data_1K9K
# 
_entry.id   1K9K 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1K9K         
RCSB  RCSB014730   
WWPDB D_1000014730 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1K8U 'CRYSTAL STRUCTURE OF CALCIUM FREE HUMAN S100A6 MUTANT CYS3MET (SE DERIVATIVE)' unspecified 
PDB 1K96 'CRYSTAL STRUCTURE OF CALCIUM BOUND HUMAN S100A6'                               unspecified 
PDB 1K9P 'CRYSTAL STRUCTURE OF CALCIUM FREE HUMAN S100A6 WILD TYPE'                      unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1K9K 
_pdbx_database_status.recvd_initial_deposition_date   2001-10-29 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Otterbein, L.R.' 1 
'Dominguez, R.'   2 
# 
_citation.id                        primary 
_citation.title                     
;Crystal structures of S100A6 in the Ca(2+)-free and Ca(2+)-bound states: the calcium sensor mechanism of S100 proteins revealed at atomic resolution.
;
_citation.journal_abbrev            Structure 
_citation.journal_volume            10 
_citation.page_first                557 
_citation.page_last                 567 
_citation.year                      2002 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11937060 
_citation.pdbx_database_id_DOI      '10.1016/S0969-2126(02)00740-2' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Otterbein, L.R.'    1 
primary 'Kordowska, J.'      2 
primary 'Witte-Hoffmann, C.' 3 
primary 'Wang, C.L.'         4 
primary 'Dominguez, R.'      5 
# 
_cell.entry_id           1K9K 
_cell.length_a           56.610 
_cell.length_b           58.439 
_cell.length_c           51.030 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1K9K 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man S100A6               10193.729 2   ? ? ? ? 
2 non-polymer syn 'CALCIUM ION'        40.078    4   ? ? ? ? 
3 non-polymer syn BETA-MERCAPTOETHANOL 78.133    2   ? ? ? ? 
4 water       nat water                18.015    151 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'CALCYCLIN, CACY' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGAL
ALIYNEALKG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGAL
ALIYNEALKG
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  ALA n 
1 3  CYS n 
1 4  PRO n 
1 5  LEU n 
1 6  ASP n 
1 7  GLN n 
1 8  ALA n 
1 9  ILE n 
1 10 GLY n 
1 11 LEU n 
1 12 LEU n 
1 13 VAL n 
1 14 ALA n 
1 15 ILE n 
1 16 PHE n 
1 17 HIS n 
1 18 LYS n 
1 19 TYR n 
1 20 SER n 
1 21 GLY n 
1 22 ARG n 
1 23 GLU n 
1 24 GLY n 
1 25 ASP n 
1 26 LYS n 
1 27 HIS n 
1 28 THR n 
1 29 LEU n 
1 30 SER n 
1 31 LYS n 
1 32 LYS n 
1 33 GLU n 
1 34 LEU n 
1 35 LYS n 
1 36 GLU n 
1 37 LEU n 
1 38 ILE n 
1 39 GLN n 
1 40 LYS n 
1 41 GLU n 
1 42 LEU n 
1 43 THR n 
1 44 ILE n 
1 45 GLY n 
1 46 SER n 
1 47 LYS n 
1 48 LEU n 
1 49 GLN n 
1 50 ASP n 
1 51 ALA n 
1 52 GLU n 
1 53 ILE n 
1 54 ALA n 
1 55 ARG n 
1 56 LEU n 
1 57 MET n 
1 58 GLU n 
1 59 ASP n 
1 60 LEU n 
1 61 ASP n 
1 62 ARG n 
1 63 ASN n 
1 64 LYS n 
1 65 ASP n 
1 66 GLN n 
1 67 GLU n 
1 68 VAL n 
1 69 ASN n 
1 70 PHE n 
1 71 GLN n 
1 72 GLU n 
1 73 TYR n 
1 74 VAL n 
1 75 THR n 
1 76 PHE n 
1 77 LEU n 
1 78 GLY n 
1 79 ALA n 
1 80 LEU n 
1 81 ALA n 
1 82 LEU n 
1 83 ILE n 
1 84 TYR n 
1 85 ASN n 
1 86 GLU n 
1 87 ALA n 
1 88 LEU n 
1 89 LYS n 
1 90 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 S100A6 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 (DE3) pLYS' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pAED4 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    S10A6_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGAL
ALIYNEALKG
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_accession          P06703 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1K9K A 1 ? 90 ? P06703 1 ? 90 ? 1 90 
2 1 1K9K B 1 ? 90 ? P06703 1 ? 90 ? 1 90 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE              ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE             ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE           ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'      ? 'C4 H7 N O4'     133.103 
BME non-polymer         . BETA-MERCAPTOETHANOL ? 'C2 H6 O S'      78.133  
CA  non-polymer         . 'CALCIUM ION'        ? 'Ca 2'           40.078  
CYS 'L-peptide linking' y CYSTEINE             ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE            ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'      ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE              ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE            ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE           ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE              ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE               ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE           ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE        ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE              ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE               ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE            ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE             ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE               ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1K9K 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.10 
_exptl_crystal.density_percent_sol   42 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.8 
_exptl_crystal_grow.pdbx_details    
'20% PEG 5000 MME, 30 mM TRIS-HCL, 8% GLYCEROL, pH 7.8, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2000-12-07 
_diffrn_detector.details                'BENT CYLINDRICAL SI- MIRROR (RH COATING)' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI(III) DOUBLE CRYSTAL MONOCHROMATOR, L1=1' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 14-BM-D' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   14-BM-D 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1 
# 
_reflns.entry_id                     1K9K 
_reflns.observed_criterion_sigma_I   0.00 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             19.2 
_reflns.d_resolution_high            1.75 
_reflns.number_obs                   16853 
_reflns.number_all                   17303 
_reflns.percent_possible_obs         97.4 
_reflns.pdbx_Rmerge_I_obs            0.0620000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        9.9 
_reflns.B_iso_Wilson_estimate        19.27 
_reflns.pdbx_redundancy              4.4 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.75 
_reflns_shell.d_res_low              1.89 
_reflns_shell.percent_possible_all   96.6 
_reflns_shell.Rmerge_I_obs           0.1920000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        3.5 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      3218 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1K9K 
_refine.ls_number_reflns_obs                     16825 
_refine.ls_number_reflns_all                     17303 
_refine.pdbx_ls_sigma_I                          0.00 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             19.2 
_refine.ls_d_res_high                            1.76 
_refine.ls_percent_reflns_obs                    97.0 
_refine.ls_R_factor_obs                          0.1850000 
_refine.ls_R_factor_all                          0.1850000 
_refine.ls_R_factor_R_work                       0.1850000 
_refine.ls_R_factor_R_free                       0.1990000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5 
_refine.ls_number_reflns_R_free                  851 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PSORIASIN S100A7 (PBD # 1PSR)' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1K9K 
_refine_analyze.Luzzati_coordinate_error_obs    ? 
_refine_analyze.Luzzati_sigma_a_obs             0.11 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1414 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         12 
_refine_hist.number_atoms_solvent             151 
_refine_hist.number_atoms_total               1577 
_refine_hist.d_res_high                       1.76 
_refine_hist.d_res_low                        19.2 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d             0.008 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg          1.34  ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_deg 18.79 ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_deg 0.79  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.d_res_high                       1.76 
_refine_ls_shell.d_res_low                        1.90 
_refine_ls_shell.number_reflns_R_work             ? 
_refine_ls_shell.R_factor_R_work                  0.2060000 
_refine_ls_shell.percent_reflns_obs               91.7 
_refine_ls_shell.R_factor_R_free                  0.2270000 
_refine_ls_shell.R_factor_R_free_error            0.11 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             147 
_refine_ls_shell.number_reflns_obs                3019 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1K9K 
_struct.title                     'CRYSTAL STRUCTURE OF CALCIUM BOUND HUMAN S100A6' 
_struct.pdbx_descriptor           'HUMAN S100A6 (CALCYCIN OR CACY), BETA-MERCAPTOETHANOL' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1K9K 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            'S100A6, CALCYCLIN, CALCIUM REGULATORY PROTEIN, CALCIUM BOUND, CACY, SIGNALING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 2 ? 
G N N 2 ? 
H N N 3 ? 
I N N 4 ? 
J N N 4 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  CYS A 3  ? GLY A 21 ? CYS A 3  GLY A 21 1 ? 19 
HELX_P HELX_P2  2  SER A 30 ? LEU A 42 ? SER A 30 LEU A 42 1 ? 13 
HELX_P HELX_P3  3  ILE A 44 ? LEU A 48 ? ILE A 44 LEU A 48 5 ? 5  
HELX_P HELX_P4  4  GLN A 49 ? ASP A 61 ? GLN A 49 ASP A 61 1 ? 13 
HELX_P HELX_P5  5  PHE A 70 ? LEU A 88 ? PHE A 70 LEU A 88 1 ? 19 
HELX_P HELX_P6  6  CYS B 3  ? GLY B 21 ? CYS B 3  GLY B 21 1 ? 19 
HELX_P HELX_P7  7  SER B 30 ? LEU B 42 ? SER B 30 LEU B 42 1 ? 13 
HELX_P HELX_P8  8  ILE B 44 ? LEU B 48 ? ILE B 44 LEU B 48 5 ? 5  
HELX_P HELX_P9  9  GLN B 49 ? ASP B 61 ? GLN B 49 ASP B 61 1 ? 13 
HELX_P HELX_P10 10 ASN B 69 ? LYS B 89 ? ASN B 69 LYS B 89 1 ? 21 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? A CYS 3 SG ? ? ? 1_555 E BME .  S2  ? ? A CYS 3   A BME 100 1_555 ? ? ? ? ? ? ? 2.017 ? 
covale2  covale ? ? B CYS 3 SG ? ? ? 1_555 H BME .  S2  ? ? B CYS 3   B BME 200 1_555 ? ? ? ? ? ? ? 2.030 ? 
metalc1  metalc ? ? C CA  . CA ? ? ? 1_555 A GLU 23 O   ? ? A CA  300 A GLU 23  1_555 ? ? ? ? ? ? ? 2.452 ? 
metalc2  metalc ? ? C CA  . CA ? ? ? 1_555 A ASP 25 O   ? ? A CA  300 A ASP 25  1_555 ? ? ? ? ? ? ? 2.388 ? 
metalc3  metalc ? ? C CA  . CA ? ? ? 1_555 A THR 28 O   ? ? A CA  300 A THR 28  1_555 ? ? ? ? ? ? ? 2.404 ? 
metalc4  metalc ? ? C CA  . CA ? ? ? 1_555 I HOH .  O   ? ? A CA  300 A HOH 409 1_555 ? ? ? ? ? ? ? 2.478 ? 
metalc5  metalc ? ? C CA  . CA ? ? ? 1_555 A GLU 33 OE2 ? ? A CA  300 A GLU 33  1_555 ? ? ? ? ? ? ? 2.659 ? 
metalc6  metalc ? ? C CA  . CA ? ? ? 1_555 A SER 20 O   ? ? A CA  300 A SER 20  1_555 ? ? ? ? ? ? ? 2.304 ? 
metalc7  metalc ? ? C CA  . CA ? ? ? 1_555 A GLU 33 OE1 ? ? A CA  300 A GLU 33  1_555 ? ? ? ? ? ? ? 2.359 ? 
metalc8  metalc ? ? D CA  . CA ? ? ? 1_555 A ASN 63 OD1 ? ? A CA  400 A ASN 63  1_555 ? ? ? ? ? ? ? 2.392 ? 
metalc9  metalc ? ? D CA  . CA ? ? ? 1_555 A ASP 65 OD2 ? ? A CA  400 A ASP 65  1_555 ? ? ? ? ? ? ? 2.373 ? 
metalc10 metalc ? ? D CA  . CA ? ? ? 1_555 A GLU 67 O   ? ? A CA  400 A GLU 67  1_555 ? ? ? ? ? ? ? 2.271 ? 
metalc11 metalc ? ? D CA  . CA ? ? ? 1_555 A GLU 72 OE1 ? ? A CA  400 A GLU 72  1_555 ? ? ? ? ? ? ? 2.503 ? 
metalc12 metalc ? ? D CA  . CA ? ? ? 1_555 A GLU 72 OE2 ? ? A CA  400 A GLU 72  1_555 ? ? ? ? ? ? ? 2.701 ? 
metalc13 metalc ? ? D CA  . CA ? ? ? 1_555 I HOH .  O   ? ? A CA  400 A HOH 401 1_555 ? ? ? ? ? ? ? 2.330 ? 
metalc14 metalc ? ? D CA  . CA ? ? ? 1_555 A ASP 61 OD1 ? ? A CA  400 A ASP 61  1_555 ? ? ? ? ? ? ? 2.349 ? 
metalc15 metalc ? ? F CA  . CA ? ? ? 1_555 B SER 20 O   ? ? B CA  300 B SER 20  1_555 ? ? ? ? ? ? ? 2.293 ? 
metalc16 metalc ? ? F CA  . CA ? ? ? 1_555 B GLU 33 OE1 ? ? B CA  300 B GLU 33  1_555 ? ? ? ? ? ? ? 2.392 ? 
metalc17 metalc ? ? F CA  . CA ? ? ? 1_555 B GLU 33 OE2 ? ? B CA  300 B GLU 33  1_555 ? ? ? ? ? ? ? 2.561 ? 
metalc18 metalc ? ? F CA  . CA ? ? ? 1_555 B GLU 23 O   ? ? B CA  300 B GLU 23  1_555 ? ? ? ? ? ? ? 2.388 ? 
metalc19 metalc ? ? F CA  . CA ? ? ? 1_555 J HOH .  O   ? ? B CA  300 B HOH 402 1_555 ? ? ? ? ? ? ? 2.488 ? 
metalc20 metalc ? ? F CA  . CA ? ? ? 1_555 B THR 28 O   ? ? B CA  300 B THR 28  1_555 ? ? ? ? ? ? ? 2.519 ? 
metalc21 metalc ? ? F CA  . CA ? ? ? 1_555 B ASP 25 O   ? ? B CA  300 B ASP 25  1_555 ? ? ? ? ? ? ? 2.386 ? 
metalc22 metalc ? ? G CA  . CA ? ? ? 1_555 B GLU 67 O   ? ? B CA  400 B GLU 67  1_555 ? ? ? ? ? ? ? 2.216 ? 
metalc23 metalc ? ? G CA  . CA ? ? ? 1_555 B GLU 72 OE1 ? ? B CA  400 B GLU 72  1_555 ? ? ? ? ? ? ? 2.487 ? 
metalc24 metalc ? ? G CA  . CA ? ? ? 1_555 B GLU 72 OE2 ? ? B CA  400 B GLU 72  1_555 ? ? ? ? ? ? ? 2.660 ? 
metalc25 metalc ? ? G CA  . CA ? ? ? 1_555 J HOH .  O   ? ? B CA  400 B HOH 416 1_555 ? ? ? ? ? ? ? 2.405 ? 
metalc26 metalc ? ? G CA  . CA ? ? ? 1_555 B ASP 65 OD2 ? ? B CA  400 B ASP 65  1_555 ? ? ? ? ? ? ? 2.449 ? 
metalc27 metalc ? ? G CA  . CA ? ? ? 1_555 B ASN 63 OD1 ? ? B CA  400 B ASN 63  1_555 ? ? ? ? ? ? ? 2.305 ? 
metalc28 metalc ? ? G CA  . CA ? ? ? 1_555 B ASP 61 OD1 ? ? B CA  400 B ASP 61  1_555 ? ? ? ? ? ? ? 2.345 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     A 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 28 ? LEU A 29 ? THR A 28 LEU A 29 
A 2 VAL A 68 ? ASN A 69 ? VAL A 68 ASN A 69 
# 
_pdbx_struct_sheet_hbond.sheet_id                A 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   LEU 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    29 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    LEU 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     29 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   VAL 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    68 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    VAL 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     68 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA A 300'  
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA A 400'  
AC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA B 300'  
AC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA B 400'  
AC5 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE BME A 100' 
AC6 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE BME B 200' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 SER A 20 ? SER A 20  . ? 1_555 ? 
2  AC1 6 GLU A 23 ? GLU A 23  . ? 1_555 ? 
3  AC1 6 ASP A 25 ? ASP A 25  . ? 1_555 ? 
4  AC1 6 THR A 28 ? THR A 28  . ? 1_555 ? 
5  AC1 6 GLU A 33 ? GLU A 33  . ? 1_555 ? 
6  AC1 6 HOH I .  ? HOH A 409 . ? 1_555 ? 
7  AC2 6 ASP A 61 ? ASP A 61  . ? 1_555 ? 
8  AC2 6 ASN A 63 ? ASN A 63  . ? 1_555 ? 
9  AC2 6 ASP A 65 ? ASP A 65  . ? 1_555 ? 
10 AC2 6 GLU A 67 ? GLU A 67  . ? 1_555 ? 
11 AC2 6 GLU A 72 ? GLU A 72  . ? 1_555 ? 
12 AC2 6 HOH I .  ? HOH A 401 . ? 1_555 ? 
13 AC3 6 SER B 20 ? SER B 20  . ? 1_555 ? 
14 AC3 6 GLU B 23 ? GLU B 23  . ? 1_555 ? 
15 AC3 6 ASP B 25 ? ASP B 25  . ? 1_555 ? 
16 AC3 6 THR B 28 ? THR B 28  . ? 1_555 ? 
17 AC3 6 GLU B 33 ? GLU B 33  . ? 1_555 ? 
18 AC3 6 HOH J .  ? HOH B 402 . ? 1_555 ? 
19 AC4 6 ASP B 61 ? ASP B 61  . ? 1_555 ? 
20 AC4 6 ASN B 63 ? ASN B 63  . ? 1_555 ? 
21 AC4 6 ASP B 65 ? ASP B 65  . ? 1_555 ? 
22 AC4 6 GLU B 67 ? GLU B 67  . ? 1_555 ? 
23 AC4 6 GLU B 72 ? GLU B 72  . ? 1_555 ? 
24 AC4 6 HOH J .  ? HOH B 416 . ? 1_555 ? 
25 AC5 3 CYS A 3  ? CYS A 3   . ? 1_555 ? 
26 AC5 3 HOH I .  ? HOH A 452 . ? 1_555 ? 
27 AC5 3 LYS B 40 ? LYS B 40  . ? 1_555 ? 
28 AC6 2 LYS A 40 ? LYS A 40  . ? 1_555 ? 
29 AC6 2 CYS B 3  ? CYS B 3   . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1K9K 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1K9K 
_atom_sites.fract_transf_matrix[1][1]   0.017665 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017112 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.019596 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ALA A 1 2  ? 36.061 22.832 24.541 1.00 26.48 ? 2   ALA A N   1 
ATOM   2    C  CA  . ALA A 1 2  ? 34.610 22.564 24.727 1.00 25.54 ? 2   ALA A CA  1 
ATOM   3    C  C   . ALA A 1 2  ? 34.413 21.125 25.181 1.00 26.18 ? 2   ALA A C   1 
ATOM   4    O  O   . ALA A 1 2  ? 35.157 20.223 24.798 1.00 27.61 ? 2   ALA A O   1 
ATOM   5    C  CB  . ALA A 1 2  ? 33.861 22.808 23.430 1.00 24.79 ? 2   ALA A CB  1 
ATOM   6    N  N   . CYS A 1 3  ? 33.413 20.935 26.029 1.00 24.47 ? 3   CYS A N   1 
ATOM   7    C  CA  . CYS A 1 3  ? 33.076 19.625 26.553 1.00 22.88 ? 3   CYS A CA  1 
ATOM   8    C  C   . CYS A 1 3  ? 32.092 18.903 25.625 1.00 22.81 ? 3   CYS A C   1 
ATOM   9    O  O   . CYS A 1 3  ? 31.487 19.525 24.757 1.00 19.80 ? 3   CYS A O   1 
ATOM   10   C  CB  . CYS A 1 3  ? 32.531 19.782 27.976 1.00 22.94 ? 3   CYS A CB  1 
ATOM   11   S  SG  . CYS A 1 3  ? 33.870 20.168 29.146 1.00 27.01 ? 3   CYS A SG  1 
ATOM   12   N  N   . PRO A 1 4  ? 31.948 17.572 25.785 1.00 20.88 ? 4   PRO A N   1 
ATOM   13   C  CA  . PRO A 1 4  ? 31.063 16.722 24.978 1.00 20.57 ? 4   PRO A CA  1 
ATOM   14   C  C   . PRO A 1 4  ? 29.688 17.297 24.634 1.00 18.25 ? 4   PRO A C   1 
ATOM   15   O  O   . PRO A 1 4  ? 29.327 17.369 23.456 1.00 18.03 ? 4   PRO A O   1 
ATOM   16   C  CB  . PRO A 1 4  ? 30.990 15.443 25.799 1.00 20.68 ? 4   PRO A CB  1 
ATOM   17   C  CG  . PRO A 1 4  ? 32.398 15.344 26.315 1.00 20.85 ? 4   PRO A CG  1 
ATOM   18   C  CD  . PRO A 1 4  ? 32.689 16.758 26.770 1.00 22.15 ? 4   PRO A CD  1 
ATOM   19   N  N   . LEU A 1 5  ? 28.920 17.694 25.644 1.00 18.18 ? 5   LEU A N   1 
ATOM   20   C  CA  . LEU A 1 5  ? 27.603 18.265 25.390 1.00 17.59 ? 5   LEU A CA  1 
ATOM   21   C  C   . LEU A 1 5  ? 27.691 19.443 24.422 1.00 16.87 ? 5   LEU A C   1 
ATOM   22   O  O   . LEU A 1 5  ? 26.998 19.481 23.410 1.00 15.19 ? 5   LEU A O   1 
ATOM   23   C  CB  . LEU A 1 5  ? 26.962 18.741 26.692 1.00 20.56 ? 5   LEU A CB  1 
ATOM   24   C  CG  . LEU A 1 5  ? 26.206 17.725 27.548 1.00 21.07 ? 5   LEU A CG  1 
ATOM   25   C  CD1 . LEU A 1 5  ? 25.618 18.443 28.759 1.00 21.95 ? 5   LEU A CD1 1 
ATOM   26   C  CD2 . LEU A 1 5  ? 25.092 17.076 26.735 1.00 23.51 ? 5   LEU A CD2 1 
ATOM   27   N  N   . ASP A 1 6  ? 28.558 20.400 24.739 1.00 14.94 ? 6   ASP A N   1 
ATOM   28   C  CA  . ASP A 1 6  ? 28.720 21.593 23.922 1.00 15.80 ? 6   ASP A CA  1 
ATOM   29   C  C   . ASP A 1 6  ? 29.221 21.335 22.510 1.00 15.01 ? 6   ASP A C   1 
ATOM   30   O  O   . ASP A 1 6  ? 28.812 22.012 21.577 1.00 14.92 ? 6   ASP A O   1 
ATOM   31   C  CB  . ASP A 1 6  ? 29.645 22.557 24.647 1.00 15.24 ? 6   ASP A CB  1 
ATOM   32   C  CG  . ASP A 1 6  ? 29.143 22.877 26.025 1.00 17.00 ? 6   ASP A CG  1 
ATOM   33   O  OD1 . ASP A 1 6  ? 28.629 23.992 26.224 1.00 16.84 ? 6   ASP A OD1 1 
ATOM   34   O  OD2 . ASP A 1 6  ? 29.238 21.997 26.904 1.00 19.07 ? 6   ASP A OD2 1 
ATOM   35   N  N   . GLN A 1 7  ? 30.119 20.366 22.362 1.00 14.43 ? 7   GLN A N   1 
ATOM   36   C  CA  . GLN A 1 7  ? 30.669 20.005 21.060 1.00 15.45 ? 7   GLN A CA  1 
ATOM   37   C  C   . GLN A 1 7  ? 29.558 19.484 20.152 1.00 14.84 ? 7   GLN A C   1 
ATOM   38   O  O   . GLN A 1 7  ? 29.441 19.888 18.999 1.00 13.44 ? 7   GLN A O   1 
ATOM   39   C  CB  . GLN A 1 7  ? 31.713 18.902 21.217 1.00 19.34 ? 7   GLN A CB  1 
ATOM   40   C  CG  . GLN A 1 7  ? 32.920 19.268 22.047 1.00 26.71 ? 7   GLN A CG  1 
ATOM   41   C  CD  . GLN A 1 7  ? 33.689 18.036 22.491 1.00 30.07 ? 7   GLN A CD  1 
ATOM   42   O  OE1 . GLN A 1 7  ? 33.948 17.130 21.695 1.00 32.70 ? 7   GLN A OE1 1 
ATOM   43   N  NE2 . GLN A 1 7  ? 34.062 17.997 23.764 1.00 31.00 ? 7   GLN A NE2 1 
ATOM   44   N  N   . ALA A 1 8  ? 28.749 18.570 20.680 1.00 14.14 ? 8   ALA A N   1 
ATOM   45   C  CA  . ALA A 1 8  ? 27.661 17.982 19.904 1.00 15.51 ? 8   ALA A CA  1 
ATOM   46   C  C   . ALA A 1 8  ? 26.584 19.007 19.557 1.00 14.54 ? 8   ALA A C   1 
ATOM   47   O  O   . ALA A 1 8  ? 26.142 19.088 18.414 1.00 13.50 ? 8   ALA A O   1 
ATOM   48   C  CB  . ALA A 1 8  ? 27.052 16.806 20.661 1.00 16.33 ? 8   ALA A CB  1 
ATOM   49   N  N   . ILE A 1 9  ? 26.161 19.780 20.548 1.00 13.24 ? 9   ILE A N   1 
ATOM   50   C  CA  . ILE A 1 9  ? 25.148 20.810 20.339 1.00 12.33 ? 9   ILE A CA  1 
ATOM   51   C  C   . ILE A 1 9  ? 25.701 21.855 19.377 1.00 12.90 ? 9   ILE A C   1 
ATOM   52   O  O   . ILE A 1 9  ? 25.007 22.305 18.464 1.00 11.30 ? 9   ILE A O   1 
ATOM   53   C  CB  . ILE A 1 9  ? 24.764 21.490 21.683 1.00 12.41 ? 9   ILE A CB  1 
ATOM   54   C  CG1 . ILE A 1 9  ? 23.995 20.497 22.557 1.00 13.62 ? 9   ILE A CG1 1 
ATOM   55   C  CG2 . ILE A 1 9  ? 23.901 22.735 21.440 1.00 13.41 ? 9   ILE A CG2 1 
ATOM   56   C  CD1 . ILE A 1 9  ? 22.692 20.033 21.948 1.00 12.62 ? 9   ILE A CD1 1 
ATOM   57   N  N   . GLY A 1 10 ? 26.960 22.224 19.587 1.00 11.74 ? 10  GLY A N   1 
ATOM   58   C  CA  . GLY A 1 10 ? 27.600 23.205 18.730 1.00 13.10 ? 10  GLY A CA  1 
ATOM   59   C  C   . GLY A 1 10 ? 27.578 22.782 17.276 1.00 13.08 ? 10  GLY A C   1 
ATOM   60   O  O   . GLY A 1 10 ? 27.235 23.576 16.405 1.00 13.06 ? 10  GLY A O   1 
ATOM   61   N  N   . LEU A 1 11 ? 27.937 21.530 17.002 1.00 13.59 ? 11  LEU A N   1 
ATOM   62   C  CA  . LEU A 1 11 ? 27.943 21.037 15.630 1.00 14.22 ? 11  LEU A CA  1 
ATOM   63   C  C   . LEU A 1 11 ? 26.551 21.115 15.014 1.00 13.07 ? 11  LEU A C   1 
ATOM   64   O  O   . LEU A 1 11 ? 26.393 21.524 13.862 1.00 12.39 ? 11  LEU A O   1 
ATOM   65   C  CB  . LEU A 1 11 ? 28.427 19.585 15.576 1.00 15.27 ? 11  LEU A CB  1 
ATOM   66   C  CG  . LEU A 1 11 ? 28.469 18.929 14.189 1.00 17.96 ? 11  LEU A CG  1 
ATOM   67   C  CD1 . LEU A 1 11 ? 29.482 19.654 13.312 1.00 19.53 ? 11  LEU A CD1 1 
ATOM   68   C  CD2 . LEU A 1 11 ? 28.855 17.463 14.323 1.00 20.96 ? 11  LEU A CD2 1 
ATOM   69   N  N   . LEU A 1 12 ? 25.543 20.702 15.773 1.00 14.39 ? 12  LEU A N   1 
ATOM   70   C  CA  . LEU A 1 12 ? 24.177 20.731 15.269 1.00 12.96 ? 12  LEU A CA  1 
ATOM   71   C  C   . LEU A 1 12 ? 23.777 22.169 14.941 1.00 12.30 ? 12  LEU A C   1 
ATOM   72   O  O   . LEU A 1 12 ? 23.067 22.418 13.969 1.00 12.16 ? 12  LEU A O   1 
ATOM   73   C  CB  . LEU A 1 12 ? 23.229 20.098 16.290 1.00 14.08 ? 12  LEU A CB  1 
