.00 27.16  ? 203 ASP B OD1 1 
ATOM 4552 O OD2 . ASP B 1 203 ? 45.626  -43.264 231.811 1.00 25.34  ? 203 ASP B OD2 1 
ATOM 4553 N N   . LYS B 1 204 ? 42.354  -46.479 229.626 1.00 21.47  ? 204 LYS B N   1 
ATOM 4554 C CA  . LYS B 1 204 ? 40.956  -46.652 230.026 1.00 23.08  ? 204 LYS B CA  1 
ATOM 4555 C C   . LYS B 1 204 ? 40.570  -46.056 231.383 1.00 23.97  ? 204 LYS B C   1 
ATOM 4556 O O   . LYS B 1 204 ? 39.380  -46.009 231.714 1.00 25.24  ? 204 LYS B O   1 
ATOM 4557 C CB  . LYS B 1 204 ? 40.551  -48.134 229.964 1.00 17.89  ? 204 LYS B CB  1 
ATOM 4558 C CG  . LYS B 1 204 ? 41.181  -48.991 231.042 1.00 18.05  ? 204 LYS B CG  1 
ATOM 4559 C CD  . LYS B 1 204 ? 40.766  -50.445 230.888 1.00 21.50  ? 204 LYS B CD  1 
ATOM 4560 C CE  . LYS B 1 204 ? 41.402  -51.326 231.958 1.00 24.17  ? 204 LYS B CE  1 
ATOM 4561 N NZ  . LYS B 1 204 ? 40.954  -52.728 231.771 1.00 23.98  ? 204 LYS B NZ  1 
ATOM 4562 N N   . THR B 1 205 ? 41.557  -45.612 232.166 1.00 23.72  ? 205 THR B N   1 
ATOM 4563 C CA  . THR B 1 205 ? 41.272  -44.994 233.465 1.00 25.88  ? 205 THR B CA  1 
ATOM 4564 C C   . THR B 1 205 ? 40.992  -43.479 233.355 1.00 25.75  ? 205 THR B C   1 
ATOM 4565 O O   . THR B 1 205 ? 40.600  -42.852 234.337 1.00 25.55  ? 205 THR B O   1 
ATOM 4566 C CB  . THR B 1 205 ? 42.385  -45.280 234.528 1.00 26.32  ? 205 THR B CB  1 
ATOM 4567 O OG1 . THR B 1 205 ? 43.621  -44.653 234.160 1.00 32.85  ? 205 THR B OG1 1 
ATOM 4568 C CG2 . THR B 1 205 ? 42.615  -46.767 234.645 1.00 27.25  ? 205 THR B CG2 1 
ATOM 4569 N N   . VAL B 1 206 ? 41.210  -42.893 232.176 1.00 26.28  ? 206 VAL B N   1 
ATOM 4570 C CA  . VAL B 1 206 ? 40.939  -41.462 231.960 1.00 30.15  ? 206 VAL B CA  1 
ATOM 4571 C C   . VAL B 1 206 ? 39.417  -41.303 231.985 1.00 31.54  ? 206 VAL B C   1 
ATOM 4572 O O   . VAL B 1 206 ? 38.687  -41.973 231.244 1.00 28.52  ? 206 VAL B O   1 
ATOM 4573 C CB  . VAL B 1 206 ? 41.533  -40.930 230.607 1.00 30.73  ? 206 VAL B CB  1 
ATOM 4574 C CG1 . VAL B 1 206 ? 40.995  -39.541 230.284 1.00 29.81  ? 206 VAL B CG1 1 
ATOM 4575 C CG2 . VAL B 1 206 ? 43.044  -40.859 230.696 1.00 23.48  ? 206 VAL B CG2 1 
ATOM 4576 N N   . GLU B 1 207 ? 38.943  -40.380 232.812 1.00 34.12  ? 207 GLU B N   1 
ATOM 4577 C CA  . GLU B 1 207 ? 37.509  -40.199 232.975 1.00 35.17  ? 207 GLU B CA  1 
ATOM 4578 C C   . GLU B 1 207 ? 36.692  -39.525 231.877 1.00 32.27  ? 207 GLU B C   1 
ATOM 4579 O O   . GLU B 1 207 ? 35.528  -39.906 231.656 1.00 30.94  ? 207 GLU B O   1 
ATOM 4580 C CB  . GLU B 1 207 ? 37.214  -39.537 234.315 1.00 42.13  ? 207 GLU B CB  1 
ATOM 4581 C CG  . GLU B 1 207 ? 35.807  -39.833 234.790 1.00 59.92  ? 207 GLU B CG  1 
ATOM 4582 C CD  . GLU B 1 207 ? 35.489  -39.180 236.110 1.00 75.04  ? 207 GLU B CD  1 
ATOM 4583 O OE1 . GLU B 1 207 ? 36.328  -39.277 237.041 1.00 81.02  ? 207 GLU B OE1 1 
ATOM 4584 O OE2 . GLU B 1 207 ? 34.395  -38.574 236.211 1.00 80.72  ? 207 GLU B OE2 1 
ATOM 4585 N N   . HIS B 1 208 ? 37.271  -38.546 231.186 1.00 26.52  ? 208 HIS B N   1 
ATOM 4586 C CA  . HIS B 1 208 ? 36.509  -37.846 230.159 1.00 25.12  ? 208 HIS B CA  1 
ATOM 4587 C C   . HIS B 1 208 ? 36.765  -38.290 228.738 1.00 24.18  ? 208 HIS B C   1 
ATOM 4588 O O   . HIS B 1 208 ? 36.833  -37.475 227.829 1.00 25.70  ? 208 HIS B O   1 
ATOM 4589 C CB  . HIS B 1 208 ? 36.677  -36.342 230.311 1.00 25.94  ? 208 HIS B CB  1 
ATOM 4590 C CG  . HIS B 1 208 ? 36.217  -35.834 231.640 1.00 29.40  ? 208 HIS B CG  1 
ATOM 4591 N ND1 . HIS B 1 208 ? 34.884  -35.758 231.986 1.00 32.74  ? 208 HIS B ND1 1 
ATOM 4592 C CD2 . HIS B 1 208 ? 36.914  -35.436 232.731 1.00 26.89  ? 208 HIS B CD2 1 
ATOM 4593 C CE1 . HIS B 1 208 ? 34.779  -35.339 233.235 1.00 26.97  ? 208 HIS B CE1 1 
ATOM 4594 N NE2 . HIS B 1 208 ? 35.995  -35.136 233.709 1.00 30.19  ? 208 HIS B NE2 1 
ATOM 4595 N N   . LEU B 1 209 ? 36.817  -39.601 228.549 1.00 23.80  ? 209 LEU B N   1 
ATOM 4596 C CA  . LEU B 1 209 ? 37.042  -40.199 227.237 1.00 23.03  ? 209 LEU B CA  1 
ATOM 4597 C C   . LEU B 1 209 ? 36.418  -41.584 227.193 1.00 23.25  ? 209 LEU B C   1 
ATOM 4598 O O   . LEU B 1 209 ? 36.230  -42.226 228.243 1.00 21.31  ? 209 LEU B O   1 
ATOM 4599 C CB  . LEU B 1 209 ? 38.539  -40.391 226.985 1.00 22.90  ? 209 LEU B CB  1 
ATOM 4600 C CG  . LEU B 1 209 ? 39.398  -39.224 226.517 1.00 22.55  ? 209 LEU B CG  1 
ATOM 4601 C CD1 . LEU B 1 209 ? 40.820  -39.709 226.240 1.00 21.87  ? 209 LEU B CD1 1 
ATOM 4602 C CD2 . LEU B 1 209 ? 38.784  -38.645 225.274 1.00 19.45  ? 209 LEU B CD2 1 
ATOM 4603 N N   . PRO B 1 210 ? 36.027  -42.036 225.988 1.00 20.90  ? 210 PRO B N   1 
ATOM 4604 C CA  . PRO B 1 210 ? 35.442  -43.373 225.822 1.00 20.53  ? 210 PRO B CA  1 
ATOM 4605 C C   . PRO B 1 210 ? 36.611  -44.320 226.185 1.00 17.59  ? 210 PRO B C   1 
ATOM 4606 O O   . PRO B 1 210 ? 37.785  -43.931 226.056 1.00 14.52  ? 210 PRO B O   1 
ATOM 4607 C CB  . PRO B 1 210 ? 35.170  -43.444 224.312 1.00 23.97  ? 210 PRO B CB  1 
ATOM 4608 C CG  . PRO B 1 210 ? 34.991  -42.022 223.915 1.00 24.28  ? 210 PRO B CG  1 
ATOM 4609 C CD  . PRO B 1 210 ? 36.025  -41.289 224.719 1.00 21.20  ? 210 PRO B CD  1 
ATOM 4610 N N   . THR B 1 211 ? 36.318  -45.545 226.616 1.00 18.18  ? 211 THR B N   1 
ATOM 4611 C CA  . THR B 1 211 ? 37.392  -46.472 226.984 1.00 17.27  ? 211 THR B CA  1 
ATOM 4612 C C   . THR B 1 211 ? 38.077  -47.169 225.800 1.00 17.54  ? 211 THR B C   1 
ATOM 4613 O O   . THR B 1 211 ? 39.131  -47.779 225.973 1.00 18.81  ? 211 THR B O   1 
ATOM 4614 C CB  . THR B 1 211 ? 36.893  -47.541 227.996 1.00 19.47  ? 211 THR B CB  1 
ATOM 4615 O OG1 . THR B 1 211 ? 35.813  -48.293 227.418 1.00 18.57  ? 211 THR B OG1 1 
ATOM 4616 C CG2 . THR B 1 211 ? 36.390  -46.868 229.270 1.00 17.23  ? 211 THR B CG2 1 
ATOM 4617 N N   . ALA B 1 212 ? 37.496  -47.068 224.603 1.00 16.68  ? 212 ALA B N   1 
ATOM 4618 C CA  . ALA B 1 212 ? 38.058  -47.725 223.418 1.00 15.42  ? 212 ALA B CA  1 
ATOM 4619 C C   . ALA B 1 212 ? 37.372  -47.270 222.139 1.00 15.85  ? 212 ALA B C   1 
ATOM 4620 O O   . ALA B 1 212 ? 36.288  -46.675 222.170 1.00 14.57  ? 212 ALA B O   1 
ATOM 4621 C CB  . ALA B 1 212 ? 37.943  -49.267 223.548 1.00 15.32  ? 212 ALA B CB  1 
ATOM 4622 N N   . TRP B 1 213 ? 38.001  -47.569 221.010 1.00 15.16  ? 213 TRP B N   1 
ATOM 4623 C CA  . TRP B 1 213 ? 37.459  -47.204 219.710 1.00 17.95  ? 213 TRP B CA  1 
ATOM 4624 C C   . TRP B 1 213 ? 37.556  -48.417 218.807 1.00 18.53  ? 213 TRP B C   1 
ATOM 4625 O O   . TRP B 1 213 ? 38.407  -49.284 219.006 1.00 16.75  ? 213 TRP B O   1 
ATOM 4626 C CB  . TRP B 1 213 ? 38.259  -46.049 219.076 1.00 18.06  ? 213 TRP B CB  1 
ATOM 4627 C CG  . TRP B 1 213 ? 38.073  -44.708 219.760 1.00 17.15  ? 213 TRP B CG  1 
ATOM 4628 C CD1 . TRP B 1 213 ? 37.245  -43.696 219.362 1.00 13.02  ? 213 TRP B CD1 1 
ATOM 4629 C CD2 . TRP B 1 213 ? 38.725  -44.247 220.958 1.00 16.07  ? 213 TRP B CD2 1 
ATOM 4630 N NE1 . TRP B 1 213 ? 37.337  -42.634 220.235 1.00 13.21  ? 213 TRP B NE1 1 
ATOM 4631 C CE2 . TRP B 1 213 ? 38.238  -42.940 221.221 1.00 21.26  ? 213 TRP B CE2 1 
ATOM 4632 C CE3 . TRP B 1 213 ? 39.679  -44.807 221.829 1.00 17.50  ? 213 TRP B CE3 1 
ATOM 4633 C CZ2 . TRP B 1 213 ? 38.667  -42.185 222.323 1.00 16.14  ? 213 TRP B CZ2 1 
ATOM 4634 C CZ3 . TRP B 1 213 ? 40.106  -44.062 222.922 1.00 18.97  ? 213 TRP B CZ3 1 
ATOM 4635 C CH2 . TRP B 1 213 ? 39.600  -42.757 223.159 1.00 22.87  ? 213 TRP B CH2 1 
ATOM 4636 N N   . GLN B 1 214 ? 36.673  -48.481 217.825 1.00 16.40  ? 214 GLN B N   1 
ATOM 4637 C CA  . GLN B 1 214 ? 36.682  -49.568 216.870 1.00 17.70  ? 214 GLN B CA  1 
ATOM 4638 C C   . GLN B 1 214 ? 37.273  -48.932 215.629 1.00 18.25  ? 214 GLN B C   1 
ATOM 4639 O O   . GLN B 1 214 ? 36.639  -48.061 215.043 1.00 20.82  ? 214 GLN B O   1 
ATOM 4640 C CB  . GLN B 1 214 ? 35.251  -50.016 216.590 1.00 23.03  ? 214 GLN B CB  1 
ATOM 4641 C CG  . GLN B 1 214 ? 35.185  -51.169 215.629 1.00 25.37  ? 214 GLN B CG  1 
ATOM 4642 C CD  . GLN B 1 214 ? 33.769  -51.606 215.321 1.00 31.83  ? 214 GLN B CD  1 
ATOM 4643 O OE1 . GLN B 1 214 ? 33.559  -52.410 214.420 1.00 31.90  ? 214 GLN B OE1 1 
ATOM 4644 N NE2 . GLN B 1 214 ? 32.798  -51.111 216.081 1.00 23.15  ? 214 GLN B NE2 1 
ATOM 4645 N N   . VAL B 1 215 ? 38.487  -49.316 215.253 1.00 17.01  ? 215 VAL B N   1 
ATOM 4646 C CA  . VAL B 1 215 ? 39.134  -48.719 214.086 1.00 18.54  ? 215 VAL B CA  1 
ATOM 4647 C C   . VAL B 1 215 ? 39.490  -49.735 213.016 1.00 19.13  ? 215 VAL B C   1 
ATOM 4648 O O   . VAL B 1 215 ? 39.493  -50.943 213.271 1.00 20.78  ? 215 VAL B O   1 
ATOM 4649 C CB  . VAL B 1 215 ? 40.433  -47.937 214.486 1.00 15.71  ? 215 VAL B CB  1 
ATOM 4650 C CG1 . VAL B 1 215 ? 40.112  -46.901 215.555 1.00 17.63  ? 215 VAL B CG1 1 
ATOM 4651 C CG2 . VAL B 1 215 ? 41.517  -48.893 214.984 1.00 12.16  ? 215 VAL B CG2 1 
ATOM 4652 N N   . HIS B 1 216 ? 39.787  -49.240 211.812 1.00 20.28  ? 216 HIS B N   1 
ATOM 4653 C CA  . HIS B 1 216 ? 40.175  -50.101 210.699 1.00 19.37  ? 216 HIS B CA  1 
ATOM 4654 C C   . HIS B 1 216 ? 41.634  -50.559 210.821 1.00 20.62  ? 216 HIS B C   1 
ATOM 4655 O O   . HIS B 1 216 ? 42.536  -49.743 211.036 1.00 19.16  ? 216 HIS B O   1 
ATOM 4656 C CB  . HIS B 1 216 ? 39.982  -49.369 209.371 1.00 22.01  ? 216 HIS B CB  1 
ATOM 4657 C CG  . HIS B 1 216 ? 40.052  -50.276 208.183 1.00 31.22  ? 216 HIS B CG  1 
ATOM 4658 N ND1 . HIS B 1 216 ? 41.246  -50.752 207.676 1.00 31.04  ? 216 HIS B ND1 1 
ATOM 4659 C CD2 . HIS B 1 216 ? 39.074  -50.848 207.440 1.00 30.81  ? 216 HIS B CD2 1 
ATOM 4660 C CE1 . HIS B 1 216 ? 40.997  -51.589 206.685 1.00 28.31  ? 216 HIS B CE1 1 
ATOM 4661 N NE2 . HIS B 1 216 ? 39.689  -51.662 206.520 1.00 32.77  ? 216 HIS B NE2 1 
ATOM 4662 N N   . ARG B 1 217 ? 41.867  -51.849 210.606 1.00 19.66  ? 217 ARG B N   1 
ATOM 4663 C CA  . ARG B 1 217 ? 43.195  -52.442 210.691 1.00 24.44  ? 217 ARG B CA  1 
ATOM 4664 C C   . ARG B 1 217 ? 44.279  -51.735 209.870 1.00 25.59  ? 217 ARG B C   1 
ATOM 4665 O O   . ARG B 1 217 ? 45.402  -51.580 210.332 1.00 24.79  ? 217 ARG B O   1 
ATOM 4666 C CB  . ARG B 1 217 ? 43.124  -53.900 210.263 1.00 28.64  ? 217 ARG B CB  1 
ATOM 4667 C CG  . ARG B 1 217 ? 44.441  -54.619 210.339 1.00 31.36  ? 217 ARG B CG  1 
ATOM 4668 C CD  . ARG B 1 217 ? 44.336  -55.951 209.649 1.00 46.57  ? 217 ARG B CD  1 
ATOM 4669 N NE  . ARG B 1 217 ? 45.606  -56.380 209.062 1.00 59.57  ? 217 ARG B NE  1 
ATOM 4670 C CZ  . ARG B 1 217 ? 46.624  -56.890 209.752 1.00 61.98  ? 217 ARG B CZ  1 
ATOM 4671 N NH1 . ARG B 1 217 ? 46.546  -57.043 211.069 1.00 64.99  ? 217 ARG B NH1 1 
ATOM 4672 N NH2 . ARG B 1 217 ? 47.731  -57.250 209.118 1.00 59.99  ? 217 ARG B NH2 1 
ATOM 4673 N N   . ASP B 1 218 ? 43.963  -51.350 208.636 1.00 26.42  ? 218 ASP B N   1 
ATOM 4674 C CA  . ASP B 1 218 ? 44.952  -50.677 207.786 1.00 28.29  ? 218 ASP B CA  1 
ATOM 4675 C C   . ASP B 1 218 ? 45.342  -49.292 208.303 1.00 27.59  ? 218 ASP B C   1 
ATOM 4676 O O   . ASP B 1 218 ? 46.502  -48.890 208.207 1.00 29.49  ? 218 ASP B O   1 
ATOM 4677 C CB  . ASP B 1 218 ? 44.488  -50.631 206.326 1.00 29.24  ? 218 ASP B CB  1 
ATOM 4678 C CG  . ASP B 1 218 ? 44.447  -52.018 205.684 1.00 30.77  ? 218 ASP B CG  1 
ATOM 4679 O OD1 . ASP B 1 218 ? 45.250  -52.901 206.060 1.00 35.55  ? 218 ASP B OD1 1 
ATOM 4680 O OD2 . ASP B 1 218 ? 43.593  -52.234 204.810 1.00 40.94  ? 218 ASP B OD2 1 
ATOM 4681 N N   . TRP B 1 219 ? 44.380  -48.574 208.872 1.00 25.91  ? 219 TRP B N   1 
ATOM 4682 C CA  . TRP B 1 219 ? 44.648  -47.264 209.456 1.00 23.83  ? 219 TRP B CA  1 
ATOM 4683 C C   . TRP B 1 219 ? 45.563  -47.457 210.678 1.00 25.14  ? 219 TRP B C   1 
ATOM 4684 O O   . TRP B 1 219 ? 46.594  -46.800 210.809 1.00 26.21  ? 219 TRP B O   1 
ATOM 4685 C CB  . TRP B 1 219 ? 43.332  -46.604 209.883 1.00 22.67  ? 219 TRP B CB  1 
ATOM 4686 C CG  . TRP B 1 219 ? 43.502  -45.296 210.608 1.00 27.38  ? 219 TRP B CG  1 
ATOM 4687 C CD1 . TRP B 1 219 ? 43.654  -44.053 210.044 1.00 30.54  ? 219 TRP B CD1 1 
ATOM 4688 C CD2 . TRP B 1 219 ? 43.522  -45.090 212.036 1.00 26.55  ? 219 TRP B CD2 1 
ATOM 4689 N NE1 . TRP B 1 219 ? 43.763  -43.091 211.030 1.00 27.64  ? 219 TRP B NE1 1 
ATOM 4690 C CE2 . TRP B 1 219 ? 43.684  -43.699 212.257 1.00 26.39  ? 219 TRP B CE2 1 
ATOM 4691 C CE3 . TRP B 1 219 ? 43.421  -45.950 213.142 1.00 22.28  ? 219 TRP B CE3 1 
ATOM 4692 C CZ2 . TRP B 1 219 ? 43.743  -43.141 213.548 1.00 26.26  ? 219 TRP B CZ2 1 
ATOM 4693 C CZ3 . TRP B 1 219 ? 43.483  -45.396 214.430 1.00 23.49  ? 219 TRP B CZ3 1 
ATOM 4694 C CH2 . TRP B 1 219 ? 43.641  -44.002 214.617 1.00 25.46  ? 219 TRP B CH2 1 
ATOM 4695 N N   . PHE B 1 220 ? 45.199  -48.396 211.548 1.00 24.67  ? 220 PHE B N   1 
ATOM 4696 C CA  . PHE B 1 220 ? 45.976  -48.684 212.745 1.00 21.83  ? 220 PHE B CA  1 
ATOM 4697 C C   . PHE B 1 220 ? 47.414  -49.078 212.401 1.00 23.99  ? 220 PHE B C   1 
ATOM 4698 O O   . PHE B 1 220 ? 48.364  -48.595 213.022 1.00 22.10  ? 220 PHE B O   1 
ATOM 4699 C CB  . PHE B 1 220 ? 45.300  -49.793 213.569 1.00 19.34  ? 220 PHE B CB  1 
ATOM 4700 C CG  . PHE B 1 220 ? 46.084  -50.218 214.790 1.00 17.56  ? 220 PHE B CG  1 
ATOM 4701 C CD1 . PHE B 1 220 ? 46.072  -49.443 215.949 1.00 17.73  ? 220 PHE B CD1 1 
ATOM 4702 C CD2 . PHE B 1 220 ? 46.851  -51.385 214.772 1.00 18.21  ? 220 PHE B CD2 1 
ATOM 4703 C CE1 . PHE B 1 220 ? 46.817  -49.827 217.077 1.00 16.83  ? 220 PHE B CE1 1 
ATOM 4704 C CE2 . PHE B 1 220 ? 47.599  -51.780 215.889 1.00 17.31  ? 220 PHE B CE2 1 
ATOM 4705 C CZ  . PHE B 1 220 ? 47.582  -50.998 217.044 1.00 15.14  ? 220 PHE B CZ  1 
ATOM 4706 N N   . ASN B 1 221 ? 47.584  -49.947 211.409 1.00 22.48  ? 221 ASN B N   1 
ATOM 4707 C CA  . ASN B 1 221 ? 48.927  -50.388 211.043 1.00 24.96  ? 221 ASN B CA  1 
ATOM 4708 C C   . ASN B 1 221 ? 49.813  -49.319 210.418 1.00 26.53  ? 221 ASN B C   1 
ATOM 4709 O O   . ASN B 1 221 ? 51.035  -49.482 210.347 1.00 30.46  ? 221 ASN B O   1 
ATOM 4710 C CB  . ASN B 1 221 ? 48.880  -51.629 210.150 1.00 26.22  ? 221 ASN B CB  1 
ATOM 4711 C CG  . ASN B 1 221 ? 48.539  -52.898 210.933 1.00 35.12  ? 221 ASN B CG  1 
ATOM 4712 O OD1 . ASN B 1 221 ? 47.853  -53.778 210.422 1.00 43.57  ? 221 ASN B OD1 1 
ATOM 4713 N ND2 . ASN B 1 221 ? 49.017  -52.994 212.177 1.00 34.10  ? 221 ASN B ND2 1 
ATOM 4714 N N   . ASP B 1 222 ? 49.206  -48.211 210.009 1.00 25.84  ? 222 ASP B N   1 
ATOM 4715 C CA  . ASP B 1 222 ? 49.942  -47.118 209.385 1.00 28.33  ? 222 ASP B CA  1 
ATOM 4716 C C   . ASP B 1 222 ? 50.234  -45.926 210.295 1.00 28.46  ? 222 ASP B C   1 
ATOM 4717 O O   . ASP B 1 222 ? 50.710  -44.899 209.823 1.00 30.95  ? 222 ASP B O   1 
ATOM 4718 C CB  . ASP B 1 222 ? 49.188  -46.627 208.148 1.00 34.10  ? 222 ASP B CB  1 
ATOM 4719 C CG  . ASP B 1 222 ? 49.625  -47.337 206.873 1.00 47.92  ? 222 ASP B CG  1 
ATOM 4720 O OD1 . ASP B 1 222 ? 49.688  -48.592 206.847 1.00 49.91  ? 222 ASP B OD1 1 
ATOM 4721 O OD2 . ASP B 1 222 ? 49.903  -46.623 205.888 1.00 57.92  ? 222 ASP B OD2 1 
ATOM 4722 N N   . LEU B 1 223 ? 49.937  -46.031 211.585 1.00 26.67  ? 223 LEU B N   1 
ATOM 4723 C CA  . LEU B 1 223 ? 50.191  -44.914 212.483 1.00 26.75  ? 223 LEU B CA  1 
ATOM 4724 C C   . LEU B 1 223 ? 51.678  -44.626 212.523 1.00 25.73  ? 223 LEU B C   1 
ATOM 4725 O O   . LEU B 1 223 ? 52.489  -45.536 212.687 1.00 23.65  ? 223 LEU B O   1 
ATOM 4726 C CB  . LEU B 1 223 ? 49.646  -45.187 213.891 1.00 25.16  ? 223 LEU B CB  1 
ATOM 4727 C CG  . LEU B 1 223 ? 48.121  -45.240 213.971 1.00 27.23  ? 223 LEU B CG  1 
ATOM 4728 C CD1 . LEU B 1 223 ? 47.709  -45.431 215.408 1.00 26.35  ? 223 LEU B CD1 1 
ATOM 4729 C CD2 . LEU B 1 223 ? 47.522  -43.964 213.409 1.00 27.18  ? 223 LEU B CD2 1 
ATOM 4730 N N   . ALA B 1 224 ? 52.024  -43.353 212.364 1.00 25.39  ? 224 ALA B N   1 
ATOM 4731 C CA  . ALA B 1 224 ? 53.422  -42.926 212.360 1.00 24.60  ? 224 ALA B CA  1 
ATOM 4732 C C   . ALA B 1 224 ? 53.886  -42.649 213.776 1.00 23.16  ? 224 ALA B C   1 
ATOM 4733 O O   . ALA B 1 224 ? 54.163  -41.509 214.140 1.00 23.87  ? 224 ALA B O   1 
ATOM 4734 C CB  . ALA B 1 224 ? 53.587  -41.685 211.498 1.00 22.49  ? 224 ALA B CB  1 
ATOM 4735 N N   . LEU B 1 225 ? 53.976  -43.701 214.574 1.00 20.41  ? 225 LEU B N   1 
ATOM 4736 C CA  . LEU B 1 225 ? 54.384  -43.570 215.961 1.00 20.87  ? 225 LEU B CA  1 
ATOM 4737 C C   . LEU B 1 225 ? 55.342  -44.694 216.300 1.00 18.72  ? 225 LEU B C   1 
ATOM 4738 O O   . LEU B 1 225 ? 55.444  -45.667 215.555 1.00 18.65  ? 225 LEU B O   1 
ATOM 4739 C CB  . LEU B 1 225 ? 53.156  -43.694 216.865 1.00 18.73  ? 225 LEU B CB  1 
ATOM 4740 C CG  . LEU B 1 225 ? 52.075  -42.619 216.773 1.00 25.12  ? 225 LEU B CG  1 
ATOM 4741 C CD1 . LEU B 1 225 ? 50.888  -43.061 217.601 1.00 22.23  ? 225 LEU B CD1 1 
ATOM 4742 C CD2 . LEU B 1 225 ? 52.611  -41.276 217.286 1.00 17.01  ? 225 LEU B CD2 1 
ATOM 4743 N N   . PRO B 1 226 ? 56.114  -44.545 217.385 1.00 16.91  ? 226 PRO B N   1 
ATOM 4744 C CA  . PRO B 1 226 ? 57.038  -45.622 217.755 1.00 17.15  ? 226 PRO B CA  1 
ATOM 4745 C C   . PRO B 1 226 ? 56.133  -46.808 218.135 1.00 19.58  ? 226 PRO B C   1 
ATOM 4746 O O   . PRO B 1 226 ? 55.054  -46.598 218.710 1.00 16.93  ? 226 PRO B O   1 
ATOM 4747 C CB  . PRO B 1 226 ? 57.733  -45.060 219.000 1.00 14.03  ? 226 PRO B CB  1 
ATOM 4748 C CG  . PRO B 1 226 ? 57.673  -43.583 218.789 1.00 12.73  ? 226 PRO B CG  1 
ATOM 4749 C CD  . PRO B 1 226 ? 56.280  -43.379 218.262 1.00 14.98  ? 226 PRO B CD  1 
ATOM 4750 N N   . TRP B 1 227 ? 56.574  -48.038 217.879 1.00 18.73  ? 227 TRP B N   1 
ATOM 4751 C CA  . TRP B 1 227 ? 55.753  -49.208 218.205 1.00 18.27  ? 227 TRP B CA  1 
ATOM 4752 C C   . TRP B 1 227 ? 56.584  -50.380 218.703 1.00 17.79  ? 227 TRP B C   1 
ATOM 4753 O O   . TRP B 1 227 ? 57.796  -50.408 218.521 1.00 18.88  ? 227 TRP B O   1 
ATOM 4754 C CB  . TRP B 1 227 ? 54.970  -49.654 216.965 1.00 18.68  ? 227 TRP B CB  1 
ATOM 4755 C CG  . TRP B 1 227 ? 55.862  -50.178 215.851 1.00 25.80  ? 227 TRP B CG  1 
ATOM 4756 C CD1 . TRP B 1 227 ? 56.522  -49.439 214.897 1.00 22.11  ? 227 TRP B CD1 1 
ATOM 4757 C CD2 . TRP B 1 227 ? 56.205  -51.554 215.598 1.00 30.39  ? 227 TRP B CD2 1 
ATOM 4758 N NE1 . TRP B 1 227 ? 57.250  -50.271 214.081 1.00 30.23  ? 227 TRP B NE1 1 
ATOM 4759 C CE2 . TRP B 1 227 ? 57.075  -51.570 214.486 1.00 30.26  ? 227 TRP B CE2 1 
ATOM 4760 C CE3 . TRP B 1 227 ? 55.859  -52.773 216.206 1.00 30.07  ? 227 TRP B CE3 1 
ATOM 4761 C CZ2 . TRP B 1 227 ? 57.603  -52.757 213.968 1.00 32.09  ? 227 TRP B CZ2 1 
ATOM 4762 C CZ3 . TRP B 1 227 ? 56.386  -53.953 215.689 1.00 31.83  ? 227 TRP B CZ3 1 
ATOM 4763 C CH2 . TRP B 1 227 ? 57.249  -53.934 214.583 1.00 27.20  ? 227 TRP B CH2 1 
ATOM 4764 N N   . LYS B 1 228 ? 55.929  -51.340 219.343 1.00 16.43  ? 228 LYS B N   1 
ATOM 4765 C CA  . LYS B 1 228 ? 56.603  -52.544 219.819 1.00 18.97  ? 228 LYS B CA  1 
ATOM 4766 C C   . LYS B 1 228 ? 55.548  -53.601 220.120 1.00 20.88  ? 228 LYS B C   1 
ATOM 4767 O O   . LYS B 1 228 ? 54.344  -53.338 220.038 1.00 18.93  ? 228 LYS B O   1 
ATOM 4768 C CB  . LYS B 1 228 ? 57.440  -52.263 221.066 1.00 15.77  ? 228 LYS B CB  1 
ATOM 4769 C CG  . LYS B 1 228 ? 56.651  -52.043 222.344 1.00 13.25  ? 228 LYS B CG  1 
ATOM 4770 C CD  . LYS B 1 228 ? 57.620  -51.762 223.476 1.00 23.52  ? 228 LYS B CD  1 
ATOM 4771 C CE  . LYS B 1 228 ? 56.913  -51.686 224.818 1.00 21.61  ? 228 LYS B CE  1 
ATOM 4772 N NZ  . LYS B 1 228 ? 56.205  -52.958 225.147 1.00 26.86  ? 228 LYS B NZ  1 
ATOM 4773 N N   . HIS B 1 229 ? 55.993  -54.816 220.401 1.00 21.56  ? 229 HIS B N   1 
ATOM 4774 C CA  . HIS B 1 229 ? 55.075  -55.879 220.756 1.00 22.11  ? 229 HIS B CA  1 
ATOM 4775 C C   . HIS B 1 229 ? 54.942  -55.773 222.246 1.00 23.56  ? 229 HIS B C   1 
ATOM 4776 O O   . HIS B 1 229 ? 55.871  -55.297 222.902 1.00 22.75  ? 229 HIS B O   1 
ATOM 4777 C CB  . HIS B 1 229 ? 55.690  -57.241 220.440 1.00 21.41  ? 229 HIS B CB  1 
ATOM 4778 C CG  . HIS B 1 229 ? 55.795  -57.514 218.982 1.00 21.56  ? 229 HIS B CG  1 
ATOM 4779 N ND1 . HIS B 1 229 ? 54.691  -57.512 218.167 1.00 26.30  ? 229 HIS B ND1 1 
ATOM 4780 C CD2 . HIS B 1 229 ? 56.865  -57.710 218.175 1.00 27.50  ? 229 HIS B CD2 1 
ATOM 4781 C CE1 . HIS B 1 229 ? 55.068  -57.679 216.913 1.00 24.77  ? 229 HIS B CE1 1 
ATOM 4782 N NE2 . HIS B 1 229 ? 56.385  -57.805 216.889 1.00 33.51  ? 229 HIS B NE2 1 
ATOM 4783 N N   . GLU B 1 230 ? 53.790  -56.168 222.787 1.00 25.41  ? 230 GLU B N   1 
ATOM 4784 C CA  . GLU B 1 230 ? 53.617  -56.175 224.242 1.00 29.63  ? 230 GLU B CA  1 
ATOM 4785 C C   . GLU B 1 230 ? 54.754  -57.076 224.718 1.00 31.44  ? 230 GLU B C   1 
ATOM 4786 O O   . GLU B 1 230 ? 55.144  -58.006 224.010 1.00 33.28  ? 230 GLU B O   1 
ATOM 4787 C CB  . GLU B 1 230 ? 52.285  -56.842 224.628 1.00 30.59  ? 230 GLU B CB  1 
ATOM 4788 C CG  . GLU B 1 230 ? 52.207  -57.193 226.121 1.00 39.17  ? 230 GLU B CG  1 
ATOM 4789 C CD  . GLU B 1 230 ? 51.072  -58.146 226.473 1.00 54.43  ? 230 GLU B CD  1 
ATOM 4790 O OE1 . GLU B 1 230 ? 50.827  -59.118 225.714 1.00 52.32  ? 230 GLU B OE1 1 
ATOM 4791 O OE2 . GLU B 1 230 ? 50.430  -57.926 227.528 1.00 59.96  ? 230 GLU B OE2 1 
ATOM 4792 N N   . GLY B 1 231 ? 55.324  -56.816 225.881 1.00 33.69  ? 231 GLY B N   1 
ATOM 4793 C CA  . GLY B 1 231 ? 56.397  -57.700 226.317 1.00 32.52  ? 231 GLY B CA  1 
ATOM 4794 C C   . GLY B 1 231 ? 57.784  -57.307 225.833 1.00 31.17  ? 231 GLY B C   1 
ATOM 4795 O O   . GLY B 1 231 ? 58.759  -57.576 226.532 1.00 31.56  ? 231 GLY B O   1 
ATOM 4796 N N   . ALA B 1 232 ? 57.896  -56.729 224.634 1.00 28.18  ? 232 ALA B N   1 
ATOM 4797 C CA  . ALA B 1 232 ? 59.200  -56.284 224.137 1.00 26.38  ? 232 ALA B CA  1 
ATOM 4798 C C   . ALA B 1 232 ? 59.650  -55.129 225.044 1.00 28.87  ? 232 ALA B C   1 
ATOM 4799 O O   . ALA B 1 232 ? 58.824  -54.388 225.599 1.00 28.67  ? 232 ALA B O   1 
ATOM 4800 C CB  . ALA B 1 232 ? 59.119  -55.833 222.681 1.00 20.99  ? 232 ALA B CB  1 
ATOM 4801 N N   . GLN B 1 233 ? 60.958  -54.996 225.207 1.00 30.68  ? 233 GLN B N   1 
ATOM 4802 C CA  . GLN B 1 233 ? 61.517  -53.973 226.078 1.00 34.46  ? 233 GLN B CA  1 
ATOM 4803 C C   . GLN B 1 233 ? 61.695  -52.617 225.397 1.00 31.53  ? 233 GLN B C   1 
ATOM 4804 O O   . GLN B 1 233 ? 61.423  -51.590 226.006 1.00 32.67  ? 233 GLN B O   1 
ATOM 4805 C CB  . GLN B 1 233 ? 62.856  -54.464 226.640 1.00 44.81  ? 233 GLN B CB  1 
ATOM 4806 C CG  . GLN B 1 233 ? 63.402  -53.670 227.818 1.00 57.20  ? 233 GLN B CG  1 
ATOM 4807 C CD  . GLN B 1 233 ? 64.836  -54.071 228.168 1.00 67.07  ? 233 GLN B CD  1 
ATOM 4808 O OE1 . GLN B 1 233 ? 65.248  -55.219 227.961 1.00 69.57  ? 233 GLN B OE1 1 
ATOM 4809 N NE2 . GLN B 1 233 ? 65.612  -53.116 228.672 1.00 71.72  ? 233 GLN B NE2 1 
ATOM 4810 N N   . ASN B 1 234 ? 62.101  -52.622 224.132 1.00 26.58  ? 234 ASN B N   1 
ATOM 4811 C CA  . ASN B 1 234 ? 62.349  -51.381 223.413 1.00 27.12  ? 234 ASN B CA  1 
ATOM 4812 C C   . ASN B 1 234 ? 61.352  -51.055 222.306 1.00 27.08  ? 234 ASN B C   1 
ATOM 4813 O O   . ASN B 1 234 ? 60.638  -51.928 221.818 1.00 28.33  ? 234 ASN B O   1 
ATOM 4814 C CB  . ASN B 1 234 ? 63.773  -51.392 222.842 1.00 28.72  ? 234 ASN B CB  1 
ATOM 4815 C CG  . ASN B 1 234 ? 64.827  -51.620 223.917 1.00 31.41  ? 234 ASN B CG  1 
ATOM 4816 O OD1 . ASN B 1 234 ? 64.754  -51.063 225.022 1.00 29.84  ? 234 ASN B OD1 1 
ATOM 4817 N ND2 . ASN B 1 234 ? 65.809  -52.447 223.604 1.00 30.16  ? 234 ASN B ND2 1 
ATOM 4818 N N   . TRP B 1 235 ? 61.371  -49.798 221.877 1.00 24.53  ? 235 TRP B N   1 
ATOM 4819 C CA  . TRP B 1 235 ? 60.486  -49.303 220.839 1.00 22.02  ? 235 TRP B CA  1 
ATOM 4820 C C   . TRP B 1 235 ? 61.163  -49.250 219.482 1.00 23.05  ? 235 TRP B C   1 
ATOM 4821 O O   . TRP B 1 235 ? 62.339  -48.916 219.381 1.00 24.36  ? 235 TRP B O   1 
ATOM 4822 C CB  . TRP B 1 235 ? 60.009  -47.899 221.219 1.00 20.73  ? 235 TRP B CB  1 
ATOM 4823 C CG  . TRP B 1 235 ? 59.194  -47.894 222.466 1.00 16.94  ? 235 TRP B CG  1 
ATOM 4824 C CD1 . TRP B 1 235 ? 59.655  -47.788 223.750 1.00 16.16  ? 235 TRP B CD1 1 
ATOM 4825 C CD2 . TRP B 1 235 ? 57.774  -48.094 222.558 1.00 16.06  ? 235 TRP B CD2 1 
ATOM 4826 N NE1 . TRP B 1 235 ? 58.605  -47.922 224.638 1.00 20.02  ? 235 TRP B NE1 1 
ATOM 4827 C CE2 . TRP B 1 235 ? 57.446  -48.110 223.934 1.00 14.13  ? 235 TRP B CE2 1 
ATOM 4828 C CE3 . TRP B 1 235 ? 56.756  -48.266 221.612 1.00 18.23  ? 235 TRP B CE3 1 
ATOM 4829 C CZ2 . TRP B 1 235 ? 56.131  -48.295 224.384 1.00 14.39  ? 235 TRP B CZ2 1 
ATOM 4830 C CZ3 . TRP B 1 235 ? 55.445  -48.448 222.065 1.00 13.73  ? 235 TRP B CZ3 1 
ATOM 4831 C CH2 . TRP B 1 235 ? 55.150  -48.457 223.438 1.00 15.33  ? 235 TRP B CH2 1 
ATOM 4832 N N   . ASN B 1 236 ? 60.419  -49.591 218.441 1.00 20.29  ? 236 ASN B N   1 
ATOM 4833 C CA  . ASN B 1 236 ? 60.927  -49.538 217.078 1.00 20.84  ? 236 ASN B CA  1 
ATOM 4834 C C   . ASN B 1 236 ? 60.528  -48.170 216.572 1.00 21.04  ? 236 ASN B C   1 
ATOM 4835 O O   . ASN B 1 236 ? 59.477  -47.652 216.952 1.00 21.03  ? 236 ASN B O   1 
ATOM 4836 C CB  . ASN B 1 236 ? 60.262  -50.586 216.173 1.00 25.20  ? 236 ASN B CB  1 
ATOM 4837 C CG  . ASN B 1 236 ? 60.470  -51.999 216.655 1.00 28.72  ? 236 ASN B CG  1 
ATOM 4838 O OD1 . ASN B 1 236 ? 59.510  -52.749 216.821 1.00 31.38  ? 236 ASN B OD1 1 
ATOM 4839 N ND2 . ASN B 1 236 ? 61.721  -52.373 216.889 1.00 27.60  ? 236 ASN B ND2 1 
ATOM 4840 N N   . ASN B 1 237 ? 61.369  -47.583 215.730 1.00 19.06  ? 237 ASN B N   1 
ATOM 4841 C CA  . ASN B 1 237 ? 61.093  -46.273 215.156 1.00 16.72  ? 237 ASN B CA  1 
ATOM 4842 C C   . ASN B 1 237 ? 60.851  -45.174 216.188 1.00 17.08  ? 237 ASN B C   1 
ATOM 4843 O O   . ASN B 1 237 ? 60.014  -44.297 215.974 1.00 18.64  ? 237 ASN B O   1 
ATOM 4844 C CB  . ASN B 1 237 ? 59.897  -46.359 214.205 1.00 21.68  ? 237 ASN B CB  1 
ATOM 4845 C CG  . ASN B 1 237 ? 60.113  -47.356 213.090 1.00 30.47  ? 237 ASN B CG  1 
ATOM 4846 O OD1 . ASN B 1 237 ? 59.349  -48.304 212.943 1.00 38.67  ? 237 ASN B OD1 1 
ATOM 4847 N ND2 . ASN B 1 237 ? 61.161  -47.155 212.301 1.00 30.74  ? 237 ASN B ND2 1 
ATOM 4848 N N   . ALA B 1 238 ? 61.598  -45.194 217.289 1.00 15.17  ? 238 ALA B N   1 
ATOM 4849 C CA  . ALA B 1 238 ? 61.439  -44.186 218.324 1.00 18.28  ? 238 ALA B CA  1 
ATOM 4850 C C   . ALA B 1 238 ? 61.770  -42.792 217.784 1.00 20.69  ? 238 ALA B C   1 
ATOM 4851 O O   . ALA B 1 238 ? 61.283  -41.780 218.291 1.00 22.75  ? 238 ALA B O   1 
ATOM 4852 C CB  . ALA B 1 238 ? 62.307  -44.518 219.524 1.00 17.92  ? 238 ALA B CB  1 
ATOM 4853 N N   . GLU B 1 239 ? 62.564  -42.743 216.724 1.00 21.22  ? 239 GLU B N   1 
ATOM 4854 C CA  . GLU B 1 239 ? 62.938  -41.470 216.125 1.00 19.97  ? 239 GLU B CA  1 
ATOM 4855 C C   . GLU B 1 239 ? 61.732  -40.697 215.618 1.00 21.37  ? 239 GLU B C   1 
ATOM 4856 O O   . GLU B 1 239 ? 61.831  -39.504 215.387 1.00 20.82  ? 239 GLU B O   1 
ATOM 4857 C CB  . GLU B 1 239 ? 63.970  -41.647 215.002 1.00 19.33  ? 239 GLU B CB  1 
ATOM 4858 C CG  . GLU B 1 239 ? 63.457  -42.320 213.737 1.00 23.39  ? 239 GLU B CG  1 
ATOM 4859 C CD  . GLU B 1 239 ? 63.391  -43.857 213.823 1.00 36.74  ? 239 GLU B CD  1 
ATOM 4860 O OE1 . GLU B 1 239 ? 63.988  -44.468 214.746 1.00 30.49  ? 239 GLU B OE1 1 
ATOM 4861 O OE2 . GLU B 1 239 ? 62.742  -44.460 212.936 1.00 39.01  ? 239 GLU B OE2 1 
ATOM 4862 N N   . ARG B 1 240 ? 60.586  -41.353 215.465 1.00 20.70  ? 240 ARG B N   1 
ATOM 4863 C CA  . ARG B 1 240 ? 59.389  -40.649 215.002 1.00 21.65  ? 240 ARG B CA  1 
ATOM 4864 C C   . ARG B 1 240 ? 58.926  -39.536 215.942 1.00 19.40  ? 240 ARG B C   1 
ATOM 4865 O O   . ARG B 1 240 ? 58.183  -38.658 215.519 1.00 21.32  ? 240 ARG B O   1 
ATOM 4866 C CB  . ARG B 1 240 ? 58.235  -41.628 214.745 1.00 22.82  ? 240 ARG B CB  1 
ATOM 4867 C CG  . ARG B 1 240 ? 58.420  -42.432 213.475 1.00 34.11  ? 240 ARG B CG  1 
ATOM 4868 C CD  . ARG B 1 240 ? 57.404  -43.537 213.373 1.00 43.30  ? 240 ARG B CD  1 
ATOM 4869 N NE  . ARG B 1 240 ? 57.635  -44.384 212.204 1.00 41.35  ? 240 ARG B NE  1 
ATOM 4870 C CZ  . ARG B 1 240 ? 57.057  -45.569 212.002 1.00 40.28  ? 240 ARG B CZ  1 
ATOM 4871 N NH1 . ARG B 1 240 ? 56.195  -46.068 212.887 1.00 31.54  ? 240 ARG B NH1 1 
ATOM 4872 N NH2 . ARG B 1 240 ? 57.364  -46.274 210.920 1.00 42.47  ? 240 ARG B NH2 1 
ATOM 4873 N N   . LEU B 1 241 ? 59.349  -39.564 217.208 1.00 17.81  ? 241 LEU B N   1 
ATOM 4874 C CA  . LEU B 1 241 ? 58.951  -38.528 218.168 1.00 20.49  ? 241 LEU B CA  1 
ATOM 4875 C C   . LEU B 1 241 ? 60.144  -37.706 218.661 1.00 23.41  ? 241 LEU B C   1 
ATOM 4876 O O   . LEU B 1 241 ? 60.033  -36.959 219.637 1.00 22.97  ? 241 LEU B O   1 
ATOM 4877 C CB  . LEU B 1 241 ? 58.239  -39.145 219.380 1.00 19.66  ? 241 LEU B CB  1 
ATOM 4878 C CG  . LEU B 1 241 ? 56.901  -39.854 219.143 1.00 23.80  ? 241 LEU B CG  1 
ATOM 4879 C CD1 . LEU B 1 241 ? 56.339  -40.289 220.472 1.00 21.21  ? 241 LEU B CD1 1 
ATOM 4880 C CD2 . LEU B 1 241 ? 55.915  -38.951 218.436 1.00 15.42  ? 241 LEU B CD2 1 
ATOM 4881 N N   . VAL B 1 242 ? 61.273  -37.830 217.968 1.00 26.67  ? 242 VAL B N   1 
ATOM 4882 C CA  . VAL B 1 242 ? 62.498  -37.131 218.349 1.00 26.35  ? 242 VAL B CA  1 
ATOM 4883 C C   . VAL B 1 242 ? 63.116  -36.364 217.184 1.00 28.41  ? 242 VAL B C   1 
ATOM 4884 O O   . VAL B 1 242 ? 63.167  -36.850 216.057 1.00 30.62  ? 242 VAL B O   1 
ATOM 4885 C CB  . VAL B 1 242 ? 63.533  -38.125 218.883 1.00 28.61  ? 242 VAL B CB  1 
ATOM 4886 C CG1 . VAL B 1 242 ? 64.794  -37.398 219.293 1.00 31.74  ? 242 VAL B CG1 1 
ATOM 4887 C CG2 . VAL B 1 242 ? 62.954  -38.894 220.059 1.00 22.05  ? 242 VAL B CG2 1 
ATOM 4888 N N   . GLU B 1 243 ? 63.600  -35.164 217.466 1.00 28.51  ? 243 GLU B N   1 
ATOM 4889 C CA  . GLU B 1 243 ? 64.222  -34.339 216.439 1.00 30.41  ? 243 GLU B CA  1 
ATOM 4890 C C   . GLU B 1 243 ? 65.558  -33.893 217.003 1.00 29.38  ? 243 GLU B C   1 
ATOM 4891 O O   . GLU B 1 243 ? 65.704  -33.748 218.220 1.00 28.70  ? 243 GLU B O   1 
ATOM 4892 C CB  . GLU B 1 243 ? 63.363  -33.105 216.141 1.00 36.58  ? 243 GLU B CB  1 
ATOM 4893 C CG  . GLU B 1 243 ? 63.363  -32.671 214.685 1.00 52.36  ? 243 GLU B CG  1 
ATOM 4894 C CD  . GLU B 1 243 ? 62.693  -33.695 213.776 1.00 61.87  ? 243 GLU B CD  1 
ATOM 4895 O OE1 . GLU B 1 243 ? 61.451  -33.643 213.639 1.00 68.42  ? 243 GLU B OE1 1 
ATOM 4896 O OE2 . GLU B 1 243 ? 63.400  -34.549 213.197 1.00 67.96  ? 243 GLU B OE2 1 
ATOM 4897 N N   . PHE B 1 244 ? 66.544  -33.745 216.128 1.00 26.81  ? 244 PHE B N   1 
ATOM 4898 C CA  . PHE B 1 244 ? 67.873  -33.302 216.530 1.00 27.24  ? 244 PHE B CA  1 
ATOM 4899 C C   . PHE B 1 244 ? 68.152  -31.930 215.932 1.00 27.14  ? 244 PHE B C   1 
ATOM 4900 O O   . PHE B 1 244 ? 67.779  -31.663 214.790 1.00 25.73  ? 244 PHE B O   1 
ATOM 4901 C CB  . PHE B 1 244 ? 68.933  -34.314 216.082 1.00 24.35  ? 244 PHE B CB  1 
ATOM 4902 C CG  . PHE B 1 244 ? 68.971  -35.567 216.924 1.00 26.46  ? 244 PHE B CG  1 
ATOM 4903 C CD1 . PHE B 1 244 ? 69.686  -35.595 218.121 1.00 27.31  ? 244 PHE B CD1 1 
ATOM 4904 C CD2 . PHE B 1 244 ? 68.288  -36.718 216.525 1.00 24.42  ? 244 PHE B CD2 1 
ATOM 4905 C CE1 . PHE B 1 244 ? 69.721  -36.753 218.907 1.00 31.70  ? 244 PHE B CE1 1 
ATOM 4906 C CE2 . PHE B 1 244 ? 68.321  -37.879 217.311 1.00 21.13  ? 244 PHE B CE2 1 
ATOM 4907 C CZ  . PHE B 1 244 ? 69.037  -37.891 218.499 1.00 25.11  ? 244 PHE B CZ  1 
ATOM 4908 N N   . GLY B 1 245 ? 68.740  -31.039 216.726 1.00 26.73  ? 245 GLY B N   1 
ATOM 4909 C CA  . GLY B 1 245 ? 69.056  -29.709 216.229 1.00 27.10  ? 245 GLY B CA  1 
ATOM 4910 C C   . GLY B 1 245 ? 70.362  -29.717 215.443 1.00 28.46  ? 245 GLY B C   1 
ATOM 4911 O O   . GLY B 1 245 ? 71.100  -30.709 215.464 1.00 26.42  ? 245 GLY B O   1 
ATOM 4912 N N   . ALA B 1 246 ? 70.630  -28.643 214.702 1.00 28.88  ? 246 ALA B N   1 
ATOM 4913 C CA  . ALA B 1 246 ? 71.873  -28.549 213.942 1.00 27.56  ? 246 ALA B CA  1 
ATOM 4914 C C   . ALA B 1 246 ? 72.976  -28.503 215.003 1.00 27.59  ? 246 ALA B C   1 
ATOM 4915 O O   . ALA B 1 246 ? 72.806  -27.877 216.062 1.00 27.90  ? 246 ALA B O   1 
ATOM 4916 C CB  . ALA B 1 246 ? 71.881  -27.285 213.091 1.00 21.94  ? 246 ALA B CB  1 
ATOM 4917 N N   . PRO B 1 247 ? 74.088  -29.214 214.778 1.00 27.66  ? 247 PRO B N   1 
ATOM 4918 C CA  . PRO B 1 247 ? 75.151  -29.189 215.783 1.00 29.83  ? 247 PRO B CA  1 
ATOM 4919 C C   . PRO B 1 247 ? 75.962  -27.904 215.749 1.00 31.32  ? 247 PRO B C   1 
ATOM 4920 O O   . PRO B 1 247 ? 76.034  -27.243 214.721 1.00 30.92  ? 247 PRO B O   1 
ATOM 4921 C CB  . PRO B 1 247 ? 76.003  -30.388 215.388 1.00 32.30  ? 247 PRO B CB  1 
ATOM 4922 C CG  . PRO B 1 247 ? 75.927  -30.348 213.887 1.00 27.59  ? 247 PRO B CG  1 
ATOM 4923 C CD  . PRO B 1 247 ? 74.465  -30.043 213.618 1.00 28.75  ? 247 PRO B CD  1 
ATOM 4924 N N   . HIS B 1 248 ? 76.498  -27.513 216.898 1.00 35.77  ? 248 HIS B N   1 
ATOM 4925 C CA  . HIS B 1 248 ? 77.376  -26.342 216.980 1.00 42.89  ? 248 HIS B CA  1 
ATOM 4926 C C   . HIS B 1 248 ? 78.512  -26.674 217.941 1.00 44.17  ? 248 HIS B C   1 
ATOM 4927 O O   . HIS B 1 248 ? 78.302  -26.839 219.151 1.00 47.82  ? 248 HIS B O   1 
ATOM 4928 C CB  . HIS B 1 248 ? 76.651  -25.017 217.337 1.00 51.99  ? 248 HIS B CB  1 
ATOM 4929 C CG  . HIS B 1 248 ? 75.586  -25.139 218.391 1.00 65.28  ? 248 HIS B CG  1 
ATOM 4930 N ND1 . HIS B 1 248 ? 75.605  -26.103 219.380 1.00 71.77  ? 248 HIS B ND1 1 
ATOM 4931 C CD2 . HIS B 1 248 ? 74.460  -24.411 218.601 1.00 66.00  ? 248 HIS B CD2 1 
ATOM 4932 C CE1 . HIS B 1 248 ? 74.538  -25.964 220.151 1.00 68.97  ? 248 HIS B CE1 1 
ATOM 4933 N NE2 . HIS B 1 248 ? 73.828  -24.945 219.699 1.00 69.60  ? 248 HIS B NE2 1 
ATOM 4934 N N   . ALA B 1 249 ? 79.700  -26.840 217.367 1.00 41.42  ? 249 ALA B N   1 
ATOM 4935 C CA  . ALA B 1 249 ? 80.913  -27.199 218.102 1.00 38.08  ? 249 ALA B CA  1 
ATOM 4936 C C   . ALA B 1 249 ? 80.809  -28.609 218.687 1.00 34.32  ? 249 ALA B C   1 
ATOM 4937 O O   . ALA B 1 249 ? 80.770  -29.574 217.935 1.00 32.97  ? 249 ALA B O   1 
ATOM 4938 C CB  . ALA B 1 249 ? 81.240  -26.171 219.185 1.00 38.10  ? 249 ALA B CB  1 
ATOM 4939 N N   . VAL B 1 250 ? 80.715  -28.725 220.008 1.00 31.14  ? 250 VAL B N   1 
ATOM 4940 C CA  . VAL B 1 250 ? 80.656  -30.045 220.642 1.00 30.58  ? 250 VAL B CA  1 
ATOM 4941 C C   . VAL B 1 250 ? 79.272  -30.362 221.219 1.00 31.09  ? 250 VAL B C   1 
ATOM 4942 O O   . VAL B 1 250 ? 79.140  -31.230 222.100 1.00 30.13  ? 250 VAL B O   1 
ATOM 4943 C CB  . VAL B 1 250 ? 81.730  -30.189 221.780 1.00 32.96  ? 250 VAL B CB  1 
ATOM 4944 C CG1 . VAL B 1 250 ? 83.138  -29.932 221.234 1.00 34.59  ? 250 VAL B CG1 1 
ATOM 4945 C CG2 . VAL B 1 250 ? 81.461  -29.220 222.927 1.00 33.96  ? 250 VAL B CG2 1 
ATOM 4946 N N   . LYS B 1 251 ? 78.237  -29.693 220.713 1.00 31.24  ? 251 LYS B N   1 
ATOM 4947 C CA  . LYS B 1 251 ? 76.884  -29.901 221.221 1.00 30.73  ? 251 LYS B CA  1 
ATOM 4948 C C   . LYS B 1 251 ? 75.870  -30.070 220.117 1.00 27.78  ? 251 LYS B C   1 
ATOM 4949 O O   . LYS B 1 251 ? 76.013  -29.507 219.032 1.00 28.20  ? 251 LYS B O   1 
ATOM 4950 C CB  . LYS B 1 251 ? 76.459  -28.714 222.086 1.00 35.13  ? 251 LYS B CB  1 
ATOM 4951 C CG  . LYS B 1 251 ? 77.252  -28.545 223.360 1.00 48.96  ? 251 LYS B CG  1 
ATOM 4952 C CD  . LYS B 1 251 ? 76.838  -27.292 224.100 1.00 62.73  ? 251 LYS B CD  1 
ATOM 4953 C CE  . LYS B 1 251 ? 77.646  -27.101 225.368 1.00 72.88  ? 251 LYS B CE  1 
ATOM 4954 N NZ  . LYS B 1 251 ? 77.212  -25.887 226.099 1.00 81.26  ? 251 LYS B NZ  1 
ATOM 4955 N N   . MET B 1 252 ? 74.812  -30.807 220.429 1.00 27.01  ? 252 MET B N   1 
ATOM 4956 C CA  . MET B 1 252 ? 73.707  -31.053 219.506 1.00 27.10  ? 252 MET B CA  1 
ATOM 4957 C C   . MET B 1 252 ? 72.448  -31.265 220.370 1.00 26.47  ? 252 MET B C   1 
ATOM 4958 O O   . MET B 1 252 ? 72.443  -32.103 221.281 1.00 24.95  ? 252 MET B O   1 
ATOM 4959 C CB  . MET B 1 252 ? 73.996  -32.280 218.640 1.00 25.88  ? 252 MET B CB  1 
ATOM 4960 C CG  . MET B 1 252 ? 72.958  -32.534 217.572 1.00 30.26  ? 252 MET B CG  1 
ATOM 4961 S SD  . MET B 1 252 ? 73.568  -33.563 216.225 1.00 43.84  ? 252 MET B SD  1 
ATOM 4962 C CE  . MET B 1 252 ? 74.385  -34.858 217.093 1.00 37.25  ? 252 MET B CE  1 
ATOM 4963 N N   . ASP B 1 253 ? 71.442  -30.416 220.169 1.00 26.09  ? 253 ASP B N   1 
ATOM 4964 C CA  . ASP B 1 253 ? 70.195  -30.479 220.942 1.00 26.51  ? 253 ASP B CA  1 
ATOM 4965 C C   . ASP B 1 253 ? 69.239  -31.601 220.492 1.00 25.40  ? 253 ASP B C   1 
ATOM 4966 O O   . ASP B 1 253 ? 69.122  -31.926 219.308 1.00 24.41  ? 253 ASP B O   1 
ATOM 4967 C CB  . ASP B 1 253 ? 69.435  -29.145 220.841 1.00 26.37  ? 253 ASP B CB  1 
ATOM 4968 C CG  . ASP B 1 253 ? 70.177  -27.973 221.473 1.00 39.75  ? 253 ASP B CG  1 
ATOM 4969 O OD1 . ASP B 1 253 ? 70.763  -28.139 222.572 1.00 39.45  ? 253 ASP B OD1 1 
ATOM 4970 O OD2 . ASP B 1 253 ? 70.142  -26.878 220.864 1.00 43.18  ? 253 ASP B OD2 1 
ATOM 4971 N N   . VAL B 1 254 ? 68.518  -32.145 221.455 1.00 26.61  ? 254 VAL B N   1 
ATOM 4972 C CA  . VAL B 1 254 ? 67.546  -33.190 221.197 1.00 26.47  ? 254 VAL B CA  1 
ATOM 4973 C C   . VAL B 1 254 ? 66.180  -32.621 221.576 1.00 23.22  ? 254 VAL B C   1 
ATOM 4974 O O   . VAL B 1 254 ? 65.992  -32.122 222.690 1.00 22.58  ? 254 VAL B O   1 
ATOM 4975 C CB  . VAL B 1 254 ? 67.837  -34.431 222.046 1.00 29.09  ? 254 VAL B CB  1 
ATOM 4976 C CG1 . VAL B 1 254 ? 66.834  -35.517 221.735 1.00 29.42  ? 254 VAL B CG1 1 
ATOM 4977 C CG2 . VAL B 1 254 ? 69.244  -34.917 221.755 1.00 36.23  ? 254 VAL B CG2 1 
ATOM 4978 N N   . TYR B 1 255 ? 65.238  -32.697 220.643 1.00 23.27  ? 255 TYR B N   1 
ATOM 4979 C CA  . TYR B 1 255 ? 63.879  -32.197 220.849 1.00 24.37  ? 255 TYR B CA  1 
ATOM 4980 C C   . TYR B 1 255 ? 62.827  -33.311 220.885 1.00 24.36  ? 255 TYR B C   1 
ATOM 4981 O O   . TYR B 1 255 ? 62.878  -34.269 220.114 1.00 22.89  ? 255 TYR B O   1 
ATOM 4982 C CB  . TYR B 1 255 ? 63.527  -31.208 219.743 1.00 26.86  ? 255 TYR B CB  1 
ATOM 4983 C CG  . TYR B 1 255 ? 64.513  -30.073 219.651 1.00 35.32  ? 255 TYR B CG  1 
ATOM 4984 C CD1 . TYR B 1 255 ? 64.763  -29.244 220.754 1.00 32.39  ? 255 TYR B CD1 1 
ATOM 4985 C CD2 . TYR B 1 255 ? 65.206  -29.827 218.470 1.00 33.12  ? 255 TYR B CD2 1 
ATOM 4986 C CE1 . TYR B 1 255 ? 65.678  -28.198 220.675 1.00 31.78  ? 255 TYR B CE1 1 
ATOM 4987 C CE2 . TYR B 1 255 ? 66.126  -28.783 218.382 1.00 33.81  ? 255 TYR B CE2 1 
ATOM 4988 C CZ  . TYR B 1 255 ? 66.356  -27.974 219.486 1.00 36.75  ? 255 TYR B CZ  1 
ATOM 4989 O OH  . TYR B 1 255 ? 67.267  -26.941 219.396 1.00 40.22  ? 255 TYR B OH  1 
ATOM 4990 N N   . ASN B 1 256 ? 61.874  -33.176 221.792 1.00 21.66  ? 256 ASN B N   1 
ATOM 4991 C CA  . ASN B 1 256 ? 60.807  -34.149 221.927 1.00 21.16  ? 256 ASN B CA  1 
ATOM 4992 C C   . ASN B 1 256 ? 59.588  -33.545 221.253 1.00 19.96  ? 256 ASN B C   1 
ATOM 4993 O O   . ASN B 1 256 ? 59.240  -32.407 221.543 1.00 20.33  ? 256 ASN B O   1 
ATOM 4994 C CB  . ASN B 1 256 ? 60.528  -34.376 223.405 1.00 17.45  ? 256 ASN B CB  1 
ATOM 4995 C CG  . ASN B 1 256 ? 59.529  -35.469 223.641 1.00 19.06  ? 256 ASN B CG  1 
ATOM 4996 O OD1 . ASN B 1 256 ? 58.603  -35.669 222.848 1.00 17.72  ? 256 ASN B OD1 1 
ATOM 4997 N ND2 . ASN B 1 256 ? 59.703  -36.190 224.735 1.00 12.53  ? 256 ASN B ND2 1 
ATOM 4998 N N   . LEU B 1 257 ? 58.940  -34.290 220.365 1.00 18.10  ? 257 LEU B N   1 
ATOM 4999 C CA  . LEU B 1 257 ? 57.760  -33.773 219.682 1.00 16.30  ? 257 LEU B CA  1 
ATOM 5000 C C   . LEU B 1 257 ? 56.467  -33.679 220.522 1.00 17.78  ? 257 LEU B C   1 
ATOM 5001 O O   . LEU B 1 257 ? 55.413  -33.306 219.998 1.00 15.23  ? 257 LEU B O   1 
ATOM 5002 C CB  . LEU B 1 257 ? 57.507  -34.524 218.376 1.00 20.43  ? 257 LEU B CB  1 
ATOM 5003 C CG  . LEU B 1 257 ? 58.610  -34.329 217.335 1.00 22.88  ? 257 LEU B CG  1 
ATOM 5004 C CD1 . LEU B 1 257 ? 58.175  -34.942 216.026 1.00 22.32  ? 257 LEU B CD1 1 
ATOM 5005 C CD2 . LEU B 1 257 ? 58.891  -32.851 217.165 1.00 27.35  ? 257 LEU B CD2 1 
ATOM 5006 N N   . GLY B 1 258 ? 56.559  -34.008 221.811 1.00 15.34  ? 258 GLY B N   1 
ATOM 5007 C CA  . GLY B 1 258 ? 55.424  -33.904 222.704 1.00 15.82  ? 258 GLY B CA  1 
ATOM 5008 C C   . GLY B 1 258 ? 54.383  -34.997 222.606 1.00 17.18  ? 258 GLY B C   1 
ATOM 5009 O O   . GLY B 1 258 ? 54.461  -35.907 221.761 1.00 18.03  ? 258 GLY B O   1 
ATOM 5010 N N   . ASP B 1 259 ? 53.384  -34.871 223.473 1.00 14.84  ? 259 ASP B N   1 
ATOM 5011 C CA  . ASP B 1 259 ? 52.281  -35.817 223.585 1.00 13.85  ? 259 ASP B CA  1 
ATOM 5012 C C   . ASP B 1 259 ? 51.391  -35.772 222.345 1.00 15.53  ? 259 ASP B C   1 
ATOM 5013 O O   . ASP B 1 259 ? 50.798  -34.732 222.034 1.00 16.54  ? 259 ASP B O   1 
ATOM 5014 C CB  . ASP B 1 259 ? 51.476  -35.499 224.853 1.00 15.41  ? 259 ASP B CB  1 
ATOM 5015 C CG  . ASP B 1 259 ? 50.404  -36.545 225.159 1.00 21.23  ? 259 ASP B CG  1 
ATOM 5016 O OD1 . ASP B 1 259 ? 50.178  -37.459 224.340 1.00 20.25  ? 259 ASP B OD1 1 
ATOM 5017 O OD2 . ASP B 1 259 ? 49.795  -36.455 226.235 1.00 18.40  ? 259 ASP B OD2 1 
ATOM 5018 N N   . GLN B 1 260 ? 51.290  -36.910 221.659 1.00 15.01  ? 260 GLN B N   1 
ATOM 5019 C CA  . GLN B 1 260 ? 50.489  -37.048 220.444 1.00 15.13  ? 260 GLN B CA  1 
ATOM 5020 C C   . GLN B 1 260 ? 49.010  -37.413 220.672 1.00 12.96  ? 260 GLN B C   1 
ATOM 5021 O O   . GLN B 1 260 ? 48.248  -37.552 219.726 1.00 16.21  ? 260 GLN B O   1 
ATOM 5022 C CB  . GLN B 1 260 ? 51.145  -38.077 219.513 1.00 14.32  ? 260 GLN B CB  1 
ATOM 5023 C CG  . GLN B 1 260 ? 52.582  -37.736 219.152 1.00 17.17  ? 260 GLN B CG  1 
ATOM 5024 C CD  . GLN B 1 260 ? 52.685  -36.394 218.420 1.00 24.86  ? 260 GLN B CD  1 
ATOM 5025 O OE1 . GLN B 1 260 ? 52.126  -36.220 217.330 1.00 14.60  ? 260 GLN B OE1 1 
ATOM 5026 N NE2 . GLN B 1 260 ? 53.386  -35.440 219.025 1.00 15.43  ? 260 GLN B NE2 1 
ATOM 5027 N N   . THR B 1 261 ? 48.599  -37.532 221.920 1.00 13.42  ? 261 THR B N   1 
ATOM 5028 C CA  . THR B 1 261 ? 47.221  -37.891 222.249 1.00 14.45  ? 261 THR B CA  1 
ATOM 5029 C C   . THR B 1 261 ? 46.194  -36.964 221.589 1.00 16.24  ? 261 THR B C   1 
ATOM 5030 O O   . THR B 1 261 ? 45.220  -37.433 220.967 1.00 16.88  ? 261 THR B O   1 
ATOM 5031 C CB  . THR B 1 261 ? 47.018  -37.898 223.772 1.00 15.00  ? 261 THR B CB  1 
ATOM 5032 O OG1 . THR B 1 261 ? 47.932  -38.837 224.358 1.00 14.63  ? 261 THR B OG1 1 
ATOM 5033 C CG2 . THR B 1 261 ? 45.563  -38.284 224.133 1.00 20.23  ? 261 THR B CG2 1 
ATOM 5034 N N   . GLY B 1 262 ? 46.434  -35.656 221.690 1.00 11.74  ? 262 GLY B N   1 
ATOM 5035 C CA  . GLY B 1 262 ? 45.523  -34.688 221.100 1.00 11.14  ? 262 GLY B CA  1 
ATOM 5036 C C   . GLY B 1 262 ? 45.406  -34.876 219.600 1.00 14.53  ? 262 GLY B C   1 
ATOM 5037 O O   . GLY B 1 262 ? 44.320  -34.759 219.024 1.00 16.62  ? 262 GLY B O   1 
ATOM 5038 N N   . VAL B 1 263 ? 46.531  -35.195 218.967 1.00 13.81  ? 263 VAL B N   1 
ATOM 5039 C CA  . VAL B 1 263 ? 46.581  -35.426 217.534 1.00 15.00  ? 263 VAL B CA  1 
ATOM 5040 C C   . VAL B 1 263 ? 45.764  -36.678 217.204 1.00 18.13  ? 263 VAL B C   1 
ATOM 5041 O O   . VAL B 1 263 ? 44.974  -36.675 216.259 1.00 19.89  ? 263 VAL B O   1 
ATOM 5042 C CB  . VAL B 1 263 ? 48.036  -35.666 217.053 1.00 17.67  ? 263 VAL B CB  1 
ATOM 5043 C CG1 . VAL B 1 263 ? 48.053  -36.065 215.574 1.00 14.95  ? 263 VAL B CG1 1 
ATOM 5044 C CG2 . VAL B 1 263 ? 48.891  -34.423 217.305 1.00 16.22  ? 263 VAL B CG2 1 
ATOM 5045 N N   . LEU B 1 264 ? 45.963  -37.747 217.973 1.00 15.48  ? 264 LEU B N   1 
ATOM 5046 C CA  . LEU B 1 264 ? 45.231  -38.993 217.726 1.00 18.85  ? 264 LEU B CA  1 
ATOM 5047 C C   . LEU B 1 264 ? 43.726  -38.798 217.904 1.00 17.64  ? 264 LEU B C   1 
ATOM 5048 O O   . LEU B 1 264 ? 42.941  -39.223 217.061 1.00 16.76  ? 264 LEU B O   1 
ATOM 5049 C CB  . LEU B 1 264 ? 45.707  -40.099 218.678 1.00 20.53  ? 264 LEU B CB  1 
ATOM 5050 C CG  . LEU B 1 264 ? 45.206  -41.496 218.323 1.00 19.36  ? 264 LEU B CG  1 
ATOM 5051 C CD1 . LEU B 1 264 ? 45.737  -41.894 216.964 1.00 23.14  ? 264 LEU B CD1 1 
ATOM 5052 C CD2 . LEU B 1 264 ? 45.676  -42.478 219.365 1.00 25.40  ? 264 LEU B CD2 1 
ATOM 5053 N N   . LEU B 1 265 ? 43.340  -38.120 218.983 1.00 17.09  ? 265 LEU B N   1 
ATOM 5054 C CA  . LEU B 1 265 ? 41.936  -37.876 219.284 1.00 19.68  ? 265 LEU B CA  1 
ATOM 5055 C C   . LEU B 1 265 ? 41.188  -37.132 218.172 1.00 22.21  ? 265 LEU B C   1 
ATOM 5056 O O   . LEU B 1 265 ? 39.986  -37.371 217.982 1.00 21.27  ? 265 LEU B O   1 
ATOM 5057 C CB  . LEU B 1 265 ? 41.784  -37.163 220.639 1.00 18.05  ? 265 LEU B CB  1 
ATOM 5058 C CG  . LEU B 1 265 ? 42.106  -38.020 221.870 1.00 20.62  ? 265 LEU B CG  1 
ATOM 5059 C CD1 . LEU B 1 265 ? 41.991  -37.191 223.133 1.00 19.02  ? 265 LEU B CD1 1 
ATOM 5060 C CD2 . LEU B 1 265 ? 41.162  -39.203 221.952 1.00 18.15  ? 265 LEU B CD2 1 
ATOM 5061 N N   . LYS B 1 266 ? 41.889  -36.259 217.436 1.00 21.39  ? 266 LYS B N   1 
ATOM 5062 C CA  . LYS B 1 266 ? 41.284  -35.518 216.323 1.00 23.21  ? 266 LYS B CA  1 
ATOM 5063 C C   . LYS B 1 266 ? 41.018  -36.505 215.211 1.00 24.47  ? 266 LYS B C   1 
ATOM 5064 O O   . LYS B 1 266 ? 39.990  -36.446 214.556 1.00 26.41  ? 266 LYS B O   1 
ATOM 5065 C CB  . LYS B 1 266 ? 42.198  -34.407 215.802 1.00 26.73  ? 266 LYS B CB  1 
ATOM 5066 C CG  . LYS B 1 266 ? 42.398  -33.264 216.780 1.00 39.02  ? 266 LYS B CG  1 
ATOM 5067 C CD  . LYS B 1 266 ? 43.045  -32.039 216.124 1.00 48.09  ? 266 LYS B CD  1 
ATOM 5068 C CE  . LYS B 1 266 ? 42.970  -30.825 217.058 1.00 52.18  ? 266 LYS B CE  1 
ATOM 5069 N NZ  . LYS B 1 266 ? 43.299  -29.545 216.362 1.00 60.19  ? 266 LYS B NZ  1 
ATOM 5070 N N   . ALA B 1 267 ? 41.947  -37.429 215.006 1.00 26.49  ? 267 ALA B N   1 
ATOM 5071 C CA  . ALA B 1 267 ? 41.783  -38.458 213.986 1.00 27.07  ? 267 ALA B CA  1 
ATOM 5072 C C   . ALA B 1 267 ? 40.636  -39.403 214.352 1.00 28.40  ? 267 ALA B C   1 
ATOM 5073 O O   . ALA B 1 267 ? 39.946  -39.903 213.475 1.00 31.03  ? 267 ALA B O   1 
ATOM 5074 C CB  . ALA B 1 267 ? 43.074  -39.250 213.835 1.00 27.61  ? 267 ALA B CB  1 
ATOM 5075 N N   . LEU B 1 268 ? 40.428  -39.627 215.649 1.00 29.82  ? 268 LEU B N   1 
ATOM 5076 C CA  . LEU B 1 268 ? 39.391  -40.536 216.151 1.00 29.14  ? 268 LEU B CA  1 
ATOM 5077 C C   . LEU B 1 268 ? 37.973  -39.974 216.244 1.00 33.37  ? 268 LEU B C   1 
ATOM 5078 O O   . LEU B 1 268 ? 37.048  -40.684 216.646 1.00 33.46  ? 268 LEU B O   1 
ATOM 5079 C CB  . LEU B 1 268 ? 39.787  -41.090 217.524 1.00 20.35  ? 268 LEU B CB  1 
ATOM 5080 C CG  . LEU B 1 268 ? 41.028  -41.980 217.624 1.00 24.38  ? 268 LEU B CG  1 
ATOM 5081 C CD1 . LEU B 1 268 ? 41.297  -42.311 219.084 1.00 18.59  ? 268 LEU B CD1 1 
ATOM 5082 C CD2 . LEU B 1 268 ? 40.842  -43.242 216.806 1.00 19.59  ? 268 LEU B CD2 1 
ATOM 5083 N N   . ALA B 1 269 ? 37.798  -38.690 215.960 1.00 36.77  ? 269 ALA B N   1 
ATOM 5084 C CA  . ALA B 1 269 ? 36.459  -38.110 216.006 1.00 38.89  ? 269 ALA B CA  1 
ATOM 5085 C C   . ALA B 1 269 ? 35.708  -38.744 214.840 1.00 38.92  ? 269 ALA B C   1 
ATOM 5086 O O   . ALA B 1 269 ? 36.280  -38.958 213.764 1.00 42.08  ? 269 ALA B O   1 
ATOM 5087 C CB  . ALA B 1 269 ? 36.526  -36.603 215.842 1.00 37.77  ? 269 ALA B CB  1 
ATOM 5088 N N   . GLY B 1 270 ? 34.462  -39.130 215.061 1.00 38.79  ? 270 GLY B N   1 
ATOM 5089 C CA  . GLY B 1 270 ? 33.722  -39.742 213.967 1.00 38.81  ? 270 GLY B CA  1 
ATOM 5090 C C   . GLY B 1 270 ? 33.965  -41.236 213.814 1.00 37.04  ? 270 GLY B C   1 
ATOM 5091 O O   . GLY B 1 270 ? 33.315  -41.886 212.995 1.00 40.79  ? 270 GLY B O   1 
ATOM 5092 N N   . VAL B 1 271 ? 34.938  -41.773 214.543 1.00 31.15  ? 271 VAL B N   1 
ATOM 5093 C CA  . VAL B 1 271 ? 35.208  -43.208 214.518 1.00 28.33  ? 271 VAL B CA  1 
ATOM 5094 C C   . VAL B 1 271 ? 34.268  -43.797 215.593 1.00 24.94  ? 271 VAL B C   1 
ATOM 5095 O O   . VAL B 1 271 ? 33.991  -43.148 216.605 1.00 23.50  ? 271 VAL B O   1 
ATOM 5096 C CB  . VAL B 1 271 ? 36.686  -43.488 214.890 1.00 30.54  ? 271 VAL B CB  1 
ATOM 5097 C CG1 . VAL B 1 271 ? 36.874  -44.923 215.309 1.00 24.00  ? 271 VAL B CG1 1 
ATOM 5098 C CG2 . VAL B 1 271 ? 37.588  -43.168 213.714 1.00 24.77  ? 271 VAL B CG2 1 
ATOM 5099 N N   . PRO B 1 272 ? 33.694  -44.985 215.347 1.00 23.60  ? 272 PRO B N   1 
ATOM 5100 C CA  . PRO B 1 272 ? 32.801  -45.536 216.380 1.00 21.48  ? 272 PRO B CA  1 
ATOM 5101 C C   . PRO B 1 272 ? 33.501  -45.963 217.679 1.00 20.62  ? 272 PRO B C   1 
ATOM 5102 O O   . PRO B 1 272 ? 34.630  -46.477 217.656 1.00 19.85  ? 272 PRO B O   1 
ATOM 5103 C CB  . PRO B 1 272 ? 32.129  -46.720 215.666 1.00 20.96  ? 272 PRO B CB  1 
ATOM 5104 C CG  . PRO B 1 272 ? 33.089  -47.092 214.561 1.00 25.78  ? 272 PRO B CG  1 
ATOM 5105 C CD  . PRO B 1 272 ? 33.614  -45.760 214.091 1.00 24.34  ? 272 PRO B CD  1 
ATOM 5106 N N   . VAL B 1 273 ? 32.854  -45.715 218.818 1.00 19.37  ? 273 VAL B N   1 
ATOM 5107 C CA  . VAL B 1 273 ? 33.441  -46.112 220.090 1.00 19.68  ? 273 VAL B CA  1 
ATOM 5108 C C   . VAL B 1 273 ? 33.165  -47.598 220.360 1.00 20.98  ? 273 VAL B C   1 
ATOM 5109 O O   . VAL B 1 273 ? 32.313  -48.230 219.704 1.00 18.57  ? 273 VAL B O   1 
ATOM 5110 C CB  . VAL B 1 273 ? 32.911  -45.268 221.289 1.00 21.28  ? 273 VAL B CB  1 
ATOM 5111 C CG1 . VAL B 1 273 ? 33.219  -43.790 221.076 1.00 21.51  ? 273 VAL B CG1 1 
ATOM 5112 C CG2 . VAL B 1 273 ? 31.424  -45.472 221.481 1.00 21.81  ? 273 VAL B CG2 1 
ATOM 5113 N N   . ALA B 1 274 ? 33.939  -48.155 221.285 1.00 17.33  ? 274 ALA B N   1 
ATOM 5114 C CA  . ALA B 1 274 ? 33.810  -49.533 221.714 1.00 16.71  ? 274 ALA B CA  1 
ATOM 5115 C C   . ALA B 1 274 ? 33.846  -49.389 223.234 1.00 16.52  ? 274 ALA B C   1 
ATOM 5116 O O   . ALA B 1 274 ? 33.851  -48.270 223.738 1.00 15.41  ? 274 ALA B O   1 
ATOM 5117 C CB  . ALA B 1 274 ? 34.990  -50.378 221.205 1.00 12.02  ? 274 ALA B CB  1 
ATOM 5118 N N   . HIS B 1 275 ? 33.905  -50.485 223.974 1.00 16.56  ? 275 HIS B N   1 
ATOM 5119 C CA  . HIS B 1 275 ? 33.932  -50.381 225.428 1.00 17.39  ? 275 HIS B CA  1 
ATOM 5120 C C   . HIS B 1 275 ? 34.697  -51.550 226.041 1.00 19.78  ? 275 HIS B C   1 
ATOM 5121 O O   . HIS B 1 275 ? 34.607  -52.669 225.550 1.00 20.90  ? 275 HIS B O   1 
ATOM 5122 C CB  . HIS B 1 275 ? 32.499  -50.361 225.954 1.00 18.47  ? 275 HIS B CB  1 
ATOM 5123 C CG  . HIS B 1 275 ? 32.403  -50.283 227.445 1.00 27.27  ? 275 HIS B CG  1 
ATOM 5124 N ND1 . HIS B 1 275 ? 32.920  -49.231 228.174 1.00 28.42  ? 275 HIS B ND1 1 
ATOM 5125 C CD2 . HIS B 1 275 ? 31.855  -51.133 228.347 1.00 28.10  ? 275 HIS B CD2 1 
ATOM 5126 C CE1 . HIS B 1 275 ? 32.693  -49.435 229.460 1.00 26.00  ? 275 HIS B CE1 1 
ATOM 5127 N NE2 . HIS B 1 275 ? 32.048  -50.582 229.591 1.00 29.74  ? 275 HIS B NE2 1 
ATOM 5128 N N   . ILE B 1 276 ? 35.450  -51.282 227.104 1.00 18.76  ? 276 ILE B N   1 
ATOM 5129 C CA  . ILE B 1 276 ? 36.211  -52.306 227.809 1.00 17.40  ? 276 ILE B CA  1 
ATOM 5130 C C   . ILE B 1 276 ? 35.692  -52.365 229.237 1.00 20.34  ? 276 ILE B C   1 
ATOM 5131 O O   . ILE B 1 276 ? 35.540  -51.331 229.877 1.00 22.08  ? 276 ILE B O   1 
ATOM 5132 C CB  . ILE B 1 276 ? 37.705  -51.948 227.878 1.00 19.30  ? 276 ILE B CB  1 
ATOM 5133 C CG1 . ILE B 1 276 ? 38.265  -51.776 226.470 1.00 18.95  ? 276 ILE B CG1 1 
ATOM 5134 C CG2 . ILE B 1 276 ? 38.490  -53.031 228.649 1.00 14.54  ? 276 ILE B CG2 1 
ATOM 5135 C CD1 . ILE B 1 276 ? 39.653  -51.252 226.478 1.00 19.38  ? 276 ILE B CD1 1 
ATOM 5136 N N   . GLU B 1 277 ? 35.381  -53.566 229.710 1.00 21.14  ? 277 GLU B N   1 
ATOM 5137 C CA  . GLU B 1 277 ? 34.896  -53.811 231.069 1.00 22.33  ? 277 GLU B CA  1 
ATOM 5138 C C   . GLU B 1 277 ? 35.807  -54.901 231.657 1.00 22.79  ? 277 GLU B C   1 
ATOM 5139 O O   . GLU B 1 277 ? 35.576  -56.098 231.464 1.00 21.62  ? 277 GLU B O   1 
ATOM 5140 C CB  . GLU B 1 277 ? 33.446  -54.304 231.029 1.00 26.87  ? 277 GLU B CB  1 
ATOM 5141 C CG  . GLU B 1 277 ? 32.751  -54.334 232.389 1.00 42.89  ? 277 GLU B CG  1 
ATOM 5142 C CD  . GLU B 1 277 ? 32.732  -52.961 233.069 1.00 60.34  ? 277 GLU B CD  1 
ATOM 5143 O OE1 . GLU B 1 277 ? 32.220  -51.982 232.465 1.00 62.71  ? 277 GLU B OE1 1 
ATOM 5144 O OE2 . GLU B 1 277 ? 33.235  -52.859 234.214 1.00 65.73  ? 277 GLU B OE2 1 
ATOM 5145 N N   . GLY B 1 278 ? 36.891  -54.480 232.297 1.00 23.46  ? 278 GLY B N   1 
ATOM 5146 C CA  . GLY B 1 278 ? 37.825  -55.435 232.868 1.00 22.34  ? 278 GLY B CA  1 
ATOM 5147 C C   . GLY B 1 278 ? 38.579  -56.116 231.747 1.00 24.79  ? 278 GLY B C   1 
ATOM 5148 O O   . GLY B 1 278 ? 39.352  -55.465 231.032 1.00 23.72  ? 278 GLY B O   1 
ATOM 5149 N N   . THR B 1 279 ? 38.334  -57.413 231.568 1.00 23.47  ? 279 THR B N   1 
ATOM 5150 C CA  . THR B 1 279 ? 38.996  -58.184 230.516 1.00 22.85  ? 279 THR B CA  1 
ATOM 5151 C C   . THR B 1 279 ? 38.087  -58.339 229.280 1.00 20.42  ? 279 THR B C   1 
ATOM 5152 O O   . THR B 1 279 ? 38.495  -58.926 228.276 1.00 19.45  ? 279 THR B O   1 
ATOM 5153 C CB  . THR B 1 279 ? 39.409  -59.603 231.032 1.00 24.84  ? 279 THR B CB  1 
ATOM 5154 O OG1 . THR B 1 279 ? 38.242  -60.315 231.464 1.00 26.83  ? 279 THR B OG1 1 
ATOM 5155 C CG2 . THR B 1 279 ? 40.372  -59.498 232.199 1.00 23.14  ? 279 THR B CG2 1 
ATOM 5156 N N   . LYS B 1 280 ? 36.859  -57.835 229.357 1.00 18.64  ? 280 LYS B N   1 
ATOM 5157 C CA  . LYS B 1 280 ? 35.924  -57.955 228.238 1.00 18.08  ? 280 LYS B CA  1 
ATOM 5158 C C   . LYS B 1 280 ? 35.980  -56.780 227.281 1.00 17.29  ? 280 LYS B C   1 
ATOM 5159 O O   . LYS B 1 280 ? 35.808  -55.631 227.689 1.00 15.62  ? 280 LYS B O   1 
ATOM 5160 C CB  . LYS B 1 280 ? 34.495  -58.133 228.739 1.00 17.33  ? 280 LYS B CB  1 
ATOM 5161 C CG  . LYS B 1 280 ? 34.291  -59.441 229.479 1.00 25.98  ? 280 LYS B CG  1 
ATOM 5162 C CD  . LYS B 1 280 ? 32.891  -59.582 230.067 1.00 35.69  ? 280 LYS B CD  1 
ATOM 5163 C CE  . LYS B 1 280 ? 32.814  -60.866 230.885 1.00 42.71  ? 280 LYS B CE  1 
ATOM 5164 N NZ  . LYS B 1 280 ? 31.584  -60.936 231.708 1.00 51.57  ? 280 LYS B NZ  1 
ATOM 5165 N N   . TYR B 1 281 ? 36.250  -57.066 226.015 1.00 17.32  ? 281 TYR B N   1 
ATOM 5166 C CA  . TYR B 1 281 ? 36.310  -56.025 224.991 1.00 16.58  ? 281 TYR B CA  1 
ATOM 5167 C C   . TYR B 1 281 ? 35.035  -56.102 224.166 1.00 14.93  ? 281 TYR B C   1 
ATOM 5168 O O   . TYR B 1 281 ? 34.858  -57.033 223.383 1.00 17.07  ? 281 TYR B O   1 
ATOM 5169 C CB  . TYR B 1 281 ? 37.559  -56.212 224.126 1.00 11.73  ? 281 TYR B CB  1 
ATOM 5170 C CG  . TYR B 1 281 ? 38.820  -55.790 224.851 1.00 19.67  ? 281 TYR B CG  1 
ATOM 5171 C CD1 . TYR B 1 281 ? 39.246  -56.457 225.998 1.00 14.17  ? 281 TYR B CD1 1 
ATOM 5172 C CD2 . TYR B 1 281 ? 39.561  -54.696 224.417 1.00 17.30  ? 281 TYR B CD2 1 
ATOM 5173 C CE1 . TYR B 1 281 ? 40.369  -56.039 226.693 1.00 18.35  ? 281 TYR B CE1 1 
ATOM 5174 C CE2 . TYR B 1 281 ? 40.691  -54.270 225.114 1.00 17.53  ? 281 TYR B CE2 1 
ATOM 5175 C CZ  . TYR B 1 281 ? 41.085  -54.949 226.249 1.00 17.06  ? 281 TYR B CZ  1 
ATOM 5176 O OH  . TYR B 1 281 ? 42.191  -54.531 226.947 1.00 18.39  ? 281 TYR B OH  1 
ATOM 5177 N N   . HIS B 1 282 ? 34.151  -55.132 224.380 1.00 15.49  ? 282 HIS B N   1 
ATOM 5178 C CA  . HIS B 1 282 ? 32.829  -55.058 223.731 1.00 16.96  ? 282 HIS B CA  1 
ATOM 5179 C C   . HIS B 1 282 ? 32.717  -54.222 222.476 1.00 18.77  ? 282 HIS B C   1 
ATOM 5180 O O   . HIS B 1 282 ? 33.282  -53.125 222.394 1.00 19.30  ? 282 HIS B O   1 
ATOM 5181 C CB  . HIS B 1 282 ? 31.800  -54.390 224.669 1.00 15.96  ? 282 HIS B CB  1 
ATOM 5182 C CG  . HIS B 1 282 ? 31.542  -55.122 225.946 1.00 16.06  ? 282 HIS B CG  1 
ATOM 5183 N ND1 . HIS B 1 282 ? 30.382  -55.834 226.166 1.00 13.11  ? 282 HIS B ND1 1 
ATOM 5184 C CD2 . HIS B 1 282 ? 32.276  -55.234 227.079 1.00 16.39  ? 282 HIS B CD2 1 
ATOM 5185 C CE1 . HIS B 1 282 ? 30.415  -56.360 227.377 1.00 15.07  ? 282 HIS B CE1 1 
ATOM 5186 N NE2 . HIS B 1 282 ? 31.553  -56.010 227.952 1.00 18.02  ? 282 HIS B NE2 1 
ATOM 5187 N N   . LEU B 1 283 ? 31.877  -54.682 221.561 1.00 19.21  ? 283 LEU B N   1 
ATOM 5188 C CA  . LEU B 1 283 ? 31.550  -53.907 220.371 1.00 22.98  ? 283 LEU B CA  1 
ATOM 5189 C C   . LEU B 1 283 ? 30.300  -53.141 220.848 1.00 23.66  ? 283 LEU B C   1 
ATOM 5190 O O   . LEU B 1 283 ? 29.591  -53.626 221.740 1.00 24.92  ? 283 LEU B O   1 
ATOM 5191 C CB  . LEU B 1 283 ? 31.175  -54.814 219.205 1.00 15.37  ? 283 LEU B CB  1 
ATOM 5192 C CG  . LEU B 1 283 ? 32.387  -55.415 218.528 1.00 20.87  ? 283 LEU B CG  1 
ATOM 5193 C CD1 . LEU B 1 283 ? 31.928  -56.417 217.506 1.00 21.70  ? 283 LEU B CD1 1 
ATOM 5194 C CD2 . LEU B 1 283 ? 33.208  -54.296 217.885 1.00 15.59  ? 283 LEU B CD2 1 
ATOM 5195 N N   . LYS B 1 284 ? 30.070  -51.932 220.345 1.00 23.20  ? 284 LYS B N   1 
ATOM 5196 C CA  . LYS B 1 284 ? 28.888  -51.165 220.749 1.00 22.70  ? 284 LYS B CA  1 
ATOM 5197 C C   . LYS B 1 284 ? 27.880  -51.145 219.610 1.00 23.11  ? 284 LYS B C   1 
ATOM 5198 O O   . LYS B 1 284 ? 26.816  -50.532 219.709 1.00 21.90  ? 284 LYS B O   1 
ATOM 5199 C CB  . LYS B 1 284 ? 29.231  -49.725 221.160 1.00 24.10  ? 284 LYS B CB  1 
ATOM 5200 C CG  . LYS B 1 284 ? 30.102  -49.591 222.404 1.00 38.72  ? 284 LYS B CG  1 
ATOM 5201 C CD  . LYS B 1 284 ? 29.538  -50.333 223.614 1.00 44.75  ? 284 LYS B CD  1 
ATOM 5202 C CE  . LYS B 1 284 ? 28.317  -49.663 224.221 1.00 52.70  ? 284 LYS B CE  1 
ATOM 5203 N NZ  . LYS B 1 284 ? 27.798  -50.481 225.370 1.00 58.28  ? 284 LYS B NZ  1 
ATOM 5204 N N   . SER B 1 285 ? 28.215  -51.826 218.528 1.00 19.91  ? 285 SER B N   1 
ATOM 5205 C CA  . SER B 1 285 ? 27.319  -51.890 217.404 1.00 22.42  ? 285 SER B CA  1 
ATOM 5206 C C   . SER B 1 285 ? 27.499  -53.274 216.800 1.00 21.53  ? 285 SER B C   1 
ATOM 5207 O O   . SER B 1 285 ? 28.621  -53.798 216.769 1.00 23.03  ? 285 SER B O   1 
ATOM 5208 C CB  . SER B 1 285 ? 27.679  -50.792 216.408 1.00 28.86  ? 285 SER B CB  1 
ATOM 5209 O OG  . SER B 1 285 ? 26.692  -50.693 215.405 1.00 48.10  ? 285 SER B OG  1 
ATOM 5210 N N   . GLY B 1 286 ? 26.403  -53.892 216.367 1.00 18.79  ? 286 GLY B N   1 
ATOM 5211 C CA  . GLY B 1 286 ? 26.495  -55.222 215.789 1.00 20.20  ? 286 GLY B CA  1 
ATOM 5212 C C   . GLY B 1 286 ? 25.133  -55.873 215.743 1.00 22.11  ? 286 GLY B C   1 
ATOM 5213 O O   . GLY B 1 286 ? 24.188  -55.329 216.318 1.00 23.59  ? 286 GLY B O   1 
ATOM 5214 N N   . HIS B 1 287 ? 25.045  -57.051 215.124 1.00 23.47  ? 287 HIS B N   1 
ATOM 5215 C CA  . HIS B 1 287 ? 23.771  -57.771 214.969 1.00 24.53  ? 287 HIS B CA  1 
