data_1K76
# 
_entry.id   1K76 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.351 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1K76         pdb_00001k76 10.2210/pdb1k76/pdb 
RCSB  RCSB014645   ?            ?                   
WWPDB D_1000014645 ?            ?                   
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1K76 
_pdbx_database_status.recvd_initial_deposition_date   2001-10-18 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ferreon, J.'    1 
'Volk, D.'       2 
'Luxon, B.'      3 
'Gorenstein, D.' 4 
'Hilser, V.'     5 
# 
_citation.id                        primary 
_citation.title                     
;Solution Structure, Dynamics and Thermodynamics of the Native State Ensemble 
of Sem-5 C-Terminal SH3 Domain
;
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            42 
_citation.page_first                5582 
_citation.page_last                 5591 
_citation.year                      2003 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12741814 
_citation.pdbx_database_id_DOI      10.1021/bi030005j 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Ferreon, J.'    1 ? 
primary 'Volk, D.'       2 ? 
primary 'Luxon, B.'      3 ? 
primary 'Gorenstein, D.' 4 ? 
primary 'Hilser, V.'     5 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'SEX MUSCLE ABNORMAL PROTEIN 5' 
_entity.formula_weight             7237.967 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              C57A 
_entity.pdbx_fragment              'SH3 domain (Residues 155-214)' 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       HMETKFVQALFDFNPQESGELAFKRGDVITLINKDDPNWWEGQLNNRRGIFPSNYVAPYNSN 
_entity_poly.pdbx_seq_one_letter_code_can   HMETKFVQALFDFNPQESGELAFKRGDVITLINKDDPNWWEGQLNNRRGIFPSNYVAPYNSN 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  HIS n 
1 2  MET n 
1 3  GLU n 
1 4  THR n 
1 5  LYS n 
1 6  PHE n 
1 7  VAL n 
1 8  GLN n 
1 9  ALA n 
1 10 LEU n 
1 11 PHE n 
1 12 ASP n 
1 13 PHE n 
1 14 ASN n 
1 15 PRO n 
1 16 GLN n 
1 17 GLU n 
1 18 SER n 
1 19 GLY n 
1 20 GLU n 
1 21 LEU n 
1 22 ALA n 
1 23 PHE n 
1 24 LYS n 
1 25 ARG n 
1 26 GLY n 
1 27 ASP n 
1 28 VAL n 
1 29 ILE n 
1 30 THR n 
1 31 LEU n 
1 32 ILE n 
1 33 ASN n 
1 34 LYS n 
1 35 ASP n 
1 36 ASP n 
1 37 PRO n 
1 38 ASN n 
1 39 TRP n 
1 40 TRP n 
1 41 GLU n 
1 42 GLY n 
1 43 GLN n 
1 44 LEU n 
1 45 ASN n 
1 46 ASN n 
1 47 ARG n 
1 48 ARG n 
1 49 GLY n 
1 50 ILE n 
1 51 PHE n 
1 52 PRO n 
1 53 SER n 
1 54 ASN n 
1 55 TYR n 
1 56 VAL n 
1 57 ALA n 
1 58 PRO n 
1 59 TYR n 
1 60 ASN n 
1 61 SER n 
1 62 ASN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Caenorhabditis 
_entity_src_gen.pdbx_gene_src_gene                 Sem-5 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Caenorhabditis elegans' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     6239 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 pLysS' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET19B 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SEM5_CAEEL 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ETKFVQALFDFNPQESGELAFKRGDVITLINKDDPNWWEGQLNNRRGIFPSNYVCPYNSN 
_struct_ref.pdbx_align_begin           155 
_struct_ref.pdbx_db_accession          P29355 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1K76 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 3 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 62 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P29355 
_struct_ref_seq.db_align_beg                  155 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  214 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       3 
_struct_ref_seq.pdbx_auth_seq_align_end       62 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1K76 
_struct_ref_seq_dif.mon_id                       ALA 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      57 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P29355 
_struct_ref_seq_dif.db_mon_id                    CYS 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          209 
_struct_ref_seq_dif.details                      'engineered mutation' 
_struct_ref_seq_dif.pdbx_auth_seq_num            57 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1 1 1 '3D 15N-NOESY-HSQC' 
2 1 1 '3D 13C-NOESY-HSQC' 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  4.8 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      '100 mM NaCl' 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
;13C,15N 1mM Sem-5 SH3 domain   
50 mM sodium acetate buffer,   
10 mM CaCl2, 100 mM NaCl,pH 4.8, 90%h20, 10%d20
;
_pdbx_nmr_sample_details.solvent_system   '90%h20, 10%d20' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              ? 
_pdbx_nmr_spectrometer.manufacturer      Varian 
_pdbx_nmr_spectrometer.model             UNITYPLUS 
_pdbx_nmr_spectrometer.field_strength    400 
# 
_pdbx_nmr_refine.entry_id           1K76 
_pdbx_nmr_refine.method             
;distance geometry 
simulated annealing 
molecular dynamics
;
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   1K76 
_pdbx_nmr_details.text       
;The structure was determined 
using triple-resonance NMR spectroscopy
;
# 
_pdbx_nmr_ensemble.entry_id                                      1K76 
_pdbx_nmr_ensemble.conformers_calculated_total_number            50 
_pdbx_nmr_ensemble.conformers_submitted_total_number             1 
_pdbx_nmr_ensemble.conformer_selection_criteria                  
'structures with the least restraint violations,structures with the lowest energy' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1K76 
_pdbx_nmr_representative.conformer_id         ? 
_pdbx_nmr_representative.selection_criteria   'minimized average structure' 
# 
loop_
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
CNS   1.0 'structure solution' Brunger           1 
Felix ?   processing           MSI               2 
VNMR  ?   collection           Varian            3 
CNS   ?   refinement           'Brunger, et al.' 4 
# 
_exptl.entry_id          1K76 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  1K76 
_struct.title                     'Solution Structure of the C-terminal Sem-5 SH3 Domain (Minimized Average Structure)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   'minimized average' 
# 
_struct_keywords.entry_id        1K76 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            'all beta protein, SIGNALING PROTEIN' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   5 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG A 47 ? PRO A 52 ? ARG A 47 PRO A 52 
A 2 TRP A 39 ? LEU A 44 ? TRP A 39 LEU A 44 
A 3 VAL A 28 ? ASN A 33 ? VAL A 28 ASN A 33 
A 4 PHE A 6  ? ALA A 9  ? PHE A 6  ALA A 9  
A 5 VAL A 56 ? PRO A 58 ? VAL A 56 PRO A 58 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O GLY A 49 ? O GLY A 49 N GLY A 42 ? N GLY A 42 
A 2 3 O GLN A 43 ? O GLN A 43 N THR A 30 ? N THR A 30 
A 3 4 O ILE A 29 ? O ILE A 29 N VAL A 7  ? N VAL A 7  
A 4 5 N GLN A 8  ? N GLN A 8  O ALA A 57 ? O ALA A 57 
# 
_database_PDB_matrix.entry_id          1K76 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1K76 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1   N N    . GLU A 1 3  ? 104.452 -4.938  -12.881 1.00 3.39 ? 3  GLU A N    1 
ATOM 2   C CA   . GLU A 1 3  ? 104.964 -5.061  -11.828 1.00 3.13 ? 3  GLU A CA   1 
ATOM 3   C C    . GLU A 1 3  ? 104.207 -4.890  -10.845 1.00 2.61 ? 3  GLU A C    1 
ATOM 4   O O    . GLU A 1 3  ? 103.630 -3.851  -10.579 1.00 2.64 ? 3  GLU A O    1 
ATOM 5   C CB   . GLU A 1 3  ? 105.949 -4.084  -11.666 1.00 3.58 ? 3  GLU A CB   1 
ATOM 6   C CG   . GLU A 1 3  ? 107.259 -4.563  -12.190 1.00 3.59 ? 3  GLU A CG   1 
ATOM 7   C CD   . GLU A 1 3  ? 107.618 -3.737  -13.450 1.00 4.30 ? 3  GLU A CD   1 
ATOM 8   O OE1  . GLU A 1 3  ? 107.964 -2.589  -13.308 1.00 4.55 ? 3  GLU A OE1  1 
ATOM 9   O OE2  . GLU A 1 3  ? 107.465 -4.171  -14.584 1.00 4.94 ? 3  GLU A OE2  1 
ATOM 10  H H    . GLU A 1 3  ? 104.076 -4.131  -13.167 1.00 3.56 ? 3  GLU A H    1 
ATOM 11  H HA   . GLU A 1 3  ? 105.419 -5.973  -11.815 1.00 3.32 ? 3  GLU A HA   1 
ATOM 12  H HB2  . GLU A 1 3  ? 105.621 -3.215  -12.185 1.00 4.08 ? 3  GLU A HB2  1 
ATOM 13  H HB3  . GLU A 1 3  ? 105.987 -3.888  -10.625 1.00 3.92 ? 3  GLU A HB3  1 
ATOM 14  H HG2  . GLU A 1 3  ? 108.006 -4.483  -11.432 1.00 3.69 ? 3  GLU A HG2  1 
ATOM 15  H HG3  . GLU A 1 3  ? 107.152 -5.600  -12.421 1.00 3.55 ? 3  GLU A HG3  1 
ATOM 16  N N    . THR A 1 4  ? 104.344 -5.852  -10.226 1.00 2.45 ? 4  THR A N    1 
ATOM 17  C CA   . THR A 1 4  ? 103.765 -5.908  -9.130  1.00 2.16 ? 4  THR A CA   1 
ATOM 18  C C    . THR A 1 4  ? 104.756 -5.791  -8.013  1.00 1.88 ? 4  THR A C    1 
ATOM 19  O O    . THR A 1 4  ? 105.896 -6.297  -8.017  1.00 2.07 ? 4  THR A O    1 
ATOM 20  C CB   . THR A 1 4  ? 103.014 -7.131  -9.215  1.00 2.57 ? 4  THR A CB   1 
ATOM 21  O OG1  . THR A 1 4  ? 101.889 -7.058  -8.399  1.00 2.91 ? 4  THR A OG1  1 
ATOM 22  C CG2  . THR A 1 4  ? 103.944 -8.343  -8.940  1.00 3.02 ? 4  THR A CG2  1 
ATOM 23  H H    . THR A 1 4  ? 104.889 -6.586  -10.548 1.00 2.75 ? 4  THR A H    1 
ATOM 24  H HA   . THR A 1 4  ? 103.138 -5.059  -9.101  1.00 2.19 ? 4  THR A HA   1 
ATOM 25  H HB   . THR A 1 4  ? 102.658 -7.181  -10.215 1.00 3.05 ? 4  THR A HB   1 
ATOM 26  H HG1  . THR A 1 4  ? 101.273 -6.403  -8.800  1.00 3.17 ? 4  THR A HG1  1 
ATOM 27  H HG21 . THR A 1 4  ? 104.930 -8.056  -9.194  1.00 3.18 ? 4  THR A HG21 1 
ATOM 28  H HG22 . THR A 1 4  ? 103.722 -9.232  -9.459  1.00 3.44 ? 4  THR A HG22 1 
ATOM 29  H HG23 . THR A 1 4  ? 103.927 -8.564  -7.943  1.00 3.45 ? 4  THR A HG23 1 
ATOM 30  N N    . LYS A 1 5  ? 104.263 -5.053  -7.087  1.00 1.62 ? 5  LYS A N    1 
ATOM 31  C CA   . LYS A 1 5  ? 104.929 -4.745  -5.911  1.00 1.45 ? 5  LYS A CA   1 
ATOM 32  C C    . LYS A 1 5  ? 104.112 -4.907  -4.751  1.00 1.31 ? 5  LYS A C    1 
ATOM 33  O O    . LYS A 1 5  ? 103.046 -4.324  -4.651  1.00 1.30 ? 5  LYS A O    1 
ATOM 34  C CB   . LYS A 1 5  ? 105.278 -3.369  -5.954  1.00 1.48 ? 5  LYS A CB   1 
ATOM 35  C CG   . LYS A 1 5  ? 106.430 -3.349  -6.617  1.00 1.96 ? 5  LYS A CG   1 
ATOM 36  C CD   . LYS A 1 5  ? 106.989 -2.097  -6.769  1.00 2.12 ? 5  LYS A CD   1 
ATOM 37  C CE   . LYS A 1 5  ? 108.264 -2.611  -7.201  1.00 2.71 ? 5  LYS A CE   1 
ATOM 38  N NZ   . LYS A 1 5  ? 109.317 -1.672  -7.322  1.00 3.03 ? 5  LYS A NZ   1 
ATOM 39  H H    . LYS A 1 5  ? 103.402 -4.652  -7.239  1.00 1.69 ? 5  LYS A H    1 
ATOM 40  H HA   . LYS A 1 5  ? 105.820 -5.335  -5.834  1.00 1.60 ? 5  LYS A HA   1 
ATOM 41  H HB2  . LYS A 1 5  ? 104.563 -2.813  -6.484  1.00 1.60 ? 5  LYS A HB2  1 
ATOM 42  H HB3  . LYS A 1 5  ? 105.442 -2.991  -4.994  1.00 1.63 ? 5  LYS A HB3  1 
ATOM 43  H HG2  . LYS A 1 5  ? 107.083 -3.928  -6.053  1.00 2.51 ? 5  LYS A HG2  1 
ATOM 44  H HG3  . LYS A 1 5  ? 106.320 -3.781  -7.550  1.00 2.42 ? 5  LYS A HG3  1 
ATOM 45  H HD2  . LYS A 1 5  ? 106.447 -1.581  -7.527  1.00 2.54 ? 5  LYS A HD2  1 
ATOM 46  H HD3  . LYS A 1 5  ? 107.016 -1.577  -5.862  1.00 2.30 ? 5  LYS A HD3  1 
ATOM 47  H HE2  . LYS A 1 5  ? 108.525 -3.434  -6.500  1.00 3.25 ? 5  LYS A HE2  1 
ATOM 48  H HE3  . LYS A 1 5  ? 108.074 -2.993  -8.183  1.00 3.12 ? 5  LYS A HE3  1 
ATOM 49  H HZ1  . LYS A 1 5  ? 110.088 -2.033  -7.886  1.00 3.24 ? 5  LYS A HZ1  1 
ATOM 50  H HZ2  . LYS A 1 5  ? 109.677 -1.414  -6.453  1.00 3.36 ? 5  LYS A HZ2  1 
ATOM 51  H HZ3  . LYS A 1 5  ? 108.944 -0.887  -7.777  1.00 3.34 ? 5  LYS A HZ3  1 
ATOM 52  N N    . PHE A 1 6  ? 104.634 -5.654  -3.850  1.00 1.44 ? 6  PHE A N    1 
ATOM 53  C CA   . PHE A 1 6  ? 103.954 -5.875  -2.639  1.00 1.38 ? 6  PHE A CA   1 
ATOM 54  C C    . PHE A 1 6  ? 104.739 -5.394  -1.476  1.00 1.39 ? 6  PHE A C    1 
ATOM 55  O O    . PHE A 1 6  ? 105.942 -5.605  -1.395  1.00 1.67 ? 6  PHE A O    1 
ATOM 56  C CB   . PHE A 1 6  ? 103.664 -7.325  -2.491  1.00 1.68 ? 6  PHE A CB   1 
