data_1K9M
# 
_entry.id   1K9M 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1K9M         
NDB   RR0044       
RCSB  RCSB014732   
WWPDB D_1000014732 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1K73 'Co-crystal structure of anisomycin bound to the 50S ribosomal subunit'    unspecified 
PDB 1K8A 'Co-crystal structure of carbomycin A bound to the 50S ribosomal subunit'  unspecified 
PDB 1KC8 'Co-crystal structure of blasticidin S bound to the 50S ribosomal subunit' unspecified 
PDB 1KD1 'Co-crystal structure of spiramycin bound to the 50S ribosomal subunit'    unspecified 
PDB 1M1K 'Co-crystal structure of azithromycin bound to the 50S ribosomal subunit'  unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1K9M 
_pdbx_database_status.recvd_initial_deposition_date   2001-10-29 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hansen, J.L.'   1 
'Ippolito, J.A.' 2 
'Ban, N.'        3 
'Nissen, P.'     4 
'Moore, P.B.'    5 
'Steitz, T.A.'   6 
# 
_citation.id                        primary 
_citation.title                     'The structures of four macrolide antibiotics bound to the large ribosomal subunit.' 
_citation.journal_abbrev            Mol.Cell 
_citation.journal_volume            10 
_citation.page_first                117 
_citation.page_last                 128 
_citation.year                      2002 
_citation.journal_id_ASTM           MOCEFL 
_citation.country                   US 
_citation.journal_id_ISSN           1097-2765 
_citation.journal_id_CSD            2168 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12150912 
_citation.pdbx_database_id_DOI      '10.1016/S1097-2765(02)00570-1' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Hansen, J.L.'   1 
primary 'Ippolito, J.A.' 2 
primary 'Ban, N.'        3 
primary 'Nissen, P.'     4 
primary 'Moore, P.B.'    5 
primary 'Steitz, T.A.'   6 
# 
_cell.entry_id           1K9M 
_cell.length_a           212.902 
_cell.length_b           300.474 
_cell.length_c           575.176 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1K9M 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat '23S RRNA'                946034.375 1    ? ? ? ? 
2  polymer     nat '5S RRNA'                 39318.414  1    ? ? ? ? 
3  polymer     nat 'RIBOSOMAL PROTEIN L2'    25237.475  1    ? ? ? ? 
4  polymer     nat 'RIBOSOMAL PROTEIN L3'    37265.195  1    ? ? ? ? 
5  polymer     nat 'RIBOSOMAL PROTEIN L4'    26442.098  1    ? ? ? ? 
6  polymer     nat 'RIBOSOMAL PROTEIN L5'    19420.498  1    ? ? ? ? 
7  polymer     nat 'RIBOSOMAL PROTEIN L6'    19830.523  1    ? ? ? ? 
8  polymer     nat 'RIBOSOMAL PROTEIN L7AE'  12600.822  1    ? ? ? ? 
9  polymer     nat 'RIBOSOMAL PROTEIN L10'   37213.805  1    ? ? ? ? 
10 polymer     nat 'RIBOSOMAL PROTEIN L10E'  18022.527  1    ? ? ? ? 
11 polymer     nat 'RIBOSOMAL PROTEIN L13'   16249.214  1    ? ? ? ? 
12 polymer     nat 'RIBOSOMAL PROTEIN L14'   14216.233  1    ? ? ? ? 
13 polymer     nat 'RIBOSOMAL PROTEIN L15'   17874.172  1    ? ? ? ? 
14 polymer     nat 'RIBOSOMAL PROTEIN L15E'  22856.566  1    ? ? ? ? 
15 polymer     nat 'RIBOSOMAL PROTEIN L18'   20509.740  1    ? ? ? ? 
16 polymer     nat 'RIBOSOMAL PROTEIN L18E'  12307.720  1    ? ? ? ? 
17 polymer     nat 'RIBOSOMAL PROTEIN L19E'  16631.322  1    ? ? ? ? 
18 polymer     nat 'RIBOSOMAL PROTEIN L21E'  10436.604  1    ? ? ? ? 
19 polymer     nat 'RIBOSOMAL PROTEIN L22'   16835.746  1    ? ? ? ? 
20 polymer     nat 'RIBOSOMAL PROTEIN L23'   9481.340   1    ? ? ? ? 
21 polymer     nat 'RIBOSOMAL PROTEIN L24'   13539.759  1    ? ? ? ? 
22 polymer     nat 'RIBOSOMAL PROTEIN L24E'  7233.720   1    ? ? ? ? 
23 polymer     nat 'RIBOSOMAL PROTEIN L29'   7758.667   1    ? ? ? ? 
24 polymer     nat 'RIBOSOMAL PROTEIN L30'   17062.885  1    ? ? ? ? 
25 polymer     nat 'RIBOSOMAL PROTEIN L31E'  10253.417  1    ? ? ? ? 
26 polymer     nat 'RIBOSOMAL PROTEIN L32E'  26324.531  1    ? ? ? ? 
27 polymer     nat 'RIBOSOMAL PROTEIN L37Ae' 8097.830   1    ? ? ? ? 
28 polymer     nat 'RIBOSOMAL PROTEIN L37E'  6199.007   1    ? ? ? ? 
29 polymer     nat 'RIBOSOMAL PROTEIN L39E'  5844.700   1    ? ? ? ? 
30 polymer     nat 'RIBOSOMAL PROTEIN L44E'  10815.245  1    ? ? ? ? 
31 non-polymer syn TYLOSIN                   916.100    1    ? ? ? ? 
32 non-polymer syn 'MAGNESIUM ION'           24.305     119  ? ? ? ? 
33 non-polymer syn 'SODIUM ION'              22.990     85   ? ? ? ? 
34 non-polymer syn 'CHLORIDE ION'            35.453     22   ? ? ? ? 
35 non-polymer syn 'POTASSIUM ION'           39.098     3    ? ? ? ? 
36 non-polymer syn 'CADMIUM ION'             112.411    5    ? ? ? ? 
37 water       nat water                     18.015     7877 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
3  '50S RIBOSOMAL PROTEIN L2P, HMAL2, HL4'          
4  '50S RIBOSOMAL PROTEIN L3P, HMAL3, HL1'          
5  '50S RIBOSOMAL PROTEIN L4E, HMAL4, HL6'          
6  '50S RIBOSOMAL PROTEIN L5P, HMAL5, HL13'         
7  '50S RIBOSOMAL PROTEIN L6P, HMAL6, HL10'         
8  '50S RIBOSOMAL PROTEIN HS6'                      
9  '50S RIBOSOMAL PROTEIN P0, HMAL10, L10E'         
11 '50S RIBOSOMAL PROTEIN L13P, HMAL13'             
12 '50S RIBOSOMAL PROTEIN L14P, HMAL14, HL27'       
13 '50S RIBOSOMAL PROTEIN L15P, HMAL15, HL9'        
15 '50S RIBOSOMAL PROTEIN L18P, HMAL18, HL12'       
16 '50S RIBOSOMAL PROTEIN L18E, HL29, L19'          
17 '50S RIBOSOMAL PROTEIN L19E, HMAL19, HL24'       
18 '50S RIBOSOMAL PROTEIN L21E, HL31'               
19 '50S RIBOSOMAL PROTEIN L22P, HMAL22, HL23'       
20 '50S RIBOSOMAL PROTEIN L23P, HMAL23, HL25, L21'  
21 '50S RIBOSOMAL PROTEIN L24P, HMAL24, HL16, HL15' 
22 '50S RIBOSOMAL PROTEIN L24E, HL21/HL22'          
23 '50S RIBOSOMAL PROTEIN L29P, HMAL29, HL33'       
24 '50S RIBOSOMAL PROTEIN L30P, HMAL30, HL20, HL16' 
25 '50S RIBOSOMAL PROTEIN L31E, L34, HL30'          
26 '50S RIBOSOMAL PROTEIN L32E, HL5'                
28 '50S RIBOSOMAL PROTEIN L37E, L35E'               
29 '50S RIBOSOMAL PROTEINS L39E, HL39E, HL46E'      
30 '50S RIBOSOMAL PROTEIN L44E, LA, HLA'            
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  polyribonucleotide no no 
;UUGGCUACUAUGCCAGCUGGUGGAUUGCUCGGCUCAGGCGCUGAUGAAGGACGUGCCAAGCUGCGAUAAGCCAUGGGGAG
CCGCACGGAGGCGAAGAACCAUGGAUUUCCGAAUGAGAAUCUCUCUAACAAUUGCUUCGCGCAAUGAGGAACCCCGAGAA
CUGAAACAUCUCAGUAUCGGGAGGAACAGAAAACGCAAUGUGAUGUCGUUAGUAACCGCGAGUGAACGCGAUACAGCCCA
AACCGAAGCCCUCACGGGCAAUGUGGUGUCAGGGCUACCUCUCAUCAGCCGACCGUCUCGACGAAGUCUCUUGGAACAGA
GCGUGAUACAGGGUGACAACCCCGUACUCGAGACCAGUACGACGUGCGGUAGUGCCAGAGUAGCGGGGGUUGGAUAUCCC
UCGCGAAUAACGCAGGCAUCGACUGCGAAGGCUAAACACAACCUGAGACCGAUAGUGAACAAGUAGUGUGAACGAACGCU
GCAAAGUACCCUCAGAAGGGAGGCGAAAUAGAGCAUGAAAUCAGUUGGCGAUCGAGCGACAGGGCAUACAAGGUCCCUCG
ACGAAUGACCGACGCGCGAGCGUCCAGUAAGACUCACGGGAAGCCGAUGUUCUGUCGUACGUUUUGAAAAACGAGCCAGG
GAGUGUGUCUGCAUGGCAAGUCUAACCGGAGUAUCCGGGGAGGCACAGGGAAACCGACAUGGCCGCAGGGCUUUGCCCGA
GGGCCGCCGUCUUCAAGGGCGGGGAGCCAUGUGGACACGACCCGAAUCCGGACGAUCUACGCAUGGACAAGAUGAAGCGU
GCCGAAAGGCACGUGGAAGUCUGUUAGAGUUGGUGUCCUACAAUACCCUCUCGUGAUCUAUGUGUAGGGGUGAAAGGCCC
AUCGAGUCCGGCAACAGCUGGUUCCAAUCGAAACAUGUCGAAGCAUGACCUCCGCCGAGGUAGUCUGUGAGGUAGAGCGA
CCGAUUGGUGUGUCCGCCUCCGAGAGGAGUCGGCACACCUGUCAAACUCCAAACUUACAGACGCCGUUUGACGCGGGGAU
UCCGGUGCGCGGGGUAAGCCUGUGUACCAGGAGGGGAACAACCCAGAGAUAGGUUAAGGUCCCCAAGUGUGGAUUAAGUG
UAAUCCUCUGAAGGUGGUCUCGAGCCCUAGACAGCCGGGAGGUGAGCUUAGAAGCAGCUACCCUCUAAGAAAAGCGUAAC
AGCUUACCGGCCGAGGUUUGAGGCGCCCAAAAUGAUCGGGACUCAAAUCCACCACCGAGACCUGUCCGUACCACUCAUAC
UGGUAAUCGAGUAGAUUGGCGCUCUAAUUGGAUGGAAGUAGGGGUGAAAACUCCUAUGGACCGAUUAGUGACGAAAAUCC
UGGCCAUAGUAGCAGCGAUAGUCGGGUGAGAACCCCGACGGCCUAAUGGAUAAGGGUUCCUCAGCACUGCUGAUCAGCUG
AGGGUUAGCCGGUCCUAAGUCAUACCGCAACUCGACUAUGACGAAAUGGGAAACGGGUUAAUAUUCCCGUGCCACUAUGC
AGUGAAAGUUGACGCCCUGGGGUCGAUCACGCUGGGCAUUCGCCCAGUCGAACCGUCCAACUCCGUGGAAGCCGUAAUGG
CAGGAAGCGGACGAACGGCGGCAUAGGGAAACGUGAUUCAACCUGGGGCCCAUGAAAAGACGAGCAUAGUGUCCGUACCG
AGAACCGACACAGGUGUCCAUGGCGGCGAAAGCCAAGGCCUGUCGGGAGCAACCAACGUUAGGGAAUUCGGCAAGUUAGU
CCCGUACCUUCGGAAGAAGGGAUGCCUGCUCCGGAACGGAGCAGGUCGCAGUGACUCGGAAGCUCGGACUGUCUAGUAAC
AACAUAGGUGACCGCAAAUCCGCAAGGACUCGUACGGUCACUGAAUCCUGCCCAGUGCAGGUAUCUGAACACCUCGUACA
AGAGGACGAAGGACCUGUCAACGGCGGGGGUAACUAUGACCCUCUUAAGGUAGCGUAGUACCUUGCCGCAUCAGUAGCGG
CUUGCAUGAAUGGAUUAACCAGAGCUUCACUGUCCCAACGUUGGGCCCGGUGAACUGUACAUUCCAGUGCGGAGUCUGGA
GACACCCAGGGGGAAGCGAAGACCCUAUGGAGCUUUACUGCAGGCUGUCGCUGAGACGUGGUCGCCGAUGUGCAGCAUAG
GUAGGAGACACUACACAGGUACCCGCGCUAGCGGGCCACCGAGUCAACAGUGAAAUACUACCCGUCGGUGACUGCGACUC
UCACUCCGGGAGGAGGACACCGAUAGCCGGGCAGUUUGACUGGGGCGGUACGCGCUCGAAAAGAUAUCGAGCGCGCCCUA
UGGCUAUCUCAGCCGGGACAGAGACCCGGCGAAGAGUGCAAGAGCAAAAGAUAGCUUGACAGUGUUCUUCCCAACGAGGA
ACGCUGACGCGAAAGCGUGGUCUAGCGAACCAAUUAGCCUGCUUGAUGCGGGCAAUUGAUGACAGAAAAGCUACCCUAGG
GAUAACAGAGUCGUCACUCGCAAGAGCACAUAUCGACCGAGUGGCUUGCUACCUCGAUGUCGGUUCCCUCCAUCCUGCCC
GUGCAGAAGCGGGCAAGGGUGAGGUUGUUCGCCUAUUAAAGGAGGUCGUGAGCUGGGUUUAGACCGUCGUGAGACAGGUC
GGCUGCUAUCUACUGGGUGUGUAAUGGUGUCUGACAAGAACGACCGUAUAGUACGAGAGGAACUACGGUUGGUGGCCACU
GGUGUACCGGUUGUUCGAGAGAGCACGUGCCGGGUAGCCACGCCACACGGGGUAAGAGCUGAACGCAUCUAAGCUCGAAA
CCCACUUGGAAAAGAGACACCGCCGAGGUCCCGCGUACAAGACGCGGUCGAUAGACUCGGGGUGUGCGCGUCGAGGUAAC
GAGACGUUAAGCCCACGAGCACUAACAGACCAAAGCCAUCAU
;
;UUGGCUACUAUGCCAGCUGGUGGAUUGCUCGGCUCAGGCGCUGAUGAAGGACGUGCCAAGCUGCGAUAAGCCAUGGGGAG
CCGCACGGAGGCGAAGAACCAUGGAUUUCCGAAUGAGAAUCUCUCUAACAAUUGCUUCGCGCAAUGAGGAACCCCGAGAA
CUGAAACAUCUCAGUAUCGGGAGGAACAGAAAACGCAAUGUGAUGUCGUUAGUAACCGCGAGUGAACGCGAUACAGCCCA
AACCGAAGCCCUCACGGGCAAUGUGGUGUCAGGGCUACCUCUCAUCAGCCGACCGUCUCGACGAAGUCUCUUGGAACAGA
GCGUGAUACAGGGUGACAACCCCGUACUCGAGACCAGUACGACGUGCGGUAGUGCCAGAGUAGCGGGGGUUGGAUAUCCC
UCGCGAAUAACGCAGGCAUCGACUGCGAAGGCUAAACACAACCUGAGACCGAUAGUGAACAAGUAGUGUGAACGAACGCU
GCAAAGUACCCUCAGAAGGGAGGCGAAAUAGAGCAUGAAAUCAGUUGGCGAUCGAGCGACAGGGCAUACAAGGUCCCUCG
ACGAAUGACCGACGCGCGAGCGUCCAGUAAGACUCACGGGAAGCCGAUGUUCUGUCGUACGUUUUGAAAAACGAGCCAGG
GAGUGUGUCUGCAUGGCAAGUCUAACCGGAGUAUCCGGGGAGGCACAGGGAAACCGACAUGGCCGCAGGGCUUUGCCCGA
GGGCCGCCGUCUUCAAGGGCGGGGAGCCAUGUGGACACGACCCGAAUCCGGACGAUCUACGCAUGGACAAGAUGAAGCGU
GCCGAAAGGCACGUGGAAGUCUGUUAGAGUUGGUGUCCUACAAUACCCUCUCGUGAUCUAUGUGUAGGGGUGAAAGGCCC
AUCGAGUCCGGCAACAGCUGGUUCCAAUCGAAACAUGUCGAAGCAUGACCUCCGCCGAGGUAGUCUGUGAGGUAGAGCGA
CCGAUUGGUGUGUCCGCCUCCGAGAGGAGUCGGCACACCUGUCAAACUCCAAACUUACAGACGCCGUUUGACGCGGGGAU
UCCGGUGCGCGGGGUAAGCCUGUGUACCAGGAGGGGAACAACCCAGAGAUAGGUUAAGGUCCCCAAGUGUGGAUUAAGUG
UAAUCCUCUGAAGGUGGUCUCGAGCCCUAGACAGCCGGGAGGUGAGCUUAGAAGCAGCUACCCUCUAAGAAAAGCGUAAC
AGCUUACCGGCCGAGGUUUGAGGCGCCCAAAAUGAUCGGGACUCAAAUCCACCACCGAGACCUGUCCGUACCACUCAUAC
UGGUAAUCGAGUAGAUUGGCGCUCUAAUUGGAUGGAAGUAGGGGUGAAAACUCCUAUGGACCGAUUAGUGACGAAAAUCC
UGGCCAUAGUAGCAGCGAUAGUCGGGUGAGAACCCCGACGGCCUAAUGGAUAAGGGUUCCUCAGCACUGCUGAUCAGCUG
AGGGUUAGCCGGUCCUAAGUCAUACCGCAACUCGACUAUGACGAAAUGGGAAACGGGUUAAUAUUCCCGUGCCACUAUGC
AGUGAAAGUUGACGCCCUGGGGUCGAUCACGCUGGGCAUUCGCCCAGUCGAACCGUCCAACUCCGUGGAAGCCGUAAUGG
CAGGAAGCGGACGAACGGCGGCAUAGGGAAACGUGAUUCAACCUGGGGCCCAUGAAAAGACGAGCAUAGUGUCCGUACCG
AGAACCGACACAGGUGUCCAUGGCGGCGAAAGCCAAGGCCUGUCGGGAGCAACCAACGUUAGGGAAUUCGGCAAGUUAGU
CCCGUACCUUCGGAAGAAGGGAUGCCUGCUCCGGAACGGAGCAGGUCGCAGUGACUCGGAAGCUCGGACUGUCUAGUAAC
AACAUAGGUGACCGCAAAUCCGCAAGGACUCGUACGGUCACUGAAUCCUGCCCAGUGCAGGUAUCUGAACACCUCGUACA
AGAGGACGAAGGACCUGUCAACGGCGGGGGUAACUAUGACCCUCUUAAGGUAGCGUAGUACCUUGCCGCAUCAGUAGCGG
CUUGCAUGAAUGGAUUAACCAGAGCUUCACUGUCCCAACGUUGGGCCCGGUGAACUGUACAUUCCAGUGCGGAGUCUGGA
GACACCCAGGGGGAAGCGAAGACCCUAUGGAGCUUUACUGCAGGCUGUCGCUGAGACGUGGUCGCCGAUGUGCAGCAUAG
GUAGGAGACACUACACAGGUACCCGCGCUAGCGGGCCACCGAGUCAACAGUGAAAUACUACCCGUCGGUGACUGCGACUC
UCACUCCGGGAGGAGGACACCGAUAGCCGGGCAGUUUGACUGGGGCGGUACGCGCUCGAAAAGAUAUCGAGCGCGCCCUA
UGGCUAUCUCAGCCGGGACAGAGACCCGGCGAAGAGUGCAAGAGCAAAAGAUAGCUUGACAGUGUUCUUCCCAACGAGGA
ACGCUGACGCGAAAGCGUGGUCUAGCGAACCAAUUAGCCUGCUUGAUGCGGGCAAUUGAUGACAGAAAAGCUACCCUAGG
GAUAACAGAGUCGUCACUCGCAAGAGCACAUAUCGACCGAGUGGCUUGCUACCUCGAUGUCGGUUCCCUCCAUCCUGCCC
GUGCAGAAGCGGGCAAGGGUGAGGUUGUUCGCCUAUUAAAGGAGGUCGUGAGCUGGGUUUAGACCGUCGUGAGACAGGUC
GGCUGCUAUCUACUGGGUGUGUAAUGGUGUCUGACAAGAACGACCGUAUAGUACGAGAGGAACUACGGUUGGUGGCCACU
GGUGUACCGGUUGUUCGAGAGAGCACGUGCCGGGUAGCCACGCCACACGGGGUAAGAGCUGAACGCAUCUAAGCUCGAAA
CCCACUUGGAAAAGAGACACCGCCGAGGUCCCGCGUACAAGACGCGGUCGAUAGACUCGGGGUGUGCGCGUCGAGGUAAC
GAGACGUUAAGCCCACGAGCACUAACAGACCAAAGCCAUCAU
;
A ? 
2  polyribonucleotide no no 
;UUAGGCGGCCACAGCGGUGGGGUUGCCUCCCGUACCCAUCCCGAACACGGAAGAUAAGCCCACCAGCGUUCCGGGGAGUA
CUGGAGUGCGCGAGCCUCUGGGAAACCCGGUUCGCCGCCACC
;
;UUAGGCGGCCACAGCGGUGGGGUUGCCUCCCGUACCCAUCCCGAACACGGAAGAUAAGCCCACCAGCGUUCCGGGGAGUA
CUGGAGUGCGCGAGCCUCUGGGAAACCCGGUUCGCCGCCACC
;
B ? 
3  'polypeptide(L)'   no no 
;GRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDEL
QVGVDAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVVG
GGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGGNE
;
;GRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDEL
QVGVDAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVVG
GGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGGNE
;
C ? 
4  'polypeptide(L)'   no no 
;PQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPMR
AVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKPD
VMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNLG
PWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVRFRPAVRPNDQ
PRLDPEVRYVSNESNQG
;
;PQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPMR
AVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKPD
VMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNLG
PWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVRFRPAVRPNDQ
PRLDPEVRYVSNESNQG
;
D ? 
5  'polypeptide(L)'   no no 
;MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKLDGRARRV
PQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEAL
DVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESAL
AEVAER
;
;MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKLDGRARRV
PQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEAL
DVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESAL
AEVAER
;
E ? 
6  'polypeptide(L)'   no no 
;SSESESGGDFHEMREPRIEKVVVHMGIGHGGRDLANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEMA
EEFLQTALPLAELATSQFDDTGNFSFGVEEHTEFPSQEYDPSIGIYGLDVTVNLVRPGYRVAKRDKASRSIPTKHRLNPA
DAVAFIESTYDVEVSE
;
;SSESESGGDFHEMREPRIEKVVVHMGIGHGGRDLANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEMA
EEFLQTALPLAELATSQFDDTGNFSFGVEEHTEFPSQEYDPSIGIYGLDVTVNLVRPGYRVAKRDKASRSIPTKHRLNPA
DAVAFIESTYDVEVSE
;
F ? 
7  'polypeptide(L)'   no no 
;PRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEGW
EYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDVR
VFQDGVYITRKPNRGDA
;
;PRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEGW
EYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDVR
VFQDGVYITRKPNRGDA
;
G ? 
8  'polypeptide(L)'   no no 
;PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQ
DDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR
;
;PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQ
DDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR
;
H ? 
9  'polypeptide(L)'   no no 
;MSAESERKTETIPEWKQEEVDAIVEMIESYESVGVVNIAGIPSRQLQDMRRDLHGTAELRVSRNTLLERALDDVDDGLED
LNGYITGQVGLIGTDDNPFSLFQELEASKTPAPIGAGEVAPNDIVIPEGDTGVDPGPFVGELQSVGADARIQEGSIQVLS
DSTVLDTGEEVSQELSNVLNELGIEPKEVGLDLRAVFADGVLFEPEELELDIDEYRSDIQAAAGRAFNLSVNADYPTATT
APTMLQSDRGNAKSLALQAAIEDPEVVPDLVSKADAQVRALASQIDDEEALPEELQGVEADVATEEPTDDQDDDTASEDD
ADADDAAEEADDDDDDDEDAGDALGAMF
;
;MSAESERKTETIPEWKQEEVDAIVEMIESYESVGVVNIAGIPSRQLQDMRRDLHGTAELRVSRNTLLERALDDVDDGLED
LNGYITGQVGLIGTDDNPFSLFQELEASKTPAPIGAGEVAPNDIVIPEGDTGVDPGPFVGELQSVGADARIQEGSIQVLS
DSTVLDTGEEVSQELSNVLNELGIEPKEVGLDLRAVFADGVLFEPEELELDIDEYRSDIQAAAGRAFNLSVNADYPTATT
APTMLQSDRGNAKSLALQAAIEDPEVVPDLVSKADAQVRALASQIDDEEALPEELQGVEADVATEEPTDDQDDDTASEDD
ADADDAAEEADDDDDDDEDAGDALGAMF
;
I ? 
10 'polypeptide(L)'   no no 
;KPGAMYRNSSKPAYTRREYISGIPGKKIAQFDMGNNGAGPTYPAQVELVVEKPVQIRHNALEAARVAANRYVQNSGAAAN
YKFRIRKFPFHVIRENKAAAAAAAAAAADGMRAPFGKPVGTAARVHGANHIFIAWVNPDPNVEEAWRRAKMKVTPTINID
SSPAGNA
;
;KPGAMYRNSSKPAYTRREYISGIPGKKIAQFDMGNNGAGPTYPAQVELVVEKPVQIRHNALEAARVAANRYVQNSGAAAN
YKFRIRKFPFHVIRENKAAAAAAAAAAADGMRAPFGKPVGTAARVHGANHIFIAWVNPDPNVEEAWRRAKMKVTPTINID
SSPAGNA
;
J ? 
11 'polypeptide(L)'   no no 
;MSVAEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFK
RTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW
;
;MSVAEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFK
RTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW
;
K ? 
12 'polypeptide(L)'   no no 
;MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRHPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPI
RRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV
;
;MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRHPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPI
RRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV
;
L ? 
13 'polypeptide(L)'   no no 
;TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADD
VAEVEDGGFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQAEAEETEDAD
ADEE
;
;TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADD
VAEVEDGGFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQAEAEETEDAD
ADEE
;
M ? 
14 'polypeptide(L)'   no no 
;ARSAYSYIREAWKRPKEGQIAELMWHRMQEWRNEPAVVRIERPTRLDRARSLGYKAKQGIIVVRVAIRKGSSRRTRFNKG
RRSKRMMVNRITRKKNIQRIAEERANRKFPNLRVLNSYSVGEDGRHKWHEVILIDPDHPAIKSDDQLSWISRTRHRLRTF
RGLTSAGRRCRGLRGQGKGSEKVRPSLRVNGAKA
;
;ARSAYSYIREAWKRPKEGQIAELMWHRMQEWRNEPAVVRIERPTRLDRARSLGYKAKQGIIVVRVAIRKGSSRRTRFNKG
RRSKRMMVNRITRKKNIQRIAEERANRKFPNLRVLNSYSVGEDGRHKWHEVILIDPDHPAIKSDDQLSWISRTRHRLRTF
RGLTSAGRRCRGLRGQGKGSEKVRPSLRVNGAKA
;
N ? 
15 'polypeptide(L)'   no no 
;ATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMPS
AYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLYS
GDFDAADLPEHFDELRETLLDGDIEL
;
;ATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMPS
AYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLYS
GDFDAADLPEHFDELRETLLDGDIEL
;
O ? 
16 'polypeptide(L)'   no no 
;SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVD
FSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR
;
;SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVD
FSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR
;
P ? 
17 'polypeptide(L)'   no no 
;TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSR
KGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDANHGDA
;
;TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSR
KGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDANHGDA
;
Q ? 
18 'polypeptide(L)'   no no 
;PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGK
EKTIIVTAAHLRRQE
;
;PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGK
EKTIIVTAAHLRRQE
;
R ? 
19 'polypeptide(L)'   no no 
;GISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGRY
PEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEPEVED
;
;GISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGRY
PEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEPEVED
;
S ? 
20 'polypeptide(L)'   no no 
;SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASR
IGVF
;
;SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASR
IGVF
;
T ? 
21 'polypeptide(L)'   no no 
;SKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTLE
KTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA
;
;SKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTLE
KTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA
;
U ? 
22 'polypeptide(L)'   no no PRTRECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTARGEAGEAEDEA 
PRTRECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTARGEAGEAEDEA V ? 
23 'polypeptide(L)'   no no TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGDLQENE 
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGDLQENE W ? 
24 'polypeptide(L)'   no no 
;MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVD
DEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR
;
;MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVD
DEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR
;
X ? 
25 'polypeptide(L)'   no no 
;SASDFEERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEEE
GEAIVEAETAE
;
;SASDFEERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEEE
GEAIVEAETAE
;
Y ? 
26 'polypeptide(L)'   no no 
;ADNEEDVEAEEEYTELTDISGVGPSKAESLREAGFESVEDVRGADQSALADVSGIGNALAARIKADVGGLEVESETEAEV
EEEGGEEAPDEDVETELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKGK
GDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEVEVSE
;
;ADNEEDVEAEEEYTELTDISGVGPSKAESLREAGFESVEDVRGADQSALADVSGIGNALAARIKADVGGLEVESETEAEV
EEEGGEEAPDEDVETELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKGK
GDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEVEVSE
;
Z ? 
27 'polypeptide(L)'   no no RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA 
RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA 1 ? 
28 'polypeptide(L)'   no no TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE 
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE 2 ? 
29 'polypeptide(L)'   no no GKKSKATKKRLAKLDNQNSRVPAWVMLKTDEVQRNHKRRHWRRNDTDE GKKSKATKKRLAKLDNQNSRVPAWVMLKTDEVQRNHKRRHWRRNDTDE 3 ? 
30 'polypeptide(L)'   no no 
;MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLR
EGWRAGRLEFQE
;
;MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLR
EGWRAGRLEFQE
;
4 ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1    U   n 
1  2    U   n 
1  3    G   n 
1  4    G   n 
1  5    C   n 
1  6    U   n 
1  7    A   n 
1  8    C   n 
1  9    U   n 
1  10   A   n 
1  11   U   n 
1  12   G   n 
1  13   C   n 
1  14   C   n 
1  15   A   n 
1  16   G   n 
1  17   C   n 
1  18   U   n 
1  19   G   n 
1  20   G   n 
1  21   U   n 
1  22   G   n 
1  23   G   n 
1  24   A   n 
1  25   U   n 
1  26   U   n 
1  27   G   n 
1  28   C   n 
1  29   U   n 
1  30   C   n 
1  31   G   n 
1  32   G   n 
1  33   C   n 
1  34   U   n 
1  35   C   n 
1  36   A   n 
1  37   G   n 
1  38   G   n 
1  39   C   n 
1  40   G   n 
1  41   C   n 
1  42   U   n 
1  43   G   n 
1  44   A   n 
1  45   U   n 
1  46   G   n 
1  47   A   n 
1  48   A   n 
1  49   G   n 
1  50   G   n 
1  51   A   n 
1  52   C   n 
1  53   G   n 
1  54   U   n 
1  55   G   n 
1  56   C   n 
1  57   C   n 
1  58   A   n 
1  59   A   n 
1  60   G   n 
1  61   C   n 
1  62   U   n 
1  63   G   n 
1  64   C   n 
1  65   G   n 
1  66   A   n 
1  67   U   n 
1  68   A   n 
1  69   A   n 
1  70   G   n 
1  71   C   n 
1  72   C   n 
1  73   A   n 
1  74   U   n 
1  75   G   n 
1  76   G   n 
1  77   G   n 
1  78   G   n 
1  79   A   n 
1  80   G   n 
1  81   C   n 
1  82   C   n 
1  83   G   n 
1  84   C   n 
1  85   A   n 
1  86   C   n 
1  87   G   n 
1  88   G   n 
1  89   A   n 
1  90   G   n 
1  91   G   n 
1  92   C   n 
1  93   G   n 
1  94   A   n 
1  95   A   n 
1  96   G   n 
1  97   A   n 
1  98   A   n 
1  99   C   n 
1  100  C   n 
1  101  A   n 
1  102  U   n 
1  103  G   n 
1  104  G   n 
1  105  A   n 
1  106  U   n 
1  107  U   n 
1  108  U   n 
1  109  C   n 
1  110  C   n 
1  111  G   n 
1  112  A   n 
1  113  A   n 
1  114  U   n 
1  115  G   n 
1  116  A   n 
1  117  G   n 
1  118  A   n 
1  119  A   n 
1  120  U   n 
1  121  C   n 
1  122  U   n 
1  123  C   n 
1  124  U   n 
1  125  C   n 
1  126  U   n 
1  127  A   n 
1  128  A   n 
1  129  C   n 
1  130  A   n 
1  131  A   n 
1  132  U   n 
1  133  U   n 
1  134  G   n 
1  135  C   n 
1  136  U   n 
1  137  U   n 
1  138  C   n 
1  139  G   n 
1  140  C   n 
1  141  G   n 
1  142  C   n 
1  143  A   n 
1  144  A   n 
1  145  U   n 
1  146  G   n 
1  147  A   n 
1  148  G   n 
1  149  G   n 
1  150  A   n 
1  151  A   n 
1  152  C   n 
1  153  C   n 
1  154  C   n 
1  155  C   n 
1  156  G   n 
1  157  A   n 
1  158  G   n 
1  159  A   n 
1  160  A   n 
1  161  C   n 
1  162  U   n 
1  163  G   n 
1  164  A   n 
1  165  A   n 
1  166  A   n 
1  167  C   n 
1  168  A   n 
1  169  U   n 
1  170  C   n 
1  171  U   n 
1  172  C   n 
1  173  A   n 
1  174  G   n 
1  175  U   n 
1  176  A   n 
1  177  U   n 
1  178  C   n 
1  179  G   n 
1  180  G   n 
1  181  G   n 
1  182  A   n 
1  183  G   n 
1  184  G   n 
1  185  A   n 
1  186  A   n 
1  187  C   n 
1  188  A   n 
1  189  G   n 
1  190  A   n 
1  191  A   n 
1  192  A   n 
1  193  A   n 
1  194  C   n 
1  195  G   n 
1  196  C   n 
1  197  A   n 
1  198  A   n 
1  199  U   n 
1  200  G   n 
1  201  U   n 
1  202  G   n 
1  203  A   n 
1  204  U   n 
1  205  G   n 
1  206  U   n 
1  207  C   n 
1  208  G   n 
1  209  U   n 
1  210  U   n 
1  211  A   n 
1  212  G   n 
1  213  U   n 
1  214  A   n 
1  215  A   n 
1  216  C   n 
1  217  C   n 
1  218  G   n 
1  219  C   n 
1  220  G   n 
1  221  A   n 
1  222  G   n 
1  223  U   n 
1  224  G   n 
1  225  A   n 
1  226  A   n 
1  227  C   n 
1  228  G   n 
1  229  C   n 
1  230  G   n 
1  231  A   n 
1  232  U   n 
1  233  A   n 
1  234  C   n 
1  235  A   n 
1  236  G   n 
1  237  C   n 
1  238  C   n 
1  239  C   n 
1  240  A   n 
1  241  A   n 
1  242  A   n 
1  243  C   n 
1  244  C   n 
1  245  G   n 
1  246  A   n 
1  247  A   n 
1  248  G   n 
1  249  C   n 
1  250  C   n 
1  251  C   n 
1  252  U   n 
1  253  C   n 
1  254  A   n 
1  255  C   n 
1  256  G   n 
1  257  G   n 
1  258  G   n 
1  259  C   n 
1  260  A   n 
1  261  A   n 
1  262  U   n 
1  263  G   n 
1  264  U   n 
1  265  G   n 
1  266  G   n 
1  267  U   n 
1  268  G   n 
1  269  U   n 
1  270  C   n 
1  271  A   n 
1  272  G   n 
1  273  G   n 
1  274  G   n 
1  275  C   n 
1  276  U   n 
1  277  A   n 
1  278  C   n 
1  279  C   n 
1  280  U   n 
1  281  C   n 
1  282  U   n 
1  283  C   n 
1  284  A   n 
1  285  U   n 
1  286  C   n 
1  287  A   n 
1  288  G   n 
1  289  C   n 
1  290  C   n 
1  291  G   n 
1  292  A   n 
1  293  C   n 
1  294  C   n 
1  295  G   n 
1  296  U   n 
1  297  C   n 
1  298  U   n 
1  299  C   n 
1  300  G   n 
1  301  A   n 
1  302  C   n 
1  303  G   n 
1  304  A   n 
1  305  A   n 
1  306  G   n 
1  307  U   n 
1  308  C   n 
1  309  U   n 
1  310  C   n 
1  311  U   n 
1  312  U   n 
1  313  G   n 
1  314  G   n 
1  315  A   n 
1  316  A   n 
1  317  C   n 
1  318  A   n 
1  319  G   n 
1  320  A   n 
1  321  G   n 
1  322  C   n 
1  323  G   n 
1  324  U   n 
1  325  G   n 
1  326  A   n 
1  327  U   n 
1  328  A   n 
1  329  C   n 
1  330  A   n 
1  331  G   n 
1  332  G   n 
1  333  G   n 
1  334  U   n 
1  335  G   n 
1  336  A   n 
1  337  C   n 
1  338  A   n 
1  339  A   n 
1  340  C   n 
1  341  C   n 
1  342  C   n 
1  343  C   n 
1  344  G   n 
1  345  U   n 
1  346  A   n 
1  347  C   n 
1  348  U   n 
1  349  C   n 
1  350  G   n 
1  351  A   n 
1  352  G   n 
1  353  A   n 
1  354  C   n 
1  355  C   n 
1  356  A   n 
1  357  G   n 
1  358  U   n 
1  359  A   n 
1  360  C   n 
1  361  G   n 
1  362  A   n 
1  363  C   n 
1  364  G   n 
1  365  U   n 
1  366  G   n 
1  367  C   n 
1  368  G   n 
1  369  G   n 
1  370  U   n 
1  371  A   n 
1  372  G   n 
1  373  U   n 
1  374  G   n 
1  375  C   n 
1  376  C   n 
1  377  A   n 
1  378  G   n 
1  379  A   n 
1  380  G   n 
1  381  U   n 
1  382  A   n 
1  383  G   n 
1  384  C   n 
1  385  G   n 
1  386  G   n 
1  387  G   n 
1  388  G   n 
1  389  G   n 
1  390  U   n 
1  391  U   n 
1  392  G   n 
1  393  G   n 
1  394  A   n 
1  395  U   n 
1  396  A   n 
1  397  U   n 
1  398  C   n 
1  399  C   n 
1  400  C   n 
1  401  U   n 
1  402  C   n 
1  403  G   n 
1  404  C   n 
1  405  G   n 
1  406  A   n 
1  407  A   n 
1  408  U   n 
1  409  A   n 
1  410  A   n 
1  411  C   n 
1  412  G   n 
1  413  C   n 
1  414  A   n 
1  415  G   n 
1  416  G   n 
1  417  C   n 
1  418  A   n 
1  419  U   n 
1  420  C   n 
1  421  G   n 
1  422  A   n 
1  423  C   n 
1  424  U   n 
1  425  G   n 
1  426  C   n 
1  427  G   n 
1  428  A   n 
1  429  A   n 
1  430  G   n 
1  431  G   n 
1  432  C   n 
1  433  U   n 
1  434  A   n 
1  435  A   n 
1  436  A   n 
1  437  C   n 
1  438  A   n 
1  439  C   n 
1  440  A   n 
1  441  A   n 
1  442  C   n 
1  443  C   n 
1  444  U   n 
1  445  G   n 
1  446  A   n 
1  447  G   n 
1  448  A   n 
1  449  C   n 
1  450  C   n 
1  451  G   n 
1  452  A   n 
1  453  U   n 
1  454  A   n 
1  455  G   n 
1  456  U   n 
1  457  G   n 
1  458  A   n 
1  459  A   n 
1  460  C   n 
1  461  A   n 
1  462  A   n 
1  463  G   n 
1  464  U   n 
1  465  A   n 
1  466  G   n 
1  467  U   n 
1  468  G   n 
1  469  U   n 
1  470  G   n 
1  471  A   n 
1  472  A   n 
1  473  C   n 
1  474  G   n 
1  475  A   n 
1  476  A   n 
1  477  C   n 
1  478  G   n 
1  479  C   n 
1  480  U   n 
1  481  G   n 
1  482  C   n 
1  483  A   n 
1  484  A   n 
1  485  A   n 
1  486  G   n 
1  487  U   n 
1  488  A   n 
1  489  C   n 
1  490  C   n 
1  491  C   n 
1  492  U   n 
1  493  C   n 
1  494  A   n 
1  495  G   n 
1  496  A   n 
1  497  A   n 
1  498  G   n 
1  499  G   n 
1  500  G   n 
1  501  A   n 
1  502  G   n 
1  503  G   n 
1  504  C   n 
1  505  G   n 
1  506  A   n 
1  507  A   n 
1  508  A   n 
1  509  U   n 
1  510  A   n 
1  511  G   n 
1  512  A   n 
1  513  G   n 
1  514  C   n 
1  515  A   n 
1  516  U   n 
1  517  G   n 
1  518  A   n 
1  519  A   n 
1  520  A   n 
1  521  U   n 
1  522  C   n 
1  523  A   n 
1  524  G   n 
1  525  U   n 
1  526  U   n 
1  527  G   n 
1  528  G   n 
1  529  C   n 
1  530  G   n 
1  531  A   n 
1  532  U   n 
1  533  C   n 
1  534  G   n 
1  535  A   n 
1  536  G   n 
1  537  C   n 
1  538  G   n 
1  539  A   n 
1  540  C   n 
1  541  A   n 
1  542  G   n 
1  543  G   n 
1  544  G   n 
1  545  C   n 
1  546  A   n 
1  547  U   n 
1  548  A   n 
1  549  C   n 
1  550  A   n 
1  551  A   n 
1  552  G   n 
1  553  G   n 
1  554  U   n 
1  555  C   n 
1  556  C   n 
1  557  C   n 
1  558  U   n 
1  559  C   n 
1  560  G   n 
1  561  A   n 
1  562  C   n 
1  563  G   n 
1  564  A   n 
1  565  A   n 
1  566  U   n 
1  567  G   n 
1  568  A   n 
1  569  C   n 
1  570  C   n 
1  571  G   n 
1  572  A   n 
1  573  C   n 
1  574  G   n 
1  575  C   n 
1  576  G   n 
1  577  C   n 
1  578  G   n 
1  579  A   n 
1  580  G   n 
1  581  C   n 
1  582  G   n 
1  583  U   n 
1  584  C   n 
1  585  C   n 
1  586  A   n 
1  587  G   n 
1  588  U   n 
1  589  A   n 
1  590  A   n 
1  591  G   n 
1  592  A   n 
1  593  C   n 
1  594  U   n 
1  595  C   n 
1  596  A   n 
1  597  C   n 
1  598  G   n 
1  599  G   n 
1  600  G   n 
1  601  A   n 
1  602  A   n 
1  603  G   n 
1  604  C   n 
1  605  C   n 
1  606  G   n 
1  607  A   n 
1  608  U   n 
1  609  G   n 
1  610  U   n 
1  611  U   n 
1  612  C   n 
1  613  U   n 
1  614  G   n 
1  615  U   n 
1  616  C   n 
1  617  G   n 
1  618  U   n 
1  619  A   n 
1  620  C   n 
1  621  G   n 
1  622  U   n 
1  623  U   n 
1  624  U   n 
1  625  U   n 
1  626  G   n 
1  627  A   n 
1  628  A   n 
1  629  A   n 
1  630  A   n 
1  631  A   n 
1  632  C   n 
1  633  G   n 
1  634  A   n 
1  635  G   n 
1  636  C   n 
1  637  C   n 
1  638  A   n 
1  639  G   n 
1  640  G   n 
1  641  G   n 
1  642  A   n 
1  643  G   n 
1  644  U   n 
1  645  G   n 
1  646  U   n 
1  647  G   n 
1  648  U   n 
1  649  C   n 
1  650  U   n 
1  651  G   n 
1  652  C   n 
1  653  A   n 
1  654  U   n 
1  655  G   n 
1  656  G   n 
1  657  C   n 
1  658  A   n 
1  659  A   n 
1  660  G   n 
1  661  U   n 
1  662  C   n 
1  663  U   n 
1  664  A   n 
1  665  A   n 
1  666  C   n 
1  667  C   n 
1  668  G   n 
1  669  G   n 
1  670  A   n 
1  671  G   n 
1  672  U   n 
1  673  A   n 
1  674  U   n 
1  675  C   n 
1  676  C   n 
1  677  G   n 
1  678  G   n 
1  679  G   n 
1  680  G   n 
1  681  A   n 
1  682  G   n 
1  683  G   n 
1  684  C   n 
1  685  A   n 
1  686  C   n 
1  687  A   n 
1  688  G   n 
1  689  G   n 
1  690  G   n 
1  691  A   n 
1  692  A   n 
1  693  A   n 
1  694  C   n 
1  695  C   n 
1  696  G   n 
1  697  A   n 
1  698  C   n 
1  699  A   n 
1  700  U   n 
1  701  G   n 
1  702  G   n 
1  703  C   n 
1  704  C   n 
1  705  G   n 
1  706  C   n 
1  707  A   n 
1  708  G   n 
1  709  G   n 
1  710  G   n 
1  711  C   n 
1  712  U   n 
1  713  U   n 
1  714  U   n 
1  715  G   n 
1  716  C   n 
1  717  C   n 
1  718  C   n 
1  719  G   n 
1  720  A   n 
1  721  G   n 
1  722  G   n 
1  723  G   n 
1  724  C   n 
1  725  C   n 
1  726  G   n 
1  727  C   n 
1  728  C   n 
1  729  G   n 
1  730  U   n 
1  731  C   n 
1  732  U   n 
1  733  U   n 
1  734  C   n 
1  735  A   n 
1  736  A   n 
1  737  G   n 
1  738  G   n 
1  739  G   n 
1  740  C   n 
1  741  G   n 
1  742  G   n 
1  743  G   n 
1  744  G   n 
1  745  A   n 
1  746  G   n 
1  747  C   n 
1  748  C   n 
1  749  A   n 
1  750  U   n 
1  751  G   n 
1  752  U   n 
1  753  G   n 
1  754  G   n 
1  755  A   n 
1  756  C   n 
1  757  A   n 
1  758  C   n 
1  759  G   n 
1  760  A   n 
1  761  C   n 
1  762  C   n 
1  763  C   n 
1  764  G   n 
1  765  A   n 
1  766  A   n 
1  767  U   n 
1  768  C   n 
1  769  C   n 
1  770  G   n 
1  771  G   n 
1  772  A   n 
1  773  C   n 
1  774  G   n 
1  775  A   n 
1  776  U   n 
1  777  C   n 
1  778  U   n 
1  779  A   n 
1  780  C   n 
1  781  G   n 
1  782  C   n 
1  783  A   n 
1  784  U   n 
1  785  G   n 
1  786  G   n 
1  787  A   n 
1  788  C   n 
1  789  A   n 
1  790  A   n 
1  791  G   n 
1  792  A   n 
1  793  U   n 
1  794  G   n 
1  795  A   n 
1  796  A   n 
1  797  G   n 
1  798  C   n 
1  799  G   n 
1  800  U   n 
1  801  G   n 
1  802  C   n 
1  803  C   n 
1  804  G   n 
1  805  A   n 
1  806  A   n 
1  807  A   n 
1  808  G   n 
1  809  G   n 
1  810  C   n 
1  811  A   n 
1  812  C   n 
1  813  G   n 
1  814  U   n 
1  815  G   n 
1  816  G   n 
1  817  A   n 
1  818  A   n 
1  819  G   n 
1  820  U   n 
1  821  C   n 
1  822  U   n 
1  823  G   n 
1  824  U   n 
1  825  U   n 
1  826  A   n 
1  827  G   n 
1  828  A   n 
1  829  G   n 
1  830  U   n 
1  831  U   n 
1  832  G   n 
1  833  G   n 
1  834  U   n 
1  835  G   n 
1  836  U   n 
1  837  C   n 
1  838  C   n 
1  839  U   n 
1  840  A   n 
1  841  C   n 
1  842  A   n 
1  843  A   n 
1  844  U   n 
1  845  A   n 
1  846  C   n 
1  847  C   n 
1  848  C   n 
1  849  U   n 
1  850  C   n 
1  851  U   n 
1  852  C   n 
1  853  G   n 
1  854  U   n 
1  855  G   n 
1  856  A   n 
1  857  U   n 
1  858  C   n 
1  859  U   n 
1  860  A   n 
1  861  U   n 
1  862  G   n 
1  863  U   n 
1  864  G   n 
1  865  U   n 
1  866  A   n 
1  867  G   n 
1  868  G   n 
1  869  G   n 
1  870  G   n 
1  871  U   n 
1  872  G   n 
1  873  A   n 
1  874  A   n 
1  875  A   n 
1  876  G   n 
1  877  G   n 
1  878  C   n 
1  879  C   n 
1  880  C   n 
1  881  A   n 
1  882  U   n 
1  883  C   n 
1  884  G   n 
1  885  A   n 
1  886  G   n 
1  887  U   n 
1  888  C   n 
1  889  C   n 
1  890  G   n 
1  891  G   n 
1  892  C   n 
1  893  A   n 
1  894  A   n 
1  895  C   n 
1  896  A   n 
1  897  G   n 
1  898  C   n 
1  899  U   n 
1  900  G   n 
1  901  G   n 
1  902  U   n 
1  903  U   n 
1  904  C   n 
1  905  C   n 
1  906  A   n 
1  907  A   n 
1  908  U   n 
1  909  C   n 
1  910  G   n 
1  911  A   n 
1  912  A   n 
1  913  A   n 
1  914  C   n 
1  915  A   n 
1  916  U   n 
1  917  G   n 
1  918  U   n 
1  919  C   n 
1  920  G   n 
1  921  A   n 
1  922  A   n 
1  923  G   n 
1  924  C   n 
1  925  A   n 
1  926  U   n 
1  927  G   n 
1  928  A   n 
1  929  C   n 
1  930  C   n 
1  931  U   n 
1  932  C   n 
1  933  C   n 
1  934  G   n 
1  935  C   n 
1  936  C   n 
1  937  G   n 
1  938  A   n 
1  939  G   n 
1  940  G   n 
1  941  U   n 
1  942  A   n 
1  943  G   n 
1  944  U   n 
1  945  C   n 
1  946  U   n 
1  947  G   n 
1  948  U   n 
1  949  G   n 
1  950  A   n 
1  951  G   n 
1  952  G   n 
1  953  U   n 
1  954  A   n 
1  955  G   n 
1  956  A   n 
1  957  G   n 
1  958  C   n 
1  959  G   n 
1  960  A   n 
1  961  C   n 
1  962  C   n 
1  963  G   n 
1  964  A   n 
1  965  U   n 
1  966  U   n 
1  967  G   n 
1  968  G   n 
1  969  U   n 
1  970  G   n 
1  971  U   n 
1  972  G   n 
1  973  U   n 
1  974  C   n 
1  975  C   n 
1  976  G   n 
1  977  C   n 
1  978  C   n 
1  979  U   n 
1  980  C   n 
1  981  C   n 
1  982  G   n 
1  983  A   n 
1  984  G   n 
1  985  A   n 
1  986  G   n 
1  987  G   n 
1  988  A   n 
1  989  G   n 
1  990  U   n 
1  991  C   n 
1  992  G   n 
1  993  G   n 
1  994  C   n 
1  995  A   n 
1  996  C   n 
1  997  A   n 
1  998  C   n 
1  999  C   n 
1  1000 U   n 
1  1001 G   n 
1  1002 U   n 
1  1003 C   n 
1  1004 A   n 
1  1005 A   n 
1  1006 A   n 
1  1007 C   n 
1  1008 U   n 
1  1009 C   n 
1  1010 C   n 
1  1011 A   n 
1  1012 A   n 
1  1013 A   n 
1  1014 C   n 
1  1015 U   n 
1  1016 U   n 
1  1017 A   n 
1  1018 C   n 
1  1019 A   n 
1  1020 G   n 
1  1021 A   n 
1  1022 C   n 
1  1023 G   n 
1  1024 C   n 
1  1025 C   n 
1  1026 G   n 
1  1027 U   n 
1  1028 U   n 
1  1029 U   n 
1  1030 G   n 
1  1031 A   n 
1  1032 C   n 
1  1033 G   n 
1  1034 C   n 
1  1035 G   n 
1  1036 G   n 
1  1037 G   n 
1  1038 G   n 
1  1039 A   n 
1  1040 U   n 
1  1041 U   n 
1  1042 C   n 
1  1043 C   n 
1  1044 G   n 
1  1045 G   n 
1  1046 U   n 
1  1047 G   n 
1  1048 C   n 
1  1049 G   n 
1  1050 C   n 
1  1051 G   n 
1  1052 G   n 
1  1053 G   n 
1  1054 G   n 
1  1055 U   n 
1  1056 A   n 
1  1057 A   n 
1  1058 G   n 
1  1059 C   n 
1  1060 C   n 
1  1061 U   n 
1  1062 G   n 
1  1063 U   n 
1  1064 G   n 
1  1065 U   n 
1  1066 A   n 
1  1067 C   n 
1  1068 C   n 
1  1069 A   n 
1  1070 G   n 
1  1071 G   n 
1  1072 A   n 
1  1073 G   n 
1  1074 G   n 
1  1075 G   n 
1  1076 G   n 
1  1077 A   n 
1  1078 A   n 
1  1079 C   n 
1  1080 A   n 
1  1081 A   n 
1  1082 C   n 
1  1083 C   n 
1  1084 C   n 
1  1085 A   n 
1  1086 G   n 
1  1087 A   n 
1  1088 G   n 
1  1089 A   n 
1  1090 U   n 
1  1091 A   n 
1  1092 G   n 
1  1093 G   n 
1  1094 U   n 
1  1095 U   n 
1  1096 A   n 
1  1097 A   n 
1  1098 G   n 
1  1099 G   n 
1  1100 U   n 
1  1101 C   n 
1  1102 C   n 
1  1103 C   n 
1  1104 C   n 
1  1105 A   n 
1  1106 A   n 
1  1107 G   n 
1  1108 U   n 
1  1109 G   n 
1  1110 U   n 
1  1111 G   n 
1  1112 G   n 
1  1113 A   n 
1  1114 U   n 
1  1115 U   n 
1  1116 A   n 
1  1117 A   n 
1  1118 G   n 
1  1119 U   n 
1  1120 G   n 
1  1121 U   n 
1  1122 A   n 
1  1123 A   n 
1  1124 U   n 
1  1125 C   n 
1  1126 C   n 
1  1127 U   n 
1  1128 C   n 
1  1129 U   n 
1  1130 G   n 
1  1131 A   n 
1  1132 A   n 
1  1133 G   n 
1  1134 G   n 
1  1135 U   n 
1  1136 G   n 
1  1137 G   n 
1  1138 U   n 
1  1139 C   n 
1  1140 U   n 
1  1141 C   n 
1  1142 G   n 
1  1143 A   n 
1  1144 G   n 
1  1145 C   n 
1  1146 C   n 
1  1147 C   n 
1  1148 U   n 
1  1149 A   n 
1  1150 G   n 
1  1151 A   n 
1  1152 C   n 
1  1153 A   n 
1  1154 G   n 
1  1155 C   n 
1  1156 C   n 
1  1157 G   n 
1  1158 G   n 
1  1159 G   n 
1  1160 A   n 
1  1161 G   n 
1  1162 G   n 
1  1163 U   n 
1  1164 G   n 
1  1165 A   n 
1  1166 G   n 
1  1167 C   n 
1  1168 U   n 
1  1169 U   n 
1  1170 A   n 
1  1171 G   n 
1  1172 A   n 
1  1173 A   n 
1  1174 G   n 
1  1175 C   n 
1  1176 A   n 
1  1177 G   n 
1  1178 C   n 
1  1179 U   n 
1  1180 A   n 
1  1181 C   n 
1  1182 C   n 
1  1183 C   n 
1  1184 U   n 
1  1185 C   n 
1  1186 U   n 
1  1187 A   n 
1  1188 A   n 
1  1189 G   n 
1  1190 A   n 
1  1191 A   n 
1  1192 A   n 
1  1193 A   n 
1  1194 G   n 
1  1195 C   n 
1  1196 G   n 
1  1197 U   n 
1  1198 A   n 
1  1199 A   n 
1  1200 C   n 
1  1201 A   n 
1  1202 G   n 
1  1203 C   n 
1  1204 U   n 
1  1205 U   n 
1  1206 A   n 
1  1207 C   n 
1  1208 C   n 
1  1209 G   n 
1  1210 G   n 
1  1211 C   n 
1  1212 C   n 
1  1213 G   n 
1  1214 A   n 
1  1215 G   n 
1  1216 G   n 
1  1217 U   n 
1  1218 U   n 
1  1219 U   n 
1  1220 G   n 
1  1221 A   n 
1  1222 G   n 
1  1223 G   n 
1  1224 C   n 
1  1225 G   n 
1  1226 C   n 
1  1227 C   n 
1  1228 C   n 
1  1229 A   n 
1  1230 A   n 
1  1231 A   n 
1  1232 A   n 
1  1233 U   n 
1  1234 G   n 
1  1235 A   n 
1  1236 U   n 
1  1237 C   n 
1  1238 G   n 
1  1239 G   n 
1  1240 G   n 
1  1241 A   n 
1  1242 C   n 
1  1243 U   n 
1  1244 C   n 
1  1245 A   n 
1  1246 A   n 
1  1247 A   n 
1  1248 U   n 
1  1249 C   n 
1  1250 C   n 
1  1251 A   n 
1  1252 C   n 
1  1253 C   n 
1  1254 A   n 
1  1255 C   n 
1  1256 C   n 
1  1257 G   n 
1  1258 A   n 
1  1259 G   n 
1  1260 A   n 
1  1261 C   n 
1  1262 C   n 
1  1263 U   n 
1  1264 G   n 
1  1265 U   n 
1  1266 C   n 
1  1267 C   n 
1  1268 G   n 
1  1269 U   n 
1  1270 A   n 
1  1271 C   n 
1  1272 C   n 
1  1273 A   n 
1  1274 C   n 
1  1275 U   n 
1  1276 C   n 
1  1277 A   n 
1  1278 U   n 
1  1279 A   n 
1  1280 C   n 
1  1281 U   n 
1  1282 G   n 
1  1283 G   n 
1  1284 U   n 
1  1285 A   n 
1  1286 A   n 
1  1287 U   n 
1  1288 C   n 
1  1289 G   n 
1  1290 A   n 
1  1291 G   n 
1  1292 U   n 
1  1293 A   n 
1  1294 G   n 
1  1295 A   n 
1  1296 U   n 
1  1297 U   n 
1  1298 G   n 
1  1299 G   n 
1  1300 C   n 
1  1301 G   n 
1  1302 C   n 
1  1303 U   n 
1  1304 C   n 
1  1305 U   n 
1  1306 A   n 
1  1307 A   n 
1  1308 U   n 
1  1309 U   n 
1  1310 G   n 
1  1311 G   n 
1  1312 A   n 
1  1313 U   n 
1  1314 G   n 
1  1315 G   n 
1  1316 A   n 
1  1317 A   n 
1  1318 G   n 
1  1319 U   n 
1  1320 A   n 
1  1321 G   n 
1  1322 G   n 
1  1323 G   n 
1  1324 G   n 
1  1325 U   n 
1  1326 G   n 
1  1327 A   n 
1  1328 A   n 
1  1329 A   n 
1  1330 A   n 
1  1331 C   n 
1  1332 U   n 
1  1333 C   n 
1  1334 C   n 
1  1335 U   n 
1  1336 A   n 
1  1337 U   n 
1  1338 G   n 
1  1339 G   n 
1  1340 A   n 
1  1341 C   n 
1  1342 C   n 
1  1343 G   n 
1  1344 A   n 
1  1345 U   n 
1  1346 U   n 
1  1347 A   n 
1  1348 G   n 
1  1349 U   n 
1  1350 G   n 
1  1351 A   n 
1  1352 C   n 
1  1353 G   n 
1  1354 A   n 
1  1355 A   n 
1  1356 A   n 
1  1357 A   n 
1  1358 U   n 
1  1359 C   n 
1  1360 C   n 
1  1361 U   n 
1  1362 G   n 
1  1363 G   n 
1  1364 C   n 
1  1365 C   n 
1  1366 A   n 
1  1367 U   n 
1  1368 A   n 
1  1369 G   n 
1  1370 U   n 
1  1371 A   n 
1  1372 G   n 
1  1373 C   n 
1  1374 A   n 
1  1375 G   n 
1  1376 C   n 
1  1377 G   n 
1  1378 A   n 
1  1379 U   n 
1  1380 A   n 
1  1381 G   n 
1  1382 U   n 
1  1383 C   n 
1  1384 G   n 
1  1385 G   n 
1  1386 G   n 
1  1387 U   n 
1  1388 G   n 
1  1389 A   n 
1  1390 G   n 
1  1391 A   n 
1  1392 A   n 
1  1393 C   n 
1  1394 C   n 
1  1395 C   n 
1  1396 C   n 
1  1397 G   n 
1  1398 A   n 
1  1399 C   n 
1  1400 G   n 
1  1401 G   n 
1  1402 C   n 
1  1403 C   n 
1  1404 U   n 
1  1405 A   n 
1  1406 A   n 
1  1407 U   n 
1  1408 G   n 
1  1409 G   n 
1  1410 A   n 
1  1411 U   n 
1  1412 A   n 
1  1413 A   n 
1  1414 G   n 
1  1415 G   n 
1  1416 G   n 
1  1417 U   n 
1  1418 U   n 
1  1419 C   n 
1  1420 C   n 
1  1421 U   n 
1  1422 C   n 
1  1423 A   n 
1  1424 G   n 
1  1425 C   n 
1  1426 A   n 
1  1427 C   n 
1  1428 U   n 
1  1429 G   n 
1  1430 C   n 
1  1431 U   n 
1  1432 G   n 
1  1433 A   n 
1  1434 U   n 
1  1435 C   n 
1  1436 A   n 
1  1437 G   n 
1  1438 C   n 
1  1439 U   n 
1  1440 G   n 
1  1441 A   n 
1  1442 G   n 
1  1443 G   n 
1  1444 G   n 
1  1445 U   n 
1  1446 U   n 
1  1447 A   n 
1  1448 G   n 
1  1449 C   n 
1  1450 C   n 
1  1451 G   n 
1  1452 G   n 
1  1453 U   n 
1  1454 C   n 
1  1455 C   n 
1  1456 U   n 
1  1457 A   n 
1  1458 A   n 
1  1459 G   n 
1  1460 U   n 
1  1461 C   n 
1  1462 A   n 
1  1463 U   n 
1  1464 A   n 
1  1465 C   n 
1  1466 C   n 
1  1467 G   n 
1  1468 C   n 
1  1469 A   n 
1  1470 A   n 
1  1471 C   n 
1  1472 U   n 
1  1473 C   n 
1  1474 G   n 
1  1475 A   n 
1  1476 C   n 
1  1477 U   n 
1  1478 A   n 
1  1479 U   n 
1  1480 G   n 
1  1481 A   n 
1  1482 C   n 
1  1483 G   n 
1  1484 A   n 
1  1485 A   n 
1  1486 A   n 
1  1487 U   n 
1  1488 G   n 
1  1489 G   n 
1  1490 G   n 
1  1491 A   n 
1  1492 A   n 
1  1493 A   n 
1  1494 C   n 
1  1495 G   n 
1  1496 G   n 
1  1497 G   n 
1  1498 U   n 
1  1499 U   n 
1  1500 A   n 
1  1501 A   n 
1  1502 U   n 
1  1503 A   n 
1  1504 U   n 
1  1505 U   n 
1  1506 C   n 
1  1507 C   n 
1  1508 C   n 
1  1509 G   n 
1  1510 U   n 
1  1511 G   n 
1  1512 C   n 
1  1513 C   n 
1  1514 A   n 
1  1515 C   n 
1  1516 U   n 
1  1517 A   n 
1  1518 U   n 
1  1519 G   n 
1  1520 C   n 
1  1521 A   n 
1  1522 G   n 
1  1523 U   n 
1  1524 G   n 
1  1525 A   n 
1  1526 A   n 
1  1527 A   n 
1  1528 G   n 
1  1529 U   n 
1  1530 U   n 
1  1531 G   n 
1  1532 A   n 
1  1533 C   n 
1  1534 G   n 
1  1535 C   n 
1  1536 C   n 
1  1537 C   n 
1  1538 U   n 
1  1539 G   n 
1  1540 G   n 
1  1541 G   n 
1  1542 G   n 
1  1543 U   n 
1  1544 C   n 
1  1545 G   n 
1  1546 A   n 
1  1547 U   n 
1  1548 C   n 
1  1549 A   n 
1  1550 C   n 
1  1551 G   n 
1  1552 C   n 
1  1553 U   n 
1  1554 G   n 
1  1555 G   n 
1  1556 G   n 
1  1557 C   n 
1  1558 A   n 
1  1559 U   n 
1  1560 U   n 
1  1561 C   n 
1  1562 G   n 
1  1563 C   n 
1  1564 C   n 
1  1565 C   n 
1  1566 A   n 
1  1567 G   n 
1  1568 U   n 
1  1569 C   n 
1  1570 G   n 
1  1571 A   n 
1  1572 A   n 
1  1573 C   n 
1  1574 C   n 
1  1575 G   n 
1  1576 U   n 
1  1577 C   n 
1  1578 C   n 
1  1579 A   n 
1  1580 A   n 
1  1581 C   n 
1  1582 U   n 
1  1583 C   n 
1  1584 C   n 
1  1585 G   n 
1  1586 U   n 
1  1587 G   n 
1  1588 G   n 
1  1589 A   n 
1  1590 A   n 
1  1591 G   n 