ATOM   74   C  CG  . LEU A 1 12 ? 23.519 18.602 16.478 1.00 12.31 ? 12  LEU A CG  1 
ATOM   75   C  CD1 . LEU A 1 12 ? 22.749 18.053 17.670 1.00 12.03 ? 12  LEU A CD1 1 
ATOM   76   C  CD2 . LEU A 1 12 ? 23.151 17.852 15.211 1.00 14.93 ? 12  LEU A CD2 1 
ATOM   77   N  N   . VAL A 1 13 ? 24.245 23.117 15.743 1.00 11.31 ? 13  VAL A N   1 
ATOM   78   C  CA  . VAL A 1 13 ? 23.944 24.515 15.476 1.00 11.74 ? 13  VAL A CA  1 
ATOM   79   C  C   . VAL A 1 13 ? 24.682 24.984 14.221 1.00 12.73 ? 13  VAL A C   1 
ATOM   80   O  O   . VAL A 1 13 ? 24.114 25.683 13.388 1.00 13.79 ? 13  VAL A O   1 
ATOM   81   C  CB  . VAL A 1 13 ? 24.330 25.414 16.669 1.00 12.81 ? 13  VAL A CB  1 
ATOM   82   C  CG1 . VAL A 1 13 ? 24.242 26.883 16.275 1.00 13.13 ? 13  VAL A CG1 1 
ATOM   83   C  CG2 . VAL A 1 13 ? 23.401 25.133 17.839 1.00 14.10 ? 13  VAL A CG2 1 
ATOM   84   N  N   . ALA A 1 14 ? 25.943 24.586 14.078 1.00 13.54 ? 14  ALA A N   1 
ATOM   85   C  CA  . ALA A 1 14 ? 26.744 24.984 12.921 1.00 12.89 ? 14  ALA A CA  1 
ATOM   86   C  C   . ALA A 1 14 ? 26.142 24.463 11.623 1.00 14.01 ? 14  ALA A C   1 
ATOM   87   O  O   . ALA A 1 14 ? 26.186 25.134 10.583 1.00 14.39 ? 14  ALA A O   1 
ATOM   88   C  CB  . ALA A 1 14 ? 28.174 24.470 13.075 1.00 13.70 ? 14  ALA A CB  1 
ATOM   89   N  N   . ILE A 1 15 ? 25.591 23.257 11.683 1.00 13.55 ? 15  ILE A N   1 
ATOM   90   C  CA  . ILE A 1 15 ? 24.984 22.656 10.512 1.00 13.75 ? 15  ILE A CA  1 
ATOM   91   C  C   . ILE A 1 15 ? 23.793 23.484 10.049 1.00 14.16 ? 15  ILE A C   1 
ATOM   92   O  O   . ILE A 1 15 ? 23.634 23.715 8.852  1.00 12.86 ? 15  ILE A O   1 
ATOM   93   C  CB  . ILE A 1 15 ? 24.580 21.197 10.805 1.00 14.75 ? 15  ILE A CB  1 
ATOM   94   C  CG1 . ILE A 1 15 ? 25.843 20.327 10.818 1.00 14.45 ? 15  ILE A CG1 1 
ATOM   95   C  CG2 . ILE A 1 15 ? 23.584 20.687 9.767  1.00 15.71 ? 15  ILE A CG2 1 
ATOM   96   C  CD1 . ILE A 1 15 ? 25.583 18.879 11.157 1.00 16.00 ? 15  ILE A CD1 1 
ATOM   97   N  N   . PHE A 1 16 ? 22.971 23.948 10.989 1.00 14.05 ? 16  PHE A N   1 
ATOM   98   C  CA  . PHE A 1 16 ? 21.815 24.768 10.623 1.00 14.29 ? 16  PHE A CA  1 
ATOM   99   C  C   . PHE A 1 16 ? 22.270 26.048 9.910  1.00 15.59 ? 16  PHE A C   1 
ATOM   100  O  O   . PHE A 1 16 ? 21.745 26.399 8.853  1.00 16.37 ? 16  PHE A O   1 
ATOM   101  C  CB  . PHE A 1 16 ? 21.008 25.155 11.865 1.00 13.12 ? 16  PHE A CB  1 
ATOM   102  C  CG  . PHE A 1 16 ? 19.772 25.956 11.561 1.00 12.56 ? 16  PHE A CG  1 
ATOM   103  C  CD1 . PHE A 1 16 ? 18.576 25.324 11.242 1.00 12.49 ? 16  PHE A CD1 1 
ATOM   104  C  CD2 . PHE A 1 16 ? 19.812 27.347 11.566 1.00 13.77 ? 16  PHE A CD2 1 
ATOM   105  C  CE1 . PHE A 1 16 ? 17.432 26.061 10.935 1.00 13.22 ? 16  PHE A CE1 1 
ATOM   106  C  CE2 . PHE A 1 16 ? 18.677 28.098 11.261 1.00 12.56 ? 16  PHE A CE2 1 
ATOM   107  C  CZ  . PHE A 1 16 ? 17.480 27.453 10.944 1.00 13.00 ? 16  PHE A CZ  1 
ATOM   108  N  N   . HIS A 1 17 ? 23.241 26.739 10.503 1.00 16.54 ? 17  HIS A N   1 
ATOM   109  C  CA  . HIS A 1 17 ? 23.758 27.988 9.949  1.00 19.26 ? 17  HIS A CA  1 
ATOM   110  C  C   . HIS A 1 17 ? 24.374 27.827 8.568  1.00 21.01 ? 17  HIS A C   1 
ATOM   111  O  O   . HIS A 1 17 ? 24.281 28.727 7.722  1.00 20.22 ? 17  HIS A O   1 
ATOM   112  C  CB  . HIS A 1 17 ? 24.780 28.601 10.905 1.00 21.23 ? 17  HIS A CB  1 
ATOM   113  C  CG  . HIS A 1 17 ? 24.164 29.231 12.114 1.00 23.13 ? 17  HIS A CG  1 
ATOM   114  N  ND1 . HIS A 1 17 ? 24.374 30.552 12.453 1.00 24.53 ? 17  HIS A ND1 1 
ATOM   115  C  CD2 . HIS A 1 17 ? 23.330 28.730 13.055 1.00 22.34 ? 17  HIS A CD2 1 
ATOM   116  C  CE1 . HIS A 1 17 ? 23.695 30.835 13.549 1.00 24.62 ? 17  HIS A CE1 1 
ATOM   117  N  NE2 . HIS A 1 17 ? 23.052 29.748 13.935 1.00 23.02 ? 17  HIS A NE2 1 
ATOM   118  N  N   . LYS A 1 18 ? 24.996 26.677 8.334  1.00 20.09 ? 18  LYS A N   1 
ATOM   119  C  CA  . LYS A 1 18 ? 25.617 26.409 7.048  1.00 21.54 ? 18  LYS A CA  1 
ATOM   120  C  C   . LYS A 1 18 ? 24.593 26.374 5.924  1.00 21.68 ? 18  LYS A C   1 
ATOM   121  O  O   . LYS A 1 18 ? 24.765 27.032 4.897  1.00 23.88 ? 18  LYS A O   1 
ATOM   122  C  CB  . LYS A 1 18 ? 26.373 25.079 7.080  1.00 23.67 ? 18  LYS A CB  1 
ATOM   123  C  CG  . LYS A 1 18 ? 26.912 24.671 5.716  1.00 26.16 ? 18  LYS A CG  1 
ATOM   124  C  CD  . LYS A 1 18 ? 27.853 23.482 5.785  1.00 28.13 ? 18  LYS A CD  1 
ATOM   125  C  CE  . LYS A 1 18 ? 28.371 23.142 4.393  1.00 29.87 ? 18  LYS A CE  1 
ATOM   126  N  NZ  . LYS A 1 18 ? 29.390 22.058 4.422  1.00 32.41 ? 18  LYS A NZ  1 
ATOM   127  N  N   . TYR A 1 19 ? 23.520 25.617 6.119  1.00 18.58 ? 19  TYR A N   1 
ATOM   128  C  CA  . TYR A 1 19 ? 22.507 25.490 5.082  1.00 16.13 ? 19  TYR A CA  1 
ATOM   129  C  C   . TYR A 1 19 ? 21.419 26.556 5.046  1.00 16.05 ? 19  TYR A C   1 
ATOM   130  O  O   . TYR A 1 19 ? 20.776 26.742 4.015  1.00 17.18 ? 19  TYR A O   1 
ATOM   131  C  CB  . TYR A 1 19 ? 21.871 24.098 5.151  1.00 16.04 ? 19  TYR A CB  1 
ATOM   132  C  CG  . TYR A 1 19 ? 22.883 23.001 4.917  1.00 16.57 ? 19  TYR A CG  1 
ATOM   133  C  CD1 . TYR A 1 19 ? 23.570 22.416 5.982  1.00 16.55 ? 19  TYR A CD1 1 
ATOM   134  C  CD2 . TYR A 1 19 ? 23.224 22.613 3.619  1.00 17.75 ? 19  TYR A CD2 1 
ATOM   135  C  CE1 . TYR A 1 19 ? 24.577 21.474 5.760  1.00 16.91 ? 19  TYR A CE1 1 
ATOM   136  C  CE2 . TYR A 1 19 ? 24.231 21.678 3.386  1.00 18.52 ? 19  TYR A CE2 1 
ATOM   137  C  CZ  . TYR A 1 19 ? 24.900 21.116 4.458  1.00 17.76 ? 19  TYR A CZ  1 
ATOM   138  O  OH  . TYR A 1 19 ? 25.898 20.205 4.226  1.00 18.14 ? 19  TYR A OH  1 
ATOM   139  N  N   . SER A 1 20 ? 21.213 27.259 6.154  1.00 15.82 ? 20  SER A N   1 
ATOM   140  C  CA  . SER A 1 20 ? 20.180 28.285 6.197  1.00 15.24 ? 20  SER A CA  1 
ATOM   141  C  C   . SER A 1 20 ? 20.559 29.550 5.427  1.00 17.23 ? 20  SER A C   1 
ATOM   142  O  O   . SER A 1 20 ? 19.684 30.291 4.983  1.00 16.95 ? 20  SER A O   1 
ATOM   143  C  CB  . SER A 1 20 ? 19.840 28.644 7.653  1.00 15.21 ? 20  SER A CB  1 
ATOM   144  O  OG  . SER A 1 20 ? 20.978 29.104 8.364  1.00 16.05 ? 20  SER A OG  1 
ATOM   145  N  N   . GLY A 1 21 ? 21.856 29.776 5.243  1.00 17.93 ? 21  GLY A N   1 
ATOM   146  C  CA  . GLY A 1 21 ? 22.306 30.970 4.546  1.00 19.99 ? 21  GLY A CA  1 
ATOM   147  C  C   . GLY A 1 21 ? 22.426 30.901 3.033  1.00 21.48 ? 21  GLY A C   1 
ATOM   148  O  O   . GLY A 1 21 ? 22.972 31.817 2.409  1.00 18.83 ? 21  GLY A O   1 
ATOM   149  N  N   . ARG A 1 22 ? 21.930 29.828 2.432  1.00 21.69 ? 22  ARG A N   1 
ATOM   150  C  CA  . ARG A 1 22 ? 22.000 29.668 0.981  1.00 24.22 ? 22  ARG A CA  1 
ATOM   151  C  C   . ARG A 1 22 ? 21.150 30.688 0.231  1.00 23.86 ? 22  ARG A C   1 
ATOM   152  O  O   . ARG A 1 22 ? 21.634 31.371 -0.671 1.00 24.22 ? 22  ARG A O   1 
ATOM   153  C  CB  . ARG A 1 22 ? 21.527 28.268 0.582  1.00 26.33 ? 22  ARG A CB  1 
ATOM   154  C  CG  . ARG A 1 22 ? 22.606 27.319 0.086  1.00 31.87 ? 22  ARG A CG  1 
ATOM   155  C  CD  . ARG A 1 22 ? 23.690 27.100 1.112  1.00 33.24 ? 22  ARG A CD  1 
ATOM   156  N  NE  . ARG A 1 22 ? 24.362 25.820 0.911  1.00 36.67 ? 22  ARG A NE  1 
ATOM   157  C  CZ  . ARG A 1 22 ? 25.560 25.521 1.403  1.00 37.93 ? 22  ARG A CZ  1 
ATOM   158  N  NH1 . ARG A 1 22 ? 26.223 26.416 2.122  1.00 38.22 ? 22  ARG A NH1 1 
ATOM   159  N  NH2 . ARG A 1 22 ? 26.089 24.325 1.186  1.00 39.11 ? 22  ARG A NH2 1 
ATOM   160  N  N   . GLU A 1 23 ? 19.880 30.780 0.614  1.00 22.44 ? 23  GLU A N   1 
ATOM   161  C  CA  . GLU A 1 23 ? 18.932 31.670 -0.041 1.00 22.00 ? 23  GLU A CA  1 
ATOM   162  C  C   . GLU A 1 23 ? 17.891 32.189 0.946  1.00 20.73 ? 23  GLU A C   1 
ATOM   163  O  O   . GLU A 1 23 ? 17.737 31.645 2.041  1.00 18.55 ? 23  GLU A O   1 
ATOM   164  C  CB  . GLU A 1 23 ? 18.215 30.900 -1.152 1.00 22.86 ? 23  GLU A CB  1 
ATOM   165  C  CG  . GLU A 1 23 ? 17.380 29.723 -0.622 1.00 26.44 ? 23  GLU A CG  1 
ATOM   166  C  CD  . GLU A 1 23 ? 16.701 28.925 -1.722 1.00 27.36 ? 23  GLU A CD  1 
ATOM   167  O  OE1 . GLU A 1 23 ? 16.668 29.407 -2.874 1.00 29.44 ? 23  GLU A OE1 1 
ATOM   168  O  OE2 . GLU A 1 23 ? 16.192 27.818 -1.433 1.00 26.73 ? 23  GLU A OE2 1 
ATOM   169  N  N   . GLY A 1 24 ? 17.163 33.226 0.542  1.00 19.87 ? 24  GLY A N   1 
ATOM   170  C  CA  . GLY A 1 24 ? 16.133 33.791 1.398  1.00 16.75 ? 24  GLY A CA  1 
ATOM   171  C  C   . GLY A 1 24 ? 16.616 34.191 2.780  1.00 16.02 ? 24  GLY A C   1 
ATOM   172  O  O   . GLY A 1 24 ? 17.744 34.659 2.947  1.00 14.88 ? 24  GLY A O   1 
ATOM   173  N  N   . ASP A 1 25 ? 15.745 34.014 3.770  1.00 14.96 ? 25  ASP A N   1 
ATOM   174  C  CA  . ASP A 1 25 ? 16.051 34.334 5.161  1.00 15.51 ? 25  ASP A CA  1 
ATOM   175  C  C   . ASP A 1 25 ? 17.314 33.568 5.539  1.00 16.03 ? 25  ASP A C   1 
ATOM   176  O  O   . ASP A 1 25 ? 17.356 32.344 5.404  1.00 16.15 ? 25  ASP A O   1 
ATOM   177  C  CB  . ASP A 1 25 ? 14.893 33.879 6.047  1.00 16.47 ? 25  ASP A CB  1 
ATOM   178  C  CG  . ASP A 1 25 ? 14.965 34.438 7.454  1.00 15.40 ? 25  ASP A CG  1 
ATOM   179  O  OD1 . ASP A 1 25 ? 16.080 34.599 7.986  1.00 16.86 ? 25  ASP A OD1 1 
ATOM   180  O  OD2 . ASP A 1 25 ? 13.892 34.701 8.039  1.00 17.06 ? 25  ASP A OD2 1 
ATOM   181  N  N   . LYS A 1 26 ? 18.347 34.266 6.003  1.00 15.52 ? 26  LYS A N   1 
ATOM   182  C  CA  . LYS A 1 26 ? 19.573 33.570 6.375  1.00 17.00 ? 26  LYS A CA  1 
ATOM   183  C  C   . LYS A 1 26 ? 19.395 32.770 7.656  1.00 15.91 ? 26  LYS A C   1 
ATOM   184  O  O   . LYS A 1 26 ? 20.267 31.980 8.015  1.00 17.66 ? 26  LYS A O   1 
ATOM   185  C  CB  . LYS A 1 26 ? 20.747 34.549 6.549  1.00 20.85 ? 26  LYS A CB  1 
ATOM   186  C  CG  . LYS A 1 26 ? 20.582 35.568 7.668  1.00 24.75 ? 26  LYS A CG  1 
ATOM   187  C  CD  . LYS A 1 26 ? 21.821 36.466 7.812  1.00 28.85 ? 26  LYS A CD  1 
ATOM   188  C  CE  . LYS A 1 26 ? 22.939 35.776 8.596  1.00 29.01 ? 26  LYS A CE  1 
ATOM   189  N  NZ  . LYS A 1 26 ? 24.300 36.331 8.299  1.00 31.69 ? 26  LYS A NZ  1 
ATOM   190  N  N   . HIS A 1 27 ? 18.275 32.975 8.345  1.00 15.31 ? 27  HIS A N   1 
ATOM   191  C  CA  . HIS A 1 27 ? 18.035 32.261 9.592  1.00 16.26 ? 27  HIS A CA  1 
ATOM   192  C  C   . HIS A 1 27 ? 16.946 31.200 9.548  1.00 16.24 ? 27  HIS A C   1 
ATOM   193  O  O   . HIS A 1 27 ? 16.490 30.734 10.588 1.00 16.73 ? 27  HIS A O   1 
ATOM   194  C  CB  . HIS A 1 27 ? 17.778 33.252 10.726 1.00 19.10 ? 27  HIS A CB  1 
ATOM   195  C  CG  . HIS A 1 27 ? 18.968 34.102 11.042 1.00 22.08 ? 27  HIS A CG  1 
ATOM   196  N  ND1 . HIS A 1 27 ? 20.230 33.573 11.198 1.00 23.43 ? 27  HIS A ND1 1 
ATOM   197  C  CD2 . HIS A 1 27 ? 19.097 35.441 11.199 1.00 22.87 ? 27  HIS A CD2 1 
ATOM   198  C  CE1 . HIS A 1 27 ? 21.088 34.549 11.435 1.00 24.10 ? 27  HIS A CE1 1 
ATOM   199  N  NE2 . HIS A 1 27 ? 20.426 35.692 11.441 1.00 24.57 ? 27  HIS A NE2 1 
ATOM   200  N  N   . THR A 1 28 ? 16.522 30.824 8.346  1.00 15.62 ? 28  THR A N   1 
ATOM   201  C  CA  . THR A 1 28 ? 15.539 29.750 8.197  1.00 15.16 ? 28  THR A CA  1 
ATOM   202  C  C   . THR A 1 28 ? 15.929 28.900 7.002  1.00 14.44 ? 28  THR A C   1 
ATOM   203  O  O   . THR A 1 28 ? 16.649 29.347 6.104  1.00 13.07 ? 28  THR A O   1 
ATOM   204  C  CB  . THR A 1 28 ? 14.082 30.243 7.966  1.00 16.86 ? 28  THR A CB  1 
ATOM   205  O  OG1 . THR A 1 28 ? 13.959 30.822 6.659  1.00 16.26 ? 28  THR A OG1 1 
ATOM   206  C  CG2 . THR A 1 28 ? 13.681 31.252 9.030  1.00 17.07 ? 28  THR A CG2 1 
ATOM   207  N  N   . LEU A 1 29 ? 15.446 27.667 7.001  1.00 12.69 ? 29  LEU A N   1 
ATOM   208  C  CA  . LEU A 1 29 ? 15.714 26.723 5.930  1.00 12.40 ? 29  LEU A CA  1 
ATOM   209  C  C   . LEU A 1 29 ? 14.543 26.646 4.964  1.00 13.86 ? 29  LEU A C   1 
ATOM   210  O  O   . LEU A 1 29 ? 13.413 26.392 5.376  1.00 11.45 ? 29  LEU A O   1 
ATOM   211  C  CB  . LEU A 1 29 ? 15.923 25.324 6.504  1.00 11.71 ? 29  LEU A CB  1 
ATOM   212  C  CG  . LEU A 1 29 ? 17.127 25.084 7.409  1.00 12.44 ? 29  LEU A CG  1 
ATOM   213  C  CD1 . LEU A 1 29 ? 17.010 23.710 8.074  1.00 12.29 ? 29  LEU A CD1 1 
ATOM   214  C  CD2 . LEU A 1 29 ? 18.392 25.164 6.575  1.00 12.37 ? 29  LEU A CD2 1 
ATOM   215  N  N   . SER A 1 30 ? 14.804 26.855 3.681  1.00 14.73 ? 30  SER A N   1 
ATOM   216  C  CA  . SER A 1 30 ? 13.746 26.732 2.684  1.00 15.73 ? 30  SER A CA  1 
ATOM   217  C  C   . SER A 1 30 ? 13.673 25.237 2.410  1.00 16.96 ? 30  SER A C   1 
ATOM   218  O  O   . SER A 1 30 ? 14.464 24.466 2.957  1.00 13.95 ? 30  SER A O   1 
ATOM   219  C  CB  . SER A 1 30 ? 14.129 27.445 1.390  1.00 16.79 ? 30  SER A CB  1 
ATOM   220  O  OG  . SER A 1 30 ? 15.291 26.853 0.825  1.00 16.60 ? 30  SER A OG  1 
ATOM   221  N  N   . LYS A 1 31 ? 12.738 24.820 1.564  1.00 17.27 ? 31  LYS A N   1 
ATOM   222  C  CA  . LYS A 1 31 ? 12.637 23.406 1.235  1.00 19.84 ? 31  LYS A CA  1 
ATOM   223  C  C   . LYS A 1 31 ? 13.937 22.913 0.600  1.00 18.46 ? 31  LYS A C   1 
ATOM   224  O  O   . LYS A 1 31 ? 14.398 21.810 0.895  1.00 17.40 ? 31  LYS A O   1 
ATOM   225  C  CB  . LYS A 1 31 ? 11.481 23.143 0.267  1.00 22.63 ? 31  LYS A CB  1 
ATOM   226  C  CG  . LYS A 1 31 ? 11.433 21.685 -0.192 1.00 26.81 ? 31  LYS A CG  1 
ATOM   227  C  CD  . LYS A 1 31 ? 10.292 21.405 -1.146 1.00 29.11 ? 31  LYS A CD  1 
ATOM   228  C  CE  . LYS A 1 31 ? 10.459 20.031 -1.787 1.00 30.87 ? 31  LYS A CE  1 
ATOM   229  N  NZ  . LYS A 1 31 ? 9.384  19.742 -2.779 1.00 32.30 ? 31  LYS A NZ  1 
ATOM   230  N  N   . LYS A 1 32 ? 14.526 23.726 -0.275 1.00 18.06 ? 32  LYS A N   1 
ATOM   231  C  CA  . LYS A 1 32 ? 15.768 23.341 -0.950 1.00 17.00 ? 32  LYS A CA  1 
ATOM   232  C  C   . LYS A 1 32 ? 16.960 23.259 -0.004 1.00 16.51 ? 32  LYS A C   1 
ATOM   233  O  O   . LYS A 1 32 ? 17.835 22.401 -0.167 1.00 15.65 ? 32  LYS A O   1 
ATOM   234  C  CB  . LYS A 1 32 ? 16.080 24.311 -2.098 1.00 19.95 ? 32  LYS A CB  1 
ATOM   235  C  CG  . LYS A 1 32 ? 15.034 24.321 -3.210 1.00 23.12 ? 32  LYS A CG  1 
ATOM   236  C  CD  . LYS A 1 32 ? 15.563 24.987 -4.483 1.00 25.19 ? 32  LYS A CD  1 
ATOM   237  C  CE  . LYS A 1 32 ? 16.054 26.401 -4.227 1.00 26.80 ? 32  LYS A CE  1 
ATOM   238  N  NZ  . LYS A 1 32 ? 14.937 27.296 -3.813 1.00 27.97 ? 32  LYS A NZ  1 
ATOM   239  N  N   . GLU A 1 33 ? 16.997 24.153 0.981  1.00 13.98 ? 33  GLU A N   1 
ATOM   240  C  CA  . GLU A 1 33 ? 18.079 24.162 1.958  1.00 15.02 ? 33  GLU A CA  1 
ATOM   241  C  C   . GLU A 1 33 ? 17.913 22.959 2.885  1.00 14.13 ? 33  GLU A C   1 
ATOM   242  O  O   . GLU A 1 33 ? 18.880 22.269 3.209  1.00 12.55 ? 33  GLU A O   1 
ATOM   243  C  CB  . GLU A 1 33 ? 18.072 25.474 2.751  1.00 14.18 ? 33  GLU A CB  1 
ATOM   244  C  CG  . GLU A 1 33 ? 18.463 26.700 1.925  1.00 16.43 ? 33  GLU A CG  1 
ATOM   245  C  CD  . GLU A 1 33 ? 18.298 27.992 2.695  1.00 17.28 ? 33  GLU A CD  1 
ATOM   246  O  OE1 . GLU A 1 33 ? 17.294 28.101 3.430  1.00 17.04 ? 33  GLU A OE1 1 
ATOM   247  O  OE2 . GLU A 1 33 ? 19.154 28.896 2.562  1.00 15.10 ? 33  GLU A OE2 1 
ATOM   248  N  N   . LEU A 1 34 ? 16.677 22.699 3.298  1.00 14.05 ? 34  LEU A N   1 
ATOM   249  C  CA  . LEU A 1 34 ? 16.392 21.553 4.157  1.00 15.14 ? 34  LEU A CA  1 
ATOM   250  C  C   . LEU A 1 34 ? 16.826 20.259 3.465  1.00 15.88 ? 34  LEU A C   1 
ATOM   251  O  O   . LEU A 1 34 ? 17.430 19.374 4.076  1.00 15.54 ? 34  LEU A O   1 
ATOM   252  C  CB  . LEU A 1 34 ? 14.894 21.470 4.442  1.00 15.05 ? 34  LEU A CB  1 
ATOM   253  C  CG  . LEU A 1 34 ? 14.493 20.218 5.221  1.00 15.06 ? 34  LEU A CG  1 
ATOM   254  C  CD1 . LEU A 1 34 ? 15.135 20.280 6.602  1.00 14.79 ? 34  LEU A CD1 1 
ATOM   255  C  CD2 . LEU A 1 34 ? 12.978 20.122 5.330  1.00 13.78 ? 34  LEU A CD2 1 
ATOM   256  N  N   . LYS A 1 35 ? 16.507 20.158 2.179  1.00 17.50 ? 35  LYS A N   1 
ATOM   257  C  CA  . LYS A 1 35 ? 16.839 18.973 1.406  1.00 18.17 ? 35  LYS A CA  1 
ATOM   258  C  C   . LYS A 1 35 ? 18.349 18.760 1.331  1.00 17.63 ? 35  LYS A C   1 
ATOM   259  O  O   . LYS A 1 35 ? 18.834 17.654 1.548  1.00 17.91 ? 35  LYS A O   1 
ATOM   260  C  CB  . LYS A 1 35 ? 16.230 19.081 0.003  1.00 20.36 ? 35  LYS A CB  1 
ATOM   261  C  CG  . LYS A 1 35 ? 16.405 17.837 -0.849 1.00 22.75 ? 35  LYS A CG  1 
ATOM   262  C  CD  . LYS A 1 35 ? 15.556 17.924 -2.102 1.00 24.75 ? 35  LYS A CD  1 
ATOM   263  C  CE  . LYS A 1 35 ? 15.685 16.669 -2.939 1.00 27.42 ? 35  LYS A CE  1 
ATOM   264  N  NZ  . LYS A 1 35 ? 14.830 16.773 -4.148 1.00 29.36 ? 35  LYS A NZ  1 
ATOM   265  N  N   . GLU A 1 36 ? 19.096 19.816 1.034  1.00 18.60 ? 36  GLU A N   1 
ATOM   266  C  CA  . GLU A 1 36 ? 20.548 19.704 0.962  1.00 19.42 ? 36  GLU A CA  1 
ATOM   267  C  C   . GLU A 1 36 ? 21.102 19.317 2.335  1.00 18.55 ? 36  GLU A C   1 
ATOM   268  O  O   . GLU A 1 36 ? 21.984 18.461 2.440  1.00 18.33 ? 36  GLU A O   1 
ATOM   269  C  CB  . GLU A 1 36 ? 21.173 21.029 0.511  1.00 21.28 ? 36  GLU A CB  1 
ATOM   270  C  CG  . GLU A 1 36 ? 22.693 20.959 0.340  1.00 25.10 ? 36  GLU A CG  1 
ATOM   271  C  CD  . GLU A 1 36 ? 23.336 22.318 0.078  1.00 26.93 ? 36  GLU A CD  1 
ATOM   272  O  OE1 . GLU A 1 36 ? 24.574 22.369 -0.098 1.00 27.29 ? 36  GLU A OE1 1 
ATOM   273  O  OE2 . GLU A 1 36 ? 22.613 23.335 0.049  1.00 29.12 ? 36  GLU A OE2 1 
ATOM   274  N  N   . LEU A 1 37 ? 20.578 19.940 3.389  1.00 16.76 ? 37  LEU A N   1 
ATOM   275  C  CA  . LEU A 1 37 ? 21.043 19.645 4.741  1.00 16.40 ? 37  LEU A CA  1 
ATOM   276  C  C   . LEU A 1 37 ? 20.840 18.167 5.053  1.00 16.67 ? 37  LEU A C   1 
ATOM   277  O  O   . LEU A 1 37 ? 21.756 17.507 5.535  1.00 16.35 ? 37  LEU A O   1 
ATOM   278  C  CB  . LEU A 1 37 ? 20.302 20.510 5.765  1.00 15.32 ? 37  LEU A CB  1 
ATOM   279  C  CG  . LEU A 1 37 ? 20.703 20.395 7.244  1.00 14.74 ? 37  LEU A CG  1 
ATOM   280  C  CD1 . LEU A 1 37 ? 20.143 21.593 7.992  1.00 13.50 ? 37  LEU A CD1 1 
ATOM   281  C  CD2 . LEU A 1 37 ? 20.182 19.096 7.857  1.00 15.80 ? 37  LEU A CD2 1 
ATOM   282  N  N   . ILE A 1 38 ? 19.646 17.656 4.769  1.00 16.16 ? 38  ILE A N   1 
ATOM   283  C  CA  . ILE A 1 38 ? 19.322 16.247 5.019  1.00 18.30 ? 38  ILE A CA  1 
ATOM   284  C  C   . ILE A 1 38 ? 20.206 15.303 4.191  1.00 18.17 ? 38  ILE A C   1 
ATOM   285  O  O   . ILE A 1 38 ? 20.826 14.379 4.728  1.00 18.16 ? 38  ILE A O   1 
ATOM   286  C  CB  . ILE A 1 38 ? 17.837 15.949 4.687  1.00 20.66 ? 38  ILE A CB  1 
ATOM   287  C  CG1 . ILE A 1 38 ? 16.918 16.827 5.538  1.00 22.96 ? 38  ILE A CG1 1 
ATOM   288  C  CG2 . ILE A 1 38 ? 17.528 14.482 4.935  1.00 21.71 ? 38  ILE A CG2 1 
ATOM   289  C  CD1 . ILE A 1 38 ? 17.050 16.599 7.023  1.00 22.96 ? 38  ILE A CD1 1 
ATOM   290  N  N   . GLN A 1 39 ? 20.274 15.552 2.886  1.00 18.05 ? 39  GLN A N   1 
ATOM   291  C  CA  . GLN A 1 39 ? 21.063 14.720 1.982  1.00 20.36 ? 39  GLN A CA  1 
ATOM   292  C  C   . GLN A 1 39 ? 22.550 14.661 2.306  1.00 20.85 ? 39  GLN A C   1 
ATOM   293  O  O   . GLN A 1 39 ? 23.186 13.625 2.128  1.00 23.25 ? 39  GLN A O   1 
ATOM   294  C  CB  . GLN A 1 39 ? 20.898 15.203 0.542  1.00 21.41 ? 39  GLN A CB  1 
ATOM   295  C  CG  . GLN A 1 39 ? 19.481 15.157 0.022  1.00 22.10 ? 39  GLN A CG  1 
ATOM   296  C  CD  . GLN A 1 39 ? 19.416 15.524 -1.440 1.00 22.79 ? 39  GLN A CD  1 
ATOM   297  O  OE1 . GLN A 1 39 ? 20.004 16.520 -1.863 1.00 24.75 ? 39  GLN A OE1 1 
ATOM   298  N  NE2 . GLN A 1 39 ? 18.705 14.725 -2.222 1.00 23.00 ? 39  GLN A NE2 1 
ATOM   299  N  N   . LYS A 1 40 ? 23.111 15.770 2.772  1.00 19.98 ? 40  LYS A N   1 
ATOM   300  C  CA  . LYS A 1 40 ? 24.533 15.814 3.090  1.00 21.25 ? 40  LYS A CA  1 
ATOM   301  C  C   . LYS A 1 40 ? 24.918 15.540 4.542  1.00 21.94 ? 40  LYS A C   1 
ATOM   302  O  O   . LYS A 1 40 ? 26.045 15.128 4.806  1.00 23.13 ? 40  LYS A O   1 
ATOM   303  C  CB  . LYS A 1 40 ? 25.116 17.173 2.687  1.00 22.49 ? 40  LYS A CB  1 
ATOM   304  C  CG  . LYS A 1 40 ? 25.146 17.425 1.192  1.00 26.03 ? 40  LYS A CG  1 
ATOM   305  C  CD  . LYS A 1 40 ? 25.775 18.775 0.871  1.00 27.96 ? 40  LYS A CD  1 
ATOM   306  C  CE  . LYS A 1 40 ? 25.891 18.991 -0.635 1.00 29.49 ? 40  LYS A CE  1 
ATOM   307  N  NZ  . LYS A 1 40 ? 26.390 20.358 -0.957 1.00 30.23 ? 40  LYS A NZ  1 
ATOM   308  N  N   . GLU A 1 41 ? 23.997 15.745 5.480  1.00 20.20 ? 41  GLU A N   1 
ATOM   309  C  CA  . GLU A 1 41 ? 24.332 15.568 6.892  1.00 19.79 ? 41  GLU A CA  1 
ATOM   310  C  C   . GLU A 1 41 ? 23.686 14.401 7.633  1.00 19.60 ? 41  GLU A C   1 
ATOM   311  O  O   . GLU A 1 41 ? 24.132 14.044 8.725  1.00 20.63 ? 41  GLU A O   1 
ATOM   312  C  CB  . GLU A 1 41 ? 24.016 16.859 7.649  1.00 18.92 ? 41  GLU A CB  1 
ATOM   313  C  CG  . GLU A 1 41 ? 24.617 18.125 7.038  1.00 20.39 ? 41  GLU A CG  1 
ATOM   314  C  CD  . GLU A 1 41 ? 26.134 18.161 7.106  1.00 22.29 ? 41  GLU A CD  1 
ATOM   315  O  OE1 . GLU A 1 41 ? 26.704 17.556 8.037  1.00 22.83 ? 41  GLU A OE1 1 
ATOM   316  O  OE2 . GLU A 1 41 ? 26.756 18.814 6.239  1.00 22.79 ? 41  GLU A OE2 1 
ATOM   317  N  N   . LEU A 1 42 ? 22.636 13.819 7.062  1.00 20.92 ? 42  LEU A N   1 
ATOM   318  C  CA  . LEU A 1 42 ? 21.938 12.708 7.708  1.00 22.30 ? 42  LEU A CA  1 
ATOM   319  C  C   . LEU A 1 42 ? 22.272 11.405 6.982  1.00 23.62 ? 42  LEU A C   1 
ATOM   320  O  O   . LEU A 1 42 ? 22.208 11.330 5.755  1.00 22.82 ? 42  LEU A O   1 
ATOM   321  C  CB  . LEU A 1 42 ? 20.424 12.972 7.689  1.00 20.78 ? 42  LEU A CB  1 
ATOM   322  C  CG  . LEU A 1 42 ? 19.456 12.131 8.532  1.00 23.82 ? 42  LEU A CG  1 
ATOM   323  C  CD1 . LEU A 1 42 ? 19.642 12.415 10.022 1.00 22.69 ? 42  LEU A CD1 1 
ATOM   324  C  CD2 . LEU A 1 42 ? 18.033 12.466 8.122  1.00 23.42 ? 42  LEU A CD2 1 
ATOM   325  N  N   . THR A 1 43 ? 22.626 10.377 7.747  1.00 25.76 ? 43  THR A N   1 
ATOM   326  C  CA  . THR A 1 43 ? 22.997 9.089  7.169  1.00 28.82 ? 43  THR A CA  1 
ATOM   327  C  C   . THR A 1 43 ? 22.055 8.587  6.078  1.00 28.93 ? 43  THR A C   1 
ATOM   328  O  O   . THR A 1 43 ? 22.505 8.213  4.994  1.00 30.18 ? 43  THR A O   1 
ATOM   329  C  CB  . THR A 1 43 ? 23.121 8.007  8.264  1.00 29.57 ? 43  THR A CB  1 
ATOM   330  O  OG1 . THR A 1 43 ? 24.115 8.406  9.216  1.00 31.81 ? 43  THR A OG1 1 
ATOM   331  C  CG2 . THR A 1 43 ? 23.525 6.673  7.651  1.00 30.51 ? 43  THR A CG2 1 
ATOM   332  N  N   . ILE A 1 44 ? 20.754 8.587  6.353  1.00 29.70 ? 44  ILE A N   1 
ATOM   333  C  CA  . ILE A 1 44 ? 19.771 8.114  5.380  1.00 30.74 ? 44  ILE A CA  1 
ATOM   334  C  C   . ILE A 1 44 ? 19.279 9.206  4.433  1.00 31.28 ? 44  ILE A C   1 
ATOM   335  O  O   . ILE A 1 44 ? 18.395 8.969  3.613  1.00 31.83 ? 44  ILE A O   1 
ATOM   336  C  CB  . ILE A 1 44 ? 18.536 7.528  6.076  1.00 32.07 ? 44  ILE A CB  1 
ATOM   337  C  CG1 . ILE A 1 44 ? 17.775 8.640  6.802  1.00 33.16 ? 44  ILE A CG1 1 