ATOM 57  C CG   . PHE A 1 6  ? 102.787 -7.773  -3.567  1.00 1.96 ? 6  PHE A CG   1 
ATOM 58  C CD1  . PHE A 1 6  ? 101.383 -7.674  -3.419  1.00 2.42 ? 6  PHE A CD1  1 
ATOM 59  C CD2  . PHE A 1 6  ? 103.371 -8.313  -4.747  1.00 2.38 ? 6  PHE A CD2  1 
ATOM 60  C CE1  . PHE A 1 6  ? 100.549 -8.093  -4.448  1.00 2.72 ? 6  PHE A CE1  1 
ATOM 61  C CE2  . PHE A 1 6  ? 102.561 -8.740  -5.786  1.00 2.71 ? 6  PHE A CE2  1 
ATOM 62  C CZ   . PHE A 1 6  ? 101.134 -8.647  -5.649  1.00 2.65 ? 6  PHE A CZ   1 
ATOM 63  H H    . PHE A 1 6  ? 105.513 -6.061  -3.999  1.00 1.70 ? 6  PHE A H    1 
ATOM 64  H HA   . PHE A 1 6  ? 103.025 -5.338  -2.695  1.00 1.19 ? 6  PHE A HA   1 
ATOM 65  H HB2  . PHE A 1 6  ? 104.583 -7.882  -2.548  1.00 1.86 ? 6  PHE A HB2  1 
ATOM 66  H HB3  . PHE A 1 6  ? 103.184 -7.506  -1.544  1.00 1.62 ? 6  PHE A HB3  1 
ATOM 67  H HD1  . PHE A 1 6  ? 100.955 -7.232  -2.480  1.00 2.88 ? 6  PHE A HD1  1 
ATOM 68  H HD2  . PHE A 1 6  ? 104.487 -8.369  -4.837  1.00 2.80 ? 6  PHE A HD2  1 
ATOM 69  H HE1  . PHE A 1 6  ? 99.452  -8.014  -4.329  1.00 3.30 ? 6  PHE A HE1  1 
ATOM 70  H HE2  . PHE A 1 6  ? 103.022 -9.161  -6.700  1.00 3.30 ? 6  PHE A HE2  1 
ATOM 71  H HZ   . PHE A 1 6  ? 100.487 -8.989  -6.464  1.00 2.96 ? 6  PHE A HZ   1 
ATOM 72  N N    . VAL A 1 7  ? 104.047 -4.761  -0.565  1.00 1.18 ? 7  VAL A N    1 
ATOM 73  C CA   . VAL A 1 7  ? 104.674 -4.259  0.625   1.00 1.18 ? 7  VAL A CA   1 
ATOM 74  C C    . VAL A 1 7  ? 103.954 -4.742  1.855   1.00 1.17 ? 7  VAL A C    1 
ATOM 75  O O    . VAL A 1 7  ? 102.760 -5.026  1.826   1.00 1.11 ? 7  VAL A O    1 
ATOM 76  C CB   . VAL A 1 7  ? 104.692 -2.736  0.647   1.00 0.99 ? 7  VAL A CB   1 
ATOM 77  C CG1  . VAL A 1 7  ? 105.660 -2.207  -0.396  1.00 1.14 ? 7  VAL A CG1  1 
ATOM 78  C CG2  . VAL A 1 7  ? 103.289 -2.194  0.418   1.00 0.76 ? 7  VAL A CG2  1 
ATOM 79  H H    . VAL A 1 7  ? 103.087 -4.638  -0.691  1.00 1.11 ? 7  VAL A H    1 
ATOM 80  H HA   . VAL A 1 7  ? 105.688 -4.619  0.647   1.00 1.39 ? 7  VAL A HA   1 
ATOM 81  H HB   . VAL A 1 7  ? 105.027 -2.423  1.625   1.00 1.00 ? 7  VAL A HB   1 
ATOM 82  H HG11 . VAL A 1 7  ? 106.631 -2.168  -0.007  1.00 1.63 ? 7  VAL A HG11 1 
ATOM 83  H HG12 . VAL A 1 7  ? 105.381 -1.251  -0.691  1.00 1.28 ? 7  VAL A HG12 1 
ATOM 84  H HG13 . VAL A 1 7  ? 105.654 -2.830  -1.238  1.00 1.62 ? 7  VAL A HG13 1 
ATOM 85  H HG21 . VAL A 1 7  ? 102.795 -2.778  -0.297  1.00 1.25 ? 7  VAL A HG21 1 
ATOM 86  H HG22 . VAL A 1 7  ? 103.333 -1.215  0.072   1.00 1.18 ? 7  VAL A HG22 1 
ATOM 87  H HG23 . VAL A 1 7  ? 102.740 -2.208  1.309   1.00 1.18 ? 7  VAL A HG23 1 
ATOM 88  N N    . GLN A 1 8  ? 104.684 -4.831  2.934   1.00 1.28 ? 8  GLN A N    1 
ATOM 89  C CA   . GLN A 1 8  ? 104.117 -5.278  4.170   1.00 1.33 ? 8  GLN A CA   1 
ATOM 90  C C    . GLN A 1 8  ? 104.134 -4.188  5.215   1.00 1.17 ? 8  GLN A C    1 
ATOM 91  O O    . GLN A 1 8  ? 105.194 -3.707  5.613   1.00 1.23 ? 8  GLN A O    1 
ATOM 92  C CB   . GLN A 1 8  ? 104.899 -6.440  4.661   1.00 1.62 ? 8  GLN A CB   1 
ATOM 93  C CG   . GLN A 1 8  ? 104.088 -7.440  5.404   1.00 1.76 ? 8  GLN A CG   1 
ATOM 94  C CD   . GLN A 1 8  ? 104.978 -8.204  6.342   1.00 2.06 ? 8  GLN A CD   1 
ATOM 95  O OE1  . GLN A 1 8  ? 106.089 -7.800  6.542   1.00 2.51 ? 8  GLN A OE1  1 
ATOM 96  N NE2  . GLN A 1 8  ? 104.502 -9.319  6.867   1.00 2.43 ? 8  GLN A NE2  1 
ATOM 97  H H    . GLN A 1 8  ? 105.634 -4.595  2.897   1.00 1.38 ? 8  GLN A H    1 
ATOM 98  H HA   . GLN A 1 8  ? 103.098 -5.583  3.990   1.00 1.29 ? 8  GLN A HA   1 
ATOM 99  H HB2  . GLN A 1 8  ? 105.366 -6.930  3.828   1.00 1.71 ? 8  GLN A HB2  1 
ATOM 100 H HB3  . GLN A 1 8  ? 105.655 -6.068  5.327   1.00 1.69 ? 8  GLN A HB3  1 
ATOM 101 H HG2  . GLN A 1 8  ? 103.323 -6.920  5.946   1.00 1.83 ? 8  GLN A HG2  1 
ATOM 102 H HG3  . GLN A 1 8  ? 103.648 -8.114  4.708   1.00 1.89 ? 8  GLN A HG3  1 
ATOM 103 H HE21 . GLN A 1 8  ? 103.629 -9.549  6.614   1.00 2.72 ? 8  GLN A HE21 1 
ATOM 104 H HE22 . GLN A 1 8  ? 105.060 -9.874  7.472   1.00 2.69 ? 8  GLN A HE22 1 
ATOM 105 N N    . ALA A 1 9  ? 102.958 -3.811  5.654   1.00 1.03 ? 9  ALA A N    1 
ATOM 106 C CA   . ALA A 1 9  ? 102.820 -2.772  6.649   1.00 0.90 ? 9  ALA A CA   1 
ATOM 107 C C    . ALA A 1 9  ? 103.341 -3.217  8.007   1.00 1.06 ? 9  ALA A C    1 
ATOM 108 O O    . ALA A 1 9  ? 103.367 -4.402  8.322   1.00 1.27 ? 9  ALA A O    1 
ATOM 109 C CB   . ALA A 1 9  ? 101.368 -2.345  6.739   1.00 0.80 ? 9  ALA A CB   1 
ATOM 110 H H    . ALA A 1 9  ? 102.155 -4.240  5.297   1.00 1.05 ? 9  ALA A H    1 
ATOM 111 H HA   . ALA A 1 9  ? 103.396 -1.926  6.314   1.00 0.82 ? 9  ALA A HA   1 
ATOM 112 H HB1  . ALA A 1 9  ? 101.252 -1.375  6.366   1.00 1.28 ? 9  ALA A HB1  1 
ATOM 113 H HB2  . ALA A 1 9  ? 101.043 -2.361  7.727   1.00 1.18 ? 9  ALA A HB2  1 
ATOM 114 H HB3  . ALA A 1 9  ? 100.769 -2.999  6.181   1.00 1.28 ? 9  ALA A HB3  1 
ATOM 115 N N    . LEU A 1 10 ? 103.745 -2.256  8.812   1.00 1.01 ? 10 LEU A N    1 
ATOM 116 C CA   . LEU A 1 10 ? 104.249 -2.552  10.145  1.00 1.15 ? 10 LEU A CA   1 
ATOM 117 C C    . LEU A 1 10 ? 103.379 -1.915  11.179  1.00 1.09 ? 10 LEU A C    1 
ATOM 118 O O    . LEU A 1 10 ? 103.711 -1.863  12.369  1.00 1.23 ? 10 LEU A O    1 
ATOM 119 C CB   . LEU A 1 10 ? 105.671 -2.033  10.298  1.00 1.27 ? 10 LEU A CB   1 
ATOM 120 C CG   . LEU A 1 10 ? 105.929 -0.661  9.687   1.00 1.22 ? 10 LEU A CG   1 
ATOM 121 C CD1  . LEU A 1 10 ? 106.484 0.287   10.733  1.00 1.32 ? 10 LEU A CD1  1 
ATOM 122 C CD2  . LEU A 1 10 ? 106.878 -0.783  8.507   1.00 1.34 ? 10 LEU A CD2  1 
ATOM 123 H H    . LEU A 1 10 ? 103.692 -1.324  8.511   1.00 0.90 ? 10 LEU A H    1 
ATOM 124 H HA   . LEU A 1 10 ? 104.246 -3.613  10.280  1.00 1.28 ? 10 LEU A HA   1 
ATOM 125 H HB2  . LEU A 1 10 ? 105.903 -1.985  11.352  1.00 1.34 ? 10 LEU A HB2  1 
ATOM 126 H HB3  . LEU A 1 10 ? 106.333 -2.740  9.827   1.00 1.40 ? 10 LEU A HB3  1 
ATOM 127 H HG   . LEU A 1 10 ? 104.998 -0.255  9.329   1.00 1.06 ? 10 LEU A HG   1 
ATOM 128 H HD11 . LEU A 1 10 ? 105.706 0.814   11.200  1.00 1.63 ? 10 LEU A HD11 1 
ATOM 129 H HD12 . LEU A 1 10 ? 107.130 0.976   10.290  1.00 1.56 ? 10 LEU A HD12 1 
ATOM 130 H HD13 . LEU A 1 10 ? 107.016 -0.250  11.456  1.00 1.80 ? 10 LEU A HD13 1 
ATOM 131 H HD21 . LEU A 1 10 ? 106.424 -0.423  7.648   1.00 1.60 ? 10 LEU A HD21 1 
ATOM 132 H HD22 . LEU A 1 10 ? 107.139 -1.779  8.348   1.00 1.90 ? 10 LEU A HD22 1 
ATOM 133 H HD23 . LEU A 1 10 ? 107.751 -0.237  8.690   1.00 1.54 ? 10 LEU A HD23 1 
ATOM 134 N N    . PHE A 1 11 ? 102.284 -1.377  10.716  1.00 1.02 ? 11 PHE A N    1 
ATOM 135 C CA   . PHE A 1 11 ? 101.381 -0.682  11.568  1.00 1.02 ? 11 PHE A CA   1 
ATOM 136 C C    . PHE A 1 11 ? 100.033 -0.581  10.963  1.00 1.02 ? 11 PHE A C    1 
ATOM 137 O O    . PHE A 1 11 ? 99.885  -0.530  9.757   1.00 1.13 ? 11 PHE A O    1 
ATOM 138 C CB   . PHE A 1 11 ? 101.906 0.663   11.741  1.00 1.00 ? 11 PHE A CB   1 
ATOM 139 C CG   . PHE A 1 11 ? 101.874 1.091   13.198  1.00 1.26 ? 11 PHE A CG   1 
ATOM 140 C CD1  . PHE A 1 11 ? 101.877 0.123   14.191  1.00 2.00 ? 11 PHE A CD1  1 
ATOM 141 C CD2  . PHE A 1 11 ? 101.838 2.417   13.432  1.00 1.88 ? 11 PHE A CD2  1 
ATOM 142 C CE1  . PHE A 1 11 ? 101.894 0.551   15.557  1.00 2.57 ? 11 PHE A CE1  1 
ATOM 143 C CE2  . PHE A 1 11 ? 101.874 2.874   14.774  1.00 2.47 ? 11 PHE A CE2  1 
ATOM 144 C CZ   . PHE A 1 11 ? 101.859 1.923   15.803  1.00 2.60 ? 11 PHE A CZ   1 
ATOM 145 H H    . PHE A 1 11 ? 102.088 -1.413  9.761   1.00 1.06 ? 11 PHE A H    1 
ATOM 146 H HA   . PHE A 1 11 ? 101.341 -1.182  12.505  1.00 1.13 ? 11 PHE A HA   1 
ATOM 147 H HB2  . PHE A 1 11 ? 102.957 0.692   11.415  1.00 1.38 ? 11 PHE A HB2  1 
ATOM 148 H HB3  . PHE A 1 11 ? 101.365 1.369   11.168  1.00 1.10 ? 11 PHE A HB3  1 
ATOM 149 H HD1  . PHE A 1 11 ? 101.875 -0.943  13.986  1.00 2.55 ? 11 PHE A HD1  1 
ATOM 150 H HD2  . PHE A 1 11 ? 101.798 3.136   12.642  1.00 2.39 ? 11 PHE A HD2  1 
ATOM 151 H HE1  . PHE A 1 11 ? 101.886 -0.212  16.357  1.00 3.34 ? 11 PHE A HE1  1 
ATOM 152 H HE2  . PHE A 1 11 ? 101.887 3.957   14.948  1.00 3.19 ? 11 PHE A HE2  1 
ATOM 153 H HZ   . PHE A 1 11 ? 101.858 2.278   16.850  1.00 3.19 ? 11 PHE A HZ   1 
ATOM 154 N N    . ASP A 1 12 ? 99.024  -0.518  11.817  1.00 1.15 ? 12 ASP A N    1 
ATOM 155 C CA   . ASP A 1 12 ? 97.676  -0.388  11.339  1.00 1.26 ? 12 ASP A CA   1 
ATOM 156 C C    . ASP A 1 12 ? 97.393  1.046   10.949  1.00 1.23 ? 12 ASP A C    1 
ATOM 157 O O    . ASP A 1 12 ? 97.846  1.987   11.605  1.00 1.22 ? 12 ASP A O    1 
ATOM 158 C CB   . ASP A 1 12 ? 96.685  -0.831  12.389  1.00 1.49 ? 12 ASP A CB   1 
ATOM 159 C CG   . ASP A 1 12 ? 96.894  -2.284  12.796  1.00 1.57 ? 12 ASP A CG   1 
ATOM 160 O OD1  . ASP A 1 12 ? 97.038  -3.124  11.926  1.00 1.68 ? 12 ASP A OD1  1 
ATOM 161 O OD2  . ASP A 1 12 ? 96.910  -2.582  13.978  1.00 2.08 ? 12 ASP A OD2  1 
ATOM 162 H H    . ASP A 1 12 ? 99.188  -0.543  12.780  1.00 1.33 ? 12 ASP A H    1 
ATOM 163 H HA   . ASP A 1 12 ? 97.585  -1.017  10.467  1.00 1.25 ? 12 ASP A HA   1 
ATOM 164 H HB2  . ASP A 1 12 ? 96.783  -0.192  13.256  1.00 1.56 ? 12 ASP A HB2  1 
ATOM 165 H HB3  . ASP A 1 12 ? 95.694  -0.726  11.987  1.00 1.68 ? 12 ASP A HB3  1 
ATOM 166 N N    . PHE A 1 13 ? 96.640  1.201   9.881   1.00 1.26 ? 13 PHE A N    1 
ATOM 167 C CA   . PHE A 1 13 ? 96.287  2.506   9.395   1.00 1.32 ? 13 PHE A CA   1 
ATOM 168 C C    . PHE A 1 13 ? 94.813  2.618   9.107   1.00 1.53 ? 13 PHE A C    1 
ATOM 169 O O    . PHE A 1 13 ? 94.286  1.975   8.201   1.00 1.54 ? 13 PHE A O    1 
ATOM 170 C CB   . PHE A 1 13 ? 97.044  2.820   8.144   1.00 1.17 ? 13 PHE A CB   1 
ATOM 171 C CG   . PHE A 1 13 ? 97.125  4.270   7.905   1.00 1.26 ? 13 PHE A CG   1 
ATOM 172 C CD1  . PHE A 1 13 ? 97.761  5.095   8.879   1.00 1.73 ? 13 PHE A CD1  1 
ATOM 173 C CD2  . PHE A 1 13 ? 96.570  4.837   6.732   1.00 1.80 ? 13 PHE A CD2  1 
ATOM 174 C CE1  . PHE A 1 13 ? 97.870  6.461   8.673   1.00 1.91 ? 13 PHE A CE1  1 
ATOM 175 C CE2  . PHE A 1 13 ? 96.665  6.207   6.509   1.00 1.93 ? 13 PHE A CE2  1 
ATOM 176 C CZ   . PHE A 1 13 ? 97.316  7.042   7.489   1.00 1.65 ? 13 PHE A CZ   1 
ATOM 177 H H    . PHE A 1 13 ? 96.315  0.411   9.407   1.00 1.29 ? 13 PHE A H    1 
ATOM 178 H HA   . PHE A 1 13 ? 96.549  3.232   10.153  1.00 1.36 ? 13 PHE A HA   1 
ATOM 179 H HB2  . PHE A 1 13 ? 98.049  2.434   8.227   1.00 1.08 ? 13 PHE A HB2  1 
ATOM 180 H HB3  . PHE A 1 13 ? 96.543  2.362   7.303   1.00 1.20 ? 13 PHE A HB3  1 
ATOM 181 H HD1  . PHE A 1 13 ? 98.181  4.627   9.801   1.00 2.37 ? 13 PHE A HD1  1 
ATOM 182 H HD2  . PHE A 1 13 ? 96.060  4.171   5.988   1.00 2.48 ? 13 PHE A HD2  1 
ATOM 183 H HE1  . PHE A 1 13 ? 98.371  7.092   9.434   1.00 2.63 ? 13 PHE A HE1  1 
ATOM 184 H HE2  . PHE A 1 13 ? 96.238  6.643   5.594   1.00 2.63 ? 13 PHE A HE2  1 
ATOM 185 H HZ   . PHE A 1 13 ? 97.401  8.119   7.318   1.00 1.85 ? 13 PHE A HZ   1 
ATOM 186 N N    . ASN A 1 14 ? 94.167  3.444   9.886   1.00 1.71 ? 14 ASN A N    1 
ATOM 187 C CA   . ASN A 1 14 ? 92.749  3.671   9.766   1.00 1.94 ? 14 ASN A CA   1 
ATOM 188 C C    . ASN A 1 14 ? 92.444  5.025   9.237   1.00 2.04 ? 14 ASN A C    1 
ATOM 189 O O    . ASN A 1 14 ? 92.109  5.934   9.997   1.00 2.17 ? 14 ASN A O    1 
ATOM 190 C CB   . ASN A 1 14 ? 92.180  3.636   11.110  1.00 2.10 ? 14 ASN A CB   1 
ATOM 191 C CG   . ASN A 1 14 ? 91.025  2.692   11.269  1.00 2.66 ? 14 ASN A CG   1 
ATOM 192 O OD1  . ASN A 1 14 ? 90.088  2.680   10.468  1.00 3.18 ? 14 ASN A OD1  1 
ATOM 193 N ND2  . ASN A 1 14 ? 91.251  1.766   12.201  1.00 3.20 ? 14 ASN A ND2  1 
ATOM 194 H H    . ASN A 1 14 ? 94.662  3.922   10.582  1.00 1.70 ? 14 ASN A H    1 
ATOM 195 H HA   . ASN A 1 14 ? 92.304  2.906   9.159   1.00 1.94 ? 14 ASN A HA   1 
ATOM 196 H HB2  . ASN A 1 14 ? 92.930  3.304   11.743  1.00 2.20 ? 14 ASN A HB2  1 
ATOM 197 H HB3  . ASN A 1 14 ? 91.931  4.621   11.393  1.00 2.34 ? 14 ASN A HB3  1 