ATOM 5216 C C   . HIS B 1 287 ? 24.008  -59.269 214.812 1.00 25.29  ? 287 HIS B C   1 
ATOM 5217 O O   . HIS B 1 287 ? 25.115  -59.693 214.461 1.00 25.45  ? 287 HIS B O   1 
ATOM 5218 C CB  . HIS B 1 287 ? 23.072  -57.296 213.695 1.00 28.20  ? 287 HIS B CB  1 
ATOM 5219 C CG  . HIS B 1 287 ? 23.852  -57.600 212.452 1.00 34.05  ? 287 HIS B CG  1 
ATOM 5220 N ND1 . HIS B 1 287 ? 24.845  -56.765 211.975 1.00 33.21  ? 287 HIS B ND1 1 
ATOM 5221 C CD2 . HIS B 1 287 ? 23.870  -58.700 211.661 1.00 32.19  ? 287 HIS B CD2 1 
ATOM 5222 C CE1 . HIS B 1 287 ? 25.451  -57.347 210.954 1.00 36.57  ? 287 HIS B CE1 1 
ATOM 5223 N NE2 . HIS B 1 287 ? 24.878  -58.521 210.744 1.00 38.29  ? 287 HIS B NE2 1 
ATOM 5224 N N   . VAL B 1 288 ? 22.934  -60.045 214.959 1.00 24.64  ? 288 VAL B N   1 
ATOM 5225 C CA  . VAL B 1 288 ? 22.994  -61.500 214.825 1.00 21.46  ? 288 VAL B CA  1 
ATOM 5226 C C   . VAL B 1 288 ? 21.570  -61.990 214.518 1.00 22.28  ? 288 VAL B C   1 
ATOM 5227 O O   . VAL B 1 288 ? 20.593  -61.350 214.922 1.00 21.47  ? 288 VAL B O   1 
ATOM 5228 C CB  . VAL B 1 288 ? 23.542  -62.170 216.147 1.00 19.14  ? 288 VAL B CB  1 
ATOM 5229 C CG1 . VAL B 1 288 ? 22.517  -62.104 217.258 1.00 10.31  ? 288 VAL B CG1 1 
ATOM 5230 C CG2 . VAL B 1 288 ? 23.951  -63.612 215.898 1.00 19.54  ? 288 VAL B CG2 1 
ATOM 5231 N N   . THR B 1 289 ? 21.438  -63.057 213.734 1.00 19.77  ? 289 THR B N   1 
ATOM 5232 C CA  . THR B 1 289 ? 20.109  -63.583 213.450 1.00 22.44  ? 289 THR B CA  1 
ATOM 5233 C C   . THR B 1 289 ? 19.875  -64.826 214.325 1.00 23.23  ? 289 THR B C   1 
ATOM 5234 O O   . THR B 1 289 ? 20.772  -65.666 214.501 1.00 22.12  ? 289 THR B O   1 
ATOM 5235 C CB  . THR B 1 289 ? 19.899  -63.908 211.936 1.00 24.60  ? 289 THR B CB  1 
ATOM 5236 O OG1 . THR B 1 289 ? 20.758  -64.973 211.549 1.00 43.79  ? 289 THR B OG1 1 
ATOM 5237 C CG2 . THR B 1 289 ? 20.262  -62.733 211.078 1.00 20.88  ? 289 THR B CG2 1 
ATOM 5238 N N   . CYS B 1 290 ? 18.696  -64.902 214.931 1.00 22.76  ? 290 CYS B N   1 
ATOM 5239 C CA  . CYS B 1 290 ? 18.348  -66.027 215.784 1.00 24.38  ? 290 CYS B CA  1 
ATOM 5240 C C   . CYS B 1 290 ? 17.026  -66.608 215.333 1.00 24.09  ? 290 CYS B C   1 
ATOM 5241 O O   . CYS B 1 290 ? 16.236  -65.932 214.677 1.00 23.77  ? 290 CYS B O   1 
ATOM 5242 C CB  . CYS B 1 290 ? 18.167  -65.580 217.234 1.00 18.65  ? 290 CYS B CB  1 
ATOM 5243 S SG  . CYS B 1 290 ? 19.615  -64.825 218.008 1.00 23.43  ? 290 CYS B SG  1 
ATOM 5244 N N   . GLU B 1 291 ? 16.816  -67.874 215.665 1.00 25.53  ? 291 GLU B N   1 
ATOM 5245 C CA  . GLU B 1 291 ? 15.570  -68.577 215.384 1.00 26.47  ? 291 GLU B CA  1 
ATOM 5246 C C   . GLU B 1 291 ? 15.015  -68.847 216.782 1.00 26.21  ? 291 GLU B C   1 
ATOM 5247 O O   . GLU B 1 291 ? 15.736  -69.365 217.647 1.00 26.15  ? 291 GLU B O   1 
ATOM 5248 C CB  . GLU B 1 291 ? 15.813  -69.901 214.653 1.00 27.88  ? 291 GLU B CB  1 
ATOM 5249 C CG  . GLU B 1 291 ? 16.320  -69.739 213.226 1.00 47.12  ? 291 GLU B CG  1 
ATOM 5250 C CD  . GLU B 1 291 ? 16.342  -71.048 212.456 1.00 56.14  ? 291 GLU B CD  1 
ATOM 5251 O OE1 . GLU B 1 291 ? 15.261  -71.649 212.256 1.00 61.51  ? 291 GLU B OE1 1 
ATOM 5252 O OE2 . GLU B 1 291 ? 17.437  -71.470 212.036 1.00 54.87  ? 291 GLU B OE2 1 
ATOM 5253 N N   . VAL B 1 292 ? 13.784  -68.413 217.028 1.00 24.34  ? 292 VAL B N   1 
ATOM 5254 C CA  . VAL B 1 292 ? 13.144  -68.594 218.323 1.00 25.34  ? 292 VAL B CA  1 
ATOM 5255 C C   . VAL B 1 292 ? 12.047  -69.654 218.193 1.00 26.23  ? 292 VAL B C   1 
ATOM 5256 O O   . VAL B 1 292 ? 11.162  -69.540 217.338 1.00 25.68  ? 292 VAL B O   1 
ATOM 5257 C CB  . VAL B 1 292 ? 12.512  -67.271 218.825 1.00 27.31  ? 292 VAL B CB  1 
ATOM 5258 C CG1 . VAL B 1 292 ? 12.010  -67.439 220.240 1.00 26.74  ? 292 VAL B CG1 1 
ATOM 5259 C CG2 . VAL B 1 292 ? 13.510  -66.134 218.750 1.00 30.47  ? 292 VAL B CG2 1 
ATOM 5260 N N   . GLY B 1 293 ? 12.131  -70.696 219.015 1.00 24.98  ? 293 GLY B N   1 
ATOM 5261 C CA  . GLY B 1 293 ? 11.145  -71.765 218.982 1.00 26.18  ? 293 GLY B CA  1 
ATOM 5262 C C   . GLY B 1 293 ? 10.135  -71.499 220.072 1.00 28.36  ? 293 GLY B C   1 
ATOM 5263 O O   . GLY B 1 293 ? 10.501  -71.461 221.261 1.00 27.09  ? 293 GLY B O   1 
ATOM 5264 N N   . LEU B 1 294 ? 8.871   -71.360 219.674 1.00 28.73  ? 294 LEU B N   1 
ATOM 5265 C CA  . LEU B 1 294 ? 7.789   -71.038 220.603 1.00 30.88  ? 294 LEU B CA  1 
ATOM 5266 C C   . LEU B 1 294 ? 6.852   -72.179 221.008 1.00 32.68  ? 294 LEU B C   1 
ATOM 5267 O O   . LEU B 1 294 ? 6.080   -72.044 221.964 1.00 31.16  ? 294 LEU B O   1 
ATOM 5268 C CB  . LEU B 1 294 ? 6.958   -69.892 220.016 1.00 32.84  ? 294 LEU B CB  1 
ATOM 5269 C CG  . LEU B 1 294 ? 7.691   -68.606 219.613 1.00 28.71  ? 294 LEU B CG  1 
ATOM 5270 C CD1 . LEU B 1 294 ? 6.741   -67.711 218.875 1.00 26.15  ? 294 LEU B CD1 1 
ATOM 5271 C CD2 . LEU B 1 294 ? 8.245   -67.902 220.840 1.00 26.14  ? 294 LEU B CD2 1 
ATOM 5272 N N   . GLU B 1 295 ? 6.947   -73.308 220.313 1.00 33.62  ? 295 GLU B N   1 
ATOM 5273 C CA  . GLU B 1 295 ? 6.080   -74.453 220.567 1.00 34.96  ? 295 GLU B CA  1 
ATOM 5274 C C   . GLU B 1 295 ? 5.905   -74.933 222.004 1.00 32.73  ? 295 GLU B C   1 
ATOM 5275 O O   . GLU B 1 295 ? 4.832   -75.414 222.344 1.00 33.20  ? 295 GLU B O   1 
ATOM 5276 C CB  . GLU B 1 295 ? 6.395   -75.628 219.615 1.00 40.71  ? 295 GLU B CB  1 
ATOM 5277 C CG  . GLU B 1 295 ? 7.832   -76.174 219.630 1.00 54.69  ? 295 GLU B CG  1 
ATOM 5278 C CD  . GLU B 1 295 ? 8.885   -75.197 219.084 1.00 64.08  ? 295 GLU B CD  1 
ATOM 5279 O OE1 . GLU B 1 295 ? 8.713   -74.651 217.965 1.00 63.70  ? 295 GLU B OE1 1 
ATOM 5280 O OE2 . GLU B 1 295 ? 9.900   -74.983 219.785 1.00 69.19  ? 295 GLU B OE2 1 
ATOM 5281 N N   . LYS B 1 296 ? 6.914   -74.776 222.854 1.00 32.49  ? 296 LYS B N   1 
ATOM 5282 C CA  . LYS B 1 296 ? 6.796   -75.222 224.252 1.00 35.37  ? 296 LYS B CA  1 
ATOM 5283 C C   . LYS B 1 296 ? 6.272   -74.148 225.224 1.00 36.05  ? 296 LYS B C   1 
ATOM 5284 O O   . LYS B 1 296 ? 6.195   -74.388 226.435 1.00 37.25  ? 296 LYS B O   1 
ATOM 5285 C CB  . LYS B 1 296 ? 8.133   -75.759 224.785 1.00 37.21  ? 296 LYS B CB  1 
ATOM 5286 C CG  . LYS B 1 296 ? 8.712   -76.927 224.020 1.00 44.61  ? 296 LYS B CG  1 
ATOM 5287 C CD  . LYS B 1 296 ? 7.773   -78.112 224.021 1.00 55.34  ? 296 LYS B CD  1 
ATOM 5288 C CE  . LYS B 1 296 ? 8.225   -79.163 223.021 1.00 63.56  ? 296 LYS B CE  1 
ATOM 5289 N NZ  . LYS B 1 296 ? 7.225   -80.254 222.884 1.00 68.01  ? 296 LYS B NZ  1 
ATOM 5290 N N   . LEU B 1 297 ? 5.947   -72.963 224.715 1.00 34.35  ? 297 LEU B N   1 
ATOM 5291 C CA  . LEU B 1 297 ? 5.442   -71.901 225.581 1.00 34.88  ? 297 LEU B CA  1 
ATOM 5292 C C   . LEU B 1 297 ? 3.931   -72.030 225.811 1.00 34.86  ? 297 LEU B C   1 
ATOM 5293 O O   . LEU B 1 297 ? 3.169   -72.301 224.888 1.00 36.65  ? 297 LEU B O   1 
ATOM 5294 C CB  . LEU B 1 297 ? 5.807   -70.509 225.026 1.00 32.59  ? 297 LEU B CB  1 
ATOM 5295 C CG  . LEU B 1 297 ? 7.297   -70.116 225.020 1.00 26.10  ? 297 LEU B CG  1 
ATOM 5296 C CD1 . LEU B 1 297 ? 7.453   -68.796 224.345 1.00 22.47  ? 297 LEU B CD1 1 
ATOM 5297 C CD2 . LEU B 1 297 ? 7.878   -70.068 226.426 1.00 24.19  ? 297 LEU B CD2 1 
ATOM 5298 N N   . LYS B 1 298 ? 3.513   -71.809 227.051 1.00 34.13  ? 298 LYS B N   1 
ATOM 5299 C CA  . LYS B 1 298 ? 2.105   -71.903 227.448 1.00 33.60  ? 298 LYS B CA  1 
ATOM 5300 C C   . LYS B 1 298 ? 1.669   -70.625 228.193 1.00 31.03  ? 298 LYS B C   1 
ATOM 5301 O O   . LYS B 1 298 ? 2.465   -70.016 228.916 1.00 30.27  ? 298 LYS B O   1 
ATOM 5302 C CB  . LYS B 1 298 ? 1.917   -73.145 228.346 1.00 38.11  ? 298 LYS B CB  1 
ATOM 5303 C CG  . LYS B 1 298 ? 2.948   -73.229 229.485 1.00 44.16  ? 298 LYS B CG  1 
ATOM 5304 C CD  . LYS B 1 298 ? 2.954   -74.557 230.271 1.00 48.53  ? 298 LYS B CD  1 
ATOM 5305 C CE  . LYS B 1 298 ? 4.097   -74.538 231.317 1.00 48.93  ? 298 LYS B CE  1 
ATOM 5306 N NZ  . LYS B 1 298 ? 4.285   -75.761 232.156 1.00 52.51  ? 298 LYS B NZ  1 
ATOM 5307 N N   . MET B 1 299 ? 0.427   -70.190 227.981 1.00 30.16  ? 299 MET B N   1 
ATOM 5308 C CA  . MET B 1 299 ? -0.087  -68.987 228.646 1.00 31.14  ? 299 MET B CA  1 
ATOM 5309 C C   . MET B 1 299 ? -0.419  -69.257 230.107 1.00 30.15  ? 299 MET B C   1 
ATOM 5310 O O   . MET B 1 299 ? -0.651  -70.399 230.503 1.00 30.14  ? 299 MET B O   1 
ATOM 5311 C CB  . MET B 1 299 ? -1.323  -68.448 227.942 1.00 32.74  ? 299 MET B CB  1 
ATOM 5312 C CG  . MET B 1 299 ? -1.056  -67.850 226.589 1.00 36.86  ? 299 MET B CG  1 
ATOM 5313 S SD  . MET B 1 299 ? -2.533  -67.015 226.046 1.00 46.08  ? 299 MET B SD  1 
ATOM 5314 C CE  . MET B 1 299 ? -1.858  -65.620 225.163 1.00 57.19  ? 299 MET B CE  1 
ATOM 5315 N N   . LYS B 1 300 ? -0.500  -68.199 230.896 1.00 28.76  ? 300 LYS B N   1 
ATOM 5316 C CA  . LYS B 1 300 ? -0.790  -68.352 232.313 1.00 29.82  ? 300 LYS B CA  1 
ATOM 5317 C C   . LYS B 1 300 ? -2.163  -67.772 232.685 1.00 30.79  ? 300 LYS B C   1 
ATOM 5318 O O   . LYS B 1 300 ? -2.564  -66.731 232.164 1.00 32.11  ? 300 LYS B O   1 
ATOM 5319 C CB  . LYS B 1 300 ? 0.321   -67.675 233.133 1.00 29.79  ? 300 LYS B CB  1 
ATOM 5320 C CG  . LYS B 1 300 ? 0.306   -67.966 234.630 1.00 43.37  ? 300 LYS B CG  1 
ATOM 5321 C CD  . LYS B 1 300 ? 1.427   -67.231 235.349 1.00 48.40  ? 300 LYS B CD  1 
ATOM 5322 C CE  . LYS B 1 300 ? 1.310   -67.387 236.855 1.00 59.01  ? 300 LYS B CE  1 
ATOM 5323 N NZ  . LYS B 1 300 ? 2.326   -66.567 237.570 1.00 62.12  ? 300 LYS B NZ  1 
ATOM 5324 N N   . GLY B 1 301 ? -2.892  -68.497 233.534 1.00 29.90  ? 301 GLY B N   1 
ATOM 5325 C CA  . GLY B 1 301 ? -4.182  -68.050 234.022 1.00 30.30  ? 301 GLY B CA  1 
ATOM 5326 C C   . GLY B 1 301 ? -5.415  -68.200 233.161 1.00 30.49  ? 301 GLY B C   1 
ATOM 5327 O O   . GLY B 1 301 ? -6.422  -67.541 233.432 1.00 32.12  ? 301 GLY B O   1 
ATOM 5328 N N   . LEU B 1 302 ? -5.379  -69.087 232.173 1.00 30.45  ? 302 LEU B N   1 
ATOM 5329 C CA  . LEU B 1 302 ? -6.532  -69.305 231.292 1.00 33.38  ? 302 LEU B CA  1 
ATOM 5330 C C   . LEU B 1 302 ? -7.791  -69.896 231.955 1.00 33.83  ? 302 LEU B C   1 
ATOM 5331 O O   . LEU B 1 302 ? -8.899  -69.754 231.439 1.00 35.69  ? 302 LEU B O   1 
ATOM 5332 C CB  . LEU B 1 302 ? -6.137  -70.183 230.103 1.00 34.50  ? 302 LEU B CB  1 
ATOM 5333 C CG  . LEU B 1 302 ? -5.259  -69.583 229.007 1.00 36.23  ? 302 LEU B CG  1 
ATOM 5334 C CD1 . LEU B 1 302 ? -4.903  -70.670 228.014 1.00 35.26  ? 302 LEU B CD1 1 
ATOM 5335 C CD2 . LEU B 1 302 ? -5.995  -68.458 228.302 1.00 39.67  ? 302 LEU B CD2 1 
ATOM 5336 N N   . THR B 1 303 ? -7.636  -70.558 233.091 1.00 32.90  ? 303 THR B N   1 
ATOM 5337 C CA  . THR B 1 303 ? -8.788  -71.151 233.739 1.00 33.77  ? 303 THR B CA  1 
ATOM 5338 C C   . THR B 1 303 ? -9.282  -70.363 234.958 1.00 35.90  ? 303 THR B C   1 
ATOM 5339 O O   . THR B 1 303 ? -10.071 -70.882 235.762 1.00 35.15  ? 303 THR B O   1 
ATOM 5340 C CB  . THR B 1 303 ? -8.488  -72.598 234.134 1.00 34.77  ? 303 THR B CB  1 
ATOM 5341 O OG1 . THR B 1 303 ? -7.542  -72.611 235.214 1.00 31.30  ? 303 THR B OG1 1 
ATOM 5342 C CG2 . THR B 1 303 ? -7.918  -73.352 232.944 1.00 28.72  ? 303 THR B CG2 1 
ATOM 5343 N N   . TYR B 1 304 ? -8.786  -69.139 235.139 1.00 33.66  ? 304 TYR B N   1 
ATOM 5344 C CA  . TYR B 1 304 ? -9.243  -68.320 236.263 1.00 31.77  ? 304 TYR B CA  1 
ATOM 5345 C C   . TYR B 1 304 ? -10.617 -67.786 235.882 1.00 29.72  ? 304 TYR B C   1 
ATOM 5346 O O   . TYR B 1 304 ? -10.972 -67.782 234.699 1.00 25.71  ? 304 TYR B O   1 
ATOM 5347 C CB  . TYR B 1 304 ? -8.361  -67.092 236.430 1.00 32.72  ? 304 TYR B CB  1 
ATOM 5348 C CG  . TYR B 1 304 ? -6.928  -67.327 236.813 1.00 39.25  ? 304 TYR B CG  1 
ATOM 5349 C CD1 . TYR B 1 304 ? -6.495  -68.560 237.303 1.00 38.59  ? 304 TYR B CD1 1 
ATOM 5350 C CD2 . TYR B 1 304 ? -6.004  -66.280 236.728 1.00 36.88  ? 304 TYR B CD2 1 
ATOM 5351 C CE1 . TYR B 1 304 ? -5.176  -68.741 237.707 1.00 37.01  ? 304 TYR B CE1 1 
ATOM 5352 C CE2 . TYR B 1 304 ? -4.696  -66.446 237.123 1.00 35.06  ? 304 TYR B CE2 1 
ATOM 5353 C CZ  . TYR B 1 304 ? -4.281  -67.673 237.615 1.00 38.99  ? 304 TYR B CZ  1 
ATOM 5354 O OH  . TYR B 1 304 ? -2.976  -67.814 238.025 1.00 30.89  ? 304 TYR B OH  1 
ATOM 5355 N N   . THR B 1 305 ? -11.391 -67.327 236.859 1.00 30.33  ? 305 THR B N   1 
ATOM 5356 C CA  . THR B 1 305 ? -12.673 -66.718 236.517 1.00 32.22  ? 305 THR B CA  1 
ATOM 5357 C C   . THR B 1 305 ? -12.371 -65.262 236.193 1.00 30.75  ? 305 THR B C   1 
ATOM 5358 O O   . THR B 1 305 ? -11.290 -64.753 236.523 1.00 29.47  ? 305 THR B O   1 
ATOM 5359 C CB  . THR B 1 305 ? -13.692 -66.711 237.672 1.00 33.33  ? 305 THR B CB  1 
ATOM 5360 O OG1 . THR B 1 305 ? -13.037 -66.371 238.902 1.00 36.55  ? 305 THR B OG1 1 
ATOM 5361 C CG2 . THR B 1 305 ? -14.416 -68.038 237.772 1.00 44.06  ? 305 THR B CG2 1 
ATOM 5362 N N   . MET B 1 306 ? -13.328 -64.592 235.564 1.00 30.26  ? 306 MET B N   1 
ATOM 5363 C CA  . MET B 1 306 ? -13.180 -63.182 235.231 1.00 30.75  ? 306 MET B CA  1 
ATOM 5364 C C   . MET B 1 306 ? -13.167 -62.389 236.522 1.00 29.63  ? 306 MET B C   1 
ATOM 5365 O O   . MET B 1 306 ? -13.830 -62.757 237.499 1.00 30.66  ? 306 MET B O   1 
ATOM 5366 C CB  . MET B 1 306 ? -14.349 -62.691 234.375 1.00 34.02  ? 306 MET B CB  1 
ATOM 5367 C CG  . MET B 1 306 ? -14.431 -63.309 232.990 1.00 39.71  ? 306 MET B CG  1 
ATOM 5368 S SD  . MET B 1 306 ? -12.943 -63.039 232.009 1.00 54.97  ? 306 MET B SD  1 
ATOM 5369 C CE  . MET B 1 306 ? -12.732 -61.312 232.194 1.00 37.31  ? 306 MET B CE  1 
ATOM 5370 N N   . CYS B 1 307 ? -12.366 -61.336 236.548 1.00 27.17  ? 307 CYS B N   1 
ATOM 5371 C CA  . CYS B 1 307 ? -12.297 -60.476 237.715 1.00 27.77  ? 307 CYS B CA  1 
ATOM 5372 C C   . CYS B 1 307 ? -13.628 -59.742 237.854 1.00 26.00  ? 307 CYS B C   1 
ATOM 5373 O O   . CYS B 1 307 ? -14.323 -59.491 236.866 1.00 23.41  ? 307 CYS B O   1 
ATOM 5374 C CB  . CYS B 1 307 ? -11.190 -59.431 237.547 1.00 30.45  ? 307 CYS B CB  1 
ATOM 5375 S SG  . CYS B 1 307 ? -9.509  -60.108 237.477 1.00 27.12  ? 307 CYS B SG  1 
ATOM 5376 N N   . ASP B 1 308 ? -13.974 -59.411 239.089 1.00 26.18  ? 308 ASP B N   1 
ATOM 5377 C CA  . ASP B 1 308 ? -15.187 -58.658 239.392 1.00 27.79  ? 308 ASP B CA  1 
ATOM 5378 C C   . ASP B 1 308 ? -15.069 -57.328 238.618 1.00 27.42  ? 308 ASP B C   1 
ATOM 5379 O O   . ASP B 1 308 ? -14.190 -56.506 238.930 1.00 25.65  ? 308 ASP B O   1 
ATOM 5380 C CB  . ASP B 1 308 ? -15.203 -58.401 240.910 1.00 30.56  ? 308 ASP B CB  1 
ATOM 5381 C CG  . ASP B 1 308 ? -16.447 -57.672 241.389 1.00 36.66  ? 308 ASP B CG  1 
ATOM 5382 O OD1 . ASP B 1 308 ? -17.000 -56.836 240.643 1.00 28.98  ? 308 ASP B OD1 1 
ATOM 5383 O OD2 . ASP B 1 308 ? -16.850 -57.921 242.550 1.00 41.98  ? 308 ASP B OD2 1 
ATOM 5384 N N   . LYS B 1 309 ? -15.980 -57.102 237.668 1.00 27.32  ? 309 LYS B N   1 
ATOM 5385 C CA  . LYS B 1 309 ? -15.993 -55.892 236.819 1.00 29.67  ? 309 LYS B CA  1 
ATOM 5386 C C   . LYS B 1 309 ? -16.144 -54.557 237.551 1.00 29.13  ? 309 LYS B C   1 
ATOM 5387 O O   . LYS B 1 309 ? -15.942 -53.491 236.975 1.00 29.23  ? 309 LYS B O   1 
ATOM 5388 C CB  . LYS B 1 309 ? -17.102 -56.009 235.774 1.00 35.52  ? 309 LYS B CB  1 
ATOM 5389 C CG  . LYS B 1 309 ? -16.875 -57.114 234.764 1.00 48.17  ? 309 LYS B CG  1 
ATOM 5390 C CD  . LYS B 1 309 ? -18.065 -57.266 233.825 1.00 66.08  ? 309 LYS B CD  1 
ATOM 5391 C CE  . LYS B 1 309 ? -17.824 -58.355 232.774 1.00 67.43  ? 309 LYS B CE  1 
ATOM 5392 N NZ  . LYS B 1 309 ? -19.080 -58.670 232.018 1.00 72.70  ? 309 LYS B NZ  1 
ATOM 5393 N N   . THR B 1 310 ? -16.461 -54.638 238.832 1.00 28.86  ? 310 THR B N   1 
ATOM 5394 C CA  . THR B 1 310 ? -16.693 -53.496 239.706 1.00 30.45  ? 310 THR B CA  1 
ATOM 5395 C C   . THR B 1 310 ? -15.501 -53.009 240.533 1.00 28.69  ? 310 THR B C   1 
ATOM 5396 O O   . THR B 1 310 ? -15.543 -51.910 241.097 1.00 26.65  ? 310 THR B O   1 
ATOM 5397 C CB  . THR B 1 310 ? -17.815 -53.920 240.694 1.00 32.56  ? 310 THR B CB  1 
ATOM 5398 O OG1 . THR B 1 310 ? -19.067 -53.873 240.009 1.00 38.74  ? 310 THR B OG1 1 
ATOM 5399 C CG2 . THR B 1 310 ? -17.841 -53.104 241.969 1.00 38.83  ? 310 THR B CG2 1 
ATOM 5400 N N   . LYS B 1 311 ? -14.434 -53.801 240.589 1.00 27.40  ? 311 LYS B N   1 
ATOM 5401 C CA  . LYS B 1 311 ? -13.307 -53.458 241.455 1.00 27.27  ? 311 LYS B CA  1 
ATOM 5402 C C   . LYS B 1 311 ? -11.992 -52.932 240.865 1.00 25.36  ? 311 LYS B C   1 
ATOM 5403 O O   . LYS B 1 311 ? -10.948 -53.024 241.524 1.00 24.91  ? 311 LYS B O   1 
ATOM 5404 C CB  . LYS B 1 311 ? -13.007 -54.652 242.360 1.00 29.50  ? 311 LYS B CB  1 
ATOM 5405 C CG  . LYS B 1 311 ? -14.231 -55.382 242.859 1.00 36.80  ? 311 LYS B CG  1 
ATOM 5406 C CD  . LYS B 1 311 ? -14.606 -54.944 244.240 1.00 49.62  ? 311 LYS B CD  1 
ATOM 5407 C CE  . LYS B 1 311 ? -15.470 -56.002 244.904 1.00 56.58  ? 311 LYS B CE  1 
ATOM 5408 N NZ  . LYS B 1 311 ? -15.389 -55.917 246.389 1.00 63.30  ? 311 LYS B NZ  1 
ATOM 5409 N N   . PHE B 1 312 ? -12.026 -52.378 239.657 1.00 24.04  ? 312 PHE B N   1 
ATOM 5410 C CA  . PHE B 1 312 ? -10.815 -51.828 239.039 1.00 19.91  ? 312 PHE B CA  1 
ATOM 5411 C C   . PHE B 1 312 ? -10.720 -50.309 239.156 1.00 21.37  ? 312 PHE B C   1 
ATOM 5412 O O   . PHE B 1 312 ? -11.738 -49.611 239.173 1.00 20.09  ? 312 PHE B O   1 
ATOM 5413 C CB  . PHE B 1 312 ? -10.751 -52.195 237.559 1.00 20.71  ? 312 PHE B CB  1 
ATOM 5414 C CG  . PHE B 1 312 ? -10.457 -53.644 237.309 1.00 23.74  ? 312 PHE B CG  1 
ATOM 5415 C CD1 . PHE B 1 312 ? -9.143  -54.115 237.335 1.00 17.58  ? 312 PHE B CD1 1 
ATOM 5416 C CD2 . PHE B 1 312 ? -11.489 -54.540 237.035 1.00 22.68  ? 312 PHE B CD2 1 
ATOM 5417 C CE1 . PHE B 1 312 ? -8.858  -55.459 237.093 1.00 21.10  ? 312 PHE B CE1 1 
ATOM 5418 C CE2 . PHE B 1 312 ? -11.213 -55.896 236.787 1.00 28.07  ? 312 PHE B CE2 1 
ATOM 5419 C CZ  . PHE B 1 312 ? -9.895  -56.354 236.816 1.00 23.63  ? 312 PHE B CZ  1 
ATOM 5420 N N   . THR B 1 313 ? -9.499  -49.811 239.327 1.00 17.90  ? 313 THR B N   1 
ATOM 5421 C CA  . THR B 1 313 ? -9.226  -48.378 239.360 1.00 16.91  ? 313 THR B CA  1 
ATOM 5422 C C   . THR B 1 313 ? -7.939  -48.177 238.549 1.00 17.91  ? 313 THR B C   1 
ATOM 5423 O O   . THR B 1 313 ? -7.194  -49.145 238.326 1.00 18.32  ? 313 THR B O   1 
ATOM 5424 C CB  . THR B 1 313 ? -9.038  -47.852 240.773 1.00 14.37  ? 313 THR B CB  1 
ATOM 5425 O OG1 . THR B 1 313 ? -8.151  -48.711 241.491 1.00 18.07  ? 313 THR B OG1 1 
ATOM 5426 C CG2 . THR B 1 313 ? -10.377 -47.789 241.483 1.00 16.63  ? 313 THR B CG2 1 
ATOM 5427 N N   . TRP B 1 314 ? -7.697  -46.962 238.063 1.00 15.14  ? 314 TRP B N   1 
ATOM 5428 C CA  . TRP B 1 314 ? -6.484  -46.692 237.283 1.00 15.80  ? 314 TRP B CA  1 
ATOM 5429 C C   . TRP B 1 314 ? -5.303  -46.309 238.172 1.00 17.36  ? 314 TRP B C   1 
ATOM 5430 O O   . TRP B 1 314 ? -5.407  -45.349 238.941 1.00 19.47  ? 314 TRP B O   1 
ATOM 5431 C CB  . TRP B 1 314 ? -6.692  -45.526 236.299 1.00 17.17  ? 314 TRP B CB  1 
ATOM 5432 C CG  . TRP B 1 314 ? -7.711  -45.742 235.238 1.00 17.63  ? 314 TRP B CG  1 
ATOM 5433 C CD1 . TRP B 1 314 ? -8.941  -45.164 235.160 1.00 15.87  ? 314 TRP B CD1 1 
ATOM 5434 C CD2 . TRP B 1 314 ? -7.601  -46.610 234.105 1.00 19.84  ? 314 TRP B CD2 1 
ATOM 5435 N NE1 . TRP B 1 314 ? -9.613  -45.624 234.055 1.00 19.48  ? 314 TRP B NE1 1 
ATOM 5436 C CE2 . TRP B 1 314 ? -8.818  -46.517 233.391 1.00 20.49  ? 314 TRP B CE2 1 
ATOM 5437 C CE3 . TRP B 1 314 ? -6.596  -47.466 233.628 1.00 14.49  ? 314 TRP B CE3 1 
ATOM 5438 C CZ2 . TRP B 1 314 ? -9.059  -47.244 232.226 1.00 18.23  ? 314 TRP B CZ2 1 
ATOM 5439 C CZ3 . TRP B 1 314 ? -6.835  -48.187 232.470 1.00 15.60  ? 314 TRP B CZ3 1 
ATOM 5440 C CH2 . TRP B 1 314 ? -8.058  -48.076 231.783 1.00 15.54  ? 314 TRP B CH2 1 
ATOM 5441 N N   . LYS B 1 315 ? -4.202  -47.059 238.096 1.00 16.86  ? 315 LYS B N   1 
ATOM 5442 C CA  . LYS B 1 315 ? -2.996  -46.711 238.851 1.00 17.56  ? 315 LYS B CA  1 
ATOM 5443 C C   . LYS B 1 315 ? -2.213  -45.758 237.930 1.00 17.80  ? 315 LYS B C   1 
ATOM 5444 O O   . LYS B 1 315 ? -1.592  -44.788 238.387 1.00 18.04  ? 315 LYS B O   1 
ATOM 5445 C CB  . LYS B 1 315 ? -2.145  -47.945 239.172 1.00 22.13  ? 315 LYS B CB  1 
ATOM 5446 C CG  . LYS B 1 315 ? -0.878  -47.593 239.957 1.00 30.89  ? 315 LYS B CG  1 
ATOM 5447 C CD  . LYS B 1 315 ? -0.918  -48.114 241.387 1.00 51.34  ? 315 LYS B CD  1 
ATOM 5448 C CE  . LYS B 1 315 ? -0.751  -49.639 241.425 1.00 64.55  ? 315 LYS B CE  1 
ATOM 5449 N NZ  . LYS B 1 315 ? -0.884  -50.242 242.792 1.00 69.91  ? 315 LYS B NZ  1 
ATOM 5450 N N   . ARG B 1 316 ? -2.205  -46.070 236.634 1.00 16.13  ? 316 ARG B N   1 
ATOM 5451 C CA  . ARG B 1 316 ? -1.555  -45.223 235.634 1.00 17.05  ? 316 ARG B CA  1 
ATOM 5452 C C   . ARG B 1 316 ? -2.527  -45.177 234.477 1.00 17.08  ? 316 ARG B C   1 
ATOM 5453 O O   . ARG B 1 316 ? -2.793  -46.207 233.838 1.00 16.30  ? 316 ARG B O   1 
ATOM 5454 C CB  . ARG B 1 316 ? -0.220  -45.810 235.163 1.00 20.79  ? 316 ARG B CB  1 
ATOM 5455 C CG  . ARG B 1 316 ? 0.838   -45.874 236.242 1.00 27.41  ? 316 ARG B CG  1 
ATOM 5456 C CD  . ARG B 1 316 ? 2.197   -45.974 235.617 1.00 33.74  ? 316 ARG B CD  1 
ATOM 5457 N NE  . ARG B 1 316 ? 2.987   -47.017 236.249 1.00 37.05  ? 316 ARG B NE  1 
ATOM 5458 C CZ  . ARG B 1 316 ? 4.316   -47.027 236.285 1.00 34.65  ? 316 ARG B CZ  1 
ATOM 5459 N NH1 . ARG B 1 316 ? 5.006   -46.045 235.727 1.00 24.92  ? 316 ARG B NH1 1 
ATOM 5460 N NH2 . ARG B 1 316 ? 4.949   -48.020 236.887 1.00 37.60  ? 316 ARG B NH2 1 
ATOM 5461 N N   . ALA B 1 317 ? -3.110  -44.001 234.257 1.00 15.76  ? 317 ALA B N   1 
ATOM 5462 C CA  . ALA B 1 317 ? -4.091  -43.809 233.203 1.00 16.80  ? 317 ALA B CA  1 
ATOM 5463 C C   . ALA B 1 317 ? -3.451  -44.093 231.855 1.00 17.10  ? 317 ALA B C   1 
ATOM 5464 O O   . ALA B 1 317 ? -2.235  -43.983 231.719 1.00 17.51  ? 317 ALA B O   1 
ATOM 5465 C CB  . ALA B 1 317 ? -4.633  -42.376 233.254 1.00 15.33  ? 317 ALA B CB  1 
ATOM 5466 N N   . PRO B 1 318 ? -4.254  -44.479 230.846 1.00 17.13  ? 318 PRO B N   1 
ATOM 5467 C CA  . PRO B 1 318 ? -3.731  -44.771 229.499 1.00 18.71  ? 318 PRO B CA  1 
ATOM 5468 C C   . PRO B 1 318 ? -2.811  -43.654 228.993 1.00 21.77  ? 318 PRO B C   1 
ATOM 5469 O O   . PRO B 1 318 ? -3.115  -42.457 229.109 1.00 19.45  ? 318 PRO B O   1 
ATOM 5470 C CB  . PRO B 1 318 ? -4.993  -44.870 228.651 1.00 13.90  ? 318 PRO B CB  1 
ATOM 5471 C CG  . PRO B 1 318 ? -5.985  -45.483 229.638 1.00 18.72  ? 318 PRO B CG  1 
ATOM 5472 C CD  . PRO B 1 318 ? -5.710  -44.700 230.915 1.00 13.02  ? 318 PRO B CD  1 
ATOM 5473 N N   . THR B 1 319 ? -1.659  -44.051 228.472 1.00 21.92  ? 319 THR B N   1 
ATOM 5474 C CA  . THR B 1 319 ? -0.708  -43.091 227.966 1.00 23.47  ? 319 THR B CA  1 
ATOM 5475 C C   . THR B 1 319 ? -0.025  -43.639 226.725 1.00 22.21  ? 319 THR B C   1 
ATOM 5476 O O   . THR B 1 319 ? 0.083   -44.857 226.523 1.00 19.26  ? 319 THR B O   1 
ATOM 5477 C CB  . THR B 1 319 ? 0.332   -42.674 229.045 1.00 29.92  ? 319 THR B CB  1 
ATOM 5478 O OG1 . THR B 1 319 ? 1.056   -41.532 228.580 1.00 48.12  ? 319 THR B OG1 1 
ATOM 5479 C CG2 . THR B 1 319 ? 1.326   -43.765 229.309 1.00 36.70  ? 319 THR B CG2 1 
ATOM 5480 N N   . ASP B 1 320 ? 0.373   -42.712 225.869 1.00 21.57  ? 320 ASP B N   1 
ATOM 5481 C CA  . ASP B 1 320 ? 1.046   -43.011 224.622 1.00 24.77  ? 320 ASP B CA  1 
ATOM 5482 C C   . ASP B 1 320 ? 2.436   -43.599 224.900 1.00 21.96  ? 320 ASP B C   1 
ATOM 5483 O O   . ASP B 1 320 ? 3.240   -42.976 225.600 1.00 19.92  ? 320 ASP B O   1 
ATOM 5484 C CB  . ASP B 1 320 ? 1.176   -41.712 223.844 1.00 33.13  ? 320 ASP B CB  1 
ATOM 5485 C CG  . ASP B 1 320 ? 1.109   -41.928 222.380 1.00 47.08  ? 320 ASP B CG  1 
ATOM 5486 O OD1 . ASP B 1 320 ? 2.074   -42.510 221.827 1.00 46.85  ? 320 ASP B OD1 1 
ATOM 5487 O OD2 . ASP B 1 320 ? 0.072   -41.538 221.798 1.00 58.38  ? 320 ASP B OD2 1 
ATOM 5488 N N   . SER B 1 321 ? 2.725   -44.778 224.353 1.00 18.91  ? 321 SER B N   1 
ATOM 5489 C CA  . SER B 1 321 ? 4.021   -45.414 224.599 1.00 20.77  ? 321 SER B CA  1 
ATOM 5490 C C   . SER B 1 321 ? 5.143   -44.896 223.712 1.00 23.72  ? 321 SER B C   1 
ATOM 5491 O O   . SER B 1 321 ? 6.320   -45.088 224.011 1.00 25.16  ? 321 SER B O   1 
ATOM 5492 C CB  . SER B 1 321 ? 3.929   -46.914 224.379 1.00 13.99  ? 321 SER B CB  1 
ATOM 5493 O OG  . SER B 1 321 ? 3.842   -47.190 222.988 1.00 14.81  ? 321 SER B OG  1 
ATOM 5494 N N   . GLY B 1 322 ? 4.790   -44.272 222.601 1.00 25.79  ? 322 GLY B N   1 
ATOM 5495 C CA  . GLY B 1 322 ? 5.824   -43.819 221.690 1.00 29.27  ? 322 GLY B CA  1 
ATOM 5496 C C   . GLY B 1 322 ? 6.081   -44.867 220.605 1.00 31.35  ? 322 GLY B C   1 
ATOM 5497 O O   . GLY B 1 322 ? 6.911   -44.653 219.721 1.00 34.50  ? 322 GLY B O   1 
ATOM 5498 N N   . HIS B 1 323 ? 5.374   -45.999 220.670 1.00 29.21  ? 323 HIS B N   1 
ATOM 5499 C CA  . HIS B 1 323 ? 5.497   -47.066 219.677 1.00 25.29  ? 323 HIS B CA  1 
ATOM 5500 C C   . HIS B 1 323 ? 4.144   -47.326 219.033 1.00 26.68  ? 323 HIS B C   1 
ATOM 5501 O O   . HIS B 1 323 ? 3.896   -48.423 218.509 1.00 25.00  ? 323 HIS B O   1 
ATOM 5502 C CB  . HIS B 1 323 ? 5.974   -48.350 220.338 1.00 22.59  ? 323 HIS B CB  1 
ATOM 5503 C CG  . HIS B 1 323 ? 7.365   -48.263 220.864 1.00 23.02  ? 323 HIS B CG  1 
ATOM 5504 N ND1 . HIS B 1 323 ? 7.656   -48.322 222.211 1.00 26.25  ? 323 HIS B ND1 1 
ATOM 5505 C CD2 . HIS B 1 323 ? 8.548   -48.102 220.226 1.00 24.30  ? 323 HIS B CD2 1 
ATOM 5506 C CE1 . HIS B 1 323 ? 8.962   -48.202 222.379 1.00 26.66  ? 323 HIS B CE1 1 
ATOM 5507 N NE2 . HIS B 1 323 ? 9.524   -48.067 221.191 1.00 26.03  ? 323 HIS B NE2 1 
ATOM 5508 N N   . ASP B 1 324 ? 3.273   -46.317 219.086 1.00 25.40  ? 324 ASP B N   1 
ATOM 5509 C CA  . ASP B 1 324 ? 1.922   -46.404 218.551 1.00 27.11  ? 324 ASP B CA  1 
ATOM 5510 C C   . ASP B 1 324 ? 1.041   -47.415 219.283 1.00 26.54  ? 324 ASP B C   1 
ATOM 5511 O O   . ASP B 1 324 ? 0.156   -48.052 218.691 1.00 27.66  ? 324 ASP B O   1 
ATOM 5512 C CB  . ASP B 1 324 ? 1.960   -46.663 217.050 1.00 31.46  ? 324 ASP B CB  1 
ATOM 5513 C CG  . ASP B 1 324 ? 2.572   -45.505 216.302 1.00 42.51  ? 324 ASP B CG  1 
ATOM 5514 O OD1 . ASP B 1 324 ? 2.255   -44.349 216.665 1.00 44.63  ? 324 ASP B OD1 1 
ATOM 5515 O OD2 . ASP B 1 324 ? 3.402   -45.741 215.397 1.00 50.82  ? 324 ASP B OD2 1 
ATOM 5516 N N   . THR B 1 325 ? 1.329   -47.585 220.570 1.00 21.60  ? 325 THR B N   1 
ATOM 5517 C CA  . THR B 1 325 ? 0.563   -48.479 221.424 1.00 19.97  ? 325 THR B CA  1 
ATOM 5518 C C   . THR B 1 325 ? 0.176   -47.645 222.633 1.00 18.92  ? 325 THR B C   1 
ATOM 5519 O O   . THR B 1 325 ? 0.695   -46.535 222.823 1.00 18.07  ? 325 THR B O   1 
ATOM 5520 C CB  . THR B 1 325 ? 1.379   -49.704 221.899 1.00 20.48  ? 325 THR B CB  1 
ATOM 5521 O OG1 . THR B 1 325 ? 2.501   -49.271 222.672 1.00 16.06  ? 325 THR B OG1 1 
ATOM 5522 C CG2 . THR B 1 325 ? 1.837   -50.523 220.729 1.00 16.58  ? 325 THR B CG2 1 
ATOM 5523 N N   . VAL B 1 326 ? -0.722  -48.174 223.453 1.00 17.80  ? 326 VAL B N   1 
ATOM 5524 C CA  . VAL B 1 326 ? -1.179  -47.473 224.641 1.00 16.29  ? 326 VAL B CA  1 
ATOM 5525 C C   . VAL B 1 326 ? -0.798  -48.360 225.823 1.00 17.23  ? 326 VAL B C   1 
ATOM 5526 O O   . VAL B 1 326 ? -0.943  -49.591 225.740 1.00 15.48  ? 326 VAL B O   1 
ATOM 5527 C CB  . VAL B 1 326 ? -2.727  -47.283 224.606 1.00 20.38  ? 326 VAL B CB  1 
ATOM 5528 C CG1 . VAL B 1 326 ? -3.174  -46.339 225.708 1.00 22.13  ? 326 VAL B CG1 1 
ATOM 5529 C CG2 . VAL B 1 326 ? -3.169  -46.756 223.255 1.00 21.89  ? 326 VAL B CG2 1 
ATOM 5530 N N   . VAL B 1 327 ? -0.208  -47.761 226.862 1.00 15.49  ? 327 VAL B N   1 
ATOM 5531 C CA  . VAL B 1 327 ? 0.163   -48.500 228.058 1.00 14.03  ? 327 VAL B CA  1 
ATOM 5532 C C   . VAL B 1 327 ? -0.658  -47.940 229.216 1.00 16.54  ? 327 VAL B C   1 
ATOM 5533 O O   . VAL B 1 327 ? -1.068  -46.774 229.189 1.00 17.39  ? 327 VAL B O   1 
ATOM 5534 C CB  . VAL B 1 327 ? 1.700   -48.464 228.360 1.00 18.13  ? 327 VAL B CB  1 
ATOM 5535 C CG1 . VAL B 1 327 ? 2.464   -49.254 227.294 1.00 15.78  ? 327 VAL B CG1 1 
ATOM 5536 C CG2 . VAL B 1 327 ? 2.213   -47.032 228.451 1.00 14.22  ? 327 VAL B CG2 1 
ATOM 5537 N N   . MET B 1 328 ? -0.932  -48.776 230.212 1.00 16.29  ? 328 MET B N   1 
ATOM 5538 C CA  . MET B 1 328 ? -1.744  -48.370 231.353 1.00 15.41  ? 328 MET B CA  1 
ATOM 5539 C C   . MET B 1 328 ? -1.539  -49.399 232.441 1.00 19.05  ? 328 MET B C   1 
ATOM 5540 O O   . MET B 1 328 ? -0.978  -50.477 232.191 1.00 18.83  ? 328 MET B O   1 
ATOM 5541 C CB  . MET B 1 328 ? -3.225  -48.396 230.963 1.00 14.75  ? 328 MET B CB  1 
ATOM 5542 C CG  . MET B 1 328 ? -3.738  -49.813 230.619 1.00 12.55  ? 328 MET B CG  1 
ATOM 5543 S SD  . MET B 1 328 ? -5.086  -49.775 229.433 1.00 19.20  ? 328 MET B SD  1 
ATOM 5544 C CE  . MET B 1 328 ? -4.210  -49.397 227.929 1.00 17.21  ? 328 MET B CE  1 
ATOM 5545 N N   . GLU B 1 329 ? -1.988  -49.073 233.646 1.00 17.22  ? 329 GLU B N   1 
ATOM 5546 C CA  . GLU B 1 329 ? -1.878  -50.011 234.737 1.00 17.26  ? 329 GLU B CA  1 
ATOM 5547 C C   . GLU B 1 329 ? -3.084  -49.840 235.659 1.00 19.00  ? 329 GLU B C   1 
ATOM 5548 O O   . GLU B 1 329 ? -3.434  -48.719 236.063 1.00 16.06  ? 329 GLU B O   1 
ATOM 5549 C CB  . GLU B 1 329 ? -0.580  -49.800 235.509 1.00 18.33  ? 329 GLU B CB  1 
ATOM 5550 C CG  . GLU B 1 329 ? -0.357  -50.868 236.553 1.00 26.82  ? 329 GLU B CG  1 
ATOM 5551 C CD  . GLU B 1 329 ? 0.819   -50.597 237.469 1.00 35.48  ? 329 GLU B CD  1 
ATOM 5552 O OE1 . GLU B 1 329 ? 1.585   -49.644 237.218 1.00 31.47  ? 329 GLU B OE1 1 
ATOM 5553 O OE2 . GLU B 1 329 ? 0.972   -51.348 238.459 1.00 38.08  ? 329 GLU B OE2 1 
ATOM 5554 N N   . VAL B 1 330 ? -3.737  -50.950 235.966 1.00 17.07  ? 330 VAL B N   1 
ATOM 5555 C CA  . VAL B 1 330 ? -4.890  -50.918 236.849 1.00 20.60  ? 330 VAL B CA  1 
ATOM 5556 C C   . VAL B 1 330 ? -4.620  -51.596 238.202 1.00 22.97  ? 330 VAL B C   1 
ATOM 5557 O O   . VAL B 1 330 ? -3.658  -52.351 238.358 1.00 22.32  ? 330 VAL B O   1 
ATOM 5558 C CB  . VAL B 1 330 ? -6.125  -51.581 236.193 1.00 17.77  ? 330 VAL B CB  1 
ATOM 5559 C CG1 . VAL B 1 330 ? -6.527  -50.819 234.942 1.00 15.88  ? 330 VAL B CG1 1 
ATOM 5560 C CG2 . VAL B 1 330 ? -5.853  -53.068 235.885 1.00 15.94  ? 330 VAL B CG2 1 
ATOM 5561 N N   . THR B 1 331 ? -5.448  -51.273 239.187 1.00 22.69  ? 331 THR B N   1 
ATOM 5562 C CA  . THR B 1 331 ? -5.363  -51.870 240.518 1.00 24.54  ? 331 THR B CA  1 
ATOM 5563 C C   . THR B 1 331 ? -6.708  -52.582 240.688 1.00 26.03  ? 331 THR B C   1 
ATOM 5564 O O   . THR B 1 331 ? -7.733  -52.081 240.215 1.00 25.65  ? 331 THR B O   1 
ATOM 5565 C CB  . THR B 1 331 ? -5.210  -50.799 241.600 1.00 23.62  ? 331 THR B CB  1 
ATOM 5566 O OG1 . THR B 1 331 ? -4.002  -50.071 241.361 1.00 26.29  ? 331 THR B OG1 1 
ATOM 5567 C CG2 . THR B 1 331 ? -5.151  -51.421 242.985 1.00 24.63  ? 331 THR B CG2 1 
ATOM 5568 N N   . PHE B 1 332 ? -6.694  -53.758 241.309 1.00 24.77  ? 332 PHE B N   1 
ATOM 5569 C CA  . PHE B 1 332 ? -7.905  -54.552 241.514 1.00 25.98  ? 332 PHE B CA  1 
ATOM 5570 C C   . PHE B 1 332 ? -8.063  -54.817 243.005 1.00 28.50  ? 332 PHE B C   1 
ATOM 5571 O O   . PHE B 1 332 ? -7.116  -55.263 243.664 1.00 29.83  ? 332 PHE B O   1 
ATOM 5572 C CB  . PHE B 1 332 ? -7.784  -55.868 240.757 1.00 21.40  ? 332 PHE B CB  1 
ATOM 5573 C CG  . PHE B 1 332 ? -8.975  -56.758 240.891 1.00 23.37  ? 332 PHE B CG  1 
ATOM 5574 C CD1 . PHE B 1 332 ? -10.172 -56.436 240.262 1.00 28.10  ? 332 PHE B CD1 1 
ATOM 5575 C CD2 . PHE B 1 332 ? -8.887  -57.956 241.609 1.00 22.74  ? 332 PHE B CD2 1 
ATOM 5576 C CE1 . PHE B 1 332 ? -11.281 -57.296 240.333 1.00 28.42  ? 332 PHE B CE1 1 
ATOM 5577 C CE2 . PHE B 1 332 ? -9.980  -58.819 241.687 1.00 24.48  ? 332 PHE B CE2 1 
ATOM 5578 C CZ  . PHE B 1 332 ? -11.185 -58.485 241.042 1.00 29.26  ? 332 PHE B CZ  1 
ATOM 5579 N N   . SER B 1 333 ? -9.259  -54.558 243.533 1.00 30.40  ? 333 SER B N   1 
ATOM 5580 C CA  . SER B 1 333 ? -9.512  -54.739 244.959 1.00 31.56  ? 333 SER B CA  1 
ATOM 5581 C C   . SER B 1 333 ? -10.348 -55.956 245.305 1.00 32.07  ? 333 SER B C   1 
ATOM 5582 O O   . SER B 1 333 ? -10.768 -56.104 246.445 1.00 36.50  ? 333 SER B O   1 
ATOM 5583 C CB  . SER B 1 333 ? -10.182 -53.491 245.534 1.00 33.99  ? 333 SER B CB  1 
ATOM 5584 O OG  . SER B 1 333 ? -11.386 -53.208 244.837 1.00 37.24  ? 333 SER B OG  1 
ATOM 5585 N N   . GLY B 1 334 ? -10.615 -56.807 244.324 1.00 30.40  ? 334 GLY B N   1 
ATOM 5586 C CA  . GLY B 1 334 ? -11.406 -57.996 244.578 1.00 32.33  ? 334 GLY B CA  1 
ATOM 5587 C C   . GLY B 1 334 ? -10.538 -59.201 244.893 1.00 34.77  ? 334 GLY B C   1 
ATOM 5588 O O   . GLY B 1 334 ? -9.355  -59.053 245.229 1.00 33.88  ? 334 GLY B O   1 
ATOM 5589 N N   . THR B 1 335 ? -11.118 -60.394 244.760 1.00 35.49  ? 335 THR B N   1 
ATOM 5590 C CA  . THR B 1 335 ? -10.386 -61.627 245.044 1.00 36.88  ? 335 THR B CA  1 
ATOM 5591 C C   . THR B 1 335 ? -9.564  -62.129 243.860 1.00 36.05  ? 335 THR B C   1 
ATOM 5592 O O   . THR B 1 335 ? -10.051 -62.230 242.718 1.00 34.56  ? 335 THR B O   1 
ATOM 5593 C CB  . THR B 1 335 ? -11.313 -62.753 245.588 1.00 42.68  ? 335 THR B CB  1 
ATOM 5594 O OG1 . THR B 1 335 ? -12.487 -62.860 244.771 1.00 41.85  ? 335 THR B OG1 1 
ATOM 5595 C CG2 . THR B 1 335 ? -11.719 -62.458 247.038 1.00 48.87  ? 335 THR B CG2 1 
ATOM 5596 N N   . LYS B 1 336 ? -8.315  -62.455 244.158 1.00 35.00  ? 336 LYS B N   1 
ATOM 5597 C CA  . LYS B 1 336 ? -7.358  -62.924 243.164 1.00 36.01  ? 336 LYS B CA  1 
ATOM 5598 C C   . LYS B 1 336 ? -7.151  -64.437 243.269 1.00 36.59  ? 336 LYS B C   1 
ATOM 5599 O O   . LYS B 1 336 ? -7.364  -65.029 244.333 1.00 38.81  ? 336 LYS B O   1 
ATOM 5600 C CB  . LYS B 1 336 ? -6.034  -62.182 243.396 1.00 38.27  ? 336 LYS B CB  1 
ATOM 5601 C CG  . LYS B 1 336 ? -6.209  -60.674 243.444 1.00 38.59  ? 336 LYS B CG  1 
ATOM 5602 C CD  . LYS B 1 336 ? -5.061  -59.983 244.131 1.00 45.46  ? 336 LYS B CD  1 
ATOM 5603 C CE  . LYS B 1 336 ? -5.364  -58.500 244.265 1.00 51.35  ? 336 LYS B CE  1 
ATOM 5604 N NZ  . LYS B 1 336 ? -4.270  -57.773 244.959 1.00 57.61  ? 336 LYS B NZ  1 
ATOM 5605 N N   . PRO B 1 337 ? -6.672  -65.082 242.191 1.00 34.06  ? 337 PRO B N   1 
ATOM 5606 C CA  . PRO B 1 337 ? -6.311  -64.491 240.900 1.00 34.17  ? 337 PRO B CA  1 
ATOM 5607 C C   . PRO B 1 337 ? -7.521  -64.498 239.975 1.00 33.89  ? 337 PRO B C   1 
ATOM 5608 O O   . PRO B 1 337 ? -8.465  -65.267 240.202 1.00 34.78  ? 337 PRO B O   1 
ATOM 5609 C CB  . PRO B 1 337 ? -5.235  -65.450 240.401 1.00 37.32  ? 337 PRO B CB  1 
ATOM 5610 C CG  . PRO B 1 337 ? -5.802  -66.779 240.813 1.00 32.60  ? 337 PRO B CG  1 
ATOM 5611 C CD  . PRO B 1 337 ? -6.327  -66.515 242.226 1.00 33.47  ? 337 PRO B CD  1 
ATOM 5612 N N   . CYS B 1 338 ? -7.476  -63.696 238.911 1.00 29.97  ? 338 CYS B N   1 
ATOM 5613 C CA  . CYS B 1 338 ? -8.587  -63.628 237.956 1.00 27.42  ? 338 CYS B CA  1 
ATOM 5614 C C   . CYS B 1 338 ? -8.170  -62.992 236.626 1.00 26.41  ? 338 CYS B C   1 
ATOM 5615 O O   . CYS B 1 338 ? -7.108  -62.370 236.526 1.00 25.90  ? 338 CYS B O   1 
ATOM 5616 C CB  . CYS B 1 338 ? -9.770  -62.868 238.584 1.00 25.57  ? 338 CYS B CB  1 
ATOM 5617 S SG  . CYS B 1 338 ? -9.358  -61.193 239.190 1.00 27.60  ? 338 CYS B SG  1 
ATOM 5618 N N   . ARG B 1 339 ? -8.969  -63.206 235.590 1.00 24.50  ? 339 ARG B N   1 
ATOM 5619 C CA  . ARG B 1 339 ? -8.679  -62.644 234.281 1.00 25.78  ? 339 ARG B CA  1 
ATOM 5620 C C   . ARG B 1 339 ? -9.266  -61.237 234.179 1.00 27.84  ? 339 ARG B C   1 
ATOM 5621 O O   . ARG B 1 339 ? -10.408 -61.005 234.578 1.00 29.14  ? 339 ARG B O   1 
ATOM 5622 C CB  . ARG B 1 339 ? -9.239  -63.542 233.187 1.00 25.70  ? 339 ARG B CB  1 
ATOM 5623 C CG  . ARG B 1 339 ? -8.361  -64.747 232.923 1.00 33.70  ? 339 ARG B CG  1 
ATOM 5624 C CD  . ARG B 1 339 ? -9.178  -65.960 232.574 1.00 36.01  ? 339 ARG B CD  1 
ATOM 5625 N NE  . ARG B 1 339 ? -9.917  -65.792 231.329 1.00 48.30  ? 339 ARG B NE  1 
ATOM 5626 C CZ  . ARG B 1 339 ? -11.162 -66.218 231.141 1.00 52.12  ? 339 ARG B CZ  1 
ATOM 5627 N NH1 . ARG B 1 339 ? -11.814 -66.837 232.121 1.00 45.84  ? 339 ARG B NH1 1 
ATOM 5628 N NH2 . ARG B 1 339 ? -11.753 -66.039 229.965 1.00 52.14  ? 339 ARG B NH2 1 
ATOM 5629 N N   . ILE B 1 340 ? -8.475  -60.296 233.673 1.00 25.74  ? 340 ILE B N   1 
ATOM 5630 C CA  . ILE B 1 340 ? -8.926  -58.914 233.536 1.00 24.82  ? 340 ILE B CA  1 
ATOM 5631 C C   . ILE B 1 340 ? -9.810  -58.764 232.298 1.00 23.54  ? 340 ILE B C   1 
ATOM 5632 O O   . ILE B 1 340 ? -9.426  -59.182 231.209 1.00 22.10  ? 340 ILE B O   1 
ATOM 5633 C CB  . ILE B 1 340 ? -7.722  -57.922 233.416 1.00 21.98  ? 340 ILE B CB  1 
ATOM 5634 C CG1 . ILE B 1 340 ? -6.803  -58.042 234.638 1.00 17.13  ? 340 ILE B CG1 1 
ATOM 5635 C CG2 . ILE B 1 340 ? -8.231  -56.478 233.305 1.00 20.73  ? 340 ILE B CG2 1 
ATOM 5636 C CD1 . ILE B 1 340 ? -5.586  -57.139 234.581 1.00 20.33  ? 340 ILE B CD1 1 
ATOM 5637 N N   . PRO B 1 341 ? -11.037 -58.241 232.467 1.00 25.01  ? 341 PRO B N   1 
ATOM 5638 C CA  . PRO B 1 341 ? -11.965 -58.042 231.346 1.00 25.40  ? 341 PRO B CA  1 
ATOM 5639 C C   . PRO B 1 341 ? -11.670 -56.706 230.639 1.00 27.68  ? 341 PRO B C   1 
ATOM 5640 O O   . PRO B 1 341 ? -12.297 -55.680 230.932 1.00 32.21  ? 341 PRO B O   1 
ATOM 5641 C CB  . PRO B 1 341 ? -13.326 -58.032 232.035 1.00 22.01  ? 341 PRO B CB  1 
ATOM 5642 C CG  . PRO B 1 341 ? -13.017 -57.418 233.369 1.00 25.13  ? 341 PRO B CG  1 
ATOM 5643 C CD  . PRO B 1 341 ? -11.724 -58.074 233.765 1.00 25.47  ? 341 PRO B CD  1 
ATOM 5644 N N   . VAL B 1 342 ? -10.720 -56.730 229.709 1.00 25.67  ? 342 VAL B N   1 
ATOM 5645 C CA  . VAL B 1 342 ? -10.303 -55.539 228.964 1.00 23.71  ? 342 VAL B CA  1 
ATOM 5646 C C   . VAL B 1 342 ? -10.872 -55.540 227.566 1.00 23.70  ? 342 VAL B C   1 
ATOM 5647 O O   . VAL B 1 342 ? -10.861 -56.571 226.899 1.00 26.53  ? 342 VAL B O   1 
ATOM 5648 C CB  . VAL B 1 342 ? -8.775  -55.512 228.690 1.00 27.59  ? 342 VAL B CB  1 
ATOM 5649 C CG1 . VAL B 1 342 ? -8.262  -54.083 228.684 1.00 22.63  ? 342 VAL B CG1 1 
ATOM 5650 C CG2 . VAL B 1 342 ? -8.014  -56.420 229.622 1.00 21.92  ? 342 VAL B CG2 1 
ATOM 5651 N N   . ARG B 1 343 ? -11.250 -54.366 227.081 1.00 21.74  ? 343 ARG B N   1 
ATOM 5652 C CA  . ARG B 1 343 ? -11.757 -54.218 225.722 1.00 21.55  ? 343 ARG B CA  1 
ATOM 5653 C C   . ARG B 1 343 ? -11.787 -52.730 225.457 1.00 21.44  ? 343 ARG B C   1 
ATOM 5654 O O   . ARG B 1 343 ? -11.553 -51.923 226.364 1.00 21.53  ? 343 ARG B O   1 
ATOM 5655 C CB  . ARG B 1 343 ? -13.164 -54.801 225.563 1.00 26.96  ? 343 ARG B CB  1 
ATOM 5656 C CG  . ARG B 1 343 ? -14.225 -54.013 226.291 1.00 27.03  ? 343 ARG B CG  1 
ATOM 5657 C CD  . ARG B 1 343 ? -15.583 -54.705 226.282 1.00 38.88  ? 343 ARG B CD  1 
ATOM 5658 N NE  . ARG B 1 343 ? -16.465 -54.024 227.229 1.00 41.83  ? 343 ARG B NE  1 
ATOM 5659 C CZ  . ARG B 1 343 ? -17.380 -53.117 226.895 1.00 39.61  ? 343 ARG B CZ  1 
ATOM 5660 N NH1 . ARG B 1 343 ? -17.569 -52.788 225.614 1.00 34.27  ? 343 ARG B NH1 1 
ATOM 5661 N NH2 . ARG B 1 343 ? -18.024 -52.453 227.859 1.00 32.68  ? 343 ARG B NH2 1 
ATOM 5662 N N   . ALA B 1 344 ? -12.050 -52.365 224.212 1.00 19.97  ? 344 ALA B N   1 
ATOM 5663 C CA  . ALA B 1 344 ? -12.123 -50.964 223.840 1.00 21.26  ? 344 ALA B CA  1 
ATOM 5664 C C   . ALA B 1 344 ? -13.062 -50.890 222.654 1.00 24.03  ? 344 ALA B C   1 
ATOM 5665 O O   . ALA B 1 344 ? -13.144 -51.844 221.862 1.00 22.07  ? 344 ALA B O   1 
ATOM 5666 C CB  . ALA B 1 344 ? -10.742 -50.432 223.466 1.00 14.45  ? 344 ALA B CB  1 
ATOM 5667 N N   . VAL B 1 345 ? -13.799 -49.783 222.557 1.00 24.71  ? 345 VAL B N   1 
ATOM 5668 C CA  . VAL B 1 345 ? -14.737 -49.581 221.460 1.00 23.00  ? 345 VAL B CA  1 
ATOM 5669 C C   . VAL B 1 345 ? -14.492 -48.218 220.854 1.00 23.51  ? 345 VAL B C   1 
ATOM 5670 O O   . VAL B 1 345 ? -13.978 -47.307 221.518 1.00 23.17  ? 345 VAL B O   1 
ATOM 5671 C CB  . VAL B 1 345 ? -16.213 -49.630 221.936 1.00 21.85  ? 345 VAL B CB  1 
ATOM 5672 C CG1 . VAL B 1 345 ? -16.518 -50.966 222.612 1.00 16.85  ? 345 VAL B CG1 1 
ATOM 5673 C CG2 . VAL B 1 345 ? -16.505 -48.467 222.881 1.00 23.93  ? 345 VAL B CG2 1 
ATOM 5674 N N   . ALA B 1 346 ? -14.838 -48.088 219.580 1.00 23.95  ? 346 ALA B N   1 
ATOM 5675 C CA  . ALA B 1 346 ? -14.703 -46.822 218.892 1.00 23.90  ? 346 ALA B CA  1 
ATOM 5676 C C   . ALA B 1 346 ? -15.929 -45.999 219.323 1.00 25.99  ? 346 ALA B C   1 
ATOM 5677 O O   . ALA B 1 346 ? -17.021 -46.548 219.524 1.00 23.56  ? 346 ALA B O   1 
ATOM 5678 C CB  . ALA B 1 346 ? -14.706 -47.035 217.386 1.00 24.29  ? 346 ALA B CB  1 
ATOM 5679 N N   . HIS B 1 347 ? -15.723 -44.706 219.537 1.00 26.61  ? 347 HIS B N   1 
ATOM 5680 C CA  . HIS B 1 347 ? -16.793 -43.796 219.930 1.00 30.53  ? 347 HIS B CA  1 
ATOM 5681 C C   . HIS B 1 347 ? -17.949 -43.973 218.911 1.00 31.97  ? 347 HIS B C   1 
ATOM 5682 O O   . HIS B 1 347 ? -17.740 -43.848 217.702 1.00 31.12  ? 347 HIS B O   1 
ATOM 5683 C CB  . HIS B 1 347 ? -16.224 -42.364 219.910 1.00 32.71  ? 347 HIS B CB  1 
ATOM 5684 C CG  . HIS B 1 347 ? -17.182 -41.309 220.366 1.00 50.84  ? 347 HIS B CG  1 
ATOM 5685 N ND1 . HIS B 1 347 ? -18.434 -41.139 219.807 1.00 59.71  ? 347 HIS B ND1 1 
ATOM 5686 C CD2 . HIS B 1 347 ? -17.068 -40.357 221.322 1.00 56.80  ? 347 HIS B CD2 1 
ATOM 5687 C CE1 . HIS B 1 347 ? -19.049 -40.132 220.402 1.00 61.89  ? 347 HIS B CE1 1 
ATOM 5688 N NE2 . HIS B 1 347 ? -18.243 -39.640 221.325 1.00 62.47  ? 347 HIS B NE2 1 
ATOM 5689 N N   . GLY B 1 348 ? -19.141 -44.333 219.387 1.00 32.41  ? 348 GLY B N   1 
ATOM 5690 C CA  . GLY B 1 348 ? -20.270 -44.517 218.485 1.00 32.20  ? 348 GLY B CA  1 
ATOM 5691 C C   . GLY B 1 348 ? -20.626 -45.962 218.136 1.00 35.55  ? 348 GLY B C   1 
ATOM 5692 O O   . GLY B 1 348 ? -21.732 -46.218 217.657 1.00 35.19  ? 348 GLY B O   1 
ATOM 5693 N N   . SER B 1 349 ? -19.704 -46.902 218.342 1.00 34.08  ? 349 SER B N   1 
ATOM 5694 C CA  . SER B 1 349 ? -19.962 -48.317 218.057 1.00 34.66  ? 349 SER B CA  1 
ATOM 5695 C C   . SER B 1 349 ? -19.629 -49.122 219.307 1.00 35.36  ? 349 SER B C   1 
ATOM 5696 O O   . SER B 1 349 ? -18.598 -49.784 219.376 1.00 36.01  ? 349 SER B O   1 
ATOM 5697 C CB  . SER B 1 349 ? -19.090 -48.801 216.900 1.00 32.21  ? 349 SER B CB  1 
ATOM 5698 O OG  . SER B 1 349 ? -19.125 -47.885 215.827 1.00 37.85  ? 349 SER B OG  1 
ATOM 5699 N N   . PRO B 1 350 ? -20.516 -49.112 220.305 1.00 36.43  ? 350 PRO B N   1 
ATOM 5700 C CA  . PRO B 1 350 ? -20.265 -49.851 221.544 1.00 35.73  ? 350 PRO B CA  1 
ATOM 5701 C C   . PRO B 1 350 ? -20.211 -51.374 221.447 1.00 36.68  ? 350 PRO B C   1 
ATOM 5702 O O   . PRO B 1 350 ? -19.799 -52.040 222.396 1.00 37.25  ? 350 PRO B O   1 
ATOM 5703 C CB  . PRO B 1 350 ? -21.411 -49.389 222.437 1.00 33.12  ? 350 PRO B CB  1 
ATOM 5704 C CG  . PRO B 1 350 ? -22.517 -49.172 221.467 1.00 33.36  ? 350 PRO B CG  1 
ATOM 5705 C CD  . PRO B 1 350 ? -21.828 -48.441 220.345 1.00 36.22  ? 350 PRO B CD  1 
ATOM 5706 N N   . ASP B 1 351 ? -20.608 -51.926 220.308 1.00 39.04  ? 351 ASP B N   1 
ATOM 5707 C CA  . ASP B 1 351 ? -20.635 -53.380 220.125 1.00 43.40  ? 351 ASP B CA  1 
ATOM 5708 C C   . ASP B 1 351 ? -19.366 -54.077 219.633 1.00 44.09  ? 351 ASP B C   1 
ATOM 5709 O O   . ASP B 1 351 ? -19.140 -55.254 219.946 1.00 47.32  ? 351 ASP B O   1 
ATOM 5710 C CB  . ASP B 1 351 ? -21.806 -53.767 219.214 1.00 50.70  ? 351 ASP B CB  1 
ATOM 5711 C CG  . ASP B 1 351 ? -23.156 -53.499 219.853 1.00 59.82  ? 351 ASP B CG  1 
ATOM 5712 O OD1 . ASP B 1 351 ? -23.388 -53.995 220.983 1.00 58.83  ? 351 ASP B OD1 1 
ATOM 5713 O OD2 . ASP B 1 351 ? -23.979 -52.797 219.220 1.00 67.35  ? 351 ASP B OD2 1 
ATOM 5714 N N   . VAL B 1 352 ? -18.552 -53.367 218.858 1.00 41.59  ? 352 VAL B N   1 
ATOM 5715 C CA  . VAL B 1 352 ? -17.322 -53.934 218.305 1.00 37.86  ? 352 VAL B CA  1 
ATOM 5716 C C   . VAL B 1 352 ? -16.074 -53.666 219.166 1.00 34.32  ? 352 VAL B C   1 
ATOM 5717 O O   . VAL B 1 352 ? -15.717 -52.506 219.389 1.00 30.06  ? 352 VAL B O   1 
ATOM 5718 C CB  . VAL B 1 352 ? -17.050 -53.344 216.903 1.00 37.91  ? 352 VAL B CB  1 
ATOM 5719 C CG1 . VAL B 1 352 ? -15.900 -54.066 216.233 1.00 38.38  ? 352 VAL B CG1 1 
ATOM 5720 C CG2 . VAL B 1 352 ? -18.309 -53.394 216.060 1.00 41.43  ? 352 VAL B CG2 1 
ATOM 5721 N N   . ASN B 1 353 ? -15.424 -54.730 219.642 1.00 29.97  ? 353 ASN B N   1 
ATOM 5722 C CA  . ASN B 1 353 ? -14.194 -54.601 220.423 1.00 29.18  ? 353 ASN B CA  1 
ATOM 5723 C C   . ASN B 1 353 ? -13.093 -54.286 219.402 1.00 29.80  ? 353 ASN B C   1 
ATOM 5724 O O   . ASN B 1 353 ? -12.922 -55.025 218.431 1.00 30.99  ? 353 ASN B O   1 
ATOM 5725 C CB  . ASN B 1 353 ? -13.873 -55.913 221.139 1.00 28.57  ? 353 ASN B CB  1 
ATOM 5726 C CG  . ASN B 1 353 ? -12.589 -55.843 221.969 1.00 33.69  ? 353 ASN B CG  1 
ATOM 5727 O OD1 . ASN B 1 353 ? -11.883 -54.831 221.985 1.00 31.24  ? 353 ASN B OD1 1 
ATOM 5728 N ND2 . ASN B 1 353 ? -12.302 -56.918 222.689 1.00 34.50  ? 353 ASN B ND2 1 
ATOM 5729 N N   . VAL B 1 354 ? -12.389 -53.170 219.580 1.00 27.85  ? 354 VAL B N   1 
ATOM 5730 C CA  . VAL B 1 354 ? -11.332 -52.784 218.649 1.00 25.94  ? 354 VAL B CA  1 
ATOM 5731 C C   . VAL B 1 354 ? -9.915  -52.886 219.241 1.00 28.09  ? 354 VAL B C   1 
ATOM 5732 O O   . VAL B 1 354 ? -8.938  -52.521 218.578 1.00 29.65  ? 354 VAL B O   1 
ATOM 5733 C CB  . VAL B 1 354 ? -11.554 -51.346 218.091 1.00 24.66  ? 354 VAL B CB  1 
ATOM 5734 C CG1 . VAL B 1 354 ? -12.858 -51.259 217.333 1.00 25.27  ? 354 VAL B CG1 1 
ATOM 5735 C CG2 . VAL B 1 354 ? -11.534 -50.328 219.212 1.00 24.92  ? 354 VAL B CG2 1 
ATOM 5736 N N   . ALA B 1 355 ? -9.807  -53.405 220.464 1.00 26.62  ? 355 ALA B N   1 
ATOM 5737 C CA  . ALA B 1 355 ? -8.516  -53.537 221.142 1.00 27.21  ? 355 ALA B CA  1 
ATOM 5738 C C   . ALA B 1 355 ? -7.697  -54.753 220.687 1.00 28.52  ? 355 ALA B C   1 
ATOM 5739 O O   . ALA B 1 355 ? -8.214  -55.882 220.641 1.00 28.89  ? 355 ALA B O   1 
ATOM 5740 C CB  . ALA B 1 355 ? -8.727  -53.592 222.655 1.00 20.34  ? 355 ALA B CB  1 
ATOM 5741 N N   . MET B 1 356 ? -6.434  -54.508 220.331 1.00 27.70  ? 356 MET B N   1 
ATOM 5742 C CA  . MET B 1 356 ? -5.503  -55.571 219.923 1.00 25.95  ? 356 MET B CA  1 
ATOM 5743 C C   . MET B 1 356 ? -4.484  -55.605 221.057 1.00 23.20  ? 356 MET B C   1 
ATOM 5744 O O   . MET B 1 356 ? -3.671  -54.691 221.198 1.00 22.60  ? 356 MET B O   1 
ATOM 5745 C CB  . MET B 1 356 ? -4.828  -55.223 218.598 1.00 27.81  ? 356 MET B CB  1 
ATOM 5746 C CG  . MET B 1 356 ? -5.818  -55.049 217.442 1.00 53.69  ? 356 MET B CG  1 
ATOM 5747 S SD  . MET B 1 356 ? -5.256  -53.966 216.067 1.00 72.54  ? 356 MET B SD  1 
ATOM 5748 C CE  . MET B 1 356 ? -6.158  -52.369 216.418 1.00 58.47  ? 356 MET B CE  1 
ATOM 5749 N N   . LEU B 1 357 ? -4.592  -56.606 221.922 1.00 21.22  ? 357 LEU B N   1 
ATOM 5750 C CA  . LEU B 1 357 ? -3.701  -56.718 223.074 1.00 22.84  ? 357 LEU B CA  1 
ATOM 5751 C C   . LEU B 1 357 ? -2.299  -57.218 222.755 1.00 22.75  ? 357 LEU B C   1 
ATOM 5752 O O   . LEU B 1 357 ? -2.130  -58.146 221.977 1.00 20.00  ? 357 LEU B O   1 
ATOM 5753 C CB  . LEU B 1 357 ? -4.328  -57.623 224.141 1.00 21.41  ? 357 LEU B CB  1 
ATOM 5754 C CG  . LEU B 1 357 ? -5.631  -57.155 224.792 1.00 22.62  ? 357 LEU B CG  1 
ATOM 5755 C CD1 . LEU B 1 357 ? -6.125  -58.208 225.749 1.00 20.10  ? 357 LEU B CD1 1 
ATOM 5756 C CD2 . LEU B 1 357 ? -5.416  -55.844 225.536 1.00 26.08  ? 357 LEU B CD2 1 
ATOM 5757 N N   . ILE B 1 358 ? -1.299  -56.559 223.327 1.00 23.00  ? 358 ILE B N   1 
ATOM 5758 C CA  . ILE B 1 358 ? 0.091   -56.969 223.165 1.00 22.95  ? 358 ILE B CA  1 
ATOM 5759 C C   . ILE B 1 358 ? 0.320   -57.892 224.376 1.00 23.16  ? 358 ILE B C   1 
ATOM 5760 O O   . ILE B 1 358 ? 0.917   -58.956 224.251 1.00 21.25  ? 358 ILE B O   1 
ATOM 5761 C CB  . ILE B 1 358 ? 1.082   -55.767 223.263 1.00 23.90  ? 358 ILE B CB  1 
ATOM 5762 C CG1 . ILE B 1 358 ? 0.859   -54.769 222.120 1.00 16.81  ? 358 ILE B CG1 1 
ATOM 5763 C CG2 . ILE B 1 358 ? 2.520   -56.274 223.291 1.00 20.80  ? 358 ILE B CG2 1 
ATOM 5764 C CD1 . ILE B 1 358 ? 1.209   -55.294 220.789 1.00 22.97  ? 358 ILE B CD1 1 
ATOM 5765 N N   . THR B 1 359 ? -0.130  -57.447 225.551 1.00 20.29  ? 359 THR B N   1 
ATOM 5766 C CA  . THR B 1 359 ? -0.017  -58.232 226.780 1.00 23.54  ? 359 THR B CA  1 
ATOM 5767 C C   . THR B 1 359 ? -0.988  -59.423 226.649 1.00 27.58  ? 359 THR B C   1 
ATOM 5768 O O   . THR B 1 359 ? -2.196  -59.236 226.461 1.00 23.84  ? 359 THR B O   1 
ATOM 5769 C CB  . THR B 1 359 ? -0.415  -57.398 228.015 1.00 21.73  ? 359 THR B CB  1 
ATOM 5770 O OG1 . THR B 1 359 ? 0.213   -56.111 227.944 1.00 24.05  ? 359 THR B OG1 1 
ATOM 5771 C CG2 . THR B 1 359 ? 0.016   -58.097 229.309 1.00 21.00  ? 359 THR B CG2 1 
ATOM 5772 N N   . PRO B 1 360 ? -0.462  -60.663 226.740 1.00 32.65  ? 360 PRO B N   1 
ATOM 5773 C CA  . PRO B 1 360 ? -1.288  -61.874 226.623 1.00 32.75  ? 360 PRO B CA  1 
ATOM 5774 C C   . PRO B 1 360 ? -2.121  -62.130 227.881 1.00 29.99  ? 360 PRO B C   1 
ATOM 5775 O O   . PRO B 1 360 ? -1.651  -61.888 229.017 1.00 27.46  ? 360 PRO B O   1 
ATOM 5776 C CB  . PRO B 1 360 ? -0.233  -62.973 226.456 1.00 34.69  ? 360 PRO B CB  1 
ATOM 5777 C CG  . PRO B 1 360 ? 0.853   -62.508 227.447 1.00 34.27  ? 360 PRO B CG  1 
ATOM 5778 C CD  . PRO B 1 360 ? 0.935   -61.008 227.117 1.00 30.76  ? 360 PRO B CD  1 
ATOM 5779 N N   . ASN B 1 361 ? -3.354  -62.593 227.666 1.00 27.58  ? 361 ASN B N   1 
ATOM 5780 C CA  . ASN B 1 361 ? -4.291  -62.942 228.740 1.00 25.29  ? 361 ASN B CA  1 
ATOM 5781 C C   . ASN B 1 361 ? -4.048  -62.173 230.047 1.00 23.83  ? 361 ASN B C   1 
ATOM 5782 O O   . ASN B 1 361 ? -3.659  -62.762 231.069 1.00 25.33  ? 361 ASN B O   1 
ATOM 5783 C CB  . ASN B 1 361 ? -4.210  -64.453 228.992 1.00 26.22  ? 361 ASN B CB  1 
ATOM 5784 C CG  . ASN B 1 361 ? -5.270  -64.935 229.959 1.00 30.35  ? 361 ASN B CG  1 
ATOM 5785 O OD1 . ASN B 1 361 ? -6.457  -64.705 229.752 1.00 33.02  ? 361 ASN B OD1 1 
ATOM 5786 N ND2 . ASN B 1 361 ? -4.845  -65.595 231.026 1.00 32.15  ? 361 ASN B ND2 1 
ATOM 5787 N N   . PRO B 1 362 ? -4.319  -60.854 230.045 1.00 22.06  ? 362 PRO B N   1 
ATOM 5788 C CA  . PRO B 1 362 ? -4.099  -60.042 231.249 1.00 20.50  ? 362 PRO B CA  1 
ATOM 5789 C C   . PRO B 1 362 ? -4.799  -60.628 232.467 1.00 21.19  ? 362 PRO B C   1 
ATOM 5790 O O   . PRO B 1 362 ? -5.996  -60.934 232.424 1.00 20.87  ? 362 PRO B O   1 
ATOM 5791 C CB  . PRO B 1 362 ? -4.658  -58.660 230.851 1.00 20.78  ? 362 PRO B CB  1 
ATOM 5792 C CG  . PRO B 1 362 ? -4.518  -58.647 229.333 1.00 22.76  ? 362 PRO B CG  1 
ATOM 5793 C CD  . PRO B 1 362 ? -4.933  -60.057 228.966 1.00 20.12  ? 362 PRO B CD  1 
ATOM 5794 N N   . THR B 1 363 ? -4.050  -60.788 233.547 1.00 20.70  ? 363 THR B N   1 
ATOM 5795 C CA  . THR B 1 363 ? -4.586  -61.355 234.770 1.00 23.03  ? 363 THR B CA  1 
ATOM 5796 C C   . THR B 1 363 ? -4.070  -60.602 235.969 1.00 25.39  ? 363 THR B C   1 
ATOM 5797 O O   . THR B 1 363 ? -3.053  -59.912 235.887 1.00 28.13  ? 363 THR B O   1 
ATOM 5798 C CB  . THR B 1 363 ? -4.140  -62.837 234.959 1.00 25.71  ? 363 THR B CB  1 
ATOM 5799 O OG1 . THR B 1 363 ? -2.708  -62.925 234.897 1.00 26.20  ? 363 THR B OG1 1 
ATOM 5800 C CG2 . THR B 1 363 ? -4.753  -63.742 233.885 1.00 29.11  ? 363 THR B CG2 1 
ATOM 5801 N N   . ILE B 1 364 ? -4.814  -60.680 237.061 1.00 24.22  ? 364 ILE B N   1 
ATOM 5802 C CA  . ILE B 1 364 ? -4.389  -60.076 238.303 1.00 26.27  ? 364 ILE B CA  1 
ATOM 5803 C C   . ILE B 1 364 ? -4.019  -61.306 239.138 1.00 28.73  ? 364 ILE B C   1 
ATOM 5804 O O   . ILE B 1 364 ? -4.881  -62.142 239.440 1.00 27.78  ? 364 ILE B O   1 
ATOM 5805 C CB  . ILE B 1 364 ? -5.526  -59.326 238.993 1.00 26.21  ? 364 ILE B CB  1 
ATOM 5806 C CG1 . ILE B 1 364 ? -5.999  -58.152 238.132 1.00 26.28  ? 364 ILE B CG1 1 
ATOM 5807 C CG2 . ILE B 1 364 ? -5.070  -58.879 240.378 1.00 20.41  ? 364 ILE B CG2 1 
ATOM 5808 C CD1 . ILE B 1 364 ? -5.044  -56.986 238.123 1.00 22.52  ? 364 ILE B CD1 1 
ATOM 5809 N N   . GLU B 1 365 ? -2.727  -61.489 239.387 1.00 30.30  ? 365 GLU B N   1 
ATOM 5810 C CA  . GLU B 1 365 ? -2.254  -62.625 240.176 1.00 32.90  ? 365 GLU B CA  1 
ATOM 5811 C C   . GLU B 1 365 ? -2.298  -62.218 241.640 1.00 36.81  ? 365 GLU B C   1 
ATOM 5812 O O   . GLU B 1 365 ? -2.702  -61.092 241.968 1.00 38.66  ? 365 GLU B O   1 
ATOM 5813 C CB  . GLU B 1 365 ? -0.824  -63.007 239.783 1.00 28.16  ? 365 GLU B CB  1 
ATOM 5814 C CG  . GLU B 1 365 ? -0.636  -63.357 238.306 1.00 31.49  ? 365 GLU B CG  1 
ATOM 5815 C CD  . GLU B 1 365 ? -1.318  -64.660 237.878 1.00 38.79  ? 365 GLU B CD  1 
ATOM 5816 O OE1 . GLU B 1 365 ? -1.730  -65.449 238.759 1.00 41.75  ? 365 GLU B OE1 1 
ATOM 5817 O OE2 . GLU B 1 365 ? -1.424  -64.905 236.651 1.00 37.79  ? 365 GLU B OE2 1 
ATOM 5818 N N   . ASN B 1 366 ? -1.901  -63.120 242.529 1.00 39.87  ? 366 ASN B N   1 
ATOM 5819 C CA  . ASN B 1 366 ? -1.923  -62.803 243.951 1.00 44.33  ? 366 ASN B CA  1 
ATOM 5820 C C   . ASN B 1 366 ? -0.918  -61.709 244.312 1.00 45.44  ? 366 ASN B C   1 
ATOM 5821 O O   . ASN B 1 366 ? -1.131  -60.954 245.269 1.00 46.73  ? 366 ASN B O   1 
ATOM 5822 C CB  . ASN B 1 366 ? -1.694  -64.063 244.809 1.00 48.08  ? 366 ASN B CB  1 
ATOM 5823 C CG  . ASN B 1 366 ? -2.945  -64.942 244.921 1.00 50.98  ? 366 ASN B CG  1 
ATOM 5824 O OD1 . ASN B 1 366 ? -2.925  -66.119 244.555 1.00 53.50  ? 366 ASN B OD1 1 
ATOM 5825 N ND2 . ASN B 1 366 ? -4.032  -64.372 245.433 1.00 53.56  ? 366 ASN B ND2 1 
ATOM 5826 N N   . ASN B 1 367 ? 0.130   -61.569 243.503 1.00 44.58  ? 367 ASN B N   1 
ATOM 5827 C CA  . ASN B 1 367 ? 1.174   -60.573 243.759 1.00 45.89  ? 367 ASN B CA  1 
ATOM 5828 C C   . ASN B 1 367 ? 1.713   -59.932 242.477 1.00 42.13  ? 367 ASN B C   1 
ATOM 5829 O O   . ASN B 1 367 ? 2.897   -59.598 242.391 1.00 43.61  ? 367 ASN B O   1 
ATOM 5830 C CB  . ASN B 1 367 ? 2.330   -61.241 244.517 1.00 54.82  ? 367 ASN B CB  1 
ATOM 5831 C CG  . ASN B 1 367 ? 2.863   -62.489 243.793 1.00 68.93  ? 367 ASN B CG  1 
ATOM 5832 O OD1 . ASN B 1 367 ? 2.270   -62.966 242.803 1.00 69.83  ? 367 ASN B OD1 1 
ATOM 5833 N ND2 . ASN B 1 367 ? 3.977   -63.026 244.285 1.00 75.05  ? 367 ASN B ND2 1 
ATOM 5834 N N   . GLY B 1 368 ? 0.846   -59.735 241.494 1.00 38.16  ? 368 GLY B N   1 
ATOM 5835 C CA  . GLY B 1 368 ? 1.286   -59.139 240.250 1.00 33.38  ? 368 GLY B CA  1 
ATOM 5836 C C   . GLY B 1 368 ? 0.154   -58.939 239.273 1.00 30.57  ? 368 GLY B C   1 
ATOM 5837 O O   . GLY B 1 368 ? -1.002  -59.208 239.602 1.00 30.20  ? 368 GLY B O   1 
ATOM 5838 N N   . GLY B 1 369 ? 0.496   -58.521 238.057 1.00 26.90  ? 369 GLY B N   1 
ATOM 5839 C CA  . GLY B 1 369 ? -0.504  -58.280 237.031 1.00 24.14  ? 369 GLY B CA  1 
ATOM 5840 C C   . GLY B 1 369 ? -1.027  -56.856 237.103 1.00 21.81  ? 369 GLY B C   1 
ATOM 5841 O O   . GLY B 1 369 ? -0.781  -56.148 238.086 1.00 24.33  ? 369 GLY B O   1 
ATOM 5842 N N   . GLY B 1 370 ? -1.715  -56.413 236.057 1.00 18.26  ? 370 GLY B N   1 
ATOM 5843 C CA  . GLY B 1 370 ? -2.253  -55.070 236.081 1.00 16.84  ? 370 GLY B CA  1 
ATOM 5844 C C   . GLY B 1 370 ? -1.766  -54.159 234.975 1.00 20.25  ? 370 GLY B C   1 
ATOM 5845 O O   . GLY B 1 370 ? -2.463  -53.195 234.622 1.00 18.96  ? 370 GLY B O   1 
ATOM 5846 N N   . PHE B 1 371 ? -0.556  -54.410 234.475 1.00 18.70  ? 371 PHE B N   1 
ATOM 5847 C CA  . PHE B 1 371 ? 0.008   -53.615 233.388 1.00 16.77  ? 371 PHE B CA  1 
ATOM 5848 C C   . PHE B 1 371 ? -0.496  -54.198 232.079 1.00 15.06  ? 371 PHE B C   1 
ATOM 5849 O O   . PHE B 1 371 ? -0.468  -55.413 231.878 1.00 16.90  ? 371 PHE B O   1 
ATOM 5850 C CB  . PHE B 1 371 ? 1.549   -53.609 233.441 1.00 15.92  ? 371 PHE B CB  1 
ATOM 5851 C CG  . PHE B 1 371 ? 2.196   -53.123 232.175 1.00 17.98  ? 371 PHE B CG  1 
ATOM 5852 C CD1 . PHE B 1 371 ? 2.119   -51.791 231.802 1.00 17.91  ? 371 PHE B CD1 1 
ATOM 5853 C CD2 . PHE B 1 371 ? 2.871   -54.009 231.345 1.00 14.63  ? 371 PHE B CD2 1 
ATOM 5854 C CE1 . PHE B 1 371 ? 2.704   -51.345 230.616 1.00 19.03  ? 371 PHE B CE1 1 
ATOM 5855 C CE2 . PHE B 1 371 ? 3.463   -53.574 230.151 1.00 20.07  ? 371 PHE B CE2 1 
ATOM 5856 C CZ  . PHE B 1 371 ? 3.377   -52.238 229.789 1.00 16.41  ? 371 PHE B CZ  1 
ATOM 5857 N N   . ILE B 1 372 ? -0.982  -53.332 231.199 1.00 16.67  ? 372 ILE B N   1 
ATOM 5858 C CA  . ILE B 1 372 ? -1.518  -53.758 229.912 1.00 17.63  ? 372 ILE B CA  1 
ATOM 5859 C C   . ILE B 1 372 ? -1.024  -52.827 228.819 1.00 17.43  ? 372 ILE B C   1 
ATOM 5860 O O   . ILE B 1 372 ? -0.969  -51.612 229.011 1.00 15.23  ? 372 ILE B O   1 
ATOM 5861 C CB  . ILE B 1 372 ? -3.079  -53.676 229.868 1.00 17.81  ? 372 ILE B CB  1 
ATOM 5862 C CG1 . ILE B 1 372 ? -3.711  -54.519 230.973 1.00 16.22  ? 372 ILE B CG1 1 
ATOM 5863 C CG2 . ILE B 1 372 ? -3.601  -54.111 228.503 1.00 15.75  ? 372 ILE B CG2 1 
ATOM 5864 C CD1 . ILE B 1 372 ? -5.182  -54.213 231.178 1.00 20.68  ? 372 ILE B CD1 1 
ATOM 5865 N N   . GLU B 1 373 ? -0.621  -53.417 227.700 1.00 15.52  ? 373 GLU B N   1 
ATOM 5866 C CA  . GLU B 1 373 ? -0.200  -52.648 226.545 1.00 15.55  ? 373 GLU B CA  1 
ATOM 5867 C C   . GLU B 1 373 ? -1.098  -53.128 225.406 1.00 17.73  ? 373 GLU B C   1 
ATOM 5868 O O   . GLU B 1 373 ? -1.258  -54.334 225.198 1.00 16.09  ? 373 GLU B O   1 
ATOM 5869 C CB  . GLU B 1 373 ? 1.264   -52.892 226.182 1.00 15.18  ? 373 GLU B CB  1 
ATOM 5870 C CG  . GLU B 1 373 ? 1.672   -52.134 224.904 1.00 11.62  ? 373 GLU B CG  1 
ATOM 5871 C CD  . GLU B 1 373 ? 3.137   -52.311 224.505 1.00 19.85  ? 373 GLU B CD  1 
ATOM 5872 O OE1 . GLU B 1 373 ? 3.786   -53.317 224.878 1.00 17.37  ? 373 GLU B OE1 1 
ATOM 5873 O OE2 . GLU B 1 373 ? 3.640   -51.438 223.781 1.00 15.40  ? 373 GLU B OE2 1 
ATOM 5874 N N   . MET B 1 374 ? -1.683  -52.195 224.665 1.00 16.97  ? 374 MET B N   1 
ATOM 5875 C CA  . MET B 1 374 ? -2.564  -52.554 223.567 1.00 17.12  ? 374 MET B CA  1 
ATOM 5876 C C   . MET B 1 374 ? -2.433  -51.547 222.438 1.00 17.14  ? 374 MET B C   1 
ATOM 5877 O O   . MET B 1 374 ? -1.826  -50.483 222.603 1.00 17.66  ? 374 MET B O   1 
ATOM 5878 C CB  . MET B 1 374 ? -4.025  -52.576 224.047 1.00 18.70  ? 374 MET B CB  1 