ATOM   338  C  CG2 . ILE A 1 44 ? 18.957 6.434  7.048  1.00 32.96 ? 44  ILE A CG2 1 
ATOM   339  C  CD1 . ILE A 1 44 ? 16.395 8.229  7.278  1.00 34.74 ? 44  ILE A CD1 1 
ATOM   340  N  N   . GLY A 1 45 ? 19.859 10.395 4.542  1.00 29.95 ? 45  GLY A N   1 
ATOM   341  C  CA  . GLY A 1 45 ? 19.443 11.510 3.710  1.00 29.54 ? 45  GLY A CA  1 
ATOM   342  C  C   . GLY A 1 45 ? 19.518 11.341 2.204  1.00 29.98 ? 45  GLY A C   1 
ATOM   343  O  O   . GLY A 1 45 ? 18.572 11.681 1.494  1.00 29.35 ? 45  GLY A O   1 
ATOM   344  N  N   . SER A 1 46 ? 20.634 10.819 1.709  1.00 30.64 ? 46  SER A N   1 
ATOM   345  C  CA  . SER A 1 46 ? 20.821 10.641 0.271  1.00 32.30 ? 46  SER A CA  1 
ATOM   346  C  C   . SER A 1 46 ? 19.860 9.645  -0.365 1.00 33.29 ? 46  SER A C   1 
ATOM   347  O  O   . SER A 1 46 ? 19.728 9.599  -1.589 1.00 34.78 ? 46  SER A O   1 
ATOM   348  C  CB  . SER A 1 46 ? 22.252 10.197 -0.017 1.00 33.02 ? 46  SER A CB  1 
ATOM   349  O  OG  . SER A 1 46 ? 22.499 8.922  0.547  1.00 32.56 ? 46  SER A OG  1 
ATOM   350  N  N   . LYS A 1 47 ? 19.190 8.847  0.456  1.00 33.73 ? 47  LYS A N   1 
ATOM   351  C  CA  . LYS A 1 47 ? 18.266 7.855  -0.070 1.00 33.48 ? 47  LYS A CA  1 
ATOM   352  C  C   . LYS A 1 47 ? 16.813 8.316  0.010  1.00 31.77 ? 47  LYS A C   1 
ATOM   353  O  O   . LYS A 1 47 ? 15.930 7.698  -0.583 1.00 31.04 ? 47  LYS A O   1 
ATOM   354  C  CB  . LYS A 1 47 ? 18.432 6.534  0.686  1.00 36.47 ? 47  LYS A CB  1 
ATOM   355  C  CG  . LYS A 1 47 ? 18.038 5.305  -0.115 1.00 39.76 ? 47  LYS A CG  1 
ATOM   356  C  CD  . LYS A 1 47 ? 18.990 5.087  -1.285 1.00 41.32 ? 47  LYS A CD  1 
ATOM   357  C  CE  . LYS A 1 47 ? 18.698 3.777  -2.002 1.00 42.18 ? 47  LYS A CE  1 
ATOM   358  N  NZ  . LYS A 1 47 ? 19.624 3.546  -3.147 1.00 43.26 ? 47  LYS A NZ  1 
ATOM   359  N  N   . LEU A 1 48 ? 16.562 9.398  0.741  1.00 29.63 ? 48  LEU A N   1 
ATOM   360  C  CA  . LEU A 1 48 ? 15.203 9.919  0.880  1.00 27.24 ? 48  LEU A CA  1 
ATOM   361  C  C   . LEU A 1 48 ? 14.675 10.524 -0.415 1.00 25.56 ? 48  LEU A C   1 
ATOM   362  O  O   . LEU A 1 48 ? 15.394 11.217 -1.136 1.00 25.47 ? 48  LEU A O   1 
ATOM   363  C  CB  . LEU A 1 48 ? 15.140 10.975 1.987  1.00 27.27 ? 48  LEU A CB  1 
ATOM   364  C  CG  . LEU A 1 48 ? 15.365 10.480 3.416  1.00 27.41 ? 48  LEU A CG  1 
ATOM   365  C  CD1 . LEU A 1 48 ? 15.228 11.636 4.400  1.00 27.89 ? 48  LEU A CD1 1 
ATOM   366  C  CD2 . LEU A 1 48 ? 14.356 9.386  3.729  1.00 27.10 ? 48  LEU A CD2 1 
ATOM   367  N  N   . GLN A 1 49 ? 13.405 10.260 -0.695 1.00 25.03 ? 49  GLN A N   1 
ATOM   368  C  CA  . GLN A 1 49 ? 12.751 10.770 -1.893 1.00 23.98 ? 49  GLN A CA  1 
ATOM   369  C  C   . GLN A 1 49 ? 12.222 12.173 -1.637 1.00 25.21 ? 49  GLN A C   1 
ATOM   370  O  O   . GLN A 1 49 ? 11.999 12.555 -0.491 1.00 22.63 ? 49  GLN A O   1 
ATOM   371  C  CB  . GLN A 1 49 ? 11.601 9.845  -2.279 1.00 24.80 ? 49  GLN A CB  1 
ATOM   372  C  CG  . GLN A 1 49 ? 12.044 8.412  -2.504 1.00 24.00 ? 49  GLN A CG  1 
ATOM   373  C  CD  . GLN A 1 49 ? 13.036 8.293  -3.640 1.00 23.45 ? 49  GLN A CD  1 
ATOM   374  O  OE1 . GLN A 1 49 ? 12.703 8.550  -4.796 1.00 22.85 ? 49  GLN A OE1 1 
ATOM   375  N  NE2 . GLN A 1 49 ? 14.270 7.915  -3.315 1.00 24.57 ? 49  GLN A NE2 1 
ATOM   376  N  N   . ASP A 1 50 ? 12.006 12.938 -2.702 1.00 25.75 ? 50  ASP A N   1 
ATOM   377  C  CA  . ASP A 1 50 ? 11.514 14.299 -2.536 1.00 26.27 ? 50  ASP A CA  1 
ATOM   378  C  C   . ASP A 1 50 ? 10.170 14.340 -1.809 1.00 25.05 ? 50  ASP A C   1 
ATOM   379  O  O   . ASP A 1 50 ? 9.918  15.244 -1.010 1.00 24.58 ? 50  ASP A O   1 
ATOM   380  C  CB  . ASP A 1 50 ? 11.389 14.994 -3.889 1.00 25.40 ? 50  ASP A CB  1 
ATOM   381  C  CG  . ASP A 1 50 ? 11.191 16.486 -3.748 1.00 25.59 ? 50  ASP A CG  1 
ATOM   382  O  OD1 . ASP A 1 50 ? 12.167 17.188 -3.394 1.00 27.37 ? 50  ASP A OD1 1 
ATOM   383  O  OD2 . ASP A 1 50 ? 10.057 16.954 -3.972 1.00 25.78 ? 50  ASP A OD2 1 
ATOM   384  N  N   . ALA A 1 51 ? 9.309  13.363 -2.078 1.00 24.61 ? 51  ALA A N   1 
ATOM   385  C  CA  . ALA A 1 51 ? 8.004  13.313 -1.426 1.00 24.34 ? 51  ALA A CA  1 
ATOM   386  C  C   . ALA A 1 51 ? 8.187  13.192 0.083  1.00 23.41 ? 51  ALA A C   1 
ATOM   387  O  O   . ALA A 1 51 ? 7.380  13.698 0.861  1.00 23.61 ? 51  ALA A O   1 
ATOM   388  C  CB  . ALA A 1 51 ? 7.192  12.132 -1.957 1.00 24.73 ? 51  ALA A CB  1 
ATOM   389  N  N   . GLU A 1 52 ? 9.261  12.523 0.489  1.00 23.49 ? 52  GLU A N   1 
ATOM   390  C  CA  . GLU A 1 52 ? 9.548  12.341 1.904  1.00 23.50 ? 52  GLU A CA  1 
ATOM   391  C  C   . GLU A 1 52 ? 10.082 13.626 2.527  1.00 22.10 ? 52  GLU A C   1 
ATOM   392  O  O   . GLU A 1 52 ? 9.830  13.901 3.698  1.00 21.69 ? 52  GLU A O   1 
ATOM   393  C  CB  . GLU A 1 52 ? 10.539 11.190 2.090  1.00 24.50 ? 52  GLU A CB  1 
ATOM   394  C  CG  . GLU A 1 52 ? 9.952  9.854  1.649  1.00 27.04 ? 52  GLU A CG  1 
ATOM   395  C  CD  . GLU A 1 52 ? 10.939 8.710  1.716  1.00 28.05 ? 52  GLU A CD  1 
ATOM   396  O  OE1 . GLU A 1 52 ? 12.016 8.814  1.090  1.00 26.15 ? 52  GLU A OE1 1 
ATOM   397  O  OE2 . GLU A 1 52 ? 10.629 7.701  2.390  1.00 30.76 ? 52  GLU A OE2 1 
ATOM   398  N  N   . ILE A 1 53 ? 10.810 14.419 1.746  1.00 22.89 ? 53  ILE A N   1 
ATOM   399  C  CA  . ILE A 1 53 ? 11.346 15.681 2.257  1.00 22.97 ? 53  ILE A CA  1 
ATOM   400  C  C   . ILE A 1 53 ? 10.192 16.669 2.399  1.00 22.89 ? 53  ILE A C   1 
ATOM   401  O  O   . ILE A 1 53 ? 10.169 17.486 3.321  1.00 21.29 ? 53  ILE A O   1 
ATOM   402  C  CB  . ILE A 1 53 ? 12.414 16.279 1.314  1.00 24.38 ? 53  ILE A CB  1 
ATOM   403  C  CG1 . ILE A 1 53 ? 13.640 15.365 1.256  1.00 26.00 ? 53  ILE A CG1 1 
ATOM   404  C  CG2 . ILE A 1 53 ? 12.826 17.656 1.802  1.00 25.58 ? 53  ILE A CG2 1 
ATOM   405  C  CD1 . ILE A 1 53 ? 14.288 15.100 2.606  1.00 27.45 ? 53  ILE A CD1 1 
ATOM   406  N  N   . ALA A 1 54 ? 9.236  16.580 1.477  1.00 23.07 ? 54  ALA A N   1 
ATOM   407  C  CA  . ALA A 1 54 ? 8.054  17.436 1.486  1.00 23.38 ? 54  ALA A CA  1 
ATOM   408  C  C   . ALA A 1 54 ? 7.208  17.133 2.716  1.00 22.88 ? 54  ALA A C   1 
ATOM   409  O  O   . ALA A 1 54 ? 6.643  18.038 3.334  1.00 22.83 ? 54  ALA A O   1 
ATOM   410  C  CB  . ALA A 1 54 ? 7.230  17.205 0.222  1.00 23.45 ? 54  ALA A CB  1 
ATOM   411  N  N   . ARG A 1 55 ? 7.113  15.855 3.067  1.00 22.49 ? 55  ARG A N   1 
ATOM   412  C  CA  . ARG A 1 55 ? 6.337  15.453 4.231  1.00 22.50 ? 55  ARG A CA  1 
ATOM   413  C  C   . ARG A 1 55 ? 7.035  15.950 5.496  1.00 21.10 ? 55  ARG A C   1 
ATOM   414  O  O   . ARG A 1 55 ? 6.378  16.384 6.449  1.00 20.45 ? 55  ARG A O   1 
ATOM   415  C  CB  . ARG A 1 55 ? 6.184  13.927 4.270  1.00 26.06 ? 55  ARG A CB  1 
ATOM   416  C  CG  . ARG A 1 55 ? 5.292  13.402 5.395  1.00 31.08 ? 55  ARG A CG  1 
ATOM   417  C  CD  . ARG A 1 55 ? 4.961  11.923 5.180  1.00 35.75 ? 55  ARG A CD  1 
ATOM   418  N  NE  . ARG A 1 55 ? 4.176  11.345 6.272  1.00 39.62 ? 55  ARG A NE  1 
ATOM   419  C  CZ  . ARG A 1 55 ? 2.900  11.629 6.528  1.00 41.85 ? 55  ARG A CZ  1 
ATOM   420  N  NH1 . ARG A 1 55 ? 2.235  12.492 5.769  1.00 42.89 ? 55  ARG A NH1 1 
ATOM   421  N  NH2 . ARG A 1 55 ? 2.288  11.046 7.553  1.00 42.45 ? 55  ARG A NH2 1 
ATOM   422  N  N   . LEU A 1 56 ? 8.364  15.896 5.492  1.00 18.53 ? 56  LEU A N   1 
ATOM   423  C  CA  . LEU A 1 56 ? 9.153  16.346 6.639  1.00 19.87 ? 56  LEU A CA  1 
ATOM   424  C  C   . LEU A 1 56 ? 8.939  17.840 6.850  1.00 19.42 ? 56  LEU A C   1 
ATOM   425  O  O   . LEU A 1 56 ? 8.795  18.303 7.978  1.00 18.24 ? 56  LEU A O   1 
ATOM   426  C  CB  . LEU A 1 56 ? 10.641 16.063 6.415  1.00 20.39 ? 56  LEU A CB  1 
ATOM   427  C  CG  . LEU A 1 56 ? 11.604 16.481 7.534  1.00 20.97 ? 56  LEU A CG  1 
ATOM   428  C  CD1 . LEU A 1 56 ? 11.207 15.799 8.834  1.00 21.16 ? 56  LEU A CD1 1 
ATOM   429  C  CD2 . LEU A 1 56 ? 13.036 16.111 7.155  1.00 21.87 ? 56  LEU A CD2 1 
ATOM   430  N  N   . MET A 1 57 ? 8.920  18.591 5.752  1.00 19.73 ? 57  MET A N   1 
ATOM   431  C  CA  . MET A 1 57 ? 8.712  20.033 5.819  1.00 20.42 ? 57  MET A CA  1 
ATOM   432  C  C   . MET A 1 57 ? 7.340  20.316 6.429  1.00 20.30 ? 57  MET A C   1 
ATOM   433  O  O   . MET A 1 57 ? 7.216  21.128 7.341  1.00 19.54 ? 57  MET A O   1 
ATOM   434  C  CB  . MET A 1 57 ? 8.809  20.642 4.416  1.00 20.81 ? 57  MET A CB  1 
ATOM   435  C  CG  . MET A 1 57 ? 8.394  22.105 4.319  1.00 22.05 ? 57  MET A CG  1 
ATOM   436  S  SD  . MET A 1 57 ? 9.388  23.241 5.318  1.00 23.14 ? 57  MET A SD  1 
ATOM   437  C  CE  . MET A 1 57 ? 10.837 23.367 4.304  1.00 21.26 ? 57  MET A CE  1 
ATOM   438  N  N   . GLU A 1 58 ? 6.315  19.630 5.928  1.00 20.43 ? 58  GLU A N   1 
ATOM   439  C  CA  . GLU A 1 58 ? 4.954  19.797 6.430  1.00 22.25 ? 58  GLU A CA  1 
ATOM   440  C  C   . GLU A 1 58 ? 4.898  19.535 7.937  1.00 21.95 ? 58  GLU A C   1 
ATOM   441  O  O   . GLU A 1 58 ? 4.245  20.268 8.681  1.00 22.86 ? 58  GLU A O   1 
ATOM   442  C  CB  . GLU A 1 58 ? 4.015  18.837 5.686  1.00 23.99 ? 58  GLU A CB  1 
ATOM   443  C  CG  . GLU A 1 58 ? 2.594  18.727 6.225  1.00 28.62 ? 58  GLU A CG  1 
ATOM   444  C  CD  . GLU A 1 58 ? 1.736  19.944 5.933  1.00 31.83 ? 58  GLU A CD  1 
ATOM   445  O  OE1 . GLU A 1 58 ? 1.843  20.504 4.819  1.00 33.70 ? 58  GLU A OE1 1 
ATOM   446  O  OE2 . GLU A 1 58 ? 0.939  20.331 6.814  1.00 33.31 ? 58  GLU A OE2 1 
ATOM   447  N  N   . ASP A 1 59 ? 5.592  18.489 8.375  1.00 20.69 ? 59  ASP A N   1 
ATOM   448  C  CA  . ASP A 1 59 ? 5.641  18.122 9.788  1.00 22.05 ? 59  ASP A CA  1 
ATOM   449  C  C   . ASP A 1 59 ? 6.350  19.178 10.630 1.00 19.52 ? 59  ASP A C   1 
ATOM   450  O  O   . ASP A 1 59 ? 5.843  19.607 11.662 1.00 21.03 ? 59  ASP A O   1 
ATOM   451  C  CB  . ASP A 1 59 ? 6.375  16.787 9.960  1.00 24.22 ? 59  ASP A CB  1 
ATOM   452  C  CG  . ASP A 1 59 ? 6.535  16.378 11.426 1.00 29.19 ? 59  ASP A CG  1 
ATOM   453  O  OD1 . ASP A 1 59 ? 6.198  17.176 12.330 1.00 32.20 ? 59  ASP A OD1 1 
ATOM   454  O  OD2 . ASP A 1 59 ? 7.010  15.248 11.673 1.00 31.76 ? 59  ASP A OD2 1 
ATOM   455  N  N   . LEU A 1 60 ? 7.525  19.603 10.182 1.00 17.05 ? 60  LEU A N   1 
ATOM   456  C  CA  . LEU A 1 60 ? 8.303  20.572 10.939 1.00 13.20 ? 60  LEU A CA  1 
ATOM   457  C  C   . LEU A 1 60 ? 7.844  22.023 10.901 1.00 14.83 ? 60  LEU A C   1 
ATOM   458  O  O   . LEU A 1 60 ? 8.027  22.754 11.871 1.00 14.40 ? 60  LEU A O   1 
ATOM   459  C  CB  . LEU A 1 60 ? 9.769  20.520 10.500 1.00 14.26 ? 60  LEU A CB  1 
ATOM   460  C  CG  . LEU A 1 60 ? 10.504 19.194 10.676 1.00 13.74 ? 60  LEU A CG  1 
ATOM   461  C  CD1 . LEU A 1 60 ? 11.929 19.343 10.173 1.00 13.64 ? 60  LEU A CD1 1 
ATOM   462  C  CD2 . LEU A 1 60 ? 10.485 18.788 12.146 1.00 15.31 ? 60  LEU A CD2 1 
ATOM   463  N  N   . ASP A 1 61 ? 7.251  22.441 9.788  1.00 14.30 ? 61  ASP A N   1 
ATOM   464  C  CA  . ASP A 1 61 ? 6.822  23.828 9.634  1.00 15.86 ? 61  ASP A CA  1 
ATOM   465  C  C   . ASP A 1 61 ? 5.559  24.183 10.406 1.00 16.46 ? 61  ASP A C   1 
ATOM   466  O  O   . ASP A 1 61 ? 4.476  24.294 9.832  1.00 17.82 ? 61  ASP A O   1 
ATOM   467  C  CB  . ASP A 1 61 ? 6.634  24.131 8.147  1.00 15.44 ? 61  ASP A CB  1 
ATOM   468  C  CG  . ASP A 1 61 ? 6.239  25.558 7.901  1.00 15.99 ? 61  ASP A CG  1 
ATOM   469  O  OD1 . ASP A 1 61 ? 6.559  26.409 8.756  1.00 16.67 ? 61  ASP A OD1 1 
ATOM   470  O  OD2 . ASP A 1 61 ? 5.623  25.831 6.857  1.00 15.66 ? 61  ASP A OD2 1 
ATOM   471  N  N   . ARG A 1 62 ? 5.704  24.400 11.708 1.00 17.63 ? 62  ARG A N   1 
ATOM   472  C  CA  . ARG A 1 62 ? 4.541  24.698 12.534 1.00 18.37 ? 62  ARG A CA  1 
ATOM   473  C  C   . ARG A 1 62 ? 3.836  26.030 12.298 1.00 18.09 ? 62  ARG A C   1 
ATOM   474  O  O   . ARG A 1 62 ? 2.623  26.119 12.511 1.00 18.60 ? 62  ARG A O   1 
ATOM   475  C  CB  . ARG A 1 62 ? 4.893  24.555 14.017 1.00 20.90 ? 62  ARG A CB  1 
ATOM   476  C  CG  . ARG A 1 62 ? 5.327  23.138 14.448 1.00 26.33 ? 62  ARG A CG  1 
ATOM   477  C  CD  . ARG A 1 62 ? 4.656  22.002 13.643 1.00 27.23 ? 62  ARG A CD  1 
ATOM   478  N  NE  . ARG A 1 62 ? 3.273  22.294 13.273 1.00 31.39 ? 62  ARG A NE  1 
ATOM   479  C  CZ  . ARG A 1 62 ? 2.646  21.749 12.232 1.00 31.92 ? 62  ARG A CZ  1 
ATOM   480  N  NH1 . ARG A 1 62 ? 1.387  22.082 11.968 1.00 32.47 ? 62  ARG A NH1 1 
ATOM   481  N  NH2 . ARG A 1 62 ? 3.271  20.870 11.456 1.00 29.05 ? 62  ARG A NH2 1 
ATOM   482  N  N   . ASN A 1 63 ? 4.558  27.061 11.857 1.00 16.06 ? 63  ASN A N   1 
ATOM   483  C  CA  . ASN A 1 63 ? 3.903  28.349 11.623 1.00 15.80 ? 63  ASN A CA  1 
ATOM   484  C  C   . ASN A 1 63 ? 3.490  28.623 10.173 1.00 15.50 ? 63  ASN A C   1 
ATOM   485  O  O   . ASN A 1 63 ? 3.138  29.745 9.811  1.00 16.87 ? 63  ASN A O   1 
ATOM   486  C  CB  . ASN A 1 63 ? 4.739  29.515 12.191 1.00 13.41 ? 63  ASN A CB  1 
ATOM   487  C  CG  . ASN A 1 63 ? 6.124  29.624 11.579 1.00 14.73 ? 63  ASN A CG  1 
ATOM   488  O  OD1 . ASN A 1 63 ? 6.473  28.907 10.644 1.00 11.88 ? 63  ASN A OD1 1 
ATOM   489  N  ND2 . ASN A 1 63 ? 6.926  30.553 12.111 1.00 12.81 ? 63  ASN A ND2 1 
ATOM   490  N  N   . LYS A 1 64 ? 3.533  27.587 9.343  1.00 17.37 ? 64  LYS A N   1 
ATOM   491  C  CA  . LYS A 1 64 ? 3.092  27.702 7.952  1.00 19.13 ? 64  LYS A CA  1 
ATOM   492  C  C   . LYS A 1 64 ? 3.728  28.785 7.082  1.00 18.40 ? 64  LYS A C   1 
ATOM   493  O  O   . LYS A 1 64 ? 3.007  29.519 6.398  1.00 18.80 ? 64  LYS A O   1 
ATOM   494  C  CB  . LYS A 1 64 ? 1.577  27.920 7.921  1.00 22.76 ? 64  LYS A CB  1 
ATOM   495  C  CG  . LYS A 1 64 ? 0.769  26.938 8.736  1.00 27.22 ? 64  LYS A CG  1 
ATOM   496  C  CD  . LYS A 1 64 ? 0.933  25.533 8.211  1.00 29.78 ? 64  LYS A CD  1 
ATOM   497  C  CE  . LYS A 1 64 ? -0.248 24.669 8.602  1.00 31.44 ? 64  LYS A CE  1 
ATOM   498  N  NZ  . LYS A 1 64 ? -0.137 23.317 7.981  1.00 33.51 ? 64  LYS A NZ  1 
ATOM   499  N  N   . ASP A 1 65 ? 5.052  28.908 7.096  1.00 15.79 ? 65  ASP A N   1 
ATOM   500  C  CA  . ASP A 1 65 ? 5.690  29.901 6.248  1.00 15.09 ? 65  ASP A CA  1 
ATOM   501  C  C   . ASP A 1 65 ? 6.549  29.189 5.206  1.00 15.37 ? 65  ASP A C   1 
ATOM   502  O  O   . ASP A 1 65 ? 7.326  29.812 4.501  1.00 16.16 ? 65  ASP A O   1 
ATOM   503  C  CB  . ASP A 1 65 ? 6.530  30.895 7.073  1.00 14.84 ? 65  ASP A CB  1 
ATOM   504  C  CG  . ASP A 1 65 ? 7.692  30.241 7.805  1.00 13.53 ? 65  ASP A CG  1 
ATOM   505  O  OD1 . ASP A 1 65 ? 8.535  30.998 8.332  1.00 12.46 ? 65  ASP A OD1 1 
ATOM   506  O  OD2 . ASP A 1 65 ? 7.769  28.995 7.864  1.00 10.41 ? 65  ASP A OD2 1 
ATOM   507  N  N   . GLN A 1 66 ? 6.378  27.872 5.126  1.00 16.94 ? 66  GLN A N   1 
ATOM   508  C  CA  . GLN A 1 66 ? 7.096  27.016 4.181  1.00 17.93 ? 66  GLN A CA  1 
ATOM   509  C  C   . GLN A 1 66 ? 8.604  27.002 4.423  1.00 19.60 ? 66  GLN A C   1 
ATOM   510  O  O   . GLN A 1 66 ? 9.387  26.676 3.527  1.00 20.76 ? 66  GLN A O   1 
ATOM   511  C  CB  . GLN A 1 66 ? 6.809  27.452 2.732  1.00 21.24 ? 66  GLN A CB  1 
ATOM   512  C  CG  . GLN A 1 66 ? 5.347  27.362 2.287  1.00 23.54 ? 66  GLN A CG  1 
ATOM   513  C  CD  . GLN A 1 66 ? 4.462  28.457 2.870  1.00 26.04 ? 66  GLN A CD  1 
ATOM   514  O  OE1 . GLN A 1 66 ? 4.724  29.650 2.693  1.00 26.42 ? 66  GLN A OE1 1 
ATOM   515  N  NE2 . GLN A 1 66 ? 3.401  28.052 3.559  1.00 26.24 ? 66  GLN A NE2 1 
ATOM   516  N  N   . GLU A 1 67 ? 9.008  27.359 5.638  1.00 17.71 ? 67  GLU A N   1 
ATOM   517  C  CA  . GLU A 1 67 ? 10.418 27.374 5.991  1.00 16.78 ? 67  GLU A CA  1 
ATOM   518  C  C   . GLU A 1 67 ? 10.594 26.757 7.359  1.00 13.40 ? 67  GLU A C   1 
ATOM   519  O  O   . GLU A 1 67 ? 9.677  26.767 8.171  1.00 13.75 ? 67  GLU A O   1 
ATOM   520  C  CB  . GLU A 1 67 ? 10.945 28.805 6.012  1.00 19.18 ? 67  GLU A CB  1 
ATOM   521  C  CG  . GLU A 1 67 ? 10.493 29.602 4.817  1.00 24.41 ? 67  GLU A CG  1 
ATOM   522  C  CD  . GLU A 1 67 ? 11.391 30.761 4.522  1.00 27.49 ? 67  GLU A CD  1 
ATOM   523  O  OE1 . GLU A 1 67 ? 11.518 31.650 5.389  1.00 29.59 ? 67  GLU A OE1 1 
ATOM   524  O  OE2 . GLU A 1 67 ? 11.974 30.777 3.417  1.00 30.71 ? 67  GLU A OE2 1 
ATOM   525  N  N   . VAL A 1 68 ? 11.775 26.210 7.608  1.00 10.92 ? 68  VAL A N   1 
ATOM   526  C  CA  . VAL A 1 68 ? 12.058 25.609 8.904  1.00 11.15 ? 68  VAL A CA  1 
ATOM   527  C  C   . VAL A 1 68 ? 12.972 26.549 9.674  1.00 10.54 ? 68  VAL A C   1 
ATOM   528  O  O   . VAL A 1 68 ? 14.134 26.742 9.288  1.00 10.92 ? 68  VAL A O   1 
ATOM   529  C  CB  . VAL A 1 68 ? 12.765 24.250 8.749  1.00 11.94 ? 68  VAL A CB  1 
ATOM   530  C  CG1 . VAL A 1 68 ? 13.170 23.717 10.101 1.00 10.36 ? 68  VAL A CG1 1 
ATOM   531  C  CG2 . VAL A 1 68 ? 11.844 23.265 8.058  1.00 11.75 ? 68  VAL A CG2 1 
ATOM   532  N  N   . ASN A 1 69 ? 12.450 27.160 10.739 1.00 10.68 ? 69  ASN A N   1 
ATOM   533  C  CA  . ASN A 1 69 ? 13.283 28.060 11.537 1.00 11.14 ? 69  ASN A CA  1 
ATOM   534  C  C   . ASN A 1 69 ? 14.097 27.213 12.504 1.00 9.63  ? 69  ASN A C   1 
ATOM   535  O  O   . ASN A 1 69 ? 13.938 25.990 12.543 1.00 12.20 ? 69  ASN A O   1 
ATOM   536  C  CB  . ASN A 1 69 ? 12.443 29.099 12.299 1.00 9.53  ? 69  ASN A CB  1 
ATOM   537  C  CG  . ASN A 1 69 ? 11.394 28.474 13.204 1.00 10.13 ? 69  ASN A CG  1 
ATOM   538  O  OD1 . ASN A 1 69 ? 11.551 27.354 13.688 1.00 10.84 ? 69  ASN A OD1 1 
ATOM   539  N  ND2 . ASN A 1 69 ? 10.318 29.216 13.454 1.00 9.80  ? 69  ASN A ND2 1 
ATOM   540  N  N   . PHE A 1 70 ? 14.970 27.843 13.281 1.00 9.51  ? 70  PHE A N   1 
ATOM   541  C  CA  . PHE A 1 70 ? 15.804 27.078 14.198 1.00 10.18 ? 70  PHE A CA  1 
ATOM   542  C  C   . PHE A 1 70 ? 15.031 26.328 15.276 1.00 10.87 ? 70  PHE A C   1 
ATOM   543  O  O   . PHE A 1 70 ? 15.459 25.264 15.721 1.00 11.74 ? 70  PHE A O   1 
ATOM   544  C  CB  . PHE A 1 70 ? 16.839 27.970 14.876 1.00 10.85 ? 70  PHE A CB  1 
ATOM   545  C  CG  . PHE A 1 70 ? 17.881 27.197 15.615 1.00 10.83 ? 70  PHE A CG  1 
ATOM   546  C  CD1 . PHE A 1 70 ? 18.902 26.553 14.922 1.00 11.44 ? 70  PHE A CD1 1 
ATOM   547  C  CD2 . PHE A 1 70 ? 17.808 27.051 16.993 1.00 11.62 ? 70  PHE A CD2 1 
ATOM   548  C  CE1 . PHE A 1 70 ? 19.839 25.762 15.592 1.00 12.35 ? 70  PHE A CE1 1 
ATOM   549  C  CE2 . PHE A 1 70 ? 18.744 26.261 17.679 1.00 13.62 ? 70  PHE A CE2 1 
ATOM   550  C  CZ  . PHE A 1 70 ? 19.759 25.617 16.972 1.00 11.85 ? 70  PHE A CZ  1 
ATOM   551  N  N   . GLN A 1 71 ? 13.899 26.886 15.699 1.00 10.62 ? 71  GLN A N   1 
ATOM   552  C  CA  . GLN A 1 71 ? 13.088 26.256 16.732 1.00 10.45 ? 71  GLN A CA  1 
ATOM   553  C  C   . GLN A 1 71 ? 12.459 24.976 16.198 1.00 11.56 ? 71  GLN A C   1 
ATOM   554  O  O   . GLN A 1 71 ? 12.399 23.963 16.896 1.00 11.60 ? 71  GLN A O   1 
ATOM   555  C  CB  . GLN A 1 71 ? 12.011 27.229 17.220 1.00 9.74  ? 71  GLN A CB  1 
ATOM   556  C  CG  . GLN A 1 71 ? 12.566 28.506 17.888 1.00 9.68  ? 71  GLN A CG  1 
ATOM   557  C  CD  . GLN A 1 71 ? 13.119 29.522 16.898 1.00 12.13 ? 71  GLN A CD  1 
ATOM   558  O  OE1 . GLN A 1 71 ? 12.604 29.676 15.791 1.00 11.31 ? 71  GLN A OE1 1 
ATOM   559  N  NE2 . GLN A 1 71 ? 14.162 30.241 17.307 1.00 13.23 ? 71  GLN A NE2 1 
ATOM   560  N  N   . GLU A 1 72 ? 12.011 25.023 14.948 1.00 11.71 ? 72  GLU A N   1 
ATOM   561  C  CA  . GLU A 1 72 ? 11.412 23.861 14.312 1.00 12.28 ? 72  GLU A CA  1 
ATOM   562  C  C   . GLU A 1 72 ? 12.512 22.829 14.030 1.00 11.38 ? 72  GLU A C   1 
ATOM   563  O  O   . GLU A 1 72 ? 12.260 21.625 14.043 1.00 11.04 ? 72  GLU A O   1 
ATOM   564  C  CB  . GLU A 1 72 ? 10.691 24.294 13.025 1.00 11.99 ? 72  GLU A CB  1 
ATOM   565  C  CG  . GLU A 1 72 ? 9.555  25.282 13.318 1.00 11.79 ? 72  GLU A CG  1 
ATOM   566  C  CD  . GLU A 1 72 ? 9.037  26.018 12.096 1.00 12.15 ? 72  GLU A CD  1 
ATOM   567  O  OE1 . GLU A 1 72 ? 9.778  26.152 11.098 1.00 9.70  ? 72  GLU A OE1 1 
ATOM   568  O  OE2 . GLU A 1 72 ? 7.884  26.493 12.152 1.00 11.87 ? 72  GLU A OE2 1 
ATOM   569  N  N   . TYR A 1 73 ? 13.730 23.310 13.794 1.00 11.00 ? 73  TYR A N   1 
ATOM   570  C  CA  . TYR A 1 73 ? 14.872 22.436 13.541 1.00 11.12 ? 73  TYR A CA  1 
ATOM   571  C  C   . TYR A 1 73 ? 15.206 21.705 14.843 1.00 12.03 ? 73  TYR A C   1 
ATOM   572  O  O   . TYR A 1 73 ? 15.565 20.528 14.835 1.00 12.78 ? 73  TYR A O   1 
ATOM   573  C  CB  . TYR A 1 73 ? 16.061 23.280 13.075 1.00 10.97 ? 73  TYR A CB  1 
ATOM   574  C  CG  . TYR A 1 73 ? 17.396 22.567 12.997 1.00 10.55 ? 73  TYR A CG  1 
ATOM   575  C  CD1 . TYR A 1 73 ? 17.645 21.595 12.027 1.00 12.48 ? 73  TYR A CD1 1 
ATOM   576  C  CD2 . TYR A 1 73 ? 18.434 22.921 13.852 1.00 9.54  ? 73  TYR A CD2 1 
ATOM   577  C  CE1 . TYR A 1 73 ? 18.910 21.002 11.909 1.00 12.32 ? 73  TYR A CE1 1 
ATOM   578  C  CE2 . TYR A 1 73 ? 19.691 22.340 13.745 1.00 11.92 ? 73  TYR A CE2 1 
ATOM   579  C  CZ  . TYR A 1 73 ? 19.926 21.387 12.769 1.00 11.97 ? 73  TYR A CZ  1 
ATOM   580  O  OH  . TYR A 1 73 ? 21.196 20.850 12.647 1.00 11.41 ? 73  TYR A OH  1 
ATOM   581  N  N   . VAL A 1 74 ? 15.080 22.407 15.965 1.00 12.64 ? 74  VAL A N   1 
ATOM   582  C  CA  . VAL A 1 74 ? 15.345 21.803 17.267 1.00 12.64 ? 74  VAL A CA  1 
ATOM   583  C  C   . VAL A 1 74 ? 14.365 20.657 17.504 1.00 13.83 ? 74  VAL A C   1 
ATOM   584  O  O   . VAL A 1 74 ? 14.724 19.626 18.070 1.00 11.89 ? 74  VAL A O   1 
ATOM   585  C  CB  . VAL A 1 74 ? 15.198 22.834 18.405 1.00 13.23 ? 74  VAL A CB  1 
ATOM   586  C  CG1 . VAL A 1 74 ? 15.159 22.123 19.761 1.00 12.88 ? 74  VAL A CG1 1 
ATOM   587  C  CG2 . VAL A 1 74 ? 16.371 23.800 18.374 1.00 13.49 ? 74  VAL A CG2 1 
ATOM   588  N  N   . THR A 1 75 ? 13.125 20.844 17.066 1.00 13.23 ? 75  THR A N   1 
ATOM   589  C  CA  . THR A 1 75 ? 12.109 19.813 17.222 1.00 12.55 ? 75  THR A CA  1 
ATOM   590  C  C   . THR A 1 75 ? 12.503 18.584 16.422 1.00 13.59 ? 75  THR A C   1 
ATOM   591  O  O   . THR A 1 75 ? 12.301 17.454 16.872 1.00 13.99 ? 75  THR A O   1 
ATOM   592  C  CB  . THR A 1 75 ? 10.738 20.324 16.759 1.00 12.67 ? 75  THR A CB  1 
ATOM   593  O  OG1 . THR A 1 75 ? 10.342 21.412 17.602 1.00 12.82 ? 75  THR A OG1 1 
ATOM   594  C  CG2 . THR A 1 75 ? 9.697  19.222 16.852 1.00 15.83 ? 75  THR A CG2 1 
ATOM   595  N  N   . PHE A 1 76 ? 13.066 18.812 15.238 1.00 11.54 ? 76  PHE A N   1 
ATOM   596  C  CA  . PHE A 1 76 ? 13.529 17.737 14.374 1.00 13.85 ? 76  PHE A CA  1 
ATOM   597  C  C   . PHE A 1 76 ? 14.652 16.970 15.078 1.00 14.73 ? 76  PHE A C   1 
ATOM   598  O  O   . PHE A 1 76 ? 14.652 15.736 15.106 1.00 14.58 ? 76  PHE A O   1 
ATOM   599  C  CB  . PHE A 1 76 ? 14.037 18.321 13.052 1.00 14.37 ? 76  PHE A CB  1 
ATOM   600  C  CG  . PHE A 1 76 ? 14.630 17.303 12.125 1.00 16.84 ? 76  PHE A CG  1 