ATOM 198 H HD21 . ASN A 1 14 ? 92.097  1.799   12.622  1.00 3.25 ? 14 ASN A HD21 1 
ATOM 199 H HD22 . ASN A 1 14 ? 90.593  1.083   12.408  1.00 3.82 ? 14 ASN A HD22 1 
ATOM 200 N N    . PRO A 1 15 ? 92.513  5.191   7.963   1.00 2.00 ? 15 PRO A N    1 
ATOM 201 C CA   . PRO A 1 15 ? 92.203  6.446   7.381   1.00 2.12 ? 15 PRO A CA   1 
ATOM 202 C C    . PRO A 1 15 ? 90.724  6.627   7.252   1.00 2.38 ? 15 PRO A C    1 
ATOM 203 O O    . PRO A 1 15 ? 90.022  5.866   6.598   1.00 2.42 ? 15 PRO A O    1 
ATOM 204 C CB   . PRO A 1 15 ? 92.818  6.375   6.023   1.00 2.00 ? 15 PRO A CB   1 
ATOM 205 C CG   . PRO A 1 15 ? 92.739  4.928   5.686   1.00 1.90 ? 15 PRO A CG   1 
ATOM 206 C CD   . PRO A 1 15 ? 92.866  4.183   6.980   1.00 1.85 ? 15 PRO A CD   1 
ATOM 207 H HA   . PRO A 1 15 ? 92.634  7.273   7.946   1.00 2.13 ? 15 PRO A HA   1 
ATOM 208 H HB2  . PRO A 1 15 ? 92.234  6.987   5.348   1.00 2.13 ? 15 PRO A HB2  1 
ATOM 209 H HB3  . PRO A 1 15 ? 93.833  6.732   6.067   1.00 1.89 ? 15 PRO A HB3  1 
ATOM 210 H HG2  . PRO A 1 15 ? 91.786  4.709   5.240   1.00 2.03 ? 15 PRO A HG2  1 
ATOM 211 H HG3  . PRO A 1 15 ? 93.541  4.664   5.025   1.00 1.75 ? 15 PRO A HG3  1 
ATOM 212 H HD2  . PRO A 1 15 ? 92.169  3.356   7.021   1.00 1.93 ? 15 PRO A HD2  1 
ATOM 213 H HD3  . PRO A 1 15 ? 93.873  3.842   7.121   1.00 1.67 ? 15 PRO A HD3  1 
ATOM 214 N N    . GLN A 1 16 ? 90.284  7.627   7.879   1.00 2.55 ? 16 GLN A N    1 
ATOM 215 C CA   . GLN A 1 16 ? 88.911  8.061   7.938   1.00 2.81 ? 16 GLN A CA   1 
ATOM 216 C C    . GLN A 1 16 ? 88.517  8.848   6.708   1.00 2.92 ? 16 GLN A C    1 
ATOM 217 O O    . GLN A 1 16 ? 87.362  9.191   6.525   1.00 3.18 ? 16 GLN A O    1 
ATOM 218 C CB   . GLN A 1 16 ? 89.006  9.173   8.952   1.00 2.94 ? 16 GLN A CB   1 
ATOM 219 C CG   . GLN A 1 16 ? 87.696  9.551   9.724   1.00 3.78 ? 16 GLN A CG   1 
ATOM 220 C CD   . GLN A 1 16 ? 87.665  9.150   11.237  1.00 4.22 ? 16 GLN A CD   1 
ATOM 221 O OE1  . GLN A 1 16 ? 87.592  10.047  12.149  1.00 4.47 ? 16 GLN A OE1  1 
ATOM 222 N NE2  . GLN A 1 16 ? 87.809  7.811   11.606  1.00 4.75 ? 16 GLN A NE2  1 
ATOM 223 H H    . GLN A 1 16 ? 90.943  8.172   8.362   1.00 2.52 ? 16 GLN A H    1 
ATOM 224 H HA   . GLN A 1 16 ? 88.210  7.267   8.236   1.00 2.84 ? 16 GLN A HA   1 
ATOM 225 H HB2  . GLN A 1 16 ? 89.791  8.934   9.608   1.00 2.86 ? 16 GLN A HB2  1 
ATOM 226 H HB3  . GLN A 1 16 ? 89.329  9.990   8.343   1.00 3.00 ? 16 GLN A HB3  1 
ATOM 227 H HG2  . GLN A 1 16 ? 87.544  10.689  9.673   1.00 4.18 ? 16 GLN A HG2  1 
ATOM 228 H HG3  . GLN A 1 16 ? 86.883  9.030   9.187   1.00 4.18 ? 16 GLN A HG3  1 
ATOM 229 H HE21 . GLN A 1 16 ? 87.945  7.061   10.954  1.00 4.87 ? 16 GLN A HE21 1 
ATOM 230 H HE22 . GLN A 1 16 ? 87.749  7.626   12.586  1.00 5.22 ? 16 GLN A HE22 1 
ATOM 231 N N    . GLU A 1 17 ? 89.525  9.300   6.005   1.00 2.79 ? 17 GLU A N    1 
ATOM 232 C CA   . GLU A 1 17 ? 89.315  10.215  4.935   1.00 2.90 ? 17 GLU A CA   1 
ATOM 233 C C    . GLU A 1 17 ? 89.602  9.530   3.655   1.00 2.77 ? 17 GLU A C    1 
ATOM 234 O O    . GLU A 1 17 ? 90.092  8.413   3.670   1.00 2.61 ? 17 GLU A O    1 
ATOM 235 C CB   . GLU A 1 17 ? 90.223  11.421  5.118   1.00 2.91 ? 17 GLU A CB   1 
ATOM 236 C CG   . GLU A 1 17 ? 90.065  12.060  6.470   1.00 3.02 ? 17 GLU A CG   1 
ATOM 237 C CD   . GLU A 1 17 ? 90.510  13.532  6.473   1.00 3.24 ? 17 GLU A CD   1 
ATOM 238 O OE1  . GLU A 1 17 ? 90.819  14.040  5.421   1.00 3.70 ? 17 GLU A OE1  1 
ATOM 239 O OE2  . GLU A 1 17 ? 90.570  14.172  7.516   1.00 3.46 ? 17 GLU A OE2  1 
ATOM 240 H H    . GLU A 1 17 ? 90.442  9.087   6.270   1.00 2.68 ? 17 GLU A H    1 
ATOM 241 H HA   . GLU A 1 17 ? 88.286  10.541  4.963   1.00 3.09 ? 17 GLU A HA   1 
ATOM 242 H HB2  . GLU A 1 17 ? 91.246  11.123  5.004   1.00 2.73 ? 17 GLU A HB2  1 
ATOM 243 H HB3  . GLU A 1 17 ? 89.977  12.162  4.387   1.00 3.02 ? 17 GLU A HB3  1 
ATOM 244 H HG2  . GLU A 1 17 ? 89.039  11.980  6.735   1.00 3.27 ? 17 GLU A HG2  1 
ATOM 245 H HG3  . GLU A 1 17 ? 90.639  11.513  7.167   1.00 3.07 ? 17 GLU A HG3  1 
ATOM 246 N N    . SER A 1 18 ? 89.307  10.177  2.554   1.00 2.86 ? 18 SER A N    1 
ATOM 247 C CA   . SER A 1 18 ? 89.556  9.555   1.279   1.00 2.76 ? 18 SER A CA   1 
ATOM 248 C C    . SER A 1 18 ? 90.936  9.878   0.773   1.00 2.59 ? 18 SER A C    1 
ATOM 249 O O    . SER A 1 18 ? 91.479  10.946  1.049   1.00 2.65 ? 18 SER A O    1 
ATOM 250 C CB   . SER A 1 18 ? 88.534  9.989   0.227   1.00 2.96 ? 18 SER A CB   1 
ATOM 251 O OG   . SER A 1 18 ? 87.682  11.040  0.731   1.00 3.33 ? 18 SER A OG   1 
ATOM 252 H H    . SER A 1 18 ? 88.919  11.075  2.598   1.00 3.00 ? 18 SER A H    1 
ATOM 253 H HA   . SER A 1 18 ? 89.485  8.489   1.426   1.00 2.67 ? 18 SER A HA   1 
ATOM 254 H HB2  . SER A 1 18 ? 89.056  10.319  -0.645  1.00 3.22 ? 18 SER A HB2  1 
ATOM 255 H HB3  . SER A 1 18 ? 87.944  9.164   -0.062  1.00 3.00 ? 18 SER A HB3  1 
ATOM 256 H HG   . SER A 1 18 ? 87.165  11.440  0.023   1.00 3.67 ? 18 SER A HG   1 
ATOM 257 N N    . GLY A 1 19 ? 91.485  8.954   0.019   1.00 2.42 ? 19 GLY A N    1 
ATOM 258 C CA   . GLY A 1 19 ? 92.792  9.151   -0.538  1.00 2.28 ? 19 GLY A CA   1 
ATOM 259 C C    . GLY A 1 19 ? 93.789  8.227   0.095   1.00 2.03 ? 19 GLY A C    1 
ATOM 260 O O    . GLY A 1 19 ? 94.710  7.750   -0.558  1.00 1.90 ? 19 GLY A O    1 
ATOM 261 H H    . GLY A 1 19 ? 90.992  8.127   -0.165  1.00 2.41 ? 19 GLY A H    1 
ATOM 262 H HA2  . GLY A 1 19 ? 92.750  8.964   -1.603  1.00 2.27 ? 19 GLY A HA2  1 
ATOM 263 H HA3  . GLY A 1 19 ? 93.095  10.173  -0.365  1.00 2.39 ? 19 GLY A HA3  1 
ATOM 264 N N    . GLU A 1 20 ? 93.592  7.958   1.375   1.00 1.98 ? 20 GLU A N    1 
ATOM 265 C CA   . GLU A 1 20 ? 94.479  7.070   2.096   1.00 1.75 ? 20 GLU A CA   1 
ATOM 266 C C    . GLU A 1 20 ? 93.942  5.665   2.105   1.00 1.67 ? 20 GLU A C    1 
ATOM 267 O O    . GLU A 1 20 ? 92.762  5.434   2.364   1.00 1.84 ? 20 GLU A O    1 
ATOM 268 C CB   . GLU A 1 20 ? 94.676  7.554   3.518   1.00 1.82 ? 20 GLU A CB   1 
ATOM 269 C CG   . GLU A 1 20 ? 95.279  8.937   3.581   1.00 1.98 ? 20 GLU A CG   1 
ATOM 270 C CD   . GLU A 1 20 ? 95.020  9.622   4.910   1.00 2.17 ? 20 GLU A CD   1 
ATOM 271 O OE1  . GLU A 1 20 ? 93.989  10.244  5.062   1.00 2.14 ? 20 GLU A OE1  1 
ATOM 272 O OE2  . GLU A 1 20 ? 95.838  9.526   5.803   1.00 2.82 ? 20 GLU A OE2  1 
ATOM 273 H H    . GLU A 1 20 ? 92.828  8.357   1.842   1.00 2.11 ? 20 GLU A H    1 
ATOM 274 H HA   . GLU A 1 20 ? 95.427  7.075   1.592   1.00 1.63 ? 20 GLU A HA   1 
ATOM 275 H HB2  . GLU A 1 20 ? 93.722  7.570   4.018   1.00 1.99 ? 20 GLU A HB2  1 
ATOM 276 H HB3  . GLU A 1 20 ? 95.332  6.870   4.024   1.00 1.63 ? 20 GLU A HB3  1 
ATOM 277 H HG2  . GLU A 1 20 ? 96.340  8.860   3.415   1.00 1.89 ? 20 GLU A HG2  1 
ATOM 278 H HG3  . GLU A 1 20 ? 94.847  9.531   2.795   1.00 2.20 ? 20 GLU A HG3  1 
ATOM 279 N N    . LEU A 1 21 ? 94.812  4.727   1.819   1.00 1.43 ? 21 LEU A N    1 
ATOM 280 C CA   . LEU A 1 21 ? 94.423  3.344   1.790   1.00 1.38 ? 21 LEU A CA   1 
ATOM 281 C C    . LEU A 1 21 ? 94.335  2.795   3.203   1.00 1.40 ? 21 LEU A C    1 
ATOM 282 O O    . LEU A 1 21 ? 95.097  3.194   4.084   1.00 1.35 ? 21 LEU A O    1 
ATOM 283 C CB   . LEU A 1 21 ? 95.404  2.540   0.936   1.00 1.14 ? 21 LEU A CB   1 
ATOM 284 C CG   . LEU A 1 21 ? 95.982  1.293   1.581   1.00 1.02 ? 21 LEU A CG   1 
ATOM 285 C CD1  . LEU A 1 21 ? 94.986  0.153   1.500   1.00 1.17 ? 21 LEU A CD1  1 
ATOM 286 C CD2  . LEU A 1 21 ? 97.285  0.918   0.907   1.00 0.79 ? 21 LEU A CD2  1 
ATOM 287 H H    . LEU A 1 21 ? 95.741  4.970   1.618   1.00 1.32 ? 21 LEU A H    1 
ATOM 288 H HA   . LEU A 1 21 ? 93.448  3.296   1.330   1.00 1.52 ? 21 LEU A HA   1 
ATOM 289 H HB2  . LEU A 1 21 ? 94.886  2.240   0.040   1.00 1.19 ? 21 LEU A HB2  1 
ATOM 290 H HB3  . LEU A 1 21 ? 96.215  3.190   0.662   1.00 1.06 ? 21 LEU A HB3  1 
ATOM 291 H HG   . LEU A 1 21 ? 96.183  1.492   2.617   1.00 1.02 ? 21 LEU A HG   1 
ATOM 292 H HD11 . LEU A 1 21 ? 94.735  -0.175  2.462   1.00 1.44 ? 21 LEU A HD11 1 
ATOM 293 H HD12 . LEU A 1 21 ? 95.387  -0.646  0.971   1.00 1.46 ? 21 LEU A HD12 1 
ATOM 294 H HD13 . LEU A 1 21 ? 94.113  0.469   1.011   1.00 1.70 ? 21 LEU A HD13 1 
ATOM 295 H HD21 . LEU A 1 21 ? 97.128  0.053   0.286   1.00 1.22 ? 21 LEU A HD21 1 
ATOM 296 H HD22 . LEU A 1 21 ? 98.030  0.695   1.649   1.00 1.31 ? 21 LEU A HD22 1 
ATOM 297 H HD23 . LEU A 1 21 ? 97.631  1.736   0.299   1.00 1.24 ? 21 LEU A HD23 1 
ATOM 298 N N    . ALA A 1 22 ? 93.409  1.879   3.411   1.00 1.51 ? 22 ALA A N    1 
ATOM 299 C CA   . ALA A 1 22 ? 93.229  1.273   4.715   1.00 1.57 ? 22 ALA A CA   1 
ATOM 300 C C    . ALA A 1 22 ? 93.952  -0.050  4.783   1.00 1.45 ? 22 ALA A C    1 
ATOM 301 O O    . ALA A 1 22 ? 93.586  -1.008  4.103   1.00 1.50 ? 22 ALA A O    1 
ATOM 302 C CB   . ALA A 1 22 ? 91.760  1.079   5.013   1.00 1.84 ? 22 ALA A CB   1 
ATOM 303 H H    . ALA A 1 22 ? 92.836  1.599   2.668   1.00 1.56 ? 22 ALA A H    1 
ATOM 304 H HA   . ALA A 1 22 ? 93.644  1.941   5.454   1.00 1.55 ? 22 ALA A HA   1 
ATOM 305 H HB1  . ALA A 1 22 ? 91.328  0.464   4.285   1.00 2.08 ? 22 ALA A HB1  1 
ATOM 306 H HB2  . ALA A 1 22 ? 91.264  1.993   5.011   1.00 2.16 ? 22 ALA A HB2  1 
ATOM 307 H HB3  . ALA A 1 22 ? 91.642  0.635   5.951   1.00 2.13 ? 22 ALA A HB3  1 
ATOM 308 N N    . PHE A 1 23 ? 94.983  -0.101  5.592   1.00 1.32 ? 23 PHE A N    1 
ATOM 309 C CA   . PHE A 1 23 ? 95.757  -1.317  5.724   1.00 1.24 ? 23 PHE A CA   1 
ATOM 310 C C    . PHE A 1 23 ? 96.081  -1.595  7.180   1.00 1.28 ? 23 PHE A C    1 
ATOM 311 O O    . PHE A 1 23 ? 95.915  -0.747  8.047   1.00 1.33 ? 23 PHE A O    1 
ATOM 312 C CB   . PHE A 1 23 ? 97.060  -1.165  4.954   1.00 1.03 ? 23 PHE A CB   1 
ATOM 313 C CG   . PHE A 1 23 ? 97.823  0.048   5.346   1.00 0.89 ? 23 PHE A CG   1 
ATOM 314 C CD1  . PHE A 1 23 ? 97.428  1.336   4.890   1.00 1.52 ? 23 PHE A CD1  1 
ATOM 315 C CD2  . PHE A 1 23 ? 98.964  -0.097  6.180   1.00 1.12 ? 23 PHE A CD2  1 
ATOM 316 C CE1  . PHE A 1 23 ? 98.163  2.457   5.260   1.00 1.46 ? 23 PHE A CE1  1 
ATOM 317 C CE2  . PHE A 1 23 ? 99.702  1.008   6.560   1.00 1.17 ? 23 PHE A CE2  1 
ATOM 318 C CZ   . PHE A 1 23 ? 99.313  2.300   6.103   1.00 0.84 ? 23 PHE A CZ   1 
ATOM 319 H H    . PHE A 1 23 ? 95.236  0.696   6.102   1.00 1.30 ? 23 PHE A H    1 
ATOM 320 H HA   . PHE A 1 23 ? 95.187  -2.130  5.307   1.00 1.36 ? 23 PHE A HA   1 
ATOM 321 H HB2  . PHE A 1 23 ? 97.689  -2.017  5.155   1.00 1.02 ? 23 PHE A HB2  1 
ATOM 322 H HB3  . PHE A 1 23 ? 96.852  -1.111  3.897   1.00 1.03 ? 23 PHE A HB3  1 
ATOM 323 H HD1  . PHE A 1 23 ? 96.529  1.446   4.243   1.00 2.29 ? 23 PHE A HD1  1 
ATOM 324 H HD2  . PHE A 1 23 ? 99.258  -1.106  6.534   1.00 1.77 ? 23 PHE A HD2  1 
ATOM 325 H HE1  . PHE A 1 23 ? 97.856  3.453   4.899   1.00 2.17 ? 23 PHE A HE1  1 
ATOM 326 H HE2  . PHE A 1 23 ? 100.587 0.876   7.208   1.00 1.88 ? 23 PHE A HE2  1 
ATOM 327 H HZ   . PHE A 1 23 ? 99.898  3.172   6.396   1.00 0.90 ? 23 PHE A HZ   1 
ATOM 328 N N    . LYS A 1 24 ? 96.548  -2.772  7.454   1.00 1.34 ? 24 LYS A N    1 
ATOM 329 C CA   . LYS A 1 24 ? 96.884  -3.124  8.776   1.00 1.42 ? 24 LYS A CA   1 
ATOM 330 C C    . LYS A 1 24 ? 98.298  -3.568  8.913   1.00 1.29 ? 24 LYS A C    1 
ATOM 331 O O    . LYS A 1 24 ? 99.100  -3.379  8.006   1.00 1.16 ? 24 LYS A O    1 
ATOM 332 C CB   . LYS A 1 24 ? 96.096  -4.224  9.113   1.00 1.71 ? 24 LYS A CB   1 
ATOM 333 C CG   . LYS A 1 24 ? 94.708  -4.311  8.675   1.00 1.94 ? 24 LYS A CG   1 
ATOM 334 C CD   . LYS A 1 24 ? 94.826  -5.679  9.307   1.00 2.23 ? 24 LYS A CD   1 
ATOM 335 C CE   . LYS A 1 24 ? 93.651  -6.653  9.339   1.00 2.57 ? 24 LYS A CE   1 
ATOM 336 N NZ   . LYS A 1 24 ? 92.688  -6.087  10.396  1.00 3.29 ? 24 LYS A NZ   1 
ATOM 337 H H    . LYS A 1 24 ? 96.659  -3.457  6.740   1.00 1.38 ? 24 LYS A H    1 
ATOM 338 H HA   . LYS A 1 24 ? 96.683  -2.338  9.475   1.00 1.41 ? 24 LYS A HA   1 