1  1592 C   n 
1  1593 C   n 
1  1594 G   n 
1  1595 U   n 
1  1596 A   n 
1  1597 A   n 
1  1598 U   n 
1  1599 G   n 
1  1600 G   n 
1  1601 C   n 
1  1602 A   n 
1  1603 G   n 
1  1604 G   n 
1  1605 A   n 
1  1606 A   n 
1  1607 G   n 
1  1608 C   n 
1  1609 G   n 
1  1610 G   n 
1  1611 A   n 
1  1612 C   n 
1  1613 G   n 
1  1614 A   n 
1  1615 A   n 
1  1616 C   n 
1  1617 G   n 
1  1618 G   n 
1  1619 C   n 
1  1620 G   n 
1  1621 G   n 
1  1622 C   n 
1  1623 A   n 
1  1624 U   n 
1  1625 A   n 
1  1626 G   n 
1  1627 G   n 
1  1628 G   n 
1  1629 A   n 
1  1630 A   n 
1  1631 A   n 
1  1632 C   n 
1  1633 G   n 
1  1634 U   n 
1  1635 G   n 
1  1636 A   n 
1  1637 U   n 
1  1638 U   n 
1  1639 C   n 
1  1640 A   n 
1  1641 A   n 
1  1642 C   n 
1  1643 C   n 
1  1644 U   n 
1  1645 G   n 
1  1646 G   n 
1  1647 G   n 
1  1648 G   n 
1  1649 C   n 
1  1650 C   n 
1  1651 C   n 
1  1652 A   n 
1  1653 U   n 
1  1654 G   n 
1  1655 A   n 
1  1656 A   n 
1  1657 A   n 
1  1658 A   n 
1  1659 G   n 
1  1660 A   n 
1  1661 C   n 
1  1662 G   n 
1  1663 A   n 
1  1664 G   n 
1  1665 C   n 
1  1666 A   n 
1  1667 U   n 
1  1668 A   n 
1  1669 G   n 
1  1670 U   n 
1  1671 G   n 
1  1672 U   n 
1  1673 C   n 
1  1674 C   n 
1  1675 G   n 
1  1676 U   n 
1  1677 A   n 
1  1678 C   n 
1  1679 C   n 
1  1680 G   n 
1  1681 A   n 
1  1682 G   n 
1  1683 A   n 
1  1684 A   n 
1  1685 C   n 
1  1686 C   n 
1  1687 G   n 
1  1688 A   n 
1  1689 C   n 
1  1690 A   n 
1  1691 C   n 
1  1692 A   n 
1  1693 G   n 
1  1694 G   n 
1  1695 U   n 
1  1696 G   n 
1  1697 U   n 
1  1698 C   n 
1  1699 C   n 
1  1700 A   n 
1  1701 U   n 
1  1702 G   n 
1  1703 G   n 
1  1704 C   n 
1  1705 G   n 
1  1706 G   n 
1  1707 C   n 
1  1708 G   n 
1  1709 A   n 
1  1710 A   n 
1  1711 A   n 
1  1712 G   n 
1  1713 C   n 
1  1714 C   n 
1  1715 A   n 
1  1716 A   n 
1  1717 G   n 
1  1718 G   n 
1  1719 C   n 
1  1720 C   n 
1  1721 U   n 
1  1722 G   n 
1  1723 U   n 
1  1724 C   n 
1  1725 G   n 
1  1726 G   n 
1  1727 G   n 
1  1728 A   n 
1  1729 G   n 
1  1730 C   n 
1  1731 A   n 
1  1732 A   n 
1  1733 C   n 
1  1734 C   n 
1  1735 A   n 
1  1736 A   n 
1  1737 C   n 
1  1738 G   n 
1  1739 U   n 
1  1740 U   n 
1  1741 A   n 
1  1742 G   n 
1  1743 G   n 
1  1744 G   n 
1  1745 A   n 
1  1746 A   n 
1  1747 U   n 
1  1748 U   n 
1  1749 C   n 
1  1750 G   n 
1  1751 G   n 
1  1752 C   n 
1  1753 A   n 
1  1754 A   n 
1  1755 G   n 
1  1756 U   n 
1  1757 U   n 
1  1758 A   n 
1  1759 G   n 
1  1760 U   n 
1  1761 C   n 
1  1762 C   n 
1  1763 C   n 
1  1764 G   n 
1  1765 U   n 
1  1766 A   n 
1  1767 C   n 
1  1768 C   n 
1  1769 U   n 
1  1770 U   n 
1  1771 C   n 
1  1772 G   n 
1  1773 G   n 
1  1774 A   n 
1  1775 A   n 
1  1776 G   n 
1  1777 A   n 
1  1778 A   n 
1  1779 G   n 
1  1780 G   n 
1  1781 G   n 
1  1782 A   n 
1  1783 U   n 
1  1784 G   n 
1  1785 C   n 
1  1786 C   n 
1  1787 U   n 
1  1788 G   n 
1  1789 C   n 
1  1790 U   n 
1  1791 C   n 
1  1792 C   n 
1  1793 G   n 
1  1794 G   n 
1  1795 A   n 
1  1796 A   n 
1  1797 C   n 
1  1798 G   n 
1  1799 G   n 
1  1800 A   n 
1  1801 G   n 
1  1802 C   n 
1  1803 A   n 
1  1804 G   n 
1  1805 G   n 
1  1806 U   n 
1  1807 C   n 
1  1808 G   n 
1  1809 C   n 
1  1810 A   n 
1  1811 G   n 
1  1812 U   n 
1  1813 G   n 
1  1814 A   n 
1  1815 C   n 
1  1816 U   n 
1  1817 C   n 
1  1818 G   n 
1  1819 G   n 
1  1820 A   n 
1  1821 A   n 
1  1822 G   n 
1  1823 C   n 
1  1824 U   n 
1  1825 C   n 
1  1826 G   n 
1  1827 G   n 
1  1828 A   n 
1  1829 C   n 
1  1830 U   n 
1  1831 G   n 
1  1832 U   n 
1  1833 C   n 
1  1834 U   n 
1  1835 A   n 
1  1836 G   n 
1  1837 U   n 
1  1838 A   n 
1  1839 A   n 
1  1840 C   n 
1  1841 A   n 
1  1842 A   n 
1  1843 C   n 
1  1844 A   n 
1  1845 U   n 
1  1846 A   n 
1  1847 G   n 
1  1848 G   n 
1  1849 U   n 
1  1850 G   n 
1  1851 A   n 
1  1852 C   n 
1  1853 C   n 
1  1854 G   n 
1  1855 C   n 
1  1856 A   n 
1  1857 A   n 
1  1858 A   n 
1  1859 U   n 
1  1860 C   n 
1  1861 C   n 
1  1862 G   n 
1  1863 C   n 
1  1864 A   n 
1  1865 A   n 
1  1866 G   n 
1  1867 G   n 
1  1868 A   n 
1  1869 C   n 
1  1870 U   n 
1  1871 C   n 
1  1872 G   n 
1  1873 U   n 
1  1874 A   n 
1  1875 C   n 
1  1876 G   n 
1  1877 G   n 
1  1878 U   n 
1  1879 C   n 
1  1880 A   n 
1  1881 C   n 
1  1882 U   n 
1  1883 G   n 
1  1884 A   n 
1  1885 A   n 
1  1886 U   n 
1  1887 C   n 
1  1888 C   n 
1  1889 U   n 
1  1890 G   n 
1  1891 C   n 
1  1892 C   n 
1  1893 C   n 
1  1894 A   n 
1  1895 G   n 
1  1896 U   n 
1  1897 G   n 
1  1898 C   n 
1  1899 A   n 
1  1900 G   n 
1  1901 G   n 
1  1902 U   n 
1  1903 A   n 
1  1904 U   n 
1  1905 C   n 
1  1906 U   n 
1  1907 G   n 
1  1908 A   n 
1  1909 A   n 
1  1910 C   n 
1  1911 A   n 
1  1912 C   n 
1  1913 C   n 
1  1914 U   n 
1  1915 C   n 
1  1916 G   n 
1  1917 U   n 
1  1918 A   n 
1  1919 C   n 
1  1920 A   n 
1  1921 A   n 
1  1922 G   n 
1  1923 A   n 
1  1924 G   n 
1  1925 G   n 
1  1926 A   n 
1  1927 C   n 
1  1928 G   n 
1  1929 A   n 
1  1930 A   n 
1  1931 G   n 
1  1932 G   n 
1  1933 A   n 
1  1934 C   n 
1  1935 C   n 
1  1936 U   n 
1  1937 G   n 
1  1938 U   n 
1  1939 C   n 
1  1940 A   n 
1  1941 A   n 
1  1942 C   n 
1  1943 G   n 
1  1944 G   n 
1  1945 C   n 
1  1946 G   n 
1  1947 G   n 
1  1948 G   n 
1  1949 G   n 
1  1950 G   n 
1  1951 U   n 
1  1952 A   n 
1  1953 A   n 
1  1954 C   n 
1  1955 U   n 
1  1956 A   n 
1  1957 U   n 
1  1958 G   n 
1  1959 A   n 
1  1960 C   n 
1  1961 C   n 
1  1962 C   n 
1  1963 U   n 
1  1964 C   n 
1  1965 U   n 
1  1966 U   n 
1  1967 A   n 
1  1968 A   n 
1  1969 G   n 
1  1970 G   n 
1  1971 U   n 
1  1972 A   n 
1  1973 G   n 
1  1974 C   n 
1  1975 G   n 
1  1976 U   n 
1  1977 A   n 
1  1978 G   n 
1  1979 U   n 
1  1980 A   n 
1  1981 C   n 
1  1982 C   n 
1  1983 U   n 
1  1984 U   n 
1  1985 G   n 
1  1986 C   n 
1  1987 C   n 
1  1988 G   n 
1  1989 C   n 
1  1990 A   n 
1  1991 U   n 
1  1992 C   n 
1  1993 A   n 
1  1994 G   n 
1  1995 U   n 
1  1996 A   n 
1  1997 G   n 
1  1998 C   n 
1  1999 G   n 
1  2000 G   n 
1  2001 C   n 
1  2002 U   n 
1  2003 U   n 
1  2004 G   n 
1  2005 C   n 
1  2006 A   n 
1  2007 U   n 
1  2008 G   n 
1  2009 A   n 
1  2010 A   n 
1  2011 U   n 
1  2012 G   n 
1  2013 G   n 
1  2014 A   n 
1  2015 U   n 
1  2016 U   n 
1  2017 A   n 
1  2018 A   n 
1  2019 C   n 
1  2020 C   n 
1  2021 A   n 
1  2022 G   n 
1  2023 A   n 
1  2024 G   n 
1  2025 C   n 
1  2026 U   n 
1  2027 U   n 
1  2028 C   n 
1  2029 A   n 
1  2030 C   n 
1  2031 U   n 
1  2032 G   n 
1  2033 U   n 
1  2034 C   n 
1  2035 C   n 
1  2036 C   n 
1  2037 A   n 
1  2038 A   n 
1  2039 C   n 
1  2040 G   n 
1  2041 U   n 
1  2042 U   n 
1  2043 G   n 
1  2044 G   n 
1  2045 G   n 
1  2046 C   n 
1  2047 C   n 
1  2048 C   n 
1  2049 G   n 
1  2050 G   n 
1  2051 U   n 
1  2052 G   n 
1  2053 A   n 
1  2054 A   n 
1  2055 C   n 
1  2056 U   n 
1  2057 G   n 
1  2058 U   n 
1  2059 A   n 
1  2060 C   n 
1  2061 A   n 
1  2062 U   n 
1  2063 U   n 
1  2064 C   n 
1  2065 C   n 
1  2066 A   n 
1  2067 G   n 
1  2068 U   n 
1  2069 G   n 
1  2070 C   n 
1  2071 G   n 
1  2072 G   n 
1  2073 A   n 
1  2074 G   n 
1  2075 U   n 
1  2076 C   n 
1  2077 U   n 
1  2078 G   n 
1  2079 G   n 
1  2080 A   n 
1  2081 G   n 
1  2082 A   n 
1  2083 C   n 
1  2084 A   n 
1  2085 C   n 
1  2086 C   n 
1  2087 C   n 
1  2088 A   n 
1  2089 G   n 
1  2090 G   n 
1  2091 G   n 
1  2092 G   n 
1  2093 G   n 
1  2094 A   n 
1  2095 A   n 
1  2096 G   n 
1  2097 C   n 
1  2098 G   n 
1  2099 A   n 
1  2100 A   n 
1  2101 G   n 
1  2102 A   n 
1  2103 C   n 
1  2104 C   n 
1  2105 C   n 
1  2106 U   n 
1  2107 A   n 
1  2108 U   n 
1  2109 G   n 
1  2110 G   n 
1  2111 A   n 
1  2112 G   n 
1  2113 C   n 
1  2114 U   n 
1  2115 U   n 
1  2116 U   n 
1  2117 A   n 
1  2118 C   n 
1  2119 U   n 
1  2120 G   n 
1  2121 C   n 
1  2122 A   n 
1  2123 G   n 
1  2124 G   n 
1  2125 C   n 
1  2126 U   n 
1  2127 G   n 
1  2128 U   n 
1  2129 C   n 
1  2130 G   n 
1  2131 C   n 
1  2132 U   n 
1  2133 G   n 
1  2134 A   n 
1  2135 G   n 
1  2136 A   n 
1  2137 C   n 
1  2138 G   n 
1  2139 U   n 
1  2140 G   n 
1  2141 G   n 
1  2142 U   n 
1  2143 C   n 
1  2144 G   n 
1  2145 C   n 
1  2146 C   n 
1  2147 G   n 
1  2148 A   n 
1  2149 U   n 
1  2150 G   n 
1  2151 U   n 
1  2152 G   n 
1  2153 C   n 
1  2154 A   n 
1  2155 G   n 
1  2156 C   n 
1  2157 A   n 
1  2158 U   n 
1  2159 A   n 
1  2160 G   n 
1  2161 G   n 
1  2162 U   n 
1  2163 A   n 
1  2164 G   n 
1  2165 G   n 
1  2166 A   n 
1  2167 G   n 
1  2168 A   n 
1  2169 C   n 
1  2170 A   n 
1  2171 C   n 
1  2172 U   n 
1  2173 A   n 
1  2174 C   n 
1  2175 A   n 
1  2176 C   n 
1  2177 A   n 
1  2178 G   n 
1  2179 G   n 
1  2180 U   n 
1  2181 A   n 
1  2182 C   n 
1  2183 C   n 
1  2184 C   n 
1  2185 G   n 
1  2186 C   n 
1  2187 G   n 
1  2188 C   n 
1  2189 U   n 
1  2190 A   n 
1  2191 G   n 
1  2192 C   n 
1  2193 G   n 
1  2194 G   n 
1  2195 G   n 
1  2196 C   n 
1  2197 C   n 
1  2198 A   n 
1  2199 C   n 
1  2200 C   n 
1  2201 G   n 
1  2202 A   n 
1  2203 G   n 
1  2204 U   n 
1  2205 C   n 
1  2206 A   n 
1  2207 A   n 
1  2208 C   n 
1  2209 A   n 
1  2210 G   n 
1  2211 U   n 
1  2212 G   n 
1  2213 A   n 
1  2214 A   n 
1  2215 A   n 
1  2216 U   n 
1  2217 A   n 
1  2218 C   n 
1  2219 U   n 
1  2220 A   n 
1  2221 C   n 
1  2222 C   n 
1  2223 C   n 
1  2224 G   n 
1  2225 U   n 
1  2226 C   n 
1  2227 G   n 
1  2228 G   n 
1  2229 U   n 
1  2230 G   n 
1  2231 A   n 
1  2232 C   n 
1  2233 U   n 
1  2234 G   n 
1  2235 C   n 
1  2236 G   n 
1  2237 A   n 
1  2238 C   n 
1  2239 U   n 
1  2240 C   n 
1  2241 U   n 
1  2242 C   n 
1  2243 A   n 
1  2244 C   n 
1  2245 U   n 
1  2246 C   n 
1  2247 C   n 
1  2248 G   n 
1  2249 G   n 
1  2250 G   n 
1  2251 A   n 
1  2252 G   n 
1  2253 G   n 
1  2254 A   n 
1  2255 G   n 
1  2256 G   n 
1  2257 A   n 
1  2258 C   n 
1  2259 A   n 
1  2260 C   n 
1  2261 C   n 
1  2262 G   n 
1  2263 A   n 
1  2264 U   n 
1  2265 A   n 
1  2266 G   n 
1  2267 C   n 
1  2268 C   n 
1  2269 G   n 
1  2270 G   n 
1  2271 G   n 
1  2272 C   n 
1  2273 A   n 
1  2274 G   n 
1  2275 U   n 
1  2276 U   n 
1  2277 U   n 
1  2278 G   n 
1  2279 A   n 
1  2280 C   n 
1  2281 U   n 
1  2282 G   n 
1  2283 G   n 
1  2284 G   n 
1  2285 G   n 
1  2286 C   n 
1  2287 G   n 
1  2288 G   n 
1  2289 U   n 
1  2290 A   n 
1  2291 C   n 
1  2292 G   n 
1  2293 C   n 
1  2294 G   n 
1  2295 C   n 
1  2296 U   n 
1  2297 C   n 
1  2298 G   n 
1  2299 A   n 
1  2300 A   n 
1  2301 A   n 
1  2302 A   n 
1  2303 G   n 
1  2304 A   n 
1  2305 U   n 
1  2306 A   n 
1  2307 U   n 
1  2308 C   n 
1  2309 G   n 
1  2310 A   n 
1  2311 G   n 
1  2312 C   n 
1  2313 G   n 
1  2314 C   n 
1  2315 G   n 
1  2316 C   n 
1  2317 C   n 
1  2318 C   n 
1  2319 U   n 
1  2320 A   n 
1  2321 U   n 
1  2322 G   n 
1  2323 G   n 
1  2324 C   n 
1  2325 U   n 
1  2326 A   n 
1  2327 U   n 
1  2328 C   n 
1  2329 U   n 
1  2330 C   n 
1  2331 A   n 
1  2332 G   n 
1  2333 C   n 
1  2334 C   n 
1  2335 G   n 
1  2336 G   n 
1  2337 G   n 
1  2338 A   n 
1  2339 C   n 
1  2340 A   n 
1  2341 G   n 
1  2342 A   n 
1  2343 G   n 
1  2344 A   n 
1  2345 C   n 
1  2346 C   n 
1  2347 C   n 
1  2348 G   n 
1  2349 G   n 
1  2350 C   n 
1  2351 G   n 
1  2352 A   n 
1  2353 A   n 
1  2354 G   n 
1  2355 A   n 
1  2356 G   n 
1  2357 U   n 
1  2358 G   n 
1  2359 C   n 
1  2360 A   n 
1  2361 A   n 
1  2362 G   n 
1  2363 A   n 
1  2364 G   n 
1  2365 C   n 
1  2366 A   n 
1  2367 A   n 
1  2368 A   n 
1  2369 A   n 
1  2370 G   n 
1  2371 A   n 
1  2372 U   n 
1  2373 A   n 
1  2374 G   n 
1  2375 C   n 
1  2376 U   n 
1  2377 U   n 
1  2378 G   n 
1  2379 A   n 
1  2380 C   n 
1  2381 A   n 
1  2382 G   n 
1  2383 U   n 
1  2384 G   n 
1  2385 U   n 
1  2386 U   n 
1  2387 C   n 
1  2388 U   n 
1  2389 U   n 
1  2390 C   n 
1  2391 C   n 
1  2392 C   n 
1  2393 A   n 
1  2394 A   n 
1  2395 C   n 
1  2396 G   n 
1  2397 A   n 
1  2398 G   n 
1  2399 G   n 
1  2400 A   n 
1  2401 A   n 
1  2402 C   n 
1  2403 G   n 
1  2404 C   n 
1  2405 U   n 
1  2406 G   n 
1  2407 A   n 
1  2408 C   n 
1  2409 G   n 
1  2410 C   n 
1  2411 G   n 
1  2412 A   n 
1  2413 A   n 
1  2414 A   n 
1  2415 G   n 
1  2416 C   n 
1  2417 G   n 
1  2418 U   n 
1  2419 G   n 
1  2420 G   n 
1  2421 U   n 
1  2422 C   n 
1  2423 U   n 
1  2424 A   n 
1  2425 G   n 
1  2426 C   n 
1  2427 G   n 
1  2428 A   n 
1  2429 A   n 
1  2430 C   n 
1  2431 C   n 
1  2432 A   n 
1  2433 A   n 
1  2434 U   n 
1  2435 U   n 
1  2436 A   n 
1  2437 G   n 
1  2438 C   n 
1  2439 C   n 
1  2440 U   n 
1  2441 G   n 
1  2442 C   n 
1  2443 U   n 
1  2444 U   n 
1  2445 G   n 
1  2446 A   n 
1  2447 U   n 
1  2448 G   n 
1  2449 C   n 
1  2450 G   n 
1  2451 G   n 
1  2452 G   n 
1  2453 C   n 
1  2454 A   n 
1  2455 A   n 
1  2456 U   n 
1  2457 U   n 
1  2458 G   n 
1  2459 A   n 
1  2460 U   n 
1  2461 G   n 
1  2462 A   n 
1  2463 C   n 
1  2464 A   n 
1  2465 G   n 
1  2466 A   n 
1  2467 A   n 
1  2468 A   n 
1  2469 A   n 
1  2470 G   n 
1  2471 C   n 
1  2472 U   n 
1  2473 A   n 
1  2474 C   n 
1  2475 C   n 
1  2476 C   n 
1  2477 U   n 
1  2478 A   n 
1  2479 G   n 
1  2480 G   n 
1  2481 G   n 
1  2482 A   n 
1  2483 U   n 
1  2484 A   n 
1  2485 A   n 
1  2486 C   n 
1  2487 A   n 
1  2488 G   n 
1  2489 A   n 
1  2490 G   n 
1  2491 U   n 
1  2492 C   n 
1  2493 G   n 
1  2494 U   n 
1  2495 C   n 
1  2496 A   n 
1  2497 C   n 
1  2498 U   n 
1  2499 C   n 
1  2500 G   n 
1  2501 C   n 
1  2502 A   n 
1  2503 A   n 
1  2504 G   n 
1  2505 A   n 
1  2506 G   n 
1  2507 C   n 
1  2508 A   n 
1  2509 C   n 
1  2510 A   n 
1  2511 U   n 
1  2512 A   n 
1  2513 U   n 
1  2514 C   n 
1  2515 G   n 
1  2516 A   n 
1  2517 C   n 
1  2518 C   n 
1  2519 G   n 
1  2520 A   n 
1  2521 G   n 
1  2522 U   n 
1  2523 G   n 
1  2524 G   n 
1  2525 C   n 
1  2526 U   n 
1  2527 U   n 
1  2528 G   n 
1  2529 C   n 
1  2530 U   n 
1  2531 A   n 
1  2532 C   n 
1  2533 C   n 
1  2534 U   n 
1  2535 C   n 
1  2536 G   n 
1  2537 A   n 
1  2538 U   n 
1  2539 G   n 
1  2540 U   n 
1  2541 C   n 
1  2542 G   n 
1  2543 G   n 
1  2544 U   n 
1  2545 U   n 
1  2546 C   n 
1  2547 C   n 
1  2548 C   n 
1  2549 U   n 
1  2550 C   n 
1  2551 C   n 
1  2552 A   n 
1  2553 U   n 
1  2554 C   n 
1  2555 C   n 
1  2556 U   n 
1  2557 G   n 
1  2558 C   n 
1  2559 C   n 
1  2560 C   n 
1  2561 G   n 
1  2562 U   n 
1  2563 G   n 
1  2564 C   n 
1  2565 A   n 
1  2566 G   n 
1  2567 A   n 
1  2568 A   n 
1  2569 G   n 
1  2570 C   n 
1  2571 G   n 
1  2572 G   n 
1  2573 G   n 
1  2574 C   n 
1  2575 A   n 
1  2576 A   n 
1  2577 G   n 
1  2578 G   n 
1  2579 G   n 
1  2580 U   n 
1  2581 G   n 
1  2582 A   n 
1  2583 G   n 
1  2584 G   n 
1  2585 U   n 
1  2586 U   n 
1  2587 G   n 
1  2588 U   n 
1  2589 U   n 
1  2590 C   n 
1  2591 G   n 
1  2592 C   n 
1  2593 C   n 
1  2594 U   n 
1  2595 A   n 
1  2596 U   n 
1  2597 U   n 
1  2598 A   n 
1  2599 A   n 
1  2600 A   n 
1  2601 G   n 
1  2602 G   n 
1  2603 A   n 
1  2604 G   n 
1  2605 G   n 
1  2606 U   n 
1  2607 C   n 
1  2608 G   n 
1  2609 U   n 
1  2610 G   n 
1  2611 A   n 
1  2612 G   n 
1  2613 C   n 
1  2614 U   n 
1  2615 G   n 
1  2616 G   n 
1  2617 G   n 
1  2618 U   n 
1  2619 U   n 
1  2620 U   n 
1  2621 A   n 
1  2622 G   n 
1  2623 A   n 
1  2624 C   n 
1  2625 C   n 
1  2626 G   n 
1  2627 U   n 
1  2628 C   n 
1  2629 G   n 
1  2630 U   n 
1  2631 G   n 
1  2632 A   n 
1  2633 G   n 
1  2634 A   n 
1  2635 C   n 
1  2636 A   n 
1  2637 G   n 
1  2638 G   n 
1  2639 U   n 
1  2640 C   n 
1  2641 G   n 
1  2642 G   n 
1  2643 C   n 
1  2644 U   n 
1  2645 G   n 
1  2646 C   n 
1  2647 U   n 
1  2648 A   n 
1  2649 U   n 
1  2650 C   n 
1  2651 U   n 
1  2652 A   n 
1  2653 C   n 
1  2654 U   n 
1  2655 G   n 
1  2656 G   n 
1  2657 G   n 
1  2658 U   n 
1  2659 G   n 
1  2660 U   n 
1  2661 G   n 
1  2662 U   n 
1  2663 A   n 
1  2664 A   n 
1  2665 U   n 
1  2666 G   n 
1  2667 G   n 
1  2668 U   n 
1  2669 G   n 
1  2670 U   n 
1  2671 C   n 
1  2672 U   n 
1  2673 G   n 
1  2674 A   n 
1  2675 C   n 
1  2676 A   n 
1  2677 A   n 
1  2678 G   n 
1  2679 A   n 
1  2680 A   n 
1  2681 C   n 
1  2682 G   n 
1  2683 A   n 
1  2684 C   n 
1  2685 C   n 
1  2686 G   n 
1  2687 U   n 
1  2688 A   n 
1  2689 U   n 
1  2690 A   n 
1  2691 G   n 
1  2692 U   n 
1  2693 A   n 
1  2694 C   n 
1  2695 G   n 
1  2696 A   n 
1  2697 G   n 
1  2698 A   n 
1  2699 G   n 
1  2700 G   n 
1  2701 A   n 
1  2702 A   n 
1  2703 C   n 
1  2704 U   n 
1  2705 A   n 
1  2706 C   n 
1  2707 G   n 
1  2708 G   n 
1  2709 U   n 
1  2710 U   n 
1  2711 G   n 
1  2712 G   n 
1  2713 U   n 
1  2714 G   n 
1  2715 G   n 
1  2716 C   n 
1  2717 C   n 
1  2718 A   n 
1  2719 C   n 
1  2720 U   n 
1  2721 G   n 
1  2722 G   n 
1  2723 U   n 
1  2724 G   n 
1  2725 U   n 
1  2726 A   n 
1  2727 C   n 
1  2728 C   n 
1  2729 G   n 
1  2730 G   n 
1  2731 U   n 
1  2732 U   n 
1  2733 G   n 
1  2734 U   n 
1  2735 U   n 
1  2736 C   n 
1  2737 G   n 
1  2738 A   n 
1  2739 G   n 
1  2740 A   n 
1  2741 G   n 
1  2742 A   n 
1  2743 G   n 
1  2744 C   n 
1  2745 A   n 
1  2746 C   n 
1  2747 G   n 
1  2748 U   n 
1  2749 G   n 
1  2750 C   n 
1  2751 C   n 
1  2752 G   n 
1  2753 G   n 
1  2754 G   n 
1  2755 U   n 
1  2756 A   n 
1  2757 G   n 
1  2758 C   n 
1  2759 C   n 
1  2760 A   n 
1  2761 C   n 
1  2762 G   n 
1  2763 C   n 
1  2764 C   n 
1  2765 A   n 
1  2766 C   n 
1  2767 A   n 
1  2768 C   n 
1  2769 G   n 
1  2770 G   n 
1  2771 G   n 
1  2772 G   n 
1  2773 U   n 
1  2774 A   n 
1  2775 A   n 
1  2776 G   n 
1  2777 A   n 
1  2778 G   n 
1  2779 C   n 
1  2780 U   n 
1  2781 G   n 
1  2782 A   n 
1  2783 A   n 
1  2784 C   n 
1  2785 G   n 
1  2786 C   n 
1  2787 A   n 
1  2788 U   n 
1  2789 C   n 
1  2790 U   n 
1  2791 A   n 
1  2792 A   n 
1  2793 G   n 
1  2794 C   n 
1  2795 U   n 
1  2796 C   n 
1  2797 G   n 
1  2798 A   n 
1  2799 A   n 
1  2800 A   n 
1  2801 C   n 
1  2802 C   n 
1  2803 C   n 
1  2804 A   n 
1  2805 C   n 
1  2806 U   n 
1  2807 U   n 
1  2808 G   n 
1  2809 G   n 
1  2810 A   n 
1  2811 A   n 
1  2812 A   n 
1  2813 A   n 
1  2814 G   n 
1  2815 A   n 
1  2816 G   n 
1  2817 A   n 
1  2818 C   n 
1  2819 A   n 
1  2820 C   n 
1  2821 C   n 
1  2822 G   n 
1  2823 C   n 
1  2824 C   n 
1  2825 G   n 
1  2826 A   n 
1  2827 G   n 
1  2828 G   n 
1  2829 U   n 
1  2830 C   n 
1  2831 C   n 
1  2832 C   n 
1  2833 G   n 
1  2834 C   n 
1  2835 G   n 
1  2836 U   n 
1  2837 A   n 
1  2838 C   n 
1  2839 A   n 
1  2840 A   n 
1  2841 G   n 
1  2842 A   n 
1  2843 C   n 
1  2844 G   n 
1  2845 C   n 
1  2846 G   n 
1  2847 G   n 
1  2848 U   n 
1  2849 C   n 
1  2850 G   n 
1  2851 A   n 
1  2852 U   n 
1  2853 A   n 
1  2854 G   n 
1  2855 A   n 
1  2856 C   n 
1  2857 U   n 
1  2858 C   n 
1  2859 G   n 
1  2860 G   n 
1  2861 G   n 
1  2862 G   n 
1  2863 U   n 
1  2864 G   n 
1  2865 U   n 
1  2866 G   n 
1  2867 C   n 
1  2868 G   n 
1  2869 C   n 
1  2870 G   n 
1  2871 U   n 
1  2872 C   n 
1  2873 G   n 
1  2874 A   n 
1  2875 G   n 
1  2876 G   n 
1  2877 U   n 
1  2878 A   n 
1  2879 A   n 
1  2880 C   n 
1  2881 G   n 
1  2882 A   n 
1  2883 G   n 
1  2884 A   n 
1  2885 C   n 
1  2886 G   n 
1  2887 U   n 
1  2888 U   n 
1  2889 A   n 
1  2890 A   n 
1  2891 G   n 
1  2892 C   n 
1  2893 C   n 
1  2894 C   n 
1  2895 A   n 
1  2896 C   n 
1  2897 G   n 
1  2898 A   n 
1  2899 G   n 
1  2900 C   n 
1  2901 A   n 
1  2902 C   n 
1  2903 U   n 
1  2904 A   n 
1  2905 A   n 
1  2906 C   n 
1  2907 A   n 
1  2908 G   n 
1  2909 A   n 
1  2910 C   n 
1  2911 C   n 
1  2912 A   n 
1  2913 A   n 
1  2914 A   n 
1  2915 G   n 
1  2916 C   n 
1  2917 C   n 
1  2918 A   n 
1  2919 U   n 
1  2920 C   n 
1  2921 A   n 
1  2922 U   n 
2  1    U   n 
2  2    U   n 
2  3    A   n 
2  4    G   n 
2  5    G   n 
2  6    C   n 
2  7    G   n 
2  8    G   n 
2  9    C   n 
2  10   C   n 
2  11   A   n 
2  12   C   n 
2  13   A   n 
2  14   G   n 
2  15   C   n 
2  16   G   n 
2  17   G   n 
2  18   U   n 
2  19   G   n 
2  20   G   n 
2  21   G   n 
2  22   G   n 
2  23   U   n 
2  24   U   n 
2  25   G   n 
2  26   C   n 
2  27   C   n 
2  28   U   n 
2  29   C   n 
2  30   C   n 
2  31   C   n 
2  32   G   n 
2  33   U   n 
2  34   A   n 
2  35   C   n 
2  36   C   n 
2  37   C   n 
2  38   A   n 
2  39   U   n 
2  40   C   n 
2  41   C   n 
2  42   C   n 
2  43   G   n 
2  44   A   n 
2  45   A   n 
2  46   C   n 
2  47   A   n 
2  48   C   n 
2  49   G   n 
2  50   G   n 
2  51   A   n 
2  52   A   n 
2  53   G   n 
2  54   A   n 
2  55   U   n 
2  56   A   n 
2  57   A   n 
2  58   G   n 
2  59   C   n 
2  60   C   n 
2  61   C   n 
2  62   A   n 
2  63   C   n 
2  64   C   n 
2  65   A   n 
2  66   G   n 
2  67   C   n 
2  68   G   n 
2  69   U   n 
2  70   U   n 
2  71   C   n 
2  72   C   n 
2  73   G   n 
2  74   G   n 
2  75   G   n 
2  76   G   n 
2  77   A   n 
2  78   G   n 
2  79   U   n 
2  80   A   n 
2  81   C   n 
2  82   U   n 
2  83   G   n 
2  84   G   n 
2  85   A   n 
2  86   G   n 
2  87   U   n 
2  88   G   n 
2  89   C   n 
2  90   G   n 
2  91   C   n 
2  92   G   n 
2  93   A   n 
2  94   G   n 
2  95   C   n 
2  96   C   n 
2  97   U   n 
2  98   C   n 
2  99   U   n 
2  100  G   n 
2  101  G   n 
2  102  G   n 
2  103  A   n 
2  104  A   n 
2  105  A   n 
2  106  C   n 
2  107  C   n 
2  108  C   n 
2  109  G   n 
2  110  G   n 
2  111  U   n 
2  112  U   n 
2  113  C   n 
2  114  G   n 
2  115  C   n 
2  116  C   n 
2  117  G   n 
2  118  C   n 
2  119  C   n 
2  120  A   n 
2  121  C   n 
2  122  C   n 
3  1    GLY n 
3  2    ARG n 
3  3    ARG n 
3  4    ILE n 
3  5    GLN n 
3  6    GLY n 
3  7    GLN n 
3  8    ARG n 
3  9    ARG n 
3  10   GLY n 
3  11   ARG n 
3  12   GLY n 
3  13   THR n 
3  14   SER n 
3  15   THR n 
3  16   PHE n 
3  17   ARG n 
3  18   ALA n 
3  19   PRO n 
3  20   SER n 
3  21   HIS n 
3  22   ARG n 
3  23   TYR n 
3  24   LYS n 
3  25   ALA n 
3  26   ASP n 
3  27   LEU n 
3  28   GLU n 
3  29   HIS n 
3  30   ARG n 
3  31   LYS n 
3  32   VAL n 
3  33   GLU n 
3  34   ASP n 
3  35   GLY n 
3  36   ASP n 
3  37   VAL n 
3  38   ILE n 
3  39   ALA n 
3  40   GLY n 
3  41   THR n 
3  42   VAL n 
3  43   VAL n 
3  44   ASP n 
3  45   ILE n 
3  46   GLU n 
3  47   HIS n 
3  48   ASP n 
3  49   PRO n 
3  50   ALA n 
3  51   ARG n 
3  52   SER n 
3  53   ALA n 
3  54   PRO n 
3  55   VAL n 
3  56   ALA n 
3  57   ALA n 
3  58   VAL n 
3  59   GLU n 
3  60   PHE n 
3  61   GLU n 
3  62   ASP n 
3  63   GLY n 
3  64   ASP n 
3  65   ARG n 
3  66   ARG n 
3  67   LEU n 
3  68   ILE n 
3  69   LEU n 
3  70   ALA n 
3  71   PRO n 
3  72   GLU n 
3  73   GLY n 
3  74   VAL n 
3  75   GLY n 
3  76   VAL n 
3  77   GLY n 
3  78   ASP n 
3  79   GLU n 
3  80   LEU n 
3  81   GLN n 
3  82   VAL n 
3  83   GLY n 
3  84   VAL n 
3  85   ASP n 
3  86   ALA n 
3  87   GLU n 
3  88   ILE n 
3  89   ALA n 
3  90   PRO n 
3  91   GLY n 
3  92   ASN n 
3  93   THR n 
3  94   LEU n 
3  95   PRO n 
3  96   LEU n 
3  97   ALA n 
3  98   GLU n 
3  99   ILE n 
3  100  PRO n 
3  101  GLU n 
3  102  GLY n 
3  103  VAL n 
3  104  PRO n 
3  105  VAL n 
3  106  CYS n 
3  107  ASN n 
3  108  VAL n 
3  109  GLU n 
3  110  SER n 
3  111  SER n 
3  112  PRO n 
3  113  GLY n 
3  114  ASP n 
3  115  GLY n 
3  116  GLY n 
3  117  LYS n 
3  118  PHE n 
3  119  ALA n 
3  120  ARG n 
3  121  ALA n 
3  122  SER n 
3  123  GLY n 
3  124  VAL n 
3  125  ASN n 
3  126  ALA n 
3  127  GLN n 
3  128  LEU n 
3  129  LEU n 
3  130  THR n 
3  131  HIS n 
3  132  ASP n 
3  133  ARG n 
3  134  ASN n 
3  135  VAL n 
3  136  ALA n 
3  137  VAL n 
3  138  VAL n 
3  139  LYS n 
3  140  LEU n 
3  141  PRO n 
3  142  SER n 
3  143  GLY n 
3  144  GLU n 
3  145  MET n 
3  146  LYS n 
3  147  ARG n 
3  148  LEU n 
3  149  ASP n 
3  150  PRO n 
3  151  GLN n 
3  152  CYS n 
3  153  ARG n 
3  154  ALA n 
3  155  THR n 
3  156  ILE n 
3  157  GLY n 
3  158  VAL n 
3  159  VAL n 
3  160  GLY n 
3  161  GLY n 
3  162  GLY n 
3  163  GLY n 
3  164  ARG n 
3  165  THR n 
3  166  ASP n 
3  167  LYS n 
3  168  PRO n 
3  169  PHE n 
3  170  VAL n 
3  171  LYS n 
3  172  ALA n 
3  173  GLY n 
3  174  ASN n 
3  175  LYS n 
3  176  HIS n 
3  177  HIS n 
3  178  LYS n 
3  179  MET n 
3  180  LYS n 
3  181  ALA n 
3  182  ARG n 
3  183  GLY n 
3  184  THR n 
3  185  LYS n 
3  186  TRP n 
3  187  PRO n 
3  188  ASN n 
3  189  VAL n 
3  190  ARG n 
3  191  GLY n 
3  192  VAL n 
3  193  ALA n 
3  194  MET n 
3  195  ASN n 
3  196  ALA n 
3  197  VAL n 
3  198  ASP n 
3  199  HIS n 
3  200  PRO n 
3  201  PHE n 
3  202  GLY n 
3  203  GLY n 
3  204  GLY n 
3  205  GLY n 
3  206  ARG n 
3  207  GLN n 
3  208  HIS n 
3  209  PRO n 
3  210  GLY n 
3  211  LYS n 
3  212  PRO n 
3  213  LYS n 
3  214  SER n 
3  215  ILE n 
3  216  SER n 
3  217  ARG n 
3  218  ASN n 
3  219  ALA n 
3  220  PRO n 
3  221  PRO n 
3  222  GLY n 
3  223  ARG n 
3  224  LYS n 
3  225  VAL n 
3  226  GLY n 
3  227  ASP n 
3  228  ILE n 
3  229  ALA n 
3  230  SER n 
3  231  LYS n 
3  232  ARG n 
3  233  THR n 
3  234  GLY n 
3  235  ARG n 
3  236  GLY n 
3  237  GLY n 
3  238  ASN n 
3  239  GLU n 
4  1    PRO n 
4  2    GLN n 
4  3    PRO n 
4  4    SER n 
4  5    ARG n 
4  6    PRO n 
4  7    ARG n 
4  8    LYS n 
4  9    GLY n 
4  10   SER n 
4  11   LEU n 
4  12   GLY n 
4  13   PHE n 
4  14   GLY n 
4  15   PRO n 
4  16   ARG n 
4  17   LYS n 
4  18   ARG n 
4  19   SER n 
4  20   THR n 
4  21   SER n 
4  22   GLU n 
4  23   THR n 
4  24   PRO n 
4  25   ARG n 
4  26   PHE n 
4  27   ASN n 
4  28   SER n 
4  29   TRP n 
4  30   PRO n 
4  31   SER n 
4  32   ASP n 
4  33   ASP n 
4  34   GLY n 
4  35   GLN n 
4  36   PRO n 
4  37   GLY n 
4  38   VAL n 
4  39   GLN n 
4  40   GLY n 
4  41   PHE n 
4  42   ALA n 
4  43   GLY n 
4  44   TYR n 
4  45   LYS n 
4  46   ALA n 
4  47   GLY n 
4  48   MET n 
4  49   THR n 
4  50   HIS n 
4  51   VAL n 
4  52   VAL n 
4  53   LEU n 
4  54   VAL n 
4  55   ASN n 
4  56   ASP n 
4  57   GLU n 
4  58   PRO n 
4  59   ASN n 
4  60   SER n 
4  61   PRO n 
4  62   ARG n 
4  63   GLU n 
4  64   GLY n 
4  65   MET n 
4  66   GLU n 
4  67   GLU n 
4  68   THR n 
4  69   VAL n 
4  70   PRO n 
4  71   VAL n 
4  72   THR n 
4  73   VAL n 
4  74   ILE n 
4  75   GLU n 
4  76   THR n 
4  77   PRO n 
4  78   PRO n 
4  79   MET n 
4  80   ARG n 
4  81   ALA n 
4  82   VAL n 
4  83   ALA n 
4  84   LEU n 
4  85   ARG n 
4  86   ALA n 
4  87   TYR n 
4  88   GLU n 
4  89   ASP n 
4  90   THR n 
4  91   PRO n 
4  92   TYR n 
4  93   GLY n 
4  94   GLN n 
4  95   ARG n 
4  96   PRO n 
4  97   LEU n 
4  98   THR n 
4  99   GLU n 
4  100  VAL n 
4  101  TRP n 
4  102  THR n 
4  103  ASP n 
4  104  GLU n 
4  105  PHE n 
4  106  HIS n 
4  107  SER n 
4  108  GLU n 
4  109  LEU n 
4  110  ASP n 
4  111  ARG n 
4  112  THR n 
4  113  LEU n 
4  114  ASP n 
4  115  VAL n 
4  116  PRO n 
4  117  GLU n 
4  118  ASP n 
4  119  HIS n 
4  120  ASP n 
4  121  PRO n 
4  122  ASP n 
4  123  ALA n 
4  124  ALA n 
4  125  GLU n 
4  126  GLU n 
4  127  GLN n 
4  128  ILE n 
4  129  ARG n 
4  130  ASP n 
4  131  ALA n 
4  132  HIS n 
4  133  GLU n 
4  134  ALA n 
4  135  GLY n 
4  136  ASP n 
4  137  LEU n 
4  138  GLY n 
4  139  ASP n 
4  140  LEU n 
4  141  ARG n 
4  142  LEU n 
4  143  ILE n 
4  144  THR n 
4  145  HIS n 
4  146  THR n 
4  147  VAL n 
4  148  PRO n 
4  149  ASP n 
4  150  ALA n 
4  151  VAL n 
4  152  PRO n 
4  153  SER n 
4  154  VAL n 
4  155  PRO n 
4  156  LYS n 
4  157  LYS n 
4  158  LYS n 
4  159  PRO n 
4  160  ASP n 
4  161  VAL n 
4  162  MET n 
4  163  GLU n 
4  164  THR n 
4  165  ARG n 
4  166  VAL n 
4  167  GLY n 
4  168  GLY n 
4  169  GLY n 
4  170  SER n 
4  171  VAL n 
4  172  SER n 
4  173  ASP n 
4  174  ARG n 
4  175  LEU n 
4  176  ASP n 
4  177  HIS n 
4  178  ALA n 
4  179  LEU n 
4  180  ASP n 
4  181  ILE n 
4  182  VAL n 
4  183  GLU n 
4  184  ASP n 
4  185  GLY n 
4  186  GLY n 
4  187  GLU n 
4  188  HIS n 
4  189  ALA n 
4  190  MET n 
4  191  ASN n 
4  192  ASP n 
4  193  ILE n 
4  194  PHE n 
4  195  ARG n 
4  196  ALA n 
4  197  GLY n 
4  198  GLU n 
4  199  TYR n 
4  200  ALA n 
4  201  ASP n 
4  202  VAL n 
4  203  ALA n 
4  204  GLY n 
4  205  VAL n 
4  206  THR n 
4  207  LYS n 
4  208  GLY n 
4  209  LYS n 
4  210  GLY n 
4  211  THR n 
4  212  GLN n 
4  213  GLY n 
4  214  PRO n 
4  215  VAL n 
4  216  LYS n 
4  217  ARG n 
4  218  TRP n 
4  219  GLY n 
4  220  VAL n 
4  221  GLN n 
4  222  LYS n 
4  223  ARG n 
4  224  LYS n 
4  225  GLY n 
4  226  LYS n 
4  227  HIS n 
4  228  ALA n 
4  229  ARG n 
4  230  GLN n 
4  231  GLY n 
4  232  TRP n 
4  233  ARG n 
4  234  ARG n 
4  235  ARG n 
4  236  ILE n 
4  237  GLY n 
4  238  ASN n 
4  239  LEU n 
4  240  GLY n 
4  241  PRO n 
4  242  TRP n 
4  243  ASN n 
4  244  PRO n 
4  245  SER n 
4  246  ARG n 
4  247  VAL n 
4  248  ARG n 
4  249  SER n 
4  250  THR n 
4  251  VAL n 
4  252  PRO n 
4  253  GLN n 
4  254  GLN n 
4  255  GLY n 
4  256  GLN n 
4  257  THR n 
4  258  GLY n 
4  259  TYR n 
4  260  HIS n 
4  261  GLN n 
4  262  ARG n 
4  263  THR n 
4  264  GLU n 
4  265  LEU n 
4  266  ASN n 
4  267  LYS n 
4  268  ARG n 
4  269  LEU n 
4  270  ILE n 
4  271  ASP n 
4  272  ILE n 
4  273  GLY n 
4  274  GLU n 
4  275  GLY n 
4  276  ASP n 
4  277  GLU n 
4  278  PRO n 
4  279  THR n 
4  280  VAL n 
4  281  ASP n 
4  282  GLY n 
4  283  GLY n 
4  284  PHE n 
4  285  VAL n 
4  286  ASN n 
4  287  TYR n 
4  288  GLY n 
4  289  GLU n 
4  290  VAL n 
4  291  ASP n 
4  292  GLY n 
4  293  PRO n 
4  294  TYR n 
4  295  THR n 
4  296  LEU n 
4  297  VAL n 
4  298  LYS n 
4  299  GLY n 
4  300  SER n 
4  301  VAL n 
4  302  PRO n 
4  303  GLY n 
4  304  PRO n 
4  305  ASP n 
4  306  LYS n 
4  307  ARG n 
4  308  LEU n 
4  309  VAL n 
4  310  ARG n 
4  311  PHE n 
4  312  ARG n 
4  313  PRO n 
4  314  ALA n 
4  315  VAL n 
4  316  ARG n 
4  317  PRO n 
4  318  ASN n 
4  319  ASP n 
4  320  GLN n 
4  321  PRO n 
4  322  ARG n 
4  323  LEU n 
4  324  ASP n 
4  325  PRO n 
4  326  GLU n 
4  327  VAL n 
4  328  ARG n 
4  329  TYR n 
4  330  VAL n 
4  331  SER n 
4  332  ASN n 
4  333  GLU n 
4  334  SER n 
4  335  ASN n 
4  336  GLN n 
4  337  GLY n 
5  1    MET n 
5  2    GLN n 
5  3    ALA n 
5  4    THR n 
5  5    ILE n 
5  6    TYR n 
5  7    ASP n 
5  8    LEU n 
5  9    ASP n 
5  10   GLY n 
5  11   ASN n 
5  12   THR n 
5  13   ASP n 
5  14   GLY n 
5  15   GLU n 
5  16   VAL n 
5  17   ASP n 
5  18   LEU n 
5  19   PRO n 
5  20   ASP n 
5  21   VAL n 
5  22   PHE n 
5  23   GLU n 
5  24   THR n 
5  25   PRO n 
5  26   VAL n 
5  27   ARG n 
5  28   SER n 
5  29   ASP n 
5  30   LEU n 
5  31   ILE n 
5  32   GLY n 
5  33   LYS n 
5  34   ALA n 
5  35   VAL n 
5  36   ARG n 
5  37   ALA n 
5  38   ALA n 
5  39   GLN n 
5  40   ALA n 
5  41   ASN n 
5  42   ARG n 
5  43   LYS n 
5  44   GLN n 
5  45   ASP n 
5  46   TYR n 
5  47   GLY n 
5  48   SER n 
5  49   ASP n 
5  50   GLU n 
5  51   TYR n 
5  52   ALA n 
5  53   GLY n 
5  54   LEU n 
5  55   ARG n 
5  56   THR n 
5  57   PRO n 
5  58   ALA n 
5  59   GLU n 
5  60   SER n 
5  61   PHE n 
5  62   GLY n 
5  63   SER n 
5  64   GLY n 
5  65   ARG n 
5  66   GLY n 
5  67   GLN n 
5  68   ALA n 
5  69   HIS n 
5  70   VAL n 
5  71   PRO n 
5  72   LYS n 
5  73   LEU n 
5  74   ASP n 
5  75   GLY n 
5  76   ARG n 
5  77   ALA n 
5  78   ARG n 
5  79   ARG n 
5  80   VAL n 
5  81   PRO n 
5  82   GLN n 
5  83   ALA n 
5  84   VAL n 
5  85   LYS n 
5  86   GLY n 
5  87   ARG n 
5  88   SER n 
5  89   ALA n 
5  90   HIS n 
5  91   PRO n 
5  92   PRO n 
5  93   LYS n 
5  94   THR n 
5  95   GLU n 
5  96   LYS n 
5  97   ASP n 
5  98   ARG n 
5  99   SER n 
5  100  LEU n 
5  101  ASP n 
5  102  LEU n 
5  103  ASN n 
5  104  ASP n 
5  105  LYS n 
5  106  GLU n 
5  107  ARG n 
5  108  GLN n 
5  109  LEU n 
5  110  ALA n 
5  111  VAL n 
5  112  ARG n 
5  113  SER n 
5  114  ALA n 
5  115  LEU n 
5  116  ALA n 
5  117  ALA n 
5  118  THR n 
5  119  ALA n 
5  120  ASP n 
5  121  ALA n 
5  122  ASP n 
5  123  LEU n 
5  124  VAL n 
5  125  ALA n 
5  126  ASP n 
5  127  ARG n 
5  128  GLY n 
5  129  HIS n 
5  130  GLU n 
5  131  PHE n 
5  132  ASP n 
5  133  ARG n 
5  134  ASP n 
5  135  GLU n 
5  136  VAL n 
5  137  PRO n 
5  138  VAL n 
5  139  VAL n 
5  140  VAL n 
5  141  SER n 
5  142  ASP n 
5  143  ASP n 
5  144  PHE n 
5  145  GLU n 
5  146  ASP n 
5  147  LEU n 
5  148  VAL n 
5  149  LYS n 
5  150  THR n 
5  151  GLN n 
5  152  GLU n 
5  153  VAL n 
5  154  VAL n 
5  155  SER n 
5  156  LEU n 
5  157  LEU n 
5  158  GLU n 
5  159  ALA n 
5  160  LEU n 
5  161  ASP n 
5  162  VAL n 
5  163  HIS n 
5  164  ALA n 
5  165  ASP n 
5  166  ILE n 
5  167  ASP n 
5  168  ARG n 
5  169  ALA n 
5  170  ASP n 
5  171  GLU n 
5  172  THR n 
5  173  LYS n 
5  174  ILE n 
5  175  LYS n 
5  176  ALA n 
5  177  GLY n 
5  178  GLN n 
5  179  GLY n 
5  180  SER n 
5  181  ALA n 
5  182  ARG n 
5  183  GLY n 
5  184  ARG n 
5  185  LYS n 
5  186  TYR n 
5  187  ARG n 
5  188  ARG n 
5  189  PRO n 
5  190  ALA n 
5  191  SER n 
5  192  ILE n 
5  193  LEU n 
5  194  PHE n 
5  195  VAL n 
5  196  THR n 
5  197  SER n 
5  198  ASP n 
5  199  GLU n 
5  200  PRO n 
5  201  SER n 
5  202  THR n 
5  203  ALA n 
5  204  ALA n 
5  205  ARG n 
5  206  ASN n 
5  207  LEU n 
5  208  ALA n 
5  209  GLY n 
5  210  ALA n 
5  211  ASP n 
5  212  VAL n 
5  213  ALA n 
5  214  THR n 
5  215  ALA n 
5  216  SER n 
5  217  GLU n 
5  218  VAL n 
5  219  ASN n 
5  220  THR n 
5  221  GLU n 
5  222  ASP n 
5  223  LEU n 
5  224  ALA n 
5  225  PRO n 
5  226  GLY n 
5  227  GLY n 
5  228  ALA n 
5  229  PRO n 
5  230  GLY n 
5  231  ARG n 
5  232  LEU n 
5  233  THR n 
5  234  VAL n 
5  235  PHE n 
5  236  THR n 
5  237  GLU n 
5  238  SER n 
5  239  ALA n 
5  240  LEU n 
5  241  ALA n 
5  242  GLU n 
5  243  VAL n 
5  244  ALA n 
5  245  GLU n 
5  246  ARG n 
6  1    SER n 
6  2    SER n 
6  3    GLU n 
6  4    SER n 
6  5    GLU n 
6  6    SER n 
6  7    GLY n 
6  8    GLY n 
6  9    ASP n 
6  10   PHE n 
6  11   HIS n 
6  12   GLU n 
6  13   MET n 
6  14   ARG n 
6  15   GLU n 
6  16   PRO n 
6  17   ARG n 
6  18   ILE n 
6  19   GLU n 
6  20   LYS n 
6  21   VAL n 
6  22   VAL n 
6  23   VAL n 
6  24   HIS n 
6  25   MET n 
6  26   GLY n 
6  27   ILE n 
6  28   GLY n 
6  29   HIS n 
6  30   GLY n 
6  31   GLY n 
6  32   ARG n 
6  33   ASP n 
6  34   LEU n 
6  35   ALA n 
6  36   ASN n 
6  37   ALA n 
6  38   GLU n 
6  39   ASP n 
6  40   ILE n 
6  41   LEU n 
6  42   GLY n 
6  43   GLU n 
6  44   ILE n 
6  45   THR n 
6  46   GLY n 
6  47   GLN n 
6  48   MET n 
6  49   PRO n 
6  50   VAL n 
6  51   ARG n 
6  52   THR n 
6  53   LYS n 
6  54   ALA n 
6  55   LYS n 
6  56   ARG n 
6  57   THR n 
6  58   VAL n 
6  59   GLY n 
6  60   GLU n 
6  61   PHE n 
6  62   ASP n 
6  63   ILE n 
6  64   ARG n 
6  65   GLU n 
6  66   GLY n 
6  67   ASP n 
6  68   PRO n 
6  69   ILE n 
6  70   GLY n 
6  71   ALA n 
6  72   LYS n 
6  73   VAL n 
6  74   THR n 
6  75   LEU n 
6  76   ARG n 
6  77   ASP n 
6  78   GLU n 
6  79   MET n 
6  80   ALA n 
6  81   GLU n 
6  82   GLU n 
6  83   PHE n 
6  84   LEU n 
6  85   GLN n 
6  86   THR n 
6  87   ALA n 
6  88   LEU n 
6  89   PRO n 
6  90   LEU n 
6  91   ALA n 
6  92   GLU n 
6  93   LEU n 
6  94   ALA n 
6  95   THR n 
6  96   SER n 
6  97   GLN n 
6  98   PHE n 
6  99   ASP n 
6  100  ASP n 
6  101  THR n 
6  102  GLY n 
6  103  ASN n 
6  104  PHE n 
6  105  SER n 
6  106  PHE n 
6  107  GLY n 
6  108  VAL n 
6  109  GLU n 
6  110  GLU n 
6  111  HIS n 
6  112  THR n 
6  113  GLU n 
6  114  PHE n 
6  115  PRO n 
6  116  SER n 
6  117  GLN n 
6  118  GLU n 
6  119  TYR n 
6  120  ASP n 
6  121  PRO n 
6  122  SER n 
6  123  ILE n 
6  124  GLY n 
6  125  ILE n 
6  126  TYR n 
6  127  GLY n 
6  128  LEU n 
6  129  ASP n 
6  130  VAL n 
6  131  THR n 
6  132  VAL n 
6  133  ASN n 
6  134  LEU n 
6  135  VAL n 
6  136  ARG n 
6  137  PRO n 
6  138  GLY n 
6  139  TYR n 
6  140  ARG n 
6  141  VAL n 
6  142  ALA n 
6  143  LYS n 
6  144  ARG n 
6  145  ASP n 
6  146  LYS n 
6  147  ALA n 
6  148  SER n 
6  149  ARG n 
6  150  SER n 
6  151  ILE n 
6  152  PRO n 
6  153  THR n 
6  154  LYS n 
6  155  HIS n 
6  156  ARG n 
6  157  LEU n 
6  158  ASN n 
6  159  PRO n 
6  160  ALA n 
6  161  ASP n 
6  162  ALA n 
6  163  VAL n 
6  164  ALA n 
6  165  PHE n 
6  166  ILE n 
6  167  GLU n 
6  168  SER n 
6  169  THR n 
6  170  TYR n 
6  171  ASP n 
6  172  VAL n 
6  173  GLU n 
6  174  VAL n 
6  175  SER n 
6  176  GLU n 
7  1    PRO n 
7  2    ARG n 
7  3    VAL n 
7  4    GLU n 
7  5    LEU n 
7  6    GLU n 
7  7    ILE n 
7  8    PRO n 
7  9    GLU n 
7  10   ASP n 
7  11   VAL n 
7  12   ASP n 
7  13   ALA n 
7  14   GLU n 
7  15   GLN n 
7  16   ASP n 
7  17   HIS n 
7  18   LEU n 
7  19   ASP n 
7  20   ILE n 
7  21   THR n 
7  22   VAL n 
7  23   GLU n 
7  24   GLY n 
7  25   ASP n 
7  26   ASN n 
7  27   GLY n 
7  28   SER n 
7  29   VAL n 
7  30   THR n 
7  31   ARG n 
7  32   ARG n 
7  33   LEU n 
7  34   TRP n 
7  35   TYR n 
7  36   PRO n 
7  37   ASP n 
7  38   ILE n 
7  39   ASP n 
7  40   VAL n 
7  41   SER n 
7  42   VAL n 
7  43   ASP n 
7  44   GLY n 
7  45   ASP n 
7  46   THR n 
7  47   VAL n 
7  48   VAL n 
7  49   ILE n 
7  50   GLU n 
7  51   SER n 
7  52   ASP n 
7  53   GLU n 
7  54   ASP n 
7  55   ASN n 
7  56   ALA n 
7  57   LYS n 
7  58   THR n 
7  59   MET n 
7  60   SER n 
7  61   THR n 
7  62   ILE n 
7  63   GLY n 
7  64   THR n 
7  65   PHE n 
7  66   GLN n 
7  67   SER n 
7  68   HIS n 
7  69   ILE n 
7  70   GLU n 
7  71   ASN n 
7  72   MET n 
7  73   PHE n 
7  74   HIS n 
7  75   GLY n 
7  76   VAL n 
7  77   THR n 
7  78   GLU n 
7  79   GLY n 
7  80   TRP n 
7  81   GLU n 
7  82   TYR n 
7  83   GLY n 
7  84   MET n 
7  85   GLU n 
7  86   VAL n 
7  87   PHE n 
7  88   TYR n 
7  89   SER n 
7  90   HIS n 
7  91   PHE n 
7  92   PRO n 
7  93   MET n 
7  94   GLN n 
7  95   VAL n 
7  96   ASN n 
7  97   VAL n 
7  98   GLU n 
7  99   GLY n 
7  100  ASP n 
7  101  GLU n 
7  102  VAL n 
7  103  VAL n 
7  104  ILE n 
7  105  GLU n 
7  106  ASN n 
7  107  PHE n 
7  108  LEU n 
7  109  GLY n 
7  110  GLU n 
7  111  LYS n 
7  112  ALA n 
7  113  PRO n 
7  114  ARG n 
7  115  ARG n 
7  116  THR n 
7  117  THR n 
7  118  ILE n 
7  119  HIS n 
7  120  GLY n 
7  121  ASP n 
7  122  THR n 
7  123  ASP n 
7  124  VAL n 
7  125  GLU n 
7  126  ILE n 
7  127  ASP n 
7  128  GLY n 
7  129  GLU n 
7  130  GLU n 
7  131  LEU n 
7  132  THR n 
7  133  VAL n 
7  134  SER n 
7  135  GLY n 
7  136  PRO n 
7  137  ASP n 
7  138  ILE n 
7  139  GLU n 
7  140  ALA n 
7  141  VAL n 
7  142  GLY n 
7  143  GLN n 
7  144  THR n 
7  145  ALA n 
7  146  ALA n 
7  147  ASP n 
7  148  ILE n 
7  149  GLU n 
7  150  GLN n 
7  151  LEU n 
7  152  THR n 
7  153  ARG n 
7  154  ILE n 
7  155  ASN n 
7  156  ASP n 
7  157  LYS n 
7  158  ASP n 
7  159  VAL n 
7  160  ARG n 
7  161  VAL n 
7  162  PHE n 
7  163  GLN n 
7  164  ASP n 
7  165  GLY n 
7  166  VAL n 
7  167  TYR n 
7  168  ILE n 
7  169  THR n 
7  170  ARG n 
7  171  LYS n 
7  172  PRO n 
7  173  ASN n 
7  174  ARG n 
7  175  GLY n 
7  176  ASP n 
7  177  ALA n 
8  1    PRO n 
8  2    VAL n 
8  3    TYR n 
8  4    VAL n 
8  5    ASP n 
8  6    PHE n 
8  7    ASP n 
8  8    VAL n 
8  9    PRO n 
8  10   ALA n 
8  11   ASP n 
8  12   LEU n 
8  13   GLU n 
8  14   ASP n 
8  15   ASP n 
8  16   ALA n 
8  17   LEU n 
8  18   GLU n 
8  19   ALA n 
8  20   LEU n 
8  21   GLU n 
8  22   VAL n 
8  23   ALA n 
8  24   ARG n 
8  25   ASP n 
8  26   THR n 
8  27   GLY n 
8  28   ALA n 
8  29   VAL n 
8  30   LYS n 
8  31   LYS n 
8  32   GLY n 
8  33   THR n 
8  34   ASN n 
8  35   GLU n 
8  36   THR n 
8  37   THR n 
8  38   LYS n 
8  39   SER n 
8  40   ILE n 
8  41   GLU n 
8  42   ARG n 
8  43   GLY n 
8  44   SER n 
8  45   ALA n 
8  46   GLU n 
8  47   LEU n 
8  48   VAL n 
8  49   PHE n 
8  50   VAL n 
8  51   ALA n 
8  52   GLU n 
8  53   ASP n 
8  54   VAL n 
8  55   GLN n 
8  56   PRO n 
8  57   GLU n 
8  58   GLU n 
8  59   ILE n 
8  60   VAL n 
8  61   MET n 
8  62   HIS n 
8  63   ILE n 
8  64   PRO n 
8  65   GLU n 
8  66   LEU n 
8  67   ALA n 
8  68   ASP n 
8  69   GLU n 
8  70   LYS n 
8  71   GLY n 
8  72   VAL n 
8  73   PRO n 
8  74   PHE n 
8  75   ILE n 
8  76   PHE n 
8  77   VAL n 
8  78   GLU n 
8  79   GLN n 
8  80   GLN n 
8  81   ASP n 
8  82   ASP n 
8  83   LEU n 
8  84   GLY n 
8  85   HIS n 
8  86   ALA n 
8  87   ALA n 
8  88   GLY n 
8  89   LEU n 
8  90   GLU n 
8  91   VAL n 
8  92   GLY n 
8  93   SER n 
8  94   ALA n 
8  95   ALA n 
8  96   ALA n 
8  97   ALA n 
8  98   VAL n 
8  99   THR n 
8  100  ASP n 
8  101  ALA n 
8  102  GLY n 
8  103  ALA n 
8  104  ALA n 
8  105  ALA n 
8  106  THR n 
8  107  VAL n 
8  108  LEU n 
8  109  GLU n 
8  110  GLU n 
8  111  ILE n 
8  112  ALA n 
8  113  ASP n 
8  114  LYS n 
8  115  VAL n 
8  116  GLU n 
8  117  GLU n 
8  118  LEU n 
8  119  ARG n 
9  1    MET n 
9  2    SER n 
9  3    ALA n 
9  4    GLU n 
9  5    SER n 
9  6    GLU n 
9  7    ARG n 
9  8    LYS n 
9  9    THR n 
9  10   GLU n 
9  11   THR n 
9  12   ILE n 
9  13   PRO n 
9  14   GLU n 
9  15   TRP n 
9  16   LYS n 
9  17   GLN n 
9  18   GLU n 
9  19   GLU n 
9  20   VAL n 
9  21   ASP n 
9  22   ALA n 
9  23   ILE n 
9  24   VAL n 
9  25   GLU n 
9  26   MET n 
9  27   ILE n 
9  28   GLU n 
9  29   SER n 
9  30   TYR n 
9  31   GLU n 
9  32   SER n 
9  33   VAL n 
9  34   GLY n 
9  35   VAL n 
9  36   VAL n 
9  37   ASN n 
9  38   ILE n 
9  39   ALA n 
9  40   GLY n 
9  41   ILE n 
9  42   PRO n 
9  43   SER n 
9  44   ARG n 
9  45   GLN n 
9  46   LEU n 
9  47   GLN n 
9  48   ASP n 
9  49   MET n 
9  50   ARG n 
9  51   ARG n 
9  52   ASP n 
9  53   LEU n 
9  54   HIS n 
9  55   GLY n 
9  56   THR n 
9  57   ALA n 
9  58   GLU n 
9  59   LEU n 
9  60   ARG n 
9  61   VAL n 
9  62   SER n 
9  63   ARG n 
9  64   ASN n 
9  65   THR n 
9  66   LEU n 
9  67   LEU n 
9  68   GLU n 
9  69   ARG n 
9  70   ALA n 
9  71   LEU n 
9  72   ASP n 
9  73   ASP n 
9  74   VAL n 
9  75   ASP n 
9  76   ASP n 
9  77   GLY n 
9  78   LEU n 
9  79   GLU n 
9  80   ASP n 
9  81   LEU n 
9  82   ASN n 
9  83   GLY n 
9  84   TYR n 
9  85   ILE n 
9  86   THR n 
9  87   GLY n 
9  88   GLN n 
9  89   VAL n 
9  90   GLY n 
9  91   LEU n 
9  92   ILE n 
9  93   GLY n 
9  94   THR n 
9  95   ASP n 
9  96   ASP n 
9  97   ASN n 
9  98   PRO n 
9  99   PHE n 
9  100  SER n 
9  101  LEU n 
9  102  PHE n 
9  103  GLN n 
9  104  GLU n 
9  105  LEU n 
9  106  GLU n 
9  107  ALA n 
9  108  SER n 
9  109  LYS n 
9  110  THR n 
9  111  PRO n 
9  112  ALA n 
9  113  PRO n 
9  114  ILE n 
9  115  GLY n 
9  116  ALA n 
9  117  GLY n 
9  118  GLU n 
9  119  VAL n 
9  120  ALA n 
9  121  PRO n 
9  122  ASN n 
9  123  ASP n 
9  124  ILE n 
9  125  VAL n 
9  126  ILE n 
9  127  PRO n 
9  128  GLU n 
9  129  GLY n 
9  130  ASP n 
9  131  THR n 
9  132  GLY n 
9  133  VAL n 
9  134  ASP n 
9  135  PRO n 
9  136  GLY n 
9  137  PRO n 
9  138  PHE n 
9  139  VAL n 
9  140  GLY n 
9  141  GLU n 
9  142  LEU n 
9  143  GLN n 
9  144  SER n 
9  145  VAL n 
9  146  GLY n 
9  147  ALA n 
9  148  ASP n 
9  149  ALA n 
9  150  ARG n 
9  151  ILE n 
9  152  GLN n 
9  153  GLU n 
9  154  GLY n 
9  155  SER n 
9  156  ILE n 
9  157  GLN n 
9  158  VAL n 
9  159  LEU n 
9  160  SER n 
9  161  ASP n 
9  162  SER n 
9  163  THR n 
9  164  VAL n 
9  165  LEU n 
9  166  ASP n 
9  167  THR n 
9  168  GLY n 
9  169  GLU n 
9  170  GLU n 
9  171  VAL n 
9  172  SER n 
9  173  GLN n 
9  174  GLU n 
9  175  LEU n 
9  176  SER n 
9  177  ASN n 
9  178  VAL n 
9  179  LEU n 
9  180  ASN n 
9  181  GLU n 
9  182  LEU n 
9  183  GLY n 
9  184  ILE n 
9  185  GLU n 
9  186  PRO n 
9  187  LYS n 
9  188  GLU n 
9  189  VAL n 
9  190  GLY n 
9  191  LEU n 
9  192  ASP n 
9  193  LEU n 
9  194  ARG n 
9  195  ALA n 
9  196  VAL n 
9  197  PHE n 
9  198  ALA n 
9  199  ASP n 
9  200  GLY n 
9  201  VAL n 
9  202  LEU n 
9  203  PHE n 
9  204  GLU n 
9  205  PRO n 
9  206  GLU n 
9  207  GLU n 
9  208  LEU n 
9  209  GLU n 
9  210  LEU n 
9  211  ASP n 
9  212  ILE n 
9  213  ASP n 
9  214  GLU n 
9  215  TYR n 
9  216  ARG n 
9  217  SER n 
9  218  ASP n 
9  219  ILE n 
9  220  GLN n 
9  221  ALA n 
9  222  ALA n 
9  223  ALA n 
9  224  GLY n 
9  225  ARG n 
9  226  ALA n 
9  227  PHE n 
9  228  ASN n 
9  229  LEU n 
9  230  SER n 
9  231  VAL n 
9  232  ASN n 
9  233  ALA n 
9  234  ASP n 
9  235  TYR n 
9  236  PRO n 
9  237  THR n 
9  238  ALA n 
9  239  THR n 
9  240  THR n 
9  241  ALA n 
9  242  PRO n 
9  243  THR n 