ATOM   601  C  CD1 . PHE A 1 76 ? 13.881 16.208 11.704 1.00 18.36 ? 76  PHE A CD1 1 
ATOM   602  C  CD2 . PHE A 1 76 ? 15.936 17.439 11.668 1.00 20.43 ? 76  PHE A CD2 1 
ATOM   603  C  CE1 . PHE A 1 76 ? 14.423 15.260 10.843 1.00 21.09 ? 76  PHE A CE1 1 
ATOM   604  C  CE2 . PHE A 1 76 ? 16.491 16.495 10.804 1.00 21.50 ? 76  PHE A CE2 1 
ATOM   605  C  CZ  . PHE A 1 76 ? 15.731 15.403 10.390 1.00 21.47 ? 76  PHE A CZ  1 
ATOM   606  N  N   . LEU A 1 77 ? 15.600 17.706 15.651 1.00 14.13 ? 77  LEU A N   1 
ATOM   607  C  CA  . LEU A 1 77 ? 16.719 17.094 16.362 1.00 13.09 ? 77  LEU A CA  1 
ATOM   608  C  C   . LEU A 1 77 ? 16.196 16.211 17.497 1.00 11.94 ? 77  LEU A C   1 
ATOM   609  O  O   . LEU A 1 77 ? 16.667 15.091 17.693 1.00 12.62 ? 77  LEU A O   1 
ATOM   610  C  CB  . LEU A 1 77 ? 17.655 18.174 16.927 1.00 14.74 ? 77  LEU A CB  1 
ATOM   611  C  CG  . LEU A 1 77 ? 18.328 19.092 15.897 1.00 14.70 ? 77  LEU A CG  1 
ATOM   612  C  CD1 . LEU A 1 77 ? 19.252 20.097 16.589 1.00 15.14 ? 77  LEU A CD1 1 
ATOM   613  C  CD2 . LEU A 1 77 ? 19.114 18.239 14.910 1.00 14.57 ? 77  LEU A CD2 1 
ATOM   614  N  N   . GLY A 1 78 ? 15.210 16.717 18.233 1.00 12.60 ? 78  GLY A N   1 
ATOM   615  C  CA  . GLY A 1 78 ? 14.648 15.956 19.335 1.00 12.90 ? 78  GLY A CA  1 
ATOM   616  C  C   . GLY A 1 78 ? 14.003 14.667 18.866 1.00 14.61 ? 78  GLY A C   1 
ATOM   617  O  O   . GLY A 1 78 ? 14.071 13.631 19.538 1.00 12.93 ? 78  GLY A O   1 
ATOM   618  N  N   . ALA A 1 79 ? 13.371 14.720 17.702 1.00 13.90 ? 79  ALA A N   1 
ATOM   619  C  CA  . ALA A 1 79 ? 12.716 13.535 17.165 1.00 15.22 ? 79  ALA A CA  1 
ATOM   620  C  C   . ALA A 1 79 ? 13.766 12.486 16.853 1.00 15.85 ? 79  ALA A C   1 
ATOM   621  O  O   . ALA A 1 79 ? 13.567 11.296 17.105 1.00 16.56 ? 79  ALA A O   1 
ATOM   622  C  CB  . ALA A 1 79 ? 11.945 13.893 15.908 1.00 15.87 ? 79  ALA A CB  1 
ATOM   623  N  N   . LEU A 1 80 ? 14.887 12.935 16.294 1.00 15.87 ? 80  LEU A N   1 
ATOM   624  C  CA  . LEU A 1 80 ? 15.972 12.033 15.939 1.00 17.13 ? 80  LEU A CA  1 
ATOM   625  C  C   . LEU A 1 80 ? 16.613 11.433 17.185 1.00 16.03 ? 80  LEU A C   1 
ATOM   626  O  O   . LEU A 1 80 ? 17.016 10.267 17.186 1.00 16.75 ? 80  LEU A O   1 
ATOM   627  C  CB  . LEU A 1 80 ? 17.025 12.768 15.099 1.00 20.73 ? 80  LEU A CB  1 
ATOM   628  C  CG  . LEU A 1 80 ? 16.594 13.242 13.705 1.00 23.90 ? 80  LEU A CG  1 
ATOM   629  C  CD1 . LEU A 1 80 ? 17.760 13.960 13.028 1.00 26.32 ? 80  LEU A CD1 1 
ATOM   630  C  CD2 . LEU A 1 80 ? 16.154 12.054 12.868 1.00 24.76 ? 80  LEU A CD2 1 
ATOM   631  N  N   . ALA A 1 81 ? 16.696 12.229 18.245 1.00 13.04 ? 81  ALA A N   1 
ATOM   632  C  CA  . ALA A 1 81 ? 17.276 11.764 19.497 1.00 13.52 ? 81  ALA A CA  1 
ATOM   633  C  C   . ALA A 1 81 ? 16.403 10.656 20.095 1.00 13.58 ? 81  ALA A C   1 
ATOM   634  O  O   . ALA A 1 81 ? 16.915 9.662  20.603 1.00 12.92 ? 81  ALA A O   1 
ATOM   635  C  CB  . ALA A 1 81 ? 17.407 12.922 20.481 1.00 13.81 ? 81  ALA A CB  1 
ATOM   636  N  N   . LEU A 1 82 ? 15.086 10.822 20.035 1.00 14.51 ? 82  LEU A N   1 
ATOM   637  C  CA  . LEU A 1 82 ? 14.190 9.802  20.577 1.00 17.34 ? 82  LEU A CA  1 
ATOM   638  C  C   . LEU A 1 82 ? 14.401 8.495  19.830 1.00 17.85 ? 82  LEU A C   1 
ATOM   639  O  O   . LEU A 1 82 ? 14.473 7.428  20.436 1.00 18.38 ? 82  LEU A O   1 
ATOM   640  C  CB  . LEU A 1 82 ? 12.726 10.233 20.450 1.00 18.49 ? 82  LEU A CB  1 
ATOM   641  C  CG  . LEU A 1 82 ? 12.286 11.452 21.265 1.00 20.64 ? 82  LEU A CG  1 
ATOM   642  C  CD1 . LEU A 1 82 ? 10.839 11.768 20.957 1.00 23.23 ? 82  LEU A CD1 1 
ATOM   643  C  CD2 . LEU A 1 82 ? 12.464 11.185 22.751 1.00 21.76 ? 82  LEU A CD2 1 
ATOM   644  N  N   . ILE A 1 83 ? 14.498 8.582  18.509 1.00 18.70 ? 83  ILE A N   1 
ATOM   645  C  CA  . ILE A 1 83 ? 14.717 7.406  17.684 1.00 21.32 ? 83  ILE A CA  1 
ATOM   646  C  C   . ILE A 1 83 ? 16.001 6.681  18.083 1.00 21.70 ? 83  ILE A C   1 
ATOM   647  O  O   . ILE A 1 83 ? 16.007 5.463  18.267 1.00 20.25 ? 83  ILE A O   1 
ATOM   648  C  CB  . ILE A 1 83 ? 14.804 7.789  16.191 1.00 23.14 ? 83  ILE A CB  1 
ATOM   649  C  CG1 . ILE A 1 83 ? 13.428 8.239  15.698 1.00 23.98 ? 83  ILE A CG1 1 
ATOM   650  C  CG2 . ILE A 1 83 ? 15.333 6.614  15.374 1.00 23.84 ? 83  ILE A CG2 1 
ATOM   651  C  CD1 . ILE A 1 83 ? 13.440 8.846  14.318 1.00 26.91 ? 83  ILE A CD1 1 
ATOM   652  N  N   . TYR A 1 84 ? 17.090 7.431  18.217 1.00 20.91 ? 84  TYR A N   1 
ATOM   653  C  CA  . TYR A 1 84 ? 18.368 6.838  18.576 1.00 22.69 ? 84  TYR A CA  1 
ATOM   654  C  C   . TYR A 1 84 ? 18.329 6.255  19.984 1.00 21.56 ? 84  TYR A C   1 
ATOM   655  O  O   . TYR A 1 84 ? 18.924 5.207  20.250 1.00 21.62 ? 84  TYR A O   1 
ATOM   656  C  CB  . TYR A 1 84 ? 19.481 7.887  18.491 1.00 26.04 ? 84  TYR A CB  1 
ATOM   657  C  CG  . TYR A 1 84 ? 20.870 7.292  18.471 1.00 31.44 ? 84  TYR A CG  1 
ATOM   658  C  CD1 . TYR A 1 84 ? 21.546 7.090  17.267 1.00 34.28 ? 84  TYR A CD1 1 
ATOM   659  C  CD2 . TYR A 1 84 ? 21.498 6.898  19.653 1.00 32.85 ? 84  TYR A CD2 1 
ATOM   660  C  CE1 . TYR A 1 84 ? 22.815 6.512  17.241 1.00 36.37 ? 84  TYR A CE1 1 
ATOM   661  C  CE2 . TYR A 1 84 ? 22.763 6.316  19.638 1.00 34.77 ? 84  TYR A CE2 1 
ATOM   662  C  CZ  . TYR A 1 84 ? 23.416 6.126  18.431 1.00 35.64 ? 84  TYR A CZ  1 
ATOM   663  O  OH  . TYR A 1 84 ? 24.672 5.559  18.403 1.00 38.21 ? 84  TYR A OH  1 
ATOM   664  N  N   . ASN A 1 85 ? 17.621 6.938  20.881 1.00 20.69 ? 85  ASN A N   1 
ATOM   665  C  CA  . ASN A 1 85 ? 17.516 6.499  22.265 1.00 22.16 ? 85  ASN A CA  1 
ATOM   666  C  C   . ASN A 1 85 ? 16.903 5.110  22.406 1.00 25.00 ? 85  ASN A C   1 
ATOM   667  O  O   . ASN A 1 85 ? 17.331 4.327  23.250 1.00 22.98 ? 85  ASN A O   1 
ATOM   668  C  CB  . ASN A 1 85 ? 16.691 7.496  23.079 1.00 20.54 ? 85  ASN A CB  1 
ATOM   669  C  CG  . ASN A 1 85 ? 16.553 7.084  24.532 1.00 21.32 ? 85  ASN A CG  1 
ATOM   670  O  OD1 . ASN A 1 85 ? 17.544 6.855  25.216 1.00 24.39 ? 85  ASN A OD1 1 
ATOM   671  N  ND2 . ASN A 1 85 ? 15.321 6.990  25.006 1.00 21.27 ? 85  ASN A ND2 1 
ATOM   672  N  N   . GLU A 1 86 ? 15.902 4.806  21.587 1.00 28.42 ? 86  GLU A N   1 
ATOM   673  C  CA  . GLU A 1 86 ? 15.249 3.501  21.659 1.00 32.90 ? 86  GLU A CA  1 
ATOM   674  C  C   . GLU A 1 86 ? 16.185 2.337  21.357 1.00 34.74 ? 86  GLU A C   1 
ATOM   675  O  O   . GLU A 1 86 ? 16.145 1.310  22.031 1.00 34.04 ? 86  GLU A O   1 
ATOM   676  C  CB  . GLU A 1 86 ? 14.047 3.447  20.712 1.00 33.50 ? 86  GLU A CB  1 
ATOM   677  C  CG  . GLU A 1 86 ? 12.836 4.216  21.217 1.00 35.72 ? 86  GLU A CG  1 
ATOM   678  C  CD  . GLU A 1 86 ? 12.475 3.860  22.650 1.00 37.47 ? 86  GLU A CD  1 
ATOM   679  O  OE1 . GLU A 1 86 ? 12.377 2.651  22.963 1.00 38.18 ? 86  GLU A OE1 1 
ATOM   680  O  OE2 . GLU A 1 86 ? 12.283 4.789  23.464 1.00 37.15 ? 86  GLU A OE2 1 
ATOM   681  N  N   . ALA A 1 87 ? 17.032 2.497  20.349 1.00 39.06 ? 87  ALA A N   1 
ATOM   682  C  CA  . ALA A 1 87 ? 17.959 1.436  19.980 1.00 42.62 ? 87  ALA A CA  1 
ATOM   683  C  C   . ALA A 1 87 ? 19.009 1.209  21.062 1.00 44.78 ? 87  ALA A C   1 
ATOM   684  O  O   . ALA A 1 87 ? 19.700 0.191  21.065 1.00 45.93 ? 87  ALA A O   1 
ATOM   685  C  CB  . ALA A 1 87 ? 18.634 1.774  18.659 1.00 42.59 ? 87  ALA A CB  1 
ATOM   686  N  N   . LEU A 1 88 ? 19.112 2.158  21.985 1.00 46.90 ? 88  LEU A N   1 
ATOM   687  C  CA  . LEU A 1 88 ? 20.084 2.081  23.069 1.00 48.85 ? 88  LEU A CA  1 
ATOM   688  C  C   . LEU A 1 88 ? 19.433 1.646  24.383 1.00 50.37 ? 88  LEU A C   1 
ATOM   689  O  O   . LEU A 1 88 ? 20.086 1.607  25.426 1.00 50.83 ? 88  LEU A O   1 
ATOM   690  C  CB  . LEU A 1 88 ? 20.750 3.449  23.254 1.00 49.11 ? 88  LEU A CB  1 
ATOM   691  C  CG  . LEU A 1 88 ? 22.254 3.470  23.523 1.00 49.28 ? 88  LEU A CG  1 
ATOM   692  C  CD1 . LEU A 1 88 ? 22.992 2.948  22.295 1.00 49.11 ? 88  LEU A CD1 1 
ATOM   693  C  CD2 . LEU A 1 88 ? 22.698 4.889  23.842 1.00 48.82 ? 88  LEU A CD2 1 
ATOM   694  N  N   . LYS A 1 89 ? 18.146 1.318  24.334 1.00 51.60 ? 89  LYS A N   1 
ATOM   695  C  CA  . LYS A 1 89 ? 17.434 0.903  25.536 1.00 52.80 ? 89  LYS A CA  1 
ATOM   696  C  C   . LYS A 1 89 ? 17.431 -0.585 25.830 1.00 53.85 ? 89  LYS A C   1 
ATOM   697  O  O   . LYS A 1 89 ? 17.561 -1.421 24.934 1.00 54.18 ? 89  LYS A O   1 
ATOM   698  C  CB  . LYS A 1 89 ? 15.987 1.380  25.507 1.00 53.21 ? 89  LYS A CB  1 
ATOM   699  C  CG  . LYS A 1 89 ? 15.807 2.843  25.807 1.00 53.99 ? 89  LYS A CG  1 
ATOM   700  C  CD  . LYS A 1 89 ? 14.396 3.081  26.281 1.00 54.46 ? 89  LYS A CD  1 
ATOM   701  C  CE  . LYS A 1 89 ? 13.937 4.465  25.923 1.00 55.20 ? 89  LYS A CE  1 
ATOM   702  N  NZ  . LYS A 1 89 ? 12.565 4.718  26.436 1.00 55.05 ? 89  LYS A NZ  1 
ATOM   703  N  N   . GLY A 1 90 ? 17.251 -0.889 27.112 1.00 54.38 ? 90  GLY A N   1 
ATOM   704  C  CA  . GLY A 1 90 ? 17.226 -2.257 27.587 1.00 55.32 ? 90  GLY A CA  1 
ATOM   705  C  C   . GLY A 1 90 ? 17.562 -2.297 29.068 1.00 55.90 ? 90  GLY A C   1 
ATOM   706  O  O   . GLY A 1 90 ? 18.644 -2.814 29.419 1.00 56.51 ? 90  GLY A O   1 
ATOM   707  O  OXT . GLY A 1 90 ? 16.755 -1.801 29.883 1.00 55.41 ? 90  GLY A OXT 1 
ATOM   708  N  N   . ALA B 1 2  ? 28.465 6.719  10.382 1.00 34.47 ? 2   ALA B N   1 
ATOM   709  C  CA  . ALA B 1 2  ? 27.352 7.708  10.452 1.00 32.55 ? 2   ALA B CA  1 
ATOM   710  C  C   . ALA B 1 2  ? 27.805 9.091  10.003 1.00 31.88 ? 2   ALA B C   1 
ATOM   711  O  O   . ALA B 1 2  ? 28.988 9.435  10.070 1.00 32.37 ? 2   ALA B O   1 
ATOM   712  C  CB  . ALA B 1 2  ? 26.801 7.779  11.873 1.00 33.48 ? 2   ALA B CB  1 
ATOM   713  N  N   . CYS B 1 3  ? 26.844 9.879  9.541  1.00 30.95 ? 3   CYS B N   1 
ATOM   714  C  CA  . CYS B 1 3  ? 27.116 11.229 9.085  1.00 28.52 ? 3   CYS B CA  1 
ATOM   715  C  C   . CYS B 1 3  ? 27.246 12.146 10.299 1.00 28.17 ? 3   CYS B C   1 
ATOM   716  O  O   . CYS B 1 3  ? 26.867 11.772 11.412 1.00 24.76 ? 3   CYS B O   1 
ATOM   717  C  CB  . CYS B 1 3  ? 25.992 11.680 8.144  1.00 29.42 ? 3   CYS B CB  1 
ATOM   718  S  SG  . CYS B 1 3  ? 25.962 10.710 6.576  1.00 32.60 ? 3   CYS B SG  1 
ATOM   719  N  N   . PRO B 1 4  ? 27.803 13.351 10.106 1.00 27.74 ? 4   PRO B N   1 
ATOM   720  C  CA  . PRO B 1 4  ? 27.993 14.324 11.186 1.00 27.82 ? 4   PRO B CA  1 
ATOM   721  C  C   . PRO B 1 4  ? 26.794 14.539 12.105 1.00 26.26 ? 4   PRO B C   1 
ATOM   722  O  O   . PRO B 1 4  ? 26.933 14.537 13.328 1.00 26.45 ? 4   PRO B O   1 
ATOM   723  C  CB  . PRO B 1 4  ? 28.377 15.595 10.434 1.00 28.11 ? 4   PRO B CB  1 
ATOM   724  C  CG  . PRO B 1 4  ? 29.161 15.063 9.289  1.00 27.72 ? 4   PRO B CG  1 
ATOM   725  C  CD  . PRO B 1 4  ? 28.335 13.877 8.834  1.00 28.04 ? 4   PRO B CD  1 
ATOM   726  N  N   . LEU B 1 5  ? 25.617 14.725 11.522 1.00 24.69 ? 5   LEU B N   1 
ATOM   727  C  CA  . LEU B 1 5  ? 24.428 14.961 12.324 1.00 24.40 ? 5   LEU B CA  1 
ATOM   728  C  C   . LEU B 1 5  ? 24.043 13.750 13.173 1.00 22.60 ? 5   LEU B C   1 
ATOM   729  O  O   . LEU B 1 5  ? 23.769 13.888 14.364 1.00 19.00 ? 5   LEU B O   1 
ATOM   730  C  CB  . LEU B 1 5  ? 23.268 15.388 11.425 1.00 26.95 ? 5   LEU B CB  1 
ATOM   731  C  CG  . LEU B 1 5  ? 22.141 16.103 12.165 1.00 28.28 ? 5   LEU B CG  1 
ATOM   732  C  CD1 . LEU B 1 5  ? 21.414 17.036 11.221 1.00 29.59 ? 5   LEU B CD1 1 
ATOM   733  C  CD2 . LEU B 1 5  ? 21.204 15.074 12.781 1.00 29.08 ? 5   LEU B CD2 1 
ATOM   734  N  N   . ASP B 1 6  ? 24.029 12.567 12.567 1.00 20.62 ? 6   ASP B N   1 
ATOM   735  C  CA  . ASP B 1 6  ? 23.694 11.348 13.299 1.00 20.00 ? 6   ASP B CA  1 
ATOM   736  C  C   . ASP B 1 6  ? 24.724 11.094 14.398 1.00 18.96 ? 6   ASP B C   1 
ATOM   737  O  O   . ASP B 1 6  ? 24.385 10.643 15.494 1.00 16.99 ? 6   ASP B O   1 
ATOM   738  C  CB  . ASP B 1 6  ? 23.662 10.150 12.347 1.00 21.82 ? 6   ASP B CB  1 
ATOM   739  C  CG  . ASP B 1 6  ? 22.523 10.227 11.351 1.00 24.61 ? 6   ASP B CG  1 
ATOM   740  O  OD1 . ASP B 1 6  ? 21.513 9.517  11.546 1.00 28.12 ? 6   ASP B OD1 1 
ATOM   741  O  OD2 . ASP B 1 6  ? 22.632 11.000 10.377 1.00 27.21 ? 6   ASP B OD2 1 
ATOM   742  N  N   . GLN B 1 7  ? 25.987 11.382 14.105 1.00 18.97 ? 7   GLN B N   1 
ATOM   743  C  CA  . GLN B 1 7  ? 27.036 11.172 15.091 1.00 19.33 ? 7   GLN B CA  1 
ATOM   744  C  C   . GLN B 1 7  ? 26.825 12.043 16.323 1.00 17.24 ? 7   GLN B C   1 
ATOM   745  O  O   . GLN B 1 7  ? 26.900 11.558 17.452 1.00 17.58 ? 7   GLN B O   1 
ATOM   746  C  CB  . GLN B 1 7  ? 28.410 11.444 14.475 1.00 25.06 ? 7   GLN B CB  1 
ATOM   747  C  CG  . GLN B 1 7  ? 28.833 10.394 13.457 1.00 30.55 ? 7   GLN B CG  1 
ATOM   748  C  CD  . GLN B 1 7  ? 29.009 9.014  14.073 1.00 33.69 ? 7   GLN B CD  1 
ATOM   749  O  OE1 . GLN B 1 7  ? 28.633 8.779  15.224 1.00 36.53 ? 7   GLN B OE1 1 
ATOM   750  N  NE2 . GLN B 1 7  ? 29.579 8.090  13.303 1.00 36.57 ? 7   GLN B NE2 1 
ATOM   751  N  N   . ALA B 1 8  ? 26.548 13.324 16.103 1.00 15.72 ? 8   ALA B N   1 
ATOM   752  C  CA  . ALA B 1 8  ? 26.329 14.255 17.205 1.00 14.90 ? 8   ALA B CA  1 
ATOM   753  C  C   . ALA B 1 8  ? 25.145 13.815 18.063 1.00 14.89 ? 8   ALA B C   1 
ATOM   754  O  O   . ALA B 1 8  ? 25.239 13.786 19.290 1.00 13.02 ? 8   ALA B O   1 
ATOM   755  C  CB  . ALA B 1 8  ? 26.095 15.671 16.659 1.00 18.01 ? 8   ALA B CB  1 
ATOM   756  N  N   . ILE B 1 9  ? 24.027 13.489 17.419 1.00 13.80 ? 9   ILE B N   1 
ATOM   757  C  CA  . ILE B 1 9  ? 22.846 13.041 18.148 1.00 14.21 ? 9   ILE B CA  1 
ATOM   758  C  C   . ILE B 1 9  ? 23.213 11.789 18.948 1.00 13.37 ? 9   ILE B C   1 
ATOM   759  O  O   . ILE B 1 9  ? 22.841 11.660 20.115 1.00 12.99 ? 9   ILE B O   1 
ATOM   760  C  CB  . ILE B 1 9  ? 21.673 12.705 17.189 1.00 14.75 ? 9   ILE B CB  1 
ATOM   761  C  CG1 . ILE B 1 9  ? 21.134 13.988 16.543 1.00 15.78 ? 9   ILE B CG1 1 
ATOM   762  C  CG2 . ILE B 1 9  ? 20.569 11.970 17.946 1.00 13.88 ? 9   ILE B CG2 1 
ATOM   763  C  CD1 . ILE B 1 9  ? 20.552 14.992 17.528 1.00 19.30 ? 9   ILE B CD1 1 
ATOM   764  N  N   . GLY B 1 10 ? 23.956 10.880 18.318 1.00 13.51 ? 10  GLY B N   1 
ATOM   765  C  CA  . GLY B 1 10 ? 24.362 9.653  18.993 1.00 14.68 ? 10  GLY B CA  1 
ATOM   766  C  C   . GLY B 1 10 ? 25.188 9.936  20.235 1.00 14.45 ? 10  GLY B C   1 
ATOM   767  O  O   . GLY B 1 10 ? 25.055 9.267  21.262 1.00 13.50 ? 10  GLY B O   1 
ATOM   768  N  N   . LEU B 1 11 ? 26.048 10.942 20.142 1.00 15.21 ? 11  LEU B N   1 
ATOM   769  C  CA  . LEU B 1 11 ? 26.896 11.316 21.266 1.00 16.68 ? 11  LEU B CA  1 
ATOM   770  C  C   . LEU B 1 11 ? 26.037 11.844 22.417 1.00 14.26 ? 11  LEU B C   1 
ATOM   771  O  O   . LEU B 1 11 ? 26.276 11.510 23.577 1.00 13.43 ? 11  LEU B O   1 
ATOM   772  C  CB  . LEU B 1 11 ? 27.907 12.384 20.823 1.00 17.61 ? 11  LEU B CB  1 
ATOM   773  C  CG  . LEU B 1 11 ? 29.035 12.779 21.779 1.00 23.13 ? 11  LEU B CG  1 
ATOM   774  C  CD1 . LEU B 1 11 ? 29.990 13.738 21.071 1.00 24.55 ? 11  LEU B CD1 1 
ATOM   775  C  CD2 . LEU B 1 11 ? 28.472 13.423 23.022 1.00 23.80 ? 11  LEU B CD2 1 
ATOM   776  N  N   . LEU B 1 12 ? 25.046 12.672 22.094 1.00 13.92 ? 12  LEU B N   1 
ATOM   777  C  CA  . LEU B 1 12 ? 24.163 13.236 23.111 1.00 13.67 ? 12  LEU B CA  1 
ATOM   778  C  C   . LEU B 1 12 ? 23.345 12.148 23.803 1.00 12.36 ? 12  LEU B C   1 
ATOM   779  O  O   . LEU B 1 12 ? 23.150 12.187 25.012 1.00 11.92 ? 12  LEU B O   1 
ATOM   780  C  CB  . LEU B 1 12 ? 23.244 14.293 22.490 1.00 14.54 ? 12  LEU B CB  1 
ATOM   781  C  CG  . LEU B 1 12 ? 23.988 15.553 22.021 1.00 15.43 ? 12  LEU B CG  1 
ATOM   782  C  CD1 . LEU B 1 12 ? 23.061 16.445 21.222 1.00 16.09 ? 12  LEU B CD1 1 
ATOM   783  C  CD2 . LEU B 1 12 ? 24.533 16.305 23.231 1.00 15.86 ? 12  LEU B CD2 1 
ATOM   784  N  N   . VAL B 1 13 ? 22.882 11.167 23.037 1.00 12.36 ? 13  VAL B N   1 
ATOM   785  C  CA  . VAL B 1 13 ? 22.111 10.076 23.618 1.00 12.65 ? 13  VAL B CA  1 
ATOM   786  C  C   . VAL B 1 13 ? 23.018 9.221  24.505 1.00 12.04 ? 13  VAL B C   1 
ATOM   787  O  O   . VAL B 1 13 ? 22.604 8.768  25.568 1.00 11.51 ? 13  VAL B O   1 
ATOM   788  C  CB  . VAL B 1 13 ? 21.479 9.199  22.522 1.00 12.89 ? 13  VAL B CB  1 
ATOM   789  C  CG1 . VAL B 1 13 ? 20.775 8.004  23.147 1.00 15.49 ? 13  VAL B CG1 1 
ATOM   790  C  CG2 . VAL B 1 13 ? 20.495 10.028 21.709 1.00 14.13 ? 13  VAL B CG2 1 
ATOM   791  N  N   . ALA B 1 14 ? 24.257 9.010  24.072 1.00 13.11 ? 14  ALA B N   1 
ATOM   792  C  CA  . ALA B 1 14 ? 25.209 8.221  24.854 1.00 12.38 ? 14  ALA B CA  1 
ATOM   793  C  C   . ALA B 1 14 ? 25.500 8.892  26.194 1.00 13.20 ? 14  ALA B C   1 
ATOM   794  O  O   . ALA B 1 14 ? 25.622 8.218  27.216 1.00 13.26 ? 14  ALA B O   1 
ATOM   795  C  CB  . ALA B 1 14 ? 26.498 8.031  24.075 1.00 14.00 ? 14  ALA B CB  1 
ATOM   796  N  N   . ILE B 1 15 ? 25.623 10.216 26.189 1.00 11.34 ? 15  ILE B N   1 
ATOM   797  C  CA  . ILE B 1 15 ? 25.880 10.949 27.426 1.00 12.81 ? 15  ILE B CA  1 
ATOM   798  C  C   . ILE B 1 15 ? 24.778 10.676 28.459 1.00 12.08 ? 15  ILE B C   1 
ATOM   799  O  O   . ILE B 1 15 ? 25.064 10.414 29.632 1.00 12.00 ? 15  ILE B O   1 
ATOM   800  C  CB  . ILE B 1 15 ? 25.980 12.477 27.156 1.00 13.15 ? 15  ILE B CB  1 
ATOM   801  C  CG1 . ILE B 1 15 ? 27.314 12.801 26.471 1.00 14.37 ? 15  ILE B CG1 1 
ATOM   802  C  CG2 . ILE B 1 15 ? 25.866 13.255 28.461 1.00 12.04 ? 15  ILE B CG2 1 
ATOM   803  C  CD1 . ILE B 1 15 ? 27.428 14.253 26.037 1.00 14.25 ? 15  ILE B CD1 1 
ATOM   804  N  N   . PHE B 1 16 ? 23.522 10.726 28.025 1.00 11.93 ? 16  PHE B N   1 
ATOM   805  C  CA  . PHE B 1 16 ? 22.395 10.486 28.924 1.00 10.94 ? 16  PHE B CA  1 
ATOM   806  C  C   . PHE B 1 16 ? 22.548 9.154  29.657 1.00 11.49 ? 16  PHE B C   1 
ATOM   807  O  O   . PHE B 1 16 ? 22.495 9.095  30.890 1.00 12.55 ? 16  PHE B O   1 
ATOM   808  C  CB  . PHE B 1 16 ? 21.086 10.467 28.132 1.00 10.93 ? 16  PHE B CB  1 
ATOM   809  C  CG  . PHE B 1 16 ? 19.873 10.213 28.975 1.00 11.78 ? 16  PHE B CG  1 
ATOM   810  C  CD1 . PHE B 1 16 ? 19.224 11.258 29.617 1.00 10.20 ? 16  PHE B CD1 1 
ATOM   811  C  CD2 . PHE B 1 16 ? 19.370 8.918  29.121 1.00 12.85 ? 16  PHE B CD2 1 
ATOM   812  C  CE1 . PHE B 1 16 ? 18.085 11.029 30.394 1.00 13.34 ? 16  PHE B CE1 1 
ATOM   813  C  CE2 . PHE B 1 16 ? 18.234 8.678  29.897 1.00 13.65 ? 16  PHE B CE2 1 
ATOM   814  C  CZ  . PHE B 1 16 ? 17.588 9.733  30.532 1.00 12.66 ? 16  PHE B CZ  1 
ATOM   815  N  N   . HIS B 1 17 ? 22.743 8.091  28.887 1.00 13.18 ? 17  HIS B N   1 
ATOM   816  C  CA  . HIS B 1 17 ? 22.877 6.752  29.446 1.00 14.47 ? 17  HIS B CA  1 
ATOM   817  C  C   . HIS B 1 17 ? 24.139 6.531  30.258 1.00 14.80 ? 17  HIS B C   1 
ATOM   818  O  O   . HIS B 1 17 ? 24.184 5.651  31.111 1.00 14.29 ? 17  HIS B O   1 
ATOM   819  C  CB  . HIS B 1 17 ? 22.756 5.731  28.321 1.00 15.85 ? 17  HIS B CB  1 
ATOM   820  C  CG  . HIS B 1 17 ? 21.383 5.682  27.730 1.00 20.63 ? 17  HIS B CG  1 
ATOM   821  N  ND1 . HIS B 1 17 ? 20.326 5.066  28.368 1.00 20.32 ? 17  HIS B ND1 1 
ATOM   822  C  CD2 . HIS B 1 17 ? 20.870 6.244  26.611 1.00 18.34 ? 17  HIS B CD2 1 
ATOM   823  C  CE1 . HIS B 1 17 ? 19.223 5.253  27.668 1.00 21.55 ? 17  HIS B CE1 1 
ATOM   824  N  NE2 . HIS B 1 17 ? 19.524 5.967  26.596 1.00 19.52 ? 17  HIS B NE2 1 
ATOM   825  N  N   . LYS B 1 18 ? 25.162 7.333  29.995 1.00 14.31 ? 18  LYS B N   1 
ATOM   826  C  CA  . LYS B 1 18 ? 26.413 7.226  30.741 1.00 14.21 ? 18  LYS B CA  1 
ATOM   827  C  C   . LYS B 1 18 ? 26.128 7.518  32.214 1.00 15.09 ? 18  LYS B C   1 
ATOM   828  O  O   . LYS B 1 18 ? 26.730 6.915  33.107 1.00 17.15 ? 18  LYS B O   1 
ATOM   829  C  CB  . LYS B 1 18 ? 27.425 8.232  30.185 1.00 14.69 ? 18  LYS B CB  1 
ATOM   830  C  CG  . LYS B 1 18 ? 28.791 8.230  30.850 1.00 18.65 ? 18  LYS B CG  1 
ATOM   831  C  CD  . LYS B 1 18 ? 29.703 9.272  30.195 1.00 18.38 ? 18  LYS B CD  1 
ATOM   832  C  CE  . LYS B 1 18 ? 31.050 9.365  30.900 1.00 21.66 ? 18  LYS B CE  1 
ATOM   833  N  NZ  . LYS B 1 18 ? 31.944 10.412 30.317 1.00 21.21 ? 18  LYS B NZ  1 
ATOM   834  N  N   . TYR B 1 19 ? 25.191 8.433  32.458 1.00 13.54 ? 19  TYR B N   1 
ATOM   835  C  CA  . TYR B 1 19 ? 24.832 8.823  33.817 1.00 13.02 ? 19  TYR B CA  1 
ATOM   836  C  C   . TYR B 1 19 ? 23.512 8.272  34.368 1.00 13.58 ? 19  TYR B C   1 
ATOM   837  O  O   . TYR B 1 19 ? 23.384 8.071  35.573 1.00 13.54 ? 19  TYR B O   1 
ATOM   838  C  CB  . TYR B 1 19 ? 24.825 10.349 33.930 1.00 14.43 ? 19  TYR B CB  1 
ATOM   839  C  CG  . TYR B 1 19 ? 26.178 10.950 33.656 1.00 14.24 ? 19  TYR B CG  1 
ATOM   840  C  CD1 . TYR B 1 19 ? 26.603 11.192 32.349 1.00 12.79 ? 19  TYR B CD1 1 
ATOM   841  C  CD2 . TYR B 1 19 ? 27.062 11.216 34.701 1.00 17.42 ? 19  TYR B CD2 1 
ATOM   842  C  CE1 . TYR B 1 19 ? 27.887 11.681 32.090 1.00 14.73 ? 19  TYR B CE1 1 
ATOM   843  C  CE2 . TYR B 1 19 ? 28.347 11.704 34.452 1.00 17.15 ? 19  TYR B CE2 1 
ATOM   844  C  CZ  . TYR B 1 19 ? 28.750 11.930 33.142 1.00 15.97 ? 19  TYR B CZ  1 
ATOM   845  O  OH  . TYR B 1 19 ? 30.026 12.380 32.879 1.00 16.67 ? 19  TYR B OH  1 
ATOM   846  N  N   . SER B 1 20 ? 22.543 8.002  33.502 1.00 12.83 ? 20  SER B N   1 
ATOM   847  C  CA  . SER B 1 20 ? 21.254 7.517  33.985 1.00 14.18 ? 20  SER B CA  1 
ATOM   848  C  C   . SER B 1 20 ? 21.281 6.132  34.648 1.00 12.62 ? 20  SER B C   1 
ATOM   849  O  O   . SER B 1 20 ? 20.455 5.845  35.515 1.00 13.43 ? 20  SER B O   1 
ATOM   850  C  CB  . SER B 1 20 ? 20.229 7.517  32.843 1.00 13.83 ? 20  SER B CB  1 
ATOM   851  O  OG  . SER B 1 20 ? 20.528 6.515  31.882 1.00 12.70 ? 20  SER B OG  1 
ATOM   852  N  N   . GLY B 1 21 ? 22.221 5.277  34.252 1.00 12.61 ? 21  GLY B N   1 
ATOM   853  C  CA  . GLY B 1 21 ? 22.271 3.939  34.823 1.00 13.10 ? 21  GLY B CA  1 
ATOM   854  C  C   . GLY B 1 21 ? 23.019 3.733  36.132 1.00 13.70 ? 21  GLY B C   1 
ATOM   855  O  O   . GLY B 1 21 ? 23.060 2.612  36.651 1.00 12.26 ? 21  GLY B O   1 
ATOM   856  N  N   . ARG B 1 22 ? 23.586 4.799  36.687 1.00 12.80 ? 22  ARG B N   1 
ATOM   857  C  CA  . ARG B 1 22 ? 24.361 4.683  37.920 1.00 13.49 ? 22  ARG B CA  1 
ATOM   858  C  C   . ARG B 1 22 ? 23.594 4.298  39.185 1.00 13.26 ? 22  ARG B C   1 
ATOM   859  O  O   . ARG B 1 22 ? 24.111 3.551  40.008 1.00 14.63 ? 22  ARG B O   1 
ATOM   860  C  CB  . ARG B 1 22 ? 25.145 5.974  38.160 1.00 14.22 ? 22  ARG B CB  1 
ATOM   861  C  CG  . ARG B 1 22 ? 25.932 6.405  36.940 1.00 17.18 ? 22  ARG B CG  1 
ATOM   862  C  CD  . ARG B 1 22 ? 26.917 7.507  37.249 1.00 21.43 ? 22  ARG B CD  1 
ATOM   863  N  NE  . ARG B 1 22 ? 27.681 7.863  36.056 1.00 26.08 ? 22  ARG B NE  1 
ATOM   864  C  CZ  . ARG B 1 22 ? 28.834 8.520  36.083 1.00 29.17 ? 22  ARG B CZ  1 