ATOM 339 H HB2  . LYS A 1 24 ? 96.591  -5.078  8.761   1.00 1.98 ? 24 LYS A HB2  1 
ATOM 340 H HB3  . LYS A 1 24 ? 96.051  -4.296  10.165  1.00 2.24 ? 24 LYS A HB3  1 
ATOM 341 H HG2  . LYS A 1 24 ? 94.088  -3.626  9.214   1.00 2.50 ? 24 LYS A HG2  1 
ATOM 342 H HG3  . LYS A 1 24 ? 94.549  -4.317  7.603   1.00 2.16 ? 24 LYS A HG3  1 
ATOM 343 H HD2  . LYS A 1 24 ? 95.722  -6.139  8.862   1.00 2.46 ? 24 LYS A HD2  1 
ATOM 344 H HD3  . LYS A 1 24 ? 95.091  -5.469  10.352  1.00 2.77 ? 24 LYS A HD3  1 
ATOM 345 H HE2  . LYS A 1 24 ? 93.234  -6.788  8.332   1.00 2.69 ? 24 LYS A HE2  1 
ATOM 346 H HE3  . LYS A 1 24 ? 93.997  -7.638  9.698   1.00 2.95 ? 24 LYS A HE3  1 
ATOM 347 H HZ1  . LYS A 1 24 ? 92.341  -6.756  11.086  1.00 3.58 ? 24 LYS A HZ1  1 
ATOM 348 H HZ2  . LYS A 1 24 ? 91.848  -5.702  9.967   1.00 3.59 ? 24 LYS A HZ2  1 
ATOM 349 H HZ3  . LYS A 1 24 ? 93.171  -5.326  10.919  1.00 3.77 ? 24 LYS A HZ3  1 
ATOM 350 N N    . ARG A 1 25 ? 98.601  -4.165  10.024  1.00 1.39 ? 25 ARG A N    1 
ATOM 351 C CA   . ARG A 1 25 ? 99.912  -4.611  10.242  1.00 1.37 ? 25 ARG A CA   1 
ATOM 352 C C    . ARG A 1 25 ? 100.243 -5.850  9.462   1.00 1.51 ? 25 ARG A C    1 
ATOM 353 O O    . ARG A 1 25 ? 99.449  -6.787  9.397   1.00 1.69 ? 25 ARG A O    1 
ATOM 354 C CB   . ARG A 1 25 ? 100.106 -4.834  11.680  1.00 1.48 ? 25 ARG A CB   1 
ATOM 355 C CG   . ARG A 1 25 ? 101.080 -3.879  12.227  1.00 1.39 ? 25 ARG A CG   1 
ATOM 356 C CD   . ARG A 1 25 ? 100.976 -4.105  13.628  1.00 1.60 ? 25 ARG A CD   1 
ATOM 357 N NE   . ARG A 1 25 ? 102.059 -3.766  14.310  1.00 2.00 ? 25 ARG A NE   1 
ATOM 358 C CZ   . ARG A 1 25 ? 102.394 -4.511  15.218  1.00 2.46 ? 25 ARG A CZ   1 
ATOM 359 N NH1  . ARG A 1 25 ? 101.601 -5.645  15.299  1.00 2.82 ? 25 ARG A NH1  1 
ATOM 360 N NH2  . ARG A 1 25 ? 103.505 -4.292  16.023  1.00 3.20 ? 25 ARG A NH2  1 
ATOM 361 H H    . ARG A 1 25 ? 97.924  -4.299  10.726  1.00 1.51 ? 25 ARG A H    1 
ATOM 362 H HA   . ARG A 1 25 ? 100.578 -3.814  9.936   1.00 1.21 ? 25 ARG A HA   1 
ATOM 363 H HB2  . ARG A 1 25 ? 99.161  -4.711  12.184  1.00 1.54 ? 25 ARG A HB2  1 
ATOM 364 H HB3  . ARG A 1 25 ? 100.481 -5.836  11.843  1.00 1.64 ? 25 ARG A HB3  1 
ATOM 365 H HG2  . ARG A 1 25 ? 102.066 -4.123  11.911  1.00 1.43 ? 25 ARG A HG2  1 
ATOM 366 H HG3  . ARG A 1 25 ? 100.797 -2.881  11.955  1.00 1.42 ? 25 ARG A HG3  1 
ATOM 367 H HD2  . ARG A 1 25 ? 100.079 -3.744  14.068  1.00 2.01 ? 25 ARG A HD2  1 
ATOM 368 H HD3  . ARG A 1 25 ? 100.939 -5.100  13.721  1.00 1.92 ? 25 ARG A HD3  1 
ATOM 369 H HE   . ARG A 1 25 ? 102.568 -2.980  14.152  1.00 2.48 ? 25 ARG A HE   1 
ATOM 370 H HH11 . ARG A 1 25 ? 100.833 -5.806  14.601  1.00 2.70 ? 25 ARG A HH11 1 
ATOM 371 H HH12 . ARG A 1 25 ? 101.593 -6.091  16.097  1.00 3.56 ? 25 ARG A HH12 1 
ATOM 372 H HH21 . ARG A 1 25 ? 104.165 -3.523  15.857  1.00 3.47 ? 25 ARG A HH21 1 
ATOM 373 H HH22 . ARG A 1 25 ? 103.608 -4.802  16.849  1.00 3.74 ? 25 ARG A HH22 1 
ATOM 374 N N    . GLY A 1 26 ? 101.426 -5.836  8.890   1.00 1.47 ? 26 GLY A N    1 
ATOM 375 C CA   . GLY A 1 26 ? 101.893 -6.958  8.112   1.00 1.64 ? 26 GLY A CA   1 
ATOM 376 C C    . GLY A 1 26 ? 100.985 -7.262  6.941   1.00 1.64 ? 26 GLY A C    1 
ATOM 377 O O    . GLY A 1 26 ? 100.984 -8.367  6.407   1.00 1.83 ? 26 GLY A O    1 
ATOM 378 H H    . GLY A 1 26 ? 101.996 -5.048  9.003   1.00 1.35 ? 26 GLY A H    1 
ATOM 379 H HA2  . GLY A 1 26 ? 102.883 -6.737  7.743   1.00 1.61 ? 26 GLY A HA2  1 
ATOM 380 H HA3  . GLY A 1 26 ? 101.935 -7.824  8.748   1.00 1.83 ? 26 GLY A HA3  1 
ATOM 381 N N    . ASP A 1 27 ? 100.199 -6.282  6.566   1.00 1.47 ? 27 ASP A N    1 
ATOM 382 C CA   . ASP A 1 27 ? 99.258  -6.417  5.492   1.00 1.51 ? 27 ASP A CA   1 
ATOM 383 C C    . ASP A 1 27 ? 99.940  -6.203  4.140   1.00 1.39 ? 27 ASP A C    1 
ATOM 384 O O    . ASP A 1 27 ? 100.479 -5.133  3.858   1.00 1.20 ? 27 ASP A O    1 
ATOM 385 C CB   . ASP A 1 27 ? 98.145  -5.418  5.770   1.00 1.43 ? 27 ASP A CB   1 
ATOM 386 C CG   . ASP A 1 27 ? 97.319  -5.048  4.560   1.00 1.75 ? 27 ASP A CG   1 
ATOM 387 O OD1  . ASP A 1 27 ? 97.483  -5.682  3.531   1.00 1.86 ? 27 ASP A OD1  1 
ATOM 388 O OD2  . ASP A 1 27 ? 96.523  -4.113  4.643   1.00 2.33 ? 27 ASP A OD2  1 
ATOM 389 H H    . ASP A 1 27 ? 100.237 -5.433  7.042   1.00 1.34 ? 27 ASP A H    1 
ATOM 390 H HA   . ASP A 1 27 ? 98.852  -7.412  5.528   1.00 1.73 ? 27 ASP A HA   1 
ATOM 391 H HB2  . ASP A 1 27 ? 97.501  -5.829  6.521   1.00 1.69 ? 27 ASP A HB2  1 
ATOM 392 H HB3  . ASP A 1 27 ? 98.583  -4.532  6.164   1.00 1.48 ? 27 ASP A HB3  1 
ATOM 393 N N    . VAL A 1 28 ? 99.924  -7.246  3.315   1.00 1.52 ? 28 VAL A N    1 
ATOM 394 C CA   . VAL A 1 28 ? 100.545 -7.195  2.006   1.00 1.46 ? 28 VAL A CA   1 
ATOM 395 C C    . VAL A 1 28 ? 99.761  -6.315  1.067   1.00 1.29 ? 28 VAL A C    1 
ATOM 396 O O    . VAL A 1 28 ? 98.725  -6.716  0.538   1.00 1.39 ? 28 VAL A O    1 
ATOM 397 C CB   . VAL A 1 28 ? 100.659 -8.589  1.387   1.00 1.69 ? 28 VAL A CB   1 
ATOM 398 C CG1  . VAL A 1 28 ? 101.465 -8.529  0.096   1.00 1.67 ? 28 VAL A CG1  1 
ATOM 399 C CG2  . VAL A 1 28 ? 101.284 -9.551  2.382   1.00 1.90 ? 28 VAL A CG2  1 
ATOM 400 H H    . VAL A 1 28 ? 99.492  -8.075  3.601   1.00 1.67 ? 28 VAL A H    1 
ATOM 401 H HA   . VAL A 1 28 ? 101.541 -6.794  2.118   1.00 1.39 ? 28 VAL A HA   1 
ATOM 402 H HB   . VAL A 1 28 ? 99.667  -8.938  1.155   1.00 1.76 ? 28 VAL A HB   1 
ATOM 403 H HG11 . VAL A 1 28 ? 102.110 -7.699  0.112   1.00 2.01 ? 28 VAL A HG11 1 
ATOM 404 H HG12 . VAL A 1 28 ? 100.828 -8.436  -0.729  1.00 1.93 ? 28 VAL A HG12 1 
ATOM 405 H HG13 . VAL A 1 28 ? 102.034 -9.405  -0.015  1.00 1.90 ? 28 VAL A HG13 1 
ATOM 406 H HG21 . VAL A 1 28 ? 102.037 -10.110 1.920   1.00 2.09 ? 28 VAL A HG21 1 
ATOM 407 H HG22 . VAL A 1 28 ? 100.566 -10.207 2.755   1.00 2.10 ? 28 VAL A HG22 1 
ATOM 408 H HG23 . VAL A 1 28 ? 101.697 -9.020  3.186   1.00 2.31 ? 28 VAL A HG23 1 
ATOM 409 N N    . ILE A 1 29 ? 100.251 -5.115  0.867   1.00 1.07 ? 29 ILE A N    1 
ATOM 410 C CA   . ILE A 1 29 ? 99.594  -4.170  0.002   1.00 0.91 ? 29 ILE A CA   1 
ATOM 411 C C    . ILE A 1 29 ? 100.263 -4.113  -1.358  1.00 0.85 ? 29 ILE A C    1 
ATOM 412 O O    . ILE A 1 29 ? 101.485 -4.056  -1.461  1.00 0.89 ? 29 ILE A O    1 
ATOM 413 C CB   . ILE A 1 29 ? 99.593  -2.777  0.629   1.00 0.72 ? 29 ILE A CB   1 
ATOM 414 C CG1  . ILE A 1 29 ? 99.058  -2.847  2.048   1.00 0.83 ? 29 ILE A CG1  1 
ATOM 415 C CG2  . ILE A 1 29 ? 98.761  -1.828  -0.208  1.00 0.66 ? 29 ILE A CG2  1 
ATOM 416 C CD1  . ILE A 1 29 ? 99.642  -1.782  2.950   1.00 0.71 ? 29 ILE A CD1  1 
ATOM 417 H H    . ILE A 1 29 ? 101.079 -4.851  1.324   1.00 1.05 ? 29 ILE A H    1 
ATOM 418 H HA   . ILE A 1 29 ? 98.569  -4.488  -0.122  1.00 1.03 ? 29 ILE A HA   1 
ATOM 419 H HB   . ILE A 1 29 ? 100.601 -2.416  0.651   1.00 0.62 ? 29 ILE A HB   1 
ATOM 420 H HG12 . ILE A 1 29 ? 97.991  -2.728  2.035   1.00 0.97 ? 29 ILE A HG12 1 
ATOM 421 H HG13 . ILE A 1 29 ? 99.307  -3.806  2.471   1.00 1.05 ? 29 ILE A HG13 1 
ATOM 422 H HG21 . ILE A 1 29 ? 97.747  -2.184  -0.262  1.00 1.18 ? 29 ILE A HG21 1 
ATOM 423 H HG22 . ILE A 1 29 ? 99.160  -1.772  -1.200  1.00 1.21 ? 29 ILE A HG22 1 
ATOM 424 H HG23 . ILE A 1 29 ? 98.773  -0.855  0.234   1.00 1.23 ? 29 ILE A HG23 1 
ATOM 425 H HD11 . ILE A 1 29 ? 100.228 -1.108  2.374   1.00 1.16 ? 29 ILE A HD11 1 
ATOM 426 H HD12 . ILE A 1 29 ? 100.260 -2.225  3.691   1.00 1.25 ? 29 ILE A HD12 1 
ATOM 427 H HD13 . ILE A 1 29 ? 98.869  -1.246  3.435   1.00 1.28 ? 29 ILE A HD13 1 
ATOM 428 N N    . THR A 1 30 ? 99.456  -4.127  -2.399  1.00 0.85 ? 30 THR A N    1 
ATOM 429 C CA   . THR A 1 30 ? 99.965  -4.076  -3.747  1.00 0.83 ? 30 THR A CA   1 
ATOM 430 C C    . THR A 1 30 ? 100.202 -2.648  -4.160  1.00 0.60 ? 30 THR A C    1 
ATOM 431 O O    . THR A 1 30 ? 99.275  -1.910  -4.497  1.00 0.52 ? 30 THR A O    1 
ATOM 432 C CB   . THR A 1 30 ? 98.990  -4.762  -4.693  1.00 0.97 ? 30 THR A CB   1 
ATOM 433 O OG1  . THR A 1 30 ? 98.502  -5.960  -4.114  1.00 1.14 ? 30 THR A OG1  1 
ATOM 434 C CG2  . THR A 1 30 ? 99.597  -5.117  -6.034  1.00 1.05 ? 30 THR A CG2  1 
ATOM 435 H H    . THR A 1 30 ? 98.490  -4.170  -2.256  1.00 0.92 ? 30 THR A H    1 
ATOM 436 H HA   . THR A 1 30 ? 100.906 -4.602  -3.767  1.00 0.93 ? 30 THR A HA   1 
ATOM 437 H HB   . THR A 1 30 ? 98.159  -4.100  -4.870  1.00 0.93 ? 30 THR A HB   1 
ATOM 438 H HG1  . THR A 1 30 ? 97.544  -5.985  -4.183  1.00 1.78 ? 30 THR A HG1  1 
ATOM 439 H HG21 . THR A 1 30 ? 98.933  -4.871  -6.802  1.00 1.38 ? 30 THR A HG21 1 
ATOM 440 H HG22 . THR A 1 30 ? 99.797  -6.137  -6.085  1.00 1.27 ? 30 THR A HG22 1 
ATOM 441 H HG23 . THR A 1 30 ? 100.495 -4.593  -6.172  1.00 1.62 ? 30 THR A HG23 1 
ATOM 442 N N    . LEU A 1 31 ? 101.452 -2.263  -4.119  1.00 0.59 ? 31 LEU A N    1 
ATOM 443 C CA   . LEU A 1 31 ? 101.837 -0.925  -4.475  1.00 0.51 ? 31 LEU A CA   1 
ATOM 444 C C    . LEU A 1 31 ? 101.244 -0.522  -5.811  1.00 0.50 ? 31 LEU A C    1 
ATOM 445 O O    . LEU A 1 31 ? 101.449 -1.190  -6.823  1.00 0.60 ? 31 LEU A O    1 
ATOM 446 C CB   . LEU A 1 31 ? 103.342 -0.818  -4.534  1.00 0.72 ? 31 LEU A CB   1 
ATOM 447 C CG   . LEU A 1 31 ? 103.844 0.601   -4.681  1.00 0.80 ? 31 LEU A CG   1 
ATOM 448 C CD1  . LEU A 1 31 ? 103.631 1.375   -3.390  1.00 0.89 ? 31 LEU A CD1  1 
ATOM 449 C CD2  . LEU A 1 31 ? 105.307 0.597   -5.049  1.00 1.13 ? 31 LEU A CD2  1 
ATOM 450 H H    . LEU A 1 31 ? 102.144 -2.896  -3.835  1.00 0.74 ? 31 LEU A H    1 
ATOM 451 H HA   . LEU A 1 31 ? 101.471 -0.259  -3.710  1.00 0.39 ? 31 LEU A HA   1 
ATOM 452 H HB2  . LEU A 1 31 ? 103.748 -1.236  -3.623  1.00 0.78 ? 31 LEU A HB2  1 
ATOM 453 H HB3  . LEU A 1 31 ? 103.690 -1.396  -5.372  1.00 0.84 ? 31 LEU A HB3  1 
ATOM 454 H HG   . LEU A 1 31 ? 103.293 1.087   -5.471  1.00 0.87 ? 31 LEU A HG   1 
ATOM 455 H HD11 . LEU A 1 31 ? 102.779 1.984   -3.459  1.00 1.33 ? 31 LEU A HD11 1 
ATOM 456 H HD12 . LEU A 1 31 ? 104.449 1.978   -3.201  1.00 1.45 ? 31 LEU A HD12 1 
ATOM 457 H HD13 . LEU A 1 31 ? 103.512 0.715   -2.586  1.00 1.27 ? 31 LEU A HD13 1 
ATOM 458 H HD21 . LEU A 1 31 ? 105.882 0.345   -4.197  1.00 1.59 ? 31 LEU A HD21 1 
ATOM 459 H HD22 . LEU A 1 31 ? 105.605 1.550   -5.385  1.00 1.53 ? 31 LEU A HD22 1 
ATOM 460 H HD23 . LEU A 1 31 ? 105.497 -0.111  -5.815  1.00 1.63 ? 31 LEU A HD23 1 
ATOM 461 N N    . ILE A 1 32 ? 100.514 0.579   -5.802  1.00 0.47 ? 32 ILE A N    1 
ATOM 462 C CA   . ILE A 1 32 ? 99.885  1.094   -7.008  1.00 0.58 ? 32 ILE A CA   1 
ATOM 463 C C    . ILE A 1 32 ? 100.812 2.045   -7.716  1.00 0.75 ? 32 ILE A C    1 
ATOM 464 O O    . ILE A 1 32 ? 101.009 1.968   -8.926  1.00 0.81 ? 32 ILE A O    1 
ATOM 465 C CB   . ILE A 1 32 ? 98.601  1.824   -6.686  1.00 0.67 ? 32 ILE A CB   1 
ATOM 466 C CG1  . ILE A 1 32 ? 97.703  0.933   -5.854  1.00 0.64 ? 32 ILE A CG1  1 
ATOM 467 C CG2  . ILE A 1 32 ? 97.912  2.251   -7.969  1.00 0.82 ? 32 ILE A CG2  1 
ATOM 468 C CD1  . ILE A 1 32 ? 96.641  1.699   -5.121  1.00 0.81 ? 32 ILE A CD1  1 
ATOM 469 H H    . ILE A 1 32 ? 100.396 1.063   -4.959  1.00 0.45 ? 32 ILE A H    1 
ATOM 470 H HA   . ILE A 1 32 ? 99.660  0.257   -7.656  1.00 0.56 ? 32 ILE A HA   1 
ATOM 471 H HB   . ILE A 1 32 ? 98.848  2.703   -6.120  1.00 0.73 ? 32 ILE A HB   1 
ATOM 472 H HG12 . ILE A 1 32 ? 97.215  0.219   -6.500  1.00 0.68 ? 32 ILE A HG12 1 
ATOM 473 H HG13 . ILE A 1 32 ? 98.298  0.407   -5.125  1.00 0.53 ? 32 ILE A HG13 1 
ATOM 474 H HG21 . ILE A 1 32 ? 97.450  1.427   -8.417  1.00 1.36 ? 32 ILE A HG21 1 
ATOM 475 H HG22 . ILE A 1 32 ? 98.611  2.642   -8.642  1.00 1.26 ? 32 ILE A HG22 1 
ATOM 476 H HG23 . ILE A 1 32 ? 97.197  2.983   -7.768  1.00 1.25 ? 32 ILE A HG23 1 
ATOM 477 H HD11 . ILE A 1 32 ? 95.730  1.257   -5.284  1.00 1.41 ? 32 ILE A HD11 1 
ATOM 478 H HD12 . ILE A 1 32 ? 96.599  2.679   -5.455  1.00 1.27 ? 32 ILE A HD12 1 
ATOM 479 H HD13 . ILE A 1 32 ? 96.838  1.708   -4.095  1.00 1.17 ? 32 ILE A HD13 1 