ATOM 5879 C CG  . MET B 1 374 ? -4.531  -51.197 224.523 1.00 25.44  ? 374 MET B CG  1 
ATOM 5880 S SD  . MET B 1 374 ? -6.323  -51.117 224.813 1.00 23.85  ? 374 MET B SD  1 
ATOM 5881 C CE  . MET B 1 374 ? -6.469  -52.144 226.238 1.00 17.83  ? 374 MET B CE  1 
ATOM 5882 N N   . GLN B 1 375 ? -2.970  -51.913 221.280 1.00 17.35  ? 375 GLN B N   1 
ATOM 5883 C CA  . GLN B 1 375 ? -2.974  -51.037 220.123 1.00 22.05  ? 375 GLN B CA  1 
ATOM 5884 C C   . GLN B 1 375 ? -4.448  -50.755 219.803 1.00 23.85  ? 375 GLN B C   1 
ATOM 5885 O O   . GLN B 1 375 ? -5.305  -51.642 219.924 1.00 24.08  ? 375 GLN B O   1 
ATOM 5886 C CB  . GLN B 1 375 ? -2.292  -51.704 218.939 1.00 21.56  ? 375 GLN B CB  1 
ATOM 5887 C CG  . GLN B 1 375 ? -2.186  -50.806 217.733 1.00 36.87  ? 375 GLN B CG  1 
ATOM 5888 C CD  . GLN B 1 375 ? -1.343  -51.420 216.633 1.00 45.54  ? 375 GLN B CD  1 
ATOM 5889 O OE1 . GLN B 1 375 ? -1.428  -52.620 216.358 1.00 52.73  ? 375 GLN B OE1 1 
ATOM 5890 N NE2 . GLN B 1 375 ? -0.512  -50.600 216.005 1.00 52.31  ? 375 GLN B NE2 1 
ATOM 5891 N N   . LEU B 1 376 ? -4.738  -49.520 219.414 1.00 23.40  ? 376 LEU B N   1 
ATOM 5892 C CA  . LEU B 1 376 ? -6.092  -49.103 219.105 1.00 24.12  ? 376 LEU B CA  1 
ATOM 5893 C C   . LEU B 1 376 ? -6.082  -48.407 217.768 1.00 25.05  ? 376 LEU B C   1 
ATOM 5894 O O   . LEU B 1 376 ? -5.047  -47.889 217.353 1.00 24.73  ? 376 LEU B O   1 
ATOM 5895 C CB  . LEU B 1 376 ? -6.578  -48.108 220.161 1.00 25.36  ? 376 LEU B CB  1 
ATOM 5896 C CG  . LEU B 1 376 ? -6.856  -48.639 221.559 1.00 28.16  ? 376 LEU B CG  1 
ATOM 5897 C CD1 . LEU B 1 376 ? -7.076  -47.493 222.518 1.00 21.56  ? 376 LEU B CD1 1 
ATOM 5898 C CD2 . LEU B 1 376 ? -8.082  -49.541 221.477 1.00 30.77  ? 376 LEU B CD2 1 
ATOM 5899 N N   . PRO B 1 377 ? -7.223  -48.418 217.054 1.00 27.32  ? 377 PRO B N   1 
ATOM 5900 C CA  . PRO B 1 377 ? -7.303  -47.754 215.751 1.00 28.13  ? 377 PRO B CA  1 
ATOM 5901 C C   . PRO B 1 377 ? -7.354  -46.242 215.970 1.00 29.37  ? 377 PRO B C   1 
ATOM 5902 O O   . PRO B 1 377 ? -7.702  -45.774 217.062 1.00 27.25  ? 377 PRO B O   1 
ATOM 5903 C CB  . PRO B 1 377 ? -8.605  -48.312 215.163 1.00 27.43  ? 377 PRO B CB  1 
ATOM 5904 C CG  . PRO B 1 377 ? -9.435  -48.593 216.360 1.00 30.93  ? 377 PRO B CG  1 
ATOM 5905 C CD  . PRO B 1 377 ? -8.442  -49.209 217.315 1.00 30.75  ? 377 PRO B CD  1 
ATOM 5906 N N   . PRO B 1 378 ? -6.935  -45.459 214.959 1.00 31.88  ? 378 PRO B N   1 
ATOM 5907 C CA  . PRO B 1 378 ? -6.928  -43.992 215.041 1.00 31.04  ? 378 PRO B CA  1 
ATOM 5908 C C   . PRO B 1 378 ? -8.321  -43.450 215.336 1.00 30.43  ? 378 PRO B C   1 
ATOM 5909 O O   . PRO B 1 378 ? -9.323  -44.038 214.913 1.00 31.45  ? 378 PRO B O   1 
ATOM 5910 C CB  . PRO B 1 378 ? -6.470  -43.575 213.642 1.00 29.94  ? 378 PRO B CB  1 
ATOM 5911 C CG  . PRO B 1 378 ? -5.613  -44.733 213.198 1.00 33.30  ? 378 PRO B CG  1 
ATOM 5912 C CD  . PRO B 1 378 ? -6.438  -45.914 213.647 1.00 33.80  ? 378 PRO B CD  1 
ATOM 5913 N N   . GLY B 1 379 ? -8.380  -42.337 216.066 1.00 31.05  ? 379 GLY B N   1 
ATOM 5914 C CA  . GLY B 1 379 ? -9.664  -41.735 216.398 1.00 31.04  ? 379 GLY B CA  1 
ATOM 5915 C C   . GLY B 1 379 ? -10.027 -41.805 217.873 1.00 30.86  ? 379 GLY B C   1 
ATOM 5916 O O   . GLY B 1 379 ? -9.186  -42.143 218.715 1.00 29.48  ? 379 GLY B O   1 
ATOM 5917 N N   . ASP B 1 380 ? -11.284 -41.489 218.181 1.00 29.00  ? 380 ASP B N   1 
ATOM 5918 C CA  . ASP B 1 380 ? -11.782 -41.498 219.555 1.00 26.52  ? 380 ASP B CA  1 
ATOM 5919 C C   . ASP B 1 380 ? -12.248 -42.890 219.940 1.00 23.57  ? 380 ASP B C   1 
ATOM 5920 O O   . ASP B 1 380 ? -13.075 -43.487 219.249 1.00 24.64  ? 380 ASP B O   1 
ATOM 5921 C CB  . ASP B 1 380 ? -12.947 -40.521 219.708 1.00 29.72  ? 380 ASP B CB  1 
ATOM 5922 C CG  . ASP B 1 380 ? -12.554 -39.089 219.420 1.00 33.45  ? 380 ASP B CG  1 
ATOM 5923 O OD1 . ASP B 1 380 ? -11.874 -38.472 220.271 1.00 36.19  ? 380 ASP B OD1 1 
ATOM 5924 O OD2 . ASP B 1 380 ? -12.933 -38.581 218.342 1.00 44.02  ? 380 ASP B OD2 1 
ATOM 5925 N N   . ASN B 1 381 ? -11.770 -43.373 221.079 1.00 18.66  ? 381 ASN B N   1 
ATOM 5926 C CA  . ASN B 1 381 ? -12.115 -44.704 221.567 1.00 16.62  ? 381 ASN B CA  1 
ATOM 5927 C C   . ASN B 1 381 ? -12.385 -44.583 223.057 1.00 17.25  ? 381 ASN B C   1 
ATOM 5928 O O   . ASN B 1 381 ? -12.098 -43.557 223.666 1.00 17.30  ? 381 ASN B O   1 
ATOM 5929 C CB  . ASN B 1 381 ? -10.919 -45.672 221.411 1.00 18.48  ? 381 ASN B CB  1 
ATOM 5930 C CG  . ASN B 1 381 ? -10.387 -45.775 219.972 1.00 21.32  ? 381 ASN B CG  1 
ATOM 5931 O OD1 . ASN B 1 381 ? -10.868 -46.581 219.177 1.00 23.78  ? 381 ASN B OD1 1 
ATOM 5932 N ND2 . ASN B 1 381 ? -9.353  -45.001 219.661 1.00 23.96  ? 381 ASN B ND2 1 
ATOM 5933 N N   . ILE B 1 382 ? -12.937 -45.636 223.646 1.00 18.48  ? 382 ILE B N   1 
ATOM 5934 C CA  . ILE B 1 382 ? -13.170 -45.665 225.085 1.00 19.09  ? 382 ILE B CA  1 
ATOM 5935 C C   . ILE B 1 382 ? -12.613 -47.018 225.507 1.00 19.38  ? 382 ILE B C   1 
ATOM 5936 O O   . ILE B 1 382 ? -12.917 -48.052 224.900 1.00 18.91  ? 382 ILE B O   1 
ATOM 5937 C CB  . ILE B 1 382 ? -14.680 -45.569 225.497 1.00 18.71  ? 382 ILE B CB  1 
ATOM 5938 C CG1 . ILE B 1 382 ? -15.291 -44.232 225.068 1.00 19.56  ? 382 ILE B CG1 1 
ATOM 5939 C CG2 . ILE B 1 382 ? -14.804 -45.657 227.006 1.00 17.97  ? 382 ILE B CG2 1 
ATOM 5940 C CD1 . ILE B 1 382 ? -15.952 -44.275 223.715 1.00 29.27  ? 382 ILE B CD1 1 
ATOM 5941 N N   . ILE B 1 383 ? -11.733 -46.999 226.493 1.00 19.47  ? 383 ILE B N   1 
ATOM 5942 C CA  . ILE B 1 383 ? -11.126 -48.217 226.984 1.00 19.35  ? 383 ILE B CA  1 
ATOM 5943 C C   . ILE B 1 383 ? -11.918 -48.646 228.212 1.00 20.47  ? 383 ILE B C   1 
ATOM 5944 O O   . ILE B 1 383 ? -12.288 -47.807 229.054 1.00 18.55  ? 383 ILE B O   1 
ATOM 5945 C CB  . ILE B 1 383 ? -9.622  -47.975 227.353 1.00 21.19  ? 383 ILE B CB  1 
ATOM 5946 C CG1 . ILE B 1 383 ? -8.824  -47.610 226.096 1.00 19.26  ? 383 ILE B CG1 1 
ATOM 5947 C CG2 . ILE B 1 383 ? -9.023  -49.205 228.043 1.00 15.48  ? 383 ILE B CG2 1 
ATOM 5948 C CD1 . ILE B 1 383 ? -7.456  -47.015 226.375 1.00 20.72  ? 383 ILE B CD1 1 
ATOM 5949 N N   . TYR B 1 384 ? -12.230 -49.938 228.275 1.00 18.65  ? 384 TYR B N   1 
ATOM 5950 C CA  . TYR B 1 384 ? -12.957 -50.509 229.403 1.00 19.13  ? 384 TYR B CA  1 
ATOM 5951 C C   . TYR B 1 384 ? -12.185 -51.646 230.060 1.00 20.96  ? 384 TYR B C   1 
ATOM 5952 O O   . TYR B 1 384 ? -11.663 -52.547 229.391 1.00 22.91  ? 384 TYR B O   1 
ATOM 5953 C CB  . TYR B 1 384 ? -14.309 -51.074 228.954 1.00 20.94  ? 384 TYR B CB  1 
ATOM 5954 C CG  . TYR B 1 384 ? -15.335 -50.043 228.560 1.00 22.98  ? 384 TYR B CG  1 
ATOM 5955 C CD1 . TYR B 1 384 ? -16.113 -49.410 229.531 1.00 27.09  ? 384 TYR B CD1 1 
ATOM 5956 C CD2 . TYR B 1 384 ? -15.569 -49.737 227.219 1.00 21.70  ? 384 TYR B CD2 1 
ATOM 5957 C CE1 . TYR B 1 384 ? -17.102 -48.501 229.181 1.00 23.41  ? 384 TYR B CE1 1 
ATOM 5958 C CE2 . TYR B 1 384 ? -16.562 -48.831 226.855 1.00 25.75  ? 384 TYR B CE2 1 
ATOM 5959 C CZ  . TYR B 1 384 ? -17.324 -48.221 227.846 1.00 29.25  ? 384 TYR B CZ  1 
ATOM 5960 O OH  . TYR B 1 384 ? -18.319 -47.339 227.509 1.00 36.47  ? 384 TYR B OH  1 
ATOM 5961 N N   . VAL B 1 385 ? -12.104 -51.591 231.376 1.00 19.42  ? 385 VAL B N   1 
ATOM 5962 C CA  . VAL B 1 385 ? -11.481 -52.642 232.156 1.00 21.43  ? 385 VAL B CA  1 
ATOM 5963 C C   . VAL B 1 385 ? -12.661 -52.923 233.096 1.00 22.74  ? 385 VAL B C   1 
ATOM 5964 O O   . VAL B 1 385 ? -12.828 -52.284 234.148 1.00 22.32  ? 385 VAL B O   1 
ATOM 5965 C CB  . VAL B 1 385 ? -10.216 -52.127 232.892 1.00 23.34  ? 385 VAL B CB  1 
ATOM 5966 C CG1 . VAL B 1 385 ? -9.642  -53.215 233.782 1.00 20.28  ? 385 VAL B CG1 1 
ATOM 5967 C CG2 . VAL B 1 385 ? -9.169  -51.704 231.857 1.00 17.09  ? 385 VAL B CG2 1 
ATOM 5968 N N   . GLY B 1 386 ? -13.556 -53.791 232.632 1.00 21.96  ? 386 GLY B N   1 
ATOM 5969 C CA  . GLY B 1 386 ? -14.763 -54.074 233.388 1.00 20.46  ? 386 GLY B CA  1 
ATOM 5970 C C   . GLY B 1 386 ? -15.629 -52.827 233.245 1.00 21.31  ? 386 GLY B C   1 
ATOM 5971 O O   . GLY B 1 386 ? -15.872 -52.365 232.133 1.00 20.94  ? 386 GLY B O   1 
ATOM 5972 N N   . GLU B 1 387 ? -16.060 -52.249 234.359 1.00 23.69  ? 387 GLU B N   1 
ATOM 5973 C CA  . GLU B 1 387 ? -16.874 -51.040 234.307 1.00 24.82  ? 387 GLU B CA  1 
ATOM 5974 C C   . GLU B 1 387 ? -16.026 -49.780 234.348 1.00 23.47  ? 387 GLU B C   1 
ATOM 5975 O O   . GLU B 1 387 ? -16.539 -48.672 234.156 1.00 23.32  ? 387 GLU B O   1 
ATOM 5976 C CB  . GLU B 1 387 ? -17.906 -51.048 235.429 1.00 25.07  ? 387 GLU B CB  1 
ATOM 5977 C CG  . GLU B 1 387 ? -18.893 -52.191 235.236 1.00 31.79  ? 387 GLU B CG  1 
ATOM 5978 C CD  . GLU B 1 387 ? -20.075 -52.139 236.181 1.00 42.56  ? 387 GLU B CD  1 
ATOM 5979 O OE1 . GLU B 1 387 ? -20.019 -51.395 237.191 1.00 47.49  ? 387 GLU B OE1 1 
ATOM 5980 O OE2 . GLU B 1 387 ? -21.068 -52.852 235.906 1.00 48.81  ? 387 GLU B OE2 1 
ATOM 5981 N N   . LEU B 1 388 ? -14.737 -49.954 234.637 1.00 19.63  ? 388 LEU B N   1 
ATOM 5982 C CA  . LEU B 1 388 ? -13.815 -48.836 234.663 1.00 17.68  ? 388 LEU B CA  1 
ATOM 5983 C C   . LEU B 1 388 ? -13.616 -48.413 233.205 1.00 17.27  ? 388 LEU B C   1 
ATOM 5984 O O   . LEU B 1 388 ? -13.362 -49.252 232.334 1.00 17.84  ? 388 LEU B O   1 
ATOM 5985 C CB  . LEU B 1 388 ? -12.486 -49.269 235.283 1.00 14.73  ? 388 LEU B CB  1 
ATOM 5986 C CG  . LEU B 1 388 ? -11.395 -48.199 235.316 1.00 18.80  ? 388 LEU B CG  1 
ATOM 5987 C CD1 . LEU B 1 388 ? -11.811 -47.101 236.292 1.00 14.48  ? 388 LEU B CD1 1 
ATOM 5988 C CD2 . LEU B 1 388 ? -10.047 -48.829 235.702 1.00 14.71  ? 388 LEU B CD2 1 
ATOM 5989 N N   . SER B 1 389 ? -13.729 -47.122 232.931 1.00 17.80  ? 389 SER B N   1 
ATOM 5990 C CA  . SER B 1 389 ? -13.594 -46.642 231.562 1.00 16.86  ? 389 SER B CA  1 
ATOM 5991 C C   . SER B 1 389 ? -12.608 -45.501 231.432 1.00 17.88  ? 389 SER B C   1 
ATOM 5992 O O   . SER B 1 389 ? -12.265 -44.849 232.424 1.00 17.70  ? 389 SER B O   1 
ATOM 5993 C CB  . SER B 1 389 ? -14.953 -46.136 231.071 1.00 23.14  ? 389 SER B CB  1 
ATOM 5994 O OG  . SER B 1 389 ? -15.321 -44.938 231.747 1.00 21.17  ? 389 SER B OG  1 
ATOM 5995 N N   . HIS B 1 390 ? -12.182 -45.233 230.204 1.00 17.10  ? 390 HIS B N   1 
ATOM 5996 C CA  . HIS B 1 390 ? -11.288 -44.111 229.959 1.00 18.59  ? 390 HIS B CA  1 
ATOM 5997 C C   . HIS B 1 390 ? -11.358 -43.680 228.509 1.00 19.50  ? 390 HIS B C   1 
ATOM 5998 O O   . HIS B 1 390 ? -11.292 -44.517 227.607 1.00 21.56  ? 390 HIS B O   1 
ATOM 5999 C CB  . HIS B 1 390 ? -9.833  -44.443 230.330 1.00 19.11  ? 390 HIS B CB  1 
ATOM 6000 C CG  . HIS B 1 390 ? -9.026  -43.233 230.683 1.00 18.15  ? 390 HIS B CG  1 
ATOM 6001 N ND1 . HIS B 1 390 ? -8.629  -42.300 229.749 1.00 14.85  ? 390 HIS B ND1 1 
ATOM 6002 C CD2 . HIS B 1 390 ? -8.636  -42.746 231.888 1.00 16.85  ? 390 HIS B CD2 1 
ATOM 6003 C CE1 . HIS B 1 390 ? -8.042  -41.285 230.358 1.00 17.29  ? 390 HIS B CE1 1 
ATOM 6004 N NE2 . HIS B 1 390 ? -8.039  -41.530 231.656 1.00 15.37  ? 390 HIS B NE2 1 
ATOM 6005 N N   . GLN B 1 391 ? -11.530 -42.384 228.279 1.00 17.41  ? 391 GLN B N   1 
ATOM 6006 C CA  . GLN B 1 391 ? -11.558 -41.866 226.909 1.00 21.31  ? 391 GLN B CA  1 
ATOM 6007 C C   . GLN B 1 391 ? -10.142 -41.980 226.350 1.00 20.15  ? 391 GLN B C   1 
ATOM 6008 O O   . GLN B 1 391 ? -9.179  -41.890 227.094 1.00 21.27  ? 391 GLN B O   1 
ATOM 6009 C CB  . GLN B 1 391 ? -11.949 -40.378 226.884 1.00 22.15  ? 391 GLN B CB  1 
ATOM 6010 C CG  . GLN B 1 391 ? -13.352 -40.089 227.365 1.00 27.90  ? 391 GLN B CG  1 
ATOM 6011 C CD  . GLN B 1 391 ? -14.396 -40.830 226.550 1.00 36.24  ? 391 GLN B CD  1 
ATOM 6012 O OE1 . GLN B 1 391 ? -14.457 -40.692 225.324 1.00 36.12  ? 391 GLN B OE1 1 
ATOM 6013 N NE2 . GLN B 1 391 ? -15.225 -41.625 227.227 1.00 34.03  ? 391 GLN B NE2 1 
ATOM 6014 N N   . TRP B 1 392 ? -10.007 -42.221 225.059 1.00 20.90  ? 392 TRP B N   1 
ATOM 6015 C CA  . TRP B 1 392 ? -8.684  -42.271 224.467 1.00 22.47  ? 392 TRP B CA  1 
ATOM 6016 C C   . TRP B 1 392 ? -8.696  -41.833 223.015 1.00 22.95  ? 392 TRP B C   1 
ATOM 6017 O O   . TRP B 1 392 ? -9.359  -42.446 222.190 1.00 24.47  ? 392 TRP B O   1 
ATOM 6018 C CB  . TRP B 1 392 ? -8.061  -43.668 224.541 1.00 18.99  ? 392 TRP B CB  1 
ATOM 6019 C CG  . TRP B 1 392 ? -6.675  -43.674 223.936 1.00 21.34  ? 392 TRP B CG  1 
ATOM 6020 C CD1 . TRP B 1 392 ? -6.296  -44.210 222.728 1.00 18.22  ? 392 TRP B CD1 1 
ATOM 6021 C CD2 . TRP B 1 392 ? -5.518  -43.009 224.456 1.00 16.32  ? 392 TRP B CD2 1 
ATOM 6022 N NE1 . TRP B 1 392 ? -4.977  -43.906 222.464 1.00 16.29  ? 392 TRP B NE1 1 
ATOM 6023 C CE2 . TRP B 1 392 ? -4.476  -43.171 223.506 1.00 17.78  ? 392 TRP B CE2 1 
ATOM 6024 C CE3 . TRP B 1 392 ? -5.261  -42.287 225.631 1.00 21.87  ? 392 TRP B CE3 1 
ATOM 6025 C CZ2 . TRP B 1 392 ? -3.199  -42.627 223.690 1.00 17.00  ? 392 TRP B CZ2 1 
ATOM 6026 C CZ3 . TRP B 1 392 ? -3.983  -41.745 225.815 1.00 24.28  ? 392 TRP B CZ3 1 
ATOM 6027 C CH2 . TRP B 1 392 ? -2.970  -41.923 224.848 1.00 21.93  ? 392 TRP B CH2 1 
ATOM 6028 N N   . PHE B 1 393 ? -8.012  -40.741 222.707 1.00 24.31  ? 393 PHE B N   1 
ATOM 6029 C CA  . PHE B 1 393 ? -7.905  -40.330 221.318 1.00 24.89  ? 393 PHE B CA  1 
ATOM 6030 C C   . PHE B 1 393 ? -6.590  -40.921 220.777 1.00 25.75  ? 393 PHE B C   1 
ATOM 6031 O O   . PHE B 1 393 ? -5.500  -40.631 221.301 1.00 23.00  ? 393 PHE B O   1 
ATOM 6032 C CB  . PHE B 1 393 ? -7.909  -38.805 221.164 1.00 27.55  ? 393 PHE B CB  1 
ATOM 6033 C CG  . PHE B 1 393 ? -7.666  -38.357 219.741 1.00 31.40  ? 393 PHE B CG  1 
ATOM 6034 C CD1 . PHE B 1 393 ? -8.627  -38.589 218.750 1.00 31.75  ? 393 PHE B CD1 1 
ATOM 6035 C CD2 . PHE B 1 393 ? -6.433  -37.818 219.369 1.00 34.18  ? 393 PHE B CD2 1 
ATOM 6036 C CE1 . PHE B 1 393 ? -8.363  -38.305 217.409 1.00 32.77  ? 393 PHE B CE1 1 
ATOM 6037 C CE2 . PHE B 1 393 ? -6.154  -37.529 218.029 1.00 34.19  ? 393 PHE B CE2 1 
ATOM 6038 C CZ  . PHE B 1 393 ? -7.118  -37.775 217.047 1.00 32.06  ? 393 PHE B CZ  1 
ATOM 6039 N N   . GLN B 1 394 ? -6.696  -41.779 219.765 1.00 27.68  ? 394 GLN B N   1 
ATOM 6040 C CA  . GLN B 1 394 ? -5.526  -42.417 219.166 1.00 29.58  ? 394 GLN B CA  1 
ATOM 6041 C C   . GLN B 1 394 ? -4.958  -41.643 217.979 1.00 33.84  ? 394 GLN B C   1 
ATOM 6042 O O   . GLN B 1 394 ? -5.666  -41.378 217.003 1.00 32.91  ? 394 GLN B O   1 
ATOM 6043 C CB  . GLN B 1 394 ? -5.862  -43.846 218.729 1.00 25.04  ? 394 GLN B CB  1 
ATOM 6044 C CG  . GLN B 1 394 ? -4.696  -44.607 218.091 1.00 26.35  ? 394 GLN B CG  1 
ATOM 6045 C CD  . GLN B 1 394 ? -3.442  -44.646 218.967 1.00 33.73  ? 394 GLN B CD  1 
ATOM 6046 O OE1 . GLN B 1 394 ? -3.483  -45.038 220.137 1.00 35.29  ? 394 GLN B OE1 1 
ATOM 6047 N NE2 . GLN B 1 394 ? -2.322  -44.221 218.401 1.00 29.57  ? 394 GLN B NE2 1 
ATOM 6048 N N   . LYS B 1 395 ? -3.661  -41.347 218.080 1.00 40.18  ? 395 LYS B N   1 
ATOM 6049 C CA  . LYS B 1 395 ? -2.839  -40.635 217.089 1.00 43.37  ? 395 LYS B CA  1 
ATOM 6050 C C   . LYS B 1 395 ? -2.616  -39.187 217.461 1.00 45.84  ? 395 LYS B C   1 
ATOM 6051 O O   . LYS B 1 395 ? -1.527  -38.827 217.902 1.00 48.70  ? 395 LYS B O   1 
ATOM 6052 C CB  . LYS B 1 395 ? -3.400  -40.718 215.678 1.00 45.65  ? 395 LYS B CB  1 
ATOM 6053 C CG  . LYS B 1 395 ? -2.648  -41.617 214.769 1.00 47.63  ? 395 LYS B CG  1 
ATOM 6054 C CD  . LYS B 1 395 ? -3.089  -41.299 213.369 1.00 61.07  ? 395 LYS B CD  1 
ATOM 6055 C CE  . LYS B 1 395 ? -2.516  -42.262 212.358 1.00 73.42  ? 395 LYS B CE  1 
ATOM 6056 N NZ  . LYS B 1 395 ? -3.263  -42.131 211.062 1.00 78.63  ? 395 LYS B NZ  1 
ATOM 6057 N N   . SER C 1 1   ? 91.458  -13.783 218.147 1.00 22.56  ? 1   SER C N   1 
ATOM 6058 C CA  . SER C 1 1   ? 90.434  -12.828 217.745 1.00 22.01  ? 1   SER C CA  1 
ATOM 6059 C C   . SER C 1 1   ? 89.061  -13.500 217.763 1.00 23.56  ? 1   SER C C   1 
ATOM 6060 O O   . SER C 1 1   ? 88.891  -14.561 217.172 1.00 20.81  ? 1   SER C O   1 
ATOM 6061 C CB  . SER C 1 1   ? 90.763  -12.380 216.344 1.00 29.68  ? 1   SER C CB  1 
ATOM 6062 O OG  . SER C 1 1   ? 89.979  -11.298 215.988 1.00 11.99  ? 1   SER C OG  1 
ATOM 6063 N N   . ARG C 1 2   ? 88.074  -12.860 218.384 1.00 20.85  ? 2   ARG C N   1 
ATOM 6064 C CA  . ARG C 1 2   ? 86.741  -13.448 218.486 1.00 20.31  ? 2   ARG C CA  1 
ATOM 6065 C C   . ARG C 1 2   ? 86.105  -13.861 217.160 1.00 17.71  ? 2   ARG C C   1 
ATOM 6066 O O   . ARG C 1 2   ? 85.537  -14.942 217.068 1.00 19.33  ? 2   ARG C O   1 
ATOM 6067 C CB  . ARG C 1 2   ? 85.805  -12.514 219.250 1.00 24.90  ? 2   ARG C CB  1 
ATOM 6068 C CG  . ARG C 1 2   ? 84.572  -13.200 219.804 1.00 24.14  ? 2   ARG C CG  1 
ATOM 6069 C CD  . ARG C 1 2   ? 83.437  -13.184 218.814 1.00 30.49  ? 2   ARG C CD  1 
ATOM 6070 N NE  . ARG C 1 2   ? 82.329  -14.039 219.237 1.00 29.80  ? 2   ARG C NE  1 
ATOM 6071 C CZ  . ARG C 1 2   ? 81.132  -14.039 218.658 1.00 36.04  ? 2   ARG C CZ  1 
ATOM 6072 N NH1 . ARG C 1 2   ? 80.885  -13.217 217.637 1.00 34.38  ? 2   ARG C NH1 1 
ATOM 6073 N NH2 . ARG C 1 2   ? 80.196  -14.891 219.062 1.00 29.18  ? 2   ARG C NH2 1 
ATOM 6074 N N   . CYS C 1 3   ? 86.194  -13.023 216.137 1.00 17.12  ? 3   CYS C N   1 
ATOM 6075 C CA  . CYS C 1 3   ? 85.603  -13.359 214.851 1.00 16.01  ? 3   CYS C CA  1 
ATOM 6076 C C   . CYS C 1 3   ? 86.132  -14.651 214.228 1.00 22.29  ? 3   CYS C C   1 
ATOM 6077 O O   . CYS C 1 3   ? 85.445  -15.249 213.392 1.00 24.35  ? 3   CYS C O   1 
ATOM 6078 C CB  . CYS C 1 3   ? 85.749  -12.227 213.846 1.00 16.73  ? 3   CYS C CB  1 
ATOM 6079 S SG  . CYS C 1 3   ? 84.722  -10.745 214.155 1.00 20.25  ? 3   CYS C SG  1 
ATOM 6080 N N   . THR C 1 4   ? 87.320  -15.113 214.629 1.00 22.44  ? 4   THR C N   1 
ATOM 6081 C CA  . THR C 1 4   ? 87.848  -16.356 214.067 1.00 22.61  ? 4   THR C CA  1 
ATOM 6082 C C   . THR C 1 4   ? 87.086  -17.582 214.606 1.00 25.46  ? 4   THR C C   1 
ATOM 6083 O O   . THR C 1 4   ? 87.274  -18.704 214.120 1.00 26.11  ? 4   THR C O   1 
ATOM 6084 C CB  . THR C 1 4   ? 89.360  -16.531 214.361 1.00 20.99  ? 4   THR C CB  1 
ATOM 6085 O OG1 . THR C 1 4   ? 89.568  -16.670 215.771 1.00 15.66  ? 4   THR C OG1 1 
ATOM 6086 C CG2 . THR C 1 4   ? 90.159  -15.355 213.822 1.00 13.67  ? 4   THR C CG2 1 
ATOM 6087 N N   . HIS C 1 5   ? 86.243  -17.370 215.622 1.00 24.41  ? 5   HIS C N   1 
ATOM 6088 C CA  . HIS C 1 5   ? 85.467  -18.444 216.237 1.00 25.07  ? 5   HIS C CA  1 
ATOM 6089 C C   . HIS C 1 5   ? 84.247  -18.868 215.417 1.00 28.86  ? 5   HIS C C   1 
ATOM 6090 O O   . HIS C 1 5   ? 83.665  -19.935 215.678 1.00 28.44  ? 5   HIS C O   1 
ATOM 6091 C CB  . HIS C 1 5   ? 84.950  -18.028 217.622 1.00 19.26  ? 5   HIS C CB  1 
ATOM 6092 C CG  . HIS C 1 5   ? 86.021  -17.746 218.630 1.00 20.97  ? 5   HIS C CG  1 
ATOM 6093 N ND1 . HIS C 1 5   ? 85.764  -17.105 219.828 1.00 21.79  ? 5   HIS C ND1 1 
ATOM 6094 C CD2 . HIS C 1 5   ? 87.346  -18.032 218.636 1.00 18.18  ? 5   HIS C CD2 1 
ATOM 6095 C CE1 . HIS C 1 5   ? 86.879  -17.009 220.524 1.00 22.06  ? 5   HIS C CE1 1 
ATOM 6096 N NE2 . HIS C 1 5   ? 87.855  -17.562 219.828 1.00 23.52  ? 5   HIS C NE2 1 
ATOM 6097 N N   . LEU C 1 6   ? 83.785  -18.011 214.510 1.00 28.80  ? 6   LEU C N   1 
ATOM 6098 C CA  . LEU C 1 6   ? 82.606  -18.350 213.727 1.00 32.74  ? 6   LEU C CA  1 
ATOM 6099 C C   . LEU C 1 6   ? 82.823  -18.400 212.233 1.00 34.95  ? 6   LEU C C   1 
ATOM 6100 O O   . LEU C 1 6   ? 83.821  -17.907 211.720 1.00 36.22  ? 6   LEU C O   1 
ATOM 6101 C CB  . LEU C 1 6   ? 81.427  -17.425 214.049 1.00 36.07  ? 6   LEU C CB  1 
ATOM 6102 C CG  . LEU C 1 6   ? 81.549  -16.010 214.605 1.00 38.60  ? 6   LEU C CG  1 
ATOM 6103 C CD1 . LEU C 1 6   ? 80.285  -15.255 214.327 1.00 40.14  ? 6   LEU C CD1 1 
ATOM 6104 C CD2 . LEU C 1 6   ? 81.754  -16.066 216.082 1.00 37.47  ? 6   LEU C CD2 1 
ATOM 6105 N N   . GLU C 1 7   ? 81.864  -19.006 211.543 1.00 37.12  ? 7   GLU C N   1 
ATOM 6106 C CA  . GLU C 1 7   ? 81.912  -19.153 210.093 1.00 38.06  ? 7   GLU C CA  1 
ATOM 6107 C C   . GLU C 1 7   ? 81.435  -17.863 209.425 1.00 37.04  ? 7   GLU C C   1 
ATOM 6108 O O   . GLU C 1 7   ? 81.976  -17.447 208.392 1.00 38.14  ? 7   GLU C O   1 
ATOM 6109 C CB  . GLU C 1 7   ? 81.042  -20.335 209.653 1.00 47.16  ? 7   GLU C CB  1 
ATOM 6110 C CG  . GLU C 1 7   ? 81.142  -20.667 208.157 1.00 68.86  ? 7   GLU C CG  1 
ATOM 6111 C CD  . GLU C 1 7   ? 80.043  -21.611 207.676 1.00 78.66  ? 7   GLU C CD  1 
ATOM 6112 O OE1 . GLU C 1 7   ? 78.860  -21.417 208.059 1.00 79.08  ? 7   GLU C OE1 1 
ATOM 6113 O OE2 . GLU C 1 7   ? 80.349  -22.547 206.891 1.00 80.27  ? 7   GLU C OE2 1 
ATOM 6114 N N   . ASN C 1 8   ? 80.448  -17.213 210.033 1.00 33.92  ? 8   ASN C N   1 
ATOM 6115 C CA  . ASN C 1 8   ? 79.906  -15.978 209.494 1.00 33.04  ? 8   ASN C CA  1 
ATOM 6116 C C   . ASN C 1 8   ? 80.758  -14.773 209.919 1.00 31.86  ? 8   ASN C C   1 
ATOM 6117 O O   . ASN C 1 8   ? 80.530  -14.186 210.975 1.00 34.65  ? 8   ASN C O   1 
ATOM 6118 C CB  . ASN C 1 8   ? 78.454  -15.809 209.959 1.00 38.41  ? 8   ASN C CB  1 
ATOM 6119 C CG  . ASN C 1 8   ? 77.753  -14.621 209.303 1.00 45.32  ? 8   ASN C CG  1 
ATOM 6120 O OD1 . ASN C 1 8   ? 78.240  -14.052 208.316 1.00 44.72  ? 8   ASN C OD1 1 
ATOM 6121 N ND2 . ASN C 1 8   ? 76.598  -14.247 209.846 1.00 47.59  ? 8   ASN C ND2 1 
ATOM 6122 N N   . ARG C 1 9   ? 81.701  -14.376 209.066 1.00 27.57  ? 9   ARG C N   1 
ATOM 6123 C CA  . ARG C 1 9   ? 82.586  -13.262 209.362 1.00 22.55  ? 9   ARG C CA  1 
ATOM 6124 C C   . ARG C 1 9   ? 82.746  -12.347 208.162 1.00 23.83  ? 9   ARG C C   1 
ATOM 6125 O O   . ARG C 1 9   ? 82.864  -12.823 207.039 1.00 25.38  ? 9   ARG C O   1 
ATOM 6126 C CB  . ARG C 1 9   ? 83.960  -13.802 209.766 1.00 22.42  ? 9   ARG C CB  1 
ATOM 6127 C CG  . ARG C 1 9   ? 85.016  -12.753 210.073 1.00 19.23  ? 9   ARG C CG  1 
ATOM 6128 C CD  . ARG C 1 9   ? 86.353  -13.423 210.353 1.00 19.69  ? 9   ARG C CD  1 
ATOM 6129 N NE  . ARG C 1 9   ? 87.366  -12.471 210.802 1.00 16.79  ? 9   ARG C NE  1 
ATOM 6130 C CZ  . ARG C 1 9   ? 88.666  -12.742 210.879 1.00 20.58  ? 9   ARG C CZ  1 
ATOM 6131 N NH1 . ARG C 1 9   ? 89.119  -13.933 210.521 1.00 16.24  ? 9   ARG C NH1 1 
ATOM 6132 N NH2 . ARG C 1 9   ? 89.517  -11.830 211.329 1.00 12.79  ? 9   ARG C NH2 1 
ATOM 6133 N N   . ASP C 1 10  ? 82.744  -11.037 208.393 1.00 23.10  ? 10  ASP C N   1 
ATOM 6134 C CA  . ASP C 1 10  ? 82.930  -10.066 207.325 1.00 24.62  ? 10  ASP C CA  1 
ATOM 6135 C C   . ASP C 1 10  ? 84.160  -9.257  207.641 1.00 26.76  ? 10  ASP C C   1 
ATOM 6136 O O   . ASP C 1 10  ? 84.541  -9.125  208.807 1.00 29.99  ? 10  ASP C O   1 
ATOM 6137 C CB  . ASP C 1 10  ? 81.747  -9.103  207.219 1.00 29.14  ? 10  ASP C CB  1 
ATOM 6138 C CG  . ASP C 1 10  ? 80.473  -9.782  206.751 1.00 42.83  ? 10  ASP C CG  1 
ATOM 6139 O OD1 . ASP C 1 10  ? 80.526  -10.583 205.783 1.00 45.29  ? 10  ASP C OD1 1 
ATOM 6140 O OD2 . ASP C 1 10  ? 79.411  -9.508  207.353 1.00 52.37  ? 10  ASP C OD2 1 
ATOM 6141 N N   . PHE C 1 11  ? 84.789  -8.718  206.606 1.00 26.78  ? 11  PHE C N   1 
ATOM 6142 C CA  . PHE C 1 11  ? 85.968  -7.886  206.778 1.00 25.09  ? 11  PHE C CA  1 
ATOM 6143 C C   . PHE C 1 11  ? 85.613  -6.497  206.229 1.00 29.00  ? 11  PHE C C   1 
ATOM 6144 O O   . PHE C 1 11  ? 85.078  -6.368  205.115 1.00 27.04  ? 11  PHE C O   1 
ATOM 6145 C CB  . PHE C 1 11  ? 87.175  -8.453  206.003 1.00 25.20  ? 11  PHE C CB  1 
ATOM 6146 C CG  . PHE C 1 11  ? 87.751  -9.740  206.576 1.00 25.10  ? 11  PHE C CG  1 
ATOM 6147 C CD1 . PHE C 1 11  ? 87.224  -10.985 206.214 1.00 21.74  ? 11  PHE C CD1 1 
ATOM 6148 C CD2 . PHE C 1 11  ? 88.847  -9.708  207.441 1.00 24.84  ? 11  PHE C CD2 1 
ATOM 6149 C CE1 . PHE C 1 11  ? 87.781  -12.180 206.705 1.00 21.87  ? 11  PHE C CE1 1 
ATOM 6150 C CE2 . PHE C 1 11  ? 89.408  -10.904 207.937 1.00 21.12  ? 11  PHE C CE2 1 
ATOM 6151 C CZ  . PHE C 1 11  ? 88.873  -12.134 207.565 1.00 22.83  ? 11  PHE C CZ  1 
ATOM 6152 N N   . VAL C 1 12  ? 85.822  -5.470  207.046 1.00 30.42  ? 12  VAL C N   1 
ATOM 6153 C CA  . VAL C 1 12  ? 85.563  -4.103  206.632 1.00 34.09  ? 12  VAL C CA  1 
ATOM 6154 C C   . VAL C 1 12  ? 86.901  -3.408  206.709 1.00 39.46  ? 12  VAL C C   1 
ATOM 6155 O O   . VAL C 1 12  ? 87.617  -3.536  207.700 1.00 41.20  ? 12  VAL C O   1 
ATOM 6156 C CB  . VAL C 1 12  ? 84.550  -3.408  207.533 1.00 32.50  ? 12  VAL C CB  1 
ATOM 6157 C CG1 . VAL C 1 12  ? 84.574  -1.925  207.275 1.00 29.52  ? 12  VAL C CG1 1 
ATOM 6158 C CG2 . VAL C 1 12  ? 83.166  -3.942  207.231 1.00 26.88  ? 12  VAL C CG2 1 
ATOM 6159 N N   . THR C 1 13  ? 87.233  -2.659  205.671 1.00 46.06  ? 13  THR C N   1 
ATOM 6160 C CA  . THR C 1 13  ? 88.517  -1.999  205.630 1.00 53.74  ? 13  THR C CA  1 
ATOM 6161 C C   . THR C 1 13  ? 88.458  -0.516  205.282 1.00 57.95  ? 13  THR C C   1 
ATOM 6162 O O   . THR C 1 13  ? 87.863  -0.121  204.279 1.00 58.88  ? 13  THR C O   1 
ATOM 6163 C CB  . THR C 1 13  ? 89.448  -2.755  204.657 1.00 56.00  ? 13  THR C CB  1 
ATOM 6164 O OG1 . THR C 1 13  ? 90.759  -2.187  204.689 1.00 58.83  ? 13  THR C OG1 1 
ATOM 6165 C CG2 . THR C 1 13  ? 88.897  -2.711  203.235 1.00 61.32  ? 13  THR C CG2 1 
ATOM 6166 N N   . GLY C 1 14  ? 89.063  0.300   206.136 1.00 63.49  ? 14  GLY C N   1 
ATOM 6167 C CA  . GLY C 1 14  ? 89.109  1.733   205.904 1.00 72.23  ? 14  GLY C CA  1 
ATOM 6168 C C   . GLY C 1 14  ? 90.479  2.108   205.353 1.00 77.68  ? 14  GLY C C   1 
ATOM 6169 O O   . GLY C 1 14  ? 91.506  1.675   205.891 1.00 78.05  ? 14  GLY C O   1 
ATOM 6170 N N   . THR C 1 15  ? 90.511  2.885   204.270 1.00 82.88  ? 15  THR C N   1 
ATOM 6171 C CA  . THR C 1 15  ? 91.783  3.297   203.661 1.00 88.26  ? 15  THR C CA  1 
ATOM 6172 C C   . THR C 1 15  ? 92.319  4.623   204.241 1.00 91.27  ? 15  THR C C   1 
ATOM 6173 O O   . THR C 1 15  ? 92.130  4.905   205.434 1.00 92.02  ? 15  THR C O   1 
ATOM 6174 C CB  . THR C 1 15  ? 91.682  3.373   202.098 1.00 89.13  ? 15  THR C CB  1 
ATOM 6175 O OG1 . THR C 1 15  ? 90.493  4.079   201.713 1.00 89.02  ? 15  THR C OG1 1 
ATOM 6176 C CG2 . THR C 1 15  ? 91.676  1.970   201.484 1.00 88.77  ? 15  THR C CG2 1 
ATOM 6177 N N   . GLN C 1 16  ? 92.999  5.417   203.409 1.00 93.31  ? 16  GLN C N   1 
ATOM 6178 C CA  . GLN C 1 16  ? 93.554  6.705   203.832 1.00 95.26  ? 16  GLN C CA  1 
ATOM 6179 C C   . GLN C 1 16  ? 92.426  7.726   204.061 1.00 95.12  ? 16  GLN C C   1 
ATOM 6180 O O   . GLN C 1 16  ? 91.549  7.898   203.206 1.00 94.06  ? 16  GLN C O   1 
ATOM 6181 C CB  . GLN C 1 16  ? 94.552  7.219   202.775 1.00 98.62  ? 16  GLN C CB  1 
ATOM 6182 C CG  . GLN C 1 16  ? 95.326  8.493   203.152 1.00 102.93 ? 16  GLN C CG  1 
ATOM 6183 C CD  . GLN C 1 16  ? 96.228  8.313   204.368 1.00 107.28 ? 16  GLN C CD  1 
ATOM 6184 O OE1 . GLN C 1 16  ? 96.141  9.070   205.335 1.00 106.78 ? 16  GLN C OE1 1 
ATOM 6185 N NE2 . GLN C 1 16  ? 97.094  7.309   204.324 1.00 107.92 ? 16  GLN C NE2 1 
ATOM 6186 N N   . GLY C 1 17  ? 92.429  8.357   205.237 1.00 95.51  ? 17  GLY C N   1 
ATOM 6187 C CA  . GLY C 1 17  ? 91.415  9.347   205.564 1.00 94.85  ? 17  GLY C CA  1 
ATOM 6188 C C   . GLY C 1 17  ? 90.174  8.778   206.230 1.00 93.93  ? 17  GLY C C   1 
ATOM 6189 O O   . GLY C 1 17  ? 89.514  9.475   207.013 1.00 94.49  ? 17  GLY C O   1 
ATOM 6190 N N   . THR C 1 18  ? 89.844  7.524   205.914 1.00 91.97  ? 18  THR C N   1 
ATOM 6191 C CA  . THR C 1 18  ? 88.674  6.857   206.486 1.00 88.41  ? 18  THR C CA  1 
ATOM 6192 C C   . THR C 1 18  ? 88.793  6.874   208.008 1.00 83.44  ? 18  THR C C   1 
ATOM 6193 O O   . THR C 1 18  ? 89.646  6.200   208.585 1.00 83.34  ? 18  THR C O   1 
ATOM 6194 C CB  . THR C 1 18  ? 88.549  5.386   205.994 1.00 91.92  ? 18  THR C CB  1 
ATOM 6195 O OG1 . THR C 1 18  ? 88.539  5.353   204.558 1.00 92.35  ? 18  THR C OG1 1 
ATOM 6196 C CG2 . THR C 1 18  ? 87.262  4.749   206.516 1.00 92.51  ? 18  THR C CG2 1 
ATOM 6197 N N   . THR C 1 19  ? 87.959  7.688   208.642 1.00 78.07  ? 19  THR C N   1 
ATOM 6198 C CA  . THR C 1 19  ? 87.969  7.823   210.091 1.00 72.87  ? 19  THR C CA  1 
ATOM 6199 C C   . THR C 1 19  ? 86.715  7.186   210.707 1.00 67.65  ? 19  THR C C   1 
ATOM 6200 O O   . THR C 1 19  ? 86.727  6.726   211.851 1.00 65.18  ? 19  THR C O   1 
ATOM 6201 C CB  . THR C 1 19  ? 88.065  9.328   210.473 1.00 75.75  ? 19  THR C CB  1 
ATOM 6202 O OG1 . THR C 1 19  ? 88.315  9.463   211.877 1.00 76.93  ? 19  THR C OG1 1 
ATOM 6203 C CG2 . THR C 1 19  ? 86.783  10.086  210.085 1.00 75.02  ? 19  THR C CG2 1 
ATOM 6204 N N   . ARG C 1 20  ? 85.659  7.110   209.901 1.00 63.44  ? 20  ARG C N   1 
ATOM 6205 C CA  . ARG C 1 20  ? 84.373  6.565   210.311 1.00 59.07  ? 20  ARG C CA  1 
ATOM 6206 C C   . ARG C 1 20  ? 84.014  5.363   209.433 1.00 53.59  ? 20  ARG C C   1 
ATOM 6207 O O   . ARG C 1 20  ? 84.353  5.328   208.248 1.00 54.28  ? 20  ARG C O   1 
ATOM 6208 C CB  . ARG C 1 20  ? 83.320  7.661   210.161 1.00 63.80  ? 20  ARG C CB  1 
ATOM 6209 C CG  . ARG C 1 20  ? 82.073  7.479   210.983 1.00 76.43  ? 20  ARG C CG  1 
ATOM 6210 C CD  . ARG C 1 20  ? 81.787  8.761   211.738 1.00 87.84  ? 20  ARG C CD  1 
ATOM 6211 N NE  . ARG C 1 20  ? 80.355  8.993   211.905 1.00 100.85 ? 20  ARG C NE  1 
ATOM 6212 C CZ  . ARG C 1 20  ? 79.833  9.989   212.618 1.00 108.03 ? 20  ARG C CZ  1 
ATOM 6213 N NH1 . ARG C 1 20  ? 80.625  10.855  213.244 1.00 110.37 ? 20  ARG C NH1 1 
ATOM 6214 N NH2 . ARG C 1 20  ? 78.514  10.135  212.690 1.00 111.60 ? 20  ARG C NH2 1 
ATOM 6215 N N   . VAL C 1 21  ? 83.339  4.377   210.014 1.00 47.44  ? 21  VAL C N   1 
ATOM 6216 C CA  . VAL C 1 21  ? 82.946  3.173   209.288 1.00 42.81  ? 21  VAL C CA  1 
ATOM 6217 C C   . VAL C 1 21  ? 81.499  2.792   209.626 1.00 39.45  ? 21  VAL C C   1 
ATOM 6218 O O   . VAL C 1 21  ? 81.132  2.747   210.799 1.00 38.92  ? 21  VAL C O   1 
ATOM 6219 C CB  . VAL C 1 21  ? 83.897  1.986   209.634 1.00 42.42  ? 21  VAL C CB  1 
ATOM 6220 C CG1 . VAL C 1 21  ? 83.344  0.702   209.107 1.00 44.27  ? 21  VAL C CG1 1 
ATOM 6221 C CG2 . VAL C 1 21  ? 85.273  2.214   209.031 1.00 44.60  ? 21  VAL C CG2 1 
ATOM 6222 N N   . THR C 1 22  ? 80.683  2.545   208.606 1.00 35.66  ? 22  THR C N   1 
ATOM 6223 C CA  . THR C 1 22  ? 79.289  2.163   208.811 1.00 35.02  ? 22  THR C CA  1 
ATOM 6224 C C   . THR C 1 22  ? 79.156  0.671   208.557 1.00 34.18  ? 22  THR C C   1 
ATOM 6225 O O   . THR C 1 22  ? 79.501  0.205   207.483 1.00 37.84  ? 22  THR C O   1 
ATOM 6226 C CB  . THR C 1 22  ? 78.353  2.939   207.864 1.00 36.30  ? 22  THR C CB  1 
ATOM 6227 O OG1 . THR C 1 22  ? 78.510  4.343   208.095 1.00 41.08  ? 22  THR C OG1 1 
ATOM 6228 C CG2 . THR C 1 22  ? 76.897  2.580   208.122 1.00 41.26  ? 22  THR C CG2 1 
ATOM 6229 N N   . LEU C 1 23  ? 78.650  -0.070  209.538 1.00 31.03  ? 23  LEU C N   1 
ATOM 6230 C CA  . LEU C 1 23  ? 78.502  -1.522  209.425 1.00 29.89  ? 23  LEU C CA  1 
ATOM 6231 C C   . LEU C 1 23  ? 77.069  -1.968  209.672 1.00 29.55  ? 23  LEU C C   1 
ATOM 6232 O O   . LEU C 1 23  ? 76.328  -1.317  210.408 1.00 30.52  ? 23  LEU C O   1 
ATOM 6233 C CB  . LEU C 1 23  ? 79.328  -2.231  210.510 1.00 31.75  ? 23  LEU C CB  1 
ATOM 6234 C CG  . LEU C 1 23  ? 80.731  -1.814  210.938 1.00 33.78  ? 23  LEU C CG  1 
ATOM 6235 C CD1 . LEU C 1 23  ? 81.095  -2.461  212.278 1.00 39.72  ? 23  LEU C CD1 1 
ATOM 6236 C CD2 . LEU C 1 23  ? 81.714  -2.212  209.879 1.00 39.06  ? 23  LEU C CD2 1 
ATOM 6237 N N   . VAL C 1 24  ? 76.700  -3.110  209.100 1.00 28.16  ? 24  VAL C N   1 
ATOM 6238 C CA  . VAL C 1 24  ? 75.390  -3.694  209.333 1.00 25.49  ? 24  VAL C CA  1 
ATOM 6239 C C   . VAL C 1 24  ? 75.729  -4.976  210.074 1.00 26.51  ? 24  VAL C C   1 
ATOM 6240 O O   . VAL C 1 24  ? 76.252  -5.934  209.490 1.00 28.84  ? 24  VAL C O   1 
ATOM 6241 C CB  . VAL C 1 24  ? 74.627  -4.008  208.047 1.00 26.46  ? 24  VAL C CB  1 
ATOM 6242 C CG1 . VAL C 1 24  ? 73.369  -4.797  208.380 1.00 29.34  ? 24  VAL C CG1 1 
ATOM 6243 C CG2 . VAL C 1 24  ? 74.241  -2.713  207.358 1.00 24.03  ? 24  VAL C CG2 1 
ATOM 6244 N N   . LEU C 1 25  ? 75.527  -4.933  211.385 1.00 24.02  ? 25  LEU C N   1 
ATOM 6245 C CA  . LEU C 1 25  ? 75.815  -6.045  212.268 1.00 22.40  ? 25  LEU C CA  1 
ATOM 6246 C C   . LEU C 1 25  ? 74.611  -6.939  212.348 1.00 22.81  ? 25  LEU C C   1 
ATOM 6247 O O   . LEU C 1 25  ? 73.487  -6.449  212.477 1.00 25.51  ? 25  LEU C O   1 
ATOM 6248 C CB  . LEU C 1 25  ? 76.139  -5.520  213.669 1.00 19.98  ? 25  LEU C CB  1 
ATOM 6249 C CG  . LEU C 1 25  ? 77.349  -4.589  213.718 1.00 23.59  ? 25  LEU C CG  1 
ATOM 6250 C CD1 . LEU C 1 25  ? 77.547  -4.039  215.132 1.00 20.45  ? 25  LEU C CD1 1 
ATOM 6251 C CD2 . LEU C 1 25  ? 78.576  -5.359  213.254 1.00 18.14  ? 25  LEU C CD2 1 
ATOM 6252 N N   . GLU C 1 26  ? 74.834  -8.241  212.251 1.00 21.34  ? 26  GLU C N   1 
ATOM 6253 C CA  . GLU C 1 26  ? 73.743  -9.188  212.363 1.00 22.12  ? 26  GLU C CA  1 
ATOM 6254 C C   . GLU C 1 26  ? 74.019  -10.224 213.445 1.00 20.87  ? 26  GLU C C   1 
ATOM 6255 O O   . GLU C 1 26  ? 75.173  -10.575 213.713 1.00 19.71  ? 26  GLU C O   1 
ATOM 6256 C CB  . GLU C 1 26  ? 73.432  -9.843  211.015 1.00 26.69  ? 26  GLU C CB  1 
ATOM 6257 C CG  . GLU C 1 26  ? 74.550  -10.632 210.385 1.00 44.59  ? 26  GLU C CG  1 
ATOM 6258 C CD  . GLU C 1 26  ? 74.256  -11.001 208.929 1.00 54.69  ? 26  GLU C CD  1 
ATOM 6259 O OE1 . GLU C 1 26  ? 73.286  -10.460 208.343 1.00 48.58  ? 26  GLU C OE1 1 
ATOM 6260 O OE2 . GLU C 1 26  ? 75.010  -11.830 208.367 1.00 59.96  ? 26  GLU C OE2 1 
ATOM 6261 N N   . LEU C 1 27  ? 72.959  -10.635 214.128 1.00 19.78  ? 27  LEU C N   1 
ATOM 6262 C CA  . LEU C 1 27  ? 73.047  -11.627 215.189 1.00 21.25  ? 27  LEU C CA  1 
ATOM 6263 C C   . LEU C 1 27  ? 73.630  -12.897 214.553 1.00 21.56  ? 27  LEU C C   1 
ATOM 6264 O O   . LEU C 1 27  ? 73.162  -13.344 213.506 1.00 22.13  ? 27  LEU C O   1 
ATOM 6265 C CB  . LEU C 1 27  ? 71.642  -11.856 215.751 1.00 22.90  ? 27  LEU C CB  1 
ATOM 6266 C CG  . LEU C 1 27  ? 71.399  -11.890 217.259 1.00 24.56  ? 27  LEU C CG  1 
ATOM 6267 C CD1 . LEU C 1 27  ? 72.191  -10.837 217.961 1.00 21.99  ? 27  LEU C CD1 1 
ATOM 6268 C CD2 . LEU C 1 27  ? 69.928  -11.676 217.530 1.00 18.62  ? 27  LEU C CD2 1 
ATOM 6269 N N   . GLY C 1 28  ? 74.660  -13.462 215.173 1.00 19.79  ? 28  GLY C N   1 
ATOM 6270 C CA  . GLY C 1 28  ? 75.323  -14.633 214.614 1.00 20.94  ? 28  GLY C CA  1 
ATOM 6271 C C   . GLY C 1 28  ? 76.456  -14.293 213.631 1.00 21.90  ? 28  GLY C C   1 
ATOM 6272 O O   . GLY C 1 28  ? 77.101  -15.178 213.064 1.00 23.08  ? 28  GLY C O   1 
ATOM 6273 N N   . GLY C 1 29  ? 76.683  -13.009 213.394 1.00 20.55  ? 29  GLY C N   1 
ATOM 6274 C CA  . GLY C 1 29  ? 77.744  -12.598 212.492 1.00 19.73  ? 29  GLY C CA  1 
ATOM 6275 C C   . GLY C 1 29  ? 78.856  -11.966 213.309 1.00 20.19  ? 29  GLY C C   1 
ATOM 6276 O O   . GLY C 1 29  ? 78.752  -11.877 214.540 1.00 19.39  ? 29  GLY C O   1 
ATOM 6277 N N   . CYS C 1 30  ? 79.912  -11.516 212.640 1.00 20.17  ? 30  CYS C N   1 
ATOM 6278 C CA  . CYS C 1 30  ? 81.044  -10.901 213.319 1.00 20.81  ? 30  CYS C CA  1 
ATOM 6279 C C   . CYS C 1 30  ? 81.806  -10.103 212.269 1.00 20.33  ? 30  CYS C C   1 
ATOM 6280 O O   . CYS C 1 30  ? 81.965  -10.565 211.140 1.00 19.07  ? 30  CYS C O   1 
ATOM 6281 C CB  . CYS C 1 30  ? 81.949  -11.988 213.926 1.00 19.12  ? 30  CYS C CB  1 
ATOM 6282 S SG  . CYS C 1 30  ? 83.117  -11.413 215.212 1.00 21.43  ? 30  CYS C SG  1 
ATOM 6283 N N   . VAL C 1 31  ? 82.230  -8.891  212.618 1.00 19.03  ? 31  VAL C N   1 
ATOM 6284 C CA  . VAL C 1 31  ? 82.969  -8.059  211.670 1.00 18.92  ? 31  VAL C CA  1 
ATOM 6285 C C   . VAL C 1 31  ? 84.390  -7.715  212.130 1.00 21.64  ? 31  VAL C C   1 
ATOM 6286 O O   . VAL C 1 31  ? 84.597  -7.272  213.273 1.00 19.80  ? 31  VAL C O   1 
ATOM 6287 C CB  . VAL C 1 31  ? 82.227  -6.722  211.406 1.00 22.72  ? 31  VAL C CB  1 
ATOM 6288 C CG1 . VAL C 1 31  ? 82.951  -5.915  210.322 1.00 16.96  ? 31  VAL C CG1 1 
ATOM 6289 C CG2 . VAL C 1 31  ? 80.771  -6.988  211.007 1.00 23.91  ? 31  VAL C CG2 1 
ATOM 6290 N N   . THR C 1 32  ? 85.374  -7.944  211.263 1.00 20.30  ? 32  THR C N   1 
ATOM 6291 C CA  . THR C 1 32  ? 86.747  -7.571  211.586 1.00 20.60  ? 32  THR C CA  1 
ATOM 6292 C C   . THR C 1 32  ? 87.025  -6.261  210.853 1.00 19.99  ? 32  THR C C   1 
ATOM 6293 O O   . THR C 1 32  ? 86.879  -6.183  209.642 1.00 19.35  ? 32  THR C O   1 
ATOM 6294 C CB  . THR C 1 32  ? 87.804  -8.626  211.139 1.00 21.67  ? 32  THR C CB  1 
ATOM 6295 O OG1 . THR C 1 32  ? 87.648  -9.824  211.910 1.00 18.47  ? 32  THR C OG1 1 
ATOM 6296 C CG2 . THR C 1 32  ? 89.223  -8.080  211.376 1.00 15.68  ? 32  THR C CG2 1 
ATOM 6297 N N   . ILE C 1 33  ? 87.350  -5.216  211.597 1.00 18.44  ? 33  ILE C N   1 
ATOM 6298 C CA  . ILE C 1 33  ? 87.659  -3.926  210.998 1.00 19.70  ? 33  ILE C CA  1 
ATOM 6299 C C   . ILE C 1 33  ? 89.179  -3.711  211.011 1.00 22.15  ? 33  ILE C C   1 
ATOM 6300 O O   . ILE C 1 33  ? 89.820  -3.827  212.065 1.00 22.00  ? 33  ILE C O   1 
ATOM 6301 C CB  . ILE C 1 33  ? 87.051  -2.759  211.817 1.00 18.15  ? 33  ILE C CB  1 
ATOM 6302 C CG1 . ILE C 1 33  ? 85.550  -2.946  212.016 1.00 19.08  ? 33  ILE C CG1 1 
ATOM 6303 C CG2 . ILE C 1 33  ? 87.355  -1.431  211.135 1.00 20.35  ? 33  ILE C CG2 1 
ATOM 6304 C CD1 . ILE C 1 33  ? 84.934  -1.868  212.899 1.00 23.45  ? 33  ILE C CD1 1 
ATOM 6305 N N   . THR C 1 34  ? 89.748  -3.378  209.859 1.00 23.56  ? 34  THR C N   1 
ATOM 6306 C CA  . THR C 1 34  ? 91.179  -3.092  209.757 1.00 27.52  ? 34  THR C CA  1 
ATOM 6307 C C   . THR C 1 34  ? 91.288  -1.699  209.120 1.00 29.25  ? 34  THR C C   1 
ATOM 6308 O O   . THR C 1 34  ? 90.444  -1.327  208.300 1.00 30.72  ? 34  THR C O   1 
ATOM 6309 C CB  . THR C 1 34  ? 91.897  -4.117  208.854 1.00 29.90  ? 34  THR C CB  1 
ATOM 6310 O OG1 . THR C 1 34  ? 91.307  -4.100  207.545 1.00 31.54  ? 34  THR C OG1 1 
ATOM 6311 C CG2 . THR C 1 34  ? 91.772  -5.509  209.427 1.00 24.10  ? 34  THR C CG2 1 
ATOM 6312 N N   . ALA C 1 35  ? 92.283  -0.915  209.514 1.00 30.94  ? 35  ALA C N   1 
ATOM 6313 C CA  . ALA C 1 35  ? 92.465  0.419   208.936 1.00 32.10  ? 35  ALA C CA  1 
ATOM 6314 C C   . ALA C 1 35  ? 93.907  0.853   209.140 1.00 32.79  ? 35  ALA C C   1 
ATOM 6315 O O   . ALA C 1 35  ? 94.487  0.577   210.194 1.00 32.72  ? 35  ALA C O   1 
ATOM 6316 C CB  . ALA C 1 35  ? 91.504  1.425   209.580 1.00 27.37  ? 35  ALA C CB  1 
ATOM 6317 N N   . GLU C 1 36  ? 94.481  1.510   208.129 1.00 35.34  ? 36  GLU C N   1 
ATOM 6318 C CA  . GLU C 1 36  ? 95.869  1.987   208.177 1.00 36.87  ? 36  GLU C CA  1 
ATOM 6319 C C   . GLU C 1 36  ? 96.158  2.807   209.425 1.00 34.80  ? 36  GLU C C   1 
ATOM 6320 O O   . GLU C 1 36  ? 95.439  3.759   209.735 1.00 34.49  ? 36  GLU C O   1 
ATOM 6321 C CB  . GLU C 1 36  ? 96.188  2.848   206.955 1.00 47.69  ? 36  GLU C CB  1 
ATOM 6322 C CG  . GLU C 1 36  ? 96.256  2.107   205.624 1.00 64.70  ? 36  GLU C CG  1 
ATOM 6323 C CD  . GLU C 1 36  ? 96.206  3.060   204.424 1.00 76.10  ? 36  GLU C CD  1 
ATOM 6324 O OE1 . GLU C 1 36  ? 96.746  4.189   204.525 1.00 82.15  ? 36  GLU C OE1 1 
ATOM 6325 O OE2 . GLU C 1 36  ? 95.608  2.686   203.386 1.00 75.31  ? 36  GLU C OE2 1 
ATOM 6326 N N   . GLY C 1 37  ? 97.205  2.419   210.145 1.00 33.45  ? 37  GLY C N   1 
ATOM 6327 C CA  . GLY C 1 37  ? 97.592  3.133   211.346 1.00 33.82  ? 37  GLY C CA  1 
ATOM 6328 C C   . GLY C 1 37  ? 96.691  2.960   212.555 1.00 35.24  ? 37  GLY C C   1 
ATOM 6329 O O   . GLY C 1 37  ? 96.906  3.611   213.581 1.00 35.52  ? 37  GLY C O   1 
ATOM 6330 N N   . LYS C 1 38  ? 95.703  2.071   212.461 1.00 34.83  ? 38  LYS C N   1 
ATOM 6331 C CA  . LYS C 1 38  ? 94.783  1.826   213.572 1.00 33.04  ? 38  LYS C CA  1 
ATOM 6332 C C   . LYS C 1 38  ? 94.850  0.370   214.014 1.00 31.39  ? 38  LYS C C   1 
ATOM 6333 O O   . LYS C 1 38  ? 95.124  -0.525  213.206 1.00 29.47  ? 38  LYS C O   1 
ATOM 6334 C CB  . LYS C 1 38  ? 93.337  2.116   213.147 1.00 36.22  ? 38  LYS C CB  1 
ATOM 6335 C CG  . LYS C 1 38  ? 93.051  3.529   212.666 1.00 38.94  ? 38  LYS C CG  1 
ATOM 6336 C CD  . LYS C 1 38  ? 93.204  4.517   213.791 1.00 40.47  ? 38  LYS C CD  1 
ATOM 6337 C CE  . LYS C 1 38  ? 92.843  5.904   213.331 1.00 38.95  ? 38  LYS C CE  1 
ATOM 6338 N NZ  . LYS C 1 38  ? 93.132  6.861   214.424 1.00 46.24  ? 38  LYS C NZ  1 
ATOM 6339 N N   . PRO C 1 39  ? 94.672  0.116   215.320 1.00 28.59  ? 39  PRO C N   1 
ATOM 6340 C CA  . PRO C 1 39  ? 94.708  -1.278  215.757 1.00 25.16  ? 39  PRO C CA  1 
ATOM 6341 C C   . PRO C 1 39  ? 93.406  -1.898  215.225 1.00 24.64  ? 39  PRO C C   1 
ATOM 6342 O O   . PRO C 1 39  ? 92.395  -1.206  215.132 1.00 24.46  ? 39  PRO C O   1 
ATOM 6343 C CB  . PRO C 1 39  ? 94.702  -1.152  217.281 1.00 28.70  ? 39  PRO C CB  1 
ATOM 6344 C CG  . PRO C 1 39  ? 93.960  0.123   217.532 1.00 30.34  ? 39  PRO C CG  1 
ATOM 6345 C CD  . PRO C 1 39  ? 94.503  1.032   216.461 1.00 30.86  ? 39  PRO C CD  1 
ATOM 6346 N N   . SER C 1 40  ? 93.446  -3.155  214.801 1.00 23.01  ? 40  SER C N   1 
ATOM 6347 C CA  . SER C 1 40  ? 92.250  -3.819  214.281 1.00 21.11  ? 40  SER C CA  1 
ATOM 6348 C C   . SER C 1 40  ? 91.235  -4.119  215.385 1.00 20.80  ? 40  SER C C   1 
ATOM 6349 O O   . SER C 1 40  ? 91.616  -4.392  216.532 1.00 18.53  ? 40  SER C O   1 
ATOM 6350 C CB  . SER C 1 40  ? 92.635  -5.092  213.532 1.00 20.24  ? 40  SER C CB  1 
ATOM 6351 O OG  . SER C 1 40  ? 93.405  -4.770  212.388 1.00 24.60  ? 40  SER C OG  1 
ATOM 6352 N N   . MET C 1 41  ? 89.951  -4.133  215.023 1.00 21.95  ? 41  MET C N   1 
ATOM 6353 C CA  . MET C 1 41  ? 88.874  -4.358  215.989 1.00 23.96  ? 41  MET C CA  1 
ATOM 6354 C C   . MET C 1 41  ? 87.851  -5.366  215.512 1.00 21.93  ? 41  MET C C   1 
ATOM 6355 O O   . MET C 1 41  ? 87.521  -5.383  214.337 1.00 21.33  ? 41  MET C O   1 
ATOM 6356 C CB  . MET C 1 41  ? 88.121  -3.038  216.238 1.00 28.83  ? 41  MET C CB  1 
ATOM 6357 C CG  . MET C 1 41  ? 88.942  -1.920  216.860 1.00 35.71  ? 41  MET C CG  1 
ATOM 6358 S SD  . MET C 1 41  ? 89.354  -2.202  218.625 1.00 43.20  ? 41  MET C SD  1 
ATOM 6359 C CE  . MET C 1 41  ? 88.479  -0.856  219.364 1.00 58.70  ? 41  MET C CE  1 
ATOM 6360 N N   . ASP C 1 42  ? 87.387  -6.235  216.414 1.00 19.78  ? 42  ASP C N   1 
ATOM 6361 C CA  . ASP C 1 42  ? 86.325  -7.201  216.092 1.00 18.81  ? 42  ASP C CA  1 
ATOM 6362 C C   . ASP C 1 42  ? 85.057  -6.656  216.764 1.00 19.53  ? 42  ASP C C   1 
ATOM 6363 O O   . ASP C 1 42  ? 85.063  -6.351  217.970 1.00 19.37  ? 42  ASP C O   1 
ATOM 6364 C CB  . ASP C 1 42  ? 86.640  -8.609  216.615 1.00 13.64  ? 42  ASP C CB  1 
ATOM 6365 C CG  . ASP C 1 42  ? 87.479  -9.436  215.628 1.00 17.45  ? 42  ASP C CG  1 
ATOM 6366 O OD1 . ASP C 1 42  ? 87.845  -8.939  214.544 1.00 16.23  ? 42  ASP C OD1 1 
ATOM 6367 O OD2 . ASP C 1 42  ? 87.748  -10.608 215.924 1.00 19.41  ? 42  ASP C OD2 1 
ATOM 6368 N N   . VAL C 1 43  ? 83.988  -6.515  215.986 1.00 17.52  ? 43  VAL C N   1 
ATOM 6369 C CA  . VAL C 1 43  ? 82.730  -5.970  216.487 1.00 17.86  ? 43  VAL C CA  1 
ATOM 6370 C C   . VAL C 1 43  ? 81.583  -6.884  216.102 1.00 18.01  ? 43  VAL C C   1 
ATOM 6371 O O   . VAL C 1 43  ? 81.568  -7.422  214.989 1.00 18.32  ? 43  VAL C O   1 
ATOM 6372 C CB  . VAL C 1 43  ? 82.463  -4.582  215.860 1.00 18.22  ? 43  VAL C CB  1 
ATOM 6373 C CG1 . VAL C 1 43  ? 81.258  -3.938  216.493 1.00 20.46  ? 43  VAL C CG1 1 
ATOM 6374 C CG2 . VAL C 1 43  ? 83.681  -3.685  216.032 1.00 19.72  ? 43  VAL C CG2 1 
ATOM 6375 N N   . TRP C 1 44  ? 80.624  -7.068  217.003 1.00 15.02  ? 44  TRP C N   1 
ATOM 6376 C CA  . TRP C 1 44  ? 79.483  -7.910  216.672 1.00 13.54  ? 44  TRP C CA  1 
ATOM 6377 C C   . TRP C 1 44  ? 78.260  -7.607  217.509 1.00 17.78  ? 44  TRP C C   1 
ATOM 6378 O O   . TRP C 1 44  ? 78.385  -7.144  218.653 1.00 17.05  ? 44  TRP C O   1 
ATOM 6379 C CB  . TRP C 1 44  ? 79.840  -9.395  216.799 1.00 13.09  ? 44  TRP C CB  1 
ATOM 6380 C CG  . TRP C 1 44  ? 80.114  -9.873  218.190 1.00 13.79  ? 44  TRP C CG  1 
ATOM 6381 C CD1 . TRP C 1 44  ? 79.241  -10.526 219.024 1.00 11.98  ? 44  TRP C CD1 1 
ATOM 6382 C CD2 . TRP C 1 44  ? 81.364  -9.799  218.897 1.00 14.40  ? 44  TRP C CD2 1 
ATOM 6383 N NE1 . TRP C 1 44  ? 79.875  -10.866 220.199 1.00 14.47  ? 44  TRP C NE1 1 
ATOM 6384 C CE2 . TRP C 1 44  ? 81.177  -10.429 220.147 1.00 15.32  ? 44  TRP C CE2 1 
ATOM 6385 C CE3 . TRP C 1 44  ? 82.627  -9.266  218.591 1.00 16.89  ? 44  TRP C CE3 1 
ATOM 6386 C CZ2 . TRP C 1 44  ? 82.212  -10.540 221.092 1.00 17.34  ? 44  TRP C CZ2 1 
ATOM 6387 C CZ3 . TRP C 1 44  ? 83.655  -9.379  219.530 1.00 15.19  ? 44  TRP C CZ3 1 
ATOM 6388 C CH2 . TRP C 1 44  ? 83.439  -10.008 220.763 1.00 16.33  ? 44  TRP C CH2 1 
ATOM 6389 N N   . LEU C 1 45  ? 77.081  -7.824  216.918 1.00 16.87  ? 45  LEU C N   1 
ATOM 6390 C CA  . LEU C 1 45  ? 75.814  -7.631  217.609 1.00 14.83  ? 45  LEU C CA  1 
ATOM 6391 C C   . LEU C 1 45  ? 75.675  -8.915  218.420 1.00 16.68  ? 45  LEU C C   1 
ATOM 6392 O O   . LEU C 1 45  ? 75.646  -10.015 217.873 1.00 17.58  ? 45  LEU C O   1 
ATOM 6393 C CB  . LEU C 1 45  ? 74.671  -7.497  216.598 1.00 14.77  ? 45  LEU C CB  1 
ATOM 6394 C CG  . LEU C 1 45  ? 73.242  -7.441  217.147 1.00 14.21  ? 45  LEU C CG  1 
ATOM 6395 C CD1 . LEU C 1 45  ? 73.085  -6.304  218.156 1.00 9.80   ? 45  LEU C CD1 1 
ATOM 6396 C CD2 . LEU C 1 45  ? 72.249  -7.313  215.987 1.00 11.81  ? 45  LEU C CD2 1 
ATOM 6397 N N   . ASP C 1 46  ? 75.621  -8.777  219.733 1.00 16.55  ? 46  ASP C N   1 
ATOM 6398 C CA  . ASP C 1 46  ? 75.548  -9.926  220.613 1.00 15.84  ? 46  ASP C CA  1 
ATOM 6399 C C   . ASP C 1 46  ? 74.150  -10.383 221.053 1.00 15.70  ? 46  ASP C C   1 
ATOM 6400 O O   . ASP C 1 46  ? 73.943  -11.565 221.304 1.00 15.94  ? 46  ASP C O   1 
ATOM 6401 C CB  . ASP C 1 46  ? 76.416  -9.650  221.846 1.00 14.83  ? 46  ASP C CB  1 
ATOM 6402 C CG  . ASP C 1 46  ? 76.769  -10.911 222.599 1.00 23.79  ? 46  ASP C CG  1 
ATOM 6403 O OD1 . ASP C 1 46  ? 77.467  -11.769 222.024 1.00 28.29  ? 46  ASP C OD1 1 
ATOM 6404 O OD2 . ASP C 1 46  ? 76.351  -11.051 223.765 1.00 25.91  ? 46  ASP C OD2 1 
ATOM 6405 N N   . ALA C 1 47  ? 73.208  -9.457  221.204 1.00 14.82  ? 47  ALA C N   1 
ATOM 6406 C CA  . ALA C 1 47  ? 71.854  -9.807  221.647 1.00 13.93  ? 47  ALA C CA  1 
ATOM 6407 C C   . ALA C 1 47  ? 70.840  -8.712  221.320 1.00 15.26  ? 47  ALA C C   1 
ATOM 6408 O O   . ALA C 1 47  ? 71.207  -7.556  221.088 1.00 13.15  ? 47  ALA C O   1 
ATOM 6409 C CB  . ALA C 1 47  ? 71.836  -10.079 223.178 1.00 9.50   ? 47  ALA C CB  1 
ATOM 6410 N N   . ILE C 1 48  ? 69.568  -9.108  221.248 1.00 16.50  ? 48  ILE C N   1 
ATOM 6411 C CA  . ILE C 1 48  ? 68.450  -8.184  221.022 1.00 16.45  ? 48  ILE C CA  1 
ATOM 6412 C C   . ILE C 1 48  ? 67.382  -8.743  221.953 1.00 16.79  ? 48  ILE C C   1 
ATOM 6413 O O   . ILE C 1 48  ? 66.996  -9.920  221.832 1.00 17.61  ? 48  ILE C O   1 
ATOM 6414 C CB  . ILE C 1 48  ? 67.905  -8.209  219.582 1.00 20.86  ? 48  ILE C CB  1 
ATOM 6415 C CG1 . ILE C 1 48  ? 69.006  -7.874  218.576 1.00 24.85  ? 48  ILE C CG1 1 
ATOM 6416 C CG2 . ILE C 1 48  ? 66.774  -7.189  219.445 1.00 21.50  ? 48  ILE C CG2 1 
ATOM 6417 C CD1 . ILE C 1 48  ? 68.525  -7.929  217.153 1.00 20.55  ? 48  ILE C CD1 1 
ATOM 6418 N N   . TYR C 1 49  ? 66.935  -7.939  222.908 1.00 13.87  ? 49  TYR C N   1 
ATOM 6419 C CA  . TYR C 1 49  ? 65.936  -8.420  223.841 1.00 14.56  ? 49  TYR C CA  1 
ATOM 6420 C C   . TYR C 1 49  ? 65.202  -7.301  224.536 1.00 16.80  ? 49  TYR C C   1 
ATOM 6421 O O   . TYR C 1 49  ? 65.579  -6.132  224.445 1.00 15.81  ? 49  TYR C O   1 
ATOM 6422 C CB  . TYR C 1 49  ? 66.616  -9.263  224.927 1.00 15.15  ? 49  TYR C CB  1 
ATOM 6423 C CG  . TYR C 1 49  ? 67.547  -8.458  225.833 1.00 16.63  ? 49  TYR C CG  1 
ATOM 6424 C CD1 . TYR C 1 49  ? 68.893  -8.272  225.498 1.00 20.90  ? 49  TYR C CD1 1 
ATOM 6425 C CD2 . TYR C 1 49  ? 67.070  -7.859  227.005 1.00 15.60  ? 49  TYR C CD2 1 
ATOM 6426 C CE1 . TYR C 1 49  ? 69.736  -7.503  226.302 1.00 17.12  ? 49  TYR C CE1 1 
ATOM 6427 C CE2 . TYR C 1 49  ? 67.901  -7.093  227.819 1.00 17.32  ? 49  TYR C CE2 1 
ATOM 6428 C CZ  . TYR C 1 49  ? 69.231  -6.917  227.461 1.00 26.82  ? 49  TYR C CZ  1 
ATOM 6429 O OH  . TYR C 1 49  ? 70.043  -6.140  228.261 1.00 26.72  ? 49  TYR C OH  1 
ATOM 6430 N N   . GLN C 1 50  ? 64.151  -7.674  225.247 1.00 14.83  ? 50  GLN C N   1 
ATOM 6431 C CA  . GLN C 1 50  ? 63.424  -6.724  226.055 1.00 16.26  ? 50  GLN C CA  1 
ATOM 6432 C C   . GLN C 1 50  ? 63.103  -7.461  227.351 1.00 16.03  ? 50  GLN C C   1 
ATOM 6433 O O   . GLN C 1 50  ? 62.810  -8.664  227.327 1.00 17.71  ? 50  GLN C O   1 
ATOM 6434 C CB  . GLN C 1 50  ? 62.137  -6.255  225.378 1.00 13.05  ? 50  GLN C CB  1 
ATOM 6435 C CG  . GLN C 1 50  ? 61.431  -5.192  226.212 1.00 13.47  ? 50  GLN C CG  1 
ATOM 6436 C CD  . GLN C 1 50  ? 60.084  -4.829  225.655 1.00 12.33  ? 50  GLN C CD  1 
ATOM 6437 O OE1 . GLN C 1 50  ? 59.873  -4.904  224.454 1.00 14.95  ? 50  GLN C OE1 1 
ATOM 6438 N NE2 . GLN C 1 50  ? 59.158  -4.445  226.523 1.00 12.66  ? 50  GLN C NE2 1 
ATOM 6439 N N   . GLU C 1 51  ? 63.261  -6.787  228.479 1.00 14.97  ? 51  GLU C N   1 
ATOM 6440 C CA  . GLU C 1 51  ? 62.926  -7.405  229.753 1.00 18.71  ? 51  GLU C CA  1 
ATOM 6441 C C   . GLU C 1 51  ? 61.431  -7.231  230.018 1.00 20.16  ? 51  GLU C C   1 
ATOM 6442 O O   . GLU C 1 51  ? 60.878  -6.163  229.766 1.00 18.90  ? 51  GLU C O   1 
ATOM 6443 C CB  . GLU C 1 51  ? 63.684  -6.745  230.885 1.00 22.70  ? 51  GLU C CB  1 
ATOM 6444 C CG  . GLU C 1 51  ? 65.151  -7.059  230.927 1.00 41.84  ? 51  GLU C CG  1 
ATOM 6445 C CD  . GLU C 1 51  ? 65.774  -6.669  232.252 1.00 45.88  ? 51  GLU C CD  1 
ATOM 6446 O OE1 . GLU C 1 51  ? 65.249  -7.088  233.311 1.00 46.15  ? 51  GLU C OE1 1 
ATOM 6447 O OE2 . GLU C 1 51  ? 66.787  -5.944  232.229 1.00 49.93  ? 51  GLU C OE2 1 
ATOM 6448 N N   . ASN C 1 52  ? 60.781  -8.272  230.525 1.00 19.84  ? 52  ASN C N   1 
ATOM 6449 C CA  . ASN C 1 52  ? 59.356  -8.218  230.852 1.00 22.03  ? 52  ASN C CA  1 
ATOM 6450 C C   . ASN C 1 52  ? 58.442  -7.595  229.799 1.00 20.51  ? 52  ASN C C   1 
ATOM 6451 O O   . ASN C 1 52  ? 57.727  -6.641  230.085 1.00 20.49  ? 52  ASN C O   1 
ATOM 6452 C CB  . ASN C 1 52  ? 59.132  -7.480  232.181 1.00 25.03  ? 52  ASN C CB  1 
ATOM 6453 C CG  . ASN C 1 52  ? 60.028  -7.988  233.278 1.00 33.38  ? 52  ASN C CG  1 
ATOM 6454 O OD1 . ASN C 1 52  ? 59.961  -9.159  233.657 1.00 42.80  ? 52  ASN C OD1 1 
ATOM 6455 N ND2 . ASN C 1 52  ? 60.895  -7.120  233.782 1.00 36.11  ? 52  ASN C ND2 1 
ATOM 6456 N N   . PRO C 1 53  ? 58.479  -8.097  228.565 1.00 18.22  ? 53  PRO C N   1 
ATOM 6457 C CA  . PRO C 1 53  ? 57.588  -7.505  227.561 1.00 18.27  ? 53  PRO C CA  1 
ATOM 6458 C C   . PRO C 1 53  ? 56.116  -7.698  227.984 1.00 20.68  ? 53  PRO C C   1 
ATOM 6459 O O   . PRO C 1 53  ? 55.804  -8.593  228.775 1.00 20.71  ? 53  PRO C O   1 
ATOM 6460 C CB  . PRO C 1 53  ? 57.919  -8.314  226.300 1.00 15.65  ? 53  PRO C CB  1 
ATOM 6461 C CG  . PRO C 1 53  ? 58.418  -9.644  226.850 1.00 13.90  ? 53  PRO C CG  1 
ATOM 6462 C CD  . PRO C 1 53  ? 59.284  -9.192  227.999 1.00 16.04  ? 53  PRO C CD  1 
ATOM 6463 N N   . ALA C 1 54  ? 55.217  -6.884  227.446 1.00 18.56  ? 54  ALA C N   1 
ATOM 6464 C CA  . ALA C 1 54  ? 53.795  -6.988  227.763 1.00 18.33  ? 54  ALA C CA  1 
ATOM 6465 C C   . ALA C 1 54  ? 53.244  -8.318  227.262 1.00 20.67  ? 54  ALA C C   1 
ATOM 6466 O O   . ALA C 1 54  ? 53.605  -8.794  226.175 1.00 19.28  ? 54  ALA C O   1 
ATOM 6467 C CB  . ALA C 1 54  ? 53.022  -5.837  227.096 1.00 16.50  ? 54  ALA C CB  1 
ATOM 6468 N N   . LYS C 1 55  ? 52.346  -8.911  228.038 1.00 22.05  ? 55  LYS C N   1 
ATOM 6469 C CA  . LYS C 1 55  ? 51.741  -10.163 227.643 1.00 21.47  ? 55  LYS C CA  1 
ATOM 6470 C C   . LYS C 1 55  ? 50.432  -9.867  226.961 1.00 24.75  ? 55  LYS C C   1 
ATOM 6471 O O   . LYS C 1 55  ? 49.689  -8.971  227.375 1.00 26.93  ? 55  LYS C O   1 
ATOM 6472 C CB  . LYS C 1 55  ? 51.431  -11.029 228.856 1.00 24.76  ? 55  LYS C CB  1 
ATOM 6473 C CG  . LYS C 1 55  ? 52.618  -11.426 229.658 1.00 27.18  ? 55  LYS C CG  1 
ATOM 6474 C CD  . LYS C 1 55  ? 52.198  -12.404 230.698 1.00 32.15  ? 55  LYS C CD  1 
ATOM 6475 C CE  . LYS C 1 55  ? 53.397  -13.019 231.364 1.00 40.92  ? 55  LYS C CE  1 
ATOM 6476 N NZ  . LYS C 1 55  ? 52.963  -14.224 232.112 1.00 48.48  ? 55  LYS C NZ  1 
ATOM 6477 N N   . THR C 1 56  ? 50.177  -10.554 225.865 1.00 21.65  ? 56  THR C N   1 
ATOM 6478 C CA  . THR C 1 56  ? 48.892  -10.408 225.217 1.00 27.53  ? 56  THR C CA  1 
ATOM 6479 C C   . THR C 1 56  ? 48.100  -11.598 225.819 1.00 28.20  ? 56  THR C C   1 
ATOM 6480 O O   . THR C 1 56  ? 48.223  -11.869 227.013 1.00 31.24  ? 56  THR C O   1 
ATOM 6481 C CB  . THR C 1 56  ? 49.023  -10.471 223.690 1.00 27.00  ? 56  THR C CB  1 
ATOM 6482 O OG1 . THR C 1 56  ? 49.872  -11.566 223.326 1.00 32.53  ? 56  THR C OG1 1 
ATOM 6483 C CG2 . THR C 1 56  ? 49.620  -9.181  223.176 1.00 38.54  ? 56  THR C CG2 1 
ATOM 6484 N N   . ARG C 1 57  ? 47.329  -12.324 225.028 1.00 28.89  ? 57  ARG C N   1 
ATOM 6485 C CA  . ARG C 1 57  ? 46.564  -13.459 225.549 1.00 25.12  ? 57  ARG C CA  1 
ATOM 6486 C C   . ARG C 1 57  ? 47.395  -14.638 226.015 1.00 21.45  ? 57  ARG C C   1 
ATOM 6487 O O   . ARG C 1 57  ? 48.521  -14.848 225.571 1.00 19.97  ? 57  ARG C O   1 
ATOM 6488 C CB  . ARG C 1 57  ? 45.687  -14.056 224.455 1.00 26.59  ? 57  ARG C CB  1 
ATOM 6489 C CG  . ARG C 1 57  ? 44.755  -13.143 223.803 1.00 37.62  ? 57  ARG C CG  1 
ATOM 6490 C CD  . ARG C 1 57  ? 44.161  -13.874 222.651 1.00 34.66  ? 57  ARG C CD  1 
ATOM 6491 N NE  . ARG C 1 57  ? 43.172  -13.043 221.994 1.00 47.76  ? 57  ARG C NE  1 
ATOM 6492 C CZ  . ARG C 1 57  ? 42.441  -13.443 220.966 1.00 58.00  ? 57  ARG C CZ  1 
ATOM 6493 N NH1 . ARG C 1 57  ? 42.595  -14.669 220.481 1.00 59.05  ? 57  ARG C NH1 1 
ATOM 6494 N NH2 . ARG C 1 57  ? 41.557  -12.617 220.423 1.00 69.24  ? 57  ARG C NH2 1 
ATOM 6495 N N   . GLU C 1 58  ? 46.760  -15.450 226.849 1.00 20.19  ? 58  GLU C N   1 
ATOM 6496 C CA  . GLU C 1 58  ? 47.298  -16.723 227.307 1.00 19.17  ? 58  GLU C CA  1 
ATOM 6497 C C   . GLU C 1 58  ? 46.282  -17.705 226.708 1.00 17.79  ? 58  GLU C C   1 
ATOM 6498 O O   . GLU C 1 58  ? 45.075  -17.425 226.687 1.00 16.27  ? 58  GLU C O   1 
ATOM 6499 C CB  . GLU C 1 58  ? 47.209  -16.890 228.815 1.00 17.39  ? 58  GLU C CB  1 
ATOM 6500 C CG  . GLU C 1 58  ? 48.137  -16.066 229.615 1.00 27.42  ? 58  GLU C CG  1 
ATOM 6501 C CD  . GLU C 1 58  ? 48.005  -16.377 231.084 1.00 28.73  ? 58  GLU C CD  1 
ATOM 6502 O OE1 . GLU C 1 58  ? 46.897  -16.766 231.525 1.00 28.30  ? 58  GLU C OE1 1 
ATOM 6503 O OE2 . GLU C 1 58  ? 49.010  -16.229 231.800 1.00 37.74  ? 58  GLU C OE2 1 
ATOM 6504 N N   . TYR C 1 59  ? 46.762  -18.824 226.191 1.00 15.66  ? 59  TYR C N   1 
ATOM 6505 C CA  . TYR C 1 59  ? 45.886  -19.841 225.645 1.00 15.80  ? 59  TYR C CA  1 
ATOM 6506 C C   . TYR C 1 59  ? 46.063  -21.091 226.507 1.00 15.97  ? 59  TYR C C   1 
ATOM 6507 O O   . TYR C 1 59  ? 47.135  -21.299 227.091 1.00 17.25  ? 59  TYR C O   1 
ATOM 6508 C CB  . TYR C 1 59  ? 46.290  -20.181 224.212 1.00 14.92  ? 59  TYR C CB  1 
ATOM 6509 C CG  . TYR C 1 59  ? 45.851  -19.173 223.194 1.00 15.72  ? 59  TYR C CG  1 
ATOM 6510 C CD1 . TYR C 1 59  ? 44.509  -19.046 222.859 1.00 13.05  ? 59  TYR C CD1 1 
ATOM 6511 C CD2 . TYR C 1 59  ? 46.778  -18.381 222.514 1.00 14.72  ? 59  TYR C CD2 1 
ATOM 6512 C CE1 . TYR C 1 59  ? 44.095  -18.158 221.862 1.00 18.46  ? 59  TYR C CE1 1 
ATOM 6513 C CE2 . TYR C 1 59  ? 46.376  -17.497 221.516 1.00 16.81  ? 59  TYR C CE2 1 
ATOM 6514 C CZ  . TYR C 1 59  ? 45.032  -17.393 221.192 1.00 16.29  ? 59  TYR C CZ  1 
ATOM 6515 O OH  . TYR C 1 59  ? 44.616  -16.559 220.173 1.00 20.60  ? 59  TYR C OH  1 
ATOM 6516 N N   . CYS C 1 60  ? 45.027  -21.917 226.593 1.00 15.14  ? 60  CYS C N   1 
ATOM 6517 C CA  . CYS C 1 60  ? 45.127  -23.161 227.353 1.00 16.35  ? 60  CYS C CA  1 
ATOM 6518 C C   . CYS C 1 60  ? 45.274  -24.342 226.377 1.00 15.64  ? 60  CYS C C   1 
ATOM 6519 O O   . CYS C 1 60  ? 44.469  -24.497 225.455 1.00 15.64  ? 60  CYS C O   1 
ATOM 6520 C CB  . CYS C 1 60  ? 43.898  -23.366 228.219 1.00 20.37  ? 60  CYS C CB  1 
ATOM 6521 S SG  . CYS C 1 60  ? 44.042  -24.924 229.124 1.00 16.21  ? 60  CYS C SG  1 
ATOM 6522 N N   . LEU C 1 61  ? 46.308  -25.160 226.559 1.00 15.64  ? 61  LEU C N   1 
ATOM 6523 C CA  . LEU C 1 61  ? 46.554  -26.301 225.673 1.00 16.02  ? 61  LEU C CA  1 
ATOM 6524 C C   . LEU C 1 61  ? 45.932  -27.593 226.197 1.00 16.09  ? 61  LEU C C   1 
ATOM 6525 O O   . LEU C 1 61  ? 45.788  -28.572 225.460 1.00 16.69  ? 61  LEU C O   1 
ATOM 6526 C CB  . LEU C 1 61  ? 48.074  -26.521 225.490 1.00 15.60  ? 61  LEU C CB  1 
ATOM 6527 C CG  . LEU C 1 61  ? 48.870  -25.434 224.763 1.00 19.24  ? 61  LEU C CG  1 
ATOM 6528 C CD1 . LEU C 1 61  ? 50.362  -25.626 224.985 1.00 17.23  ? 61  LEU C CD1 1 
ATOM 6529 C CD2 . LEU C 1 61  ? 48.526  -25.475 223.278 1.00 17.47  ? 61  LEU C CD2 1 
ATOM 6530 N N   . HIS C 1 62  ? 45.614  -27.624 227.480 1.00 14.24  ? 62  HIS C N   1 
ATOM 6531 C CA  . HIS C 1 62  ? 45.052  -28.838 228.055 1.00 15.31  ? 62  HIS C CA  1 
ATOM 6532 C C   . HIS C 1 62  ? 44.074  -28.491 229.165 1.00 14.21  ? 62  HIS C C   1 
ATOM 6533 O O   . HIS C 1 62  ? 44.487  -28.033 230.232 1.00 16.09  ? 62  HIS C O   1 
ATOM 6534 C CB  . HIS C 1 62  ? 46.186  -29.703 228.610 1.00 16.42  ? 62  HIS C CB  1 
ATOM 6535 C CG  . HIS C 1 62  ? 45.766  -31.103 228.938 1.00 23.01  ? 62  HIS C CG  1 
ATOM 6536 N ND1 . HIS C 1 62  ? 46.566  -31.970 229.651 1.00 21.20  ? 62  HIS C ND1 1 
ATOM 6537 C CD2 . HIS C 1 62  ? 44.630  -31.779 228.655 1.00 18.34  ? 62  HIS C CD2 1 
ATOM 6538 C CE1 . HIS C 1 62  ? 45.933  -33.124 229.794 1.00 20.34  ? 62  HIS C CE1 1 
ATOM 6539 N NE2 . HIS C 1 62  ? 44.756  -33.027 229.198 1.00 20.76  ? 62  HIS C NE2 1 
ATOM 6540 N N   . ALA C 1 63  ? 42.786  -28.699 228.910 1.00 14.33  ? 63  ALA C N   1 
ATOM 6541 C CA  . ALA C 1 63  ? 41.756  -28.385 229.896 1.00 16.98  ? 63  ALA C CA  1 
ATOM 6542 C C   . ALA C 1 63  ? 41.711  -29.395 231.037 1.00 19.59  ? 63  ALA C C   1 