ATOM   865  N  NH1 . ARG B 1 22 ? 29.346 8.885  37.241 1.00 32.04 ? 22  ARG B NH1 1 
ATOM   866  N  NH2 . ARG B 1 22 ? 29.480 8.804  34.960 1.00 30.39 ? 22  ARG B NH2 1 
ATOM   867  N  N   . GLU B 1 23 ? 22.369 4.791  39.341 1.00 14.57 ? 23  GLU B N   1 
ATOM   868  C  CA  . GLU B 1 23 ? 21.573 4.471  40.523 1.00 13.34 ? 23  GLU B CA  1 
ATOM   869  C  C   . GLU B 1 23 ? 20.089 4.573  40.200 1.00 13.54 ? 23  GLU B C   1 
ATOM   870  O  O   . GLU B 1 23 ? 19.706 5.191  39.200 1.00 12.34 ? 23  GLU B O   1 
ATOM   871  C  CB  . GLU B 1 23 ? 21.895 5.438  41.669 1.00 15.29 ? 23  GLU B CB  1 
ATOM   872  C  CG  . GLU B 1 23 ? 21.448 6.873  41.390 1.00 17.61 ? 23  GLU B CG  1 
ATOM   873  C  CD  . GLU B 1 23 ? 21.722 7.837  42.538 1.00 21.70 ? 23  GLU B CD  1 
ATOM   874  O  OE1 . GLU B 1 23 ? 21.310 9.011  42.430 1.00 23.00 ? 23  GLU B OE1 1 
ATOM   875  O  OE2 . GLU B 1 23 ? 22.345 7.431  43.545 1.00 21.24 ? 23  GLU B OE2 1 
ATOM   876  N  N   . GLY B 1 24 ? 19.262 3.978  41.056 1.00 11.33 ? 24  GLY B N   1 
ATOM   877  C  CA  . GLY B 1 24 ? 17.821 4.016  40.848 1.00 12.72 ? 24  GLY B CA  1 
ATOM   878  C  C   . GLY B 1 24 ? 17.445 3.475  39.482 1.00 12.22 ? 24  GLY B C   1 
ATOM   879  O  O   . GLY B 1 24 ? 18.090 2.548  38.991 1.00 12.04 ? 24  GLY B O   1 
ATOM   880  N  N   . ASP B 1 25 ? 16.406 4.043  38.868 1.00 11.70 ? 25  ASP B N   1 
ATOM   881  C  CA  . ASP B 1 25 ? 15.985 3.607  37.541 1.00 12.35 ? 25  ASP B CA  1 
ATOM   882  C  C   . ASP B 1 25 ? 17.160 3.755  36.580 1.00 12.89 ? 25  ASP B C   1 
ATOM   883  O  O   . ASP B 1 25 ? 17.877 4.754  36.621 1.00 12.87 ? 25  ASP B O   1 
ATOM   884  C  CB  . ASP B 1 25 ? 14.833 4.455  37.025 1.00 13.92 ? 25  ASP B CB  1 
ATOM   885  C  CG  . ASP B 1 25 ? 14.201 3.860  35.791 1.00 14.01 ? 25  ASP B CG  1 
ATOM   886  O  OD1 . ASP B 1 25 ? 13.277 3.035  35.942 1.00 17.18 ? 25  ASP B OD1 1 
ATOM   887  O  OD2 . ASP B 1 25 ? 14.645 4.194  34.675 1.00 14.48 ? 25  ASP B OD2 1 
ATOM   888  N  N   . LYS B 1 26 ? 17.340 2.778  35.701 1.00 11.92 ? 26  LYS B N   1 
ATOM   889  C  CA  . LYS B 1 26 ? 18.450 2.797  34.750 1.00 12.46 ? 26  LYS B CA  1 
ATOM   890  C  C   . LYS B 1 26 ? 18.282 3.798  33.607 1.00 10.98 ? 26  LYS B C   1 
ATOM   891  O  O   . LYS B 1 26 ? 19.267 4.223  33.009 1.00 11.76 ? 26  LYS B O   1 
ATOM   892  C  CB  . LYS B 1 26 ? 18.634 1.399  34.156 1.00 14.29 ? 26  LYS B CB  1 
ATOM   893  C  CG  . LYS B 1 26 ? 19.887 1.208  33.318 1.00 15.84 ? 26  LYS B CG  1 
ATOM   894  C  CD  . LYS B 1 26 ? 19.868 -0.154 32.632 1.00 16.93 ? 26  LYS B CD  1 
ATOM   895  C  CE  . LYS B 1 26 ? 21.174 -0.444 31.908 1.00 19.87 ? 26  LYS B CE  1 
ATOM   896  N  NZ  . LYS B 1 26 ? 21.082 -1.647 31.019 1.00 24.56 ? 26  LYS B NZ  1 
ATOM   897  N  N   . HIS B 1 27 ? 17.038 4.176  33.321 1.00 11.78 ? 27  HIS B N   1 
ATOM   898  C  CA  . HIS B 1 27 ? 16.725 5.073  32.208 1.00 10.99 ? 27  HIS B CA  1 
ATOM   899  C  C   . HIS B 1 27 ? 16.323 6.511  32.528 1.00 11.24 ? 27  HIS B C   1 
ATOM   900  O  O   . HIS B 1 27 ? 15.906 7.258  31.637 1.00 11.28 ? 27  HIS B O   1 
ATOM   901  C  CB  . HIS B 1 27 ? 15.655 4.409  31.341 1.00 12.81 ? 27  HIS B CB  1 
ATOM   902  C  CG  . HIS B 1 27 ? 16.108 3.124  30.731 1.00 13.65 ? 27  HIS B CG  1 
ATOM   903  N  ND1 . HIS B 1 27 ? 15.243 2.098  30.411 1.00 13.84 ? 27  HIS B ND1 1 
ATOM   904  C  CD2 . HIS B 1 27 ? 17.344 2.690  30.383 1.00 16.30 ? 27  HIS B CD2 1 
ATOM   905  C  CE1 . HIS B 1 27 ? 15.924 1.094  29.897 1.00 15.71 ? 27  HIS B CE1 1 
ATOM   906  N  NE2 . HIS B 1 27 ? 17.204 1.427  29.868 1.00 15.67 ? 27  HIS B NE2 1 
ATOM   907  N  N   . THR B 1 28 ? 16.442 6.905  33.789 1.00 11.77 ? 28  THR B N   1 
ATOM   908  C  CA  . THR B 1 28 ? 16.124 8.273  34.161 1.00 10.89 ? 28  THR B CA  1 
ATOM   909  C  C   . THR B 1 28 ? 17.251 8.795  35.044 1.00 12.84 ? 28  THR B C   1 
ATOM   910  O  O   . THR B 1 28 ? 17.947 8.022  35.705 1.00 11.58 ? 28  THR B O   1 
ATOM   911  C  CB  . THR B 1 28 ? 14.764 8.368  34.882 1.00 12.03 ? 28  THR B CB  1 
ATOM   912  O  OG1 . THR B 1 28 ? 14.809 7.630  36.110 1.00 12.73 ? 28  THR B OG1 1 
ATOM   913  C  CG2 . THR B 1 28 ? 13.662 7.813  33.979 1.00 10.87 ? 28  THR B CG2 1 
ATOM   914  N  N   . LEU B 1 29 ? 17.438 10.107 35.039 1.00 10.48 ? 29  LEU B N   1 
ATOM   915  C  CA  . LEU B 1 29 ? 18.510 10.722 35.810 1.00 10.50 ? 29  LEU B CA  1 
ATOM   916  C  C   . LEU B 1 29 ? 18.036 11.254 37.158 1.00 10.89 ? 29  LEU B C   1 
ATOM   917  O  O   . LEU B 1 29 ? 17.092 12.033 37.223 1.00 11.03 ? 29  LEU B O   1 
ATOM   918  C  CB  . LEU B 1 29 ? 19.123 11.879 35.007 1.00 9.50  ? 29  LEU B CB  1 
ATOM   919  C  CG  . LEU B 1 29 ? 19.753 11.603 33.639 1.00 10.39 ? 29  LEU B CG  1 
ATOM   920  C  CD1 . LEU B 1 29 ? 19.763 12.881 32.816 1.00 10.59 ? 29  LEU B CD1 1 
ATOM   921  C  CD2 . LEU B 1 29 ? 21.170 11.081 33.827 1.00 12.23 ? 29  LEU B CD2 1 
ATOM   922  N  N   . SER B 1 30 ? 18.685 10.818 38.231 1.00 12.31 ? 30  SER B N   1 
ATOM   923  C  CA  . SER B 1 30 ? 18.354 11.301 39.572 1.00 11.83 ? 30  SER B CA  1 
ATOM   924  C  C   . SER B 1 30 ? 19.018 12.666 39.702 1.00 13.30 ? 30  SER B C   1 
ATOM   925  O  O   . SER B 1 30 ? 19.801 13.061 38.836 1.00 12.76 ? 30  SER B O   1 
ATOM   926  C  CB  . SER B 1 30 ? 18.948 10.380 40.624 1.00 12.53 ? 30  SER B CB  1 
ATOM   927  O  OG  . SER B 1 30 ? 20.367 10.431 40.544 1.00 10.70 ? 30  SER B OG  1 
ATOM   928  N  N   . LYS B 1 31 ? 18.722 13.380 40.783 1.00 12.51 ? 31  LYS B N   1 
ATOM   929  C  CA  . LYS B 1 31 ? 19.320 14.697 41.007 1.00 14.95 ? 31  LYS B CA  1 
ATOM   930  C  C   . LYS B 1 31 ? 20.840 14.571 41.024 1.00 15.05 ? 31  LYS B C   1 
ATOM   931  O  O   . LYS B 1 31 ? 21.561 15.444 40.534 1.00 14.90 ? 31  LYS B O   1 
ATOM   932  C  CB  . LYS B 1 31 ? 18.868 15.265 42.355 1.00 15.43 ? 31  LYS B CB  1 
ATOM   933  C  CG  . LYS B 1 31 ? 17.370 15.497 42.500 1.00 18.71 ? 31  LYS B CG  1 
ATOM   934  C  CD  . LYS B 1 31 ? 16.928 16.670 41.662 1.00 17.44 ? 31  LYS B CD  1 
ATOM   935  C  CE  . LYS B 1 31 ? 15.488 17.053 41.934 1.00 16.36 ? 31  LYS B CE  1 
ATOM   936  N  NZ  . LYS B 1 31 ? 15.088 18.214 41.085 1.00 14.70 ? 31  LYS B NZ  1 
ATOM   937  N  N   . LYS B 1 32 ? 21.318 13.480 41.611 1.00 13.50 ? 32  LYS B N   1 
ATOM   938  C  CA  . LYS B 1 32 ? 22.748 13.219 41.719 1.00 13.82 ? 32  LYS B CA  1 
ATOM   939  C  C   . LYS B 1 32 ? 23.389 12.950 40.355 1.00 14.59 ? 32  LYS B C   1 
ATOM   940  O  O   . LYS B 1 32 ? 24.433 13.525 40.031 1.00 14.58 ? 32  LYS B O   1 
ATOM   941  C  CB  . LYS B 1 32 ? 22.983 12.032 42.663 1.00 15.68 ? 32  LYS B CB  1 
ATOM   942  C  CG  . LYS B 1 32 ? 24.448 11.706 42.926 1.00 17.54 ? 32  LYS B CG  1 
ATOM   943  C  CD  . LYS B 1 32 ? 24.599 10.522 43.884 1.00 19.44 ? 32  LYS B CD  1 
ATOM   944  C  CE  . LYS B 1 32 ? 26.074 10.179 44.100 1.00 20.30 ? 32  LYS B CE  1 
ATOM   945  N  NZ  . LYS B 1 32 ? 26.248 9.014  45.009 1.00 20.77 ? 32  LYS B NZ  1 
ATOM   946  N  N   . GLU B 1 33 ? 22.760 12.084 39.559 1.00 12.70 ? 33  GLU B N   1 
ATOM   947  C  CA  . GLU B 1 33 ? 23.264 11.732 38.230 1.00 12.07 ? 33  GLU B CA  1 
ATOM   948  C  C   . GLU B 1 33 ? 23.272 12.923 37.272 1.00 11.33 ? 33  GLU B C   1 
ATOM   949  O  O   . GLU B 1 33 ? 24.231 13.123 36.522 1.00 11.53 ? 33  GLU B O   1 
ATOM   950  C  CB  . GLU B 1 33 ? 22.420 10.603 37.621 1.00 12.53 ? 33  GLU B CB  1 
ATOM   951  C  CG  . GLU B 1 33 ? 22.444 9.295  38.404 1.00 11.81 ? 33  GLU B CG  1 
ATOM   952  C  CD  . GLU B 1 33 ? 21.394 8.297  37.919 1.00 13.25 ? 33  GLU B CD  1 
ATOM   953  O  OE1 . GLU B 1 33 ? 20.267 8.728  37.580 1.00 13.66 ? 33  GLU B OE1 1 
ATOM   954  O  OE2 . GLU B 1 33 ? 21.688 7.084  37.889 1.00 11.74 ? 33  GLU B OE2 1 
ATOM   955  N  N   . LEU B 1 34 ? 22.187 13.692 37.285 1.00 11.82 ? 34  LEU B N   1 
ATOM   956  C  CA  . LEU B 1 34 ? 22.065 14.851 36.419 1.00 12.26 ? 34  LEU B CA  1 
ATOM   957  C  C   . LEU B 1 34 ? 23.081 15.925 36.792 1.00 12.54 ? 34  LEU B C   1 
ATOM   958  O  O   . LEU B 1 34 ? 23.657 16.572 35.915 1.00 13.28 ? 34  LEU B O   1 
ATOM   959  C  CB  . LEU B 1 34 ? 20.647 15.429 36.485 1.00 12.56 ? 34  LEU B CB  1 
ATOM   960  C  CG  . LEU B 1 34 ? 20.409 16.684 35.635 1.00 12.13 ? 34  LEU B CG  1 
ATOM   961  C  CD1 . LEU B 1 34 ? 20.873 16.439 34.207 1.00 13.26 ? 34  LEU B CD1 1 
ATOM   962  C  CD2 . LEU B 1 34 ? 18.932 17.058 35.658 1.00 13.97 ? 34  LEU B CD2 1 
ATOM   963  N  N   . LYS B 1 35 ? 23.308 16.118 38.087 1.00 12.03 ? 35  LYS B N   1 
ATOM   964  C  CA  . LYS B 1 35 ? 24.272 17.130 38.508 1.00 11.84 ? 35  LYS B CA  1 
ATOM   965  C  C   . LYS B 1 35 ? 25.655 16.722 38.029 1.00 12.47 ? 35  LYS B C   1 
ATOM   966  O  O   . LYS B 1 35 ? 26.434 17.544 37.559 1.00 12.39 ? 35  LYS B O   1 
ATOM   967  C  CB  . LYS B 1 35 ? 24.279 17.291 40.032 1.00 12.14 ? 35  LYS B CB  1 
ATOM   968  C  CG  . LYS B 1 35 ? 25.310 18.319 40.497 1.00 13.92 ? 35  LYS B CG  1 
ATOM   969  C  CD  . LYS B 1 35 ? 25.153 18.667 41.963 1.00 16.28 ? 35  LYS B CD  1 
ATOM   970  C  CE  . LYS B 1 35 ? 26.124 19.766 42.358 1.00 18.38 ? 35  LYS B CE  1 
ATOM   971  N  NZ  . LYS B 1 35 ? 25.853 20.237 43.738 1.00 21.05 ? 35  LYS B NZ  1 
ATOM   972  N  N   . GLU B 1 36 ? 25.947 15.435 38.142 1.00 13.04 ? 36  GLU B N   1 
ATOM   973  C  CA  . GLU B 1 36 ? 27.222 14.907 37.712 1.00 16.20 ? 36  GLU B CA  1 
ATOM   974  C  C   . GLU B 1 36 ? 27.361 15.065 36.188 1.00 15.58 ? 36  GLU B C   1 
ATOM   975  O  O   . GLU B 1 36 ? 28.405 15.492 35.693 1.00 15.18 ? 36  GLU B O   1 
ATOM   976  C  CB  . GLU B 1 36 ? 27.310 13.451 38.154 1.00 20.02 ? 36  GLU B CB  1 
ATOM   977  C  CG  . GLU B 1 36 ? 28.429 12.667 37.553 1.00 26.11 ? 36  GLU B CG  1 
ATOM   978  C  CD  . GLU B 1 36 ? 28.548 11.308 38.193 1.00 31.14 ? 36  GLU B CD  1 
ATOM   979  O  OE1 . GLU B 1 36 ? 27.498 10.720 38.551 1.00 32.42 ? 36  GLU B OE1 1 
ATOM   980  O  OE2 . GLU B 1 36 ? 29.694 10.834 38.335 1.00 34.42 ? 36  GLU B OE2 1 
ATOM   981  N  N   . LEU B 1 37 ? 26.295 14.761 35.450 1.00 13.69 ? 37  LEU B N   1 
ATOM   982  C  CA  . LEU B 1 37 ? 26.303 14.900 33.992 1.00 12.54 ? 37  LEU B CA  1 
ATOM   983  C  C   . LEU B 1 37 ? 26.682 16.343 33.615 1.00 12.26 ? 37  LEU B C   1 
ATOM   984  O  O   . LEU B 1 37 ? 27.556 16.574 32.778 1.00 13.16 ? 37  LEU B O   1 
ATOM   985  C  CB  . LEU B 1 37 ? 24.911 14.564 33.435 1.00 12.21 ? 37  LEU B CB  1 
ATOM   986  C  CG  . LEU B 1 37 ? 24.716 14.507 31.916 1.00 10.04 ? 37  LEU B CG  1 
ATOM   987  C  CD1 . LEU B 1 37 ? 23.501 13.651 31.594 1.00 10.79 ? 37  LEU B CD1 1 
ATOM   988  C  CD2 . LEU B 1 37 ? 24.553 15.907 31.348 1.00 8.39  ? 37  LEU B CD2 1 
ATOM   989  N  N   . ILE B 1 38 ? 26.016 17.301 34.254 1.00 12.33 ? 38  ILE B N   1 
ATOM   990  C  CA  . ILE B 1 38 ? 26.239 18.726 34.020 1.00 12.48 ? 38  ILE B CA  1 
ATOM   991  C  C   . ILE B 1 38 ? 27.664 19.173 34.379 1.00 13.07 ? 38  ILE B C   1 
ATOM   992  O  O   . ILE B 1 38 ? 28.314 19.862 33.600 1.00 13.94 ? 38  ILE B O   1 
ATOM   993  C  CB  . ILE B 1 38 ? 25.229 19.583 34.843 1.00 14.07 ? 38  ILE B CB  1 
ATOM   994  C  CG1 . ILE B 1 38 ? 23.812 19.406 34.290 1.00 14.25 ? 38  ILE B CG1 1 
ATOM   995  C  CG2 . ILE B 1 38 ? 25.629 21.053 34.817 1.00 15.02 ? 38  ILE B CG2 1 
ATOM   996  C  CD1 . ILE B 1 38 ? 22.740 20.058 35.145 1.00 14.28 ? 38  ILE B CD1 1 
ATOM   997  N  N   . GLN B 1 39 ? 28.148 18.787 35.552 1.00 14.17 ? 39  GLN B N   1 
ATOM   998  C  CA  . GLN B 1 39 ? 29.494 19.193 35.971 1.00 16.17 ? 39  GLN B CA  1 
ATOM   999  C  C   . GLN B 1 39 ? 30.611 18.572 35.140 1.00 15.55 ? 39  GLN B C   1 
ATOM   1000 O  O   . GLN B 1 39 ? 31.685 19.157 34.989 1.00 14.15 ? 39  GLN B O   1 
ATOM   1001 C  CB  . GLN B 1 39 ? 29.728 18.846 37.447 1.00 15.78 ? 39  GLN B CB  1 
ATOM   1002 C  CG  . GLN B 1 39 ? 28.764 19.502 38.407 1.00 18.58 ? 39  GLN B CG  1 
ATOM   1003 C  CD  . GLN B 1 39 ? 29.094 19.199 39.856 1.00 22.12 ? 39  GLN B CD  1 
ATOM   1004 O  OE1 . GLN B 1 39 ? 29.343 18.049 40.222 1.00 21.99 ? 39  GLN B OE1 1 
ATOM   1005 N  NE2 . GLN B 1 39 ? 29.090 20.231 40.689 1.00 22.70 ? 39  GLN B NE2 1 
ATOM   1006 N  N   . LYS B 1 40 ? 30.357 17.393 34.588 1.00 14.79 ? 40  LYS B N   1 
ATOM   1007 C  CA  . LYS B 1 40 ? 31.371 16.696 33.809 1.00 17.01 ? 40  LYS B CA  1 
ATOM   1008 C  C   . LYS B 1 40 ? 31.263 16.816 32.294 1.00 18.05 ? 40  LYS B C   1 
ATOM   1009 O  O   . LYS B 1 40 ? 32.267 16.698 31.594 1.00 19.55 ? 40  LYS B O   1 
ATOM   1010 C  CB  . LYS B 1 40 ? 31.369 15.208 34.171 1.00 17.16 ? 40  LYS B CB  1 
ATOM   1011 C  CG  . LYS B 1 40 ? 31.787 14.896 35.588 1.00 22.02 ? 40  LYS B CG  1 
ATOM   1012 C  CD  . LYS B 1 40 ? 31.654 13.407 35.870 1.00 25.33 ? 40  LYS B CD  1 
ATOM   1013 C  CE  . LYS B 1 40 ? 32.242 13.030 37.220 1.00 27.38 ? 40  LYS B CE  1 
ATOM   1014 N  NZ  . LYS B 1 40 ? 32.152 11.553 37.463 1.00 28.74 ? 40  LYS B NZ  1 
ATOM   1015 N  N   . GLU B 1 41 ? 30.061 17.055 31.786 1.00 15.80 ? 41  GLU B N   1 
ATOM   1016 C  CA  . GLU B 1 41 ? 29.861 17.125 30.341 1.00 16.09 ? 41  GLU B CA  1 
ATOM   1017 C  C   . GLU B 1 41 ? 29.571 18.505 29.759 1.00 15.22 ? 41  GLU B C   1 
ATOM   1018 O  O   . GLU B 1 41 ? 29.689 18.704 28.553 1.00 15.15 ? 41  GLU B O   1 
ATOM   1019 C  CB  . GLU B 1 41 ? 28.732 16.175 29.942 1.00 14.83 ? 41  GLU B CB  1 
ATOM   1020 C  CG  . GLU B 1 41 ? 28.879 14.754 30.468 1.00 14.77 ? 41  GLU B CG  1 
ATOM   1021 C  CD  . GLU B 1 41 ? 30.066 14.025 29.882 1.00 16.65 ? 41  GLU B CD  1 
ATOM   1022 O  OE1 . GLU B 1 41 ? 30.524 14.428 28.797 1.00 17.35 ? 41  GLU B OE1 1 
ATOM   1023 O  OE2 . GLU B 1 41 ? 30.525 13.035 30.495 1.00 17.65 ? 41  GLU B OE2 1 
ATOM   1024 N  N   . LEU B 1 42 ? 29.170 19.447 30.602 1.00 15.99 ? 42  LEU B N   1 
ATOM   1025 C  CA  . LEU B 1 42 ? 28.882 20.799 30.132 1.00 16.53 ? 42  LEU B CA  1 
ATOM   1026 C  C   . LEU B 1 42 ? 30.119 21.647 30.394 1.00 16.06 ? 42  LEU B C   1 
ATOM   1027 O  O   . LEU B 1 42 ? 30.623 21.687 31.513 1.00 14.63 ? 42  LEU B O   1 
ATOM   1028 C  CB  . LEU B 1 42 ? 27.674 21.381 30.876 1.00 16.15 ? 42  LEU B CB  1 
ATOM   1029 C  CG  . LEU B 1 42 ? 27.142 22.729 30.389 1.00 16.87 ? 42  LEU B CG  1 
ATOM   1030 C  CD1 . LEU B 1 42 ? 26.509 22.566 29.016 1.00 16.43 ? 42  LEU B CD1 1 
ATOM   1031 C  CD2 . LEU B 1 42 ? 26.123 23.266 31.391 1.00 17.41 ? 42  LEU B CD2 1 
ATOM   1032 N  N   . THR B 1 43 ? 30.612 22.316 29.357 1.00 15.80 ? 43  THR B N   1 
ATOM   1033 C  CA  . THR B 1 43 ? 31.809 23.145 29.488 1.00 16.63 ? 43  THR B CA  1 
ATOM   1034 C  C   . THR B 1 43 ? 31.824 24.011 30.745 1.00 15.47 ? 43  THR B C   1 
ATOM   1035 O  O   . THR B 1 43 ? 32.794 24.001 31.501 1.00 17.64 ? 43  THR B O   1 
ATOM   1036 C  CB  . THR B 1 43 ? 31.984 24.064 28.257 1.00 17.33 ? 43  THR B CB  1 
ATOM   1037 O  OG1 . THR B 1 43 ? 32.035 23.265 27.067 1.00 19.83 ? 43  THR B OG1 1 
ATOM   1038 C  CG2 . THR B 1 43 ? 33.279 24.867 28.372 1.00 21.37 ? 43  THR B CG2 1 
ATOM   1039 N  N   . ILE B 1 44 ? 30.750 24.753 30.979 1.00 15.06 ? 44  ILE B N   1 
ATOM   1040 C  CA  . ILE B 1 44 ? 30.696 25.636 32.135 1.00 16.11 ? 44  ILE B CA  1 
ATOM   1041 C  C   . ILE B 1 44 ? 30.073 24.989 33.364 1.00 16.05 ? 44  ILE B C   1 
ATOM   1042 O  O   . ILE B 1 44 ? 29.960 25.622 34.409 1.00 16.14 ? 44  ILE B O   1 
ATOM   1043 C  CB  . ILE B 1 44 ? 29.882 26.895 31.815 1.00 15.86 ? 44  ILE B CB  1 
ATOM   1044 C  CG1 . ILE B 1 44 ? 30.253 28.016 32.787 1.00 18.94 ? 44  ILE B CG1 1 
ATOM   1045 C  CG2 . ILE B 1 44 ? 28.401 26.583 31.886 1.00 16.52 ? 44  ILE B CG2 1 
ATOM   1046 C  CD1 . ILE B 1 44 ? 31.655 28.557 32.572 1.00 19.04 ? 44  ILE B CD1 1 
ATOM   1047 N  N   . GLY B 1 45 ? 29.673 23.728 33.237 1.00 14.96 ? 45  GLY B N   1 
ATOM   1048 C  CA  . GLY B 1 45 ? 29.029 23.040 34.345 1.00 15.81 ? 45  GLY B CA  1 
ATOM   1049 C  C   . GLY B 1 45 ? 29.678 23.108 35.716 1.00 17.20 ? 45  GLY B C   1 
ATOM   1050 O  O   . GLY B 1 45 ? 29.018 23.428 36.706 1.00 16.42 ? 45  GLY B O   1 
ATOM   1051 N  N   . SER B 1 46 ? 30.967 22.805 35.784 1.00 17.51 ? 46  SER B N   1 
ATOM   1052 C  CA  . SER B 1 46 ? 31.680 22.806 37.056 1.00 19.16 ? 46  SER B CA  1 
ATOM   1053 C  C   . SER B 1 46 ? 31.803 24.178 37.711 1.00 19.25 ? 46  SER B C   1 
ATOM   1054 O  O   . SER B 1 46 ? 32.181 24.273 38.879 1.00 21.45 ? 46  SER B O   1 
ATOM   1055 C  CB  . SER B 1 46 ? 33.079 22.226 36.867 1.00 19.49 ? 46  SER B CB  1 
ATOM   1056 O  OG  . SER B 1 46 ? 33.855 23.085 36.057 1.00 21.04 ? 46  SER B OG  1 
ATOM   1057 N  N   . LYS B 1 47 ? 31.485 25.235 36.971 1.00 18.26 ? 47  LYS B N   1 
ATOM   1058 C  CA  . LYS B 1 47 ? 31.596 26.586 37.509 1.00 19.31 ? 47  LYS B CA  1 
ATOM   1059 C  C   . LYS B 1 47 ? 30.268 27.205 37.933 1.00 18.37 ? 47  LYS B C   1 
ATOM   1060 O  O   . LYS B 1 47 ? 30.242 28.314 38.465 1.00 18.81 ? 47  LYS B O   1 
ATOM   1061 C  CB  . LYS B 1 47 ? 32.272 27.506 36.486 1.00 19.55 ? 47  LYS B CB  1 
ATOM   1062 C  CG  . LYS B 1 47 ? 33.685 27.099 36.102 1.00 22.51 ? 47  LYS B CG  1 
ATOM   1063 C  CD  . LYS B 1 47 ? 34.317 28.158 35.200 1.00 25.40 ? 47  LYS B CD  1 
ATOM   1064 C  CE  . LYS B 1 47 ? 35.712 27.758 34.733 1.00 26.52 ? 47  LYS B CE  1 
ATOM   1065 N  NZ  . LYS B 1 47 ? 35.683 26.591 33.805 1.00 28.44 ? 47  LYS B NZ  1 
ATOM   1066 N  N   . LEU B 1 48 ? 29.167 26.496 37.701 1.00 16.41 ? 48  LEU B N   1 
ATOM   1067 C  CA  . LEU B 1 48 ? 27.853 27.007 38.064 1.00 16.67 ? 48  LEU B CA  1 
ATOM   1068 C  C   . LEU B 1 48 ? 27.611 26.862 39.561 1.00 16.41 ? 48  LEU B C   1 
ATOM   1069 O  O   . LEU B 1 48 ? 28.095 25.924 40.188 1.00 17.26 ? 48  LEU B O   1 
ATOM   1070 C  CB  . LEU B 1 48 ? 26.751 26.246 37.304 1.00 17.39 ? 48  LEU B CB  1 
ATOM   1071 C  CG  . LEU B 1 48 ? 26.721 26.301 35.774 1.00 19.67 ? 48  LEU B CG  1 
ATOM   1072 C  CD1 . LEU B 1 48 ? 25.609 25.401 35.247 1.00 18.01 ? 48  LEU B CD1 1 
ATOM   1073 C  CD2 . LEU B 1 48 ? 26.506 27.729 35.318 1.00 20.19 ? 48  LEU B CD2 1 
ATOM   1074 N  N   . GLN B 1 49 ? 26.867 27.800 40.130 1.00 17.08 ? 49  GLN B N   1 
ATOM   1075 C  CA  . GLN B 1 49 ? 26.533 27.755 41.550 1.00 19.57 ? 49  GLN B CA  1 
ATOM   1076 C  C   . GLN B 1 49 ? 25.681 26.510 41.796 1.00 19.20 ? 49  GLN B C   1 
ATOM   1077 O  O   . GLN B 1 49 ? 24.914 26.107 40.923 1.00 19.23 ? 49  GLN B O   1 
ATOM   1078 C  CB  . GLN B 1 49 ? 25.723 28.988 41.930 1.00 21.75 ? 49  GLN B CB  1 
ATOM   1079 C  CG  . GLN B 1 49 ? 26.470 30.310 41.820 1.00 26.82 ? 49  GLN B CG  1 
ATOM   1080 C  CD  . GLN B 1 49 ? 25.544 31.493 42.006 1.00 29.96 ? 49  GLN B CD  1 
ATOM   1081 O  OE1 . GLN B 1 49 ? 24.469 31.360 42.592 1.00 34.02 ? 49  GLN B OE1 1 
ATOM   1082 N  NE2 . GLN B 1 49 ? 25.957 32.660 41.522 1.00 30.67 ? 49  GLN B NE2 1 
ATOM   1083 N  N   . ASP B 1 50 ? 25.806 25.907 42.977 1.00 19.54 ? 50  ASP B N   1 
ATOM   1084 C  CA  . ASP B 1 50 ? 25.019 24.713 43.294 1.00 20.72 ? 50  ASP B CA  1 
ATOM   1085 C  C   . ASP B 1 50 ? 23.531 25.033 43.225 1.00 20.60 ? 50  ASP B C   1 
ATOM   1086 O  O   . ASP B 1 50 ? 22.729 24.227 42.749 1.00 18.69 ? 50  ASP B O   1 
ATOM   1087 C  CB  . ASP B 1 50 ? 25.344 24.187 44.699 1.00 23.72 ? 50  ASP B CB  1 
ATOM   1088 C  CG  . ASP B 1 50 ? 26.714 23.540 44.789 1.00 24.96 ? 50  ASP B CG  1 
ATOM   1089 O  OD1 . ASP B 1 50 ? 27.100 22.800 43.858 1.00 26.28 ? 50  ASP B OD1 1 
ATOM   1090 O  OD2 . ASP B 1 50 ? 27.401 23.753 45.810 1.00 27.45 ? 50  ASP B OD2 1 
ATOM   1091 N  N   . ALA B 1 51 ? 23.167 26.219 43.702 1.00 19.65 ? 51  ALA B N   1 
ATOM   1092 C  CA  . ALA B 1 51 ? 21.773 26.641 43.702 1.00 18.81 ? 51  ALA B CA  1 
ATOM   1093 C  C   . ALA B 1 51 ? 21.227 26.753 42.286 1.00 18.03 ? 51  ALA B C   1 
ATOM   1094 O  O   . ALA B 1 51 ? 20.070 26.425 42.036 1.00 16.46 ? 51  ALA B O   1 
ATOM   1095 C  CB  . ALA B 1 51 ? 21.630 27.978 44.433 1.00 19.23 ? 51  ALA B CB  1 
ATOM   1096 N  N   . GLU B 1 52 ? 22.051 27.213 41.352 1.00 18.17 ? 52  GLU B N   1 
ATOM   1097 C  CA  . GLU B 1 52 ? 21.590 27.337 39.980 1.00 18.50 ? 52  GLU B CA  1 
ATOM   1098 C  C   . GLU B 1 52 ? 21.437 25.984 39.305 1.00 17.04 ? 52  GLU B C   1 
ATOM   1099 O  O   . GLU B 1 52 ? 20.523 25.790 38.503 1.00 18.53 ? 52  GLU B O   1 
ATOM   1100 C  CB  . GLU B 1 52 ? 22.529 28.239 39.184 1.00 20.87 ? 52  GLU B CB  1 
ATOM   1101 C  CG  . GLU B 1 52 ? 22.296 29.700 39.493 1.00 25.91 ? 52  GLU B CG  1 
ATOM   1102 C  CD  . GLU B 1 52 ? 20.826 30.071 39.370 1.00 27.87 ? 52  GLU B CD  1 
ATOM   1103 O  OE1 . GLU B 1 52 ? 20.236 29.817 38.300 1.00 29.05 ? 52  GLU B OE1 1 
ATOM   1104 O  OE2 . GLU B 1 52 ? 20.259 30.614 40.340 1.00 31.75 ? 52  GLU B OE2 1 
ATOM   1105 N  N   . ILE B 1 53 ? 22.323 25.049 39.626 1.00 17.16 ? 53  ILE B N   1 
ATOM   1106 C  CA  . ILE B 1 53 ? 22.232 23.713 39.045 1.00 16.32 ? 53  ILE B CA  1 
ATOM   1107 C  C   . ILE B 1 53 ? 20.943 23.079 39.571 1.00 16.36 ? 53  ILE B C   1 
ATOM   1108 O  O   . ILE B 1 53 ? 20.200 22.424 38.830 1.00 15.68 ? 53  ILE B O   1 
ATOM   1109 C  CB  . ILE B 1 53 ? 23.457 22.838 39.427 1.00 17.16 ? 53  ILE B CB  1 
ATOM   1110 C  CG1 . ILE B 1 53 ? 24.673 23.252 38.592 1.00 17.26 ? 53  ILE B CG1 1 
ATOM   1111 C  CG2 . ILE B 1 53 ? 23.151 21.360 39.183 1.00 16.64 ? 53  ILE B CG2 1 
ATOM   1112 C  CD1 . ILE B 1 53 ? 25.943 22.502 38.928 1.00 18.15 ? 53  ILE B CD1 1 
ATOM   1113 N  N   . ALA B 1 54 ? 20.667 23.301 40.851 1.00 16.24 ? 54  ALA B N   1 
ATOM   1114 C  CA  . ALA B 1 54 ? 19.463 22.757 41.465 1.00 17.30 ? 54  ALA B CA  1 
ATOM   1115 C  C   . ALA B 1 54 ? 18.208 23.347 40.827 1.00 16.92 ? 54  ALA B C   1 
ATOM   1116 O  O   . ALA B 1 54 ? 17.231 22.642 40.616 1.00 17.64 ? 54  ALA B O   1 
ATOM   1117 C  CB  . ALA B 1 54 ? 19.473 23.024 42.971 1.00 16.40 ? 54  ALA B CB  1 
ATOM   1118 N  N   . ARG B 1 55 ? 18.230 24.638 40.509 1.00 17.52 ? 55  ARG B N   1 
ATOM   1119 C  CA  . ARG B 1 55 ? 17.066 25.261 39.890 1.00 19.69 ? 55  ARG B CA  1 
ATOM   1120 C  C   . ARG B 1 55 ? 16.876 24.681 38.491 1.00 18.64 ? 55  ARG B C   1 
ATOM   1121 O  O   . ARG B 1 55 ? 15.755 24.384 38.072 1.00 19.68 ? 55  ARG B O   1 
ATOM   1122 C  CB  . ARG B 1 55 ? 17.250 26.780 39.807 1.00 23.13 ? 55  ARG B CB  1 
ATOM   1123 C  CG  . ARG B 1 55 ? 16.011 27.504 39.292 1.00 27.21 ? 55  ARG B CG  1 
ATOM   1124 C  CD  . ARG B 1 55 ? 16.144 29.010 39.436 1.00 32.89 ? 55  ARG B CD  1 
ATOM   1125 N  NE  . ARG B 1 55 ? 16.966 29.617 38.392 1.00 36.48 ? 55  ARG B NE  1 
ATOM   1126 C  CZ  . ARG B 1 55 ? 16.587 29.771 37.126 1.00 38.30 ? 55  ARG B CZ  1 
ATOM   1127 N  NH1 . ARG B 1 55 ? 15.389 29.361 36.725 1.00 40.19 ? 55  ARG B NH1 1 
ATOM   1128 N  NH2 . ARG B 1 55 ? 17.409 30.349 36.259 1.00 40.89 ? 55  ARG B NH2 1 