ATOM 480 N N    . ASN A 1 33 ? 101.440 2.892   -6.931  1.00 0.88 ? 33 ASN A N    1 
ATOM 481 C CA   . ASN A 1 33 ? 102.439 3.798   -7.457  1.00 1.11 ? 33 ASN A CA   1 
ATOM 482 C C    . ASN A 1 33 ? 103.191 4.486   -6.348  1.00 1.17 ? 33 ASN A C    1 
ATOM 483 O O    . ASN A 1 33 ? 102.876 4.354   -5.171  1.00 1.09 ? 33 ASN A O    1 
ATOM 484 C CB   . ASN A 1 33 ? 101.968 4.858   -8.514  1.00 1.31 ? 33 ASN A CB   1 
ATOM 485 C CG   . ASN A 1 33 ? 100.502 5.471   -8.393  1.00 1.43 ? 33 ASN A CG   1 
ATOM 486 O OD1  . ASN A 1 33 ? 100.074 6.154   -9.303  1.00 2.19 ? 33 ASN A OD1  1 
ATOM 487 N ND2  . ASN A 1 33 ? 99.766  5.250   -7.271  1.00 1.64 ? 33 ASN A ND2  1 
ATOM 488 H H    . ASN A 1 33 ? 101.281 2.852   -5.963  1.00 0.86 ? 33 ASN A H    1 
ATOM 489 H HA   . ASN A 1 33 ? 103.158 3.145   -7.930  1.00 1.18 ? 33 ASN A HA   1 
ATOM 490 H HB2  . ASN A 1 33 ? 102.673 5.674   -8.472  1.00 1.83 ? 33 ASN A HB2  1 
ATOM 491 H HB3  . ASN A 1 33 ? 102.087 4.431   -9.497  1.00 1.55 ? 33 ASN A HB3  1 
ATOM 492 H HD21 . ASN A 1 33 ? 100.176 4.738   -6.629  1.00 1.91 ? 33 ASN A HD21 1 
ATOM 493 H HD22 . ASN A 1 33 ? 98.836  5.641   -7.148  1.00 2.02 ? 33 ASN A HD22 1 
ATOM 494 N N    . LYS A 1 34 ? 104.226 5.190   -6.759  1.00 1.41 ? 34 LYS A N    1 
ATOM 495 C CA   . LYS A 1 34 ? 105.084 5.886   -5.837  1.00 1.55 ? 34 LYS A CA   1 
ATOM 496 C C    . LYS A 1 34 ? 105.221 7.332   -6.208  1.00 1.76 ? 34 LYS A C    1 
ATOM 497 O O    . LYS A 1 34 ? 106.326 7.869   -6.307  1.00 1.94 ? 34 LYS A O    1 
ATOM 498 C CB   . LYS A 1 34 ? 106.443 5.269   -5.802  1.00 1.67 ? 34 LYS A CB   1 
ATOM 499 C CG   . LYS A 1 34 ? 106.509 4.055   -4.934  1.00 1.54 ? 34 LYS A CG   1 
ATOM 500 C CD   . LYS A 1 34 ? 107.864 3.434   -5.039  1.00 1.73 ? 34 LYS A CD   1 
ATOM 501 C CE   . LYS A 1 34 ? 108.021 2.724   -6.356  1.00 1.99 ? 34 LYS A CE   1 
ATOM 502 N NZ   . LYS A 1 34 ? 109.172 1.805   -6.309  1.00 2.19 ? 34 LYS A NZ   1 
ATOM 503 H H    . LYS A 1 34 ? 104.425 5.226   -7.718  1.00 1.52 ? 34 LYS A H    1 
ATOM 504 H HA   . LYS A 1 34 ? 104.640 5.811   -4.850  1.00 1.46 ? 34 LYS A HA   1 
ATOM 505 H HB2  . LYS A 1 34 ? 106.717 4.979   -6.814  1.00 1.74 ? 34 LYS A HB2  1 
ATOM 506 H HB3  . LYS A 1 34 ? 107.151 5.991   -5.437  1.00 1.84 ? 34 LYS A HB3  1 
ATOM 507 H HG2  . LYS A 1 34 ? 106.315 4.339   -3.914  1.00 1.49 ? 34 LYS A HG2  1 
ATOM 508 H HG3  . LYS A 1 34 ? 105.771 3.346   -5.267  1.00 1.41 ? 34 LYS A HG3  1 
ATOM 509 H HD2  . LYS A 1 34 ? 108.602 4.210   -4.961  1.00 1.98 ? 34 LYS A HD2  1 
ATOM 510 H HD3  . LYS A 1 34 ? 107.986 2.736   -4.236  1.00 1.62 ? 34 LYS A HD3  1 
ATOM 511 H HE2  . LYS A 1 34 ? 107.124 2.172   -6.567  1.00 1.97 ? 34 LYS A HE2  1 
ATOM 512 H HE3  . LYS A 1 34 ? 108.191 3.451   -7.124  1.00 2.26 ? 34 LYS A HE3  1 
ATOM 513 H HZ1  . LYS A 1 34 ? 109.267 1.431   -5.351  1.00 2.60 ? 34 LYS A HZ1  1 
ATOM 514 H HZ2  . LYS A 1 34 ? 110.026 2.304   -6.566  1.00 2.50 ? 34 LYS A HZ2  1 
ATOM 515 H HZ3  . LYS A 1 34 ? 109.063 1.027   -6.957  1.00 2.22 ? 34 LYS A HZ3  1 
ATOM 516 N N    . ASP A 1 35 ? 104.098 7.950   -6.394  1.00 1.79 ? 35 ASP A N    1 
ATOM 517 C CA   . ASP A 1 35 ? 104.016 9.347   -6.728  1.00 2.02 ? 35 ASP A CA   1 
ATOM 518 C C    . ASP A 1 35 ? 104.815 10.181  -5.747  1.00 2.17 ? 35 ASP A C    1 
ATOM 519 O O    . ASP A 1 35 ? 105.291 11.275  -6.047  1.00 2.40 ? 35 ASP A O    1 
ATOM 520 C CB   . ASP A 1 35 ? 102.565 9.726   -6.586  1.00 2.05 ? 35 ASP A CB   1 
ATOM 521 C CG   . ASP A 1 35 ? 101.944 10.271  -7.933  1.00 2.33 ? 35 ASP A CG   1 
ATOM 522 O OD1  . ASP A 1 35 ? 102.010 11.474  -8.217  1.00 2.76 ? 35 ASP A OD1  1 
ATOM 523 O OD2  . ASP A 1 35 ? 101.449 9.480   -8.756  1.00 2.89 ? 35 ASP A OD2  1 
ATOM 524 H H    . ASP A 1 35 ? 103.280 7.443   -6.273  1.00 1.67 ? 35 ASP A H    1 
ATOM 525 H HA   . ASP A 1 35 ? 104.343 9.501   -7.745  1.00 2.11 ? 35 ASP A HA   1 
ATOM 526 H HB2  . ASP A 1 35 ? 102.005 8.893   -6.215  1.00 2.27 ? 35 ASP A HB2  1 
ATOM 527 H HB3  . ASP A 1 35 ? 102.493 10.475  -5.821  1.00 2.32 ? 35 ASP A HB3  1 
ATOM 528 N N    . ASP A 1 36 ? 104.878 9.670   -4.543  1.00 2.06 ? 36 ASP A N    1 
ATOM 529 C CA   . ASP A 1 36 ? 105.516 10.373  -3.471  1.00 2.19 ? 36 ASP A CA   1 
ATOM 530 C C    . ASP A 1 36 ? 106.520 9.490   -2.771  1.00 2.11 ? 36 ASP A C    1 
ATOM 531 O O    . ASP A 1 36 ? 106.169 8.429   -2.260  1.00 1.89 ? 36 ASP A O    1 
ATOM 532 C CB   . ASP A 1 36 ? 104.443 10.841  -2.494  1.00 2.18 ? 36 ASP A CB   1 
ATOM 533 C CG   . ASP A 1 36 ? 104.947 11.973  -1.591  1.00 2.54 ? 36 ASP A CG   1 
ATOM 534 O OD1  . ASP A 1 36 ? 105.195 13.076  -2.103  1.00 2.98 ? 36 ASP A OD1  1 
ATOM 535 O OD2  . ASP A 1 36 ? 105.137 11.743  -0.381  1.00 2.63 ? 36 ASP A OD2  1 
ATOM 536 H H    . ASP A 1 36 ? 104.448 8.823   -4.354  1.00 1.90 ? 36 ASP A H    1 
ATOM 537 H HA   . ASP A 1 36 ? 106.006 11.239  -3.874  1.00 2.39 ? 36 ASP A HA   1 
ATOM 538 H HB2  . ASP A 1 36 ? 103.580 11.160  -3.060  1.00 2.31 ? 36 ASP A HB2  1 
ATOM 539 H HB3  . ASP A 1 36 ? 104.151 10.020  -1.888  1.00 2.15 ? 36 ASP A HB3  1 
ATOM 540 N N    . PRO A 1 37 ? 107.787 9.905   -2.755  1.00 2.32 ? 37 PRO A N    1 
ATOM 541 C CA   . PRO A 1 37 ? 108.848 9.131   -2.128  1.00 2.33 ? 37 PRO A CA   1 
ATOM 542 C C    . PRO A 1 37 ? 108.477 8.675   -0.725  1.00 2.16 ? 37 PRO A C    1 
ATOM 543 O O    . PRO A 1 37 ? 108.999 7.679   -0.230  1.00 2.10 ? 37 PRO A O    1 
ATOM 544 C CB   . PRO A 1 37 ? 110.037 10.091  -2.041  1.00 2.62 ? 37 PRO A CB   1 
ATOM 545 C CG   . PRO A 1 37 ? 109.679 11.322  -2.837  1.00 2.77 ? 37 PRO A CG   1 
ATOM 546 C CD   . PRO A 1 37 ? 108.271 11.153  -3.364  1.00 2.61 ? 37 PRO A CD   1 
ATOM 547 H HA   . PRO A 1 37 ? 109.115 8.271   -2.720  1.00 2.29 ? 37 PRO A HA   1 
ATOM 548 H HB2  . PRO A 1 37 ? 110.212 10.334  -1.002  1.00 2.74 ? 37 PRO A HB2  1 
ATOM 549 H HB3  . PRO A 1 37 ? 110.912 9.603   -2.441  1.00 2.68 ? 37 PRO A HB3  1 
ATOM 550 H HG2  . PRO A 1 37 ? 109.733 12.191  -2.206  1.00 2.98 ? 37 PRO A HG2  1 
ATOM 551 H HG3  . PRO A 1 37 ? 110.368 11.437  -3.659  1.00 2.94 ? 37 PRO A HG3  1 
ATOM 552 H HD2  . PRO A 1 37 ? 107.650 11.983  -3.053  1.00 2.64 ? 37 PRO A HD2  1 
ATOM 553 H HD3  . PRO A 1 37 ? 108.274 11.079  -4.443  1.00 2.71 ? 37 PRO A HD3  1 
ATOM 554 N N    . ASN A 1 38 ? 107.591 9.414   -0.079  1.00 2.13 ? 38 ASN A N    1 
ATOM 555 C CA   . ASN A 1 38 ? 107.184 9.079   1.270   1.00 1.99 ? 38 ASN A CA   1 
ATOM 556 C C    . ASN A 1 38 ? 105.834 8.410   1.267   1.00 1.75 ? 38 ASN A C    1 
ATOM 557 O O    . ASN A 1 38 ? 105.601 7.444   1.990   1.00 1.57 ? 38 ASN A O    1 
ATOM 558 C CB   . ASN A 1 38 ? 107.128 10.331  2.136   1.00 2.17 ? 38 ASN A CB   1 
ATOM 559 C CG   . ASN A 1 38 ? 108.475 10.660  2.735   1.00 2.36 ? 38 ASN A CG   1 
ATOM 560 O OD1  . ASN A 1 38 ? 109.099 11.661  2.384   1.00 2.59 ? 38 ASN A OD1  1 
ATOM 561 N ND2  . ASN A 1 38 ? 108.931 9.806   3.642   1.00 2.28 ? 38 ASN A ND2  1 
ATOM 562 H H    . ASN A 1 38 ? 107.210 10.204  -0.515  1.00 2.22 ? 38 ASN A H    1 
ATOM 563 H HA   . ASN A 1 38 ? 107.914 8.401   1.678   1.00 1.98 ? 38 ASN A HA   1 
ATOM 564 H HB2  . ASN A 1 38 ? 106.800 11.168  1.536   1.00 2.28 ? 38 ASN A HB2  1 
ATOM 565 H HB3  . ASN A 1 38 ? 106.428 10.172  2.943   1.00 2.08 ? 38 ASN A HB3  1 
ATOM 566 H HD21 . ASN A 1 38 ? 108.377 9.029   3.862   1.00 2.10 ? 38 ASN A HD21 1 
ATOM 567 H HD22 . ASN A 1 38 ? 109.797 9.987   4.053   1.00 2.42 ? 38 ASN A HD22 1 
ATOM 568 N N    . TRP A 1 39 ? 104.945 8.941   0.455   1.00 1.78 ? 39 TRP A N    1 
ATOM 569 C CA   . TRP A 1 39 ? 103.607 8.415   0.362   1.00 1.59 ? 39 TRP A CA   1 
ATOM 570 C C    . TRP A 1 39 ? 103.444 7.534   -0.852  1.00 1.45 ? 39 TRP A C    1 
ATOM 571 O O    . TRP A 1 39 ? 103.453 8.003   -1.988  1.00 1.54 ? 39 TRP A O    1 
ATOM 572 C CB   . TRP A 1 39 ? 102.608 9.554   0.323   1.00 1.75 ? 39 TRP A CB   1 
ATOM 573 C CG   . TRP A 1 39 ? 102.307 10.087  1.678   1.00 1.82 ? 39 TRP A CG   1 
ATOM 574 C CD1  . TRP A 1 39 ? 103.135 10.816  2.482   1.00 1.97 ? 39 TRP A CD1  1 
ATOM 575 C CD2  . TRP A 1 39 ? 101.091 9.912   2.396   1.00 1.77 ? 39 TRP A CD2  1 
ATOM 576 N NE1  . TRP A 1 39 ? 102.495 11.118  3.658   1.00 1.99 ? 39 TRP A NE1  1 
ATOM 577 C CE2  . TRP A 1 39 ? 101.236 10.573  3.628   1.00 1.88 ? 39 TRP A CE2  1 
ATOM 578 C CE3  . TRP A 1 39 ? 99.888  9.264   2.110   1.00 1.68 ? 39 TRP A CE3  1 
ATOM 579 C CZ2  . TRP A 1 39 ? 100.219 10.603  4.576   1.00 1.90 ? 39 TRP A CZ2  1 
ATOM 580 C CZ3  . TRP A 1 39 ? 98.879  9.292   3.050   1.00 1.74 ? 39 TRP A CZ3  1 
ATOM 581 C CH2  . TRP A 1 39 ? 99.048  9.959   4.271   1.00 1.85 ? 39 TRP A CH2  1 
ATOM 582 H H    . TRP A 1 39 ? 105.196 9.716   -0.089  1.00 1.95 ? 39 TRP A H    1 
ATOM 583 H HA   . TRP A 1 39 ? 103.425 7.824   1.245   1.00 1.46 ? 39 TRP A HA   1 
ATOM 584 H HB2  . TRP A 1 39 ? 103.005 10.357  -0.277  1.00 1.92 ? 39 TRP A HB2  1 
ATOM 585 H HB3  . TRP A 1 39 ? 101.685 9.203   -0.112  1.00 1.67 ? 39 TRP A HB3  1 
ATOM 586 H HD1  . TRP A 1 39 ? 104.142 11.109  2.218   1.00 2.07 ? 39 TRP A HD1  1 
ATOM 587 H HE1  . TRP A 1 39 ? 102.876 11.638  4.397   1.00 2.09 ? 39 TRP A HE1  1 
ATOM 588 H HE3  . TRP A 1 39 ? 99.742  8.743   1.174   1.00 1.61 ? 39 TRP A HE3  1 
ATOM 589 H HZ2  . TRP A 1 39 ? 100.335 11.113  5.520   1.00 1.99 ? 39 TRP A HZ2  1 
ATOM 590 H HZ3  . TRP A 1 39 ? 97.945  8.794   2.846   1.00 1.74 ? 39 TRP A HZ3  1 
ATOM 591 H HH2  . TRP A 1 39 ? 98.232  9.957   4.979   1.00 1.91 ? 39 TRP A HH2  1 
ATOM 592 N N    . TRP A 1 40 ? 103.292 6.251   -0.601  1.00 1.24 ? 40 TRP A N    1 
ATOM 593 C CA   . TRP A 1 40 ? 103.122 5.298   -1.665  1.00 1.09 ? 40 TRP A CA   1 
ATOM 594 C C    . TRP A 1 40 ? 101.697 4.825   -1.736  1.00 0.92 ? 40 TRP A C    1 
ATOM 595 O O    . TRP A 1 40 ? 101.044 4.613   -0.717  1.00 0.85 ? 40 TRP A O    1 
ATOM 596 C CB   . TRP A 1 40 ? 104.039 4.115   -1.449  1.00 1.02 ? 40 TRP A CB   1 
ATOM 597 C CG   . TRP A 1 40 ? 105.468 4.460   -1.639  1.00 1.25 ? 40 TRP A CG   1 
ATOM 598 C CD1  . TRP A 1 40 ? 105.988 5.691   -1.907  1.00 1.49 ? 40 TRP A CD1  1 
ATOM 599 C CD2  . TRP A 1 40 ? 106.562 3.558   -1.582  1.00 1.31 ? 40 TRP A CD2  1 
ATOM 600 N NE1  . TRP A 1 40 ? 107.351 5.607   -2.002  1.00 1.67 ? 40 TRP A NE1  1 
ATOM 601 C CE2  . TRP A 1 40 ? 107.726 4.305   -1.813  1.00 1.58 ? 40 TRP A CE2  1 
ATOM 602 C CE3  . TRP A 1 40 ? 106.667 2.188   -1.353  1.00 1.22 ? 40 TRP A CE3  1 
ATOM 603 C CZ2  . TRP A 1 40 ? 108.986 3.729   -1.824  1.00 1.73 ? 40 TRP A CZ2  1 
ATOM 604 C CZ3  . TRP A 1 40 ? 107.919 1.610   -1.363  1.00 1.42 ? 40 TRP A CZ3  1 
ATOM 605 C CH2  . TRP A 1 40 ? 109.068 2.381   -1.598  1.00 1.66 ? 40 TRP A CH2  1 
ATOM 606 H H    . TRP A 1 40 ? 103.293 5.939   0.327   1.00 1.18 ? 40 TRP A H    1 
ATOM 607 H HA   . TRP A 1 40 ? 103.383 5.778   -2.595  1.00 1.22 ? 40 TRP A HA   1 
ATOM 608 H HB2  . TRP A 1 40 ? 103.914 3.745   -0.444  1.00 0.93 ? 40 TRP A HB2  1 
ATOM 609 H HB3  . TRP A 1 40 ? 103.785 3.342   -2.148  1.00 0.92 ? 40 TRP A HB3  1 
ATOM 610 H HD1  . TRP A 1 40 ? 105.399 6.589   -2.016  1.00 1.56 ? 40 TRP A HD1  1 
ATOM 611 H HE1  . TRP A 1 40 ? 107.954 6.351   -2.176  1.00 1.85 ? 40 TRP A HE1  1 
ATOM 612 H HE3  . TRP A 1 40 ? 105.789 1.584   -1.171  1.00 1.04 ? 40 TRP A HE3  1 
ATOM 613 H HZ2  . TRP A 1 40 ? 109.875 4.311   -2.003  1.00 1.94 ? 40 TRP A HZ2  1 
ATOM 614 H HZ3  . TRP A 1 40 ? 108.022 0.549   -1.188  1.00 1.43 ? 40 TRP A HZ3  1 
ATOM 615 H HH2  . TRP A 1 40 ? 110.030 1.891   -1.599  1.00 1.82 ? 40 TRP A HH2  1 
ATOM 616 N N    . GLU A 1 41 ? 101.223 4.639   -2.942  1.00 0.90 ? 41 GLU A N    1 
ATOM 617 C CA   . GLU A 1 41 ? 99.880  4.164   -3.138  1.00 0.81 ? 41 GLU A CA   1 
ATOM 618 C C    . GLU A 1 41 ? 99.880  2.654   -3.185  1.00 0.57 ? 41 GLU A C    1 
ATOM 619 O O    . GLU A 1 41 ? 100.817 2.040   -3.689  1.00 0.51 ? 41 GLU A O    1 
ATOM 620 C CB   . GLU A 1 41 ? 99.320  4.714   -4.421  1.00 0.96 ? 41 GLU A CB   1 