9  244  MET n 
9  245  LEU n 
9  246  GLN n 
9  247  SER n 
9  248  ASP n 
9  249  ARG n 
9  250  GLY n 
9  251  ASN n 
9  252  ALA n 
9  253  LYS n 
9  254  SER n 
9  255  LEU n 
9  256  ALA n 
9  257  LEU n 
9  258  GLN n 
9  259  ALA n 
9  260  ALA n 
9  261  ILE n 
9  262  GLU n 
9  263  ASP n 
9  264  PRO n 
9  265  GLU n 
9  266  VAL n 
9  267  VAL n 
9  268  PRO n 
9  269  ASP n 
9  270  LEU n 
9  271  VAL n 
9  272  SER n 
9  273  LYS n 
9  274  ALA n 
9  275  ASP n 
9  276  ALA n 
9  277  GLN n 
9  278  VAL n 
9  279  ARG n 
9  280  ALA n 
9  281  LEU n 
9  282  ALA n 
9  283  SER n 
9  284  GLN n 
9  285  ILE n 
9  286  ASP n 
9  287  ASP n 
9  288  GLU n 
9  289  GLU n 
9  290  ALA n 
9  291  LEU n 
9  292  PRO n 
9  293  GLU n 
9  294  GLU n 
9  295  LEU n 
9  296  GLN n 
9  297  GLY n 
9  298  VAL n 
9  299  GLU n 
9  300  ALA n 
9  301  ASP n 
9  302  VAL n 
9  303  ALA n 
9  304  THR n 
9  305  GLU n 
9  306  GLU n 
9  307  PRO n 
9  308  THR n 
9  309  ASP n 
9  310  ASP n 
9  311  GLN n 
9  312  ASP n 
9  313  ASP n 
9  314  ASP n 
9  315  THR n 
9  316  ALA n 
9  317  SER n 
9  318  GLU n 
9  319  ASP n 
9  320  ASP n 
9  321  ALA n 
9  322  ASP n 
9  323  ALA n 
9  324  ASP n 
9  325  ASP n 
9  326  ALA n 
9  327  ALA n 
9  328  GLU n 
9  329  GLU n 
9  330  ALA n 
9  331  ASP n 
9  332  ASP n 
9  333  ASP n 
9  334  ASP n 
9  335  ASP n 
9  336  ASP n 
9  337  ASP n 
9  338  GLU n 
9  339  ASP n 
9  340  ALA n 
9  341  GLY n 
9  342  ASP n 
9  343  ALA n 
9  344  LEU n 
9  345  GLY n 
9  346  ALA n 
9  347  MET n 
9  348  PHE n 
10 1    LYS n 
10 2    PRO n 
10 3    GLY n 
10 4    ALA n 
10 5    MET n 
10 6    TYR n 
10 7    ARG n 
10 8    ASN n 
10 9    SER n 
10 10   SER n 
10 11   LYS n 
10 12   PRO n 
10 13   ALA n 
10 14   TYR n 
10 15   THR n 
10 16   ARG n 
10 17   ARG n 
10 18   GLU n 
10 19   TYR n 
10 20   ILE n 
10 21   SER n 
10 22   GLY n 
10 23   ILE n 
10 24   PRO n 
10 25   GLY n 
10 26   LYS n 
10 27   LYS n 
10 28   ILE n 
10 29   ALA n 
10 30   GLN n 
10 31   PHE n 
10 32   ASP n 
10 33   MET n 
10 34   GLY n 
10 35   ASN n 
10 36   ASN n 
10 37   GLY n 
10 38   ALA n 
10 39   GLY n 
10 40   PRO n 
10 41   THR n 
10 42   TYR n 
10 43   PRO n 
10 44   ALA n 
10 45   GLN n 
10 46   VAL n 
10 47   GLU n 
10 48   LEU n 
10 49   VAL n 
10 50   VAL n 
10 51   GLU n 
10 52   LYS n 
10 53   PRO n 
10 54   VAL n 
10 55   GLN n 
10 56   ILE n 
10 57   ARG n 
10 58   HIS n 
10 59   ASN n 
10 60   ALA n 
10 61   LEU n 
10 62   GLU n 
10 63   ALA n 
10 64   ALA n 
10 65   ARG n 
10 66   VAL n 
10 67   ALA n 
10 68   ALA n 
10 69   ASN n 
10 70   ARG n 
10 71   TYR n 
10 72   VAL n 
10 73   GLN n 
10 74   ASN n 
10 75   SER n 
10 76   GLY n 
10 77   ALA n 
10 78   ALA n 
10 79   ALA n 
10 80   ASN n 
10 81   TYR n 
10 82   LYS n 
10 83   PHE n 
10 84   ARG n 
10 85   ILE n 
10 86   ARG n 
10 87   LYS n 
10 88   PHE n 
10 89   PRO n 
10 90   PHE n 
10 91   HIS n 
10 92   VAL n 
10 93   ILE n 
10 94   ARG n 
10 95   GLU n 
10 96   ASN n 
10 97   LYS n 
10 98   ALA n 
10 99   ALA n 
10 100  ALA n 
10 101  ALA n 
10 102  ALA n 
10 103  ALA n 
10 104  ALA n 
10 105  ALA n 
10 106  ALA n 
10 107  ALA n 
10 108  ALA n 
10 109  ASP n 
10 110  GLY n 
10 111  MET n 
10 112  ARG n 
10 113  ALA n 
10 114  PRO n 
10 115  PHE n 
10 116  GLY n 
10 117  LYS n 
10 118  PRO n 
10 119  VAL n 
10 120  GLY n 
10 121  THR n 
10 122  ALA n 
10 123  ALA n 
10 124  ARG n 
10 125  VAL n 
10 126  HIS n 
10 127  GLY n 
10 128  ALA n 
10 129  ASN n 
10 130  HIS n 
10 131  ILE n 
10 132  PHE n 
10 133  ILE n 
10 134  ALA n 
10 135  TRP n 
10 136  VAL n 
10 137  ASN n 
10 138  PRO n 
10 139  ASP n 
10 140  PRO n 
10 141  ASN n 
10 142  VAL n 
10 143  GLU n 
10 144  GLU n 
10 145  ALA n 
10 146  TRP n 
10 147  ARG n 
10 148  ARG n 
10 149  ALA n 
10 150  LYS n 
10 151  MET n 
10 152  LYS n 
10 153  VAL n 
10 154  THR n 
10 155  PRO n 
10 156  THR n 
10 157  ILE n 
10 158  ASN n 
10 159  ILE n 
10 160  ASP n 
10 161  SER n 
10 162  SER n 
10 163  PRO n 
10 164  ALA n 
10 165  GLY n 
10 166  ASN n 
10 167  ALA n 
11 1    MET n 
11 2    SER n 
11 3    VAL n 
11 4    ALA n 
11 5    GLU n 
11 6    PHE n 
11 7    ASP n 
11 8    ALA n 
11 9    ASP n 
11 10   VAL n 
11 11   ILE n 
11 12   VAL n 
11 13   ASP n 
11 14   ALA n 
11 15   ARG n 
11 16   ASP n 
11 17   CYS n 
11 18   ILE n 
11 19   MET n 
11 20   GLY n 
11 21   ARG n 
11 22   VAL n 
11 23   ALA n 
11 24   SER n 
11 25   GLN n 
11 26   VAL n 
11 27   ALA n 
11 28   GLU n 
11 29   GLN n 
11 30   ALA n 
11 31   LEU n 
11 32   ASP n 
11 33   GLY n 
11 34   GLU n 
11 35   THR n 
11 36   VAL n 
11 37   ALA n 
11 38   VAL n 
11 39   VAL n 
11 40   ASN n 
11 41   ALA n 
11 42   GLU n 
11 43   ARG n 
11 44   ALA n 
11 45   VAL n 
11 46   ILE n 
11 47   THR n 
11 48   GLY n 
11 49   ARG n 
11 50   GLU n 
11 51   GLU n 
11 52   GLN n 
11 53   ILE n 
11 54   VAL n 
11 55   GLU n 
11 56   LYS n 
11 57   TYR n 
11 58   GLU n 
11 59   LYS n 
11 60   ARG n 
11 61   VAL n 
11 62   ASP n 
11 63   ILE n 
11 64   GLY n 
11 65   ASN n 
11 66   ASP n 
11 67   ASN n 
11 68   GLY n 
11 69   TYR n 
11 70   PHE n 
11 71   TYR n 
11 72   PRO n 
11 73   LYS n 
11 74   ARG n 
11 75   PRO n 
11 76   ASP n 
11 77   GLY n 
11 78   ILE n 
11 79   PHE n 
11 80   LYS n 
11 81   ARG n 
11 82   THR n 
11 83   ILE n 
11 84   ARG n 
11 85   GLY n 
11 86   MET n 
11 87   LEU n 
11 88   PRO n 
11 89   HIS n 
11 90   LYS n 
11 91   LYS n 
11 92   GLN n 
11 93   ARG n 
11 94   GLY n 
11 95   ARG n 
11 96   GLU n 
11 97   ALA n 
11 98   PHE n 
11 99   GLU n 
11 100  SER n 
11 101  VAL n 
11 102  ARG n 
11 103  VAL n 
11 104  TYR n 
11 105  LEU n 
11 106  GLY n 
11 107  ASN n 
11 108  PRO n 
11 109  TYR n 
11 110  ASP n 
11 111  GLU n 
11 112  ASP n 
11 113  GLY n 
11 114  GLU n 
11 115  VAL n 
11 116  LEU n 
11 117  ASP n 
11 118  GLY n 
11 119  THR n 
11 120  SER n 
11 121  LEU n 
11 122  ASP n 
11 123  ARG n 
11 124  LEU n 
11 125  SER n 
11 126  ASN n 
11 127  ILE n 
11 128  LYS n 
11 129  PHE n 
11 130  VAL n 
11 131  THR n 
11 132  LEU n 
11 133  GLY n 
11 134  GLU n 
11 135  ILE n 
11 136  SER n 
11 137  GLU n 
11 138  THR n 
11 139  LEU n 
11 140  GLY n 
11 141  ALA n 
11 142  ASN n 
11 143  LYS n 
11 144  THR n 
11 145  TRP n 
12 1    MET n 
12 2    GLU n 
12 3    ALA n 
12 4    LEU n 
12 5    GLY n 
12 6    ALA n 
12 7    ASP n 
12 8    VAL n 
12 9    THR n 
12 10   GLN n 
12 11   GLY n 
12 12   LEU n 
12 13   GLU n 
12 14   LYS n 
12 15   GLY n 
12 16   SER n 
12 17   LEU n 
12 18   ILE n 
12 19   THR n 
12 20   CYS n 
12 21   ALA n 
12 22   ASP n 
12 23   ASN n 
12 24   THR n 
12 25   GLY n 
12 26   ALA n 
12 27   ARG n 
12 28   GLU n 
12 29   LEU n 
12 30   LYS n 
12 31   VAL n 
12 32   ILE n 
12 33   SER n 
12 34   VAL n 
12 35   HIS n 
12 36   GLY n 
12 37   TYR n 
12 38   SER n 
12 39   GLY n 
12 40   THR n 
12 41   LYS n 
12 42   ASN n 
12 43   ARG n 
12 44   HIS n 
12 45   PRO n 
12 46   LYS n 
12 47   ALA n 
12 48   GLY n 
12 49   LEU n 
12 50   GLY n 
12 51   ASP n 
12 52   LYS n 
12 53   ILE n 
12 54   THR n 
12 55   VAL n 
12 56   SER n 
12 57   VAL n 
12 58   THR n 
12 59   LYS n 
12 60   GLY n 
12 61   THR n 
12 62   PRO n 
12 63   GLU n 
12 64   MET n 
12 65   ARG n 
12 66   ARG n 
12 67   GLN n 
12 68   VAL n 
12 69   LEU n 
12 70   GLU n 
12 71   ALA n 
12 72   VAL n 
12 73   VAL n 
12 74   VAL n 
12 75   ARG n 
12 76   GLN n 
12 77   ARG n 
12 78   LYS n 
12 79   PRO n 
12 80   ILE n 
12 81   ARG n 
12 82   ARG n 
12 83   PRO n 
12 84   ASP n 
12 85   GLY n 
12 86   THR n 
12 87   ARG n 
12 88   VAL n 
12 89   LYS n 
12 90   PHE n 
12 91   GLU n 
12 92   ASP n 
12 93   ASN n 
12 94   ALA n 
12 95   ALA n 
12 96   VAL n 
12 97   ILE n 
12 98   VAL n 
12 99   ASP n 
12 100  GLU n 
12 101  ASN n 
12 102  GLU n 
12 103  ASP n 
12 104  PRO n 
12 105  ARG n 
12 106  GLY n 
12 107  THR n 
12 108  GLU n 
12 109  LEU n 
12 110  LYS n 
12 111  GLY n 
12 112  PRO n 
12 113  ILE n 
12 114  ALA n 
12 115  ARG n 
12 116  GLU n 
12 117  VAL n 
12 118  ALA n 
12 119  GLN n 
12 120  ARG n 
12 121  PHE n 
12 122  GLY n 
12 123  SER n 
12 124  VAL n 
12 125  ALA n 
12 126  SER n 
12 127  ALA n 
12 128  ALA n 
12 129  THR n 
12 130  MET n 
12 131  ILE n 
12 132  VAL n 
13 1    THR n 
13 2    SER n 
13 3    LYS n 
13 4    LYS n 
13 5    LYS n 
13 6    ARG n 
13 7    GLN n 
13 8    ARG n 
13 9    GLY n 
13 10   SER n 
13 11   ARG n 
13 12   THR n 
13 13   HIS n 
13 14   GLY n 
13 15   GLY n 
13 16   GLY n 
13 17   SER n 
13 18   HIS n 
13 19   LYS n 
13 20   ASN n 
13 21   ARG n 
13 22   ARG n 
13 23   GLY n 
13 24   ALA n 
13 25   GLY n 
13 26   HIS n 
13 27   ARG n 
13 28   GLY n 
13 29   GLY n 
13 30   ARG n 
13 31   GLY n 
13 32   ASP n 
13 33   ALA n 
13 34   GLY n 
13 35   ARG n 
13 36   ASP n 
13 37   LYS n 
13 38   HIS n 
13 39   GLU n 
13 40   PHE n 
13 41   HIS n 
13 42   ASN n 
13 43   HIS n 
13 44   GLU n 
13 45   PRO n 
13 46   LEU n 
13 47   GLY n 
13 48   LYS n 
13 49   SER n 
13 50   GLY n 
13 51   PHE n 
13 52   LYS n 
13 53   ARG n 
13 54   PRO n 
13 55   GLN n 
13 56   LYS n 
13 57   VAL n 
13 58   GLN n 
13 59   GLU n 
13 60   GLU n 
13 61   ALA n 
13 62   ALA n 
13 63   THR n 
13 64   ILE n 
13 65   ASP n 
13 66   VAL n 
13 67   ARG n 
13 68   GLU n 
13 69   ILE n 
13 70   ASP n 
13 71   GLU n 
13 72   ASN n 
13 73   VAL n 
13 74   THR n 
13 75   LEU n 
13 76   LEU n 
13 77   ALA n 
13 78   ALA n 
13 79   ASP n 
13 80   ASP n 
13 81   VAL n 
13 82   ALA n 
13 83   GLU n 
13 84   VAL n 
13 85   GLU n 
13 86   ASP n 
13 87   GLY n 
13 88   GLY n 
13 89   PHE n 
13 90   ARG n 
13 91   VAL n 
13 92   ASP n 
13 93   VAL n 
13 94   ARG n 
13 95   ASP n 
13 96   VAL n 
13 97   VAL n 
13 98   GLU n 
13 99   GLU n 
13 100  ALA n 
13 101  ASP n 
13 102  ASP n 
13 103  ALA n 
13 104  ASP n 
13 105  TYR n 
13 106  VAL n 
13 107  LYS n 
13 108  VAL n 
13 109  LEU n 
13 110  GLY n 
13 111  ALA n 
13 112  GLY n 
13 113  GLN n 
13 114  VAL n 
13 115  ARG n 
13 116  HIS n 
13 117  GLU n 
13 118  LEU n 
13 119  THR n 
13 120  LEU n 
13 121  ILE n 
13 122  ALA n 
13 123  ASP n 
13 124  ASP n 
13 125  PHE n 
13 126  SER n 
13 127  GLU n 
13 128  GLY n 
13 129  ALA n 
13 130  ARG n 
13 131  GLU n 
13 132  LYS n 
13 133  VAL n 
13 134  GLU n 
13 135  GLY n 
13 136  ALA n 
13 137  GLY n 
13 138  GLY n 
13 139  SER n 
13 140  VAL n 
13 141  GLU n 
13 142  LEU n 
13 143  THR n 
13 144  ASP n 
13 145  LEU n 
13 146  GLY n 
13 147  GLU n 
13 148  GLU n 
13 149  ARG n 
13 150  GLN n 
13 151  ALA n 
13 152  GLU n 
13 153  ALA n 
13 154  GLU n 
13 155  GLU n 
13 156  THR n 
13 157  GLU n 
13 158  ASP n 
13 159  ALA n 
13 160  ASP n 
13 161  ALA n 
13 162  ASP n 
13 163  GLU n 
13 164  GLU n 
14 1    ALA n 
14 2    ARG n 
14 3    SER n 
14 4    ALA n 
14 5    TYR n 
14 6    SER n 
14 7    TYR n 
14 8    ILE n 
14 9    ARG n 
14 10   GLU n 
14 11   ALA n 
14 12   TRP n 
14 13   LYS n 
14 14   ARG n 
14 15   PRO n 
14 16   LYS n 
14 17   GLU n 
14 18   GLY n 
14 19   GLN n 
14 20   ILE n 
14 21   ALA n 
14 22   GLU n 
14 23   LEU n 
14 24   MET n 
14 25   TRP n 
14 26   HIS n 
14 27   ARG n 
14 28   MET n 
14 29   GLN n 
14 30   GLU n 
14 31   TRP n 
14 32   ARG n 
14 33   ASN n 
14 34   GLU n 
14 35   PRO n 
14 36   ALA n 
14 37   VAL n 
14 38   VAL n 
14 39   ARG n 
14 40   ILE n 
14 41   GLU n 
14 42   ARG n 
14 43   PRO n 
14 44   THR n 
14 45   ARG n 
14 46   LEU n 
14 47   ASP n 
14 48   ARG n 
14 49   ALA n 
14 50   ARG n 
14 51   SER n 
14 52   LEU n 
14 53   GLY n 
14 54   TYR n 
14 55   LYS n 
14 56   ALA n 
14 57   LYS n 
14 58   GLN n 
14 59   GLY n 
14 60   ILE n 
14 61   ILE n 
14 62   VAL n 
14 63   VAL n 
14 64   ARG n 
14 65   VAL n 
14 66   ALA n 
14 67   ILE n 
14 68   ARG n 
14 69   LYS n 
14 70   GLY n 
14 71   SER n 
14 72   SER n 
14 73   ARG n 
14 74   ARG n 
14 75   THR n 
14 76   ARG n 
14 77   PHE n 
14 78   ASN n 
14 79   LYS n 
14 80   GLY n 
14 81   ARG n 
14 82   ARG n 
14 83   SER n 
14 84   LYS n 
14 85   ARG n 
14 86   MET n 
14 87   MET n 
14 88   VAL n 
14 89   ASN n 
14 90   ARG n 
14 91   ILE n 
14 92   THR n 
14 93   ARG n 
14 94   LYS n 
14 95   LYS n 
14 96   ASN n 
14 97   ILE n 
14 98   GLN n 
14 99   ARG n 
14 100  ILE n 
14 101  ALA n 
14 102  GLU n 
14 103  GLU n 
14 104  ARG n 
14 105  ALA n 
14 106  ASN n 
14 107  ARG n 
14 108  LYS n 
14 109  PHE n 
14 110  PRO n 
14 111  ASN n 
14 112  LEU n 
14 113  ARG n 
14 114  VAL n 
14 115  LEU n 
14 116  ASN n 
14 117  SER n 
14 118  TYR n 
14 119  SER n 
14 120  VAL n 
14 121  GLY n 
14 122  GLU n 
14 123  ASP n 
14 124  GLY n 
14 125  ARG n 
14 126  HIS n 
14 127  LYS n 
14 128  TRP n 
14 129  HIS n 
14 130  GLU n 
14 131  VAL n 
14 132  ILE n 
14 133  LEU n 
14 134  ILE n 
14 135  ASP n 
14 136  PRO n 
14 137  ASP n 
14 138  HIS n 
14 139  PRO n 
14 140  ALA n 
14 141  ILE n 
14 142  LYS n 
14 143  SER n 
14 144  ASP n 
14 145  ASP n 
14 146  GLN n 
14 147  LEU n 
14 148  SER n 
14 149  TRP n 
14 150  ILE n 
14 151  SER n 
14 152  ARG n 
14 153  THR n 
14 154  ARG n 
14 155  HIS n 
14 156  ARG n 
14 157  LEU n 
14 158  ARG n 
14 159  THR n 
14 160  PHE n 
14 161  ARG n 
14 162  GLY n 
14 163  LEU n 
14 164  THR n 
14 165  SER n 
14 166  ALA n 
14 167  GLY n 
14 168  ARG n 
14 169  ARG n 
14 170  CYS n 
14 171  ARG n 
14 172  GLY n 
14 173  LEU n 
14 174  ARG n 
14 175  GLY n 
14 176  GLN n 
14 177  GLY n 
14 178  LYS n 
14 179  GLY n 
14 180  SER n 
14 181  GLU n 
14 182  LYS n 
14 183  VAL n 
14 184  ARG n 
14 185  PRO n 
14 186  SER n 
14 187  LEU n 
14 188  ARG n 
14 189  VAL n 
14 190  ASN n 
14 191  GLY n 
14 192  ALA n 
14 193  LYS n 
14 194  ALA n 
15 1    ALA n 
15 2    THR n 
15 3    GLY n 
15 4    PRO n 
15 5    ARG n 
15 6    TYR n 
15 7    LYS n 
15 8    VAL n 
15 9    PRO n 
15 10   MET n 
15 11   ARG n 
15 12   ARG n 
15 13   ARG n 
15 14   ARG n 
15 15   GLU n 
15 16   ALA n 
15 17   ARG n 
15 18   THR n 
15 19   ASP n 
15 20   TYR n 
15 21   HIS n 
15 22   GLN n 
15 23   ARG n 
15 24   LEU n 
15 25   ARG n 
15 26   LEU n 
15 27   LEU n 
15 28   LYS n 
15 29   SER n 
15 30   GLY n 
15 31   LYS n 
15 32   PRO n 
15 33   ARG n 
15 34   LEU n 
15 35   VAL n 
15 36   ALA n 
15 37   ARG n 
15 38   LYS n 
15 39   SER n 
15 40   ASN n 
15 41   LYS n 
15 42   HIS n 
15 43   VAL n 
15 44   ARG n 
15 45   ALA n 
15 46   GLN n 
15 47   LEU n 
15 48   VAL n 
15 49   THR n 
15 50   LEU n 
15 51   GLY n 
15 52   PRO n 
15 53   ASN n 
15 54   GLY n 
15 55   ASP n 
15 56   ASP n 
15 57   THR n 
15 58   LEU n 
15 59   ALA n 
15 60   SER n 
15 61   ALA n 
15 62   HIS n 
15 63   SER n 
15 64   SER n 
15 65   ASP n 
15 66   LEU n 
15 67   ALA n 
15 68   GLU n 
15 69   TYR n 
15 70   GLY n 
15 71   TRP n 
15 72   GLU n 
15 73   ALA n 
15 74   PRO n 
15 75   THR n 
15 76   GLY n 
15 77   ASN n 
15 78   MET n 
15 79   PRO n 
15 80   SER n 
15 81   ALA n 
15 82   TYR n 
15 83   LEU n 
15 84   THR n 
15 85   GLY n 
15 86   LEU n 
15 87   LEU n 
15 88   ALA n 
15 89   GLY n 
15 90   LEU n 
15 91   ARG n 
15 92   ALA n 
15 93   GLN n 
15 94   GLU n 
15 95   ALA n 
15 96   GLY n 
15 97   VAL n 
15 98   GLU n 
15 99   GLU n 
15 100  ALA n 
15 101  VAL n 
15 102  LEU n 
15 103  ASP n 
15 104  ILE n 
15 105  GLY n 
15 106  LEU n 
15 107  ASN n 
15 108  SER n 
15 109  PRO n 
15 110  THR n 
15 111  PRO n 
15 112  GLY n 
15 113  SER n 
15 114  LYS n 
15 115  VAL n 
15 116  PHE n 
15 117  ALA n 
15 118  ILE n 
15 119  GLN n 
15 120  GLU n 
15 121  GLY n 
15 122  ALA n 
15 123  ILE n 
15 124  ASP n 
15 125  ALA n 
15 126  GLY n 
15 127  LEU n 
15 128  ASP n 
15 129  ILE n 
15 130  PRO n 
15 131  HIS n 
15 132  ASN n 
15 133  ASP n 
15 134  ASP n 
15 135  VAL n 
15 136  LEU n 
15 137  ALA n 
15 138  ASP n 
15 139  TRP n 
15 140  GLN n 
15 141  ARG n 
15 142  THR n 
15 143  ARG n 
15 144  GLY n 
15 145  ALA n 
15 146  HIS n 
15 147  ILE n 
15 148  ALA n 
15 149  GLU n 
15 150  TYR n 
15 151  ASP n 
15 152  GLU n 
15 153  GLN n 
15 154  LEU n 
15 155  GLU n 
15 156  GLU n 
15 157  PRO n 
15 158  LEU n 
15 159  TYR n 
15 160  SER n 
15 161  GLY n 
15 162  ASP n 
15 163  PHE n 
15 164  ASP n 
15 165  ALA n 
15 166  ALA n 
15 167  ASP n 
15 168  LEU n 
15 169  PRO n 
15 170  GLU n 
15 171  HIS n 
15 172  PHE n 
15 173  ASP n 
15 174  GLU n 
15 175  LEU n 
15 176  ARG n 
15 177  GLU n 
15 178  THR n 
15 179  LEU n 
15 180  LEU n 
15 181  ASP n 
15 182  GLY n 
15 183  ASP n 
15 184  ILE n 
15 185  GLU n 
15 186  LEU n 
16 1    SER n 
16 2    LYS n 
16 3    THR n 
16 4    ASN n 
16 5    PRO n 
16 6    ARG n 
16 7    LEU n 
16 8    SER n 
16 9    SER n 
16 10   LEU n 
16 11   ILE n 
16 12   ALA n 
16 13   ASP n 
16 14   LEU n 
16 15   LYS n 
16 16   SER n 
16 17   ALA n 
16 18   ALA n 
16 19   ARG n 
16 20   SER n 
16 21   SER n 
16 22   GLY n 
16 23   GLY n 
16 24   ALA n 
16 25   VAL n 
16 26   TRP n 
16 27   GLY n 
16 28   ASP n 
16 29   VAL n 
16 30   ALA n 
16 31   GLU n 
16 32   ARG n 
16 33   LEU n 
16 34   GLU n 
16 35   LYS n 
16 36   PRO n 
16 37   ARG n 
16 38   ARG n 
16 39   THR n 
16 40   HIS n 
16 41   ALA n 
16 42   GLU n 
16 43   VAL n 
16 44   ASN n 
16 45   LEU n 
16 46   GLY n 
16 47   ARG n 
16 48   ILE n 
16 49   GLU n 
16 50   ARG n 
16 51   TYR n 
16 52   ALA n 
16 53   GLN n 
16 54   GLU n 
16 55   ASP n 
16 56   GLU n 
16 57   THR n 
16 58   VAL n 
16 59   VAL n 
16 60   VAL n 
16 61   PRO n 
16 62   GLY n 
16 63   LYS n 
16 64   VAL n 
16 65   LEU n 
16 66   GLY n 
16 67   SER n 
16 68   GLY n 
16 69   VAL n 
16 70   LEU n 
16 71   GLN n 
16 72   LYS n 
16 73   ASP n 
16 74   VAL n 
16 75   THR n 
16 76   VAL n 
16 77   ALA n 
16 78   ALA n 
16 79   VAL n 
16 80   ASP n 
16 81   PHE n 
16 82   SER n 
16 83   GLY n 
16 84   THR n 
16 85   ALA n 
16 86   GLU n 
16 87   THR n 
16 88   LYS n 
16 89   ILE n 
16 90   ASP n 
16 91   GLN n 
16 92   VAL n 
16 93   GLY n 
16 94   GLU n 
16 95   ALA n 
16 96   VAL n 
16 97   SER n 
16 98   LEU n 
16 99   GLU n 
16 100  GLN n 
16 101  ALA n 
16 102  ILE n 
16 103  GLU n 
16 104  ASN n 
16 105  ASN n 
16 106  PRO n 
16 107  GLU n 
16 108  GLY n 
16 109  SER n 
16 110  HIS n 
16 111  VAL n 
16 112  ARG n 
16 113  VAL n 
16 114  ILE n 
16 115  ARG n 
17 1    THR n 
17 2    ASP n 
17 3    LEU n 
17 4    SER n 
17 5    ALA n 
17 6    GLN n 
17 7    LYS n 
17 8    ARG n 
17 9    LEU n 
17 10   ALA n 
17 11   ALA n 
17 12   ASP n 
17 13   VAL n 
17 14   LEU n 
17 15   ASP n 
17 16   VAL n 
17 17   GLY n 
17 18   LYS n 
17 19   ASN n 
17 20   ARG n 
17 21   VAL n 
17 22   TRP n 
17 23   PHE n 
17 24   ASN n 
17 25   PRO n 
17 26   GLU n 
17 27   ARG n 
17 28   GLN n 
17 29   GLY n 
17 30   ASP n 
17 31   ILE n 
17 32   ALA n 
17 33   ASP n 
17 34   ALA n 
17 35   ILE n 
17 36   THR n 
17 37   ARG n 
17 38   GLU n 
17 39   ASP n 
17 40   VAL n 
17 41   ARG n 
17 42   GLU n 
17 43   LEU n 
17 44   VAL n 
17 45   ASP n 
17 46   GLU n 
17 47   GLY n 
17 48   ALA n 
17 49   ILE n 
17 50   GLN n 
17 51   ALA n 
17 52   LYS n 
17 53   ASP n 
17 54   LYS n 
17 55   LYS n 
17 56   GLY n 
17 57   ASN n 
17 58   SER n 
17 59   ARG n 
17 60   GLY n 
17 61   ARG n 
17 62   ALA n 
17 63   ARG n 
17 64   GLU n 
17 65   ARG n 
17 66   GLN n 
17 67   LYS n 
17 68   LYS n 
17 69   ARG n 
17 70   ALA n 
17 71   LYS n 
17 72   GLY n 
17 73   HIS n 
17 74   GLN n 
17 75   LYS n 
17 76   GLY n 
17 77   ALA n 
17 78   GLY n 
17 79   SER n 
17 80   ARG n 
17 81   LYS n 
17 82   GLY n 
17 83   LYS n 
17 84   ALA n 
17 85   GLY n 
17 86   ALA n 
17 87   ARG n 
17 88   GLN n 
17 89   ASN n 
17 90   SER n 
17 91   LYS n 
17 92   GLU n 
17 93   ASP n 
17 94   TRP n 
17 95   GLU n 
17 96   SER n 
17 97   ARG n 
17 98   ILE n 
17 99   ARG n 
17 100  ALA n 
17 101  GLN n 
17 102  ARG n 
17 103  THR n 
17 104  LYS n 
17 105  LEU n 
17 106  ARG n 
17 107  GLU n 
17 108  LEU n 
17 109  ARG n 
17 110  ASP n 
17 111  GLU n 
17 112  GLY n 
17 113  THR n 
17 114  LEU n 
17 115  SER n 
17 116  SER n 
17 117  SER n 
17 118  GLN n 
17 119  TYR n 
17 120  ARG n 
17 121  ASP n 
17 122  LEU n 
17 123  TYR n 
17 124  ASP n 
17 125  LYS n 
17 126  ALA n 
17 127  GLY n 
17 128  GLY n 
17 129  GLY n 
17 130  GLU n 
17 131  PHE n 
17 132  ASP n 
17 133  SER n 
17 134  VAL n 
17 135  ALA n 
17 136  ASP n 
17 137  LEU n 
17 138  GLU n 
17 139  ARG n 
17 140  TYR n 
17 141  ILE n 
17 142  ASP n 
17 143  ALA n 
17 144  ASN n 
17 145  HIS n 
17 146  GLY n 
17 147  ASP n 
17 148  ALA n 
18 1    PRO n 
18 2    SER n 
18 3    SER n 
18 4    ASN n 
18 5    GLY n 
18 6    PRO n 
18 7    LEU n 
18 8    GLU n 
18 9    GLY n 
18 10   THR n 
18 11   ARG n 
18 12   GLY n 
18 13   LYS n 
18 14   LEU n 
18 15   LYS n 
18 16   ASN n 
18 17   LYS n 
18 18   PRO n 
18 19   ARG n 
18 20   ASP n 
18 21   ARG n 
18 22   GLY n 
18 23   THR n 
18 24   SER n 
18 25   PRO n 
18 26   PRO n 
18 27   GLN n 
18 28   ARG n 
18 29   ALA n 
18 30   VAL n 
18 31   GLU n 
18 32   GLU n 
18 33   PHE n 
18 34   ASP n 
18 35   ASP n 
18 36   GLY n 
18 37   GLU n 
18 38   LYS n 
18 39   VAL n 
18 40   HIS n 
18 41   LEU n 
18 42   LYS n 
18 43   ILE n 
18 44   ASP n 
18 45   PRO n 
18 46   SER n 
18 47   VAL n 
18 48   PRO n 
18 49   ASN n 
18 50   GLY n 
18 51   ARG n 
18 52   PHE n 
18 53   HIS n 
18 54   PRO n 
18 55   ARG n 
18 56   PHE n 
18 57   ASP n 
18 58   GLY n 
18 59   GLN n 
18 60   THR n 
18 61   GLY n 
18 62   THR n 
18 63   VAL n 
18 64   GLU n 
18 65   GLY n 
18 66   LYS n 
18 67   GLN n 
18 68   GLY n 
18 69   ASP n 
18 70   ALA n 
18 71   TYR n 
18 72   LYS n 
18 73   VAL n 
18 74   ASP n 
18 75   ILE n 
18 76   VAL n 
18 77   ASP n 
18 78   GLY n 
18 79   GLY n 
18 80   LYS n 
18 81   GLU n 
18 82   LYS n 
18 83   THR n 
18 84   ILE n 
18 85   ILE n 
18 86   VAL n 
18 87   THR n 
18 88   ALA n 
18 89   ALA n 
18 90   HIS n 
18 91   LEU n 
18 92   ARG n 
18 93   ARG n 
18 94   GLN n 
18 95   GLU n 
19 1    GLY n 
19 2    ILE n 
19 3    SER n 
19 4    TYR n 
19 5    SER n 
19 6    VAL n 
19 7    GLU n 
19 8    ALA n 
19 9    ASP n 
19 10   PRO n 
19 11   ASP n 
19 12   THR n 
19 13   THR n 
19 14   ALA n 
19 15   LYS n 
19 16   ALA n 
19 17   MET n 
19 18   LEU n 
19 19   ARG n 
19 20   GLU n 
19 21   ARG n 
19 22   GLN n 
19 23   MET n 
19 24   SER n 
19 25   PHE n 
19 26   LYS n 
19 27   HIS n 
19 28   SER n 
19 29   LYS n 
19 30   ALA n 
19 31   ILE n 
19 32   ALA n 
19 33   ARG n 
19 34   GLU n 
19 35   ILE n 
19 36   LYS n 
19 37   GLY n 
19 38   LYS n 
19 39   THR n 
19 40   ALA n 
19 41   GLY n 
19 42   GLU n 
19 43   ALA n 
19 44   VAL n 
19 45   ASP n 
19 46   TYR n 
19 47   LEU n 
19 48   GLU n 
19 49   ALA n 
19 50   VAL n 
19 51   ILE n 
19 52   GLU n 
19 53   GLY n 
19 54   ASP n 
19 55   GLN n 
19 56   PRO n 
19 57   VAL n 
19 58   PRO n 
19 59   PHE n 
19 60   LYS n 
19 61   GLN n 
19 62   HIS n 
19 63   ASN n 
19 64   SER n 
19 65   GLY n 
19 66   VAL n 
19 67   GLY n 
19 68   HIS n 
19 69   LYS n 
19 70   SER n 
19 71   LYS n 
19 72   VAL n 
19 73   ASP n 
19 74   GLY n 
19 75   TRP n 
19 76   ASP n 
19 77   ALA n 
19 78   GLY n 
19 79   ARG n 
19 80   TYR n 
19 81   PRO n 
19 82   GLU n 
19 83   LYS n 
19 84   ALA n 
19 85   SER n 
19 86   LYS n 
19 87   ALA n 
19 88   PHE n 
19 89   LEU n 
19 90   ASP n 
19 91   LEU n 
19 92   LEU n 
19 93   GLU n 
19 94   ASN n 
19 95   ALA n 
19 96   VAL n 
19 97   GLY n 
19 98   ASN n 
19 99   ALA n 
19 100  ASP n 
19 101  HIS n 
19 102  GLN n 
19 103  GLY n 
19 104  PHE n 
19 105  ASP n 
19 106  GLY n 
19 107  GLU n 
19 108  ALA n 
19 109  MET n 
19 110  THR n 
19 111  ILE n 
19 112  LYS n 
19 113  HIS n 
19 114  VAL n 
19 115  ALA n 
19 116  ALA n 
19 117  HIS n 
19 118  LYS n 
19 119  VAL n 
19 120  GLY n 
19 121  GLU n 
19 122  GLN n 
19 123  GLN n 
19 124  GLY n 
19 125  ARG n 
19 126  LYS n 
19 127  PRO n 
19 128  ARG n 
19 129  ALA n 
19 130  MET n 
19 131  GLY n 
19 132  ARG n 
19 133  ALA n 
19 134  SER n 
19 135  ALA n 
19 136  TRP n 
19 137  ASN n 
19 138  SER n 
19 139  PRO n 
19 140  GLN n 
19 141  VAL n 
19 142  ASP n 
19 143  VAL n 
19 144  GLU n 
19 145  LEU n 
19 146  ILE n 
19 147  LEU n 
19 148  GLU n 
19 149  GLU n 
19 150  PRO n 
19 151  GLU n 
19 152  VAL n 
19 153  GLU n 
19 154  ASP n 
20 1    SER n 
20 2    TRP n 
20 3    ASP n 
20 4    VAL n 
20 5    ILE n 
20 6    LYS n 
20 7    HIS n 
20 8    PRO n 
20 9    HIS n 
20 10   VAL n 
20 11   THR n 
20 12   GLU n 
20 13   LYS n 
20 14   ALA n 
20 15   MET n 
20 16   ASN n 
20 17   ASP n 
20 18   MET n 
20 19   ASP n 
20 20   PHE n 
20 21   GLN n 
20 22   ASN n 
20 23   LYS n 
20 24   LEU n 
20 25   GLN n 
20 26   PHE n 
20 27   ALA n 
20 28   VAL n 
20 29   ASP n 
20 30   ASP n 
20 31   ARG n 
20 32   ALA n 
20 33   SER n 
20 34   LYS n 
20 35   GLY n 
20 36   GLU n 
20 37   VAL n 
20 38   ALA n 
20 39   ASP n 
20 40   ALA n 
20 41   VAL n 
20 42   GLU n 
20 43   GLU n 
20 44   GLN n 
20 45   TYR n 
20 46   ASP n 
20 47   VAL n 
20 48   THR n 
20 49   VAL n 
20 50   GLU n 
20 51   GLN n 
20 52   VAL n 
20 53   ASN n 
20 54   THR n 
20 55   GLN n 
20 56   ASN n 
20 57   THR n 
20 58   MET n 
20 59   ASP n 
20 60   GLY n 
20 61   GLU n 
20 62   LYS n 
20 63   LYS n 
20 64   ALA n 
20 65   VAL n 
20 66   VAL n 
20 67   ARG n 
20 68   LEU n 
20 69   SER n 
20 70   GLU n 
20 71   ASP n 
20 72   ASP n 
20 73   ASP n 
20 74   ALA n 
20 75   GLN n 
20 76   GLU n 
20 77   VAL n 
20 78   ALA n 
20 79   SER n 
20 80   ARG n 
20 81   ILE n 
20 82   GLY n 
20 83   VAL n 
20 84   PHE n 
21 1    SER n 
21 2    LYS n 
21 3    GLN n 
21 4    PRO n 
21 5    ASP n 
21 6    LYS n 
21 7    GLN n 
21 8    ARG n 
21 9    LYS n 
21 10   SER n 
21 11   GLN n 
21 12   ARG n 
21 13   ARG n 
21 14   ALA n 
21 15   PRO n 
21 16   LEU n 
21 17   HIS n 
21 18   GLU n 
21 19   ARG n 
21 20   HIS n 
21 21   LYS n 
21 22   GLN n 
21 23   VAL n 
21 24   ARG n 
21 25   ALA n 
21 26   THR n 
21 27   LEU n 
21 28   SER n 
21 29   ALA n 
21 30   ASP n 
21 31   LEU n 
21 32   ARG n 
21 33   GLU n 
21 34   GLU n 
21 35   TYR n 
21 36   GLY n 
21 37   GLN n 
21 38   ARG n 
21 39   ASN n 
21 40   VAL n 
21 41   ARG n 
21 42   VAL n 
21 43   ASN n 
21 44   ALA n 
21 45   GLY n 
21 46   ASP n 
21 47   THR n 
21 48   VAL n 
21 49   GLU n 
21 50   VAL n 
21 51   LEU n 
21 52   ARG n 
21 53   GLY n 
21 54   ASP n 
21 55   PHE n 
21 56   ALA n 
21 57   GLY n 
21 58   GLU n 
21 59   GLU n 
21 60   GLY n 
21 61   GLU n 
21 62   VAL n 
21 63   ILE n 
21 64   ASN n 
21 65   VAL n 
21 66   ASP n 
21 67   LEU n 
21 68   ASP n 
21 69   LYS n 
21 70   ALA n 
21 71   VAL n 
21 72   ILE n 
21 73   HIS n 
21 74   VAL n 
21 75   GLU n 
21 76   ASP n 
21 77   VAL n 
21 78   THR n 
21 79   LEU n 
21 80   GLU n 
21 81   LYS n 
21 82   THR n 
21 83   ASP n 
21 84   GLY n 
21 85   GLU n 
21 86   GLU n 
21 87   VAL n 
21 88   PRO n 
21 89   ARG n 
21 90   PRO n 
21 91   LEU n 
21 92   ASP n 
21 93   THR n 
21 94   SER n 
21 95   ASN n 
21 96   VAL n 
21 97   ARG n 
21 98   VAL n 
21 99   THR n 
21 100  ASP n 
21 101  LEU n 
21 102  ASP n 
21 103  LEU n 
21 104  GLU n 
21 105  ASP n 
21 106  GLU n 
21 107  LYS n 
21 108  ARG n 
21 109  GLU n 
21 110  ALA n 
21 111  ARG n 
21 112  LEU n 
21 113  GLU n 
21 114  SER n 
21 115  GLU n 
21 116  ASP n 
21 117  ASP n 
21 118  SER n 
21 119  ALA n 
22 1    PRO n 
22 2    ARG n 
22 3    THR n 
22 4    ARG n 
22 5    GLU n 
22 6    CYS n 
22 7    ASP n 
22 8    TYR n 
22 9    CYS n 
22 10   GLY n 
22 11   THR n 
22 12   ASP n 
22 13   ILE n 
22 14   GLU n 
22 15   PRO n 
22 16   GLY n 
22 17   THR n 
22 18   GLY n 
22 19   THR n 
22 20   MET n 
22 21   PHE n 
22 22   VAL n 
22 23   HIS n 
22 24   LYS n 
22 25   ASP n 
22 26   GLY n 
22 27   ALA n 
22 28   THR n 
22 29   THR n 
22 30   HIS n 
22 31   PHE n 
22 32   CYS n 
22 33   SER n 
22 34   SER n 
22 35   LYS n 
22 36   CYS n 
22 37   GLU n 
22 38   ASN n 
22 39   ASN n 
22 40   ALA n 
22 41   ASP n 
22 42   LEU n 
22 43   GLY n 
22 44   ARG n 
22 45   GLU n 
22 46   ALA n 
22 47   ARG n 
22 48   ASN n 
22 49   LEU n 
22 50   GLU n 
22 51   TRP n 
22 52   THR n 
22 53   ASP n 
22 54   THR n 
22 55   ALA n 
22 56   ARG n 
22 57   GLY n 
22 58   GLU n 
22 59   ALA n 
22 60   GLY n 
22 61   GLU n 
22 62   ALA n 
22 63   GLU n 
22 64   ASP n 
22 65   GLU n 
22 66   ALA n 
23 1    THR n 
23 2    VAL n 
23 3    LEU n 
23 4    HIS n 
23 5    VAL n 
23 6    GLN n 
23 7    GLU n 
23 8    ILE n 
23 9    ARG n 
23 10   ASP n 
23 11   MET n 
23 12   THR n 
23 13   PRO n 
23 14   ALA n 
23 15   GLU n 
23 16   ARG n 
23 17   GLU n 
23 18   ALA n 
23 19   GLU n 
23 20   LEU n 
23 21   ASP n 
23 22   ASP n 
23 23   LEU n 
23 24   LYS n 
23 25   THR n 
23 26   GLU n 
23 27   LEU n 
23 28   LEU n 
23 29   ASN n 
23 30   ALA n 
23 31   ARG n 
23 32   ALA n 
23 33   VAL n 
23 34   GLN n 
23 35   ALA n 
23 36   ALA n 
23 37   GLY n 
23 38   GLY n 
23 39   ALA n 
23 40   PRO n 
23 41   GLU n 
23 42   ASN n 
23 43   PRO n 
23 44   GLY n 
23 45   ARG n 
23 46   ILE n 
23 47   LYS n 
23 48   GLU n 
23 49   LEU n 
23 50   ARG n 
23 51   LYS n 
23 52   ALA n 
23 53   ILE n 
23 54   ALA n 
23 55   ARG n 
23 56   ILE n 
23 57   LYS n 
23 58   THR n 
23 59   ILE n 
23 60   GLN n 
23 61   GLY n 
23 62   GLU n 
23 63   GLU n 
23 64   GLY n 
23 65   ASP n 
23 66   LEU n 
23 67   GLN n 
23 68   GLU n 
23 69   ASN n 
23 70   GLU n 
24 1    MET n 
24 2    HIS n 
24 3    ALA n 
24 4    LEU n 
24 5    VAL n 
24 6    GLN n 
24 7    LEU n 
24 8    ARG n 
24 9    GLY n 
24 10   GLU n 
24 11   VAL n 
24 12   ASN n 
24 13   MET n 
24 14   HIS n 
24 15   THR n 
24 16   ASP n 
24 17   ILE n 
24 18   GLN n 
24 19   ASP n 
24 20   THR n 
24 21   LEU n 
24 22   GLU n 
24 23   MET n 
24 24   LEU n 
24 25   ASN n 
24 26   ILE n 
24 27   HIS n 
24 28   HIS n 
24 29   VAL n 
24 30   ASN n 
24 31   HIS n 
24 32   CYS n 
24 33   THR n 
24 34   LEU n 
24 35   VAL n 
24 36   PRO n 
24 37   GLU n 
24 38   THR n 
24 39   ASP n 
24 40   ALA n 
24 41   TYR n 
24 42   ARG n 
24 43   GLY n 
24 44   MET n 
24 45   VAL n 
24 46   ALA n 
24 47   LYS n 
24 48   VAL n 
24 49   ASN n 
24 50   ASP n 
24 51   PHE n 
24 52   VAL n 
24 53   ALA n 
24 54   PHE n 
24 55   GLY n 
24 56   GLU n 
24 57   PRO n 
24 58   SER n 
24 59   GLN n 
24 60   GLU n 
24 61   THR n 
24 62   LEU n 
24 63   GLU n 
24 64   THR n 
24 65   VAL n 
24 66   LEU n 
24 67   ALA n 
24 68   THR n 
24 69   ARG n 
24 70   ALA n 
24 71   GLU n 
24 72   PRO n 
24 73   LEU n 
24 74   GLU n 
24 75   GLY n 
24 76   ASP n 
24 77   ALA n 
24 78   ASP n 
24 79   VAL n 
24 80   ASP n 
24 81   ASP n 
24 82   GLU n 
24 83   TRP n 
24 84   VAL n 
24 85   ALA n 
24 86   GLU n 
24 87   HIS n 
24 88   THR n 
24 89   ASP n 
24 90   TYR n 
24 91   ASP n 
24 92   ASP n 
24 93   ILE n 
24 94   SER n 
24 95   GLY n 
24 96   LEU n 
24 97   ALA n 
24 98   PHE n 
24 99   ALA n 
24 100  LEU n 
24 101  LEU n 
24 102  SER n 
24 103  GLU n 
24 104  GLU n 
24 105  THR n 
24 106  THR n 
24 107  LEU n 
24 108  ARG n 
24 109  GLU n 
24 110  GLN n 
24 111  GLY n 
24 112  LEU n 
24 113  SER n 
24 114  PRO n 
24 115  THR n 
24 116  LEU n 
24 117  ARG n 
24 118  LEU n 
24 119  HIS n 
24 120  PRO n 
24 121  PRO n 
24 122  ARG n 
24 123  GLY n 
24 124  GLY n 
24 125  HIS n 
24 126  ASP n 
24 127  GLY n 
24 128  VAL n 
24 129  LYS n 
24 130  HIS n 
24 131  PRO n 
24 132  VAL n 
24 133  LYS n 
24 134  GLU n 
24 135  GLY n 
24 136  GLY n 
24 137  GLN n 
24 138  LEU n 
24 139  GLY n 
24 140  LYS n 
24 141  HIS n 
24 142  ASP n 
24 143  THR n 
24 144  GLU n 
24 145  GLY n 
24 146  ILE n 
24 147  ASP n 
24 148  ASP n 
24 149  LEU n 
24 150  LEU n 
24 151  GLU n 
24 152  ALA n 
24 153  MET n 
24 154  ARG n 
25 1    SER n 
25 2    ALA n 
25 3    SER n 
25 4    ASP n 
25 5    PHE n 
25 6    GLU n 
25 7    GLU n 
25 8    ARG n 
25 9    VAL n 
25 10   VAL n 
25 11   THR n 
25 12   ILE n 
25 13   PRO n 
25 14   LEU n 
25 15   ARG n 
25 16   ASP n 
25 17   ALA n 
25 18   ARG n 
25 19   ALA n 
25 20   GLU n 
25 21   PRO n 
25 22   ASN n 
25 23   HIS n 
25 24   LYS n 
25 25   ARG n 
25 26   ALA n 
25 27   ASP n 
25 28   LYS n 
25 29   ALA n 
25 30   MET n 
25 31   ILE n 
25 32   LEU n 
25 33   ILE n 
25 34   ARG n 
25 35   GLU n 
25 36   HIS n 
25 37   LEU n 
25 38   ALA n 
25 39   LYS n 
25 40   HIS n 
25 41   PHE n 
25 42   SER n 
25 43   VAL n 
25 44   ASP n 
25 45   GLU n 
25 46   ASP n 
25 47   ALA n 
25 48   VAL n 
25 49   ARG n 
25 50   LEU n 
25 51   ASP n 
25 52   PRO n 
25 53   SER n 
25 54   ILE n 
25 55   ASN n 
25 56   GLU n 
25 57   ALA n 
25 58   ALA n 
25 59   TRP n 
25 60   ALA n 
25 61   ARG n 
25 62   GLY n 
25 63   ARG n 
25 64   ALA n 
25 65   ASN n 
25 66   THR n 
25 67   PRO n 
25 68   SER n 
25 69   LYS n 
25 70   ILE n 
25 71   ARG n 
25 72   VAL n 
25 73   ARG n 
25 74   ALA n 
25 75   ALA n 
25 76   ARG n 
25 77   PHE n 
25 78   GLU n 
25 79   GLU n 
25 80   GLU n 
25 81   GLY n 
25 82   GLU n 
25 83   ALA n 
25 84   ILE n 
25 85   VAL n 
25 86   GLU n 
25 87   ALA n 
25 88   GLU n 
25 89   THR n 
25 90   ALA n 
25 91   GLU n 
26 1    ALA n 
26 2    ASP n 
26 3    ASN n 
26 4    GLU n 
26 5    GLU n 
26 6    ASP n 
26 7    VAL n 
26 8    GLU n 
26 9    ALA n 
26 10   GLU n 
26 11   GLU n 
26 12   GLU n 
26 13   TYR n 
26 14   THR n 
26 15   GLU n 
26 16   LEU n 
26 17   THR n 
26 18   ASP n 
26 19   ILE n 
26 20   SER n 
26 21   GLY n 
26 22   VAL n 
26 23   GLY n 
26 24   PRO n 
26 25   SER n 
26 26   LYS n 
26 27   ALA n 
26 28   GLU n 
26 29   SER n 
26 30   LEU n 
26 31   ARG n 
26 32   GLU n 
26 33   ALA n 
26 34   GLY n 
26 35   PHE n 
26 36   GLU n 
26 37   SER n 
26 38   VAL n 
26 39   GLU n 
26 40   ASP n 
26 41   VAL n 
26 42   ARG n 
26 43   GLY n 
26 44   ALA n 
26 45   ASP n 
26 46   GLN n 
26 47   SER n 
26 48   ALA n 
26 49   LEU n 
26 50   ALA n 
26 51   ASP n 
26 52   VAL n 
26 53   SER n 
26 54   GLY n 
26 55   ILE n 
26 56   GLY n 
26 57   ASN n 
26 58   ALA n 
26 59   LEU n 
26 60   ALA n 
26 61   ALA n 
26 62   ARG n 
26 63   ILE n 
26 64   LYS n 
26 65   ALA n 
26 66   ASP n 
26 67   VAL n 
26 68   GLY n 
26 69   GLY n 
26 70   LEU n 
26 71   GLU n 
26 72   VAL n 
26 73   GLU n 
26 74   SER n 
26 75   GLU n 
26 76   THR n 
26 77   GLU n 
26 78   ALA n 
26 79   GLU n 
26 80   VAL n 
26 81   GLU n 
26 82   GLU n 
26 83   GLU n 
26 84   GLY n 
26 85   GLY n 
26 86   GLU n 
26 87   GLU n 
26 88   ALA n 
26 89   PRO n 
26 90   ASP n 
26 91   GLU n 
26 92   ASP n 
26 93   VAL n 
26 94   GLU n 
26 95   THR n 
26 96   GLU n 
26 97   LEU n 
26 98   GLN n 
26 99   ALA n 
26 100  ARG n 
26 101  GLY n 
26 102  LEU n 
26 103  THR n 
26 104  GLU n 
26 105  LYS n 
26 106  THR n 
26 107  PRO n 
26 108  ASP n 
26 109  LEU n 
26 110  SER n 
26 111  ASP n 
26 112  GLU n 
26 113  ASP n 
26 114  ALA n 
26 115  ARG n 
26 116  LEU n 
26 117  LEU n 
26 118  THR n 
26 119  GLN n 
26 120  ARG n 
26 121  HIS n 
26 122  ARG n 
26 123  VAL n 
26 124  GLY n 
26 125  LYS n 
26 126  PRO n 
26 127  GLN n 
26 128  PHE n 
26 129  ASN n 
26 130  ARG n 
26 131  GLN n 
26 132  ASP n 
26 133  HIS n 
26 134  HIS n 
26 135  LYS n 
26 136  LYS n 
26 137  LYS n 
26 138  ARG n 
26 139  VAL n 
26 140  SER n 
26 141  THR n 
26 142  SER n 
26 143  TRP n 
26 144  ARG n 
26 145  LYS n 
26 146  PRO n 
26 147  ARG n 
26 148  GLY n 
26 149  GLN n 
26 150  LEU n 
26 151  SER n 
26 152  LYS n 
26 153  GLN n 
26 154  ARG n 
26 155  ARG n 
26 156  GLY n 
26 157  ILE n 
26 158  LYS n 
26 159  GLY n 
26 160  LYS n 
26 161  GLY n 
26 162  ASP n 
26 163  THR n 
26 164  VAL n 
26 165  GLU n 
26 166  ALA n 
26 167  GLY n 
26 168  PHE n 
26 169  ARG n 
26 170  SER n 
26 171  PRO n 
26 172  THR n 
26 173  ALA n 
26 174  VAL n 
26 175  ARG n 
26 176  GLY n 
26 177  LYS n 
26 178  HIS n 
26 179  PRO n 
26 180  SER n 
26 181  GLY n 
26 182  PHE n 
26 183  GLU n 
26 184  GLU n 
26 185  VAL n 
26 186  ARG n 
26 187  VAL n 
26 188  HIS n 
26 189  ASN n 
26 190  VAL n 
26 191  ASP n 
26 192  ASP n 
26 193  LEU n 
26 194  GLU n 
26 195  GLY n 
26 196  VAL n 
26 197  ASP n 
26 198  GLY n 
26 199  ASP n 
26 200  THR n 
26 201  GLU n 
26 202  ALA n 
26 203  VAL n 
26 204  ARG n 
26 205  ILE n 
26 206  ALA n 
26 207  SER n 
26 208  LYS n 
26 209  VAL n 
26 210  GLY n 
26 211  ALA n 
26 212  ARG n 
26 213  LYS n 
26 214  ARG n 
26 215  GLU n 
26 216  ARG n 
26 217  ILE n 
26 218  GLU n 
26 219  GLU n 
26 220  GLU n 
26 221  ALA n 
26 222  GLU n 
26 223  ASP n 
26 224  ALA n 
26 225  GLY n 
26 226  ILE n 
26 227  ARG n 
26 228  VAL n 
26 229  LEU n 
26 230  ASN n 
26 231  PRO n 
26 232  THR n 
26 233  TYR n 
26 234  VAL n 
26 235  GLU n 
26 236  VAL n 
26 237  GLU n 
26 238  VAL n 
26 239  SER n 
26 240  GLU n 
27 1    ARG n 
27 2    THR n 
27 3    GLY n 
27 4    ARG n 
27 5    PHE n 
27 6    GLY n 
27 7    PRO n 
27 8    ARG n 
27 9    TYR n 
27 10   GLY n 
27 11   LEU n 
27 12   LYS n 
27 13   ILE n 
27 14   ARG n 
27 15   VAL n 
27 16   ARG n 
27 17   VAL n 
27 18   ALA n 
27 19   ASP n 
27 20   VAL n 
27 21   GLU n 
27 22   ILE n 
27 23   LYS n 
27 24   HIS n 
27 25   LYS n 
27 26   LYS n 
27 27   LYS n 
27 28   HIS n 
27 29   LYS n 
27 30   CYS n 
27 31   PRO n 
27 32   VAL n 
27 33   CYS n 
27 34   GLY n 
27 35   PHE n 
27 36   LYS n 
27 37   LYS n 
27 38   LEU n 
27 39   LYS n 
27 40   ARG n 
27 41   ALA n 
27 42   GLY n 
27 43   THR n 
27 44   GLY n 
27 45   ILE n 
27 46   TRP n 
27 47   MET n 
27 48   CYS n 
27 49   GLY n 
27 50   HIS n 
27 51   CYS n 
27 52   GLY n 
27 53   TYR n 
27 54   LYS n 
27 55   ILE n 
27 56   ALA n 
27 57   GLY n 
27 58   GLY n 
27 59   CYS n 
27 60   TYR n 
27 61   GLN n 
27 62   PRO n 
27 63   GLU n 
27 64   THR n 
27 65   VAL n 
27 66   ALA n 
27 67   GLY n 
27 68   LYS n 
27 69   ALA n 
27 70   VAL n 
27 71   MET n 
27 72   LYS n 
27 73   ALA n 
28 1    THR n 
28 2    GLY n 
28 3    ALA n 
28 4    GLY n 
28 5    THR n 
28 6    PRO n 
28 7    SER n 
28 8    GLN n 
28 9    GLY n 
28 10   LYS n 
28 11   LYS n 
28 12   ASN n 
28 13   THR n 
28 14   THR n 
28 15   THR n 
28 16   HIS n 
28 17   THR n 
28 18   LYS n 
28 19   CYS n 
28 20   ARG n 
28 21   ARG n 
28 22   CYS n 
28 23   GLY n 
28 24   GLU n 
28 25   LYS n 
28 26   SER n 
28 27   TYR n 
28 28   HIS n 
28 29   THR n 
28 30   LYS n 
28 31   LYS n 
28 32   LYS n 
28 33   VAL n 
28 34   CYS n 
28 35   SER n 
28 36   SER n 
28 37   CYS n 
28 38   GLY n 
28 39   PHE n 
28 40   GLY n 
28 41   LYS n 
28 42   SER n 
28 43   ALA n 
28 44   LYS n 
28 45   ARG n 
28 46   ARG n 
28 47   ASP n 
28 48   TYR n 
28 49   GLU n 
28 50   TRP n 
28 51   GLN n 
28 52   SER n 
28 53   LYS n 
28 54   ALA n 
28 55   GLY n 
28 56   GLU n 
29 1    GLY n 
29 2    LYS n 
29 3    LYS n 
29 4    SER n 
29 5    LYS n 
29 6    ALA n 
29 7    THR n 
29 8    LYS n 
29 9    LYS n 
29 10   ARG n 
29 11   LEU n 
29 12   ALA n 
29 13   LYS n 
29 14   LEU n 
29 15   ASP n 
29 16   ASN n 
29 17   GLN n 
29 18   ASN n 
29 19   SER n 
29 20   ARG n 
29 21   VAL n 
29 22   PRO n 
29 23   ALA n 
29 24   TRP n 
29 25   VAL n 
29 26   MET n 
29 27   LEU n 
29 28   LYS n 
29 29   THR n 
29 30   ASP n 
29 31   GLU n 
29 32   VAL n 
29 33   GLN n 
29 34   ARG n 
29 35   ASN n 
29 36   HIS n 
29 37   LYS n 
29 38   ARG n 
29 39   ARG n 
29 40   HIS n 
29 41   TRP n 
29 42   ARG n 
29 43   ARG n 
29 44   ASN n 
29 45   ASP n 
29 46   THR n 
29 47   ASP n 
29 48   GLU n 
30 1    MET n 
30 2    GLN n 
30 3    MET n 
30 4    PRO n 
30 5    ARG n 
30 6    ARG n 
30 7    PHE n 
30 8    ASN n 
30 9    THR n 
30 10   TYR n 
30 11   CYS n 
30 12   PRO n 
30 13   HIS n 
30 14   CYS n 
30 15   ASN n 
30 16   GLU n 
30 17   HIS n 
30 18   GLN n 
30 19   GLU n 
30 20   HIS n 
30 21   GLU n 
30 22   VAL n 
30 23   GLU n 
30 24   LYS n 
30 25   VAL n 
30 26   ARG n 
30 27   SER n 
30 28   GLY n 
30 29   ARG n 
30 30   GLN n 
30 31   THR n 
30 32   GLY n 
30 33   MET n 
30 34   LYS n 
30 35   TRP n 
30 36   ILE n 
30 37   ASP n 
30 38   ARG n 
30 39   GLN n 
30 40   ARG n 
30 41   GLU n 
30 42   ARG n 
30 43   ASN n 
30 44   SER n 
30 45   GLY n 
30 46   ILE n 
30 47   GLY n 
30 48   ASN n 
30 49   ASP n 
30 50   GLY n 
30 51   LYS n 
30 52   PHE n 
30 53   SER n 
30 54   LYS n 
30 55   VAL n 
30 56   PRO n 
30 57   GLY n 
30 58   GLY n 
30 59   ASP n 
30 60   LYS n 
30 61   PRO n 
30 62   THR n 
30 63   LYS n 
30 64   LYS n 
30 65   THR n 
30 66   ASP n 
30 67   LEU n 
30 68   LYS n 
30 69   TYR n 
30 70   ARG n 
30 71   CYS n 
30 72   GLY n 
30 73   GLU n 
30 74   CYS n 
30 75   GLY n 
30 76   LYS n 
30 77   ALA n 
30 78   HIS n 
30 79   LEU n 
30 80   ARG n 
30 81   GLU n 
30 82   GLY n 
30 83   TRP n 
30 84   ARG n 
30 85   ALA n 
30 86   GLY n 
30 87   ARG n 
30 88   LEU n 
30 89   GLU n 
30 90   PHE n 
30 91   GLN n 
30 92   GLU n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
9  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
10 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
11 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
12 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
13 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
14 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
15 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
16 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
17 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
18 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
19 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
20 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
21 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
22 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
23 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
24 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
25 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
26 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
27 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
28 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
29 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
30 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.pdbx_db_accession 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1  GB  3377779 AF034620   1  2597 
;UUGGCUACUAUGCCAGCUGGUGGAUUGCUCGGCUCAGGCGCUGAUGAAGGACGUGCCAAGCUGCGAUAAGCCAUGGGGAG
CCGCACGGAGGCGAAGAACCAUGGAUUUCCGAAUGAGAAUCUCUCUAACAAUUGCUUCGCGCAAUGAGGAACCCCGAGAA
CUGAAACAUCUCAGUAUCGGGAGGAACAGAAAACGCAAUGUGAUGUCGUUAGUAACCGCGAGUGAACGCGAUACAGCCCA
AACCGAAGCCCUCACGGGCAAUGUGGUGUCAGGGCUACCUCUCAUCAGCCGACCGUCUCGACGAAGUCUCUUGGAACAGA
GCGUGAUACAGGGUGACAACCCCGUACUCGAGACCAGUACGACGUGCGGUAGUGCCAGAGUAGCGGGGGUUGGAUAUCCC
UCGCGAAUAACGCAGGCAUCGACUGCGAAGGCUAAACACAACCUGAGACCGAUAGUGAACAAGUAGUGUGAACGAACGCU
GCAAAGUACCCUCAGAAGGGAGGCGAAAUAGAGCAUGAAAUCAGUUGGCGAUCGAGCGACAGGGCAUACAAGGUCCCUUG
ACGAAUGACCGACGCGCGAGCGUCCAGUAAGACUCACGGGAAGCCGAUGUUCUGUCGUACGUUUUGAAAAACGAGCCAGG
GAGUGUGUCUGCAUGGCAAGUCUAACCGGAGUAUCCGGGGAGGCACAGGGAAACCGACAUGGCCGCAGGGCUUUGCCCGA
GGGCCGCCGUCUUCAAGGGCGGGGAGCCAUGUGGACACGACCCGAAUCCGGACGAUCUACGCAUGGACAAGAUGAAGCGU
GCCGAAAGGCACGUGGAAGUCUGUUAGAGUUGGUGUCCUACAAUACCCUCUCGUGAUCUAUGUGUAGGGGUGAAAGGCCC
AUCGAGUCCGGCAACAGCUGGUUCCAAUCGAAACAUGUCGAAGCAUGACCUCCGCCGAGGUAGUCUGUGAGGUAGAGCGA
CCGAUUGGUGUGUCCGCCUCCGAGAGGAGUCGGCACACCUGUCAAACUCCAAACUUACAGACGCCGUUUGACGCGGGGAU
UCCGGUGCGCGGGGUAAGCCUGUGUACCAGGAGGGGAACAACCCAGAGAUAGGUUAAGGUCCCCAAGUGUGGAUUAAGUG
UAAUCCUCUGAAGGUGGUCUCGAGCCCUAGACAGCCGGGAGGUGAGCUUAGAAGCAGCUACCCUCUAAGAAAAGCGUAAC
AGCUUACCGGCCGAGGUUUGAGGCGCCCAAAAUGAUCGGGACUCAAAUCCACCACCGAGACCUGUCCGUACCACUCAUAC
UGGUAAUCGAGUAGAUUGGCGCUCUAAUUGGAUGGAAGUAGGGGUGAAAACUCCUAUGGACCGAUUAGUGACGAAAAUCC
UGGCCAUAGUAGCAGCGAUAGUCGGGUGAGAACCCCGACGGCCUAAUGGAUAAGGGUUCCUCAGCACUGCUGAUCAGCUG
AGGGUUAGCCGGUCCUAAGUCAUACCGCAACUCGACUAUGACGAAAUGGGAAACGGGUUAAUAUUCCCGUGCCACUAUGC
AGUGAAAGUUGACGCCCUGGGGUCGAUCACGCUGGGCAUUCGCCCAGUCGAACCGUCCAACUCCGUGGAAGCCGUAAUGG
CAGGAAGCGGACGAACGGCGGCAUAGGGAAACGUGAUUCAACCUGGGGCCCAUGAAAAGACGAGCAUAGUGUCCGUACCG
AGAACCGACACAGGUGUCCAUGGCGGCGAAAGCCAAGGCCUGUCGGGAGCAACCAACGUUAGGGAAUUCGGCAAGUUAGU
CCCGUACCUUCGGAAGAAGGGAUGCCUGCUCCGGAACGGAGCAGGUCGCAGUGACUCGGAAGCUCGGACUGUCUAGUAAC
AACAUAGGUGACCGCAAAUCCGCAAGGACUCGUACGGUCACUGAAUCCUGCCCAGUGCAGGUAUCUGAACACCUCGUACA
AGAGGACGAAGGACCUGUCAACGGCGGGGGUAACUAUGACCCUCUUAAGGUAGCGUAGUACCUUGCCGCAUCAGUAGCGG
CUUGCAUGAAUGGAUUAACCAGAGCUUCACUGUCCCAACGUUGGGCCCGGUGAACUGUACAUUCCAGUGCGGAGUCUGGA
GACACCCAGGGGGAAGCGAAGACCCUAUGGAGCUUUACUGCAGGCUGUCGCUGAGACGUGGUCGCCGAUGUGCAGCAUAG
GUAGGAGACACUACACAGGUACCCGCGCUAGCGGGCCACCGAGUCAACAGUGAAAUACUACCCGUCGGUGACUGCGACUC
UCACUCCGGGAGGAGGACACCGAUAGCCGGGCAGUUUGACUGGGGCGGUACGCGCUCGAAAAGAUAUCGAGCGCGCCCUA
UGGCUAUCUCAGCCGGGACAGAGACCCGGCGAAGAGUGCAAGAGCAAAAGAUAGCUUGACAGUGUUCUUCCCAACGAGGA
ACGCUGACGCGAAAGCGUGGUCUAGCGAACCAAUUAGCCUGCUUGAUGCGGGCAAUUGAUGACAGAAAAGCUACCCUAGG
GAUAACAGAGUCGUCACUCGCAAGAGCACAUAUCGACCGAGUGGCUUGCUACCUCGAUGUCGGUUCCCUCCAUCCUGCCC
GUGCAGAAGCGGGCAAGGGUGAGGUUGUUCGCCUAUUAAAGGAGGUCGUGAGCUGGGUUUAGACCGUCGUGAGACAGGUC
GGCUGCUAUCUACUGGGUGUGUAAUGGUGUCUGACAAGAACGACCGUAUAGUACGAGAGGAACUACGGUUGGUGGCCACU
GGUGUACCGGUUGUUCGAGAGAGCACGUGCCGGGUAGCCACGCCACACGGGGUAAGAGCUGAACGCAUCUAAGCUCGAAA
CCCACUUGGAAAAGAGACACCGCCGAGGUCCCGCGUACAAGACGCGGUCGAUAGACUCGGGGUGUGCGCGUCGAGGUAAC
GAGACGUUAAGCCCACGAGCACUAACAGACCAAAGCCAUCAU
;
? 