ATOM 6543 O O   . ALA C 1 63  ? 41.932  -30.588 230.833 1.00 18.31  ? 63  ALA C O   1 
ATOM 6544 C CB  . ALA C 1 63  ? 40.385  -28.300 229.225 1.00 16.17  ? 63  ALA C CB  1 
ATOM 6545 N N   . LYS C 1 64  ? 41.498  -28.880 232.241 1.00 20.03  ? 64  LYS C N   1 
ATOM 6546 C CA  . LYS C 1 64  ? 41.364  -29.677 233.446 1.00 22.57  ? 64  LYS C CA  1 
ATOM 6547 C C   . LYS C 1 64  ? 39.877  -29.531 233.788 1.00 25.26  ? 64  LYS C C   1 
ATOM 6548 O O   . LYS C 1 64  ? 39.417  -28.431 234.136 1.00 26.18  ? 64  LYS C O   1 
ATOM 6549 C CB  . LYS C 1 64  ? 42.212  -29.090 234.569 1.00 26.10  ? 64  LYS C CB  1 
ATOM 6550 C CG  . LYS C 1 64  ? 42.089  -29.834 235.890 1.00 36.40  ? 64  LYS C CG  1 
ATOM 6551 C CD  . LYS C 1 64  ? 42.969  -29.203 236.949 1.00 51.90  ? 64  LYS C CD  1 
ATOM 6552 C CE  . LYS C 1 64  ? 42.980  -30.032 238.222 1.00 65.28  ? 64  LYS C CE  1 
ATOM 6553 N NZ  . LYS C 1 64  ? 43.929  -29.475 239.240 1.00 71.17  ? 64  LYS C NZ  1 
ATOM 6554 N N   . LEU C 1 65  ? 39.110  -30.601 233.603 1.00 26.28  ? 65  LEU C N   1 
ATOM 6555 C CA  . LEU C 1 65  ? 37.671  -30.552 233.865 1.00 26.20  ? 65  LEU C CA  1 
ATOM 6556 C C   . LEU C 1 65  ? 37.326  -31.211 235.170 1.00 27.01  ? 65  LEU C C   1 
ATOM 6557 O O   . LEU C 1 65  ? 37.929  -32.214 235.540 1.00 29.92  ? 65  LEU C O   1 
ATOM 6558 C CB  . LEU C 1 65  ? 36.902  -31.249 232.751 1.00 26.49  ? 65  LEU C CB  1 
ATOM 6559 C CG  . LEU C 1 65  ? 37.208  -30.786 231.327 1.00 25.59  ? 65  LEU C CG  1 
ATOM 6560 C CD1 . LEU C 1 65  ? 36.447  -31.674 230.356 1.00 19.90  ? 65  LEU C CD1 1 
ATOM 6561 C CD2 . LEU C 1 65  ? 36.844  -29.304 231.145 1.00 19.88  ? 65  LEU C CD2 1 
ATOM 6562 N N   . SER C 1 66  ? 36.342  -30.670 235.869 1.00 29.05  ? 66  SER C N   1 
ATOM 6563 C CA  . SER C 1 66  ? 35.941  -31.266 237.127 1.00 29.72  ? 66  SER C CA  1 
ATOM 6564 C C   . SER C 1 66  ? 34.524  -30.879 237.494 1.00 31.24  ? 66  SER C C   1 
ATOM 6565 O O   . SER C 1 66  ? 33.916  -29.988 236.869 1.00 24.79  ? 66  SER C O   1 
ATOM 6566 C CB  . SER C 1 66  ? 36.899  -30.862 238.246 1.00 28.69  ? 66  SER C CB  1 
ATOM 6567 O OG  . SER C 1 66  ? 36.694  -29.510 238.623 1.00 34.55  ? 66  SER C OG  1 
ATOM 6568 N N   . ASP C 1 67  ? 34.009  -31.596 238.497 1.00 35.79  ? 67  ASP C N   1 
ATOM 6569 C CA  . ASP C 1 67  ? 32.665  -31.402 239.054 1.00 38.40  ? 67  ASP C CA  1 
ATOM 6570 C C   . ASP C 1 67  ? 31.530  -31.390 238.042 1.00 35.66  ? 67  ASP C C   1 
ATOM 6571 O O   . ASP C 1 67  ? 30.740  -30.435 237.998 1.00 33.66  ? 67  ASP C O   1 
ATOM 6572 C CB  . ASP C 1 67  ? 32.616  -30.129 239.912 1.00 46.83  ? 67  ASP C CB  1 
ATOM 6573 C CG  . ASP C 1 67  ? 33.512  -30.217 241.142 1.00 60.49  ? 67  ASP C CG  1 
ATOM 6574 O OD1 . ASP C 1 67  ? 34.401  -31.112 241.207 1.00 66.20  ? 67  ASP C OD1 1 
ATOM 6575 O OD2 . ASP C 1 67  ? 33.321  -29.378 242.052 1.00 67.90  ? 67  ASP C OD2 1 
ATOM 6576 N N   . THR C 1 68  ? 31.462  -32.454 237.240 1.00 32.56  ? 68  THR C N   1 
ATOM 6577 C CA  . THR C 1 68  ? 30.424  -32.618 236.226 1.00 33.72  ? 68  THR C CA  1 
ATOM 6578 C C   . THR C 1 68  ? 29.053  -32.694 236.924 1.00 34.54  ? 68  THR C C   1 
ATOM 6579 O O   . THR C 1 68  ? 28.882  -33.442 237.903 1.00 36.56  ? 68  THR C O   1 
ATOM 6580 C CB  . THR C 1 68  ? 30.667  -33.917 235.414 1.00 31.38  ? 68  THR C CB  1 
ATOM 6581 O OG1 . THR C 1 68  ? 32.054  -34.000 235.070 1.00 44.57  ? 68  THR C OG1 1 
ATOM 6582 C CG2 . THR C 1 68  ? 29.833  -33.939 234.134 1.00 33.06  ? 68  THR C CG2 1 
ATOM 6583 N N   . LYS C 1 69  ? 28.108  -31.873 236.474 1.00 33.74  ? 69  LYS C N   1 
ATOM 6584 C CA  . LYS C 1 69  ? 26.768  -31.864 237.047 1.00 34.18  ? 69  LYS C CA  1 
ATOM 6585 C C   . LYS C 1 69  ? 25.721  -31.940 235.952 1.00 32.72  ? 69  LYS C C   1 
ATOM 6586 O O   . LYS C 1 69  ? 25.865  -31.314 234.900 1.00 32.09  ? 69  LYS C O   1 
ATOM 6587 C CB  . LYS C 1 69  ? 26.549  -30.619 237.906 1.00 37.08  ? 69  LYS C CB  1 
ATOM 6588 C CG  . LYS C 1 69  ? 27.409  -30.600 239.153 1.00 44.70  ? 69  LYS C CG  1 
ATOM 6589 C CD  . LYS C 1 69  ? 27.057  -29.440 240.045 1.00 54.80  ? 69  LYS C CD  1 
ATOM 6590 C CE  . LYS C 1 69  ? 28.014  -29.349 241.219 1.00 62.58  ? 69  LYS C CE  1 
ATOM 6591 N NZ  . LYS C 1 69  ? 27.611  -28.271 242.173 1.00 64.15  ? 69  LYS C NZ  1 
ATOM 6592 N N   . VAL C 1 70  ? 24.686  -32.742 236.191 1.00 32.07  ? 70  VAL C N   1 
ATOM 6593 C CA  . VAL C 1 70  ? 23.590  -32.923 235.238 1.00 30.60  ? 70  VAL C CA  1 
ATOM 6594 C C   . VAL C 1 70  ? 22.239  -32.705 235.927 1.00 32.04  ? 70  VAL C C   1 
ATOM 6595 O O   . VAL C 1 70  ? 22.051  -33.079 237.089 1.00 34.25  ? 70  VAL C O   1 
ATOM 6596 C CB  . VAL C 1 70  ? 23.598  -34.354 234.631 1.00 28.55  ? 70  VAL C CB  1 
ATOM 6597 C CG1 . VAL C 1 70  ? 22.488  -34.504 233.610 1.00 27.59  ? 70  VAL C CG1 1 
ATOM 6598 C CG2 . VAL C 1 70  ? 24.941  -34.655 233.980 1.00 28.46  ? 70  VAL C CG2 1 
ATOM 6599 N N   . ALA C 1 71  ? 21.327  -32.035 235.233 1.00 31.10  ? 71  ALA C N   1 
ATOM 6600 C CA  . ALA C 1 71  ? 19.982  -31.796 235.742 1.00 28.74  ? 71  ALA C CA  1 
ATOM 6601 C C   . ALA C 1 71  ? 19.059  -32.199 234.585 1.00 28.73  ? 71  ALA C C   1 
ATOM 6602 O O   . ALA C 1 71  ? 19.308  -31.838 233.426 1.00 26.61  ? 71  ALA C O   1 
ATOM 6603 C CB  . ALA C 1 71  ? 19.795  -30.329 236.104 1.00 24.61  ? 71  ALA C CB  1 
ATOM 6604 N N   . ALA C 1 72  ? 18.043  -33.006 234.883 1.00 26.62  ? 72  ALA C N   1 
ATOM 6605 C CA  . ALA C 1 72  ? 17.106  -33.466 233.856 1.00 27.17  ? 72  ALA C CA  1 
ATOM 6606 C C   . ALA C 1 72  ? 15.669  -33.359 234.369 1.00 26.15  ? 72  ALA C C   1 
ATOM 6607 O O   . ALA C 1 72  ? 15.423  -33.576 235.548 1.00 26.80  ? 72  ALA C O   1 
ATOM 6608 C CB  . ALA C 1 72  ? 17.429  -34.904 233.479 1.00 22.34  ? 72  ALA C CB  1 
ATOM 6609 N N   . ARG C 1 73  ? 14.729  -33.028 233.493 1.00 27.18  ? 73  ARG C N   1 
ATOM 6610 C CA  . ARG C 1 73  ? 13.322  -32.897 233.885 1.00 28.49  ? 73  ARG C CA  1 
ATOM 6611 C C   . ARG C 1 73  ? 12.453  -33.735 232.974 1.00 27.31  ? 73  ARG C C   1 
ATOM 6612 O O   . ARG C 1 73  ? 12.730  -33.858 231.781 1.00 26.38  ? 73  ARG C O   1 
ATOM 6613 C CB  . ARG C 1 73  ? 12.846  -31.455 233.731 1.00 36.50  ? 73  ARG C CB  1 
ATOM 6614 C CG  . ARG C 1 73  ? 13.491  -30.458 234.642 1.00 40.82  ? 73  ARG C CG  1 
ATOM 6615 C CD  . ARG C 1 73  ? 12.996  -30.584 236.044 1.00 49.42  ? 73  ARG C CD  1 
ATOM 6616 N NE  . ARG C 1 73  ? 13.189  -29.317 236.732 1.00 65.12  ? 73  ARG C NE  1 
ATOM 6617 C CZ  . ARG C 1 73  ? 12.320  -28.785 237.585 1.00 68.85  ? 73  ARG C CZ  1 
ATOM 6618 N NH1 . ARG C 1 73  ? 11.185  -29.419 237.868 1.00 63.79  ? 73  ARG C NH1 1 
ATOM 6619 N NH2 . ARG C 1 73  ? 12.570  -27.595 238.123 1.00 70.42  ? 73  ARG C NH2 1 
ATOM 6620 N N   . CYS C 1 74  ? 11.362  -34.256 233.517 1.00 25.28  ? 74  CYS C N   1 
ATOM 6621 C CA  . CYS C 1 74  ? 10.441  -35.051 232.723 1.00 21.71  ? 74  CYS C CA  1 
ATOM 6622 C C   . CYS C 1 74  ? 9.764   -34.132 231.714 1.00 20.61  ? 74  CYS C C   1 
ATOM 6623 O O   . CYS C 1 74  ? 9.774   -32.917 231.890 1.00 21.03  ? 74  CYS C O   1 
ATOM 6624 C CB  . CYS C 1 74  ? 9.426   -35.726 233.643 1.00 19.90  ? 74  CYS C CB  1 
ATOM 6625 S SG  . CYS C 1 74  ? 10.167  -37.109 234.557 1.00 21.06  ? 74  CYS C SG  1 
ATOM 6626 N N   . PRO C 1 75  ? 9.153   -34.690 230.649 1.00 23.73  ? 75  PRO C N   1 
ATOM 6627 C CA  . PRO C 1 75  ? 8.466   -33.928 229.598 1.00 26.80  ? 75  PRO C CA  1 
ATOM 6628 C C   . PRO C 1 75  ? 7.498   -32.776 229.994 1.00 32.44  ? 75  PRO C C   1 
ATOM 6629 O O   . PRO C 1 75  ? 7.363   -31.795 229.253 1.00 36.40  ? 75  PRO C O   1 
ATOM 6630 C CB  . PRO C 1 75  ? 7.750   -35.021 228.808 1.00 25.54  ? 75  PRO C CB  1 
ATOM 6631 C CG  . PRO C 1 75  ? 8.670   -36.170 228.924 1.00 22.09  ? 75  PRO C CG  1 
ATOM 6632 C CD  . PRO C 1 75  ? 9.048   -36.140 230.378 1.00 23.64  ? 75  PRO C CD  1 
ATOM 6633 N N   . THR C 1 76  ? 6.811   -32.877 231.128 1.00 35.45  ? 76  THR C N   1 
ATOM 6634 C CA  . THR C 1 76  ? 5.878   -31.801 231.533 1.00 37.13  ? 76  THR C CA  1 
ATOM 6635 C C   . THR C 1 76  ? 6.416   -30.856 232.619 1.00 37.91  ? 76  THR C C   1 
ATOM 6636 O O   . THR C 1 76  ? 5.809   -29.824 232.921 1.00 39.27  ? 76  THR C O   1 
ATOM 6637 C CB  . THR C 1 76  ? 4.531   -32.397 232.044 1.00 32.09  ? 76  THR C CB  1 
ATOM 6638 O OG1 . THR C 1 76  ? 4.781   -33.333 233.102 1.00 29.90  ? 76  THR C OG1 1 
ATOM 6639 C CG2 . THR C 1 76  ? 3.801   -33.096 230.923 1.00 29.09  ? 76  THR C CG2 1 
ATOM 6640 N N   . MET C 1 77  ? 7.566   -31.214 233.181 1.00 36.16  ? 77  MET C N   1 
ATOM 6641 C CA  . MET C 1 77  ? 8.185   -30.473 234.265 1.00 32.47  ? 77  MET C CA  1 
ATOM 6642 C C   . MET C 1 77  ? 9.001   -29.219 233.934 1.00 32.21  ? 77  MET C C   1 
ATOM 6643 O O   . MET C 1 77  ? 9.642   -28.657 234.827 1.00 30.42  ? 77  MET C O   1 
ATOM 6644 C CB  . MET C 1 77  ? 9.024   -31.440 235.104 1.00 37.36  ? 77  MET C CB  1 
ATOM 6645 C CG  . MET C 1 77  ? 8.226   -32.598 235.714 1.00 42.94  ? 77  MET C CG  1 
ATOM 6646 S SD  . MET C 1 77  ? 6.940   -32.047 236.874 1.00 45.12  ? 77  MET C SD  1 
ATOM 6647 C CE  . MET C 1 77  ? 7.751   -32.317 238.492 1.00 39.14  ? 77  MET C CE  1 
ATOM 6648 N N   . GLY C 1 78  ? 8.970   -28.760 232.686 1.00 29.93  ? 78  GLY C N   1 
ATOM 6649 C CA  . GLY C 1 78  ? 9.731   -27.565 232.332 1.00 33.20  ? 78  GLY C CA  1 
ATOM 6650 C C   . GLY C 1 78  ? 11.241  -27.715 232.112 1.00 34.68  ? 78  GLY C C   1 
ATOM 6651 O O   . GLY C 1 78  ? 11.775  -28.831 232.102 1.00 32.62  ? 78  GLY C O   1 
ATOM 6652 N N   . PRO C 1 79  ? 11.966  -26.588 231.951 1.00 36.67  ? 79  PRO C N   1 
ATOM 6653 C CA  . PRO C 1 79  ? 13.422  -26.577 231.724 1.00 34.88  ? 79  PRO C CA  1 
ATOM 6654 C C   . PRO C 1 79  ? 14.255  -27.041 232.896 1.00 32.68  ? 79  PRO C C   1 
ATOM 6655 O O   . PRO C 1 79  ? 13.956  -26.744 234.055 1.00 33.10  ? 79  PRO C O   1 
ATOM 6656 C CB  . PRO C 1 79  ? 13.714  -25.093 231.444 1.00 37.10  ? 79  PRO C CB  1 
ATOM 6657 C CG  . PRO C 1 79  ? 12.386  -24.520 231.024 1.00 41.55  ? 79  PRO C CG  1 
ATOM 6658 C CD  . PRO C 1 79  ? 11.444  -25.218 231.982 1.00 41.06  ? 79  PRO C CD  1 
ATOM 6659 N N   . ALA C 1 80  ? 15.312  -27.785 232.591 1.00 30.76  ? 80  ALA C N   1 
ATOM 6660 C CA  . ALA C 1 80  ? 16.225  -28.242 233.621 1.00 30.58  ? 80  ALA C CA  1 
ATOM 6661 C C   . ALA C 1 80  ? 17.199  -27.073 233.778 1.00 30.16  ? 80  ALA C C   1 
ATOM 6662 O O   . ALA C 1 80  ? 17.481  -26.367 232.806 1.00 29.03  ? 80  ALA C O   1 
ATOM 6663 C CB  . ALA C 1 80  ? 16.965  -29.484 233.146 1.00 31.11  ? 80  ALA C CB  1 
ATOM 6664 N N   . THR C 1 81  ? 17.660  -26.815 234.994 1.00 29.62  ? 81  THR C N   1 
ATOM 6665 C CA  . THR C 1 81  ? 18.603  -25.726 235.207 1.00 31.46  ? 81  THR C CA  1 
ATOM 6666 C C   . THR C 1 81  ? 19.625  -26.069 236.285 1.00 33.24  ? 81  THR C C   1 
ATOM 6667 O O   . THR C 1 81  ? 19.356  -26.865 237.196 1.00 32.23  ? 81  THR C O   1 
ATOM 6668 C CB  . THR C 1 81  ? 17.906  -24.393 235.602 1.00 33.41  ? 81  THR C CB  1 
ATOM 6669 O OG1 . THR C 1 81  ? 17.217  -24.559 236.842 1.00 34.69  ? 81  THR C OG1 1 
ATOM 6670 C CG2 . THR C 1 81  ? 16.921  -23.941 234.535 1.00 30.42  ? 81  THR C CG2 1 
ATOM 6671 N N   . LEU C 1 82  ? 20.801  -25.461 236.161 1.00 34.44  ? 82  LEU C N   1 
ATOM 6672 C CA  . LEU C 1 82  ? 21.903  -25.640 237.103 1.00 35.56  ? 82  LEU C CA  1 
ATOM 6673 C C   . LEU C 1 82  ? 22.437  -24.250 237.403 1.00 36.23  ? 82  LEU C C   1 
ATOM 6674 O O   . LEU C 1 82  ? 22.449  -23.380 236.521 1.00 36.54  ? 82  LEU C O   1 
ATOM 6675 C CB  . LEU C 1 82  ? 23.015  -26.481 236.471 1.00 33.67  ? 82  LEU C CB  1 
ATOM 6676 C CG  . LEU C 1 82  ? 22.769  -27.985 236.379 1.00 35.90  ? 82  LEU C CG  1 
ATOM 6677 C CD1 . LEU C 1 82  ? 23.806  -28.651 235.493 1.00 33.81  ? 82  LEU C CD1 1 
ATOM 6678 C CD2 . LEU C 1 82  ? 22.797  -28.563 237.782 1.00 32.78  ? 82  LEU C CD2 1 
ATOM 6679 N N   . ALA C 1 83  ? 22.854  -24.025 238.642 1.00 37.04  ? 83  ALA C N   1 
ATOM 6680 C CA  . ALA C 1 83  ? 23.411  -22.724 239.024 1.00 39.29  ? 83  ALA C CA  1 
ATOM 6681 C C   . ALA C 1 83  ? 24.663  -22.429 238.174 1.00 40.36  ? 83  ALA C C   1 
ATOM 6682 O O   . ALA C 1 83  ? 24.930  -21.272 237.810 1.00 41.68  ? 83  ALA C O   1 
ATOM 6683 C CB  . ALA C 1 83  ? 23.769  -22.722 240.518 1.00 38.38  ? 83  ALA C CB  1 
ATOM 6684 N N   . GLU C 1 84  ? 25.375  -23.496 237.801 1.00 37.72  ? 84  GLU C N   1 
ATOM 6685 C CA  . GLU C 1 84  ? 26.595  -23.405 237.005 1.00 35.54  ? 84  GLU C CA  1 
ATOM 6686 C C   . GLU C 1 84  ? 26.389  -22.765 235.646 1.00 34.21  ? 84  GLU C C   1 
ATOM 6687 O O   . GLU C 1 84  ? 27.303  -22.153 235.117 1.00 35.03  ? 84  GLU C O   1 
ATOM 6688 C CB  . GLU C 1 84  ? 27.233  -24.780 236.812 1.00 37.69  ? 84  GLU C CB  1 
ATOM 6689 C CG  . GLU C 1 84  ? 27.897  -25.365 238.045 1.00 40.33  ? 84  GLU C CG  1 
ATOM 6690 C CD  . GLU C 1 84  ? 26.912  -25.905 239.083 1.00 50.36  ? 84  GLU C CD  1 
ATOM 6691 O OE1 . GLU C 1 84  ? 25.680  -25.934 238.835 1.00 44.76  ? 84  GLU C OE1 1 
ATOM 6692 O OE2 . GLU C 1 84  ? 27.389  -26.319 240.160 1.00 50.11  ? 84  GLU C OE2 1 
ATOM 6693 N N   . GLU C 1 85  ? 25.189  -22.867 235.088 1.00 32.59  ? 85  GLU C N   1 
ATOM 6694 C CA  . GLU C 1 85  ? 24.930  -22.276 233.783 1.00 36.65  ? 85  GLU C CA  1 
ATOM 6695 C C   . GLU C 1 85  ? 25.193  -20.772 233.770 1.00 40.09  ? 85  GLU C C   1 
ATOM 6696 O O   . GLU C 1 85  ? 25.348  -20.164 232.706 1.00 39.05  ? 85  GLU C O   1 
ATOM 6697 C CB  . GLU C 1 85  ? 23.474  -22.483 233.386 1.00 37.45  ? 85  GLU C CB  1 
ATOM 6698 C CG  . GLU C 1 85  ? 23.080  -23.887 233.066 1.00 37.40  ? 85  GLU C CG  1 
ATOM 6699 C CD  . GLU C 1 85  ? 21.695  -23.936 232.482 1.00 30.07  ? 85  GLU C CD  1 
ATOM 6700 O OE1 . GLU C 1 85  ? 21.522  -23.543 231.307 1.00 27.21  ? 85  GLU C OE1 1 
ATOM 6701 O OE2 . GLU C 1 85  ? 20.775  -24.338 233.212 1.00 35.74  ? 85  GLU C OE2 1 
ATOM 6702 N N   . HIS C 1 86  ? 25.161  -20.162 234.950 1.00 42.79  ? 86  HIS C N   1 
ATOM 6703 C CA  . HIS C 1 86  ? 25.348  -18.726 235.059 1.00 47.21  ? 86  HIS C CA  1 
ATOM 6704 C C   . HIS C 1 86  ? 26.680  -18.314 235.627 1.00 48.62  ? 86  HIS C C   1 
ATOM 6705 O O   . HIS C 1 86  ? 26.960  -17.123 235.745 1.00 50.45  ? 86  HIS C O   1 
ATOM 6706 C CB  . HIS C 1 86  ? 24.210  -18.119 235.871 1.00 50.79  ? 86  HIS C CB  1 
ATOM 6707 C CG  . HIS C 1 86  ? 22.865  -18.408 235.292 1.00 59.01  ? 86  HIS C CG  1 
ATOM 6708 N ND1 . HIS C 1 86  ? 22.535  -18.071 233.993 1.00 60.94  ? 86  HIS C ND1 1 
ATOM 6709 C CD2 . HIS C 1 86  ? 21.808  -19.092 235.786 1.00 60.48  ? 86  HIS C CD2 1 
ATOM 6710 C CE1 . HIS C 1 86  ? 21.331  -18.542 233.714 1.00 62.83  ? 86  HIS C CE1 1 
ATOM 6711 N NE2 . HIS C 1 86  ? 20.871  -19.166 234.785 1.00 67.81  ? 86  HIS C NE2 1 
ATOM 6712 N N   . GLN C 1 87  ? 27.498  -19.288 235.997 1.00 47.18  ? 87  GLN C N   1 
ATOM 6713 C CA  . GLN C 1 87  ? 28.808  -18.989 236.533 1.00 45.95  ? 87  GLN C CA  1 
ATOM 6714 C C   . GLN C 1 87  ? 29.845  -18.978 235.409 1.00 44.88  ? 87  GLN C C   1 
ATOM 6715 O O   . GLN C 1 87  ? 29.666  -19.619 234.360 1.00 45.25  ? 87  GLN C O   1 
ATOM 6716 C CB  . GLN C 1 87  ? 29.187  -20.017 237.587 1.00 45.96  ? 87  GLN C CB  1 
ATOM 6717 C CG  . GLN C 1 87  ? 28.257  -20.020 238.767 1.00 51.53  ? 87  GLN C CG  1 
ATOM 6718 C CD  . GLN C 1 87  ? 28.439  -21.243 239.648 1.00 59.62  ? 87  GLN C CD  1 
ATOM 6719 O OE1 . GLN C 1 87  ? 29.544  -21.765 239.798 1.00 61.85  ? 87  GLN C OE1 1 
ATOM 6720 N NE2 . GLN C 1 87  ? 27.345  -21.714 240.231 1.00 65.63  ? 87  GLN C NE2 1 
ATOM 6721 N N   . GLY C 1 88  ? 30.873  -18.156 235.584 1.00 41.90  ? 88  GLY C N   1 
ATOM 6722 C CA  . GLY C 1 88  ? 31.940  -18.114 234.609 1.00 41.04  ? 88  GLY C CA  1 
ATOM 6723 C C   . GLY C 1 88  ? 32.829  -19.277 235.018 1.00 40.30  ? 88  GLY C C   1 
ATOM 6724 O O   . GLY C 1 88  ? 32.761  -19.758 236.169 1.00 41.06  ? 88  GLY C O   1 
ATOM 6725 N N   . GLY C 1 89  ? 33.621  -19.784 234.088 1.00 36.72  ? 89  GLY C N   1 
ATOM 6726 C CA  . GLY C 1 89  ? 34.489  -20.889 234.446 1.00 35.17  ? 89  GLY C CA  1 
ATOM 6727 C C   . GLY C 1 89  ? 33.854  -22.264 234.359 1.00 32.47  ? 89  GLY C C   1 
ATOM 6728 O O   . GLY C 1 89  ? 34.411  -23.227 234.892 1.00 32.29  ? 89  GLY C O   1 
ATOM 6729 N N   . THR C 1 90  ? 32.703  -22.357 233.689 1.00 29.55  ? 90  THR C N   1 
ATOM 6730 C CA  . THR C 1 90  ? 32.004  -23.627 233.497 1.00 27.12  ? 90  THR C CA  1 
ATOM 6731 C C   . THR C 1 90  ? 31.613  -23.691 232.027 1.00 26.20  ? 90  THR C C   1 
ATOM 6732 O O   . THR C 1 90  ? 31.506  -22.651 231.375 1.00 26.90  ? 90  THR C O   1 
ATOM 6733 C CB  . THR C 1 90  ? 30.688  -23.729 234.332 1.00 26.29  ? 90  THR C CB  1 
ATOM 6734 O OG1 . THR C 1 90  ? 29.785  -22.693 233.926 1.00 26.06  ? 90  THR C OG1 1 
ATOM 6735 C CG2 . THR C 1 90  ? 30.964  -23.598 235.819 1.00 21.21  ? 90  THR C CG2 1 
ATOM 6736 N N   . VAL C 1 91  ? 31.462  -24.904 231.497 1.00 24.80  ? 91  VAL C N   1 
ATOM 6737 C CA  . VAL C 1 91  ? 31.039  -25.101 230.112 1.00 24.10  ? 91  VAL C CA  1 
ATOM 6738 C C   . VAL C 1 91  ? 29.778  -25.961 230.252 1.00 23.97  ? 91  VAL C C   1 
ATOM 6739 O O   . VAL C 1 91  ? 29.805  -26.982 230.947 1.00 23.44  ? 91  VAL C O   1 
ATOM 6740 C CB  . VAL C 1 91  ? 32.106  -25.876 229.288 1.00 24.55  ? 91  VAL C CB  1 
ATOM 6741 C CG1 . VAL C 1 91  ? 31.571  -26.189 227.887 1.00 22.55  ? 91  VAL C CG1 1 
ATOM 6742 C CG2 . VAL C 1 91  ? 33.373  -25.059 229.181 1.00 25.57  ? 91  VAL C CG2 1 
ATOM 6743 N N   . CYS C 1 92  ? 28.691  -25.561 229.606 1.00 22.23  ? 92  CYS C N   1 
ATOM 6744 C CA  . CYS C 1 92  ? 27.440  -26.306 229.721 1.00 24.79  ? 92  CYS C CA  1 
ATOM 6745 C C   . CYS C 1 92  ? 26.795  -26.560 228.382 1.00 26.85  ? 92  CYS C C   1 
ATOM 6746 O O   . CYS C 1 92  ? 27.045  -25.825 227.423 1.00 28.41  ? 92  CYS C O   1 
ATOM 6747 C CB  . CYS C 1 92  ? 26.415  -25.516 230.537 1.00 19.43  ? 92  CYS C CB  1 
ATOM 6748 S SG  . CYS C 1 92  ? 26.918  -24.995 232.199 1.00 26.62  ? 92  CYS C SG  1 
ATOM 6749 N N   . LYS C 1 93  ? 25.973  -27.607 228.311 1.00 26.32  ? 93  LYS C N   1 
ATOM 6750 C CA  . LYS C 1 93  ? 25.218  -27.896 227.096 1.00 25.91  ? 93  LYS C CA  1 
ATOM 6751 C C   . LYS C 1 93  ? 23.808  -28.315 227.502 1.00 27.24  ? 93  LYS C C   1 
ATOM 6752 O O   . LYS C 1 93  ? 23.629  -29.124 228.419 1.00 29.36  ? 93  LYS C O   1 
ATOM 6753 C CB  . LYS C 1 93  ? 25.842  -28.981 226.221 1.00 22.62  ? 93  LYS C CB  1 
ATOM 6754 C CG  . LYS C 1 93  ? 25.275  -28.912 224.816 1.00 26.46  ? 93  LYS C CG  1 
ATOM 6755 C CD  . LYS C 1 93  ? 25.583  -30.112 223.962 1.00 32.50  ? 93  LYS C CD  1 
ATOM 6756 C CE  . LYS C 1 93  ? 24.986  -29.892 222.581 1.00 38.36  ? 93  LYS C CE  1 
ATOM 6757 N NZ  . LYS C 1 93  ? 25.336  -30.974 221.618 1.00 50.12  ? 93  LYS C NZ  1 
ATOM 6758 N N   . ARG C 1 94  ? 22.822  -27.678 226.885 1.00 25.57  ? 94  ARG C N   1 
ATOM 6759 C CA  . ARG C 1 94  ? 21.428  -27.969 227.147 1.00 26.93  ? 94  ARG C CA  1 
ATOM 6760 C C   . ARG C 1 94  ? 20.978  -28.798 225.956 1.00 27.73  ? 94  ARG C C   1 
ATOM 6761 O O   . ARG C 1 94  ? 21.343  -28.492 224.812 1.00 28.15  ? 94  ARG C O   1 
ATOM 6762 C CB  . ARG C 1 94  ? 20.610  -26.676 227.209 1.00 28.46  ? 94  ARG C CB  1 
ATOM 6763 C CG  . ARG C 1 94  ? 21.065  -25.658 228.239 1.00 29.51  ? 94  ARG C CG  1 
ATOM 6764 C CD  . ARG C 1 94  ? 20.051  -24.504 228.318 1.00 35.64  ? 94  ARG C CD  1 
ATOM 6765 N NE  . ARG C 1 94  ? 18.715  -25.004 228.642 1.00 24.83  ? 94  ARG C NE  1 
ATOM 6766 C CZ  . ARG C 1 94  ? 18.302  -25.305 229.871 1.00 26.99  ? 94  ARG C CZ  1 
ATOM 6767 N NH1 . ARG C 1 94  ? 19.105  -25.150 230.919 1.00 21.26  ? 94  ARG C NH1 1 
ATOM 6768 N NH2 . ARG C 1 94  ? 17.090  -25.811 230.051 1.00 25.70  ? 94  ARG C NH2 1 
ATOM 6769 N N   . ASP C 1 95  ? 20.185  -29.836 226.206 1.00 27.16  ? 95  ASP C N   1 
ATOM 6770 C CA  . ASP C 1 95  ? 19.712  -30.697 225.130 1.00 27.06  ? 95  ASP C CA  1 
ATOM 6771 C C   . ASP C 1 95  ? 18.364  -31.297 225.573 1.00 29.82  ? 95  ASP C C   1 
ATOM 6772 O O   . ASP C 1 95  ? 17.708  -30.777 226.483 1.00 28.70  ? 95  ASP C O   1 
ATOM 6773 C CB  . ASP C 1 95  ? 20.769  -31.795 224.863 1.00 23.79  ? 95  ASP C CB  1 
ATOM 6774 C CG  . ASP C 1 95  ? 20.761  -32.313 223.416 1.00 30.16  ? 95  ASP C CG  1 
ATOM 6775 O OD1 . ASP C 1 95  ? 19.748  -32.174 222.691 1.00 33.72  ? 95  ASP C OD1 1 
ATOM 6776 O OD2 . ASP C 1 95  ? 21.793  -32.882 222.998 1.00 31.93  ? 95  ASP C OD2 1 
ATOM 6777 N N   . GLN C 1 96  ? 17.956  -32.386 224.932 1.00 31.84  ? 96  GLN C N   1 
ATOM 6778 C CA  . GLN C 1 96  ? 16.707  -33.065 225.249 1.00 30.12  ? 96  GLN C CA  1 
ATOM 6779 C C   . GLN C 1 96  ? 16.981  -34.545 225.193 1.00 29.11  ? 96  GLN C C   1 
ATOM 6780 O O   . GLN C 1 96  ? 17.672  -35.008 224.289 1.00 28.76  ? 96  GLN C O   1 
ATOM 6781 C CB  . GLN C 1 96  ? 15.656  -32.744 224.198 1.00 28.20  ? 96  GLN C CB  1 
ATOM 6782 C CG  . GLN C 1 96  ? 15.055  -31.368 224.298 1.00 37.40  ? 96  GLN C CG  1 
ATOM 6783 C CD  . GLN C 1 96  ? 13.916  -31.200 223.316 1.00 49.73  ? 96  GLN C CD  1 
ATOM 6784 O OE1 . GLN C 1 96  ? 12.870  -30.648 223.653 1.00 53.01  ? 96  GLN C OE1 1 
ATOM 6785 N NE2 . GLN C 1 96  ? 14.095  -31.722 222.100 1.00 49.52  ? 96  GLN C NE2 1 
ATOM 6786 N N   . SER C 1 97  ? 16.466  -35.283 226.162 1.00 27.66  ? 97  SER C N   1 
ATOM 6787 C CA  . SER C 1 97  ? 16.645  -36.723 226.177 1.00 27.74  ? 97  SER C CA  1 
ATOM 6788 C C   . SER C 1 97  ? 15.274  -37.380 226.089 1.00 26.31  ? 97  SER C C   1 
ATOM 6789 O O   . SER C 1 97  ? 14.256  -36.737 226.347 1.00 27.39  ? 97  SER C O   1 
ATOM 6790 C CB  . SER C 1 97  ? 17.338  -37.161 227.463 1.00 22.52  ? 97  SER C CB  1 
ATOM 6791 O OG  . SER C 1 97  ? 16.602  -36.719 228.579 1.00 25.89  ? 97  SER C OG  1 
ATOM 6792 N N   . ASP C 1 98  ? 15.250  -38.647 225.694 1.00 24.83  ? 98  ASP C N   1 
ATOM 6793 C CA  . ASP C 1 98  ? 14.012  -39.410 225.595 1.00 23.53  ? 98  ASP C CA  1 
ATOM 6794 C C   . ASP C 1 98  ? 13.684  -39.910 226.999 1.00 21.71  ? 98  ASP C C   1 
ATOM 6795 O O   . ASP C 1 98  ? 14.535  -40.484 227.676 1.00 21.20  ? 98  ASP C O   1 
ATOM 6796 C CB  . ASP C 1 98  ? 14.192  -40.587 224.642 1.00 25.60  ? 98  ASP C CB  1 
ATOM 6797 C CG  . ASP C 1 98  ? 14.542  -40.145 223.234 1.00 31.12  ? 98  ASP C CG  1 
ATOM 6798 O OD1 . ASP C 1 98  ? 13.825  -39.281 222.687 1.00 34.09  ? 98  ASP C OD1 1 
ATOM 6799 O OD2 . ASP C 1 98  ? 15.535  -40.661 222.679 1.00 40.34  ? 98  ASP C OD2 1 
ATOM 6800 N N   . ARG C 1 99  ? 12.463  -39.643 227.443 1.00 19.59  ? 99  ARG C N   1 
ATOM 6801 C CA  . ARG C 1 99  ? 12.024  -40.028 228.778 1.00 18.60  ? 99  ARG C CA  1 
ATOM 6802 C C   . ARG C 1 99  ? 10.731  -40.837 228.653 1.00 20.20  ? 99  ARG C C   1 
ATOM 6803 O O   . ARG C 1 99  ? 10.077  -40.809 227.610 1.00 19.46  ? 99  ARG C O   1 
ATOM 6804 C CB  . ARG C 1 99  ? 11.753  -38.768 229.618 1.00 20.58  ? 99  ARG C CB  1 
ATOM 6805 C CG  . ARG C 1 99  ? 12.933  -37.805 229.753 1.00 19.10  ? 99  ARG C CG  1 
ATOM 6806 C CD  . ARG C 1 99  ? 14.126  -38.481 230.394 1.00 18.49  ? 99  ARG C CD  1 
ATOM 6807 N NE  . ARG C 1 99  ? 13.849  -38.960 231.746 1.00 16.03  ? 99  ARG C NE  1 
ATOM 6808 C CZ  . ARG C 1 99  ? 13.933  -38.210 232.841 1.00 23.80  ? 99  ARG C CZ  1 
ATOM 6809 N NH1 . ARG C 1 99  ? 14.291  -36.933 232.769 1.00 17.94  ? 99  ARG C NH1 1 
ATOM 6810 N NH2 . ARG C 1 99  ? 13.652  -38.735 234.020 1.00 13.10  ? 99  ARG C NH2 1 
ATOM 6811 N N   . GLY C 1 100 ? 10.351  -41.527 229.722 1.00 20.97  ? 100 GLY C N   1 
ATOM 6812 C CA  . GLY C 1 100 ? 9.137   -42.329 229.709 1.00 18.97  ? 100 GLY C CA  1 
ATOM 6813 C C   . GLY C 1 100 ? 9.028   -43.036 231.035 1.00 19.85  ? 100 GLY C C   1 
ATOM 6814 O O   . GLY C 1 100 ? 9.765   -42.706 231.972 1.00 19.18  ? 100 GLY C O   1 
ATOM 6815 N N   . TRP C 1 101 ? 8.143   -44.022 231.132 1.00 18.81  ? 101 TRP C N   1 
ATOM 6816 C CA  . TRP C 1 101 ? 7.985   -44.759 232.386 1.00 18.04  ? 101 TRP C CA  1 
ATOM 6817 C C   . TRP C 1 101 ? 9.273   -45.460 232.824 1.00 19.15  ? 101 TRP C C   1 
ATOM 6818 O O   . TRP C 1 101 ? 9.527   -45.593 234.021 1.00 19.15  ? 101 TRP C O   1 
ATOM 6819 C CB  . TRP C 1 101 ? 6.884   -45.803 232.254 1.00 18.50  ? 101 TRP C CB  1 
ATOM 6820 C CG  . TRP C 1 101 ? 5.498   -45.250 232.175 1.00 21.63  ? 101 TRP C CG  1 
ATOM 6821 C CD1 . TRP C 1 101 ? 5.130   -43.940 232.059 1.00 19.18  ? 101 TRP C CD1 1 
ATOM 6822 C CD2 . TRP C 1 101 ? 4.290   -46.008 232.171 1.00 17.39  ? 101 TRP C CD2 1 
ATOM 6823 N NE1 . TRP C 1 101 ? 3.764   -43.839 231.975 1.00 17.46  ? 101 TRP C NE1 1 
ATOM 6824 C CE2 . TRP C 1 101 ? 3.221   -45.092 232.043 1.00 20.39  ? 101 TRP C CE2 1 
ATOM 6825 C CE3 . TRP C 1 101 ? 4.007   -47.381 232.253 1.00 17.30  ? 101 TRP C CE3 1 
ATOM 6826 C CZ2 . TRP C 1 101 ? 1.885   -45.502 231.997 1.00 20.68  ? 101 TRP C CZ2 1 
ATOM 6827 C CZ3 . TRP C 1 101 ? 2.682   -47.792 232.201 1.00 18.78  ? 101 TRP C CZ3 1 
ATOM 6828 C CH2 . TRP C 1 101 ? 1.634   -46.852 232.074 1.00 21.47  ? 101 TRP C CH2 1 
ATOM 6829 N N   . GLY C 1 102 ? 10.077  -45.890 231.853 1.00 18.83  ? 102 GLY C N   1 
ATOM 6830 C CA  . GLY C 1 102 ? 11.323  -46.585 232.139 1.00 17.92  ? 102 GLY C CA  1 
ATOM 6831 C C   . GLY C 1 102 ? 12.300  -45.788 232.976 1.00 20.01  ? 102 GLY C C   1 
ATOM 6832 O O   . GLY C 1 102 ? 13.121  -46.356 233.707 1.00 19.70  ? 102 GLY C O   1 
ATOM 6833 N N   . ASN C 1 103 ? 12.239  -44.468 232.870 1.00 20.46  ? 103 ASN C N   1 
ATOM 6834 C CA  . ASN C 1 103 ? 13.119  -43.623 233.663 1.00 22.41  ? 103 ASN C CA  1 
ATOM 6835 C C   . ASN C 1 103 ? 12.321  -42.668 234.553 1.00 25.30  ? 103 ASN C C   1 
ATOM 6836 O O   . ASN C 1 103 ? 12.714  -41.527 234.808 1.00 23.68  ? 103 ASN C O   1 
ATOM 6837 C CB  . ASN C 1 103 ? 14.145  -42.896 232.783 1.00 22.77  ? 103 ASN C CB  1 
ATOM 6838 C CG  . ASN C 1 103 ? 13.553  -42.415 231.498 1.00 20.84  ? 103 ASN C CG  1 
ATOM 6839 O OD1 . ASN C 1 103 ? 12.723  -41.521 231.498 1.00 23.09  ? 103 ASN C OD1 1 
ATOM 6840 N ND2 . ASN C 1 103 ? 13.933  -43.044 230.393 1.00 20.64  ? 103 ASN C ND2 1 
ATOM 6841 N N   . HIS C 1 104 ? 11.167  -43.154 234.994 1.00 24.58  ? 104 HIS C N   1 
ATOM 6842 C CA  . HIS C 1 104 ? 10.309  -42.442 235.925 1.00 24.45  ? 104 HIS C CA  1 
ATOM 6843 C C   . HIS C 1 104 ? 9.623   -41.139 235.575 1.00 23.49  ? 104 HIS C C   1 
ATOM 6844 O O   . HIS C 1 104 ? 9.569   -40.240 236.407 1.00 24.83  ? 104 HIS C O   1 
ATOM 6845 C CB  . HIS C 1 104 ? 11.026  -42.333 237.274 1.00 25.48  ? 104 HIS C CB  1 
ATOM 6846 C CG  . HIS C 1 104 ? 11.520  -43.654 237.758 1.00 28.70  ? 104 HIS C CG  1 
ATOM 6847 N ND1 . HIS C 1 104 ? 12.756  -44.154 237.408 1.00 31.88  ? 104 HIS C ND1 1 
ATOM 6848 C CD2 . HIS C 1 104 ? 10.886  -44.648 238.425 1.00 27.18  ? 104 HIS C CD2 1 
ATOM 6849 C CE1 . HIS C 1 104 ? 12.857  -45.405 237.822 1.00 29.49  ? 104 HIS C CE1 1 
ATOM 6850 N NE2 . HIS C 1 104 ? 11.734  -45.728 238.442 1.00 23.65  ? 104 HIS C NE2 1 
ATOM 6851 N N   . CYS C 1 105 ? 9.083   -41.044 234.366 1.00 21.19  ? 105 CYS C N   1 
ATOM 6852 C CA  . CYS C 1 105 ? 8.319   -39.874 233.959 1.00 21.64  ? 105 CYS C CA  1 
ATOM 6853 C C   . CYS C 1 105 ? 6.901   -40.366 233.653 1.00 24.14  ? 105 CYS C C   1 
ATOM 6854 O O   . CYS C 1 105 ? 6.718   -41.524 233.246 1.00 25.42  ? 105 CYS C O   1 
ATOM 6855 C CB  . CYS C 1 105 ? 8.921   -39.204 232.730 1.00 21.74  ? 105 CYS C CB  1 
ATOM 6856 S SG  . CYS C 1 105 ? 10.531  -38.441 233.078 1.00 21.87  ? 105 CYS C SG  1 
ATOM 6857 N N   . GLY C 1 106 ? 5.905   -39.511 233.874 1.00 23.41  ? 106 GLY C N   1 
ATOM 6858 C CA  . GLY C 1 106 ? 4.527   -39.900 233.615 1.00 22.45  ? 106 GLY C CA  1 
ATOM 6859 C C   . GLY C 1 106 ? 4.222   -40.062 232.137 1.00 23.49  ? 106 GLY C C   1 
ATOM 6860 O O   . GLY C 1 106 ? 3.407   -40.911 231.756 1.00 22.60  ? 106 GLY C O   1 
ATOM 6861 N N   . LEU C 1 107 ? 4.844   -39.217 231.312 1.00 23.09  ? 107 LEU C N   1 
ATOM 6862 C CA  . LEU C 1 107 ? 4.668   -39.250 229.860 1.00 21.59  ? 107 LEU C CA  1 
ATOM 6863 C C   . LEU C 1 107 ? 5.922   -39.747 229.160 1.00 22.99  ? 107 LEU C C   1 
ATOM 6864 O O   . LEU C 1 107 ? 7.011   -39.678 229.716 1.00 25.02  ? 107 LEU C O   1 
ATOM 6865 C CB  . LEU C 1 107 ? 4.388   -37.848 229.327 1.00 17.60  ? 107 LEU C CB  1 
ATOM 6866 C CG  . LEU C 1 107 ? 3.033   -37.246 229.653 1.00 27.17  ? 107 LEU C CG  1 
ATOM 6867 C CD1 . LEU C 1 107 ? 2.948   -35.830 229.114 1.00 31.04  ? 107 LEU C CD1 1 
ATOM 6868 C CD2 . LEU C 1 107 ? 1.963   -38.105 229.012 1.00 27.68  ? 107 LEU C CD2 1 
ATOM 6869 N N   . PHE C 1 108 ? 5.747   -40.252 227.943 1.00 23.16  ? 108 PHE C N   1 
ATOM 6870 C CA  . PHE C 1 108 ? 6.841   -40.717 227.093 1.00 23.83  ? 108 PHE C CA  1 
ATOM 6871 C C   . PHE C 1 108 ? 7.043   -39.557 226.116 1.00 26.27  ? 108 PHE C C   1 
ATOM 6872 O O   . PHE C 1 108 ? 6.121   -39.200 225.376 1.00 26.28  ? 108 PHE C O   1 
ATOM 6873 C CB  . PHE C 1 108 ? 6.440   -41.969 226.290 1.00 21.45  ? 108 PHE C CB  1 
ATOM 6874 C CG  . PHE C 1 108 ? 6.362   -43.225 227.111 1.00 23.95  ? 108 PHE C CG  1 
ATOM 6875 C CD1 . PHE C 1 108 ? 5.302   -43.440 227.985 1.00 23.00  ? 108 PHE C CD1 1 
ATOM 6876 C CD2 . PHE C 1 108 ? 7.355   -44.194 227.011 1.00 23.33  ? 108 PHE C CD2 1 
ATOM 6877 C CE1 . PHE C 1 108 ? 5.227   -44.597 228.748 1.00 25.54  ? 108 PHE C CE1 1 
ATOM 6878 C CE2 . PHE C 1 108 ? 7.291   -45.364 227.774 1.00 30.53  ? 108 PHE C CE2 1 
ATOM 6879 C CZ  . PHE C 1 108 ? 6.218   -45.564 228.647 1.00 24.22  ? 108 PHE C CZ  1 
ATOM 6880 N N   . GLY C 1 109 ? 8.211   -38.930 226.162 1.00 27.17  ? 109 GLY C N   1 
ATOM 6881 C CA  . GLY C 1 109 ? 8.497   -37.817 225.271 1.00 27.03  ? 109 GLY C CA  1 
ATOM 6882 C C   . GLY C 1 109 ? 9.867   -37.222 225.558 1.00 27.94  ? 109 GLY C C   1 
ATOM 6883 O O   . GLY C 1 109 ? 10.689  -37.823 226.261 1.00 27.13  ? 109 GLY C O   1 
ATOM 6884 N N   . LYS C 1 110 ? 10.105  -36.029 225.029 1.00 29.30  ? 110 LYS C N   1 
ATOM 6885 C CA  . LYS C 1 110 ? 11.367  -35.330 225.209 1.00 26.39  ? 110 LYS C CA  1 
ATOM 6886 C C   . LYS C 1 110 ? 11.388  -34.571 226.518 1.00 25.20  ? 110 LYS C C   1 
ATOM 6887 O O   . LYS C 1 110 ? 10.431  -33.870 226.860 1.00 27.48  ? 110 LYS C O   1 
ATOM 6888 C CB  . LYS C 1 110 ? 11.590  -34.356 224.055 1.00 26.62  ? 110 LYS C CB  1 
ATOM 6889 C CG  . LYS C 1 110 ? 11.741  -35.023 222.698 1.00 31.18  ? 110 LYS C CG  1 
ATOM 6890 C CD  . LYS C 1 110 ? 13.044  -35.807 222.601 1.00 37.72  ? 110 LYS C CD  1 
ATOM 6891 C CE  . LYS C 1 110 ? 13.206  -36.403 221.209 1.00 43.53  ? 110 LYS C CE  1 
ATOM 6892 N NZ  . LYS C 1 110 ? 14.510  -37.103 221.034 1.00 51.21  ? 110 LYS C NZ  1 
ATOM 6893 N N   . GLY C 1 111 ? 12.469  -34.740 227.262 1.00 23.94  ? 111 GLY C N   1 
ATOM 6894 C CA  . GLY C 1 111 ? 12.623  -34.051 228.530 1.00 24.11  ? 111 GLY C CA  1 
ATOM 6895 C C   . GLY C 1 111 ? 13.878  -33.196 228.482 1.00 26.44  ? 111 GLY C C   1 
ATOM 6896 O O   . GLY C 1 111 ? 14.861  -33.550 227.827 1.00 27.07  ? 111 GLY C O   1 
ATOM 6897 N N   . SER C 1 112 ? 13.838  -32.053 229.147 1.00 26.56  ? 112 SER C N   1 
ATOM 6898 C CA  . SER C 1 112 ? 14.973  -31.147 229.175 1.00 26.37  ? 112 SER C CA  1 
ATOM 6899 C C   . SER C 1 112 ? 16.128  -31.705 230.021 1.00 26.27  ? 112 SER C C   1 
ATOM 6900 O O   . SER C 1 112 ? 15.913  -32.260 231.110 1.00 26.00  ? 112 SER C O   1 
ATOM 6901 C CB  . SER C 1 112 ? 14.503  -29.787 229.717 1.00 29.06  ? 112 SER C CB  1 
ATOM 6902 O OG  . SER C 1 112 ? 15.571  -28.967 230.152 1.00 25.97  ? 112 SER C OG  1 
ATOM 6903 N N   . ILE C 1 113 ? 17.351  -31.552 229.516 1.00 26.31  ? 113 ILE C N   1 
ATOM 6904 C CA  . ILE C 1 113 ? 18.545  -31.999 230.233 1.00 23.64  ? 113 ILE C CA  1 
ATOM 6905 C C   . ILE C 1 113 ? 19.667  -30.967 230.021 1.00 24.47  ? 113 ILE C C   1 
ATOM 6906 O O   . ILE C 1 113 ? 19.762  -30.369 228.950 1.00 21.14  ? 113 ILE C O   1 
ATOM 6907 C CB  . ILE C 1 113 ? 18.993  -33.413 229.755 1.00 23.69  ? 113 ILE C CB  1 
ATOM 6908 C CG1 . ILE C 1 113 ? 20.164  -33.919 230.593 1.00 19.69  ? 113 ILE C CG1 1 
ATOM 6909 C CG2 . ILE C 1 113 ? 19.325  -33.407 228.266 1.00 20.15  ? 113 ILE C CG2 1 
ATOM 6910 C CD1 . ILE C 1 113 ? 20.443  -35.396 230.412 1.00 22.86  ? 113 ILE C CD1 1 
ATOM 6911 N N   . VAL C 1 114 ? 20.457  -30.712 231.059 1.00 23.06  ? 114 VAL C N   1 
ATOM 6912 C CA  . VAL C 1 114 ? 21.565  -29.769 230.967 1.00 26.37  ? 114 VAL C CA  1 
ATOM 6913 C C   . VAL C 1 114 ? 22.722  -30.337 231.780 1.00 25.69  ? 114 VAL C C   1 
ATOM 6914 O O   . VAL C 1 114 ? 22.514  -30.873 232.863 1.00 25.31  ? 114 VAL C O   1 
ATOM 6915 C CB  . VAL C 1 114 ? 21.188  -28.327 231.483 1.00 29.10  ? 114 VAL C CB  1 
ATOM 6916 C CG1 . VAL C 1 114 ? 20.742  -28.347 232.936 1.00 25.77  ? 114 VAL C CG1 1 
ATOM 6917 C CG2 . VAL C 1 114 ? 22.372  -27.399 231.339 1.00 29.00  ? 114 VAL C CG2 1 
ATOM 6918 N N   . ALA C 1 115 ? 23.926  -30.294 231.212 1.00 25.76  ? 115 ALA C N   1 
ATOM 6919 C CA  . ALA C 1 115 ? 25.127  -30.785 231.882 1.00 24.17  ? 115 ALA C CA  1 
ATOM 6920 C C   . ALA C 1 115 ? 26.178  -29.672 231.858 1.00 25.18  ? 115 ALA C C   1 
ATOM 6921 O O   . ALA C 1 115 ? 26.294  -28.951 230.862 1.00 23.01  ? 115 ALA C O   1 
ATOM 6922 C CB  . ALA C 1 115 ? 25.658  -32.023 231.177 1.00 20.66  ? 115 ALA C CB  1 
ATOM 6923 N N   . CYS C 1 116 ? 26.931  -29.538 232.951 1.00 25.37  ? 116 CYS C N   1 
ATOM 6924 C CA  . CYS C 1 116 ? 27.979  -28.520 233.071 1.00 24.63  ? 116 CYS C CA  1 
ATOM 6925 C C   . CYS C 1 116 ? 29.225  -29.091 233.716 1.00 25.79  ? 116 CYS C C   1 
ATOM 6926 O O   . CYS C 1 116 ? 29.124  -29.994 234.551 1.00 26.54  ? 116 CYS C O   1 
ATOM 6927 C CB  . CYS C 1 116 ? 27.539  -27.379 233.993 1.00 24.84  ? 116 CYS C CB  1 
ATOM 6928 S SG  . CYS C 1 116 ? 26.127  -26.382 233.447 1.00 26.53  ? 116 CYS C SG  1 
ATOM 6929 N N   . VAL C 1 117 ? 30.392  -28.565 233.334 1.00 25.41  ? 117 VAL C N   1 
ATOM 6930 C CA  . VAL C 1 117 ? 31.666  -28.951 233.952 1.00 23.09  ? 117 VAL C CA  1 
ATOM 6931 C C   . VAL C 1 117 ? 32.417  -27.675 234.241 1.00 22.01  ? 117 VAL C C   1 
ATOM 6932 O O   . VAL C 1 117 ? 32.246  -26.676 233.536 1.00 21.66  ? 117 VAL C O   1 
ATOM 6933 C CB  . VAL C 1 117 ? 32.632  -29.779 233.048 1.00 23.18  ? 117 VAL C CB  1 
ATOM 6934 C CG1 . VAL C 1 117 ? 32.455  -31.241 233.297 1.00 27.49  ? 117 VAL C CG1 1 
ATOM 6935 C CG2 . VAL C 1 117 ? 32.484  -29.410 231.574 1.00 16.70  ? 117 VAL C CG2 1 
ATOM 6936 N N   . LYS C 1 118 ? 33.219  -27.699 235.291 1.00 19.74  ? 118 LYS C N   1 
ATOM 6937 C CA  . LYS C 1 118 ? 34.056  -26.559 235.605 1.00 24.51  ? 118 LYS C CA  1 
ATOM 6938 C C   . LYS C 1 118 ? 35.279  -26.773 234.717 1.00 24.62  ? 118 LYS C C   1 
ATOM 6939 O O   . LYS C 1 118 ? 35.789  -27.890 234.614 1.00 23.36  ? 118 LYS C O   1 
ATOM 6940 C CB  . LYS C 1 118 ? 34.411  -26.536 237.093 1.00 29.34  ? 118 LYS C CB  1 
ATOM 6941 C CG  . LYS C 1 118 ? 33.348  -25.787 237.912 1.00 48.69  ? 118 LYS C CG  1 
ATOM 6942 C CD  . LYS C 1 118 ? 33.209  -26.293 239.337 1.00 60.91  ? 118 LYS C CD  1 
ATOM 6943 C CE  . LYS C 1 118 ? 34.508  -26.153 240.106 1.00 68.41  ? 118 LYS C CE  1 
ATOM 6944 N NZ  . LYS C 1 118 ? 34.345  -26.630 241.503 1.00 71.77  ? 118 LYS C NZ  1 
ATOM 6945 N N   . ALA C 1 119 ? 35.679  -25.726 234.007 1.00 23.43  ? 119 ALA C N   1 
ATOM 6946 C CA  . ALA C 1 119 ? 36.810  -25.805 233.095 1.00 24.34  ? 119 ALA C CA  1 
ATOM 6947 C C   . ALA C 1 119 ? 37.946  -24.895 233.534 1.00 25.58  ? 119 ALA C C   1 
ATOM 6948 O O   . ALA C 1 119 ? 37.759  -23.698 233.732 1.00 28.29  ? 119 ALA C O   1 
ATOM 6949 C CB  . ALA C 1 119 ? 36.360  -25.440 231.691 1.00 18.56  ? 119 ALA C CB  1 
ATOM 6950 N N   . ALA C 1 120 ? 39.114  -25.483 233.735 1.00 23.57  ? 120 ALA C N   1 
ATOM 6951 C CA  . ALA C 1 120 ? 40.300  -24.738 234.120 1.00 21.56  ? 120 ALA C CA  1 
ATOM 6952 C C   . ALA C 1 120 ? 41.415  -25.252 233.210 1.00 21.11  ? 120 ALA C C   1 
ATOM 6953 O O   . ALA C 1 120 ? 41.160  -26.006 232.256 1.00 20.77  ? 120 ALA C O   1 
ATOM 6954 C CB  . ALA C 1 120 ? 40.642  -24.997 235.583 1.00 19.84  ? 120 ALA C CB  1 
ATOM 6955 N N   . CYS C 1 121 ? 42.651  -24.879 233.509 1.00 18.11  ? 121 CYS C N   1 
ATOM 6956 C CA  . CYS C 1 121 ? 43.764  -25.320 232.685 1.00 17.75  ? 121 CYS C CA  1 
ATOM 6957 C C   . CYS C 1 121 ? 44.774  -26.088 233.521 1.00 15.29  ? 121 CYS C C   1 
ATOM 6958 O O   . CYS C 1 121 ? 45.011  -25.751 234.674 1.00 18.16  ? 121 CYS C O   1 
ATOM 6959 C CB  . CYS C 1 121 ? 44.431  -24.106 232.019 1.00 15.95  ? 121 CYS C CB  1 
ATOM 6960 S SG  . CYS C 1 121 ? 45.421  -24.511 230.548 1.00 15.99  ? 121 CYS C SG  1 
ATOM 6961 N N   . GLU C 1 122 ? 45.327  -27.156 232.958 1.00 16.64  ? 122 GLU C N   1 
ATOM 6962 C CA  . GLU C 1 122 ? 46.332  -27.947 233.649 1.00 16.95  ? 122 GLU C CA  1 
ATOM 6963 C C   . GLU C 1 122 ? 47.541  -27.073 233.950 1.00 18.85  ? 122 GLU C C   1 
ATOM 6964 O O   . GLU C 1 122 ? 47.865  -26.160 233.180 1.00 17.98  ? 122 GLU C O   1 
ATOM 6965 C CB  . GLU C 1 122 ? 46.769  -29.115 232.771 1.00 21.62  ? 122 GLU C CB  1 
ATOM 6966 C CG  . GLU C 1 122 ? 45.796  -30.266 232.767 1.00 29.62  ? 122 GLU C CG  1 
ATOM 6967 C CD  . GLU C 1 122 ? 45.724  -30.989 234.108 1.00 33.87  ? 122 GLU C CD  1 
ATOM 6968 O OE1 . GLU C 1 122 ? 46.622  -30.793 234.965 1.00 36.07  ? 122 GLU C OE1 1 
ATOM 6969 O OE2 . GLU C 1 122 ? 44.762  -31.762 234.293 1.00 31.62  ? 122 GLU C OE2 1 
ATOM 6970 N N   . ALA C 1 123 ? 48.201  -27.344 235.072 1.00 20.85  ? 123 ALA C N   1 
ATOM 6971 C CA  . ALA C 1 123 ? 49.386  -26.587 235.463 1.00 22.62  ? 123 ALA C CA  1 
ATOM 6972 C C   . ALA C 1 123 ? 50.427  -26.722 234.351 1.00 25.11  ? 123 ALA C C   1 
ATOM 6973 O O   . ALA C 1 123 ? 50.593  -27.807 233.778 1.00 26.84  ? 123 ALA C O   1 
ATOM 6974 C CB  . ALA C 1 123 ? 49.953  -27.129 236.766 1.00 19.60  ? 123 ALA C CB  1 
ATOM 6975 N N   . LYS C 1 124 ? 51.048  -25.604 233.990 1.00 22.68  ? 124 LYS C N   1 
ATOM 6976 C CA  . LYS C 1 124 ? 52.087  -25.586 232.974 1.00 21.82  ? 124 LYS C CA  1 
ATOM 6977 C C   . LYS C 1 124 ? 51.682  -25.990 231.566 1.00 19.10  ? 124 LYS C C   1 
ATOM 6978 O O   . LYS C 1 124 ? 52.526  -26.378 230.753 1.00 17.82  ? 124 LYS C O   1 
ATOM 6979 C CB  . LYS C 1 124 ? 53.296  -26.386 233.454 1.00 23.94  ? 124 LYS C CB  1 
ATOM 6980 C CG  . LYS C 1 124 ? 53.953  -25.737 234.656 1.00 34.39  ? 124 LYS C CG  1 
ATOM 6981 C CD  . LYS C 1 124 ? 55.197  -26.463 235.096 1.00 53.54  ? 124 LYS C CD  1 
ATOM 6982 C CE  . LYS C 1 124 ? 55.926  -25.654 236.154 1.00 62.63  ? 124 LYS C CE  1 
ATOM 6983 N NZ  . LYS C 1 124 ? 57.271  -26.228 236.435 1.00 69.19  ? 124 LYS C NZ  1 
ATOM 6984 N N   . LYS C 1 125 ? 50.401  -25.812 231.255 1.00 16.71  ? 125 LYS C N   1 
ATOM 6985 C CA  . LYS C 1 125 ? 49.883  -26.142 229.939 1.00 14.01  ? 125 LYS C CA  1 
ATOM 6986 C C   . LYS C 1 125 ? 49.323  -24.917 229.214 1.00 15.90  ? 125 LYS C C   1 
ATOM 6987 O O   . LYS C 1 125 ? 48.342  -25.006 228.449 1.00 14.72  ? 125 LYS C O   1 
ATOM 6988 C CB  . LYS C 1 125 ? 48.845  -27.266 230.046 1.00 15.96  ? 125 LYS C CB  1 
ATOM 6989 C CG  . LYS C 1 125 ? 49.456  -28.628 230.337 1.00 15.21  ? 125 LYS C CG  1 
ATOM 6990 C CD  . LYS C 1 125 ? 50.270  -29.072 229.135 1.00 20.06  ? 125 LYS C CD  1 
ATOM 6991 C CE  . LYS C 1 125 ? 51.206  -30.233 229.443 1.00 17.49  ? 125 LYS C CE  1 
ATOM 6992 N NZ  . LYS C 1 125 ? 51.936  -30.629 228.187 1.00 17.05  ? 125 LYS C NZ  1 
ATOM 6993 N N   . LYS C 1 126 ? 49.961  -23.768 229.432 1.00 15.12  ? 126 LYS C N   1 
ATOM 6994 C CA  . LYS C 1 126 ? 49.545  -22.535 228.770 1.00 15.27  ? 126 LYS C CA  1 
ATOM 6995 C C   . LYS C 1 126 ? 50.523  -22.195 227.654 1.00 15.79  ? 126 LYS C C   1 
ATOM 6996 O O   . LYS C 1 126 ? 51.667  -22.645 227.666 1.00 15.69  ? 126 LYS C O   1 
ATOM 6997 C CB  . LYS C 1 126 ? 49.571  -21.356 229.727 1.00 18.02  ? 126 LYS C CB  1 
ATOM 6998 C CG  . LYS C 1 126 ? 48.658  -21.405 230.914 1.00 21.07  ? 126 LYS C CG  1 
ATOM 6999 C CD  . LYS C 1 126 ? 48.741  -20.034 231.564 1.00 30.42  ? 126 LYS C CD  1 
ATOM 7000 C CE  . LYS C 1 126 ? 48.215  -20.002 232.963 1.00 35.51  ? 126 LYS C CE  1 
ATOM 7001 N NZ  . LYS C 1 126 ? 48.532  -18.676 233.560 1.00 37.82  ? 126 LYS C NZ  1 
ATOM 7002 N N   . ALA C 1 127 ? 50.047  -21.411 226.691 1.00 16.03  ? 127 ALA C N   1 
ATOM 7003 C CA  . ALA C 1 127 ? 50.851  -20.907 225.581 1.00 14.63  ? 127 ALA C CA  1 
ATOM 7004 C C   . ALA C 1 127 ? 50.606  -19.400 225.714 1.00 16.07  ? 127 ALA C C   1 
ATOM 7005 O O   . ALA C 1 127 ? 49.467  -18.953 225.560 1.00 14.48  ? 127 ALA C O   1 
ATOM 7006 C CB  . ALA C 1 127 ? 50.314  -21.407 224.254 1.00 14.70  ? 127 ALA C CB  1 
ATOM 7007 N N   . THR C 1 128 ? 51.635  -18.642 226.091 1.00 15.99  ? 128 THR C N   1 
ATOM 7008 C CA  . THR C 1 128 ? 51.489  -17.202 226.304 1.00 17.90  ? 128 THR C CA  1 
ATOM 7009 C C   . THR C 1 128 ? 52.218  -16.377 225.255 1.00 16.26  ? 128 THR C C   1 
ATOM 7010 O O   . THR C 1 128 ? 53.346  -16.695 224.905 1.00 17.63  ? 128 THR C O   1 
ATOM 7011 C CB  . THR C 1 128 ? 52.052  -16.802 227.680 1.00 16.40  ? 128 THR C CB  1 
ATOM 7012 O OG1 . THR C 1 128 ? 51.397  -17.560 228.702 1.00 23.58  ? 128 THR C OG1 1 
ATOM 7013 C CG2 . THR C 1 128 ? 51.807  -15.304 227.957 1.00 26.55  ? 128 THR C CG2 1 
ATOM 7014 N N   . GLY C 1 129 ? 51.570  -15.316 224.763 1.00 16.34  ? 129 GLY C N   1 
ATOM 7015 C CA  . GLY C 1 129 ? 52.205  -14.448 223.783 1.00 15.71  ? 129 GLY C CA  1 
ATOM 7016 C C   . GLY C 1 129 ? 52.710  -13.157 224.413 1.00 17.09  ? 129 GLY C C   1 
ATOM 7017 O O   . GLY C 1 129 ? 52.126  -12.664 225.387 1.00 20.14  ? 129 GLY C O   1 
ATOM 7018 N N   . HIS C 1 130 ? 53.820  -12.633 223.897 1.00 18.00  ? 130 HIS C N   1 
ATOM 7019 C CA  . HIS C 1 130 ? 54.422  -11.387 224.395 1.00 14.77  ? 130 HIS C CA  1 
ATOM 7020 C C   . HIS C 1 130 ? 54.718  -10.471 223.215 1.00 15.52  ? 130 HIS C C   1 
ATOM 7021 O O   . HIS C 1 130 ? 55.070  -10.951 222.130 1.00 15.65  ? 130 HIS C O   1 
ATOM 7022 C CB  . HIS C 1 130 ? 55.732  -11.678 225.115 1.00 15.93  ? 130 HIS C CB  1 
ATOM 7023 C CG  . HIS C 1 130 ? 55.607  -12.689 226.210 1.00 18.17  ? 130 HIS C CG  1 
ATOM 7024 N ND1 . HIS C 1 130 ? 55.527  -12.340 227.542 1.00 25.44  ? 130 HIS C ND1 1 
ATOM 7025 C CD2 . HIS C 1 130 ? 55.531  -14.041 226.168 1.00 13.17  ? 130 HIS C CD2 1 
ATOM 7026 C CE1 . HIS C 1 130 ? 55.403  -13.433 228.272 1.00 20.82  ? 130 HIS C CE1 1 
ATOM 7027 N NE2 . HIS C 1 130 ? 55.402  -14.477 227.462 1.00 22.14  ? 130 HIS C NE2 1 
ATOM 7028 N N   . VAL C 1 131 ? 54.579  -9.162  223.421 1.00 15.94  ? 131 VAL C N   1 
ATOM 7029 C CA  . VAL C 1 131 ? 54.839  -8.188  222.361 1.00 17.04  ? 131 VAL C CA  1 
ATOM 7030 C C   . VAL C 1 131 ? 55.911  -7.202  222.790 1.00 17.05  ? 131 VAL C C   1 
ATOM 7031 O O   . VAL C 1 131 ? 55.982  -6.808  223.957 1.00 17.32  ? 131 VAL C O   1 
ATOM 7032 C CB  . VAL C 1 131 ? 53.579  -7.396  221.953 1.00 19.48  ? 131 VAL C CB  1 
ATOM 7033 C CG1 . VAL C 1 131 ? 52.587  -8.313  221.294 1.00 23.88  ? 131 VAL C CG1 1 
ATOM 7034 C CG2 . VAL C 1 131 ? 52.962  -6.701  223.171 1.00 17.10  ? 131 VAL C CG2 1 
ATOM 7035 N N   . TYR C 1 132 ? 56.727  -6.788  221.828 1.00 15.41  ? 132 TYR C N   1 
ATOM 7036 C CA  . TYR C 1 132 ? 57.815  -5.866  222.093 1.00 13.93  ? 132 TYR C CA  1 
ATOM 7037 C C   . TYR C 1 132 ? 57.375  -4.415  221.982 1.00 16.98  ? 132 TYR C C   1 
ATOM 7038 O O   . TYR C 1 132 ? 56.394  -4.091  221.304 1.00 17.99  ? 132 TYR C O   1 
ATOM 7039 C CB  . TYR C 1 132 ? 58.944  -6.100  221.087 1.00 10.25  ? 132 TYR C CB  1 
ATOM 7040 C CG  . TYR C 1 132 ? 59.765  -7.350  221.312 1.00 14.81  ? 132 TYR C CG  1 
ATOM 7041 C CD1 . TYR C 1 132 ? 60.631  -7.447  222.400 1.00 16.07  ? 132 TYR C CD1 1 
ATOM 7042 C CD2 . TYR C 1 132 ? 59.717  -8.421  220.406 1.00 9.49   ? 132 TYR C CD2 1 
ATOM 7043 C CE1 . TYR C 1 132 ? 61.434  -8.580  222.582 1.00 16.11  ? 132 TYR C CE1 1 
ATOM 7044 C CE2 . TYR C 1 132 ? 60.517  -9.552  220.578 1.00 13.66  ? 132 TYR C CE2 1 
ATOM 7045 C CZ  . TYR C 1 132 ? 61.373  -9.624  221.671 1.00 18.73  ? 132 TYR C CZ  1 
ATOM 7046 O OH  . TYR C 1 132 ? 62.172  -10.735 221.862 1.00 19.60  ? 132 TYR C OH  1 
ATOM 7047 N N   . ASP C 1 133 ? 58.091  -3.560  222.692 1.00 14.09  ? 133 ASP C N   1 
ATOM 7048 C CA  . ASP C 1 133 ? 57.873  -2.138  222.653 1.00 14.10  ? 133 ASP C CA  1 
ATOM 7049 C C   . ASP C 1 133 ? 59.224  -1.645  222.084 1.00 15.75  ? 133 ASP C C   1 
ATOM 7050 O O   . ASP C 1 133 ? 60.262  -1.806  222.726 1.00 15.80  ? 133 ASP C O   1 
ATOM 7051 C CB  . ASP C 1 133 ? 57.653  -1.615  224.068 1.00 13.10  ? 133 ASP C CB  1 
ATOM 7052 C CG  . ASP C 1 133 ? 57.451  -0.106  224.120 1.00 25.95  ? 133 ASP C CG  1 
ATOM 7053 O OD1 . ASP C 1 133 ? 57.913  0.615   223.216 1.00 21.15  ? 133 ASP C OD1 1 
ATOM 7054 O OD2 . ASP C 1 133 ? 56.844  0.378   225.088 1.00 25.20  ? 133 ASP C OD2 1 
ATOM 7055 N N   . ALA C 1 134 ? 59.207  -1.071  220.883 1.00 16.07  ? 134 ALA C N   1 
ATOM 7056 C CA  . ALA C 1 134 ? 60.420  -0.578  220.218 1.00 18.96  ? 134 ALA C CA  1 
ATOM 7057 C C   . ALA C 1 134 ? 61.209  0.380   221.087 1.00 19.82  ? 134 ALA C C   1 
ATOM 7058 O O   . ALA C 1 134 ? 62.411  0.512   220.945 1.00 21.37  ? 134 ALA C O   1 
ATOM 7059 C CB  . ALA C 1 134 ? 60.066  0.092   218.910 1.00 19.66  ? 134 ALA C CB  1 
ATOM 7060 N N   . ASN C 1 135 ? 60.525  1.032   222.009 1.00 20.54  ? 135 ASN C N   1 
ATOM 7061 C CA  . ASN C 1 135 ? 61.176  1.957   222.905 1.00 20.57  ? 135 ASN C CA  1 
ATOM 7062 C C   . ASN C 1 135 ? 61.839  1.329   224.105 1.00 21.18  ? 135 ASN C C   1 
ATOM 7063 O O   . ASN C 1 135 ? 62.583  1.999   224.822 1.00 23.67  ? 135 ASN C O   1 
ATOM 7064 C CB  . ASN C 1 135 ? 60.197  3.023   223.358 1.00 25.88  ? 135 ASN C CB  1 
ATOM 7065 C CG  . ASN C 1 135 ? 60.090  4.132   222.349 1.00 36.92  ? 135 ASN C CG  1 
ATOM 7066 O OD1 . ASN C 1 135 ? 60.914  5.055   222.343 1.00 48.07  ? 135 ASN C OD1 1 
ATOM 7067 N ND2 . ASN C 1 135 ? 59.121  4.021   221.440 1.00 33.03  ? 135 ASN C ND2 1 
ATOM 7068 N N   . LYS C 1 136 ? 61.622  0.041   224.313 1.00 18.28  ? 136 LYS C N   1 
ATOM 7069 C CA  . LYS C 1 136 ? 62.218  -0.634  225.449 1.00 17.31  ? 136 LYS C CA  1 
ATOM 7070 C C   . LYS C 1 136 ? 63.172  -1.754  225.044 1.00 17.70  ? 136 LYS C C   1 
ATOM 7071 O O   . LYS C 1 136 ? 63.860  -2.326  225.896 1.00 16.49  ? 136 LYS C O   1 
ATOM 7072 C CB  . LYS C 1 136 ? 61.118  -1.177  226.354 1.00 17.06  ? 136 LYS C CB  1 
ATOM 7073 C CG  . LYS C 1 136 ? 60.355  -0.082  227.029 1.00 23.24  ? 136 LYS C CG  1 
ATOM 7074 C CD  . LYS C 1 136 ? 59.254  -0.637  227.867 1.00 32.12  ? 136 LYS C CD  1 
ATOM 7075 C CE  . LYS C 1 136 ? 58.507  0.467   228.583 1.00 38.61  ? 136 LYS C CE  1 
ATOM 7076 N NZ  . LYS C 1 136 ? 57.377  -0.104  229.376 1.00 44.17  ? 136 LYS C NZ  1 
ATOM 7077 N N   . ILE C 1 137 ? 63.216  -2.060  223.751 1.00 15.27  ? 137 ILE C N   1 
ATOM 7078 C CA  . ILE C 1 137 ? 64.069  -3.127  223.264 1.00 17.36  ? 137 ILE C CA  1 
ATOM 7079 C C   . ILE C 1 137 ? 65.552  -2.697  223.355 1.00 18.68  ? 137 ILE C C   1 
ATOM 7080 O O   . ILE C 1 137 ? 65.875  -1.533  223.149 1.00 20.44  ? 137 ILE C O   1 
ATOM 7081 C CB  . ILE C 1 137 ? 63.635  -3.553  221.846 1.00 16.43  ? 137 ILE C CB  1 
ATOM 7082 C CG1 . ILE C 1 137 ? 64.236  -4.905  221.508 1.00 21.99  ? 137 ILE C CG1 1 
ATOM 7083 C CG2 . ILE C 1 137 ? 64.068  -2.523  220.805 1.00 18.74  ? 137 ILE C CG2 1 
ATOM 7084 C CD1 . ILE C 1 137 ? 63.499  -5.608  220.424 1.00 22.05  ? 137 ILE C CD1 1 
ATOM 7085 N N   . VAL C 1 138 ? 66.433  -3.623  223.719 1.00 17.18  ? 138 VAL C N   1 
ATOM 7086 C CA  . VAL C 1 138 ? 67.856  -3.339  223.894 1.00 16.08  ? 138 VAL C CA  1 
ATOM 7087 C C   . VAL C 1 138 ? 68.696  -4.141  222.906 1.00 16.49  ? 138 VAL C C   1 
ATOM 7088 O O   . VAL C 1 138 ? 68.439  -5.330  222.696 1.00 16.10  ? 138 VAL C O   1 
ATOM 7089 C CB  . VAL C 1 138 ? 68.310  -3.750  225.318 1.00 15.91  ? 138 VAL C CB  1 
ATOM 7090 C CG1 . VAL C 1 138 ? 69.794  -3.489  225.518 1.00 16.55  ? 138 VAL C CG1 1 
ATOM 7091 C CG2 . VAL C 1 138 ? 67.521  -3.021  226.348 1.00 12.64  ? 138 VAL C CG2 1 
ATOM 7092 N N   . TYR C 1 139 ? 69.675  -3.480  222.291 1.00 16.30  ? 139 TYR C N   1 
ATOM 7093 C CA  . TYR C 1 139 ? 70.608  -4.112  221.355 1.00 13.72  ? 139 TYR C CA  1 
ATOM 7094 C C   . TYR C 1 139 ? 71.979  -4.027  222.016 1.00 16.15  ? 139 TYR C C   1 
ATOM 7095 O O   . TYR C 1 139 ? 72.430  -2.937  222.375 1.00 17.93  ? 139 TYR C O   1 
ATOM 7096 C CB  . TYR C 1 139 ? 70.675  -3.347  220.039 1.00 13.55  ? 139 TYR C CB  1 
ATOM 7097 C CG  . TYR C 1 139 ? 69.533  -3.623  219.088 1.00 21.44  ? 139 TYR C CG  1 
ATOM 7098 C CD1 . TYR C 1 139 ? 68.221  -3.256  219.405 1.00 20.04  ? 139 TYR C CD1 1 
ATOM 7099 C CD2 . TYR C 1 139 ? 69.768  -4.231  217.857 1.00 19.83  ? 139 TYR C CD2 1 
ATOM 7100 C CE1 . TYR C 1 139 ? 67.168  -3.492  218.507 1.00 19.90  ? 139 TYR C CE1 1 
ATOM 7101 C CE2 . TYR C 1 139 ? 68.731  -4.464  216.955 1.00 24.14  ? 139 TYR C CE2 1 
ATOM 7102 C CZ  . TYR C 1 139 ? 67.434  -4.095  217.281 1.00 22.13  ? 139 TYR C CZ  1 
ATOM 7103 O OH  . TYR C 1 139 ? 66.414  -4.340  216.382 1.00 25.33  ? 139 TYR C OH  1 
ATOM 7104 N N   . THR C 1 140 ? 72.628  -5.168  222.186 1.00 15.49  ? 140 THR C N   1 
ATOM 7105 C CA  . THR C 1 140 ? 73.946  -5.231  222.817 1.00 15.76  ? 140 THR C CA  1 
ATOM 7106 C C   . THR C 1 140 ? 75.020  -5.509  221.773 1.00 16.89  ? 140 THR C C   1 
ATOM 7107 O O   . THR C 1 140 ? 74.917  -6.460  220.984 1.00 16.97  ? 140 THR C O   1 
ATOM 7108 C CB  . THR C 1 140 ? 73.975  -6.313  223.903 1.00 14.36  ? 140 THR C CB  1 
ATOM 7109 O OG1 . THR C 1 140 ? 73.026  -5.962  224.921 1.00 18.67  ? 140 THR C OG1 1 
ATOM 7110 C CG2 . THR C 1 140 ? 75.359  -6.429  224.523 1.00 17.39  ? 140 THR C CG2 1 
ATOM 7111 N N   . VAL C 1 141 ? 76.032  -4.650  221.752 1.00 17.49  ? 141 VAL C N   1 
ATOM 7112 C CA  . VAL C 1 141 ? 77.152  -4.754  220.810 1.00 18.20  ? 141 VAL C CA  1 
ATOM 7113 C C   . VAL C 1 141 ? 78.480  -4.937  221.563 1.00 19.58  ? 141 VAL C C   1 
ATOM 7114 O O   . VAL C 1 141 ? 78.716  -4.304  222.604 1.00 16.84  ? 141 VAL C O   1 
ATOM 7115 C CB  . VAL C 1 141 ? 77.222  -3.509  219.904 1.00 16.70  ? 141 VAL C CB  1 
ATOM 7116 C CG1 . VAL C 1 141 ? 78.428  -3.566  219.001 1.00 16.62  ? 141 VAL C CG1 1 
ATOM 7117 C CG2 . VAL C 1 141 ? 75.946  -3.409  219.073 1.00 12.04  ? 141 VAL C CG2 1 
ATOM 7118 N N   . LYS C 1 142 ? 79.290  -5.890  221.100 1.00 17.58  ? 142 LYS C N   1 
ATOM 7119 C CA  . LYS C 1 142 ? 80.581  -6.149  221.732 1.00 17.37  ? 142 LYS C CA  1 
ATOM 7120 C C   . LYS C 1 142 ? 81.733  -5.760  220.814 1.00 16.10  ? 142 LYS C C   1 
ATOM 7121 O O   . LYS C 1 142 ? 81.619  -5.834  219.587 1.00 18.66  ? 142 LYS C O   1 
ATOM 7122 C CB  . LYS C 1 142 ? 80.691  -7.597  222.219 1.00 15.62  ? 142 LYS C CB  1 
ATOM 7123 C CG  . LYS C 1 142 ? 79.796  -7.860  223.416 1.00 15.90  ? 142 LYS C CG  1 
ATOM 7124 C CD  . LYS C 1 142 ? 79.982  -9.242  223.924 1.00 27.32  ? 142 LYS C CD  1 
ATOM 7125 C CE  . LYS C 1 142 ? 78.937  -9.606  224.965 1.00 28.82  ? 142 LYS C CE  1 
ATOM 7126 N NZ  . LYS C 1 142 ? 79.175  -8.995  226.277 1.00 41.23  ? 142 LYS C NZ  1 
ATOM 7127 N N   . VAL C 1 143 ? 82.799  -5.251  221.424 1.00 17.35  ? 143 VAL C N   1 
ATOM 7128 C CA  . VAL C 1 143 ? 83.996  -4.809  220.709 1.00 17.23  ? 143 VAL C CA  1 
ATOM 7129 C C   . VAL C 1 143 ? 85.204  -5.438  221.393 1.00 18.08  ? 143 VAL C C   1 
ATOM 7130 O O   . VAL C 1 143 ? 85.277  -5.486  222.627 1.00 17.54  ? 143 VAL C O   1 
ATOM 7131 C CB  . VAL C 1 143 ? 84.146  -3.276  220.746 1.00 21.94  ? 143 VAL C CB  1 
ATOM 7132 C CG1 . VAL C 1 143 ? 85.347  -2.846  219.936 1.00 21.22  ? 143 VAL C CG1 1 
ATOM 7133 C CG2 . VAL C 1 143 ? 82.892  -2.615  220.198 1.00 17.36  ? 143 VAL C CG2 1 
ATOM 7134 N N   . GLU C 1 144 ? 86.150  -5.911  220.590 1.00 17.52  ? 144 GLU C N   1 
ATOM 7135 C CA  . GLU C 1 144 ? 87.350  -6.564  221.100 1.00 18.56  ? 144 GLU C CA  1 
ATOM 7136 C C   . GLU C 1 144 ? 88.538  -6.130  220.249 1.00 19.76  ? 144 GLU C C   1 
ATOM 7137 O O   . GLU C 1 144 ? 88.501  -6.209  219.014 1.00 18.41  ? 144 GLU C O   1 
ATOM 7138 C CB  . GLU C 1 144 ? 87.162  -8.068  220.991 1.00 21.15  ? 144 GLU C CB  1 
ATOM 7139 C CG  . GLU C 1 144 ? 88.293  -8.875  221.488 1.00 24.11  ? 144 GLU C CG  1 
ATOM 7140 C CD  . GLU C 1 144 ? 88.017  -10.337 221.353 1.00 29.75  ? 144 GLU C CD  1 
ATOM 7141 O OE1 . GLU C 1 144 ? 87.122  -10.839 222.065 1.00 23.68  ? 144 GLU C OE1 1 
ATOM 7142 O OE2 . GLU C 1 144 ? 88.693  -10.989 220.534 1.00 21.30  ? 144 GLU C OE2 1 
ATOM 7143 N N   . PRO C 1 145 ? 89.598  -5.621  220.889 1.00 21.42  ? 145 PRO C N   1 
ATOM 7144 C CA  . PRO C 1 145 ? 90.752  -5.196  220.097 1.00 22.62  ? 145 PRO C CA  1 
ATOM 7145 C C   . PRO C 1 145 ? 91.640  -6.399  219.728 1.00 22.71  ? 145 PRO C C   1 
ATOM 7146 O O   . PRO C 1 145 ? 91.603  -7.426  220.426 1.00 19.92  ? 145 PRO C O   1 
ATOM 7147 C CB  . PRO C 1 145 ? 91.467  -4.245  221.059 1.00 21.12  ? 145 PRO C CB  1 
ATOM 7148 C CG  . PRO C 1 145 ? 91.249  -4.900  222.386 1.00 22.35  ? 145 PRO C CG  1 
ATOM 7149 C CD  . PRO C 1 145 ? 89.803  -5.349  222.327 1.00 22.32  ? 145 PRO C CD  1 
ATOM 7150 N N   . HIS C 1 146 ? 92.367  -6.302  218.610 1.00 21.28  ? 146 HIS C N   1 
ATOM 7151 C CA  . HIS C 1 146 ? 93.307  -7.360  218.193 1.00 24.01  ? 146 HIS C CA  1 
ATOM 7152 C C   . HIS C 1 146 ? 94.596  -7.108  218.976 1.00 22.14  ? 146 HIS C C   1 
ATOM 7153 O O   . HIS C 1 146 ? 95.364  -6.198  218.657 1.00 24.74  ? 146 HIS C O   1 
ATOM 7154 C CB  . HIS C 1 146 ? 93.606  -7.282  216.695 1.00 21.53  ? 146 HIS C CB  1 
ATOM 7155 C CG  . HIS C 1 146 ? 92.512  -7.822  215.833 1.00 27.17  ? 146 HIS C CG  1 
ATOM 7156 N ND1 . HIS C 1 146 ? 92.757  -8.610  214.729 1.00 27.10  ? 146 HIS C ND1 1 
ATOM 7157 C CD2 . HIS C 1 146 ? 91.170  -7.675  215.900 1.00 23.07  ? 146 HIS C CD2 1 
ATOM 7158 C CE1 . HIS C 1 146 ? 91.613  -8.925  214.151 1.00 25.40  ? 146 HIS C CE1 1 
ATOM 7159 N NE2 . HIS C 1 146 ? 90.634  -8.370  214.841 1.00 24.35  ? 146 HIS C NE2 1 
ATOM 7160 N N   . THR C 1 147 ? 94.830  -7.903  220.006 1.00 21.19  ? 147 THR C N   1 
ATOM 7161 C CA  . THR C 1 147 ? 95.996  -7.709  220.846 1.00 22.67  ? 147 THR C CA  1 
ATOM 7162 C C   . THR C 1 147 ? 97.146  -8.691  220.599 1.00 24.68  ? 147 THR C C   1 
ATOM 7163 O O   . THR C 1 147 ? 98.127  -8.695  221.346 1.00 25.91  ? 147 THR C O   1 
ATOM 7164 C CB  . THR C 1 147 ? 95.587  -7.840  222.308 1.00 25.52  ? 147 THR C CB  1 
ATOM 7165 O OG1 . THR C 1 147 ? 95.057  -9.154  222.524 1.00 19.00  ? 147 THR C OG1 1 
ATOM 7166 C CG2 . THR C 1 147 ? 94.518  -6.810  222.662 1.00 24.73  ? 147 THR C CG2 1 
ATOM 7167 N N   . GLY C 1 148 ? 97.037  -9.522  219.564 1.00 22.34  ? 148 GLY C N   1 
ATOM 7168 C CA  . GLY C 1 148 ? 98.082  -10.497 219.309 1.00 19.96  ? 148 GLY C CA  1 
ATOM 7169 C C   . GLY C 1 148 ? 97.993  -11.653 220.297 1.00 22.34  ? 148 GLY C C   1 
ATOM 7170 O O   . GLY C 1 148 ? 98.957  -12.410 220.465 1.00 20.14  ? 148 GLY C O   1 
ATOM 7171 N N   . ASP C 1 149 ? 96.865  -11.770 221.002 1.00 20.90  ? 149 ASP C N   1 
ATOM 7172 C CA  . ASP C 1 149 ? 96.680  -12.886 221.946 1.00 22.67  ? 149 ASP C CA  1 
ATOM 7173 C C   . ASP C 1 149 ? 95.504  -13.702 221.457 1.00 20.20  ? 149 ASP C C   1 
ATOM 7174 O O   . ASP C 1 149 ? 94.442  -13.148 221.180 1.00 20.11  ? 149 ASP C O   1 
ATOM 7175 C CB  . ASP C 1 149 ? 96.332  -12.409 223.355 1.00 24.02  ? 149 ASP C CB  1 
ATOM 7176 C CG  . ASP C 1 149 ? 97.410  -11.572 223.972 1.00 31.30  ? 149 ASP C CG  1 
ATOM 7177 O OD1 . ASP C 1 149 ? 98.462  -12.141 224.317 1.00 28.78  ? 149 ASP C OD1 1 
ATOM 7178 O OD2 . ASP C 1 149 ? 97.196  -10.348 224.117 1.00 35.20  ? 149 ASP C OD2 1 
ATOM 7179 N N   . TYR C 1 150 ? 95.688  -15.008 221.350 1.00 18.43  ? 150 TYR C N   1 
ATOM 7180 C CA  . TYR C 1 150 ? 94.605  -15.858 220.921 1.00 17.39  ? 150 TYR C CA  1 
ATOM 7181 C C   . TYR C 1 150 ? 93.869  -16.406 222.145 1.00 20.16  ? 150 TYR C C   1 
ATOM 7182 O O   . TYR C 1 150 ? 94.474  -16.948 223.083 1.00 20.22  ? 150 TYR C O   1 
ATOM 7183 C CB  . TYR C 1 150 ? 95.100  -16.994 220.026 1.00 16.73  ? 150 TYR C CB  1 
ATOM 7184 C CG  . TYR C 1 150 ? 93.932  -17.768 219.466 1.00 19.62  ? 150 TYR C CG  1 
ATOM 7185 C CD1 . TYR C 1 150 ? 93.232  -17.290 218.354 1.00 17.46  ? 150 TYR C CD1 1 
ATOM 7186 C CD2 . TYR C 1 150 ? 93.424  -18.885 220.143 1.00 17.08  ? 150 TYR C CD2 1 
ATOM 7187 C CE1 . TYR C 1 150 ? 92.050  -17.887 217.947 1.00 25.17  ? 150 TYR C CE1 1 
ATOM 7188 C CE2 . TYR C 1 150 ? 92.244  -19.490 219.742 1.00 19.00  ? 150 TYR C CE2 1 
ATOM 7189 C CZ  . TYR C 1 150 ? 91.559  -18.981 218.658 1.00 24.61  ? 150 TYR C CZ  1 
ATOM 7190 O OH  . TYR C 1 150 ? 90.342  -19.517 218.348 1.00 33.00  ? 150 TYR C OH  1 
ATOM 7191 N N   . VAL C 1 151 ? 92.552  -16.266 222.110 1.00 19.08  ? 151 VAL C N   1 
ATOM 7192 C CA  . VAL C 1 151 ? 91.669  -16.705 223.179 1.00 20.29  ? 151 VAL C CA  1 
ATOM 7193 C C   . VAL C 1 151 ? 90.584  -17.601 222.571 1.00 19.98  ? 151 VAL C C   1 
ATOM 7194 O O   . VAL C 1 151 ? 89.969  -17.253 221.561 1.00 20.00  ? 151 VAL C O   1 
ATOM 7195 C CB  . VAL C 1 151 ? 91.016  -15.474 223.862 1.00 24.39  ? 151 VAL C CB  1 
ATOM 7196 C CG1 . VAL C 1 151 ? 89.958  -15.900 224.874 1.00 24.13  ? 151 VAL C CG1 1 
ATOM 7197 C CG2 . VAL C 1 151 ? 92.095  -14.641 224.550 1.00 23.62  ? 151 VAL C CG2 1 
ATOM 7198 N N   . ALA C 1 152 ? 90.387  -18.774 223.159 1.00 17.47  ? 152 ALA C N   1 
ATOM 7199 C CA  . ALA C 1 152 ? 89.385  -19.712 222.681 1.00 20.48  ? 152 ALA C CA  1 
ATOM 7200 C C   . ALA C 1 152 ? 87.984  -19.210 223.040 1.00 23.33  ? 152 ALA C C   1 
ATOM 7201 O O   . ALA C 1 152 ? 87.832  -18.302 223.868 1.00 23.61  ? 152 ALA C O   1 
ATOM 7202 C CB  . ALA C 1 152 ? 89.634  -21.090 223.280 1.00 18.76  ? 152 ALA C CB  1 
ATOM 7203 N N   . ALA C 1 153 ? 86.973  -19.806 222.412 1.00 23.26  ? 153 ALA C N   1 
ATOM 7204 C CA  . ALA C 1 153 ? 85.582  -19.426 222.620 1.00 25.58  ? 153 ALA C CA  1 
ATOM 7205 C C   . ALA C 1 153 ? 85.086  -19.572 224.073 1.00 28.16  ? 153 ALA C C   1 
ATOM 7206 O O   . ALA C 1 153 ? 84.273  -18.769 224.530 1.00 29.90  ? 153 ALA C O   1 