ATOM 621 C CG   . GLU A 1 41 ? 97.817  4.614   -4.527  1.00 1.02 ? 41 GLU A CG   1 
ATOM 622 C CD   . GLU A 1 41 ? 97.136  5.957   -4.697  1.00 1.31 ? 41 GLU A CD   1 
ATOM 623 O OE1  . GLU A 1 41 ? 97.780  6.899   -5.107  1.00 1.59 ? 41 GLU A OE1  1 
ATOM 624 O OE2  . GLU A 1 41 ? 95.954  6.063   -4.428  1.00 1.91 ? 41 GLU A OE2  1 
ATOM 625 H H    . GLU A 1 41 ? 101.797 4.809   -3.719  1.00 0.98 ? 41 GLU A H    1 
ATOM 626 H HA   . GLU A 1 41 ? 99.277  4.497   -2.311  1.00 0.88 ? 41 GLU A HA   1 
ATOM 627 H HB2  . GLU A 1 41 ? 99.610  5.747   -4.527  1.00 1.13 ? 41 GLU A HB2  1 
ATOM 628 H HB3  . GLU A 1 41 ? 99.743  4.140   -5.216  1.00 0.89 ? 41 GLU A HB3  1 
ATOM 629 H HG2  . GLU A 1 41 ? 97.594  4.013   -5.387  1.00 0.98 ? 41 GLU A HG2  1 
ATOM 630 H HG3  . GLU A 1 41 ? 97.435  4.131   -3.639  1.00 0.97 ? 41 GLU A HG3  1 
ATOM 631 N N    . GLY A 1 42 ? 98.840  2.056   -2.656  1.00 0.54 ? 42 GLY A N    1 
ATOM 632 C CA   . GLY A 1 42 ? 98.772  0.622   -2.646  1.00 0.44 ? 42 GLY A CA   1 
ATOM 633 C C    . GLY A 1 42 ? 97.371  0.113   -2.720  1.00 0.65 ? 42 GLY A C    1 
ATOM 634 O O    . GLY A 1 42 ? 96.413  0.815   -2.391  1.00 0.82 ? 42 GLY A O    1 
ATOM 635 H H    . GLY A 1 42 ? 98.119  2.589   -2.266  1.00 0.69 ? 42 GLY A H    1 
ATOM 636 H HA2  . GLY A 1 42 ? 99.323  0.239   -3.493  1.00 0.38 ? 42 GLY A HA2  1 
ATOM 637 H HA3  . GLY A 1 42 ? 99.227  0.258   -1.739  1.00 0.39 ? 42 GLY A HA3  1 
ATOM 638 N N    . GLN A 1 43 ? 97.247  -1.107  -3.162  1.00 0.70 ? 43 GLN A N    1 
ATOM 639 C CA   . GLN A 1 43 ? 95.962  -1.715  -3.295  1.00 0.94 ? 43 GLN A CA   1 
ATOM 640 C C    . GLN A 1 43 ? 95.850  -2.928  -2.434  1.00 1.12 ? 43 GLN A C    1 
ATOM 641 O O    . GLN A 1 43 ? 96.620  -3.876  -2.557  1.00 1.25 ? 43 GLN A O    1 
ATOM 642 C CB   . GLN A 1 43 ? 95.722  -2.091  -4.717  1.00 0.99 ? 43 GLN A CB   1 
ATOM 643 C CG   . GLN A 1 43 ? 94.274  -2.093  -5.092  1.00 1.26 ? 43 GLN A CG   1 
ATOM 644 C CD   . GLN A 1 43 ? 94.062  -2.789  -6.406  1.00 1.57 ? 43 GLN A CD   1 
ATOM 645 O OE1  . GLN A 1 43 ? 94.988  -2.907  -7.180  1.00 2.00 ? 43 GLN A OE1  1 
ATOM 646 N NE2  . GLN A 1 43 ? 92.854  -3.277  -6.628  1.00 1.88 ? 43 GLN A NE2  1 
ATOM 647 H H    . GLN A 1 43 ? 98.045  -1.614  -3.414  1.00 0.63 ? 43 GLN A H    1 
ATOM 648 H HA   . GLN A 1 43 ? 95.224  -1.003  -2.995  1.00 1.03 ? 43 GLN A HA   1 
ATOM 649 H HB2  . GLN A 1 43 ? 96.245  -1.405  -5.356  1.00 0.91 ? 43 GLN A HB2  1 
ATOM 650 H HB3  . GLN A 1 43 ? 96.101  -3.077  -4.870  1.00 1.05 ? 43 GLN A HB3  1 
ATOM 651 H HG2  . GLN A 1 43 ? 93.729  -2.610  -4.332  1.00 1.48 ? 43 GLN A HG2  1 
ATOM 652 H HG3  . GLN A 1 43 ? 93.927  -1.086  -5.159  1.00 1.45 ? 43 GLN A HG3  1 
ATOM 653 H HE21 . GLN A 1 43 ? 92.209  -3.146  -5.941  1.00 2.09 ? 43 GLN A HE21 1 
ATOM 654 H HE22 . GLN A 1 43 ? 92.665  -3.766  -7.462  1.00 2.16 ? 43 GLN A HE22 1 
ATOM 655 N N    . LEU A 1 44 ? 94.885  -2.883  -1.566  1.00 1.30 ? 44 LEU A N    1 
ATOM 656 C CA   . LEU A 1 44 ? 94.643  -3.949  -0.671  1.00 1.52 ? 44 LEU A CA   1 
ATOM 657 C C    . LEU A 1 44 ? 93.497  -4.766  -1.128  1.00 1.81 ? 44 LEU A C    1 
ATOM 658 O O    . LEU A 1 44 ? 92.380  -4.589  -0.664  1.00 2.04 ? 44 LEU A O    1 
ATOM 659 C CB   . LEU A 1 44 ? 94.370  -3.407  0.700   1.00 1.57 ? 44 LEU A CB   1 
ATOM 660 C CG   . LEU A 1 44 ? 95.386  -3.816  1.773   1.00 1.67 ? 44 LEU A CG   1 
ATOM 661 C CD1  . LEU A 1 44 ? 94.663  -3.938  3.111   1.00 1.84 ? 44 LEU A CD1  1 
ATOM 662 C CD2  . LEU A 1 44 ? 96.040  -5.188  1.477   1.00 1.86 ? 44 LEU A CD2  1 
ATOM 663 H H    . LEU A 1 44 ? 94.308  -2.098  -1.525  1.00 1.37 ? 44 LEU A H    1 
ATOM 664 H HA   . LEU A 1 44 ? 95.510  -4.574  -0.632  1.00 1.50 ? 44 LEU A HA   1 
ATOM 665 H HB2  . LEU A 1 44 ? 94.321  -2.325  0.612   1.00 1.56 ? 44 LEU A HB2  1 
ATOM 666 H HB3  . LEU A 1 44 ? 93.408  -3.753  1.022   1.00 1.83 ? 44 LEU A HB3  1 
ATOM 667 H HG   . LEU A 1 44 ? 96.154  -3.060  1.832   1.00 2.14 ? 44 LEU A HG   1 
ATOM 668 H HD11 . LEU A 1 44 ? 93.944  -3.177  3.250   1.00 2.22 ? 44 LEU A HD11 1 
ATOM 669 H HD12 . LEU A 1 44 ? 95.330  -3.889  3.912   1.00 2.26 ? 44 LEU A HD12 1 
ATOM 670 H HD13 . LEU A 1 44 ? 94.184  -4.863  3.147   1.00 2.09 ? 44 LEU A HD13 1 
ATOM 671 H HD21 . LEU A 1 44 ? 96.701  -5.152  0.623   1.00 2.25 ? 44 LEU A HD21 1 
ATOM 672 H HD22 . LEU A 1 44 ? 95.292  -5.902  1.284   1.00 2.14 ? 44 LEU A HD22 1 
ATOM 673 H HD23 . LEU A 1 44 ? 96.585  -5.518  2.316   1.00 2.26 ? 44 LEU A HD23 1 
ATOM 674 N N    . ASN A 1 45 ? 93.779  -5.669  -2.031  1.00 1.99 ? 45 ASN A N    1 
ATOM 675 C CA   . ASN A 1 45 ? 92.773  -6.542  -2.537  1.00 2.28 ? 45 ASN A CA   1 
ATOM 676 C C    . ASN A 1 45 ? 91.923  -5.902  -3.567  1.00 2.25 ? 45 ASN A C    1 
ATOM 677 O O    . ASN A 1 45 ? 91.438  -6.540  -4.477  1.00 2.68 ? 45 ASN A O    1 
ATOM 678 C CB   . ASN A 1 45 ? 91.859  -6.967  -1.425  1.00 2.59 ? 45 ASN A CB   1 
ATOM 679 C CG   . ASN A 1 45 ? 91.618  -8.428  -1.571  1.00 3.05 ? 45 ASN A CG   1 
ATOM 680 O OD1  . ASN A 1 45 ? 91.328  -8.862  -2.657  1.00 3.67 ? 45 ASN A OD1  1 
ATOM 681 N ND2  . ASN A 1 45 ? 91.953  -9.180  -0.519  1.00 3.24 ? 45 ASN A ND2  1 
ATOM 682 H H    . ASN A 1 45 ? 94.690  -5.754  -2.358  1.00 2.05 ? 45 ASN A H    1 
ATOM 683 H HA   . ASN A 1 45 ? 93.238  -7.417  -2.940  1.00 2.41 ? 45 ASN A HA   1 
ATOM 684 H HB2  . ASN A 1 45 ? 92.339  -6.788  -0.501  1.00 2.48 ? 45 ASN A HB2  1 
ATOM 685 H HB3  . ASN A 1 45 ? 90.932  -6.404  -1.467  1.00 2.91 ? 45 ASN A HB3  1 
ATOM 686 H HD21 . ASN A 1 45 ? 92.294  -8.708  0.217   1.00 3.22 ? 45 ASN A HD21 1 
ATOM 687 H HD22 . ASN A 1 45 ? 91.924  -10.167 -0.561  1.00 3.69 ? 45 ASN A HD22 1 
ATOM 688 N N    . ASN A 1 46 ? 91.652  -4.674  -3.346  1.00 2.01 ? 46 ASN A N    1 
ATOM 689 C CA   . ASN A 1 46 ? 90.731  -3.974  -4.183  1.00 2.02 ? 46 ASN A CA   1 
ATOM 690 C C    . ASN A 1 46 ? 90.693  -2.528  -3.895  1.00 1.98 ? 46 ASN A C    1 
ATOM 691 O O    . ASN A 1 46 ? 90.244  -1.728  -4.699  1.00 2.26 ? 46 ASN A O    1 
ATOM 692 C CB   . ASN A 1 46 ? 89.404  -4.481  -3.838  1.00 2.29 ? 46 ASN A CB   1 
ATOM 693 C CG   . ASN A 1 46 ? 88.746  -5.273  -4.918  1.00 2.88 ? 46 ASN A CG   1 
ATOM 694 O OD1  . ASN A 1 46 ? 89.375  -5.712  -5.850  1.00 3.52 ? 46 ASN A OD1  1 
ATOM 695 N ND2  . ASN A 1 46 ? 87.443  -5.317  -4.814  1.00 3.19 ? 46 ASN A ND2  1 
ATOM 696 H H    . ASN A 1 46 ? 92.003  -4.256  -2.557  1.00 2.05 ? 46 ASN A H    1 
ATOM 697 H HA   . ASN A 1 46 ? 90.933  -4.161  -5.200  1.00 1.96 ? 46 ASN A HA   1 
ATOM 698 H HB2  . ASN A 1 46 ? 89.480  -5.034  -2.940  1.00 2.59 ? 46 ASN A HB2  1 
ATOM 699 H HB3  . ASN A 1 46 ? 88.779  -3.664  -3.658  1.00 2.40 ? 46 ASN A HB3  1 
ATOM 700 H HD21 . ASN A 1 46 ? 87.076  -4.840  -4.094  1.00 3.05 ? 46 ASN A HD21 1 
ATOM 701 H HD22 . ASN A 1 46 ? 86.898  -5.796  -5.461  1.00 3.83 ? 46 ASN A HD22 1 
ATOM 702 N N    . ARG A 1 47 ? 91.082  -2.202  -2.725  1.00 1.88 ? 47 ARG A N    1 
ATOM 703 C CA   . ARG A 1 47 ? 91.035  -0.886  -2.340  1.00 1.89 ? 47 ARG A CA   1 
ATOM 704 C C    . ARG A 1 47 ? 92.310  -0.230  -2.592  1.00 1.62 ? 47 ARG A C    1 
ATOM 705 O O    . ARG A 1 47 ? 93.370  -0.774  -2.312  1.00 1.49 ? 47 ARG A O    1 
ATOM 706 C CB   . ARG A 1 47 ? 90.787  -0.774  -0.922  1.00 2.07 ? 47 ARG A CB   1 
ATOM 707 C CG   . ARG A 1 47 ? 91.415  -1.839  -0.110  1.00 2.08 ? 47 ARG A CG   1 
ATOM 708 C CD   . ARG A 1 47 ? 90.999  -1.538  1.225   1.00 2.47 ? 47 ARG A CD   1 
ATOM 709 N NE   . ARG A 1 47 ? 90.190  -2.521  1.702   1.00 3.20 ? 47 ARG A NE   1 
ATOM 710 C CZ   . ARG A 1 47 ? 88.927  -2.209  2.003   1.00 3.57 ? 47 ARG A CZ   1 
ATOM 711 N NH1  . ARG A 1 47 ? 88.219  -1.261  1.180   1.00 3.43 ? 47 ARG A NH1  1 
ATOM 712 N NH2  . ARG A 1 47 ? 88.389  -2.912  2.981   1.00 4.50 ? 47 ARG A NH2  1 
ATOM 713 H H    . ARG A 1 47 ? 91.370  -2.863  -2.098  1.00 1.97 ? 47 ARG A H    1 
ATOM 714 H HA   . ARG A 1 47 ? 90.246  -0.399  -2.877  1.00 2.04 ? 47 ARG A HA   1 
ATOM 715 H HB2  . ARG A 1 47 ? 91.153  0.177   -0.590  1.00 2.36 ? 47 ARG A HB2  1 
ATOM 716 H HB3  . ARG A 1 47 ? 89.750  -0.808  -0.737  1.00 2.30 ? 47 ARG A HB3  1 
ATOM 717 H HG2  . ARG A 1 47 ? 91.000  -2.780  -0.375  1.00 2.20 ? 47 ARG A HG2  1 
ATOM 718 H HG3  . ARG A 1 47 ? 92.489  -1.849  -0.195  1.00 2.16 ? 47 ARG A HG3  1 
ATOM 719 H HD2  . ARG A 1 47 ? 91.766  -1.255  1.880   1.00 2.63 ? 47 ARG A HD2  1 
ATOM 720 H HD3  . ARG A 1 47 ? 90.355  -0.741  1.105   1.00 2.70 ? 47 ARG A HD3  1 
ATOM 721 H HE   . ARG A 1 47 ? 90.609  -3.382  1.971   1.00 3.72 ? 47 ARG A HE   1 
ATOM 722 H HH11 . ARG A 1 47 ? 88.669  -0.800  0.414   1.00 3.08 ? 47 ARG A HH11 1 
ATOM 723 H HH12 . ARG A 1 47 ? 87.238  -1.078  1.305   1.00 3.98 ? 47 ARG A HH12 1 
ATOM 724 H HH21 . ARG A 1 47 ? 88.961  -3.588  3.446   1.00 4.95 ? 47 ARG A HH21 1 
ATOM 725 H HH22 . ARG A 1 47 ? 87.473  -2.798  3.281   1.00 4.90 ? 47 ARG A HH22 1 
ATOM 726 N N    . ARG A 1 48 ? 92.198  0.955   -3.066  1.00 1.63 ? 48 ARG A N    1 
ATOM 727 C CA   . ARG A 1 48 ? 93.353  1.748   -3.321  1.00 1.43 ? 48 ARG A CA   1 
ATOM 728 C C    . ARG A 1 48 ? 93.470  2.837   -2.323  1.00 1.46 ? 48 ARG A C    1 
ATOM 729 O O    . ARG A 1 48 ? 92.489  3.230   -1.702  1.00 1.68 ? 48 ARG A O    1 
ATOM 730 C CB   . ARG A 1 48 ? 93.265  2.365   -4.661  1.00 1.48 ? 48 ARG A CB   1 
ATOM 731 C CG   . ARG A 1 48 ? 93.768  1.471   -5.706  1.00 1.37 ? 48 ARG A CG   1 
ATOM 732 C CD   . ARG A 1 48 ? 92.615  1.139   -6.400  1.00 1.63 ? 48 ARG A CD   1 
ATOM 733 N NE   . ARG A 1 48 ? 92.740  0.517   -7.586  1.00 1.73 ? 48 ARG A NE   1 
ATOM 734 C CZ   . ARG A 1 48 ? 91.665  0.415   -8.334  1.00 1.96 ? 48 ARG A CZ   1 
ATOM 735 N NH1  . ARG A 1 48 ? 90.569  1.104   -7.816  1.00 2.16 ? 48 ARG A NH1  1 
ATOM 736 N NH2  . ARG A 1 48 ? 91.620  -0.316  -9.472  1.00 2.78 ? 48 ARG A NH2  1 
ATOM 737 H H    . ARG A 1 48 ? 91.303  1.322   -3.222  1.00 1.82 ? 48 ARG A H    1 
ATOM 738 H HA   . ARG A 1 48 ? 94.218  1.111   -3.281  1.00 1.26 ? 48 ARG A HA   1 
ATOM 739 H HB2  . ARG A 1 48 ? 92.213  2.545   -4.851  1.00 1.66 ? 48 ARG A HB2  1 
ATOM 740 H HB3  . ARG A 1 48 ? 93.797  3.290   -4.695  1.00 1.47 ? 48 ARG A HB3  1 
ATOM 741 H HG2  . ARG A 1 48 ? 94.433  1.979   -6.363  1.00 1.26 ? 48 ARG A HG2  1 
ATOM 742 H HG3  . ARG A 1 48 ? 94.202  0.581   -5.280  1.00 1.31 ? 48 ARG A HG3  1 
ATOM 743 H HD2  . ARG A 1 48 ? 91.991  0.566   -5.769  1.00 2.30 ? 48 ARG A HD2  1 
ATOM 744 H HD3  . ARG A 1 48 ? 92.144  2.050   -6.618  1.00 1.93 ? 48 ARG A HD3  1 
ATOM 745 H HE   . ARG A 1 48 ? 93.601  0.137   -7.826  1.00 2.29 ? 48 ARG A HE   1 
ATOM 746 H HH11 . ARG A 1 48 ? 90.659  1.585   -6.944  1.00 2.24 ? 48 ARG A HH11 1 
ATOM 747 H HH12 . ARG A 1 48 ? 89.696  1.121   -8.259  1.00 2.72 ? 48 ARG A HH12 1 
ATOM 748 H HH21 . ARG A 1 48 ? 92.439  -0.815  -9.779  1.00 3.27 ? 48 ARG A HH21 1 
ATOM 749 H HH22 . ARG A 1 48 ? 90.828  -0.386  -10.028 1.00 3.19 ? 48 ARG A HH22 1 
ATOM 750 N N    . GLY A 1 49 ? 94.667  3.336   -2.197  1.00 1.27 ? 49 GLY A N    1 
ATOM 751 C CA   . GLY A 1 49 ? 94.894  4.398   -1.276  1.00 1.34 ? 49 GLY A CA   1 
ATOM 752 C C    . GLY A 1 49 ? 96.353  4.717   -1.129  1.00 1.18 ? 49 GLY A C    1 
ATOM 753 O O    . GLY A 1 49 ? 97.215  3.905   -1.462  1.00 0.97 ? 49 GLY A O    1 
ATOM 754 H H    . GLY A 1 49 ? 95.403  2.982   -2.741  1.00 1.11 ? 49 GLY A H    1 
ATOM 755 H HA2  . GLY A 1 49 ? 94.370  5.271   -1.607  1.00 1.51 ? 49 GLY A HA2  1 
ATOM 756 H HA3  . GLY A 1 49 ? 94.503  4.108   -0.322  1.00 1.38 ? 49 GLY A HA3  1 
ATOM 757 N N    . ILE A 1 50 ? 96.631  5.894   -0.626  1.00 1.31 ? 50 ILE A N    1 
ATOM 758 C CA   . ILE A 1 50 ? 97.995  6.325   -0.426  1.00 1.25 ? 50 ILE A CA   1 
ATOM 759 C C    . ILE A 1 50 ? 98.335  6.333   1.050   1.00 1.24 ? 50 ILE A C    1 
ATOM 760 O O    . ILE A 1 50 ? 97.465  6.510   1.897   1.00 1.36 ? 50 ILE A O    1 
ATOM 761 C CB   . ILE A 1 50 ? 98.223  7.730   -0.994  1.00 1.48 ? 50 ILE A CB   1 