ATOM   1129 N  N   . LEU B 1 56 ? 17.988 24.515 37.782 1.00 19.14 ? 56  LEU B N   1 
ATOM   1130 C  CA  . LEU B 1 56 ? 17.980 23.963 36.433 1.00 18.86 ? 56  LEU B CA  1 
ATOM   1131 C  C   . LEU B 1 56 ? 17.358 22.569 36.444 1.00 17.67 ? 56  LEU B C   1 
ATOM   1132 O  O   . LEU B 1 56 ? 16.443 22.278 35.673 1.00 15.31 ? 56  LEU B O   1 
ATOM   1133 C  CB  . LEU B 1 56 ? 19.414 23.896 35.898 1.00 21.56 ? 56  LEU B CB  1 
ATOM   1134 C  CG  . LEU B 1 56 ? 19.677 23.231 34.543 1.00 24.52 ? 56  LEU B CG  1 
ATOM   1135 C  CD1 . LEU B 1 56 ? 18.923 23.952 33.438 1.00 26.86 ? 56  LEU B CD1 1 
ATOM   1136 C  CD2 . LEU B 1 56 ? 21.177 23.250 34.271 1.00 26.94 ? 56  LEU B CD2 1 
ATOM   1137 N  N   . MET B 1 57 ? 17.848 21.706 37.327 1.00 16.75 ? 57  MET B N   1 
ATOM   1138 C  CA  . MET B 1 57 ? 17.313 20.354 37.399 1.00 15.04 ? 57  MET B CA  1 
ATOM   1139 C  C   . MET B 1 57 ? 15.842 20.365 37.789 1.00 15.79 ? 57  MET B C   1 
ATOM   1140 O  O   . MET B 1 57 ? 15.054 19.588 37.260 1.00 14.96 ? 57  MET B O   1 
ATOM   1141 C  CB  . MET B 1 57 ? 18.114 19.504 38.386 1.00 16.11 ? 57  MET B CB  1 
ATOM   1142 C  CG  . MET B 1 57 ? 19.600 19.422 38.050 1.00 15.37 ? 57  MET B CG  1 
ATOM   1143 S  SD  . MET B 1 57 ? 20.484 18.131 38.959 1.00 18.12 ? 57  MET B SD  1 
ATOM   1144 C  CE  . MET B 1 57 ? 20.419 18.794 40.663 1.00 15.00 ? 57  MET B CE  1 
ATOM   1145 N  N   . GLU B 1 58 ? 15.469 21.254 38.704 1.00 15.99 ? 58  GLU B N   1 
ATOM   1146 C  CA  . GLU B 1 58 ? 14.082 21.344 39.143 1.00 18.36 ? 58  GLU B CA  1 
ATOM   1147 C  C   . GLU B 1 58 ? 13.151 21.659 37.981 1.00 18.27 ? 58  GLU B C   1 
ATOM   1148 O  O   . GLU B 1 58 ? 12.111 21.019 37.816 1.00 17.84 ? 58  GLU B O   1 
ATOM   1149 C  CB  . GLU B 1 58 ? 13.919 22.425 40.217 1.00 19.49 ? 58  GLU B CB  1 
ATOM   1150 C  CG  . GLU B 1 58 ? 12.521 22.466 40.818 1.00 23.39 ? 58  GLU B CG  1 
ATOM   1151 C  CD  . GLU B 1 58 ? 12.173 21.177 41.532 1.00 24.13 ? 58  GLU B CD  1 
ATOM   1152 O  OE1 . GLU B 1 58 ? 11.095 20.608 41.254 1.00 26.48 ? 58  GLU B OE1 1 
ATOM   1153 O  OE2 . GLU B 1 58 ? 12.982 20.731 42.372 1.00 25.04 ? 58  GLU B OE2 1 
ATOM   1154 N  N   . ASP B 1 59 ? 13.530 22.643 37.172 1.00 18.22 ? 59  ASP B N   1 
ATOM   1155 C  CA  . ASP B 1 59 ? 12.706 23.036 36.041 1.00 19.22 ? 59  ASP B CA  1 
ATOM   1156 C  C   . ASP B 1 59 ? 12.629 21.986 34.942 1.00 18.29 ? 59  ASP B C   1 
ATOM   1157 O  O   . ASP B 1 59 ? 11.614 21.888 34.253 1.00 18.98 ? 59  ASP B O   1 
ATOM   1158 C  CB  . ASP B 1 59 ? 13.187 24.372 35.474 1.00 21.76 ? 59  ASP B CB  1 
ATOM   1159 C  CG  . ASP B 1 59 ? 12.979 25.514 36.450 1.00 25.42 ? 59  ASP B CG  1 
ATOM   1160 O  OD1 . ASP B 1 59 ? 11.972 25.466 37.190 1.00 27.47 ? 59  ASP B OD1 1 
ATOM   1161 O  OD2 . ASP B 1 59 ? 13.803 26.455 36.477 1.00 28.58 ? 59  ASP B OD2 1 
ATOM   1162 N  N   . LEU B 1 60 ? 13.687 21.200 34.781 1.00 16.60 ? 60  LEU B N   1 
ATOM   1163 C  CA  . LEU B 1 60 ? 13.689 20.159 33.763 1.00 15.64 ? 60  LEU B CA  1 
ATOM   1164 C  C   . LEU B 1 60 ? 12.757 19.018 34.157 1.00 14.99 ? 60  LEU B C   1 
ATOM   1165 O  O   . LEU B 1 60 ? 12.281 18.277 33.298 1.00 14.26 ? 60  LEU B O   1 
ATOM   1166 C  CB  . LEU B 1 60 ? 15.098 19.607 33.558 1.00 15.05 ? 60  LEU B CB  1 
ATOM   1167 C  CG  . LEU B 1 60 ? 16.127 20.525 32.897 1.00 16.36 ? 60  LEU B CG  1 
ATOM   1168 C  CD1 . LEU B 1 60 ? 17.471 19.800 32.849 1.00 16.20 ? 60  LEU B CD1 1 
ATOM   1169 C  CD2 . LEU B 1 60 ? 15.669 20.917 31.496 1.00 15.79 ? 60  LEU B CD2 1 
ATOM   1170 N  N   . ASP B 1 61 ? 12.519 18.868 35.457 1.00 15.56 ? 61  ASP B N   1 
ATOM   1171 C  CA  . ASP B 1 61 ? 11.641 17.811 35.958 1.00 15.91 ? 61  ASP B CA  1 
ATOM   1172 C  C   . ASP B 1 61 ? 10.202 18.318 35.921 1.00 17.51 ? 61  ASP B C   1 
ATOM   1173 O  O   . ASP B 1 61 ? 9.654  18.756 36.932 1.00 19.17 ? 61  ASP B O   1 
ATOM   1174 C  CB  . ASP B 1 61 ? 12.055 17.435 37.385 1.00 15.48 ? 61  ASP B CB  1 
ATOM   1175 C  CG  . ASP B 1 61 ? 11.141 16.399 38.007 1.00 14.67 ? 61  ASP B CG  1 
ATOM   1176 O  OD1 . ASP B 1 61 ? 10.454 15.681 37.259 1.00 14.66 ? 61  ASP B OD1 1 
ATOM   1177 O  OD2 . ASP B 1 61 ? 11.123 16.295 39.248 1.00 15.59 ? 61  ASP B OD2 1 
ATOM   1178 N  N   . ARG B 1 62 ? 9.599  18.242 34.741 1.00 17.85 ? 62  ARG B N   1 
ATOM   1179 C  CA  . ARG B 1 62 ? 8.239  18.726 34.524 1.00 21.55 ? 62  ARG B CA  1 
ATOM   1180 C  C   . ARG B 1 62 ? 7.125  18.018 35.283 1.00 22.03 ? 62  ARG B C   1 
ATOM   1181 O  O   . ARG B 1 62 ? 6.163  18.663 35.691 1.00 21.78 ? 62  ARG B O   1 
ATOM   1182 C  CB  . ARG B 1 62 ? 7.912  18.703 33.025 1.00 23.84 ? 62  ARG B CB  1 
ATOM   1183 C  CG  . ARG B 1 62 ? 8.904  19.469 32.161 1.00 29.22 ? 62  ARG B CG  1 
ATOM   1184 C  CD  . ARG B 1 62 ? 8.969  20.936 32.547 1.00 32.62 ? 62  ARG B CD  1 
ATOM   1185 N  NE  . ARG B 1 62 ? 10.246 21.549 32.175 1.00 36.04 ? 62  ARG B NE  1 
ATOM   1186 C  CZ  . ARG B 1 62 ? 10.499 22.157 31.019 1.00 37.60 ? 62  ARG B CZ  1 
ATOM   1187 N  NH1 . ARG B 1 62 ? 9.562  22.257 30.084 1.00 38.04 ? 62  ARG B NH1 1 
ATOM   1188 N  NH2 . ARG B 1 62 ? 11.704 22.666 30.799 1.00 38.07 ? 62  ARG B NH2 1 
ATOM   1189 N  N   . ASN B 1 63 ? 7.239  16.705 35.475 1.00 20.62 ? 63  ASN B N   1 
ATOM   1190 C  CA  . ASN B 1 63 ? 6.184  15.962 36.168 1.00 21.30 ? 63  ASN B CA  1 
ATOM   1191 C  C   . ASN B 1 63 ? 6.435  15.799 37.667 1.00 21.56 ? 63  ASN B C   1 
ATOM   1192 O  O   . ASN B 1 63 ? 5.650  15.158 38.379 1.00 21.48 ? 63  ASN B O   1 
ATOM   1193 C  CB  . ASN B 1 63 ? 5.979  14.597 35.498 1.00 21.21 ? 63  ASN B CB  1 
ATOM   1194 C  CG  . ASN B 1 63 ? 7.149  13.654 35.709 1.00 22.37 ? 63  ASN B CG  1 
ATOM   1195 O  OD1 . ASN B 1 63 ? 8.273  14.086 35.936 1.00 17.63 ? 63  ASN B OD1 1 
ATOM   1196 N  ND2 . ASN B 1 63 ? 6.883  12.355 35.625 1.00 22.20 ? 63  ASN B ND2 1 
ATOM   1197 N  N   . LYS B 1 64 ? 7.532  16.391 38.131 1.00 20.18 ? 64  LYS B N   1 
ATOM   1198 C  CA  . LYS B 1 64 ? 7.924  16.375 39.535 1.00 20.10 ? 64  LYS B CA  1 
ATOM   1199 C  C   . LYS B 1 64 ? 8.057  15.013 40.205 1.00 19.41 ? 64  LYS B C   1 
ATOM   1200 O  O   . LYS B 1 64 ? 7.589  14.823 41.329 1.00 20.82 ? 64  LYS B O   1 
ATOM   1201 C  CB  . LYS B 1 64 ? 6.963  17.256 40.342 1.00 22.45 ? 64  LYS B CB  1 
ATOM   1202 C  CG  . LYS B 1 64 ? 6.877  18.681 39.823 1.00 23.09 ? 64  LYS B CG  1 
ATOM   1203 C  CD  . LYS B 1 64 ? 8.262  19.326 39.774 1.00 22.76 ? 64  LYS B CD  1 
ATOM   1204 C  CE  . LYS B 1 64 ? 8.250  20.627 38.989 1.00 22.44 ? 64  LYS B CE  1 
ATOM   1205 N  NZ  . LYS B 1 64 ? 9.631  21.165 38.783 1.00 22.20 ? 64  LYS B NZ  1 
ATOM   1206 N  N   . ASP B 1 65 ? 8.687  14.061 39.527 1.00 17.54 ? 65  ASP B N   1 
ATOM   1207 C  CA  . ASP B 1 65 ? 8.889  12.757 40.135 1.00 18.20 ? 65  ASP B CA  1 
ATOM   1208 C  C   . ASP B 1 65 ? 10.339 12.661 40.617 1.00 17.61 ? 65  ASP B C   1 
ATOM   1209 O  O   . ASP B 1 65 ? 10.802 11.602 41.037 1.00 16.89 ? 65  ASP B O   1 
ATOM   1210 C  CB  . ASP B 1 65 ? 8.534  11.626 39.155 1.00 18.21 ? 65  ASP B CB  1 
ATOM   1211 C  CG  . ASP B 1 65 ? 9.382  11.629 37.901 1.00 17.98 ? 65  ASP B CG  1 
ATOM   1212 O  OD1 . ASP B 1 65 ? 9.222  10.689 37.090 1.00 15.50 ? 65  ASP B OD1 1 
ATOM   1213 O  OD2 . ASP B 1 65 ? 10.204 12.553 37.718 1.00 15.48 ? 65  ASP B OD2 1 
ATOM   1214 N  N   . GLN B 1 66 ? 11.024 13.805 40.567 1.00 16.68 ? 66  GLN B N   1 
ATOM   1215 C  CA  . GLN B 1 66 ? 12.416 13.967 40.991 1.00 15.31 ? 66  GLN B CA  1 
ATOM   1216 C  C   . GLN B 1 66 ? 13.427 13.302 40.066 1.00 14.84 ? 66  GLN B C   1 
ATOM   1217 O  O   . GLN B 1 66 ? 14.611 13.217 40.384 1.00 13.68 ? 66  GLN B O   1 
ATOM   1218 C  CB  . GLN B 1 66 ? 12.604 13.460 42.424 1.00 17.45 ? 66  GLN B CB  1 
ATOM   1219 C  CG  . GLN B 1 66 ? 11.569 14.012 43.395 1.00 19.85 ? 66  GLN B CG  1 
ATOM   1220 C  CD  . GLN B 1 66 ? 11.500 15.525 43.366 1.00 20.49 ? 66  GLN B CD  1 
ATOM   1221 O  OE1 . GLN B 1 66 ? 12.496 16.208 43.607 1.00 23.36 ? 66  GLN B OE1 1 
ATOM   1222 N  NE2 . GLN B 1 66 ? 10.320 16.059 43.068 1.00 21.59 ? 66  GLN B NE2 1 
ATOM   1223 N  N   . GLU B 1 67 ? 12.948 12.841 38.916 1.00 13.89 ? 67  GLU B N   1 
ATOM   1224 C  CA  . GLU B 1 67 ? 13.798 12.197 37.926 1.00 13.36 ? 67  GLU B CA  1 
ATOM   1225 C  C   . GLU B 1 67 ? 13.694 12.985 36.625 1.00 14.53 ? 67  GLU B C   1 
ATOM   1226 O  O   . GLU B 1 67 ? 12.663 13.600 36.341 1.00 14.28 ? 67  GLU B O   1 
ATOM   1227 C  CB  . GLU B 1 67 ? 13.310 10.770 37.636 1.00 12.39 ? 67  GLU B CB  1 
ATOM   1228 C  CG  . GLU B 1 67 ? 13.351 9.780  38.783 1.00 13.16 ? 67  GLU B CG  1 
ATOM   1229 C  CD  . GLU B 1 67 ? 14.759 9.349  39.156 1.00 15.01 ? 67  GLU B CD  1 
ATOM   1230 O  OE1 . GLU B 1 67 ? 15.602 9.184  38.252 1.00 14.77 ? 67  GLU B OE1 1 
ATOM   1231 O  OE2 . GLU B 1 67 ? 15.016 9.153  40.360 1.00 18.15 ? 67  GLU B OE2 1 
ATOM   1232 N  N   . VAL B 1 68 ? 14.763 12.975 35.841 1.00 13.21 ? 68  VAL B N   1 
ATOM   1233 C  CA  . VAL B 1 68 ? 14.727 13.626 34.543 1.00 11.70 ? 68  VAL B CA  1 
ATOM   1234 C  C   . VAL B 1 68 ? 14.847 12.474 33.546 1.00 13.03 ? 68  VAL B C   1 
ATOM   1235 O  O   . VAL B 1 68 ? 15.905 11.849 33.429 1.00 10.17 ? 68  VAL B O   1 
ATOM   1236 C  CB  . VAL B 1 68 ? 15.892 14.643 34.367 1.00 12.57 ? 68  VAL B CB  1 
ATOM   1237 C  CG1 . VAL B 1 68 ? 16.044 15.020 32.895 1.00 13.48 ? 68  VAL B CG1 1 
ATOM   1238 C  CG2 . VAL B 1 68 ? 15.605 15.903 35.187 1.00 13.91 ? 68  VAL B CG2 1 
ATOM   1239 N  N   . ASN B 1 69 ? 13.745 12.159 32.862 1.00 12.02 ? 69  ASN B N   1 
ATOM   1240 C  CA  . ASN B 1 69 ? 13.756 11.077 31.882 1.00 11.42 ? 69  ASN B CA  1 
ATOM   1241 C  C   . ASN B 1 69 ? 14.353 11.581 30.562 1.00 12.97 ? 69  ASN B C   1 
ATOM   1242 O  O   . ASN B 1 69 ? 14.813 12.725 30.480 1.00 11.11 ? 69  ASN B O   1 
ATOM   1243 C  CB  . ASN B 1 69 ? 12.341 10.493 31.669 1.00 12.19 ? 69  ASN B CB  1 
ATOM   1244 C  CG  . ASN B 1 69 ? 11.316 11.537 31.239 1.00 13.40 ? 69  ASN B CG  1 
ATOM   1245 O  OD1 . ASN B 1 69 ? 11.659 12.548 30.628 1.00 12.68 ? 69  ASN B OD1 1 
ATOM   1246 N  ND2 . ASN B 1 69 ? 10.042 11.278 31.544 1.00 12.40 ? 69  ASN B ND2 1 
ATOM   1247 N  N   . PHE B 1 70 ? 14.346 10.749 29.525 1.00 12.60 ? 70  PHE B N   1 
ATOM   1248 C  CA  . PHE B 1 70 ? 14.943 11.165 28.258 1.00 11.28 ? 70  PHE B CA  1 
ATOM   1249 C  C   . PHE B 1 70 ? 14.251 12.348 27.583 1.00 12.91 ? 70  PHE B C   1 
ATOM   1250 O  O   . PHE B 1 70 ? 14.904 13.228 27.022 1.00 13.36 ? 70  PHE B O   1 
ATOM   1251 C  CB  . PHE B 1 70 ? 15.011 9.998  27.276 1.00 13.39 ? 70  PHE B CB  1 
ATOM   1252 C  CG  . PHE B 1 70 ? 15.930 10.261 26.132 1.00 13.29 ? 70  PHE B CG  1 
ATOM   1253 C  CD1 . PHE B 1 70 ? 17.302 10.308 26.337 1.00 12.66 ? 70  PHE B CD1 1 
ATOM   1254 C  CD2 . PHE B 1 70 ? 15.427 10.563 24.873 1.00 14.83 ? 70  PHE B CD2 1 
ATOM   1255 C  CE1 . PHE B 1 70 ? 18.167 10.667 25.311 1.00 14.71 ? 70  PHE B CE1 1 
ATOM   1256 C  CE2 . PHE B 1 70 ? 16.286 10.925 23.833 1.00 15.73 ? 70  PHE B CE2 1 
ATOM   1257 C  CZ  . PHE B 1 70 ? 17.660 10.977 24.055 1.00 15.15 ? 70  PHE B CZ  1 
ATOM   1258 N  N   . GLN B 1 71 ? 12.926 12.368 27.634 1.00 12.75 ? 71  GLN B N   1 
ATOM   1259 C  CA  . GLN B 1 71 ? 12.189 13.462 27.030 1.00 13.30 ? 71  GLN B CA  1 
ATOM   1260 C  C   . GLN B 1 71 ? 12.498 14.776 27.737 1.00 13.34 ? 71  GLN B C   1 
ATOM   1261 O  O   . GLN B 1 71 ? 12.644 15.815 27.090 1.00 13.10 ? 71  GLN B O   1 
ATOM   1262 C  CB  . GLN B 1 71 ? 10.697 13.147 27.073 1.00 17.30 ? 71  GLN B CB  1 
ATOM   1263 C  CG  . GLN B 1 71 ? 10.326 11.963 26.207 1.00 22.75 ? 71  GLN B CG  1 
ATOM   1264 C  CD  . GLN B 1 71 ? 8.934  11.485 26.500 1.00 28.35 ? 71  GLN B CD  1 
ATOM   1265 O  OE1 . GLN B 1 71 ? 8.645  11.040 27.612 1.00 30.43 ? 71  GLN B OE1 1 
ATOM   1266 N  NE2 . GLN B 1 71 ? 8.054  11.580 25.514 1.00 31.44 ? 71  GLN B NE2 1 
ATOM   1267 N  N   . GLU B 1 72 ? 12.624 14.734 29.061 1.00 12.43 ? 72  GLU B N   1 
ATOM   1268 C  CA  . GLU B 1 72 ? 12.948 15.953 29.792 1.00 11.00 ? 72  GLU B CA  1 
ATOM   1269 C  C   . GLU B 1 72 ? 14.385 16.360 29.468 1.00 12.16 ? 72  GLU B C   1 
ATOM   1270 O  O   . GLU B 1 72 ? 14.699 17.550 29.418 1.00 13.52 ? 72  GLU B O   1 
ATOM   1271 C  CB  . GLU B 1 72 ? 12.729 15.751 31.300 1.00 10.52 ? 72  GLU B CB  1 
ATOM   1272 C  CG  . GLU B 1 72 ? 11.254 15.417 31.607 1.00 13.22 ? 72  GLU B CG  1 
ATOM   1273 C  CD  . GLU B 1 72 ? 10.999 15.004 33.040 1.00 13.25 ? 72  GLU B CD  1 
ATOM   1274 O  OE1 . GLU B 1 72 ? 11.825 14.261 33.602 1.00 13.38 ? 72  GLU B OE1 1 
ATOM   1275 O  OE2 . GLU B 1 72 ? 9.955  15.408 33.598 1.00 15.34 ? 72  GLU B OE2 1 
ATOM   1276 N  N   . TYR B 1 73 ? 15.242 15.375 29.207 1.00 11.91 ? 73  TYR B N   1 
ATOM   1277 C  CA  . TYR B 1 73 ? 16.638 15.641 28.838 1.00 12.43 ? 73  TYR B CA  1 
ATOM   1278 C  C   . TYR B 1 73 ? 16.689 16.327 27.464 1.00 12.61 ? 73  TYR B C   1 
ATOM   1279 O  O   . TYR B 1 73 ? 17.512 17.216 27.224 1.00 11.80 ? 73  TYR B O   1 
ATOM   1280 C  CB  . TYR B 1 73 ? 17.410 14.315 28.805 1.00 12.23 ? 73  TYR B CB  1 
ATOM   1281 C  CG  . TYR B 1 73 ? 18.819 14.389 28.238 1.00 10.51 ? 73  TYR B CG  1 
ATOM   1282 C  CD1 . TYR B 1 73 ? 19.848 15.027 28.930 1.00 11.01 ? 73  TYR B CD1 1 
ATOM   1283 C  CD2 . TYR B 1 73 ? 19.132 13.756 27.036 1.00 11.41 ? 73  TYR B CD2 1 
ATOM   1284 C  CE1 . TYR B 1 73 ? 21.167 15.018 28.436 1.00 9.24  ? 73  TYR B CE1 1 
ATOM   1285 C  CE2 . TYR B 1 73 ? 20.433 13.741 26.538 1.00 8.66  ? 73  TYR B CE2 1 
ATOM   1286 C  CZ  . TYR B 1 73 ? 21.442 14.367 27.241 1.00 9.36  ? 73  TYR B CZ  1 
ATOM   1287 O  OH  . TYR B 1 73 ? 22.736 14.304 26.762 1.00 11.12 ? 73  TYR B OH  1 
ATOM   1288 N  N   . VAL B 1 74 ? 15.806 15.908 26.561 1.00 13.05 ? 74  VAL B N   1 
ATOM   1289 C  CA  . VAL B 1 74 ? 15.756 16.497 25.231 1.00 14.21 ? 74  VAL B CA  1 
ATOM   1290 C  C   . VAL B 1 74 ? 15.404 17.981 25.350 1.00 13.66 ? 74  VAL B C   1 
ATOM   1291 O  O   . VAL B 1 74 ? 15.905 18.811 24.587 1.00 12.42 ? 74  VAL B O   1 
ATOM   1292 C  CB  . VAL B 1 74 ? 14.741 15.746 24.346 1.00 13.54 ? 74  VAL B CB  1 
ATOM   1293 C  CG1 . VAL B 1 74 ? 14.436 16.541 23.084 1.00 14.50 ? 74  VAL B CG1 1 
ATOM   1294 C  CG2 . VAL B 1 74 ? 15.324 14.395 23.962 1.00 15.26 ? 74  VAL B CG2 1 
ATOM   1295 N  N   . THR B 1 75 ? 14.560 18.322 26.320 1.00 12.83 ? 75  THR B N   1 
ATOM   1296 C  CA  . THR B 1 75 ? 14.202 19.723 26.527 1.00 14.63 ? 75  THR B CA  1 
ATOM   1297 C  C   . THR B 1 75 ? 15.473 20.511 26.882 1.00 14.37 ? 75  THR B C   1 
ATOM   1298 O  O   . THR B 1 75 ? 15.680 21.633 26.405 1.00 14.17 ? 75  THR B O   1 
ATOM   1299 C  CB  . THR B 1 75 ? 13.146 19.861 27.644 1.00 15.87 ? 75  THR B CB  1 
ATOM   1300 O  OG1 . THR B 1 75 ? 11.925 19.245 27.212 1.00 15.70 ? 75  THR B OG1 1 
ATOM   1301 C  CG2 . THR B 1 75 ? 12.881 21.320 27.961 1.00 17.53 ? 75  THR B CG2 1 
ATOM   1302 N  N   . PHE B 1 76 ? 16.321 19.911 27.709 1.00 13.60 ? 76  PHE B N   1 
ATOM   1303 C  CA  . PHE B 1 76 ? 17.587 20.523 28.113 1.00 13.81 ? 76  PHE B CA  1 
ATOM   1304 C  C   . PHE B 1 76 ? 18.488 20.731 26.885 1.00 14.41 ? 76  PHE B C   1 
ATOM   1305 O  O   . PHE B 1 76 ? 19.063 21.812 26.699 1.00 14.60 ? 76  PHE B O   1 
ATOM   1306 C  CB  . PHE B 1 76 ? 18.268 19.624 29.149 1.00 15.63 ? 76  PHE B CB  1 
ATOM   1307 C  CG  . PHE B 1 76 ? 19.651 20.067 29.548 1.00 17.83 ? 76  PHE B CG  1 
ATOM   1308 C  CD1 . PHE B 1 76 ? 19.874 21.337 30.067 1.00 18.72 ? 76  PHE B CD1 1 
ATOM   1309 C  CD2 . PHE B 1 76 ? 20.722 19.189 29.438 1.00 19.93 ? 76  PHE B CD2 1 
ATOM   1310 C  CE1 . PHE B 1 76 ? 21.149 21.726 30.475 1.00 21.00 ? 76  PHE B CE1 1 
ATOM   1311 C  CE2 . PHE B 1 76 ? 22.003 19.569 29.844 1.00 21.55 ? 76  PHE B CE2 1 
ATOM   1312 C  CZ  . PHE B 1 76 ? 22.214 20.838 30.362 1.00 20.73 ? 76  PHE B CZ  1 
ATOM   1313 N  N   . LEU B 1 77 ? 18.606 19.702 26.047 1.00 11.88 ? 77  LEU B N   1 
ATOM   1314 C  CA  . LEU B 1 77 ? 19.423 19.795 24.843 1.00 12.75 ? 77  LEU B CA  1 
ATOM   1315 C  C   . LEU B 1 77 ? 18.918 20.935 23.968 1.00 13.14 ? 77  LEU B C   1 
ATOM   1316 O  O   . LEU B 1 77 ? 19.703 21.699 23.415 1.00 12.73 ? 77  LEU B O   1 
ATOM   1317 C  CB  . LEU B 1 77 ? 19.363 18.497 24.045 1.00 12.44 ? 77  LEU B CB  1 
ATOM   1318 C  CG  . LEU B 1 77 ? 19.874 17.236 24.743 1.00 11.87 ? 77  LEU B CG  1 
ATOM   1319 C  CD1 . LEU B 1 77 ? 19.746 16.056 23.789 1.00 14.13 ? 77  LEU B CD1 1 
ATOM   1320 C  CD2 . LEU B 1 77 ? 21.319 17.435 25.170 1.00 13.90 ? 77  LEU B CD2 1 
ATOM   1321 N  N   . GLY B 1 78 ? 17.602 21.039 23.841 1.00 12.80 ? 78  GLY B N   1 
ATOM   1322 C  CA  . GLY B 1 78 ? 17.027 22.100 23.032 1.00 13.70 ? 78  GLY B CA  1 
ATOM   1323 C  C   . GLY B 1 78 ? 17.346 23.472 23.595 1.00 12.71 ? 78  GLY B C   1 
ATOM   1324 O  O   . GLY B 1 78 ? 17.559 24.428 22.843 1.00 13.98 ? 78  GLY B O   1 
ATOM   1325 N  N   . ALA B 1 79 ? 17.372 23.582 24.921 1.00 12.22 ? 79  ALA B N   1 
ATOM   1326 C  CA  . ALA B 1 79 ? 17.676 24.858 25.557 1.00 13.59 ? 79  ALA B CA  1 
ATOM   1327 C  C   . ALA B 1 79 ? 19.116 25.245 25.259 1.00 13.27 ? 79  ALA B C   1 
ATOM   1328 O  O   . ALA B 1 79 ? 19.416 26.412 24.994 1.00 13.85 ? 79  ALA B O   1 
ATOM   1329 C  CB  . ALA B 1 79 ? 17.473 24.764 27.052 1.00 12.45 ? 79  ALA B CB  1 
ATOM   1330 N  N   . LEU B 1 80 ? 20.005 24.262 25.319 1.00 11.32 ? 80  LEU B N   1 
ATOM   1331 C  CA  . LEU B 1 80 ? 21.422 24.498 25.051 1.00 12.64 ? 80  LEU B CA  1 
ATOM   1332 C  C   . LEU B 1 80 ? 21.622 24.956 23.612 1.00 12.59 ? 80  LEU B C   1 
ATOM   1333 O  O   . LEU B 1 80 ? 22.405 25.872 23.341 1.00 13.34 ? 80  LEU B O   1 
ATOM   1334 C  CB  . LEU B 1 80 ? 22.231 23.222 25.302 1.00 14.62 ? 80  LEU B CB  1 
ATOM   1335 C  CG  . LEU B 1 80 ? 22.387 22.740 26.749 1.00 17.74 ? 80  LEU B CG  1 
ATOM   1336 C  CD1 . LEU B 1 80 ? 23.165 21.436 26.775 1.00 18.70 ? 80  LEU B CD1 1 
ATOM   1337 C  CD2 . LEU B 1 80 ? 23.106 23.798 27.565 1.00 19.63 ? 80  LEU B CD2 1 
ATOM   1338 N  N   . ALA B 1 81 ? 20.904 24.321 22.692 1.00 13.23 ? 81  ALA B N   1 
ATOM   1339 C  CA  . ALA B 1 81 ? 20.994 24.657 21.279 1.00 12.79 ? 81  ALA B CA  1 
ATOM   1340 C  C   . ALA B 1 81 ? 20.500 26.083 21.025 1.00 13.99 ? 81  ALA B C   1 
ATOM   1341 O  O   . ALA B 1 81 ? 21.110 26.833 20.262 1.00 12.42 ? 81  ALA B O   1 
ATOM   1342 C  CB  . ALA B 1 81 ? 20.183 23.657 20.458 1.00 12.65 ? 81  ALA B CB  1 
ATOM   1343 N  N   . LEU B 1 82 ? 19.402 26.466 21.667 1.00 14.03 ? 82  LEU B N   1 
ATOM   1344 C  CA  . LEU B 1 82 ? 18.871 27.818 21.490 1.00 14.68 ? 82  LEU B CA  1 
ATOM   1345 C  C   . LEU B 1 82 ? 19.881 28.846 21.989 1.00 15.69 ? 82  LEU B C   1 
ATOM   1346 O  O   . LEU B 1 82 ? 20.070 29.898 21.374 1.00 15.36 ? 82  LEU B O   1 
ATOM   1347 C  CB  . LEU B 1 82 ? 17.549 27.984 22.248 1.00 16.63 ? 82  LEU B CB  1 
ATOM   1348 C  CG  . LEU B 1 82 ? 16.333 27.198 21.742 1.00 18.96 ? 82  LEU B CG  1 
ATOM   1349 C  CD1 . LEU B 1 82 ? 15.147 27.484 22.642 1.00 20.70 ? 82  LEU B CD1 1 
ATOM   1350 C  CD2 . LEU B 1 82 ? 16.004 27.588 20.301 1.00 18.04 ? 82  LEU B CD2 1 
ATOM   1351 N  N   . ILE B 1 83 ? 20.529 28.544 23.108 1.00 14.39 ? 83  ILE B N   1 
ATOM   1352 C  CA  . ILE B 1 83 ? 21.526 29.447 23.679 1.00 16.27 ? 83  ILE B CA  1 
ATOM   1353 C  C   . ILE B 1 83 ? 22.670 29.686 22.693 1.00 14.16 ? 83  ILE B C   1 
ATOM   1354 O  O   . ILE B 1 83 ? 23.022 30.832 22.401 1.00 13.39 ? 83  ILE B O   1 
ATOM   1355 C  CB  . ILE B 1 83 ? 22.087 28.880 25.010 1.00 17.12 ? 83  ILE B CB  1 
ATOM   1356 C  CG1 . ILE B 1 83 ? 20.995 28.948 26.083 1.00 18.49 ? 83  ILE B CG1 1 
ATOM   1357 C  CG2 . ILE B 1 83 ? 23.330 29.662 25.447 1.00 20.51 ? 83  ILE B CG2 1 
ATOM   1358 C  CD1 . ILE B 1 83 ? 21.336 28.228 27.370 1.00 17.63 ? 83  ILE B CD1 1 
ATOM   1359 N  N   . TYR B 1 84 ? 23.249 28.614 22.164 1.00 11.73 ? 84  TYR B N   1 
ATOM   1360 C  CA  . TYR B 1 84 ? 24.340 28.784 21.215 1.00 11.01 ? 84  TYR B CA  1 
ATOM   1361 C  C   . TYR B 1 84 ? 23.881 29.519 19.961 1.00 10.81 ? 84  TYR B C   1 
ATOM   1362 O  O   . TYR B 1 84 ? 24.576 30.406 19.472 1.00 11.95 ? 84  TYR B O   1 
ATOM   1363 C  CB  . TYR B 1 84 ? 24.965 27.432 20.846 1.00 12.40 ? 84  TYR B CB  1 
ATOM   1364 C  CG  . TYR B 1 84 ? 26.024 26.978 21.834 1.00 14.15 ? 84  TYR B CG  1 
ATOM   1365 C  CD1 . TYR B 1 84 ? 25.739 26.028 22.821 1.00 14.14 ? 84  TYR B CD1 1 
ATOM   1366 C  CD2 . TYR B 1 84 ? 27.311 27.520 21.790 1.00 14.45 ? 84  TYR B CD2 1 
ATOM   1367 C  CE1 . TYR B 1 84 ? 26.718 25.628 23.742 1.00 15.14 ? 84  TYR B CE1 1 
ATOM   1368 C  CE2 . TYR B 1 84 ? 28.290 27.131 22.699 1.00 14.92 ? 84  TYR B CE2 1 
ATOM   1369 C  CZ  . TYR B 1 84 ? 27.992 26.189 23.673 1.00 15.16 ? 84  TYR B CZ  1 
ATOM   1370 O  OH  . TYR B 1 84 ? 28.963 25.826 24.579 1.00 17.04 ? 84  TYR B OH  1 
ATOM   1371 N  N   . ASN B 1 85 ? 22.705 29.169 19.450 1.00 11.27 ? 85  ASN B N   1 
ATOM   1372 C  CA  . ASN B 1 85 ? 22.182 29.809 18.250 1.00 11.65 ? 85  ASN B CA  1 
ATOM   1373 C  C   . ASN B 1 85 ? 21.959 31.313 18.447 1.00 11.61 ? 85  ASN B C   1 
ATOM   1374 O  O   . ASN B 1 85 ? 22.268 32.110 17.563 1.00 13.24 ? 85  ASN B O   1 
ATOM   1375 C  CB  . ASN B 1 85 ? 20.873 29.129 17.830 1.00 11.89 ? 85  ASN B CB  1 
ATOM   1376 C  CG  . ASN B 1 85 ? 20.299 29.703 16.549 1.00 13.06 ? 85  ASN B CG  1 
ATOM   1377 O  OD1 . ASN B 1 85 ? 20.944 29.686 15.501 1.00 14.49 ? 85  ASN B OD1 1 
ATOM   1378 N  ND2 . ASN B 1 85 ? 19.078 30.210 16.627 1.00 14.45 ? 85  ASN B ND2 1 
ATOM   1379 N  N   . GLU B 1 86 ? 21.431 31.701 19.604 1.00 12.53 ? 86  GLU B N   1 
ATOM   1380 C  CA  . GLU B 1 86 ? 21.180 33.117 19.883 1.00 13.51 ? 86  GLU B CA  1 
ATOM   1381 C  C   . GLU B 1 86 ? 22.472 33.924 19.955 1.00 14.31 ? 86  GLU B C   1 
ATOM   1382 O  O   . GLU B 1 86 ? 22.525 35.076 19.523 1.00 13.56 ? 86  GLU B O   1 
ATOM   1383 C  CB  . GLU B 1 86 ? 20.410 33.275 21.191 1.00 15.78 ? 86  GLU B CB  1 
ATOM   1384 C  CG  . GLU B 1 86 ? 18.962 32.829 21.093 1.00 17.46 ? 86  GLU B CG  1 
ATOM   1385 C  CD  . GLU B 1 86 ? 18.188 33.028 22.377 1.00 22.43 ? 86  GLU B CD  1 
ATOM   1386 O  OE1 . GLU B 1 86 ? 18.667 33.768 23.263 1.00 20.93 ? 86  GLU B OE1 1 
ATOM   1387 O  OE2 . GLU B 1 86 ? 17.087 32.449 22.489 1.00 24.67 ? 86  GLU B OE2 1 
ATOM   1388 N  N   . ALA B 1 87 ? 23.517 33.319 20.495 1.00 14.52 ? 87  ALA B N   1 
ATOM   1389 C  CA  . ALA B 1 87 ? 24.785 34.022 20.600 1.00 14.44 ? 87  ALA B CA  1 
ATOM   1390 C  C   . ALA B 1 87 ? 25.348 34.290 19.207 1.00 15.61 ? 87  ALA B C   1 
ATOM   1391 O  O   . ALA B 1 87 ? 25.827 35.386 18.927 1.00 16.06 ? 87  ALA B O   1 