ATOM 7207 C CB  . ALA C 1 153 ? 84.667  -20.190 221.633 1.00 21.57  ? 153 ALA C CB  1 
ATOM 7208 N N   . ASN C 1 154 ? 85.579  -20.572 224.802 1.00 29.37  ? 154 ASN C N   1 
ATOM 7209 C CA  . ASN C 1 154 ? 85.156  -20.756 226.185 1.00 31.21  ? 154 ASN C CA  1 
ATOM 7210 C C   . ASN C 1 154 ? 85.959  -19.883 227.131 1.00 34.97  ? 154 ASN C C   1 
ATOM 7211 O O   . ASN C 1 154 ? 85.760  -19.945 228.334 1.00 37.66  ? 154 ASN C O   1 
ATOM 7212 C CB  . ASN C 1 154 ? 85.218  -22.242 226.621 1.00 29.85  ? 154 ASN C CB  1 
ATOM 7213 C CG  . ASN C 1 154 ? 86.642  -22.750 226.877 1.00 32.26  ? 154 ASN C CG  1 
ATOM 7214 O OD1 . ASN C 1 154 ? 87.585  -22.297 226.231 1.00 37.58  ? 154 ASN C OD1 1 
ATOM 7215 N ND2 . ASN C 1 154 ? 86.785  -23.712 227.800 1.00 33.05  ? 154 ASN C ND2 1 
ATOM 7216 N N   . GLU C 1 155 ? 86.857  -19.057 226.596 1.00 38.12  ? 155 GLU C N   1 
ATOM 7217 C CA  . GLU C 1 155 ? 87.688  -18.187 227.429 1.00 39.45  ? 155 GLU C CA  1 
ATOM 7218 C C   . GLU C 1 155 ? 87.261  -16.731 227.255 1.00 40.50  ? 155 GLU C C   1 
ATOM 7219 O O   . GLU C 1 155 ? 86.603  -16.374 226.276 1.00 40.13  ? 155 GLU C O   1 
ATOM 7220 C CB  . GLU C 1 155 ? 89.171  -18.369 227.078 1.00 45.12  ? 155 GLU C CB  1 
ATOM 7221 C CG  . GLU C 1 155 ? 89.752  -19.761 227.413 1.00 50.77  ? 155 GLU C CG  1 
ATOM 7222 C CD  . GLU C 1 155 ? 91.058  -20.116 226.641 1.00 58.94  ? 155 GLU C CD  1 
ATOM 7223 O OE1 . GLU C 1 155 ? 91.717  -19.215 226.056 1.00 50.42  ? 155 GLU C OE1 1 
ATOM 7224 O OE2 . GLU C 1 155 ? 91.422  -21.323 226.614 1.00 58.12  ? 155 GLU C OE2 1 
ATOM 7225 N N   . THR C 1 156 ? 87.636  -15.888 228.207 1.00 42.33  ? 156 THR C N   1 
ATOM 7226 C CA  . THR C 1 156 ? 87.264  -14.470 228.157 1.00 44.00  ? 156 THR C CA  1 
ATOM 7227 C C   . THR C 1 156 ? 88.441  -13.544 227.848 1.00 38.73  ? 156 THR C C   1 
ATOM 7228 O O   . THR C 1 156 ? 89.489  -13.610 228.504 1.00 39.77  ? 156 THR C O   1 
ATOM 7229 C CB  . THR C 1 156 ? 86.560  -14.018 229.479 1.00 54.34  ? 156 THR C CB  1 
ATOM 7230 O OG1 . THR C 1 156 ? 87.344  -14.431 230.617 1.00 55.41  ? 156 THR C OG1 1 
ATOM 7231 C CG2 . THR C 1 156 ? 85.136  -14.614 229.565 1.00 52.70  ? 156 THR C CG2 1 
ATOM 7232 N N   . HIS C 1 157 ? 88.286  -12.740 226.798 1.00 35.05  ? 157 HIS C N   1 
ATOM 7233 C CA  . HIS C 1 157 ? 89.328  -11.799 226.379 1.00 32.42  ? 157 HIS C CA  1 
ATOM 7234 C C   . HIS C 1 157 ? 89.243  -10.565 227.277 1.00 32.29  ? 157 HIS C C   1 
ATOM 7235 O O   . HIS C 1 157 ? 88.263  -9.826  227.214 1.00 31.47  ? 157 HIS C O   1 
ATOM 7236 C CB  . HIS C 1 157 ? 89.120  -11.400 224.911 1.00 32.29  ? 157 HIS C CB  1 
ATOM 7237 C CG  . HIS C 1 157 ? 90.251  -10.608 224.333 1.00 27.71  ? 157 HIS C CG  1 
ATOM 7238 N ND1 . HIS C 1 157 ? 90.599  -9.357  224.797 1.00 31.12  ? 157 HIS C ND1 1 
ATOM 7239 C CD2 . HIS C 1 157 ? 91.136  -10.903 223.352 1.00 29.47  ? 157 HIS C CD2 1 
ATOM 7240 C CE1 . HIS C 1 157 ? 91.657  -8.920  224.134 1.00 31.40  ? 157 HIS C CE1 1 
ATOM 7241 N NE2 . HIS C 1 157 ? 92.001  -9.840  223.251 1.00 30.69  ? 157 HIS C NE2 1 
ATOM 7242 N N   . SER C 1 158 ? 90.293  -10.304 228.050 1.00 31.14  ? 158 SER C N   1 
ATOM 7243 C CA  . SER C 1 158 ? 90.298  -9.179  228.985 1.00 30.42  ? 158 SER C CA  1 
ATOM 7244 C C   . SER C 1 158 ? 90.033  -7.797  228.377 1.00 29.01  ? 158 SER C C   1 
ATOM 7245 O O   . SER C 1 158 ? 89.619  -6.880  229.085 1.00 30.97  ? 158 SER C O   1 
ATOM 7246 C CB  . SER C 1 158 ? 91.596  -9.166  229.801 1.00 29.50  ? 158 SER C CB  1 
ATOM 7247 O OG  . SER C 1 158 ? 92.726  -9.111  228.943 1.00 38.56  ? 158 SER C OG  1 
ATOM 7248 N N   . GLY C 1 159 ? 90.253  -7.658  227.074 1.00 24.89  ? 159 GLY C N   1 
ATOM 7249 C CA  . GLY C 1 159 ? 90.032  -6.377  226.424 1.00 23.79  ? 159 GLY C CA  1 
ATOM 7250 C C   . GLY C 1 159 ? 88.670  -6.162  225.792 1.00 23.46  ? 159 GLY C C   1 
ATOM 7251 O O   . GLY C 1 159 ? 88.436  -5.126  225.188 1.00 21.75  ? 159 GLY C O   1 
ATOM 7252 N N   . ARG C 1 160 ? 87.775  -7.135  225.921 1.00 22.76  ? 160 ARG C N   1 
ATOM 7253 C CA  . ARG C 1 160 ? 86.437  -7.038  225.331 1.00 24.39  ? 160 ARG C CA  1 
ATOM 7254 C C   . ARG C 1 160 ? 85.519  -6.067  226.101 1.00 24.26  ? 160 ARG C C   1 
ATOM 7255 O O   . ARG C 1 160 ? 85.424  -6.136  227.332 1.00 25.12  ? 160 ARG C O   1 
ATOM 7256 C CB  . ARG C 1 160 ? 85.800  -8.431  225.272 1.00 22.10  ? 160 ARG C CB  1 
ATOM 7257 C CG  . ARG C 1 160 ? 84.495  -8.500  224.499 1.00 23.40  ? 160 ARG C CG  1 
ATOM 7258 C CD  . ARG C 1 160 ? 83.978  -9.926  224.446 1.00 20.91  ? 160 ARG C CD  1 
ATOM 7259 N NE  . ARG C 1 160 ? 84.924  -10.826 223.789 1.00 21.97  ? 160 ARG C NE  1 
ATOM 7260 C CZ  . ARG C 1 160 ? 84.850  -12.154 223.827 1.00 23.31  ? 160 ARG C CZ  1 
ATOM 7261 N NH1 . ARG C 1 160 ? 83.865  -12.749 224.492 1.00 18.23  ? 160 ARG C NH1 1 
ATOM 7262 N NH2 . ARG C 1 160 ? 85.776  -12.891 223.215 1.00 23.22  ? 160 ARG C NH2 1 
ATOM 7263 N N   . LYS C 1 161 ? 84.849  -5.179  225.368 1.00 23.49  ? 161 LYS C N   1 
ATOM 7264 C CA  . LYS C 1 161 ? 83.932  -4.181  225.940 1.00 23.67  ? 161 LYS C CA  1 
ATOM 7265 C C   . LYS C 1 161 ? 82.494  -4.402  225.428 1.00 23.91  ? 161 LYS C C   1 
ATOM 7266 O O   . LYS C 1 161 ? 82.291  -4.918  224.321 1.00 20.96  ? 161 LYS C O   1 
ATOM 7267 C CB  . LYS C 1 161 ? 84.387  -2.770  225.550 1.00 26.10  ? 161 LYS C CB  1 
ATOM 7268 C CG  . LYS C 1 161 ? 85.758  -2.377  226.072 1.00 40.06  ? 161 LYS C CG  1 
ATOM 7269 C CD  . LYS C 1 161 ? 85.749  -2.184  227.567 1.00 44.00  ? 161 LYS C CD  1 
ATOM 7270 C CE  . LYS C 1 161 ? 87.122  -1.791  228.048 1.00 55.23  ? 161 LYS C CE  1 
ATOM 7271 N NZ  . LYS C 1 161 ? 87.123  -1.533  229.505 1.00 63.91  ? 161 LYS C NZ  1 
ATOM 7272 N N   . THR C 1 162 ? 81.508  -3.986  226.217 1.00 20.43  ? 162 THR C N   1 
ATOM 7273 C CA  . THR C 1 162 ? 80.111  -4.144  225.844 1.00 21.03  ? 162 THR C CA  1 
ATOM 7274 C C   . THR C 1 162 ? 79.383  -2.798  225.815 1.00 21.41  ? 162 THR C C   1 
ATOM 7275 O O   . THR C 1 162 ? 79.618  -1.942  226.670 1.00 22.58  ? 162 THR C O   1 
ATOM 7276 C CB  . THR C 1 162 ? 79.406  -5.084  226.828 1.00 22.05  ? 162 THR C CB  1 
ATOM 7277 O OG1 . THR C 1 162 ? 80.077  -6.344  226.831 1.00 24.26  ? 162 THR C OG1 1 
ATOM 7278 C CG2 . THR C 1 162 ? 77.957  -5.303  226.431 1.00 23.07  ? 162 THR C CG2 1 
ATOM 7279 N N   . ALA C 1 163 ? 78.546  -2.592  224.804 1.00 18.92  ? 163 ALA C N   1 
ATOM 7280 C CA  . ALA C 1 163 ? 77.771  -1.361  224.678 1.00 20.17  ? 163 ALA C CA  1 
ATOM 7281 C C   . ALA C 1 163 ? 76.290  -1.718  224.462 1.00 21.29  ? 163 ALA C C   1 
ATOM 7282 O O   . ALA C 1 163 ? 75.972  -2.597  223.659 1.00 21.32  ? 163 ALA C O   1 
ATOM 7283 C CB  . ALA C 1 163 ? 78.286  -0.529  223.516 1.00 16.43  ? 163 ALA C CB  1 
ATOM 7284 N N   . SER C 1 164 ? 75.394  -1.067  225.201 1.00 19.79  ? 164 SER C N   1 
ATOM 7285 C CA  . SER C 1 164 ? 73.967  -1.318  225.064 1.00 20.33  ? 164 SER C CA  1 
ATOM 7286 C C   . SER C 1 164 ? 73.298  -0.117  224.448 1.00 18.97  ? 164 SER C C   1 
ATOM 7287 O O   . SER C 1 164 ? 73.665  1.015   224.730 1.00 20.45  ? 164 SER C O   1 
ATOM 7288 C CB  . SER C 1 164 ? 73.336  -1.645  226.407 1.00 23.89  ? 164 SER C CB  1 
ATOM 7289 O OG  . SER C 1 164 ? 73.522  -3.022  226.697 1.00 38.10  ? 164 SER C OG  1 
ATOM 7290 N N   . PHE C 1 165 ? 72.339  -0.374  223.572 1.00 17.55  ? 165 PHE C N   1 
ATOM 7291 C CA  . PHE C 1 165 ? 71.630  0.683   222.880 1.00 17.19  ? 165 PHE C CA  1 
ATOM 7292 C C   . PHE C 1 165 ? 70.125  0.514   222.970 1.00 16.74  ? 165 PHE C C   1 
ATOM 7293 O O   . PHE C 1 165 ? 69.632  -0.615  222.967 1.00 14.40  ? 165 PHE C O   1 
ATOM 7294 C CB  . PHE C 1 165 ? 72.013  0.678   221.405 1.00 15.43  ? 165 PHE C CB  1 
ATOM 7295 C CG  . PHE C 1 165 ? 73.467  0.874   221.169 1.00 21.74  ? 165 PHE C CG  1 
ATOM 7296 C CD1 . PHE C 1 165 ? 74.002  2.161   221.089 1.00 25.52  ? 165 PHE C CD1 1 
ATOM 7297 C CD2 . PHE C 1 165 ? 74.320  -0.221  221.054 1.00 17.98  ? 165 PHE C CD2 1 
ATOM 7298 C CE1 . PHE C 1 165 ? 75.377  2.357   220.901 1.00 24.23  ? 165 PHE C CE1 1 
ATOM 7299 C CE2 . PHE C 1 165 ? 75.694  -0.035  220.868 1.00 19.03  ? 165 PHE C CE2 1 
ATOM 7300 C CZ  . PHE C 1 165 ? 76.222  1.257   220.791 1.00 20.24  ? 165 PHE C CZ  1 
ATOM 7301 N N   . THR C 1 166 ? 69.424  1.646   223.100 1.00 17.35  ? 166 THR C N   1 
ATOM 7302 C CA  . THR C 1 166 ? 67.957  1.727   223.117 1.00 16.04  ? 166 THR C CA  1 
ATOM 7303 C C   . THR C 1 166 ? 67.685  2.900   222.163 1.00 18.55  ? 166 THR C C   1 
ATOM 7304 O O   . THR C 1 166 ? 68.607  3.635   221.814 1.00 16.06  ? 166 THR C O   1 
ATOM 7305 C CB  . THR C 1 166 ? 67.381  2.042   224.515 1.00 16.09  ? 166 THR C CB  1 
ATOM 7306 O OG1 . THR C 1 166 ? 67.970  3.246   225.023 1.00 21.94  ? 166 THR C OG1 1 
ATOM 7307 C CG2 . THR C 1 166 ? 67.656  0.901   225.487 1.00 19.61  ? 166 THR C CG2 1 
ATOM 7308 N N   . ILE C 1 167 ? 66.458  3.056   221.695 1.00 19.67  ? 167 ILE C N   1 
ATOM 7309 C CA  . ILE C 1 167 ? 66.134  4.143   220.789 1.00 22.79  ? 167 ILE C CA  1 
ATOM 7310 C C   . ILE C 1 167 ? 66.474  5.517   221.383 1.00 22.52  ? 167 ILE C C   1 
ATOM 7311 O O   . ILE C 1 167 ? 66.885  6.424   220.668 1.00 25.86  ? 167 ILE C O   1 
ATOM 7312 C CB  . ILE C 1 167 ? 64.630  4.078   220.375 1.00 29.41  ? 167 ILE C CB  1 
ATOM 7313 C CG1 . ILE C 1 167 ? 64.479  3.269   219.090 1.00 29.88  ? 167 ILE C CG1 1 
ATOM 7314 C CG2 . ILE C 1 167 ? 64.035  5.465   220.175 1.00 35.71  ? 167 ILE C CG2 1 
ATOM 7315 C CD1 . ILE C 1 167 ? 63.063  3.265   218.537 1.00 31.05  ? 167 ILE C CD1 1 
ATOM 7316 N N   . SER C 1 168 ? 66.328  5.674   222.690 1.00 22.01  ? 168 SER C N   1 
ATOM 7317 C CA  . SER C 1 168 ? 66.616  6.967   223.302 1.00 24.82  ? 168 SER C CA  1 
ATOM 7318 C C   . SER C 1 168 ? 68.089  7.190   223.671 1.00 26.88  ? 168 SER C C   1 
ATOM 7319 O O   . SER C 1 168 ? 68.441  8.266   224.168 1.00 28.90  ? 168 SER C O   1 
ATOM 7320 C CB  . SER C 1 168 ? 65.740  7.169   224.538 1.00 28.46  ? 168 SER C CB  1 
ATOM 7321 O OG  . SER C 1 168 ? 66.027  6.200   225.535 1.00 40.79  ? 168 SER C OG  1 
ATOM 7322 N N   . SER C 1 169 ? 68.941  6.188   223.438 1.00 24.25  ? 169 SER C N   1 
ATOM 7323 C CA  . SER C 1 169 ? 70.367  6.283   223.766 1.00 21.99  ? 169 SER C CA  1 
ATOM 7324 C C   . SER C 1 169 ? 71.146  5.533   222.687 1.00 19.96  ? 169 SER C C   1 
ATOM 7325 O O   . SER C 1 169 ? 71.524  4.373   222.851 1.00 21.75  ? 169 SER C O   1 
ATOM 7326 C CB  . SER C 1 169 ? 70.612  5.687   225.150 1.00 21.51  ? 169 SER C CB  1 
ATOM 7327 O OG  . SER C 1 169 ? 71.937  5.931   225.576 1.00 31.34  ? 169 SER C OG  1 
ATOM 7328 N N   . GLU C 1 170 ? 71.378  6.217   221.578 1.00 18.58  ? 170 GLU C N   1 
ATOM 7329 C CA  . GLU C 1 170 ? 72.042  5.643   220.416 1.00 23.07  ? 170 GLU C CA  1 
ATOM 7330 C C   . GLU C 1 170 ? 73.559  5.740   220.300 1.00 23.76  ? 170 GLU C C   1 
ATOM 7331 O O   . GLU C 1 170 ? 74.143  5.157   219.385 1.00 25.30  ? 170 GLU C O   1 
ATOM 7332 C CB  . GLU C 1 170 ? 71.459  6.289   219.176 1.00 29.62  ? 170 GLU C CB  1 
ATOM 7333 C CG  . GLU C 1 170 ? 71.761  7.792   219.121 1.00 36.59  ? 170 GLU C CG  1 
ATOM 7334 C CD  . GLU C 1 170 ? 71.036  8.513   217.996 1.00 44.39  ? 170 GLU C CD  1 
ATOM 7335 O OE1 . GLU C 1 170 ? 70.110  7.911   217.394 1.00 45.20  ? 170 GLU C OE1 1 
ATOM 7336 O OE2 . GLU C 1 170 ? 71.396  9.685   217.725 1.00 45.95  ? 170 GLU C OE2 1 
ATOM 7337 N N   . LYS C 1 171 ? 74.196  6.529   221.151 1.00 23.40  ? 171 LYS C N   1 
ATOM 7338 C CA  . LYS C 1 171 ? 75.636  6.671   221.056 1.00 21.88  ? 171 LYS C CA  1 
ATOM 7339 C C   . LYS C 1 171 ? 76.357  6.336   222.355 1.00 23.45  ? 171 LYS C C   1 
ATOM 7340 O O   . LYS C 1 171 ? 75.886  6.680   223.448 1.00 23.00  ? 171 LYS C O   1 
ATOM 7341 C CB  . LYS C 1 171 ? 75.980  8.083   220.598 1.00 23.34  ? 171 LYS C CB  1 
ATOM 7342 C CG  . LYS C 1 171 ? 77.416  8.258   220.143 1.00 27.40  ? 171 LYS C CG  1 
ATOM 7343 C CD  . LYS C 1 171 ? 77.604  9.632   219.549 1.00 35.13  ? 171 LYS C CD  1 
ATOM 7344 C CE  . LYS C 1 171 ? 79.024  9.831   219.051 1.00 43.88  ? 171 LYS C CE  1 
ATOM 7345 N NZ  . LYS C 1 171 ? 79.280  11.244  218.632 1.00 44.72  ? 171 LYS C NZ  1 
ATOM 7346 N N   . THR C 1 172 ? 77.466  5.609   222.224 1.00 21.06  ? 172 THR C N   1 
ATOM 7347 C CA  . THR C 1 172 ? 78.302  5.207   223.358 1.00 24.51  ? 172 THR C CA  1 
ATOM 7348 C C   . THR C 1 172 ? 79.778  5.423   222.971 1.00 24.81  ? 172 THR C C   1 
ATOM 7349 O O   . THR C 1 172 ? 80.135  5.268   221.800 1.00 22.44  ? 172 THR C O   1 
ATOM 7350 C CB  . THR C 1 172 ? 78.118  3.696   223.705 1.00 28.55  ? 172 THR C CB  1 
ATOM 7351 O OG1 . THR C 1 172 ? 76.790  3.455   224.186 1.00 40.10  ? 172 THR C OG1 1 
ATOM 7352 C CG2 . THR C 1 172 ? 79.091  3.275   224.785 1.00 39.40  ? 172 THR C CG2 1 
ATOM 7353 N N   . ILE C 1 173 ? 80.600  5.844   223.934 1.00 23.75  ? 173 ILE C N   1 
ATOM 7354 C CA  . ILE C 1 173 ? 82.037  6.037   223.724 1.00 25.56  ? 173 ILE C CA  1 
ATOM 7355 C C   . ILE C 1 173 ? 82.672  4.961   224.614 1.00 27.14  ? 173 ILE C C   1 
ATOM 7356 O O   . ILE C 1 173 ? 82.409  4.939   225.823 1.00 26.82  ? 173 ILE C O   1 
ATOM 7357 C CB  . ILE C 1 173 ? 82.550  7.404   224.269 1.00 29.29  ? 173 ILE C CB  1 
ATOM 7358 C CG1 . ILE C 1 173 ? 81.711  8.582   223.760 1.00 29.24  ? 173 ILE C CG1 1 
ATOM 7359 C CG2 . ILE C 1 173 ? 84.016  7.591   223.897 1.00 26.46  ? 173 ILE C CG2 1 
ATOM 7360 C CD1 . ILE C 1 173 ? 81.984  8.966   222.351 1.00 28.26  ? 173 ILE C CD1 1 
ATOM 7361 N N   . LEU C 1 174 ? 83.446  4.041   224.041 1.00 25.54  ? 174 LEU C N   1 
ATOM 7362 C CA  . LEU C 1 174 ? 84.087  2.994   224.840 1.00 25.02  ? 174 LEU C CA  1 
ATOM 7363 C C   . LEU C 1 174 ? 85.588  3.229   224.914 1.00 25.32  ? 174 LEU C C   1 
ATOM 7364 O O   . LEU C 1 174 ? 86.205  3.675   223.948 1.00 26.50  ? 174 LEU C O   1 
ATOM 7365 C CB  . LEU C 1 174 ? 83.847  1.609   224.225 1.00 27.49  ? 174 LEU C CB  1 
ATOM 7366 C CG  . LEU C 1 174 ? 82.440  1.015   224.155 1.00 28.60  ? 174 LEU C CG  1 
ATOM 7367 C CD1 . LEU C 1 174 ? 82.454  -0.211  223.263 1.00 26.22  ? 174 LEU C CD1 1 
ATOM 7368 C CD2 . LEU C 1 174 ? 81.937  0.666   225.545 1.00 29.64  ? 174 LEU C CD2 1 
ATOM 7369 N N   . THR C 1 175 ? 86.168  2.966   226.075 1.00 23.34  ? 175 THR C N   1 
ATOM 7370 C CA  . THR C 1 175 ? 87.607  3.103   226.236 1.00 26.03  ? 175 THR C CA  1 
ATOM 7371 C C   . THR C 1 175 ? 88.202  1.697   226.049 1.00 24.57  ? 175 THR C C   1 
ATOM 7372 O O   . THR C 1 175 ? 87.955  0.791   226.860 1.00 25.21  ? 175 THR C O   1 
ATOM 7373 C CB  . THR C 1 175 ? 87.980  3.700   227.634 1.00 28.02  ? 175 THR C CB  1 
ATOM 7374 O OG1 . THR C 1 175 ? 87.573  5.074   227.689 1.00 24.65  ? 175 THR C OG1 1 
ATOM 7375 C CG2 . THR C 1 175 ? 89.494  3.656   227.861 1.00 25.55  ? 175 THR C CG2 1 
ATOM 7376 N N   . MET C 1 176 ? 88.910  1.498   224.941 1.00 22.79  ? 176 MET C N   1 
ATOM 7377 C CA  . MET C 1 176 ? 89.521  0.201   224.633 1.00 24.87  ? 176 MET C CA  1 
ATOM 7378 C C   . MET C 1 176 ? 90.913  0.054   225.276 1.00 25.70  ? 176 MET C C   1 
ATOM 7379 O O   . MET C 1 176 ? 91.924  -0.061  224.577 1.00 24.21  ? 176 MET C O   1 
ATOM 7380 C CB  . MET C 1 176 ? 89.626  0.017   223.115 1.00 23.28  ? 176 MET C CB  1 
ATOM 7381 C CG  . MET C 1 176 ? 88.287  0.136   222.387 1.00 26.95  ? 176 MET C CG  1 
ATOM 7382 S SD  . MET C 1 176 ? 86.977  -0.900  223.115 1.00 27.45  ? 176 MET C SD  1 
ATOM 7383 C CE  . MET C 1 176 ? 87.678  -2.538  222.969 1.00 22.04  ? 176 MET C CE  1 
ATOM 7384 N N   . GLY C 1 177 ? 90.957  0.058   226.608 1.00 26.14  ? 177 GLY C N   1 
ATOM 7385 C CA  . GLY C 1 177 ? 92.220  -0.056  227.327 1.00 28.77  ? 177 GLY C CA  1 
ATOM 7386 C C   . GLY C 1 177 ? 93.212  1.012   226.894 1.00 31.25  ? 177 GLY C C   1 
ATOM 7387 O O   . GLY C 1 177 ? 92.883  2.203   226.873 1.00 32.41  ? 177 GLY C O   1 
ATOM 7388 N N   . GLU C 1 178 ? 94.410  0.602   226.493 1.00 30.56  ? 178 GLU C N   1 
ATOM 7389 C CA  . GLU C 1 178 ? 95.415  1.557   226.047 1.00 32.47  ? 178 GLU C CA  1 
ATOM 7390 C C   . GLU C 1 178 ? 95.330  1.913   224.562 1.00 29.86  ? 178 GLU C C   1 
ATOM 7391 O O   . GLU C 1 178 ? 96.099  2.736   224.077 1.00 28.86  ? 178 GLU C O   1 
ATOM 7392 C CB  . GLU C 1 178 ? 96.812  1.039   226.403 1.00 41.68  ? 178 GLU C CB  1 
ATOM 7393 C CG  . GLU C 1 178 ? 97.051  0.877   227.921 1.00 58.70  ? 178 GLU C CG  1 
ATOM 7394 C CD  . GLU C 1 178 ? 98.239  -0.036  228.240 1.00 73.33  ? 178 GLU C CD  1 
ATOM 7395 O OE1 . GLU C 1 178 ? 98.119  -1.269  228.041 1.00 78.14  ? 178 GLU C OE1 1 
ATOM 7396 O OE2 . GLU C 1 178 ? 99.290  0.477   228.695 1.00 79.01  ? 178 GLU C OE2 1 
ATOM 7397 N N   . TYR C 1 179 ? 94.372  1.323   223.853 1.00 29.75  ? 179 TYR C N   1 
ATOM 7398 C CA  . TYR C 1 179 ? 94.192  1.624   222.431 1.00 28.58  ? 179 TYR C CA  1 
ATOM 7399 C C   . TYR C 1 179 ? 93.416  2.905   222.136 1.00 29.89  ? 179 TYR C C   1 
ATOM 7400 O O   . TYR C 1 179 ? 93.249  3.288   220.973 1.00 32.56  ? 179 TYR C O   1 
ATOM 7401 C CB  . TYR C 1 179 ? 93.526  0.437   221.726 1.00 27.17  ? 179 TYR C CB  1 
ATOM 7402 C CG  . TYR C 1 179 ? 94.340  -0.820  221.734 1.00 23.23  ? 179 TYR C CG  1 
ATOM 7403 C CD1 . TYR C 1 179 ? 95.302  -1.045  220.752 1.00 25.49  ? 179 TYR C CD1 1 
ATOM 7404 C CD2 . TYR C 1 179 ? 94.183  -1.776  222.746 1.00 21.56  ? 179 TYR C CD2 1 
ATOM 7405 C CE1 . TYR C 1 179 ? 96.103  -2.199  220.778 1.00 24.09  ? 179 TYR C CE1 1 
ATOM 7406 C CE2 . TYR C 1 179 ? 94.986  -2.929  222.776 1.00 26.52  ? 179 TYR C CE2 1 
ATOM 7407 C CZ  . TYR C 1 179 ? 95.945  -3.129  221.789 1.00 20.83  ? 179 TYR C CZ  1 
ATOM 7408 O OH  . TYR C 1 179 ? 96.757  -4.243  221.827 1.00 27.71  ? 179 TYR C OH  1 
ATOM 7409 N N   . GLY C 1 180 ? 92.903  3.554   223.174 1.00 27.07  ? 180 GLY C N   1 
ATOM 7410 C CA  . GLY C 1 180 ? 92.143  4.770   222.954 1.00 26.73  ? 180 GLY C CA  1 
ATOM 7411 C C   . GLY C 1 180 ? 90.639  4.567   223.030 1.00 24.54  ? 180 GLY C C   1 
ATOM 7412 O O   . GLY C 1 180 ? 90.144  3.522   223.469 1.00 23.02  ? 180 GLY C O   1 
ATOM 7413 N N   . ASP C 1 181 ? 89.900  5.581   222.617 1.00 24.65  ? 181 ASP C N   1 
ATOM 7414 C CA  . ASP C 1 181 ? 88.450  5.518   222.674 1.00 25.23  ? 181 ASP C CA  1 
ATOM 7415 C C   . ASP C 1 181 ? 87.850  5.257   221.306 1.00 25.41  ? 181 ASP C C   1 
ATOM 7416 O O   . ASP C 1 181 ? 88.391  5.708   220.301 1.00 26.69  ? 181 ASP C O   1 
ATOM 7417 C CB  . ASP C 1 181 ? 87.892  6.834   223.230 1.00 22.52  ? 181 ASP C CB  1 
ATOM 7418 C CG  . ASP C 1 181 ? 88.063  6.965   224.734 1.00 27.60  ? 181 ASP C CG  1 
ATOM 7419 O OD1 . ASP C 1 181 ? 88.583  6.039   225.393 1.00 27.37  ? 181 ASP C OD1 1 
ATOM 7420 O OD2 . ASP C 1 181 ? 87.644  8.004   225.273 1.00 33.21  ? 181 ASP C OD2 1 
ATOM 7421 N N   . VAL C 1 182 ? 86.758  4.495   221.276 1.00 25.13  ? 182 VAL C N   1 
ATOM 7422 C CA  . VAL C 1 182 ? 86.045  4.194   220.038 1.00 24.32  ? 182 VAL C CA  1 
ATOM 7423 C C   . VAL C 1 182 ? 84.583  4.655   220.259 1.00 23.85  ? 182 VAL C C   1 
ATOM 7424 O O   . VAL C 1 182 ? 84.043  4.518   221.364 1.00 22.61  ? 182 VAL C O   1 
ATOM 7425 C CB  . VAL C 1 182 ? 86.114  2.661   219.666 1.00 26.14  ? 182 VAL C CB  1 
ATOM 7426 C CG1 . VAL C 1 182 ? 85.447  1.816   220.722 1.00 23.09  ? 182 VAL C CG1 1 
ATOM 7427 C CG2 . VAL C 1 182 ? 85.465  2.415   218.319 1.00 25.95  ? 182 VAL C CG2 1 
ATOM 7428 N N   . SER C 1 183 ? 83.975  5.288   219.261 1.00 23.62  ? 183 SER C N   1 
ATOM 7429 C CA  . SER C 1 183 ? 82.590  5.722   219.416 1.00 25.11  ? 183 SER C CA  1 
ATOM 7430 C C   . SER C 1 183 ? 81.683  4.819   218.597 1.00 24.96  ? 183 SER C C   1 
ATOM 7431 O O   . SER C 1 183 ? 82.041  4.431   217.482 1.00 24.76  ? 183 SER C O   1 
ATOM 7432 C CB  . SER C 1 183 ? 82.395  7.174   218.983 1.00 21.39  ? 183 SER C CB  1 
ATOM 7433 O OG  . SER C 1 183 ? 82.573  7.324   217.585 1.00 27.56  ? 183 SER C OG  1 
ATOM 7434 N N   . LEU C 1 184 ? 80.539  4.463   219.175 1.00 24.26  ? 184 LEU C N   1 
ATOM 7435 C CA  . LEU C 1 184 ? 79.559  3.609   218.522 1.00 24.25  ? 184 LEU C CA  1 
ATOM 7436 C C   . LEU C 1 184 ? 78.204  4.276   218.478 1.00 23.70  ? 184 LEU C C   1 
ATOM 7437 O O   . LEU C 1 184 ? 77.649  4.630   219.521 1.00 24.44  ? 184 LEU C O   1 
ATOM 7438 C CB  . LEU C 1 184 ? 79.391  2.295   219.284 1.00 27.06  ? 184 LEU C CB  1 
ATOM 7439 C CG  . LEU C 1 184 ? 80.384  1.182   219.044 1.00 29.26  ? 184 LEU C CG  1 
ATOM 7440 C CD1 . LEU C 1 184 ? 80.077  0.043   219.990 1.00 35.30  ? 184 LEU C CD1 1 
ATOM 7441 C CD2 . LEU C 1 184 ? 80.261  0.739   217.609 1.00 28.20  ? 184 LEU C CD2 1 
ATOM 7442 N N   . LEU C 1 185 ? 77.678  4.452   217.274 1.00 20.67  ? 185 LEU C N   1 
ATOM 7443 C CA  . LEU C 1 185 ? 76.358  5.022   217.107 1.00 20.87  ? 185 LEU C CA  1 
ATOM 7444 C C   . LEU C 1 185 ? 75.544  3.951   216.390 1.00 21.01  ? 185 LEU C C   1 
ATOM 7445 O O   . LEU C 1 185 ? 75.727  3.712   215.200 1.00 22.91  ? 185 LEU C O   1 
ATOM 7446 C CB  . LEU C 1 185 ? 76.409  6.299   216.269 1.00 24.62  ? 185 LEU C CB  1 
ATOM 7447 C CG  . LEU C 1 185 ? 75.214  7.251   216.424 1.00 32.07  ? 185 LEU C CG  1 
ATOM 7448 C CD1 . LEU C 1 185 ? 75.489  8.498   215.615 1.00 33.49  ? 185 LEU C CD1 1 
ATOM 7449 C CD2 . LEU C 1 185 ? 73.917  6.611   215.971 1.00 27.11  ? 185 LEU C CD2 1 
ATOM 7450 N N   . CYS C 1 186 ? 74.673  3.279   217.129 1.00 20.82  ? 186 CYS C N   1 
ATOM 7451 C CA  . CYS C 1 186 ? 73.834  2.248   216.558 1.00 21.01  ? 186 CYS C CA  1 
ATOM 7452 C C   . CYS C 1 186 ? 72.386  2.698   216.634 1.00 23.13  ? 186 CYS C C   1 
ATOM 7453 O O   . CYS C 1 186 ? 71.907  3.070   217.700 1.00 23.82  ? 186 CYS C O   1 
ATOM 7454 C CB  . CYS C 1 186 ? 74.012  0.959   217.338 1.00 22.41  ? 186 CYS C CB  1 
ATOM 7455 S SG  . CYS C 1 186 ? 75.725  0.355   217.341 1.00 24.93  ? 186 CYS C SG  1 
ATOM 7456 N N   . ARG C 1 187 ? 71.674  2.653   215.518 1.00 25.45  ? 187 ARG C N   1 
ATOM 7457 C CA  . ARG C 1 187 ? 70.279  3.077   215.530 1.00 29.34  ? 187 ARG C CA  1 
ATOM 7458 C C   . ARG C 1 187 ? 69.294  1.922   215.582 1.00 27.07  ? 187 ARG C C   1 
ATOM 7459 O O   . ARG C 1 187 ? 69.124  1.190   214.610 1.00 26.56  ? 187 ARG C O   1 
ATOM 7460 C CB  . ARG C 1 187 ? 69.975  3.986   214.339 1.00 34.50  ? 187 ARG C CB  1 
ATOM 7461 C CG  . ARG C 1 187 ? 70.663  5.331   214.436 1.00 45.65  ? 187 ARG C CG  1 
ATOM 7462 C CD  . ARG C 1 187 ? 70.234  6.278   213.323 1.00 50.34  ? 187 ARG C CD  1 
ATOM 7463 N NE  . ARG C 1 187 ? 71.005  7.518   213.343 1.00 49.43  ? 187 ARG C NE  1 
ATOM 7464 C CZ  . ARG C 1 187 ? 72.235  7.639   212.852 1.00 53.93  ? 187 ARG C CZ  1 
ATOM 7465 N NH1 . ARG C 1 187 ? 72.837  6.591   212.292 1.00 46.30  ? 187 ARG C NH1 1 
ATOM 7466 N NH2 . ARG C 1 187 ? 72.876  8.797   212.952 1.00 53.82  ? 187 ARG C NH2 1 
ATOM 7467 N N   . VAL C 1 188 ? 68.642  1.772   216.728 1.00 28.19  ? 188 VAL C N   1 
ATOM 7468 C CA  . VAL C 1 188 ? 67.655  0.711   216.941 1.00 30.94  ? 188 VAL C CA  1 
ATOM 7469 C C   . VAL C 1 188 ? 66.516  0.806   215.898 1.00 30.53  ? 188 VAL C C   1 
ATOM 7470 O O   . VAL C 1 188 ? 65.968  -0.217  215.476 1.00 32.06  ? 188 VAL C O   1 
ATOM 7471 C CB  . VAL C 1 188 ? 67.132  0.751   218.426 1.00 33.00  ? 188 VAL C CB  1 
ATOM 7472 C CG1 . VAL C 1 188 ? 65.881  -0.125  218.616 1.00 36.22  ? 188 VAL C CG1 1 
ATOM 7473 C CG2 . VAL C 1 188 ? 68.246  0.292   219.376 1.00 33.14  ? 188 VAL C CG2 1 
ATOM 7474 N N   . ALA C 1 189 ? 66.218  2.023   215.437 1.00 31.02  ? 189 ALA C N   1 
ATOM 7475 C CA  . ALA C 1 189 ? 65.174  2.255   214.422 1.00 32.12  ? 189 ALA C CA  1 
ATOM 7476 C C   . ALA C 1 189 ? 65.524  1.579   213.084 1.00 32.79  ? 189 ALA C C   1 
ATOM 7477 O O   . ALA C 1 189 ? 64.653  1.323   212.246 1.00 33.14  ? 189 ALA C O   1 
ATOM 7478 C CB  . ALA C 1 189 ? 64.971  3.760   214.216 1.00 33.03  ? 189 ALA C CB  1 
ATOM 7479 N N   . SER C 1 190 ? 66.812  1.310   212.887 1.00 33.15  ? 190 SER C N   1 
ATOM 7480 C CA  . SER C 1 190 ? 67.299  0.652   211.674 1.00 33.51  ? 190 SER C CA  1 
ATOM 7481 C C   . SER C 1 190 ? 67.217  -0.859  211.843 1.00 34.61  ? 190 SER C C   1 
ATOM 7482 O O   . SER C 1 190 ? 67.585  -1.614  210.933 1.00 34.91  ? 190 SER C O   1 
ATOM 7483 C CB  . SER C 1 190 ? 68.769  1.041   211.401 1.00 36.03  ? 190 SER C CB  1 
ATOM 7484 O OG  . SER C 1 190 ? 69.688  0.286   212.189 1.00 26.68  ? 190 SER C OG  1 
ATOM 7485 N N   . GLY C 1 191 ? 66.806  -1.291  213.035 1.00 34.79  ? 191 GLY C N   1 
ATOM 7486 C CA  . GLY C 1 191 ? 66.714  -2.706  213.326 1.00 35.73  ? 191 GLY C CA  1 
ATOM 7487 C C   . GLY C 1 191 ? 65.487  -3.393  212.759 1.00 37.29  ? 191 GLY C C   1 
ATOM 7488 O O   . GLY C 1 191 ? 64.808  -2.890  211.860 1.00 35.11  ? 191 GLY C O   1 
ATOM 7489 N N   . VAL C 1 192 ? 65.194  -4.546  213.342 1.00 40.74  ? 192 VAL C N   1 
ATOM 7490 C CA  . VAL C 1 192 ? 64.070  -5.395  212.962 1.00 43.41  ? 192 VAL C CA  1 
ATOM 7491 C C   . VAL C 1 192 ? 62.717  -4.749  213.284 1.00 41.73  ? 192 VAL C C   1 
ATOM 7492 O O   . VAL C 1 192 ? 62.552  -4.206  214.381 1.00 39.41  ? 192 VAL C O   1 
ATOM 7493 C CB  . VAL C 1 192 ? 64.165  -6.720  213.761 1.00 50.63  ? 192 VAL C CB  1 
ATOM 7494 C CG1 . VAL C 1 192 ? 63.020  -7.651  213.408 1.00 58.29  ? 192 VAL C CG1 1 
ATOM 7495 C CG2 . VAL C 1 192 ? 65.524  -7.378  213.523 1.00 52.24  ? 192 VAL C CG2 1 
ATOM 7496 N N   . ASP C 1 193 ? 61.775  -4.744  212.332 1.00 42.06  ? 193 ASP C N   1 
ATOM 7497 C CA  . ASP C 1 193 ? 60.443  -4.196  212.635 1.00 42.76  ? 193 ASP C CA  1 
ATOM 7498 C C   . ASP C 1 193 ? 59.715  -5.295  213.411 1.00 40.23  ? 193 ASP C C   1 
ATOM 7499 O O   . ASP C 1 193 ? 59.641  -6.440  212.953 1.00 40.53  ? 193 ASP C O   1 
ATOM 7500 C CB  . ASP C 1 193 ? 59.613  -3.825  211.402 1.00 51.36  ? 193 ASP C CB  1 
ATOM 7501 C CG  . ASP C 1 193 ? 58.200  -3.338  211.791 1.00 62.30  ? 193 ASP C CG  1 
ATOM 7502 O OD1 . ASP C 1 193 ? 58.083  -2.275  212.451 1.00 64.93  ? 193 ASP C OD1 1 
ATOM 7503 O OD2 . ASP C 1 193 ? 57.212  -4.050  211.504 1.00 71.53  ? 193 ASP C OD2 1 
ATOM 7504 N N   . LEU C 1 194 ? 59.132  -4.931  214.548 1.00 36.45  ? 194 LEU C N   1 
ATOM 7505 C CA  . LEU C 1 194 ? 58.481  -5.899  215.415 1.00 35.34  ? 194 LEU C CA  1 
ATOM 7506 C C   . LEU C 1 194 ? 56.979  -5.784  215.557 1.00 33.59  ? 194 LEU C C   1 
ATOM 7507 O O   . LEU C 1 194 ? 56.391  -6.428  216.419 1.00 33.98  ? 194 LEU C O   1 
ATOM 7508 C CB  . LEU C 1 194 ? 59.128  -5.814  216.795 1.00 36.71  ? 194 LEU C CB  1 
ATOM 7509 C CG  . LEU C 1 194 ? 60.650  -5.973  216.742 1.00 41.11  ? 194 LEU C CG  1 
ATOM 7510 C CD1 . LEU C 1 194 ? 61.270  -5.340  217.954 1.00 38.00  ? 194 LEU C CD1 1 
ATOM 7511 C CD2 . LEU C 1 194 ? 61.037  -7.447  216.590 1.00 40.43  ? 194 LEU C CD2 1 
ATOM 7512 N N   . ALA C 1 195 ? 56.350  -5.001  214.695 1.00 31.88  ? 195 ALA C N   1 
ATOM 7513 C CA  . ALA C 1 195 ? 54.904  -4.802  214.773 1.00 32.00  ? 195 ALA C CA  1 
ATOM 7514 C C   . ALA C 1 195 ? 54.068  -6.093  214.723 1.00 27.87  ? 195 ALA C C   1 
ATOM 7515 O O   . ALA C 1 195 ? 53.143  -6.267  215.500 1.00 28.19  ? 195 ALA C O   1 
ATOM 7516 C CB  . ALA C 1 195 ? 54.458  -3.835  213.669 1.00 35.29  ? 195 ALA C CB  1 
ATOM 7517 N N   . GLN C 1 196 ? 54.409  -6.993  213.815 1.00 26.44  ? 196 GLN C N   1 
ATOM 7518 C CA  . GLN C 1 196 ? 53.672  -8.242  213.662 1.00 27.39  ? 196 GLN C CA  1 
ATOM 7519 C C   . GLN C 1 196 ? 54.270  -9.444  214.409 1.00 24.99  ? 196 GLN C C   1 
ATOM 7520 O O   . GLN C 1 196 ? 53.859  -10.577 214.164 1.00 25.78  ? 196 GLN C O   1 
ATOM 7521 C CB  . GLN C 1 196 ? 53.533  -8.587  212.167 1.00 32.94  ? 196 GLN C CB  1 
ATOM 7522 C CG  . GLN C 1 196 ? 52.721  -7.583  211.342 1.00 41.57  ? 196 GLN C CG  1 
ATOM 7523 C CD  . GLN C 1 196 ? 51.283  -7.401  211.854 1.00 50.76  ? 196 GLN C CD  1 
ATOM 7524 O OE1 . GLN C 1 196 ? 51.020  -6.563  212.712 1.00 53.71  ? 196 GLN C OE1 1 
ATOM 7525 N NE2 . GLN C 1 196 ? 50.349  -8.165  211.299 1.00 55.72  ? 196 GLN C NE2 1 
ATOM 7526 N N   . THR C 1 197 ? 55.232  -9.207  215.296 1.00 21.18  ? 197 THR C N   1 
ATOM 7527 C CA  . THR C 1 197 ? 55.880  -10.284 216.047 1.00 19.61  ? 197 THR C CA  1 
ATOM 7528 C C   . THR C 1 197 ? 55.276  -10.522 217.433 1.00 19.02  ? 197 THR C C   1 
ATOM 7529 O O   . THR C 1 197 ? 54.877  -9.580  218.134 1.00 17.20  ? 197 THR C O   1 
ATOM 7530 C CB  . THR C 1 197 ? 57.422  -10.014 216.218 1.00 19.18  ? 197 THR C CB  1 
ATOM 7531 O OG1 . THR C 1 197 ? 58.080  -10.198 214.968 1.00 27.27  ? 197 THR C OG1 1 
ATOM 7532 C CG2 . THR C 1 197 ? 58.068  -10.955 217.227 1.00 16.91  ? 197 THR C CG2 1 
ATOM 7533 N N   . VAL C 1 198 ? 55.177  -11.801 217.787 1.00 18.47  ? 198 VAL C N   1 
ATOM 7534 C CA  . VAL C 1 198 ? 54.711  -12.237 219.089 1.00 17.51  ? 198 VAL C CA  1 
ATOM 7535 C C   . VAL C 1 198 ? 55.703  -13.315 219.521 1.00 15.37  ? 198 VAL C C   1 
ATOM 7536 O O   . VAL C 1 198 ? 56.069  -14.163 218.709 1.00 16.23  ? 198 VAL C O   1 
ATOM 7537 C CB  . VAL C 1 198 ? 53.313  -12.875 219.026 1.00 16.04  ? 198 VAL C CB  1 
ATOM 7538 C CG1 . VAL C 1 198 ? 52.951  -13.461 220.380 1.00 18.23  ? 198 VAL C CG1 1 
ATOM 7539 C CG2 . VAL C 1 198 ? 52.289  -11.847 218.632 1.00 15.76  ? 198 VAL C CG2 1 
ATOM 7540 N N   . ILE C 1 199 ? 56.233  -13.216 220.734 1.00 12.05  ? 199 ILE C N   1 
ATOM 7541 C CA  . ILE C 1 199 ? 57.134  -14.249 221.239 1.00 13.46  ? 199 ILE C CA  1 
ATOM 7542 C C   . ILE C 1 199 ? 56.215  -15.235 221.991 1.00 13.06  ? 199 ILE C C   1 
ATOM 7543 O O   . ILE C 1 199 ? 55.513  -14.851 222.932 1.00 11.76  ? 199 ILE C O   1 
ATOM 7544 C CB  . ILE C 1 199 ? 58.218  -13.686 222.205 1.00 17.20  ? 199 ILE C CB  1 
ATOM 7545 C CG1 . ILE C 1 199 ? 59.101  -12.660 221.484 1.00 16.89  ? 199 ILE C CG1 1 
ATOM 7546 C CG2 . ILE C 1 199 ? 59.088  -14.826 222.734 1.00 10.62  ? 199 ILE C CG2 1 
ATOM 7547 C CD1 . ILE C 1 199 ? 59.713  -13.155 220.172 1.00 16.11  ? 199 ILE C CD1 1 
ATOM 7548 N N   . LEU C 1 200 ? 56.147  -16.474 221.513 1.00 13.11  ? 200 LEU C N   1 
ATOM 7549 C CA  . LEU C 1 200 ? 55.283  -17.483 222.113 1.00 11.99  ? 200 LEU C CA  1 
ATOM 7550 C C   . LEU C 1 200 ? 56.071  -18.307 223.110 1.00 12.72  ? 200 LEU C C   1 
ATOM 7551 O O   . LEU C 1 200 ? 57.110  -18.843 222.770 1.00 14.81  ? 200 LEU C O   1 
ATOM 7552 C CB  . LEU C 1 200 ? 54.720  -18.399 221.029 1.00 15.35  ? 200 LEU C CB  1 
ATOM 7553 C CG  . LEU C 1 200 ? 53.834  -19.559 221.494 1.00 21.12  ? 200 LEU C CG  1 
ATOM 7554 C CD1 . LEU C 1 200 ? 52.516  -19.010 221.959 1.00 16.91  ? 200 LEU C CD1 1 
ATOM 7555 C CD2 . LEU C 1 200 ? 53.612  -20.564 220.361 1.00 25.29  ? 200 LEU C CD2 1 
ATOM 7556 N N   . GLU C 1 201 ? 55.543  -18.438 224.321 1.00 11.18  ? 201 GLU C N   1 
ATOM 7557 C CA  . GLU C 1 201 ? 56.190  -19.196 225.383 1.00 12.98  ? 201 GLU C CA  1 
ATOM 7558 C C   . GLU C 1 201 ? 55.260  -20.300 225.870 1.00 15.70  ? 201 GLU C C   1 
ATOM 7559 O O   . GLU C 1 201 ? 54.066  -20.065 226.073 1.00 15.13  ? 201 GLU C O   1 
ATOM 7560 C CB  . GLU C 1 201 ? 56.468  -18.264 226.550 1.00 14.10  ? 201 GLU C CB  1 
ATOM 7561 C CG  . GLU C 1 201 ? 57.052  -18.963 227.766 1.00 15.19  ? 201 GLU C CG  1 
ATOM 7562 C CD  . GLU C 1 201 ? 57.245  -18.011 228.925 1.00 21.65  ? 201 GLU C CD  1 
ATOM 7563 O OE1 . GLU C 1 201 ? 56.934  -16.810 228.769 1.00 17.07  ? 201 GLU C OE1 1 
ATOM 7564 O OE2 . GLU C 1 201 ? 57.714  -18.463 229.991 1.00 19.04  ? 201 GLU C OE2 1 
ATOM 7565 N N   . LEU C 1 202 ? 55.781  -21.512 226.010 1.00 14.32  ? 202 LEU C N   1 
ATOM 7566 C CA  . LEU C 1 202 ? 54.964  -22.613 226.508 1.00 16.20  ? 202 LEU C CA  1 
ATOM 7567 C C   . LEU C 1 202 ? 55.406  -22.802 227.950 1.00 17.53  ? 202 LEU C C   1 
ATOM 7568 O O   . LEU C 1 202 ? 55.095  -21.973 228.802 1.00 20.72  ? 202 LEU C O   1 
ATOM 7569 C CB  . LEU C 1 202 ? 55.175  -23.882 225.679 1.00 17.12  ? 202 LEU C CB  1 
ATOM 7570 C CG  . LEU C 1 202 ? 54.804  -23.839 224.190 1.00 21.79  ? 202 LEU C CG  1 
ATOM 7571 C CD1 . LEU C 1 202 ? 54.672  -25.260 223.672 1.00 19.82  ? 202 LEU C CD1 1 
ATOM 7572 C CD2 . LEU C 1 202 ? 53.514  -23.088 223.961 1.00 23.36  ? 202 LEU C CD2 1 
ATOM 7573 N N   . ASP C 1 203 ? 56.091  -23.896 228.240 1.00 17.78  ? 203 ASP C N   1 
ATOM 7574 C CA  . ASP C 1 203 ? 56.608  -24.123 229.579 1.00 19.22  ? 203 ASP C CA  1 
ATOM 7575 C C   . ASP C 1 203 ? 58.133  -24.150 229.375 1.00 21.13  ? 203 ASP C C   1 
ATOM 7576 O O   . ASP C 1 203 ? 58.696  -25.165 228.960 1.00 21.86  ? 203 ASP C O   1 
ATOM 7577 C CB  . ASP C 1 203 ? 56.095  -25.449 230.143 1.00 18.76  ? 203 ASP C CB  1 
ATOM 7578 C CG  . ASP C 1 203 ? 56.745  -25.821 231.472 1.00 25.35  ? 203 ASP C CG  1 
ATOM 7579 O OD1 . ASP C 1 203 ? 57.495  -25.009 232.040 1.00 27.16  ? 203 ASP C OD1 1 
ATOM 7580 O OD2 . ASP C 1 203 ? 56.503  -26.938 231.957 1.00 25.34  ? 203 ASP C OD2 1 
ATOM 7581 N N   . LYS C 1 204 ? 58.788  -23.025 229.659 1.00 21.47  ? 204 LYS C N   1 
ATOM 7582 C CA  . LYS C 1 204 ? 60.235  -22.887 229.481 1.00 23.08  ? 204 LYS C CA  1 
ATOM 7583 C C   . LYS C 1 204 ? 61.105  -23.825 230.322 1.00 23.97  ? 204 LYS C C   1 
ATOM 7584 O O   . LYS C 1 204 ? 62.320  -23.889 230.106 1.00 25.24  ? 204 LYS C O   1 
ATOM 7585 C CB  . LYS C 1 204 ? 60.672  -21.428 229.690 1.00 17.89  ? 204 LYS C CB  1 
ATOM 7586 C CG  . LYS C 1 204 ? 60.596  -20.963 231.130 1.00 18.05  ? 204 LYS C CG  1 
ATOM 7587 C CD  . LYS C 1 204 ? 61.004  -19.503 231.249 1.00 21.50  ? 204 LYS C CD  1 
ATOM 7588 C CE  . LYS C 1 204 ? 60.921  -19.014 232.691 1.00 24.17  ? 204 LYS C CE  1 
ATOM 7589 N NZ  . LYS C 1 204 ? 61.341  -17.591 232.752 1.00 23.98  ? 204 LYS C NZ  1 
ATOM 7590 N N   . THR C 1 205 ? 60.500  -24.539 231.275 1.00 23.72  ? 205 THR C N   1 
ATOM 7591 C CA  . THR C 1 205 ? 61.253  -25.488 232.101 1.00 25.88  ? 205 THR C CA  1 
ATOM 7592 C C   . THR C 1 205 ? 61.365  -26.885 231.452 1.00 25.75  ? 205 THR C C   1 
ATOM 7593 O O   . THR C 1 205 ? 62.085  -27.743 231.958 1.00 25.55  ? 205 THR C O   1 
ATOM 7594 C CB  . THR C 1 205 ? 60.696  -25.594 233.561 1.00 26.32  ? 205 THR C CB  1 
ATOM 7595 O OG1 . THR C 1 205 ? 59.380  -26.166 233.568 1.00 32.85  ? 205 THR C OG1 1 
ATOM 7596 C CG2 . THR C 1 205 ? 60.629  -24.224 234.188 1.00 27.25  ? 205 THR C CG2 1 
ATOM 7597 N N   . VAL C 1 206 ? 60.646  -27.116 230.352 1.00 26.28  ? 206 VAL C N   1 
ATOM 7598 C CA  . VAL C 1 206 ? 60.712  -28.402 229.639 1.00 30.15  ? 206 VAL C CA  1 
ATOM 7599 C C   . VAL C 1 206 ? 62.097  -28.464 228.990 1.00 31.54  ? 206 VAL C C   1 
ATOM 7600 O O   . VAL C 1 206 ? 62.499  -27.562 228.244 1.00 28.52  ? 206 VAL C O   1 
ATOM 7601 C CB  . VAL C 1 206 ? 59.582  -28.556 228.559 1.00 30.73  ? 206 VAL C CB  1 
ATOM 7602 C CG1 . VAL C 1 206 ? 59.850  -29.753 227.656 1.00 29.81  ? 206 VAL C CG1 1 
ATOM 7603 C CG2 . VAL C 1 206 ? 58.240  -28.746 229.236 1.00 23.48  ? 206 VAL C CG2 1 
ATOM 7604 N N   . GLU C 1 207 ? 62.809  -29.555 229.243 1.00 34.12  ? 207 GLU C N   1 
ATOM 7605 C CA  . GLU C 1 207 ? 64.168  -29.683 228.742 1.00 35.17  ? 207 GLU C CA  1 
ATOM 7606 C C   . GLU C 1 207 ? 64.418  -29.956 227.262 1.00 32.27  ? 207 GLU C C   1 
ATOM 7607 O O   . GLU C 1 207 ? 65.410  -29.454 226.703 1.00 30.94  ? 207 GLU C O   1 
ATOM 7608 C CB  . GLU C 1 207 ? 64.944  -30.686 229.587 1.00 42.13  ? 207 GLU C CB  1 
ATOM 7609 C CG  . GLU C 1 207 ? 66.438  -30.452 229.506 1.00 59.92  ? 207 GLU C CG  1 
ATOM 7610 C CD  . GLU C 1 207 ? 67.227  -31.438 230.327 1.00 75.04  ? 207 GLU C CD  1 
ATOM 7611 O OE1 . GLU C 1 207 ? 66.853  -31.669 231.504 1.00 81.02  ? 207 GLU C OE1 1 
ATOM 7612 O OE2 . GLU C 1 207 ? 68.225  -31.975 229.789 1.00 80.72  ? 207 GLU C OE2 1 
ATOM 7613 N N   . HIS C 1 208 ? 63.545  -30.728 226.618 1.00 26.52  ? 208 HIS C N   1 
ATOM 7614 C CA  . HIS C 1 208 ? 63.772  -31.049 225.215 1.00 25.12  ? 208 HIS C CA  1 
ATOM 7615 C C   . HIS C 1 208 ? 62.983  -30.230 224.220 1.00 24.18  ? 208 HIS C C   1 
ATOM 7616 O O   . HIS C 1 208 ? 62.496  -30.748 223.225 1.00 25.70  ? 208 HIS C O   1 
ATOM 7617 C CB  . HIS C 1 208 ? 63.585  -32.540 224.978 1.00 25.94  ? 208 HIS C CB  1 
ATOM 7618 C CG  . HIS C 1 208 ? 64.516  -33.381 225.791 1.00 29.40  ? 208 HIS C CG  1 
ATOM 7619 N ND1 . HIS C 1 208 ? 65.866  -33.469 225.520 1.00 32.74  ? 208 HIS C ND1 1 
ATOM 7620 C CD2 . HIS C 1 208 ? 64.305  -34.123 226.904 1.00 26.89  ? 208 HIS C CD2 1 
ATOM 7621 C CE1 . HIS C 1 208 ? 66.448  -34.225 226.435 1.00 26.97  ? 208 HIS C CE1 1 
ATOM 7622 N NE2 . HIS C 1 208 ? 65.523  -34.634 227.285 1.00 30.19  ? 208 HIS C NE2 1 
ATOM 7623 N N   . LEU C 1 209 ? 62.942  -28.926 224.458 1.00 23.80  ? 209 LEU C N   1 
ATOM 7624 C CA  . LEU C 1 209 ? 62.238  -27.988 223.590 1.00 23.03  ? 209 LEU C CA  1 
ATOM 7625 C C   . LEU C 1 209 ? 62.876  -26.614 223.698 1.00 23.25  ? 209 LEU C C   1 
ATOM 7626 O O   . LEU C 1 209 ? 63.518  -26.293 224.715 1.00 21.31  ? 209 LEU C O   1 
ATOM 7627 C CB  . LEU C 1 209 ? 60.784  -27.827 224.043 1.00 22.90  ? 209 LEU C CB  1 
ATOM 7628 C CG  . LEU C 1 209 ? 59.737  -28.860 223.652 1.00 22.55  ? 209 LEU C CG  1 
ATOM 7629 C CD1 . LEU C 1 209 ? 58.360  -28.408 224.137 1.00 21.87  ? 209 LEU C CD1 1 
ATOM 7630 C CD2 . LEU C 1 209 ? 59.747  -29.013 222.157 1.00 19.45  ? 209 LEU C CD2 1 
ATOM 7631 N N   . PRO C 1 210 ? 62.766  -25.807 222.627 1.00 20.90  ? 210 PRO C N   1 
ATOM 7632 C CA  . PRO C 1 210 ? 63.315  -24.445 222.631 1.00 20.53  ? 210 PRO C CA  1 
ATOM 7633 C C   . PRO C 1 210 ? 62.462  -23.721 223.700 1.00 17.59  ? 210 PRO C C   1 
ATOM 7634 O O   . PRO C 1 210 ? 61.315  -24.130 223.958 1.00 14.52  ? 210 PRO C O   1 
ATOM 7635 C CB  . PRO C 1 210 ? 62.947  -23.921 221.235 1.00 23.97  ? 210 PRO C CB  1 
ATOM 7636 C CG  . PRO C 1 210 ? 62.855  -25.153 220.405 1.00 24.28  ? 210 PRO C CG  1 
ATOM 7637 C CD  . PRO C 1 210 ? 62.198  -26.152 221.312 1.00 21.20  ? 210 PRO C CD  1 
ATOM 7638 N N   . THR C 1 211 ? 62.983  -22.657 224.308 1.00 18.18  ? 211 THR C N   1 
ATOM 7639 C CA  . THR C 1 211 ? 62.216  -21.947 225.336 1.00 17.27  ? 211 THR C CA  1 
ATOM 7640 C C   . THR C 1 211 ? 61.152  -20.983 224.796 1.00 17.54  ? 211 THR C C   1 
ATOM 7641 O O   . THR C 1 211 ? 60.303  -20.517 225.555 1.00 18.81  ? 211 THR C O   1 
ATOM 7642 C CB  . THR C 1 211 ? 63.154  -21.189 226.316 1.00 19.47  ? 211 THR C CB  1 
ATOM 7643 O OG1 . THR C 1 211 ? 63.947  -20.234 225.591 1.00 18.57  ? 211 THR C OG1 1 
ATOM 7644 C CG2 . THR C 1 211 ? 64.091  -22.169 227.015 1.00 17.23  ? 211 THR C CG2 1 
ATOM 7645 N N   . ALA C 1 212 ? 61.182  -20.694 223.494 1.00 16.68  ? 212 ALA C N   1 
ATOM 7646 C CA  . ALA C 1 212 ? 60.226  -19.759 222.890 1.00 15.42  ? 212 ALA C CA  1 
ATOM 7647 C C   . ALA C 1 212 ? 60.296  -19.778 221.371 1.00 15.85  ? 212 ALA C C   1 
ATOM 7648 O O   . ALA C 1 212 ? 61.257  -20.286 220.780 1.00 14.57  ? 212 ALA C O   1 
ATOM 7649 C CB  . ALA C 1 212 ? 60.483  -18.317 223.403 1.00 15.32  ? 212 ALA C CB  1 
ATOM 7650 N N   . TRP C 1 213 ? 59.280  -19.205 220.741 1.00 15.16  ? 213 TRP C N   1 
ATOM 7651 C CA  . TRP C 1 213 ? 59.215  -19.142 219.288 1.00 17.95  ? 213 TRP C CA  1 
ATOM 7652 C C   . TRP C 1 213 ? 58.834  -17.728 218.899 1.00 18.53  ? 213 TRP C C   1 
ATOM 7653 O O   . TRP C 1 213 ? 58.197  -17.012 219.672 1.00 16.75  ? 213 TRP C O   1 
ATOM 7654 C CB  . TRP C 1 213 ? 58.154  -20.112 218.733 1.00 18.06  ? 213 TRP C CB  1 
ATOM 7655 C CG  . TRP C 1 213 ? 58.519  -21.579 218.858 1.00 17.15  ? 213 TRP C CG  1 
ATOM 7656 C CD1 . TRP C 1 213 ? 59.043  -22.376 217.881 1.00 13.02  ? 213 TRP C CD1 1 
ATOM 7657 C CD2 . TRP C 1 213 ? 58.388  -22.408 220.028 1.00 16.07  ? 213 TRP C CD2 1 
ATOM 7658 N NE1 . TRP C 1 213 ? 59.250  -23.649 218.365 1.00 13.21  ? 213 TRP C NE1 1 
ATOM 7659 C CE2 . TRP C 1 213 ? 58.855  -23.701 219.676 1.00 21.26  ? 213 TRP C CE2 1 
ATOM 7660 C CE3 . TRP C 1 213 ? 57.913  -22.188 221.335 1.00 17.50  ? 213 TRP C CE3 1 
ATOM 7661 C CZ2 . TRP C 1 213 ? 58.869  -24.769 220.586 1.00 16.14  ? 213 TRP C CZ2 1 
ATOM 7662 C CZ3 . TRP C 1 213 ? 57.926  -23.243 222.239 1.00 18.97  ? 213 TRP C CZ3 1 
ATOM 7663 C CH2 . TRP C 1 213 ? 58.400  -24.525 221.857 1.00 22.87  ? 213 TRP C CH2 1 
ATOM 7664 N N   . GLN C 1 214 ? 59.238  -17.325 217.706 1.00 16.40  ? 214 GLN C N   1 
ATOM 7665 C CA  . GLN C 1 214 ? 58.908  -16.011 217.201 1.00 17.70  ? 214 GLN C CA  1 
ATOM 7666 C C   . GLN C 1 214 ? 57.820  -16.295 216.185 1.00 18.25  ? 214 GLN C C   1 
ATOM 7667 O O   . GLN C 1 214 ? 58.100  -16.916 215.166 1.00 20.82  ? 214 GLN C O   1 
ATOM 7668 C CB  . GLN C 1 214 ? 60.123  -15.410 216.501 1.00 23.03  ? 214 GLN C CB  1 
ATOM 7669 C CG  . GLN C 1 214 ? 59.863  -14.026 215.978 1.00 25.37  ? 214 GLN C CG  1 
ATOM 7670 C CD  . GLN C 1 214 ? 61.052  -13.429 215.257 1.00 31.83  ? 214 GLN C CD  1 
ATOM 7671 O OE1 . GLN C 1 214 ? 60.924  -12.386 214.625 1.00 31.90  ? 214 GLN C OE1 1 
ATOM 7672 N NE2 . GLN C 1 214 ? 62.216  -14.060 215.372 1.00 23.15  ? 214 GLN C NE2 1 
ATOM 7673 N N   . VAL C 1 215 ? 56.586  -15.897 216.470 1.00 17.01  ? 215 VAL C N   1 
ATOM 7674 C CA  . VAL C 1 215 ? 55.480  -16.170 215.554 1.00 18.54  ? 215 VAL C CA  1 
ATOM 7675 C C   . VAL C 1 215 ? 54.782  -14.912 215.069 1.00 19.13  ? 215 VAL C C   1 
ATOM 7676 O O   . VAL C 1 215 ? 54.961  -13.833 215.642 1.00 20.78  ? 215 VAL C O   1 
ATOM 7677 C CB  . VAL C 1 215 ? 54.413  -17.116 216.206 1.00 15.71  ? 215 VAL C CB  1 
ATOM 7678 C CG1 . VAL C 1 215 ? 55.077  -18.394 216.698 1.00 17.63  ? 215 VAL C CG1 1 
ATOM 7679 C CG2 . VAL C 1 215 ? 53.693  -16.417 217.359 1.00 12.16  ? 215 VAL C CG2 1 
ATOM 7680 N N   . HIS C 1 216 ? 53.987  -15.054 214.008 1.00 20.28  ? 216 HIS C N   1 
ATOM 7681 C CA  . HIS C 1 216 ? 53.231  -13.933 213.455 1.00 19.37  ? 216 HIS C CA  1 
ATOM 7682 C C   . HIS C 1 216 ? 51.983  -13.625 214.292 1.00 20.62  ? 216 HIS C C   1 
ATOM 7683 O O   . HIS C 1 216 ? 51.199  -14.525 214.611 1.00 19.16  ? 216 HIS C O   1 
ATOM 7684 C CB  . HIS C 1 216 ? 52.815  -14.235 212.015 1.00 22.01  ? 216 HIS C CB  1 
ATOM 7685 C CG  . HIS C 1 216 ? 52.321  -13.029 211.280 1.00 31.22  ? 216 HIS C CG  1 
ATOM 7686 N ND1 . HIS C 1 216 ? 51.058  -12.504 211.470 1.00 31.04  ? 216 HIS C ND1 1 
ATOM 7687 C CD2 . HIS C 1 216 ? 52.943  -12.204 210.402 1.00 30.81  ? 216 HIS C CD2 1 
ATOM 7688 C CE1 . HIS C 1 216 ? 50.930  -11.401 210.754 1.00 28.31  ? 216 HIS C CE1 1 
ATOM 7689 N NE2 . HIS C 1 216 ? 52.057  -11.199 210.096 1.00 32.77  ? 216 HIS C NE2 1 
ATOM 7690 N N   . ARG C 1 217 ? 51.766  -12.346 214.576 1.00 19.66  ? 217 ARG C N   1 
ATOM 7691 C CA  . ARG C 1 217 ? 50.631  -11.890 215.367 1.00 24.44  ? 217 ARG C CA  1 
ATOM 7692 C C   . ARG C 1 217 ? 49.263  -12.395 214.897 1.00 25.59  ? 217 ARG C C   1 
ATOM 7693 O O   . ARG C 1 217 ? 48.420  -12.749 215.713 1.00 24.79  ? 217 ARG C O   1 
ATOM 7694 C CB  . ARG C 1 217 ? 50.613  -10.368 215.391 1.00 28.64  ? 217 ARG C CB  1 
ATOM 7695 C CG  . ARG C 1 217 ? 49.492  -9.788  216.206 1.00 31.36  ? 217 ARG C CG  1 
ATOM 7696 C CD  . ARG C 1 217 ? 49.389  -8.309  215.953 1.00 46.57  ? 217 ARG C CD  1 
ATOM 7697 N NE  . ARG C 1 217 ? 48.021  -7.810  216.092 1.00 59.57  ? 217 ARG C NE  1 
ATOM 7698 C CZ  . ARG C 1 217 ? 47.410  -7.588  217.254 1.00 61.98  ? 217 ARG C CZ  1 
ATOM 7699 N NH1 . ARG C 1 217 ? 48.032  -7.820  218.405 1.00 64.99  ? 217 ARG C NH1 1 
ATOM 7700 N NH2 . ARG C 1 217 ? 46.166  -7.132  217.265 1.00 59.99  ? 217 ARG C NH2 1 
ATOM 7701 N N   . ASP C 1 218 ? 49.019  -12.384 213.589 1.00 26.42  ? 218 ASP C N   1 
ATOM 7702 C CA  . ASP C 1 218 ? 47.727  -12.844 213.065 1.00 28.29  ? 218 ASP C CA  1 
ATOM 7703 C C   . ASP C 1 218 ? 47.496  -14.341 213.270 1.00 27.59  ? 218 ASP C C   1 
ATOM 7704 O O   . ASP C 1 218 ? 46.376  -14.771 213.546 1.00 29.49  ? 218 ASP C O   1 
ATOM 7705 C CB  . ASP C 1 218 ? 47.547  -12.434 211.599 1.00 29.24  ? 218 ASP C CB  1 
ATOM 7706 C CG  . ASP C 1 218 ? 47.409  -10.921 211.430 1.00 30.77  ? 218 ASP C CG  1 
ATOM 7707 O OD1 . ASP C 1 218 ? 46.889  -10.238 212.340 1.00 35.55  ? 218 ASP C OD1 1 
ATOM 7708 O OD2 . ASP C 1 218 ? 47.840  -10.406 210.386 1.00 40.94  ? 218 ASP C OD2 1 
ATOM 7709 N N   . TRP C 1 219 ? 48.559  -15.130 213.159 1.00 25.91  ? 219 TRP C N   1 
ATOM 7710 C CA  . TRP C 1 219 ? 48.471  -16.567 213.393 1.00 23.83  ? 219 TRP C CA  1 
ATOM 7711 C C   . TRP C 1 219 ? 48.153  -16.797 214.881 1.00 25.14  ? 219 TRP C C   1 
ATOM 7712 O O   . TRP C 1 219 ? 47.226  -17.527 215.226 1.00 26.21  ? 219 TRP C O   1 
ATOM 7713 C CB  . TRP C 1 219 ? 49.801  -17.238 213.030 1.00 22.67  ? 219 TRP C CB  1 
ATOM 7714 C CG  . TRP C 1 219 ? 49.860  -18.708 213.347 1.00 27.38  ? 219 TRP C CG  1 
ATOM 7715 C CD1 . TRP C 1 219 ? 49.411  -19.741 212.561 1.00 30.54  ? 219 TRP C CD1 1 
ATOM 7716 C CD2 . TRP C 1 219 ? 50.415  -19.320 214.530 1.00 26.55  ? 219 TRP C CD2 1 
ATOM 7717 N NE1 . TRP C 1 219 ? 49.655  -20.952 213.179 1.00 27.64  ? 219 TRP C NE1 1 
ATOM 7718 C CE2 . TRP C 1 219 ? 50.269  -20.723 214.383 1.00 26.39  ? 219 TRP C CE2 1 
ATOM 7719 C CE3 . TRP C 1 219 ? 51.016  -18.814 215.695 1.00 22.28  ? 219 TRP C CE3 1 
ATOM 7720 C CZ2 . TRP C 1 219 ? 50.710  -21.635 215.362 1.00 26.26  ? 219 TRP C CZ2 1 
ATOM 7721 C CZ3 . TRP C 1 219 ? 51.453  -19.721 216.672 1.00 23.49  ? 219 TRP C CZ3 1 
ATOM 7722 C CH2 . TRP C 1 219 ? 51.297  -21.116 216.494 1.00 25.46  ? 219 TRP C CH2 1 
ATOM 7723 N N   . PHE C 1 220 ? 48.900  -16.129 215.756 1.00 24.67  ? 220 PHE C N   1 
ATOM 7724 C CA  . PHE C 1 220 ? 48.704  -16.251 217.194 1.00 21.83  ? 220 PHE C CA  1 
ATOM 7725 C C   . PHE C 1 220 ? 47.280  -15.867 217.600 1.00 23.99  ? 220 PHE C C   1 
ATOM 7726 O O   . PHE C 1 220 ? 46.640  -16.570 218.387 1.00 22.10  ? 220 PHE C O   1 
ATOM 7727 C CB  . PHE C 1 220 ? 49.728  -15.389 217.950 1.00 19.34  ? 220 PHE C CB  1 
ATOM 7728 C CG  . PHE C 1 220 ? 49.543  -15.387 219.450 1.00 17.56  ? 220 PHE C CG  1 
ATOM 7729 C CD1 . PHE C 1 220 ? 49.980  -16.463 220.222 1.00 17.73  ? 220 PHE C CD1 1 
ATOM 7730 C CD2 . PHE C 1 220 ? 48.912  -14.316 220.088 1.00 18.21  ? 220 PHE C CD2 1 
ATOM 7731 C CE1 . PHE C 1 220 ? 49.791  -16.471 221.615 1.00 16.83  ? 220 PHE C CE1 1 
ATOM 7732 C CE2 . PHE C 1 220 ? 48.716  -14.312 221.476 1.00 17.31  ? 220 PHE C CE2 1 
ATOM 7733 C CZ  . PHE C 1 220 ? 49.156  -15.392 222.240 1.00 15.14  ? 220 PHE C CZ  1 
ATOM 7734 N N   . ASN C 1 221 ? 46.774  -14.760 217.065 1.00 22.48  ? 221 ASN C N   1 
ATOM 7735 C CA  . ASN C 1 221 ? 45.430  -14.319 217.428 1.00 24.96  ? 221 ASN C CA  1 
ATOM 7736 C C   . ASN C 1 221 ? 44.299  -15.215 216.941 1.00 26.53  ? 221 ASN C C   1 
ATOM 7737 O O   . ASN C 1 221 ? 43.169  -15.117 217.429 1.00 30.46  ? 221 ASN C O   1 
ATOM 7738 C CB  . ASN C 1 221 ? 45.186  -12.872 216.997 1.00 26.22  ? 221 ASN C CB  1 
ATOM 7739 C CG  . ASN C 1 221 ? 45.898  -11.865 217.903 1.00 35.12  ? 221 ASN C CG  1 
ATOM 7740 O OD1 . ASN C 1 221 ? 46.368  -10.833 217.435 1.00 43.57  ? 221 ASN C OD1 1 
ATOM 7741 N ND2 . ASN C 1 221 ? 45.980  -12.166 219.202 1.00 34.10  ? 221 ASN C ND2 1 
ATOM 7742 N N   . ASP C 1 222 ? 44.613  -16.116 216.017 1.00 25.84  ? 222 ASP C N   1 
ATOM 7743 C CA  . ASP C 1 222 ? 43.617  -17.025 215.462 1.00 28.33  ? 222 ASP C CA  1 
ATOM 7744 C C   . ASP C 1 222 ? 43.649  -18.446 216.023 1.00 28.46  ? 222 ASP C C   1 
ATOM 7745 O O   . ASP C 1 222 ? 42.957  -19.320 215.512 1.00 30.95  ? 222 ASP C O   1 
ATOM 7746 C CB  . ASP C 1 222 ? 43.763  -17.087 213.941 1.00 34.10  ? 222 ASP C CB  1 
ATOM 7747 C CG  . ASP C 1 222 ? 42.888  -16.066 213.225 1.00 47.92  ? 222 ASP C CG  1 
ATOM 7748 O OD1 . ASP C 1 222 ? 42.900  -14.864 213.592 1.00 49.91  ? 222 ASP C OD1 1 
ATOM 7749 O OD2 . ASP C 1 222 ? 42.185  -16.480 212.280 1.00 57.92  ? 222 ASP C OD2 1 
ATOM 7750 N N   . LEU C 1 223 ? 44.455  -18.700 217.046 1.00 26.67  ? 223 LEU C N   1 
ATOM 7751 C CA  . LEU C 1 223 ? 44.521  -20.044 217.603 1.00 26.75  ? 223 LEU C CA  1 
ATOM 7752 C C   . LEU C 1 223 ? 43.167  -20.426 218.164 1.00 25.73  ? 223 LEU C C   1 
ATOM 7753 O O   . LEU C 1 223 ? 42.555  -19.656 218.903 1.00 23.65  ? 223 LEU C O   1 
ATOM 7754 C CB  . LEU C 1 223 ? 45.613  -20.157 218.676 1.00 25.16  ? 223 LEU C CB  1 
ATOM 7755 C CG  . LEU C 1 223 ? 47.036  -20.033 218.134 1.00 27.23  ? 223 LEU C CG  1 
ATOM 7756 C CD1 . LEU C 1 223 ? 48.013  -20.241 219.262 1.00 26.35  ? 223 LEU C CD1 1 
ATOM 7757 C CD2 . LEU C 1 223 ? 47.268  -21.050 217.032 1.00 27.18  ? 223 LEU C CD2 1 
ATOM 7758 N N   . ALA C 1 224 ? 42.705  -21.617 217.800 1.00 25.39  ? 224 ALA C N   1 
ATOM 7759 C CA  . ALA C 1 224 ? 41.405  -22.114 218.246 1.00 24.60  ? 224 ALA C CA  1 
ATOM 7760 C C   . ALA C 1 224 ? 41.546  -22.819 219.580 1.00 23.16  ? 224 ALA C C   1 
ATOM 7761 O O   . ALA C 1 224 ? 41.371  -24.030 219.678 1.00 23.87  ? 224 ALA C O   1 
ATOM 7762 C CB  . ALA C 1 224 ? 40.822  -23.058 217.208 1.00 22.49  ? 224 ALA C CB  1 
ATOM 7763 N N   . LEU C 1 225 ? 41.860  -22.051 220.612 1.00 20.41  ? 225 LEU C N   1 
ATOM 7764 C CA  . LEU C 1 225 ? 42.050  -22.605 221.940 1.00 20.87  ? 225 LEU C CA  1 
ATOM 7765 C C   . LEU C 1 225 ? 41.389  -21.691 222.953 1.00 18.72  ? 225 LEU C C   1 
ATOM 7766 O O   . LEU C 1 225 ? 41.053  -20.553 222.633 1.00 18.65  ? 225 LEU C O   1 
ATOM 7767 C CB  . LEU C 1 225 ? 43.545  -22.670 222.254 1.00 18.73  ? 225 LEU C CB  1 
ATOM 7768 C CG  . LEU C 1 225 ? 44.422  -23.601 221.419 1.00 25.12  ? 225 LEU C CG  1 
ATOM 7769 C CD1 . LEU C 1 225 ? 45.870  -23.344 221.775 1.00 22.23  ? 225 LEU C CD1 1 
ATOM 7770 C CD2 . LEU C 1 225 ? 44.059  -25.066 221.692 1.00 17.01  ? 225 LEU C CD2 1 
ATOM 7771 N N   . PRO C 1 226 ? 41.122  -22.198 224.165 1.00 16.91  ? 226 PRO C N   1 
ATOM 7772 C CA  . PRO C 1 226 ? 40.503  -21.336 225.177 1.00 17.15  ? 226 PRO C CA  1 
ATOM 7773 C C   . PRO C 1 226 ? 41.558  -20.256 225.478 1.00 19.58  ? 226 PRO C C   1 
ATOM 7774 O O   . PRO C 1 226 ? 42.762  -20.555 225.471 1.00 16.93  ? 226 PRO C O   1 
ATOM 7775 C CB  . PRO C 1 226 ? 40.346  -22.279 226.375 1.00 14.03  ? 226 PRO C CB  1 
ATOM 7776 C CG  . PRO C 1 226 ? 40.220  -23.624 225.740 1.00 12.73  ? 226 PRO C CG  1 
ATOM 7777 C CD  . PRO C 1 226 ? 41.258  -23.576 224.652 1.00 14.98  ? 226 PRO C CD  1 
ATOM 7778 N N   . TRP C 1 227 ? 41.130  -19.035 225.795 1.00 18.73  ? 227 TRP C N   1 
ATOM 7779 C CA  . TRP C 1 227 ? 42.086  -17.961 226.079 1.00 18.27  ? 227 TRP C CA  1 
ATOM 7780 C C   . TRP C 1 227 ? 41.609  -17.039 227.191 1.00 17.79  ? 227 TRP C C   1 
ATOM 7781 O O   . TRP C 1 227 ? 40.434  -17.038 227.539 1.00 18.88  ? 227 TRP C O   1 
ATOM 7782 C CB  . TRP C 1 227 ? 42.317  -17.125 224.815 1.00 18.68  ? 227 TRP C CB  1 
ATOM 7783 C CG  . TRP C 1 227 ? 41.082  -16.358 224.370 1.00 25.80  ? 227 TRP C CG  1 
ATOM 7784 C CD1 . TRP C 1 227 ? 40.043  -16.829 223.602 1.00 22.11  ? 227 TRP C CD1 1 
ATOM 7785 C CD2 . TRP C 1 227 ? 40.754  -14.993 224.691 1.00 30.39  ? 227 TRP C CD2 1 
ATOM 7786 N NE1 . TRP C 1 227 ? 39.099  -15.845 223.437 1.00 30.23  ? 227 TRP C NE1 1 
ATOM 7787 C CE2 . TRP C 1 227 ? 39.507  -14.711 224.092 1.00 30.26  ? 227 TRP C CE2 1 
ATOM 7788 C CE3 . TRP C 1 227 ? 41.397  -13.984 225.429 1.00 30.07  ? 227 TRP C CE3 1 
ATOM 7789 C CZ2 . TRP C 1 227 ? 38.890  -13.460 224.206 1.00 32.09  ? 227 TRP C CZ2 1 
ATOM 7790 C CZ3 . TRP C 1 227 ? 40.780  -12.741 225.541 1.00 31.83  ? 227 TRP C CZ3 1 
ATOM 7791 C CH2 . TRP C 1 227 ? 39.540  -12.492 224.934 1.00 27.20  ? 227 TRP C CH2 1 
ATOM 7792 N N   . LYS C 1 228 ? 42.529  -16.266 227.754 1.00 16.43  ? 228 LYS C N   1 
ATOM 7793 C CA  . LYS C 1 228 ? 42.189  -15.298 228.791 1.00 18.97  ? 228 LYS C CA  1 
ATOM 7794 C C   . LYS C 1 228 ? 43.340  -14.309 228.925 1.00 20.88  ? 228 LYS C C   1 
ATOM 7795 O O   . LYS C 1 228 ? 44.384  -14.459 228.284 1.00 18.93  ? 228 LYS C O   1 
ATOM 7796 C CB  . LYS C 1 228 ? 41.921  -15.981 230.131 1.00 15.77  ? 228 LYS C CB  1 
ATOM 7797 C CG  . LYS C 1 228 ? 43.149  -16.513 230.849 1.00 13.25  ? 228 LYS C CG  1 
ATOM 7798 C CD  . LYS C 1 228 ? 42.715  -17.172 232.143 1.00 23.52  ? 228 LYS C CD  1 
ATOM 7799 C CE  . LYS C 1 228 ? 43.904  -17.588 232.990 1.00 21.61  ? 228 LYS C CE  1 
ATOM 7800 N NZ  . LYS C 1 228 ? 44.764  -16.424 233.354 1.00 26.86  ? 228 LYS C NZ  1 
ATOM 7801 N N   . HIS C 1 229 ? 43.127  -13.259 229.704 1.00 21.56  ? 229 HIS C N   1 
ATOM 7802 C CA  . HIS C 1 229 ? 44.176  -12.288 229.942 1.00 22.11  ? 229 HIS C CA  1 
ATOM 7803 C C   . HIS C 1 229 ? 44.902  -12.814 231.145 1.00 23.56  ? 229 HIS C C   1 
ATOM 7804 O O   . HIS C 1 229 ? 44.295  -13.518 231.955 1.00 22.75  ? 229 HIS C O   1 
ATOM 7805 C CB  . HIS C 1 229 ? 43.574  -10.936 230.317 1.00 21.41  ? 229 HIS C CB  1 
ATOM 7806 C CG  . HIS C 1 229 ? 42.898  -10.258 229.179 1.00 21.56  ? 229 HIS C CG  1 
ATOM 7807 N ND1 . HIS C 1 229 ? 43.567  -9.953  228.020 1.00 26.30  ? 229 HIS C ND1 1 
ATOM 7808 C CD2 . HIS C 1 229 ? 41.605  -9.905  228.977 1.00 27.50  ? 229 HIS C CD2 1 
ATOM 7809 C CE1 . HIS C 1 229 ? 42.719  -9.453  227.139 1.00 24.77  ? 229 HIS C CE1 1 
ATOM 7810 N NE2 . HIS C 1 229 ? 41.520  -9.410  227.696 1.00 33.51  ? 229 HIS C NE2 1 
ATOM 7811 N N   . GLU C 1 230 ? 46.197  -12.520 231.253 1.00 25.41  ? 230 GLU C N   1 
ATOM 7812 C CA  . GLU C 1 230 ? 46.952  -12.924 232.442 1.00 29.63  ? 230 GLU C CA  1 
ATOM 7813 C C   . GLU C 1 230 ? 46.171  -12.274 233.582 1.00 31.44  ? 230 GLU C C   1 
ATOM 7814 O O   . GLU C 1 230 ? 45.585  -11.206 233.400 1.00 33.28  ? 230 GLU C O   1 
ATOM 7815 C CB  . GLU C 1 230 ? 48.365  -12.315 232.423 1.00 30.59  ? 230 GLU C CB  1 
ATOM 7816 C CG  . GLU C 1 230 ? 49.071  -12.408 233.784 1.00 39.17  ? 230 GLU C CG  1 
ATOM 7817 C CD  . GLU C 1 230 ? 50.309  -11.528 233.899 1.00 54.43  ? 230 GLU C CD  1 
ATOM 7818 O OE1 . GLU C 1 230 ? 50.282  -10.363 233.424 1.00 52.32  ? 230 GLU C OE1 1 
ATOM 7819 O OE2 . GLU C 1 230 ? 51.312  -12.003 234.483 1.00 59.96  ? 230 GLU C OE2 1 
ATOM 7820 N N   . GLY C 1 231 ? 46.114  -12.897 234.746 1.00 33.69  ? 231 GLY C N   1 
ATOM 7821 C CA  . GLY C 1 231 ? 45.373  -12.248 235.821 1.00 32.52  ? 231 GLY C CA  1 
ATOM 7822 C C   . GLY C 1 231 ? 43.887  -12.572 235.857 1.00 31.17  ? 231 GLY C C   1 
ATOM 7823 O O   . GLY C 1 231 ? 43.305  -12.580 236.940 1.00 31.56  ? 231 GLY C O   1 
ATOM 7824 N N   . ALA C 1 232 ? 43.257  -12.782 234.699 1.00 28.18  ? 232 ALA C N   1 
ATOM 7825 C CA  . ALA C 1 232 ? 41.838  -13.147 234.675 1.00 26.38  ? 232 ALA C CA  1 
ATOM 7826 C C   . ALA C 1 232 ? 41.727  -14.541 235.309 1.00 28.87  ? 232 ALA C C   1 
ATOM 7827 O O   . ALA C 1 232 ? 42.659  -15.357 235.235 1.00 28.67  ? 232 ALA C O   1 
ATOM 7828 C CB  . ALA C 1 232 ? 41.285  -13.149 233.253 1.00 20.99  ? 232 ALA C CB  1 
ATOM 7829 N N   . GLN C 1 233 ? 40.596  -14.799 235.948 1.00 30.68  ? 233 GLN C N   1 
ATOM 7830 C CA  . GLN C 1 233 ? 40.380  -16.065 236.634 1.00 34.46  ? 233 GLN C CA  1 
ATOM 7831 C C   . GLN C 1 233 ? 39.851  -17.173 235.725 1.00 31.53  ? 233 GLN C C   1 
ATOM 7832 O O   . GLN C 1 233 ? 40.283  -18.313 235.841 1.00 32.67  ? 233 GLN C O   1 
ATOM 7833 C CB  . GLN C 1 233 ? 39.423  -15.845 237.812 1.00 44.81  ? 233 GLN C CB  1 
ATOM 7834 C CG  . GLN C 1 233 ? 39.359  -16.979 238.824 1.00 57.20  ? 233 GLN C CG  1 
ATOM 7835 C CD  . GLN C 1 233 ? 38.225  -16.790 239.831 1.00 67.07  ? 233 GLN C CD  1 
ATOM 7836 O OE1 . GLN C 1 233 ? 37.838  -15.659 240.155 1.00 69.57  ? 233 GLN C OE1 1 
ATOM 7837 N NE2 . GLN C 1 233 ? 37.665  -17.897 240.308 1.00 71.72  ? 233 GLN C NE2 1 
ATOM 7838 N N   . ASN C 1 234 ? 38.963  -16.827 234.799 1.00 26.58  ? 234 ASN C N   1 
ATOM 7839 C CA  . ASN C 1 234 ? 38.363  -17.819 233.919 1.00 27.12  ? 234 ASN C CA  1 
ATOM 7840 C C   . ASN C 1 234 ? 38.794  -17.746 232.459 1.00 27.08  ? 234 ASN C C   1 
ATOM 7841 O O   . ASN C 1 234 ? 39.299  -16.724 231.996 1.00 28.33  ? 234 ASN C O   1 
ATOM 7842 C CB  . ASN C 1 234 ? 36.833  -17.734 234.014 1.00 28.72  ? 234 ASN C CB  1 
ATOM 7843 C CG  . ASN C 1 234 ? 36.331  -17.895 235.442 1.00 31.41  ? 234 ASN C CG  1 
ATOM 7844 O OD1 . ASN C 1 234 ? 36.815  -18.743 236.205 1.00 29.84  ? 234 ASN C OD1 1 
ATOM 7845 N ND2 . ASN C 1 234 ? 35.362  -17.078 235.814 1.00 30.16  ? 234 ASN C ND2 1 
ATOM 7846 N N   . TRP C 1 235 ? 38.520  -18.822 231.731 1.00 24.53  ? 235 TRP C N   1 
ATOM 7847 C CA  . TRP C 1 235 ? 38.867  -18.937 230.326 1.00 22.02  ? 235 TRP C CA  1 
ATOM 7848 C C   . TRP C 1 235 ? 37.692  -18.637 229.416 1.00 23.05  ? 235 TRP C C   1 
ATOM 7849 O O   . TRP C 1 235 ? 36.559  -19.002 229.714 1.00 24.36  ? 235 TRP C O   1 
ATOM 7850 C CB  . TRP C 1 235 ? 39.368  -20.357 230.051 1.00 20.73  ? 235 TRP C CB  1 
ATOM 7851 C CG  . TRP C 1 235 ? 40.621  -20.673 230.794 1.00 16.94  ? 235 TRP C CG  1 
ATOM 7852 C CD1 . TRP C 1 235 ? 40.722  -21.176 232.061 1.00 16.16  ? 235 TRP C CD1 1 
ATOM 7853 C CD2 . TRP C 1 235 ? 41.963  -20.417 230.348 1.00 16.06  ? 235 TRP C CD2 1 
ATOM 7854 N NE1 . TRP C 1 235 ? 42.050  -21.238 232.438 1.00 20.02  ? 235 TRP C NE1 1 
ATOM 7855 C CE2 . TRP C 1 235 ? 42.827  -20.780 231.408 1.00 14.13  ? 235 TRP C CE2 1 
ATOM 7856 C CE3 . TRP C 1 235 ? 42.512  -19.913 229.162 1.00 18.23  ? 235 TRP C CE3 1 
ATOM 7857 C CZ2 . TRP C 1 235 ? 44.220  -20.650 231.310 1.00 14.39  ? 235 TRP C CZ2 1 
ATOM 7858 C CZ3 . TRP C 1 235 ? 43.901  -19.787 229.068 1.00 13.73  ? 235 TRP C CZ3 1 
ATOM 7859 C CH2 . TRP C 1 235 ? 44.734  -20.158 230.137 1.00 15.33  ? 235 TRP C CH2 1 
ATOM 7860 N N   . ASN C 1 236 ? 37.963  -17.962 228.309 1.00 20.29  ? 236 ASN C N   1 
ATOM 7861 C CA  . ASN C 1 236 ? 36.938  -17.649 227.325 1.00 20.84  ? 236 ASN C CA  1 
ATOM 7862 C C   . ASN C 1 236 ? 37.005  -18.783 226.327 1.00 21.04  ? 236 ASN C C   1 
ATOM 7863 O O   . ASN C 1 236 ? 38.085  -19.321 226.073 1.00 21.03  ? 236 ASN C O   1 
ATOM 7864 C CB  . ASN C 1 236 ? 37.238  -16.343 226.574 1.00 25.20  ? 236 ASN C CB  1 
ATOM 7865 C CG  . ASN C 1 236 ? 37.337  -15.148 227.486 1.00 28.72  ? 236 ASN C CG  1 
ATOM 7866 O OD1 . ASN C 1 236 ? 38.327  -14.418 227.453 1.00 31.38  ? 236 ASN C OD1 1 
ATOM 7867 N ND2 . ASN C 1 236 ? 36.319  -14.938 228.310 1.00 27.60  ? 236 ASN C ND2 1 
ATOM 7868 N N   . ASN C 1 237 ? 35.857  -19.153 225.774 1.00 19.06  ? 237 ASN C N   1 
ATOM 7869 C CA  . ASN C 1 237 ? 35.789  -20.219 224.784 1.00 16.72  ? 237 ASN C CA  1 
ATOM 7870 C C   . ASN C 1 237 ? 36.363  -21.552 225.257 1.00 17.08  ? 237 ASN C C   1 