ATOM 762 C CG1  . ILE A 1 50 ? 97.191  8.688   -0.428  1.00 1.70 ? 50 ILE A CG1  1 
ATOM 763 C CG2  . ILE A 1 50 ? 98.136  7.711   -2.508  1.00 1.50 ? 50 ILE A CG2  1 
ATOM 764 C CD1  . ILE A 1 50 ? 97.765  10.049  -0.117  1.00 1.90 ? 50 ILE A CD1  1 
ATOM 765 H H    . ILE A 1 50 ? 95.898  6.495   -0.375  1.00 1.48 ? 50 ILE A H    1 
ATOM 766 H HA   . ILE A 1 50 ? 98.645  5.635   -0.938  1.00 1.09 ? 50 ILE A HA   1 
ATOM 767 H HB   . ILE A 1 50 ? 99.207  8.060   -0.713  1.00 1.48 ? 50 ILE A HB   1 
ATOM 768 H HG12 . ILE A 1 50 ? 96.390  8.814   -1.140  1.00 1.75 ? 50 ILE A HG12 1 
ATOM 769 H HG13 . ILE A 1 50 ? 96.797  8.279   0.489   1.00 1.72 ? 50 ILE A HG13 1 
ATOM 770 H HG21 . ILE A 1 50 ? 97.194  7.306   -2.807  1.00 1.86 ? 50 ILE A HG21 1 
ATOM 771 H HG22 . ILE A 1 50 ? 98.913  7.101   -2.916  1.00 1.68 ? 50 ILE A HG22 1 
ATOM 772 H HG23 . ILE A 1 50 ? 98.230  8.705   -2.890  1.00 1.91 ? 50 ILE A HG23 1 
ATOM 773 H HD11 . ILE A 1 50 ? 97.197  10.802  -0.590  1.00 2.39 ? 50 ILE A HD11 1 
ATOM 774 H HD12 . ILE A 1 50 ? 98.757  10.109  -0.452  1.00 2.06 ? 50 ILE A HD12 1 
ATOM 775 H HD13 . ILE A 1 50 ? 97.759  10.217  0.926   1.00 2.14 ? 50 ILE A HD13 1 
ATOM 776 N N    . PHE A 1 51 ? 99.602  6.144   1.353   1.00 1.13 ? 51 PHE A N    1 
ATOM 777 C CA   . PHE A 1 51 ? 100.047 6.144   2.730   1.00 1.13 ? 51 PHE A CA   1 
ATOM 778 C C    . PHE A 1 51 ? 101.563 6.200   2.792   1.00 1.10 ? 51 PHE A C    1 
ATOM 779 O O    . PHE A 1 51 ? 102.256 5.826   1.844   1.00 1.05 ? 51 PHE A O    1 
ATOM 780 C CB   . PHE A 1 51 ? 99.547  4.896   3.450   1.00 0.98 ? 51 PHE A CB   1 
ATOM 781 C CG   . PHE A 1 51 ? 100.154 3.666   2.898   1.00 0.74 ? 51 PHE A CG   1 
ATOM 782 C CD1  . PHE A 1 51 ? 99.901  3.314   1.543   1.00 1.29 ? 51 PHE A CD1  1 
ATOM 783 C CD2  . PHE A 1 51 ? 100.955 2.838   3.704   1.00 1.34 ? 51 PHE A CD2  1 
ATOM 784 C CE1  . PHE A 1 51 ? 100.459 2.171   1.000   1.00 1.27 ? 51 PHE A CE1  1 
ATOM 785 C CE2  . PHE A 1 51 ? 101.515 1.696   3.174   1.00 1.25 ? 51 PHE A CE2  1 
ATOM 786 C CZ   . PHE A 1 51 ? 101.263 1.334   1.812   1.00 0.49 ? 51 PHE A CZ   1 
ATOM 787 H H    . PHE A 1 51 ? 100.251 6.005   0.633   1.00 1.08 ? 51 PHE A H    1 
ATOM 788 H HA   . PHE A 1 51 ? 99.646  7.013   3.211   1.00 1.31 ? 51 PHE A HA   1 
ATOM 789 H HB2  . PHE A 1 51 ? 99.801  4.958   4.505   1.00 1.01 ? 51 PHE A HB2  1 
ATOM 790 H HB3  . PHE A 1 51 ? 98.475  4.822   3.343   1.00 1.08 ? 51 PHE A HB3  1 
ATOM 791 H HD1  . PHE A 1 51 ? 99.266  3.974   0.921   1.00 2.13 ? 51 PHE A HD1  1 
ATOM 792 H HD2  . PHE A 1 51 ? 101.159 3.125   4.767   1.00 2.21 ? 51 PHE A HD2  1 
ATOM 793 H HE1  . PHE A 1 51 ? 100.257 1.911   -0.055  1.00 2.14 ? 51 PHE A HE1  1 
ATOM 794 H HE2  . PHE A 1 51 ? 102.127 1.062   3.808   1.00 2.09 ? 51 PHE A HE2  1 
ATOM 795 H HZ   . PHE A 1 51 ? 101.708 0.426   1.396   1.00 0.53 ? 51 PHE A HZ   1 
ATOM 796 N N    . PRO A 1 52 ? 102.098 6.646   3.926   1.00 1.18 ? 52 PRO A N    1 
ATOM 797 C CA   . PRO A 1 52 ? 103.534 6.724   4.120   1.00 1.24 ? 52 PRO A CA   1 
ATOM 798 C C    . PRO A 1 52 ? 104.145 5.339   4.059   1.00 1.08 ? 52 PRO A C    1 
ATOM 799 O O    . PRO A 1 52 ? 103.959 4.538   4.971   1.00 0.96 ? 52 PRO A O    1 
ATOM 800 C CB   . PRO A 1 52 ? 103.698 7.314   5.523   1.00 1.34 ? 52 PRO A CB   1 
ATOM 801 C CG   . PRO A 1 52 ? 102.359 7.880   5.878   1.00 1.44 ? 52 PRO A CG   1 
ATOM 802 C CD   . PRO A 1 52 ? 101.347 7.075   5.112   1.00 1.26 ? 52 PRO A CD   1 
ATOM 803 H HA   . PRO A 1 52 ? 104.003 7.367   3.388   1.00 1.39 ? 52 PRO A HA   1 
ATOM 804 H HB2  . PRO A 1 52 ? 103.990 6.531   6.205   1.00 1.26 ? 52 PRO A HB2  1 
ATOM 805 H HB3  . PRO A 1 52 ? 104.459 8.079   5.505   1.00 1.48 ? 52 PRO A HB3  1 
ATOM 806 H HG2  . PRO A 1 52 ? 102.191 7.784   6.940   1.00 1.52 ? 52 PRO A HG2  1 
ATOM 807 H HG3  . PRO A 1 52 ? 102.310 8.917   5.587   1.00 1.66 ? 52 PRO A HG3  1 
ATOM 808 H HD2  . PRO A 1 52 ? 101.021 6.223   5.690   1.00 1.12 ? 52 PRO A HD2  1 
ATOM 809 H HD3  . PRO A 1 52 ? 100.502 7.688   4.831   1.00 1.39 ? 52 PRO A HD3  1 
ATOM 810 N N    . SER A 1 53 ? 104.869 5.051   2.992   1.00 1.14 ? 53 SER A N    1 
ATOM 811 C CA   . SER A 1 53 ? 105.493 3.752   2.842   1.00 1.09 ? 53 SER A CA   1 
ATOM 812 C C    . SER A 1 53 ? 106.353 3.435   4.049   1.00 1.18 ? 53 SER A C    1 
ATOM 813 O O    . SER A 1 53 ? 106.655 2.281   4.346   1.00 1.17 ? 53 SER A O    1 
ATOM 814 C CB   . SER A 1 53 ? 106.337 3.731   1.565   1.00 1.26 ? 53 SER A CB   1 
ATOM 815 O OG   . SER A 1 53 ? 107.037 4.968   1.374   1.00 1.97 ? 53 SER A OG   1 
ATOM 816 H H    . SER A 1 53 ? 104.992 5.722   2.291   1.00 1.26 ? 53 SER A H    1 
ATOM 817 H HA   . SER A 1 53 ? 104.711 3.013   2.775   1.00 0.92 ? 53 SER A HA   1 
ATOM 818 H HB2  . SER A 1 53 ? 107.063 2.960   1.646   1.00 1.27 ? 53 SER A HB2  1 
ATOM 819 H HB3  . SER A 1 53 ? 105.703 3.530   0.721   1.00 1.50 ? 53 SER A HB3  1 
ATOM 820 H HG   . SER A 1 53 ? 106.775 5.406   0.558   1.00 2.45 ? 53 SER A HG   1 
ATOM 821 N N    . ASN A 1 54 ? 106.716 4.472   4.757   1.00 1.31 ? 54 ASN A N    1 
ATOM 822 C CA   . ASN A 1 54 ? 107.519 4.334   5.946   1.00 1.41 ? 54 ASN A CA   1 
ATOM 823 C C    . ASN A 1 54 ? 106.870 3.418   6.946   1.00 1.26 ? 54 ASN A C    1 
ATOM 824 O O    . ASN A 1 54 ? 107.524 2.880   7.836   1.00 1.33 ? 54 ASN A O    1 
ATOM 825 C CB   . ASN A 1 54 ? 107.681 5.650   6.575   1.00 1.57 ? 54 ASN A CB   1 
ATOM 826 C CG   . ASN A 1 54 ? 109.138 6.032   6.712   1.00 2.27 ? 54 ASN A CG   1 
ATOM 827 O OD1  . ASN A 1 54 ? 110.036 5.298   6.334   1.00 2.89 ? 54 ASN A OD1  1 
ATOM 828 N ND2  . ASN A 1 54 ? 109.366 7.184   7.263   1.00 2.45 ? 54 ASN A ND2  1 
ATOM 829 H H    . ASN A 1 54 ? 106.417 5.366   4.486   1.00 1.37 ? 54 ASN A H    1 
ATOM 830 H HA   . ASN A 1 54 ? 108.476 3.963   5.668   1.00 1.53 ? 54 ASN A HA   1 
ATOM 831 H HB2  . ASN A 1 54 ? 107.162 6.363   5.989   1.00 1.80 ? 54 ASN A HB2  1 
ATOM 832 H HB3  . ASN A 1 54 ? 107.238 5.619   7.538   1.00 1.68 ? 54 ASN A HB3  1 
ATOM 833 H HD21 . ASN A 1 54 ? 108.614 7.678   7.529   1.00 2.07 ? 54 ASN A HD21 1 
ATOM 834 H HD22 . ASN A 1 54 ? 110.272 7.486   7.375   1.00 3.08 ? 54 ASN A HD22 1 
ATOM 835 N N    . TYR A 1 55 ? 105.574 3.285   6.799   1.00 1.06 ? 55 TYR A N    1 
ATOM 836 C CA   . TYR A 1 55 ? 104.808 2.482   7.675   1.00 0.94 ? 55 TYR A CA   1 
ATOM 837 C C    . TYR A 1 55 ? 104.681 1.064   7.167   1.00 0.86 ? 55 TYR A C    1 
ATOM 838 O O    . TYR A 1 55 ? 103.798 0.326   7.584   1.00 0.78 ? 55 TYR A O    1 
ATOM 839 C CB   . TYR A 1 55 ? 103.440 3.097   7.835   1.00 0.85 ? 55 TYR A CB   1 
ATOM 840 C CG   . TYR A 1 55 ? 103.260 3.791   9.150   1.00 0.96 ? 55 TYR A CG   1 
ATOM 841 C CD1  . TYR A 1 55 ? 103.588 3.137   10.317  1.00 1.61 ? 55 TYR A CD1  1 
ATOM 842 C CD2  . TYR A 1 55 ? 102.720 5.053   9.237   1.00 1.53 ? 55 TYR A CD2  1 
ATOM 843 C CE1  . TYR A 1 55 ? 103.412 3.731   11.567  1.00 1.71 ? 55 TYR A CE1  1 
ATOM 844 C CE2  . TYR A 1 55 ? 102.545 5.711   10.498  1.00 1.60 ? 55 TYR A CE2  1 
ATOM 845 C CZ   . TYR A 1 55 ? 102.852 4.985   11.648  1.00 1.21 ? 55 TYR A CZ   1 
ATOM 846 O OH   . TYR A 1 55 ? 102.622 5.589   12.892  1.00 1.34 ? 55 TYR A OH   1 
ATOM 847 H H    . TYR A 1 55 ? 105.121 3.768   6.085   1.00 1.03 ? 55 TYR A H    1 
ATOM 848 H HA   . TYR A 1 55 ? 105.289 2.465   8.645   1.00 1.03 ? 55 TYR A HA   1 
ATOM 849 H HB2  . TYR A 1 55 ? 103.274 3.831   7.048   1.00 0.89 ? 55 TYR A HB2  1 
ATOM 850 H HB3  . TYR A 1 55 ? 102.666 2.320   7.726   1.00 0.75 ? 55 TYR A HB3  1 
ATOM 851 H HD1  . TYR A 1 55 ? 103.995 2.132   10.272  1.00 2.38 ? 55 TYR A HD1  1 
ATOM 852 H HD2  . TYR A 1 55 ? 102.516 5.628   8.316   1.00 2.30 ? 55 TYR A HD2  1 
ATOM 853 H HE1  . TYR A 1 55 ? 103.674 3.175   12.453  1.00 2.52 ? 55 TYR A HE1  1 
ATOM 854 H HE2  . TYR A 1 55 ? 102.068 6.657   10.553  1.00 2.36 ? 55 TYR A HE2  1 
ATOM 855 H HH   . TYR A 1 55 ? 103.437 5.962   13.234  1.00 1.67 ? 55 TYR A HH   1 
ATOM 856 N N    . VAL A 1 56 ? 105.565 0.692   6.250   1.00 0.97 ? 56 VAL A N    1 
ATOM 857 C CA   . VAL A 1 56 ? 105.520 -0.631  5.679   1.00 0.99 ? 56 VAL A CA   1 
ATOM 858 C C    . VAL A 1 56 ? 106.902 -1.125  5.326   1.00 1.24 ? 56 VAL A C    1 
ATOM 859 O O    . VAL A 1 56 ? 107.908 -0.534  5.715   1.00 1.40 ? 56 VAL A O    1 
ATOM 860 C CB   . VAL A 1 56 ? 104.626 -0.669  4.428   1.00 0.83 ? 56 VAL A CB   1 
ATOM 861 C CG1  . VAL A 1 56 ? 103.335 0.062   4.689   1.00 0.61 ? 56 VAL A CG1  1 
ATOM 862 C CG2  . VAL A 1 56 ? 105.338 -0.065  3.214   1.00 0.93 ? 56 VAL A CG2  1 
ATOM 863 H H    . VAL A 1 56 ? 106.246 1.323   5.940   1.00 1.08 ? 56 VAL A H    1 
ATOM 864 H HA   . VAL A 1 56 ? 105.094 -1.292  6.418   1.00 0.98 ? 56 VAL A HA   1 
ATOM 865 H HB   . VAL A 1 56 ? 104.388 -1.693  4.207   1.00 0.86 ? 56 VAL A HB   1 
ATOM 866 H HG11 . VAL A 1 56 ? 103.379 0.587   5.589   1.00 0.99 ? 56 VAL A HG11 1 
ATOM 867 H HG12 . VAL A 1 56 ? 102.531 -0.604  4.733   1.00 1.22 ? 56 VAL A HG12 1 
ATOM 868 H HG13 . VAL A 1 56 ? 103.170 0.733   3.915   1.00 1.14 ? 56 VAL A HG13 1 
ATOM 869 H HG21 . VAL A 1 56 ? 105.516 -0.804  2.489   1.00 1.35 ? 56 VAL A HG21 1 
ATOM 870 H HG22 . VAL A 1 56 ? 106.259 0.351   3.497   1.00 1.39 ? 56 VAL A HG22 1 
ATOM 871 H HG23 . VAL A 1 56 ? 104.746 0.699   2.790   1.00 1.42 ? 56 VAL A HG23 1 
ATOM 872 N N    . ALA A 1 57 ? 106.941 -2.213  4.591   1.00 1.33 ? 57 ALA A N    1 
ATOM 873 C CA   . ALA A 1 57 ? 108.189 -2.797  4.186   1.00 1.59 ? 57 ALA A CA   1 
ATOM 874 C C    . ALA A 1 57 ? 107.978 -3.729  3.010   1.00 1.61 ? 57 ALA A C    1 
ATOM 875 O O    . ALA A 1 57 ? 107.314 -4.760  3.136   1.00 1.60 ? 57 ALA A O    1 
ATOM 876 C CB   . ALA A 1 57 ? 108.816 -3.533  5.355   1.00 1.78 ? 57 ALA A CB   1 
ATOM 877 H H    . ALA A 1 57 ? 106.103 -2.637  4.316   1.00 1.22 ? 57 ALA A H    1 
ATOM 878 H HA   . ALA A 1 57 ? 108.851 -2.000  3.890   1.00 1.67 ? 57 ALA A HA   1 
ATOM 879 H HB1  . ALA A 1 57 ? 108.126 -4.279  5.724   1.00 2.18 ? 57 ALA A HB1  1 
ATOM 880 H HB2  . ALA A 1 57 ? 109.030 -2.827  6.151   1.00 1.92 ? 57 ALA A HB2  1 
ATOM 881 H HB3  . ALA A 1 57 ? 109.737 -4.012  5.027   1.00 2.16 ? 57 ALA A HB3  1 
ATOM 882 N N    . PRO A 1 58 ? 108.543 -3.384  1.845   1.00 1.69 ? 58 PRO A N    1 
ATOM 883 C CA   . PRO A 1 58 ? 108.418 -4.203  0.648   1.00 1.74 ? 58 PRO A CA   1 
ATOM 884 C C    . PRO A 1 58 ? 108.675 -5.657  0.966   1.00 1.92 ? 58 PRO A C    1 
ATOM 885 O O    . PRO A 1 58 ? 109.749 -6.031  1.430   1.00 2.12 ? 58 PRO A O    1 
ATOM 886 C CB   . PRO A 1 58 ? 109.496 -3.642  -0.273  1.00 1.91 ? 58 PRO A CB   1 
ATOM 887 C CG   . PRO A 1 58 ? 109.601 -2.209  0.124   1.00 1.85 ? 58 PRO A CG   1 
ATOM 888 C CD   . PRO A 1 58 ? 109.355 -2.178  1.608   1.00 1.77 ? 58 PRO A CD   1 
ATOM 889 H HA   . PRO A 1 58 ? 107.449 -4.094  0.185   1.00 1.57 ? 58 PRO A HA   1 
ATOM 890 H HB2  . PRO A 1 58 ? 110.422 -4.170  -0.110  1.00 2.10 ? 58 PRO A HB2  1 
ATOM 891 H HB3  . PRO A 1 58 ? 109.188 -3.746  -1.303  1.00 1.89 ? 58 PRO A HB3  1 
ATOM 892 H HG2  . PRO A 1 58 ? 110.588 -1.834  -0.103  1.00 2.02 ? 58 PRO A HG2  1 
ATOM 893 H HG3  . PRO A 1 58 ? 108.849 -1.629  -0.392  1.00 1.71 ? 58 PRO A HG3  1 
ATOM 894 H HD2  . PRO A 1 58 ? 110.289 -2.231  2.148   1.00 1.94 ? 58 PRO A HD2  1 
ATOM 895 H HD3  . PRO A 1 58 ? 108.807 -1.288  1.884   1.00 1.65 ? 58 PRO A HD3  1 
ATOM 896 N N    . TYR A 1 59 ? 107.706 -6.472  0.686   1.00 1.88 ? 59 TYR A N    1 
ATOM 897 C CA   . TYR A 1 59 ? 107.829 -7.854  0.887   1.00 2.08 ? 59 TYR A CA   1 
ATOM 898 C C    . TYR A 1 59 ? 108.209 -8.304  -0.447  1.00 2.19 ? 59 TYR A C    1 
ATOM 899 O O    . TYR A 1 59 ? 109.279 -8.903  -0.676  1.00 2.42 ? 59 TYR A O    1 
ATOM 900 C CB   . TYR A 1 59 ? 106.502 -8.419  1.353   1.00 2.03 ? 59 TYR A CB   1 
ATOM 901 C CG   . TYR A 1 59 ? 106.508 -9.878  1.560   1.00 2.25 ? 59 TYR A CG   1 
ATOM 902 C CD1  . TYR A 1 59 ? 107.719 -10.623 1.473   1.00 2.69 ? 59 TYR A CD1  1 