2  GB  3377779 AF034620   2  5658 
;UUAGGCGGCCACAGCGGUGGGGUUGCCUCCCGUACCCAUCCCGAACACGGAAGAUAAGCCCACCAGCGUUCCGGGGAGUA
CUGGAGUGCGCGAGCCUCUGGGAAACCCGGUUCGCCGCCACC
;
? 
3  UNP P20276  RL2_HALMA  3  1    
;GRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDEL
QVGVDAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVVG
GGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGGNE
;
? 
4  UNP P20279  RL3_HALMA  4  1    
;PQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPMR
AVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKPD
VMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNLG
PWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVPFFRPAVRPND
QPRLDPEVRYVSNESNQG
;
? 
5  UNP P12735  RL4_HALMA  5  1    
;MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKLDGRARRV
PQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEAL
DVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESAL
AEVAER
;
? 
6  UNP P14124  RL5_HALMA  6  1    
;SSESESGGDFHEMREPRIEKVVVHMGIGHGGRDLANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEMA
EEFLQTALPLAELATSQFDDTGNFSFGVEEHTEFPSQEYDPSIGIYGLDVTVNLVRPGYRVAKRDKASRSIPTKHRLNPA
DAVAFIESTYDVEVSE
;
? 
7  UNP P14135  RL6_HALMA  7  1    
;PRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEGW
EYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDVR
VFQDGVYITRKPNRGDA
;
? 
8  UNP P12743  RL7A_HALMA 8  1    
;PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQ
DDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR
;
? 
9  UNP P15825  RLA0_HALMA 9  1    
;MSAESERKTETIPEWKQEEVDAIVEMIESYESVGVVNIAGIPSRQLQDMRRDLHGTAELRVSRNTLLERALDDVDDGLED
LNGYITGQVGLIGTDDNPFSLFQELEASKTPAPIGAGEVAPNDIVIPEGDTGVDPGPFVGELQSVGADARIQEGSIQVLS
DSTVLDTGEEVSQELSNVLNELGIEPKEVGLDLRAVFADGVLFEPEELELDIDEYRSDIQAAAGRAFNLSVNADYPTATT
APTMLQSDRGNAKSLALQAAIEDPEVVPDLVSKADAQVRALASQIDDEEALPEELQGVEADVATEEPTDDQDDDTASEDD
ADADDAAEEADDDDDDDEDAGDALGAMF
;
? 
10 UNP P29198  RL13_HALMA 11 1    
;MSVAEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFK
RTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW
;
? 
11 UNP P22450  RL14_HALMA 12 1    
;MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRHPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPI
RRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV
;
? 
12 UNP P12737  RL15_HALMA 13 1    
;TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADD
VAEVEDGGFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQAEAEETEDAD
ADEE
;
? 
13 UNP P14123  RL18_HALMA 15 1    
;ATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMPS
AYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLYS
GDFDAADLPEHFDELRETLLDGDIEL
;
? 
14 UNP P12733  R18E_HALMA 16 1    
;SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVD
FSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR
;
? 
15 UNP P14119  RL19_HALMA 17 1    
;TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSR
KGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDANHGDA
;
? 
16 UNP P12734  RL21_HALMA 18 1    
;PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGK
EKTIIVTAAHLRRQE
;
? 
17 UNP P10970  RL22_HALMA 19 1    
;GISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGRY
PEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEPEVED
;
? 
18 UNP P12732  RL23_HALMA 20 1    
;SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASR
IGVF
;
? 
19 UNP P10972  RL24_HALMA 21 1    
;SKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTLE
KTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA
;
? 
20 UNP P14116  R24E_HALMA 22 1    PRTRECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTARGEAGEAEDEA ? 
21 UNP P10971  RL29_HALMA 23 1    TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGDLQENE ? 
22 UNP P14121  RL30_HALMA 24 1    
;MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVD
DEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR
;
? 
23 UNP P18138  RL31_HALMA 25 1    
;SASDFEERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEEE
GEAIVEAETAE
;
? 
24 UNP P12736  RL32_HALMA 26 1    
;ADNEEDVEAEEEYTELTDISGVGPSKAESLREAGFESVEDVRGADQSALADVSGIGNALAARIKADVGGLEVESETEAEV
EEEGGEEAPDEDVETELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKGK
GDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEVEVSE

;
? 
25 UNP P32410  RL37_HALMA 28 1    TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE ? 
26 UNP P22452  RL39_HALMA 29 1    GKKSKATKKRLAKLDNQNSRVPAWVMLKTDREVQRNHKRRHWRRNDTDE ? 
27 UNP P32411  RL44_HALMA 30 1    
;MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLR
EGWRAGRLEFQE
;
? 
28 PDB 1K9M    1K9M       10 ?    ? ? 
29 PDB 1K9M    1K9M       14 ?    ? ? 
30 PDB 1K9M    1K9M       27 ?    ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  1K9M A 1 ? 2922 ? 3377779 2597 ? 5518 ? 2    2923 
2  2  1K9M B 1 ? 122  ? 3377779 5658 ? 5779 ? 3001 3122 
3  3  1K9M C 1 ? 239  ? P20276  1    ? 239  ? 1    239  
4  4  1K9M D 1 ? 337  ? P20279  1    ? 338  ? 1    337  
5  5  1K9M E 1 ? 246  ? P12735  1    ? 246  ? 1    246  
6  6  1K9M F 1 ? 176  ? P14124  1    ? 176  ? 1    176  
7  7  1K9M G 1 ? 177  ? P14135  1    ? 177  ? 1    177  
8  8  1K9M H 1 ? 119  ? P12743  1    ? 119  ? 1    119  
9  9  1K9M I 1 ? 348  ? P15825  1    ? 348  ? 1    348  
10 10 1K9M K 1 ? 145  ? P29198  1    ? 145  ? 1    145  
11 11 1K9M L 1 ? 132  ? P22450  1    ? 132  ? 1    132  
12 12 1K9M M 1 ? 164  ? P12737  1    ? 164  ? 1    164  
13 13 1K9M O 1 ? 186  ? P14123  1    ? 186  ? 1    186  
14 14 1K9M P 1 ? 115  ? P12733  1    ? 115  ? 1    115  
15 15 1K9M Q 1 ? 148  ? P14119  1    ? 148  ? 1    148  
16 16 1K9M R 1 ? 95   ? P12734  1    ? 95   ? 1    95   
17 17 1K9M S 1 ? 154  ? P10970  1    ? 154  ? 1    154  
18 18 1K9M T 1 ? 84   ? P12732  1    ? 84   ? 1    84   
19 19 1K9M U 1 ? 119  ? P10972  1    ? 119  ? 1    119  
20 20 1K9M V 1 ? 66   ? P14116  1    ? 66   ? 1    66   
21 21 1K9M W 1 ? 70   ? P10971  1    ? 70   ? 1    70   
22 22 1K9M X 1 ? 154  ? P14121  1    ? 154  ? 1    154  
23 23 1K9M Y 1 ? 91   ? P18138  1    ? 91   ? 1    91   
24 24 1K9M Z 1 ? 240  ? P12736  1    ? 240  ? 1    240  
25 25 1K9M 2 1 ? 56   ? P32410  1    ? 56   ? 1    56   
26 26 1K9M 3 1 ? 47   ? P22452  1    ? 49   ? 1    48   
27 27 1K9M 4 1 ? 92   ? P32411  1    ? 92   ? 1    92   
28 28 1K9M J 1 ? 167  ? 1K9M    1    ? 167  ? 1    167  
29 29 1K9M N 1 ? 194  ? 1K9M    1    ? 194  ? 1    194  
30 30 1K9M 1 1 ? 73   ? 1K9M    10   ? 82   ? 10   82   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  1K9M C   A 559 ? ?   3377779 U   3155 CONFLICT 560 1 
4  1K9M ?   D ?   ? UNP P20279  PRO 310  DELETION ?   2 
4  1K9M ARG D 310 ? UNP P20279  PHE 311  CONFLICT 310 3 
15 1K9M LYS Q 71  ? UNP P14119  TYR 71   CONFLICT 71  4 
26 1K9M ?   3 ?   ? UNP P22452  ARG 31   DELETION ?   5 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
ALA 'L-peptide linking' y ALANINE                      ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                     ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                   ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'              ? 'C4 H7 N O4'      133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O8 P'  323.197 
CD  non-polymer         . 'CADMIUM ION'                ? 'Cd 2'            112.411 
CL  non-polymer         . 'CHLORIDE ION'               ? 'Cl -1'           35.453  
CYS 'L-peptide linking' y CYSTEINE                     ? 'C3 H7 N O2 S'    121.158 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O8 P' 363.221 
GLN 'L-peptide linking' y GLUTAMINE                    ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'              ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                      ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                    ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                        ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                   ? 'C6 H13 N O2'     131.173 
K   non-polymer         . 'POTASSIUM ION'              ? 'K 1'             39.098  
LEU 'L-peptide linking' y LEUCINE                      ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                       ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                   ? 'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION'              ? 'Mg 2'            24.305  
NA  non-polymer         . 'SODIUM ION'                 ? 'Na 1'            22.990  
PHE 'L-peptide linking' y PHENYLALANINE                ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                      ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                       ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                    ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                   ? 'C11 H12 N2 O2'   204.225 
TYK non-polymer         . TYLOSIN                      ? 'C46 H77 N O17'   916.100 
TYR 'L-peptide linking' y TYROSINE                     ? 'C9 H11 N O3'     181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"   ? 'C9 H13 N2 O9 P'  324.181 
VAL 'L-peptide linking' y VALINE                       ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1K9M 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.17 
_exptl_crystal.density_percent_sol   61.17 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.temp            292 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.8 
_exptl_crystal_grow.pdbx_details    'PEG 6K, KCl, Na-acetate, NH4Cl, MgCl2, pH 5.8, VAPOR DIFFUSION, temperature 292K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.details 
1 1 1 'PEG 6000' ? ? ? 
1 2 1 KCl        ? ? ? 
1 3 1 NaOAC      ? ? ? 
1 4 1 NH4Cl      ? ? ? 
1 5 1 MgCl2      ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   CUSTOM-MADE 
_diffrn_detector.pdbx_collection_date   2000-09-27 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si-111, Si-220 monochromator' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.033 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 19-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   19-ID 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.033 
# 
_reflns.entry_id                     1K9M 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.observed_criterion_sigma_F   -3.0 
_reflns.d_resolution_low             20.0 
_reflns.d_resolution_high            3.0 
_reflns.number_obs                   366365 
_reflns.number_all                   366365 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            0.15 
_reflns.pdbx_Rsym_value              0.15 
_reflns.pdbx_netI_over_sigmaI        12.8 
_reflns.B_iso_Wilson_estimate        39.9 
_reflns.pdbx_redundancy              6.0 
_reflns.R_free_details               ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             3.00 
_reflns_shell.d_res_low              3.11 
_reflns_shell.percent_possible_all   95.2 
_reflns_shell.Rmerge_I_obs           0.709 
_reflns_shell.pdbx_Rsym_value        0.709 
_reflns_shell.meanI_over_sigI_obs    2.3 
_reflns_shell.pdbx_redundancy        4 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      34695 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1K9M 
_refine.ls_number_reflns_obs                     337448 
_refine.ls_number_reflns_all                     359798 
_refine.pdbx_ls_sigma_I                          0.0 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               435172.63 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.ls_d_res_low                             19.99 
_refine.ls_d_res_high                            3.00 
_refine.ls_percent_reflns_obs                    92.9 
_refine.ls_R_factor_obs                          0.219 
_refine.ls_R_factor_all                          0.219 
_refine.ls_R_factor_R_work                       0.219 
_refine.ls_R_factor_R_free                       0.262 
_refine.ls_R_factor_R_free_error                 0.005 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 1.0 
_refine.ls_number_reflns_R_free                  3303 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               55.1 
_refine.aniso_B[1][1]                            12.15 
_refine.aniso_B[2][2]                            -5.96 
_refine.aniso_B[3][3]                            -6.20 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.300425 
_refine.solvent_model_param_bsol                 25.4751 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1JJ2 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       
;RNA modified from Brunger and 
Bergman 
Tylosin parameters constructed from xplo2d 
based on CSD small molecule structures PRTYLD, LANKVL10, and NAVTAF, and standard stereochemical parameters
;
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            'RANDOM same as 1JJ2' 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1K9M 
_refine_analyze.Luzzati_coordinate_error_obs    0.38 
_refine_analyze.Luzzati_sigma_a_obs             0.52 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.45 
_refine_analyze.Luzzati_sigma_a_free            0.57 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        28801 
_refine_hist.pdbx_number_atoms_nucleic_acid   61617 
_refine_hist.pdbx_number_atoms_ligand         298 
_refine_hist.number_atoms_solvent             7877 
_refine_hist.number_atoms_total               98593 
_refine_hist.d_res_high                       3.00 
_refine_hist.d_res_low                        19.99 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.009 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.3   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      17.7  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      1.60  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.05  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            1.81  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             1.24  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            1.99  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   10 
_refine_ls_shell.d_res_high                       3.00 
_refine_ls_shell.d_res_low                        3.11 
_refine_ls_shell.number_reflns_R_work             28404 
_refine_ls_shell.R_factor_R_work                  0.334 
_refine_ls_shell.percent_reflns_obs               79.5 
_refine_ls_shell.R_factor_R_free                  0.361 
_refine_ls_shell.R_factor_R_free_error            0.021 
_refine_ls_shell.percent_reflns_R_free            1.0 
_refine_ls_shell.number_reflns_R_free             290 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 RNA_JEFF.PARAM5         RNA_JEFF.TOP5           'X-RAY DIFFRACTION' 
2 PROTEIN_JEFF.PARAM3     PROTEIN_TYM.TOP3        'X-RAY DIFFRACTION' 
3 ION.PARAM               ION.TOP                 'X-RAY DIFFRACTION' 
4 WATER_REP.PARAM         WATER_REP.TOP           'X-RAY DIFFRACTION' 
5 TYLF_JEFF_PRT_CIN_3.PAR TYLF_JEFF_PRT_CIN_3.TOP 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1K9M 
_struct.title                     'Co-crystal structure of tylosin bound to the 50S ribosomal subunit of Haloarcula marismortui' 
_struct.pdbx_descriptor           '50S RIBOSOMAL SUBUNIT COMPLEXED WITH TYLOSIN' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1K9M 
_struct_keywords.pdbx_keywords   RIBOSOME 
_struct_keywords.text            '50S subunit, tylosin, antibiotic, RIBOSOME' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 2  ? 
C  N N 3  ? 
D  N N 4  ? 
E  N N 5  ? 
F  N N 6  ? 
G  N N 7  ? 
H  N N 8  ? 
I  N N 9  ? 
J  N N 10 ? 
K  N N 11 ? 
L  N N 12 ? 
M  N N 13 ? 
N  N N 14 ? 
O  N N 15 ? 
P  N N 16 ? 
Q  N N 17 ? 
R  N N 18 ? 
S  N N 19 ? 
T  N N 20 ? 
U  N N 21 ? 
V  N N 22 ? 
W  N N 23 ? 
X  N N 24 ? 
Y  N N 25 ? 
Z  N N 26 ? 
AA N N 27 ? 
BA N N 28 ? 
CA N N 29 ? 
DA N N 30 ? 
EA N N 31 ? 
FA N N 32 ? 
GA N N 32 ? 
HA N N 32 ? 
IA N N 32 ? 
JA N N 32 ? 
KA N N 32 ? 
LA N N 32 ? 
MA N N 32 ? 
NA N N 32 ? 
OA N N 32 ? 
PA N N 32 ? 
QA N N 32 ? 
RA N N 32 ? 
SA N N 32 ? 
TA N N 32 ? 
UA N N 32 ? 
VA N N 32 ? 
WA N N 32 ? 
XA N N 32 ? 
YA N N 32 ? 
ZA N N 32 ? 
AB N N 32 ? 
BB N N 32 ? 
CB N N 32 ? 
DB N N 32 ? 
EB N N 32 ? 
FB N N 32 ? 
GB N N 32 ? 
HB N N 32 ? 
IB N N 32 ? 
JB N N 32 ? 
KB N N 32 ? 
LB N N 32 ? 
MB N N 32 ? 
NB N N 32 ? 
OB N N 32 ? 
PB N N 32 ? 
QB N N 32 ? 
RB N N 32 ? 
SB N N 32 ? 
TB N N 32 ? 
UB N N 32 ? 
VB N N 32 ? 
WB N N 32 ? 
XB N N 32 ? 
YB N N 32 ? 
ZB N N 32 ? 
AC N N 32 ? 
BC N N 32 ? 
CC N N 32 ? 
DC N N 32 ? 
EC N N 32 ? 
FC N N 32 ? 
GC N N 32 ? 
HC N N 32 ? 
IC N N 32 ? 
JC N N 32 ? 
KC N N 32 ? 
LC N N 32 ? 
MC N N 32 ? 
NC N N 32 ? 
OC N N 32 ? 
PC N N 32 ? 
QC N N 32 ? 
RC N N 32 ? 
SC N N 32 ? 
TC N N 32 ? 
UC N N 32 ? 
VC N N 32 ? 
WC N N 32 ? 
XC N N 32 ? 
YC N N 32 ? 
ZC N N 32 ? 
AD N N 32 ? 
BD N N 32 ? 
CD N N 32 ? 
DD N N 32 ? 
ED N N 32 ? 
FD N N 32 ? 
GD N N 32 ? 
HD N N 32 ? 
ID N N 32 ? 
JD N N 32 ? 
KD N N 32 ? 
LD N N 32 ? 
MD N N 32 ? 
ND N N 32 ? 
OD N N 32 ? 
PD N N 32 ? 
QD N N 32 ? 
RD N N 32 ? 
SD N N 32 ? 
TD N N 32 ? 
UD N N 32 ? 
VD N N 32 ? 
WD N N 32 ? 
XD N N 32 ? 
YD N N 32 ? 
ZD N N 32 ? 
AE N N 32 ? 
BE N N 32 ? 
CE N N 32 ? 
DE N N 32 ? 
EE N N 32 ? 
FE N N 32 ? 
GE N N 32 ? 
HE N N 32 ? 
IE N N 32 ? 
JE N N 32 ? 
KE N N 32 ? 
LE N N 32 ? 
ME N N 33 ? 
NE N N 33 ? 
OE N N 33 ? 
PE N N 33 ? 
QE N N 33 ? 
RE N N 33 ? 
SE N N 33 ? 
TE N N 33 ? 
UE N N 33 ? 
VE N N 33 ? 
WE N N 33 ? 
XE N N 33 ? 
YE N N 33 ? 
ZE N N 33 ? 
AF N N 33 ? 
BF N N 33 ? 
CF N N 33 ? 
DF N N 33 ? 
EF N N 33 ? 
FF N N 33 ? 
GF N N 33 ? 
HF N N 33 ? 
IF N N 33 ? 
JF N N 33 ? 
KF N N 33 ? 
LF N N 33 ? 
MF N N 33 ? 
NF N N 33 ? 
OF N N 33 ? 
PF N N 33 ? 
QF N N 33 ? 
RF N N 33 ? 
SF N N 33 ? 
TF N N 33 ? 
UF N N 33 ? 
VF N N 33 ? 
WF N N 33 ? 
XF N N 33 ? 
YF N N 33 ? 
ZF N N 33 ? 
AG N N 33 ? 
BG N N 33 ? 
CG N N 33 ? 
DG N N 33 ? 
EG N N 33 ? 
FG N N 33 ? 
GG N N 33 ? 
HG N N 33 ? 
IG N N 33 ? 
JG N N 33 ? 
KG N N 33 ? 
LG N N 33 ? 
MG N N 33 ? 
NG N N 33 ? 
OG N N 33 ? 
PG N N 33 ? 
QG N N 33 ? 
RG N N 33 ? 
SG N N 33 ? 
TG N N 33 ? 
UG N N 33 ? 
VG N N 33 ? 
WG N N 33 ? 
XG N N 33 ? 
YG N N 33 ? 
ZG N N 33 ? 
AH N N 33 ? 
BH N N 33 ? 
CH N N 33 ? 
DH N N 33 ? 
EH N N 33 ? 
FH N N 33 ? 
GH N N 34 ? 
HH N N 34 ? 
IH N N 34 ? 
JH N N 34 ? 
KH N N 34 ? 
LH N N 34 ? 
MH N N 34 ? 
NH N N 34 ? 
OH N N 35 ? 
PH N N 35 ? 
QH N N 35 ? 
RH N N 32 ? 
SH N N 33 ? 
TH N N 33 ? 
UH N N 32 ? 
VH N N 33 ? 
WH N N 34 ? 
XH N N 32 ? 
YH N N 34 ? 
ZH N N 33 ? 
AI N N 33 ? 
BI N N 33 ? 
CI N N 33 ? 
DI N N 34 ? 
EI N N 34 ? 
FI N N 34 ? 
GI N N 34 ? 
HI N N 32 ? 
II N N 33 ? 
JI N N 34 ? 
KI N N 33 ? 
LI N N 34 ? 
MI N N 34 ? 
NI N N 36 ? 
OI N N 34 ? 
PI N N 33 ? 
QI N N 34 ? 
RI N N 33 ? 
SI N N 33 ? 
TI N N 34 ? 
UI N N 33 ? 
VI N N 32 ? 
WI N N 36 ? 
XI N N 32 ? 
YI N N 34 ? 
ZI N N 32 ? 
AJ N N 36 ? 
BJ N N 36 ? 
CJ N N 32 ? 
DJ N N 36 ? 
EJ N N 34 ? 
FJ N N 37 ? 
GJ N N 37 ? 
HJ N N 37 ? 
IJ N N 37 ? 
JJ N N 37 ? 
KJ N N 37 ? 
LJ N N 37 ? 
MJ N N 37 ? 
NJ N N 37 ? 
OJ N N 37 ? 
PJ N N 37 ? 
QJ N N 37 ? 
RJ N N 37 ? 
SJ N N 37 ? 
TJ N N 37 ? 
UJ N N 37 ? 
VJ N N 37 ? 
WJ N N 37 ? 
XJ N N 37 ? 
YJ N N 37 ? 
ZJ N N 37 ? 
AK N N 37 ? 
BK N N 37 ? 
CK N N 37 ? 
DK N N 37 ? 
EK N N 37 ? 
FK N N 37 ? 
GK N N 37 ? 
HK N N 37 ? 
IK N N 37 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   ILE C  4   ? ARG C  11  ? ILE C 4   ARG C 11  1 ? 8  
HELX_P HELX_P2   2   GLY C  12  ? GLY C  12  ? GLY C 12  GLY C 12  5 ? 1  
HELX_P HELX_P3   3   THR C  13  ? ARG C  17  ? THR C 13  ARG C 17  5 ? 5  
HELX_P HELX_P4   4   PRO C  19  ? TYR C  23  ? PRO C 19  TYR C 23  5 ? 5  
HELX_P HELX_P5   5   GLY C  163 ? LYS C  167 ? GLY C 163 LYS C 167 5 ? 5  
HELX_P HELX_P6   6   LYS C  171 ? LYS C  180 ? LYS C 171 LYS C 180 1 ? 10 
HELX_P HELX_P7   7   ARG C  190 ? MET C  194 ? ARG C 190 MET C 194 5 ? 5  
HELX_P HELX_P8   8   ASN C  195 ? HIS C  199 ? ASN C 195 HIS C 199 5 ? 5  
HELX_P HELX_P9   9   GLU D  108 ? THR D  112 ? GLU D 108 THR D 112 5 ? 5  
HELX_P HELX_P10  10  ASP D  120 ? GLY D  135 ? ASP D 120 GLY D 135 1 ? 16 
HELX_P HELX_P11  11  VAL D  147 ? VAL D  151 ? VAL D 147 VAL D 151 5 ? 5  
HELX_P HELX_P12  12  SER D  170 ? GLY D  185 ? SER D 170 GLY D 185 1 ? 16 
HELX_P HELX_P13  13  ALA D  189 ? ILE D  193 ? ALA D 189 ILE D 193 5 ? 5  
HELX_P HELX_P14  14  GLY D  213 ? GLY D  219 ? GLY D 213 GLY D 219 1 ? 7  
HELX_P HELX_P15  15  LYS D  224 ? GLN D  230 ? LYS D 224 GLN D 230 5 ? 7  
HELX_P HELX_P16  16  PRO E  19  ? THR E  24  ? PRO E 19  THR E 24  5 ? 6  
HELX_P HELX_P17  17  ARG E  27  ? ARG E  42  ? ARG E 27  ARG E 42  1 ? 16 
HELX_P HELX_P18  18  ASN E  103 ? THR E  118 ? ASN E 103 THR E 118 1 ? 16 
HELX_P HELX_P19  19  ASP E  120 ? ARG E  127 ? ASP E 120 ARG E 127 1 ? 8  
HELX_P HELX_P20  20  ASP E  142 ? LEU E  147 ? ASP E 142 LEU E 147 5 ? 6  
HELX_P HELX_P21  21  LYS E  149 ? LEU E  160 ? LYS E 149 LEU E 160 1 ? 12 
HELX_P HELX_P22  22  VAL E  162 ? ALA E  169 ? VAL E 162 ALA E 169 1 ? 8  
HELX_P HELX_P23  23  GLY E  177 ? GLY E  183 ? GLY E 177 GLY E 183 5 ? 7  
HELX_P HELX_P24  24  SER E  201 ? ASN E  206 ? SER E 201 ASN E 206 1 ? 6  
HELX_P HELX_P25  25  ASN E  219 ? ALA E  224 ? ASN E 219 ALA E 224 1 ? 6  
HELX_P HELX_P26  26  PRO E  225 ? ALA E  228 ? PRO E 225 ALA E 228 5 ? 4  
HELX_P HELX_P27  27  GLU E  237 ? ALA E  244 ? GLU E 237 ALA E 244 1 ? 8  
HELX_P HELX_P28  28  ALA F  37  ? GLY F  46  ? ALA F 37  GLY F 46  1 ? 10 
HELX_P HELX_P29  29  ASP F  77  ? LEU F  88  ? ASP F 77  LEU F 88  1 ? 12 
HELX_P HELX_P30  30  PRO F  89  ? ALA F  91  ? PRO F 89  ALA F 91  5 ? 3  
HELX_P HELX_P31  31  TYR F  139 ? ARG F  144 ? TYR F 139 ARG F 144 1 ? 6  
HELX_P HELX_P32  32  PRO F  152 ? ARG F  156 ? PRO F 152 ARG F 156 5 ? 5  
HELX_P HELX_P33  33  ASN F  158 ? SER F  168 ? ASN F 158 SER F 168 1 ? 11 
HELX_P HELX_P34  34  ASN G  55  ? THR G  77  ? ASN G 55  THR G 77  1 ? 23 
HELX_P HELX_P35  35  ASN G  106 ? GLU G  110 ? ASN G 106 GLU G 110 5 ? 5  
HELX_P HELX_P36  36  ASP G  137 ? THR G  152 ? ASP G 137 THR G 152 1 ? 16 
HELX_P HELX_P37  37  PRO H  9   ? GLY H  27  ? PRO H 9   GLY H 27  1 ? 19 
HELX_P HELX_P38  38  GLY H  32  ? GLY H  43  ? GLY H 32  GLY H 43  1 ? 12 
HELX_P HELX_P39  39  GLU H  57  ? HIS H  62  ? GLU H 57  HIS H 62  1 ? 6  
HELX_P HELX_P40  40  HIS H  62  ? GLU H  69  ? HIS H 62  GLU H 69  1 ? 8  
HELX_P HELX_P41  41  GLN H  79  ? ALA H  87  ? GLN H 79  ALA H 87  1 ? 9  
HELX_P HELX_P42  42  ALA H  104 ? LEU H  118 ? ALA H 104 LEU H 118 1 ? 15 
HELX_P HELX_P43  43  PRO I  13  ? SER I  29  ? PRO I 13  SER I 29  1 ? 17 
HELX_P HELX_P44  44  ARG I  63  ? ASP I  72  ? ARG I 63  ASP I 72  1 ? 10 
HELX_P HELX_P45  45  PRO J  2   ? TYR J  6   ? PRO J 2   TYR J 6   5 ? 5  
HELX_P HELX_P46  46  HIS J  58  ? ARG J  70  ? HIS J 58  ARG J 70  1 ? 13 
HELX_P HELX_P47  47  ASN J  141 ? ARG J  148 ? ASN J 141 ARG J 148 1 ? 8  
HELX_P HELX_P48  48  ILE K  18  ? LEU K  31  ? ILE K 18  LEU K 31  1 ? 14 
HELX_P HELX_P49  49  ASN K  40  ? ARG K  43  ? ASN K 40  ARG K 43  5 ? 4  
HELX_P HELX_P50  50  ARG K  49  ? ILE K  63  ? ARG K 49  ILE K 63  1 ? 15 
HELX_P HELX_P51  51  ARG K  74  ? GLY K  85  ? ARG K 74  GLY K 85  1 ? 12 
HELX_P HELX_P52  52  LYS K  91  ? SER K  100 ? LYS K 91  SER K 100 1 ? 10 
HELX_P HELX_P53  53  ASP K  122 ? ASN K  126 ? ASP K 122 ASN K 126 5 ? 5  
HELX_P HELX_P54  54  LEU K  132 ? GLY K  140 ? LEU K 132 GLY K 140 1 ? 9  
HELX_P HELX_P55  55  GLU L  116 ? ALA L  118 ? GLU L 116 ALA L 118 5 ? 3  
HELX_P HELX_P56  56  PHE L  121 ? SER L  126 ? PHE L 121 SER L 126 1 ? 6  
HELX_P HELX_P57  57  LYS M  3   ? GLN M  7   ? LYS M 3   GLN M 7   5 ? 5  
HELX_P HELX_P58  58  GLY M  23  ? GLY M  28  ? GLY M 23  GLY M 28  5 ? 6  
HELX_P HELX_P59  59  PRO M  54  ? GLN M  58  ? PRO M 54  GLN M 58  5 ? 5  
HELX_P HELX_P60  60  VAL M  66  ? ASN M  72  ? VAL M 66  ASN M 72  1 ? 7  
HELX_P HELX_P61  61  ARG M  94  ? VAL M  96  ? ARG M 94  VAL M 96  5 ? 3  
HELX_P HELX_P62  62  SER M  126 ? ALA M  136 ? SER M 126 ALA M 136 1 ? 11 
HELX_P HELX_P63  63  ALA N  4   ? LYS N  13  ? ALA N 4   LYS N 13  1 ? 10 
HELX_P HELX_P64  64  GLU N  17  ? ARG N  32  ? GLU N 17  ARG N 32  1 ? 16 
HELX_P HELX_P65  65  ARG N  45  ? GLY N  53  ? ARG N 45  GLY N 53  1 ? 9  
HELX_P HELX_P66  66  ARG N  82  ? MET N  86  ? ARG N 82  MET N 86  5 ? 5  
HELX_P HELX_P67  67  ASN N  96  ? PHE N  109 ? ASN N 96  PHE N 109 1 ? 14 
HELX_P HELX_P68  68  LEU N  147 ? ARG N  156 ? LEU N 147 ARG N 156 5 ? 10 
HELX_P HELX_P69  69  ARG N  158 ? GLY N  162 ? ARG N 158 GLY N 162 5 ? 5  
HELX_P HELX_P70  70  THR N  164 ? ARG N  171 ? THR N 164 ARG N 171 1 ? 8  
HELX_P HELX_P71  71  LEU N  187 ? GLY N  191 ? LEU N 187 GLY N 191 5 ? 5  
HELX_P HELX_P72  72  MET O  10  ? GLU O  15  ? MET O 10  GLU O 15  1 ? 6  
HELX_P HELX_P73  73  ASP O  19  ? SER O  29  ? ASP O 19  SER O 29  1 ? 11 
HELX_P HELX_P74  74  SER O  64  ? GLY O  70  ? SER O 64  GLY O 70  5 ? 7  
HELX_P HELX_P75  75  ASN O  77  ? ALA O  95  ? ASN O 77  ALA O 95  1 ? 19 
HELX_P HELX_P76  76  SER O  113 ? ALA O  125 ? SER O 113 ALA O 125 1 ? 13 
HELX_P HELX_P77  77  ASN O  132 ? LEU O  136 ? ASN O 132 LEU O 136 5 ? 5  
HELX_P HELX_P78  78  TRP O  139 ? GLY O  144 ? TRP O 139 GLY O 144 1 ? 6  
HELX_P HELX_P79  79  GLY O  144 ? GLN O  153 ? GLY O 144 GLN O 153 1 ? 10 
HELX_P HELX_P80  80  LEU O  168 ? LEU O  180 ? LEU O 168 LEU O 180 1 ? 13 
HELX_P HELX_P81  81  ASN P  4   ? SER P  21  ? ASN P 4   SER P 21  1 ? 18 
HELX_P HELX_P82  82  ALA P  24  ? LYS P  35  ? ALA P 24  LYS P 35  1 ? 12 
HELX_P HELX_P83  83  PRO P  36  ? HIS P  40  ? PRO P 36  HIS P 40  5 ? 5  
HELX_P HELX_P84  84  LEU P  45  ? ALA P  52  ? LEU P 45  ALA P 52  1 ? 8  
HELX_P HELX_P85  85  SER P  82  ? GLY P  93  ? SER P 82  GLY P 93  1 ? 12 
HELX_P HELX_P86  86  LEU P  98  ? ASN P  105 ? LEU P 98  ASN P 105 1 ? 8  
HELX_P HELX_P87  87  LEU Q  3   ? LEU Q  14  ? LEU Q 3   LEU Q 14  1 ? 12 
HELX_P HELX_P88  88  GLY Q  17  ? ASN Q  19  ? GLY Q 17  ASN Q 19  5 ? 3  
HELX_P HELX_P89  89  ARG Q  27  ? ALA Q  34  ? ARG Q 27  ALA Q 34  1 ? 8  
HELX_P HELX_P90  90  THR Q  36  ? GLU Q  46  ? THR Q 36  GLU Q 46  1 ? 11 
HELX_P HELX_P91  91  ARG Q  59  ? LYS Q  71  ? ARG Q 59  LYS Q 71  1 ? 13 
HELX_P HELX_P92  92  GLY Q  76  ? ARG Q  80  ? GLY Q 76  ARG Q 80  5 ? 5  
HELX_P HELX_P93  93  LYS Q  83  ? GLN Q  88  ? LYS Q 83  GLN Q 88  1 ? 6  
HELX_P HELX_P94  94  ASN Q  89  ? GLU Q  111 ? ASN Q 89  GLU Q 111 1 ? 23 
HELX_P HELX_P95  95  SER Q  115 ? GLY Q  128 ? SER Q 115 GLY Q 128 1 ? 14 
HELX_P HELX_P96  96  SER Q  133 ? ASP Q  142 ? SER Q 133 ASP Q 142 1 ? 10 
HELX_P HELX_P97  97  LYS R  17  ? ARG R  21  ? LYS R 17  ARG R 21  5 ? 5  
HELX_P HELX_P98  98  PRO R  26  ? GLU R  31  ? PRO R 26  GLU R 31  1 ? 6  
HELX_P HELX_P99  99  HIS R  53  ? ASP R  57  ? HIS R 53  ASP R 57  5 ? 5  
HELX_P HELX_P100 100 THR R  87  ? ALA R  89  ? THR R 87  ALA R 89  5 ? 3  
HELX_P HELX_P101 101 SER S  24  ? LYS S  36  ? SER S 24  LYS S 36  1 ? 13 
HELX_P HELX_P102 102 THR S  39  ? GLY S  53  ? THR S 39  GLY S 53  1 ? 15 
HELX_P HELX_P103 103 PRO S  81  ? HIS S  101 ? PRO S 81  HIS S 101 1 ? 21 
HELX_P HELX_P104 104 THR T  11  ? ASN T  22  ? THR T 11  ASN T 22  1 ? 12 
HELX_P HELX_P105 105 SER T  33  ? ASP T  46  ? SER T 33  ASP T 46  1 ? 14 
HELX_P HELX_P106 106 ASP T  73  ? ARG T  80  ? ASP T 73  ARG T 80  1 ? 8  
HELX_P HELX_P107 107 GLN U  3   ? ARG U  13  ? GLN U 3   ARG U 13  1 ? 11 
HELX_P HELX_P108 108 PRO U  15  ? GLN U  22  ? PRO U 15  GLN U 22  5 ? 8  
HELX_P HELX_P109 109 SER U  28  ? GLY U  36  ? SER U 28  GLY U 36  1 ? 9  
HELX_P HELX_P110 110 ASP U  92  ? SER U  94  ? ASP U 92  SER U 94  5 ? 3  
HELX_P HELX_P111 111 ASP U  105 ? SER U  114 ? ASP U 105 SER U 114 1 ? 10 
HELX_P HELX_P112 112 SER V  33  ? LEU V  42  ? SER V 33  LEU V 42  1 ? 10 
HELX_P HELX_P113 113 GLU V  45  ? LEU V  49  ? GLU V 45  LEU V 49  5 ? 5  
HELX_P HELX_P114 114 HIS W  4   ? ASP W  10  ? HIS W 4   ASP W 10  1 ? 7  
HELX_P HELX_P115 115 THR W  12  ? ALA W  36  ? THR W 12  ALA W 36  1 ? 25 
HELX_P HELX_P116 116 PRO W  43  ? GLY W  64  ? PRO W 43  GLY W 64  1 ? 22 
HELX_P HELX_P117 117 HIS X  14  ? LEU X  24  ? HIS X 14  LEU X 24  1 ? 11 
HELX_P HELX_P118 118 THR X  38  ? ASN X  49  ? THR X 38  ASN X 49  1 ? 12 
HELX_P HELX_P119 119 SER X  58  ? ALA X  70  ? SER X 58  ALA X 70  1 ? 13 
HELX_P HELX_P120 120 ASP X  80  ? THR X  88  ? ASP X 80  THR X 88  1 ? 9  
HELX_P HELX_P121 121 ASP X  92  ? SER X  102 ? ASP X 92  SER X 102 1 ? 11 
HELX_P HELX_P122 122 PRO X  131 ? GLY X  135 ? PRO X 131 GLY X 135 5 ? 5  
HELX_P HELX_P123 123 ASP X  142 ? MET X  153 ? ASP X 142 MET X 153 1 ? 12 
HELX_P HELX_P124 124 ARG Y  15  ? GLU Y  20  ? ARG Y 15  GLU Y 20  5 ? 6  
HELX_P HELX_P125 125 PRO Y  21  ? HIS Y  23  ? PRO Y 21  HIS Y 23  5 ? 3  
HELX_P HELX_P126 126 LYS Y  24  ? PHE Y  41  ? LYS Y 24  PHE Y 41  1 ? 18 
HELX_P HELX_P127 127 ASP Y  51  ? ALA Y  60  ? ASP Y 51  ALA Y 60  1 ? 10 
HELX_P HELX_P128 128 SER Z  110 ? GLY Z  124 ? SER Z 110 GLY Z 124 1 ? 15 
HELX_P HELX_P129 129 GLU Z  165 ? ARG Z  169 ? GLU Z 165 ARG Z 169 5 ? 5  
HELX_P HELX_P130 130 VAL Z  190 ? GLU Z  194 ? VAL Z 190 GLU Z 194 5 ? 5  
HELX_P HELX_P131 131 GLY Z  210 ? ALA Z  224 ? GLY Z 210 ALA Z 224 1 ? 15 
HELX_P HELX_P132 132 ARG AA 1   ? GLY AA 6   ? ARG 1 10  GLY 1 15  5 ? 6  
HELX_P HELX_P133 133 GLY AA 10  ? LYS AA 26  ? GLY 1 19  LYS 1 35  1 ? 17 
HELX_P HELX_P134 134 THR AA 64  ? ALA AA 73  ? THR 1 73  ALA 1 82  1 ? 10 
HELX_P HELX_P135 135 GLY BA 4   ? GLY BA 9   ? GLY 2 4   GLY 2 9   5 ? 6  
HELX_P HELX_P136 136 TYR BA 48  ? SER BA 52  ? TYR 2 48  SER 2 52  5 ? 5  
HELX_P HELX_P137 137 SER CA 4   ? ASN CA 18  ? SER 3 4   ASN 3 18  1 ? 15 
HELX_P HELX_P138 138 PRO CA 22  ? THR CA 29  ? PRO 3 22  THR 3 29  1 ? 8  
HELX_P HELX_P139 139 LYS DA 34  ? SER DA 44  ? LYS 4 34  SER 4 44  1 ? 11 
HELX_P HELX_P140 140 ASP DA 49  ? LYS DA 54  ? ASP 4 49  LYS 4 54  5 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1    covale ? ? EA TYK .    C20   ? ? ? 1_555 A  A   2102 N6    ? ? A TYK 9000 A A   2103 1_555 ? ? ? ? ? ? ? 1.400 ? 
metalc1    metalc ? ? ZI MG  .    MG    ? ? ? 1_555 AA ARG 4    NH1   ? ? 1 MG  8105 1 ARG 13   1_555 ? ? ? ? ? ? ? 3.079 ? 
metalc2    metalc ? ? BJ CD  .    CD    ? ? ? 1_555 BA CYS 22   SG    ? ? 2 CD  8402 2 CYS 22   1_555 ? ? ? ? ? ? ? 2.671 ? 
metalc3    metalc ? ? BJ CD  .    CD    ? ? ? 1_555 BA CYS 37   SG    ? ? 2 CD  8402 2 CYS 37   1_555 ? ? ? ? ? ? ? 2.313 ? 
metalc4    metalc ? ? BJ CD  .    CD    ? ? ? 1_555 BA CYS 34   SG    ? ? 2 CD  8402 2 CYS 34   1_555 ? ? ? ? ? ? ? 2.566 ? 
metalc5    metalc ? ? BJ CD  .    CD    ? ? ? 1_555 BA CYS 19   SG    ? ? 2 CD  8402 2 CYS 19   1_555 ? ? ? ? ? ? ? 2.540 ? 
metalc6    metalc ? ? CJ MG  .    MG    ? ? ? 1_555 DA GLY 45   O     ? ? 4 MG  8078 4 GLY 45   1_555 ? ? ? ? ? ? ? 2.236 ? 
metalc7    metalc ? ? CJ MG  .    MG    ? ? ? 1_555 DA GLY 47   O     ? ? 4 MG  8078 4 GLY 47   1_555 ? ? ? ? ? ? ? 2.597 ? 
metalc8    metalc ? ? CJ MG  .    MG    ? ? ? 1_555 DA ASP 49   OD1   ? ? 4 MG  8078 4 ASP 49   1_555 ? ? ? ? ? ? ? 2.970 ? 
metalc9    metalc ? ? CJ MG  .    MG    ? ? ? 1_555 IK HOH .    O     ? ? 4 MG  8078 4 HOH 8575 1_555 ? ? ? ? ? ? ? 2.349 ? 
metalc10   metalc ? ? CJ MG  .    MG    ? ? ? 1_555 IK HOH .    O     ? ? 4 MG  8078 4 HOH 8576 1_555 ? ? ? ? ? ? ? 2.146 ? 
metalc11   metalc ? ? DJ CD  .    CD    ? ? ? 1_555 DA CYS 71   SG    ? ? 4 CD  8404 4 CYS 71   1_555 ? ? ? ? ? ? ? 3.074 ? 
metalc12   metalc ? ? DJ CD  .    CD    ? ? ? 1_555 IK HOH .    O     ? ? 4 CD  8404 4 HOH 8563 1_555 ? ? ? ? ? ? ? 2.976 ? 
metalc13   metalc ? ? FA MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8001 A HOH 9178 1_555 ? ? ? ? ? ? ? 2.106 ? 
metalc14   metalc ? ? FA MG  .    MG    ? ? ? 1_555 A  A   2482 OP2   ? ? A MG  8001 A A   2483 1_555 ? ? ? ? ? ? ? 2.459 ? 
metalc15   metalc ? ? FA MG  .    MG    ? ? ? 1_555 A  C   2532 OP2   ? ? A MG  8001 A C   2533 1_555 ? ? ? ? ? ? ? 2.183 ? 
metalc16   metalc ? ? FA MG  .    MG    ? ? ? 1_555 A  C   2533 OP2   ? ? A MG  8001 A C   2534 1_555 ? ? ? ? ? ? ? 2.078 ? 
metalc17   metalc ? ? GA MG  .    MG    ? ? ? 1_555 A  G   626  O6    ? ? A MG  8002 A G   627  1_555 ? ? ? ? ? ? ? 2.051 ? 
metalc18   metalc ? ? GA MG  .    MG    ? ? ? 1_555 A  A   2482 OP1   ? ? A MG  8002 A A   2483 1_555 ? ? ? ? ? ? ? 1.977 ? 
metalc19   metalc ? ? GA MG  .    MG    ? ? ? 1_555 A  C   2533 OP1   ? ? A MG  8002 A C   2534 1_555 ? ? ? ? ? ? ? 1.999 ? 
metalc20   metalc ? ? HA MG  .    MG    ? ? ? 1_555 A  G   876  OP2   ? ? A MG  8003 A G   877  1_555 ? ? ? ? ? ? ? 2.057 ? 
metalc21   metalc ? ? HA MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8003 A HOH 9021 1_555 ? ? ? ? ? ? ? 2.157 ? 
metalc22   metalc ? ? HA MG  .    MG    ? ? ? 1_555 A  A   2623 OP1   ? ? A MG  8003 A A   2624 1_555 ? ? ? ? ? ? ? 1.832 ? 
metalc23   metalc ? ? HA MG  .    MG    ? ? ? 1_555 A  A   875  OP2   ? ? A MG  8003 A A   876  1_555 ? ? ? ? ? ? ? 2.073 ? 
metalc24   metalc ? ? HA MG  .    MG    ? ? ? 1_555 HJ HOH .    O     ? ? A MG  8003 C HOH 8537 1_555 ? ? ? ? ? ? ? 2.433 ? 
metalc25   metalc ? ? IA MG  .    MG    ? ? ? 1_555 A  G   455  O6    ? ? A MG  8004 A G   456  1_555 ? ? ? ? ? ? ? 2.037 ? 
metalc26   metalc ? ? IA MG  .    MG    ? ? ? 1_555 A  A   458  OP1   ? ? A MG  8004 A A   459  1_555 ? ? ? ? ? ? ? 1.569 ? 
metalc27   metalc ? ? IA MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8004 A HOH 9047 1_555 ? ? ? ? ? ? ? 2.128 ? 
metalc28   metalc ? ? IA MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8004 A HOH 9767 1_555 ? ? ? ? ? ? ? 1.914 ? 
metalc29   metalc ? ? JA MG  .    MG    ? ? ? 1_555 A  U   1837 OP1   ? ? A MG  8005 A U   1838 1_555 ? ? ? ? ? ? ? 1.970 ? 
metalc30   metalc ? ? JA MG  .    MG    ? ? ? 1_555 A  A   1835 OP1   ? ? A MG  8005 A A   1836 1_555 ? ? ? ? ? ? ? 2.185 ? 
metalc31   metalc ? ? JA MG  .    MG    ? ? ? 1_555 A  A   1838 OP2   ? ? A MG  8005 A A   1839 1_555 ? ? ? ? ? ? ? 1.797 ? 
metalc32   metalc ? ? KA MG  .    MG    ? ? ? 1_555 A  U   820  OP2   ? ? A MG  8006 A U   821  1_555 ? ? ? ? ? ? ? 2.149 ? 
metalc33   metalc ? ? KA MG  .    MG    ? ? ? 1_555 A  G   853  OP1   ? ? A MG  8006 A G   854  1_555 ? ? ? ? ? ? ? 1.993 ? 
metalc34   metalc ? ? KA MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8006 A HOH 9800 1_555 ? ? ? ? ? ? ? 1.750 ? 
metalc35   metalc ? ? KA MG  .    MG    ? ? ? 1_555 A  C   821  OP2   ? ? A MG  8006 A C   822  1_555 ? ? ? ? ? ? ? 1.646 ? 
metalc36   metalc ? ? LA MG  .    MG    ? ? ? 1_555 A  U   831  OP2   ? ? A MG  8007 A U   832  1_555 ? ? ? ? ? ? ? 2.086 ? 
metalc37   metalc ? ? LA MG  .    MG    ? ? ? 1_555 A  A   1838 OP1   ? ? A MG  8007 A A   1839 1_555 ? ? ? ? ? ? ? 1.898 ? 
metalc38   metalc ? ? LA MG  .    MG    ? ? ? 1_555 A  A   1839 OP2   ? ? A MG  8007 A A   1840 1_555 ? ? ? ? ? ? ? 2.255 ? 
metalc39   metalc ? ? LA MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8007 A HOH 9006 1_555 ? ? ? ? ? ? ? 2.469 ? 
metalc40   metalc ? ? MA MG  .    MG    ? ? ? 1_555 A  A   2464 OP1   ? ? A MG  8008 A A   2465 1_555 ? ? ? ? ? ? ? 2.234 ? 
metalc41   metalc ? ? MA MG  .    MG    ? ? ? 1_555 A  U   918  OP1   ? ? A MG  8008 A U   919  1_555 ? ? ? ? ? ? ? 1.931 ? 
metalc42   metalc ? ? MA MG  .    MG    ? ? ? 1_555 A  C   2463 OP1   ? ? A MG  8008 A C   2464 1_555 ? ? ? ? ? ? ? 2.080 ? 
metalc43   metalc ? ? NA MG  .    MG    ? ? ? 1_555 A  G   2610 OP1   ? ? A MG  8009 A G   2611 1_555 ? ? ? ? ? ? ? 2.154 ? 
metalc44   metalc ? ? NA MG  .    MG    ? ? ? 1_555 A  A   2611 OP1   ? ? A MG  8009 A A   2612 1_555 ? ? ? ? ? ? ? 1.905 ? 
metalc45   metalc ? ? OA MG  .    MG    ? ? ? 1_555 A  G   835  OP1   ? ? A MG  8010 A G   836  1_555 ? ? ? ? ? ? ? 1.476 ? 
metalc46   metalc ? ? OA MG  .    MG    ? ? ? 1_555 A  U   2614 OP1   ? ? A MG  8010 A U   2615 1_555 ? ? ? ? ? ? ? 2.484 ? 
metalc47   metalc ? ? OA MG  .    MG    ? ? ? 1_555 D  GLN 230  OE1   ? ? A MG  8010 D GLN 230  1_555 ? ? ? ? ? ? ? 2.112 ? 
metalc48   metalc ? ? OA MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8010 A HOH 9360 1_555 ? ? ? ? ? ? ? 2.476 ? 
metalc49   metalc ? ? OA MG  .    MG    ? ? ? 1_555 IJ HOH .    O     ? ? A MG  8010 D HOH 8523 1_555 ? ? ? ? ? ? ? 1.814 ? 
metalc50   metalc ? ? PA MG  .    MG    ? ? ? 1_555 A  G   823  N7    ? ? A MG  8011 A G   824  1_555 ? ? ? ? ? ? ? 1.824 ? 
metalc51   metalc ? ? PA MG  .    MG    ? ? ? 1_555 A  G   853  N7    ? ? A MG  8011 A G   854  1_555 ? ? ? ? ? ? ? 1.974 ? 
metalc52   metalc ? ? QA MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8012 A HOH 9630 1_555 ? ? ? ? ? ? ? 1.916 ? 
metalc53   metalc ? ? QA MG  .    MG    ? ? ? 1_555 A  G   27   OP1   ? ? A MG  8012 A G   28   1_555 ? ? ? ? ? ? ? 1.921 ? 
metalc54   metalc ? ? QA MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8012 A HOH 9039 1_555 ? ? ? ? ? ? ? 2.032 ? 
metalc55   metalc ? ? RA MG  .    MG    ? ? ? 1_555 A  G   2622 OP1   ? ? A MG  8013 A G   2623 1_555 ? ? ? ? ? ? ? 1.605 ? 
metalc56   metalc ? ? RA MG  .    MG    ? ? ? 1_555 A  G   876  OP1   ? ? A MG  8013 A G   877  1_555 ? ? ? ? ? ? ? 1.864 ? 
metalc57   metalc ? ? RA MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8013 A HOH 9020 1_555 ? ? ? ? ? ? ? 1.870 ? 
metalc58   metalc ? ? SA MG  .    MG    ? ? ? 1_555 A  G   2536 OP2   ? ? A MG  8014 A G   2537 1_555 ? ? ? ? ? ? ? 1.742 ? 
metalc59   metalc ? ? SA MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8014 A HOH 9033 1_555 ? ? ? ? ? ? ? 2.036 ? 
metalc60   metalc ? ? SA MG  .    MG    ? ? ? 1_555 A  G   2101 OP2   ? ? A MG  8014 A G   2102 1_555 ? ? ? ? ? ? ? 2.343 ? 
metalc61   metalc ? ? TA MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8015 A HOH 9004 1_555 ? ? ? ? ? ? ? 1.904 ? 
metalc62   metalc ? ? TA MG  .    MG    ? ? ? 1_555 A  A   843  OP1   ? ? A MG  8015 A A   844  1_555 ? ? ? ? ? ? ? 1.935 ? 
metalc63   metalc ? ? TA MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8015 A HOH 9024 1_555 ? ? ? ? ? ? ? 2.136 ? 
metalc64   metalc ? ? TA MG  .    MG    ? ? ? 1_555 A  A   1688 OP1   ? ? A MG  8015 A A   1689 1_555 ? ? ? ? ? ? ? 2.161 ? 
metalc65   metalc ? ? UA MG  .    MG    ? ? ? 1_555 A  C   1678 OP2   ? ? A MG  8016 A C   1679 1_555 ? ? ? ? ? ? ? 1.828 ? 
metalc66   metalc ? ? UA MG  .    MG    ? ? ? 1_555 A  A   1503 OP1   ? ? A MG  8016 A A   1504 1_555 ? ? ? ? ? ? ? 2.425 ? 
metalc67   metalc ? ? UA MG  .    MG    ? ? ? 1_555 A  A   1677 OP1   ? ? A MG  8016 A A   1678 1_555 ? ? ? ? ? ? ? 2.053 ? 
metalc68   metalc ? ? VA MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8017 A HOH 9410 1_555 ? ? ? ? ? ? ? 1.778 ? 
metalc69   metalc ? ? VA MG  .    MG    ? ? ? 1_555 JJ HOH .    O     ? ? A MG  8017 E HOH 8359 1_555 ? ? ? ? ? ? ? 2.088 ? 
metalc70   metalc ? ? VA MG  .    MG    ? ? ? 1_555 JJ HOH .    O     ? ? A MG  8017 E HOH 8468 1_555 ? ? ? ? ? ? ? 1.917 ? 
metalc71   metalc ? ? VA MG  .    MG    ? ? ? 1_555 A  G   455  OP2   ? ? A MG  8017 A G   456  1_555 ? ? ? ? ? ? ? 2.130 ? 
metalc72   metalc ? ? WA MG  .    MG    ? ? ? 1_555 A  A   1290 OP1   ? ? A MG  8018 A A   1291 1_555 ? ? ? ? ? ? ? 1.989 ? 
metalc73   metalc ? ? WA MG  .    MG    ? ? ? 1_555 A  A   1290 OP2   ? ? A MG  8018 A A   1291 1_555 ? ? ? ? ? ? ? 2.961 ? 
metalc74   metalc ? ? WA MG  .    MG    ? ? ? 1_555 A  G   1291 OP2   ? ? A MG  8018 A G   1292 1_555 ? ? ? ? ? ? ? 2.194 ? 
metalc75   metalc ? ? XA MG  .    MG    ? ? ? 1_555 A  A   2010 OP1   ? ? A MG  8019 A A   2011 1_555 ? ? ? ? ? ? ? 3.131 ? 
metalc76   metalc ? ? XA MG  .    MG    ? ? ? 1_555 A  A   2010 OP2   ? ? A MG  8019 A A   2011 1_555 ? ? ? ? ? ? ? 2.392 ? 
metalc77   metalc ? ? YA MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8020 A HOH 9126 1_555 ? ? ? ? ? ? ? 1.911 ? 
metalc78   metalc ? ? YA MG  .    MG    ? ? ? 1_555 A  C   1829 OP1   ? ? A MG  8020 A C   1830 1_555 ? ? ? ? ? ? ? 1.942 ? 
metalc79   metalc ? ? YA MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8020 A HOH 9199 1_555 ? ? ? ? ? ? ? 1.647 ? 
metalc80   metalc ? ? YA MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8020 A HOH 9129 1_555 ? ? ? ? ? ? ? 2.100 ? 
metalc81   metalc ? ? ZA MG  .    MG    ? ? ? 1_555 A  G   2303 OP2   ? ? A MG  8021 A G   2304 1_555 ? ? ? ? ? ? ? 2.080 ? 
metalc82   metalc ? ? ZA MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8021 A HOH 9951 1_555 ? ? ? ? ? ? ? 2.243 ? 
metalc83   metalc ? ? AB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8022 A HOH 9454 1_555 ? ? ? ? ? ? ? 2.393 ? 
metalc84   metalc ? ? AB MG  .    MG    ? ? ? 1_555 A  G   2539 OP1   ? ? A MG  8022 A G   2540 1_555 ? ? ? ? ? ? ? 2.615 ? 
metalc85   metalc ? ? AB MG  .    MG    ? ? ? 1_555 A  G   2096 OP2   ? ? A MG  8022 A G   2097 1_555 ? ? ? ? ? ? ? 3.100 ? 
metalc86   metalc ? ? BB MG  .    MG    ? ? ? 1_555 A  G   2617 OP2   ? ? A MG  8023 A G   2618 1_555 ? ? ? ? ? ? ? 2.204 ? 
metalc87   metalc ? ? BB MG  .    MG    ? ? ? 1_555 A  G   2616 OP2   ? ? A MG  8023 A G   2617 1_555 ? ? ? ? ? ? ? 2.568 ? 
metalc88   metalc ? ? CB MG  .    MG    ? ? ? 1_555 A  A   1380 N7    ? ? A MG  8024 A A   1381 1_555 ? ? ? ? ? ? ? 2.366 ? 
metalc89   metalc ? ? CB MG  .    MG    ? ? ? 1_555 DK HOH .    O     ? ? A MG  8024 Y HOH 7830 1_555 ? ? ? ? ? ? ? 2.377 ? 
metalc90   metalc ? ? CB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8024 A HOH 9924 1_555 ? ? ? ? ? ? ? 2.043 ? 
metalc91   metalc ? ? DB MG  .    MG    ? ? ? 1_555 A  G   1120 OP2   ? ? A MG  8025 A G   1121 1_555 ? ? ? ? ? ? ? 2.170 ? 
metalc92   metalc ? ? DB MG  .    MG    ? ? ? 1_555 A  U   1119 OP2   ? ? A MG  8025 A U   1120 1_555 ? ? ? ? ? ? ? 2.425 ? 
metalc93   metalc ? ? EB MG  .    MG    ? ? ? 1_555 A  U   2609 OP2   ? ? A MG  8026 A U   2610 1_555 ? ? ? ? ? ? ? 1.826 ? 
metalc94   metalc ? ? EB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8026 A HOH 9388 1_555 ? ? ? ? ? ? ? 2.317 ? 
metalc95   metalc ? ? EB MG  .    MG    ? ? ? 1_555 A  C   2607 OP1   ? ? A MG  8026 A C   2608 1_555 ? ? ? ? ? ? ? 1.782 ? 
metalc96   metalc ? ? EB MG  .    MG    ? ? ? 1_555 A  G   2608 OP1   ? ? A MG  8026 A G   2609 1_555 ? ? ? ? ? ? ? 1.762 ? 
metalc97   metalc ? ? FB MG  .    MG    ? ? ? 1_555 A  G   268  O6    ? ? A MG  8027 A G   269  1_555 ? ? ? ? ? ? ? 2.056 ? 
metalc98   metalc ? ? FB MG  .    MG    ? ? ? 1_555 SJ HOH .    O     ? ? A MG  8027 N HOH 8643 1_555 ? ? ? ? ? ? ? 2.081 ? 
metalc99   metalc ? ? FB MG  .    MG    ? ? ? 1_555 A  C   239  OP1   ? ? A MG  8027 A C   240  1_555 ? ? ? ? ? ? ? 1.813 ? 
metalc100  metalc ? ? GB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8028 A HOH 9571 1_555 ? ? ? ? ? ? ? 2.207 ? 
metalc101  metalc ? ? GB MG  .    MG    ? ? ? 1_555 YJ HOH .    O     ? ? A MG  8028 T HOH 8346 1_555 ? ? ? ? ? ? ? 2.262 ? 
metalc102  metalc ? ? GB MG  .    MG    ? ? ? 1_555 A  A   1447 OP2   ? ? A MG  8028 A A   1448 1_555 ? ? ? ? ? ? ? 2.323 ? 
metalc103  metalc ? ? GB MG  .    MG    ? ? ? 1_555 A  U   1676 O4    ? ? A MG  8028 A U   1677 1_555 ? ? ? ? ? ? ? 1.949 ? 
metalc104  metalc ? ? HB MG  .    MG    ? ? ? 1_555 A  C   1678 OP1   ? ? A MG  8029 A C   1679 1_555 ? ? ? ? ? ? ? 2.313 ? 
metalc105  metalc ? ? HB MG  .    MG    ? ? ? 1_555 A  U   1502 OP1   ? ? A MG  8029 A U   1503 1_555 ? ? ? ? ? ? ? 1.891 ? 
metalc106  metalc ? ? IB MG  .    MG    ? ? ? 1_555 A  U   1748 OP2   ? ? A MG  8030 A U   1749 1_555 ? ? ? ? ? ? ? 2.207 ? 
metalc107  metalc ? ? IB MG  .    MG    ? ? ? 1_555 A  U   1747 OP1   ? ? A MG  8030 A U   1748 1_555 ? ? ? ? ? ? ? 1.990 ? 
metalc108  metalc ? ? JB MG  .    MG    ? ? ? 1_555 A  C   777  OP2   ? ? A MG  8031 A C   778  1_555 ? ? ? ? ? ? ? 2.437 ? 
metalc109  metalc ? ? JB MG  .    MG    ? ? ? 1_555 A  U   776  OP2   ? ? A MG  8031 A U   777  1_555 ? ? ? ? ? ? ? 1.876 ? 
metalc110  metalc ? ? KB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8032 A HOH 9979 1_555 ? ? ? ? ? ? ? 2.268 ? 
metalc111  metalc ? ? KB MG  .    MG    ? ? ? 1_555 HJ HOH .    O     ? ? A MG  8032 C HOH 8631 1_555 ? ? ? ? ? ? ? 2.548 ? 
metalc112  metalc ? ? KB MG  .    MG    ? ? ? 1_555 A  U   2114 OP1   ? ? A MG  8032 A U   2115 1_555 ? ? ? ? ? ? ? 1.902 ? 
metalc113  metalc ? ? LB MG  .    MG    ? ? ? 1_555 A  A   1746 OP2   ? ? A MG  8033 A A   1747 1_555 ? ? ? ? ? ? ? 2.221 ? 
metalc114  metalc ? ? LB MG  .    MG    ? ? ? 1_555 A  U   1748 O4    ? ? A MG  8033 A U   1749 1_555 ? ? ? ? ? ? ? 2.319 ? 
metalc115  metalc ? ? LB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8033 A HOH 9668 1_555 ? ? ? ? ? ? ? 2.196 ? 
metalc116  metalc ? ? LB MG  .    MG    ? ? ? 1_555 A  G   2584 OP1   ? ? A MG  8033 A G   2585 1_555 ? ? ? ? ? ? ? 2.138 ? 