ATOM 7871 O O   . ASN C 1 237 ? 36.980  -22.275 224.474 1.00 18.64  ? 237 ASN C O   1 
ATOM 7872 C CB  . ASN C 1 237 ? 36.492  -19.785 223.496 1.00 21.68  ? 237 ASN C CB  1 
ATOM 7873 C CG  . ASN C 1 237 ? 35.901  -18.523 222.910 1.00 30.47  ? 237 ASN C CG  1 
ATOM 7874 O OD1 . ASN C 1 237 ? 36.596  -17.526 222.744 1.00 38.67  ? 237 ASN C OD1 1 
ATOM 7875 N ND2 . ASN C 1 237 ? 34.611  -18.553 222.600 1.00 30.74  ? 237 ASN C ND2 1 
ATOM 7876 N N   . ALA C 1 238 ? 36.137  -21.901 226.521 1.00 15.17  ? 238 ALA C N   1 
ATOM 7877 C CA  . ALA C 1 238 ? 36.641  -23.154 227.058 1.00 18.28  ? 238 ALA C CA  1 
ATOM 7878 C C   . ALA C 1 238 ? 36.030  -24.349 226.323 1.00 20.69  ? 238 ALA C C   1 
ATOM 7879 O O   . ALA C 1 238 ? 36.616  -25.432 226.267 1.00 22.75  ? 238 ALA C O   1 
ATOM 7880 C CB  . ALA C 1 238 ? 36.366  -23.240 228.548 1.00 17.92  ? 238 ALA C CB  1 
ATOM 7881 N N   . GLU C 1 239 ? 34.869  -24.139 225.719 1.00 21.22  ? 239 GLU C N   1 
ATOM 7882 C CA  . GLU C 1 239 ? 34.201  -25.205 224.984 1.00 19.97  ? 239 GLU C CA  1 
ATOM 7883 C C   . GLU C 1 239 ? 35.041  -25.719 223.827 1.00 21.37  ? 239 GLU C C   1 
ATOM 7884 O O   . GLU C 1 239 ? 34.780  -26.796 223.321 1.00 20.82  ? 239 GLU C O   1 
ATOM 7885 C CB  . GLU C 1 239 ? 32.813  -24.776 224.489 1.00 19.33  ? 239 GLU C CB  1 
ATOM 7886 C CG  . GLU C 1 239 ? 32.804  -23.733 223.380 1.00 23.39  ? 239 GLU C CG  1 
ATOM 7887 C CD  . GLU C 1 239 ? 32.997  -22.286 223.873 1.00 36.74  ? 239 GLU C CD  1 
ATOM 7888 O OE1 . GLU C 1 239 ? 32.872  -22.009 225.094 1.00 30.49  ? 239 GLU C OE1 1 
ATOM 7889 O OE2 . GLU C 1 239 ? 33.262  -21.412 223.015 1.00 39.01  ? 239 GLU C OE2 1 
ATOM 7890 N N   . ARG C 1 240 ? 36.063  -24.975 223.414 1.00 20.70  ? 240 ARG C N   1 
ATOM 7891 C CA  . ARG C 1 240 ? 36.916  -25.436 222.318 1.00 21.65  ? 240 ARG C CA  1 
ATOM 7892 C C   . ARG C 1 240 ? 37.652  -26.742 222.618 1.00 19.40  ? 240 ARG C C   1 
ATOM 7893 O O   . ARG C 1 240 ? 38.098  -27.409 221.692 1.00 21.32  ? 240 ARG C O   1 
ATOM 7894 C CB  . ARG C 1 240 ? 37.923  -24.353 221.906 1.00 22.82  ? 240 ARG C CB  1 
ATOM 7895 C CG  . ARG C 1 240 ? 37.285  -23.228 221.119 1.00 34.11  ? 240 ARG C CG  1 
ATOM 7896 C CD  . ARG C 1 240 ? 38.238  -22.078 220.934 1.00 43.30  ? 240 ARG C CD  1 
ATOM 7897 N NE  . ARG C 1 240 ? 37.602  -20.945 220.264 1.00 41.35  ? 240 ARG C NE  1 
ATOM 7898 C CZ  . ARG C 1 240 ? 38.121  -19.719 220.196 1.00 40.28  ? 240 ARG C CZ  1 
ATOM 7899 N NH1 . ARG C 1 240 ? 39.300  -19.443 220.752 1.00 31.54  ? 240 ARG C NH1 1 
ATOM 7900 N NH2 . ARG C 1 240 ? 37.442  -18.751 219.592 1.00 42.47  ? 240 ARG C NH2 1 
ATOM 7901 N N   . LEU C 1 241 ? 37.789  -27.110 223.894 1.00 17.81  ? 241 LEU C N   1 
ATOM 7902 C CA  . LEU C 1 241 ? 38.479  -28.352 224.260 1.00 20.49  ? 241 LEU C CA  1 
ATOM 7903 C C   . LEU C 1 241 ? 37.543  -29.356 224.937 1.00 23.41  ? 241 LEU C C   1 
ATOM 7904 O O   . LEU C 1 241 ? 37.997  -30.345 225.518 1.00 22.97  ? 241 LEU C O   1 
ATOM 7905 C CB  . LEU C 1 241 ? 39.663  -28.069 225.194 1.00 19.66  ? 241 LEU C CB  1 
ATOM 7906 C CG  . LEU C 1 241 ? 40.829  -27.237 224.646 1.00 23.80  ? 241 LEU C CG  1 
ATOM 7907 C CD1 . LEU C 1 241 ? 41.913  -27.172 225.690 1.00 21.21  ? 241 LEU C CD1 1 
ATOM 7908 C CD2 . LEU C 1 241 ? 41.378  -27.832 223.368 1.00 15.42  ? 241 LEU C CD2 1 
ATOM 7909 N N   . VAL C 1 242 ? 36.240  -29.109 224.837 1.00 26.67  ? 242 VAL C N   1 
ATOM 7910 C CA  . VAL C 1 242 ? 35.238  -29.965 225.466 1.00 26.35  ? 242 VAL C CA  1 
ATOM 7911 C C   . VAL C 1 242 ? 34.148  -30.399 224.491 1.00 28.41  ? 242 VAL C C   1 
ATOM 7912 O O   . VAL C 1 242 ? 33.670  -29.610 223.678 1.00 30.62  ? 242 VAL C O   1 
ATOM 7913 C CB  . VAL C 1 242 ? 34.579  -29.237 226.642 1.00 28.61  ? 242 VAL C CB  1 
ATOM 7914 C CG1 . VAL C 1 242 ? 33.554  -30.130 227.303 1.00 31.74  ? 242 VAL C CG1 1 
ATOM 7915 C CG2 . VAL C 1 242 ? 35.637  -28.807 227.644 1.00 22.05  ? 242 VAL C CG2 1 
ATOM 7916 N N   . GLU C 1 243 ? 33.747  -31.657 224.585 1.00 28.51  ? 243 GLU C N   1 
ATOM 7917 C CA  . GLU C 1 243 ? 32.706  -32.187 223.713 1.00 30.41  ? 243 GLU C CA  1 
ATOM 7918 C C   . GLU C 1 243 ? 31.695  -32.861 224.620 1.00 29.38  ? 243 GLU C C   1 
ATOM 7919 O O   . GLU C 1 243 ? 32.052  -33.362 225.689 1.00 28.70  ? 243 GLU C O   1 
ATOM 7920 C CB  . GLU C 1 243 ? 33.287  -33.223 222.745 1.00 36.58  ? 243 GLU C CB  1 
ATOM 7921 C CG  . GLU C 1 243 ? 32.662  -33.215 221.360 1.00 52.36  ? 243 GLU C CG  1 
ATOM 7922 C CD  . GLU C 1 243 ? 32.964  -31.931 220.596 1.00 61.87  ? 243 GLU C CD  1 
ATOM 7923 O OE1 . GLU C 1 243 ? 34.034  -31.861 219.953 1.00 68.42  ? 243 GLU C OE1 1 
ATOM 7924 O OE2 . GLU C 1 243 ? 32.137  -30.993 220.634 1.00 67.96  ? 243 GLU C OE2 1 
ATOM 7925 N N   . PHE C 1 244 ? 30.429  -32.812 224.225 1.00 26.81  ? 244 PHE C N   1 
ATOM 7926 C CA  . PHE C 1 244 ? 29.357  -33.436 224.990 1.00 27.24  ? 244 PHE C CA  1 
ATOM 7927 C C   . PHE C 1 244 ? 28.770  -34.590 224.189 1.00 27.14  ? 244 PHE C C   1 
ATOM 7928 O O   . PHE C 1 244 ? 28.624  -34.490 222.971 1.00 25.73  ? 244 PHE C O   1 
ATOM 7929 C CB  . PHE C 1 244 ? 28.273  -32.408 225.331 1.00 24.35  ? 244 PHE C CB  1 
ATOM 7930 C CG  . PHE C 1 244 ? 28.665  -31.458 226.439 1.00 26.46  ? 244 PHE C CG  1 
ATOM 7931 C CD1 . PHE C 1 244 ? 28.507  -31.824 227.775 1.00 27.31  ? 244 PHE C CD1 1 
ATOM 7932 C CD2 . PHE C 1 244 ? 29.196  -30.200 226.148 1.00 24.42  ? 244 PHE C CD2 1 
ATOM 7933 C CE1 . PHE C 1 244 ? 28.872  -30.950 228.805 1.00 31.70  ? 244 PHE C CE1 1 
ATOM 7934 C CE2 . PHE C 1 244 ? 29.562  -29.322 227.177 1.00 21.13  ? 244 PHE C CE2 1 
ATOM 7935 C CZ  . PHE C 1 244 ? 29.399  -29.700 228.501 1.00 25.11  ? 244 PHE C CZ  1 
ATOM 7936 N N   . GLY C 1 245 ? 28.505  -35.710 224.858 1.00 26.73  ? 245 GLY C N   1 
ATOM 7937 C CA  . GLY C 1 245 ? 27.927  -36.855 224.172 1.00 27.10  ? 245 GLY C CA  1 
ATOM 7938 C C   . GLY C 1 245 ? 26.418  -36.703 224.031 1.00 28.46  ? 245 GLY C C   1 
ATOM 7939 O O   . GLY C 1 245 ? 25.818  -35.809 224.641 1.00 26.42  ? 245 GLY C O   1 
ATOM 7940 N N   . ALA C 1 246 ? 25.801  -37.530 223.189 1.00 28.88  ? 246 ALA C N   1 
ATOM 7941 C CA  . ALA C 1 246 ? 24.352  -37.479 223.015 1.00 27.56  ? 246 ALA C CA  1 
ATOM 7942 C C   . ALA C 1 246 ? 23.782  -37.902 224.371 1.00 27.59  ? 246 ALA C C   1 
ATOM 7943 O O   . ALA C 1 246 ? 24.331  -38.796 225.035 1.00 27.90  ? 246 ALA C O   1 
ATOM 7944 C CB  . ALA C 1 246 ? 23.915  -38.439 221.916 1.00 21.94  ? 246 ALA C CB  1 
ATOM 7945 N N   . PRO C 1 247 ? 22.723  -37.229 224.840 1.00 27.66  ? 247 PRO C N   1 
ATOM 7946 C CA  . PRO C 1 247 ? 22.167  -37.612 226.138 1.00 29.83  ? 247 PRO C CA  1 
ATOM 7947 C C   . PRO C 1 247 ? 21.333  -38.881 226.068 1.00 31.32  ? 247 PRO C C   1 
ATOM 7948 O O   . PRO C 1 247 ? 20.803  -39.219 225.018 1.00 30.92  ? 247 PRO C O   1 
ATOM 7949 C CB  . PRO C 1 247 ? 21.306  -36.407 226.494 1.00 32.30  ? 247 PRO C CB  1 
ATOM 7950 C CG  . PRO C 1 247 ? 20.757  -36.004 225.154 1.00 27.59  ? 247 PRO C CG  1 
ATOM 7951 C CD  . PRO C 1 247 ? 21.957  -36.124 224.232 1.00 28.75  ? 247 PRO C CD  1 
ATOM 7952 N N   . HIS C 1 248 ? 21.293  -39.621 227.168 1.00 35.77  ? 248 HIS C N   1 
ATOM 7953 C CA  . HIS C 1 248 ? 20.453  -40.820 227.260 1.00 42.89  ? 248 HIS C CA  1 
ATOM 7954 C C   . HIS C 1 248 ? 19.836  -40.855 228.653 1.00 44.17  ? 248 HIS C C   1 
ATOM 7955 O O   . HIS C 1 248 ? 20.534  -41.034 229.660 1.00 47.82  ? 248 HIS C O   1 
ATOM 7956 C CB  . HIS C 1 248 ? 21.175  -42.142 226.886 1.00 51.99  ? 248 HIS C CB  1 
ATOM 7957 C CG  . HIS C 1 248 ? 22.584  -42.264 227.395 1.00 65.28  ? 248 HIS C CG  1 
ATOM 7958 N ND1 . HIS C 1 248 ? 23.034  -41.631 228.538 1.00 71.77  ? 248 HIS C ND1 1 
ATOM 7959 C CD2 . HIS C 1 248 ? 23.647  -42.948 226.904 1.00 66.00  ? 248 HIS C CD2 1 
ATOM 7960 C CE1 . HIS C 1 248 ? 24.312  -41.920 228.726 1.00 68.97  ? 248 HIS C CE1 1 
ATOM 7961 N NE2 . HIS C 1 248 ? 24.707  -42.716 227.748 1.00 69.60  ? 248 HIS C NE2 1 
ATOM 7962 N N   . ALA C 1 249 ? 18.530  -40.605 228.692 1.00 41.42  ? 249 ALA C N   1 
ATOM 7963 C CA  . ALA C 1 249 ? 17.751  -40.553 229.930 1.00 38.08  ? 249 ALA C CA  1 
ATOM 7964 C C   . ALA C 1 249 ? 18.176  -39.370 230.803 1.00 34.32  ? 249 ALA C C   1 
ATOM 7965 O O   . ALA C 1 249 ? 17.965  -38.228 230.417 1.00 32.97  ? 249 ALA C O   1 
ATOM 7966 C CB  . ALA C 1 249 ? 17.833  -41.870 230.702 1.00 38.10  ? 249 ALA C CB  1 
ATOM 7967 N N   . VAL C 1 250 ? 18.811  -39.637 231.940 1.00 31.14  ? 250 VAL C N   1 
ATOM 7968 C CA  . VAL C 1 250 ? 19.210  -38.557 232.847 1.00 30.58  ? 250 VAL C CA  1 
ATOM 7969 C C   . VAL C 1 250 ? 20.725  -38.333 232.869 1.00 31.09  ? 250 VAL C C   1 
ATOM 7970 O O   . VAL C 1 250 ? 21.263  -37.752 233.829 1.00 30.13  ? 250 VAL C O   1 
ATOM 7971 C CB  . VAL C 1 250 ? 18.709  -38.818 234.313 1.00 32.96  ? 250 VAL C CB  1 
ATOM 7972 C CG1 . VAL C 1 250 ? 17.188  -38.995 234.344 1.00 34.59  ? 250 VAL C CG1 1 
ATOM 7973 C CG2 . VAL C 1 250 ? 19.363  -40.059 234.913 1.00 33.96  ? 250 VAL C CG2 1 
ATOM 7974 N N   . LYS C 1 251 ? 21.416  -38.759 231.813 1.00 31.24  ? 251 LYS C N   1 
ATOM 7975 C CA  . LYS C 1 251 ? 22.869  -38.621 231.757 1.00 30.73  ? 251 LYS C CA  1 
ATOM 7976 C C   . LYS C 1 251 ? 23.349  -38.074 230.435 1.00 27.78  ? 251 LYS C C   1 
ATOM 7977 O O   . LYS C 1 251 ? 22.737  -38.307 229.393 1.00 28.20  ? 251 LYS C O   1 
ATOM 7978 C CB  . LYS C 1 251 ? 23.535  -39.979 231.985 1.00 35.13  ? 251 LYS C CB  1 
ATOM 7979 C CG  . LYS C 1 251 ? 23.326  -40.560 233.363 1.00 48.96  ? 251 LYS C CG  1 
ATOM 7980 C CD  . LYS C 1 251 ? 23.926  -41.945 233.469 1.00 62.73  ? 251 LYS C CD  1 
ATOM 7981 C CE  . LYS C 1 251 ? 23.699  -42.547 234.841 1.00 72.88  ? 251 LYS C CE  1 
ATOM 7982 N NZ  . LYS C 1 251 ? 24.316  -43.891 234.943 1.00 81.26  ? 251 LYS C NZ  1 
ATOM 7983 N N   . MET C 1 252 ? 24.486  -37.394 230.485 1.00 27.01  ? 252 MET C N   1 
ATOM 7984 C CA  . MET C 1 252 ? 25.128  -36.820 229.304 1.00 27.10  ? 252 MET C CA  1 
ATOM 7985 C C   . MET C 1 252 ? 26.642  -36.788 229.596 1.00 26.47  ? 252 MET C C   1 
ATOM 7986 O O   . MET C 1 252 ? 27.074  -36.252 230.625 1.00 24.95  ? 252 MET C O   1 
ATOM 7987 C CB  . MET C 1 252 ? 24.588  -35.416 229.031 1.00 25.88  ? 252 MET C CB  1 
ATOM 7988 C CG  . MET C 1 252 ? 25.111  -34.797 227.755 1.00 30.26  ? 252 MET C CG  1 
ATOM 7989 S SD  . MET C 1 252 ? 24.068  -33.463 227.140 1.00 43.84  ? 252 MET C SD  1 
ATOM 7990 C CE  . MET C 1 252 ? 23.764  -32.530 228.601 1.00 37.25  ? 252 MET C CE  1 
ATOM 7991 N N   . ASP C 1 253 ? 27.420  -37.476 228.763 1.00 26.09  ? 253 ASP C N   1 
ATOM 7992 C CA  . ASP C 1 253 ? 28.876  -37.561 228.937 1.00 26.51  ? 253 ASP C CA  1 
ATOM 7993 C C   . ASP C 1 253 ? 29.632  -36.298 228.482 1.00 25.40  ? 253 ASP C C   1 
ATOM 7994 O O   . ASP C 1 253 ? 29.273  -35.636 227.505 1.00 24.41  ? 253 ASP C O   1 
ATOM 7995 C CB  . ASP C 1 253 ? 29.440  -38.756 228.151 1.00 26.37  ? 253 ASP C CB  1 
ATOM 7996 C CG  . ASP C 1 253 ? 28.950  -40.106 228.661 1.00 39.75  ? 253 ASP C CG  1 
ATOM 7997 O OD1 . ASP C 1 253 ? 28.879  -40.305 229.900 1.00 39.45  ? 253 ASP C OD1 1 
ATOM 7998 O OD2 . ASP C 1 253 ? 28.661  -40.973 227.803 1.00 43.18  ? 253 ASP C OD2 1 
ATOM 7999 N N   . VAL C 1 254 ? 30.718  -36.012 229.176 1.00 26.61  ? 254 VAL C N   1 
ATOM 8000 C CA  . VAL C 1 254 ? 31.563  -34.877 228.857 1.00 26.47  ? 254 VAL C CA  1 
ATOM 8001 C C   . VAL C 1 254 ? 32.925  -35.443 228.458 1.00 23.22  ? 254 VAL C C   1 
ATOM 8002 O O   . VAL C 1 254 ? 33.521  -36.231 229.199 1.00 22.58  ? 254 VAL C O   1 
ATOM 8003 C CB  . VAL C 1 254 ? 31.727  -33.957 230.071 1.00 29.09  ? 254 VAL C CB  1 
ATOM 8004 C CG1 . VAL C 1 254 ? 32.580  -32.766 229.705 1.00 29.42  ? 254 VAL C CG1 1 
ATOM 8005 C CG2 . VAL C 1 254 ? 30.358  -33.498 230.538 1.00 36.23  ? 254 VAL C CG2 1 
ATOM 8006 N N   . TYR C 1 255 ? 33.404  -35.039 227.288 1.00 23.27  ? 255 TYR C N   1 
ATOM 8007 C CA  . TYR C 1 255 ? 34.692  -35.489 226.763 1.00 24.37  ? 255 TYR C CA  1 
ATOM 8008 C C   . TYR C 1 255 ? 35.736  -34.369 226.686 1.00 24.36  ? 255 TYR C C   1 
ATOM 8009 O O   . TYR C 1 255 ? 35.434  -33.234 226.318 1.00 22.89  ? 255 TYR C O   1 
ATOM 8010 C CB  . TYR C 1 255 ? 34.496  -36.090 225.375 1.00 26.86  ? 255 TYR C CB  1 
ATOM 8011 C CG  . TYR C 1 255 ? 33.488  -37.211 225.371 1.00 35.32  ? 255 TYR C CG  1 
ATOM 8012 C CD1 . TYR C 1 255 ? 33.660  -38.339 226.187 1.00 32.39  ? 255 TYR C CD1 1 
ATOM 8013 C CD2 . TYR C 1 255 ? 32.357  -37.147 224.563 1.00 33.12  ? 255 TYR C CD2 1 
ATOM 8014 C CE1 . TYR C 1 255 ? 32.729  -39.372 226.190 1.00 31.78  ? 255 TYR C CE1 1 
ATOM 8015 C CE2 . TYR C 1 255 ? 31.418  -38.177 224.562 1.00 33.81  ? 255 TYR C CE2 1 
ATOM 8016 C CZ  . TYR C 1 255 ? 31.610  -39.285 225.375 1.00 36.75  ? 255 TYR C CZ  1 
ATOM 8017 O OH  . TYR C 1 255 ? 30.678  -40.303 225.372 1.00 40.22  ? 255 TYR C OH  1 
ATOM 8018 N N   . ASN C 1 256 ? 36.966  -34.700 227.039 1.00 21.66  ? 256 ASN C N   1 
ATOM 8019 C CA  . ASN C 1 256 ? 38.054  -33.743 227.000 1.00 21.16  ? 256 ASN C CA  1 
ATOM 8020 C C   . ASN C 1 256 ? 38.848  -34.046 225.742 1.00 19.96  ? 256 ASN C C   1 
ATOM 8021 O O   . ASN C 1 256 ? 39.210  -35.194 225.519 1.00 20.33  ? 256 ASN C O   1 
ATOM 8022 C CB  . ASN C 1 256 ? 38.929  -33.937 228.229 1.00 17.45  ? 256 ASN C CB  1 
ATOM 8023 C CG  . ASN C 1 256 ? 40.005  -32.898 228.340 1.00 19.06  ? 256 ASN C CG  1 
ATOM 8024 O OD1 . ASN C 1 256 ? 40.534  -32.418 227.333 1.00 17.72  ? 256 ASN C OD1 1 
ATOM 8025 N ND2 . ASN C 1 256 ? 40.341  -32.539 229.567 1.00 12.53  ? 256 ASN C ND2 1 
ATOM 8026 N N   . LEU C 1 257 ? 39.120  -33.035 224.925 1.00 18.10  ? 257 LEU C N   1 
ATOM 8027 C CA  . LEU C 1 257 ? 39.880  -33.255 223.699 1.00 16.30  ? 257 LEU C CA  1 
ATOM 8028 C C   . LEU C 1 257 ? 41.395  -33.506 223.867 1.00 17.78  ? 257 LEU C C   1 
ATOM 8029 O O   . LEU C 1 257 ? 42.115  -33.642 222.873 1.00 15.23  ? 257 LEU C O   1 
ATOM 8030 C CB  . LEU C 1 257 ? 39.622  -32.143 222.685 1.00 20.43  ? 257 LEU C CB  1 
ATOM 8031 C CG  . LEU C 1 257 ? 38.179  -32.097 222.180 1.00 22.88  ? 257 LEU C CG  1 
ATOM 8032 C CD1 . LEU C 1 257 ? 38.076  -31.105 221.048 1.00 22.32  ? 257 LEU C CD1 1 
ATOM 8033 C CD2 . LEU C 1 257 ? 37.759  -33.477 221.721 1.00 27.35  ? 257 LEU C CD2 1 
ATOM 8034 N N   . GLY C 1 258 ? 41.861  -33.572 225.115 1.00 15.34  ? 258 GLY C N   1 
ATOM 8035 C CA  . GLY C 1 258 ? 43.254  -33.858 225.391 1.00 15.82  ? 258 GLY C CA  1 
ATOM 8036 C C   . GLY C 1 258 ? 44.230  -32.719 225.195 1.00 17.18  ? 258 GLY C C   1 
ATOM 8037 O O   . GLY C 1 258 ? 43.870  -31.611 224.762 1.00 18.03  ? 258 GLY C O   1 
ATOM 8038 N N   . ASP C 1 259 ? 45.487  -33.027 225.499 1.00 14.84  ? 259 ASP C N   1 
ATOM 8039 C CA  . ASP C 1 259 ? 46.597  -32.086 225.417 1.00 13.85  ? 259 ASP C CA  1 
ATOM 8040 C C   . ASP C 1 259 ? 46.895  -31.713 223.967 1.00 15.53  ? 259 ASP C C   1 
ATOM 8041 O O   . ASP C 1 259 ? 47.239  -32.577 223.153 1.00 16.54  ? 259 ASP C O   1 
ATOM 8042 C CB  . ASP C 1 259 ? 47.829  -32.706 226.091 1.00 15.41  ? 259 ASP C CB  1 
ATOM 8043 C CG  . ASP C 1 259 ? 48.997  -31.728 226.219 1.00 21.23  ? 259 ASP C CG  1 
ATOM 8044 O OD1 . ASP C 1 259 ? 48.925  -30.604 225.683 1.00 20.25  ? 259 ASP C OD1 1 
ATOM 8045 O OD2 . ASP C 1 259 ? 49.987  -32.087 226.873 1.00 18.40  ? 259 ASP C OD2 1 
ATOM 8046 N N   . GLN C 1 260 ? 46.777  -30.420 223.663 1.00 15.01  ? 260 GLN C N   1 
ATOM 8047 C CA  . GLN C 1 260 ? 47.016  -29.885 222.324 1.00 15.13  ? 260 GLN C CA  1 
ATOM 8048 C C   . GLN C 1 260 ? 48.478  -29.507 222.020 1.00 12.96  ? 260 GLN C C   1 
ATOM 8049 O O   . GLN C 1 260 ? 48.791  -29.052 220.929 1.00 16.21  ? 260 GLN C O   1 
ATOM 8050 C CB  . GLN C 1 260 ? 46.103  -28.673 222.087 1.00 14.32  ? 260 GLN C CB  1 
ATOM 8051 C CG  . GLN C 1 260 ? 44.626  -28.986 222.266 1.00 17.17  ? 260 GLN C CG  1 
ATOM 8052 C CD  . GLN C 1 260 ? 44.146  -30.062 221.286 1.00 24.86  ? 260 GLN C CD  1 
ATOM 8053 O OE1 . GLN C 1 260 ? 44.195  -29.876 220.064 1.00 14.60  ? 260 GLN C OE1 1 
ATOM 8054 N NE2 . GLN C 1 260 ? 43.695  -31.194 221.820 1.00 15.43  ? 260 GLN C NE2 1 
ATOM 8055 N N   . THR C 1 261 ? 49.372  -29.730 222.964 1.00 13.42  ? 261 THR C N   1 
ATOM 8056 C CA  . THR C 1 261 ? 50.783  -29.395 222.787 1.00 14.45  ? 261 THR C CA  1 
ATOM 8057 C C   . THR C 1 261 ? 51.388  -30.023 221.526 1.00 16.24  ? 261 THR C C   1 
ATOM 8058 O O   . THR C 1 261 ? 52.048  -29.332 220.725 1.00 16.88  ? 261 THR C O   1 
ATOM 8059 C CB  . THR C 1 261 ? 51.594  -29.817 224.023 1.00 15.00  ? 261 THR C CB  1 
ATOM 8060 O OG1 . THR C 1 261 ? 51.062  -29.149 225.176 1.00 14.63  ? 261 THR C OG1 1 
ATOM 8061 C CG2 . THR C 1 261 ? 53.090  -29.460 223.850 1.00 20.23  ? 261 THR C CG2 1 
ATOM 8062 N N   . GLY C 1 262 ? 51.127  -31.316 221.332 1.00 11.74  ? 262 GLY C N   1 
ATOM 8063 C CA  . GLY C 1 262 ? 51.652  -32.011 220.167 1.00 11.14  ? 262 GLY C CA  1 
ATOM 8064 C C   . GLY C 1 262 ? 51.154  -31.388 218.877 1.00 14.53  ? 262 GLY C C   1 
ATOM 8065 O O   . GLY C 1 262 ? 51.898  -31.264 217.900 1.00 16.62  ? 262 GLY C O   1 
ATOM 8066 N N   . VAL C 1 263 ? 49.891  -30.972 218.884 1.00 13.81  ? 263 VAL C N   1 
ATOM 8067 C CA  . VAL C 1 263 ? 49.273  -30.339 217.733 1.00 15.00  ? 263 VAL C CA  1 
ATOM 8068 C C   . VAL C 1 263 ? 49.960  -28.995 217.476 1.00 18.13  ? 263 VAL C C   1 
ATOM 8069 O O   . VAL C 1 263 ? 50.291  -28.674 216.334 1.00 19.89  ? 263 VAL C O   1 
ATOM 8070 C CB  . VAL C 1 263 ? 47.767  -30.063 217.985 1.00 17.67  ? 263 VAL C CB  1 
ATOM 8071 C CG1 . VAL C 1 263 ? 47.170  -29.254 216.828 1.00 14.95  ? 263 VAL C CG1 1 
ATOM 8072 C CG2 . VAL C 1 263 ? 47.013  -31.378 218.192 1.00 16.22  ? 263 VAL C CG2 1 
ATOM 8073 N N   . LEU C 1 264 ? 50.163  -28.210 218.532 1.00 15.48  ? 264 LEU C N   1 
ATOM 8074 C CA  . LEU C 1 264 ? 50.807  -26.903 218.380 1.00 18.85  ? 264 LEU C CA  1 
ATOM 8075 C C   . LEU C 1 264 ? 52.236  -27.044 217.860 1.00 17.64  ? 264 LEU C C   1 
ATOM 8076 O O   . LEU C 1 264 ? 52.631  -26.343 216.932 1.00 16.76  ? 264 LEU C O   1 
ATOM 8077 C CB  . LEU C 1 264 ? 50.836  -26.153 219.720 1.00 20.53  ? 264 LEU C CB  1 
ATOM 8078 C CG  . LEU C 1 264 ? 51.235  -24.684 219.613 1.00 19.36  ? 264 LEU C CG  1 
ATOM 8079 C CD1 . LEU C 1 264 ? 50.219  -23.944 218.772 1.00 23.14  ? 264 LEU C CD1 1 
ATOM 8080 C CD2 . LEU C 1 264 ? 51.298  -24.080 220.991 1.00 25.40  ? 264 LEU C CD2 1 
ATOM 8081 N N   . LEU C 1 265 ? 52.988  -27.980 218.438 1.00 17.09  ? 265 LEU C N   1 
ATOM 8082 C CA  . LEU C 1 265 ? 54.372  -28.211 218.051 1.00 19.68  ? 265 LEU C CA  1 
ATOM 8083 C C   . LEU C 1 265 ? 54.549  -28.550 216.566 1.00 22.21  ? 265 LEU C C   1 
ATOM 8084 O O   . LEU C 1 265 ? 55.579  -28.190 215.978 1.00 21.27  ? 265 LEU C O   1 
ATOM 8085 C CB  . LEU C 1 265 ? 55.022  -29.275 218.952 1.00 18.05  ? 265 LEU C CB  1 
ATOM 8086 C CG  . LEU C 1 265 ? 55.289  -28.835 220.397 1.00 20.62  ? 265 LEU C CG  1 
ATOM 8087 C CD1 . LEU C 1 265 ? 55.859  -29.986 221.201 1.00 19.02  ? 265 LEU C CD1 1 
ATOM 8088 C CD2 . LEU C 1 265 ? 56.256  -27.669 220.424 1.00 18.15  ? 265 LEU C CD2 1 
ATOM 8089 N N   . LYS C 1 266 ? 53.553  -29.216 215.964 1.00 21.39  ? 266 LYS C N   1 
ATOM 8090 C CA  . LYS C 1 266 ? 53.600  -29.561 214.539 1.00 23.21  ? 266 LYS C CA  1 
ATOM 8091 C C   . LYS C 1 266 ? 53.448  -28.279 213.754 1.00 24.47  ? 266 LYS C C   1 
ATOM 8092 O O   . LYS C 1 266 ? 54.111  -28.079 212.749 1.00 26.41  ? 266 LYS C O   1 
ATOM 8093 C CB  . LYS C 1 266 ? 52.483  -30.529 214.141 1.00 26.73  ? 266 LYS C CB  1 
ATOM 8094 C CG  . LYS C 1 266 ? 52.629  -31.917 214.737 1.00 39.02  ? 266 LYS C CG  1 
ATOM 8095 C CD  . LYS C 1 266 ? 51.694  -32.937 214.079 1.00 48.09  ? 266 LYS C CD  1 
ATOM 8096 C CE  . LYS C 1 266 ? 52.068  -34.363 214.504 1.00 52.18  ? 266 LYS C CE  1 
ATOM 8097 N NZ  . LYS C 1 266 ? 51.401  -35.404 213.665 1.00 60.19  ? 266 LYS C NZ  1 
ATOM 8098 N N   . ALA C 1 267 ? 52.578  -27.396 214.227 1.00 26.49  ? 267 ALA C N   1 
ATOM 8099 C CA  . ALA C 1 267 ? 52.374  -26.107 213.576 1.00 27.07  ? 267 ALA C CA  1 
ATOM 8100 C C   . ALA C 1 267 ? 53.628  -25.238 213.696 1.00 28.40  ? 267 ALA C C   1 
ATOM 8101 O O   . ALA C 1 267 ? 53.927  -24.462 212.801 1.00 31.03  ? 267 ALA C O   1 
ATOM 8102 C CB  . ALA C 1 267 ? 51.188  -25.390 214.206 1.00 27.61  ? 267 ALA C CB  1 
ATOM 8103 N N   . LEU C 1 268 ? 54.364  -25.387 214.797 1.00 29.82  ? 268 LEU C N   1 
ATOM 8104 C CA  . LEU C 1 268 ? 55.571  -24.599 215.069 1.00 29.14  ? 268 LEU C CA  1 
ATOM 8105 C C   . LEU C 1 268 ? 56.863  -25.072 214.404 1.00 33.37  ? 268 LEU C C   1 
ATOM 8106 O O   . LEU C 1 268 ? 57.914  -24.452 214.578 1.00 33.46  ? 268 LEU C O   1 
ATOM 8107 C CB  . LEU C 1 268 ? 55.810  -24.494 216.579 1.00 20.35  ? 268 LEU C CB  1 
ATOM 8108 C CG  . LEU C 1 268 ? 54.779  -23.753 217.433 1.00 24.38  ? 268 LEU C CG  1 
ATOM 8109 C CD1 . LEU C 1 268 ? 55.155  -23.877 218.903 1.00 18.59  ? 268 LEU C CD1 1 
ATOM 8110 C CD2 . LEU C 1 268 ? 54.693  -22.298 217.016 1.00 19.59  ? 268 LEU C CD2 1 
ATOM 8111 N N   . ALA C 1 269 ? 56.824  -26.204 213.714 1.00 36.77  ? 269 ALA C N   1 
ATOM 8112 C CA  . ALA C 1 269 ? 58.024  -26.686 213.036 1.00 38.89  ? 269 ALA C CA  1 
ATOM 8113 C C   . ALA C 1 269 ? 58.268  -25.694 211.904 1.00 38.92  ? 269 ALA C C   1 
ATOM 8114 O O   . ALA C 1 269 ? 57.320  -25.214 211.271 1.00 42.08  ? 269 ALA C O   1 
ATOM 8115 C CB  . ALA C 1 269 ? 57.799  -28.081 212.484 1.00 37.77  ? 269 ALA C CB  1 
ATOM 8116 N N   . GLY C 1 270 ? 59.517  -25.310 211.695 1.00 38.79  ? 270 GLY C N   1 
ATOM 8117 C CA  . GLY C 1 270 ? 59.780  -24.361 210.623 1.00 38.81  ? 270 GLY C CA  1 
ATOM 8118 C C   . GLY C 1 270 ? 59.592  -22.906 211.025 1.00 37.04  ? 270 GLY C C   1 
ATOM 8119 O O   . GLY C 1 270 ? 59.888  -22.006 210.239 1.00 40.79  ? 270 GLY C O   1 
ATOM 8120 N N   . VAL C 1 271 ? 59.041  -22.666 212.210 1.00 31.15  ? 271 VAL C N   1 
ATOM 8121 C CA  . VAL C 1 271 ? 58.876  -21.306 212.716 1.00 28.33  ? 271 VAL C CA  1 
ATOM 8122 C C   . VAL C 1 271 ? 60.211  -20.996 213.430 1.00 24.94  ? 271 VAL C C   1 
ATOM 8123 O O   . VAL C 1 271 ? 60.836  -21.892 214.003 1.00 23.50  ? 271 VAL C O   1 
ATOM 8124 C CB  . VAL C 1 271 ? 57.703  -21.241 213.726 1.00 30.54  ? 271 VAL C CB  1 
ATOM 8125 C CG1 . VAL C 1 271 ? 57.795  -20.005 214.581 1.00 24.00  ? 271 VAL C CG1 1 
ATOM 8126 C CG2 . VAL C 1 271 ? 56.378  -21.263 212.987 1.00 24.77  ? 271 VAL C CG2 1 
ATOM 8127 N N   . PRO C 1 272 ? 60.708  -19.753 213.327 1.00 23.60  ? 272 PRO C N   1 
ATOM 8128 C CA  . PRO C 1 272 ? 61.979  -19.470 214.014 1.00 21.48  ? 272 PRO C CA  1 
ATOM 8129 C C   . PRO C 1 272 ? 61.903  -19.485 215.547 1.00 20.62  ? 272 PRO C C   1 
ATOM 8130 O O   . PRO C 1 272 ? 60.899  -19.059 216.140 1.00 19.85  ? 272 PRO C O   1 
ATOM 8131 C CB  . PRO C 1 272 ? 62.373  -18.090 213.464 1.00 20.96  ? 272 PRO C CB  1 
ATOM 8132 C CG  . PRO C 1 272 ? 61.070  -17.475 213.011 1.00 25.78  ? 272 PRO C CG  1 
ATOM 8133 C CD  . PRO C 1 272 ? 60.314  -18.644 212.434 1.00 24.34  ? 272 PRO C CD  1 
ATOM 8134 N N   . VAL C 1 273 ? 62.943  -20.010 216.194 1.00 19.37  ? 273 VAL C N   1 
ATOM 8135 C CA  . VAL C 1 273 ? 62.957  -20.038 217.650 1.00 19.68  ? 273 VAL C CA  1 
ATOM 8136 C C   . VAL C 1 273 ? 63.413  -18.679 218.201 1.00 20.98  ? 273 VAL C C   1 
ATOM 8137 O O   . VAL C 1 273 ? 63.959  -17.831 217.468 1.00 18.57  ? 273 VAL C O   1 
ATOM 8138 C CB  . VAL C 1 273 ? 63.877  -21.158 218.224 1.00 21.28  ? 273 VAL C CB  1 
ATOM 8139 C CG1 . VAL C 1 273 ? 63.415  -22.527 217.738 1.00 21.51  ? 273 VAL C CG1 1 
ATOM 8140 C CG2 . VAL C 1 273 ? 65.321  -20.923 217.839 1.00 21.81  ? 273 VAL C CG2 1 
ATOM 8141 N N   . ALA C 1 274 ? 63.125  -18.466 219.481 1.00 17.33  ? 274 ALA C N   1 
ATOM 8142 C CA  . ALA C 1 274 ? 63.506  -17.266 220.198 1.00 16.71  ? 274 ALA C CA  1 
ATOM 8143 C C   . ALA C 1 274 ? 64.088  -17.848 221.485 1.00 16.52  ? 274 ALA C C   1 
ATOM 8144 O O   . ALA C 1 274 ? 64.220  -19.062 221.598 1.00 15.41  ? 274 ALA C O   1 
ATOM 8145 C CB  . ALA C 1 274 ? 62.278  -16.388 220.488 1.00 12.02  ? 274 ALA C CB  1 
ATOM 8146 N N   . HIS C 1 275 ? 64.409  -17.019 222.467 1.00 16.56  ? 275 HIS C N   1 
ATOM 8147 C CA  . HIS C 1 275 ? 64.974  -17.542 223.705 1.00 17.39  ? 275 HIS C CA  1 
ATOM 8148 C C   . HIS C 1 275 ? 64.605  -16.653 224.889 1.00 19.78  ? 275 HIS C C   1 
ATOM 8149 O O   . HIS C 1 275 ? 64.557  -15.436 224.751 1.00 20.90  ? 275 HIS C O   1 
ATOM 8150 C CB  . HIS C 1 275 ? 66.492  -17.623 223.565 1.00 18.47  ? 275 HIS C CB  1 
ATOM 8151 C CG  . HIS C 1 275 ? 67.187  -18.124 224.793 1.00 27.27  ? 275 HIS C CG  1 
ATOM 8152 N ND1 . HIS C 1 275 ? 66.949  -19.373 225.330 1.00 28.42  ? 275 HIS C ND1 1 
ATOM 8153 C CD2 . HIS C 1 275 ? 68.110  -17.539 225.594 1.00 28.10  ? 275 HIS C CD2 1 
ATOM 8154 C CE1 . HIS C 1 275 ? 67.697  -19.537 226.407 1.00 26.00  ? 275 HIS C CE1 1 
ATOM 8155 N NE2 . HIS C 1 275 ? 68.410  -18.438 226.589 1.00 29.74  ? 275 HIS C NE2 1 
ATOM 8156 N N   . ILE C 1 276 ? 64.339  -17.266 226.039 1.00 18.76  ? 276 ILE C N   1 
ATOM 8157 C CA  . ILE C 1 276 ? 64.002  -16.541 227.258 1.00 17.40  ? 276 ILE C CA  1 
ATOM 8158 C C   . ILE C 1 276 ? 65.064  -16.866 228.296 1.00 20.34  ? 276 ILE C C   1 
ATOM 8159 O O   . ILE C 1 276 ? 65.398  -18.030 228.487 1.00 22.08  ? 276 ILE C O   1 
ATOM 8160 C CB  . ILE C 1 276 ? 62.648  -16.999 227.826 1.00 19.30  ? 276 ILE C CB  1 
ATOM 8161 C CG1 . ILE C 1 276 ? 61.550  -16.790 226.789 1.00 18.95  ? 276 ILE C CG1 1 
ATOM 8162 C CG2 . ILE C 1 276 ? 62.320  -16.239 229.129 1.00 14.54  ? 276 ILE C CG2 1 
ATOM 8163 C CD1 . ILE C 1 276 ? 60.257  -17.382 227.214 1.00 19.38  ? 276 ILE C CD1 1 
ATOM 8164 N N   . GLU C 1 277 ? 65.618  -15.837 228.925 1.00 21.14  ? 277 GLU C N   1 
ATOM 8165 C CA  . GLU C 1 277 ? 66.633  -15.967 229.972 1.00 22.33  ? 277 GLU C CA  1 
ATOM 8166 C C   . GLU C 1 277 ? 66.115  -15.155 231.171 1.00 22.79  ? 277 GLU C C   1 
ATOM 8167 O O   . GLU C 1 277 ? 66.322  -13.941 231.256 1.00 21.62  ? 277 GLU C O   1 
ATOM 8168 C CB  . GLU C 1 277 ? 67.967  -15.391 229.486 1.00 26.87  ? 277 GLU C CB  1 
ATOM 8169 C CG  . GLU C 1 277 ? 69.159  -15.713 230.384 1.00 42.89  ? 277 GLU C CG  1 
ATOM 8170 C CD  . GLU C 1 277 ? 69.367  -17.221 230.566 1.00 60.34  ? 277 GLU C CD  1 
ATOM 8171 O OE1 . GLU C 1 277 ? 69.523  -17.948 229.550 1.00 62.71  ? 277 GLU C OE1 1 
ATOM 8172 O OE2 . GLU C 1 277 ? 69.373  -17.682 231.733 1.00 65.73  ? 277 GLU C OE2 1 
ATOM 8173 N N   . GLY C 1 278 ? 65.365  -15.811 232.047 1.00 23.46  ? 278 GLY C N   1 
ATOM 8174 C CA  . GLY C 1 278 ? 64.811  -15.125 233.201 1.00 22.34  ? 278 GLY C CA  1 
ATOM 8175 C C   . GLY C 1 278 ? 63.708  -14.198 232.740 1.00 24.79  ? 278 GLY C C   1 
ATOM 8176 O O   . GLY C 1 278 ? 62.670  -14.661 232.250 1.00 23.72  ? 278 GLY C O   1 
ATOM 8177 N N   . THR C 1 279 ? 63.940  -12.892 232.860 1.00 23.47  ? 279 THR C N   1 
ATOM 8178 C CA  . THR C 1 279 ? 62.956  -11.893 232.447 1.00 22.85  ? 279 THR C CA  1 
ATOM 8179 C C   . THR C 1 279 ? 63.284  -11.328 231.050 1.00 20.42  ? 279 THR C C   1 
ATOM 8180 O O   . THR C 1 279 ? 62.540  -10.502 230.520 1.00 19.45  ? 279 THR C O   1 
ATOM 8181 C CB  . THR C 1 279 ? 62.883  -10.714 233.475 1.00 24.84  ? 279 THR C CB  1 
ATOM 8182 O OG1 . THR C 1 279 ? 64.166  -10.085 233.576 1.00 26.83  ? 279 THR C OG1 1 
ATOM 8183 C CG2 . THR C 1 279 ? 62.479  -11.215 234.848 1.00 23.14  ? 279 THR C CG2 1 
ATOM 8184 N N   . LYS C 1 280 ? 64.402  -11.753 230.467 1.00 18.64  ? 280 LYS C N   1 
ATOM 8185 C CA  . LYS C 1 280 ? 64.800  -11.254 229.150 1.00 18.08  ? 280 LYS C CA  1 
ATOM 8186 C C   . LYS C 1 280 ? 64.281  -12.101 228.005 1.00 17.29  ? 280 LYS C C   1 
ATOM 8187 O O   . LYS C 1 280 ? 64.532  -13.305 227.953 1.00 15.62  ? 280 LYS C O   1 
ATOM 8188 C CB  . LYS C 1 280 ? 66.317  -11.138 229.048 1.00 17.33  ? 280 LYS C CB  1 
ATOM 8189 C CG  . LYS C 1 280 ? 66.890  -10.090 229.984 1.00 25.98  ? 280 LYS C CG  1 
ATOM 8190 C CD  . LYS C 1 280 ? 68.414  -10.037 229.959 1.00 35.69  ? 280 LYS C CD  1 
ATOM 8191 C CE  . LYS C 1 280 ? 68.902  -9.044  231.007 1.00 42.71  ? 280 LYS C CE  1 
ATOM 8192 N NZ  . LYS C 1 280 ? 70.363  -9.138  231.233 1.00 51.57  ? 280 LYS C NZ  1 
ATOM 8193 N N   . TYR C 1 281 ? 63.534  -11.478 227.104 1.00 17.32  ? 281 TYR C N   1 
ATOM 8194 C CA  . TYR C 1 281 ? 62.992  -12.179 225.942 1.00 16.58  ? 281 TYR C CA  1 
ATOM 8195 C C   . TYR C 1 281 ? 63.819  -11.784 224.728 1.00 14.93  ? 281 TYR C C   1 
ATOM 8196 O O   . TYR C 1 281 ? 63.718  -10.657 224.247 1.00 17.07  ? 281 TYR C O   1 
ATOM 8197 C CB  . TYR C 1 281 ? 61.513  -11.829 225.761 1.00 11.73  ? 281 TYR C CB  1 
ATOM 8198 C CG  . TYR C 1 281 ? 60.637  -12.523 226.783 1.00 19.67  ? 281 TYR C CG  1 
ATOM 8199 C CD1 . TYR C 1 281 ? 60.763  -12.247 228.143 1.00 14.17  ? 281 TYR C CD1 1 
ATOM 8200 C CD2 . TYR C 1 281 ? 59.714  -13.489 226.394 1.00 17.30  ? 281 TYR C CD2 1 
ATOM 8201 C CE1 . TYR C 1 281 ? 60.000  -12.919 229.084 1.00 18.35  ? 281 TYR C CE1 1 
ATOM 8202 C CE2 . TYR C 1 281 ? 58.946  -14.170 227.337 1.00 17.53  ? 281 TYR C CE2 1 
ATOM 8203 C CZ  . TYR C 1 281 ? 59.097  -13.876 228.677 1.00 17.06  ? 281 TYR C CZ  1 
ATOM 8204 O OH  . TYR C 1 281 ? 58.350  -14.549 229.613 1.00 18.39  ? 281 TYR C OH  1 
ATOM 8205 N N   . HIS C 1 282 ? 64.649  -12.716 224.267 1.00 15.49  ? 282 HIS C N   1 
ATOM 8206 C CA  . HIS C 1 282 ? 65.580  -12.514 223.143 1.00 16.96  ? 282 HIS C CA  1 
ATOM 8207 C C   . HIS C 1 282 ? 65.113  -12.941 221.769 1.00 18.77  ? 282 HIS C C   1 
ATOM 8208 O O   . HIS C 1 282 ? 64.496  -14.001 221.612 1.00 19.30  ? 282 HIS C O   1 
ATOM 8209 C CB  . HIS C 1 282 ? 66.858  -13.358 223.337 1.00 15.96  ? 282 HIS C CB  1 
ATOM 8210 C CG  . HIS C 1 282 ? 67.664  -13.013 224.548 1.00 16.06  ? 282 HIS C CG  1 
ATOM 8211 N ND1 . HIS C 1 282 ? 68.855  -12.324 224.468 1.00 13.11  ? 282 HIS C ND1 1 
ATOM 8212 C CD2 . HIS C 1 282 ? 67.469  -13.282 225.861 1.00 16.39  ? 282 HIS C CD2 1 
ATOM 8213 C CE1 . HIS C 1 282 ? 69.355  -12.175 225.681 1.00 15.07  ? 282 HIS C CE1 1 
ATOM 8214 N NE2 . HIS C 1 282 ? 68.535  -12.749 226.544 1.00 18.02  ? 282 HIS C NE2 1 
ATOM 8215 N N   . LEU C 1 283 ? 65.531  -12.182 220.767 1.00 19.21  ? 283 LEU C N   1 
ATOM 8216 C CA  . LEU C 1 283 ? 65.290  -12.556 219.379 1.00 22.98  ? 283 LEU C CA  1 
ATOM 8217 C C   . LEU C 1 283 ? 66.575  -13.345 219.056 1.00 23.66  ? 283 LEU C C   1 
ATOM 8218 O O   . LEU C 1 283 ? 67.617  -13.096 219.677 1.00 24.92  ? 283 LEU C O   1 
ATOM 8219 C CB  . LEU C 1 283 ? 65.211  -11.327 218.481 1.00 15.37  ? 283 LEU C CB  1 
ATOM 8220 C CG  . LEU C 1 283 ? 63.868  -10.635 218.567 1.00 20.87  ? 283 LEU C CG  1 
ATOM 8221 C CD1 . LEU C 1 283 ? 63.931  -9.352  217.787 1.00 21.70  ? 283 LEU C CD1 1 
ATOM 8222 C CD2 . LEU C 1 283 ? 62.787  -11.569 218.023 1.00 15.59  ? 283 LEU C CD2 1 
ATOM 8223 N N   . LYS C 1 284 ? 66.500  -14.339 218.176 1.00 23.20  ? 284 LYS C N   1 
ATOM 8224 C CA  . LYS C 1 284 ? 67.692  -15.114 217.817 1.00 22.70  ? 284 LYS C CA  1 
ATOM 8225 C C   . LYS C 1 284 ? 68.140  -14.738 216.413 1.00 23.11  ? 284 LYS C C   1 
ATOM 8226 O O   . LYS C 1 284 ? 69.109  -15.284 215.884 1.00 21.90  ? 284 LYS C O   1 
ATOM 8227 C CB  . LYS C 1 284 ? 67.456  -16.630 217.896 1.00 24.10  ? 284 LYS C CB  1 
ATOM 8228 C CG  . LYS C 1 284 ? 67.166  -17.175 219.290 1.00 38.72  ? 284 LYS C CG  1 
ATOM 8229 C CD  . LYS C 1 284 ? 68.223  -16.781 220.319 1.00 44.75  ? 284 LYS C CD  1 
ATOM 8230 C CE  . LYS C 1 284 ? 69.540  -17.519 220.148 1.00 52.70  ? 284 LYS C CE  1 
ATOM 8231 N NZ  . LYS C 1 284 ? 70.536  -17.039 221.166 1.00 58.28  ? 284 LYS C NZ  1 
ATOM 8232 N N   . SER C 1 285 ? 67.434  -13.795 215.813 1.00 19.91  ? 285 SER C N   1 
ATOM 8233 C CA  . SER C 1 285 ? 67.792  -13.351 214.492 1.00 22.42  ? 285 SER C CA  1 
ATOM 8234 C C   . SER C 1 285 ? 67.469  -11.864 214.445 1.00 21.53  ? 285 SER C C   1 
ATOM 8235 O O   . SER C 1 285 ? 66.469  -11.427 215.032 1.00 23.03  ? 285 SER C O   1 
ATOM 8236 C CB  . SER C 1 285 ? 66.986  -14.133 213.460 1.00 28.86  ? 285 SER C CB  1 
ATOM 8237 O OG  . SER C 1 285 ? 67.465  -13.873 212.159 1.00 48.10  ? 285 SER C OG  1 
ATOM 8238 N N   . GLY C 1 286 ? 68.327  -11.079 213.800 1.00 18.79  ? 286 GLY C N   1 
ATOM 8239 C CA  . GLY C 1 286 ? 68.091  -9.647  213.725 1.00 20.20  ? 286 GLY C CA  1 
ATOM 8240 C C   . GLY C 1 286 ? 69.353  -8.926  213.315 1.00 22.11  ? 286 GLY C C   1 
ATOM 8241 O O   . GLY C 1 286 ? 70.414  -9.551  213.266 1.00 23.59  ? 286 GLY C O   1 
ATOM 8242 N N   . HIS C 1 287 ? 69.254  -7.615  213.085 1.00 23.47  ? 287 HIS C N   1 
ATOM 8243 C CA  . HIS C 1 287 ? 70.396  -6.801  212.637 1.00 24.53  ? 287 HIS C CA  1 
ATOM 8244 C C   . HIS C 1 287 ? 70.211  -5.341  213.034 1.00 25.29  ? 287 HIS C C   1 
ATOM 8245 O O   . HIS C 1 287 ? 69.087  -4.904  213.308 1.00 25.45  ? 287 HIS C O   1 
ATOM 8246 C CB  . HIS C 1 287 ? 70.478  -6.840  211.112 1.00 28.20  ? 287 HIS C CB  1 
ATOM 8247 C CG  . HIS C 1 287 ? 69.277  -6.240  210.446 1.00 34.05  ? 287 HIS C CG  1 
ATOM 8248 N ND1 . HIS C 1 287 ? 68.125  -6.961  210.198 1.00 33.21  ? 287 HIS C ND1 1 
ATOM 8249 C CD2 . HIS C 1 287 ? 69.007  -4.960  210.089 1.00 32.19  ? 287 HIS C CD2 1 
ATOM 8250 C CE1 . HIS C 1 287 ? 67.192  -6.148  209.734 1.00 36.57  ? 287 HIS C CE1 1 
ATOM 8251 N NE2 . HIS C 1 287 ? 67.702  -4.930  209.658 1.00 38.29  ? 287 HIS C NE2 1 
ATOM 8252 N N   . VAL C 1 288 ? 71.298  -4.574  212.946 1.00 24.64  ? 288 VAL C N   1 
ATOM 8253 C CA  . VAL C 1 288 ? 71.282  -3.149  213.277 1.00 21.46  ? 288 VAL C CA  1 
ATOM 8254 C C   . VAL C 1 288 ? 72.482  -2.501  212.569 1.00 22.28  ? 288 VAL C C   1 
ATOM 8255 O O   . VAL C 1 288 ? 73.495  -3.167  212.332 1.00 21.47  ? 288 VAL C O   1 
ATOM 8256 C CB  . VAL C 1 288 ? 71.368  -2.928  214.838 1.00 19.14  ? 288 VAL C CB  1 
ATOM 8257 C CG1 . VAL C 1 288 ? 72.753  -3.248  215.359 1.00 10.31  ? 288 VAL C CG1 1 
ATOM 8258 C CG2 . VAL C 1 288 ? 70.987  -1.505  215.210 1.00 19.54  ? 288 VAL C CG2 1 
ATOM 8259 N N   . THR C 1 289 ? 72.349  -1.247  212.146 1.00 19.77  ? 289 THR C N   1 
ATOM 8260 C CA  . THR C 1 289 ? 73.475  -0.577  211.508 1.00 22.44  ? 289 THR C CA  1 
ATOM 8261 C C   . THR C 1 289 ? 74.126  0.371   212.529 1.00 23.23  ? 289 THR C C   1 
ATOM 8262 O O   . THR C 1 289 ? 73.436  1.065   213.294 1.00 22.12  ? 289 THR C O   1 
ATOM 8263 C CB  . THR C 1 289 ? 73.065  0.187   210.208 1.00 24.60  ? 289 THR C CB  1 
ATOM 8264 O OG1 . THR C 1 289 ? 72.192  1.261   210.535 1.00 43.79  ? 289 THR C OG1 1 
ATOM 8265 C CG2 . THR C 1 289 ? 72.307  -0.710  209.273 1.00 20.88  ? 289 THR C CG2 1 
ATOM 8266 N N   . CYS C 1 290 ? 75.452  0.342   212.591 1.00 22.76  ? 290 CYS C N   1 
ATOM 8267 C CA  . CYS C 1 290 ? 76.191  1.192   213.512 1.00 24.38  ? 290 CYS C CA  1 
ATOM 8268 C C   . CYS C 1 290 ? 77.245  1.961   212.748 1.00 24.09  ? 290 CYS C C   1 
ATOM 8269 O O   . CYS C 1 290 ? 77.651  1.557   211.661 1.00 23.77  ? 290 CYS C O   1 
ATOM 8270 C CB  . CYS C 1 290 ? 76.922  0.356   214.562 1.00 18.65  ? 290 CYS C CB  1 
ATOM 8271 S SG  . CYS C 1 290 ? 75.874  -0.683  215.606 1.00 23.43  ? 290 CYS C SG  1 
ATOM 8272 N N   . GLU C 1 291 ? 77.653  3.088   213.317 1.00 25.53  ? 291 GLU C N   1 
ATOM 8273 C CA  . GLU C 1 291 ? 78.716  3.920   212.766 1.00 26.47  ? 291 GLU C CA  1 
ATOM 8274 C C   . GLU C 1 291 ? 79.812  3.808   213.825 1.00 26.21  ? 291 GLU C C   1 
ATOM 8275 O O   . GLU C 1 291 ? 79.545  4.005   215.019 1.00 26.15  ? 291 GLU C O   1 
ATOM 8276 C CB  . GLU C 1 291 ? 78.279  5.381   212.618 1.00 27.88  ? 291 GLU C CB  1 
ATOM 8277 C CG  . GLU C 1 291 ? 77.222  5.608   211.545 1.00 47.12  ? 291 GLU C CG  1 
ATOM 8278 C CD  . GLU C 1 291 ? 76.970  7.080   211.269 1.00 56.14  ? 291 GLU C CD  1 
ATOM 8279 O OE1 . GLU C 1 291 ? 77.909  7.781   210.828 1.00 61.51  ? 291 GLU C OE1 1 
ATOM 8280 O OE2 . GLU C 1 291 ? 75.828  7.535   211.478 1.00 54.87  ? 291 GLU C OE2 1 
ATOM 8281 N N   . VAL C 1 292 ? 81.005  3.400   213.406 1.00 24.34  ? 292 VAL C N   1 
ATOM 8282 C CA  . VAL C 1 292 ? 82.130  3.239   214.316 1.00 25.34  ? 292 VAL C CA  1 
ATOM 8283 C C   . VAL C 1 292 ? 83.143  4.358   214.061 1.00 26.23  ? 292 VAL C C   1 
ATOM 8284 O O   . VAL C 1 292 ? 83.589  4.554   212.925 1.00 25.68  ? 292 VAL C O   1 
ATOM 8285 C CB  . VAL C 1 292 ? 82.827  1.869   214.106 1.00 27.31  ? 292 VAL C CB  1 
ATOM 8286 C CG1 . VAL C 1 292 ? 83.875  1.652   215.172 1.00 26.74  ? 292 VAL C CG1 1 
ATOM 8287 C CG2 . VAL C 1 292 ? 81.816  0.742   214.121 1.00 30.47  ? 292 VAL C CG2 1 
ATOM 8288 N N   . GLY C 1 293 ? 83.471  5.109   215.108 1.00 24.98  ? 293 GLY C N   1 
ATOM 8289 C CA  . GLY C 1 293 ? 84.422  6.203   214.985 1.00 26.18  ? 293 GLY C CA  1 
ATOM 8290 C C   . GLY C 1 293 ? 85.771  5.697   215.435 1.00 28.36  ? 293 GLY C C   1 
ATOM 8291 O O   . GLY C 1 293 ? 85.924  5.292   216.602 1.00 27.09  ? 293 GLY C O   1 
ATOM 8292 N N   . LEU C 1 294 ? 86.749  5.760   214.532 1.00 28.73  ? 294 LEU C N   1 
ATOM 8293 C CA  . LEU C 1 294 ? 88.094  5.252   214.798 1.00 30.88  ? 294 LEU C CA  1 
ATOM 8294 C C   . LEU C 1 294 ? 89.185  6.284   215.094 1.00 32.68  ? 294 LEU C C   1 
ATOM 8295 O O   . LEU C 1 294 ? 90.271  5.927   215.565 1.00 31.16  ? 294 LEU C O   1 
ATOM 8296 C CB  . LEU C 1 294 ? 88.535  4.382   213.616 1.00 32.84  ? 294 LEU C CB  1 
ATOM 8297 C CG  . LEU C 1 294 ? 87.621  3.223   213.195 1.00 28.71  ? 294 LEU C CG  1 
ATOM 8298 C CD1 . LEU C 1 294 ? 88.125  2.644   211.908 1.00 26.15  ? 294 LEU C CD1 1 
ATOM 8299 C CD2 . LEU C 1 294 ? 87.576  2.160   214.279 1.00 26.14  ? 294 LEU C CD2 1 
ATOM 8300 N N   . GLU C 1 295 ? 88.885  7.557   214.860 1.00 33.62  ? 295 GLU C N   1 
ATOM 8301 C CA  . GLU C 1 295 ? 89.852  8.633   215.056 1.00 34.96  ? 295 GLU C CA  1 
ATOM 8302 C C   . GLU C 1 295 ? 90.632  8.685   216.366 1.00 32.73  ? 295 GLU C C   1 
ATOM 8303 O O   . GLU C 1 295 ? 91.777  9.114   216.359 1.00 33.20  ? 295 GLU C O   1 
ATOM 8304 C CB  . GLU C 1 295 ? 89.249  10.010  214.704 1.00 40.71  ? 295 GLU C CB  1 
ATOM 8305 C CG  . GLU C 1 295 ? 87.983  10.436  215.465 1.00 54.69  ? 295 GLU C CG  1 
ATOM 8306 C CD  . GLU C 1 295 ? 86.738  9.594   215.142 1.00 64.08  ? 295 GLU C CD  1 
ATOM 8307 O OE1 . GLU C 1 295 ? 86.402  9.409   213.945 1.00 63.70  ? 295 GLU C OE1 1 
ATOM 8308 O OE2 . GLU C 1 295 ? 86.090  9.121   216.102 1.00 69.19  ? 295 GLU C OE2 1 
ATOM 8309 N N   . LYS C 1 296 ? 90.052  8.224   217.469 1.00 32.49  ? 296 LYS C N   1 
ATOM 8310 C CA  . LYS C 1 296 ? 90.762  8.251   218.758 1.00 35.37  ? 296 LYS C CA  1 
ATOM 8311 C C   . LYS C 1 296 ? 91.569  6.978   219.072 1.00 36.05  ? 296 LYS C C   1 
ATOM 8312 O O   . LYS C 1 296 ? 92.152  6.860   220.157 1.00 37.25  ? 296 LYS C O   1 
ATOM 8313 C CB  . LYS C 1 296 ? 89.799  8.524   219.924 1.00 37.21  ? 296 LYS C CB  1 
ATOM 8314 C CG  . LYS C 1 296 ? 89.033  9.824   219.840 1.00 44.61  ? 296 LYS C CG  1 
ATOM 8315 C CD  . LYS C 1 296 ? 89.964  11.015  219.798 1.00 55.34  ? 296 LYS C CD  1 
ATOM 8316 C CE  . LYS C 1 296 ? 89.209  12.280  219.425 1.00 63.56  ? 296 LYS C CE  1 
ATOM 8317 N NZ  . LYS C 1 296 ? 90.132  13.426  219.213 1.00 68.01  ? 296 LYS C NZ  1 
ATOM 8318 N N   . LEU C 1 297 ? 91.581  6.015   218.155 1.00 34.35  ? 297 LEU C N   1 
ATOM 8319 C CA  . LEU C 1 297 ? 92.327  4.781   218.387 1.00 34.88  ? 297 LEU C CA  1 
ATOM 8320 C C   . LEU C 1 297 ? 93.804  4.935   218.004 1.00 34.86  ? 297 LEU C C   1 
ATOM 8321 O O   . LEU C 1 297 ? 94.136  5.510   216.972 1.00 36.65  ? 297 LEU C O   1 
ATOM 8322 C CB  . LEU C 1 297 ? 91.678  3.590   217.653 1.00 32.59  ? 297 LEU C CB  1 
ATOM 8323 C CG  . LEU C 1 297 ? 90.296  3.121   218.146 1.00 26.10  ? 297 LEU C CG  1 
ATOM 8324 C CD1 . LEU C 1 297 ? 89.792  2.047   217.244 1.00 22.47  ? 297 LEU C CD1 1 
ATOM 8325 C CD2 . LEU C 1 297 ? 90.341  2.630   219.586 1.00 24.19  ? 297 LEU C CD2 1 
ATOM 8326 N N   . LYS C 1 298 ? 94.680  4.390   218.840 1.00 34.13  ? 298 LYS C N   1 
ATOM 8327 C CA  . LYS C 1 298 ? 96.129  4.455   218.633 1.00 33.60  ? 298 LYS C CA  1 
ATOM 8328 C C   . LYS C 1 298 ? 96.750  3.046   218.726 1.00 31.03  ? 298 LYS C C   1 
ATOM 8329 O O   . LYS C 1 298 ? 96.284  2.204   219.501 1.00 30.27  ? 298 LYS C O   1 
ATOM 8330 C CB  . LYS C 1 298 ? 96.748  5.392   219.692 1.00 38.11  ? 298 LYS C CB  1 
ATOM 8331 C CG  . LYS C 1 298 ? 96.283  5.075   221.124 1.00 44.16  ? 298 LYS C CG  1 
ATOM 8332 C CD  . LYS C 1 298 ? 96.685  6.115   222.191 1.00 48.53  ? 298 LYS C CD  1 
ATOM 8333 C CE  . LYS C 1 298 ? 96.074  5.720   223.559 1.00 48.93  ? 298 LYS C CE  1 
ATOM 8334 N NZ  . LYS C 1 298 ? 96.325  6.632   224.716 1.00 52.51  ? 298 LYS C NZ  1 
ATOM 8335 N N   . MET C 1 299 ? 97.765  2.772   217.907 1.00 30.16  ? 299 MET C N   1 
ATOM 8336 C CA  . MET C 1 299 ? 98.428  1.463   217.922 1.00 31.14  ? 299 MET C CA  1 
ATOM 8337 C C   . MET C 1 299 ? 99.347  1.318   219.126 1.00 30.15  ? 299 MET C C   1 
ATOM 8338 O O   . MET C 1 299 ? 99.794  2.308   219.705 1.00 30.14  ? 299 MET C O   1 
ATOM 8339 C CB  . MET C 1 299 ? 99.229  1.232   216.649 1.00 32.74  ? 299 MET C CB  1 
ATOM 8340 C CG  . MET C 1 299 ? 98.393  1.036   215.416 1.00 36.86  ? 299 MET C CG  1 
ATOM 8341 S SD  . MET C 1 299 ? 99.460  0.491   214.097 1.00 46.08  ? 299 MET C SD  1 
ATOM 8342 C CE  . MET C 1 299 ? 98.394  -0.628  213.206 1.00 57.19  ? 299 MET C CE  1 
ATOM 8343 N N   . LYS C 1 300 ? 99.677  0.084   219.468 1.00 28.76  ? 300 LYS C N   1 
ATOM 8344 C CA  . LYS C 1 300 ? 100.533 -0.163  220.619 1.00 29.82  ? 300 LYS C CA  1 
ATOM 8345 C C   . LYS C 1 300 ? 101.897 -0.737  220.208 1.00 30.79  ? 300 LYS C C   1 
ATOM 8346 O O   . LYS C 1 300 ? 101.982 -1.554  219.290 1.00 32.11  ? 300 LYS C O   1 
ATOM 8347 C CB  . LYS C 1 300 ? 99.815  -1.118  221.587 1.00 29.79  ? 300 LYS C CB  1 
ATOM 8348 C CG  . LYS C 1 300 ? 100.463 -1.274  222.959 1.00 43.37  ? 300 LYS C CG  1 
ATOM 8349 C CD  . LYS C 1 300 ? 99.691  -2.256  223.827 1.00 48.40  ? 300 LYS C CD  1 
ATOM 8350 C CE  . LYS C 1 300 ? 100.426 -2.537  225.127 1.00 59.01  ? 300 LYS C CE  1 
ATOM 8351 N NZ  . LYS C 1 300 ? 99.742  -3.593  225.924 1.00 62.12  ? 300 LYS C NZ  1 
ATOM 8352 N N   . GLY C 1 301 ? 102.955 -0.245  220.853 1.00 29.90  ? 301 GLY C N   1 
ATOM 8353 C CA  . GLY C 1 301 ? 104.301 -0.731  220.616 1.00 30.30  ? 301 GLY C CA  1 
ATOM 8354 C C   . GLY C 1 301 ? 105.078 -0.259  219.408 1.00 30.49  ? 301 GLY C C   1 
ATOM 8355 O O   . GLY C 1 301 ? 106.063 -0.902  219.038 1.00 32.12  ? 301 GLY C O   1 
ATOM 8356 N N   . LEU C 1 302 ? 104.696 0.873   218.826 1.00 30.45  ? 302 LEU C N   1 
ATOM 8357 C CA  . LEU C 1 302 ? 105.398 1.410   217.655 1.00 33.38  ? 302 LEU C CA  1 
ATOM 8358 C C   . LEU C 1 302 ? 106.853 1.862   217.883 1.00 33.83  ? 302 LEU C C   1 
ATOM 8359 O O   . LEU C 1 302 ? 107.639 1.948   216.941 1.00 35.69  ? 302 LEU C O   1 
ATOM 8360 C CB  . LEU C 1 302 ? 104.606 2.568   217.045 1.00 34.50  ? 302 LEU C CB  1 
ATOM 8361 C CG  . LEU C 1 302 ? 103.319 2.257   216.283 1.00 36.23  ? 302 LEU C CG  1 
ATOM 8362 C CD1 . LEU C 1 302 ? 102.657 3.561   215.886 1.00 35.26  ? 302 LEU C CD1 1 
ATOM 8363 C CD2 . LEU C 1 302 ? 103.628 1.435   215.045 1.00 39.67  ? 302 LEU C CD2 1 
ATOM 8364 N N   . THR C 1 303 ? 107.220 2.155   219.120 1.00 32.90  ? 303 THR C N   1 
ATOM 8365 C CA  . THR C 1 303 ? 108.572 2.607   219.380 1.00 33.77  ? 303 THR C CA  1 
ATOM 8366 C C   . THR C 1 303 ? 109.472 1.532   220.002 1.00 35.90  ? 303 THR C C   1 
ATOM 8367 O O   . THR C 1 303 ? 110.552 1.844   220.524 1.00 35.15  ? 303 THR C O   1 
ATOM 8368 C CB  . THR C 1 303 ? 108.554 3.855   220.265 1.00 34.77  ? 303 THR C CB  1 
ATOM 8369 O OG1 . THR C 1 303 ? 108.138 3.493   221.591 1.00 31.30  ? 303 THR C OG1 1 
ATOM 8370 C CG2 . THR C 1 303 ? 107.595 4.883   219.689 1.00 28.72  ? 303 THR C CG2 1 
ATOM 8371 N N   . TYR C 1 304 ? 109.017 0.280   220.007 1.00 33.66  ? 304 TYR C N   1 
ATOM 8372 C CA  . TYR C 1 304 ? 109.841 -0.800  220.554 1.00 31.77  ? 304 TYR C CA  1 
ATOM 8373 C C   . TYR C 1 304 ? 110.900 -1.111  219.505 1.00 29.72  ? 304 TYR C C   1 
ATOM 8374 O O   . TYR C 1 304 ? 110.737 -0.749  218.336 1.00 25.71  ? 304 TYR C O   1 
ATOM 8375 C CB  . TYR C 1 304 ? 109.029 -2.077  220.704 1.00 32.72  ? 304 TYR C CB  1 
ATOM 8376 C CG  . TYR C 1 304 ? 107.898 -2.055  221.691 1.00 39.25  ? 304 TYR C CG  1 
ATOM 8377 C CD1 . TYR C 1 304 ? 107.784 -1.048  222.650 1.00 38.59  ? 304 TYR C CD1 1 
ATOM 8378 C CD2 . TYR C 1 304 ? 106.956 -3.090  221.692 1.00 36.88  ? 304 TYR C CD2 1 
ATOM 8379 C CE1 . TYR C 1 304 ? 106.761 -1.077  223.593 1.00 37.01  ? 304 TYR C CE1 1 
ATOM 8380 C CE2 . TYR C 1 304 ? 105.938 -3.130  222.620 1.00 35.06  ? 304 TYR C CE2 1 
ATOM 8381 C CZ  . TYR C 1 304 ? 105.841 -2.127  223.571 1.00 38.99  ? 304 TYR C CZ  1 
ATOM 8382 O OH  . TYR C 1 304 ? 104.832 -2.195  224.502 1.00 30.89  ? 304 TYR C OH  1 
ATOM 8383 N N   . THR C 1 305 ? 111.976 -1.783  219.899 1.00 30.33  ? 305 THR C N   1 
ATOM 8384 C CA  . THR C 1 305 ? 112.963 -2.184  218.900 1.00 32.22  ? 305 THR C CA  1 
ATOM 8385 C C   . THR C 1 305 ? 112.462 -3.499  218.321 1.00 30.75  ? 305 THR C C   1 
ATOM 8386 O O   . THR C 1 305 ? 111.581 -4.150  218.903 1.00 29.47  ? 305 THR C O   1 
ATOM 8387 C CB  . THR C 1 305 ? 114.364 -2.461  219.478 1.00 33.33  ? 305 THR C CB  1 
ATOM 8388 O OG1 . THR C 1 305 ? 114.251 -3.184  220.712 1.00 36.55  ? 305 THR C OG1 1 
ATOM 8389 C CG2 . THR C 1 305 ? 115.148 -1.177  219.652 1.00 44.06  ? 305 THR C CG2 1 
ATOM 8390 N N   . MET C 1 306 ? 113.032 -3.896  217.190 1.00 30.26  ? 306 MET C N   1 
ATOM 8391 C CA  . MET C 1 306 ? 112.670 -5.154  216.554 1.00 30.75  ? 306 MET C CA  1 
ATOM 8392 C C   . MET C 1 306 ? 113.137 -6.287  217.445 1.00 29.63  ? 306 MET C C   1 
ATOM 8393 O O   . MET C 1 306 ? 114.166 -6.177  218.124 1.00 30.66  ? 306 MET C O   1 
ATOM 8394 C CB  . MET C 1 306 ? 113.351 -5.300  215.192 1.00 34.02  ? 306 MET C CB  1 
ATOM 8395 C CG  . MET C 1 306 ? 112.896 -4.303  214.140 1.00 39.71  ? 306 MET C CG  1 
ATOM 8396 S SD  . MET C 1 306 ? 111.122 -4.371  213.824 1.00 54.97  ? 306 MET C SD  1 
ATOM 8397 C CE  . MET C 1 306 ? 110.897 -6.087  213.570 1.00 37.31  ? 306 MET C CE  1 
ATOM 8398 N N   . CYS C 1 307 ? 112.352 -7.351  217.490 1.00 27.17  ? 307 CYS C N   1 
ATOM 8399 C CA  . CYS C 1 307 ? 112.714 -8.515  218.278 1.00 27.77  ? 307 CYS C CA  1 
ATOM 8400 C C   . CYS C 1 307 ? 113.935 -9.172  217.639 1.00 26.00  ? 307 CYS C C   1 
ATOM 8401 O O   . CYS C 1 307 ? 114.145 -9.080  216.427 1.00 23.41  ? 307 CYS C O   1 
ATOM 8402 C CB  . CYS C 1 307 ? 111.571 -9.535  218.284 1.00 30.45  ? 307 CYS C CB  1 
ATOM 8403 S SG  . CYS C 1 307 ? 110.056 -8.976  219.110 1.00 27.12  ? 307 CYS C SG  1 
ATOM 8404 N N   . ASP C 1 308 ? 114.736 -9.824  218.468 1.00 26.18  ? 308 ASP C N   1 
ATOM 8405 C CA  . ASP C 1 308 ? 115.915 -10.554 218.014 1.00 27.79  ? 308 ASP C CA  1 
ATOM 8406 C C   . ASP C 1 308 ? 115.404 -11.606 217.007 1.00 27.42  ? 308 ASP C C   1 
ATOM 8407 O O   . ASP C 1 308 ? 114.681 -12.538 217.399 1.00 25.65  ? 308 ASP C O   1 
ATOM 8408 C CB  . ASP C 1 308 ? 116.536 -11.238 219.245 1.00 30.56  ? 308 ASP C CB  1 
ATOM 8409 C CG  . ASP C 1 308 ? 117.818 -11.994 218.937 1.00 36.66  ? 308 ASP C CG  1 
ATOM 8410 O OD1 . ASP C 1 308 ? 117.961 -12.540 217.822 1.00 28.98  ? 308 ASP C OD1 1 
ATOM 8411 O OD2 . ASP C 1 308 ? 118.677 -12.068 219.847 1.00 41.98  ? 308 ASP C OD2 1 
ATOM 8412 N N   . LYS C 1 309 ? 115.829 -11.488 215.746 1.00 27.32  ? 309 LYS C N   1 
ATOM 8413 C CA  . LYS C 1 309 ? 115.415 -12.396 214.656 1.00 29.67  ? 309 LYS C CA  1 
ATOM 8414 C C   . LYS C 1 309 ? 115.768 -13.874 214.839 1.00 29.13  ? 309 LYS C C   1 
ATOM 8415 O O   . LYS C 1 309 ? 115.279 -14.737 214.114 1.00 29.23  ? 309 LYS C O   1 
ATOM 8416 C CB  . LYS C 1 309 ? 116.003 -11.910 213.331 1.00 35.52  ? 309 LYS C CB  1 
ATOM 8417 C CG  . LYS C 1 309 ? 115.452 -10.577 212.872 1.00 48.17  ? 309 LYS C CG  1 
ATOM 8418 C CD  . LYS C 1 309 ? 116.158 -10.083 211.616 1.00 66.08  ? 309 LYS C CD  1 
ATOM 8419 C CE  . LYS C 1 309 ? 115.577 -8.753  211.123 1.00 67.43  ? 309 LYS C CE  1 
ATOM 8420 N NZ  . LYS C 1 309 ? 116.430 -8.153  210.044 1.00 72.70  ? 309 LYS C NZ  1 
ATOM 8421 N N   . THR C 1 310 ? 116.587 -14.148 215.839 1.00 28.86  ? 310 THR C N   1 
ATOM 8422 C CA  . THR C 1 310 ? 117.084 -15.477 216.169 1.00 30.45  ? 310 THR C CA  1 
ATOM 8423 C C   . THR C 1 310 ? 116.308 -16.259 217.231 1.00 28.69  ? 310 THR C C   1 
ATOM 8424 O O   . THR C 1 310 ? 116.508 -17.469 217.382 1.00 26.65  ? 310 THR C O   1 
ATOM 8425 C CB  . THR C 1 310 ? 118.537 -15.287 216.685 1.00 32.56  ? 310 THR C CB  1 
ATOM 8426 O OG1 . THR C 1 310 ? 119.392 -15.053 215.565 1.00 38.74  ? 310 THR C OG1 1 
ATOM 8427 C CG2 . THR C 1 310 ? 119.032 -16.435 217.539 1.00 38.83  ? 310 THR C CG2 1 
ATOM 8428 N N   . LYS C 1 311 ? 115.411 -15.586 217.947 1.00 27.40  ? 311 LYS C N   1 
ATOM 8429 C CA  . LYS C 1 311 ? 114.719 -16.237 219.059 1.00 27.27  ? 311 LYS C CA  1 
ATOM 8430 C C   . LYS C 1 311 ? 113.247 -16.653 218.936 1.00 25.36  ? 311 LYS C C   1 
ATOM 8431 O O   . LYS C 1 311 ? 112.574 -16.822 219.962 1.00 24.91  ? 311 LYS C O   1 
ATOM 8432 C CB  . LYS C 1 311 ? 114.894 -15.380 220.311 1.00 29.50  ? 311 LYS C CB  1 
ATOM 8433 C CG  . LYS C 1 311 ? 116.260 -14.749 220.452 1.00 36.80  ? 311 LYS C CG  1 
ATOM 8434 C CD  . LYS C 1 311 ? 117.139 -15.544 221.365 1.00 49.62  ? 311 LYS C CD  1 
ATOM 8435 C CE  . LYS C 1 311 ? 118.265 -14.672 221.891 1.00 56.58  ? 311 LYS C CE  1 
ATOM 8436 N NZ  . LYS C 1 311 ? 118.796 -15.189 223.184 1.00 63.30  ? 311 LYS C NZ  1 
ATOM 8437 N N   . PHE C 1 312 ? 112.747 -16.829 217.717 1.00 24.04  ? 312 PHE C N   1 
ATOM 8438 C CA  . PHE C 1 312 ? 111.357 -17.252 217.521 1.00 19.91  ? 312 PHE C CA  1 
ATOM 8439 C C   . PHE C 1 312 ? 111.221 -18.742 217.220 1.00 21.37  ? 312 PHE C C   1 
ATOM 8440 O O   . PHE C 1 312 ? 112.110 -19.349 216.614 1.00 20.09  ? 312 PHE C O   1 
ATOM 8441 C CB  . PHE C 1 312 ? 110.714 -16.476 216.374 1.00 20.71  ? 312 PHE C CB  1 
ATOM 8442 C CG  . PHE C 1 312 ? 110.437 -15.039 216.700 1.00 23.74  ? 312 PHE C CG  1 
ATOM 8443 C CD1 . PHE C 1 312 ? 109.282 -14.681 217.399 1.00 17.58  ? 312 PHE C CD1 1 
ATOM 8444 C CD2 . PHE C 1 312 ? 111.321 -14.038 216.299 1.00 22.68  ? 312 PHE C CD2 1 
ATOM 8445 C CE1 . PHE C 1 312 ? 109.010 -13.345 217.696 1.00 21.10  ? 312 PHE C CE1 1 
ATOM 8446 C CE2 . PHE C 1 312 ? 111.054 -12.689 216.591 1.00 28.07  ? 312 PHE C CE2 1 
ATOM 8447 C CZ  . PHE C 1 312 ? 109.897 -12.344 217.291 1.00 23.63  ? 312 PHE C CZ  1 
ATOM 8448 N N   . THR C 1 313 ? 110.149 -19.345 217.725 1.00 17.90  ? 313 THR C N   1 
ATOM 8449 C CA  . THR C 1 313 ? 109.822 -20.741 217.450 1.00 16.91  ? 313 THR C CA  1 
ATOM 8450 C C   . THR C 1 313 ? 108.306 -20.780 217.219 1.00 17.91  ? 313 THR C C   1 
ATOM 8451 O O   . THR C 1 313 ? 107.599 -19.838 217.612 1.00 18.32  ? 313 THR C O   1 
ATOM 8452 C CB  . THR C 1 313 ? 110.198 -21.665 218.595 1.00 14.37  ? 313 THR C CB  1 
ATOM 8453 O OG1 . THR C 1 313 ? 109.740 -21.110 219.829 1.00 18.07  ? 313 THR C OG1 1 
ATOM 8454 C CG2 . THR C 1 313 ? 111.704 -21.845 218.641 1.00 16.63  ? 313 THR C CG2 1 
ATOM 8455 N N   . TRP C 1 314 ? 107.809 -21.814 216.545 1.00 15.14  ? 314 TRP C N   1 
ATOM 8456 C CA  . TRP C 1 314 ? 106.368 -21.923 216.290 1.00 15.80  ? 314 TRP C CA  1 
ATOM 8457 C C   . TRP C 1 314 ? 105.634 -22.623 217.433 1.00 17.36  ? 314 TRP C C   1 
ATOM 8458 O O   . TRP C 1 314 ? 105.984 -23.755 217.776 1.00 19.47  ? 314 TRP C O   1 
ATOM 8459 C CB  . TRP C 1 314 ? 106.079 -22.737 215.016 1.00 17.17  ? 314 TRP C CB  1 
ATOM 8460 C CG  . TRP C 1 314 ? 106.584 -22.158 213.743 1.00 17.63  ? 314 TRP C CG  1 
ATOM 8461 C CD1 . TRP C 1 314 ? 107.634 -22.608 213.003 1.00 15.87  ? 314 TRP C CD1 1 
ATOM 8462 C CD2 . TRP C 1 314 ? 106.074 -21.007 213.061 1.00 19.84  ? 314 TRP C CD2 1 
ATOM 8463 N NE1 . TRP C 1 314 ? 107.821 -21.806 211.906 1.00 19.48  ? 314 TRP C NE1 1 
ATOM 8464 C CE2 . TRP C 1 314 ? 106.882 -20.811 211.917 1.00 20.49  ? 314 TRP C CE2 1 
ATOM 8465 C CE3 . TRP C 1 314 ? 105.019 -20.115 213.309 1.00 14.49  ? 314 TRP C CE3 1 
ATOM 8466 C CZ2 . TRP C 1 314 ? 106.669 -19.764 211.022 1.00 18.23  ? 314 TRP C CZ2 1 
ATOM 8467 C CZ3 . TRP C 1 314 ? 104.807 -19.076 212.420 1.00 15.60  ? 314 TRP C CZ3 1 
ATOM 8468 C CH2 . TRP C 1 314 ? 105.630 -18.904 211.291 1.00 15.54  ? 314 TRP C CH2 1 
ATOM 8469 N N   . LYS C 1 315 ? 104.650 -21.955 218.036 1.00 16.86  ? 315 LYS C N   1 
ATOM 8470 C CA  . LYS C 1 315 ? 103.840 -22.583 219.083 1.00 17.56  ? 315 LYS C CA  1 
ATOM 8471 C C   . LYS C 1 315 ? 102.689 -23.276 218.332 1.00 17.80  ? 315 LYS C C   1 
ATOM 8472 O O   . LYS C 1 315 ? 102.250 -24.374 218.700 1.00 18.04  ? 315 LYS C O   1 
ATOM 8473 C CB  . LYS C 1 315 ? 103.277 -21.553 220.068 1.00 22.13  ? 315 LYS C CB  1 
ATOM 8474 C CG  . LYS C 1 315 ? 102.424 -22.197 221.164 1.00 30.89  ? 315 LYS C CG  1 
ATOM 8475 C CD  . LYS C 1 315 ? 103.080 -22.112 222.535 1.00 51.34  ? 315 LYS C CD  1 
ATOM 8476 C CE  . LYS C 1 315 ? 103.042 -20.678 223.079 1.00 64.55  ? 315 LYS C CE  1 
ATOM 8477 N NZ  . LYS C 1 315 ? 103.763 -20.490 224.381 1.00 69.91  ? 315 LYS C NZ  1 
ATOM 8478 N N   . ARG C 1 316 ? 102.170 -22.602 217.306 1.00 16.13  ? 316 ARG C N   1 
ATOM 8479 C CA  . ARG C 1 316 ? 101.114 -23.161 216.462 1.00 17.05  ? 316 ARG C CA  1 
ATOM 8480 C C   . ARG C 1 316 ? 101.520 -22.808 215.049 1.00 17.08  ? 316 ARG C C   1 
ATOM 8481 O O   . ARG C 1 316 ? 101.565 -21.622 214.687 1.00 16.30  ? 316 ARG C O   1 
ATOM 8482 C CB  . ARG C 1 316 ? 99.744  -22.550 216.773 1.00 20.79  ? 316 ARG C CB  1 
ATOM 8483 C CG  . ARG C 1 316 ? 99.228  -22.870 218.158 1.00 27.41  ? 316 ARG C CG  1 
ATOM 8484 C CD  . ARG C 1 316 ? 97.742  -22.680 218.205 1.00 33.74  ? 316 ARG C CD  1 
ATOM 8485 N NE  . ARG C 1 316 ? 97.349  -21.918 219.379 1.00 37.05  ? 316 ARG C NE  1 
ATOM 8486 C CZ  . ARG C 1 316 ? 96.156  -22.003 219.958 1.00 34.65  ? 316 ARG C CZ  1 
ATOM 8487 N NH1 . ARG C 1 316 ? 95.236  -22.824 219.474 1.00 24.92  ? 316 ARG C NH1 1 
ATOM 8488 N NH2 . ARG C 1 316 ? 95.891  -21.270 221.027 1.00 37.60  ? 316 ARG C NH2 1 
ATOM 8489 N N   . ALA C 1 317 ? 101.885 -23.829 214.279 1.00 15.76  ? 317 ALA C N   1 
ATOM 8490 C CA  . ALA C 1 317 ? 102.332 -23.644 212.909 1.00 16.80  ? 317 ALA C CA  1 
ATOM 8491 C C   . ALA C 1 317 ? 101.215 -23.023 212.089 1.00 17.10  ? 317 ALA C C   1 
ATOM 8492 O O   . ALA C 1 317 ? 100.045 -23.166 212.439 1.00 17.51  ? 317 ALA C O   1 
ATOM 8493 C CB  . ALA C 1 317 ? 102.755 -24.993 212.315 1.00 15.33  ? 317 ALA C CB  1 
ATOM 8494 N N   . PRO C 1 318 ? 101.556 -22.310 210.999 1.00 17.13  ? 318 PRO C N   1 
ATOM 8495 C CA  . PRO C 1 318 ? 100.545 -21.674 210.134 1.00 18.71  ? 318 PRO C CA  1 
ATOM 8496 C C   . PRO C 1 318 ? 99.429  -22.652 209.750 1.00 21.77  ? 318 PRO C C   1 
ATOM 8497 O O   . PRO C 1 318 ? 99.677  -23.810 209.379 1.00 19.45  ? 318 PRO C O   1 
ATOM 8498 C CB  . PRO C 1 318 ? 101.352 -21.253 208.912 1.00 13.90  ? 318 PRO C CB  1 
ATOM 8499 C CG  . PRO C 1 318 ? 102.698 -20.890 209.535 1.00 18.72  ? 318 PRO C CG  1 
ATOM 8500 C CD  . PRO C 1 318 ? 102.923 -22.026 210.525 1.00 13.02  ? 318 PRO C CD  1 
ATOM 8501 N N   . THR C 1 319 ? 98.194  -22.195 209.888 1.00 21.92  ? 319 THR C N   1 
ATOM 8502 C CA  . THR C 1 319 ? 97.059  -23.026 209.562 1.00 23.47  ? 319 THR C CA  1 
ATOM 8503 C C   . THR C 1 319 ? 95.963  -22.186 208.929 1.00 22.21  ? 319 THR C C   1 
ATOM 8504 O O   . THR C 1 319 ? 95.860  -20.972 209.152 1.00 19.26  ? 319 THR C O   1 
ATOM 8505 C CB  . THR C 1 319 ? 96.530  -23.804 210.801 1.00 29.92  ? 319 THR C CB  1 
ATOM 8506 O OG1 . THR C 1 319 ? 95.607  -24.806 210.365 1.00 48.12  ? 319 THR C OG1 1 
ATOM 8507 C CG2 . THR C 1 319 ? 95.803  -22.902 211.754 1.00 36.70  ? 319 THR C CG2 1 
ATOM 8508 N N   . ASP C 1 320 ? 95.191  -22.848 208.083 1.00 21.57  ? 320 ASP C N   1 
ATOM 8509 C CA  . ASP C 1 320 ? 94.085  -22.244 207.368 1.00 24.77  ? 320 ASP C CA  1 
ATOM 8510 C C   . ASP C 1 320 ? 92.973  -21.852 208.350 1.00 21.96  ? 320 ASP C C   1 
ATOM 8511 O O   . ASP C 1 320 ? 92.490  -22.701 209.104 1.00 19.92  ? 320 ASP C O   1 
ATOM 8512 C CB  . ASP C 1 320 ? 93.565  -23.267 206.373 1.00 33.13  ? 320 ASP C CB  1 
ATOM 8513 C CG  . ASP C 1 320 ? 93.039  -22.632 205.142 1.00 47.08  ? 320 ASP C CG  1 
ATOM 8514 O OD1 . ASP C 1 320 ? 91.971  -21.977 205.229 1.00 46.85  ? 320 ASP C OD1 1 
ATOM 8515 O OD2 . ASP C 1 320 ? 93.718  -22.768 204.100 1.00 58.38  ? 320 ASP C OD2 1 
ATOM 8516 N N   . SER C 1 321 ? 92.561  -20.586 208.338 1.00 18.91  ? 321 SER C N   1 
ATOM 8517 C CA  . SER C 1 321 ? 91.523  -20.133 209.267 1.00 20.77  ? 321 SER C CA  1 
ATOM 8518 C C   . SER C 1 321 ? 90.106  -20.442 208.811 1.00 23.72  ? 321 SER C C   1 
ATOM 8519 O O   . SER C 1 321 ? 89.171  -20.420 209.609 1.00 25.16  ? 321 SER C O   1 
ATOM 8520 C CB  . SER C 1 321 ? 91.613  -18.631 209.475 1.00 13.99  ? 321 SER C CB  1 
ATOM 8521 O OG  . SER C 1 321 ? 91.139  -17.958 208.317 1.00 14.81  ? 321 SER C OG  1 
ATOM 8522 N N   . GLY C 1 322 ? 89.931  -20.693 207.524 1.00 25.79  ? 322 GLY C N   1 
ATOM 8523 C CA  . GLY C 1 322 ? 88.587  -20.926 207.030 1.00 29.27  ? 322 GLY C CA  1 
ATOM 8524 C C   . GLY C 1 322 ? 87.975  -19.628 206.502 1.00 31.35  ? 322 GLY C C   1 
ATOM 8525 O O   . GLY C 1 322 ? 86.844  -19.628 206.017 1.00 34.50  ? 322 GLY C O   1 
ATOM 8526 N N   . HIS C 1 323 ? 88.717  -18.521 206.597 1.00 29.21  ? 323 HIS C N   1 
ATOM 8527 C CA  . HIS C 1 323 ? 88.266  -17.221 206.098 1.00 25.29  ? 323 HIS C CA  1 
ATOM 8528 C C   . HIS C 1 323 ? 89.249  -16.699 205.062 1.00 26.68  ? 323 HIS C C   1 
ATOM 8529 O O   . HIS C 1 323 ? 89.330  -15.485 204.824 1.00 25.00  ? 323 HIS C O   1 
ATOM 8530 C CB  . HIS C 1 323 ? 88.186  -16.217 207.238 1.00 22.59  ? 323 HIS C CB  1 
ATOM 8531 C CG  . HIS C 1 323 ? 87.132  -16.542 208.239 1.00 23.02  ? 323 HIS C CG  1 
ATOM 8532 N ND1 . HIS C 1 323 ? 87.423  -16.895 209.540 1.00 26.25  ? 323 HIS C ND1 1 
ATOM 8533 C CD2 . HIS C 1 323 ? 85.782  -16.587 208.126 1.00 24.30  ? 323 HIS C CD2 1 
ATOM 8534 C CE1 . HIS C 1 323 ? 86.296  -17.142 210.186 1.00 26.66  ? 323 HIS C CE1 1 