ATOM   1392 C  CB  . ALA B 1 87 ? 25.773 33.202 21.431 1.00 15.86 ? 87  ALA B CB  1 
ATOM   1393 N  N   . LEU B 1 88 ? 25.272 33.298 18.326 1.00 15.02 ? 88  LEU B N   1 
ATOM   1394 C  CA  . LEU B 1 88 ? 25.794 33.454 16.974 1.00 17.10 ? 88  LEU B CA  1 
ATOM   1395 C  C   . LEU B 1 88 ? 25.052 34.481 16.127 1.00 19.74 ? 88  LEU B C   1 
ATOM   1396 O  O   . LEU B 1 88 ? 25.596 34.976 15.139 1.00 18.27 ? 88  LEU B O   1 
ATOM   1397 C  CB  . LEU B 1 88 ? 25.795 32.114 16.244 1.00 18.23 ? 88  LEU B CB  1 
ATOM   1398 C  CG  . LEU B 1 88 ? 26.627 30.996 16.871 1.00 18.79 ? 88  LEU B CG  1 
ATOM   1399 C  CD1 . LEU B 1 88 ? 26.518 29.748 16.005 1.00 20.93 ? 88  LEU B CD1 1 
ATOM   1400 C  CD2 . LEU B 1 88 ? 28.079 31.441 17.002 1.00 21.02 ? 88  LEU B CD2 1 
ATOM   1401 N  N   . LYS B 1 89 ? 23.814 34.804 16.495 1.00 21.27 ? 89  LYS B N   1 
ATOM   1402 C  CA  . LYS B 1 89 ? 23.050 35.780 15.725 1.00 24.23 ? 89  LYS B CA  1 
ATOM   1403 C  C   . LYS B 1 89 ? 23.338 37.223 16.130 1.00 26.74 ? 89  LYS B C   1 
ATOM   1404 O  O   . LYS B 1 89 ? 22.758 38.158 15.573 1.00 29.05 ? 89  LYS B O   1 
ATOM   1405 C  CB  . LYS B 1 89 ? 21.546 35.493 15.832 1.00 21.90 ? 89  LYS B CB  1 
ATOM   1406 C  CG  . LYS B 1 89 ? 21.115 34.267 15.053 1.00 22.38 ? 89  LYS B CG  1 
ATOM   1407 C  CD  . LYS B 1 89 ? 19.612 34.265 14.787 1.00 21.71 ? 89  LYS B CD  1 
ATOM   1408 C  CE  . LYS B 1 89 ? 18.811 34.253 16.072 1.00 19.91 ? 89  LYS B CE  1 
ATOM   1409 N  NZ  . LYS B 1 89 ? 17.377 33.946 15.803 1.00 20.22 ? 89  LYS B NZ  1 
ATOM   1410 N  N   . GLY B 1 90 ? 24.229 37.392 17.102 1.00 28.32 ? 90  GLY B N   1 
ATOM   1411 C  CA  . GLY B 1 90 ? 24.613 38.715 17.574 1.00 29.68 ? 90  GLY B CA  1 
ATOM   1412 C  C   . GLY B 1 90 ? 23.510 39.734 17.812 1.00 30.86 ? 90  GLY B C   1 
ATOM   1413 O  O   . GLY B 1 90 ? 23.657 40.880 17.333 1.00 31.78 ? 90  GLY B O   1 
ATOM   1414 O  OXT . GLY B 1 90 ? 22.514 39.404 18.492 1.00 28.65 ? 90  GLY B OXT 1 
HETATM 1415 CA CA  . CA  C 2 .  ? 17.552 30.345 4.112  1.00 14.48 ? 300 CA  A CA  1 
HETATM 1416 CA CA  . CA  D 2 .  ? 8.295  27.646 9.744  1.00 11.28 ? 400 CA  A CA  1 
HETATM 1417 C  C1  . BME E 3 .  ? 35.018 17.917 31.453 1.00 36.16 ? 100 BME A C1  1 
HETATM 1418 C  C2  . BME E 3 .  ? 35.319 17.526 29.990 1.00 35.25 ? 100 BME A C2  1 
HETATM 1419 O  O1  . BME E 3 .  ? 35.727 18.762 32.089 1.00 36.88 ? 100 BME A O1  1 
HETATM 1420 S  S2  . BME E 3 .  ? 35.452 18.941 28.897 1.00 33.16 ? 100 BME A S2  1 
HETATM 1421 CA CA  . CA  F 2 .  ? 19.243 6.583  37.316 1.00 12.10 ? 300 CA  B CA  1 
HETATM 1422 CA CA  . CA  G 2 .  ? 10.561 13.918 35.716 1.00 14.06 ? 400 CA  B CA  1 
HETATM 1423 C  C1  . BME H 3 .  ? 27.658 11.437 3.065  1.00 63.41 ? 200 BME B C1  1 
HETATM 1424 C  C2  . BME H 3 .  ? 27.849 12.092 4.429  1.00 63.41 ? 200 BME B C2  1 
HETATM 1425 O  O1  . BME H 3 .  ? 26.606 10.902 2.720  1.00 63.28 ? 200 BME B O1  1 
HETATM 1426 S  S2  . BME H 3 .  ? 27.855 11.021 5.912  1.00 62.86 ? 200 BME B S2  1 
HETATM 1427 O  O   . HOH I 4 .  ? 9.605  29.536 10.120 1.00 9.87  ? 401 HOH A O   1 
HETATM 1428 O  O   . HOH I 4 .  ? 15.304 30.598 12.962 1.00 11.13 ? 402 HOH A O   1 
HETATM 1429 O  O   . HOH I 4 .  ? 7.955  27.822 14.694 1.00 13.43 ? 403 HOH A O   1 
HETATM 1430 O  O   . HOH I 4 .  ? 8.317  23.025 16.499 1.00 15.30 ? 404 HOH A O   1 
HETATM 1431 O  O   . HOH I 4 .  ? 3.126  22.621 8.180  1.00 17.42 ? 405 HOH A O   1 
HETATM 1432 O  O   . HOH I 4 .  ? 12.887 26.047 -1.664 1.00 18.60 ? 406 HOH A O   1 
HETATM 1433 O  O   . HOH I 4 .  ? 8.183  21.508 14.364 1.00 18.99 ? 407 HOH A O   1 
HETATM 1434 O  O   . HOH I 4 .  ? 11.674 24.105 19.505 1.00 19.45 ? 408 HOH A O   1 
HETATM 1435 O  O   . HOH I 4 .  ? 15.133 30.449 3.583  1.00 19.95 ? 409 HOH A O   1 
HETATM 1436 O  O   . HOH I 4 .  ? 18.279 37.194 6.018  1.00 20.78 ? 410 HOH A O   1 
HETATM 1437 O  O   . HOH I 4 .  ? 16.563 36.839 9.354  1.00 21.46 ? 411 HOH A O   1 
HETATM 1438 O  O   . HOH I 4 .  ? 28.224 26.949 10.162 1.00 22.12 ? 412 HOH A O   1 
HETATM 1439 O  O   . HOH I 4 .  ? 13.595 18.940 20.558 1.00 22.17 ? 413 HOH A O   1 
HETATM 1440 O  O   . HOH I 4 .  ? 3.214  32.163 8.474  1.00 22.99 ? 414 HOH A O   1 
HETATM 1441 O  O   . HOH I 4 .  ? 10.484 26.610 0.967  1.00 23.04 ? 415 HOH A O   1 
HETATM 1442 O  O   . HOH I 4 .  ? 28.765 25.262 28.644 1.00 23.34 ? 416 HOH A O   1 
HETATM 1443 O  O   . HOH I 4 .  ? 20.588 24.469 -0.987 1.00 24.84 ? 417 HOH A O   1 
HETATM 1444 O  O   . HOH I 4 .  ? 5.536  20.404 2.182  1.00 25.09 ? 418 HOH A O   1 
HETATM 1445 O  O   . HOH I 4 .  ? 21.104 30.676 10.970 1.00 25.22 ? 419 HOH A O   1 
HETATM 1446 O  O   . HOH I 4 .  ? 1.052  30.178 4.501  1.00 25.54 ? 420 HOH A O   1 
HETATM 1447 O  O   . HOH I 4 .  ? 13.547 12.319 -5.265 1.00 25.66 ? 421 HOH A O   1 
HETATM 1448 O  O   . HOH I 4 .  ? 10.575 5.147  1.935  1.00 25.67 ? 422 HOH A O   1 
HETATM 1449 O  O   . HOH I 4 .  ? 11.188 10.404 16.875 1.00 26.04 ? 423 HOH A O   1 
HETATM 1450 O  O   . HOH I 4 .  ? 19.163 -3.800 31.863 1.00 26.26 ? 424 HOH A O   1 
HETATM 1451 O  O   . HOH I 4 .  ? 23.162 11.082 3.299  1.00 27.90 ? 425 HOH A O   1 
HETATM 1452 O  O   . HOH I 4 .  ? 9.426  33.032 6.519  1.00 28.02 ? 426 HOH A O   1 
HETATM 1453 O  O   . HOH I 4 .  ? 14.177 6.363  27.811 1.00 28.54 ? 427 HOH A O   1 
HETATM 1454 O  O   . HOH I 4 .  ? 17.949 20.991 -2.485 1.00 28.77 ? 428 HOH A O   1 
HETATM 1455 O  O   . HOH I 4 .  ? 1.558  31.364 11.661 1.00 29.17 ? 429 HOH A O   1 
HETATM 1456 O  O   . HOH I 4 .  ? 22.915 31.434 8.233  1.00 29.20 ? 430 HOH A O   1 
HETATM 1457 O  O   . HOH I 4 .  ? 12.975 7.386  23.185 1.00 29.29 ? 431 HOH A O   1 
HETATM 1458 O  O   . HOH I 4 .  ? 3.963  23.857 5.746  1.00 29.31 ? 432 HOH A O   1 
HETATM 1459 O  O   . HOH I 4 .  ? 11.252 35.003 7.342  1.00 30.39 ? 433 HOH A O   1 
HETATM 1460 O  O   . HOH I 4 .  ? 9.201  11.776 -4.616 1.00 30.50 ? 434 HOH A O   1 
HETATM 1461 O  O   . HOH I 4 .  ? 19.425 35.357 1.052  1.00 30.55 ? 435 HOH A O   1 
HETATM 1462 O  O   . HOH I 4 .  ? 9.384  12.028 5.622  1.00 30.84 ? 436 HOH A O   1 
HETATM 1463 O  O   . HOH I 4 .  ? 13.545 30.755 1.512  1.00 31.12 ? 437 HOH A O   1 
HETATM 1464 O  O   . HOH I 4 .  ? 19.544 18.676 -3.083 1.00 31.14 ? 438 HOH A O   1 
HETATM 1465 O  O   . HOH I 4 .  ? 18.321 15.275 -5.141 1.00 31.33 ? 439 HOH A O   1 
HETATM 1466 O  O   . HOH I 4 .  ? 0.141  25.423 12.723 1.00 31.37 ? 440 HOH A O   1 
HETATM 1467 O  O   . HOH I 4 .  ? 13.151 33.089 3.069  1.00 32.87 ? 441 HOH A O   1 
HETATM 1468 O  O   . HOH I 4 .  ? 14.715 15.212 -6.061 1.00 33.13 ? 442 HOH A O   1 
HETATM 1469 O  O   . HOH I 4 .  ? 9.838  15.388 12.703 1.00 34.18 ? 443 HOH A O   1 
HETATM 1470 O  O   . HOH I 4 .  ? 17.635 12.585 -1.106 1.00 34.27 ? 444 HOH A O   1 
HETATM 1471 O  O   . HOH I 4 .  ? 4.652  14.222 0.308  1.00 35.02 ? 445 HOH A O   1 
HETATM 1472 O  O   . HOH I 4 .  ? 7.080  18.909 14.604 1.00 36.23 ? 446 HOH A O   1 
HETATM 1473 O  O   . HOH I 4 .  ? 13.362 6.561  0.903  1.00 36.70 ? 447 HOH A O   1 
HETATM 1474 O  O   . HOH I 4 .  ? 2.369  25.181 3.846  1.00 37.64 ? 448 HOH A O   1 
HETATM 1475 O  O   . HOH I 4 .  ? 25.434 29.348 4.146  1.00 38.29 ? 449 HOH A O   1 
HETATM 1476 O  O   . HOH I 4 .  ? 10.123 20.907 20.272 1.00 38.90 ? 450 HOH A O   1 
HETATM 1477 O  O   . HOH I 4 .  ? 16.901 7.232  -4.654 1.00 38.97 ? 451 HOH A O   1 
HETATM 1478 O  O   . HOH I 4 .  ? 35.178 21.106 32.773 1.00 39.28 ? 452 HOH A O   1 
HETATM 1479 O  O   . HOH I 4 .  ? 4.269  15.473 8.580  1.00 39.38 ? 453 HOH A O   1 
HETATM 1480 O  O   . HOH I 4 .  ? 35.705 16.703 19.700 1.00 40.44 ? 454 HOH A O   1 
HETATM 1481 O  O   . HOH I 4 .  ? 24.747 12.959 -0.143 1.00 40.70 ? 455 HOH A O   1 
HETATM 1482 O  O   . HOH I 4 .  ? 10.471 16.639 19.028 1.00 40.99 ? 456 HOH A O   1 
HETATM 1483 O  O   . HOH I 4 .  ? 29.432 20.098 6.293  1.00 41.51 ? 457 HOH A O   1 
HETATM 1484 O  O   . HOH I 4 .  ? 3.959  32.097 3.540  1.00 41.51 ? 458 HOH A O   1 
HETATM 1485 O  O   . HOH I 4 .  ? 24.663 23.872 -2.496 1.00 41.79 ? 459 HOH A O   1 
HETATM 1486 O  O   . HOH I 4 .  ? 0.783  20.186 9.391  1.00 42.26 ? 460 HOH A O   1 
HETATM 1487 O  O   . HOH I 4 .  ? 28.999 18.404 8.735  1.00 42.44 ? 461 HOH A O   1 
HETATM 1488 O  O   . HOH I 4 .  ? 0.870  8.564  7.288  1.00 43.21 ? 462 HOH A O   1 
HETATM 1489 O  O   . HOH I 4 .  ? 9.596  21.732 -5.018 1.00 43.98 ? 463 HOH A O   1 
HETATM 1490 O  O   . HOH I 4 .  ? 29.268 17.478 6.171  1.00 46.67 ? 464 HOH A O   1 
HETATM 1491 O  O   . HOH I 4 .  ? 8.708  7.602  4.663  1.00 48.15 ? 465 HOH A O   1 
HETATM 1492 O  O   . HOH I 4 .  ? 27.814 20.925 2.219  1.00 52.37 ? 466 HOH A O   1 
HETATM 1493 O  O   . HOH I 4 .  ? 4.319  12.758 8.752  1.00 53.85 ? 467 HOH A O   1 
HETATM 1494 O  O   . HOH I 4 .  ? -1.912 22.043 9.595  1.00 58.70 ? 468 HOH A O   1 
HETATM 1495 O  O   . HOH I 4 .  ? 26.462 20.481 -3.762 1.00 59.65 ? 469 HOH A O   1 
HETATM 1496 O  O   . HOH J 4 .  ? 13.808 7.868  30.013 1.00 11.40 ? 401 HOH B O   1 
HETATM 1497 O  O   . HOH J 4 .  ? 17.525 7.500  38.865 1.00 14.61 ? 402 HOH B O   1 
HETATM 1498 O  O   . HOH J 4 .  ? 16.568 14.615 38.515 1.00 14.74 ? 403 HOH B O   1 
HETATM 1499 O  O   . HOH J 4 .  ? 16.172 35.913 14.353 1.00 15.55 ? 404 HOH B O   1 
HETATM 1500 O  O   . HOH J 4 .  ? 16.421 12.366 42.265 1.00 16.44 ? 405 HOH B O   1 
HETATM 1501 O  O   . HOH J 4 .  ? 15.836 31.732 20.013 1.00 16.78 ? 406 HOH B O   1 
HETATM 1502 O  O   . HOH J 4 .  ? 15.044 5.935  40.349 1.00 16.81 ? 407 HOH B O   1 
HETATM 1503 O  O   . HOH J 4 .  ? 15.913 33.738 18.025 1.00 17.11 ? 408 HOH B O   1 
HETATM 1504 O  O   . HOH J 4 .  ? 22.511 0.293  35.524 1.00 17.22 ? 409 HOH B O   1 
HETATM 1505 O  O   . HOH J 4 .  ? 15.477 17.040 38.519 1.00 17.35 ? 410 HOH B O   1 
HETATM 1506 O  O   . HOH J 4 .  ? 32.383 21.454 33.662 1.00 17.64 ? 411 HOH B O   1 
HETATM 1507 O  O   . HOH J 4 .  ? 17.800 31.502 14.228 1.00 17.90 ? 412 HOH B O   1 
HETATM 1508 O  O   . HOH J 4 .  ? 9.738  8.453  32.979 1.00 18.29 ? 413 HOH B O   1 
HETATM 1509 O  O   . HOH J 4 .  ? 12.294 18.017 40.813 1.00 18.84 ? 414 HOH B O   1 
HETATM 1510 O  O   . HOH J 4 .  ? 22.807 32.789 24.251 1.00 19.32 ? 415 HOH B O   1 
HETATM 1511 O  O   . HOH J 4 .  ? 10.337 11.766 34.666 1.00 19.36 ? 416 HOH B O   1 
HETATM 1512 O  O   . HOH J 4 .  ? 26.781 5.776  27.212 1.00 19.73 ? 417 HOH B O   1 
HETATM 1513 O  O   . HOH J 4 .  ? 16.737 20.300 41.930 1.00 19.76 ? 418 HOH B O   1 
HETATM 1514 O  O   . HOH J 4 .  ? 26.246 14.745 42.006 1.00 20.26 ? 419 HOH B O   1 
HETATM 1515 O  O   . HOH J 4 .  ? 11.018 16.638 24.897 1.00 20.51 ? 420 HOH B O   1 
HETATM 1516 O  O   . HOH J 4 .  ? 7.755  15.036 32.067 1.00 20.52 ? 421 HOH B O   1 
HETATM 1517 O  O   . HOH J 4 .  ? 21.006 37.289 19.294 1.00 20.59 ? 422 HOH B O   1 
HETATM 1518 O  O   . HOH J 4 .  ? 19.518 0.177  28.814 1.00 20.95 ? 423 HOH B O   1 
HETATM 1519 O  O   . HOH J 4 .  ? 19.826 12.084 43.763 1.00 21.39 ? 424 HOH B O   1 
HETATM 1520 O  O   . HOH J 4 .  ? 25.174 4.592  33.763 1.00 21.83 ? 425 HOH B O   1 
HETATM 1521 O  O   . HOH J 4 .  ? 17.778 7.312  41.701 1.00 21.97 ? 426 HOH B O   1 
HETATM 1522 O  O   . HOH J 4 .  ? 23.118 21.483 43.078 1.00 22.94 ? 427 HOH B O   1 
HETATM 1523 O  O   . HOH J 4 .  ? 12.183 19.098 30.829 1.00 23.32 ? 428 HOH B O   1 
HETATM 1524 O  O   . HOH J 4 .  ? 10.214 18.281 28.834 1.00 23.39 ? 429 HOH B O   1 
HETATM 1525 O  O   . HOH J 4 .  ? 17.931 30.221 19.254 1.00 23.49 ? 430 HOH B O   1 
HETATM 1526 O  O   . HOH J 4 .  ? 31.488 25.520 25.492 1.00 23.86 ? 431 HOH B O   1 
HETATM 1527 O  O   . HOH J 4 .  ? 14.204 20.218 22.715 1.00 24.68 ? 432 HOH B O   1 
HETATM 1528 O  O   . HOH J 4 .  ? 22.954 3.129  31.564 1.00 26.21 ? 433 HOH B O   1 
HETATM 1529 O  O   . HOH J 4 .  ? 13.249 18.773 44.192 1.00 26.48 ? 434 HOH B O   1 
HETATM 1530 O  O   . HOH J 4 .  ? 10.454 8.578  35.752 1.00 26.54 ? 435 HOH B O   1 
HETATM 1531 O  O   . HOH J 4 .  ? 28.792 10.384 24.034 1.00 26.61 ? 436 HOH B O   1 
HETATM 1532 O  O   . HOH J 4 .  ? 16.074 9.789  42.512 1.00 26.63 ? 437 HOH B O   1 
HETATM 1533 O  O   . HOH J 4 .  ? 29.299 23.011 39.524 1.00 27.07 ? 438 HOH B O   1 
HETATM 1534 O  O   . HOH J 4 .  ? 20.786 3.018  30.262 1.00 27.69 ? 439 HOH B O   1 
HETATM 1535 O  O   . HOH J 4 .  ? 24.771 28.034 45.390 1.00 27.70 ? 440 HOH B O   1 
HETATM 1536 O  O   . HOH J 4 .  ? 19.915 30.855 13.174 1.00 27.75 ? 441 HOH B O   1 
HETATM 1537 O  O   . HOH J 4 .  ? 18.147 26.195 43.951 1.00 27.89 ? 442 HOH B O   1 
HETATM 1538 O  O   . HOH J 4 .  ? 20.061 8.894  9.387  1.00 28.03 ? 443 HOH B O   1 
HETATM 1539 O  O   . HOH J 4 .  ? 17.611 28.442 25.981 1.00 28.55 ? 444 HOH B O   1 
HETATM 1540 O  O   . HOH J 4 .  ? 31.625 10.883 34.749 1.00 29.10 ? 445 HOH B O   1 
HETATM 1541 O  O   . HOH J 4 .  ? 9.764  19.322 43.323 1.00 29.17 ? 446 HOH B O   1 
HETATM 1542 O  O   . HOH J 4 .  ? 29.420 6.414  34.219 1.00 29.51 ? 447 HOH B O   1 
HETATM 1543 O  O   . HOH J 4 .  ? 31.218 12.235 27.244 1.00 29.71 ? 448 HOH B O   1 
HETATM 1544 O  O   . HOH J 4 .  ? 27.858 27.309 44.810 1.00 29.76 ? 449 HOH B O   1 
HETATM 1545 O  O   . HOH J 4 .  ? 20.396 32.711 25.218 1.00 30.30 ? 450 HOH B O   1 
HETATM 1546 O  O   . HOH J 4 .  ? 21.547 38.606 13.307 1.00 31.00 ? 451 HOH B O   1 
HETATM 1547 O  O   . HOH J 4 .  ? 13.204 9.539  42.085 1.00 31.27 ? 452 HOH B O   1 
HETATM 1548 O  O   . HOH J 4 .  ? 25.241 35.631 12.637 1.00 33.03 ? 453 HOH B O   1 
HETATM 1549 O  O   . HOH J 4 .  ? 13.747 23.703 25.628 1.00 33.03 ? 454 HOH B O   1 
HETATM 1550 O  O   . HOH J 4 .  ? 20.651 9.897  44.791 1.00 33.44 ? 455 HOH B O   1 
HETATM 1551 O  O   . HOH J 4 .  ? 34.198 18.505 36.195 1.00 33.77 ? 456 HOH B O   1 
HETATM 1552 O  O   . HOH J 4 .  ? 9.441  9.328  42.239 1.00 33.94 ? 457 HOH B O   1 
HETATM 1553 O  O   . HOH J 4 .  ? 27.928 11.455 41.160 1.00 33.99 ? 458 HOH B O   1 
HETATM 1554 O  O   . HOH J 4 .  ? 24.805 6.575  21.360 1.00 34.08 ? 459 HOH B O   1 
HETATM 1555 O  O   . HOH J 4 .  ? 20.151 28.060 36.569 1.00 34.30 ? 460 HOH B O   1 
HETATM 1556 O  O   . HOH J 4 .  ? 14.832 22.413 43.877 1.00 34.58 ? 461 HOH B O   1 
HETATM 1557 O  O   . HOH J 4 .  ? 28.327 15.963 41.221 1.00 35.29 ? 462 HOH B O   1 
HETATM 1558 O  O   . HOH J 4 .  ? 22.135 16.838 43.338 1.00 35.46 ? 463 HOH B O   1 
HETATM 1559 O  O   . HOH J 4 .  ? 10.830 14.413 23.444 1.00 35.82 ? 464 HOH B O   1 
HETATM 1560 O  O   . HOH J 4 .  ? 28.271 9.099  18.050 1.00 38.37 ? 465 HOH B O   1 
HETATM 1561 O  O   . HOH J 4 .  ? 22.111 5.303  45.236 1.00 39.77 ? 466 HOH B O   1 
HETATM 1562 O  O   . HOH J 4 .  ? 13.082 28.823 37.751 1.00 39.97 ? 467 HOH B O   1 
HETATM 1563 O  O   . HOH J 4 .  ? 9.780  24.015 38.232 1.00 40.48 ? 468 HOH B O   1 
HETATM 1564 O  O   . HOH J 4 .  ? 6.325  21.515 36.325 1.00 40.58 ? 469 HOH B O   1 
HETATM 1565 O  O   . HOH J 4 .  ? 31.677 22.516 41.162 1.00 40.60 ? 470 HOH B O   1 
HETATM 1566 O  O   . HOH J 4 .  ? 31.091 15.806 39.481 1.00 40.61 ? 471 HOH B O   1 
HETATM 1567 O  O   . HOH J 4 .  ? 10.261 20.340 25.785 1.00 40.83 ? 472 HOH B O   1 
HETATM 1568 O  O   . HOH J 4 .  ? 35.560 23.403 31.390 1.00 40.88 ? 473 HOH B O   1 
HETATM 1569 O  O   . HOH J 4 .  ? 26.926 4.769  12.453 1.00 41.17 ? 474 HOH B O   1 
HETATM 1570 O  O   . HOH J 4 .  ? 25.702 18.003 45.424 1.00 41.94 ? 475 HOH B O   1 
HETATM 1571 O  O   . HOH J 4 .  ? 34.210 14.245 31.861 1.00 44.19 ? 476 HOH B O   1 
HETATM 1572 O  O   . HOH J 4 .  ? 8.391  13.829 44.118 1.00 46.14 ? 477 HOH B O   1 
HETATM 1573 O  O   . HOH J 4 .  ? 24.063 42.690 19.420 1.00 48.79 ? 478 HOH B O   1 
HETATM 1574 O  O   . HOH J 4 .  ? 6.575  16.323 43.980 1.00 50.21 ? 479 HOH B O   1 
HETATM 1575 O  O   . HOH J 4 .  ? 34.794 28.493 31.744 1.00 52.07 ? 480 HOH B O   1 
HETATM 1576 O  O   . HOH J 4 .  ? 24.722 6.863  44.418 1.00 54.19 ? 481 HOH B O   1 
HETATM 1577 O  O   . HOH J 4 .  ? 23.820 -1.962 31.179 1.00 55.03 ? 482 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  MET 1  1  ?  ?   ?   A . n 
A 1 2  ALA 2  2  2  ALA ALA A . n 
A 1 3  CYS 3  3  3  CYS CYS A . n 
A 1 4  PRO 4  4  4  PRO PRO A . n 
A 1 5  LEU 5  5  5  LEU LEU A . n 
A 1 6  ASP 6  6  6  ASP ASP A . n 
A 1 7  GLN 7  7  7  GLN GLN A . n 
A 1 8  ALA 8  8  8  ALA ALA A . n 
A 1 9  ILE 9  9  9  ILE ILE A . n 
A 1 10 GLY 10 10 10 GLY GLY A . n 
A 1 11 LEU 11 11 11 LEU LEU A . n 
A 1 12 LEU 12 12 12 LEU LEU A . n 
A 1 13 VAL 13 13 13 VAL VAL A . n 
A 1 14 ALA 14 14 14 ALA ALA A . n 
A 1 15 ILE 15 15 15 ILE ILE A . n 
A 1 16 PHE 16 16 16 PHE PHE A . n 
A 1 17 HIS 17 17 17 HIS HIS A . n 
A 1 18 LYS 18 18 18 LYS LYS A . n 
A 1 19 TYR 19 19 19 TYR TYR A . n 
A 1 20 SER 20 20 20 SER SER A . n 
A 1 21 GLY 21 21 21 GLY GLY A . n 
A 1 22 ARG 22 22 22 ARG ARG A . n 
A 1 23 GLU 23 23 23 GLU GLU A . n 
A 1 24 GLY 24 24 24 GLY GLY A . n 
A 1 25 ASP 25 25 25 ASP ASP A . n 
A 1 26 LYS 26 26 26 LYS LYS A . n 
A 1 27 HIS 27 27 27 HIS HIS A . n 
A 1 28 THR 28 28 28 THR THR A . n 
A 1 29 LEU 29 29 29 LEU LEU A . n 
A 1 30 SER 30 30 30 SER SER A . n 
A 1 31 LYS 31 31 31 LYS LYS A . n 
A 1 32 LYS 32 32 32 LYS LYS A . n 
A 1 33 GLU 33 33 33 GLU GLU A . n 
A 1 34 LEU 34 34 34 LEU LEU A . n 
A 1 35 LYS 35 35 35 LYS LYS A . n 
A 1 36 GLU 36 36 36 GLU GLU A . n 
A 1 37 LEU 37 37 37 LEU LEU A . n 
A 1 38 ILE 38 38 38 ILE ILE A . n 
A 1 39 GLN 39 39 39 GLN GLN A . n 
A 1 40 LYS 40 40 40 LYS LYS A . n 
A 1 41 GLU 41 41 41 GLU GLU A . n 
A 1 42 LEU 42 42 42 LEU LEU A . n 
A 1 43 THR 43 43 43 THR THR A . n 
A 1 44 ILE 44 44 44 ILE ILE A . n 
A 1 45 GLY 45 45 45 GLY GLY A . n 
A 1 46 SER 46 46 46 SER SER A . n 
A 1 47 LYS 47 47 47 LYS LYS A . n 
A 1 48 LEU 48 48 48 LEU LEU A . n 
A 1 49 GLN 49 49 49 GLN GLN A . n 
A 1 50 ASP 50 50 50 ASP ASP A . n 
A 1 51 ALA 51 51 51 ALA ALA A . n 
A 1 52 GLU 52 52 52 GLU GLU A . n 
A 1 53 ILE 53 53 53 ILE ILE A . n 
A 1 54 ALA 54 54 54 ALA ALA A . n 
A 1 55 ARG 55 55 55 ARG ARG A . n 
A 1 56 LEU 56 56 56 LEU LEU A . n 
A 1 57 MET 57 57 57 MET MET A . n 
A 1 58 GLU 58 58 58 GLU GLU A . n 
A 1 59 ASP 59 59 59 ASP ASP A . n 
A 1 60 LEU 60 60 60 LEU LEU A . n 
A 1 61 ASP 61 61 61 ASP ASP A . n 
A 1 62 ARG 62 62 62 ARG ARG A . n 
A 1 63 ASN 63 63 63 ASN ASN A . n 
A 1 64 LYS 64 64 64 LYS LYS A . n 
A 1 65 ASP 65 65 65 ASP ASP A . n 
A 1 66 GLN 66 66 66 GLN GLN A . n 
A 1 67 GLU 67 67 67 GLU GLU A . n 
A 1 68 VAL 68 68 68 VAL VAL A . n 
A 1 69 ASN 69 69 69 ASN ASN A . n 
A 1 70 PHE 70 70 70 PHE PHE A . n 
A 1 71 GLN 71 71 71 GLN GLN A . n 
A 1 72 GLU 72 72 72 GLU GLU A . n 
A 1 73 TYR 73 73 73 TYR TYR A . n 
A 1 74 VAL 74 74 74 VAL VAL A . n 
A 1 75 THR 75 75 75 THR THR A . n 
A 1 76 PHE 76 76 76 PHE PHE A . n 
A 1 77 LEU 77 77 77 LEU LEU A . n 
A 1 78 GLY 78 78 78 GLY GLY A . n 
A 1 79 ALA 79 79 79 ALA ALA A . n 
A 1 80 LEU 80 80 80 LEU LEU A . n 
A 1 81 ALA 81 81 81 ALA ALA A . n 
A 1 82 LEU 82 82 82 LEU LEU A . n 
A 1 83 ILE 83 83 83 ILE ILE A . n 
A 1 84 TYR 84 84 84 TYR TYR A . n 
A 1 85 ASN 85 85 85 ASN ASN A . n 
A 1 86 GLU 86 86 86 GLU GLU A . n 
A 1 87 ALA 87 87 87 ALA ALA A . n 
A 1 88 LEU 88 88 88 LEU LEU A . n 
A 1 89 LYS 89 89 89 LYS LYS A . n 
A 1 90 GLY 90 90 90 GLY GLY A . n 
B 1 1  MET 1  1  ?  ?   ?   B . n 
B 1 2  ALA 2  2  2  ALA ALA B . n 
B 1 3  CYS 3  3  3  CYS CYS B . n 
B 1 4  PRO 4  4  4  PRO PRO B . n 
B 1 5  LEU 5  5  5  LEU LEU B . n 
B 1 6  ASP 6  6  6  ASP ASP B . n 
B 1 7  GLN 7  7  7  GLN GLN B . n 
B 1 8  ALA 8  8  8  ALA ALA B . n 
B 1 9  ILE 9  9  9  ILE ILE B . n 
B 1 10 GLY 10 10 10 GLY GLY B . n 
B 1 11 LEU 11 11 11 LEU LEU B . n 
B 1 12 LEU 12 12 12 LEU LEU B . n 
B 1 13 VAL 13 13 13 VAL VAL B . n 
B 1 14 ALA 14 14 14 ALA ALA B . n 
B 1 15 ILE 15 15 15 ILE ILE B . n 
B 1 16 PHE 16 16 16 PHE PHE B . n 
B 1 17 HIS 17 17 17 HIS HIS B . n 
B 1 18 LYS 18 18 18 LYS LYS B . n 
B 1 19 TYR 19 19 19 TYR TYR B . n 
B 1 20 SER 20 20 20 SER SER B . n 
B 1 21 GLY 21 21 21 GLY GLY B . n 
B 1 22 ARG 22 22 22 ARG ARG B . n 
B 1 23 GLU 23 23 23 GLU GLU B . n 
B 1 24 GLY 24 24 24 GLY GLY B . n 
B 1 25 ASP 25 25 25 ASP ASP B . n 
B 1 26 LYS 26 26 26 LYS LYS B . n 
B 1 27 HIS 27 27 27 HIS HIS B . n 
B 1 28 THR 28 28 28 THR THR B . n 
B 1 29 LEU 29 29 29 LEU LEU B . n 
B 1 30 SER 30 30 30 SER SER B . n 
B 1 31 LYS 31 31 31 LYS LYS B . n 
B 1 32 LYS 32 32 32 LYS LYS B . n 
B 1 33 GLU 33 33 33 GLU GLU B . n 
B 1 34 LEU 34 34 34 LEU LEU B . n 
B 1 35 LYS 35 35 35 LYS LYS B . n 
B 1 36 GLU 36 36 36 GLU GLU B . n 
B 1 37 LEU 37 37 37 LEU LEU B . n 
B 1 38 ILE 38 38 38 ILE ILE B . n 
B 1 39 GLN 39 39 39 GLN GLN B . n 
B 1 40 LYS 40 40 40 LYS LYS B . n 
B 1 41 GLU 41 41 41 GLU GLU B . n 
B 1 42 LEU 42 42 42 LEU LEU B . n 
B 1 43 THR 43 43 43 THR THR B . n 
B 1 44 ILE 44 44 44 ILE ILE B . n 
B 1 45 GLY 45 45 45 GLY GLY B . n 
B 1 46 SER 46 46 46 SER SER B . n 
B 1 47 LYS 47 47 47 LYS LYS B . n 
B 1 48 LEU 48 48 48 LEU LEU B . n 
B 1 49 GLN 49 49 49 GLN GLN B . n 
B 1 50 ASP 50 50 50 ASP ASP B . n 
B 1 51 ALA 51 51 51 ALA ALA B . n 
B 1 52 GLU 52 52 52 GLU GLU B . n 
B 1 53 ILE 53 53 53 ILE ILE B . n 
B 1 54 ALA 54 54 54 ALA ALA B . n 
B 1 55 ARG 55 55 55 ARG ARG B . n 
B 1 56 LEU 56 56 56 LEU LEU B . n 
B 1 57 MET 57 57 57 MET MET B . n 
B 1 58 GLU 58 58 58 GLU GLU B . n 
B 1 59 ASP 59 59 59 ASP ASP B . n 
B 1 60 LEU 60 60 60 LEU LEU B . n 
B 1 61 ASP 61 61 61 ASP ASP B . n 
B 1 62 ARG 62 62 62 ARG ARG B . n 
B 1 63 ASN 63 63 63 ASN ASN B . n 
B 1 64 LYS 64 64 64 LYS LYS B . n 
B 1 65 ASP 65 65 65 ASP ASP B . n 
B 1 66 GLN 66 66 66 GLN GLN B . n 
B 1 67 GLU 67 67 67 GLU GLU B . n 
B 1 68 VAL 68 68 68 VAL VAL B . n 
B 1 69 ASN 69 69 69 ASN ASN B . n 
B 1 70 PHE 70 70 70 PHE PHE B . n 
B 1 71 GLN 71 71 71 GLN GLN B . n 
B 1 72 GLU 72 72 72 GLU GLU B . n 
B 1 73 TYR 73 73 73 TYR TYR B . n 
B 1 74 VAL 74 74 74 VAL VAL B . n 
B 1 75 THR 75 75 75 THR THR B . n 
B 1 76 PHE 76 76 76 PHE PHE B . n 
B 1 77 LEU 77 77 77 LEU LEU B . n 
B 1 78 GLY 78 78 78 GLY GLY B . n 
B 1 79 ALA 79 79 79 ALA ALA B . n 
B 1 80 LEU 80 80 80 LEU LEU B . n 
B 1 81 ALA 81 81 81 ALA ALA B . n 
B 1 82 LEU 82 82 82 LEU LEU B . n 
B 1 83 ILE 83 83 83 ILE ILE B . n 
B 1 84 TYR 84 84 84 TYR TYR B . n 
B 1 85 ASN 85 85 85 ASN ASN B . n 
B 1 86 GLU 86 86 86 GLU GLU B . n 
B 1 87 ALA 87 87 87 ALA ALA B . n 
B 1 88 LEU 88 88 88 LEU LEU B . n 
B 1 89 LYS 89 89 89 LYS LYS B . n 
B 1 90 GLY 90 90 90 GLY GLY B . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric    2 
2 software_defined_assembly            PISA tetrameric 4 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1   A,B,C,D,E,F,G,H,I,J 
2 1,2 A,B,C,D,E,F,G,H,I,J 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3800  ? 