metalc117  metalc ? ? LB MG  .    MG    ? ? ? 1_555 A  U   1747 OP2   ? ? A MG  8033 A U   1748 1_555 ? ? ? ? ? ? ? 1.608 ? 
metalc118  metalc ? ? MB MG  .    MG    ? ? ? 1_555 A  A   2302 OP1   ? ? A MG  8034 A A   2303 1_555 ? ? ? ? ? ? ? 2.194 ? 
metalc119  metalc ? ? MB MG  .    MG    ? ? ? 1_555 A  A   2301 OP1   ? ? A MG  8034 A A   2302 1_555 ? ? ? ? ? ? ? 1.881 ? 
metalc120  metalc ? ? NB MG  .    MG    ? ? ? 1_555 A  G   1483 OP2   ? ? A MG  8035 A G   1484 1_555 ? ? ? ? ? ? ? 1.777 ? 
metalc121  metalc ? ? OB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8036 A HOH 9365 1_555 ? ? ? ? ? ? ? 1.614 ? 
metalc122  metalc ? ? OB MG  .    MG    ? ? ? 1_555 A  G   955  OP2   ? ? A MG  8036 A G   956  1_555 ? ? ? ? ? ? ? 1.740 ? 
metalc123  metalc ? ? PB MG  .    MG    ? ? ? 1_555 A  A   2552 OP2   ? ? A MG  8037 A A   2553 1_555 ? ? ? ? ? ? ? 2.424 ? 
metalc124  metalc ? ? PB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8037 A HOH 9081 1_555 ? ? ? ? ? ? ? 2.701 ? 
metalc125  metalc ? ? QB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8038 A HOH 9281 1_555 ? ? ? ? ? ? ? 2.036 ? 
metalc126  metalc ? ? RB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8039 A HOH 9897 1_555 ? ? ? ? ? ? ? 2.500 ? 
metalc127  metalc ? ? RB MG  .    MG    ? ? ? 1_555 A  U   114  OP2   ? ? A MG  8039 A U   115  1_555 ? ? ? ? ? ? ? 1.976 ? 
metalc128  metalc ? ? SB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8040 A HOH 9682 1_555 ? ? ? ? ? ? ? 2.526 ? 
metalc129  metalc ? ? SB MG  .    MG    ? ? ? 1_555 A  U   391  OP2   ? ? A MG  8040 A U   392  1_555 ? ? ? ? ? ? ? 2.028 ? 
metalc130  metalc ? ? TB MG  .    MG    ? ? ? 1_555 A  C   227  "O4'" ? ? A MG  8041 A C   228  1_555 ? ? ? ? ? ? ? 2.551 ? 
metalc131  metalc ? ? TB MG  .    MG    ? ? ? 1_555 A  A   226  "O2'" ? ? A MG  8041 A A   227  1_555 ? ? ? ? ? ? ? 2.499 ? 
metalc132  metalc ? ? TB MG  .    MG    ? ? ? 1_555 A  G   195  OP1   ? ? A MG  8041 A G   196  1_555 ? ? ? ? ? ? ? 2.588 ? 
metalc133  metalc ? ? UB MG  .    MG    ? ? ? 1_555 A  U   1345 O2    ? ? A MG  8042 A U   1346 1_555 ? ? ? ? ? ? ? 2.625 ? 
metalc134  metalc ? ? UB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8042 A HOH 9432 1_555 ? ? ? ? ? ? ? 2.614 ? 
metalc135  metalc ? ? UB MG  .    MG    ? ? ? 1_555 A  U   1308 O2    ? ? A MG  8042 A U   1309 1_555 ? ? ? ? ? ? ? 2.763 ? 
metalc136  metalc ? ? VB MG  .    MG    ? ? ? 1_555 A  G   815  O6    ? ? A MG  8043 A G   816  1_555 ? ? ? ? ? ? ? 2.325 ? 
metalc137  metalc ? ? VB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8043 A HOH 9804 1_555 ? ? ? ? ? ? ? 2.535 ? 
metalc138  metalc ? ? VB MG  .    MG    ? ? ? 1_555 A  G   816  O6    ? ? A MG  8043 A G   817  1_555 ? ? ? ? ? ? ? 2.608 ? 
metalc139  metalc ? ? WB MG  .    MG    ? ? ? 1_555 A  A   2088 OP1   ? ? A MG  8044 A A   2089 1_555 ? ? ? ? ? ? ? 2.296 ? 
metalc140  metalc ? ? WB MG  .    MG    ? ? ? 1_555 A  C   2047 OP1   ? ? A MG  8044 A C   2048 1_555 ? ? ? ? ? ? ? 2.311 ? 
metalc141  metalc ? ? WB MG  .    MG    ? ? ? 1_555 S  GLY 65   O     ? ? A MG  8044 S GLY 65   1_555 ? ? ? ? ? ? ? 2.390 ? 
metalc142  metalc ? ? XB MG  .    MG    ? ? ? 1_555 A  G   1978 OP2   ? ? A MG  8045 A G   1979 1_555 ? ? ? ? ? ? ? 1.697 ? 
metalc143  metalc ? ? YB MG  .    MG    ? ? ? 1_555 A  G   1793 N7    ? ? A MG  8046 A G   1794 1_555 ? ? ? ? ? ? ? 2.551 ? 
metalc144  metalc ? ? ZB MG  .    MG    ? ? ? 1_555 A  A   1097 OP2   ? ? A MG  8047 A A   1098 1_555 ? ? ? ? ? ? ? 2.041 ? 
metalc145  metalc ? ? AC MG  .    MG    ? ? ? 1_555 A  A   2745 OP2   ? ? A MG  8048 A A   2746 1_555 ? ? ? ? ? ? ? 2.331 ? 
metalc146  metalc ? ? AC MG  .    MG    ? ? ? 1_555 A  G   2749 OP2   ? ? A MG  8048 A G   2750 1_555 ? ? ? ? ? ? ? 2.107 ? 
metalc147  metalc ? ? BC MG  .    MG    ? ? ? 1_555 A  G   2420 OP1   ? ? A MG  8049 A G   2421 1_555 ? ? ? ? ? ? ? 2.147 ? 
metalc148  metalc ? ? BC MG  .    MG    ? ? ? 1_555 A  C   2422 OP1   ? ? A MG  8049 A C   2423 1_555 ? ? ? ? ? ? ? 3.052 ? 
metalc149  metalc ? ? CC MG  .    MG    ? ? ? 1_555 A  C   2247 OP1   ? ? A MG  8050 A C   2248 1_555 ? ? ? ? ? ? ? 2.992 ? 
metalc150  metalc ? ? CC MG  .    MG    ? ? ? 1_555 A  C   2247 OP2   ? ? A MG  8050 A C   2248 1_555 ? ? ? ? ? ? ? 2.231 ? 
metalc151  metalc ? ? DC MG  .    MG    ? ? ? 1_555 A  G   640  OP2   ? ? A MG  8051 A G   641  1_555 ? ? ? ? ? ? ? 1.950 ? 
metalc152  metalc ? ? EC MG  .    MG    ? ? ? 1_555 B  G   92   OP1   ? ? A MG  8052 B G   3092 1_555 ? ? ? ? ? ? ? 2.879 ? 
metalc153  metalc ? ? EC MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? A MG  8052 B HOH 737  1_555 ? ? ? ? ? ? ? 2.512 ? 
metalc154  metalc ? ? EC MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? A MG  8052 B HOH 2357 1_555 ? ? ? ? ? ? ? 2.461 ? 
metalc155  metalc ? ? EC MG  .    MG    ? ? ? 1_555 A  U   1124 OP1   ? ? A MG  8052 A U   1125 1_555 ? ? ? ? ? ? ? 2.097 ? 
metalc156  metalc ? ? FC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8053 A HOH 9240 1_555 ? ? ? ? ? ? ? 2.543 ? 
metalc157  metalc ? ? FC MG  .    MG    ? ? ? 1_555 A  G   470  O6    ? ? A MG  8053 A G   471  1_555 ? ? ? ? ? ? ? 2.190 ? 
metalc158  metalc ? ? FC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8053 A HOH 9205 1_555 ? ? ? ? ? ? ? 2.692 ? 
metalc159  metalc ? ? GC MG  .    MG    ? ? ? 1_555 A  C   161  OP1   ? ? A MG  8054 A C   162  1_555 ? ? ? ? ? ? ? 2.166 ? 
metalc160  metalc ? ? GC MG  .    MG    ? ? ? 1_555 A  U   2275 OP1   ? ? A MG  8054 A U   2276 1_555 ? ? ? ? ? ? ? 2.245 ? 
metalc161  metalc ? ? GC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8054 A HOH 9428 1_555 ? ? ? ? ? ? ? 1.640 ? 
metalc162  metalc ? ? HC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8056 A HOH 9971 1_555 ? ? ? ? ? ? ? 2.036 ? 
metalc163  metalc ? ? HC MG  .    MG    ? ? ? 1_555 A  A   2756 OP1   ? ? A MG  8056 A A   2757 1_555 ? ? ? ? ? ? ? 1.776 ? 
metalc164  metalc ? ? HC MG  .    MG    ? ? ? 1_555 D  ASN 335  O     ? ? A MG  8056 D ASN 335  1_555 ? ? ? ? ? ? ? 2.274 ? 
metalc165  metalc ? ? IC MG  .    MG    ? ? ? 1_555 A  U   1882 OP1   ? ? A MG  8057 A U   1883 1_555 ? ? ? ? ? ? ? 2.457 ? 
metalc166  metalc ? ? IC MG  .    MG    ? ? ? 1_555 A  U   2011 "O2'" ? ? A MG  8057 A U   2012 1_555 ? ? ? ? ? ? ? 2.398 ? 
metalc167  metalc ? ? IC MG  .    MG    ? ? ? 1_555 C  GLN 207  O     ? ? A MG  8057 C GLN 207  1_555 ? ? ? ? ? ? ? 3.003 ? 
metalc168  metalc ? ? IC MG  .    MG    ? ? ? 1_555 HJ HOH .    O     ? ? A MG  8057 C HOH 8634 1_555 ? ? ? ? ? ? ? 3.072 ? 
metalc169  metalc ? ? JC MG  .    MG    ? ? ? 1_555 A  G   2012 OP2   ? ? A MG  8058 A G   2013 1_555 ? ? ? ? ? ? ? 1.951 ? 
metalc170  metalc ? ? JC MG  .    MG    ? ? ? 1_555 HJ HOH .    O     ? ? A MG  8058 C HOH 8632 1_555 ? ? ? ? ? ? ? 2.181 ? 
metalc171  metalc ? ? JC MG  .    MG    ? ? ? 1_555 HJ HOH .    O     ? ? A MG  8058 C HOH 8634 1_555 ? ? ? ? ? ? ? 2.082 ? 
metalc172  metalc ? ? KC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8059 A HOH 9042 1_555 ? ? ? ? ? ? ? 2.144 ? 
metalc173  metalc ? ? KC MG  .    MG    ? ? ? 1_555 A  G   2617 OP1   ? ? A MG  8059 A G   2618 1_555 ? ? ? ? ? ? ? 2.251 ? 
metalc174  metalc ? ? KC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8059 A HOH 9038 1_555 ? ? ? ? ? ? ? 1.910 ? 
metalc175  metalc ? ? LC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8060 A HOH 9172 1_555 ? ? ? ? ? ? ? 2.192 ? 
metalc176  metalc ? ? LC MG  .    MG    ? ? ? 1_555 A  G   174  OP2   ? ? A MG  8060 A G   175  1_555 ? ? ? ? ? ? ? 2.502 ? 
metalc177  metalc ? ? MC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8061 A HOH 9809 1_555 ? ? ? ? ? ? ? 1.984 ? 
metalc178  metalc ? ? MC MG  .    MG    ? ? ? 1_555 A  U   2649 OP1   ? ? A MG  8061 A U   2650 1_555 ? ? ? ? ? ? ? 2.254 ? 
metalc179  metalc ? ? MC MG  .    MG    ? ? ? 1_555 A  A   1368 OP2   ? ? A MG  8061 A A   1369 1_555 ? ? ? ? ? ? ? 2.397 ? 
metalc180  metalc ? ? NC MG  .    MG    ? ? ? 1_555 A  G   1488 OP2   ? ? A MG  8062 A G   1489 1_555 ? ? ? ? ? ? ? 2.369 ? 
metalc181  metalc ? ? NC MG  .    MG    ? ? ? 1_555 A  G   1490 O6    ? ? A MG  8062 A G   1491 1_555 ? ? ? ? ? ? ? 2.092 ? 
metalc182  metalc ? ? NC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8062 A HOH 9390 1_555 ? ? ? ? ? ? ? 2.399 ? 
metalc183  metalc ? ? PC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8064 A HOH 9585 1_555 ? ? ? ? ? ? ? 2.551 ? 
metalc184  metalc ? ? PC MG  .    MG    ? ? ? 1_555 A  U   2277 O4    ? ? A MG  8064 A U   2278 1_555 ? ? ? ? ? ? ? 2.535 ? 
metalc185  metalc ? ? PC MG  .    MG    ? ? ? 1_555 A  G   2470 O6    ? ? A MG  8064 A G   2471 1_555 ? ? ? ? ? ? ? 2.536 ? 
metalc186  metalc ? ? PC MG  .    MG    ? ? ? 1_555 A  U   2276 O4    ? ? A MG  8064 A U   2277 1_555 ? ? ? ? ? ? ? 2.662 ? 
metalc187  metalc ? ? QC MG  .    MG    ? ? ? 1_555 A  C   1871 "O3'" ? ? A MG  8066 A C   1872 1_555 ? ? ? ? ? ? ? 2.757 ? 
metalc188  metalc ? ? QC MG  .    MG    ? ? ? 1_555 C  ASP 26   OD2   ? ? A MG  8066 C ASP 26   1_555 ? ? ? ? ? ? ? 2.034 ? 
metalc189  metalc ? ? QC MG  .    MG    ? ? ? 1_555 A  G   1872 OP2   ? ? A MG  8066 A G   1873 1_555 ? ? ? ? ? ? ? 1.824 ? 
metalc190  metalc ? ? QC MG  .    MG    ? ? ? 1_555 HJ HOH .    O     ? ? A MG  8066 C HOH 8565 1_555 ? ? ? ? ? ? ? 2.590 ? 
metalc191  metalc ? ? QC MG  .    MG    ? ? ? 1_555 C  ASP 26   OD1   ? ? A MG  8066 C ASP 26   1_555 ? ? ? ? ? ? ? 2.543 ? 
metalc192  metalc ? ? RC MG  .    MG    ? ? ? 1_555 A  U   1845 OP2   ? ? A MG  8067 A U   1846 1_555 ? ? ? ? ? ? ? 2.720 ? 
metalc193  metalc ? ? RC MG  .    MG    ? ? ? 1_555 C  ASN 188  O     ? ? A MG  8067 C ASN 188  1_555 ? ? ? ? ? ? ? 2.421 ? 
metalc194  metalc ? ? RC MG  .    MG    ? ? ? 1_555 A  G   1883 O6    ? ? A MG  8067 A G   1884 1_555 ? ? ? ? ? ? ? 2.536 ? 
metalc195  metalc ? ? RC MG  .    MG    ? ? ? 1_555 A  A   1844 OP1   ? ? A MG  8067 A A   1845 1_555 ? ? ? ? ? ? ? 1.990 ? 
metalc196  metalc ? ? RC MG  .    MG    ? ? ? 1_555 A  A   1844 "O5'" ? ? A MG  8067 A A   1845 1_555 ? ? ? ? ? ? ? 3.073 ? 
metalc197  metalc ? ? SC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8068 A HOH 9724 1_555 ? ? ? ? ? ? ? 2.215 ? 
metalc198  metalc ? ? SC MG  .    MG    ? ? ? 1_555 A  A   2567 OP2   ? ? A MG  8068 A A   2568 1_555 ? ? ? ? ? ? ? 1.944 ? 
metalc199  metalc ? ? TC MG  .    MG    ? ? ? 1_555 A  A   165  OP1   ? ? A MG  8070 A A   166  1_555 ? ? ? ? ? ? ? 2.004 ? 
metalc200  metalc ? ? TC MG  .    MG    ? ? ? 1_555 A  G   218  O6    ? ? A MG  8070 A G   219  1_555 ? ? ? ? ? ? ? 2.586 ? 
metalc201  metalc ? ? TC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8070 A HOH 9127 1_555 ? ? ? ? ? ? ? 2.847 ? 
metalc202  metalc ? ? VC MG  .    MG    ? ? ? 1_555 A  U   953  OP1   ? ? A MG  8072 A U   954  1_555 ? ? ? ? ? ? ? 2.320 ? 
metalc203  metalc ? ? WC MG  .    MG    ? ? ? 1_555 A  A   1286 OP1   ? ? A MG  8074 A A   1287 1_555 ? ? ? ? ? ? ? 2.139 ? 
metalc204  metalc ? ? WC MG  .    MG    ? ? ? 1_555 CK HOH .    O     ? ? A MG  8074 X HOH 7874 1_555 ? ? ? ? ? ? ? 2.118 ? 
metalc205  metalc ? ? WC MG  .    MG    ? ? ? 1_555 A  A   1285 OP1   ? ? A MG  8074 A A   1286 1_555 ? ? ? ? ? ? ? 1.739 ? 
metalc206  metalc ? ? XC MG  .    MG    ? ? ? 1_555 A  A   907  "O4'" ? ? A MG  8075 A A   908  1_555 ? ? ? ? ? ? ? 2.823 ? 
metalc207  metalc ? ? XC MG  .    MG    ? ? ? 1_555 A  A   906  "O2'" ? ? A MG  8075 A A   907  1_555 ? ? ? ? ? ? ? 2.751 ? 
metalc208  metalc ? ? YC MG  .    MG    ? ? ? 1_555 HK HOH .    O     ? ? A MG  8076 3 HOH 7875 1_555 ? ? ? ? ? ? ? 2.071 ? 
metalc209  metalc ? ? ZC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8077 A HOH 9239 1_555 ? ? ? ? ? ? ? 2.368 ? 
metalc210  metalc ? ? ZC MG  .    MG    ? ? ? 1_555 A  U   882  OP2   ? ? A MG  8077 A U   883  1_555 ? ? ? ? ? ? ? 2.138 ? 
metalc211  metalc ? ? ZC MG  .    MG    ? ? ? 1_555 A  C   879  OP1   ? ? A MG  8077 A C   880  1_555 ? ? ? ? ? ? ? 2.064 ? 
metalc212  metalc ? ? AD MG  .    MG    ? ? ? 1_555 A  C   167  OP2   ? ? A MG  8079 A C   168  1_555 ? ? ? ? ? ? ? 1.899 ? 
metalc213  metalc ? ? AD MG  .    MG    ? ? ? 1_555 A  A   166  OP1   ? ? A MG  8079 A A   167  1_555 ? ? ? ? ? ? ? 1.736 ? 
metalc214  metalc ? ? AD MG  .    MG    ? ? ? 1_555 A  A   164  N7    ? ? A MG  8079 A A   165  1_555 ? ? ? ? ? ? ? 1.851 ? 
metalc215  metalc ? ? BD MG  .    MG    ? ? ? 1_555 A  A   1683 OP2   ? ? A MG  8080 A A   1684 1_555 ? ? ? ? ? ? ? 2.320 ? 
metalc216  metalc ? ? BD MG  .    MG    ? ? ? 1_555 A  U   1723 OP2   ? ? A MG  8080 A U   1724 1_555 ? ? ? ? ? ? ? 2.159 ? 
metalc217  metalc ? ? CD MG  .    MG    ? ? ? 1_555 A  G   1437 OP1   ? ? A MG  8081 A G   1438 1_555 ? ? ? ? ? ? ? 2.198 ? 
metalc218  metalc ? ? CD MG  .    MG    ? ? ? 1_555 A  C   1420 OP2   ? ? A MG  8081 A C   1421 1_555 ? ? ? ? ? ? ? 2.109 ? 
metalc219  metalc ? ? CD MG  .    MG    ? ? ? 1_555 A  C   1419 OP1   ? ? A MG  8081 A C   1420 1_555 ? ? ? ? ? ? ? 2.101 ? 
metalc220  metalc ? ? CD MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8081 A HOH 9605 1_555 ? ? ? ? ? ? ? 2.672 ? 
metalc221  metalc ? ? DD MG  .    MG    ? ? ? 1_555 A  A   1436 OP2   ? ? A MG  8082 A A   1437 1_555 ? ? ? ? ? ? ? 2.840 ? 
metalc222  metalc ? ? ED MG  .    MG    ? ? ? 1_555 A  A   1753 OP2   ? ? A MG  8083 A A   1754 1_555 ? ? ? ? ? ? ? 2.388 ? 
metalc223  metalc ? ? FD MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8084 A HOH 9741 1_555 ? ? ? ? ? ? ? 2.165 ? 
metalc224  metalc ? ? FD MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8084 A HOH 9370 1_555 ? ? ? ? ? ? ? 2.431 ? 
metalc225  metalc ? ? FD MG  .    MG    ? ? ? 1_555 A  A   1741 OP2   ? ? A MG  8084 A A   1742 1_555 ? ? ? ? ? ? ? 1.892 ? 
metalc226  metalc ? ? FD MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8084 A HOH 9249 1_555 ? ? ? ? ? ? ? 2.275 ? 
metalc227  metalc ? ? GD MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8085 A HOH 9596 1_555 ? ? ? ? ? ? ? 2.962 ? 
metalc228  metalc ? ? GD MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8085 A HOH 9038 1_555 ? ? ? ? ? ? ? 2.581 ? 
metalc229  metalc ? ? GD MG  .    MG    ? ? ? 1_555 A  G   2617 OP1   ? ? A MG  8085 A G   2618 1_555 ? ? ? ? ? ? ? 2.715 ? 
metalc230  metalc ? ? GD MG  .    MG    ? ? ? 1_555 A  G   2616 "O3'" ? ? A MG  8085 A G   2617 1_555 ? ? ? ? ? ? ? 3.043 ? 
metalc231  metalc ? ? HD MG  .    MG    ? ? ? 1_555 A  U   532  OP1   ? ? A MG  8086 A U   533  1_555 ? ? ? ? ? ? ? 1.923 ? 
metalc232  metalc ? ? HD MG  .    MG    ? ? ? 1_555 A  A   531  OP1   ? ? A MG  8086 A A   532  1_555 ? ? ? ? ? ? ? 2.521 ? 
metalc233  metalc ? ? ID MG  .    MG    ? ? ? 1_555 A  G   682  OP2   ? ? A MG  8087 A G   683  1_555 ? ? ? ? ? ? ? 2.119 ? 
metalc234  metalc ? ? ID MG  .    MG    ? ? ? 1_555 A  A   681  OP2   ? ? A MG  8087 A A   682  1_555 ? ? ? ? ? ? ? 1.978 ? 
metalc235  metalc ? ? JD MG  .    MG    ? ? ? 1_555 A  G   2610 "O2'" ? ? A MG  8088 A G   2611 1_555 ? ? ? ? ? ? ? 2.662 ? 
metalc236  metalc ? ? JD MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8088 A HOH 9295 1_555 ? ? ? ? ? ? ? 2.064 ? 
metalc237  metalc ? ? JD MG  .    MG    ? ? ? 1_555 A  G   2539 O6    ? ? A MG  8088 A G   2540 1_555 ? ? ? ? ? ? ? 2.638 ? 
metalc238  metalc ? ? JD MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8088 A HOH 9066 1_555 ? ? ? ? ? ? ? 1.810 ? 
metalc239  metalc ? ? KD MG  .    MG    ? ? ? 1_555 A  U   516  OP2   ? ? A MG  8089 A U   517  1_555 ? ? ? ? ? ? ? 2.526 ? 
metalc240  metalc ? ? KD MG  .    MG    ? ? ? 1_555 A  A   515  OP1   ? ? A MG  8089 A A   516  1_555 ? ? ? ? ? ? ? 2.384 ? 
metalc241  metalc ? ? KD MG  .    MG    ? ? ? 1_555 A  G   517  N7    ? ? A MG  8089 A G   518  1_555 ? ? ? ? ? ? ? 3.082 ? 
metalc242  metalc ? ? LD MG  .    MG    ? ? ? 1_555 A  G   2101 OP2   ? ? A MG  8090 A G   2102 1_555 ? ? ? ? ? ? ? 2.916 ? 
metalc243  metalc ? ? LD MG  .    MG    ? ? ? 1_555 A  A   2478 OP2   ? ? A MG  8090 A A   2479 1_555 ? ? ? ? ? ? ? 2.602 ? 
metalc244  metalc ? ? MD MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8091 A HOH 9542 1_555 ? ? ? ? ? ? ? 2.048 ? 
metalc245  metalc ? ? MD MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8091 A HOH 9095 1_555 ? ? ? ? ? ? ? 2.696 ? 
metalc246  metalc ? ? MD MG  .    MG    ? ? ? 1_555 A  G   917  OP1   ? ? A MG  8091 A G   918  1_555 ? ? ? ? ? ? ? 2.147 ? 
metalc247  metalc ? ? ND MG  .    MG    ? ? ? 1_555 A  C   1843 OP2   ? ? A MG  8092 A C   1844 1_555 ? ? ? ? ? ? ? 2.178 ? 
metalc248  metalc ? ? OD MG  .    MG    ? ? ? 1_555 A  A   1069 "O2'" ? ? A MG  8093 A A   1070 1_555 ? ? ? ? ? ? ? 2.937 ? 
metalc249  metalc ? ? OD MG  .    MG    ? ? ? 1_555 EK HOH .    O     ? ? A MG  8093 Z HOH 8543 1_555 ? ? ? ? ? ? ? 2.515 ? 
metalc250  metalc ? ? OD MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8093 A HOH 9674 1_555 ? ? ? ? ? ? ? 2.638 ? 
metalc251  metalc ? ? OD MG  .    MG    ? ? ? 1_555 A  G   1070 OP1   ? ? A MG  8093 A G   1071 1_555 ? ? ? ? ? ? ? 2.714 ? 
metalc252  metalc ? ? PD MG  .    MG    ? ? ? 1_555 A  U   1095 OP2   ? ? A MG  8094 A U   1096 1_555 ? ? ? ? ? ? ? 2.149 ? 
metalc253  metalc ? ? PD MG  .    MG    ? ? ? 1_555 A  C   1256 OP2   ? ? A MG  8094 A C   1257 1_555 ? ? ? ? ? ? ? 2.151 ? 
metalc254  metalc ? ? QD MG  .    MG    ? ? ? 1_555 A  G   1848 O6    ? ? A MG  8096 A G   1849 1_555 ? ? ? ? ? ? ? 1.934 ? 
metalc255  metalc ? ? QD MG  .    MG    ? ? ? 1_555 A  G   1847 O6    ? ? A MG  8096 A G   1848 1_555 ? ? ? ? ? ? ? 2.173 ? 
metalc256  metalc ? ? RD MG  .    MG    ? ? ? 1_555 A  U   863  O4    ? ? A MG  8097 A U   864  1_555 ? ? ? ? ? ? ? 2.768 ? 
metalc257  metalc ? ? RD MG  .    MG    ? ? ? 1_555 A  G   862  O6    ? ? A MG  8097 A G   863  1_555 ? ? ? ? ? ? ? 2.547 ? 
metalc258  metalc ? ? SD MG  .    MG    ? ? ? 1_555 EK HOH .    O     ? ? A MG  8098 Z HOH 8568 1_555 ? ? ? ? ? ? ? 2.781 ? 
metalc259  metalc ? ? SD MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8098 A HOH 9930 1_555 ? ? ? ? ? ? ? 1.810 ? 
metalc260  metalc ? ? SD MG  .    MG    ? ? ? 1_555 A  A   906  N7    ? ? A MG  8098 A A   907  1_555 ? ? ? ? ? ? ? 2.750 ? 
metalc261  metalc ? ? TD MG  .    MG    ? ? ? 1_555 A  A   2611 "O2'" ? ? A MG  8099 A A   2612 1_555 ? ? ? ? ? ? ? 2.768 ? 
metalc262  metalc ? ? UD MG  .    MG    ? ? ? 1_555 A  G   2079 O6    ? ? A MG  8100 A G   2080 1_555 ? ? ? ? ? ? ? 3.103 ? 
metalc263  metalc ? ? VD MG  .    MG    ? ? ? 1_555 A  U   2281 O4    ? ? A MG  8101 A U   2282 1_555 ? ? ? ? ? ? ? 2.257 ? 
metalc264  metalc ? ? VD MG  .    MG    ? ? ? 1_555 A  C   2280 OP2   ? ? A MG  8101 A C   2281 1_555 ? ? ? ? ? ? ? 2.080 ? 
metalc265  metalc ? ? WD MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8102 A HOH 9252 1_555 ? ? ? ? ? ? ? 2.570 ? 
metalc266  metalc ? ? WD MG  .    MG    ? ? ? 1_555 IK HOH .    O     ? ? A MG  8102 4 HOH 8525 1_555 ? ? ? ? ? ? ? 2.955 ? 
metalc267  metalc ? ? WD MG  .    MG    ? ? ? 1_555 A  A   2433 N3    ? ? A MG  8102 A A   2434 1_555 ? ? ? ? ? ? ? 2.013 ? 
metalc268  metalc ? ? XD MG  .    MG    ? ? ? 1_555 A  G   2578 OP2   ? ? A MG  8103 A G   2579 1_555 ? ? ? ? ? ? ? 2.840 ? 
metalc269  metalc ? ? XD MG  .    MG    ? ? ? 1_555 A  G   2577 OP2   ? ? A MG  8103 A G   2578 1_555 ? ? ? ? ? ? ? 2.709 ? 
metalc270  metalc ? ? YD MG  .    MG    ? ? ? 1_555 A  C   2104 OP2   ? ? A MG  8104 A C   2105 1_555 ? ? ? ? ? ? ? 2.662 ? 
metalc271  metalc ? ? ZD MG  .    MG    ? ? ? 1_555 VJ HOH .    O     ? ? A MG  8106 Q HOH 5319 1_555 ? ? ? ? ? ? ? 2.921 ? 
metalc272  metalc ? ? ZD MG  .    MG    ? ? ? 1_555 A  G   816  O6    ? ? A MG  8106 A G   817  1_555 ? ? ? ? ? ? ? 2.265 ? 
metalc273  metalc ? ? AE MG  .    MG    ? ? ? 1_555 A  A   1105 OP2   ? ? A MG  8107 A A   1106 1_555 ? ? ? ? ? ? ? 1.897 ? 
metalc274  metalc ? ? AE MG  .    MG    ? ? ? 1_555 A  A   1106 OP2   ? ? A MG  8107 A A   1107 1_555 ? ? ? ? ? ? ? 2.299 ? 
metalc275  metalc ? ? CE MG  .    MG    ? ? ? 1_555 A  U   902  OP1   ? ? A MG  8110 A U   903  1_555 ? ? ? ? ? ? ? 2.307 ? 
metalc276  metalc ? ? CE MG  .    MG    ? ? ? 1_555 A  A   1356 N7    ? ? A MG  8110 A A   1357 1_555 ? ? ? ? ? ? ? 2.459 ? 
metalc277  metalc ? ? CE MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8110 A HOH 9504 1_555 ? ? ? ? ? ? ? 2.617 ? 
metalc278  metalc ? ? DE MG  .    MG    ? ? ? 1_555 A  G   2608 N7    ? ? A MG  8111 A G   2609 1_555 ? ? ? ? ? ? ? 2.575 ? 
metalc279  metalc ? ? EE MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8112 A HOH 9564 1_555 ? ? ? ? ? ? ? 2.748 ? 
metalc280  metalc ? ? EE MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8112 A HOH 9331 1_555 ? ? ? ? ? ? ? 2.161 ? 
metalc281  metalc ? ? EE MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8112 A HOH 9132 1_555 ? ? ? ? ? ? ? 2.588 ? 
metalc282  metalc ? ? EE MG  .    MG    ? ? ? 1_555 A  A   186  N1    ? ? A MG  8112 A A   187  1_555 ? ? ? ? ? ? ? 2.328 ? 
metalc283  metalc ? ? FE MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8113 A HOH 9585 1_555 ? ? ? ? ? ? ? 2.953 ? 
metalc284  metalc ? ? FE MG  .    MG    ? ? ? 1_555 A  A   2111 N7    ? ? A MG  8113 A A   2112 1_555 ? ? ? ? ? ? ? 2.590 ? 
metalc285  metalc ? ? GE MG  .    MG    ? ? ? 1_555 IK HOH .    O     ? ? A MG  8114 4 HOH 8539 1_555 ? ? ? ? ? ? ? 2.231 ? 
metalc286  metalc ? ? GE MG  .    MG    ? ? ? 1_555 IK HOH .    O     ? ? A MG  8114 4 HOH 8535 1_555 ? ? ? ? ? ? ? 3.018 ? 
metalc287  metalc ? ? GE MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8114 A HOH 9447 1_555 ? ? ? ? ? ? ? 2.499 ? 
metalc288  metalc ? ? GE MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8114 A HOH 9348 1_555 ? ? ? ? ? ? ? 2.139 ? 
metalc289  metalc ? ? HE MG  .    MG    ? ? ? 1_555 HJ HOH .    O     ? ? A MG  8115 C HOH 8635 1_555 ? ? ? ? ? ? ? 2.806 ? 
metalc290  metalc ? ? IE MG  .    MG    ? ? ? 1_555 A  U   1849 O4    ? ? A MG  8116 A U   1850 1_555 ? ? ? ? ? ? ? 2.460 ? 
metalc291  metalc ? ? IE MG  .    MG    ? ? ? 1_555 HJ HOH .    O     ? ? A MG  8116 C HOH 8555 1_555 ? ? ? ? ? ? ? 2.458 ? 
metalc292  metalc ? ? JE MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8117 A HOH 9222 1_555 ? ? ? ? ? ? ? 2.680 ? 
metalc293  metalc ? ? JE MG  .    MG    ? ? ? 1_555 A  A   2021 N7    ? ? A MG  8117 A A   2022 1_555 ? ? ? ? ? ? ? 2.553 ? 
metalc294  metalc ? ? JE MG  .    MG    ? ? ? 1_555 A  C   1840 OP2   ? ? A MG  8117 A C   1841 1_555 ? ? ? ? ? ? ? 2.705 ? 
metalc295  metalc ? ? JE MG  .    MG    ? ? ? 1_555 A  A   1839 "O2'" ? ? A MG  8117 A A   1840 1_555 ? ? ? ? ? ? ? 2.498 ? 
metalc296  metalc ? ? JE MG  .    MG    ? ? ? 1_555 A  A   1839 "O3'" ? ? A MG  8117 A A   1840 1_555 ? ? ? ? ? ? ? 2.212 ? 
metalc297  metalc ? ? KE MG  .    MG    ? ? ? 1_555 A  A   2099 "O2'" ? ? A MG  8118 A A   2100 1_555 ? ? ? ? ? ? ? 2.584 ? 
metalc298  metalc ? ? LE MG  .    MG    ? ? ? 1_555 A  G   2539 "O5'" ? ? A MG  8119 A G   2540 1_555 ? ? ? ? ? ? ? 2.302 ? 
metalc299  metalc ? ? LE MG  .    MG    ? ? ? 1_555 A  G   2539 OP2   ? ? A MG  8119 A G   2540 1_555 ? ? ? ? ? ? ? 2.478 ? 
metalc300  metalc ? ? LE MG  .    MG    ? ? ? 1_555 A  A   2537 "O2'" ? ? A MG  8119 A A   2538 1_555 ? ? ? ? ? ? ? 2.873 ? 
metalc301  metalc ? ? ME NA  .    NA    ? ? ? 1_555 A  C   1068 OP2   ? ? A NA  8301 A C   1069 1_555 ? ? ? ? ? ? ? 2.565 ? 
metalc302  metalc ? ? NE NA  .    NA    ? ? ? 1_555 A  G   1118 "O2'" ? ? A NA  8302 A G   1119 1_555 ? ? ? ? ? ? ? 2.497 ? 
metalc303  metalc ? ? QE NA  .    NA    ? ? ? 1_555 A  G   2093 N7    ? ? A NA  8306 A G   2094 1_555 ? ? ? ? ? ? ? 2.545 ? 
metalc304  metalc ? ? RE NA  .    NA    ? ? ? 1_555 A  C   39   "O2'" ? ? A NA  8307 A C   40   1_555 ? ? ? ? ? ? ? 2.530 ? 
metalc305  metalc ? ? SE NA  .    NA    ? ? ? 1_555 A  U   1431 O4    ? ? A NA  8308 A U   1432 1_555 ? ? ? ? ? ? ? 2.341 ? 
metalc306  metalc ? ? SE NA  .    NA    ? ? ? 1_555 A  U   1723 O2    ? ? A NA  8308 A U   1724 1_555 ? ? ? ? ? ? ? 2.221 ? 
metalc307  metalc ? ? SE NA  .    NA    ? ? ? 1_555 A  C   1393 O2    ? ? A NA  8308 A C   1394 1_555 ? ? ? ? ? ? ? 2.238 ? 
metalc308  metalc ? ? UE NA  .    NA    ? ? ? 1_555 A  G   2524 O6    ? ? A NA  8311 A G   2525 1_555 ? ? ? ? ? ? ? 2.482 ? 
metalc309  metalc ? ? VE NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8313 A HOH 9939 1_555 ? ? ? ? ? ? ? 2.347 ? 
metalc310  metalc ? ? WE NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8314 A HOH 9332 1_555 ? ? ? ? ? ? ? 2.277 ? 
metalc311  metalc ? ? WE NA  .    NA    ? ? ? 1_555 A  U   2606 "O2'" ? ? A NA  8314 A U   2607 1_555 ? ? ? ? ? ? ? 2.447 ? 
metalc312  metalc ? ? XE NA  .    NA    ? ? ? 1_555 A  A   165  "O3'" ? ? A NA  8315 A A   166  1_555 ? ? ? ? ? ? ? 2.492 ? 
metalc313  metalc ? ? XE NA  .    NA    ? ? ? 1_555 A  A   165  "O2'" ? ? A NA  8315 A A   166  1_555 ? ? ? ? ? ? ? 2.586 ? 
metalc314  metalc ? ? XE NA  .    NA    ? ? ? 1_555 A  A   164  OP2   ? ? A NA  8315 A A   165  1_555 ? ? ? ? ? ? ? 2.519 ? 
metalc315  metalc ? ? ZE NA  .    NA    ? ? ? 1_555 HK HOH .    O     ? ? A NA  8317 3 HOH 4135 1_555 ? ? ? ? ? ? ? 2.041 ? 
metalc316  metalc ? ? ZE NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8317 A HOH 9277 1_555 ? ? ? ? ? ? ? 2.050 ? 
metalc317  metalc ? ? ZE NA  .    NA    ? ? ? 1_555 CA TRP 41   O     ? ? A NA  8317 3 TRP 42   1_555 ? ? ? ? ? ? ? 2.514 ? 
metalc318  metalc ? ? CF NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8320 A HOH 9732 1_555 ? ? ? ? ? ? ? 2.335 ? 
metalc319  metalc ? ? DF NA  .    NA    ? ? ? 1_555 A  G   835  "O3'" ? ? A NA  8321 A G   836  1_555 ? ? ? ? ? ? ? 2.589 ? 
metalc320  metalc ? ? EF NA  .    NA    ? ? ? 1_555 A  C   2474 N4    ? ? A NA  8323 A C   2475 1_555 ? ? ? ? ? ? ? 2.541 ? 
metalc321  metalc ? ? FF NA  .    NA    ? ? ? 1_555 A  U   145  O4    ? ? A NA  8324 A U   146  1_555 ? ? ? ? ? ? ? 2.547 ? 
metalc322  metalc ? ? GF NA  .    NA    ? ? ? 1_555 A  U   778  O4    ? ? A NA  8325 A U   779  1_555 ? ? ? ? ? ? ? 2.542 ? 
metalc323  metalc ? ? GF NA  .    NA    ? ? ? 1_555 A  A   775  "O3'" ? ? A NA  8325 A A   776  1_555 ? ? ? ? ? ? ? 2.582 ? 
metalc324  metalc ? ? GF NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8325 A HOH 9619 1_555 ? ? ? ? ? ? ? 2.403 ? 
metalc325  metalc ? ? HF NA  .    NA    ? ? ? 1_555 A  U   2011 O4    ? ? A NA  8326 A U   2012 1_555 ? ? ? ? ? ? ? 2.305 ? 
metalc326  metalc ? ? IF NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8327 A HOH 9037 1_555 ? ? ? ? ? ? ? 2.323 ? 
metalc327  metalc ? ? IF NA  .    NA    ? ? ? 1_555 A  U   1830 "O2'" ? ? A NA  8327 A U   1831 1_555 ? ? ? ? ? ? ? 2.554 ? 
metalc328  metalc ? ? JF NA  .    NA    ? ? ? 1_555 A  G   55   O6    ? ? A NA  8328 A G   56   1_555 ? ? ? ? ? ? ? 2.540 ? 
metalc329  metalc ? ? LF NA  .    NA    ? ? ? 1_555 A  C   140  "O4'" ? ? A NA  8330 A C   141  1_555 ? ? ? ? ? ? ? 2.262 ? 
metalc330  metalc ? ? LF NA  .    NA    ? ? ? 1_555 A  C   140  O2    ? ? A NA  8330 A C   141  1_555 ? ? ? ? ? ? ? 2.197 ? 
metalc331  metalc ? ? MF NA  .    NA    ? ? ? 1_555 A  C   217  "O2'" ? ? A NA  8331 A C   218  1_555 ? ? ? ? ? ? ? 2.293 ? 
metalc332  metalc ? ? OF NA  .    NA    ? ? ? 1_555 A  C   1893 O2    ? ? A NA  8333 A C   1894 1_555 ? ? ? ? ? ? ? 2.435 ? 
metalc333  metalc ? ? RF NA  .    NA    ? ? ? 1_555 A  G   1705 O6    ? ? A NA  8336 A G   1706 1_555 ? ? ? ? ? ? ? 2.534 ? 
metalc334  metalc ? ? RF NA  .    NA    ? ? ? 1_555 A  G   1706 O6    ? ? A NA  8336 A G   1707 1_555 ? ? ? ? ? ? ? 2.552 ? 
metalc335  metalc ? ? SF NA  .    NA    ? ? ? 1_555 XJ HOH .    O     ? ? A NA  8338 S HOH 8515 1_555 ? ? ? ? ? ? ? 2.322 ? 
metalc336  metalc ? ? SF NA  .    NA    ? ? ? 1_555 XJ HOH .    O     ? ? A NA  8338 S HOH 8527 1_555 ? ? ? ? ? ? ? 2.187 ? 
metalc337  metalc ? ? SF NA  .    NA    ? ? ? 1_555 S  TRP 75   O     ? ? A NA  8338 S TRP 75   1_555 ? ? ? ? ? ? ? 2.488 ? 
metalc338  metalc ? ? SF NA  .    NA    ? ? ? 1_555 S  VAL 72   O     ? ? A NA  8338 S VAL 72   1_555 ? ? ? ? ? ? ? 2.127 ? 
metalc339  metalc ? ? TF NA  .    NA    ? ? ? 1_555 A  U   2644 O2    ? ? A NA  8339 A U   2645 1_555 ? ? ? ? ? ? ? 2.351 ? 
metalc340  metalc ? ? VF NA  .    NA    ? ? ? 1_555 A  G   682  O6    ? ? A NA  8341 A G   683  1_555 ? ? ? ? ? ? ? 2.557 ? 
metalc341  metalc ? ? XF NA  .    NA    ? ? ? 1_555 U  SER 94   OG    ? ? A NA  8343 U SER 94   1_555 ? ? ? ? ? ? ? 2.402 ? 
metalc342  metalc ? ? XF NA  .    NA    ? ? ? 1_555 A  C   341  O2    ? ? A NA  8343 A C   342  1_555 ? ? ? ? ? ? ? 2.467 ? 
metalc343  metalc ? ? XF NA  .    NA    ? ? ? 1_555 ZJ HOH .    O     ? ? A NA  8343 U HOH 1124 1_555 ? ? ? ? ? ? ? 2.305 ? 
metalc344  metalc ? ? XF NA  .    NA    ? ? ? 1_555 U  ASN 95   OD1   ? ? A NA  8343 U ASN 95   1_555 ? ? ? ? ? ? ? 2.575 ? 
metalc345  metalc ? ? YF NA  .    NA    ? ? ? 1_555 A  A   2810 "O2'" ? ? A NA  8344 A A   2811 1_555 ? ? ? ? ? ? ? 2.589 ? 
metalc346  metalc ? ? YF NA  .    NA    ? ? ? 1_555 A  A   2810 "O3'" ? ? A NA  8344 A A   2811 1_555 ? ? ? ? ? ? ? 2.591 ? 
metalc347  metalc ? ? ZF NA  .    NA    ? ? ? 1_555 A  A   913  "O3'" ? ? A NA  8349 A A   914  1_555 ? ? ? ? ? ? ? 2.548 ? 
metalc348  metalc ? ? ZF NA  .    NA    ? ? ? 1_555 A  G   1044 OP2   ? ? A NA  8349 A G   1045 1_555 ? ? ? ? ? ? ? 2.289 ? 
metalc349  metalc ? ? CG NA  .    NA    ? ? ? 1_555 M  GLY 14   O     ? ? A NA  8353 M GLY 14   1_555 ? ? ? ? ? ? ? 2.287 ? 
metalc350  metalc ? ? CG NA  .    NA    ? ? ? 1_555 RJ HOH .    O     ? ? A NA  8353 M HOH 8516 1_555 ? ? ? ? ? ? ? 2.295 ? 
metalc351  metalc ? ? GG NA  .    NA    ? ? ? 1_555 A  G   1023 O6    ? ? A NA  8357 A G   1024 1_555 ? ? ? ? ? ? ? 2.515 ? 
metalc352  metalc ? ? IG NA  .    NA    ? ? ? 1_555 A  A   452  "O2'" ? ? A NA  8360 A A   453  1_555 ? ? ? ? ? ? ? 2.493 ? 
metalc353  metalc ? ? IG NA  .    NA    ? ? ? 1_555 A  G   478  OP2   ? ? A NA  8360 A G   479  1_555 ? ? ? ? ? ? ? 2.561 ? 
metalc354  metalc ? ? KG NA  .    NA    ? ? ? 1_555 A  G   2109 OP2   ? ? A NA  8362 A G   2110 1_555 ? ? ? ? ? ? ? 2.223 ? 
metalc355  metalc ? ? LG NA  .    NA    ? ? ? 1_555 A  C   1359 OP1   ? ? A NA  8363 A C   1360 1_555 ? ? ? ? ? ? ? 2.311 ? 
metalc356  metalc ? ? MG NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8364 A HOH 9588 1_555 ? ? ? ? ? ? ? 2.270 ? 
metalc357  metalc ? ? MG NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8364 A HOH 9807 1_555 ? ? ? ? ? ? ? 2.547 ? 
metalc358  metalc ? ? NG NA  .    NA    ? ? ? 1_555 N  LYS 193  O     ? ? A NA  8365 N LYS 193  1_555 ? ? ? ? ? ? ? 2.547 ? 
metalc359  metalc ? ? OG NA  .    NA    ? ? ? 1_555 A  G   544  O6    ? ? A NA  8366 A G   545  1_555 ? ? ? ? ? ? ? 2.361 ? 
metalc360  metalc ? ? PG NA  .    NA    ? ? ? 1_555 A  G   463  O6    ? ? A NA  8367 A G   464  1_555 ? ? ? ? ? ? ? 2.453 ? 
metalc361  metalc ? ? PG NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8367 A HOH 9818 1_555 ? ? ? ? ? ? ? 2.529 ? 
metalc362  metalc ? ? RG NA  .    NA    ? ? ? 1_555 IK HOH .    O     ? ? A NA  8369 4 HOH 8547 1_555 ? ? ? ? ? ? ? 2.305 ? 
metalc363  metalc ? ? SG NA  .    NA    ? ? ? 1_555 A  G   1831 OP2   ? ? A NA  8370 A G   1832 1_555 ? ? ? ? ? ? ? 2.483 ? 
metalc364  metalc ? ? AH NA  .    NA    ? ? ? 1_555 RJ HOH .    O     ? ? A NA  8378 M HOH 8536 1_555 ? ? ? ? ? ? ? 2.581 ? 
metalc365  metalc ? ? CH NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8381 A HOH 9330 1_555 ? ? ? ? ? ? ? 2.327 ? 
metalc366  metalc ? ? EH NA  .    NA    ? ? ? 1_555 A  C   196  N3    ? ? A NA  8384 A C   197  1_555 ? ? ? ? ? ? ? 2.548 ? 
metalc367  metalc ? ? FH NA  .    NA    ? ? ? 1_555 A  G   1076 N7    ? ? A NA  8385 A G   1077 1_555 ? ? ? ? ? ? ? 2.342 ? 
metalc368  metalc ? ? FH NA  .    NA    ? ? ? 1_555 A  A   1078 OP1   ? ? A NA  8385 A A   1079 1_555 ? ? ? ? ? ? ? 2.128 ? 
metalc369  metalc ? ? OH K   .    K     ? ? ? 1_555 A  G   2481 O6    ? ? A K   8601 A G   2482 1_555 ? ? ? ? ? ? ? 2.859 ? 
metalc370  metalc ? ? OH K   .    K     ? ? ? 1_555 A  G   2101 N7    ? ? A K   8601 A G   2102 1_555 ? ? ? ? ? ? ? 3.296 ? 
metalc371  metalc ? ? OH K   .    K     ? ? ? 1_555 A  C   2535 "O4'" ? ? A K   8601 A C   2536 1_555 ? ? ? ? ? ? ? 3.209 ? 
metalc372  metalc ? ? OH K   .    K     ? ? ? 1_555 A  G   2101 O6    ? ? A K   8601 A G   2102 1_555 ? ? ? ? ? ? ? 2.839 ? 
metalc373  metalc ? ? OH K   .    K     ? ? ? 1_555 A  C   2535 O2    ? ? A K   8601 A C   2536 1_555 ? ? ? ? ? ? ? 3.021 ? 
metalc374  metalc ? ? OH K   .    K     ? ? ? 1_555 A  G   2481 N7    ? ? A K   8601 A G   2482 1_555 ? ? ? ? ? ? ? 3.088 ? 
metalc375  metalc ? ? PH K   .    K     ? ? ? 1_555 A  C   161  OP2   ? ? A K   8602 A C   162  1_555 ? ? ? ? ? ? ? 3.304 ? 
metalc376  metalc ? ? PH K   .    K     ? ? ? 1_555 FJ HOH .    O     ? ? A K   8602 A HOH 9116 1_555 ? ? ? ? ? ? ? 2.629 ? 
metalc377  metalc ? ? PH K   .    K     ? ? ? 1_555 A  U   171  O4    ? ? A K   8602 A U   172  1_555 ? ? ? ? ? ? ? 3.156 ? 
metalc378  metalc ? ? PH K   .    K     ? ? ? 1_555 FJ HOH .    O     ? ? A K   8602 A HOH 9150 1_555 ? ? ? ? ? ? ? 3.480 ? 
metalc379  metalc ? ? PH K   .    K     ? ? ? 1_555 FJ HOH .    O     ? ? A K   8602 A HOH 9014 1_555 ? ? ? ? ? ? ? 2.539 ? 
metalc380  metalc ? ? PH K   .    K     ? ? ? 1_555 A  U   162  O4    ? ? A K   8602 A U   163  1_555 ? ? ? ? ? ? ? 3.033 ? 
metalc381  metalc ? ? RH MG  .    MG    ? ? ? 1_555 B  A   57   OP2   ? ? B MG  8095 B A   3057 1_555 ? ? ? ? ? ? ? 2.486 ? 
metalc382  metalc ? ? RH MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? B MG  8095 B HOH 7361 1_555 ? ? ? ? ? ? ? 1.874 ? 
metalc383  metalc ? ? RH MG  .    MG    ? ? ? 1_555 B  A   56   OP2   ? ? B MG  8095 B A   3056 1_555 ? ? ? ? ? ? ? 2.038 ? 
metalc384  metalc ? ? SH NA  .    NA    ? ? ? 1_555 B  C   40   N3    ? ? B NA  8351 B C   3040 1_555 ? ? ? ? ? ? ? 2.467 ? 
metalc385  metalc ? ? SH NA  .    NA    ? ? ? 1_555 B  C   40   O2    ? ? B NA  8351 B C   3040 1_555 ? ? ? ? ? ? ? 2.415 ? 
metalc386  metalc ? ? UH MG  .    MG    ? ? ? 1_555 HJ HOH .    O     ? ? C MG  8065 C HOH 8633 1_555 ? ? ? ? ? ? ? 2.107 ? 
metalc387  metalc ? ? UH MG  .    MG    ? ? ? 1_555 HJ HOH .    O     ? ? C MG  8065 C HOH 8522 1_555 ? ? ? ? ? ? ? 2.002 ? 
metalc388  metalc ? ? UH MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? C MG  8065 A HOH 9912 1_555 ? ? ? ? ? ? ? 2.860 ? 
metalc389  metalc ? ? UH MG  .    MG    ? ? ? 1_555 HJ HOH .    O     ? ? C MG  8065 C HOH 8604 1_555 ? ? ? ? ? ? ? 2.644 ? 
metalc390  metalc ? ? UH MG  .    MG    ? ? ? 1_555 HJ HOH .    O     ? ? C MG  8065 C HOH 8552 1_555 ? ? ? ? ? ? ? 1.990 ? 
metalc391  metalc ? ? VH NA  .    NA    ? ? ? 1_555 C  PHE 201  O     ? ? C NA  8345 C PHE 201  1_555 ? ? ? ? ? ? ? 2.386 ? 
metalc392  metalc ? ? VH NA  .    NA    ? ? ? 1_555 C  GLY 203  O     ? ? C NA  8345 C GLY 203  1_555 ? ? ? ? ? ? ? 2.552 ? 
metalc393  metalc ? ? VH NA  .    NA    ? ? ? 1_555 HJ HOH .    O     ? ? C NA  8345 C HOH 8558 1_555 ? ? ? ? ? ? ? 2.172 ? 
metalc394  metalc ? ? XH MG  .    MG    ? ? ? 1_555 IJ HOH .    O     ? ? D MG  8055 D HOH 8664 1_555 ? ? ? ? ? ? ? 2.559 ? 
metalc395  metalc ? ? XH MG  .    MG    ? ? ? 1_555 IJ HOH .    O     ? ? D MG  8055 D HOH 8663 1_555 ? ? ? ? ? ? ? 2.567 ? 
metalc396  metalc ? ? XH MG  .    MG    ? ? ? 1_555 IJ HOH .    O     ? ? D MG  8055 D HOH 8552 1_555 ? ? ? ? ? ? ? 2.343 ? 
metalc397  metalc ? ? XH MG  .    MG    ? ? ? 1_555 IJ HOH .    O     ? ? D MG  8055 D HOH 8625 1_555 ? ? ? ? ? ? ? 2.947 ? 
metalc398  metalc ? ? CI NA  .    NA    ? ? ? 1_555 K  TYR 69   O     ? ? K NA  8346 K TYR 69   1_555 ? ? ? ? ? ? ? 2.540 ? 
metalc399  metalc ? ? CI NA  .    NA    ? ? ? 1_555 K  ILE 63   O     ? ? K NA  8346 K ILE 63   1_555 ? ? ? ? ? ? ? 2.403 ? 
metalc400  metalc ? ? CI NA  .    NA    ? ? ? 1_555 K  VAL 61   O     ? ? K NA  8346 K VAL 61   1_555 ? ? ? ? ? ? ? 2.489 ? 
metalc401  metalc ? ? HI MG  .    MG    ? ? ? 1_555 QJ HOH .    O     ? ? L MG  8069 L HOH 7871 1_555 ? ? ? ? ? ? ? 2.018 ? 
metalc402  metalc ? ? HI MG  .    MG    ? ? ? 1_555 QJ HOH .    O     ? ? L MG  8069 L HOH 2121 1_555 ? ? ? ? ? ? ? 1.675 ? 
metalc403  metalc ? ? HI MG  .    MG    ? ? ? 1_555 QJ HOH .    O     ? ? L MG  8069 L HOH 1797 1_555 ? ? ? ? ? ? ? 2.344 ? 
metalc404  metalc ? ? HI MG  .    MG    ? ? ? 1_555 L  ASN 42   OD1   ? ? L MG  8069 L ASN 42   1_555 ? ? ? ? ? ? ? 2.294 ? 
metalc405  metalc ? ? II NA  .    NA    ? ? ? 1_555 M  ALA 33   O     ? ? M NA  8380 M ALA 33   1_555 ? ? ? ? ? ? ? 2.212 ? 
metalc406  metalc ? ? II NA  .    NA    ? ? ? 1_555 RJ HOH .    O     ? ? M NA  8380 M HOH 8593 1_555 ? ? ? ? ? ? ? 2.379 ? 
metalc407  metalc ? ? KI NA  .    NA    ? ? ? 1_555 N  ASN 106  OD1   ? ? N NA  8347 N ASN 106  1_555 ? ? ? ? ? ? ? 2.464 ? 
metalc408  metalc ? ? KI NA  .    NA    ? ? ? 1_555 N  LEU 112  O     ? ? N NA  8347 N LEU 112  1_555 ? ? ? ? ? ? ? 2.370 ? 
metalc409  metalc ? ? KI NA  .    NA    ? ? ? 1_555 SJ HOH .    O     ? ? N NA  8347 N HOH 8628 1_555 ? ? ? ? ? ? ? 1.975 ? 
metalc410  metalc ? ? NI CD  .    CD    ? ? ? 1_555 UJ HOH .    O     ? ? P CD  8405 P HOH 5650 1_555 ? ? ? ? ? ? ? 2.687 ? 
metalc411  metalc ? ? NI CD  .    CD    ? ? ? 1_555 P  HIS 40   ND1   ? ? P CD  8405 P HIS 40   1_555 ? ? ? ? ? ? ? 2.864 ? 
metalc412  metalc ? ? PI NA  .    NA    ? ? ? 1_555 R  SER 46   OG    ? ? R NA  8348 R SER 46   1_555 ? ? ? ? ? ? ? 2.297 ? 
metalc413  metalc ? ? PI NA  .    NA    ? ? ? 1_555 R  GLY 22   O     ? ? R NA  8348 R GLY 22   1_555 ? ? ? ? ? ? ? 2.188 ? 
metalc414  metalc ? ? RI NA  .    NA    ? ? ? 1_555 XJ HOH .    O     ? ? S NA  8337 S HOH 8525 1_555 ? ? ? ? ? ? ? 2.487 ? 
metalc415  metalc ? ? VI MG  .    MG    ? ? ? 1_555 U  ASP 117  O     ? ? U MG  8073 U ASP 117  1_555 ? ? ? ? ? ? ? 2.256 ? 
metalc416  metalc ? ? VI MG  .    MG    ? ? ? 1_555 U  SER 114  O     ? ? U MG  8073 U SER 114  1_555 ? ? ? ? ? ? ? 2.480 ? 
metalc417  metalc ? ? VI MG  .    MG    ? ? ? 1_555 U  LEU 112  O     ? ? U MG  8073 U LEU 112  1_555 ? ? ? ? ? ? ? 2.700 ? 
metalc418  metalc ? ? VI MG  .    MG    ? ? ? 1_555 U  ARG 111  O     ? ? U MG  8073 U ARG 111  1_555 ? ? ? ? ? ? ? 2.741 ? 
metalc419  metalc ? ? VI MG  .    MG    ? ? ? 1_555 U  GLN 37   OE1   ? ? U MG  8073 U GLN 37   1_555 ? ? ? ? ? ? ? 2.593 ? 
metalc420  metalc ? ? VI MG  .    MG    ? ? ? 1_555 ZJ HOH .    O     ? ? U MG  8073 U HOH 2868 1_555 ? ? ? ? ? ? ? 2.758 ? 
metalc421  metalc ? ? WI CD  .    CD    ? ? ? 1_555 V  CYS 9    N     ? ? V CD  8401 V CYS 9    1_555 ? ? ? ? ? ? ? 2.985 ? 
metalc422  metalc ? ? WI CD  .    CD    ? ? ? 1_555 V  CYS 6    SG    ? ? V CD  8401 V CYS 6    1_555 ? ? ? ? ? ? ? 3.110 ? 
metalc423  metalc ? ? WI CD  .    CD    ? ? ? 1_555 V  CYS 36   SG    ? ? V CD  8401 V CYS 36   1_555 ? ? ? ? ? ? ? 3.076 ? 
metalc424  metalc ? ? XI MG  .    MG    ? ? ? 1_555 Z  VAL 139  O     ? ? Z MG  8109 Z VAL 139  1_555 ? ? ? ? ? ? ? 2.249 ? 
metalc425  metalc ? ? XI MG  .    MG    ? ? ? 1_555 Z  LYS 136  O     ? ? Z MG  8109 Z LYS 136  1_555 ? ? ? ? ? ? ? 2.579 ? 
metalc426  metalc ? ? XI MG  .    MG    ? ? ? 1_555 EK HOH .    O     ? ? Z MG  8109 Z HOH 8562 1_555 ? ? ? ? ? ? ? 2.806 ? 
metalc427  metalc ? ? XI MG  .    MG    ? ? ? 1_555 EK HOH .    O     ? ? Z MG  8109 Z HOH 8616 1_555 ? ? ? ? ? ? ? 2.211 ? 
metalc428  metalc ? ? XI MG  .    MG    ? ? ? 1_555 Z  HIS 133  O     ? ? Z MG  8109 Z HIS 133  1_555 ? ? ? ? ? ? ? 2.444 ? 
metalc429  metalc ? ? XI MG  .    MG    ? ? ? 1_555 EK HOH .    O     ? ? Z MG  8109 Z HOH 8582 1_555 ? ? ? ? ? ? ? 2.574 ? 
metalc430  metalc ? ? A  C   39   O2    ? ? ? 1_555 RE NA  .    NA    ? ? A C   40   A NA  8307 1_555 ? ? ? ? ? ? ? 2.785 ? 
metalc431  metalc ? ? A  G   40   "O4'" ? ? ? 1_555 RE NA  .    NA    ? ? A G   41   A NA  8307 1_555 ? ? ? ? ? ? ? 2.879 ? 
metalc432  metalc ? ? A  A   58   N3    ? ? ? 1_555 JF NA  .    NA    ? ? A A   59   A NA  8328 1_555 ? ? ? ? ? ? ? 2.661 ? 
metalc433  metalc ? ? A  G   60   N7    ? ? ? 1_555 JF NA  .    NA    ? ? A G   61   A NA  8328 1_555 ? ? ? ? ? ? ? 2.745 ? 
metalc434  metalc ? ? A  G   60   O6    ? ? ? 1_555 JF NA  .    NA    ? ? A G   61   A NA  8328 1_555 ? ? ? ? ? ? ? 2.777 ? 
metalc435  metalc ? ? A  G   65   OP1   ? ? ? 1_555 KF NA  .    NA    ? ? A G   66   A NA  8329 1_555 ? ? ? ? ? ? ? 2.947 ? 
metalc436  metalc ? ? A  U   106  O4    ? ? ? 1_555 KF NA  .    NA    ? ? A U   107  A NA  8329 1_555 ? ? ? ? ? ? ? 2.956 ? 
metalc437  metalc ? ? A  U   107  O2    ? ? ? 1_555 KF NA  .    NA    ? ? A U   108  A NA  8329 1_555 ? ? ? ? ? ? ? 2.629 ? 
metalc438  metalc ? ? A  G   141  N7    ? ? ? 1_555 LF NA  .    NA    ? ? A G   142  A NA  8330 1_555 ? ? ? ? ? ? ? 2.855 ? 
metalc439  metalc ? ? A  G   141  O6    ? ? ? 1_555 LF NA  .    NA    ? ? A G   142  A NA  8330 1_555 ? ? ? ? ? ? ? 2.961 ? 
metalc440  metalc ? ? A  A   166  OP1   ? ? ? 1_555 XE NA  .    NA    ? ? A A   167  A NA  8315 1_555 ? ? ? ? ? ? ? 2.943 ? 
metalc441  metalc ? ? A  U   169  O2    ? ? ? 1_555 MF NA  .    NA    ? ? A U   170  A NA  8331 1_555 ? ? ? ? ? ? ? 2.787 ? 
metalc442  metalc ? ? A  G   195  N7    ? ? ? 1_555 WG NA  .    NA    ? ? A G   196  A NA  8374 1_555 ? ? ? ? ? ? ? 2.916 ? 
metalc443  metalc ? ? A  G   220  O6    ? ? ? 1_555 MF NA  .    NA    ? ? A G   221  A NA  8331 1_555 ? ? ? ? ? ? ? 2.936 ? 
metalc444  metalc ? ? A  U   307  O4    ? ? ? 1_555 XF NA  .    NA    ? ? A U   308  A NA  8343 1_555 ? ? ? ? ? ? ? 2.729 ? 
metalc445  metalc ? ? A  U   334  O2    ? ? ? 1_555 XF NA  .    NA    ? ? A U   335  A NA  8343 1_555 ? ? ? ? ? ? ? 2.784 ? 
metalc446  metalc ? ? A  G   385  O6    ? ? ? 1_555 NF NA  .    NA    ? ? A G   386  A NA  8332 1_555 ? ? ? ? ? ? ? 2.889 ? 
metalc447  metalc ? ? A  G   386  O6    ? ? ? 1_555 NF NA  .    NA    ? ? A G   387  A NA  8332 1_555 ? ? ? ? ? ? ? 2.610 ? 
metalc448  metalc ? ? A  U   390  "O2'" ? ? ? 1_555 NG NA  .    NA    ? ? A U   391  A NA  8365 1_555 ? ? ? ? ? ? ? 2.831 ? 
metalc449  metalc ? ? A  U   390  O4    ? ? ? 1_555 RG NA  .    NA    ? ? A U   391  A NA  8369 1_555 ? ? ? ? ? ? ? 2.886 ? 
metalc450  metalc ? ? A  U   401  O4    ? ? ? 1_555 NF NA  .    NA    ? ? A U   402  A NA  8332 1_555 ? ? ? ? ? ? ? 2.696 ? 
metalc451  metalc ? ? A  G   474  OP2   ? ? ? 1_555 PG NA  .    NA    ? ? A G   475  A NA  8367 1_555 ? ? ? ? ? ? ? 2.914 ? 
metalc452  metalc ? ? A  U   622  O2    ? ? ? 1_555 AG NA  .    NA    ? ? A U   623  A NA  8350 1_555 ? ? ? ? ? ? ? 2.996 ? 
metalc453  metalc ? ? A  U   622  O4    ? ? ? 1_555 QF NA  .    NA    ? ? A U   623  A NA  8335 1_555 ? ? ? ? ? ? ? 2.651 ? 
metalc454  metalc ? ? A  A   629  N3    ? ? ? 1_555 PE NA  .    NA    ? ? A A   630  A NA  8305 1_555 ? ? ? ? ? ? ? 2.717 ? 
metalc455  metalc ? ? A  A   630  "O2'" ? ? ? 1_555 PE NA  .    NA    ? ? A A   631  A NA  8305 1_555 ? ? ? ? ? ? ? 2.719 ? 
metalc456  metalc ? ? A  C   632  OP1   ? ? ? 1_555 YG NA  .    NA    ? ? A C   633  A NA  8376 1_555 ? ? ? ? ? ? ? 2.730 ? 
metalc457  metalc ? ? A  A   642  OP2   ? ? ? 1_555 OE NA  .    NA    ? ? A A   643  A NA  8303 1_555 ? ? ? ? ? ? ? 2.984 ? 
metalc458  metalc ? ? A  G   643  OP1   ? ? ? 1_555 OE NA  .    NA    ? ? A G   644  A NA  8303 1_555 ? ? ? ? ? ? ? 2.692 ? 
metalc459  metalc ? ? A  G   680  "O2'" ? ? ? 1_555 VF NA  .    NA    ? ? A G   681  A NA  8341 1_555 ? ? ? ? ? ? ? 2.889 ? 
metalc460  metalc ? ? A  G   682  N7    ? ? ? 1_555 VF NA  .    NA    ? ? A G   683  A NA  8341 1_555 ? ? ? ? ? ? ? 2.953 ? 