ATOM 8535 N NE2 . HIS C 1 323 ? 85.289  -16.963 209.351 1.00 26.03  ? 323 HIS C NE2 1 
ATOM 8536 N N   . ASP C 1 324 ? 89.999  -17.623 204.457 1.00 25.40  ? 324 ASP C N   1 
ATOM 8537 C CA  . ASP C 1 324 ? 91.014  -17.298 203.465 1.00 27.11  ? 324 ASP C CA  1 
ATOM 8538 C C   . ASP C 1 324 ? 92.180  -16.489 204.030 1.00 26.54  ? 324 ASP C C   1 
ATOM 8539 O O   . ASP C 1 324 ? 92.782  -15.652 203.340 1.00 27.66  ? 324 ASP C O   1 
ATOM 8540 C CB  . ASP C 1 324 ? 90.380  -16.617 202.258 1.00 31.46  ? 324 ASP C CB  1 
ATOM 8541 C CG  . ASP C 1 324 ? 89.441  -17.545 201.527 1.00 42.51  ? 324 ASP C CG  1 
ATOM 8542 O OD1 . ASP C 1 324 ? 89.805  -18.734 201.375 1.00 44.63  ? 324 ASP C OD1 1 
ATOM 8543 O OD2 . ASP C 1 324 ? 88.330  -17.110 201.153 1.00 50.82  ? 324 ASP C OD2 1 
ATOM 8544 N N   . THR C 1 325 ? 92.457  -16.719 205.309 1.00 21.60  ? 325 THR C N   1 
ATOM 8545 C CA  . THR C 1 325 ? 93.562  -16.064 205.993 1.00 19.97  ? 325 THR C CA  1 
ATOM 8546 C C   . THR C 1 325 ? 94.357  -17.186 206.637 1.00 18.92  ? 325 THR C C   1 
ATOM 8547 O O   . THR C 1 325 ? 93.892  -18.334 206.693 1.00 18.07  ? 325 THR C O   1 
ATOM 8548 C CB  . THR C 1 325 ? 93.093  -15.084 207.094 1.00 20.48  ? 325 THR C CB  1 
ATOM 8549 O OG1 . THR C 1 325 ? 92.362  -15.794 208.097 1.00 16.06  ? 325 THR C OG1 1 
ATOM 8550 C CG2 . THR C 1 325 ? 92.248  -13.992 206.508 1.00 16.58  ? 325 THR C CG2 1 
ATOM 8551 N N   . VAL C 1 326 ? 95.544  -16.861 207.131 1.00 17.80  ? 326 VAL C N   1 
ATOM 8552 C CA  . VAL C 1 326 ? 96.402  -17.847 207.767 1.00 16.29  ? 326 VAL C CA  1 
ATOM 8553 C C   . VAL C 1 326 ? 96.598  -17.368 209.202 1.00 17.23  ? 326 VAL C C   1 
ATOM 8554 O O   . VAL C 1 326 ? 96.775  -16.158 209.429 1.00 15.48  ? 326 VAL C O   1 
ATOM 8555 C CB  . VAL C 1 326 ? 97.784  -17.919 207.046 1.00 20.38  ? 326 VAL C CB  1 
ATOM 8556 C CG1 . VAL C 1 326 ? 98.582  -19.112 207.541 1.00 22.13  ? 326 VAL C CG1 1 
ATOM 8557 C CG2 . VAL C 1 326 ? 97.598  -18.002 205.544 1.00 21.89  ? 326 VAL C CG2 1 
ATOM 8558 N N   . VAL C 1 327 ? 96.450  -18.278 210.169 1.00 15.49  ? 327 VAL C N   1 
ATOM 8559 C CA  . VAL C 1 327 ? 96.650  -17.943 211.570 1.00 14.03  ? 327 VAL C CA  1 
ATOM 8560 C C   . VAL C 1 327 ? 97.837  -18.762 212.071 1.00 16.54  ? 327 VAL C C   1 
ATOM 8561 O O   . VAL C 1 327 ? 98.124  -19.841 211.541 1.00 17.39  ? 327 VAL C O   1 
ATOM 8562 C CB  . VAL C 1 327 ? 95.374  -18.164 212.451 1.00 18.13  ? 327 VAL C CB  1 
ATOM 8563 C CG1 . VAL C 1 327 ? 94.292  -17.149 212.072 1.00 15.78  ? 327 VAL C CG1 1 
ATOM 8564 C CG2 . VAL C 1 327 ? 94.853  -19.590 212.324 1.00 14.22  ? 327 VAL C CG2 1 
ATOM 8565 N N   . MET C 1 328 ? 98.549  -18.236 213.061 1.00 16.29  ? 328 MET C N   1 
ATOM 8566 C CA  . MET C 1 328 ? 99.729  -18.902 213.597 1.00 15.41  ? 328 MET C CA  1 
ATOM 8567 C C   . MET C 1 328 ? 100.055 -18.249 214.920 1.00 19.05  ? 328 MET C C   1 
ATOM 8568 O O   . MET C 1 328 ? 99.511  -17.183 215.248 1.00 18.83  ? 328 MET C O   1 
ATOM 8569 C CB  . MET C 1 328 ? 100.918 -18.670 212.660 1.00 14.75  ? 328 MET C CB  1 
ATOM 8570 C CG  . MET C 1 328 ? 101.333 -17.184 212.563 1.00 12.55  ? 328 MET C CG  1 
ATOM 8571 S SD  . MET C 1 328 ? 102.071 -16.790 210.973 1.00 19.20  ? 328 MET C SD  1 
ATOM 8572 C CE  . MET C 1 328 ? 100.632 -16.770 209.923 1.00 17.21  ? 328 MET C CE  1 
ATOM 8573 N N   . GLU C 1 329 ? 100.937 -18.881 215.683 1.00 17.22  ? 329 GLU C N   1 
ATOM 8574 C CA  . GLU C 1 329 ? 101.346 -18.309 216.944 1.00 17.26  ? 329 GLU C CA  1 
ATOM 8575 C C   . GLU C 1 329 ? 102.810 -18.663 217.196 1.00 19.00  ? 329 GLU C C   1 
ATOM 8576 O O   . GLU C 1 329 ? 103.222 -19.828 217.076 1.00 16.06  ? 329 GLU C O   1 
ATOM 8577 C CB  . GLU C 1 329 ? 100.468 -18.818 218.083 1.00 18.33  ? 329 GLU C CB  1 
ATOM 8578 C CG  . GLU C 1 329 ? 100.763 -18.116 219.387 1.00 26.82  ? 329 GLU C CG  1 
ATOM 8579 C CD  . GLU C 1 329 ? 100.051 -18.715 220.583 1.00 35.48  ? 329 GLU C CD  1 
ATOM 8580 O OE1 . GLU C 1 329 ? 99.190  -19.601 220.403 1.00 31.47  ? 329 GLU C OE1 1 
ATOM 8581 O OE2 . GLU C 1 329 ? 100.367 -18.295 221.719 1.00 38.08  ? 329 GLU C OE2 1 
ATOM 8582 N N   . VAL C 1 330 ? 103.601 -17.650 217.516 1.00 17.07  ? 330 VAL C N   1 
ATOM 8583 C CA  . VAL C 1 330 ? 105.010 -17.863 217.796 1.00 20.60  ? 330 VAL C CA  1 
ATOM 8584 C C   . VAL C 1 330 ? 105.363 -17.626 219.273 1.00 22.97  ? 330 VAL C C   1 
ATOM 8585 O O   . VAL C 1 330 ? 104.601 -17.012 220.021 1.00 22.32  ? 330 VAL C O   1 
ATOM 8586 C CB  . VAL C 1 330 ? 105.906 -16.962 216.914 1.00 17.77  ? 330 VAL C CB  1 
ATOM 8587 C CG1 . VAL C 1 330 ? 105.710 -17.300 215.447 1.00 15.88  ? 330 VAL C CG1 1 
ATOM 8588 C CG2 . VAL C 1 330 ? 105.628 -15.470 217.191 1.00 15.94  ? 330 VAL C CG2 1 
ATOM 8589 N N   . THR C 1 331 ? 106.500 -18.168 219.691 1.00 22.69  ? 331 THR C N   1 
ATOM 8590 C CA  . THR C 1 331 ? 107.007 -17.990 221.049 1.00 24.54  ? 331 THR C CA  1 
ATOM 8591 C C   . THR C 1 331 ? 108.346 -17.273 220.852 1.00 26.03  ? 331 THR C C   1 
ATOM 8592 O O   . THR C 1 331 ? 109.053 -17.548 219.876 1.00 25.65  ? 331 THR C O   1 
ATOM 8593 C CB  . THR C 1 331 ? 107.244 -19.336 221.737 1.00 23.62  ? 331 THR C CB  1 
ATOM 8594 O OG1 . THR C 1 331 ? 106.000 -20.039 221.815 1.00 26.29  ? 331 THR C OG1 1 
ATOM 8595 C CG2 . THR C 1 331 ? 107.799 -19.148 223.139 1.00 24.63  ? 331 THR C CG2 1 
ATOM 8596 N N   . PHE C 1 332 ? 108.663 -16.332 221.735 1.00 24.77  ? 332 PHE C N   1 
ATOM 8597 C CA  . PHE C 1 332 ? 109.899 -15.555 221.645 1.00 25.98  ? 332 PHE C CA  1 
ATOM 8598 C C   . PHE C 1 332 ? 110.672 -15.725 222.946 1.00 28.50  ? 332 PHE C C   1 
ATOM 8599 O O   . PHE C 1 332 ? 110.110 -15.551 224.035 1.00 29.83  ? 332 PHE C O   1 
ATOM 8600 C CB  . PHE C 1 332 ? 109.563 -14.087 221.422 1.00 21.40  ? 332 PHE C CB  1 
ATOM 8601 C CG  . PHE C 1 332 ? 110.758 -13.199 221.308 1.00 23.37  ? 332 PHE C CG  1 
ATOM 8602 C CD1 . PHE C 1 332 ? 111.569 -13.248 220.180 1.00 28.10  ? 332 PHE C CD1 1 
ATOM 8603 C CD2 . PHE C 1 332 ? 111.050 -12.270 222.312 1.00 22.74  ? 332 PHE C CD2 1 
ATOM 8604 C CE1 . PHE C 1 332 ? 112.661 -12.377 220.035 1.00 28.42  ? 332 PHE C CE1 1 
ATOM 8605 C CE2 . PHE C 1 332 ? 112.131 -11.399 222.182 1.00 24.48  ? 332 PHE C CE2 1 
ATOM 8606 C CZ  . PHE C 1 332 ? 112.941 -11.453 221.033 1.00 29.26  ? 332 PHE C CZ  1 
ATOM 8607 N N   . SER C 1 333 ? 111.961 -16.049 222.837 1.00 30.40  ? 333 SER C N   1 
ATOM 8608 C CA  . SER C 1 333 ? 112.788 -16.274 224.018 1.00 31.56  ? 333 SER C CA  1 
ATOM 8609 C C   . SER C 1 333 ? 113.768 -15.159 224.327 1.00 32.07  ? 333 SER C C   1 
ATOM 8610 O O   . SER C 1 333 ? 114.627 -15.322 225.183 1.00 36.50  ? 333 SER C O   1 
ATOM 8611 C CB  . SER C 1 333 ? 113.554 -17.589 223.878 1.00 33.99  ? 333 SER C CB  1 
ATOM 8612 O OG  . SER C 1 333 ? 114.345 -17.581 222.699 1.00 37.24  ? 333 SER C OG  1 
ATOM 8613 N N   . GLY C 1 334 ? 113.662 -14.045 223.617 1.00 30.40  ? 334 GLY C N   1 
ATOM 8614 C CA  . GLY C 1 334 ? 114.562 -12.933 223.857 1.00 32.33  ? 334 GLY C CA  1 
ATOM 8615 C C   . GLY C 1 334 ? 113.979 -11.929 224.834 1.00 34.77  ? 334 GLY C C   1 
ATOM 8616 O O   . GLY C 1 334 ? 113.031 -12.243 225.568 1.00 33.88  ? 334 GLY C O   1 
ATOM 8617 N N   . THR C 1 335 ? 114.528 -10.714 224.828 1.00 35.49  ? 335 THR C N   1 
ATOM 8618 C CA  . THR C 1 335 ? 114.058 -9.667  225.732 1.00 36.88  ? 335 THR C CA  1 
ATOM 8619 C C   . THR C 1 335 ? 112.856 -8.895  225.191 1.00 36.05  ? 335 THR C C   1 
ATOM 8620 O O   . THR C 1 335 ? 112.837 -8.436  224.034 1.00 34.56  ? 335 THR C O   1 
ATOM 8621 C CB  . THR C 1 335 ? 115.196 -8.690  226.148 1.00 42.68  ? 335 THR C CB  1 
ATOM 8622 O OG1 . THR C 1 335 ? 115.935 -8.275  224.992 1.00 41.85  ? 335 THR C OG1 1 
ATOM 8623 C CG2 . THR C 1 335 ? 116.143 -9.366  227.149 1.00 48.87  ? 335 THR C CG2 1 
ATOM 8624 N N   . LYS C 1 336 ? 111.863 -8.750  226.057 1.00 35.00  ? 336 LYS C N   1 
ATOM 8625 C CA  . LYS C 1 336 ? 110.615 -8.076  225.727 1.00 36.01  ? 336 LYS C CA  1 
ATOM 8626 C C   . LYS C 1 336 ? 110.566 -6.675  226.341 1.00 36.59  ? 336 LYS C C   1 
ATOM 8627 O O   . LYS C 1 336 ? 111.234 -6.404  227.345 1.00 38.81  ? 336 LYS C O   1 
ATOM 8628 C CB  . LYS C 1 336 ? 109.458 -8.936  226.255 1.00 38.27  ? 336 LYS C CB  1 
ATOM 8629 C CG  . LYS C 1 336 ? 109.540 -10.378 225.787 1.00 38.59  ? 336 LYS C CG  1 
ATOM 8630 C CD  . LYS C 1 336 ? 108.735 -11.311 226.651 1.00 45.46  ? 336 LYS C CD  1 
ATOM 8631 C CE  . LYS C 1 336 ? 108.970 -12.746 226.213 1.00 51.35  ? 336 LYS C CE  1 
ATOM 8632 N NZ  . LYS C 1 336 ? 108.214 -13.713 227.051 1.00 57.61  ? 336 LYS C NZ  1 
ATOM 8633 N N   . PRO C 1 337 ? 109.729 -5.777  225.793 1.00 34.06  ? 337 PRO C N   1 
ATOM 8634 C CA  . PRO C 1 337 ? 108.834 -5.989  224.654 1.00 34.17  ? 337 PRO C CA  1 
ATOM 8635 C C   . PRO C 1 337 ? 109.554 -5.637  223.359 1.00 33.89  ? 337 PRO C C   1 
ATOM 8636 O O   . PRO C 1 337 ? 110.555 -4.908  223.391 1.00 34.78  ? 337 PRO C O   1 
ATOM 8637 C CB  . PRO C 1 337 ? 107.711 -4.997  224.942 1.00 37.32  ? 337 PRO C CB  1 
ATOM 8638 C CG  . PRO C 1 337 ? 108.481 -3.811  225.452 1.00 32.60  ? 337 PRO C CG  1 
ATOM 8639 C CD  . PRO C 1 337 ? 109.521 -4.440  226.381 1.00 33.47  ? 337 PRO C CD  1 
ATOM 8640 N N   . CYS C 1 338 ? 109.025 -6.097  222.225 1.00 29.97  ? 338 CYS C N   1 
ATOM 8641 C CA  . CYS C 1 338 ? 109.640 -5.814  220.924 1.00 27.42  ? 338 CYS C CA  1 
ATOM 8642 C C   . CYS C 1 338 ? 108.674 -6.061  219.761 1.00 26.41  ? 338 CYS C C   1 
ATOM 8643 O O   . CYS C 1 338 ? 107.627 -6.693  219.931 1.00 25.90  ? 338 CYS C O   1 
ATOM 8644 C CB  . CYS C 1 338 ? 110.924 -6.646  220.761 1.00 25.57  ? 338 CYS C CB  1 
ATOM 8645 S SG  . CYS C 1 338 ? 110.692 -8.447  220.968 1.00 27.60  ? 338 CYS C SG  1 
ATOM 8646 N N   . ARG C 1 339 ? 108.988 -5.505  218.600 1.00 24.50  ? 339 ARG C N   1 
ATOM 8647 C CA  . ARG C 1 339 ? 108.152 -5.680  217.424 1.00 25.78  ? 339 ARG C CA  1 
ATOM 8648 C C   . ARG C 1 339 ? 108.554 -6.956  216.687 1.00 27.84  ? 339 ARG C C   1 
ATOM 8649 O O   . ARG C 1 339 ? 109.742 -7.221  216.495 1.00 29.14  ? 339 ARG C O   1 
ATOM 8650 C CB  . ARG C 1 339 ? 108.269 -4.469  216.509 1.00 25.70  ? 339 ARG C CB  1 
ATOM 8651 C CG  . ARG C 1 339 ? 107.440 -3.298  216.991 1.00 33.70  ? 339 ARG C CG  1 
ATOM 8652 C CD  . ARG C 1 339 ? 108.117 -1.987  216.706 1.00 36.01  ? 339 ARG C CD  1 
ATOM 8653 N NE  . ARG C 1 339 ? 108.267 -1.739  215.278 1.00 48.30  ? 339 ARG C NE  1 
ATOM 8654 C CZ  . ARG C 1 339 ? 109.350 -1.197  214.728 1.00 52.12  ? 339 ARG C CZ  1 
ATOM 8655 N NH1 . ARG C 1 339 ? 110.385 -0.849  215.488 1.00 45.84  ? 339 ARG C NH1 1 
ATOM 8656 N NH2 . ARG C 1 339 ? 109.393 -0.990  213.417 1.00 52.14  ? 339 ARG C NH2 1 
ATOM 8657 N N   . ILE C 1 340 ? 107.567 -7.759  216.301 1.00 25.74  ? 340 ILE C N   1 
ATOM 8658 C CA  . ILE C 1 340 ? 107.832 -9.010  215.596 1.00 24.82  ? 340 ILE C CA  1 
ATOM 8659 C C   . ILE C 1 340 ? 108.118 -8.737  214.120 1.00 23.54  ? 340 ILE C C   1 
ATOM 8660 O O   . ILE C 1 340 ? 107.349 -8.046  213.457 1.00 22.10  ? 340 ILE C O   1 
ATOM 8661 C CB  . ILE C 1 340 ? 106.624 -9.999  215.699 1.00 21.98  ? 340 ILE C CB  1 
ATOM 8662 C CG1 . ILE C 1 340 ? 106.297 -10.298 217.167 1.00 17.13  ? 340 ILE C CG1 1 
ATOM 8663 C CG2 . ILE C 1 340 ? 106.950 -11.313 214.975 1.00 20.73  ? 340 ILE C CG2 1 
ATOM 8664 C CD1 . ILE C 1 340 ? 105.110 -11.221 217.356 1.00 20.33  ? 340 ILE C CD1 1 
ATOM 8665 N N   . PRO C 1 341 ? 109.271 -9.207  213.611 1.00 25.01  ? 341 PRO C N   1 
ATOM 8666 C CA  . PRO C 1 341 ? 109.641 -9.012  212.202 1.00 25.40  ? 341 PRO C CA  1 
ATOM 8667 C C   . PRO C 1 341 ? 108.997 -10.102 211.324 1.00 27.68  ? 341 PRO C C   1 
ATOM 8668 O O   . PRO C 1 341 ? 109.623 -11.126 211.023 1.00 32.21  ? 341 PRO C O   1 
ATOM 8669 C CB  . PRO C 1 341 ? 111.162 -9.135  212.236 1.00 22.01  ? 341 PRO C CB  1 
ATOM 8670 C CG  . PRO C 1 341 ? 111.390 -10.128 213.338 1.00 25.13  ? 341 PRO C CG  1 
ATOM 8671 C CD  . PRO C 1 341 ? 110.417 -9.699  214.401 1.00 25.47  ? 341 PRO C CD  1 
ATOM 8672 N N   . VAL C 1 342 ? 107.754 -9.869  210.918 1.00 25.67  ? 342 VAL C N   1 
ATOM 8673 C CA  . VAL C 1 342 ? 106.993 -10.817 210.099 1.00 23.71  ? 342 VAL C CA  1 
ATOM 8674 C C   . VAL C 1 342 ? 106.936 -10.374 208.657 1.00 23.70  ? 342 VAL C C   1 
ATOM 8675 O O   . VAL C 1 342 ? 106.718 -9.197  208.384 1.00 26.53  ? 342 VAL C O   1 
ATOM 8676 C CB  . VAL C 1 342 ? 105.488 -10.861 210.482 1.00 27.59  ? 342 VAL C CB  1 
ATOM 8677 C CG1 . VAL C 1 342 ? 104.928 -12.257 210.272 1.00 22.63  ? 342 VAL C CG1 1 
ATOM 8678 C CG2 . VAL C 1 342 ? 105.236 -10.313 211.863 1.00 21.92  ? 342 VAL C CG2 1 
ATOM 8679 N N   . ARG C 1 343 ? 107.005 -11.330 207.742 1.00 21.74  ? 343 ARG C N   1 
ATOM 8680 C CA  . ARG C 1 343 ? 106.899 -11.045 206.316 1.00 21.55  ? 343 ARG C CA  1 
ATOM 8681 C C   . ARG C 1 343 ? 106.723 -12.386 205.643 1.00 21.44  ? 343 ARG C C   1 
ATOM 8682 O O   . ARG C 1 343 ? 106.830 -13.435 206.289 1.00 21.53  ? 343 ARG C O   1 
ATOM 8683 C CB  . ARG C 1 343 ? 108.151 -10.351 205.771 1.00 26.96  ? 343 ARG C CB  1 
ATOM 8684 C CG  . ARG C 1 343 ? 109.365 -11.248 205.736 1.00 27.03  ? 343 ARG C CG  1 
ATOM 8685 C CD  . ARG C 1 343 ? 110.641 -10.498 205.371 1.00 38.88  ? 343 ARG C CD  1 
ATOM 8686 N NE  . ARG C 1 343 ? 111.788 -11.366 205.631 1.00 41.83  ? 343 ARG C NE  1 
ATOM 8687 C CZ  . ARG C 1 343 ? 112.426 -12.077 204.702 1.00 39.61  ? 343 ARG C CZ  1 
ATOM 8688 N NH1 . ARG C 1 343 ? 112.051 -12.007 203.422 1.00 34.27  ? 343 ARG C NH1 1 
ATOM 8689 N NH2 . ARG C 1 343 ? 113.364 -12.949 205.078 1.00 32.68  ? 343 ARG C NH2 1 
ATOM 8690 N N   . ALA C 1 344 ? 106.428 -12.357 204.352 1.00 19.97  ? 344 ALA C N   1 
ATOM 8691 C CA  . ALA C 1 344 ? 106.251 -13.581 203.595 1.00 21.26  ? 344 ALA C CA  1 
ATOM 8692 C C   . ALA C 1 344 ? 106.614 -13.248 202.162 1.00 24.03  ? 344 ALA C C   1 
ATOM 8693 O O   . ALA C 1 344 ? 106.425 -12.102 201.721 1.00 22.07  ? 344 ALA C O   1 
ATOM 8694 C CB  . ALA C 1 344 ? 104.809 -14.069 203.684 1.00 14.45  ? 344 ALA C CB  1 
ATOM 8695 N N   . VAL C 1 345 ? 107.174 -14.230 201.455 1.00 24.71  ? 345 VAL C N   1 
ATOM 8696 C CA  . VAL C 1 345 ? 107.564 -14.045 200.063 1.00 23.00  ? 345 VAL C CA  1 
ATOM 8697 C C   . VAL C 1 345 ? 107.005 -15.185 199.244 1.00 23.51  ? 345 VAL C C   1 
ATOM 8698 O O   . VAL C 1 345 ? 106.752 -16.281 199.765 1.00 23.17  ? 345 VAL C O   1 
ATOM 8699 C CB  . VAL C 1 345 ? 109.105 -14.041 199.883 1.00 21.85  ? 345 VAL C CB  1 
ATOM 8700 C CG1 . VAL C 1 345 ? 109.745 -12.942 200.729 1.00 16.85  ? 345 VAL C CG1 1 
ATOM 8701 C CG2 . VAL C 1 345 ? 109.684 -15.407 200.242 1.00 23.93  ? 345 VAL C CG2 1 
ATOM 8702 N N   . ALA C 1 346 ? 106.789 -14.918 197.963 1.00 23.95  ? 346 ALA C N   1 
ATOM 8703 C CA  . ALA C 1 346 ? 106.303 -15.936 197.056 1.00 23.90  ? 346 ALA C CA  1 
ATOM 8704 C C   . ALA C 1 346 ? 107.542 -16.768 196.686 1.00 25.99  ? 346 ALA C C   1 
ATOM 8705 O O   . ALA C 1 346 ? 108.653 -16.233 196.571 1.00 23.56  ? 346 ALA C O   1 
ATOM 8706 C CB  . ALA C 1 346 ? 105.700 -15.295 195.815 1.00 24.29  ? 346 ALA C CB  1 
ATOM 8707 N N   . HIS C 1 347 ? 107.360 -18.078 196.581 1.00 26.61  ? 347 HIS C N   1 
ATOM 8708 C CA  . HIS C 1 347 ? 108.436 -18.993 196.217 1.00 30.53  ? 347 HIS C CA  1 
ATOM 8709 C C   . HIS C 1 347 ? 109.081 -18.453 194.914 1.00 31.97  ? 347 HIS C C   1 
ATOM 8710 O O   . HIS C 1 347 ? 108.386 -18.235 193.918 1.00 31.12  ? 347 HIS C O   1 
ATOM 8711 C CB  . HIS C 1 347 ? 107.819 -20.390 196.018 1.00 32.71  ? 347 HIS C CB  1 
ATOM 8712 C CG  . HIS C 1 347 ? 108.811 -21.469 195.712 1.00 50.84  ? 347 HIS C CG  1 
ATOM 8713 N ND1 . HIS C 1 347 ? 109.708 -21.389 194.666 1.00 59.71  ? 347 HIS C ND1 1 
ATOM 8714 C CD2 . HIS C 1 347 ? 109.038 -22.663 196.309 1.00 56.80  ? 347 HIS C CD2 1 
ATOM 8715 C CE1 . HIS C 1 347 ? 110.448 -22.484 194.636 1.00 61.89  ? 347 HIS C CE1 1 
ATOM 8716 N NE2 . HIS C 1 347 ? 110.062 -23.273 195.622 1.00 62.47  ? 347 HIS C NE2 1 
ATOM 8717 N N   . GLY C 1 348 ? 110.384 -18.172 194.940 1.00 32.41  ? 348 GLY C N   1 
ATOM 8718 C CA  . GLY C 1 348 ? 111.051 -17.663 193.750 1.00 32.20  ? 348 GLY C CA  1 
ATOM 8719 C C   . GLY C 1 348 ? 111.325 -16.159 193.722 1.00 35.55  ? 348 GLY C C   1 
ATOM 8720 O O   . GLY C 1 348 ? 112.150 -15.705 192.928 1.00 35.19  ? 348 GLY C O   1 
ATOM 8721 N N   . SER C 1 349 ? 110.631 -15.380 194.551 1.00 34.08  ? 349 SER C N   1 
ATOM 8722 C CA  . SER C 1 349 ? 110.839 -13.930 194.609 1.00 34.66  ? 349 SER C CA  1 
ATOM 8723 C C   . SER C 1 349 ? 111.100 -13.545 196.060 1.00 35.36  ? 349 SER C C   1 
ATOM 8724 O O   . SER C 1 349 ? 110.234 -12.999 196.735 1.00 36.01  ? 349 SER C O   1 
ATOM 8725 C CB  . SER C 1 349 ? 109.602 -13.187 194.108 1.00 32.21  ? 349 SER C CB  1 
ATOM 8726 O OG  . SER C 1 349 ? 109.134 -13.748 192.900 1.00 37.85  ? 349 SER C OG  1 
ATOM 8727 N N   . PRO C 1 350 ? 112.316 -13.787 196.556 1.00 36.43  ? 350 PRO C N   1 
ATOM 8728 C CA  . PRO C 1 350 ? 112.644 -13.458 197.944 1.00 35.73  ? 350 PRO C CA  1 
ATOM 8729 C C   . PRO C 1 350 ? 112.652 -11.979 198.325 1.00 36.68  ? 350 PRO C C   1 
ATOM 8730 O O   . PRO C 1 350 ? 112.709 -11.645 199.508 1.00 37.25  ? 350 PRO C O   1 
ATOM 8731 C CB  . PRO C 1 350 ? 114.024 -14.085 198.112 1.00 33.12  ? 350 PRO C CB  1 
ATOM 8732 C CG  . PRO C 1 350 ? 114.617 -13.940 196.756 1.00 33.36  ? 350 PRO C CG  1 
ATOM 8733 C CD  . PRO C 1 350 ? 113.483 -14.356 195.857 1.00 36.22  ? 350 PRO C CD  1 
ATOM 8734 N N   . ASP C 1 351 ? 112.581 -11.096 197.337 1.00 39.04  ? 351 ASP C N   1 
ATOM 8735 C CA  . ASP C 1 351 ? 112.624 -9.653  197.591 1.00 43.40  ? 351 ASP C CA  1 
ATOM 8736 C C   . ASP C 1 351 ? 111.312 -8.926  197.889 1.00 44.09  ? 351 ASP C C   1 
ATOM 8737 O O   . ASP C 1 351 ? 111.309 -7.907  198.593 1.00 47.32  ? 351 ASP C O   1 
ATOM 8738 C CB  . ASP C 1 351 ? 113.340 -8.944  196.434 1.00 50.70  ? 351 ASP C CB  1 
ATOM 8739 C CG  . ASP C 1 351 ? 114.813 -9.299  196.355 1.00 59.82  ? 351 ASP C CG  1 
ATOM 8740 O OD1 . ASP C 1 351 ? 115.519 -9.138  197.380 1.00 58.83  ? 351 ASP C OD1 1 
ATOM 8741 O OD2 . ASP C 1 351 ? 115.256 -9.733  195.266 1.00 67.35  ? 351 ASP C OD2 1 
ATOM 8742 N N   . VAL C 1 352 ? 110.208 -9.430  197.347 1.00 41.59  ? 352 VAL C N   1 
ATOM 8743 C CA  . VAL C 1 352 ? 108.898 -8.807  197.538 1.00 37.86  ? 352 VAL C CA  1 
ATOM 8744 C C   . VAL C 1 352 ? 108.099 -9.392  198.717 1.00 34.32  ? 352 VAL C C   1 
ATOM 8745 O O   . VAL C 1 352 ? 107.792 -10.588 198.719 1.00 30.06  ? 352 VAL C O   1 
ATOM 8746 C CB  . VAL C 1 352 ? 108.038 -8.981  196.266 1.00 37.91  ? 352 VAL C CB  1 
ATOM 8747 C CG1 . VAL C 1 352 ? 106.762 -8.170  196.370 1.00 38.38  ? 352 VAL C CG1 1 
ATOM 8748 C CG2 . VAL C 1 352 ? 108.840 -8.608  195.035 1.00 41.43  ? 352 VAL C CG2 1 
ATOM 8749 N N   . ASN C 1 353 ? 107.772 -8.556  199.704 1.00 29.97  ? 353 ASN C N   1 
ATOM 8750 C CA  . ASN C 1 353 ? 106.965 -8.985  200.846 1.00 29.18  ? 353 ASN C CA  1 
ATOM 8751 C C   . ASN C 1 353 ? 105.524 -9.059  200.325 1.00 29.80  ? 353 ASN C C   1 
ATOM 8752 O O   . ASN C 1 353 ? 105.017 -8.083  199.770 1.00 30.99  ? 353 ASN C O   1 
ATOM 8753 C CB  . ASN C 1 353 ? 107.051 -7.961  201.978 1.00 28.57  ? 353 ASN C CB  1 
ATOM 8754 C CG  . ASN C 1 353 ? 106.219 -8.350  203.202 1.00 33.69  ? 353 ASN C CG  1 
ATOM 8755 O OD1 . ASN C 1 353 ? 105.518 -9.366  203.212 1.00 31.24  ? 353 ASN C OD1 1 
ATOM 8756 N ND2 . ASN C 1 353 ? 106.322 -7.551  204.254 1.00 34.50  ? 353 ASN C ND2 1 
ATOM 8757 N N   . VAL C 1 354 ? 104.886 -10.222 200.443 1.00 27.85  ? 354 VAL C N   1 
ATOM 8758 C CA  . VAL C 1 354 ? 103.518 -10.388 199.961 1.00 25.94  ? 354 VAL C CA  1 
ATOM 8759 C C   . VAL C 1 354 ? 102.478 -10.553 201.083 1.00 28.09  ? 354 VAL C C   1 
ATOM 8760 O O   . VAL C 1 354 ? 101.294 -10.771 200.806 1.00 29.65  ? 354 VAL C O   1 
ATOM 8761 C CB  . VAL C 1 354 ? 103.398 -11.585 198.970 1.00 24.66  ? 354 VAL C CB  1 
ATOM 8762 C CG1 . VAL C 1 354 ? 104.268 -11.365 197.753 1.00 25.27  ? 354 VAL C CG1 1 
ATOM 8763 C CG2 . VAL C 1 354 ? 103.775 -12.883 199.652 1.00 24.92  ? 354 VAL C CG2 1 
ATOM 8764 N N   . ALA C 1 355 ? 102.915 -10.419 202.335 1.00 26.62  ? 355 ALA C N   1 
ATOM 8765 C CA  . ALA C 1 355 ? 102.027 -10.572 203.490 1.00 27.21  ? 355 ALA C CA  1 
ATOM 8766 C C   . ALA C 1 355 ? 101.174 -9.332  203.786 1.00 28.52  ? 355 ALA C C   1 
ATOM 8767 O O   . ALA C 1 355 ? 101.697 -8.207  203.861 1.00 28.89  ? 355 ALA C O   1 
ATOM 8768 C CB  . ALA C 1 355 ? 102.844 -10.945 204.727 1.00 20.34  ? 355 ALA C CB  1 
ATOM 8769 N N   . MET C 1 356 ? 99.863  -9.543  203.926 1.00 27.70  ? 356 MET C N   1 
ATOM 8770 C CA  . MET C 1 356 ? 98.916  -8.469  204.264 1.00 25.95  ? 356 MET C CA  1 
ATOM 8771 C C   . MET C 1 356 ? 98.457  -8.831  205.672 1.00 23.20  ? 356 MET C C   1 
ATOM 8772 O O   . MET C 1 356 ? 97.717  -9.797  205.862 1.00 22.60  ? 356 MET C O   1 
ATOM 8773 C CB  . MET C 1 356 ? 97.737  -8.460  203.294 1.00 27.81  ? 356 MET C CB  1 
ATOM 8774 C CG  . MET C 1 356 ? 98.151  -8.227  201.839 1.00 53.69  ? 356 MET C CG  1 
ATOM 8775 S SD  . MET C 1 356 ? 97.006  -8.898  200.566 1.00 72.54  ? 356 MET C SD  1 
ATOM 8776 C CE  . MET C 1 356 ? 97.869  -10.467 200.036 1.00 58.47  ? 356 MET C CE  1 
ATOM 8777 N N   . LEU C 1 357 ? 98.974  -8.119  206.666 1.00 21.22  ? 357 LEU C N   1 
ATOM 8778 C CA  . LEU C 1 357 ? 98.644  -8.404  208.060 1.00 22.84  ? 357 LEU C CA  1 
ATOM 8779 C C   . LEU C 1 357 ? 97.270  -7.923  208.505 1.00 22.75  ? 357 LEU C C   1 
ATOM 8780 O O   . LEU C 1 357 ? 96.856  -6.822  208.171 1.00 20.00  ? 357 LEU C O   1 
ATOM 8781 C CB  . LEU C 1 357 ? 99.711  -7.809  208.988 1.00 21.41  ? 357 LEU C CB  1 
ATOM 8782 C CG  . LEU C 1 357 ? 101.133 -8.361  208.879 1.00 22.62  ? 357 LEU C CG  1 
ATOM 8783 C CD1 . LEU C 1 357 ? 102.042 -7.602  209.810 1.00 20.10  ? 357 LEU C CD1 1 
ATOM 8784 C CD2 . LEU C 1 357 ? 101.159 -9.843  209.231 1.00 26.08  ? 357 LEU C CD2 1 
ATOM 8785 N N   . ILE C 1 358 ? 96.553  -8.782  209.218 1.00 23.00  ? 358 ILE C N   1 
ATOM 8786 C CA  . ILE C 1 358 ? 95.249  -8.433  209.769 1.00 22.95  ? 358 ILE C CA  1 
ATOM 8787 C C   . ILE C 1 358 ? 95.596  -7.918  211.177 1.00 23.16  ? 358 ILE C C   1 
ATOM 8788 O O   . ILE C 1 358 ? 95.070  -6.904  211.623 1.00 21.25  ? 358 ILE C O   1 
ATOM 8789 C CB  . ILE C 1 358 ? 94.310  -9.672  209.912 1.00 23.90  ? 358 ILE C CB  1 
ATOM 8790 C CG1 . ILE C 1 358 ? 93.980  -10.279 208.542 1.00 16.81  ? 358 ILE C CG1 1 
ATOM 8791 C CG2 . ILE C 1 358 ? 93.047  -9.288  210.673 1.00 20.80  ? 358 ILE C CG2 1 
ATOM 8792 C CD1 . ILE C 1 358 ? 93.149  -9.414  207.687 1.00 22.97  ? 358 ILE C CD1 1 
ATOM 8793 N N   . THR C 1 359 ? 96.459  -8.655  211.879 1.00 20.29  ? 359 THR C N   1 
ATOM 8794 C CA  . THR C 1 359 ? 96.912  -8.269  213.215 1.00 23.54  ? 359 THR C CA  1 
ATOM 8795 C C   . THR C 1 359 ? 97.816  -7.032  213.049 1.00 27.58  ? 359 THR C C   1 
ATOM 8796 O O   . THR C 1 359 ? 98.827  -7.079  212.337 1.00 23.84  ? 359 THR C O   1 
ATOM 8797 C CB  . THR C 1 359 ? 97.727  -9.398  213.878 1.00 21.73  ? 359 THR C CB  1 
ATOM 8798 O OG1 . THR C 1 359 ? 97.045  -10.647 213.700 1.00 24.05  ? 359 THR C OG1 1 
ATOM 8799 C CG2 . THR C 1 359 ? 97.911  -9.134  215.376 1.00 21.00  ? 359 THR C CG2 1 
ATOM 8800 N N   . PRO C 1 360 ? 97.455  -5.908  213.704 1.00 32.65  ? 360 PRO C N   1 
ATOM 8801 C CA  . PRO C 1 360 ? 98.236  -4.665  213.615 1.00 32.75  ? 360 PRO C CA  1 
ATOM 8802 C C   . PRO C 1 360 ? 99.527  -4.733  214.435 1.00 29.99  ? 360 PRO C C   1 
ATOM 8803 O O   . PRO C 1 360 ? 99.550  -5.323  215.540 1.00 27.46  ? 360 PRO C O   1 
ATOM 8804 C CB  . PRO C 1 360 ? 97.278  -3.635  214.223 1.00 34.69  ? 360 PRO C CB  1 
ATOM 8805 C CG  . PRO C 1 360 ? 96.667  -4.435  215.390 1.00 34.27  ? 360 PRO C CG  1 
ATOM 8806 C CD  . PRO C 1 360 ? 96.361  -5.777  214.703 1.00 30.76  ? 360 PRO C CD  1 
ATOM 8807 N N   . ASN C 1 361 ? 100.589 -4.149  213.877 1.00 27.58  ? 361 ASN C N   1 
ATOM 8808 C CA  . ASN C 1 361 ? 101.905 -4.067  214.522 1.00 25.29  ? 361 ASN C CA  1 
ATOM 8809 C C   . ASN C 1 361 ? 102.171 -5.197  215.528 1.00 23.83  ? 361 ASN C C   1 
ATOM 8810 O O   . ASN C 1 361 ? 102.274 -4.956  216.743 1.00 25.33  ? 361 ASN C O   1 
ATOM 8811 C CB  . ASN C 1 361 ? 102.031 -2.703  215.212 1.00 26.22  ? 361 ASN C CB  1 
ATOM 8812 C CG  . ASN C 1 361 ? 103.423 -2.456  215.752 1.00 30.35  ? 361 ASN C CG  1 
ATOM 8813 O OD1 . ASN C 1 361 ? 104.403 -2.539  215.019 1.00 33.02  ? 361 ASN C OD1 1 
ATOM 8814 N ND2 . ASN C 1 361 ? 103.517 -2.162  217.041 1.00 32.15  ? 361 ASN C ND2 1 
ATOM 8815 N N   . PRO C 1 362 ? 102.333 -6.439  215.032 1.00 22.06  ? 362 PRO C N   1 
ATOM 8816 C CA  . PRO C 1 362 ? 102.574 -7.578  215.928 1.00 20.50  ? 362 PRO C CA  1 
ATOM 8817 C C   . PRO C 1 362 ? 103.749 -7.326  216.863 1.00 21.19  ? 362 PRO C C   1 
ATOM 8818 O O   . PRO C 1 362 ? 104.840 -6.945  216.424 1.00 20.87  ? 362 PRO C O   1 
ATOM 8819 C CB  . PRO C 1 362 ? 102.832 -8.746  214.954 1.00 20.78  ? 362 PRO C CB  1 
ATOM 8820 C CG  . PRO C 1 362 ? 102.080 -8.326  213.695 1.00 22.76  ? 362 PRO C CG  1 
ATOM 8821 C CD  . PRO C 1 362 ? 102.397 -6.847  213.617 1.00 20.12  ? 362 PRO C CD  1 
ATOM 8822 N N   . THR C 1 363 ? 103.521 -7.535  218.152 1.00 20.70  ? 363 THR C N   1 
ATOM 8823 C CA  . THR C 1 363 ? 104.547 -7.314  219.153 1.00 23.03  ? 363 THR C CA  1 
ATOM 8824 C C   . THR C 1 363 ? 104.522 -8.414  220.182 1.00 25.39  ? 363 THR C C   1 
ATOM 8825 O O   . THR C 1 363 ? 103.519 -9.114  220.329 1.00 28.13  ? 363 THR C O   1 
ATOM 8826 C CB  . THR C 1 363 ? 104.314 -5.982  219.930 1.00 25.71  ? 363 THR C CB  1 
ATOM 8827 O OG1 . THR C 1 363 ? 102.991 -5.972  220.490 1.00 26.20  ? 363 THR C OG1 1 
ATOM 8828 C CG2 . THR C 1 363 ? 104.488 -4.767  219.013 1.00 29.11  ? 363 THR C CG2 1 
ATOM 8829 N N   . ILE C 1 364 ? 105.652 -8.609  220.844 1.00 24.22  ? 364 ILE C N   1 
ATOM 8830 C CA  . ILE C 1 364 ? 105.736 -9.574  221.917 1.00 26.27  ? 364 ILE C CA  1 
ATOM 8831 C C   . ILE C 1 364 ? 105.821 -8.665  223.147 1.00 28.73  ? 364 ILE C C   1 
ATOM 8832 O O   . ILE C 1 364 ? 106.783 -7.900  223.297 1.00 27.78  ? 364 ILE C O   1 
ATOM 8833 C CB  . ILE C 1 364 ? 107.006 -10.417 221.829 1.00 26.21  ? 364 ILE C CB  1 
ATOM 8834 C CG1 . ILE C 1 364 ? 107.008 -11.258 220.549 1.00 26.28  ? 364 ILE C CG1 1 
ATOM 8835 C CG2 . ILE C 1 364 ? 107.131 -11.275 223.083 1.00 20.41  ? 364 ILE C CG2 1 
ATOM 8836 C CD1 . ILE C 1 364 ? 106.061 -12.430 220.595 1.00 22.52  ? 364 ILE C CD1 1 
ATOM 8837 N N   . GLU C 1 365 ? 104.760 -8.645  223.946 1.00 30.30  ? 365 GLU C N   1 
ATOM 8838 C CA  . GLU C 1 365 ? 104.726 -7.819  225.152 1.00 32.90  ? 365 GLU C CA  1 
ATOM 8839 C C   . GLU C 1 365 ? 105.342 -8.631  226.281 1.00 36.81  ? 365 GLU C C   1 
ATOM 8840 O O   . GLU C 1 365 ? 105.772 -9.775  226.072 1.00 38.66  ? 365 GLU C O   1 
ATOM 8841 C CB  . GLU C 1 365 ? 103.288 -7.433  225.510 1.00 28.16  ? 365 GLU C CB  1 
ATOM 8842 C CG  . GLU C 1 365 ? 102.534 -6.682  224.413 1.00 31.49  ? 365 GLU C CG  1 
ATOM 8843 C CD  . GLU C 1 365 ? 103.062 -5.270  224.141 1.00 38.79  ? 365 GLU C CD  1 
ATOM 8844 O OE1 . GLU C 1 365 ? 103.849 -4.746  224.962 1.00 41.75  ? 365 GLU C OE1 1 
ATOM 8845 O OE2 . GLU C 1 365 ? 102.669 -4.673  223.107 1.00 37.79  ? 365 GLU C OE2 1 
ATOM 8846 N N   . ASN C 1 366 ? 105.402 -8.053  227.474 1.00 39.87  ? 366 ASN C N   1 
ATOM 8847 C CA  . ASN C 1 366 ? 105.987 -8.767  228.603 1.00 44.33  ? 366 ASN C CA  1 
ATOM 8848 C C   . ASN C 1 366 ? 105.151 -9.981  229.009 1.00 45.44  ? 366 ASN C C   1 
ATOM 8849 O O   . ASN C 1 366 ? 105.688 -10.965 229.531 1.00 46.73  ? 366 ASN C O   1 
ATOM 8850 C CB  . ASN C 1 366 ? 106.210 -7.828  229.804 1.00 48.08  ? 366 ASN C CB  1 
ATOM 8851 C CG  . ASN C 1 366 ? 107.451 -6.941  229.643 1.00 50.98  ? 366 ASN C CG  1 
ATOM 8852 O OD1 . ASN C 1 366 ? 107.358 -5.711  229.676 1.00 53.50  ? 366 ASN C OD1 1 
ATOM 8853 N ND2 . ASN C 1 366 ? 108.614 -7.564  229.473 1.00 53.56  ? 366 ASN C ND2 1 
ATOM 8854 N N   . ASN C 1 367 ? 103.856 -9.946  228.700 1.00 44.58  ? 367 ASN C N   1 
ATOM 8855 C CA  . ASN C 1 367 ? 102.948 -11.038 229.061 1.00 45.89  ? 367 ASN C CA  1 
ATOM 8856 C C   . ASN C 1 367 ? 101.890 -11.313 227.988 1.00 42.13  ? 367 ASN C C   1 
ATOM 8857 O O   . ASN C 1 367 ? 100.756 -11.682 228.303 1.00 43.61  ? 367 ASN C O   1 
ATOM 8858 C CB  . ASN C 1 367 ? 102.250 -10.694 230.384 1.00 54.82  ? 367 ASN C CB  1 
ATOM 8859 C CG  . ASN C 1 367 ? 101.548 -9.327  230.339 1.00 68.93  ? 367 ASN C CG  1 
ATOM 8860 O OD1 . ASN C 1 367 ? 101.711 -8.546  229.379 1.00 69.83  ? 367 ASN C OD1 1 
ATOM 8861 N ND2 . ASN C 1 367 ? 100.771 -9.028  231.378 1.00 75.05  ? 367 ASN C ND2 1 
ATOM 8862 N N   . GLY C 1 368 ? 102.263 -11.160 226.725 1.00 38.16  ? 368 GLY C N   1 
ATOM 8863 C CA  . GLY C 1 368 ? 101.314 -11.396 225.658 1.00 33.38  ? 368 GLY C CA  1 
ATOM 8864 C C   . GLY C 1 368 ? 101.929 -11.231 224.290 1.00 30.57  ? 368 GLY C C   1 
ATOM 8865 O O   . GLY C 1 368 ? 103.133 -10.996 224.178 1.00 30.20  ? 368 GLY C O   1 
ATOM 8866 N N   . GLY C 1 369 ? 101.093 -11.299 223.258 1.00 26.90  ? 369 GLY C N   1 
ATOM 8867 C CA  . GLY C 1 369 ? 101.566 -11.168 221.891 1.00 24.14  ? 369 GLY C CA  1 
ATOM 8868 C C   . GLY C 1 369 ? 101.980 -12.515 221.325 1.00 21.81  ? 369 GLY C C   1 
ATOM 8869 O O   . GLY C 1 369 ? 102.114 -13.491 222.070 1.00 24.33  ? 369 GLY C O   1 
ATOM 8870 N N   . GLY C 1 370 ? 102.149 -12.590 220.010 1.00 18.26  ? 370 GLY C N   1 
ATOM 8871 C CA  . GLY C 1 370 ? 102.561 -13.845 219.420 1.00 16.84  ? 370 GLY C CA  1 
ATOM 8872 C C   . GLY C 1 370 ? 101.607 -14.425 218.400 1.00 20.25  ? 370 GLY C C   1 
ATOM 8873 O O   . GLY C 1 370 ? 102.034 -15.198 217.528 1.00 18.96  ? 370 GLY C O   1 
ATOM 8874 N N   . PHE C 1 371 ? 100.316 -14.117 218.537 1.00 18.70  ? 371 PHE C N   1 
ATOM 8875 C CA  . PHE C 1 371 ? 99.307  -14.598 217.598 1.00 16.77  ? 371 PHE C CA  1 
ATOM 8876 C C   . PHE C 1 371 ? 99.265  -13.628 216.429 1.00 15.06  ? 371 PHE C C   1 
ATOM 8877 O O   . PHE C 1 371 ? 99.235  -12.411 216.618 1.00 16.90  ? 371 PHE C O   1 
ATOM 8878 C CB  . PHE C 1 371 ? 97.926  -14.717 218.275 1.00 15.92  ? 371 PHE C CB  1 
ATOM 8879 C CG  . PHE C 1 371 ? 96.787  -14.855 217.305 1.00 17.98  ? 371 PHE C CG  1 
ATOM 8880 C CD1 . PHE C 1 371 ? 96.618  -16.013 216.564 1.00 17.91  ? 371 PHE C CD1 1 
ATOM 8881 C CD2 . PHE C 1 371 ? 95.888  -13.811 217.121 1.00 14.63  ? 371 PHE C CD2 1 
ATOM 8882 C CE1 . PHE C 1 371 ? 95.571  -16.132 215.650 1.00 19.03  ? 371 PHE C CE1 1 
ATOM 8883 C CE2 . PHE C 1 371 ? 94.832  -13.918 216.207 1.00 20.07  ? 371 PHE C CE2 1 
ATOM 8884 C CZ  . PHE C 1 371 ? 94.676  -15.082 215.470 1.00 16.41  ? 371 PHE C CZ  1 
ATOM 8885 N N   . ILE C 1 372 ? 99.291  -14.168 215.217 1.00 16.67  ? 372 ILE C N   1 
ATOM 8886 C CA  . ILE C 1 372 ? 99.276  -13.354 214.008 1.00 17.63  ? 372 ILE C CA  1 
ATOM 8887 C C   . ILE C 1 372 ? 98.319  -13.958 212.996 1.00 17.43  ? 372 ILE C C   1 
ATOM 8888 O O   . ILE C 1 372 ? 98.270  -15.177 212.831 1.00 15.23  ? 372 ILE C O   1 
ATOM 8889 C CB  . ILE C 1 372 ? 100.674 -13.320 213.305 1.00 17.81  ? 372 ILE C CB  1 
ATOM 8890 C CG1 . ILE C 1 372 ? 101.756 -12.796 214.246 1.00 16.22  ? 372 ILE C CG1 1 
ATOM 8891 C CG2 . ILE C 1 372 ? 100.616 -12.474 212.037 1.00 15.75  ? 372 ILE C CG2 1 
ATOM 8892 C CD1 . ILE C 1 372 ? 103.158 -13.053 213.730 1.00 20.68  ? 372 ILE C CD1 1 
ATOM 8893 N N   . GLU C 1 373 ? 97.530  -13.095 212.365 1.00 15.52  ? 373 GLU C N   1 
ATOM 8894 C CA  . GLU C 1 373 ? 96.625  -13.521 211.317 1.00 15.55  ? 373 GLU C CA  1 
ATOM 8895 C C   . GLU C 1 373 ? 97.004  -12.675 210.102 1.00 17.73  ? 373 GLU C C   1 
ATOM 8896 O O   . GLU C 1 373 ? 97.141  -11.453 210.207 1.00 16.09  ? 373 GLU C O   1 
ATOM 8897 C CB  . GLU C 1 373 ? 95.160  -13.276 211.675 1.00 15.18  ? 373 GLU C CB  1 
ATOM 8898 C CG  . GLU C 1 373 ? 94.215  -13.655 210.517 1.00 11.62  ? 373 GLU C CG  1 
ATOM 8899 C CD  . GLU C 1 373 ? 92.730  -13.464 210.825 1.00 19.85  ? 373 GLU C CD  1 
ATOM 8900 O OE1 . GLU C 1 373 ? 92.357  -12.653 211.706 1.00 17.37  ? 373 GLU C OE1 1 
ATOM 8901 O OE2 . GLU C 1 373 ? 91.920  -14.119 210.152 1.00 15.40  ? 373 GLU C OE2 1 
ATOM 8902 N N   . MET C 1 374 ? 97.173  -13.313 208.951 1.00 16.97  ? 374 MET C N   1 
ATOM 8903 C CA  . MET C 1 374 ? 97.546  -12.595 207.744 1.00 17.12  ? 374 MET C CA  1 
ATOM 8904 C C   . MET C 1 374 ? 96.899  -13.238 206.530 1.00 17.14  ? 374 MET C C   1 
ATOM 8905 O O   . MET C 1 374 ? 96.347  -14.340 206.613 1.00 17.66  ? 374 MET C O   1 
ATOM 8906 C CB  . MET C 1 374 ? 99.074  -12.620 207.566 1.00 18.70  ? 374 MET C CB  1 
ATOM 8907 C CG  . MET C 1 374 ? 99.641  -14.042 207.369 1.00 25.44  ? 374 MET C CG  1 
ATOM 8908 S SD  . MET C 1 374 ? 101.385 -14.089 206.861 1.00 23.85  ? 374 MET C SD  1 
ATOM 8909 C CE  . MET C 1 374 ? 102.168 -13.513 208.332 1.00 17.83  ? 374 MET C CE  1 
ATOM 8910 N N   . GLN C 1 375 ? 96.936  -12.517 205.415 1.00 17.35  ? 375 GLN C N   1 
ATOM 8911 C CA  . GLN C 1 375 ? 96.409  -13.017 204.159 1.00 22.05  ? 375 GLN C CA  1 
ATOM 8912 C C   . GLN C 1 375 ? 97.600  -13.100 203.195 1.00 23.85  ? 375 GLN C C   1 
ATOM 8913 O O   . GLN C 1 375 ? 98.485  -12.233 203.206 1.00 24.08  ? 375 GLN C O   1 
ATOM 8914 C CB  . GLN C 1 375 ? 95.345  -12.081 203.608 1.00 21.56  ? 375 GLN C CB  1 
ATOM 8915 C CG  . GLN C 1 375 ? 94.695  -12.595 202.349 1.00 36.87  ? 375 GLN C CG  1 
ATOM 8916 C CD  . GLN C 1 375 ? 93.517  -11.743 201.922 1.00 45.54  ? 375 GLN C CD  1 
ATOM 8917 O OE1 . GLN C 1 375 ? 93.558  -10.512 201.998 1.00 52.73  ? 375 GLN C OE1 1 
ATOM 8918 N NE2 . GLN C 1 375 ? 92.451  -12.397 201.483 1.00 52.31  ? 375 GLN C NE2 1 
ATOM 8919 N N   . LEU C 1 376 ? 97.624  -14.148 202.381 1.00 23.40  ? 376 LEU C N   1 
ATOM 8920 C CA  . LEU C 1 376 ? 98.704  -14.370 201.438 1.00 24.12  ? 376 LEU C CA  1 
ATOM 8921 C C   . LEU C 1 376 ? 98.101  -14.647 200.084 1.00 25.05  ? 376 LEU C C   1 
ATOM 8922 O O   . LEU C 1 376 ? 96.956  -15.087 200.000 1.00 24.73  ? 376 LEU C O   1 
ATOM 8923 C CB  . LEU C 1 376 ? 99.515  -15.595 201.862 1.00 25.36  ? 376 LEU C CB  1 
ATOM 8924 C CG  . LEU C 1 376 ? 100.376 -15.476 203.110 1.00 28.16  ? 376 LEU C CG  1 
ATOM 8925 C CD1 . LEU C 1 376 ? 100.896 -16.835 203.517 1.00 21.56  ? 376 LEU C CD1 1 
ATOM 8926 C CD2 . LEU C 1 376 ? 101.515 -14.513 202.798 1.00 30.77  ? 376 LEU C CD2 1 
ATOM 8927 N N   . PRO C 1 377 ? 98.846  -14.356 199.001 1.00 27.32  ? 377 PRO C N   1 
ATOM 8928 C CA  . PRO C 1 377 ? 98.341  -14.607 197.650 1.00 28.13  ? 377 PRO C CA  1 
ATOM 8929 C C   . PRO C 1 377 ? 98.381  -16.111 197.379 1.00 29.37  ? 377 PRO C C   1 
ATOM 8930 O O   . PRO C 1 377 ? 99.116  -16.852 198.044 1.00 27.25  ? 377 PRO C O   1 
ATOM 8931 C CB  . PRO C 1 377 ? 99.320  -13.820 196.769 1.00 27.43  ? 377 PRO C CB  1 
ATOM 8932 C CG  . PRO C 1 377 ? 100.585 -13.846 197.544 1.00 30.93  ? 377 PRO C CG  1 
ATOM 8933 C CD  . PRO C 1 377 ? 100.112 -13.599 198.956 1.00 30.75  ? 377 PRO C CD  1 
ATOM 8934 N N   . PRO C 1 378 ? 97.535  -16.592 196.450 1.00 31.88  ? 378 PRO C N   1 
ATOM 8935 C CA  . PRO C 1 378 ? 97.468  -18.016 196.098 1.00 31.04  ? 378 PRO C CA  1 
ATOM 8936 C C   . PRO C 1 378 ? 98.822  -18.531 195.624 1.00 30.43  ? 378 PRO C C   1 
ATOM 8937 O O   . PRO C 1 378 ? 99.597  -17.783 195.017 1.00 31.45  ? 378 PRO C O   1 
ATOM 8938 C CB  . PRO C 1 378 ? 96.451  -18.038 194.956 1.00 29.94  ? 378 PRO C CB  1 
ATOM 8939 C CG  . PRO C 1 378 ? 95.563  -16.859 195.259 1.00 33.30  ? 378 PRO C CG  1 
ATOM 8940 C CD  . PRO C 1 378 ? 96.573  -15.809 195.651 1.00 33.80  ? 378 PRO C CD  1 
ATOM 8941 N N   . GLY C 1 379 ? 99.104  -19.801 195.907 1.00 31.05  ? 379 GLY C N   1 
ATOM 8942 C CA  . GLY C 1 379 ? 100.370 -20.390 195.493 1.00 31.04  ? 379 GLY C CA  1 
ATOM 8943 C C   . GLY C 1 379 ? 101.310 -20.729 196.638 1.00 30.86  ? 379 GLY C C   1 
ATOM 8944 O O   . GLY C 1 379 ? 100.913 -20.704 197.809 1.00 29.48  ? 379 GLY C O   1 
ATOM 8945 N N   . ASP C 1 380 ? 102.560 -21.039 196.297 1.00 29.00  ? 380 ASP C N   1 
ATOM 8946 C CA  . ASP C 1 380 ? 103.577 -21.398 197.283 1.00 26.52  ? 380 ASP C CA  1 
ATOM 8947 C C   . ASP C 1 380 ? 104.249 -20.151 197.829 1.00 23.57  ? 380 ASP C C   1 
ATOM 8948 O O   . ASP C 1 380 ? 104.755 -19.328 197.065 1.00 24.64  ? 380 ASP C O   1 
ATOM 8949 C CB  . ASP C 1 380 ? 104.638 -22.301 196.654 1.00 29.72  ? 380 ASP C CB  1 
ATOM 8950 C CG  . ASP C 1 380 ? 104.070 -23.610 196.150 1.00 33.45  ? 380 ASP C CG  1 
ATOM 8951 O OD1 . ASP C 1 380 ? 103.762 -24.489 196.986 1.00 36.19  ? 380 ASP C OD1 1 
ATOM 8952 O OD2 . ASP C 1 380 ? 103.940 -23.757 194.915 1.00 44.02  ? 380 ASP C OD2 1 
ATOM 8953 N N   . ASN C 1 381 ? 104.312 -20.051 199.150 1.00 18.66  ? 381 ASN C N   1 
ATOM 8954 C CA  . ASN C 1 381 ? 104.911 -18.899 199.816 1.00 16.62  ? 381 ASN C CA  1 
ATOM 8955 C C   . ASN C 1 381 ? 105.761 -19.430 200.958 1.00 17.25  ? 381 ASN C C   1 
ATOM 8956 O O   . ASN C 1 381 ? 105.684 -20.605 201.305 1.00 17.30  ? 381 ASN C O   1 
ATOM 8957 C CB  . ASN C 1 381 ? 103.821 -18.007 200.453 1.00 18.48  ? 381 ASN C CB  1 
ATOM 8958 C CG  . ASN C 1 381 ? 102.753 -17.524 199.457 1.00 21.32  ? 381 ASN C CG  1 
ATOM 8959 O OD1 . ASN C 1 381 ? 102.915 -16.493 198.807 1.00 23.78  ? 381 ASN C OD1 1 
ATOM 8960 N ND2 . ASN C 1 381 ? 101.636 -18.239 199.389 1.00 23.96  ? 381 ASN C ND2 1 
ATOM 8961 N N   . ILE C 1 382 ? 106.571 -18.561 201.547 1.00 18.48  ? 382 ILE C N   1 
ATOM 8962 C CA  . ILE C 1 382 ? 107.377 -18.936 202.703 1.00 19.09  ? 382 ILE C CA  1 
ATOM 8963 C C   . ILE C 1 382 ? 107.130 -17.802 203.690 1.00 19.38  ? 382 ILE C C   1 
ATOM 8964 O O   . ILE C 1 382 ? 107.223 -16.619 203.340 1.00 18.91  ? 382 ILE C O   1 
ATOM 8965 C CB  . ILE C 1 382 ? 108.913 -19.050 202.412 1.00 18.71  ? 382 ILE C CB  1 
ATOM 8966 C CG1 . ILE C 1 382 ? 109.208 -20.163 201.402 1.00 19.56  ? 382 ILE C CG1 1 
ATOM 8967 C CG2 . ILE C 1 382 ? 109.651 -19.397 203.690 1.00 17.97  ? 382 ILE C CG2 1 
ATOM 8968 C CD1 . ILE C 1 382 ? 109.256 -19.688 199.973 1.00 29.27  ? 382 ILE C CD1 1 
ATOM 8969 N N   . ILE C 1 383 ? 106.733 -18.163 204.897 1.00 19.47  ? 383 ILE C N   1 
ATOM 8970 C CA  . ILE C 1 383 ? 106.460 -17.181 205.924 1.00 19.35  ? 383 ILE C CA  1 
ATOM 8971 C C   . ILE C 1 383 ? 107.712 -17.077 206.785 1.00 20.47  ? 383 ILE C C   1 
ATOM 8972 O O   . ILE C 1 383 ? 108.340 -18.099 207.118 1.00 18.55  ? 383 ILE C O   1 
ATOM 8973 C CB  . ILE C 1 383 ? 105.228 -17.616 206.791 1.00 21.19  ? 383 ILE C CB  1 
ATOM 8974 C CG1 . ILE C 1 383 ? 103.962 -17.650 205.926 1.00 19.26  ? 383 ILE C CG1 1 
ATOM 8975 C CG2 . ILE C 1 383 ? 105.045 -16.679 207.990 1.00 15.48  ? 383 ILE C CG2 1 
ATOM 8976 C CD1 . ILE C 1 383 ? 102.795 -18.386 206.555 1.00 20.72  ? 383 ILE C CD1 1 
ATOM 8977 N N   . TYR C 1 384 ? 108.104 -15.842 207.087 1.00 18.65  ? 384 TYR C N   1 
ATOM 8978 C CA  . TYR C 1 384 ? 109.264 -15.578 207.929 1.00 19.13  ? 384 TYR C CA  1 
ATOM 8979 C C   . TYR C 1 384 ? 108.905 -14.731 209.143 1.00 20.96  ? 384 TYR C C   1 
ATOM 8980 O O   . TYR C 1 384 ? 108.213 -13.710 209.041 1.00 22.91  ? 384 TYR C O   1 
ATOM 8981 C CB  . TYR C 1 384 ? 110.347 -14.821 207.150 1.00 20.94  ? 384 TYR C CB  1 
ATOM 8982 C CG  . TYR C 1 384 ? 111.052 -15.626 206.089 1.00 22.98  ? 384 TYR C CG  1 
ATOM 8983 C CD1 . TYR C 1 384 ? 112.118 -16.463 206.425 1.00 27.09  ? 384 TYR C CD1 1 
ATOM 8984 C CD2 . TYR C 1 384 ? 110.695 -15.514 204.745 1.00 21.70  ? 384 TYR C CD2 1 
ATOM 8985 C CE1 . TYR C 1 384 ? 112.816 -17.165 205.452 1.00 23.41  ? 384 TYR C CE1 1 
ATOM 8986 C CE2 . TYR C 1 384 ? 111.390 -16.210 203.759 1.00 25.75  ? 384 TYR C CE2 1 
ATOM 8987 C CZ  . TYR C 1 384 ? 112.452 -17.031 204.126 1.00 29.25  ? 384 TYR C CZ  1 
ATOM 8988 O OH  . TYR C 1 384 ? 113.162 -17.711 203.171 1.00 36.47  ? 384 TYR C OH  1 
ATOM 8989 N N   . VAL C 1 385 ? 109.368 -15.171 210.298 1.00 19.42  ? 385 VAL C N   1 
ATOM 8990 C CA  . VAL C 1 385 ? 109.189 -14.434 211.534 1.00 21.43  ? 385 VAL C CA  1 
ATOM 8991 C C   . VAL C 1 385 ? 110.666 -14.363 211.943 1.00 22.74  ? 385 VAL C C   1 
ATOM 8992 O O   . VAL C 1 385 ? 111.209 -15.268 212.599 1.00 22.32  ? 385 VAL C O   1 
ATOM 8993 C CB  . VAL C 1 385 ? 108.307 -15.220 212.540 1.00 23.34  ? 385 VAL C CB  1 
ATOM 8994 C CG1 . VAL C 1 385 ? 108.220 -14.477 213.861 1.00 20.28  ? 385 VAL C CG1 1 
ATOM 8995 C CG2 . VAL C 1 385 ? 106.904 -15.391 211.952 1.00 17.09  ? 385 VAL C CG2 1 
ATOM 8996 N N   . GLY C 1 386 ? 111.345 -13.343 211.427 1.00 21.96  ? 386 GLY C N   1 
ATOM 8997 C CA  . GLY C 1 386 ? 112.772 -13.215 211.667 1.00 20.46  ? 386 GLY C CA  1 
ATOM 8998 C C   . GLY C 1 386 ? 113.421 -14.309 210.826 1.00 21.31  ? 386 GLY C C   1 
ATOM 8999 O O   . GLY C 1 386 ? 113.156 -14.412 209.631 1.00 20.94  ? 386 GLY C O   1 
ATOM 9000 N N   . GLU C 1 387 ? 114.233 -15.156 211.444 1.00 23.69  ? 387 GLU C N   1 
ATOM 9001 C CA  . GLU C 1 387 ? 114.875 -16.244 210.714 1.00 24.82  ? 387 GLU C CA  1 
ATOM 9002 C C   . GLU C 1 387 ? 114.040 -17.513 210.732 1.00 23.47  ? 387 GLU C C   1 
ATOM 9003 O O   . GLU C 1 387 ? 114.356 -18.482 210.034 1.00 23.32  ? 387 GLU C O   1 
ATOM 9004 C CB  . GLU C 1 387 ? 116.275 -16.495 211.263 1.00 25.07  ? 387 GLU C CB  1 
ATOM 9005 C CG  . GLU C 1 387 ? 117.167 -15.285 211.023 1.00 31.79  ? 387 GLU C CG  1 
ATOM 9006 C CD  . GLU C 1 387 ? 118.626 -15.533 211.339 1.00 42.56  ? 387 GLU C CD  1 
ATOM 9007 O OE1 . GLU C 1 387 ? 118.942 -16.541 212.020 1.00 47.49  ? 387 GLU C OE1 1 
ATOM 9008 O OE2 . GLU C 1 387 ? 119.462 -14.709 210.900 1.00 48.81  ? 387 GLU C OE2 1 
ATOM 9009 N N   . LEU C 1 388 ? 112.997 -17.513 211.561 1.00 19.63  ? 388 LEU C N   1 
ATOM 9010 C CA  . LEU C 1 388 ? 112.098 -18.647 211.638 1.00 17.68  ? 388 LEU C CA  1 
ATOM 9011 C C   . LEU C 1 388 ? 111.291 -18.640 210.337 1.00 17.27  ? 388 LEU C C   1 
ATOM 9012 O O   . LEU C 1 388 ? 110.756 -17.603 209.931 1.00 17.84  ? 388 LEU C O   1 
ATOM 9013 C CB  . LEU C 1 388 ? 111.172 -18.498 212.845 1.00 14.73  ? 388 LEU C CB  1 
ATOM 9014 C CG  . LEU C 1 388 ? 110.123 -19.599 213.011 1.00 18.80  ? 388 LEU C CG  1 
ATOM 9015 C CD1 . LEU C 1 388 ? 110.833 -20.904 213.366 1.00 14.48  ? 388 LEU C CD1 1 
ATOM 9016 C CD2 . LEU C 1 388 ? 109.096 -19.196 214.081 1.00 14.71  ? 388 LEU C CD2 1 
ATOM 9017 N N   . SER C 1 389 ? 111.199 -19.787 209.679 1.00 17.80  ? 389 SER C N   1 
ATOM 9018 C CA  . SER C 1 389 ? 110.483 -19.856 208.411 1.00 16.86  ? 389 SER C CA  1 
ATOM 9019 C C   . SER C 1 389 ? 109.460 -20.970 208.373 1.00 17.88  ? 389 SER C C   1 
ATOM 9020 O O   . SER C 1 389 ? 109.514 -21.903 209.182 1.00 17.70  ? 389 SER C O   1 
ATOM 9021 C CB  . SER C 1 389 ? 111.486 -20.110 207.283 1.00 23.14  ? 389 SER C CB  1 
ATOM 9022 O OG  . SER C 1 389 ? 112.021 -21.426 207.368 1.00 21.17  ? 389 SER C OG  1 
ATOM 9023 N N   . HIS C 1 390 ? 108.551 -20.897 207.408 1.00 17.10  ? 390 HIS C N   1 
ATOM 9024 C CA  . HIS C 1 390 ? 107.566 -21.954 207.238 1.00 18.59  ? 390 HIS C CA  1 
ATOM 9025 C C   . HIS C 1 390 ? 107.007 -21.940 205.830 1.00 19.50  ? 390 HIS C C   1 
ATOM 9026 O O   . HIS C 1 390 ? 106.630 -20.884 205.321 1.00 21.56  ? 390 HIS C O   1 
ATOM 9027 C CB  . HIS C 1 390 ? 106.416 -21.839 208.252 1.00 19.11  ? 390 HIS C CB  1 
ATOM 9028 C CG  . HIS C 1 390 ? 105.750 -23.148 208.537 1.00 18.15  ? 390 HIS C CG  1 
ATOM 9029 N ND1 . HIS C 1 390 ? 104.946 -23.792 207.622 1.00 14.85  ? 390 HIS C ND1 1 
ATOM 9030 C CD2 . HIS C 1 390 ? 105.858 -23.987 209.598 1.00 16.85  ? 390 HIS C CD2 1 
ATOM 9031 C CE1 . HIS C 1 390 ? 104.597 -24.976 208.094 1.00 17.29  ? 390 HIS C CE1 1 
ATOM 9032 N NE2 . HIS C 1 390 ? 105.143 -25.119 209.289 1.00 15.37  ? 390 HIS C NE2 1 
ATOM 9033 N N   . GLN C 1 391 ? 106.986 -23.100 205.185 1.00 17.41  ? 391 GLN C N   1 
ATOM 9034 C CA  . GLN C 1 391 ? 106.416 -23.195 203.839 1.00 21.31  ? 391 GLN C CA  1 
ATOM 9035 C C   . GLN C 1 391 ? 104.906 -23.015 203.970 1.00 20.15  ? 391 GLN C C   1 
ATOM 9036 O O   . GLN C 1 391 ? 104.330 -23.378 204.982 1.00 21.27  ? 391 GLN C O   1 
ATOM 9037 C CB  . GLN C 1 391 ? 106.667 -24.584 203.225 1.00 22.15  ? 391 GLN C CB  1 
ATOM 9038 C CG  . GLN C 1 391 ? 108.122 -24.910 202.981 1.00 27.90  ? 391 GLN C CG  1 
ATOM 9039 C CD  . GLN C 1 391 ? 108.784 -23.899 202.063 1.00 36.24  ? 391 GLN C CD  1 
ATOM 9040 O OE1 . GLN C 1 391 ? 108.327 -23.671 200.938 1.00 36.12  ? 391 GLN C OE1 1 
ATOM 9041 N NE2 . GLN C 1 391 ? 109.867 -23.284 202.539 1.00 34.03  ? 391 GLN C NE2 1 
ATOM 9042 N N   . TRP C 1 392 ? 104.269 -22.418 202.980 1.00 20.90  ? 392 TRP C N   1 
ATOM 9043 C CA  . TRP C 1 392 ? 102.826 -22.284 203.026 1.00 22.47  ? 392 TRP C CA  1 
ATOM 9044 C C   . TRP C 1 392 ? 102.212 -22.280 201.639 1.00 22.95  ? 392 TRP C C   1 
ATOM 9045 O O   . TRP C 1 392 ? 102.516 -21.412 200.831 1.00 24.47  ? 392 TRP C O   1 
ATOM 9046 C CB  . TRP C 1 392 ? 102.378 -21.011 203.751 1.00 18.99  ? 392 TRP C CB  1 
ATOM 9047 C CG  . TRP C 1 392 ? 100.870 -20.918 203.798 1.00 21.34  ? 392 TRP C CG  1 
ATOM 9048 C CD1 . TRP C 1 392 ? 100.063 -20.080 203.065 1.00 18.22  ? 392 TRP C CD1 1 
ATOM 9049 C CD2 . TRP C 1 392 ? 99.988  -21.778 204.529 1.00 16.32  ? 392 TRP C CD2 1 
ATOM 9050 N NE1 . TRP C 1 392 ? 98.736  -20.378 203.290 1.00 16.29  ? 392 TRP C NE1 1 
ATOM 9051 C CE2 . TRP C 1 392 ? 98.661  -21.414 204.183 1.00 17.78  ? 392 TRP C CE2 1 
ATOM 9052 C CE3 . TRP C 1 392 ? 100.190 -22.825 205.441 1.00 21.87  ? 392 TRP C CE3 1 
ATOM 9053 C CZ2 . TRP C 1 392 ? 97.540  -22.069 204.709 1.00 17.00  ? 392 TRP C CZ2 1 
ATOM 9054 C CZ3 . TRP C 1 392 ? 99.069  -23.478 205.968 1.00 24.28  ? 392 TRP C CZ3 1 
ATOM 9055 C CH2 . TRP C 1 392 ? 97.762  -23.091 205.599 1.00 21.93  ? 392 TRP C CH2 1 
ATOM 9056 N N   . PHE C 1 393 ? 101.394 -23.276 201.336 1.00 24.31  ? 393 PHE C N   1 
ATOM 9057 C CA  . PHE C 1 393 ? 100.700 -23.273 200.060 1.00 24.89  ? 393 PHE C CA  1 
ATOM 9058 C C   . PHE C 1 393 ? 99.320  -22.635 200.304 1.00 25.75  ? 393 PHE C C   1 
ATOM 9059 O O   . PHE C 1 393 ? 98.525  -23.134 201.120 1.00 23.00  ? 393 PHE C O   1 
ATOM 9060 C CB  . PHE C 1 393 ? 100.543 -24.684 199.482 1.00 27.55  ? 393 PHE C CB  1 
ATOM 9061 C CG  . PHE C 1 393 ? 99.709  -24.714 198.222 1.00 31.40  ? 393 PHE C CG  1 
ATOM 9062 C CD1 . PHE C 1 393 ? 100.191 -24.144 197.038 1.00 31.75  ? 393 PHE C CD1 1 
ATOM 9063 C CD2 . PHE C 1 393 ? 98.400  -25.200 198.250 1.00 34.18  ? 393 PHE C CD2 1 
ATOM 9064 C CE1 . PHE C 1 393 ? 99.382  -24.043 195.905 1.00 32.77  ? 393 PHE C CE1 1 
ATOM 9065 C CE2 . PHE C 1 393 ? 97.579  -25.105 197.123 1.00 34.19  ? 393 PHE C CE2 1 
ATOM 9066 C CZ  . PHE C 1 393 ? 98.068  -24.523 195.949 1.00 32.06  ? 393 PHE C CZ  1 
ATOM 9067 N N   . GLN C 1 394 ? 99.055  -21.515 199.634 1.00 27.68  ? 394 GLN C N   1 
ATOM 9068 C CA  . GLN C 1 394 ? 97.786  -20.808 199.781 1.00 29.58  ? 394 GLN C CA  1 
ATOM 9069 C C   . GLN C 1 394 ? 96.733  -21.238 198.764 1.00 33.84  ? 394 GLN C C   1 
ATOM 9070 O O   . GLN C 1 394 ? 96.958  -21.162 197.553 1.00 32.91  ? 394 GLN C O   1 
ATOM 9071 C CB  . GLN C 1 394 ? 98.004  -19.295 199.681 1.00 25.04  ? 394 GLN C CB  1 
ATOM 9072 C CG  . GLN C 1 394 ? 96.729  -18.458 199.829 1.00 26.35  ? 394 GLN C CG  1 
ATOM 9073 C CD  . GLN C 1 394 ? 95.951  -18.754 201.112 1.00 33.73  ? 394 GLN C CD  1 
ATOM 9074 O OE1 . GLN C 1 394 ? 96.494  -18.717 202.221 1.00 35.29  ? 394 GLN C OE1 1 
ATOM 9075 N NE2 . GLN C 1 394 ? 94.672  -19.067 200.960 1.00 29.57  ? 394 GLN C NE2 1 
ATOM 9076 N N   . LYS C 1 395 ? 95.575  -21.633 199.298 1.00 40.18  ? 395 LYS C N   1 
ATOM 9077 C CA  . LYS C 1 395 ? 94.376  -22.077 198.573 1.00 43.37  ? 395 LYS C CA  1 
ATOM 9078 C C   . LYS C 1 395 ? 94.233  -23.583 198.565 1.00 45.84  ? 395 LYS C C   1 
ATOM 9079 O O   . LYS C 1 395 ? 93.400  -24.124 199.289 1.00 48.70  ? 395 LYS C O   1 
ATOM 9080 C CB  . LYS C 1 395 ? 94.312  -21.553 197.146 1.00 45.65  ? 395 LYS C CB  1 
ATOM 9081 C CG  . LYS C 1 395 ? 93.312  -20.478 196.930 1.00 47.63  ? 395 LYS C CG  1 
ATOM 9082 C CD  . LYS C 1 395 ? 93.118  -20.348 195.446 1.00 61.07  ? 395 LYS C CD  1 
ATOM 9083 C CE  . LYS C 1 395 ? 92.243  -19.172 195.087 1.00 73.42  ? 395 LYS C CE  1 
ATOM 9084 N NZ  . LYS C 1 395 ? 92.382  -18.873 193.623 1.00 78.63  ? 395 LYS C NZ  1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   1   1   SER SER A . n 
A 1 2   ARG 2   2   2   ARG ARG A . n 
A 1 3   CYS 3   3   3   CYS CYS A . n 
A 1 4   THR 4   4   4   THR THR A . n 
A 1 5   HIS 5   5   5   HIS HIS A . n 
A 1 6   LEU 6   6   6   LEU LEU A . n 
A 1 7   GLU 7   7   7   GLU GLU A . n 
A 1 8   ASN 8   8   8   ASN ASN A . n 
A 1 9   ARG 9   9   9   ARG ARG A . n 
A 1 10  ASP 10  10  10  ASP ASP A . n 
A 1 11  PHE 11  11  11  PHE PHE A . n 
A 1 12  VAL 12  12  12  VAL VAL A . n 
A 1 13  THR 13  13  13  THR THR A . n 
A 1 14  GLY 14  14  14  GLY GLY A . n 
A 1 15  THR 15  15  15  THR THR A . n 
A 1 16  GLN 16  16  16  GLN GLN A . n 
A 1 17  GLY 17  17  17  GLY GLY A . n 
A 1 18  THR 18  18  18  THR THR A . n 
A 1 19  THR 19  19  19  THR THR A . n 
A 1 20  ARG 20  20  20  ARG ARG A . n 
A 1 21  VAL 21  21  21  VAL VAL A . n 
A 1 22  THR 22  22  22  THR THR A . n 
A 1 23  LEU 23  23  23  LEU LEU A . n 
A 1 24  VAL 24  24  24  VAL VAL A . n 
A 1 25  LEU 25  25  25  LEU LEU A . n 
A 1 26  GLU 26  26  26  GLU GLU A . n 
A 1 27  LEU 27  27  27  LEU LEU A . n 
A 1 28  GLY 28  28  28  GLY GLY A . n 
A 1 29  GLY 29  29  29  GLY GLY A . n 
A 1 30  CYS 30  30  30  CYS CYS A . n 
A 1 31  VAL 31  31  31  VAL VAL A . n 
A 1 32  THR 32  32  32  THR THR A . n 
A 1 33  ILE 33  33  33  ILE ILE A . n 
A 1 34  THR 34  34  34  THR THR A . n 
A 1 35  ALA 35  35  35  ALA ALA A . n 
A 1 36  GLU 36  36  36  GLU GLU A . n 
A 1 37  GLY 37  37  37  GLY GLY A . n 
A 1 38  LYS 38  38  38  LYS LYS A . n 
A 1 39  PRO 39  39  39  PRO PRO A . n 
A 1 40  SER 40  40  40  SER SER A . n 
A 1 41  MET 41  41  41  MET MET A . n 
A 1 42  ASP 42  42  42  ASP ASP A . n 
A 1 43  VAL 43  43  43  VAL VAL A . n 
A 1 44  TRP 44  44  44  TRP TRP A . n 
A 1 45  LEU 45  45  45  LEU LEU A . n 
A 1 46  ASP 46  46  46  ASP ASP A . n 
A 1 47  ALA 47  47  47  ALA ALA A . n 
A 1 48  ILE 48  48  48  ILE ILE A . n 
A 1 49  TYR 49  49  49  TYR TYR A . n 
A 1 50  GLN 50  50  50  GLN GLN A . n 
A 1 51  GLU 51  51  51  GLU GLU A . n 
A 1 52  ASN 52  52  52  ASN ASN A . n 
A 1 53  PRO 53  53  53  PRO PRO A . n 
A 1 54  ALA 54  54  54  ALA ALA A . n 
A 1 55  LYS 55  55  55  LYS LYS A . n 
A 1 56  THR 56  56  56  THR THR A . n 
A 1 57  ARG 57  57  57  ARG ARG A . n 
A 1 58  GLU 58  58  58  GLU GLU A . n 
A 1 59  TYR 59  59  59  TYR TYR A . n 
A 1 60  CYS 60  60  60  CYS CYS A . n 
A 1 61  LEU 61  61  61  LEU LEU A . n 
A 1 62  HIS 62  62  62  HIS HIS A . n 
A 1 63  ALA 63  63  63  ALA ALA A . n 
A 1 64  LYS 64  64  64  LYS LYS A . n 
A 1 65  LEU 65  65  65  LEU LEU A . n 
A 1 66  SER 66  66  66  SER SER A . n 
A 1 67  ASP 67  67  67  ASP ASP A . n 
A 1 68  THR 68  68  68  THR THR A . n 
A 1 69  LYS 69  69  69  LYS LYS A . n 
A 1 70  VAL 70  70  70  VAL VAL A . n 
A 1 71  ALA 71  71  71  ALA ALA A . n 
A 1 72  ALA 72  72  72  ALA ALA A . n 
A 1 73  ARG 73  73  73  ARG ARG A . n 
A 1 74  CYS 74  74  74  CYS CYS A . n 
A 1 75  PRO 75  75  75  PRO PRO A . n 
A 1 76  THR 76  76  76  THR THR A . n 
A 1 77  MET 77  77  77  MET MET A . n 
A 1 78  GLY 78  78  78  GLY GLY A . n 
A 1 79  PRO 79  79  79  PRO PRO A . n 
A 1 80  ALA 80  80  80  ALA ALA A . n 
A 1 81  THR 81  81  81  THR THR A . n 
A 1 82  LEU 82  82  82  LEU LEU A . n 
A 1 83  ALA 83  83  83  ALA ALA A . n 
A 1 84  GLU 84  84  84  GLU GLU A . n 
A 1 85  GLU 85  85  85  GLU GLU A . n 
A 1 86  HIS 86  86  86  HIS HIS A . n 
A 1 87  GLN 87  87  87  GLN GLN A . n 
A 1 88  GLY 88  88  88  GLY GLY A . n 
A 1 89  GLY 89  89  89  GLY GLY A . n 
A 1 90  THR 90  90  90  THR THR A . n 
A 1 91  VAL 91  91  91  VAL VAL A . n 
A 1 92  CYS 92  92  92  CYS CYS A . n 
A 1 93  LYS 93  93  93  LYS LYS A . n 
A 1 94  ARG 94  94  94  ARG ARG A . n 
A 1 95  ASP 95  95  95  ASP ASP A . n 
A 1 96  GLN 96  96  96  GLN GLN A . n 
A 1 97  SER 97  97  97  SER SER A . n 
A 1 98  ASP 98  98  98  ASP ASP A . n 
A 1 99  ARG 99  99  99  ARG ARG A . n 
A 1 100 GLY 100 100 100 GLY GLY A . n 
A 1 101 TRP 101 101 101 TRP TRP A . n 
A 1 102 GLY 102 102 102 GLY GLY A . n 
A 1 103 ASN 103 103 103 ASN ASN A . n 
A 1 104 HIS 104 104 104 HIS HIS A . n 
A 1 105 CYS 105 105 105 CYS CYS A . n 
A 1 106 GLY 106 106 106 GLY GLY A . n 
A 1 107 LEU 107 107 107 LEU LEU A . n 
A 1 108 PHE 108 108 108 PHE PHE A . n 
A 1 109 GLY 109 109 109 GLY GLY A . n 
A 1 110 LYS 110 110 110 LYS LYS A . n 
A 1 111 GLY 111 111 111 GLY GLY A . n 
A 1 112 SER 112 112 112 SER SER A . n 
A 1 113 ILE 113 113 113 ILE ILE A . n 
A 1 114 VAL 114 114 114 VAL VAL A . n 
A 1 115 ALA 115 115 115 ALA ALA A . n 
A 1 116 CYS 116 116 116 CYS CYS A . n 
A 1 117 VAL 117 117 117 VAL VAL A . n 
A 1 118 LYS 118 118 118 LYS LYS A . n 
A 1 119 ALA 119 119 119 ALA ALA A . n 
A 1 120 ALA 120 120 120 ALA ALA A . n 
A 1 121 CYS 121 121 121 CYS CYS A . n 
A 1 122 GLU 122 122 122 GLU GLU A . n 
A 1 123 ALA 123 123 123 ALA ALA A . n 
A 1 124 LYS 124 124 124 LYS LYS A . n 
A 1 125 LYS 125 125 125 LYS LYS A . n 
A 1 126 LYS 126 126 126 LYS LYS A . n 
A 1 127 ALA 127 127 127 ALA ALA A . n 
A 1 128 THR 128 128 128 THR THR A . n 
A 1 129 GLY 129 129 129 GLY GLY A . n 
A 1 130 HIS 130 130 130 HIS HIS A . n 
A 1 131 VAL 131 131 131 VAL VAL A . n 
A 1 132 TYR 132 132 132 TYR TYR A . n 
A 1 133 ASP 133 133 133 ASP ASP A . n 
A 1 134 ALA 134 134 134 ALA ALA A . n 
A 1 135 ASN 135 135 135 ASN ASN A . n 
A 1 136 LYS 136 136 136 LYS LYS A . n 
A 1 137 ILE 137 137 137 ILE ILE A . n 
A 1 138 VAL 138 138 138 VAL VAL A . n 
A 1 139 TYR 139 139 139 TYR TYR A . n 
A 1 140 THR 140 140 140 THR THR A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 LYS 142 142 142 LYS LYS A . n 
A 1 143 VAL 143 143 143 VAL VAL A . n 
A 1 144 GLU 144 144 144 GLU GLU A . n 
A 1 145 PRO 145 145 145 PRO PRO A . n 
A 1 146 HIS 146 146 146 HIS HIS A . n 
A 1 147 THR 147 147 147 THR THR A . n 
A 1 148 GLY 148 148 148 GLY GLY A . n 
A 1 149 ASP 149 149 149 ASP ASP A . n 
A 1 150 TYR 150 150 150 TYR TYR A . n 
A 1 151 VAL 151 151 151 VAL VAL A . n 
A 1 152 ALA 152 152 152 ALA ALA A . n 
A 1 153 ALA 153 153 153 ALA ALA A . n 
A 1 154 ASN 154 154 154 ASN ASN A . n 
A 1 155 GLU 155 155 155 GLU GLU A . n 
A 1 156 THR 156 156 156 THR THR A . n 
A 1 157 HIS 157 157 157 HIS HIS A . n 
A 1 158 SER 158 158 158 SER SER A . n 
A 1 159 GLY 159 159 159 GLY GLY A . n 
A 1 160 ARG 160 160 160 ARG ARG A . n 
A 1 161 LYS 161 161 161 LYS LYS A . n 
A 1 162 THR 162 162 162 THR THR A . n 
A 1 163 ALA 163 163 163 ALA ALA A . n 
A 1 164 SER 164 164 164 SER SER A . n 
A 1 165 PHE 165 165 165 PHE PHE A . n 
A 1 166 THR 166 166 166 THR THR A . n 
A 1 167 ILE 167 167 167 ILE ILE A . n 
A 1 168 SER 168 168 168 SER SER A . n 
A 1 169 SER 169 169 169 SER SER A . n 
A 1 170 GLU 170 170 170 GLU GLU A . n 
A 1 171 LYS 171 171 171 LYS LYS A . n 
A 1 172 THR 172 172 172 THR THR A . n 
A 1 173 ILE 173 173 173 ILE ILE A . n 
A 1 174 LEU 174 174 174 LEU LEU A . n 
A 1 175 THR 175 175 175 THR THR A . n 
A 1 176 MET 176 176 176 MET MET A . n 
A 1 177 GLY 177 177 177 GLY GLY A . n 
A 1 178 GLU 178 178 178 GLU GLU A . n 
A 1 179 TYR 179 179 179 TYR TYR A . n 
A 1 180 GLY 180 180 180 GLY GLY A . n 
A 1 181 ASP 181 181 181 ASP ASP A . n 
A 1 182 VAL 182 182 182 VAL VAL A . n 
A 1 183 SER 183 183 183 SER SER A . n 
A 1 184 LEU 184 184 184 LEU LEU A . n 
A 1 185 LEU 185 185 185 LEU LEU A . n 
A 1 186 CYS 186 186 186 CYS CYS A . n 
A 1 187 ARG 187 187 187 ARG ARG A . n 
A 1 188 VAL 188 188 188 VAL VAL A . n 
A 1 189 ALA 189 189 189 ALA ALA A . n 
A 1 190 SER 190 190 190 SER SER A . n 
A 1 191 GLY 191 191 191 GLY GLY A . n 
A 1 192 VAL 192 192 192 VAL VAL A . n 
A 1 193 ASP 193 193 193 ASP ASP A . n 
A 1 194 LEU 194 194 194 LEU LEU A . n 
A 1 195 ALA 195 195 195 ALA ALA A . n 
A 1 196 GLN 196 196 196 GLN GLN A . n 
A 1 197 THR 197 197 197 THR THR A . n 
A 1 198 VAL 198 198 198 VAL VAL A . n 
A 1 199 ILE 199 199 199 ILE ILE A . n 
A 1 200 LEU 200 200 200 LEU LEU A . n 
A 1 201 GLU 201 201 201 GLU GLU A . n 
A 1 202 LEU 202 202 202 LEU LEU A . n 
A 1 203 ASP 203 203 203 ASP ASP A . n 
A 1 204 LYS 204 204 204 LYS LYS A . n 
A 1 205 THR 205 205 205 THR THR A . n 
A 1 206 VAL 206 206 206 VAL VAL A . n 
A 1 207 GLU 207 207 207 GLU GLU A . n 
A 1 208 HIS 208 208 208 HIS HIS A . n 
A 1 209 LEU 209 209 209 LEU LEU A . n 
A 1 210 PRO 210 210 210 PRO PRO A . n 
A 1 211 THR 211 211 211 THR THR A . n 
A 1 212 ALA 212 212 212 ALA ALA A . n 
A 1 213 TRP 213 213 213 TRP TRP A . n 
A 1 214 GLN 214 214 214 GLN GLN A . n 
A 1 215 VAL 215 215 215 VAL VAL A . n 
A 1 216 HIS 216 216 216 HIS HIS A . n 
A 1 217 ARG 217 217 217 ARG ARG A . n 
A 1 218 ASP 218 218 218 ASP ASP A . n 
A 1 219 TRP 219 219 219 TRP TRP A . n 
A 1 220 PHE 220 220 220 PHE PHE A . n 
A 1 221 ASN 221 221 221 ASN ASN A . n 
A 1 222 ASP 222 222 222 ASP ASP A . n 
A 1 223 LEU 223 223 223 LEU LEU A . n 
A 1 224 ALA 224 224 224 ALA ALA A . n 
A 1 225 LEU 225 225 225 LEU LEU A . n 
A 1 226 PRO 226 226 226 PRO PRO A . n 
A 1 227 TRP 227 227 227 TRP TRP A . n 
A 1 228 LYS 228 228 228 LYS LYS A . n 
A 1 229 HIS 229 229 229 HIS HIS A . n 
A 1 230 GLU 230 230 230 GLU GLU A . n 
A 1 231 GLY 231 231 231 GLY GLY A . n 
A 1 232 ALA 232 232 232 ALA ALA A . n 
A 1 233 GLN 233 233 233 GLN GLN A . n 
A 1 234 ASN 234 234 234 ASN ASN A . n 
A 1 235 TRP 235 235 235 TRP TRP A . n 
A 1 236 ASN 236 236 236 ASN ASN A . n 
A 1 237 ASN 237 237 237 ASN ASN A . n 
A 1 238 ALA 238 238 238 ALA ALA A . n 
A 1 239 GLU 239 239 239 GLU GLU A . n 
A 1 240 ARG 240 240 240 ARG ARG A . n 
A 1 241 LEU 241 241 241 LEU LEU A . n 
A 1 242 VAL 242 242 242 VAL VAL A . n 
A 1 243 GLU 243 243 243 GLU GLU A . n 
A 1 244 PHE 244 244 244 PHE PHE A . n 
A 1 245 GLY 245 245 245 GLY GLY A . n 
A 1 246 ALA 246 246 246 ALA ALA A . n 
A 1 247 PRO 247 247 247 PRO PRO A . n 
A 1 248 HIS 248 248 248 HIS HIS A . n 
A 1 249 ALA 249 249 249 ALA ALA A . n 
A 1 250 VAL 250 250 250 VAL VAL A . n 
A 1 251 LYS 251 251 251 LYS LYS A . n 
A 1 252 MET 252 252 252 MET MET A . n 
A 1 253 ASP 253 253 253 ASP ASP A . n 