ATOM 903 C CD2  . TYR A 1 59 ? 105.306 -10.553 1.849   1.00 2.57 ? 59 TYR A CD2  1 
ATOM 904 C CE1  . TYR A 1 59 ? 107.730 -11.971 1.707   1.00 2.88 ? 59 TYR A CE1  1 
ATOM 905 C CE2  . TYR A 1 59 ? 105.298 -11.904 2.083   1.00 2.78 ? 59 TYR A CE2  1 
ATOM 906 C CZ   . TYR A 1 59 ? 106.514 -12.627 2.003   1.00 2.68 ? 59 TYR A CZ   1 
ATOM 907 O OH   . TYR A 1 59 ? 106.511 -13.982 2.229   1.00 2.91 ? 59 TYR A OH   1 
ATOM 908 H H    . TYR A 1 59 ? 106.883 -6.134  0.270   1.00 1.73 ? 59 TYR A H    1 
ATOM 909 H HA   . TYR A 1 59 ? 108.610 -8.086  1.597   1.00 2.23 ? 59 TYR A HA   1 
ATOM 910 H HB2  . TYR A 1 59 ? 106.274 -7.962  2.311   1.00 2.01 ? 59 TYR A HB2  1 
ATOM 911 H HB3  . TYR A 1 59 ? 105.726 -8.158  0.646   1.00 1.92 ? 59 TYR A HB3  1 
ATOM 912 H HD1  . TYR A 1 59 ? 108.658 -10.083 1.236   1.00 3.18 ? 59 TYR A HD1  1 
ATOM 913 H HD2  . TYR A 1 59 ? 104.372 -9.962  1.898   1.00 3.00 ? 59 TYR A HD2  1 
ATOM 914 H HE1  . TYR A 1 59 ? 108.682 -12.535 1.647   1.00 3.47 ? 59 TYR A HE1  1 
ATOM 915 H HE2  . TYR A 1 59 ? 104.350 -12.417 2.322   1.00 3.31 ? 59 TYR A HE2  1 
ATOM 916 H HH   . TYR A 1 59 ? 106.132 -14.431 1.467   1.00 3.09 ? 59 TYR A HH   1 
ATOM 917 N N    . ASN A 1 60 ? 107.305 -7.996  -1.369  1.00 2.07 ? 60 ASN A N    1 
ATOM 918 C CA   . ASN A 1 60 ? 107.531 -8.377  -2.694  1.00 2.20 ? 60 ASN A CA   1 
ATOM 919 C C    . ASN A 1 60 ? 108.068 -9.552  -2.561  1.00 2.28 ? 60 ASN A C    1 
ATOM 920 O O    . ASN A 1 60 ? 109.103 -9.917  -3.124  1.00 2.76 ? 60 ASN A O    1 
ATOM 921 C CB   . ASN A 1 60 ? 108.521 -7.809  -3.593  1.00 3.01 ? 60 ASN A CB   1 
ATOM 922 C CG   . ASN A 1 60 ? 108.801 -8.941  -4.690  1.00 3.22 ? 60 ASN A CG   1 
ATOM 923 O OD1  . ASN A 1 60 ? 109.900 -9.425  -4.731  1.00 3.39 ? 60 ASN A OD1  1 
ATOM 924 N ND2  . ASN A 1 60 ? 107.764 -9.485  -5.440  1.00 3.66 ? 60 ASN A ND2  1 
ATOM 925 H H    . ASN A 1 60 ? 106.447 -7.565  -1.101  1.00 1.92 ? 60 ASN A H    1 
ATOM 926 H HA   . ASN A 1 60 ? 106.627 -8.563  -3.221  1.00 2.26 ? 60 ASN A HA   1 
ATOM 927 H HB2  . ASN A 1 60 ? 108.215 -6.884  -4.003  1.00 3.39 ? 60 ASN A HB2  1 
ATOM 928 H HB3  . ASN A 1 60 ? 109.381 -7.660  -3.013  1.00 3.47 ? 60 ASN A HB3  1 
ATOM 929 H HD21 . ASN A 1 60 ? 106.876 -9.178  -5.261  1.00 3.99 ? 60 ASN A HD21 1 
ATOM 930 H HD22 . ASN A 1 60 ? 107.954 -10.190 -6.180  1.00 3.85 ? 60 ASN A HD22 1 
ATOM 931 N N    . SER A 1 61 ? 107.208 -10.151 -2.041  1.00 2.45 ? 61 SER A N    1 
ATOM 932 C CA   . SER A 1 61 ? 107.320 -11.348 -2.116  1.00 3.39 ? 61 SER A CA   1 
ATOM 933 C C    . SER A 1 61 ? 108.081 -11.456 -3.253  1.00 3.66 ? 61 SER A C    1 
ATOM 934 O O    . SER A 1 61 ? 107.544 -11.633 -4.281  1.00 3.93 ? 61 SER A O    1 
ATOM 935 C CB   . SER A 1 61 ? 106.047 -11.758 -2.607  1.00 4.13 ? 61 SER A CB   1 
ATOM 936 O OG   . SER A 1 61 ? 105.416 -12.595 -1.710  1.00 4.49 ? 61 SER A OG   1 
ATOM 937 H H    . SER A 1 61 ? 106.385 -9.767  -1.812  1.00 2.29 ? 61 SER A H    1 
ATOM 938 H HA   . SER A 1 61 ? 107.714 -11.920 -1.350  1.00 3.83 ? 61 SER A HA   1 
ATOM 939 H HB2  . SER A 1 61 ? 105.416 -10.861 -2.837  1.00 4.57 ? 61 SER A HB2  1 
ATOM 940 H HB3  . SER A 1 61 ? 106.201 -12.262 -3.542  1.00 4.44 ? 61 SER A HB3  1 
ATOM 941 H HG   . SER A 1 61 ? 104.721 -12.083 -1.264  1.00 4.81 ? 61 SER A HG   1 
ATOM 942 N N    . ASN A 1 62 ? 109.220 -11.541 -3.121  1.00 4.07 ? 62 ASN A N    1 
ATOM 943 C CA   . ASN A 1 62 ? 109.475 -12.009 -4.162  1.00 4.63 ? 62 ASN A CA   1 
ATOM 944 C C    . ASN A 1 62 ? 108.810 -13.363 -3.657  1.00 4.89 ? 62 ASN A C    1 
ATOM 945 O O    . ASN A 1 62 ? 108.967 -13.727 -2.464  1.00 5.02 ? 62 ASN A O    1 
ATOM 946 C CB   . ASN A 1 62 ? 110.963 -12.010 -4.579  1.00 5.39 ? 62 ASN A CB   1 
ATOM 947 C CG   . ASN A 1 62 ? 110.753 -13.377 -5.271  1.00 6.00 ? 62 ASN A CG   1 
ATOM 948 O OD1  . ASN A 1 62 ? 109.951 -13.550 -6.190  1.00 6.41 ? 62 ASN A OD1  1 
ATOM 949 N ND2  . ASN A 1 62 ? 111.208 -14.260 -4.394  1.00 6.42 ? 62 ASN A ND2  1 
ATOM 950 O OXT  . ASN A 1 62 ? 108.062 -13.975 -4.286  1.00 5.40 ? 62 ASN A OXT  1 
ATOM 951 H H    . ASN A 1 62 ? 109.768 -11.633 -2.388  1.00 4.27 ? 62 ASN A H    1 
ATOM 952 H HA   . ASN A 1 62 ? 108.849 -11.479 -4.899  1.00 4.77 ? 62 ASN A HA   1 
ATOM 953 H HB2  . ASN A 1 62 ? 111.283 -10.992 -5.007  1.00 5.60 ? 62 ASN A HB2  1 
ATOM 954 H HB3  . ASN A 1 62 ? 111.528 -12.197 -3.760  1.00 5.69 ? 62 ASN A HB3  1 
ATOM 955 H HD21 . ASN A 1 62 ? 111.500 -13.855 -3.468  1.00 6.35 ? 62 ASN A HD21 1 
ATOM 956 H HD22 . ASN A 1 62 ? 111.270 -15.190 -4.644  1.00 6.98 ? 62 ASN A HD22 1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  HIS 1  1  ?  ?   ?   A . n 
A 1 2  MET 2  2  ?  ?   ?   A . n 
A 1 3  GLU 3  3  3  GLU GLU A . n 
A 1 4  THR 4  4  4  THR THR A . n 
A 1 5  LYS 5  5  5  LYS LYS A . n 
A 1 6  PHE 6  6  6  PHE PHE A . n 
A 1 7  VAL 7  7  7  VAL VAL A . n 
A 1 8  GLN 8  8  8  GLN GLN A . n 
A 1 9  ALA 9  9  9  ALA ALA A . n 
A 1 10 LEU 10 10 10 LEU LEU A . n 
A 1 11 PHE 11 11 11 PHE PHE A . n 
A 1 12 ASP 12 12 12 ASP ASP A . n 
A 1 13 PHE 13 13 13 PHE PHE A . n 
A 1 14 ASN 14 14 14 ASN ASN A . n 
A 1 15 PRO 15 15 15 PRO PRO A . n 
A 1 16 GLN 16 16 16 GLN GLN A . n 
A 1 17 GLU 17 17 17 GLU GLU A . n 
A 1 18 SER 18 18 18 SER SER A . n 
A 1 19 GLY 19 19 19 GLY GLY A . n 
A 1 20 GLU 20 20 20 GLU GLU A . n 
A 1 21 LEU 21 21 21 LEU LEU A . n 
A 1 22 ALA 22 22 22 ALA ALA A . n 
A 1 23 PHE 23 23 23 PHE PHE A . n 
A 1 24 LYS 24 24 24 LYS LYS A . n 
A 1 25 ARG 25 25 25 ARG ARG A . n 
A 1 26 GLY 26 26 26 GLY GLY A . n 
A 1 27 ASP 27 27 27 ASP ASP A . n 
A 1 28 VAL 28 28 28 VAL VAL A . n 
A 1 29 ILE 29 29 29 ILE ILE A . n 
A 1 30 THR 30 30 30 THR THR A . n 
A 1 31 LEU 31 31 31 LEU LEU A . n 
A 1 32 ILE 32 32 32 ILE ILE A . n 
A 1 33 ASN 33 33 33 ASN ASN A . n 
A 1 34 LYS 34 34 34 LYS LYS A . n 
A 1 35 ASP 35 35 35 ASP ASP A . n 
A 1 36 ASP 36 36 36 ASP ASP A . n 
A 1 37 PRO 37 37 37 PRO PRO A . n 
A 1 38 ASN 38 38 38 ASN ASN A . n 
A 1 39 TRP 39 39 39 TRP TRP A . n 
A 1 40 TRP 40 40 40 TRP TRP A . n 
A 1 41 GLU 41 41 41 GLU GLU A . n 
A 1 42 GLY 42 42 42 GLY GLY A . n 
A 1 43 GLN 43 43 43 GLN GLN A . n 
A 1 44 LEU 44 44 44 LEU LEU A . n 
A 1 45 ASN 45 45 45 ASN ASN A . n 
A 1 46 ASN 46 46 46 ASN ASN A . n 
A 1 47 ARG 47 47 47 ARG ARG A . n 
A 1 48 ARG 48 48 48 ARG ARG A . n 
A 1 49 GLY 49 49 49 GLY GLY A . n 
A 1 50 ILE 50 50 50 ILE ILE A . n 
A 1 51 PHE 51 51 51 PHE PHE A . n 
A 1 52 PRO 52 52 52 PRO PRO A . n 
A 1 53 SER 53 53 53 SER SER A . n 
A 1 54 ASN 54 54 54 ASN ASN A . n 
A 1 55 TYR 55 55 55 TYR TYR A . n 
A 1 56 VAL 56 56 56 VAL VAL A . n 
A 1 57 ALA 57 57 57 ALA ALA A . n 
A 1 58 PRO 58 58 58 PRO PRO A . n 
A 1 59 TYR 59 59 59 TYR TYR A . n 
A 1 60 ASN 60 60 60 ASN ASN A . n 
A 1 61 SER 61 61 61 SER SER A . n 
A 1 62 ASN 62 62 62 ASN ASN A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   ? 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-05-20 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2021-10-27 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
4 4 'Structure model' 'Database references'       
5 4 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' database_2            
2 4 'Structure model' pdbx_nmr_software     
3 4 'Structure model' pdbx_struct_assembly  
4 4 'Structure model' pdbx_struct_oper_list 
5 4 'Structure model' struct_ref_seq_dif    
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_database_2.pdbx_DOI'                
2 4 'Structure model' '_database_2.pdbx_database_accession' 
3 4 'Structure model' '_pdbx_nmr_software.name'             
4 4 'Structure model' '_struct_ref_seq_dif.details'         
# 
_software.name             CNS 
_software.classification   refinement 
_software.version          . 
_software.citation_id      ? 
_software.pdbx_ordinal     1 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 HE2 A PHE 51 ? ? HG13 A VAL 56 ? ? 1.10 
2 1 OD2 A ASP 27 ? ? HD12 A LEU 44 ? ? 1.42 
3 1 O   A SER 61 ? ? HA   A ASN 62 ? ? 1.45 
4 1 OD1 A ASP 27 ? ? HD23 A LEU 44 ? ? 1.52 
5 1 O   A ASN 60 ? ? N    A ASN 62 ? ? 1.63 
6 1 C   A SER 61 ? ? CA   A ASN 62 ? ? 1.75 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1  1 N  A GLU 3  ? ? CA  A GLU 3  ? ? 1.177 1.459 -0.282 0.020 N 
2  1 CA A GLU 3  ? ? CB  A GLU 3  ? ? 1.397 1.535 -0.138 0.022 N 
3  1 CA A GLU 3  ? ? C   A GLU 3  ? ? 1.252 1.525 -0.273 0.026 N 
4  1 C  A GLU 3  ? ? N   A THR 4  ? ? 1.152 1.336 -0.184 0.023 Y 
5  1 N  A THR 4  ? ? CA  A THR 4  ? ? 1.241 1.459 -0.218 0.020 N 
6  1 CB A LYS 5  ? ? CG  A LYS 5  ? ? 1.329 1.521 -0.192 0.027 N 
7  1 CA A LYS 24 ? ? CB  A LYS 24 ? ? 1.394 1.535 -0.141 0.022 N 
8  1 CD A ARG 25 ? ? NE  A ARG 25 ? ? 1.324 1.460 -0.136 0.017 N 
9  1 NE A ARG 25 ? ? CZ  A ARG 25 ? ? 1.221 1.326 -0.105 0.013 N 
10 1 CZ A ARG 47 ? ? NH1 A ARG 47 ? ? 1.441 1.326 0.115  0.013 N 
11 1 CD A ARG 48 ? ? NE  A ARG 48 ? ? 1.345 1.460 -0.115 0.017 N 
12 1 CA A ASN 60 ? ? C   A ASN 60 ? ? 1.299 1.525 -0.226 0.026 N 
13 1 C  A ASN 60 ? ? N   A SER 61 ? ? 1.170 1.336 -0.166 0.023 Y 
14 1 N  A SER 61 ? ? CA  A SER 61 ? ? 1.205 1.459 -0.254 0.020 N 
15 1 CA A SER 61 ? ? CB  A SER 61 ? ? 1.425 1.525 -0.100 0.015 N 
16 1 C  A SER 61 ? ? N   A ASN 62 ? ? 1.150 1.336 -0.186 0.023 Y 
17 1 N  A ASN 62 ? ? CA  A ASN 62 ? ? 1.169 1.459 -0.290 0.020 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CA A GLU 3  ? ? C  A GLU 3  ? ? N   A THR 4  ? ? 103.64 117.20 -13.56 2.20 Y 
2  1 CG A LYS 5  ? ? CD A LYS 5  ? ? CE  A LYS 5  ? ? 93.89  111.90 -18.01 3.00 N 
3  1 CB A PHE 11 ? ? CG A PHE 11 ? ? CD2 A PHE 11 ? ? 116.40 120.80 -4.40  0.70 N 
4  1 CB A LYS 24 ? ? CG A LYS 24 ? ? CD  A LYS 24 ? ? 81.61  111.60 -29.99 2.60 N 
5  1 NE A ARG 25 ? ? CZ A ARG 25 ? ? NH1 A ARG 25 ? ? 112.68 120.30 -7.62  0.50 N 
6  1 NE A ARG 25 ? ? CZ A ARG 25 ? ? NH2 A ARG 25 ? ? 123.64 120.30 3.34   0.50 N 
7  1 NE A ARG 47 ? ? CZ A ARG 47 ? ? NH2 A ARG 47 ? ? 115.36 120.30 -4.94  0.50 N 
8  1 NE A ARG 48 ? ? CZ A ARG 48 ? ? NH1 A ARG 48 ? ? 113.16 120.30 -7.14  0.50 N 
9  1 CB A ASN 60 ? ? CA A ASN 60 ? ? C   A ASN 60 ? ? 97.78  110.40 -12.62 2.00 N 
10 1 N  A ASN 60 ? ? CA A ASN 60 ? ? CB  A ASN 60 ? ? 126.19 110.60 15.59  1.80 N 
11 1 CA A ASN 60 ? ? C  A ASN 60 ? ? N   A SER 61 ? ? 101.82 117.20 -15.38 2.20 Y 
12 1 C  A SER 61 ? ? N  A ASN 62 ? ? CA  A ASN 62 ? ? 98.24  121.70 -23.46 2.50 Y 
13 1 CA A ASN 62 ? ? CB A ASN 62 ? ? CG  A ASN 62 ? ? 89.46  113.40 -23.94 2.20 N 
14 1 N  A ASN 62 ? ? CA A ASN 62 ? ? C   A ASN 62 ? ? 88.10  111.00 -22.90 2.70 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LYS A 24 ? ? -123.28 -166.19 
2 1 ASN A 45 ? ? 79.65   -37.75  
3 1 ASN A 46 ? ? -171.78 -23.05  
4 1 ALA A 57 ? ? -161.34 114.65  
5 1 ASN A 60 ? ? 38.54   62.24   
6 1 SER A 61 ? ? -25.22  94.93   
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    ARG 
_pdbx_validate_planes.auth_asym_id    A 
_pdbx_validate_planes.auth_seq_id     47 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    ? 
_pdbx_validate_planes.rmsd            0.156 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
loop_
_pdbx_validate_polymer_linkage.id 
_pdbx_validate_polymer_linkage.PDB_model_num 
_pdbx_validate_polymer_linkage.auth_atom_id_1 
_pdbx_validate_polymer_linkage.auth_asym_id_1 
_pdbx_validate_polymer_linkage.auth_comp_id_1 
_pdbx_validate_polymer_linkage.auth_seq_id_1 
_pdbx_validate_polymer_linkage.PDB_ins_code_1 
_pdbx_validate_polymer_linkage.label_alt_id_1 
_pdbx_validate_polymer_linkage.auth_atom_id_2 
_pdbx_validate_polymer_linkage.auth_asym_id_2 
_pdbx_validate_polymer_linkage.auth_comp_id_2 
_pdbx_validate_polymer_linkage.auth_seq_id_2 
_pdbx_validate_polymer_linkage.PDB_ins_code_2 
_pdbx_validate_polymer_linkage.label_alt_id_2 
_pdbx_validate_polymer_linkage.dist 
1 1 C A GLU 3  ? ? N A THR 4  ? ? 1.15 
2 1 C A ASN 60 ? ? N A SER 61 ? ? 1.17 
3 1 C A SER 61 ? ? N A ASN 62 ? ? 1.15 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A HIS 1 ? A HIS 1 
2 1 Y 1 A MET 2 ? A MET 2 
#