metalc461  metalc ? ? A  C   761  N4    ? ? ? 1_555 AH NA  .    NA    ? ? A C   762  A NA  8378 1_555 ? ? ? ? ? ? ? 2.986 ? 
metalc462  metalc ? ? A  A   775  "O2'" ? ? ? 1_555 GF NA  .    NA    ? ? A A   776  A NA  8325 1_555 ? ? ? ? ? ? ? 2.754 ? 
metalc463  metalc ? ? A  U   776  OP2   ? ? ? 1_555 GF NA  .    NA    ? ? A U   777  A NA  8325 1_555 ? ? ? ? ? ? ? 2.848 ? 
metalc464  metalc ? ? A  G   797  O6    ? ? ? 1_555 QG NA  .    NA    ? ? A G   798  A NA  8368 1_555 ? ? ? ? ? ? ? 2.950 ? 
metalc465  metalc ? ? A  U   814  O4    ? ? ? 1_555 QG NA  .    NA    ? ? A U   815  A NA  8368 1_555 ? ? ? ? ? ? ? 2.641 ? 
metalc466  metalc ? ? A  U   820  OP2   ? ? ? 1_555 IF NA  .    NA    ? ? A U   821  A NA  8327 1_555 ? ? ? ? ? ? ? 2.982 ? 
metalc467  metalc ? ? A  G   853  OP1   ? ? ? 1_555 IF NA  .    NA    ? ? A G   854  A NA  8327 1_555 ? ? ? ? ? ? ? 2.876 ? 
metalc468  metalc ? ? A  G   891  N7    ? ? ? 1_555 WF NA  .    NA    ? ? A G   892  A NA  8342 1_555 ? ? ? ? ? ? ? 2.832 ? 
metalc469  metalc ? ? A  C   892  "O2'" ? ? ? 1_555 WF NA  .    NA    ? ? A C   893  A NA  8342 1_555 ? ? ? ? ? ? ? 2.989 ? 
metalc470  metalc ? ? A  C   895  "O2'" ? ? ? 1_555 YE NA  .    NA    ? ? A C   896  A NA  8316 1_555 ? ? ? ? ? ? ? 2.769 ? 
metalc471  metalc ? ? A  A   896  "O4'" ? ? ? 1_555 YE NA  .    NA    ? ? A A   897  A NA  8316 1_555 ? ? ? ? ? ? ? 2.874 ? 
metalc472  metalc ? ? A  G   900  OP1   ? ? ? 1_555 AG NA  .    NA    ? ? A G   901  A NA  8350 1_555 ? ? ? ? ? ? ? 2.804 ? 
metalc473  metalc ? ? A  G   901  O6    ? ? ? 1_555 AH NA  .    NA    ? ? A G   902  A NA  8378 1_555 ? ? ? ? ? ? ? 2.945 ? 
metalc474  metalc ? ? A  U   902  O4    ? ? ? 1_555 AH NA  .    NA    ? ? A U   903  A NA  8378 1_555 ? ? ? ? ? ? ? 2.873 ? 
metalc475  metalc ? ? A  U   903  O4    ? ? ? 1_555 OE NA  .    NA    ? ? A U   904  A NA  8303 1_555 ? ? ? ? ? ? ? 2.863 ? 
metalc476  metalc ? ? A  A   913  "O2'" ? ? ? 1_555 ZF NA  .    NA    ? ? A A   914  A NA  8349 1_555 ? ? ? ? ? ? ? 2.979 ? 
metalc477  metalc ? ? A  C   914  OP2   ? ? ? 1_555 ZF NA  .    NA    ? ? A C   915  A NA  8349 1_555 ? ? ? ? ? ? ? 2.823 ? 
metalc478  metalc ? ? A  U   918  O4    ? ? ? 1_555 UG NA  .    NA    ? ? A U   919  A NA  8372 1_555 ? ? ? ? ? ? ? 2.970 ? 
metalc479  metalc ? ? A  A   922  "O2'" ? ? ? 1_555 HG NA  .    NA    ? ? A A   923  A NA  8359 1_555 ? ? ? ? ? ? ? 2.805 ? 
metalc480  metalc ? ? A  G   940  O6    ? ? ? 1_555 GG NA  .    NA    ? ? A G   941  A NA  8357 1_555 ? ? ? ? ? ? ? 2.685 ? 
metalc481  metalc ? ? A  U   941  O4    ? ? ? 1_555 GG NA  .    NA    ? ? A U   942  A NA  8357 1_555 ? ? ? ? ? ? ? 2.674 ? 
metalc482  metalc ? ? A  G   1071 N7    ? ? ? 1_555 ME NA  .    NA    ? ? A G   1072 A NA  8301 1_555 ? ? ? ? ? ? ? 2.770 ? 
metalc483  metalc ? ? A  G   1118 "O3'" ? ? ? 1_555 NE NA  .    NA    ? ? A G   1119 A NA  8302 1_555 ? ? ? ? ? ? ? 2.831 ? 
metalc484  metalc ? ? A  U   1119 OP2   ? ? ? 1_555 NE NA  .    NA    ? ? A U   1120 A NA  8302 1_555 ? ? ? ? ? ? ? 2.929 ? 
metalc485  metalc ? ? A  G   1120 O6    ? ? ? 1_555 NE NA  .    NA    ? ? A G   1121 A NA  8302 1_555 ? ? ? ? ? ? ? 2.866 ? 
metalc486  metalc ? ? A  A   1132 "O3'" ? ? ? 1_555 AI NA  .    NA    ? ? A A   1133 J NA  8309 1_555 ? ? ? ? ? ? ? 2.640 ? 
metalc487  metalc ? ? A  A   1132 "O2'" ? ? ? 1_555 AI NA  .    NA    ? ? A A   1133 J NA  8309 1_555 ? ? ? ? ? ? ? 2.819 ? 
metalc488  metalc ? ? A  U   1292 OP2   ? ? ? 1_555 ZG NA  .    NA    ? ? A U   1293 A NA  8377 1_555 ? ? ? ? ? ? ? 2.677 ? 
metalc489  metalc ? ? A  G   1294 O6    ? ? ? 1_555 ZG NA  .    NA    ? ? A G   1295 A NA  8377 1_555 ? ? ? ? ? ? ? 2.936 ? 
metalc490  metalc ? ? A  A   1295 OP1   ? ? ? 1_555 CG NA  .    NA    ? ? A A   1296 A NA  8353 1_555 ? ? ? ? ? ? ? 2.877 ? 
metalc491  metalc ? ? A  G   1415 "O3'" ? ? ? 1_555 ZE NA  .    NA    ? ? A G   1416 A NA  8317 1_555 ? ? ? ? ? ? ? 2.648 ? 
metalc492  metalc ? ? A  G   1416 OP1   ? ? ? 1_555 ZE NA  .    NA    ? ? A G   1417 A NA  8317 1_555 ? ? ? ? ? ? ? 2.862 ? 
metalc493  metalc ? ? A  G   1575 O6    ? ? ? 1_555 VG NA  .    NA    ? ? A G   1576 A NA  8373 1_555 ? ? ? ? ? ? ? 2.939 ? 
metalc494  metalc ? ? A  U   1576 O4    ? ? ? 1_555 VG NA  .    NA    ? ? A U   1577 A NA  8373 1_555 ? ? ? ? ? ? ? 2.868 ? 
metalc495  metalc ? ? A  G   1617 O6    ? ? ? 1_555 VG NA  .    NA    ? ? A G   1618 A NA  8373 1_555 ? ? ? ? ? ? ? 2.824 ? 
metalc496  metalc ? ? A  G   1618 O6    ? ? ? 1_555 VG NA  .    NA    ? ? A G   1619 A NA  8373 1_555 ? ? ? ? ? ? ? 2.872 ? 
metalc497  metalc ? ? A  A   1735 OP1   ? ? ? 1_555 DF NA  .    NA    ? ? A A   1736 A NA  8321 1_555 ? ? ? ? ? ? ? 2.895 ? 
metalc498  metalc ? ? A  U   1739 O4    ? ? ? 1_555 UF NA  .    NA    ? ? A U   1740 A NA  8340 1_555 ? ? ? ? ? ? ? 2.692 ? 
metalc499  metalc ? ? A  U   1740 O4    ? ? ? 1_555 UF NA  .    NA    ? ? A U   1741 A NA  8340 1_555 ? ? ? ? ? ? ? 2.876 ? 
metalc500  metalc ? ? A  C   1893 O2    ? ? ? 1_555 PF NA  .    NA    ? ? A C   1894 A NA  8334 1_555 ? ? ? ? ? ? ? 2.927 ? 
metalc501  metalc ? ? A  G   1895 N7    ? ? ? 1_555 PF NA  .    NA    ? ? A G   1896 A NA  8334 1_555 ? ? ? ? ? ? ? 2.816 ? 
metalc502  metalc ? ? A  G   1895 O6    ? ? ? 1_555 PF NA  .    NA    ? ? A G   1896 A NA  8334 1_555 ? ? ? ? ? ? ? 2.811 ? 
metalc503  metalc ? ? A  U   1896 O4    ? ? ? 1_555 OF NA  .    NA    ? ? A U   1897 A NA  8333 1_555 ? ? ? ? ? ? ? 2.870 ? 
metalc504  metalc ? ? A  U   1938 O4    ? ? ? 1_555 OF NA  .    NA    ? ? A U   1939 A NA  8333 1_555 ? ? ? ? ? ? ? 2.980 ? 
metalc505  metalc ? ? A  G   2057 O6    ? ? ? 1_555 MG NA  .    NA    ? ? A G   2058 A NA  8364 1_555 ? ? ? ? ? ? ? 2.874 ? 
metalc506  metalc ? ? A  G   2093 O6    ? ? ? 1_555 QE NA  .    NA    ? ? A G   2094 A NA  8306 1_555 ? ? ? ? ? ? ? 2.743 ? 
metalc507  metalc ? ? A  U   2108 OP2   ? ? ? 1_555 HG NA  .    NA    ? ? A U   2109 A NA  8359 1_555 ? ? ? ? ? ? ? 2.666 ? 
metalc508  metalc ? ? A  A   2111 N3    ? ? ? 1_555 EF NA  .    NA    ? ? A A   2112 A NA  8323 1_555 ? ? ? ? ? ? ? 2.820 ? 
metalc509  metalc ? ? A  U   2276 OP1   ? ? ? 1_555 KG NA  .    NA    ? ? A U   2277 A NA  8362 1_555 ? ? ? ? ? ? ? 2.953 ? 
metalc510  metalc ? ? A  G   2398 O6    ? ? ? 1_555 VE NA  .    NA    ? ? A G   2399 A NA  8313 1_555 ? ? ? ? ? ? ? 2.742 ? 
metalc511  metalc ? ? A  G   2465 OP2   ? ? ? 1_555 BF NA  .    NA    ? ? A G   2466 A NA  8319 1_555 ? ? ? ? ? ? ? 2.803 ? 
metalc512  metalc ? ? A  U   2491 O4    ? ? ? 1_555 TG NA  .    NA    ? ? A U   2492 A NA  8371 1_555 ? ? ? ? ? ? ? 3.000 ? 
metalc513  metalc ? ? A  G   2523 N7    ? ? ? 1_555 UE NA  .    NA    ? ? A G   2524 A NA  8311 1_555 ? ? ? ? ? ? ? 2.667 ? 
metalc514  metalc ? ? A  G   2528 O6    ? ? ? 1_555 TG NA  .    NA    ? ? A G   2529 A NA  8371 1_555 ? ? ? ? ? ? ? 2.951 ? 
metalc515  metalc ? ? A  C   2535 OP1   ? ? ? 1_555 YG NA  .    NA    ? ? A C   2536 A NA  8376 1_555 ? ? ? ? ? ? ? 2.781 ? 
metalc516  metalc ? ? A  G   2539 O6    ? ? ? 1_555 TF NA  .    NA    ? ? A G   2540 A NA  8339 1_555 ? ? ? ? ? ? ? 2.607 ? 
metalc517  metalc ? ? A  G   2542 O6    ? ? ? 1_555 CF NA  .    NA    ? ? A G   2543 A NA  8320 1_555 ? ? ? ? ? ? ? 2.861 ? 
metalc518  metalc ? ? A  G   2543 O6    ? ? ? 1_555 AF NA  .    NA    ? ? A G   2544 A NA  8318 1_555 ? ? ? ? ? ? ? 2.852 ? 
metalc519  metalc ? ? A  G   2577 N7    ? ? ? 1_555 TE NA  .    NA    ? ? A G   2578 A NA  8310 1_555 ? ? ? ? ? ? ? 2.992 ? 
metalc520  metalc ? ? A  G   2578 N7    ? ? ? 1_555 TE NA  .    NA    ? ? A G   2579 A NA  8310 1_555 ? ? ? ? ? ? ? 2.771 ? 
metalc521  metalc ? ? A  G   2578 O6    ? ? ? 1_555 TE NA  .    NA    ? ? A G   2579 A NA  8310 1_555 ? ? ? ? ? ? ? 2.611 ? 
metalc522  metalc ? ? A  U   2585 O4    ? ? ? 1_555 CH NA  .    NA    ? ? A U   2586 A NA  8381 1_555 ? ? ? ? ? ? ? 2.606 ? 
metalc523  metalc ? ? A  G   2591 O6    ? ? ? 1_555 CH NA  .    NA    ? ? A G   2592 A NA  8381 1_555 ? ? ? ? ? ? ? 2.879 ? 
metalc524  metalc ? ? A  G   2615 O6    ? ? ? 1_555 TF NA  .    NA    ? ? A G   2616 A NA  8339 1_555 ? ? ? ? ? ? ? 2.976 ? 
metalc525  metalc ? ? A  U   2644 "O2'" ? ? ? 1_555 TF NA  .    NA    ? ? A U   2645 A NA  8339 1_555 ? ? ? ? ? ? ? 2.704 ? 
metalc526  metalc ? ? A  A   2648 N1    ? ? ? 1_555 QE NA  .    NA    ? ? A A   2649 A NA  8306 1_555 ? ? ? ? ? ? ? 2.937 ? 
metalc527  metalc ? ? A  U   2658 "O3'" ? ? ? 1_555 SF NA  .    NA    ? ? A U   2659 A NA  8338 1_555 ? ? ? ? ? ? ? 2.729 ? 
metalc528  metalc ? ? A  G   2659 OP1   ? ? ? 1_555 SF NA  .    NA    ? ? A G   2660 A NA  8338 1_555 ? ? ? ? ? ? ? 2.784 ? 
metalc529  metalc ? ? A  U   2662 O2    ? ? ? 1_555 YF NA  .    NA    ? ? A U   2663 A NA  8344 1_555 ? ? ? ? ? ? ? 2.602 ? 
metalc530  metalc ? ? A  G   2771 O6    ? ? ? 1_555 DH NA  .    NA    ? ? A G   2772 A NA  8382 1_555 ? ? ? ? ? ? ? 2.865 ? 
metalc531  metalc ? ? A  G   2772 O6    ? ? ? 1_555 DH NA  .    NA    ? ? A G   2773 A NA  8382 1_555 ? ? ? ? ? ? ? 2.606 ? 
metalc532  metalc ? ? A  A   2815 "O2'" ? ? ? 1_555 YF NA  .    NA    ? ? A A   2816 A NA  8344 1_555 ? ? ? ? ? ? ? 2.677 ? 
metalc533  metalc ? ? A  G   2816 OP2   ? ? ? 1_555 YF NA  .    NA    ? ? A G   2817 A NA  8344 1_555 ? ? ? ? ? ? ? 2.824 ? 
metalc534  metalc ? ? B  A   57   N1    ? ? ? 1_555 TH NA  .    NA    ? ? B A   3057 B NA  8383 1_555 ? ? ? ? ? ? ? 2.972 ? 
metalc535  metalc ? ? C  HIS 208  O     ? ? ? 1_555 VH NA  .    NA    ? ? C HIS 208  C NA  8345 1_555 ? ? ? ? ? ? ? 2.681 ? 
metalc536  metalc ? ? D  ARG 229  O     ? ? ? 1_555 DF NA  .    NA    ? ? D ARG 229  A NA  8321 1_555 ? ? ? ? ? ? ? 2.943 ? 
metalc537  metalc ? ? D  GLN 230  O     ? ? ? 1_555 JG NA  .    NA    ? ? D GLN 230  A NA  8361 1_555 ? ? ? ? ? ? ? 2.958 ? 
metalc538  metalc ? ? E  ASP 45   OD1   ? ? ? 1_555 ZH NA  .    NA    ? ? E ASP 45   E NA  8304 1_555 ? ? ? ? ? ? ? 2.650 ? 
metalc539  metalc ? ? E  THR 94   O     ? ? ? 1_555 ZH NA  .    NA    ? ? E THR 94   E NA  8304 1_555 ? ? ? ? ? ? ? 2.867 ? 
metalc540  metalc ? ? E  LYS 96   O     ? ? ? 1_555 ZH NA  .    NA    ? ? E LYS 96   E NA  8304 1_555 ? ? ? ? ? ? ? 2.644 ? 
metalc541  metalc ? ? J  VAL 153  O     ? ? ? 1_555 AI NA  .    NA    ? ? J VAL 153  J NA  8309 1_555 ? ? ? ? ? ? ? 2.767 ? 
metalc542  metalc ? ? J  PRO 155  O     ? ? ? 1_555 AI NA  .    NA    ? ? J PRO 155  J NA  8309 1_555 ? ? ? ? ? ? ? 2.795 ? 
metalc543  metalc ? ? K  THR 47   O     ? ? ? 1_555 EG NA  .    NA    ? ? K THR 47   A NA  8355 1_555 ? ? ? ? ? ? ? 2.763 ? 
metalc544  metalc ? ? M  ASP 36   O     ? ? ? 1_555 BF NA  .    NA    ? ? M ASP 36   A NA  8319 1_555 ? ? ? ? ? ? ? 2.634 ? 
metalc545  metalc ? ? M  GLU 39   OE1   ? ? ? 1_555 II NA  .    NA    ? ? M GLU 39   M NA  8380 1_555 ? ? ? ? ? ? ? 2.761 ? 
metalc546  metalc ? ? N  PRO 110  O     ? ? ? 1_555 KI NA  .    NA    ? ? N PRO 110  N NA  8347 1_555 ? ? ? ? ? ? ? 2.812 ? 
metalc547  metalc ? ? R  ASP 20   O     ? ? ? 1_555 PI NA  .    NA    ? ? R ASP 20   R NA  8348 1_555 ? ? ? ? ? ? ? 2.842 ? 
metalc548  metalc ? ? R  SER 24   OG    ? ? ? 1_555 PI NA  .    NA    ? ? R SER 24   R NA  8348 1_555 ? ? ? ? ? ? ? 2.652 ? 
metalc549  metalc ? ? S  ASN 63   OD1   ? ? ? 1_555 SI NA  .    NA    ? ? S ASN 63   S NA  8386 1_555 ? ? ? ? ? ? ? 2.913 ? 
metalc550  metalc ? ? S  SER 70   O     ? ? ? 1_555 RI NA  .    NA    ? ? S SER 70   S NA  8337 1_555 ? ? ? ? ? ? ? 2.614 ? 
metalc551  metalc ? ? S  VAL 72   O     ? ? ? 1_555 RI NA  .    NA    ? ? S VAL 72   S NA  8337 1_555 ? ? ? ? ? ? ? 2.727 ? 
metalc552  metalc ? ? T  HIS 7    NE2   ? ? ? 1_555 UI NA  .    NA    ? ? T HIS 7    T NA  8312 1_555 ? ? ? ? ? ? ? 2.605 ? 
metalc553  metalc ? ? T  GLU 61   OE2   ? ? ? 1_555 UI NA  .    NA    ? ? T GLU 61   T NA  8312 1_555 ? ? ? ? ? ? ? 2.641 ? 
metalc554  metalc ? ? CA ASN 44   O     ? ? ? 1_555 ZE NA  .    NA    ? ? 3 ASN 45   A NA  8317 1_555 ? ? ? ? ? ? ? 2.781 ? 
metalc555  metalc ? ? XE NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8315 A HOH 9677 1_555 ? ? ? ? ? ? ? 2.771 ? 
metalc556  metalc ? ? BF NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8319 A HOH 9062 1_555 ? ? ? ? ? ? ? 2.842 ? 
metalc557  metalc ? ? BF NA  .    NA    ? ? ? 1_555 RJ HOH .    O     ? ? A NA  8319 M HOH 8542 1_555 ? ? ? ? ? ? ? 2.943 ? 
metalc558  metalc ? ? CF NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8320 A HOH 9059 1_555 ? ? ? ? ? ? ? 2.602 ? 
metalc559  metalc ? ? CF NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8320 A HOH 9090 1_555 ? ? ? ? ? ? ? 2.791 ? 
metalc560  metalc ? ? MF NA  .    NA    ? ? ? 1_555 IK HOH .    O     ? ? A NA  8331 4 HOH 8506 1_555 ? ? ? ? ? ? ? 2.918 ? 
metalc561  metalc ? ? QF NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8335 A HOH 9859 1_555 ? ? ? ? ? ? ? 2.755 ? 
metalc562  metalc ? ? RF NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8336 A HOH 9911 1_555 ? ? ? ? ? ? ? 2.719 ? 
metalc563  metalc ? ? RI NA  .    NA    ? ? ? 1_555 XJ HOH .    O     ? ? S NA  8337 S HOH 8527 1_555 ? ? ? ? ? ? ? 2.731 ? 
metalc564  metalc ? ? YF NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8344 A HOH 9221 1_555 ? ? ? ? ? ? ? 2.624 ? 
metalc565  metalc ? ? CI NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? K NA  8346 A HOH 9481 1_555 ? ? ? ? ? ? ? 2.810 ? 
metalc566  metalc ? ? PI NA  .    NA    ? ? ? 1_555 WJ HOH .    O     ? ? R NA  8348 R HOH 1795 1_555 ? ? ? ? ? ? ? 2.758 ? 
metalc567  metalc ? ? OG NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8366 A HOH 9853 1_555 ? ? ? ? ? ? ? 2.844 ? 
metalc568  metalc ? ? OG NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8366 A HOH 9872 1_555 ? ? ? ? ? ? ? 2.871 ? 
metalc569  metalc ? ? SG NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8370 A HOH 9107 1_555 ? ? ? ? ? ? ? 2.983 ? 
metalc570  metalc ? ? TG NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8371 A HOH 9620 1_555 ? ? ? ? ? ? ? 2.878 ? 
metalc571  metalc ? ? WG NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8374 A HOH 9884 1_555 ? ? ? ? ? ? ? 2.686 ? 
metalc572  metalc ? ? AH NA  .    NA    ? ? ? 1_555 RJ HOH .    O     ? ? A NA  8378 M HOH 8557 1_555 ? ? ? ? ? ? ? 2.818 ? 
metalc573  metalc ? ? TH NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? B NA  8383 B HOH 7361 1_555 ? ? ? ? ? ? ? 2.924 ? 
metalc574  metalc ? ? FA MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8001 A HOH 3608 1_555 ? ? ? ? ? ? ? 2.028 ? 
metalc575  metalc ? ? GA MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8002 A HOH 4317 1_555 ? ? ? ? ? ? ? 2.265 ? 
metalc576  metalc ? ? GA MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8002 A HOH 7766 1_555 ? ? ? ? ? ? ? 2.151 ? 
metalc577  metalc ? ? HA MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8003 A HOH 3657 1_555 ? ? ? ? ? ? ? 2.363 ? 
metalc578  metalc ? ? IA MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8004 A HOH 3774 1_555 ? ? ? ? ? ? ? 1.948 ? 
metalc579  metalc ? ? JA MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8005 A HOH 7789 1_555 ? ? ? ? ? ? ? 1.981 ? 
metalc580  metalc ? ? KA MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8006 A HOH 3610 1_555 ? ? ? ? ? ? ? 2.481 ? 
metalc581  metalc ? ? KA MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8006 A HOH 3744 1_555 ? ? ? ? ? ? ? 2.242 ? 
metalc582  metalc ? ? LA MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8007 A HOH 3351 1_555 ? ? ? ? ? ? ? 2.071 ? 
metalc583  metalc ? ? LA MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8007 A HOH 7778 1_555 ? ? ? ? ? ? ? 1.807 ? 
metalc584  metalc ? ? MA MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8008 A HOH 3621 1_555 ? ? ? ? ? ? ? 2.358 ? 
metalc585  metalc ? ? MA MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8008 A HOH 7867 1_555 ? ? ? ? ? ? ? 2.130 ? 
metalc586  metalc ? ? MA MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8008 A HOH 7782 1_555 ? ? ? ? ? ? ? 1.898 ? 
metalc587  metalc ? ? NA MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8009 A HOH 3730 1_555 ? ? ? ? ? ? ? 2.220 ? 
metalc588  metalc ? ? NA MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8009 A HOH 7783 1_555 ? ? ? ? ? ? ? 2.355 ? 
metalc589  metalc ? ? OA MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8010 A HOH 3830 1_555 ? ? ? ? ? ? ? 1.991 ? 
metalc590  metalc ? ? PA MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8011 A HOH 4523 1_555 ? ? ? ? ? ? ? 2.091 ? 
metalc591  metalc ? ? PA MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8011 A HOH 4282 1_555 ? ? ? ? ? ? ? 1.896 ? 
metalc592  metalc ? ? PA MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8011 A HOH 4412 1_555 ? ? ? ? ? ? ? 2.128 ? 
metalc593  metalc ? ? QA MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8012 A HOH 3220 1_555 ? ? ? ? ? ? ? 2.428 ? 
metalc594  metalc ? ? QA MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8012 A HOH 7868 1_555 ? ? ? ? ? ? ? 2.018 ? 
metalc595  metalc ? ? RA MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8013 A HOH 3645 1_555 ? ? ? ? ? ? ? 1.951 ? 
metalc596  metalc ? ? RA MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8013 A HOH 3633 1_555 ? ? ? ? ? ? ? 2.019 ? 
metalc597  metalc ? ? RA MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8013 A HOH 7797 1_555 ? ? ? ? ? ? ? 2.200 ? 
metalc598  metalc ? ? SA MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8014 A HOH 4156 1_555 ? ? ? ? ? ? ? 1.905 ? 
metalc599  metalc ? ? SA MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8014 A HOH 7764 1_555 ? ? ? ? ? ? ? 1.974 ? 
metalc600  metalc ? ? TA MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8015 A HOH 3613 1_555 ? ? ? ? ? ? ? 1.974 ? 
metalc601  metalc ? ? TA MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8015 A HOH 7799 1_555 ? ? ? ? ? ? ? 1.943 ? 
metalc602  metalc ? ? UA MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8016 A HOH 7791 1_555 ? ? ? ? ? ? ? 2.265 ? 
metalc603  metalc ? ? UA MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8016 A HOH 3736 1_555 ? ? ? ? ? ? ? 1.936 ? 
metalc604  metalc ? ? UA MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8016 A HOH 7792 1_555 ? ? ? ? ? ? ? 2.147 ? 
metalc605  metalc ? ? VA MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8017 A HOH 3933 1_555 ? ? ? ? ? ? ? 1.830 ? 
metalc606  metalc ? ? VA MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8017 A HOH 7774 1_555 ? ? ? ? ? ? ? 1.877 ? 
metalc607  metalc ? ? WA MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8018 A HOH 7479 1_555 ? ? ? ? ? ? ? 1.853 ? 
metalc608  metalc ? ? WA MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8018 A HOH 3213 1_555 ? ? ? ? ? ? ? 2.396 ? 
metalc609  metalc ? ? WA MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8018 A HOH 3606 1_555 ? ? ? ? ? ? ? 1.956 ? 
metalc610  metalc ? ? WA MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8018 A HOH 7869 1_555 ? ? ? ? ? ? ? 2.475 ? 
metalc611  metalc ? ? XA MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8019 A HOH 4143 1_555 ? ? ? ? ? ? ? 2.188 ? 
metalc612  metalc ? ? XA MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8019 A HOH 7246 1_555 ? ? ? ? ? ? ? 1.942 ? 
metalc613  metalc ? ? XA MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8019 A HOH 7794 1_555 ? ? ? ? ? ? ? 1.930 ? 
metalc614  metalc ? ? XA MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8019 A HOH 7795 1_555 ? ? ? ? ? ? ? 1.972 ? 
metalc615  metalc ? ? YA MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8020 A HOH 7777 1_555 ? ? ? ? ? ? ? 1.768 ? 
metalc616  metalc ? ? ZA MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8021 A HOH 7780 1_555 ? ? ? ? ? ? ? 2.103 ? 
metalc617  metalc ? ? ZA MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8021 A HOH 3630 1_555 ? ? ? ? ? ? ? 1.788 ? 
metalc618  metalc ? ? BB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8023 A HOH 3619 1_555 ? ? ? ? ? ? ? 2.380 ? 
metalc619  metalc ? ? BB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8023 A HOH 3811 1_555 ? ? ? ? ? ? ? 2.199 ? 
metalc620  metalc ? ? BB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8023 A HOH 7801 1_555 ? ? ? ? ? ? ? 1.769 ? 
metalc621  metalc ? ? DB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8025 A HOH 7804 1_555 ? ? ? ? ? ? ? 1.952 ? 
metalc622  metalc ? ? DB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8025 A HOH 4161 1_555 ? ? ? ? ? ? ? 1.959 ? 
metalc623  metalc ? ? DB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8025 A HOH 7803 1_555 ? ? ? ? ? ? ? 1.768 ? 
metalc624  metalc ? ? EB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8026 A HOH 7805 1_555 ? ? ? ? ? ? ? 2.352 ? 
metalc625  metalc ? ? EB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8026 A HOH 7806 1_555 ? ? ? ? ? ? ? 1.871 ? 
metalc626  metalc ? ? FB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8027 A HOH 4148 1_555 ? ? ? ? ? ? ? 1.775 ? 
metalc627  metalc ? ? FB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8027 A HOH 4006 1_555 ? ? ? ? ? ? ? 2.229 ? 
metalc628  metalc ? ? GB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8028 A HOH 3701 1_555 ? ? ? ? ? ? ? 1.945 ? 
metalc629  metalc ? ? GB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8028 A HOH 3669 1_555 ? ? ? ? ? ? ? 2.383 ? 
metalc630  metalc ? ? GB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8028 A HOH 3690 1_555 ? ? ? ? ? ? ? 2.007 ? 
metalc631  metalc ? ? HB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8029 A HOH 7809 1_555 ? ? ? ? ? ? ? 2.072 ? 
metalc632  metalc ? ? HB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8029 A HOH 7810 1_555 ? ? ? ? ? ? ? 2.267 ? 
metalc633  metalc ? ? HB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8029 A HOH 7811 1_555 ? ? ? ? ? ? ? 1.965 ? 
metalc634  metalc ? ? HB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8029 A HOH 7812 1_555 ? ? ? ? ? ? ? 1.793 ? 
metalc635  metalc ? ? IB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8030 A HOH 3631 1_555 ? ? ? ? ? ? ? 1.815 ? 
metalc636  metalc ? ? IB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8030 A HOH 7775 1_555 ? ? ? ? ? ? ? 1.762 ? 
metalc637  metalc ? ? IB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8030 A HOH 7776 1_555 ? ? ? ? ? ? ? 2.323 ? 
metalc638  metalc ? ? JB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8031 A HOH 3268 1_555 ? ? ? ? ? ? ? 2.170 ? 
metalc639  metalc ? ? JB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8031 A HOH 7815 1_555 ? ? ? ? ? ? ? 2.394 ? 
metalc640  metalc ? ? KB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8032 A HOH 4182 1_555 ? ? ? ? ? ? ? 2.326 ? 
metalc641  metalc ? ? KB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8032 A HOH 3780 1_555 ? ? ? ? ? ? ? 2.399 ? 
metalc642  metalc ? ? KB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8032 A HOH 3716 1_555 ? ? ? ? ? ? ? 2.117 ? 
metalc643  metalc ? ? MB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8034 A HOH 4864 1_555 ? ? ? ? ? ? ? 1.806 ? 
metalc644  metalc ? ? MB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8034 A HOH 3634 1_555 ? ? ? ? ? ? ? 2.302 ? 
metalc645  metalc ? ? MB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8034 A HOH 7817 1_555 ? ? ? ? ? ? ? 1.893 ? 
metalc646  metalc ? ? MB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8034 A HOH 3762 1_555 ? ? ? ? ? ? ? 2.083 ? 
metalc647  metalc ? ? NB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8035 A HOH 3706 1_555 ? ? ? ? ? ? ? 2.147 ? 
metalc648  metalc ? ? NB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8035 A HOH 7818 1_555 ? ? ? ? ? ? ? 2.093 ? 
metalc649  metalc ? ? NB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8035 A HOH 7819 1_555 ? ? ? ? ? ? ? 2.000 ? 
metalc650  metalc ? ? OB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8036 A HOH 3661 1_555 ? ? ? ? ? ? ? 2.179 ? 
metalc651  metalc ? ? OB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8036 A HOH 7821 1_555 ? ? ? ? ? ? ? 2.094 ? 
metalc652  metalc ? ? OB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8036 A HOH 7822 1_555 ? ? ? ? ? ? ? 2.182 ? 
metalc653  metalc ? ? PB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8037 A HOH 3124 1_555 ? ? ? ? ? ? ? 1.972 ? 
metalc654  metalc ? ? PB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8037 A HOH 3203 1_555 ? ? ? ? ? ? ? 2.037 ? 
metalc655  metalc ? ? PB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8037 A HOH 7875 1_555 ? ? ? ? ? ? ? 2.377 ? 
metalc656  metalc ? ? PB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8037 A HOH 3639 1_555 ? ? ? ? ? ? ? 1.913 ? 
metalc657  metalc ? ? QB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8038 A HOH 3617 1_555 ? ? ? ? ? ? ? 1.982 ? 
metalc658  metalc ? ? QB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8038 A HOH 7824 1_555 ? ? ? ? ? ? ? 2.275 ? 
metalc659  metalc ? ? QB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8038 A HOH 3640 1_555 ? ? ? ? ? ? ? 1.753 ? 
metalc660  metalc ? ? QB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8038 A HOH 3662 1_555 ? ? ? ? ? ? ? 1.880 ? 
metalc661  metalc ? ? QB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8038 A HOH 3664 1_555 ? ? ? ? ? ? ? 2.385 ? 
metalc662  metalc ? ? RB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8039 A HOH 3957 1_555 ? ? ? ? ? ? ? 2.064 ? 
metalc663  metalc ? ? RB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8039 A HOH 5102 1_555 ? ? ? ? ? ? ? 2.040 ? 
metalc664  metalc ? ? RB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8039 A HOH 7825 1_555 ? ? ? ? ? ? ? 2.040 ? 
metalc665  metalc ? ? SB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8040 A HOH 7877 1_555 ? ? ? ? ? ? ? 2.145 ? 
metalc666  metalc ? ? SB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8040 A HOH 7878 1_555 ? ? ? ? ? ? ? 2.056 ? 
metalc667  metalc ? ? TB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8041 A HOH 4193 1_555 ? ? ? ? ? ? ? 2.383 ? 
metalc668  metalc ? ? TB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8041 A HOH 4103 1_555 ? ? ? ? ? ? ? 2.385 ? 
metalc669  metalc ? ? UB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8042 A HOH 7827 1_555 ? ? ? ? ? ? ? 2.000 ? 
metalc670  metalc ? ? UB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8042 A HOH 4409 1_555 ? ? ? ? ? ? ? 2.226 ? 
metalc671  metalc ? ? VB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8043 A HOH 7430 1_555 ? ? ? ? ? ? ? 1.810 ? 
metalc672  metalc ? ? XB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8045 A HOH 7829 1_555 ? ? ? ? ? ? ? 2.277 ? 
metalc673  metalc ? ? YB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8046 A HOH 7883 1_555 ? ? ? ? ? ? ? 1.992 ? 
metalc674  metalc ? ? YB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8046 A HOH 7884 1_555 ? ? ? ? ? ? ? 2.398 ? 
metalc675  metalc ? ? YB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8046 A HOH 7310 1_555 ? ? ? ? ? ? ? 2.318 ? 
metalc676  metalc ? ? ZB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8047 A HOH 3118 1_555 ? ? ? ? ? ? ? 2.423 ? 
metalc677  metalc ? ? ZB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8047 A HOH 6280 1_555 ? ? ? ? ? ? ? 2.243 ? 
metalc678  metalc ? ? ZB MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8047 A HOH 7898 1_555 ? ? ? ? ? ? ? 1.987 ? 
metalc679  metalc ? ? AC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8048 A HOH 7920 1_555 ? ? ? ? ? ? ? 2.379 ? 
metalc680  metalc ? ? AC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8048 A HOH 6271 1_555 ? ? ? ? ? ? ? 2.216 ? 
metalc681  metalc ? ? AC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8048 A HOH 7885 1_555 ? ? ? ? ? ? ? 2.286 ? 
metalc682  metalc ? ? AC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8048 A HOH 5879 1_555 ? ? ? ? ? ? ? 2.276 ? 
metalc683  metalc ? ? BC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8049 A HOH 7886 1_555 ? ? ? ? ? ? ? 2.132 ? 
metalc684  metalc ? ? CC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8050 A HOH 7332 1_555 ? ? ? ? ? ? ? 2.333 ? 
metalc685  metalc ? ? DC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8051 A HOH 4098 1_555 ? ? ? ? ? ? ? 2.402 ? 
metalc686  metalc ? ? DC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8051 A HOH 7831 1_555 ? ? ? ? ? ? ? 2.136 ? 
metalc687  metalc ? ? EC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8052 A HOH 3615 1_555 ? ? ? ? ? ? ? 1.997 ? 
metalc688  metalc ? ? FC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8053 A HOH 3031 1_555 ? ? ? ? ? ? ? 2.471 ? 
metalc689  metalc ? ? FC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8053 A HOH 5618 1_555 ? ? ? ? ? ? ? 2.261 ? 
metalc690  metalc ? ? GC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8054 A HOH 7833 1_555 ? ? ? ? ? ? ? 2.301 ? 
metalc691  metalc ? ? XH MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? D MG  8055 A HOH 7729 1_555 ? ? ? ? ? ? ? 2.385 ? 
metalc692  metalc ? ? HC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8056 A HOH 3966 1_555 ? ? ? ? ? ? ? 2.027 ? 
metalc693  metalc ? ? HC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8056 A HOH 3659 1_555 ? ? ? ? ? ? ? 2.380 ? 
metalc694  metalc ? ? HC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8056 A HOH 7851 1_555 ? ? ? ? ? ? ? 2.255 ? 
metalc695  metalc ? ? IC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8057 A HOH 5009 1_555 ? ? ? ? ? ? ? 2.008 ? 
metalc696  metalc ? ? JC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8058 A HOH 7834 1_555 ? ? ? ? ? ? ? 2.002 ? 
metalc697  metalc ? ? JC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8058 A HOH 7835 1_555 ? ? ? ? ? ? ? 1.784 ? 
metalc698  metalc ? ? JC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8058 A HOH 3756 1_555 ? ? ? ? ? ? ? 2.401 ? 
metalc699  metalc ? ? KC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8059 A HOH 4042 1_555 ? ? ? ? ? ? ? 2.181 ? 
metalc700  metalc ? ? KC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8059 A HOH 3712 1_555 ? ? ? ? ? ? ? 2.159 ? 
metalc701  metalc ? ? LC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8060 A HOH 7836 1_555 ? ? ? ? ? ? ? 2.419 ? 
metalc702  metalc ? ? LC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8060 A HOH 7838 1_555 ? ? ? ? ? ? ? 2.136 ? 
metalc703  metalc ? ? LC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8060 A HOH 7837 1_555 ? ? ? ? ? ? ? 2.175 ? 
metalc704  metalc ? ? MC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8061 A HOH 7839 1_555 ? ? ? ? ? ? ? 1.801 ? 
metalc705  metalc ? ? MC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8061 A HOH 7840 1_555 ? ? ? ? ? ? ? 2.247 ? 
metalc706  metalc ? ? MC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8061 A HOH 7841 1_555 ? ? ? ? ? ? ? 2.038 ? 
metalc707  metalc ? ? NC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8062 A HOH 3948 1_555 ? ? ? ? ? ? ? 2.002 ? 
metalc708  metalc ? ? NC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8062 A HOH 6180 1_555 ? ? ? ? ? ? ? 2.343 ? 
metalc709  metalc ? ? OC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8063 A HOH 7013 1_555 ? ? ? ? ? ? ? 2.076 ? 
metalc710  metalc ? ? OC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8063 A HOH 7850 1_555 ? ? ? ? ? ? ? 2.226 ? 
metalc711  metalc ? ? OC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8063 A HOH 7448 1_555 ? ? ? ? ? ? ? 2.128 ? 
metalc712  metalc ? ? OC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8063 A HOH 7772 1_555 ? ? ? ? ? ? ? 2.028 ? 
metalc713  metalc ? ? OC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8063 A HOH 4174 1_555 ? ? ? ? ? ? ? 2.374 ? 
metalc714  metalc ? ? OC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8063 A HOH 7901 1_555 ? ? ? ? ? ? ? 2.311 ? 
metalc715  metalc ? ? UH MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? C MG  8065 A HOH 3961 1_555 ? ? ? ? ? ? ? 2.226 ? 
metalc716  metalc ? ? SC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8068 A HOH 3742 1_555 ? ? ? ? ? ? ? 2.316 ? 
metalc717  metalc ? ? SC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8068 A HOH 4816 1_555 ? ? ? ? ? ? ? 1.938 ? 
metalc718  metalc ? ? SC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8068 A HOH 7902 1_555 ? ? ? ? ? ? ? 2.018 ? 
metalc719  metalc ? ? SC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8068 A HOH 6230 1_555 ? ? ? ? ? ? ? 2.496 ? 
metalc720  metalc ? ? HI MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? L MG  8069 A HOH 6049 1_555 ? ? ? ? ? ? ? 2.131 ? 
metalc721  metalc ? ? UC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8071 A HOH 7571 1_555 ? ? ? ? ? ? ? 1.768 ? 
metalc722  metalc ? ? UC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8071 A HOH 7434 1_555 ? ? ? ? ? ? ? 1.767 ? 
metalc723  metalc ? ? UC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8071 A HOH 7848 1_555 ? ? ? ? ? ? ? 2.040 ? 
metalc724  metalc ? ? UC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8071 A HOH 7849 1_555 ? ? ? ? ? ? ? 2.496 ? 
metalc725  metalc ? ? UC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8071 A HOH 6058 1_555 ? ? ? ? ? ? ? 1.921 ? 
metalc726  metalc ? ? UC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8071 A HOH 4107 1_555 ? ? ? ? ? ? ? 2.177 ? 
metalc727  metalc ? ? VC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8072 A HOH 7847 1_555 ? ? ? ? ? ? ? 2.433 ? 
metalc728  metalc ? ? VC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8072 A HOH 3988 1_555 ? ? ? ? ? ? ? 2.268 ? 
metalc729  metalc ? ? VC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8072 A HOH 3225 1_555 ? ? ? ? ? ? ? 1.996 ? 
metalc730  metalc ? ? WC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8074 A HOH 7904 1_555 ? ? ? ? ? ? ? 2.050 ? 
metalc731  metalc ? ? WC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8074 A HOH 7844 1_555 ? ? ? ? ? ? ? 1.910 ? 
metalc732  metalc ? ? XC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8075 A HOH 7846 1_555 ? ? ? ? ? ? ? 2.482 ? 
metalc733  metalc ? ? XC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8075 A HOH 4935 1_555 ? ? ? ? ? ? ? 2.323 ? 
metalc734  metalc ? ? YC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8076 A HOH 7905 1_555 ? ? ? ? ? ? ? 2.356 ? 
metalc735  metalc ? ? YC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8076 A HOH 7906 1_555 ? ? ? ? ? ? ? 1.853 ? 
metalc736  metalc ? ? ZC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8077 A HOH 3614 1_555 ? ? ? ? ? ? ? 2.007 ? 
metalc737  metalc ? ? ZC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8077 A HOH 7854 1_555 ? ? ? ? ? ? ? 1.943 ? 
metalc738  metalc ? ? BD MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8080 A HOH 4485 1_555 ? ? ? ? ? ? ? 2.019 ? 
metalc739  metalc ? ? BD MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8080 A HOH 4197 1_555 ? ? ? ? ? ? ? 2.419 ? 
metalc740  metalc ? ? CD MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8081 A HOH 4093 1_555 ? ? ? ? ? ? ? 2.123 ? 
metalc741  metalc ? ? DD MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8082 A HOH 5244 1_555 ? ? ? ? ? ? ? 2.310 ? 
metalc742  metalc ? ? DD MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8082 A HOH 7915 1_555 ? ? ? ? ? ? ? 1.996 ? 
metalc743  metalc ? ? DD MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8082 A HOH 7916 1_555 ? ? ? ? ? ? ? 2.476 ? 
metalc744  metalc ? ? ED MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8083 A HOH 7857 1_555 ? ? ? ? ? ? ? 2.369 ? 
metalc745  metalc ? ? ED MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8083 A HOH 3697 1_555 ? ? ? ? ? ? ? 2.004 ? 
metalc746  metalc ? ? ED MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8083 A HOH 4144 1_555 ? ? ? ? ? ? ? 2.114 ? 
metalc747  metalc ? ? ED MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8083 A HOH 6366 1_555 ? ? ? ? ? ? ? 1.902 ? 
metalc748  metalc ? ? ED MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8083 A HOH 7908 1_555 ? ? ? ? ? ? ? 2.064 ? 
metalc749  metalc ? ? FD MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8084 A HOH 3626 1_555 ? ? ? ? ? ? ? 2.214 ? 
metalc750  metalc ? ? GD MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8085 A HOH 3779 1_555 ? ? ? ? ? ? ? 2.258 ? 
metalc751  metalc ? ? GD MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8085 A HOH 4478 1_555 ? ? ? ? ? ? ? 2.301 ? 
metalc752  metalc ? ? HD MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8086 A HOH 3724 1_555 ? ? ? ? ? ? ? 2.344 ? 
metalc753  metalc ? ? HD MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8086 A HOH 7860 1_555 ? ? ? ? ? ? ? 2.276 ? 
metalc754  metalc ? ? HD MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8086 A HOH 7859 1_555 ? ? ? ? ? ? ? 2.269 ? 
metalc755  metalc ? ? ID MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8087 A HOH 7917 1_555 ? ? ? ? ? ? ? 1.851 ? 
metalc756  metalc ? ? JD MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8088 A HOH 3035 1_555 ? ? ? ? ? ? ? 2.485 ? 
metalc757  metalc ? ? KD MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8089 A HOH 7909 1_555 ? ? ? ? ? ? ? 2.354 ? 
metalc758  metalc ? ? KD MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8089 A HOH 7910 1_555 ? ? ? ? ? ? ? 1.763 ? 
metalc759  metalc ? ? KD MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8089 A HOH 7861 1_555 ? ? ? ? ? ? ? 2.090 ? 
metalc760  metalc ? ? MD MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8091 A HOH 7862 1_555 ? ? ? ? ? ? ? 2.315 ? 
metalc761  metalc ? ? MD MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8091 A HOH 6491 1_555 ? ? ? ? ? ? ? 2.335 ? 
metalc762  metalc ? ? ND MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8092 A HOH 3636 1_555 ? ? ? ? ? ? ? 2.128 ? 
metalc763  metalc ? ? ND MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8092 A HOH 3651 1_555 ? ? ? ? ? ? ? 2.038 ? 
metalc764  metalc ? ? OD MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8093 A HOH 3641 1_555 ? ? ? ? ? ? ? 1.799 ? 
metalc765  metalc ? ? OD MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8093 A HOH 3713 1_555 ? ? ? ? ? ? ? 2.442 ? 
metalc766  metalc ? ? PD MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8094 A HOH 7912 1_555 ? ? ? ? ? ? ? 2.095 ? 
metalc767  metalc ? ? PD MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8094 A HOH 7863 1_555 ? ? ? ? ? ? ? 1.832 ? 
metalc768  metalc ? ? QD MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8096 A HOH 3825 1_555 ? ? ? ? ? ? ? 2.048 ? 
metalc769  metalc ? ? RD MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8097 A HOH 3667 1_555 ? ? ? ? ? ? ? 2.313 ? 
metalc770  metalc ? ? RD MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8097 A HOH 3333 1_555 ? ? ? ? ? ? ? 2.404 ? 
metalc771  metalc ? ? RD MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8097 A HOH 3663 1_555 ? ? ? ? ? ? ? 2.216 ? 
metalc772  metalc ? ? TD MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8099 A HOH 3005 1_555 ? ? ? ? ? ? ? 2.335 ? 
metalc773  metalc ? ? TD MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8099 A HOH 3670 1_555 ? ? ? ? ? ? ? 2.250 ? 
metalc774  metalc ? ? UD MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8100 A HOH 4242 1_555 ? ? ? ? ? ? ? 2.066 ? 
metalc775  metalc ? ? UD MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8100 A HOH 5507 1_555 ? ? ? ? ? ? ? 2.042 ? 
metalc776  metalc ? ? XD MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8103 A HOH 7913 1_555 ? ? ? ? ? ? ? 1.906 ? 
metalc777  metalc ? ? ZD MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8106 A HOH 7425 1_555 ? ? ? ? ? ? ? 2.246 ? 
metalc778  metalc ? ? ZD MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8106 A HOH 7879 1_555 ? ? ? ? ? ? ? 2.497 ? 
metalc779  metalc ? ? AE MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8107 A HOH 7891 1_555 ? ? ? ? ? ? ? 2.372 ? 
metalc780  metalc ? ? BE MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8108 A HOH 7895 1_555 ? ? ? ? ? ? ? 2.242 ? 
metalc781  metalc ? ? BE MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8108 A HOH 7894 1_555 ? ? ? ? ? ? ? 2.393 ? 
metalc782  metalc ? ? BE MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8108 A HOH 7507 1_555 ? ? ? ? ? ? ? 2.120 ? 
metalc783  metalc ? ? BE MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8108 A HOH 7893 1_555 ? ? ? ? ? ? ? 2.477 ? 
metalc784  metalc ? ? CE MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8110 A HOH 5401 1_555 ? ? ? ? ? ? ? 2.027 ? 
metalc785  metalc ? ? CE MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8110 A HOH 6036 1_555 ? ? ? ? ? ? ? 2.348 ? 
metalc786  metalc ? ? CE MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8110 A HOH 3915 1_555 ? ? ? ? ? ? ? 2.106 ? 
metalc787  metalc ? ? DE MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8111 A HOH 5752 1_555 ? ? ? ? ? ? ? 2.357 ? 
metalc788  metalc ? ? DE MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8111 A HOH 3711 1_555 ? ? ? ? ? ? ? 1.969 ? 
metalc789  metalc ? ? DE MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8111 A HOH 5603 1_555 ? ? ? ? ? ? ? 2.201 ? 
metalc790  metalc ? ? EE MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8112 A HOH 3718 1_555 ? ? ? ? ? ? ? 2.099 ? 
metalc791  metalc ? ? FE MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8113 A HOH 6136 1_555 ? ? ? ? ? ? ? 1.882 ? 
metalc792  metalc ? ? FE MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8113 A HOH 3913 1_555 ? ? ? ? ? ? ? 2.380 ? 
metalc793  metalc ? ? HE MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8115 A HOH 4277 1_555 ? ? ? ? ? ? ? 1.765 ? 
metalc794  metalc ? ? HE MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8115 A HOH 6610 1_555 ? ? ? ? ? ? ? 2.238 ? 
metalc795  metalc ? ? IE MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8116 A HOH 3654 1_555 ? ? ? ? ? ? ? 2.244 ? 
metalc796  metalc ? ? IE MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8116 A HOH 3856 1_555 ? ? ? ? ? ? ? 2.430 ? 
metalc797  metalc ? ? JE MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8117 A HOH 6569 1_555 ? ? ? ? ? ? ? 2.313 ? 
metalc798  metalc ? ? ME NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8301 A HOH 4969 1_555 ? ? ? ? ? ? ? 2.182 ? 
metalc799  metalc ? ? ME NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8301 A HOH 3193 1_555 ? ? ? ? ? ? ? 2.640 ? 
metalc800  metalc ? ? NE NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8302 A HOH 5686 1_555 ? ? ? ? ? ? ? 2.784 ? 
metalc801  metalc ? ? PE NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8305 A HOH 4083 1_555 ? ? ? ? ? ? ? 2.246 ? 
metalc802  metalc ? ? PE NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8305 A HOH 4697 1_555 ? ? ? ? ? ? ? 2.591 ? 
metalc803  metalc ? ? PE NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8305 A HOH 5788 1_555 ? ? ? ? ? ? ? 2.334 ? 
metalc804  metalc ? ? SE NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8308 A HOH 3406 1_555 ? ? ? ? ? ? ? 2.511 ? 
metalc805  metalc ? ? UE NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8311 A HOH 4651 1_555 ? ? ? ? ? ? ? 2.774 ? 
metalc806  metalc ? ? UE NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8311 A HOH 3567 1_555 ? ? ? ? ? ? ? 2.208 ? 
metalc807  metalc ? ? VE NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8313 A HOH 3826 1_555 ? ? ? ? ? ? ? 2.265 ? 
metalc808  metalc ? ? WE NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8314 A HOH 3119 1_555 ? ? ? ? ? ? ? 2.830 ? 
metalc809  metalc ? ? AF NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8318 A HOH 3919 1_555 ? ? ? ? ? ? ? 2.270 ? 
metalc810  metalc ? ? BF NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8319 A HOH 4252 1_555 ? ? ? ? ? ? ? 2.731 ? 
metalc811  metalc ? ? BF NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8319 A HOH 6051 1_555 ? ? ? ? ? ? ? 2.274 ? 
metalc812  metalc ? ? EF NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8323 A HOH 4472 1_555 ? ? ? ? ? ? ? 2.529 ? 
metalc813  metalc ? ? GF NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8325 A HOH 7678 1_555 ? ? ? ? ? ? ? 2.344 ? 
metalc814  metalc ? ? GF NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8325 A HOH 3268 1_555 ? ? ? ? ? ? ? 2.163 ? 
metalc815  metalc ? ? IF NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8327 A HOH 3197 1_555 ? ? ? ? ? ? ? 2.956 ? 
metalc816  metalc ? ? JF NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8328 A HOH 5217 1_555 ? ? ? ? ? ? ? 2.895 ? 
metalc817  metalc ? ? KF NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8329 A HOH 6588 1_555 ? ? ? ? ? ? ? 2.777 ? 
metalc818  metalc ? ? NF NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8332 A HOH 7082 1_555 ? ? ? ? ? ? ? 2.639 ? 
metalc819  metalc ? ? PF NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8334 A HOH 5250 1_555 ? ? ? ? ? ? ? 2.002 ? 
metalc820  metalc ? ? RF NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8336 A HOH 7361 1_555 ? ? ? ? ? ? ? 2.408 ? 
metalc821  metalc ? ? RF NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8336 A HOH 7705 1_555 ? ? ? ? ? ? ? 2.648 ? 
metalc822  metalc ? ? RI NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? S NA  8337 A HOH 5920 1_555 ? ? ? ? ? ? ? 2.647 ? 
metalc823  metalc ? ? TF NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8339 A HOH 3018 1_555 ? ? ? ? ? ? ? 2.843 ? 
metalc824  metalc ? ? TF NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8339 A HOH 4285 1_555 ? ? ? ? ? ? ? 2.920 ? 
metalc825  metalc ? ? UF NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8340 A HOH 3027 1_555 ? ? ? ? ? ? ? 2.971 ? 
metalc826  metalc ? ? WF NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8342 A HOH 5629 1_555 ? ? ? ? ? ? ? 2.849 ? 
metalc827  metalc ? ? CI NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? K NA  8346 A HOH 5761 1_555 ? ? ? ? ? ? ? 2.200 ? 
metalc828  metalc ? ? AG NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8350 A HOH 6967 1_555 ? ? ? ? ? ? ? 2.293 ? 
metalc829  metalc ? ? BG NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8352 A HOH 5258 1_555 ? ? ? ? ? ? ? 2.835 ? 
metalc830  metalc ? ? CG NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8353 A HOH 4873 1_555 ? ? ? ? ? ? ? 2.650 ? 
metalc831  metalc ? ? DG NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8354 A HOH 4813 1_555 ? ? ? ? ? ? ? 2.284 ? 
metalc832  metalc ? ? EG NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8355 A HOH 4806 1_555 ? ? ? ? ? ? ? 2.357 ? 
metalc833  metalc ? ? GG NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8357 A HOH 6284 1_555 ? ? ? ? ? ? ? 2.046 ? 
metalc834  metalc ? ? HG NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8359 A HOH 3180 1_555 ? ? ? ? ? ? ? 2.979 ? 
metalc835  metalc ? ? JG NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8361 A HOH 5101 1_555 ? ? ? ? ? ? ? 2.865 ? 
metalc836  metalc ? ? JG NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8361 A HOH 7350 1_555 ? ? ? ? ? ? ? 2.429 ? 
metalc837  metalc ? ? JG NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8361 A HOH 4903 1_555 ? ? ? ? ? ? ? 2.503 ? 
metalc838  metalc ? ? OG NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8366 A HOH 3812 1_555 ? ? ? ? ? ? ? 2.439 ? 
metalc839  metalc ? ? PG NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8367 A HOH 4599 1_555 ? ? ? ? ? ? ? 2.775 ? 
metalc840  metalc ? ? PG NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8367 A HOH 4471 1_555 ? ? ? ? ? ? ? 2.724 ? 
metalc841  metalc ? ? QG NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8368 A HOH 3875 1_555 ? ? ? ? ? ? ? 2.550 ? 
metalc842  metalc ? ? SG NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8370 A HOH 4097 1_555 ? ? ? ? ? ? ? 2.246 ? 
metalc843  metalc ? ? VG NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8373 A HOH 7314 1_555 ? ? ? ? ? ? ? 2.869 ? 
metalc844  metalc ? ? VG NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8373 A HOH 3671 1_555 ? ? ? ? ? ? ? 2.181 ? 
metalc845  metalc ? ? ZG NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8377 A HOH 6353 1_555 ? ? ? ? ? ? ? 2.195 ? 
metalc846  metalc ? ? AH NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8378 A HOH 3201 1_555 ? ? ? ? ? ? ? 2.249 ? 
metalc847  metalc ? ? BH NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8379 A HOH 3704 1_555 ? ? ? ? ? ? ? 2.600 ? 
metalc848  metalc ? ? BH NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8379 A HOH 4416 1_555 ? ? ? ? ? ? ? 2.233 ? 
metalc849  metalc ? ? CH NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8381 A HOH 3681 1_555 ? ? ? ? ? ? ? 2.039 ? 
metalc850  metalc ? ? CH NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8381 A HOH 7084 1_555 ? ? ? ? ? ? ? 2.352 ? 
metalc851  metalc ? ? EH NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8384 A HOH 5018 1_555 ? ? ? ? ? ? ? 2.680 ? 
metalc852  metalc ? ? FH NA  .    NA    ? ? ? 1_555 FJ HOH .    O     ? ? A NA  8385 A HOH 7698 1_555 ? ? ? ? ? ? ? 2.246 ? 
metalc853  metalc ? ? QH K   .    K     ? ? ? 1_555 FJ HOH .    O     ? ? A K   8603 A HOH 5695 1_555 ? ? ? ? ? ? ? 2.578 ? 
hydrog1    hydrog ? ? A  U   11   O4    ? ? ? 1_555 A  G   530  N2    ? ? A U   12   A G   531  1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog2    hydrog ? ? A  G   12   N1    ? ? ? 1_555 A  C   529  N3    ? ? A G   13   A C   530  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3    hydrog ? ? A  G   12   N2    ? ? ? 1_555 A  C   529  O2    ? ? A G   13   A C   530  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4    hydrog ? ? A  G   12   O6    ? ? ? 1_555 A  C   529  N4    ? ? A G   13   A C   530  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5    hydrog ? ? A  C   13   N3    ? ? ? 1_555 A  G   528  N1    ? ? A C   14   A G   529  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6    hydrog ? ? A  C   13   N4    ? ? ? 1_555 A  G   528  O6    ? ? A C   14   A G   529  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7    hydrog ? ? A  C   13   O2    ? ? ? 1_555 A  G   528  N2    ? ? A C   14   A G   529  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8    hydrog ? ? A  C   14   N3    ? ? ? 1_555 A  G   527  N1    ? ? A C   15   A G   528  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9    hydrog ? ? A  C   14   N4    ? ? ? 1_555 A  G   527  O6    ? ? A C   15   A G   528  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10   hydrog ? ? A  C   14   O2    ? ? ? 1_555 A  G   527  N2    ? ? A C   15   A G   528  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11   hydrog ? ? A  A   15   N1    ? ? ? 1_555 A  U   526  N3    ? ? A A   16   A U   527  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12   hydrog ? ? A  A   15   N6    ? ? ? 1_555 A  U   526  O4    ? ? A A   16   A U   527  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13   hydrog ? ? A  G   16   N1    ? ? ? 1_555 A  U   525  O2    ? ? A G   17   A U   526  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog14   hydrog ? ? A  G   16   O6    ? ? ? 1_555 A  U   525  N3    ? ? A G   17   A U   526  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog15   hydrog ? ? A  C   17   N3    ? ? ? 1_555 A  G   524  N1    ? ? A C   18   A G   525  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16   hydrog ? ? A  C   17   N4    ? ? ? 1_555 A  G   524  O6    ? ? A C   18   A G   525  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17   hydrog ? ? A  C   17   O2    ? ? ? 1_555 A  G   524  N2    ? ? A C   18   A G   525  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18   hydrog ? ? A  U   18   N3    ? ? ? 1_555 A  A   523  N1    ? ? A U   19   A A   524  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19   hydrog ? ? A  U   18   O4    ? ? ? 1_555 A  A   523  N6    ? ? A U   19   A A   524  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20   hydrog ? ? A  G   19   N1    ? ? ? 1_555 A  C   522  N3    ? ? A G   20   A C   523  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21   hydrog ? ? A  G   19   N2    ? ? ? 1_555 A  C   522  O2    ? ? A G   20   A C   523  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22   hydrog ? ? A  G   19   O6    ? ? ? 1_555 A  C   522  N4    ? ? A G   20   A C   523  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23   hydrog ? ? A  G   20   N1    ? ? ? 1_555 A  U   521  O2    ? ? A G   21   A U   522  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog24   hydrog ? ? A  G   20   O6    ? ? ? 1_555 A  U   521  N3    ? ? A G   21   A U   522  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog25   hydrog ? ? A  U   21   O2    ? ? ? 1_555 A  A   520  N6    ? ? A U   22   A A   521  1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog26   hydrog ? ? A  G   22   N2    ? ? ? 1_555 A  A   519  N7    ? ? A G   23   A A   520  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog27   hydrog ? ? A  G   22   N3    ? ? ? 1_555 A  A   519  N6    ? ? A G   23   A A   520  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog28   hydrog ? ? A  G   23   N2    ? ? ? 1_555 A  A   518  N7    ? ? A G   24   A A   519  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog29   hydrog ? ? A  G   23   N3    ? ? ? 1_555 A  A   518  N6    ? ? A G   24   A A   519  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog30   hydrog ? ? A  A   24   N6    ? ? ? 1_555 A  G   517  N3    ? ? A A   25   A G   518  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog31   hydrog ? ? A  A   24   N7    ? ? ? 1_555 A  G   517  N2    ? ? A A   25   A G   518  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog32   hydrog ? ? A  U   25   N3    ? ? ? 1_555 A  U   516  O2    ? ? A U   26   A U   517  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog33   hydrog ? ? A  U   25   O4    ? ? ? 1_555 A  U   516  N3    ? ? A U   26   A U   517  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog34   hydrog ? ? A  U   26   N3    ? ? ? 1_555 A  A   515  N1    ? ? A U   27   A A   516  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog35   hydrog ? ? A  U   26   O4    ? ? ? 1_555 A  A   515  N6    ? ? A U   27   A A   516  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog36   hydrog ? ? A  G   27   N1    ? ? ? 1_555 A  C   479  N3    ? ? A G   28   A C   480  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog37   hydrog ? ? A  G   27   N2    ? ? ? 1_555 A  C   479  O2    ? ? A G   28   A C   480  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog38   hydrog ? ? A  G   27   O6    ? ? ? 1_555 A  C   479  N4    ? ? A G   28   A C   480  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog39   hydrog ? ? A  C   28   N3    ? ? ? 1_555 A  G   478  N1    ? ? A C   29   A G   479  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog40   hydrog ? ? A  C   28   N4    ? ? ? 1_555 A  G   478  O6    ? ? A C   29   A G   479  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog41   hydrog ? ? A  C   28   O2    ? ? ? 1_555 A  G   478  N2    ? ? A C   29   A G   479  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog42   hydrog ? ? A  U   29   N3    ? ? ? 1_555 A  A   452  N7    ? ? A U   30   A A   453  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog43   hydrog ? ? A  U   29   O2    ? ? ? 1_555 A  A   452  N6    ? ? A U   30   A A   453  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog44   hydrog ? ? A  G   31   N1    ? ? ? 1_555 A  C   450  N3    ? ? A G   32   A C   451  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog45   hydrog ? ? A  G   31   N2    ? ? ? 1_555 A  C   450  O2    ? ? A G   32   A C   451  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog46   hydrog ? ? A  G   31   O6    ? ? ? 1_555 A  C   450  N4    ? ? A G   32   A C   451  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog47   hydrog ? ? A  G   31   N2    ? ? ? 1_555 A  A   454  N1    ? ? A G   32   A A   455  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog48   hydrog ? ? A  G   31   N2    ? ? ? 1_555 A  G   455  N3    ? ? A G   32   A G   456  1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog49   hydrog ? ? A  G   31   N3    ? ? ? 1_555 A  G   455  N2    ? ? A G   32   A G   456  1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog50   hydrog ? ? A  G   32   N1    ? ? ? 1_555 A  C   449  N3    ? ? A G   33   A C   450  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog51   hydrog ? ? A  G   32   N2    ? ? ? 1_555 A  C   449  O2    ? ? A G   33   A C   450  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog52   hydrog ? ? A  G   32   O6    ? ? ? 1_555 A  C   449  N4    ? ? A G   33   A C   450  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog53   hydrog ? ? A  C   33   N3    ? ? ? 1_555 A  G   447  N1    ? ? A C   34   A G   448  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog54   hydrog ? ? A  C   33   N4    ? ? ? 1_555 A  G   447  O6    ? ? A C   34   A G   448  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog55   hydrog ? ? A  C   33   O2    ? ? ? 1_555 A  G   447  N2    ? ? A C   34   A G   448  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog56   hydrog ? ? A  U   34   N3    ? ? ? 1_555 A  A   446  N1    ? ? A U   35   A A   447  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog57   hydrog ? ? A  U   34   O4    ? ? ? 1_555 A  A   446  N6    ? ? A U   35   A A   447  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog58   hydrog ? ? A  C   35   N3    ? ? ? 1_555 A  G   445  N1    ? ? A C   36   A G   446  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog59   hydrog ? ? A  C   35   N4    ? ? ? 1_555 A  G   445  O6    ? ? A C   36   A G   446  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog60   hydrog ? ? A  C   35   O2    ? ? ? 1_555 A  G   445  N2    ? ? A C   36   A G   446  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog61   hydrog ? ? A  C   35   O2    ? ? ? 1_555 A  A   673  N6    ? ? A C   36   A A   674  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog62   hydrog ? ? A  A   36   N1    ? ? ? 1_555 A  U   444  N3    ? ? A A   37   A U   445  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog63   hydrog ? ? A  A   36   N6    ? ? ? 1_555 A  U   444  O4    ? ? A A   37   A U   445  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog64   hydrog ? ? A  G   37   N1    ? ? ? 1_555 A  C   443  N3    ? ? A G   38   A C   444  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog65   hydrog ? ? A  G   37   N2    ? ? ? 1_555 A  C   443  O2    ? ? A G   38   A C   444  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog66   hydrog ? ? A  G   37   O6    ? ? ? 1_555 A  C   443  N4    ? ? A G   38   A C   444  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog67   hydrog ? ? A  G   38   N1    ? ? ? 1_555 A  C   442  N3    ? ? A G   39   A C   443  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog68   hydrog ? ? A  G   38   N2    ? ? ? 1_555 A  C   442  O2    ? ? A G   39   A C   443  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog69   hydrog ? ? A  G   38   O6    ? ? ? 1_555 A  C   442  N4    ? ? A G   39   A C   443  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog70   hydrog ? ? A  C   39   N4    ? ? ? 1_555 A  A   440  N1    ? ? A C   40   A A   441  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog71   hydrog ? ? A  C   39   O2    ? ? ? 1_555 A  A   441  N6    ? ? A C   40   A A   442  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog72   hydrog ? ? A  G   40   N2    ? ? ? 1_555 A  A   150  N1    ? ? A G   41   A A   151  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog73   hydrog ? ? A  G   40   N1    ? ? ? 1_555 A  C   439  N3    ? ? A G   41   A C   440  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog74   hydrog ? ? A  G   40   N2    ? ? ? 1_555 A  C   439  O2    ? ? A G   41   A C   440  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog75   hydrog ? ? A  G   40   O6    ? ? ? 1_555 A  C   439  N4    ? ? A G   41   A C   440  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog76   hydrog ? ? A  C   41   N3    ? ? ? 1_555 A  G   148  N1    ? ? A C   42   A G   149  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog77   hydrog ? ? A  C   41   N4    ? ? ? 1_555 A  G   148  O6    ? ? A C   42   A G   149  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog78   hydrog ? ? A  C   41   O2    ? ? ? 1_555 A  G   148  N2    ? ? A C   42   A G   149  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog79   hydrog ? ? A  U   42   N3    ? ? ? 1_555 A  A   147  N1    ? ? A U   43   A A   148  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog80   hydrog ? ? A  U   42   O4    ? ? ? 1_555 A  A   147  N6    ? ? A U   43   A A   148  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog81   hydrog ? ? A  G   43   N2    ? ? ? 1_555 A  A   44   N1    ? ? A G   44   A A   45   1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog82   hydrog ? ? A  A   44   N6    ? ? ? 1_555 A  U   114  O4    ? ? A A   45   A U   115  1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog83   hydrog ? ? A  A   44   N7    ? ? ? 1_555 A  U   114  N3    ? ? A A   45   A U   115  1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog84   hydrog ? ? A  G   46   N2    ? ? ? 1_555 A  A   112  N7    ? ? A G   47   A A   113  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog85   hydrog ? ? A  G   46   N3    ? ? ? 1_555 A  A   112  N6    ? ? A G   47   A A   113  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog86   hydrog ? ? A  A   47   N6    ? ? ? 1_555 A  A   113  N7    ? ? A A   48   A A   114  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog87   hydrog ? ? A  A   47   N7    ? ? ? 1_555 A  A   113  N6    ? ? A A   48   A A   114  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog88   hydrog ? ? A  A   48   N6    ? ? ? 1_555 A  G   111  N3    ? ? A A   49   A G   112  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog89   hydrog ? ? A  A   48   N7    ? ? ? 1_555 A  G   111  N2    ? ? A A   49   A G   112  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog90   hydrog ? ? A  G   49   N1    ? ? ? 1_555 A  C   110  N3    ? ? A G   50   A C   111  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog91   hydrog ? ? A  G   49   N2    ? ? ? 1_555 A  C   110  O2    ? ? A G   50   A C   111  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog92   hydrog ? ? A  G   49   O6    ? ? ? 1_555 A  C   110  N4    ? ? A G   50   A C   111  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog93   hydrog ? ? A  G   50   N1    ? ? ? 1_555 A  C   109  N3    ? ? A G   51   A C   110  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog94   hydrog ? ? A  G   50   N2    ? ? ? 1_555 A  C   109  O2    ? ? A G   51   A C   110  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog95   hydrog ? ? A  G   50   O6    ? ? ? 1_555 A  C   109  N4    ? ? A G   51   A C   110  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog96   hydrog ? ? A  G   50   N2    ? ? ? 1_555 A  U   120  O2    ? ? A G   51   A U   121  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog97   hydrog ? ? A  A   51   N1    ? ? ? 1_555 A  U   108  N3    ? ? A A   52   A U   109  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog98   hydrog ? ? A  A   51   N6    ? ? ? 1_555 A  U   108  O4    ? ? A A   52   A U   109  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog99   hydrog ? ? A  C   52   N3    ? ? ? 1_555 A  G   65   N1    ? ? A C   53   A G   66   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog100  hydrog ? ? A  C   52   N4    ? ? ? 1_555 A  G   65   O6    ? ? A C   53   A G   66   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog101  hydrog ? ? A  C   52   O2    ? ? ? 1_555 A  G   65   N2    ? ? A C   53   A G   66   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog102  hydrog ? ? A  G   53   N1    ? ? ? 1_555 A  C   64   N3    ? ? A G   54   A C   65   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog103  hydrog ? ? A  G   53   N2    ? ? ? 1_555 A  C   64   O2    ? ? A G   54   A C   65   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog104  hydrog ? ? A  G   53   O6    ? ? ? 1_555 A  C   64   N4    ? ? A G   54   A C   65   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog105  hydrog ? ? A  G   53   N2    ? ? ? 1_555 A  A   68   N3    ? ? A G   54   A A   69   1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog106  hydrog ? ? A  U   54   N3    ? ? ? 1_555 A  G   63   O6    ? ? A U   55   A G   64   1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog107  hydrog ? ? A  U   54   O2    ? ? ? 1_555 A  G   63   N1    ? ? A U   55   A G   64   1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog108  hydrog ? ? A  G   55   O6    ? ? ? 1_555 A  C   61   N4    ? ? A G   56   A C   62   1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog109  hydrog ? ? A  G   55   N1    ? ? ? 1_555 A  G   83   O6    ? ? A G   56   A G   84   1_555 ? ? ? ? ? ? TYPE_6_PAIR ? ? 