A 1 254 VAL 254 254 254 VAL VAL A . n 
A 1 255 TYR 255 255 255 TYR TYR A . n 
A 1 256 ASN 256 256 256 ASN ASN A . n 
A 1 257 LEU 257 257 257 LEU LEU A . n 
A 1 258 GLY 258 258 258 GLY GLY A . n 
A 1 259 ASP 259 259 259 ASP ASP A . n 
A 1 260 GLN 260 260 260 GLN GLN A . n 
A 1 261 THR 261 261 261 THR THR A . n 
A 1 262 GLY 262 262 262 GLY GLY A . n 
A 1 263 VAL 263 263 263 VAL VAL A . n 
A 1 264 LEU 264 264 264 LEU LEU A . n 
A 1 265 LEU 265 265 265 LEU LEU A . n 
A 1 266 LYS 266 266 266 LYS LYS A . n 
A 1 267 ALA 267 267 267 ALA ALA A . n 
A 1 268 LEU 268 268 268 LEU LEU A . n 
A 1 269 ALA 269 269 269 ALA ALA A . n 
A 1 270 GLY 270 270 270 GLY GLY A . n 
A 1 271 VAL 271 271 271 VAL VAL A . n 
A 1 272 PRO 272 272 272 PRO PRO A . n 
A 1 273 VAL 273 273 273 VAL VAL A . n 
A 1 274 ALA 274 274 274 ALA ALA A . n 
A 1 275 HIS 275 275 275 HIS HIS A . n 
A 1 276 ILE 276 276 276 ILE ILE A . n 
A 1 277 GLU 277 277 277 GLU GLU A . n 
A 1 278 GLY 278 278 278 GLY GLY A . n 
A 1 279 THR 279 279 279 THR THR A . n 
A 1 280 LYS 280 280 280 LYS LYS A . n 
A 1 281 TYR 281 281 281 TYR TYR A . n 
A 1 282 HIS 282 282 282 HIS HIS A . n 
A 1 283 LEU 283 283 283 LEU LEU A . n 
A 1 284 LYS 284 284 284 LYS LYS A . n 
A 1 285 SER 285 285 285 SER SER A . n 
A 1 286 GLY 286 286 286 GLY GLY A . n 
A 1 287 HIS 287 287 287 HIS HIS A . n 
A 1 288 VAL 288 288 288 VAL VAL A . n 
A 1 289 THR 289 289 289 THR THR A . n 
A 1 290 CYS 290 290 290 CYS CYS A . n 
A 1 291 GLU 291 291 291 GLU GLU A . n 
A 1 292 VAL 292 292 292 VAL VAL A . n 
A 1 293 GLY 293 293 293 GLY GLY A . n 
A 1 294 LEU 294 294 294 LEU LEU A . n 
A 1 295 GLU 295 295 295 GLU GLU A . n 
A 1 296 LYS 296 296 296 LYS LYS A . n 
A 1 297 LEU 297 297 297 LEU LEU A . n 
A 1 298 LYS 298 298 298 LYS LYS A . n 
A 1 299 MET 299 299 299 MET MET A . n 
A 1 300 LYS 300 300 300 LYS LYS A . n 
A 1 301 GLY 301 301 301 GLY GLY A . n 
A 1 302 LEU 302 302 302 LEU LEU A . n 
A 1 303 THR 303 303 303 THR THR A . n 
A 1 304 TYR 304 304 304 TYR TYR A . n 
A 1 305 THR 305 305 305 THR THR A . n 
A 1 306 MET 306 306 306 MET MET A . n 
A 1 307 CYS 307 307 307 CYS CYS A . n 
A 1 308 ASP 308 308 308 ASP ASP A . n 
A 1 309 LYS 309 309 309 LYS LYS A . n 
A 1 310 THR 310 310 310 THR THR A . n 
A 1 311 LYS 311 311 311 LYS LYS A . n 
A 1 312 PHE 312 312 312 PHE PHE A . n 
A 1 313 THR 313 313 313 THR THR A . n 
A 1 314 TRP 314 314 314 TRP TRP A . n 
A 1 315 LYS 315 315 315 LYS LYS A . n 
A 1 316 ARG 316 316 316 ARG ARG A . n 
A 1 317 ALA 317 317 317 ALA ALA A . n 
A 1 318 PRO 318 318 318 PRO PRO A . n 
A 1 319 THR 319 319 319 THR THR A . n 
A 1 320 ASP 320 320 320 ASP ASP A . n 
A 1 321 SER 321 321 321 SER SER A . n 
A 1 322 GLY 322 322 322 GLY GLY A . n 
A 1 323 HIS 323 323 323 HIS HIS A . n 
A 1 324 ASP 324 324 324 ASP ASP A . n 
A 1 325 THR 325 325 325 THR THR A . n 
A 1 326 VAL 326 326 326 VAL VAL A . n 
A 1 327 VAL 327 327 327 VAL VAL A . n 
A 1 328 MET 328 328 328 MET MET A . n 
A 1 329 GLU 329 329 329 GLU GLU A . n 
A 1 330 VAL 330 330 330 VAL VAL A . n 
A 1 331 THR 331 331 331 THR THR A . n 
A 1 332 PHE 332 332 332 PHE PHE A . n 
A 1 333 SER 333 333 333 SER SER A . n 
A 1 334 GLY 334 334 334 GLY GLY A . n 
A 1 335 THR 335 335 335 THR THR A . n 
A 1 336 LYS 336 336 336 LYS LYS A . n 
A 1 337 PRO 337 337 337 PRO PRO A . n 
A 1 338 CYS 338 338 338 CYS CYS A . n 
A 1 339 ARG 339 339 339 ARG ARG A . n 
A 1 340 ILE 340 340 340 ILE ILE A . n 
A 1 341 PRO 341 341 341 PRO PRO A . n 
A 1 342 VAL 342 342 342 VAL VAL A . n 
A 1 343 ARG 343 343 343 ARG ARG A . n 
A 1 344 ALA 344 344 344 ALA ALA A . n 
A 1 345 VAL 345 345 345 VAL VAL A . n 
A 1 346 ALA 346 346 346 ALA ALA A . n 
A 1 347 HIS 347 347 347 HIS HIS A . n 
A 1 348 GLY 348 348 348 GLY GLY A . n 
A 1 349 SER 349 349 349 SER SER A . n 
A 1 350 PRO 350 350 350 PRO PRO A . n 
A 1 351 ASP 351 351 351 ASP ASP A . n 
A 1 352 VAL 352 352 352 VAL VAL A . n 
A 1 353 ASN 353 353 353 ASN ASN A . n 
A 1 354 VAL 354 354 354 VAL VAL A . n 
A 1 355 ALA 355 355 355 ALA ALA A . n 
A 1 356 MET 356 356 356 MET MET A . n 
A 1 357 LEU 357 357 357 LEU LEU A . n 
A 1 358 ILE 358 358 358 ILE ILE A . n 
A 1 359 THR 359 359 359 THR THR A . n 
A 1 360 PRO 360 360 360 PRO PRO A . n 
A 1 361 ASN 361 361 361 ASN ASN A . n 
A 1 362 PRO 362 362 362 PRO PRO A . n 
A 1 363 THR 363 363 363 THR THR A . n 
A 1 364 ILE 364 364 364 ILE ILE A . n 
A 1 365 GLU 365 365 365 GLU GLU A . n 
A 1 366 ASN 366 366 366 ASN ASN A . n 
A 1 367 ASN 367 367 367 ASN ASN A . n 
A 1 368 GLY 368 368 368 GLY GLY A . n 
A 1 369 GLY 369 369 369 GLY GLY A . n 
A 1 370 GLY 370 370 370 GLY GLY A . n 
A 1 371 PHE 371 371 371 PHE PHE A . n 
A 1 372 ILE 372 372 372 ILE ILE A . n 
A 1 373 GLU 373 373 373 GLU GLU A . n 
A 1 374 MET 374 374 374 MET MET A . n 
A 1 375 GLN 375 375 375 GLN GLN A . n 
A 1 376 LEU 376 376 376 LEU LEU A . n 
A 1 377 PRO 377 377 377 PRO PRO A . n 
A 1 378 PRO 378 378 378 PRO PRO A . n 
A 1 379 GLY 379 379 379 GLY GLY A . n 
A 1 380 ASP 380 380 380 ASP ASP A . n 
A 1 381 ASN 381 381 381 ASN ASN A . n 
A 1 382 ILE 382 382 382 ILE ILE A . n 
A 1 383 ILE 383 383 383 ILE ILE A . n 
A 1 384 TYR 384 384 384 TYR TYR A . n 
A 1 385 VAL 385 385 385 VAL VAL A . n 
A 1 386 GLY 386 386 386 GLY GLY A . n 
A 1 387 GLU 387 387 387 GLU GLU A . n 
A 1 388 LEU 388 388 388 LEU LEU A . n 
A 1 389 SER 389 389 389 SER SER A . n 
A 1 390 HIS 390 390 390 HIS HIS A . n 
A 1 391 GLN 391 391 391 GLN GLN A . n 
A 1 392 TRP 392 392 392 TRP TRP A . n 
A 1 393 PHE 393 393 393 PHE PHE A . n 
A 1 394 GLN 394 394 394 GLN GLN A . n 
A 1 395 LYS 395 395 395 LYS LYS A . n 
B 1 1   SER 1   1   1   SER SER B . n 
B 1 2   ARG 2   2   2   ARG ARG B . n 
B 1 3   CYS 3   3   3   CYS CYS B . n 
B 1 4   THR 4   4   4   THR THR B . n 
B 1 5   HIS 5   5   5   HIS HIS B . n 
B 1 6   LEU 6   6   6   LEU LEU B . n 
B 1 7   GLU 7   7   7   GLU GLU B . n 
B 1 8   ASN 8   8   8   ASN ASN B . n 
B 1 9   ARG 9   9   9   ARG ARG B . n 
B 1 10  ASP 10  10  10  ASP ASP B . n 
B 1 11  PHE 11  11  11  PHE PHE B . n 
B 1 12  VAL 12  12  12  VAL VAL B . n 
B 1 13  THR 13  13  13  THR THR B . n 
B 1 14  GLY 14  14  14  GLY GLY B . n 
B 1 15  THR 15  15  15  THR THR B . n 
B 1 16  GLN 16  16  16  GLN GLN B . n 
B 1 17  GLY 17  17  17  GLY GLY B . n 
B 1 18  THR 18  18  18  THR THR B . n 
B 1 19  THR 19  19  19  THR THR B . n 
B 1 20  ARG 20  20  20  ARG ARG B . n 
B 1 21  VAL 21  21  21  VAL VAL B . n 
B 1 22  THR 22  22  22  THR THR B . n 
B 1 23  LEU 23  23  23  LEU LEU B . n 
B 1 24  VAL 24  24  24  VAL VAL B . n 
B 1 25  LEU 25  25  25  LEU LEU B . n 
B 1 26  GLU 26  26  26  GLU GLU B . n 
B 1 27  LEU 27  27  27  LEU LEU B . n 
B 1 28  GLY 28  28  28  GLY GLY B . n 
B 1 29  GLY 29  29  29  GLY GLY B . n 
B 1 30  CYS 30  30  30  CYS CYS B . n 
B 1 31  VAL 31  31  31  VAL VAL B . n 
B 1 32  THR 32  32  32  THR THR B . n 
B 1 33  ILE 33  33  33  ILE ILE B . n 
B 1 34  THR 34  34  34  THR THR B . n 
B 1 35  ALA 35  35  35  ALA ALA B . n 
B 1 36  GLU 36  36  36  GLU GLU B . n 
B 1 37  GLY 37  37  37  GLY GLY B . n 
B 1 38  LYS 38  38  38  LYS LYS B . n 
B 1 39  PRO 39  39  39  PRO PRO B . n 
B 1 40  SER 40  40  40  SER SER B . n 
B 1 41  MET 41  41  41  MET MET B . n 
B 1 42  ASP 42  42  42  ASP ASP B . n 
B 1 43  VAL 43  43  43  VAL VAL B . n 
B 1 44  TRP 44  44  44  TRP TRP B . n 
B 1 45  LEU 45  45  45  LEU LEU B . n 
B 1 46  ASP 46  46  46  ASP ASP B . n 
B 1 47  ALA 47  47  47  ALA ALA B . n 
B 1 48  ILE 48  48  48  ILE ILE B . n 
B 1 49  TYR 49  49  49  TYR TYR B . n 
B 1 50  GLN 50  50  50  GLN GLN B . n 
B 1 51  GLU 51  51  51  GLU GLU B . n 
B 1 52  ASN 52  52  52  ASN ASN B . n 
B 1 53  PRO 53  53  53  PRO PRO B . n 
B 1 54  ALA 54  54  54  ALA ALA B . n 
B 1 55  LYS 55  55  55  LYS LYS B . n 
B 1 56  THR 56  56  56  THR THR B . n 
B 1 57  ARG 57  57  57  ARG ARG B . n 
B 1 58  GLU 58  58  58  GLU GLU B . n 
B 1 59  TYR 59  59  59  TYR TYR B . n 
B 1 60  CYS 60  60  60  CYS CYS B . n 
B 1 61  LEU 61  61  61  LEU LEU B . n 
B 1 62  HIS 62  62  62  HIS HIS B . n 
B 1 63  ALA 63  63  63  ALA ALA B . n 
B 1 64  LYS 64  64  64  LYS LYS B . n 
B 1 65  LEU 65  65  65  LEU LEU B . n 
B 1 66  SER 66  66  66  SER SER B . n 
B 1 67  ASP 67  67  67  ASP ASP B . n 
B 1 68  THR 68  68  68  THR THR B . n 
B 1 69  LYS 69  69  69  LYS LYS B . n 
B 1 70  VAL 70  70  70  VAL VAL B . n 
B 1 71  ALA 71  71  71  ALA ALA B . n 
B 1 72  ALA 72  72  72  ALA ALA B . n 
B 1 73  ARG 73  73  73  ARG ARG B . n 
B 1 74  CYS 74  74  74  CYS CYS B . n 
B 1 75  PRO 75  75  75  PRO PRO B . n 
B 1 76  THR 76  76  76  THR THR B . n 
B 1 77  MET 77  77  77  MET MET B . n 
B 1 78  GLY 78  78  78  GLY GLY B . n 
B 1 79  PRO 79  79  79  PRO PRO B . n 
B 1 80  ALA 80  80  80  ALA ALA B . n 
B 1 81  THR 81  81  81  THR THR B . n 
B 1 82  LEU 82  82  82  LEU LEU B . n 
B 1 83  ALA 83  83  83  ALA ALA B . n 
B 1 84  GLU 84  84  84  GLU GLU B . n 
B 1 85  GLU 85  85  85  GLU GLU B . n 
B 1 86  HIS 86  86  86  HIS HIS B . n 
B 1 87  GLN 87  87  87  GLN GLN B . n 
B 1 88  GLY 88  88  88  GLY GLY B . n 
B 1 89  GLY 89  89  89  GLY GLY B . n 
B 1 90  THR 90  90  90  THR THR B . n 
B 1 91  VAL 91  91  91  VAL VAL B . n 
B 1 92  CYS 92  92  92  CYS CYS B . n 
B 1 93  LYS 93  93  93  LYS LYS B . n 
B 1 94  ARG 94  94  94  ARG ARG B . n 
B 1 95  ASP 95  95  95  ASP ASP B . n 
B 1 96  GLN 96  96  96  GLN GLN B . n 
B 1 97  SER 97  97  97  SER SER B . n 
B 1 98  ASP 98  98  98  ASP ASP B . n 
B 1 99  ARG 99  99  99  ARG ARG B . n 
B 1 100 GLY 100 100 100 GLY GLY B . n 
B 1 101 TRP 101 101 101 TRP TRP B . n 
B 1 102 GLY 102 102 102 GLY GLY B . n 
B 1 103 ASN 103 103 103 ASN ASN B . n 
B 1 104 HIS 104 104 104 HIS HIS B . n 
B 1 105 CYS 105 105 105 CYS CYS B . n 
B 1 106 GLY 106 106 106 GLY GLY B . n 
B 1 107 LEU 107 107 107 LEU LEU B . n 
B 1 108 PHE 108 108 108 PHE PHE B . n 
B 1 109 GLY 109 109 109 GLY GLY B . n 
B 1 110 LYS 110 110 110 LYS LYS B . n 
B 1 111 GLY 111 111 111 GLY GLY B . n 
B 1 112 SER 112 112 112 SER SER B . n 
B 1 113 ILE 113 113 113 ILE ILE B . n 
B 1 114 VAL 114 114 114 VAL VAL B . n 
B 1 115 ALA 115 115 115 ALA ALA B . n 
B 1 116 CYS 116 116 116 CYS CYS B . n 
B 1 117 VAL 117 117 117 VAL VAL B . n 
B 1 118 LYS 118 118 118 LYS LYS B . n 
B 1 119 ALA 119 119 119 ALA ALA B . n 
B 1 120 ALA 120 120 120 ALA ALA B . n 
B 1 121 CYS 121 121 121 CYS CYS B . n 
B 1 122 GLU 122 122 122 GLU GLU B . n 
B 1 123 ALA 123 123 123 ALA ALA B . n 
B 1 124 LYS 124 124 124 LYS LYS B . n 
B 1 125 LYS 125 125 125 LYS LYS B . n 
B 1 126 LYS 126 126 126 LYS LYS B . n 
B 1 127 ALA 127 127 127 ALA ALA B . n 
B 1 128 THR 128 128 128 THR THR B . n 
B 1 129 GLY 129 129 129 GLY GLY B . n 
B 1 130 HIS 130 130 130 HIS HIS B . n 
B 1 131 VAL 131 131 131 VAL VAL B . n 
B 1 132 TYR 132 132 132 TYR TYR B . n 
B 1 133 ASP 133 133 133 ASP ASP B . n 
B 1 134 ALA 134 134 134 ALA ALA B . n 
B 1 135 ASN 135 135 135 ASN ASN B . n 
B 1 136 LYS 136 136 136 LYS LYS B . n 
B 1 137 ILE 137 137 137 ILE ILE B . n 
B 1 138 VAL 138 138 138 VAL VAL B . n 
B 1 139 TYR 139 139 139 TYR TYR B . n 
B 1 140 THR 140 140 140 THR THR B . n 
B 1 141 VAL 141 141 141 VAL VAL B . n 
B 1 142 LYS 142 142 142 LYS LYS B . n 
B 1 143 VAL 143 143 143 VAL VAL B . n 
B 1 144 GLU 144 144 144 GLU GLU B . n 
B 1 145 PRO 145 145 145 PRO PRO B . n 
B 1 146 HIS 146 146 146 HIS HIS B . n 
B 1 147 THR 147 147 147 THR THR B . n 
B 1 148 GLY 148 148 148 GLY GLY B . n 
B 1 149 ASP 149 149 149 ASP ASP B . n 
B 1 150 TYR 150 150 150 TYR TYR B . n 
B 1 151 VAL 151 151 151 VAL VAL B . n 
B 1 152 ALA 152 152 152 ALA ALA B . n 
B 1 153 ALA 153 153 153 ALA ALA B . n 
B 1 154 ASN 154 154 154 ASN ASN B . n 
B 1 155 GLU 155 155 155 GLU GLU B . n 
B 1 156 THR 156 156 156 THR THR B . n 
B 1 157 HIS 157 157 157 HIS HIS B . n 
B 1 158 SER 158 158 158 SER SER B . n 
B 1 159 GLY 159 159 159 GLY GLY B . n 
B 1 160 ARG 160 160 160 ARG ARG B . n 
B 1 161 LYS 161 161 161 LYS LYS B . n 
B 1 162 THR 162 162 162 THR THR B . n 
B 1 163 ALA 163 163 163 ALA ALA B . n 
B 1 164 SER 164 164 164 SER SER B . n 
B 1 165 PHE 165 165 165 PHE PHE B . n 
B 1 166 THR 166 166 166 THR THR B . n 
B 1 167 ILE 167 167 167 ILE ILE B . n 
B 1 168 SER 168 168 168 SER SER B . n 
B 1 169 SER 169 169 169 SER SER B . n 
B 1 170 GLU 170 170 170 GLU GLU B . n 
B 1 171 LYS 171 171 171 LYS LYS B . n 
B 1 172 THR 172 172 172 THR THR B . n 
B 1 173 ILE 173 173 173 ILE ILE B . n 
B 1 174 LEU 174 174 174 LEU LEU B . n 
B 1 175 THR 175 175 175 THR THR B . n 
B 1 176 MET 176 176 176 MET MET B . n 
B 1 177 GLY 177 177 177 GLY GLY B . n 
B 1 178 GLU 178 178 178 GLU GLU B . n 
B 1 179 TYR 179 179 179 TYR TYR B . n 
B 1 180 GLY 180 180 180 GLY GLY B . n 
B 1 181 ASP 181 181 181 ASP ASP B . n 
B 1 182 VAL 182 182 182 VAL VAL B . n 
B 1 183 SER 183 183 183 SER SER B . n 
B 1 184 LEU 184 184 184 LEU LEU B . n 
B 1 185 LEU 185 185 185 LEU LEU B . n 
B 1 186 CYS 186 186 186 CYS CYS B . n 
B 1 187 ARG 187 187 187 ARG ARG B . n 
B 1 188 VAL 188 188 188 VAL VAL B . n 
B 1 189 ALA 189 189 189 ALA ALA B . n 
B 1 190 SER 190 190 190 SER SER B . n 
B 1 191 GLY 191 191 191 GLY GLY B . n 
B 1 192 VAL 192 192 192 VAL VAL B . n 
B 1 193 ASP 193 193 193 ASP ASP B . n 
B 1 194 LEU 194 194 194 LEU LEU B . n 
B 1 195 ALA 195 195 195 ALA ALA B . n 
B 1 196 GLN 196 196 196 GLN GLN B . n 
B 1 197 THR 197 197 197 THR THR B . n 
B 1 198 VAL 198 198 198 VAL VAL B . n 
B 1 199 ILE 199 199 199 ILE ILE B . n 
B 1 200 LEU 200 200 200 LEU LEU B . n 
B 1 201 GLU 201 201 201 GLU GLU B . n 
B 1 202 LEU 202 202 202 LEU LEU B . n 
B 1 203 ASP 203 203 203 ASP ASP B . n 
B 1 204 LYS 204 204 204 LYS LYS B . n 
B 1 205 THR 205 205 205 THR THR B . n 
B 1 206 VAL 206 206 206 VAL VAL B . n 
B 1 207 GLU 207 207 207 GLU GLU B . n 
B 1 208 HIS 208 208 208 HIS HIS B . n 
B 1 209 LEU 209 209 209 LEU LEU B . n 
B 1 210 PRO 210 210 210 PRO PRO B . n 
B 1 211 THR 211 211 211 THR THR B . n 
B 1 212 ALA 212 212 212 ALA ALA B . n 
B 1 213 TRP 213 213 213 TRP TRP B . n 
B 1 214 GLN 214 214 214 GLN GLN B . n 
B 1 215 VAL 215 215 215 VAL VAL B . n 
B 1 216 HIS 216 216 216 HIS HIS B . n 
B 1 217 ARG 217 217 217 ARG ARG B . n 
B 1 218 ASP 218 218 218 ASP ASP B . n 
B 1 219 TRP 219 219 219 TRP TRP B . n 
B 1 220 PHE 220 220 220 PHE PHE B . n 
B 1 221 ASN 221 221 221 ASN ASN B . n 
B 1 222 ASP 222 222 222 ASP ASP B . n 
B 1 223 LEU 223 223 223 LEU LEU B . n 
B 1 224 ALA 224 224 224 ALA ALA B . n 
B 1 225 LEU 225 225 225 LEU LEU B . n 
B 1 226 PRO 226 226 226 PRO PRO B . n 
B 1 227 TRP 227 227 227 TRP TRP B . n 
B 1 228 LYS 228 228 228 LYS LYS B . n 
B 1 229 HIS 229 229 229 HIS HIS B . n 
B 1 230 GLU 230 230 230 GLU GLU B . n 
B 1 231 GLY 231 231 231 GLY GLY B . n 
B 1 232 ALA 232 232 232 ALA ALA B . n 
B 1 233 GLN 233 233 233 GLN GLN B . n 
B 1 234 ASN 234 234 234 ASN ASN B . n 
B 1 235 TRP 235 235 235 TRP TRP B . n 
B 1 236 ASN 236 236 236 ASN ASN B . n 
B 1 237 ASN 237 237 237 ASN ASN B . n 
B 1 238 ALA 238 238 238 ALA ALA B . n 
B 1 239 GLU 239 239 239 GLU GLU B . n 
B 1 240 ARG 240 240 240 ARG ARG B . n 
B 1 241 LEU 241 241 241 LEU LEU B . n 
B 1 242 VAL 242 242 242 VAL VAL B . n 
B 1 243 GLU 243 243 243 GLU GLU B . n 
B 1 244 PHE 244 244 244 PHE PHE B . n 
B 1 245 GLY 245 245 245 GLY GLY B . n 
B 1 246 ALA 246 246 246 ALA ALA B . n 
B 1 247 PRO 247 247 247 PRO PRO B . n 
B 1 248 HIS 248 248 248 HIS HIS B . n 
B 1 249 ALA 249 249 249 ALA ALA B . n 
B 1 250 VAL 250 250 250 VAL VAL B . n 
B 1 251 LYS 251 251 251 LYS LYS B . n 
B 1 252 MET 252 252 252 MET MET B . n 
B 1 253 ASP 253 253 253 ASP ASP B . n 
B 1 254 VAL 254 254 254 VAL VAL B . n 
B 1 255 TYR 255 255 255 TYR TYR B . n 
B 1 256 ASN 256 256 256 ASN ASN B . n 
B 1 257 LEU 257 257 257 LEU LEU B . n 
B 1 258 GLY 258 258 258 GLY GLY B . n 
B 1 259 ASP 259 259 259 ASP ASP B . n 
B 1 260 GLN 260 260 260 GLN GLN B . n 
B 1 261 THR 261 261 261 THR THR B . n 
B 1 262 GLY 262 262 262 GLY GLY B . n 
B 1 263 VAL 263 263 263 VAL VAL B . n 
B 1 264 LEU 264 264 264 LEU LEU B . n 
B 1 265 LEU 265 265 265 LEU LEU B . n 
B 1 266 LYS 266 266 266 LYS LYS B . n 
B 1 267 ALA 267 267 267 ALA ALA B . n 
B 1 268 LEU 268 268 268 LEU LEU B . n 
B 1 269 ALA 269 269 269 ALA ALA B . n 
B 1 270 GLY 270 270 270 GLY GLY B . n 
B 1 271 VAL 271 271 271 VAL VAL B . n 
B 1 272 PRO 272 272 272 PRO PRO B . n 
B 1 273 VAL 273 273 273 VAL VAL B . n 
B 1 274 ALA 274 274 274 ALA ALA B . n 
B 1 275 HIS 275 275 275 HIS HIS B . n 
B 1 276 ILE 276 276 276 ILE ILE B . n 
B 1 277 GLU 277 277 277 GLU GLU B . n 
B 1 278 GLY 278 278 278 GLY GLY B . n 
B 1 279 THR 279 279 279 THR THR B . n 
B 1 280 LYS 280 280 280 LYS LYS B . n 
B 1 281 TYR 281 281 281 TYR TYR B . n 
B 1 282 HIS 282 282 282 HIS HIS B . n 
B 1 283 LEU 283 283 283 LEU LEU B . n 
B 1 284 LYS 284 284 284 LYS LYS B . n 
B 1 285 SER 285 285 285 SER SER B . n 
B 1 286 GLY 286 286 286 GLY GLY B . n 
B 1 287 HIS 287 287 287 HIS HIS B . n 
B 1 288 VAL 288 288 288 VAL VAL B . n 
B 1 289 THR 289 289 289 THR THR B . n 
B 1 290 CYS 290 290 290 CYS CYS B . n 
B 1 291 GLU 291 291 291 GLU GLU B . n 
B 1 292 VAL 292 292 292 VAL VAL B . n 
B 1 293 GLY 293 293 293 GLY GLY B . n 
B 1 294 LEU 294 294 294 LEU LEU B . n 
B 1 295 GLU 295 295 295 GLU GLU B . n 
B 1 296 LYS 296 296 296 LYS LYS B . n 
B 1 297 LEU 297 297 297 LEU LEU B . n 
B 1 298 LYS 298 298 298 LYS LYS B . n 
B 1 299 MET 299 299 299 MET MET B . n 
B 1 300 LYS 300 300 300 LYS LYS B . n 
B 1 301 GLY 301 301 301 GLY GLY B . n 
B 1 302 LEU 302 302 302 LEU LEU B . n 
B 1 303 THR 303 303 303 THR THR B . n 
B 1 304 TYR 304 304 304 TYR TYR B . n 
B 1 305 THR 305 305 305 THR THR B . n 
B 1 306 MET 306 306 306 MET MET B . n 
B 1 307 CYS 307 307 307 CYS CYS B . n 
B 1 308 ASP 308 308 308 ASP ASP B . n 
B 1 309 LYS 309 309 309 LYS LYS B . n 
B 1 310 THR 310 310 310 THR THR B . n 
B 1 311 LYS 311 311 311 LYS LYS B . n 
B 1 312 PHE 312 312 312 PHE PHE B . n 
B 1 313 THR 313 313 313 THR THR B . n 
B 1 314 TRP 314 314 314 TRP TRP B . n 
B 1 315 LYS 315 315 315 LYS LYS B . n 
B 1 316 ARG 316 316 316 ARG ARG B . n 
B 1 317 ALA 317 317 317 ALA ALA B . n 
B 1 318 PRO 318 318 318 PRO PRO B . n 
B 1 319 THR 319 319 319 THR THR B . n 
B 1 320 ASP 320 320 320 ASP ASP B . n 
B 1 321 SER 321 321 321 SER SER B . n 
B 1 322 GLY 322 322 322 GLY GLY B . n 
B 1 323 HIS 323 323 323 HIS HIS B . n 
B 1 324 ASP 324 324 324 ASP ASP B . n 
B 1 325 THR 325 325 325 THR THR B . n 
B 1 326 VAL 326 326 326 VAL VAL B . n 
B 1 327 VAL 327 327 327 VAL VAL B . n 
B 1 328 MET 328 328 328 MET MET B . n 
B 1 329 GLU 329 329 329 GLU GLU B . n 
B 1 330 VAL 330 330 330 VAL VAL B . n 
B 1 331 THR 331 331 331 THR THR B . n 
B 1 332 PHE 332 332 332 PHE PHE B . n 
B 1 333 SER 333 333 333 SER SER B . n 
B 1 334 GLY 334 334 334 GLY GLY B . n 
B 1 335 THR 335 335 335 THR THR B . n 
B 1 336 LYS 336 336 336 LYS LYS B . n 
B 1 337 PRO 337 337 337 PRO PRO B . n 
B 1 338 CYS 338 338 338 CYS CYS B . n 
B 1 339 ARG 339 339 339 ARG ARG B . n 
B 1 340 ILE 340 340 340 ILE ILE B . n 
B 1 341 PRO 341 341 341 PRO PRO B . n 
B 1 342 VAL 342 342 342 VAL VAL B . n 
B 1 343 ARG 343 343 343 ARG ARG B . n 
B 1 344 ALA 344 344 344 ALA ALA B . n 
B 1 345 VAL 345 345 345 VAL VAL B . n 
B 1 346 ALA 346 346 346 ALA ALA B . n 
B 1 347 HIS 347 347 347 HIS HIS B . n 
B 1 348 GLY 348 348 348 GLY GLY B . n 
B 1 349 SER 349 349 349 SER SER B . n 
B 1 350 PRO 350 350 350 PRO PRO B . n 
B 1 351 ASP 351 351 351 ASP ASP B . n 
B 1 352 VAL 352 352 352 VAL VAL B . n 
B 1 353 ASN 353 353 353 ASN ASN B . n 
B 1 354 VAL 354 354 354 VAL VAL B . n 
B 1 355 ALA 355 355 355 ALA ALA B . n 
B 1 356 MET 356 356 356 MET MET B . n 
B 1 357 LEU 357 357 357 LEU LEU B . n 
B 1 358 ILE 358 358 358 ILE ILE B . n 
B 1 359 THR 359 359 359 THR THR B . n 
B 1 360 PRO 360 360 360 PRO PRO B . n 
B 1 361 ASN 361 361 361 ASN ASN B . n 
B 1 362 PRO 362 362 362 PRO PRO B . n 
B 1 363 THR 363 363 363 THR THR B . n 
B 1 364 ILE 364 364 364 ILE ILE B . n 
B 1 365 GLU 365 365 365 GLU GLU B . n 
B 1 366 ASN 366 366 366 ASN ASN B . n 
B 1 367 ASN 367 367 367 ASN ASN B . n 
B 1 368 GLY 368 368 368 GLY GLY B . n 
B 1 369 GLY 369 369 369 GLY GLY B . n 
B 1 370 GLY 370 370 370 GLY GLY B . n 
B 1 371 PHE 371 371 371 PHE PHE B . n 
B 1 372 ILE 372 372 372 ILE ILE B . n 
B 1 373 GLU 373 373 373 GLU GLU B . n 
B 1 374 MET 374 374 374 MET MET B . n 
B 1 375 GLN 375 375 375 GLN GLN B . n 
B 1 376 LEU 376 376 376 LEU LEU B . n 
B 1 377 PRO 377 377 377 PRO PRO B . n 
B 1 378 PRO 378 378 378 PRO PRO B . n 
B 1 379 GLY 379 379 379 GLY GLY B . n 
B 1 380 ASP 380 380 380 ASP ASP B . n 
B 1 381 ASN 381 381 381 ASN ASN B . n 
B 1 382 ILE 382 382 382 ILE ILE B . n 
B 1 383 ILE 383 383 383 ILE ILE B . n 
B 1 384 TYR 384 384 384 TYR TYR B . n 
B 1 385 VAL 385 385 385 VAL VAL B . n 
B 1 386 GLY 386 386 386 GLY GLY B . n 
B 1 387 GLU 387 387 387 GLU GLU B . n 
B 1 388 LEU 388 388 388 LEU LEU B . n 
B 1 389 SER 389 389 389 SER SER B . n 
B 1 390 HIS 390 390 390 HIS HIS B . n 
B 1 391 GLN 391 391 391 GLN GLN B . n 
B 1 392 TRP 392 392 392 TRP TRP B . n 
B 1 393 PHE 393 393 393 PHE PHE B . n 
B 1 394 GLN 394 394 394 GLN GLN B . n 
B 1 395 LYS 395 395 395 LYS LYS B . n 
C 1 1   SER 1   1   1   SER SER C . n 
C 1 2   ARG 2   2   2   ARG ARG C . n 
C 1 3   CYS 3   3   3   CYS CYS C . n 
C 1 4   THR 4   4   4   THR THR C . n 
C 1 5   HIS 5   5   5   HIS HIS C . n 
C 1 6   LEU 6   6   6   LEU LEU C . n 
C 1 7   GLU 7   7   7   GLU GLU C . n 
C 1 8   ASN 8   8   8   ASN ASN C . n 
C 1 9   ARG 9   9   9   ARG ARG C . n 
C 1 10  ASP 10  10  10  ASP ASP C . n 
C 1 11  PHE 11  11  11  PHE PHE C . n 
C 1 12  VAL 12  12  12  VAL VAL C . n 
C 1 13  THR 13  13  13  THR THR C . n 
C 1 14  GLY 14  14  14  GLY GLY C . n 
C 1 15  THR 15  15  15  THR THR C . n 
C 1 16  GLN 16  16  16  GLN GLN C . n 
C 1 17  GLY 17  17  17  GLY GLY C . n 
C 1 18  THR 18  18  18  THR THR C . n 
C 1 19  THR 19  19  19  THR THR C . n 
C 1 20  ARG 20  20  20  ARG ARG C . n 
C 1 21  VAL 21  21  21  VAL VAL C . n 
C 1 22  THR 22  22  22  THR THR C . n 
C 1 23  LEU 23  23  23  LEU LEU C . n 
C 1 24  VAL 24  24  24  VAL VAL C . n 
C 1 25  LEU 25  25  25  LEU LEU C . n 
C 1 26  GLU 26  26  26  GLU GLU C . n 
C 1 27  LEU 27  27  27  LEU LEU C . n 
C 1 28  GLY 28  28  28  GLY GLY C . n 
C 1 29  GLY 29  29  29  GLY GLY C . n 
C 1 30  CYS 30  30  30  CYS CYS C . n 
C 1 31  VAL 31  31  31  VAL VAL C . n 
C 1 32  THR 32  32  32  THR THR C . n 
C 1 33  ILE 33  33  33  ILE ILE C . n 
C 1 34  THR 34  34  34  THR THR C . n 
C 1 35  ALA 35  35  35  ALA ALA C . n 
C 1 36  GLU 36  36  36  GLU GLU C . n 
C 1 37  GLY 37  37  37  GLY GLY C . n 
C 1 38  LYS 38  38  38  LYS LYS C . n 
C 1 39  PRO 39  39  39  PRO PRO C . n 
C 1 40  SER 40  40  40  SER SER C . n 
C 1 41  MET 41  41  41  MET MET C . n 
C 1 42  ASP 42  42  42  ASP ASP C . n 
C 1 43  VAL 43  43  43  VAL VAL C . n 
C 1 44  TRP 44  44  44  TRP TRP C . n 
C 1 45  LEU 45  45  45  LEU LEU C . n 
C 1 46  ASP 46  46  46  ASP ASP C . n 
C 1 47  ALA 47  47  47  ALA ALA C . n 
C 1 48  ILE 48  48  48  ILE ILE C . n 
C 1 49  TYR 49  49  49  TYR TYR C . n 
C 1 50  GLN 50  50  50  GLN GLN C . n 
C 1 51  GLU 51  51  51  GLU GLU C . n 
C 1 52  ASN 52  52  52  ASN ASN C . n 
C 1 53  PRO 53  53  53  PRO PRO C . n 
C 1 54  ALA 54  54  54  ALA ALA C . n 
C 1 55  LYS 55  55  55  LYS LYS C . n 
C 1 56  THR 56  56  56  THR THR C . n 
C 1 57  ARG 57  57  57  ARG ARG C . n 
C 1 58  GLU 58  58  58  GLU GLU C . n 
C 1 59  TYR 59  59  59  TYR TYR C . n 
C 1 60  CYS 60  60  60  CYS CYS C . n 
C 1 61  LEU 61  61  61  LEU LEU C . n 
C 1 62  HIS 62  62  62  HIS HIS C . n 
C 1 63  ALA 63  63  63  ALA ALA C . n 
C 1 64  LYS 64  64  64  LYS LYS C . n 
C 1 65  LEU 65  65  65  LEU LEU C . n 
C 1 66  SER 66  66  66  SER SER C . n 
C 1 67  ASP 67  67  67  ASP ASP C . n 
C 1 68  THR 68  68  68  THR THR C . n 
C 1 69  LYS 69  69  69  LYS LYS C . n 
C 1 70  VAL 70  70  70  VAL VAL C . n 
C 1 71  ALA 71  71  71  ALA ALA C . n 
C 1 72  ALA 72  72  72  ALA ALA C . n 
C 1 73  ARG 73  73  73  ARG ARG C . n 
C 1 74  CYS 74  74  74  CYS CYS C . n 
C 1 75  PRO 75  75  75  PRO PRO C . n 
C 1 76  THR 76  76  76  THR THR C . n 
C 1 77  MET 77  77  77  MET MET C . n 
C 1 78  GLY 78  78  78  GLY GLY C . n 
C 1 79  PRO 79  79  79  PRO PRO C . n 
C 1 80  ALA 80  80  80  ALA ALA C . n 
C 1 81  THR 81  81  81  THR THR C . n 
C 1 82  LEU 82  82  82  LEU LEU C . n 
C 1 83  ALA 83  83  83  ALA ALA C . n 
C 1 84  GLU 84  84  84  GLU GLU C . n 
C 1 85  GLU 85  85  85  GLU GLU C . n 
C 1 86  HIS 86  86  86  HIS HIS C . n 
C 1 87  GLN 87  87  87  GLN GLN C . n 
C 1 88  GLY 88  88  88  GLY GLY C . n 
C 1 89  GLY 89  89  89  GLY GLY C . n 
C 1 90  THR 90  90  90  THR THR C . n 
C 1 91  VAL 91  91  91  VAL VAL C . n 
C 1 92  CYS 92  92  92  CYS CYS C . n 
C 1 93  LYS 93  93  93  LYS LYS C . n 
C 1 94  ARG 94  94  94  ARG ARG C . n 
C 1 95  ASP 95  95  95  ASP ASP C . n 
C 1 96  GLN 96  96  96  GLN GLN C . n 
C 1 97  SER 97  97  97  SER SER C . n 
C 1 98  ASP 98  98  98  ASP ASP C . n 
C 1 99  ARG 99  99  99  ARG ARG C . n 
C 1 100 GLY 100 100 100 GLY GLY C . n 
C 1 101 TRP 101 101 101 TRP TRP C . n 
C 1 102 GLY 102 102 102 GLY GLY C . n 
C 1 103 ASN 103 103 103 ASN ASN C . n 
C 1 104 HIS 104 104 104 HIS HIS C . n 
C 1 105 CYS 105 105 105 CYS CYS C . n 
C 1 106 GLY 106 106 106 GLY GLY C . n 
C 1 107 LEU 107 107 107 LEU LEU C . n 
C 1 108 PHE 108 108 108 PHE PHE C . n 
C 1 109 GLY 109 109 109 GLY GLY C . n 
C 1 110 LYS 110 110 110 LYS LYS C . n 
C 1 111 GLY 111 111 111 GLY GLY C . n 
C 1 112 SER 112 112 112 SER SER C . n 
C 1 113 ILE 113 113 113 ILE ILE C . n 
C 1 114 VAL 114 114 114 VAL VAL C . n 
C 1 115 ALA 115 115 115 ALA ALA C . n 
C 1 116 CYS 116 116 116 CYS CYS C . n 
C 1 117 VAL 117 117 117 VAL VAL C . n 
C 1 118 LYS 118 118 118 LYS LYS C . n 
C 1 119 ALA 119 119 119 ALA ALA C . n 
C 1 120 ALA 120 120 120 ALA ALA C . n 
C 1 121 CYS 121 121 121 CYS CYS C . n 
C 1 122 GLU 122 122 122 GLU GLU C . n 
C 1 123 ALA 123 123 123 ALA ALA C . n 
C 1 124 LYS 124 124 124 LYS LYS C . n 
C 1 125 LYS 125 125 125 LYS LYS C . n 
C 1 126 LYS 126 126 126 LYS LYS C . n 
C 1 127 ALA 127 127 127 ALA ALA C . n 
C 1 128 THR 128 128 128 THR THR C . n 
C 1 129 GLY 129 129 129 GLY GLY C . n 
C 1 130 HIS 130 130 130 HIS HIS C . n 
C 1 131 VAL 131 131 131 VAL VAL C . n 
C 1 132 TYR 132 132 132 TYR TYR C . n 
C 1 133 ASP 133 133 133 ASP ASP C . n 
C 1 134 ALA 134 134 134 ALA ALA C . n 
C 1 135 ASN 135 135 135 ASN ASN C . n 
C 1 136 LYS 136 136 136 LYS LYS C . n 
C 1 137 ILE 137 137 137 ILE ILE C . n 
C 1 138 VAL 138 138 138 VAL VAL C . n 
C 1 139 TYR 139 139 139 TYR TYR C . n 
C 1 140 THR 140 140 140 THR THR C . n 
C 1 141 VAL 141 141 141 VAL VAL C . n 
C 1 142 LYS 142 142 142 LYS LYS C . n 
C 1 143 VAL 143 143 143 VAL VAL C . n 
C 1 144 GLU 144 144 144 GLU GLU C . n 
C 1 145 PRO 145 145 145 PRO PRO C . n 
C 1 146 HIS 146 146 146 HIS HIS C . n 
C 1 147 THR 147 147 147 THR THR C . n 
C 1 148 GLY 148 148 148 GLY GLY C . n 
C 1 149 ASP 149 149 149 ASP ASP C . n 
C 1 150 TYR 150 150 150 TYR TYR C . n 
C 1 151 VAL 151 151 151 VAL VAL C . n 
C 1 152 ALA 152 152 152 ALA ALA C . n 
C 1 153 ALA 153 153 153 ALA ALA C . n 
C 1 154 ASN 154 154 154 ASN ASN C . n 
C 1 155 GLU 155 155 155 GLU GLU C . n 
C 1 156 THR 156 156 156 THR THR C . n 
C 1 157 HIS 157 157 157 HIS HIS C . n 
C 1 158 SER 158 158 158 SER SER C . n 
C 1 159 GLY 159 159 159 GLY GLY C . n 
C 1 160 ARG 160 160 160 ARG ARG C . n 
C 1 161 LYS 161 161 161 LYS LYS C . n 
C 1 162 THR 162 162 162 THR THR C . n 
C 1 163 ALA 163 163 163 ALA ALA C . n 
C 1 164 SER 164 164 164 SER SER C . n 
C 1 165 PHE 165 165 165 PHE PHE C . n 
C 1 166 THR 166 166 166 THR THR C . n 
C 1 167 ILE 167 167 167 ILE ILE C . n 
C 1 168 SER 168 168 168 SER SER C . n 
C 1 169 SER 169 169 169 SER SER C . n 
C 1 170 GLU 170 170 170 GLU GLU C . n 
C 1 171 LYS 171 171 171 LYS LYS C . n 
C 1 172 THR 172 172 172 THR THR C . n 
C 1 173 ILE 173 173 173 ILE ILE C . n 
C 1 174 LEU 174 174 174 LEU LEU C . n 
C 1 175 THR 175 175 175 THR THR C . n 
C 1 176 MET 176 176 176 MET MET C . n 
C 1 177 GLY 177 177 177 GLY GLY C . n 
C 1 178 GLU 178 178 178 GLU GLU C . n 
C 1 179 TYR 179 179 179 TYR TYR C . n 
C 1 180 GLY 180 180 180 GLY GLY C . n 
C 1 181 ASP 181 181 181 ASP ASP C . n 
C 1 182 VAL 182 182 182 VAL VAL C . n 
C 1 183 SER 183 183 183 SER SER C . n 
C 1 184 LEU 184 184 184 LEU LEU C . n 
C 1 185 LEU 185 185 185 LEU LEU C . n 
C 1 186 CYS 186 186 186 CYS CYS C . n 
C 1 187 ARG 187 187 187 ARG ARG C . n 
C 1 188 VAL 188 188 188 VAL VAL C . n 
C 1 189 ALA 189 189 189 ALA ALA C . n 
C 1 190 SER 190 190 190 SER SER C . n 
C 1 191 GLY 191 191 191 GLY GLY C . n 
C 1 192 VAL 192 192 192 VAL VAL C . n 
C 1 193 ASP 193 193 193 ASP ASP C . n 
C 1 194 LEU 194 194 194 LEU LEU C . n 
C 1 195 ALA 195 195 195 ALA ALA C . n 
C 1 196 GLN 196 196 196 GLN GLN C . n 
C 1 197 THR 197 197 197 THR THR C . n 
C 1 198 VAL 198 198 198 VAL VAL C . n 
C 1 199 ILE 199 199 199 ILE ILE C . n 
C 1 200 LEU 200 200 200 LEU LEU C . n 
C 1 201 GLU 201 201 201 GLU GLU C . n 
C 1 202 LEU 202 202 202 LEU LEU C . n 
C 1 203 ASP 203 203 203 ASP ASP C . n 
C 1 204 LYS 204 204 204 LYS LYS C . n 
C 1 205 THR 205 205 205 THR THR C . n 
C 1 206 VAL 206 206 206 VAL VAL C . n 
C 1 207 GLU 207 207 207 GLU GLU C . n 
C 1 208 HIS 208 208 208 HIS HIS C . n 
C 1 209 LEU 209 209 209 LEU LEU C . n 
C 1 210 PRO 210 210 210 PRO PRO C . n 
C 1 211 THR 211 211 211 THR THR C . n 
C 1 212 ALA 212 212 212 ALA ALA C . n 
C 1 213 TRP 213 213 213 TRP TRP C . n 
C 1 214 GLN 214 214 214 GLN GLN C . n 
C 1 215 VAL 215 215 215 VAL VAL C . n 
C 1 216 HIS 216 216 216 HIS HIS C . n 
C 1 217 ARG 217 217 217 ARG ARG C . n 
C 1 218 ASP 218 218 218 ASP ASP C . n 
C 1 219 TRP 219 219 219 TRP TRP C . n 
C 1 220 PHE 220 220 220 PHE PHE C . n 
C 1 221 ASN 221 221 221 ASN ASN C . n 
C 1 222 ASP 222 222 222 ASP ASP C . n 
C 1 223 LEU 223 223 223 LEU LEU C . n 
C 1 224 ALA 224 224 224 ALA ALA C . n 
C 1 225 LEU 225 225 225 LEU LEU C . n 
C 1 226 PRO 226 226 226 PRO PRO C . n 
C 1 227 TRP 227 227 227 TRP TRP C . n 
C 1 228 LYS 228 228 228 LYS LYS C . n 
C 1 229 HIS 229 229 229 HIS HIS C . n 
C 1 230 GLU 230 230 230 GLU GLU C . n 
C 1 231 GLY 231 231 231 GLY GLY C . n 
C 1 232 ALA 232 232 232 ALA ALA C . n 
C 1 233 GLN 233 233 233 GLN GLN C . n 
C 1 234 ASN 234 234 234 ASN ASN C . n 
C 1 235 TRP 235 235 235 TRP TRP C . n 
C 1 236 ASN 236 236 236 ASN ASN C . n 
C 1 237 ASN 237 237 237 ASN ASN C . n 
C 1 238 ALA 238 238 238 ALA ALA C . n 
C 1 239 GLU 239 239 239 GLU GLU C . n 
C 1 240 ARG 240 240 240 ARG ARG C . n 
C 1 241 LEU 241 241 241 LEU LEU C . n 
C 1 242 VAL 242 242 242 VAL VAL C . n 
C 1 243 GLU 243 243 243 GLU GLU C . n 
C 1 244 PHE 244 244 244 PHE PHE C . n 
C 1 245 GLY 245 245 245 GLY GLY C . n 
C 1 246 ALA 246 246 246 ALA ALA C . n 
C 1 247 PRO 247 247 247 PRO PRO C . n 
C 1 248 HIS 248 248 248 HIS HIS C . n 
C 1 249 ALA 249 249 249 ALA ALA C . n 
C 1 250 VAL 250 250 250 VAL VAL C . n 
C 1 251 LYS 251 251 251 LYS LYS C . n 
C 1 252 MET 252 252 252 MET MET C . n 
C 1 253 ASP 253 253 253 ASP ASP C . n 
C 1 254 VAL 254 254 254 VAL VAL C . n 
C 1 255 TYR 255 255 255 TYR TYR C . n 
C 1 256 ASN 256 256 256 ASN ASN C . n 
C 1 257 LEU 257 257 257 LEU LEU C . n 
C 1 258 GLY 258 258 258 GLY GLY C . n 
C 1 259 ASP 259 259 259 ASP ASP C . n 
C 1 260 GLN 260 260 260 GLN GLN C . n 
C 1 261 THR 261 261 261 THR THR C . n 
C 1 262 GLY 262 262 262 GLY GLY C . n 
C 1 263 VAL 263 263 263 VAL VAL C . n 
C 1 264 LEU 264 264 264 LEU LEU C . n 
C 1 265 LEU 265 265 265 LEU LEU C . n 
C 1 266 LYS 266 266 266 LYS LYS C . n 
C 1 267 ALA 267 267 267 ALA ALA C . n 
C 1 268 LEU 268 268 268 LEU LEU C . n 
C 1 269 ALA 269 269 269 ALA ALA C . n 
C 1 270 GLY 270 270 270 GLY GLY C . n 
C 1 271 VAL 271 271 271 VAL VAL C . n 
C 1 272 PRO 272 272 272 PRO PRO C . n 
C 1 273 VAL 273 273 273 VAL VAL C . n 
C 1 274 ALA 274 274 274 ALA ALA C . n 
C 1 275 HIS 275 275 275 HIS HIS C . n 
C 1 276 ILE 276 276 276 ILE ILE C . n 
C 1 277 GLU 277 277 277 GLU GLU C . n 
C 1 278 GLY 278 278 278 GLY GLY C . n 
C 1 279 THR 279 279 279 THR THR C . n 
C 1 280 LYS 280 280 280 LYS LYS C . n 
C 1 281 TYR 281 281 281 TYR TYR C . n 
C 1 282 HIS 282 282 282 HIS HIS C . n 
C 1 283 LEU 283 283 283 LEU LEU C . n 
C 1 284 LYS 284 284 284 LYS LYS C . n 
C 1 285 SER 285 285 285 SER SER C . n 
C 1 286 GLY 286 286 286 GLY GLY C . n 
C 1 287 HIS 287 287 287 HIS HIS C . n 
C 1 288 VAL 288 288 288 VAL VAL C . n 
C 1 289 THR 289 289 289 THR THR C . n 
C 1 290 CYS 290 290 290 CYS CYS C . n 
C 1 291 GLU 291 291 291 GLU GLU C . n 
C 1 292 VAL 292 292 292 VAL VAL C . n 
C 1 293 GLY 293 293 293 GLY GLY C . n 
C 1 294 LEU 294 294 294 LEU LEU C . n 
C 1 295 GLU 295 295 295 GLU GLU C . n 
C 1 296 LYS 296 296 296 LYS LYS C . n 
C 1 297 LEU 297 297 297 LEU LEU C . n 
C 1 298 LYS 298 298 298 LYS LYS C . n 
C 1 299 MET 299 299 299 MET MET C . n 
C 1 300 LYS 300 300 300 LYS LYS C . n 
C 1 301 GLY 301 301 301 GLY GLY C . n 
C 1 302 LEU 302 302 302 LEU LEU C . n 
C 1 303 THR 303 303 303 THR THR C . n 
C 1 304 TYR 304 304 304 TYR TYR C . n 
C 1 305 THR 305 305 305 THR THR C . n 
C 1 306 MET 306 306 306 MET MET C . n 
C 1 307 CYS 307 307 307 CYS CYS C . n 
C 1 308 ASP 308 308 308 ASP ASP C . n 
C 1 309 LYS 309 309 309 LYS LYS C . n 
C 1 310 THR 310 310 310 THR THR C . n 
C 1 311 LYS 311 311 311 LYS LYS C . n 
C 1 312 PHE 312 312 312 PHE PHE C . n 
C 1 313 THR 313 313 313 THR THR C . n 
C 1 314 TRP 314 314 314 TRP TRP C . n 
C 1 315 LYS 315 315 315 LYS LYS C . n 
C 1 316 ARG 316 316 316 ARG ARG C . n 
C 1 317 ALA 317 317 317 ALA ALA C . n 
C 1 318 PRO 318 318 318 PRO PRO C . n 
C 1 319 THR 319 319 319 THR THR C . n 
C 1 320 ASP 320 320 320 ASP ASP C . n 
C 1 321 SER 321 321 321 SER SER C . n 
C 1 322 GLY 322 322 322 GLY GLY C . n 
C 1 323 HIS 323 323 323 HIS HIS C . n 
C 1 324 ASP 324 324 324 ASP ASP C . n 
C 1 325 THR 325 325 325 THR THR C . n 
C 1 326 VAL 326 326 326 VAL VAL C . n 
C 1 327 VAL 327 327 327 VAL VAL C . n 
C 1 328 MET 328 328 328 MET MET C . n 
C 1 329 GLU 329 329 329 GLU GLU C . n 
C 1 330 VAL 330 330 330 VAL VAL C . n 
C 1 331 THR 331 331 331 THR THR C . n 
C 1 332 PHE 332 332 332 PHE PHE C . n 
C 1 333 SER 333 333 333 SER SER C . n 
C 1 334 GLY 334 334 334 GLY GLY C . n 
C 1 335 THR 335 335 335 THR THR C . n 
C 1 336 LYS 336 336 336 LYS LYS C . n 
C 1 337 PRO 337 337 337 PRO PRO C . n 
C 1 338 CYS 338 338 338 CYS CYS C . n 
C 1 339 ARG 339 339 339 ARG ARG C . n 
C 1 340 ILE 340 340 340 ILE ILE C . n 
C 1 341 PRO 341 341 341 PRO PRO C . n 
C 1 342 VAL 342 342 342 VAL VAL C . n 
C 1 343 ARG 343 343 343 ARG ARG C . n 
C 1 344 ALA 344 344 344 ALA ALA C . n 
C 1 345 VAL 345 345 345 VAL VAL C . n 
C 1 346 ALA 346 346 346 ALA ALA C . n 
C 1 347 HIS 347 347 347 HIS HIS C . n 
C 1 348 GLY 348 348 348 GLY GLY C . n 
C 1 349 SER 349 349 349 SER SER C . n 
C 1 350 PRO 350 350 350 PRO PRO C . n 
C 1 351 ASP 351 351 351 ASP ASP C . n 
C 1 352 VAL 352 352 352 VAL VAL C . n 
C 1 353 ASN 353 353 353 ASN ASN C . n 
C 1 354 VAL 354 354 354 VAL VAL C . n 
C 1 355 ALA 355 355 355 ALA ALA C . n 
C 1 356 MET 356 356 356 MET MET C . n 
C 1 357 LEU 357 357 357 LEU LEU C . n 
C 1 358 ILE 358 358 358 ILE ILE C . n 
C 1 359 THR 359 359 359 THR THR C . n 
C 1 360 PRO 360 360 360 PRO PRO C . n 
C 1 361 ASN 361 361 361 ASN ASN C . n 
C 1 362 PRO 362 362 362 PRO PRO C . n 
C 1 363 THR 363 363 363 THR THR C . n 
C 1 364 ILE 364 364 364 ILE ILE C . n 
C 1 365 GLU 365 365 365 GLU GLU C . n 
C 1 366 ASN 366 366 366 ASN ASN C . n 
C 1 367 ASN 367 367 367 ASN ASN C . n 
C 1 368 GLY 368 368 368 GLY GLY C . n 
C 1 369 GLY 369 369 369 GLY GLY C . n 
C 1 370 GLY 370 370 370 GLY GLY C . n 
C 1 371 PHE 371 371 371 PHE PHE C . n 
C 1 372 ILE 372 372 372 ILE ILE C . n 
C 1 373 GLU 373 373 373 GLU GLU C . n 
C 1 374 MET 374 374 374 MET MET C . n 
C 1 375 GLN 375 375 375 GLN GLN C . n 
C 1 376 LEU 376 376 376 LEU LEU C . n 
C 1 377 PRO 377 377 377 PRO PRO C . n 
C 1 378 PRO 378 378 378 PRO PRO C . n 
C 1 379 GLY 379 379 379 GLY GLY C . n 
C 1 380 ASP 380 380 380 ASP ASP C . n 
C 1 381 ASN 381 381 381 ASN ASN C . n 
C 1 382 ILE 382 382 382 ILE ILE C . n 
C 1 383 ILE 383 383 383 ILE ILE C . n 
C 1 384 TYR 384 384 384 TYR TYR C . n 
C 1 385 VAL 385 385 385 VAL VAL C . n 
C 1 386 GLY 386 386 386 GLY GLY C . n 
C 1 387 GLU 387 387 387 GLU GLU C . n 
C 1 388 LEU 388 388 388 LEU LEU C . n 
C 1 389 SER 389 389 389 SER SER C . n 
C 1 390 HIS 390 390 390 HIS HIS C . n 
C 1 391 GLN 391 391 391 GLN GLN C . n 
C 1 392 TRP 392 392 392 TRP TRP C . n 
C 1 393 PHE 393 393 393 PHE PHE C . n 
C 1 394 GLN 394 394 394 GLN GLN C . n 
C 1 395 LYS 395 395 395 LYS LYS C . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 'complete icosahedral assembly'                ? 180-MERIC      180 
2 'icosahedral asymmetric unit'                  ? trimeric       3   
3 'icosahedral pentamer'                         ? pentadecameric 15  
4 'icosahedral 23 hexamer'                       ? octadecameric  18  
5 'icosahedral asymmetric unit, std point frame' ? trimeric       3   
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 '(1-60)'           A,B,C 
2 1                  A,B,C 
3 '(1-5)'            A,B,C 
4 '(1,2,6,10,23,24)' A,B,C 
5 P                  A,B,C 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
P  'transform to point frame' ? ? 0.00000000  -1.00000000 0.00000000  0.00000 1.00000000  0.00000000  0.00000000  0.00000 
0.00000000  0.00000000  1.00000000  -0.00000 
1  'point symmetry operation' ? ? 1.00000000  0.00000000  0.00000000  0.00000 0.00000000  1.00000000  0.00000000  0.00000 
0.00000000  0.00000000  1.00000000  0.00000  
2  'point symmetry operation' ? ? 0.50000000  -0.80901699 0.30901699  0.00000 0.80901699  0.30901699  -0.50000000 0.00000 
0.30901699  0.50000000  0.80901699  0.00000  
3  'point symmetry operation' ? ? -0.30901699 -0.50000000 0.80901699  0.00000 0.50000000  -0.80901699 -0.30901699 0.00000 
0.80901699  0.30901699  0.50000000  0.00000  
4  'point symmetry operation' ? ? -0.30901699 0.50000000  0.80901699  0.00000 -0.50000000 -0.80901699 0.30901699  0.00000 
0.80901699  -0.30901699 0.50000000  0.00000  
5  'point symmetry operation' ? ? 0.50000000  0.80901699  0.30901699  0.00000 -0.80901699 0.30901699  0.50000000  0.00000 
0.30901699  -0.50000000 0.80901699  0.00000  
6  'point symmetry operation' ? ? -1.00000000 0.00000000  0.00000000  0.00000 0.00000000  -1.00000000 0.00000000  0.00000 
0.00000000  0.00000000  1.00000000  0.00000  
7  'point symmetry operation' ? ? -0.50000000 0.80901699  -0.30901699 0.00000 -0.80901699 -0.30901699 0.50000000  0.00000 
0.30901699  0.50000000  0.80901699  0.00000  
8  'point symmetry operation' ? ? 0.30901699  0.50000000  -0.80901699 0.00000 -0.50000000 0.80901699  0.30901699  0.00000 
0.80901699  0.30901699  0.50000000  0.00000  
9  'point symmetry operation' ? ? 0.30901699  -0.50000000 -0.80901699 0.00000 0.50000000  0.80901699  -0.30901699 0.00000 
0.80901699  -0.30901699 0.50000000  0.00000  
10 'point symmetry operation' ? ? -0.50000000 -0.80901699 -0.30901699 0.00000 0.80901699  -0.30901699 -0.50000000 0.00000 
0.30901699  -0.50000000 0.80901699  0.00000  
11 'point symmetry operation' ? ? 1.00000000  0.00000000  0.00000000  0.00000 0.00000000  -1.00000000 0.00000000  0.00000 
0.00000000  0.00000000  -1.00000000 0.00000  
12 'point symmetry operation' ? ? 0.50000000  -0.80901699 0.30901699  0.00000 -0.80901699 -0.30901699 0.50000000  0.00000 
-0.30901699 -0.50000000 -0.80901699 0.00000  
13 'point symmetry operation' ? ? -0.30901699 -0.50000000 0.80901699  0.00000 -0.50000000 0.80901699  0.30901699  0.00000 
-0.80901699 -0.30901699 -0.50000000 0.00000  
14 'point symmetry operation' ? ? -0.30901699 0.50000000  0.80901699  0.00000 0.50000000  0.80901699  -0.30901699 0.00000 
-0.80901699 0.30901699  -0.50000000 0.00000  
15 'point symmetry operation' ? ? 0.50000000  0.80901699  0.30901699  0.00000 0.80901699  -0.30901699 -0.50000000 0.00000 
-0.30901699 0.50000000  -0.80901699 0.00000  
16 'point symmetry operation' ? ? -1.00000000 0.00000000  0.00000000  0.00000 0.00000000  1.00000000  0.00000000  0.00000 
0.00000000  0.00000000  -1.00000000 0.00000  
17 'point symmetry operation' ? ? -0.50000000 0.80901699  -0.30901699 0.00000 0.80901699  0.30901699  -0.50000000 0.00000 
-0.30901699 -0.50000000 -0.80901699 0.00000  
18 'point symmetry operation' ? ? 0.30901699  0.50000000  -0.80901699 0.00000 0.50000000  -0.80901699 -0.30901699 0.00000 
-0.80901699 -0.30901699 -0.50000000 0.00000  
19 'point symmetry operation' ? ? 0.30901699  -0.50000000 -0.80901699 0.00000 -0.50000000 -0.80901699 0.30901699  0.00000 
-0.80901699 0.30901699  -0.50000000 0.00000  
20 'point symmetry operation' ? ? -0.50000000 -0.80901699 -0.30901699 0.00000 -0.80901699 0.30901699  0.50000000  0.00000 
-0.30901699 0.50000000  -0.80901699 0.00000  
21 'point symmetry operation' ? ? 0.00000000  -1.00000000 0.00000000  0.00000 0.00000000  0.00000000  -1.00000000 0.00000 
1.00000000  0.00000000  0.00000000  0.00000  
22 'point symmetry operation' ? ? -0.80901699 -0.30901699 0.50000000  0.00000 -0.30901699 -0.50000000 -0.80901699 0.00000 
0.50000000  -0.80901699 0.30901699  0.00000  
23 'point symmetry operation' ? ? -0.50000000 0.80901699  0.30901699  0.00000 -0.80901699 -0.30901699 -0.50000000 0.00000 
-0.30901699 -0.50000000 0.80901699  0.00000  
24 'point symmetry operation' ? ? 0.50000000  0.80901699  -0.30901699 0.00000 -0.80901699 0.30901699  -0.50000000 0.00000 
-0.30901699 0.50000000  0.80901699  0.00000  
25 'point symmetry operation' ? ? 0.80901699  -0.30901699 -0.50000000 0.00000 -0.30901699 0.50000000  -0.80901699 0.00000 
0.50000000  0.80901699  0.30901699  0.00000  
26 'point symmetry operation' ? ? 0.00000000  1.00000000  0.00000000  0.00000 0.00000000  0.00000000  -1.00000000 0.00000 
-1.00000000 0.00000000  0.00000000  0.00000  
27 'point symmetry operation' ? ? 0.80901699  0.30901699  -0.50000000 0.00000 -0.30901699 -0.50000000 -0.80901699 0.00000 
-0.50000000 0.80901699  -0.30901699 0.00000  
28 'point symmetry operation' ? ? 0.50000000  -0.80901699 -0.30901699 0.00000 -0.80901699 -0.30901699 -0.50000000 0.00000 
0.30901699  0.50000000  -0.80901699 0.00000  
29 'point symmetry operation' ? ? -0.50000000 -0.80901699 0.30901699  0.00000 -0.80901699 0.30901699  -0.50000000 0.00000 
0.30901699  -0.50000000 -0.80901699 0.00000  
30 'point symmetry operation' ? ? -0.80901699 0.30901699  0.50000000  0.00000 -0.30901699 0.50000000  -0.80901699 0.00000 
-0.50000000 -0.80901699 -0.30901699 0.00000  
31 'point symmetry operation' ? ? 0.00000000  1.00000000  0.00000000  0.00000 0.00000000  0.00000000  1.00000000  0.00000 
1.00000000  0.00000000  0.00000000  0.00000  
32 'point symmetry operation' ? ? 0.80901699  0.30901699  -0.50000000 0.00000 0.30901699  0.50000000  0.80901699  0.00000 
0.50000000  -0.80901699 0.30901699  0.00000  
33 'point symmetry operation' ? ? 0.50000000  -0.80901699 -0.30901699 0.00000 0.80901699  0.30901699  0.50000000  0.00000 
-0.30901699 -0.50000000 0.80901699  0.00000  
34 'point symmetry operation' ? ? -0.50000000 -0.80901699 0.30901699  0.00000 0.80901699  -0.30901699 0.50000000  0.00000 
-0.30901699 0.50000000  0.80901699  0.00000  
35 'point symmetry operation' ? ? -0.80901699 0.30901699  0.50000000  0.00000 0.30901699  -0.50000000 0.80901699  0.00000 
0.50000000  0.80901699  0.30901699  0.00000  
36 'point symmetry operation' ? ? 0.00000000  -1.00000000 0.00000000  0.00000 0.00000000  0.00000000  1.00000000  0.00000 
-1.00000000 0.00000000  0.00000000  0.00000  
37 'point symmetry operation' ? ? -0.80901699 -0.30901699 0.50000000  0.00000 0.30901699  0.50000000  0.80901699  0.00000 
-0.50000000 0.80901699  -0.30901699 0.00000  
38 'point symmetry operation' ? ? -0.50000000 0.80901699  0.30901699  0.00000 0.80901699  0.30901699  0.50000000  0.00000 
0.30901699  0.50000000  -0.80901699 0.00000  
39 'point symmetry operation' ? ? 0.50000000  0.80901699  -0.30901699 0.00000 0.80901699  -0.30901699 0.50000000  0.00000 
0.30901699  -0.50000000 -0.80901699 0.00000  
40 'point symmetry operation' ? ? 0.80901699  -0.30901699 -0.50000000 0.00000 0.30901699  -0.50000000 0.80901699  0.00000 
-0.50000000 -0.80901699 -0.30901699 0.00000  
41 'point symmetry operation' ? ? 0.00000000  0.00000000  1.00000000  0.00000 -1.00000000 0.00000000  0.00000000  0.00000 
0.00000000  -1.00000000 0.00000000  0.00000  
42 'point symmetry operation' ? ? 0.30901699  0.50000000  0.80901699  0.00000 -0.50000000 0.80901699  -0.30901699 0.00000 
-0.80901699 -0.30901699 0.50000000  0.00000  
43 'point symmetry operation' ? ? 0.80901699  0.30901699  0.50000000  0.00000 0.30901699  0.50000000  -0.80901699 0.00000 
-0.50000000 0.80901699  0.30901699  0.00000  
44 'point symmetry operation' ? ? 0.80901699  -0.30901699 0.50000000  0.00000 0.30901699  -0.50000000 -0.80901699 0.00000 
0.50000000  0.80901699  -0.30901699 0.00000  
45 'point symmetry operation' ? ? 0.30901699  -0.50000000 0.80901699  0.00000 -0.50000000 -0.80901699 -0.30901699 0.00000 
0.80901699  -0.30901699 -0.50000000 0.00000  
46 'point symmetry operation' ? ? 0.00000000  0.00000000  1.00000000  0.00000 1.00000000  0.00000000  0.00000000  0.00000 
0.00000000  1.00000000  0.00000000  0.00000  
47 'point symmetry operation' ? ? 0.30901699  0.50000000  0.80901699  0.00000 0.50000000  -0.80901699 0.30901699  0.00000 
0.80901699  0.30901699  -0.50000000 0.00000  
48 'point symmetry operation' ? ? 0.80901699  0.30901699  0.50000000  0.00000 -0.30901699 -0.50000000 0.80901699  0.00000 
0.50000000  -0.80901699 -0.30901699 0.00000  
49 'point symmetry operation' ? ? 0.80901699  -0.30901699 0.50000000  0.00000 -0.30901699 0.50000000  0.80901699  0.00000 
-0.50000000 -0.80901699 0.30901699  0.00000  
50 'point symmetry operation' ? ? 0.30901699  -0.50000000 0.80901699  0.00000 0.50000000  0.80901699  0.30901699  0.00000 
-0.80901699 0.30901699  0.50000000  0.00000  
51 'point symmetry operation' ? ? 0.00000000  0.00000000  -1.00000000 0.00000 -1.00000000 0.00000000  0.00000000  0.00000 
0.00000000  1.00000000  0.00000000  0.00000  
52 'point symmetry operation' ? ? -0.30901699 -0.50000000 -0.80901699 0.00000 -0.50000000 0.80901699  -0.30901699 0.00000 
0.80901699  0.30901699  -0.50000000 0.00000  
53 'point symmetry operation' ? ? -0.80901699 -0.30901699 -0.50000000 0.00000 0.30901699  0.50000000  -0.80901699 0.00000 
0.50000000  -0.80901699 -0.30901699 0.00000  
54 'point symmetry operation' ? ? -0.80901699 0.30901699  -0.50000000 0.00000 0.30901699  -0.50000000 -0.80901699 0.00000 
-0.50000000 -0.80901699 0.30901699  0.00000  
55 'point symmetry operation' ? ? -0.30901699 0.50000000  -0.80901699 0.00000 -0.50000000 -0.80901699 -0.30901699 0.00000 
-0.80901699 0.30901699  0.50000000  0.00000  
56 'point symmetry operation' ? ? 0.00000000  0.00000000  -1.00000000 0.00000 1.00000000  0.00000000  0.00000000  0.00000 
0.00000000  -1.00000000 0.00000000  0.00000  
57 'point symmetry operation' ? ? -0.30901699 -0.50000000 -0.80901699 0.00000 0.50000000  -0.80901699 0.30901699  0.00000 
-0.80901699 -0.30901699 0.50000000  0.00000  
58 'point symmetry operation' ? ? -0.80901699 -0.30901699 -0.50000000 0.00000 -0.30901699 -0.50000000 0.80901699  0.00000 
-0.50000000 0.80901699  0.30901699  0.00000  
59 'point symmetry operation' ? ? -0.80901699 0.30901699  -0.50000000 0.00000 -0.30901699 0.50000000  0.80901699  0.00000 
0.50000000  0.80901699  -0.30901699 0.00000  
60 'point symmetry operation' ? ? -0.30901699 0.50000000  -0.80901699 0.00000 0.50000000  0.80901699  0.30901699  0.00000 
0.80901699  -0.30901699 -0.50000000 0.00000  
# 
_pdbx_point_symmetry.entry_id             1K4R 
_pdbx_point_symmetry.Schoenflies_symbol   I 
_pdbx_point_symmetry.H-M_notation         532 
_pdbx_point_symmetry.circular_symmetry    ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-03-13 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2018-07-18 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            em_software 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_em_software.image_processing_id' 
2 4 'Structure model' '_em_software.name'                
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
emfit 'model building' . ? 1 
EMFIT phasing          . ? 2 
# 
_pdbx_database_remark.id     2 
_pdbx_database_remark.text   'RESOLUTION. 24.00 ANGSTROM.' 
# 
_em_3d_fitting.id                1 
_em_3d_fitting.entry_id          1K4R 
_em_3d_fitting.ref_protocol      'RIGID BODY FIT' 
_em_3d_fitting.ref_space         REAL 
_em_3d_fitting.overall_b_value   ? 
_em_3d_fitting.target_criteria   ? 
_em_3d_fitting.details           
;METHOD--IN THE FIRST STEP THE CRYSTAL STRUCTURE OF TBEV-E CRYSTALLOGRAPHIC 
DIMER (REY ET.AL., 1995 NATURELONDON) 375, 291-298) WAS ROTATED ABOUT AND 
TRANSLATEDAROUND AN ICOSAHEDRAL TWO FOLD AXES TO FIND THE BEST FIT. AFTER THAT 
THE DENSITIES AT ALL PIXELS COVERED BY THE FIRST FITTED DIMER WERE SET TO ZERO. 
THE SECOND DIMER WAS THAN PLACED ON A RADIAL AXIS PASSING THROUGH A POINT NEAR 
THE QUASI-TWOFOLD AXIS.
;
_em_3d_fitting.method            ? 
# 
_em_3d_fitting_list.3d_fitting_id   1 
_em_3d_fitting_list.id              1 
_em_3d_fitting_list.pdb_chain_id    ? 
_em_3d_fitting_list.pdb_entry_id    1SVB 
# 
_em_3d_reconstruction.entry_id                    1K4R 
_em_3d_reconstruction.id                          1 
_em_3d_reconstruction.symmetry_type               POINT 
_em_3d_reconstruction.num_particles               526 
_em_3d_reconstruction.image_processing_id         1 
_em_3d_reconstruction.method                      
;COMMON-LINES AND POLAR-FOURIER-TRANSFORM   
(FULLER ET AL. 1996, J.STRUC.BIOL. 116, 48-55   
BAKER AND CHENG, 1996, J.STRUC.BIOL. 116, 120-130)  
SOFTWARE USED, PURDUE PROGRAMS
;
_em_3d_reconstruction.nominal_pixel_size          2.8 
_em_3d_reconstruction.actual_pixel_size           2.9 
_em_3d_reconstruction.resolution                  24 
_em_3d_reconstruction.resolution_method           ? 
_em_3d_reconstruction.magnification_calibration   ? 
_em_3d_reconstruction.details                     ? 
_em_3d_reconstruction.num_class_averages          ? 
_em_3d_reconstruction.algorithm                   ? 
# 
_em_buffer.id            1 
_em_buffer.specimen_id   1 
_em_buffer.name          ? 
_em_buffer.pH            7.6 
_em_buffer.details       ? 
# 
_em_entity_assembly.id                   1 
_em_entity_assembly.name                 'DENGUE VIRUS MAJOR ENVELOPE PROTEIN E' 
_em_entity_assembly.type                 VIRUS 
_em_entity_assembly.parent_id            0 
_em_entity_assembly.synonym              ? 
_em_entity_assembly.details              
'SAMPLES WERE PREPARED AS THIN LAYERS OF VITREOUS ICE AND MAINTAINED AT NEAR LIQUID NITROGEN TEMPERATURE IN THE ELECTRON MICROSCOPE.' 
_em_entity_assembly.entity_id_list       ? 
_em_entity_assembly.source               ? 
_em_entity_assembly.oligomeric_details   ? 
# 
_em_image_scans.entry_id                1K4R 
_em_image_scans.id                      1 
_em_image_scans.image_recording_id      1 
_em_image_scans.number_digital_images   25 
_em_image_scans.citation_id             ? 
_em_image_scans.od_range                ? 
_em_image_scans.quant_bit_size          ? 
_em_image_scans.sampling_size           ? 
_em_image_scans.scanner_model           ? 
_em_image_scans.details                 ? 
_em_image_scans.dimension_height        ? 
_em_image_scans.dimension_width         ? 
_em_image_scans.frames_per_image        ? 
# 
_em_imaging.entry_id                        1K4R 
_em_imaging.id                              1 
_em_imaging.microscope_model                'FEI/PHILIPS CM200T' 
_em_imaging.illumination_mode               'FLOOD BEAM' 
_em_imaging.electron_source                 'FIELD EMISSION GUN' 
_em_imaging.specimen_id                     1 
_em_imaging.date                            ? 
_em_imaging.temperature                     100 
_em_imaging.nominal_defocus_max             1920.0 
_em_imaging.nominal_defocus_min             790.0 
_em_imaging.tilt_angle_max                  0.0 
_em_imaging.tilt_angle_min                  0.0 
_em_imaging.nominal_cs                      2.0 
_em_imaging.mode                            'BRIGHT FIELD' 
_em_imaging.nominal_magnification           50000 
_em_imaging.calibrated_magnification        ? 
_em_imaging.accelerating_voltage            . 
_em_imaging.details                         ? 
_em_imaging.citation_id                     ? 
_em_imaging.detector_distance               ? 
_em_imaging.recording_temperature_maximum   ? 
_em_imaging.recording_temperature_minimum   ? 
_em_imaging.specimen_holder_model           ? 
_em_imaging.specimen_holder_type            ? 
_em_imaging.astigmatism                     ? 
_em_imaging.electron_beam_tilt_params       ? 
_em_imaging.calibrated_defocus_max          ? 
_em_imaging.alignment_procedure             ? 
_em_imaging.c2_aperture_diameter            ? 
_em_imaging.calibrated_defocus_min          ? 
_em_imaging.cryogen                         ? 
_em_imaging.residual_tilt                   ? 
# 
_em_sample_support.id               1 
_em_sample_support.specimen_id      1 
_em_sample_support.details          'sample conc. l2.0E10 PFU/ML' 
_em_sample_support.film_material    ? 
_em_sample_support.grid_material    ? 
_em_sample_support.grid_mesh_size   ? 
_em_sample_support.grid_type        ? 
_em_sample_support.method           ? 
# 
_em_virus_entity.id                    1 
_em_virus_entity.virus_host_category   VERTEBRATES 
_em_virus_entity.virus_type            VIRION 
_em_virus_entity.virus_isolate         SPECIES 
_em_virus_entity.empty                 NO 
_em_virus_entity.entity_assembly_id    1 
_em_virus_entity.enveloped             YES 
_em_virus_entity.details               ? 
# 
_em_vitrification.entry_id              1K4R 
_em_vitrification.id                    1 
_em_vitrification.citation_id           ? 
_em_vitrification.details               'LIQUID NITROGEN TEMPERATURE 50MM TRIS-HCL, 75MM NACL, 1MM EDTA' 
_em_vitrification.cryogen_name          ? 
_em_vitrification.humidity              ? 
_em_vitrification.instrument            ? 
_em_vitrification.method                ? 
_em_vitrification.specimen_id           1 
_em_vitrification.temp                  ? 
_em_vitrification.time_resolved_state   ? 
# 
_em_experiment.entry_id                1K4R 
_em_experiment.id                      1 
_em_experiment.aggregation_state       PARTICLE 
_em_experiment.entity_assembly_id      1 
_em_experiment.reconstruction_method   'SINGLE PARTICLE' 
# 
_em_single_particle_entity.entry_id              1K4R 
_em_single_particle_entity.id                    1 
_em_single_particle_entity.point_symmetry        I 
_em_single_particle_entity.image_processing_id   1 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   ND1 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   HIS 
_pdbx_validate_close_contact.auth_seq_id_1    86 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   C 
_pdbx_validate_close_contact.auth_comp_id_2   HIS 
_pdbx_validate_close_contact.auth_seq_id_2    86 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             1.43 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 THR A 15  ? ? -90.28  -147.09 
2  1 THR A 18  ? ? -56.88  108.43  
3  1 THR A 56  ? ? -95.21  -137.69 
4  1 LEU A 202 ? ? -103.78 -109.87 
5  1 HIS A 208 ? ? -99.82  44.43   
6  1 ALA A 249 ? ? 66.33   -110.84 
7  1 ASN A 361 ? ? 26.68   69.16   
8  1 ASN A 367 ? ? -142.87 35.20   
9  1 THR B 15  ? ? -90.29  -147.10 
10 1 THR B 18  ? ? -56.86  108.44  
11 1 THR B 56  ? ? -95.15  -137.70 
12 1 LEU B 202 ? ? -103.72 -109.88 
13 1 HIS B 208 ? ? -99.76  44.33   
14 1 ALA B 249 ? ? 66.34   -110.85 
15 1 ASN B 361 ? ? 26.71   69.15   
16 1 ASN B 367 ? ? -142.94 35.25   
17 1 THR C 15  ? ? -90.20  -147.11 
18 1 THR C 18  ? ? -56.86  108.45  
19 1 THR C 56  ? ? -95.14  -137.66 
20 1 LEU C 202 ? ? -103.80 -109.86 
21 1 HIS C 208 ? ? -99.81  44.41   
22 1 ALA C 249 ? ? 66.35   -110.84 
23 1 ASN C 361 ? ? 26.71   69.17   
24 1 ASN C 367 ? ? -142.88 35.23   
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 TYR A 150 ? ? 0.074 'SIDE CHAIN' 
2 1 TYR B 150 ? ? 0.074 'SIDE CHAIN' 
3 1 TYR C 150 ? ? 0.074 'SIDE CHAIN' 
# 
_em_ctf_correction.id                       1 
_em_ctf_correction.details                  
'EACH VIRAL IMAGE WAS CTF CORRECTED BEFORE RECONSTRUCTION, BASED ON THE FOLLOWING EQUATION: F(CORR)=F(OBS)/[|CTF|+WIENER]' 
_em_ctf_correction.type                     . 
_em_ctf_correction.em_image_processing_id   ? 
# 
_em_image_processing.id                   1 
_em_image_processing.image_recording_id   1 
_em_image_processing.details              ? 
# 
_em_image_recording.avg_electron_dose_per_image   25.5 
_em_image_recording.details                       ? 
_em_image_recording.id                            1 
_em_image_recording.film_or_detector_model        'KODAK SO-163 FILM' 
_em_image_recording.imaging_id                    1 
_em_image_recording.average_exposure_time         ? 
_em_image_recording.num_grids_imaged              ? 
_em_image_recording.num_diffraction_images        ? 
_em_image_recording.num_real_images               ? 
_em_image_recording.detector_mode                 ? 
# 
loop_
_em_software.id 
_em_software.name 
_em_software.version 
_em_software.category 
_em_software.details 
_em_software.image_processing_id 
1 EMfit ? 'MODEL FITTING' 'CLIMB procedure' ? 
2 OTHER ? RECONSTRUCTION  ?                 1 
# 
_em_specimen.experiment_id           1 
_em_specimen.id                      1 
_em_specimen.concentration           ? 
_em_specimen.vitrification_applied   YES 
_em_specimen.staining_applied        NO 
_em_specimen.embedding_applied       NO 
_em_specimen.shadowing_applied       NO 
_em_specimen.details                 ? 
# 
_em_virus_natural_host.entity_assembly_id   1 
_em_virus_natural_host.id                   1 
_em_virus_natural_host.ncbi_tax_id          9443 
_em_virus_natural_host.organism             Primates 
_em_virus_natural_host.strain               ? 
#