1 MORE         -87   ? 
1 'SSA (A^2)'  9380  ? 
2 'ABSA (A^2)' 9600  ? 
2 MORE         -187  ? 
2 'SSA (A^2)'  16750 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z       1.0000000000  0.0000000000 0.0000000000 0.0000000000  0.0000000000 1.0000000000  
0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 2_665 -x+1,-y+1,z -1.0000000000 0.0000000000 0.0000000000 56.6100000000 0.0000000000 -1.0000000000 
0.0000000000 58.4390000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? A GLU 23 ? A GLU 23  ? 1_555 CA ? C CA . ? A CA 300 ? 1_555 O   ? A ASP 25 ? A ASP 25  ? 1_555 91.1  ? 
2  O   ? A GLU 23 ? A GLU 23  ? 1_555 CA ? C CA . ? A CA 300 ? 1_555 O   ? A THR 28 ? A THR 28  ? 1_555 161.5 ? 
3  O   ? A ASP 25 ? A ASP 25  ? 1_555 CA ? C CA . ? A CA 300 ? 1_555 O   ? A THR 28 ? A THR 28  ? 1_555 82.4  ? 
4  O   ? A GLU 23 ? A GLU 23  ? 1_555 CA ? C CA . ? A CA 300 ? 1_555 O   ? I HOH .  ? A HOH 409 ? 1_555 82.6  ? 
5  O   ? A ASP 25 ? A ASP 25  ? 1_555 CA ? C CA . ? A CA 300 ? 1_555 O   ? I HOH .  ? A HOH 409 ? 1_555 90.0  ? 
6  O   ? A THR 28 ? A THR 28  ? 1_555 CA ? C CA . ? A CA 300 ? 1_555 O   ? I HOH .  ? A HOH 409 ? 1_555 80.1  ? 
7  O   ? A GLU 23 ? A GLU 23  ? 1_555 CA ? C CA . ? A CA 300 ? 1_555 OE2 ? A GLU 33 ? A GLU 33  ? 1_555 75.6  ? 
8  O   ? A ASP 25 ? A ASP 25  ? 1_555 CA ? C CA . ? A CA 300 ? 1_555 OE2 ? A GLU 33 ? A GLU 33  ? 1_555 145.2 ? 
9  O   ? A THR 28 ? A THR 28  ? 1_555 CA ? C CA . ? A CA 300 ? 1_555 OE2 ? A GLU 33 ? A GLU 33  ? 1_555 118.9 ? 
10 O   ? I HOH .  ? A HOH 409 ? 1_555 CA ? C CA . ? A CA 300 ? 1_555 OE2 ? A GLU 33 ? A GLU 33  ? 1_555 119.1 ? 
11 O   ? A GLU 23 ? A GLU 23  ? 1_555 CA ? C CA . ? A CA 300 ? 1_555 O   ? A SER 20 ? A SER 20  ? 1_555 105.2 ? 
12 O   ? A ASP 25 ? A ASP 25  ? 1_555 CA ? C CA . ? A CA 300 ? 1_555 O   ? A SER 20 ? A SER 20  ? 1_555 83.7  ? 
13 O   ? A THR 28 ? A THR 28  ? 1_555 CA ? C CA . ? A CA 300 ? 1_555 O   ? A SER 20 ? A SER 20  ? 1_555 91.4  ? 
14 O   ? I HOH .  ? A HOH 409 ? 1_555 CA ? C CA . ? A CA 300 ? 1_555 O   ? A SER 20 ? A SER 20  ? 1_555 170.1 ? 
15 OE2 ? A GLU 33 ? A GLU 33  ? 1_555 CA ? C CA . ? A CA 300 ? 1_555 O   ? A SER 20 ? A SER 20  ? 1_555 69.5  ? 
16 O   ? A GLU 23 ? A GLU 23  ? 1_555 CA ? C CA . ? A CA 300 ? 1_555 OE1 ? A GLU 33 ? A GLU 33  ? 1_555 105.6 ? 
17 O   ? A ASP 25 ? A ASP 25  ? 1_555 CA ? C CA . ? A CA 300 ? 1_555 OE1 ? A GLU 33 ? A GLU 33  ? 1_555 160.6 ? 
18 O   ? A THR 28 ? A THR 28  ? 1_555 CA ? C CA . ? A CA 300 ? 1_555 OE1 ? A GLU 33 ? A GLU 33  ? 1_555 78.7  ? 
19 O   ? I HOH .  ? A HOH 409 ? 1_555 CA ? C CA . ? A CA 300 ? 1_555 OE1 ? A GLU 33 ? A GLU 33  ? 1_555 82.6  ? 
20 OE2 ? A GLU 33 ? A GLU 33  ? 1_555 CA ? C CA . ? A CA 300 ? 1_555 OE1 ? A GLU 33 ? A GLU 33  ? 1_555 51.6  ? 
21 O   ? A SER 20 ? A SER 20  ? 1_555 CA ? C CA . ? A CA 300 ? 1_555 OE1 ? A GLU 33 ? A GLU 33  ? 1_555 100.8 ? 
22 OD1 ? A ASN 63 ? A ASN 63  ? 1_555 CA ? D CA . ? A CA 400 ? 1_555 OD2 ? A ASP 65 ? A ASP 65  ? 1_555 80.2  ? 
23 OD1 ? A ASN 63 ? A ASN 63  ? 1_555 CA ? D CA . ? A CA 400 ? 1_555 O   ? A GLU 67 ? A GLU 67  ? 1_555 158.2 ? 
24 OD2 ? A ASP 65 ? A ASP 65  ? 1_555 CA ? D CA . ? A CA 400 ? 1_555 O   ? A GLU 67 ? A GLU 67  ? 1_555 78.8  ? 
25 OD1 ? A ASN 63 ? A ASN 63  ? 1_555 CA ? D CA . ? A CA 400 ? 1_555 OE1 ? A GLU 72 ? A GLU 72  ? 1_555 124.2 ? 
26 OD2 ? A ASP 65 ? A ASP 65  ? 1_555 CA ? D CA . ? A CA 400 ? 1_555 OE1 ? A GLU 72 ? A GLU 72  ? 1_555 154.1 ? 
27 O   ? A GLU 67 ? A GLU 67  ? 1_555 CA ? D CA . ? A CA 400 ? 1_555 OE1 ? A GLU 72 ? A GLU 72  ? 1_555 77.5  ? 
28 OD1 ? A ASN 63 ? A ASN 63  ? 1_555 CA ? D CA . ? A CA 400 ? 1_555 OE2 ? A GLU 72 ? A GLU 72  ? 1_555 76.9  ? 
29 OD2 ? A ASP 65 ? A ASP 65  ? 1_555 CA ? D CA . ? A CA 400 ? 1_555 OE2 ? A GLU 72 ? A GLU 72  ? 1_555 156.2 ? 
30 O   ? A GLU 67 ? A GLU 67  ? 1_555 CA ? D CA . ? A CA 400 ? 1_555 OE2 ? A GLU 72 ? A GLU 72  ? 1_555 123.0 ? 
31 OE1 ? A GLU 72 ? A GLU 72  ? 1_555 CA ? D CA . ? A CA 400 ? 1_555 OE2 ? A GLU 72 ? A GLU 72  ? 1_555 49.7  ? 
32 OD1 ? A ASN 63 ? A ASN 63  ? 1_555 CA ? D CA . ? A CA 400 ? 1_555 O   ? I HOH .  ? A HOH 401 ? 1_555 86.6  ? 
33 OD2 ? A ASP 65 ? A ASP 65  ? 1_555 CA ? D CA . ? A CA 400 ? 1_555 O   ? I HOH .  ? A HOH 401 ? 1_555 78.0  ? 
34 O   ? A GLU 67 ? A GLU 67  ? 1_555 CA ? D CA . ? A CA 400 ? 1_555 O   ? I HOH .  ? A HOH 401 ? 1_555 94.8  ? 
35 OE1 ? A GLU 72 ? A GLU 72  ? 1_555 CA ? D CA . ? A CA 400 ? 1_555 O   ? I HOH .  ? A HOH 401 ? 1_555 93.7  ? 
36 OE2 ? A GLU 72 ? A GLU 72  ? 1_555 CA ? D CA . ? A CA 400 ? 1_555 O   ? I HOH .  ? A HOH 401 ? 1_555 106.7 ? 
37 OD1 ? A ASN 63 ? A ASN 63  ? 1_555 CA ? D CA . ? A CA 400 ? 1_555 OD1 ? A ASP 61 ? A ASP 61  ? 1_555 82.7  ? 
38 OD2 ? A ASP 65 ? A ASP 65  ? 1_555 CA ? D CA . ? A CA 400 ? 1_555 OD1 ? A ASP 61 ? A ASP 61  ? 1_555 78.6  ? 
39 O   ? A GLU 67 ? A GLU 67  ? 1_555 CA ? D CA . ? A CA 400 ? 1_555 OD1 ? A ASP 61 ? A ASP 61  ? 1_555 87.4  ? 
40 OE1 ? A GLU 72 ? A GLU 72  ? 1_555 CA ? D CA . ? A CA 400 ? 1_555 OD1 ? A ASP 61 ? A ASP 61  ? 1_555 110.5 ? 
41 OE2 ? A GLU 72 ? A GLU 72  ? 1_555 CA ? D CA . ? A CA 400 ? 1_555 OD1 ? A ASP 61 ? A ASP 61  ? 1_555 92.2  ? 
42 O   ? I HOH .  ? A HOH 401 ? 1_555 CA ? D CA . ? A CA 400 ? 1_555 OD1 ? A ASP 61 ? A ASP 61  ? 1_555 155.5 ? 
43 O   ? B SER 20 ? B SER 20  ? 1_555 CA ? F CA . ? B CA 300 ? 1_555 OE1 ? B GLU 33 ? B GLU 33  ? 1_555 98.6  ? 
44 O   ? B SER 20 ? B SER 20  ? 1_555 CA ? F CA . ? B CA 300 ? 1_555 OE2 ? B GLU 33 ? B GLU 33  ? 1_555 74.6  ? 
45 OE1 ? B GLU 33 ? B GLU 33  ? 1_555 CA ? F CA . ? B CA 300 ? 1_555 OE2 ? B GLU 33 ? B GLU 33  ? 1_555 52.5  ? 
46 O   ? B SER 20 ? B SER 20  ? 1_555 CA ? F CA . ? B CA 300 ? 1_555 O   ? B GLU 23 ? B GLU 23  ? 1_555 109.2 ? 
47 OE1 ? B GLU 33 ? B GLU 33  ? 1_555 CA ? F CA . ? B CA 300 ? 1_555 O   ? B GLU 23 ? B GLU 23  ? 1_555 110.7 ? 
48 OE2 ? B GLU 33 ? B GLU 33  ? 1_555 CA ? F CA . ? B CA 300 ? 1_555 O   ? B GLU 23 ? B GLU 23  ? 1_555 75.7  ? 
49 O   ? B SER 20 ? B SER 20  ? 1_555 CA ? F CA . ? B CA 300 ? 1_555 O   ? J HOH .  ? B HOH 402 ? 1_555 166.5 ? 
50 OE1 ? B GLU 33 ? B GLU 33  ? 1_555 CA ? F CA . ? B CA 300 ? 1_555 O   ? J HOH .  ? B HOH 402 ? 1_555 84.1  ? 
51 OE2 ? B GLU 33 ? B GLU 33  ? 1_555 CA ? F CA . ? B CA 300 ? 1_555 O   ? J HOH .  ? B HOH 402 ? 1_555 116.6 ? 
52 O   ? B GLU 23 ? B GLU 23  ? 1_555 CA ? F CA . ? B CA 300 ? 1_555 O   ? J HOH .  ? B HOH 402 ? 1_555 81.8  ? 
53 O   ? B SER 20 ? B SER 20  ? 1_555 CA ? F CA . ? B CA 300 ? 1_555 O   ? B THR 28 ? B THR 28  ? 1_555 87.3  ? 
54 OE1 ? B GLU 33 ? B GLU 33  ? 1_555 CA ? F CA . ? B CA 300 ? 1_555 O   ? B THR 28 ? B THR 28  ? 1_555 77.2  ? 
55 OE2 ? B GLU 33 ? B GLU 33  ? 1_555 CA ? F CA . ? B CA 300 ? 1_555 O   ? B THR 28 ? B THR 28  ? 1_555 121.5 ? 
56 O   ? B GLU 23 ? B GLU 23  ? 1_555 CA ? F CA . ? B CA 300 ? 1_555 O   ? B THR 28 ? B THR 28  ? 1_555 159.6 ? 
57 O   ? J HOH .  ? B HOH 402 ? 1_555 CA ? F CA . ? B CA 300 ? 1_555 O   ? B THR 28 ? B THR 28  ? 1_555 80.4  ? 
58 O   ? B SER 20 ? B SER 20  ? 1_555 CA ? F CA . ? B CA 300 ? 1_555 O   ? B ASP 25 ? B ASP 25  ? 1_555 80.0  ? 
59 OE1 ? B GLU 33 ? B GLU 33  ? 1_555 CA ? F CA . ? B CA 300 ? 1_555 O   ? B ASP 25 ? B ASP 25  ? 1_555 164.7 ? 
60 OE2 ? B GLU 33 ? B GLU 33  ? 1_555 CA ? F CA . ? B CA 300 ? 1_555 O   ? B ASP 25 ? B ASP 25  ? 1_555 139.6 ? 
61 O   ? B GLU 23 ? B GLU 23  ? 1_555 CA ? F CA . ? B CA 300 ? 1_555 O   ? B ASP 25 ? B ASP 25  ? 1_555 83.9  ? 
62 O   ? J HOH .  ? B HOH 402 ? 1_555 CA ? F CA . ? B CA 300 ? 1_555 O   ? B ASP 25 ? B ASP 25  ? 1_555 93.9  ? 
63 O   ? B THR 28 ? B THR 28  ? 1_555 CA ? F CA . ? B CA 300 ? 1_555 O   ? B ASP 25 ? B ASP 25  ? 1_555 87.5  ? 
64 O   ? B GLU 67 ? B GLU 67  ? 1_555 CA ? G CA . ? B CA 400 ? 1_555 OE1 ? B GLU 72 ? B GLU 72  ? 1_555 77.1  ? 
65 O   ? B GLU 67 ? B GLU 67  ? 1_555 CA ? G CA . ? B CA 400 ? 1_555 OE2 ? B GLU 72 ? B GLU 72  ? 1_555 121.4 ? 
66 OE1 ? B GLU 72 ? B GLU 72  ? 1_555 CA ? G CA . ? B CA 400 ? 1_555 OE2 ? B GLU 72 ? B GLU 72  ? 1_555 50.3  ? 
67 O   ? B GLU 67 ? B GLU 67  ? 1_555 CA ? G CA . ? B CA 400 ? 1_555 O   ? J HOH .  ? B HOH 416 ? 1_555 94.8  ? 
68 OE1 ? B GLU 72 ? B GLU 72  ? 1_555 CA ? G CA . ? B CA 400 ? 1_555 O   ? J HOH .  ? B HOH 416 ? 1_555 78.4  ? 
69 OE2 ? B GLU 72 ? B GLU 72  ? 1_555 CA ? G CA . ? B CA 400 ? 1_555 O   ? J HOH .  ? B HOH 416 ? 1_555 97.6  ? 
70 O   ? B GLU 67 ? B GLU 67  ? 1_555 CA ? G CA . ? B CA 400 ? 1_555 OD2 ? B ASP 65 ? B ASP 65  ? 1_555 80.1  ? 
71 OE1 ? B GLU 72 ? B GLU 72  ? 1_555 CA ? G CA . ? B CA 400 ? 1_555 OD2 ? B ASP 65 ? B ASP 65  ? 1_555 147.8 ? 
72 OE2 ? B GLU 72 ? B GLU 72  ? 1_555 CA ? G CA . ? B CA 400 ? 1_555 OD2 ? B ASP 65 ? B ASP 65  ? 1_555 158.4 ? 
73 O   ? J HOH .  ? B HOH 416 ? 1_555 CA ? G CA . ? B CA 400 ? 1_555 OD2 ? B ASP 65 ? B ASP 65  ? 1_555 81.1  ? 
74 O   ? B GLU 67 ? B GLU 67  ? 1_555 CA ? G CA . ? B CA 400 ? 1_555 OD1 ? B ASN 63 ? B ASN 63  ? 1_555 157.7 ? 
75 OE1 ? B GLU 72 ? B GLU 72  ? 1_555 CA ? G CA . ? B CA 400 ? 1_555 OD1 ? B ASN 63 ? B ASN 63  ? 1_555 125.1 ? 
76 OE2 ? B GLU 72 ? B GLU 72  ? 1_555 CA ? G CA . ? B CA 400 ? 1_555 OD1 ? B ASN 63 ? B ASN 63  ? 1_555 79.0  ? 
77 O   ? J HOH .  ? B HOH 416 ? 1_555 CA ? G CA . ? B CA 400 ? 1_555 OD1 ? B ASN 63 ? B ASN 63  ? 1_555 90.8  ? 
78 OD2 ? B ASP 65 ? B ASP 65  ? 1_555 CA ? G CA . ? B CA 400 ? 1_555 OD1 ? B ASN 63 ? B ASN 63  ? 1_555 79.5  ? 
79 O   ? B GLU 67 ? B GLU 67  ? 1_555 CA ? G CA . ? B CA 400 ? 1_555 OD1 ? B ASP 61 ? B ASP 61  ? 1_555 88.0  ? 
80 OE1 ? B GLU 72 ? B GLU 72  ? 1_555 CA ? G CA . ? B CA 400 ? 1_555 OD1 ? B ASP 61 ? B ASP 61  ? 1_555 118.6 ? 
81 OE2 ? B GLU 72 ? B GLU 72  ? 1_555 CA ? G CA . ? B CA 400 ? 1_555 OD1 ? B ASP 61 ? B ASP 61  ? 1_555 95.3  ? 
82 O   ? J HOH .  ? B HOH 416 ? 1_555 CA ? G CA . ? B CA 400 ? 1_555 OD1 ? B ASP 61 ? B ASP 61  ? 1_555 162.9 ? 
83 OD2 ? B ASP 65 ? B ASP 65  ? 1_555 CA ? G CA . ? B CA 400 ? 1_555 OD1 ? B ASP 61 ? B ASP 61  ? 1_555 82.8  ? 
84 OD1 ? B ASN 63 ? B ASN 63  ? 1_555 CA ? G CA . ? B CA 400 ? 1_555 OD1 ? B ASP 61 ? B ASP 61  ? 1_555 80.6  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-04-10 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
AMoRE     phasing          . ? 1 
REFMAC    refinement       . ? 2 
DENZO     'data reduction' . ? 3 
SCALEPACK 'data scaling'   . ? 4 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A MET 1 ? A MET 1 
2 1 Y 1 B MET 1 ? B MET 1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'CALCIUM ION'        CA  
3 BETA-MERCAPTOETHANOL BME 
4 water                HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 CA  1  300 300 CA  CA  A . 
D 2 CA  1  400 400 CA  CA  A . 
E 3 BME 1  100 100 BME BME A . 
F 2 CA  1  300 300 CA  CA  B . 
G 2 CA  1  400 400 CA  CA  B . 
H 3 BME 1  200 200 BME BME B . 
I 4 HOH 1  401 1   HOH HOH A . 
I 4 HOH 2  402 2   HOH HOH A . 
I 4 HOH 3  403 4   HOH HOH A . 
I 4 HOH 4  404 7   HOH HOH A . 
I 4 HOH 5  405 15  HOH HOH A . 
I 4 HOH 6  406 19  HOH HOH A . 
I 4 HOH 7  407 21  HOH HOH A . 
I 4 HOH 8  408 24  HOH HOH A . 
I 4 HOH 9  409 27  HOH HOH A . 
I 4 HOH 10 410 32  HOH HOH A . 
I 4 HOH 11 411 35  HOH HOH A . 
I 4 HOH 12 412 38  HOH HOH A . 
I 4 HOH 13 413 39  HOH HOH A . 
I 4 HOH 14 414 41  HOH HOH A . 
I 4 HOH 15 415 42  HOH HOH A . 
I 4 HOH 16 416 44  HOH HOH A . 
I 4 HOH 17 417 49  HOH HOH A . 
I 4 HOH 18 418 50  HOH HOH A . 
I 4 HOH 19 419 51  HOH HOH A . 
I 4 HOH 20 420 52  HOH HOH A . 
I 4 HOH 21 421 53  HOH HOH A . 
I 4 HOH 22 422 54  HOH HOH A . 
I 4 HOH 23 423 55  HOH HOH A . 
I 4 HOH 24 424 57  HOH HOH A . 
I 4 HOH 25 425 67  HOH HOH A . 
I 4 HOH 26 426 68  HOH HOH A . 
I 4 HOH 27 427 70  HOH HOH A . 
I 4 HOH 28 428 72  HOH HOH A . 
I 4 HOH 29 429 75  HOH HOH A . 
I 4 HOH 30 430 76  HOH HOH A . 
I 4 HOH 31 431 77  HOH HOH A . 
I 4 HOH 32 432 78  HOH HOH A . 
I 4 HOH 33 433 83  HOH HOH A . 
I 4 HOH 34 434 84  HOH HOH A . 
I 4 HOH 35 435 85  HOH HOH A . 
I 4 HOH 36 436 86  HOH HOH A . 
I 4 HOH 37 437 88  HOH HOH A . 
I 4 HOH 38 438 89  HOH HOH A . 
I 4 HOH 39 439 91  HOH HOH A . 
I 4 HOH 40 440 92  HOH HOH A . 
I 4 HOH 41 441 93  HOH HOH A . 
I 4 HOH 42 442 96  HOH HOH A . 
I 4 HOH 43 443 102 HOH HOH A . 
I 4 HOH 44 444 103 HOH HOH A . 
I 4 HOH 45 445 106 HOH HOH A . 
I 4 HOH 46 446 110 HOH HOH A . 
I 4 HOH 47 447 111 HOH HOH A . 
I 4 HOH 48 448 112 HOH HOH A . 
I 4 HOH 49 449 113 HOH HOH A . 
I 4 HOH 50 450 115 HOH HOH A . 
I 4 HOH 51 451 116 HOH HOH A . 
I 4 HOH 52 452 117 HOH HOH A . 
I 4 HOH 53 453 118 HOH HOH A . 
I 4 HOH 54 454 121 HOH HOH A . 
I 4 HOH 55 455 126 HOH HOH A . 
I 4 HOH 56 456 129 HOH HOH A . 
I 4 HOH 57 457 131 HOH HOH A . 
I 4 HOH 58 458 132 HOH HOH A . 
I 4 HOH 59 459 133 HOH HOH A . 
I 4 HOH 60 460 135 HOH HOH A . 
I 4 HOH 61 461 136 HOH HOH A . 
I 4 HOH 62 462 137 HOH HOH A . 
I 4 HOH 63 463 138 HOH HOH A . 
I 4 HOH 64 464 141 HOH HOH A . 
I 4 HOH 65 465 142 HOH HOH A . 
I 4 HOH 66 466 146 HOH HOH A . 
I 4 HOH 67 467 147 HOH HOH A . 
I 4 HOH 68 468 150 HOH HOH A . 
I 4 HOH 69 469 151 HOH HOH A . 
J 4 HOH 1  401 3   HOH HOH B . 
J 4 HOH 2  402 5   HOH HOH B . 
J 4 HOH 3  403 6   HOH HOH B . 
J 4 HOH 4  404 8   HOH HOH B . 
J 4 HOH 5  405 9   HOH HOH B . 
J 4 HOH 6  406 10  HOH HOH B . 
J 4 HOH 7  407 11  HOH HOH B . 
J 4 HOH 8  408 12  HOH HOH B . 
J 4 HOH 9  409 13  HOH HOH B . 
J 4 HOH 10 410 14  HOH HOH B . 
J 4 HOH 11 411 16  HOH HOH B . 
J 4 HOH 12 412 17  HOH HOH B . 
J 4 HOH 13 413 18  HOH HOH B . 
J 4 HOH 14 414 20  HOH HOH B . 
J 4 HOH 15 415 22  HOH HOH B . 
J 4 HOH 16 416 23  HOH HOH B . 
J 4 HOH 17 417 25  HOH HOH B . 
J 4 HOH 18 418 26  HOH HOH B . 
J 4 HOH 19 419 28  HOH HOH B . 
J 4 HOH 20 420 29  HOH HOH B . 
J 4 HOH 21 421 30  HOH HOH B . 
J 4 HOH 22 422 31  HOH HOH B . 
J 4 HOH 23 423 33  HOH HOH B . 
J 4 HOH 24 424 34  HOH HOH B . 
J 4 HOH 25 425 36  HOH HOH B . 
J 4 HOH 26 426 37  HOH HOH B . 
J 4 HOH 27 427 40  HOH HOH B . 
J 4 HOH 28 428 43  HOH HOH B . 
J 4 HOH 29 429 45  HOH HOH B . 
J 4 HOH 30 430 46  HOH HOH B . 
J 4 HOH 31 431 47  HOH HOH B . 
J 4 HOH 32 432 48  HOH HOH B . 
J 4 HOH 33 433 56  HOH HOH B . 
J 4 HOH 34 434 58  HOH HOH B . 
J 4 HOH 35 435 59  HOH HOH B . 
J 4 HOH 36 436 60  HOH HOH B . 
J 4 HOH 37 437 61  HOH HOH B . 
J 4 HOH 38 438 62  HOH HOH B . 
J 4 HOH 39 439 63  HOH HOH B . 
J 4 HOH 40 440 64  HOH HOH B . 
J 4 HOH 41 441 65  HOH HOH B . 
J 4 HOH 42 442 66  HOH HOH B . 
J 4 HOH 43 443 69  HOH HOH B . 
J 4 HOH 44 444 71  HOH HOH B . 
J 4 HOH 45 445 73  HOH HOH B . 
J 4 HOH 46 446 74  HOH HOH B . 
J 4 HOH 47 447 79  HOH HOH B . 
J 4 HOH 48 448 80  HOH HOH B . 
J 4 HOH 49 449 81  HOH HOH B . 
J 4 HOH 50 450 82  HOH HOH B . 
J 4 HOH 51 451 87  HOH HOH B . 
J 4 HOH 52 452 90  HOH HOH B . 
J 4 HOH 53 453 94  HOH HOH B . 
J 4 HOH 54 454 95  HOH HOH B . 
J 4 HOH 55 455 97  HOH HOH B . 
J 4 HOH 56 456 98  HOH HOH B . 
J 4 HOH 57 457 99  HOH HOH B . 
J 4 HOH 58 458 100 HOH HOH B . 
J 4 HOH 59 459 101 HOH HOH B . 
J 4 HOH 60 460 104 HOH HOH B . 
J 4 HOH 61 461 105 HOH HOH B . 
J 4 HOH 62 462 107 HOH HOH B . 
J 4 HOH 63 463 108 HOH HOH B . 
J 4 HOH 64 464 109 HOH HOH B . 
J 4 HOH 65 465 114 HOH HOH B . 
J 4 HOH 66 466 119 HOH HOH B . 
J 4 HOH 67 467 120 HOH HOH B . 
J 4 HOH 68 468 122 HOH HOH B . 
J 4 HOH 69 469 123 HOH HOH B . 
J 4 HOH 70 470 124 HOH HOH B . 
J 4 HOH 71 471 125 HOH HOH B . 
J 4 HOH 72 472 127 HOH HOH B . 
J 4 HOH 73 473 128 HOH HOH B . 
J 4 HOH 74 474 130 HOH HOH B . 
J 4 HOH 75 475 134 HOH HOH B . 
J 4 HOH 76 476 139 HOH HOH B . 
J 4 HOH 77 477 140 HOH HOH B . 
J 4 HOH 78 478 143 HOH HOH B . 
J 4 HOH 79 479 144 HOH HOH B . 
J 4 HOH 80 480 145 HOH HOH B . 
J 4 HOH 81 481 148 HOH HOH B . 
J 4 HOH 82 482 149 HOH HOH B . 
#