hydrog110  hydrog ? ? A  G   55   N2    ? ? ? 1_555 A  G   83   N7    ? ? A G   56   A G   84   1_555 ? ? ? ? ? ? TYPE_6_PAIR ? ? 
hydrog111  hydrog ? ? A  C   56   N3    ? ? ? 1_555 A  G   88   N1    ? ? A C   57   A G   89   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog112  hydrog ? ? A  C   56   N4    ? ? ? 1_555 A  G   88   O6    ? ? A C   57   A G   89   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog113  hydrog ? ? A  C   56   O2    ? ? ? 1_555 A  G   88   N2    ? ? A C   57   A G   89   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog114  hydrog ? ? A  C   57   N3    ? ? ? 1_555 A  G   87   N1    ? ? A C   58   A G   88   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog115  hydrog ? ? A  C   57   N4    ? ? ? 1_555 A  G   87   O6    ? ? A C   58   A G   88   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog116  hydrog ? ? A  C   57   O2    ? ? ? 1_555 A  G   87   N2    ? ? A C   58   A G   88   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog117  hydrog ? ? A  A   58   N3    ? ? ? 1_555 A  A   59   N6    ? ? A A   59   A A   60   1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog118  hydrog ? ? A  A   58   N1    ? ? ? 1_555 A  C   84   N4    ? ? A A   59   A C   85   1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog119  hydrog ? ? A  A   59   N1    ? ? ? 1_555 A  A   85   N6    ? ? A A   60   A A   86   1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog120  hydrog ? ? A  A   59   N6    ? ? ? 1_555 A  A   85   N1    ? ? A A   60   A A   86   1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog121  hydrog ? ? A  G   60   N1    ? ? ? 1_555 A  C   84   N3    ? ? A G   61   A C   85   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog122  hydrog ? ? A  G   60   N2    ? ? ? 1_555 A  C   84   O2    ? ? A G   61   A C   85   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog123  hydrog ? ? A  G   60   O6    ? ? ? 1_555 A  C   84   N4    ? ? A G   61   A C   85   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog124  hydrog ? ? A  C   61   N3    ? ? ? 1_555 A  G   83   N1    ? ? A C   62   A G   84   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog125  hydrog ? ? A  C   61   N4    ? ? ? 1_555 A  G   83   O6    ? ? A C   62   A G   84   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog126  hydrog ? ? A  C   61   O2    ? ? ? 1_555 A  G   83   N2    ? ? A C   62   A G   84   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog127  hydrog ? ? A  U   62   N3    ? ? ? 1_555 A  A   69   N7    ? ? A U   63   A A   70   1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog128  hydrog ? ? A  U   62   O4    ? ? ? 1_555 A  A   69   N6    ? ? A U   63   A A   70   1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog129  hydrog ? ? A  G   65   N2    ? ? ? 1_555 A  A   66   N1    ? ? A G   66   A A   67   1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog130  hydrog ? ? A  G   70   N1    ? ? ? 1_555 A  A   105  N1    ? ? A G   71   A A   106  1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog131  hydrog ? ? A  G   70   O6    ? ? ? 1_555 A  A   105  N6    ? ? A G   71   A A   106  1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog132  hydrog ? ? A  G   70   N1    ? ? ? 1_555 A  U   106  O2    ? ? A G   71   A U   107  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog133  hydrog ? ? A  C   71   N3    ? ? ? 1_555 A  G   104  N1    ? ? A C   72   A G   105  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog134  hydrog ? ? A  C   71   N4    ? ? ? 1_555 A  G   104  O6    ? ? A C   72   A G   105  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog135  hydrog ? ? A  C   71   O2    ? ? ? 1_555 A  G   104  N2    ? ? A C   72   A G   105  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog136  hydrog ? ? A  C   72   N3    ? ? ? 1_555 A  G   103  N1    ? ? A C   73   A G   104  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog137  hydrog ? ? A  C   72   N4    ? ? ? 1_555 A  G   103  O6    ? ? A C   73   A G   104  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog138  hydrog ? ? A  C   72   O2    ? ? ? 1_555 A  G   103  N2    ? ? A C   73   A G   104  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog139  hydrog ? ? A  A   73   N1    ? ? ? 1_555 A  U   102  N3    ? ? A A   74   A U   103  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog140  hydrog ? ? A  A   73   N6    ? ? ? 1_555 A  U   102  O4    ? ? A A   74   A U   103  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog141  hydrog ? ? A  U   74   N3    ? ? ? 1_555 A  A   101  N1    ? ? A U   75   A A   102  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog142  hydrog ? ? A  U   74   O4    ? ? ? 1_555 A  A   101  N6    ? ? A U   75   A A   102  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog143  hydrog ? ? A  G   75   N1    ? ? ? 1_555 A  C   100  N3    ? ? A G   76   A C   101  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog144  hydrog ? ? A  G   75   N2    ? ? ? 1_555 A  C   100  O2    ? ? A G   76   A C   101  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog145  hydrog ? ? A  G   75   O6    ? ? ? 1_555 A  C   100  N4    ? ? A G   76   A C   101  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog146  hydrog ? ? A  G   76   N1    ? ? ? 1_555 A  C   99   N3    ? ? A G   77   A C   100  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog147  hydrog ? ? A  G   76   N2    ? ? ? 1_555 A  C   99   O2    ? ? A G   77   A C   100  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog148  hydrog ? ? A  G   76   O6    ? ? ? 1_555 A  C   99   N4    ? ? A G   77   A C   100  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog149  hydrog ? ? A  G   77   N2    ? ? ? 1_555 A  A   98   N7    ? ? A G   78   A A   99   1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog150  hydrog ? ? A  G   77   N3    ? ? ? 1_555 A  A   98   N6    ? ? A G   78   A A   99   1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog151  hydrog ? ? A  G   78   N2    ? ? ? 1_555 A  A   97   N7    ? ? A G   79   A A   98   1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog152  hydrog ? ? A  A   79   N3    ? ? ? 1_555 A  G   93   N2    ? ? A A   80   A G   94   1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog153  hydrog ? ? A  A   79   N6    ? ? ? 1_555 A  G   96   N3    ? ? A A   80   A G   97   1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog154  hydrog ? ? A  A   79   N7    ? ? ? 1_555 A  G   96   N2    ? ? A A   80   A G   97   1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog155  hydrog ? ? A  G   80   N1    ? ? ? 1_555 A  C   92   N3    ? ? A G   81   A C   93   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog156  hydrog ? ? A  G   80   N2    ? ? ? 1_555 A  C   92   O2    ? ? A G   81   A C   93   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog157  hydrog ? ? A  G   80   O6    ? ? ? 1_555 A  C   92   N4    ? ? A G   81   A C   93   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog158  hydrog ? ? A  G   80   N2    ? ? ? 1_555 A  A   97   N3    ? ? A G   81   A A   98   1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog159  hydrog ? ? A  C   81   N3    ? ? ? 1_555 A  G   91   N1    ? ? A C   82   A G   92   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog160  hydrog ? ? A  C   81   N4    ? ? ? 1_555 A  G   91   O6    ? ? A C   82   A G   92   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog161  hydrog ? ? A  C   81   O2    ? ? ? 1_555 A  G   91   N2    ? ? A C   82   A G   92   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog162  hydrog ? ? A  C   82   N3    ? ? ? 1_555 A  G   90   N1    ? ? A C   83   A G   91   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog163  hydrog ? ? A  C   82   N4    ? ? ? 1_555 A  G   90   O6    ? ? A C   83   A G   91   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog164  hydrog ? ? A  C   82   O2    ? ? ? 1_555 A  G   90   N2    ? ? A C   83   A G   91   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog165  hydrog ? ? A  G   115  N1    ? ? ? 1_555 A  C   123  N3    ? ? A G   116  A C   124  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog166  hydrog ? ? A  G   115  N2    ? ? ? 1_555 A  C   123  O2    ? ? A G   116  A C   124  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog167  hydrog ? ? A  G   115  O6    ? ? ? 1_555 A  C   123  N4    ? ? A G   116  A C   124  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog168  hydrog ? ? A  A   116  N1    ? ? ? 1_555 A  U   122  N3    ? ? A A   117  A U   123  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog169  hydrog ? ? A  A   116  N6    ? ? ? 1_555 A  U   122  O4    ? ? A A   117  A U   123  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog170  hydrog ? ? A  G   117  N1    ? ? ? 1_555 A  C   121  N3    ? ? A G   118  A C   122  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog171  hydrog ? ? A  G   117  N2    ? ? ? 1_555 A  C   121  O2    ? ? A G   118  A C   122  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog172  hydrog ? ? A  G   117  O6    ? ? ? 1_555 A  C   121  N4    ? ? A G   118  A C   122  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog173  hydrog ? ? A  U   124  N3    ? ? ? 1_555 A  A   128  N1    ? ? A U   125  A A   129  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog174  hydrog ? ? A  U   124  O4    ? ? ? 1_555 A  A   128  N6    ? ? A U   125  A A   129  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog175  hydrog ? ? A  C   129  N3    ? ? ? 1_555 A  A   143  N6    ? ? A C   130  A A   144  1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog176  hydrog ? ? A  C   129  N4    ? ? ? 1_555 A  A   143  N7    ? ? A C   130  A A   144  1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog177  hydrog ? ? A  A   130  N6    ? ? ? 1_555 A  G   146  N7    ? ? A A   131  A G   147  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog178  hydrog ? ? A  A   131  N1    ? ? ? 1_555 A  U   145  N3    ? ? A A   132  A U   146  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog179  hydrog ? ? A  A   131  N6    ? ? ? 1_555 A  U   145  O4    ? ? A A   132  A U   146  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog180  hydrog ? ? A  U   132  N3    ? ? ? 1_555 A  A   144  N1    ? ? A U   133  A A   145  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog181  hydrog ? ? A  U   132  O4    ? ? ? 1_555 A  A   144  N6    ? ? A U   133  A A   145  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog182  hydrog ? ? A  U   133  N3    ? ? ? 1_555 A  A   143  N1    ? ? A U   134  A A   144  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog183  hydrog ? ? A  U   133  O4    ? ? ? 1_555 A  A   143  N6    ? ? A U   134  A A   144  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog184  hydrog ? ? A  G   134  N1    ? ? ? 1_555 A  C   142  N3    ? ? A G   135  A C   143  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog185  hydrog ? ? A  G   134  N2    ? ? ? 1_555 A  C   142  O2    ? ? A G   135  A C   143  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog186  hydrog ? ? A  G   134  O6    ? ? ? 1_555 A  C   142  N4    ? ? A G   135  A C   143  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog187  hydrog ? ? A  C   135  N3    ? ? ? 1_555 A  G   141  N1    ? ? A C   136  A G   142  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog188  hydrog ? ? A  C   135  N4    ? ? ? 1_555 A  G   141  O6    ? ? A C   136  A G   142  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog189  hydrog ? ? A  C   135  O2    ? ? ? 1_555 A  G   141  N2    ? ? A C   136  A G   142  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog190  hydrog ? ? A  U   136  O2    ? ? ? 1_555 A  G   139  N1    ? ? A U   137  A G   140  1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog191  hydrog ? ? A  C   140  O2    ? ? ? 1_555 A  C   142  N4    ? ? A C   141  A C   143  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog192  hydrog ? ? A  C   140  N3    ? ? ? 1_555 A  A   143  N6    ? ? A C   141  A A   144  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog193  hydrog ? ? A  A   151  N1    ? ? ? 1_555 A  G   184  N1    ? ? A A   152  A G   185  1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog194  hydrog ? ? A  A   151  N6    ? ? ? 1_555 A  G   184  O6    ? ? A A   152  A G   185  1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog195  hydrog ? ? A  C   152  N3    ? ? ? 1_555 A  G   183  N1    ? ? A C   153  A G   184  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog196  hydrog ? ? A  C   152  N4    ? ? ? 1_555 A  G   183  O6    ? ? A C   153  A G   184  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog197  hydrog ? ? A  C   152  O2    ? ? ? 1_555 A  G   183  N2    ? ? A C   153  A G   184  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog198  hydrog ? ? A  C   153  N3    ? ? ? 1_555 A  G   181  N1    ? ? A C   154  A G   182  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog199  hydrog ? ? A  C   153  N4    ? ? ? 1_555 A  G   181  O6    ? ? A C   154  A G   182  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog200  hydrog ? ? A  C   153  O2    ? ? ? 1_555 A  G   181  N2    ? ? A C   154  A G   182  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog201  hydrog ? ? A  C   154  N3    ? ? ? 1_555 A  G   180  N1    ? ? A C   155  A G   181  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog202  hydrog ? ? A  C   154  N4    ? ? ? 1_555 A  G   180  O6    ? ? A C   155  A G   181  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog203  hydrog ? ? A  C   154  O2    ? ? ? 1_555 A  G   180  N2    ? ? A C   155  A G   181  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog204  hydrog ? ? A  C   155  N3    ? ? ? 1_555 A  G   179  N1    ? ? A C   156  A G   180  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog205  hydrog ? ? A  C   155  N4    ? ? ? 1_555 A  G   179  O6    ? ? A C   156  A G   180  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog206  hydrog ? ? A  C   155  O2    ? ? ? 1_555 A  G   179  N2    ? ? A C   156  A G   180  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog207  hydrog ? ? A  G   156  N1    ? ? ? 1_555 A  C   178  N3    ? ? A G   157  A C   179  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog208  hydrog ? ? A  G   156  N2    ? ? ? 1_555 A  C   178  O2    ? ? A G   157  A C   179  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog209  hydrog ? ? A  G   156  O6    ? ? ? 1_555 A  C   178  N4    ? ? A G   157  A C   179  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog210  hydrog ? ? A  G   156  N2    ? ? ? 1_555 A  A   1469 N1    ? ? A G   157  A A   1470 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog211  hydrog ? ? A  A   157  N1    ? ? ? 1_555 A  U   177  N3    ? ? A A   158  A U   178  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog212  hydrog ? ? A  A   157  N6    ? ? ? 1_555 A  U   177  O4    ? ? A A   158  A U   178  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog213  hydrog ? ? A  G   158  N2    ? ? ? 1_555 A  A   176  N7    ? ? A G   159  A A   177  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog214  hydrog ? ? A  G   158  N3    ? ? ? 1_555 A  A   176  N6    ? ? A G   159  A A   177  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog215  hydrog ? ? A  G   158  N2    ? ? ? 1_555 A  U   177  O4    ? ? A G   159  A U   178  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog216  hydrog ? ? A  A   159  N6    ? ? ? 1_555 A  U   175  O2    ? ? A A   160  A U   176  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog217  hydrog ? ? A  A   159  N7    ? ? ? 1_555 A  U   175  N3    ? ? A A   160  A U   176  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog218  hydrog ? ? A  A   160  N6    ? ? ? 1_555 A  A   173  N7    ? ? A A   161  A A   174  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog219  hydrog ? ? A  A   160  N7    ? ? ? 1_555 A  A   173  N6    ? ? A A   161  A A   174  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog220  hydrog ? ? A  A   160  N6    ? ? ? 1_555 A  U   175  O2    ? ? A A   161  A U   176  1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog221  hydrog ? ? A  A   160  N3    ? ? ? 1_555 A  G   891  N2    ? ? A A   161  A G   892  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog222  hydrog ? ? A  C   161  N4    ? ? ? 1_555 A  C   172  O2    ? ? A C   162  A C   173  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog223  hydrog ? ? A  C   161  O2    ? ? ? 1_555 A  C   892  N4    ? ? A C   162  A C   893  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog224  hydrog ? ? A  U   162  N3    ? ? ? 1_555 A  U   171  O2    ? ? A U   163  A U   172  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog225  hydrog ? ? A  U   162  O4    ? ? ? 1_555 A  U   171  N3    ? ? A U   163  A U   172  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog226  hydrog ? ? A  G   163  N1    ? ? ? 1_555 A  C   170  N3    ? ? A G   164  A C   171  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog227  hydrog ? ? A  G   163  N2    ? ? ? 1_555 A  C   170  O2    ? ? A G   164  A C   171  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog228  hydrog ? ? A  G   163  O6    ? ? ? 1_555 A  C   170  N4    ? ? A G   164  A C   171  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog229  hydrog ? ? A  G   163  N2    ? ? ? 1_555 A  A   221  N3    ? ? A G   164  A A   222  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog230  hydrog ? ? A  A   164  N3    ? ? ? 1_555 A  G   220  N2    ? ? A A   165  A G   221  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog231  hydrog ? ? A  A   165  N1    ? ? ? 1_555 A  G   923  N2    ? ? A A   166  A G   924  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog232  hydrog ? ? A  A   165  N6    ? ? ? 1_555 A  G   923  N3    ? ? A A   166  A G   924  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog233  hydrog ? ? A  C   167  N3    ? ? ? 1_555 A  G   218  N1    ? ? A C   168  A G   219  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog234  hydrog ? ? A  C   167  N4    ? ? ? 1_555 A  G   218  O6    ? ? A C   168  A G   219  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog235  hydrog ? ? A  C   167  O2    ? ? ? 1_555 A  G   218  N2    ? ? A C   168  A G   219  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog236  hydrog ? ? A  U   169  N3    ? ? ? 1_555 A  G   220  O6    ? ? A U   170  A G   221  1_555 ? ? ? ? ? ? TYPE_27_PAIR ? ? 
hydrog237  hydrog ? ? A  U   169  O4    ? ? ? 1_555 A  G   220  N1    ? ? A U   170  A G   221  1_555 ? ? ? ? ? ? TYPE_27_PAIR ? ? 
hydrog238  hydrog ? ? A  C   170  O2    ? ? ? 1_555 A  G   220  N1    ? ? A C   171  A G   221  1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog239  hydrog ? ? A  G   174  N2    ? ? ? 1_555 A  U   175  O4    ? ? A G   175  A U   176  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog240  hydrog ? ? A  G   184  N2    ? ? ? 1_555 A  A   438  N1    ? ? A G   185  A A   439  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog241  hydrog ? ? A  G   184  N2    ? ? ? 1_555 A  C   439  O2    ? ? A G   185  A C   440  1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog242  hydrog ? ? A  G   189  N2    ? ? ? 1_555 A  A   434  N7    ? ? A G   190  A A   435  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog243  hydrog ? ? A  A   190  N6    ? ? ? 1_555 A  U   433  O2    ? ? A A   191  A U   434  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog244  hydrog ? ? A  A   190  N7    ? ? ? 1_555 A  U   433  N3    ? ? A A   191  A U   434  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog245  hydrog ? ? A  A   191  N6    ? ? ? 1_555 A  G   202  N3    ? ? A A   192  A G   203  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog246  hydrog ? ? A  A   191  N7    ? ? ? 1_555 A  G   202  N2    ? ? A A   192  A G   203  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog247  hydrog ? ? A  A   192  N3    ? ? ? 1_555 A  G   412  N2    ? ? A A   193  A G   413  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog248  hydrog ? ? A  A   193  N1    ? ? ? 1_555 A  U   201  N3    ? ? A A   194  A U   202  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog249  hydrog ? ? A  A   193  N6    ? ? ? 1_555 A  U   201  O4    ? ? A A   194  A U   202  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog250  hydrog ? ? A  C   194  N3    ? ? ? 1_555 A  G   200  N1    ? ? A C   195  A G   201  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog251  hydrog ? ? A  C   194  N4    ? ? ? 1_555 A  G   200  O6    ? ? A C   195  A G   201  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog252  hydrog ? ? A  C   194  O2    ? ? ? 1_555 A  G   200  N2    ? ? A C   195  A G   201  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog253  hydrog ? ? A  C   194  O2    ? ? ? 1_555 A  U   201  N3    ? ? A C   195  A U   202  1_555 ? ? ? ? ? ? 'C-U MISPAIR' ? 
? 
hydrog254  hydrog ? ? A  G   195  N2    ? ? ? 1_555 A  A   198  N7    ? ? A G   196  A A   199  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog255  hydrog ? ? A  G   195  N3    ? ? ? 1_555 A  A   198  N6    ? ? A G   196  A A   199  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog256  hydrog ? ? A  G   195  N1    ? ? ? 1_555 A  U   424  O2    ? ? A G   196  A U   425  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog257  hydrog ? ? A  A   197  N1    ? ? ? 1_555 A  G   415  N2    ? ? A A   198  A G   416  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog258  hydrog ? ? A  A   197  N6    ? ? ? 1_555 A  G   415  N3    ? ? A A   198  A G   416  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog259  hydrog ? ? A  A   203  N1    ? ? ? 1_555 A  A   435  N6    ? ? A A   204  A A   436  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog260  hydrog ? ? A  A   203  N6    ? ? ? 1_555 A  A   435  N1    ? ? A A   204  A A   436  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog261  hydrog ? ? A  U   204  N3    ? ? ? 1_555 A  A   436  N1    ? ? A U   205  A A   437  1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog262  hydrog ? ? A  U   204  O2    ? ? ? 1_555 A  A   436  N6    ? ? A U   205  A A   437  1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog263  hydrog ? ? A  G   205  N1    ? ? ? 1_555 A  U   232  O2    ? ? A G   206  A U   233  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog264  hydrog ? ? A  G   205  O6    ? ? ? 1_555 A  U   232  N3    ? ? A G   206  A U   233  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog265  hydrog ? ? A  U   206  N3    ? ? ? 1_555 A  A   231  N1    ? ? A U   207  A A   232  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog266  hydrog ? ? A  U   206  O4    ? ? ? 1_555 A  A   231  N6    ? ? A U   207  A A   232  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog267  hydrog ? ? A  C   207  N3    ? ? ? 1_555 A  G   230  N1    ? ? A C   208  A G   231  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog268  hydrog ? ? A  C   207  N4    ? ? ? 1_555 A  G   230  O6    ? ? A C   208  A G   231  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog269  hydrog ? ? A  C   207  O2    ? ? ? 1_555 A  G   230  N2    ? ? A C   208  A G   231  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog270  hydrog ? ? A  G   208  N1    ? ? ? 1_555 A  C   229  N3    ? ? A G   209  A C   230  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog271  hydrog ? ? A  G   208  N2    ? ? ? 1_555 A  C   229  O2    ? ? A G   209  A C   230  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog272  hydrog ? ? A  G   208  O6    ? ? ? 1_555 A  C   229  N4    ? ? A G   209  A C   230  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog273  hydrog ? ? A  U   209  N3    ? ? ? 1_555 A  G   228  O6    ? ? A U   210  A G   229  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog274  hydrog ? ? A  U   209  O2    ? ? ? 1_555 A  G   228  N1    ? ? A U   210  A G   229  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog275  hydrog ? ? A  U   210  O2    ? ? ? 1_555 A  C   227  N4    ? ? A U   211  A C   228  1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog276  hydrog ? ? A  A   211  N6    ? ? ? 1_555 A  A   226  N7    ? ? A A   212  A A   227  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog277  hydrog ? ? A  A   211  N7    ? ? ? 1_555 A  A   226  N6    ? ? A A   212  A A   227  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog278  hydrog ? ? A  G   212  N2    ? ? ? 1_555 A  U   213  O4    ? ? A G   213  A U   214  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog279  hydrog ? ? A  U   213  N3    ? ? ? 1_555 A  A   225  N7    ? ? A U   214  A A   226  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog280  hydrog ? ? A  U   213  O2    ? ? ? 1_555 A  A   225  N6    ? ? A U   214  A A   226  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog281  hydrog ? ? A  A   214  N6    ? ? ? 1_555 A  G   224  N3    ? ? A A   215  A G   225  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog282  hydrog ? ? A  A   214  N7    ? ? ? 1_555 A  G   224  N2    ? ? A A   215  A G   225  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog283  hydrog ? ? A  A   215  N1    ? ? ? 1_555 A  U   223  N3    ? ? A A   216  A U   224  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog284  hydrog ? ? A  A   215  N6    ? ? ? 1_555 A  U   223  O4    ? ? A A   216  A U   224  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog285  hydrog ? ? A  C   216  N3    ? ? ? 1_555 A  G   222  N1    ? ? A C   217  A G   223  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog286  hydrog ? ? A  C   216  N4    ? ? ? 1_555 A  G   222  O6    ? ? A C   217  A G   223  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog287  hydrog ? ? A  C   216  O2    ? ? ? 1_555 A  G   222  N2    ? ? A C   217  A G   223  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog288  hydrog ? ? A  C   217  O2    ? ? ? 1_555 A  A   221  N6    ? ? A C   218  A A   222  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog289  hydrog ? ? A  G   230  N2    ? ? ? 1_555 A  A   665  N3    ? ? A G   231  A A   666  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog290  hydrog ? ? A  G   236  N1    ? ? ? 1_555 A  C   432  N3    ? ? A G   237  A C   433  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog291  hydrog ? ? A  G   236  N2    ? ? ? 1_555 A  C   432  O2    ? ? A G   237  A C   433  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog292  hydrog ? ? A  G   236  O6    ? ? ? 1_555 A  C   432  N4    ? ? A G   237  A C   433  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog293  hydrog ? ? A  C   237  N3    ? ? ? 1_555 A  G   431  N1    ? ? A C   238  A G   432  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog294  hydrog ? ? A  C   237  N4    ? ? ? 1_555 A  G   431  O6    ? ? A C   238  A G   432  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog295  hydrog ? ? A  C   237  O2    ? ? ? 1_555 A  G   431  N2    ? ? A C   238  A G   432  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog296  hydrog ? ? A  C   238  N3    ? ? ? 1_555 A  G   430  N1    ? ? A C   239  A G   431  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog297  hydrog ? ? A  C   238  N4    ? ? ? 1_555 A  G   430  O6    ? ? A C   239  A G   431  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog298  hydrog ? ? A  C   238  O2    ? ? ? 1_555 A  G   430  N2    ? ? A C   239  A G   431  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog299  hydrog ? ? A  C   239  N3    ? ? ? 1_555 A  G   378  N1    ? ? A C   240  A G   379  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog300  hydrog ? ? A  C   239  N4    ? ? ? 1_555 A  G   378  O6    ? ? A C   240  A G   379  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog301  hydrog ? ? A  C   239  O2    ? ? ? 1_555 A  G   378  N2    ? ? A C   240  A G   379  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog302  hydrog ? ? A  A   240  N6    ? ? ? 1_555 A  U   269  O2    ? ? A A   241  A U   270  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog303  hydrog ? ? A  A   240  N7    ? ? ? 1_555 A  U   269  N3    ? ? A A   241  A U   270  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog304  hydrog ? ? A  A   241  N6    ? ? ? 1_555 A  G   268  N3    ? ? A A   242  A G   269  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog305  hydrog ? ? A  A   241  N7    ? ? ? 1_555 A  G   268  N2    ? ? A A   242  A G   269  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog306  hydrog ? ? A  A   242  N6    ? ? ? 1_555 A  U   267  O2    ? ? A A   243  A U   268  1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog307  hydrog ? ? A  A   242  N3    ? ? ? 1_555 A  G   273  N2    ? ? A A   243  A G   274  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog308  hydrog ? ? A  C   243  N3    ? ? ? 1_555 A  G   266  N1    ? ? A C   244  A G   267  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog309  hydrog ? ? A  C   243  N4    ? ? ? 1_555 A  G   266  O6    ? ? A C   244  A G   267  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog310  hydrog ? ? A  C   243  O2    ? ? ? 1_555 A  G   266  N2    ? ? A C   244  A G   267  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog311  hydrog ? ? A  C   244  N3    ? ? ? 1_555 A  G   265  N1    ? ? A C   245  A G   266  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog312  hydrog ? ? A  C   244  N4    ? ? ? 1_555 A  G   265  O6    ? ? A C   245  A G   266  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog313  hydrog ? ? A  C   244  O2    ? ? ? 1_555 A  G   265  N2    ? ? A C   245  A G   266  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog314  hydrog ? ? A  G   245  N2    ? ? ? 1_555 A  U   264  O4    ? ? A G   246  A U   265  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog315  hydrog ? ? A  A   246  N6    ? ? ? 1_555 A  G   263  N3    ? ? A A   247  A G   264  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog316  hydrog ? ? A  A   246  N7    ? ? ? 1_555 A  G   263  N2    ? ? A A   247  A G   264  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog317  hydrog ? ? A  A   247  N1    ? ? ? 1_555 A  U   264  N3    ? ? A A   248  A U   265  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog318  hydrog ? ? A  A   247  N6    ? ? ? 1_555 A  U   264  O4    ? ? A A   248  A U   265  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog319  hydrog ? ? A  G   248  N1    ? ? ? 1_555 A  C   259  N3    ? ? A G   249  A C   260  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog320  hydrog ? ? A  G   248  N2    ? ? ? 1_555 A  C   259  O2    ? ? A G   249  A C   260  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog321  hydrog ? ? A  G   248  O6    ? ? ? 1_555 A  C   259  N4    ? ? A G   249  A C   260  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog322  hydrog ? ? A  C   249  N3    ? ? ? 1_555 A  G   258  N1    ? ? A C   250  A G   259  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog323  hydrog ? ? A  C   249  N4    ? ? ? 1_555 A  G   258  O6    ? ? A C   250  A G   259  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog324  hydrog ? ? A  C   249  O2    ? ? ? 1_555 A  G   258  N2    ? ? A C   250  A G   259  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog325  hydrog ? ? A  C   250  N3    ? ? ? 1_555 A  G   257  N1    ? ? A C   251  A G   258  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog326  hydrog ? ? A  C   250  N4    ? ? ? 1_555 A  G   257  O6    ? ? A C   251  A G   258  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog327  hydrog ? ? A  C   250  O2    ? ? ? 1_555 A  G   257  N2    ? ? A C   251  A G   258  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog328  hydrog ? ? A  C   251  N3    ? ? ? 1_555 A  G   256  N1    ? ? A C   252  A G   257  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog329  hydrog ? ? A  C   251  N4    ? ? ? 1_555 A  G   256  O6    ? ? A C   252  A G   257  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog330  hydrog ? ? A  C   251  O2    ? ? ? 1_555 A  G   256  N2    ? ? A C   252  A G   257  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog331  hydrog ? ? A  U   252  O2    ? ? ? 1_555 A  C   255  N4    ? ? A U   253  A C   256  1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog332  hydrog ? ? A  C   270  N4    ? ? ? 1_555 A  A   377  N1    ? ? A C   271  A A   378  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog333  hydrog ? ? A  G   272  N1    ? ? ? 1_555 A  C   376  N3    ? ? A G   273  A C   377  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog334  hydrog ? ? A  G   272  N2    ? ? ? 1_555 A  C   376  O2    ? ? A G   273  A C   377  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog335  hydrog ? ? A  G   272  O6    ? ? ? 1_555 A  C   376  N4    ? ? A G   273  A C   377  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog336  hydrog ? ? A  G   273  N1    ? ? ? 1_555 A  C   375  N3    ? ? A G   274  A C   376  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog337  hydrog ? ? A  G   273  N2    ? ? ? 1_555 A  C   375  O2    ? ? A G   274  A C   376  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog338  hydrog ? ? A  G   273  O6    ? ? ? 1_555 A  C   375  N4    ? ? A G   274  A C   376  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog339  hydrog ? ? A  G   274  N1    ? ? ? 1_555 A  U   373  O2    ? ? A G   275  A U   374  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog340  hydrog ? ? A  G   274  O6    ? ? ? 1_555 A  U   373  N3    ? ? A G   275  A U   374  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog341  hydrog ? ? A  C   275  N3    ? ? ? 1_555 A  G   372  N1    ? ? A C   276  A G   373  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog342  hydrog ? ? A  C   275  N4    ? ? ? 1_555 A  G   372  O6    ? ? A C   276  A G   373  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog343  hydrog ? ? A  C   275  O2    ? ? ? 1_555 A  G   372  N2    ? ? A C   276  A G   373  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog344  hydrog ? ? A  U   276  N3    ? ? ? 1_555 A  A   371  N1    ? ? A U   277  A A   372  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog345  hydrog ? ? A  U   276  O4    ? ? ? 1_555 A  A   371  N6    ? ? A U   277  A A   372  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog346  hydrog ? ? A  A   277  N1    ? ? ? 1_555 A  U   370  N3    ? ? A A   278  A U   371  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog347  hydrog ? ? A  A   277  N6    ? ? ? 1_555 A  U   370  O4    ? ? A A   278  A U   371  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog348  hydrog ? ? A  C   278  N3    ? ? ? 1_555 A  G   369  N1    ? ? A C   279  A G   370  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog349  hydrog ? ? A  C   278  N4    ? ? ? 1_555 A  G   369  O6    ? ? A C   279  A G   370  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog350  hydrog ? ? A  C   278  O2    ? ? ? 1_555 A  G   369  N2    ? ? A C   279  A G   370  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog351  hydrog ? ? A  C   279  N3    ? ? ? 1_555 A  G   368  N1    ? ? A C   280  A G   369  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog352  hydrog ? ? A  C   279  N4    ? ? ? 1_555 A  G   368  O6    ? ? A C   280  A G   369  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog353  hydrog ? ? A  C   279  O2    ? ? ? 1_555 A  G   368  N2    ? ? A C   280  A G   369  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog354  hydrog ? ? A  U   280  O2    ? ? ? 1_555 A  C   367  N4    ? ? A U   281  A C   368  1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog355  hydrog ? ? A  C   281  O2    ? ? ? 1_555 A  C   367  N4    ? ? A C   282  A C   368  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog356  hydrog ? ? A  A   284  N6    ? ? ? 1_555 A  U   365  O2    ? ? A A   285  A U   366  1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog357  hydrog ? ? A  A   284  N6    ? ? ? 1_555 A  G   366  N3    ? ? A A   285  A G   367  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog358  hydrog ? ? A  U   285  N3    ? ? ? 1_555 A  U   365  O2    ? ? A U   286  A U   366  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog359  hydrog ? ? A  U   285  O4    ? ? ? 1_555 A  U   365  N3    ? ? A U   286  A U   366  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog360  hydrog ? ? A  C   286  N3    ? ? ? 1_555 A  G   364  N1    ? ? A C   287  A G   365  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog361  hydrog ? ? A  C   286  N4    ? ? ? 1_555 A  G   364  O6    ? ? A C   287  A G   365  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog362  hydrog ? ? A  C   286  O2    ? ? ? 1_555 A  G   364  N2    ? ? A C   287  A G   365  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog363  hydrog ? ? A  G   288  N1    ? ? ? 1_555 A  A   362  N1    ? ? A G   289  A A   363  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog364  hydrog ? ? A  C   289  N3    ? ? ? 1_555 A  G   361  N1    ? ? A C   290  A G   362  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog365  hydrog ? ? A  C   289  N4    ? ? ? 1_555 A  G   361  O6    ? ? A C   290  A G   362  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog366  hydrog ? ? A  C   289  O2    ? ? ? 1_555 A  G   361  N2    ? ? A C   290  A G   362  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog367  hydrog ? ? A  C   290  N3    ? ? ? 1_555 A  C   360  N4    ? ? A C   291  A C   361  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog368  hydrog ? ? A  G   291  N2    ? ? ? 1_555 A  A   359  N7    ? ? A G   292  A A   360  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog369  hydrog ? ? A  G   291  N3    ? ? ? 1_555 A  A   359  N6    ? ? A G   292  A A   360  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog370  hydrog ? ? A  A   292  N6    ? ? ? 1_555 A  U   358  O2    ? ? A A   293  A U   359  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog371  hydrog ? ? A  A   292  N7    ? ? ? 1_555 A  U   358  N3    ? ? A A   293  A U   359  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog372  hydrog ? ? A  C   294  N4    ? ? ? 1_555 A  C   355  O2    ? ? A C   295  A C   356  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog373  hydrog ? ? A  G   295  N1    ? ? ? 1_555 A  C   354  N3    ? ? A G   296  A C   355  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog374  hydrog ? ? A  G   295  N2    ? ? ? 1_555 A  C   354  O2    ? ? A G   296  A C   355  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog375  hydrog ? ? A  G   295  O6    ? ? ? 1_555 A  C   354  N4    ? ? A G   296  A C   355  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog376  hydrog ? ? A  U   296  N3    ? ? ? 1_555 A  A   353  N1    ? ? A U   297  A A   354  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog377  hydrog ? ? A  U   296  O4    ? ? ? 1_555 A  A   353  N6    ? ? A U   297  A A   354  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog378  hydrog ? ? A  C   297  N3    ? ? ? 1_555 A  G   352  N1    ? ? A C   298  A G   353  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog379  hydrog ? ? A  C   297  N4    ? ? ? 1_555 A  G   352  O6    ? ? A C   298  A G   353  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog380  hydrog ? ? A  C   297  O2    ? ? ? 1_555 A  G   352  N2    ? ? A C   298  A G   353  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog381  hydrog ? ? A  U   298  N3    ? ? ? 1_555 A  A   351  N1    ? ? A U   299  A A   352  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog382  hydrog ? ? A  U   298  O4    ? ? ? 1_555 A  A   351  N6    ? ? A U   299  A A   352  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog383  hydrog ? ? A  C   299  N3    ? ? ? 1_555 A  G   350  N1    ? ? A C   300  A G   351  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog384  hydrog ? ? A  C   299  N4    ? ? ? 1_555 A  G   350  O6    ? ? A C   300  A G   351  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog385  hydrog ? ? A  C   299  O2    ? ? ? 1_555 A  G   350  N2    ? ? A C   300  A G   351  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog386  hydrog ? ? A  G   300  N1    ? ? ? 1_555 A  C   349  N3    ? ? A G   301  A C   350  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog387  hydrog ? ? A  G   300  N2    ? ? ? 1_555 A  C   349  O2    ? ? A G   301  A C   350  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog388  hydrog ? ? A  G   300  O6    ? ? ? 1_555 A  C   349  N4    ? ? A G   301  A C   350  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog389  hydrog ? ? A  A   301  N1    ? ? ? 1_555 A  U   348  N3    ? ? A A   302  A U   349  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog390  hydrog ? ? A  A   301  N6    ? ? ? 1_555 A  U   348  O4    ? ? A A   302  A U   349  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog391  hydrog ? ? A  C   302  N3    ? ? ? 1_555 A  C   347  N4    ? ? A C   303  A C   348  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog392  hydrog ? ? A  G   303  N2    ? ? ? 1_555 A  A   346  N7    ? ? A G   304  A A   347  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog393  hydrog ? ? A  G   303  N3    ? ? ? 1_555 A  A   346  N6    ? ? A G   304  A A   347  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog394  hydrog ? ? A  A   304  N6    ? ? ? 1_555 A  G   344  O6    ? ? A A   305  A G   345  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog395  hydrog ? ? A  A   305  N6    ? ? ? 1_555 A  G   344  O6    ? ? A A   306  A G   345  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog396  hydrog ? ? A  G   306  N1    ? ? ? 1_555 A  C   322  N3    ? ? A G   307  A C   323  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog397  hydrog ? ? A  G   306  N2    ? ? ? 1_555 A  C   322  O2    ? ? A G   307  A C   323  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog398  hydrog ? ? A  G   306  O6    ? ? ? 1_555 A  C   322  N4    ? ? A G   307  A C   323  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog399  hydrog ? ? A  U   307  N3    ? ? ? 1_555 A  A   338  N1    ? ? A U   308  A A   339  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog400  hydrog ? ? A  U   307  O4    ? ? ? 1_555 A  A   338  N6    ? ? A U   308  A A   339  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog401  hydrog ? ? A  C   308  N3    ? ? ? 1_555 A  G   321  N1    ? ? A C   309  A G   322  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog402  hydrog ? ? A  C   308  N4    ? ? ? 1_555 A  G   321  O6    ? ? A C   309  A G   322  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog403  hydrog ? ? A  C   308  O2    ? ? ? 1_555 A  G   321  N2    ? ? A C   309  A G   322  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog404  hydrog ? ? A  U   309  N3    ? ? ? 1_555 A  A   320  N1    ? ? A U   310  A A   321  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog405  hydrog ? ? A  U   309  O4    ? ? ? 1_555 A  A   320  N6    ? ? A U   310  A A   321  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog406  hydrog ? ? A  C   310  N3    ? ? ? 1_555 A  G   319  N1    ? ? A C   311  A G   320  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog407  hydrog ? ? A  C   310  N4    ? ? ? 1_555 A  G   319  O6    ? ? A C   311  A G   320  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog408  hydrog ? ? A  C   310  O2    ? ? ? 1_555 A  G   319  N2    ? ? A C   311  A G   320  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog409  hydrog ? ? A  U   311  N3    ? ? ? 1_555 A  A   318  N1    ? ? A U   312  A A   319  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog410  hydrog ? ? A  U   311  O4    ? ? ? 1_555 A  A   318  N6    ? ? A U   312  A A   319  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog411  hydrog ? ? A  U   312  N3    ? ? ? 1_555 A  A   316  N7    ? ? A U   313  A A   317  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog412  hydrog ? ? A  U   312  O2    ? ? ? 1_555 A  A   316  N6    ? ? A U   313  A A   317  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog413  hydrog ? ? A  G   313  N2    ? ? ? 1_555 A  A   336  N1    ? ? A G   314  A A   337  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog414  hydrog ? ? A  G   313  N3    ? ? ? 1_555 A  A   336  N6    ? ? A G   314  A A   337  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog415  hydrog ? ? A  G   314  N2    ? ? ? 1_555 A  G   335  N3    ? ? A G   315  A G   336  1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog416  hydrog ? ? A  G   314  N3    ? ? ? 1_555 A  G   335  N2    ? ? A G   315  A G   336  1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog417  hydrog ? ? A  A   315  N6    ? ? ? 1_555 A  U   1313 O2    ? ? A A   316  A U   1314 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog418  hydrog ? ? A  G   323  N1    ? ? ? 1_555 A  C   340  N3    ? ? A G   324  A C   341  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog419  hydrog ? ? A  G   323  N2    ? ? ? 1_555 A  C   340  O2    ? ? A G   324  A C   341  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog420  hydrog ? ? A  G   323  O6    ? ? ? 1_555 A  C   340  N4    ? ? A G   324  A C   341  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog421  hydrog ? ? A  U   324  N3    ? ? ? 1_555 A  A   339  N1    ? ? A U   325  A A   340  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog422  hydrog ? ? A  U   324  O4    ? ? ? 1_555 A  A   339  N6    ? ? A U   325  A A   340  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog423  hydrog ? ? A  G   325  N1    ? ? ? 1_555 A  C   329  N3    ? ? A G   326  A C   330  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog424  hydrog ? ? A  G   325  N2    ? ? ? 1_555 A  C   329  O2    ? ? A G   326  A C   330  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog425  hydrog ? ? A  G   325  O6    ? ? ? 1_555 A  C   329  N4    ? ? A G   326  A C   330  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog426  hydrog ? ? A  A   328  N3    ? ? ? 1_555 A  U   345  N3    ? ? A A   329  A U   346  1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog427  hydrog ? ? A  A   330  N6    ? ? ? 1_555 A  G   344  N3    ? ? A A   331  A G   345  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog428  hydrog ? ? A  A   330  N7    ? ? ? 1_555 A  G   344  N2    ? ? A A   331  A G   345  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog429  hydrog ? ? A  G   331  N1    ? ? ? 1_555 A  C   343  N3    ? ? A G   332  A C   344  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog430  hydrog ? ? A  G   331  N2    ? ? ? 1_555 A  C   343  O2    ? ? A G   332  A C   344  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog431  hydrog ? ? A  G   331  O6    ? ? ? 1_555 A  C   343  N4    ? ? A G   332  A C   344  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog432  hydrog ? ? A  G   332  N1    ? ? ? 1_555 A  C   342  N3    ? ? A G   333  A C   343  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog433  hydrog ? ? A  G   332  N2    ? ? ? 1_555 A  C   342  O2    ? ? A G   333  A C   343  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog434  hydrog ? ? A  G   332  O6    ? ? ? 1_555 A  C   342  N4    ? ? A G   333  A C   343  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog435  hydrog ? ? A  G   333  N1    ? ? ? 1_555 A  C   341  N3    ? ? A G   334  A C   342  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog436  hydrog ? ? A  G   333  N2    ? ? ? 1_555 A  C   341  O2    ? ? A G   334  A C   342  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog437  hydrog ? ? A  G   333  O6    ? ? ? 1_555 A  C   341  N4    ? ? A G   334  A C   342  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog438  hydrog ? ? A  U   334  N3    ? ? ? 1_555 A  A   338  N7    ? ? A U   335  A A   339  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog439  hydrog ? ? A  U   334  O2    ? ? ? 1_555 A  A   338  N6    ? ? A U   335  A A   339  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog440  hydrog ? ? A  G   357  N2    ? ? ? 1_555 A  U   358  O4    ? ? A G   358  A U   359  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog441  hydrog ? ? A  A   379  N6    ? ? ? 1_555 A  A   407  N7    ? ? A A   380  A A   408  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog442  hydrog ? ? A  A   379  N7    ? ? ? 1_555 A  A   407  N6    ? ? A A   380  A A   408  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog443  hydrog ? ? A  G   380  N2    ? ? ? 1_555 A  U   381  O4    ? ? A G   381  A U   382  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog444  hydrog ? ? A  U   381  N3    ? ? ? 1_555 A  A   406  N7    ? ? A U   382  A A   407  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog445  hydrog ? ? A  U   381  O2    ? ? ? 1_555 A  A   406  N6    ? ? A U   382  A A   407  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog446  hydrog ? ? A  A   382  N6    ? ? ? 1_555 A  G   405  N3    ? ? A A   383  A G   406  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog447  hydrog ? ? A  A   382  N7    ? ? ? 1_555 A  G   405  N2    ? ? A A   383  A G   406  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog448  hydrog ? ? A  G   383  N1    ? ? ? 1_555 A  C   404  N3    ? ? A G   384  A C   405  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog449  hydrog ? ? A  G   383  N2    ? ? ? 1_555 A  C   404  O2    ? ? A G   384  A C   405  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog450  hydrog ? ? A  G   383  O6    ? ? ? 1_555 A  C   404  N4    ? ? A G   384  A C   405  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog451  hydrog ? ? A  C   384  N3    ? ? ? 1_555 A  G   403  N1    ? ? A C   385  A G   404  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog452  hydrog ? ? A  C   384  N4    ? ? ? 1_555 A  G   403  O6    ? ? A C   385  A G   404  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog453  hydrog ? ? A  C   384  O2    ? ? ? 1_555 A  G   403  N2    ? ? A C   385  A G   404  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog454  hydrog ? ? A  G   385  N1    ? ? ? 1_555 A  C   402  N3    ? ? A G   386  A C   403  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog455  hydrog ? ? A  G   385  N2    ? ? ? 1_555 A  C   402  O2    ? ? A G   386  A C   403  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog456  hydrog ? ? A  G   385  O6    ? ? ? 1_555 A  C   402  N4    ? ? A G   386  A C   403  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog457  hydrog ? ? A  G   386  N1    ? ? ? 1_555 A  U   401  O2    ? ? A G   387  A U   402  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog458  hydrog ? ? A  G   386  O6    ? ? ? 1_555 A  U   401  N3    ? ? A G   387  A U   402  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog459  hydrog ? ? A  G   387  N1    ? ? ? 1_555 A  C   400  N3    ? ? A G   388  A C   401  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog460  hydrog ? ? A  G   387  N2    ? ? ? 1_555 A  C   400  O2    ? ? A G   388  A C   401  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog461  hydrog ? ? A  G   387  O6    ? ? ? 1_555 A  C   400  N4    ? ? A G   388  A C   401  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog462  hydrog ? ? A  G   388  N1    ? ? ? 1_555 A  C   399  N3    ? ? A G   389  A C   400  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog463  hydrog ? ? A  G   388  N2    ? ? ? 1_555 A  C   399  O2    ? ? A G   389  A C   400  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog464  hydrog ? ? A  G   388  O6    ? ? ? 1_555 A  C   399  N4    ? ? A G   389  A C   400  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog465  hydrog ? ? A  G   389  N1    ? ? ? 1_555 A  C   398  N3    ? ? A G   390  A C   399  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog466  hydrog ? ? A  G   389  N2    ? ? ? 1_555 A  C   398  O2    ? ? A G   390  A C   399  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog467  hydrog ? ? A  G   389  O6    ? ? ? 1_555 A  C   398  N4    ? ? A G   390  A C   399  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog468  hydrog ? ? A  U   390  N3    ? ? ? 1_555 A  U   397  O4    ? ? A U   391  A U   398  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog469  hydrog ? ? A  U   390  O2    ? ? ? 1_555 A  U   397  N3    ? ? A U   391  A U   398  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog470  hydrog ? ? A  G   393  N3    ? ? ? 1_555 A  G   416  N2    ? ? A G   394  A G   417  1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog471  hydrog ? ? A  A   394  N1    ? ? ? 1_555 A  C   2442 N4    ? ? A A   395  A C   2443 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog472  hydrog ? ? A  U   395  O4    ? ? ? 1_555 A  G   2441 N2    ? ? A U   396  A G   2442 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog473  hydrog ? ? A  A   406  N6    ? ? ? 1_555 A  A   428  N1    ? ? A A   407  A A   429  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog474  hydrog ? ? A  A   407  N1    ? ? ? 1_555 A  A   428  N6    ? ? A A   408  A A   429  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog475  hydrog ? ? A  A   407  N6    ? ? ? 1_555 A  A   429  N1    ? ? A A   408  A A   430  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog476  hydrog ? ? A  C   411  N3    ? ? ? 1_555 A  G   427  N1    ? ? A C   412  A G   428  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog477  hydrog ? ? A  C   411  N4    ? ? ? 1_555 A  G   427  O6    ? ? A C   412  A G   428  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog478  hydrog ? ? A  C   411  O2    ? ? ? 1_555 A  G   427  N2    ? ? A C   412  A G   428  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog479  hydrog ? ? A  G   412  N1    ? ? ? 1_555 A  C   426  N3    ? ? A G   413  A C   427  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog480  hydrog ? ? A  G   412  N2    ? ? ? 1_555 A  C   426  O2    ? ? A G   413  A C   427  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog481  hydrog ? ? A  G   412  O6    ? ? ? 1_555 A  C   426  N4    ? ? A G   413  A C   427  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog482  hydrog ? ? A  C   413  N3    ? ? ? 1_555 A  G   425  N1    ? ? A C   414  A G   426  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog483  hydrog ? ? A  C   413  N4    ? ? ? 1_555 A  G   425  O6    ? ? A C   414  A G   426  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog484  hydrog ? ? A  C   413  O2    ? ? ? 1_555 A  G   425  N2    ? ? A C   414  A G   426  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog485  hydrog ? ? A  A   414  N1    ? ? ? 1_555 A  U   424  N3    ? ? A A   415  A U   425  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog486  hydrog ? ? A  A   414  N6    ? ? ? 1_555 A  U   424  O4    ? ? A A   415  A U   425  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog487  hydrog ? ? A  G   415  N1    ? ? ? 1_555 A  C   423  N3    ? ? A G   416  A C   424  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog488  hydrog ? ? A  G   415  N2    ? ? ? 1_555 A  C   423  O2    ? ? A G   416  A C   424  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog489  hydrog ? ? A  G   415  O6    ? ? ? 1_555 A  C   423  N4    ? ? A G   416  A C   424  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog490  hydrog ? ? A  C   417  N3    ? ? ? 1_555 A  G   2448 N1    ? ? A C   418  A G   2449 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog491  hydrog ? ? A  C   417  N4    ? ? ? 1_555 A  G   2448 O6    ? ? A C   418  A G   2449 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog492  hydrog ? ? A  C   417  O2    ? ? ? 1_555 A  G   2448 N2    ? ? A C   418  A G   2449 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog493  hydrog ? ? A  A   418  N3    ? ? ? 1_555 A  C   1919 N4    ? ? A A   419  A C   1920 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog494  hydrog ? ? A  A   418  N1    ? ? ? 1_555 A  U   2447 N3    ? ? A A   419  A U   2448 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog495  hydrog ? ? A  A   418  N6    ? ? ? 1_555 A  U   2447 O4    ? ? A A   419  A U   2448 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog496  hydrog ? ? A  U   419  N3    ? ? ? 1_555 A  A   2446 N1    ? ? A U   420  A A   2447 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog497  hydrog ? ? A  U   419  O4    ? ? ? 1_555 A  A   2446 N6    ? ? A U   420  A A   2447 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog498  hydrog ? ? A  C   420  N3    ? ? ? 1_555 A  G   2445 N1    ? ? A C   421  A G   2446 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog499  hydrog ? ? A  C   420  N4    ? ? ? 1_555 A  G   2445 O6    ? ? A C   421  A G   2446 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog500  hydrog ? ? A  C   420  O2    ? ? ? 1_555 A  G   2445 N2    ? ? A C   421  A G   2446 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog501  hydrog ? ? A  G   421  N1    ? ? ? 1_555 A  U   2444 O2    ? ? A G   422  A U   2445 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog502  hydrog ? ? A  G   421  O6    ? ? ? 1_555 A  U   2444 N3    ? ? A G   422  A U   2445 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog503  hydrog ? ? A  A   422  N1    ? ? ? 1_555 A  U   2443 N3    ? ? A A   423  A U   2444 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog504  hydrog ? ? A  A   422  N6    ? ? ? 1_555 A  U   2443 O4    ? ? A A   423  A U   2444 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog505  hydrog ? ? A  A   440  N3    ? ? ? 1_555 A  A   441  N6    ? ? A A   441  A A   442  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog506  hydrog ? ? A  A   448  N3    ? ? ? 1_555 A  G   1348 N2    ? ? A A   449  A G   1349 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog507  hydrog ? ? A  G   451  N2    ? ? ? 1_555 A  A   459  N1    ? ? A G   452  A A   460  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog508  hydrog ? ? A  U   453  N3    ? ? ? 1_555 A  U   1361 O2    ? ? A U   454  A U   1362 1_555 ? ? ? ? ? ? 'U-U MISPAIR' ? 
? 
hydrog509  hydrog ? ? A  A   454  N1    ? ? ? 1_555 A  A   459  N6    ? ? A A   455  A A   460  1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
hydrog510  hydrog ? ? A  A   454  N6    ? ? ? 1_555 A  A   459  N7    ? ? A A   455  A A   460  1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
hydrog511  hydrog ? ? A  G   457  N2    ? ? ? 1_555 A  A   462  N3    ? ? A G   458  A A   463  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog512  hydrog ? ? A  A   462  N6    ? ? ? 1_555 A  A   476  N7    ? ? A A   463  A A   477  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog513  hydrog ? ? A  A   462  N7    ? ? ? 1_555 A  A   476  N6    ? ? A A   463  A A   477  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog514  hydrog ? ? A  A   462  N7    ? ? ? 1_555 A  C   477  N4    ? ? A A   463  A C   478  1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog515  hydrog ? ? A  G   463  N2    ? ? ? 1_555 A  U   464  O4    ? ? A G   464  A U   465  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog516  hydrog ? ? A  U   464  N3    ? ? ? 1_555 A  A   475  N7    ? ? A U   465  A A   476  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog517  hydrog ? ? A  U   464  O2    ? ? ? 1_555 A  A   475  N6    ? ? A U   465  A A   476  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog518  hydrog ? ? A  A   465  N6    ? ? ? 1_555 A  G   474  N3    ? ? A A   466  A G   475  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog519  hydrog ? ? A  A   465  N7    ? ? ? 1_555 A  G   474  N2    ? ? A A   466  A G   475  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog520  hydrog ? ? A  G   466  N1    ? ? ? 1_555 A  C   473  N3    ? ? A G   467  A C   474  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog521  hydrog ? ? A  G   466  N2    ? ? ? 1_555 A  C   473  O2    ? ? A G   467  A C   474  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog522  hydrog ? ? A  G   466  O6    ? ? ? 1_555 A  C   473  N4    ? ? A G   467  A C   474  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog523  hydrog ? ? A  U   467  N3    ? ? ? 1_555 A  A   472  N1    ? ? A U   468  A A   473  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog524  hydrog ? ? A  U   467  O4    ? ? ? 1_555 A  A   472  N6    ? ? A U   468  A A   473  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog525  hydrog ? ? A  G   468  N2    ? ? ? 1_555 A  A   471  N7    ? ? A G   469  A A   472  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog526  hydrog ? ? A  G   470  N2    ? ? ? 1_555 A  C   773  O2    ? ? A G   471  A C   774  1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog527  hydrog ? ? A  U   480  N3    ? ? ? 1_555 A  A   484  N7    ? ? A U   481  A A   485  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog528  hydrog ? ? A  U   480  O2    ? ? ? 1_555 A  A   484  N6    ? ? A U   481  A A   485  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog529  hydrog ? ? A  G   481  N2    ? ? ? 1_555 A  A   485  N7    ? ? A G   482  A A   486  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog530  hydrog ? ? A  A   484  N1    ? ? ? 1_555 A  A   508  N6    ? ? A A   485  A A   509  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog531  hydrog ? ? A  A   484  N6    ? ? ? 1_555 A  A   508  N1    ? ? A A   485  A A   509  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog532  hydrog ? ? A  A   485  N1    ? ? ? 1_555 A  A   510  N6    ? ? A A   486  A A   511  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog533  hydrog ? ? A  A   485  N6    ? ? ? 1_555 A  A   510  N1    ? ? A A   486  A A   511  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog534  hydrog ? ? A  G   486  N2    ? ? ? 1_555 A  G   511  N3    ? ? A G   487  A G   512  1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog535  hydrog ? ? A  G   486  N3    ? ? ? 1_555 A  G   511  N2    ? ? A G   487  A G   512  1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog536  hydrog ? ? A  G   486  N1    ? ? ? 1_555 A  C   514  N3    ? ? A G   487  A C   515  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog537  hydrog ? ? A  G   486  N2    ? ? ? 1_555 A  C   514  O2    ? ? A G   487  A C   515  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog538  hydrog ? ? A  G   486  O6    ? ? ? 1_555 A  C   514  N4    ? ? A G   487  A C   515  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog539  hydrog ? ? A  U   487  O2    ? ? ? 1_555 A  G   502  N1    ? ? A U   488  A G   503  1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog540  hydrog ? ? A  A   488  N6    ? ? ? 1_555 A  G   502  N3    ? ? A A   489  A G   503  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog541  hydrog ? ? A  A   488  N7    ? ? ? 1_555 A  G   502  N2    ? ? A A   489  A G   503  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog542  hydrog ? ? A  C   489  N4    ? ? ? 1_555 A  A   501  N1    ? ? A C   490  A A   502  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog543  hydrog ? ? A  C   490  N3    ? ? ? 1_555 A  G   500  N1    ? ? A C   491  A G   501  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog544  hydrog ? ? A  C   490  N4    ? ? ? 1_555 A  G   500  O6    ? ? A C   491  A G   501  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog545  hydrog ? ? A  C   490  O2    ? ? ? 1_555 A  G   500  N2    ? ? A C   491  A G   501  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog546  hydrog ? ? A  C   490  N4    ? ? ? 1_555 A  A   501  N1    ? ? A C   491  A A   502  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog547  hydrog ? ? A  C   491  N3    ? ? ? 1_555 A  G   499  N1    ? ? A C   492  A G   500  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog548  hydrog ? ? A  C   491  N4    ? ? ? 1_555 A  G   499  O6    ? ? A C   492  A G   500  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog549  hydrog ? ? A  C   491  O2    ? ? ? 1_555 A  G   499  N2    ? ? A C   492  A G   500  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog550  hydrog ? ? A  U   492  N3    ? ? ? 1_555 A  G   498  O6    ? ? A U   493  A G   499  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog551  hydrog ? ? A  U   492  O2    ? ? ? 1_555 A  G   498  N1    ? ? A U   493  A G   499  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog552  hydrog ? ? A  C   493  O2    ? ? ? 1_555 A  A   497  N6    ? ? A C   494  A A   498  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog553  hydrog ? ? A  G   503  N1    ? ? ? 1_555 A  G   511  O6    ? ? A G   504  A G   512  1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog554  hydrog ? ? A  C   504  O2    ? ? ? 1_555 A  A   508  N6    ? ? A C   505  A A   509  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog555  hydrog ? ? A  G   505  N2    ? ? ? 1_555 A  A   510  N7    ? ? A G   506  A A   511  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog556  hydrog ? ? A  G   505  N3    ? ? ? 1_555 A  A   510  N6    ? ? A G   506  A A   511  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog557  hydrog ? ? A  A   520  N3    ? ? ? 1_555 A  G   1363 N2    ? ? A A   521  A G   1364 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog558  hydrog ? ? A  A   531  N3    ? ? ? 1_555 A  G   2659 N2    ? ? A A   532  A G   2660 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog559  hydrog ? ? A  G   534  N7    ? ? ? 1_555 A  G   2081 N1    ? ? A G   535  A G   2082 1_555 ? ? ? ? ? ? TYPE_7_PAIR ? ? 
hydrog560  hydrog ? ? A  G   534  O6    ? ? ? 1_555 A  G   2081 N2    ? ? A G   535  A G   2082 1_555 ? ? ? ? ? ? TYPE_7_PAIR ? ? 
hydrog561  hydrog ? ? A  A   535  N3    ? ? ? 1_555 A  G   2074 N2    ? ? A A   536  A G   2075 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog562  hydrog ? ? A  G   536  N1    ? ? ? 1_555 A  U   2058 O2    ? ? A G   537  A U   2059 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog563  hydrog ? ? A  G   536  O6    ? ? ? 1_555 A  U   2058 N3    ? ? A G   537  A U   2059 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog564  hydrog ? ? A  C   537  N4    ? ? ? 1_555 A  A   2059 N3    ? ? A C   538  A A   2060 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog565  hydrog ? ? A  G   538  N1    ? ? ? 1_555 A  C   616  N3    ? ? A G   539  A C   617  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog566  hydrog ? ? A  G   538  N2    ? ? ? 1_555 A  C   616  O2    ? ? A G   539  A C   617  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog567  hydrog ? ? A  G   538  O6    ? ? ? 1_555 A  C   616  N4    ? ? A G   539  A C   617  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog568  hydrog ? ? A  A   539  N1    ? ? ? 1_555 A  U   615  N3    ? ? A A   540  A U   616  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog569  hydrog ? ? A  A   539  N6    ? ? ? 1_555 A  U   615  O4    ? ? A A   540  A U   616  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog570  hydrog ? ? A  C   540  N3    ? ? ? 1_555 A  G   614  N1    ? ? A C   541  A G   615  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog571  hydrog ? ? A  C   540  N4    ? ? ? 1_555 A  G   614  O6    ? ? A C   541  A G   615  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog572  hydrog ? ? A  C   540  O2    ? ? ? 1_555 A  G   614  N2    ? ? A C   541  A G   615  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog573  hydrog ? ? A  A   541  N1    ? ? ? 1_555 A  U   613  N3    ? ? A A   542  A U   614  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog574  hydrog ? ? A  A   541  N6    ? ? ? 1_555 A  U   613  O4    ? ? A A   542  A U   614  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog575  hydrog ? ? A  G   542  N1    ? ? ? 1_555 A  C   612  N3    ? ? A G   543  A C   613  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog576  hydrog ? ? A  G   542  N2    ? ? ? 1_555 A  C   612  O2    ? ? A G   543  A C   613  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog577  hydrog ? ? A  G   542  O6    ? ? ? 1_555 A  C   612  N4    ? ? A G   543  A C   613  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog578  hydrog ? ? A  G   543  N1    ? ? ? 1_555 A  U   611  O2    ? ? A G   544  A U   612  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog579  hydrog ? ? A  G   543  O6    ? ? ? 1_555 A  U   611  N3    ? ? A G   544  A U   612  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog580  hydrog ? ? A  G   544  N1    ? ? ? 1_555 A  U   610  O2    ? ? A G   545  A U   611  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog581  hydrog ? ? A  G   544  O6    ? ? ? 1_555 A  U   610  N3    ? ? A G   545  A U   611  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog582  hydrog ? ? A  C   545  N3    ? ? ? 1_555 A  G   609  N1    ? ? A C   546  A G   610  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog583  hydrog ? ? A  C   545  N4    ? ? ? 1_555 A  G   609  O6    ? ? A C   546  A G   610  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog584  hydrog ? ? A  C   545  O2    ? ? ? 1_555 A  G   609  N2    ? ? A C   546  A G   610  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog585  hydrog ? ? A  A   546  N1    ? ? ? 1_555 A  U   608  N3    ? ? A A   547  A U   609  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog586  hydrog ? ? A  A   546  N6    ? ? ? 1_555 A  U   608  O4    ? ? A A   547  A U   609  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog587  hydrog ? ? A  U   547  N3    ? ? ? 1_555 A  A   607  N1    ? ? A U   548  A A   608  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog588  hydrog ? ? A  U   547  O4    ? ? ? 1_555 A  A   607  N6    ? ? A U   548  A A   608  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog589  hydrog ? ? A  A   551  N3    ? ? ? 1_555 A  G   1322 N2    ? ? A A   552  A G   1323 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog590  hydrog ? ? A  G   552  N1    ? ? ? 1_555 A  C   605  N3    ? ? A G   553  A C   606  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog591  hydrog ? ? A  G   552  N2    ? ? ? 1_555 A  C   605  O2    ? ? A G   553  A C   606  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog592  hydrog ? ? A  G   552  O6    ? ? ? 1_555 A  C   605  N4    ? ? A G   553  A C   606  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog593  hydrog ? ? A  G   553  N1    ? ? ? 1_555 A  C   604  N3    ? ? A G   554  A C   605  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog594  hydrog ? ? A  G   553  N2    ? ? ? 1_555 A  C   604  O2    ? ? A G   554  A C   605  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog595  hydrog ? ? A  G   553  O6    ? ? ? 1_555 A  C   604  N4    ? ? A G   554  A C   605  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog596  hydrog ? ? A  U   554  N3    ? ? ? 1_555 A  A   601  N1    ? ? A U   555  A A   602  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog597  hydrog ? ? A  U   554  O4    ? ? ? 1_555 A  A   601  N6    ? ? A U   555  A A   602  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog598  hydrog ? ? A  C   555  N3    ? ? ? 1_555 A  G   600  N1    ? ? A C   556  A G   601  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog599  hydrog ? ? A  C   555  N4    ? ? ? 1_555 A  G   600  O6    ? ? A C   556  A G   601  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog600  hydrog ? ? A  C   555  O2    ? ? ? 1_555 A  G   600  N2    ? ? A C   556  A G   601  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog601  hydrog ? ? A  C   556  N3    ? ? ? 1_555 A  G   599  N1    ? ? A C   557  A G   600  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog602  hydrog ? ? A  C   556  N4    ? ? ? 1_555 A  G   599  O6    ? ? A C   557  A G   600  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog603  hydrog ? ? A  C   556  O2    ? ? ? 1_555 A  G   599  N2    ? ? A C   557  A G   600  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog604  hydrog ? ? A  C   557  N3    ? ? ? 1_555 A  G   598  N1    ? ? A C   558  A G   599  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog605  hydrog ? ? A  C   557  N4    ? ? ? 1_555 A  G   598  O6    ? ? A C   558  A G   599  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog606  hydrog ? ? A  C   557  O2    ? ? ? 1_555 A  G   598  N2    ? ? A C   558  A G   599  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog607  hydrog ? ? A  U   558  O4    ? ? ? 1_555 A  C   597  N4    ? ? A U   559  A C   598  1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog608  hydrog ? ? A  G   560  N1    ? ? ? 1_555 A  C   595  N3    ? ? A G   561  A C   596  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog609  hydrog ? ? A  G   560  N2    ? ? ? 1_555 A  C   595  O2    ? ? A G   561  A C   596  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog610  hydrog ? ? A  G   560  O6    ? ? ? 1_555 A  C   595  N4    ? ? A G   561  A C   596  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog611  hydrog ? ? A  A   561  N1    ? ? ? 1_555 A  U   594  N3    ? ? A A   562  A U   595  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog612  hydrog ? ? A  A   561  N6    ? ? ? 1_555 A  U   594  O4    ? ? A A   562  A U   595  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog613  hydrog ? ? A  C   562  O2    ? ? ? 1_555 A  C   593  N4    ? ? A C   563  A C   594  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog614  hydrog ? ? A  A   565  N6    ? ? ? 1_555 A  G   591  N3    ? ? A A   566  A G   592  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog615  hydrog ? ? A  A   565  N7    ? ? ? 1_555 A  G   591  N2    ? ? A A   566  A G   592  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog616  hydrog ? ? A  A   565  N3    ? ? ? 1_555 A  G   1092 N2    ? ? A A   566  A G   1093 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog617  hydrog ? ? A  U   566  N3    ? ? ? 1_555 A  A   590  N1    ? ? A U   567  A A   591  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog618  hydrog ? ? A  U   566  O4    ? ? ? 1_555 A  A   590  N6    ? ? A U   567  A A   591  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog619  hydrog ? ? A  G   567  N2    ? ? ? 1_555 A  A   589  N7    ? ? A G   568  A A   590  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog620  hydrog ? ? A  G   567  N3    ? ? ? 1_555 A  A   589  N6    ? ? A G   568  A A   590  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog621  hydrog ? ? A  A   568  N6    ? ? ? 1_555 A  U   588  O2    ? ? A A   569  A U   589  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog622  hydrog ? ? A  A   568  N7    ? ? ? 1_555 A  U   588  N3    ? ? A A   569  A U   589  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog623  hydrog ? ? A  C   570  N4    ? ? ? 1_555 A  C   585  O2    ? ? A C   571  A C   586  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog624  hydrog ? ? A  G   571  N1    ? ? ? 1_555 A  C   584  N3    ? ? A G   572  A C   585  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog625  hydrog ? ? A  G   571  N2    ? ? ? 1_555 A  C   584  O2    ? ? A G   572  A C   585  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog626  hydrog ? ? A  G   571  O6    ? ? ? 1_555 A  C   584  N4    ? ? A G   572  A C   585  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog627  hydrog ? ? A  A   572  N1    ? ? ? 1_555 A  U   583  N3    ? ? A A   573  A U   584  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog628  hydrog ? ? A  A   572  N6    ? ? ? 1_555 A  U   583  O4    ? ? A A   573  A U   584  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog629  hydrog ? ? A  C   573  N3    ? ? ? 1_555 A  G   582  N1    ? ? A C   574  A G   583  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog630  hydrog ? ? A  C   573  N4    ? ? ? 1_555 A  G   582  O6    ? ? A C   574  A G   583  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog631  hydrog ? ? A  C   573  O2    ? ? ? 1_555 A  G   582  N2    ? ? A C   574  A G   583  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog632  hydrog ? ? A  G   574  N1    ? ? ? 1_555 A  C   581  N3    ? ? A G   575  A C   582  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog633  hydrog ? ? A  G   574  N2    ? ? ? 1_555 A  C   581  O2    ? ? A G   575  A C   582  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog634  hydrog ? ? A  G   574  O6    ? ? ? 1_555 A  C   581  N4    ? ? A G   575  A C   582  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog635  hydrog ? ? A  C   575  N3    ? ? ? 1_555 A  G   580  N1    ? ? A C   576  A G   581  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog636  hydrog ? ? A  C   575  N4    ? ? ? 1_555 A  G   580  O6    ? ? A C   576  A G   581  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog637  hydrog ? ? A  C   575  O2    ? ? ? 1_555 A  G   580  N2    ? ? A C   576  A G   581  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog638  hydrog ? ? A  G   578  N2    ? ? ? 1_555 A  U   1110 O2    ? ? A G   579  A U   1111 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog639  hydrog ? ? A  A   579  N3    ? ? ? 1_555 A  G   1109 N2    ? ? A A   580  A G   1110 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog640  hydrog ? ? A  G   587  N2    ? ? ? 1_555 A  U   588  O4    ? ? A G   588  A U   589  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog641  hydrog ? ? A  G   603  N1    ? ? ? 1_555 A  G   606  O6    ? ? A G   604  A G   607  1_555 ? ? ? ? ? ? TYPE_6_PAIR ? ? 
hydrog642  hydrog ? ? A  G   603  N2    ? ? ? 1_555 A  G   606  N7    ? ? A G   604  A G   607  1_555 ? ? ? ? ? ? TYPE_6_PAIR ? ? 
hydrog643  hydrog ? ? A  U   618  N3    ? ? ? 1_555 A  A   2073 N1    ? ? A U   619  A A   2074 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog644  hydrog ? ? A  A   619  N6    ? ? ? 1_555 A  A   634  N1    ? ? A A   620  A A   635  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog645  hydrog ? ? A  C   620  N3    ? ? ? 1_555 A  G   633  N1    ? ? A C   621  A G   634  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog646  hydrog ? ? A  C   620  N4    ? ? ? 1_555 A  G   633  O6    ? ? A C   621  A G   634  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog647  hydrog ? ? A  C   620  O2    ? ? ? 1_555 A  G   633  N2    ? ? A C   621  A G   634  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog648  hydrog ? ? A  G   621  N1    ? ? ? 1_555 A  C   632  N3    ? ? A G   622  A C   633  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog649  hydrog ? ? A  G   621  N2    ? ? ? 1_555 A  C   632  O2    ? ? A G   622  A C   633  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog650  hydrog ? ? A  G   621  O6    ? ? ? 1_555 A  C   632  N4    ? ? A G   622  A C   633  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog651  hydrog ? ? A  U   622  N3    ? ? ? 1_555 A  A   631  N1    ? ? A U   623  A A   632  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog652  hydrog ? ? A  U   622  O4    ? ? ? 1_555 A  A   631  N6    ? ? A U   623  A A   632  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog653  hydrog ? ? A  U   623  N3    ? ? ? 1_555 A  A   627  N7    ? ? A U   624  A A   628  1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog654  hydrog ? ? A  U   624  O2    ? ? ? 1_555 A  C   2070 N4    ? ? A U   625  A C   2071 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog655  hydrog ? ? A  U   625  O2    ? ? ? 1_555 A  A   1080 N6    ? ? A U   626  A A   1081 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog656  hydrog ? ? A  A   628  N1    ? ? ? 1_555 A  G   2069 N2    ? ? A A   629  A G   2070 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog657  hydrog ? ? A  A   628  N6    ? ? ? 1_555 A  G   2069 N3    ? ? A A   629  A G   2070 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog658  hydrog ? ? A  G   635  N1    ? ? ? 1_555 A  C   1364 N3    ? ? A G   636  A C   1365 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog659  hydrog ? ? A  G   635  N2    ? ? ? 1_555 A  C   1364 O2    ? ? A G   636  A C   1365 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog660  hydrog ? ? A  G   635  O6    ? ? ? 1_555 A  C   1364 N4    ? ? A G   636  A C   1365 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog661  hydrog ? ? A  C   636  N3    ? ? ? 1_555 A  G   1363 N1    ? ? A C   637  A G   1364 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog662  hydrog ? ? A  C   636  N4    ? ? ? 1_555 A  G   1363 O6    ? ? A C   637  A G   1364 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog663  hydrog ? ? A  C   636  O2    ? ? ? 1_555 A  G   1363 N2    ? ? A C   637  A G   1364 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog664  hydrog ? ? A  C   637  N3    ? ? ? 1_555 A  G   1362 N1    ? ? A C   638  A G   1363 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog665  hydrog ? ? A  C   637  N4    ? ? ? 1_555 A  G   1362 O6    ? ? A C   638  A G   1363 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog666  hydrog ? ? A  C   637  O2    ? ? ? 1_555 A  G   1362 N2    ? ? A C   638  A G   1363 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog667  hydrog ? ? A  A   638  N1    ? ? ? 1_555 A  U   1361 N3    ? ? A A   639  A U   1362 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog668  hydrog ? ? A  A   638  N6    ? ? ? 1_555 A  U   1361 O4    ? ? A A   639  A U   1362 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog669  hydrog ? ? A  G   639  N1    ? ? ? 1_555 A  C   1360 N3    ? ? A G   640  A C   1361 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog670  hydrog ? ? A  G   639  N2    ? ? ? 1_555 A  C   1360 O2    ? ? A G   640  A C   1361 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog671  hydrog ? ? A  G   639  O6    ? ? ? 1_555 A  C   1360 N4    ? ? A G   640  A C   1361 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog672  hydrog ? ? A  G   640  N1    ? ? ? 1_555 A  C   1359 N3    ? ? A G   641  A C   1360 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog673  hydrog ? ? A  G   640  N2    ? ? ? 1_555 A  C   1359 O2    ? ? A G   641  A C   1360 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog674  hydrog ? ? A  G   640  O6    ? ? ? 1_555 A  C   1359 N4    ? ? A G   641  A C   1360 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog675  hydrog ? ? A  G   641  N2    ? ? ? 1_555 A  A   1357 N7    ? ? A G   642  A A   1358 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog676  hydrog ? ? A  G   641  N3    ? ? ? 1_555 A  A   1357 N6    ? ? A G   642  A A   1358 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog677  hydrog ? ? A  A   642  N3    ? ? ? 1_555 A  G   901  N2    ? ? A A   643  A G   902  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog678  hydrog ? ? A  A   642  N6    ? ? ? 1_555 A  A   1354 N7    ? ? A A   643  A A   1355 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog679  hydrog ? ? A  A   642  N7    ? ? ? 1_555 A  A   1354 N6    ? ? A A   643  A A   1355 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog680  hydrog ? ? A  G   643  N1    ? ? ? 1_555 A  U   902  O2    ? ? A G   644  A U   903  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog681  hydrog ? ? A  U   644  N3    ? ? ? 1_555 A  A   760  N3    ? ? A U   645  A A   761  1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog682  hydrog ? ? A  G   645  N1    ? ? ? 1_555 A  C   758  N3    ? ? A G   646  A C   759  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog683  hydrog ? ? A  G   645  N2    ? ? ? 1_555 A  C   758  O2    ? ? A G   646  A C   759  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog684  hydrog ? ? A  G   645  O6    ? ? ? 1_555 A  C   758  N4    ? ? A G   646  A C   759  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog685  hydrog ? ? A  U   646  N3    ? ? ? 1_555 A  A   757  N1    ? ? A U   647  A A   758  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog686  hydrog ? ? A  U   646  O4    ? ? ? 1_555 A  A   757  N6    ? ? A U   647  A A   758  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog687  hydrog ? ? A  G   647  N1    ? ? ? 1_555 A  C   756  N3    ? ? A G   648  A C   757  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog688  hydrog ? ? A  G   647  N2    ? ? ? 1_555 A  C   756  O2    ? ? A G   648  A C   757  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog689  hydrog ? ? A  G   647  O6    ? ? ? 1_555 A  C   756  N4    ? ? A G   648  A C   757  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog690  hydrog ? ? A  U   648  N3    ? ? ? 1_555 A  A   755  N1    ? ? A U   649  A A   756  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog691  hydrog ? ? A  U   648  O4    ? ? ? 1_555 A  A   755  N6    ? ? A U   649  A A   756  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog692  hydrog ? ? A  C   649  N3    ? ? ? 1_555 A  G   754  N1    ? ? A C   650  A G   755  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog693  hydrog ? ? A  C   649  N4    ? ? ? 1_555 A  G   754  O6    ? ? A C   650  A G   755  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog694  hydrog ? ? A  C   649  O2    ? ? ? 1_555 A  G   754  N2    ? ? A C   650  A G   755  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog695  hydrog ? ? A  U   650  N3    ? ? ? 1_555 A  G   753  O6    ? ? A U   651  A G   754  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog696  hydrog ? ? A  U   650  O2    ? ? ? 1_555 A  G   753  N1    ? ? A U   651  A G   754  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog697  hydrog ? ? A  G   651  N1    ? ? ? 1_555 A  U   752  O2    ? ? A G   652  A U   753  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog698  hydrog ? ? A  G   651  O6    ? ? ? 1_555 A  U   752  N3    ? ? A G   652  A U   753  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog699  hydrog ? ? A  C   652  N3    ? ? ? 1_555 A  G   751  N1    ? ? A C   653  A G   752  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog700  hydrog ? ? A  C   652  N4    ? ? ? 1_555 A  G   751  O6    ? ? A C   653  A G   752  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog701  hydrog ? ? A  C   652  O2    ? ? ? 1_555 A  G   751  N2    ? ? A C   653  A G   752  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog702  hydrog ? ? A  A   653  N1    ? ? ? 1_555 A  U   750  N3    ? ? A A   654  A U   751  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog703  hydrog ? ? A  A   653  N6    ? ? ? 1_555 A  U   750  O4    ? ? A A   654  A U   751  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog704  hydrog ? ? A  U   654  N3    ? ? ? 1_555 A  A   749  N1    ? ? A U   655  A A   750  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog705  hydrog ? ? A  U   654  O4    ? ? ? 1_555 A  A   749  N6    ? ? A U   655  A A   750  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog706  hydrog ? ? A  G   655  N1    ? ? ? 1_555 A  C   748  N3    ? ? A G   656  A C   749  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog707  hydrog ? ? A  G   655  N2    ? ? ? 1_555 A  C   748  O2    ? ? A G   656  A C   749  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog708  hydrog ? ? A  G   655  O6    ? ? ? 1_555 A  C   748  N4    ? ? A G   656  A C   749  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog709  hydrog ? ? A  G   656  N1    ? ? ? 1_555 A  C   747  N3    ? ? A G   657  A C   748  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog710  hydrog ? ? A  G   656  N2    ? ? ? 1_555 A  C   747  O2    ? ? A G   657  A C   748  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog711  hydrog ? ? A  G   656  O6    ? ? ? 1_555 A  C   747  N4    ? ? A G   657  A C   748  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog712  hydrog ? ? A  C   657  N3    ? ? ? 1_555 A  G   746  N1    ? ? A C   658  A G   747  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog713  hydrog ? ? A  C   657  N4    ? ? ? 1_555 A  G   746  O6    ? ? A C   658  A G   747  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog714  hydrog ? ? A  C   657  O2    ? ? ? 1_555 A  G   746  N2    ? ? A C   658  A G   747  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog715  hydrog ? ? A  G   660  N1    ? ? ? 1_555 A  C   684  N3    ? ? A G   661  A C   685  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog716  hydrog ? ? A  G   660  N2    ? ? ? 1_555 A  C   684  O2    ? ? A G   661  A C   685  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog717  hydrog ? ? A  G   660  O6    ? ? ? 1_555 A  C   684  N4    ? ? A G   661  A C   685  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog718  hydrog ? ? A  U   661  N3    ? ? ? 1_555 A  G   683  O6    ? ? A U   662  A G   684  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog719  hydrog ? ? A  U   661  O2    ? ? ? 1_555 A  G   683  N1    ? ? A U   662  A G   684  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog720  hydrog ? ? A  C   662  N3    ? ? ? 1_555 A  G   682  N1    ? ? A C   663  A G   683  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog721  hydrog ? ? A  C   662  N4    ? ? ? 1_555 A  G   682  O6    ? ? A C   663  A G   683  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog722  hydrog ? ? A  C   662  O2    ? ? ? 1_555 A  G   682  N2    ? ? A C   663  A G   683  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog723  hydrog ? ? A  U   663  N3    ? ? ? 1_555 A  A   681  N7    ? ? A U   664  A A   682  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog724  hydrog ? ? A  U   663  O2    ? ? ? 1_555 A  A   681  N6    ? ? A U   664  A A   682  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog725  hydrog ? ? A  A   665  N6    ? ? ? 1_555 A  G   679  N3    ? ? A A   666  A G   680  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog726  hydrog ? ? A  A   665  N7    ? ? ? 1_555 A  G   679  N2    ? ? A A   666  A G   680  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog727  hydrog ? ? A  C   666  N3    ? ? ? 1_555 A  G   678  N1    ? ? A C   667  A G   679  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog728  hydrog ? ? A  C   666  N4    ? ? ? 1_555 A  G   678  O6    ? ? A C   667  A G   679  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog729  hydrog ? ? A  C   666  O2    ? ? ? 1_555 A  G   678  N2    ? ? A C   667  A G   679  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog730  hydrog ? ? A  C   667  N3    ? ? ? 1_555 A  G   677  N1    ? ? A C   668  A G   678  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog731  hydrog ? ? A  C   667  N4    ? ? ? 1_555 A  G   677  O6    ? ? A C   668  A G   678  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog732  hydrog ? ? A  C   667  O2    ? ? ? 1_555 A  G   677  N2    ? ? A C   668  A G   678  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog733  hydrog ? ? A  G   668  N1    ? ? ? 1_555 A  C   676  N3    ? ? A G   669  A C   677  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog734  hydrog ? ? A  G   668  N2    ? ? ? 1_555 A  C   676  O2    ? ? A G   669  A C   677  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog735  hydrog ? ? A  G   668  O6    ? ? ? 1_555 A  C   676  N4    ? ? A G   669  A C   677  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog736  hydrog ? ? A  G   669  N1    ? ? ? 1_555 A  C   675  N3    ? ? A G   670  A C   676  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog737  hydrog ? ? A  G   669  N2    ? ? ? 1_555 A  C   675  O2    ? ? A G   670  A C   676  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog738  hydrog ? ? A  G   669  O6    ? ? ? 1_555 A  C   675  N4    ? ? A G   670  A C   676  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog739  hydrog ? ? A  G   688  N1    ? ? ? 1_555 A  C   695  N3    ? ? A G   689  A C   696  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog740  hydrog ? ? A  G   688  N2    ? ? ? 1_555 A  C   695  O2    ? ? A G   689  A C   696  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog741  hydrog ? ? A  G   688  O6    ? ? ? 1_555 A  C   695  N4    ? ? A G   689  A C   696  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog742  hydrog ? ? A  G   689  N1    ? ? ? 1_555 A  C   694  N3    ? ? A G   690  A C   695  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog743  hydrog ? ? A  G   689  N2    ? ? ? 1_555 A  C   694  O2    ? ? A G   690  A C   695  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog744  hydrog ? ? A  G   689  O6    ? ? ? 1_555 A  C   694  N4    ? ? A G   690  A C   695  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog745  hydrog ? ? A  G   690  N2    ? ? ? 1_555 A  A   693  N7    ? ? A G   691  A A   694  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog746  hydrog ? ? A  A   691  N1    ? ? ? 1_555 A  G   2452 N2    ? ? A A   692  A G   2453 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog747  hydrog ? ? A  A   697  N3    ? ? ? 1_555 A  G   741  N2    ? ? A A   698  A G   742  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog748  hydrog ? ? A  C   698  N3    ? ? ? 1_555 A  G   726  N1    ? ? A C   699  A G   727  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog749  hydrog ? ? A  C   698  N4    ? ? ? 1_555 A  G   726  O6    ? ? A C   699  A G   727  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog750  hydrog ? ? A  C   698  O2    ? ? ? 1_555 A  G   726  N2    ? ? A C   699  A G   727  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog751  hydrog ? ? A  G   701  N1    ? ? ? 1_555 A  C   725  N3    ? ? A G   702  A C   726  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog752  hydrog ? ? A  G   701  N2    ? ? ? 1_555 A  C   725  O2    ? ? A G   702  A C   726  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog753  hydrog ? ? A  G   701  O6    ? ? ? 1_555 A  C   725  N4    ? ? A G   702  A C   726  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog754  hydrog ? ? A  G   701  N7    ? ? ? 1_555 A  G   743  N2    ? ? A G   702  A G   744  1_555 ? ? ? ? ? ? TYPE_6_PAIR ? ? 
hydrog755  hydrog ? ? A  G   701  O6    ? ? ? 1_555 A  G   743  N1    ? ? A G   702  A G   744  1_555 ? ? ? ? ? ? TYPE_6_PAIR ? ? 
hydrog756  hydrog ? ? A  G   702  N1    ? ? ? 1_555 A  C   724  N3    ? ? A G   703  A C   725  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog757  hydrog ? ? A  G   702  N2    ? ? ? 1_555 A  C   724  O2    ? ? A G   703  A C   725  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog758  hydrog ? ? A  G   702  O6    ? ? ? 1_555 A  C   724  N4    ? ? A G   703  A C   725  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog759  hydrog ? ? A  C   703  N3    ? ? ? 1_555 A  G   723  N1    ? ? A C   704  A G   724  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog760  hydrog ? ? A  C   703  N4    ? ? ? 1_555 A  G   723  O6    ? ? A C   704  A G   724  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog761  hydrog ? ? A  C   703  O2    ? ? ? 1_555 A  G   723  N2    ? ? A C   704  A G   724  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog762  hydrog ? ? A  C   704  N3    ? ? ? 1_555 A  G   722  N1    ? ? A C   705  A G   723  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog763  hydrog ? ? A  C   704  N4    ? ? ? 1_555 A  G   722  O6    ? ? A C   705  A G   723  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog764  hydrog ? ? A  C   704  O2    ? ? ? 1_555 A  G   722  N2    ? ? A C   705  A G   723  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog765  hydrog ? ? A  G   705  N2    ? ? ? 1_555 A  G   721  O6    ? ? A G   706  A G   722  1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog766  hydrog ? ? A  C   706  N3    ? ? ? 1_555 A  A   720  N6    ? ? A C   707  A A   721  1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog767  hydrog ? ? A  C   706  N4    ? ? ? 1_555 A  A   720  N7    ? ? A C   707  A A   721  1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog768  hydrog ? ? A  A   707  N6    ? ? ? 1_555 A  G   719  N3    ? ? A A   708  A G   720  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog769  hydrog ? ? A  A   707  N7    ? ? ? 1_555 A  G   719  N2    ? ? A A   708  A G   720  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog770  hydrog ? ? A  G   708  N1    ? ? ? 1_555 A  C   718  N3    ? ? A G   709  A C   719  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog771  hydrog ? ? A  G   708  N2    ? ? ? 1_555 A  C   718  O2    ? ? A G   709  A C   719  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog772  hydrog ? ? A  G   708  O6    ? ? ? 1_555 A  C   718  N4    ? ? A G   709  A C   719  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog773  hydrog ? ? A  G   709  N1    ? ? ? 1_555 A  C   717  N3    ? ? A G   710  A C   718  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog774  hydrog ? ? A  G   709  N2    ? ? ? 1_555 A  C   717  O2    ? ? A G   710  A C   718  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog775  hydrog ? ? A  G   709  O6    ? ? ? 1_555 A  C   717  N4    ? ? A G   710  A C   718  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog776  hydrog ? ? A  G   710  N1    ? ? ? 1_555 A  C   716  N3    ? ? A G   711  A C   717  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog777  hydrog ? ? A  G   710  N2    ? ? ? 1_555 A  C   716  O2    ? ? A G   711  A C   717  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog778  hydrog ? ? A  G   710  O6    ? ? ? 1_555 A  C   716  N4    ? ? A G   711  A C   717  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog779  hydrog ? ? A  C   711  N3    ? ? ? 1_555 A  G   715  N1    ? ? A C   712  A G   716  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog780  hydrog ? ? A  C   711  N4    ? ? ? 1_555 A  G   715  O6    ? ? A C   712  A G   716  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog781  hydrog ? ? A  C   711  O2    ? ? ? 1_555 A  G   715  N2    ? ? A C   712  A G   716  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog782  hydrog ? ? A  C   725  N4    ? ? ? 1_555 A  G   743  O6    ? ? A C   726  A G   744  1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog783  hydrog ? ? A  C   727  N3    ? ? ? 1_555 A  G   742  N1    ? ? A C   728  A G   743  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog784  hydrog ? ? A  C   727  N4    ? ? ? 1_555 A  G   742  O6    ? ? A C   728  A G   743  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog785  hydrog ? ? A  C   727  O2    ? ? ? 1_555 A  G   742  N2    ? ? A C   728  A G   743  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog786  hydrog ? ? A  C   728  N3    ? ? ? 1_555 A  G   741  N1    ? ? A C   729  A G   742  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog787  hydrog ? ? A  C   728  N4    ? ? ? 1_555 A  G   741  O6    ? ? A C   729  A G   742  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog788  hydrog ? ? A  C   728  O2    ? ? ? 1_555 A  G   741  N2    ? ? A C   729  A G   742  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog789  hydrog ? ? A  G   729  N1    ? ? ? 1_555 A  C   740  N3    ? ? A G   730  A C   741  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog790  hydrog ? ? A  G   729  N2    ? ? ? 1_555 A  C   740  O2    ? ? A G   730  A C   741  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog791  hydrog ? ? A  G   729  O6    ? ? ? 1_555 A  C   740  N4    ? ? A G   730  A C   741  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog792  hydrog ? ? A  U   730  N3    ? ? ? 1_555 A  G   739  O6    ? ? A U   731  A G   740  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog793  hydrog ? ? A  U   730  O2    ? ? ? 1_555 A  G   739  N1    ? ? A U   731  A G   740  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog794  hydrog ? ? A  C   731  N3    ? ? ? 1_555 A  G   738  N1    ? ? A C   732  A G   739  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog795  hydrog ? ? A  C   731  N4    ? ? ? 1_555 A  G   738  O6    ? ? A C   732  A G   739  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog796  hydrog ? ? A  C   731  O2    ? ? ? 1_555 A  G   738  N2    ? ? A C   732  A G   739  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog797  hydrog ? ? A  U   732  N3    ? ? ? 1_555 A  G   737  O6    ? ? A U   733  A G   738  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog798  hydrog ? ? A  U   732  O2    ? ? ? 1_555 A  G   737  N1    ? ? A U   733  A G   738  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog799  hydrog ? ? A  C   761  N3    ? ? ? 1_555 A  G   901  N1    ? ? A C   762  A G   902  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog800  hydrog ? ? A  C   761  N4    ? ? ? 1_555 A  G   901  O6    ? ? A C   762  A G   902  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog801  hydrog ? ? A  C   761  O2    ? ? ? 1_555 A  G   901  N2    ? ? A C   762  A G   902  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog802  hydrog ? ? A  C   762  N3    ? ? ? 1_555 A  G   900  N1    ? ? A C   763  A G   901  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog803  hydrog ? ? A  C   762  N4    ? ? ? 1_555 A  G   900  O6    ? ? A C   763  A G   901  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog804  hydrog ? ? A  C   762  O2    ? ? ? 1_555 A  G   900  N2    ? ? A C   763  A G   901  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog805  hydrog ? ? A  C   763  N4    ? ? ? 1_555 A  U   899  O4    ? ? A C   764  A U   900  1_555 ? ? ? ? ? ? 'C-U MISPAIR' ? 
? 
hydrog806  hydrog ? ? A  G   764  N1    ? ? ? 1_555 A  C   898  N3    ? ? A G   765  A C   899  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog807  hydrog ? ? A  G   764  N2    ? ? ? 1_555 A  C   898  O2    ? ? A G   765  A C   899  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog808  hydrog ? ? A  G   764  O6    ? ? ? 1_555 A  C   898  N4    ? ? A G   765  A C   899  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog809  hydrog ? ? A  A   765  N6    ? ? ? 1_555 A  C   895  N3    ? ? A A   766  A C   896  1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog810  hydrog ? ? A  A   765  N7    ? ? ? 1_555 A  C   895  N4    ? ? A A   766  A C   896  1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog811  hydrog ? ? A  A   766  N6    ? ? ? 1_555 A  A   894  N1    ? ? A A   767  A A   895  1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
hydrog812  hydrog ? ? A  A   766  N7    ? ? ? 1_555 A  A   894  N6    ? ? A A   767  A A   895  1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
hydrog813  hydrog ? ? A  A   766  N3    ? ? ? 1_555 A  G   2109 N2    ? ? A A   767  A G   2110 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog814  hydrog ? ? A  U   767  O4    ? ? ? 1_555 A  C   892  N4    ? ? A U   768  A C   893  1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog815  hydrog ? ? A  C   768  N3    ? ? ? 1_555 A  G   891  N1    ? ? A C   769  A G   892  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog816  hydrog ? ? A  C   768  N4    ? ? ? 1_555 A  G   891  O6    ? ? A C   769  A G   892  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog817  hydrog ? ? A  C   768  O2    ? ? ? 1_555 A  G   891  N2    ? ? A C   769  A G   892  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog818  hydrog ? ? A  C   769  N3    ? ? ? 1_555 A  G   890  N1    ? ? A C   770  A G   891  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog819  hydrog ? ? A  C   769  N4    ? ? ? 1_555 A  G   890  O6    ? ? A C   770  A G   891  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog820  hydrog ? ? A  C   769  O2    ? ? ? 1_555 A  G   890  N2    ? ? A C   770  A G   891  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog821  hydrog ? ? A  G   770  N1    ? ? ? 1_555 A  C   889  N3    ? ? A G   771  A C   890  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog822  hydrog ? ? A  G   770  N2    ? ? ? 1_555 A  C   889  O2    ? ? A G   771  A C   890  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog823  hydrog ? ? A  G   770  O6    ? ? ? 1_555 A  C   889  N4    ? ? A G   771  A C   890  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog824  hydrog ? ? A  G   771  N1    ? ? ? 1_555 A  C   888  N3    ? ? A G   772  A C   889  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog825  hydrog ? ? A  G   771  N2    ? ? ? 1_555 A  C   888  O2    ? ? A G   772  A C   889  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog826  hydrog ? ? A  G   771  O6    ? ? ? 1_555 A  C   888  N4    ? ? A G   772  A C   889  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog827  hydrog ? ? A  A   772  N1    ? ? ? 1_555 A  U   887  N3    ? ? A A   773  A U   888  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog828  hydrog ? ? A  A   772  N6    ? ? ? 1_555 A  U   887  O4    ? ? A A   773  A U   888  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog829  hydrog ? ? A  C   773  N3    ? ? ? 1_555 A  G   886  N1    ? ? A C   774  A G   887  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog830  hydrog ? ? A  C   773  N4    ? ? ? 1_555 A  G   886  O6    ? ? A C   774  A G   887  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog831  hydrog ? ? A  C   773  O2    ? ? ? 1_555 A  G   886  N2    ? ? A C   774  A G   887  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog832  hydrog ? ? A  G   774  N1    ? ? ? 1_555 A  G   867  N7    ? ? A G   775  A G   868  1_555 ? ? ? ? ? ? TYPE_7_PAIR ? ? 
hydrog833  hydrog ? ? A  G   774  N2    ? ? ? 1_555 A  G   867  O6    ? ? A G   775  A G   868  1_555 ? ? ? ? ? ? TYPE_7_PAIR ? ? 
hydrog834  hydrog ? ? A  A   775  N3    ? ? ? 1_555 A  C   777  N4    ? ? A A   776  A C   778  1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog835  hydrog ? ? A  A   775  N3    ? ? ? 1_555 A  U   778  N3    ? ? A A   776  A U   779  1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog836  hydrog ? ? A  A   775  N1    ? ? ? 1_555 A  G   870  N2    ? ? A A   776  A G   871  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog837  hydrog ? ? A  A   775  N6    ? ? ? 1_555 A  G   870  N3    ? ? A A   776  A G   871  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog838  hydrog ? ? A  C   777  O2    ? ? ? 1_555 A  A   1835 N6    ? ? A C   778  A A   1836 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog839  hydrog ? ? A  A   779  N1    ? ? ? 1_555 A  U   865  N3    ? ? A A   780  A U   866  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog840  hydrog ? ? A  A   779  N6    ? ? ? 1_555 A  U   865  O4    ? ? A A   780  A U   866  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog841  hydrog ? ? A  C   780  N3    ? ? ? 1_555 A  G   864  N1    ? ? A C   781  A G   865  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog842  hydrog ? ? A  C   780  N4    ? ? ? 1_555 A  G   864  O6    ? ? A C   781  A G   865  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog843  hydrog ? ? A  C   780  O2    ? ? ? 1_555 A  G   864  N2    ? ? A C   781  A G   865  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog844  hydrog ? ? A  G   781  N1    ? ? ? 1_555 A  U   863  O2    ? ? A G   782  A U   864  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog845  hydrog ? ? A  G   781  O6    ? ? ? 1_555 A  U   863  N3    ? ? A G   782  A U   864  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog846  hydrog ? ? A  C   782  N3    ? ? ? 1_555 A  G   862  N1    ? ? A C   783  A G   863  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog847  hydrog ? ? A  C   782  N4    ? ? ? 1_555 A  G   862  O6    ? ? A C   783  A G   863  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog848  hydrog ? ? A  C   782  O2    ? ? ? 1_555 A  G   862  N2    ? ? A C   783  A G   863  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog849  hydrog ? ? A  A   783  N1    ? ? ? 1_555 A  U   861  N3    ? ? A A   784  A U   862  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog850  hydrog ? ? A  A   783  N6    ? ? ? 1_555 A  U   861  O4    ? ? A A   784  A U   862  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog851  hydrog ? ? A  U   784  N3    ? ? ? 1_555 A  A   860  N1    ? ? A U   785  A A   861  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog852  hydrog ? ? A  U   784  O4    ? ? ? 1_555 A  A   860  N6    ? ? A U   785  A A   861  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog853  hydrog ? ? A  G   785  N1    ? ? ? 1_555 A  U   859  O2    ? ? A G   786  A U   860  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog854  hydrog ? ? A  G   785  O6    ? ? ? 1_555 A  U   859  N3    ? ? A G   786  A U   860  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog855  hydrog ? ? A  G   786  N1    ? ? ? 1_555 A  C   858  N3    ? ? A G   787  A C   859  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog856  hydrog ? ? A  G   786  N2    ? ? ? 1_555 A  C   858  O2    ? ? A G   787  A C   859  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog857  hydrog ? ? A  G   786  O6    ? ? ? 1_555 A  C   858  N4    ? ? A G   787  A C   859  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog858  hydrog ? ? A  A   787  N1    ? ? ? 1_555 A  U   857  N3    ? ? A A   788  A U   858  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog859  hydrog ? ? A  A   787  N6    ? ? ? 1_555 A  U   857  O4    ? ? A A   788  A U   858  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog860  hydrog ? ? A  C   788  N3    ? ? ? 1_555 A  G   855  N1    ? ? A C   789  A G   856  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog861  hydrog ? ? A  C   788  N4    ? ? ? 1_555 A  G   855  O6    ? ? A C   789  A G   856  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog862  hydrog ? ? A  C   788  O2    ? ? ? 1_555 A  G   855  N2    ? ? A C   789  A G   856  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog863  hydrog ? ? A  A   789  N6    ? ? ? 1_555 A  G   823  N3    ? ? A A   790  A G   824  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog864  hydrog ? ? A  A   789  N7    ? ? ? 1_555 A  G   823  N2    ? ? A A   790  A G   824  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog865  hydrog ? ? A  A   789  N1    ? ? ? 1_555 A  G   1708 N2    ? ? A A   790  A G   1709 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog866  hydrog ? ? A  A   790  N1    ? ? ? 1_555 A  U   822  N3    ? ? A A   791  A U   823  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog867  hydrog ? ? A  A   790  N6    ? ? ? 1_555 A  U   822  O4    ? ? A A   791  A U   823  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog868  hydrog ? ? A  G   791  N1    ? ? ? 1_555 A  C   821  N3    ? ? A G   792  A C   822  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog869  hydrog ? ? A  G   791  N2    ? ? ? 1_555 A  C   821  O2    ? ? A G   792  A C   822  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog870  hydrog ? ? A  G   791  O6    ? ? ? 1_555 A  C   821  N4    ? ? A G   792  A C   822  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog871  hydrog ? ? A  A   792  N1    ? ? ? 1_555 A  U   820  N3    ? ? A A   793  A U   821  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog872  hydrog ? ? A  A   792  N6    ? ? ? 1_555 A  U   820  O4    ? ? A A   793  A U   821  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog873  hydrog ? ? A  U   793  N3    ? ? ? 1_555 A  A   818  N1    ? ? A U   794  A A   819  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog874  hydrog ? ? A  U   793  O4    ? ? ? 1_555 A  A   818  N6    ? ? A U   794  A A   819  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog875  hydrog ? ? A  G   794  N2    ? ? ? 1_555 A  A   817  N7    ? ? A G   795  A A   818  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog876  hydrog ? ? A  G   794  N3    ? ? ? 1_555 A  A   817  N6    ? ? A G   795  A A   818  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog877  hydrog ? ? A  A   795  N6    ? ? ? 1_555 A  G   816  N3    ? ? A A   796  A G   817  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog878  hydrog ? ? A  A   795  N7    ? ? ? 1_555 A  G   816  N2    ? ? A A   796  A G   817  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog879  hydrog ? ? A  A   796  N6    ? ? ? 1_555 A  G   815  N3    ? ? A A   797  A G   816  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog880  hydrog ? ? A  A   796  N7    ? ? ? 1_555 A  G   815  N2    ? ? A A   797  A G   816  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog881  hydrog ? ? A  G   797  N1    ? ? ? 1_555 A  U   814  O2    ? ? A G   798  A U   815  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog882  hydrog ? ? A  G   797  O6    ? ? ? 1_555 A  U   814  N3    ? ? A G   798  A U   815  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog883  hydrog ? ? A  C   798  N3    ? ? ? 1_555 A  G   813  N1    ? ? A C   799  A G   814  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog884  hydrog ? ? A  C   798  N4    ? ? ? 1_555 A  G   813  O6    ? ? A C   799  A G   814  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog885  hydrog ? ? A  C   798  O2    ? ? ? 1_555 A  G   813  N2    ? ? A C   799  A G   814  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog886  hydrog ? ? A  G   799  N1    ? ? ? 1_555 A  C   812  N3    ? ? A G   800  A C   813  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog887  hydrog ? ? A  G   799  N2    ? ? ? 1_555 A  C   812  O2    ? ? A G   800  A C   813  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog888  hydrog ? ? A  G   799  O6    ? ? ? 1_555 A  C   812  N4    ? ? A G   800  A C   813  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog889  hydrog ? ? A  U   800  N3    ? ? ? 1_555 A  A   811  N1    ? ? A U   801  A A   812  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog890  hydrog ? ? A  U   800  O4    ? ? ? 1_555 A  A   811  N6    ? ? A U   801  A A   812  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog891  hydrog ? ? A  G   801  N1    ? ? ? 1_555 A  C   810  N3    ? ? A G   802  A C   811  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog892  hydrog ? ? A  G   801  N2    ? ? ? 1_555 A  C   810  O2    ? ? A G   802  A C   811  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog893  hydrog ? ? A  G   801  O6    ? ? ? 1_555 A  C   810  N4    ? ? A G   802  A C   811  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog894  hydrog ? ? A  C   802  N3    ? ? ? 1_555 A  G   809  N1    ? ? A C   803  A G   810  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog895  hydrog ? ? A  C   802  N4    ? ? ? 1_555 A  G   809  O6    ? ? A C   803  A G   810  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog896  hydrog ? ? A  C   802  O2    ? ? ? 1_555 A  G   809  N2    ? ? A C   803  A G   810  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog897  hydrog ? ? A  C   803  N3    ? ? ? 1_555 A  G   808  N1    ? ? A C   804  A G   809  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog898  hydrog ? ? A  C   803  N4    ? ? ? 1_555 A  G   808  O6    ? ? A C   804  A G   809  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog899  hydrog ? ? A  C   803  O2    ? ? ? 1_555 A  G   808  N2    ? ? A C   804  A G   809  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog900  hydrog ? ? A  G   804  N2    ? ? ? 1_555 A  A   807  N7    ? ? A G   805  A A   808  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog901  hydrog ? ? A  G   819  N1    ? ? ? 1_555 A  C   1829 N3    ? ? A G   820  A C   1830 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog902  hydrog ? ? A  G   819  N2    ? ? ? 1_555 A  C   1829 O2    ? ? A G   820  A C   1830 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog903  hydrog ? ? A  G   819  O6    ? ? ? 1_555 A  C   1829 N4    ? ? A G   820  A C   1830 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog904  hydrog ? ? A  G   823  N2    ? ? ? 1_555 A  U   825  O4    ? ? A G   824  A U   826  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog905  hydrog ? ? A  A   826  N6    ? ? ? 1_555 A  G   853  N3    ? ? A A   827  A G   854  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog906  hydrog ? ? A  A   826  N7    ? ? ? 1_555 A  G   853  N2    ? ? A A   827  A G   854  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog907  hydrog ? ? A  G   827  N1    ? ? ? 1_555 A  C   852  N3    ? ? A G   828  A C   853  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog908  hydrog ? ? A  G   827  N2    ? ? ? 1_555 A  C   852  O2    ? ? A G   828  A C   853  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog909  hydrog ? ? A  G   827  O6    ? ? ? 1_555 A  C   852  N4    ? ? A G   828  A C   853  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog910  hydrog ? ? A  A   828  N1    ? ? ? 1_555 A  U   851  N3    ? ? A A   829  A U   852  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog911  hydrog ? ? A  A   828  N6    ? ? ? 1_555 A  U   851  O4    ? ? A A   829  A U   852  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog912  hydrog ? ? A  G   829  N1    ? ? ? 1_555 A  C   850  N3    ? ? A G   830  A C   851  1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog913  hydrog ? ? A  G   829  N2    ? ? ? 1_555 A  A   2021 N1    ? ? A G   830  A A   2022 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog914  hydrog ? ? A  U   831  N3    ? ? ? 1_555 A  U   849  O2    ? ? A U   832  A U   850  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog915  hydrog ? ? A  U   831  O4    ? ? ? 1_555 A  U   849  N3    ? ? A U   832  A U   850  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog916  hydrog ? ? A  G   832  N1    ? ? ? 1_555 A  C   848  N3    ? ? A G   833  A C   849  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog917  hydrog ? ? A  G   832  N2    ? ? ? 1_555 A  C   848  O2    ? ? A G   833  A C   849  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog918  hydrog ? ? A  G   832  O6    ? ? ? 1_555 A  C   848  N4    ? ? A G   833  A C   849  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog919  hydrog ? ? A  G   833  N1    ? ? ? 1_555 A  C   847  N3    ? ? A G   834  A C   848  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog920  hydrog ? ? A  G   833  N2    ? ? ? 1_555 A  C   847  O2    ? ? A G   834  A C   848  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog921  hydrog ? ? A  G   833  O6    ? ? ? 1_555 A  C   847  N4    ? ? A G   834  A C   848  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog922  hydrog ? ? A  G   835  N1    ? ? ? 1_555 A  C   846  N3    ? ? A G   836  A C   847  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog923  hydrog ? ? A  G   835  N2    ? ? ? 1_555 A  C   846  O2    ? ? A G   836  A C   847  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog924  hydrog ? ? A  G   835  O6    ? ? ? 1_555 A  C   846  N4    ? ? A G   836  A C   847  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog925  hydrog ? ? A  U   836  N3    ? ? ? 1_555 A  A   845  N1    ? ? A U   837  A A   846  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog926  hydrog ? ? A  U   836  O4    ? ? ? 1_555 A  A   845  N6    ? ? A U   837  A A   846  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog927  hydrog ? ? A  C   837  O2    ? ? ? 1_555 A  A   842  N6    ? ? A C   838  A A   843  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog928  hydrog ? ? A  U   839  N3    ? ? ? 1_555 A  A   2054 N3    ? ? A U   840  A A   2055 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog929  hydrog ? ? A  C   841  N4    ? ? ? 1_555 A  A   845  N3    ? ? A C   842  A A   846  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog930  hydrog ? ? A  A   856  N6    ? ? ? 1_555 A  U   1830 O4    ? ? A A   857  A U   1831 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog931  hydrog ? ? A  A   856  N7    ? ? ? 1_555 A  U   1830 N3    ? ? A A   857  A U   1831 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog932  hydrog ? ? A  A   856  N6    ? ? ? 1_555 A  A   1844 N3    ? ? A A   857  A A   1845 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog933  hydrog ? ? A  A   860  N3    ? ? ? 1_555 A  U   1487 N3    ? ? A A   861  A U   1488 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog934  hydrog ? ? A  G   862  N2    ? ? ? 1_555 A  A   1458 N3    ? ? A G   863  A A   1459 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog935  hydrog ? ? A  A   866  N3    ? ? ? 1_555 A  G   869  N2    ? ? A A   867  A G   870  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog936  hydrog ? ? A  G   867  N1    ? ? ? 1_555 A  C   883  N3    ? ? A G   868  A C   884  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog937  hydrog ? ? A  G   867  N2    ? ? ? 1_555 A  C   883  O2    ? ? A G   868  A C   884  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog938  hydrog ? ? A  G   867  O6    ? ? ? 1_555 A  C   883  N4    ? ? A G   868  A C   884  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog939  hydrog ? ? A  G   869  N1    ? ? ? 1_555 A  C   879  N3    ? ? A G   870  A C   880  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog940  hydrog ? ? A  G   869  N2    ? ? ? 1_555 A  C   879  O2    ? ? A G   870  A C   880  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog941  hydrog ? ? A  G   869  O6    ? ? ? 1_555 A  C   879  N4    ? ? A G   870  A C   880  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog942  hydrog ? ? A  G   870  N1    ? ? ? 1_555 A  C   878  N3    ? ? A G   871  A C   879  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog943  hydrog ? ? A  G   870  N2    ? ? ? 1_555 A  C   878  O2    ? ? A G   871  A C   879  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog944  hydrog ? ? A  G   870  O6    ? ? ? 1_555 A  C   878  N4    ? ? A G   871  A C   879  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog945  hydrog ? ? A  U   871  N3    ? ? ? 1_555 A  G   877  O6    ? ? A U   872  A G   878  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog946  hydrog ? ? A  U   871  O2    ? ? ? 1_555 A  G   877  N1    ? ? A U   872  A G   878  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog947  hydrog ? ? A  G   872  N2    ? ? ? 1_555 A  A   875  N1    ? ? A G   873  A A   876  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog948  hydrog ? ? A  G   872  N3    ? ? ? 1_555 A  A   875  N6    ? ? A G   873  A A   876  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog949  hydrog ? ? A  A   873  N3    ? ? ? 1_555 A  G   1831 N2    ? ? A A   874  A G   1832 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog950  hydrog ? ? A  G   884  N2    ? ? ? 1_555 A  G   2112 N3    ? ? A G   885  A G   2113 1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog951  hydrog ? ? A  U   899  O2    ? ? ? 1_555 A  A   2100 N6    ? ? A U   900  A A   2101 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog952  hydrog ? ? A  G   900  N2    ? ? ? 1_555 A  A   1357 N3    ? ? A G   901  A A   1358 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog953  hydrog ? ? A  C   904  N3    ? ? ? 1_555 A  G   1299 N1    ? ? A C   905  A G   1300 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog954  hydrog ? ? A  C   904  N4    ? ? ? 1_555 A  G   1299 O6    ? ? A C   905  A G   1300 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog955  hydrog ? ? A  C   904  O2    ? ? ? 1_555 A  G   1299 N2    ? ? A C   905  A G   1300 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog956  hydrog ? ? A  C   905  N3    ? ? ? 1_555 A  G   1298 N1    ? ? A C   906  A G   1299 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog957  hydrog ? ? A  C   905  N4    ? ? ? 1_555 A  G   1298 O6    ? ? A C   906  A G   1299 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog958  hydrog ? ? A  C   905  O2    ? ? ? 1_555 A  G   1298 N2    ? ? A C   906  A G   1299 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog959  hydrog ? ? A  A   906  N1    ? ? ? 1_555 A  U   1297 N3    ? ? A A   907  A U   1298 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog960  hydrog ? ? A  A   906  N6    ? ? ? 1_555 A  U   1297 O4    ? ? A A   907  A U   1298 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog961  hydrog ? ? A  A   907  N1    ? ? ? 1_555 A  U   1296 N3    ? ? A A   908  A U   1297 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog962  hydrog ? ? A  A   907  N6    ? ? ? 1_555 A  U   1296 O4    ? ? A A   908  A U   1297 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog963  hydrog ? ? A  U   908  N3    ? ? ? 1_555 A  A   1295 N1    ? ? A U   909  A A   1296 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog964  hydrog ? ? A  U   908  O4    ? ? ? 1_555 A  A   1295 N6    ? ? A U   909  A A   1296 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog965  hydrog ? ? A  C   909  N3    ? ? ? 1_555 A  G   1294 N1    ? ? A C   910  A G   1295 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog966  hydrog ? ? A  C   909  N4    ? ? ? 1_555 A  G   1294 O6    ? ? A C   910  A G   1295 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog967  hydrog ? ? A  C   909  O2    ? ? ? 1_555 A  G   1294 N2    ? ? A C   910  A G   1295 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog968  hydrog ? ? A  G   910  N2    ? ? ? 1_555 A  A   1293 N7    ? ? A G   911  A A   1294 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog969  hydrog ? ? A  G   910  N3    ? ? ? 1_555 A  A   1293 N6    ? ? A G   911  A A   1294 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog970  hydrog ? ? A  A   911  N6    ? ? ? 1_555 A  U   1292 O2    ? ? A A   912  A U   1293 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog971  hydrog ? ? A  A   911  N7    ? ? ? 1_555 A  U   1292 N3    ? ? A A   912  A U   1293 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog972  hydrog ? ? A  A   912  N6    ? ? ? 1_555 A  G   1070 O6    ? ? A A   913  A G   1071 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog973  hydrog ? ? A  A   913  N6    ? ? ? 1_555 A  A   1069 N3    ? ? A A   914  A A   1070 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog974  hydrog ? ? A  C   914  N3    ? ? ? 1_555 A  G   927  N1    ? ? A C   915  A G   928  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog975  hydrog ? ? A  C   914  N4    ? ? ? 1_555 A  G   927  O6    ? ? A C   915  A G   928  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog976  hydrog ? ? A  C   914  O2    ? ? ? 1_555 A  G   927  N2    ? ? A C   915  A G   928  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog977  hydrog ? ? A  C   914  N4    ? ? ? 1_555 A  U   1041 O2    ? ? A C   915  A U   1042 1_555 ? ? ? ? ? ? 'C-U MISPAIR' ? 
? 
hydrog978  hydrog ? ? A  A   915  N1    ? ? ? 1_555 A  U   926  N3    ? ? A A   916  A U   927  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog979  hydrog ? ? A  A   915  N6    ? ? ? 1_555 A  U   926  O4    ? ? A A   916  A U   927  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog980  hydrog ? ? A  A   915  N6    ? ? ? 1_555 A  C   1042 O2    ? ? A A   916  A C   1043 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog981  hydrog ? ? A  U   916  N3    ? ? ? 1_555 A  A   925  N1    ? ? A U   917  A A   926  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog982  hydrog ? ? A  U   916  O4    ? ? ? 1_555 A  A   925  N6    ? ? A U   917  A A   926  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog983  hydrog ? ? A  G   917  N1    ? ? ? 1_555 A  C   924  N3    ? ? A G   918  A C   925  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog984  hydrog ? ? A  G   917  N2    ? ? ? 1_555 A  C   924  O2    ? ? A G   918  A C   925  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog985  hydrog ? ? A  G   917  O6    ? ? ? 1_555 A  C   924  N4    ? ? A G   918  A C   925  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog986  hydrog ? ? A  U   918  N3    ? ? ? 1_555 A  G   923  O6    ? ? A U   919  A G   924  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog987  hydrog ? ? A  U   918  O2    ? ? ? 1_555 A  G   923  N1    ? ? A U   919  A G   924  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog988  hydrog ? ? A  G   920  O6    ? ? ? 1_555 A  G   2278 N2    ? ? A G   921  A G   2279 1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog989  hydrog ? ? A  A   922  N6    ? ? ? 1_555 A  U   2106 O2    ? ? A A   923  A U   2107 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog990  hydrog ? ? A  A   922  N6    ? ? ? 1_555 A  G   2479 N3    ? ? A A   923  A G   2480 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog991  hydrog ? ? A  A   925  N6    ? ? ? 1_555 A  C   1042 N3    ? ? A A   926  A C   1043 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog992  hydrog ? ? A  A   925  N7    ? ? ? 1_555 A  C   1042 N4    ? ? A A   926  A C   1043 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog993  hydrog ? ? A  G   927  N2    ? ? ? 1_555 A  A   2393 N1    ? ? A G   928  A A   2394 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog994  hydrog ? ? A  A   928  N6    ? ? ? 1_555 A  U   1040 O4    ? ? A A   929  A U   1041 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog995  hydrog ? ? A  C   929  O2    ? ? ? 1_555 A  A   1039 N6    ? ? A C   930  A A   1040 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog996  hydrog ? ? A  C   930  N3    ? ? ? 1_555 A  G   1038 N1    ? ? A C   931  A G   1039 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog997  hydrog ? ? A  C   930  N4    ? ? ? 1_555 A  G   1038 O6    ? ? A C   931  A G   1039 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog998  hydrog ? ? A  C   930  O2    ? ? ? 1_555 A  G   1038 N2    ? ? A C   931  A G   1039 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog999  hydrog ? ? A  U   931  N3    ? ? ? 1_555 A  G   1037 O6    ? ? A U   932  A G   1038 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1000 hydrog ? ? A  U   931  O2    ? ? ? 1_555 A  G   1037 N1    ? ? A U   932  A G   1038 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1001 hydrog ? ? A  C   932  N3    ? ? ? 1_555 A  G   1036 N1    ? ? A C   933  A G   1037 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1002 hydrog ? ? A  C   932  N4    ? ? ? 1_555 A  G   1036 O6    ? ? A C   933  A G   1037 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1003 hydrog ? ? A  C   932  O2    ? ? ? 1_555 A  G   1036 N2    ? ? A C   933  A G   1037 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1004 hydrog ? ? A  C   933  N3    ? ? ? 1_555 A  G   1035 N1    ? ? A C   934  A G   1036 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1005 hydrog ? ? A  C   933  N4    ? ? ? 1_555 A  G   1035 O6    ? ? A C   934  A G   1036 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1006 hydrog ? ? A  C   933  O2    ? ? ? 1_555 A  G   1035 N2    ? ? A C   934  A G   1036 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1007 hydrog ? ? A  G   934  N1    ? ? ? 1_555 A  C   1034 N3    ? ? A G   935  A C   1035 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1008 hydrog ? ? A  G   934  N2    ? ? ? 1_555 A  C   1034 O2    ? ? A G   935  A C   1035 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1009 hydrog ? ? A  G   934  O6    ? ? ? 1_555 A  C   1034 N4    ? ? A G   935  A C   1035 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1010 hydrog ? ? A  C   935  N3    ? ? ? 1_555 A  G   1033 N1    ? ? A C   936  A G   1034 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1011 hydrog ? ? A  C   935  N4    ? ? ? 1_555 A  G   1033 O6    ? ? A C   936  A G   1034 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1012 hydrog ? ? A  C   935  O2    ? ? ? 1_555 A  G   1033 N2    ? ? A C   936  A G   1034 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1013 hydrog ? ? A  C   936  O2    ? ? ? 1_555 A  C   1032 N4    ? ? A C   937  A C   1033 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1014 hydrog ? ? A  G   937  N2    ? ? ? 1_555 A  A   1031 N7    ? ? A G   938  A A   1032 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1015 hydrog ? ? A  A   938  N3    ? ? ? 1_555 A  G   1026 N2    ? ? A A   939  A G   1027 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1016 hydrog ? ? A  A   938  N6    ? ? ? 1_555 A  G   1030 N3    ? ? A A   939  A G   1031 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1017 hydrog ? ? A  A   938  N7    ? ? ? 1_555 A  G   1030 N2    ? ? A A   939  A G   1031 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1018 hydrog ? ? A  G   939  N1    ? ? ? 1_555 A  C   1025 O2    ? ? A G   940  A C   1026 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1019 hydrog ? ? A  G   939  N2    ? ? ? 1_555 A  A   1031 N3    ? ? A G   940  A A   1032 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1020 hydrog ? ? A  G   940  N1    ? ? ? 1_555 A  C   1024 N3    ? ? A G   941  A C   1025 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1021 hydrog ? ? A  G   940  N2    ? ? ? 1_555 A  C   1024 O2    ? ? A G   941  A C   1025 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1022 hydrog ? ? A  G   940  O6    ? ? ? 1_555 A  C   1024 N4    ? ? A G   941  A C   1025 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1023 hydrog ? ? A  U   941  N3    ? ? ? 1_555 A  G   1023 O6    ? ? A U   942  A G   1024 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1024 hydrog ? ? A  U   941  O2    ? ? ? 1_555 A  G   1023 N1    ? ? A U   942  A G   1024 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1025 hydrog ? ? A  A   942  N6    ? ? ? 1_555 A  C   1024 O2    ? ? A A   943  A C   1025 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog1026 hydrog ? ? A  G   943  N1    ? ? ? 1_555 A  C   1022 N3    ? ? A G   944  A C   1023 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1027 hydrog ? ? A  G   943  N2    ? ? ? 1_555 A  C   1022 O2    ? ? A G   944  A C   1023 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1028 hydrog ? ? A  G   943  O6    ? ? ? 1_555 A  C   1022 N4    ? ? A G   944  A C   1023 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1029 hydrog ? ? A  U   944  N3    ? ? ? 1_555 A  A   1021 N1    ? ? A U   945  A A   1022 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1030 hydrog ? ? A  U   944  O4    ? ? ? 1_555 A  A   1021 N6    ? ? A U   945  A A   1022 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1031 hydrog ? ? A  C   945  N3    ? ? ? 1_555 A  G   1020 N1    ? ? A C   946  A G   1021 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1032 hydrog ? ? A  C   945  N4    ? ? ? 1_555 A  G   1020 O6    ? ? A C   946  A G   1021 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1033 hydrog ? ? A  C   945  O2    ? ? ? 1_555 A  G   1020 N2    ? ? A C   946  A G   1021 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1034 hydrog ? ? A  U   946  N3    ? ? ? 1_555 A  A   1019 N1    ? ? A U   947  A A   1020 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1035 hydrog ? ? A  U   946  O4    ? ? ? 1_555 A  A   1019 N6    ? ? A U   947  A A   1020 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1036 hydrog ? ? A  G   947  N1    ? ? ? 1_555 A  C   1018 N3    ? ? A G   948  A C   1019 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1037 hydrog ? ? A  G   947  N2    ? ? ? 1_555 A  C   1018 O2    ? ? A G   948  A C   1019 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1038 hydrog ? ? A  G   947  O6    ? ? ? 1_555 A  C   1018 N4    ? ? A G   948  A C   1019 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1039 hydrog ? ? A  U   948  N3    ? ? ? 1_555 A  A   1017 N1    ? ? A U   949  A A   1018 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1040 hydrog ? ? A  U   948  O4    ? ? ? 1_555 A  A   1017 N6    ? ? A U   949  A A   1018 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1041 hydrog ? ? A  G   949  N1    ? ? ? 1_555 A  U   1016 O2    ? ? A G   950  A U   1017 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1042 hydrog ? ? A  G   949  O6    ? ? ? 1_555 A  U   1016 N3    ? ? A G   950  A U   1017 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1043 hydrog ? ? A  A   950  N1    ? ? ? 1_555 A  U   1015 N3    ? ? A A   951  A U   1016 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1044 hydrog ? ? A  A   950  N6    ? ? ? 1_555 A  U   1015 O4    ? ? A A   951  A U   1016 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1045 hydrog ? ? A  G   951  N1    ? ? ? 1_555 A  C   1014 N3    ? ? A G   952  A C   1015 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1046 hydrog ? ? A  G   951  N2    ? ? ? 1_555 A  C   1014 O2    ? ? A G   952  A C   1015 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1047 hydrog ? ? A  G   951  O6    ? ? ? 1_555 A  C   1014 N4    ? ? A G   952  A C   1015 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1048 hydrog ? ? A  G   952  N2    ? ? ? 1_555 A  U   953  O4    ? ? A G   953  A U   954  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1049 hydrog ? ? A  U   953  N3    ? ? ? 1_555 A  A   1012 N7    ? ? A U   954  A A   1013 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1050 hydrog ? ? A  U   953  O2    ? ? ? 1_555 A  A   1012 N6    ? ? A U   954  A A   1013 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1051 hydrog ? ? A  A   954  N6    ? ? ? 1_555 A  A   1011 N3    ? ? A A   955  A A   1012 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog1052 hydrog ? ? A  G   955  N1    ? ? ? 1_555 A  C   1010 N3    ? ? A G   956  A C   1011 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1053 hydrog ? ? A  G   955  N2    ? ? ? 1_555 A  C   1010 O2    ? ? A G   956  A C   1011 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1054 hydrog ? ? A  G   955  O6    ? ? ? 1_555 A  C   1010 N4    ? ? A G   956  A C   1011 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1055 hydrog ? ? A  A   956  N1    ? ? ? 1_555 A  U   1008 N3    ? ? A A   957  A U   1009 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1056 hydrog ? ? A  A   956  N6    ? ? ? 1_555 A  U   1008 O4    ? ? A A   957  A U   1009 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1057 hydrog ? ? A  G   957  N2    ? ? ? 1_555 A  A   960  N1    ? ? A G   958  A A   961  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog1058 hydrog ? ? A  G   957  N3    ? ? ? 1_555 A  A   960  N6    ? ? A G   958  A A   961  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog1059 hydrog ? ? A  G   957  N1    ? ? ? 1_555 A  C   1007 N3    ? ? A G   958  A C   1008 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1060 hydrog ? ? A  G   957  N2    ? ? ? 1_555 A  C   1007 O2    ? ? A G   958  A C   1008 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1061 hydrog ? ? A  G   957  O6    ? ? ? 1_555 A  C   1007 N4    ? ? A G   958  A C   1008 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1062 hydrog ? ? A  C   958  O2    ? ? ? 1_555 A  C   961  N4    ? ? A C   959  A C   962  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1063 hydrog ? ? A  C   958  O2    ? ? ? 1_555 A  C   962  N4    ? ? A C   959  A C   963  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1064 hydrog ? ? A  C   958  N3    ? ? ? 1_555 A  A   1004 N6    ? ? A C   959  A A   1005 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1065 hydrog ? ? A  C   958  N4    ? ? ? 1_555 A  A   1004 N7    ? ? A C   959  A A   1005 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1066 hydrog ? ? A  C   961  N4    ? ? ? 1_555 A  C   1007 O2    ? ? A C   962  A C   1008 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1067 hydrog ? ? A  C   962  N3    ? ? ? 1_555 A  A   1004 N6    ? ? A C   963  A A   1005 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog1068 hydrog ? ? A  G   963  N1    ? ? ? 1_555 A  C   1003 N3    ? ? A G   964  A C   1004 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1069 hydrog ? ? A  G   963  N2    ? ? ? 1_555 A  C   1003 O2    ? ? A G   964  A C   1004 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1070 hydrog ? ? A  G   963  O6    ? ? ? 1_555 A  C   1003 N4    ? ? A G   964  A C   1004 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1071 hydrog ? ? A  A   964  N1    ? ? ? 1_555 A  U   1002 N3    ? ? A A   965  A U   1003 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1072 hydrog ? ? A  A   964  N6    ? ? ? 1_555 A  U   1002 O4    ? ? A A   965  A U   1003 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1073 hydrog ? ? A  U   965  O2    ? ? ? 1_555 A  G   1001 N1    ? ? A U   966  A G   1002 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog1074 hydrog ? ? A  U   966  N3    ? ? ? 1_555 A  U   1000 O2    ? ? A U   967  A U   1001 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog1075 hydrog ? ? A  U   966  O4    ? ? ? 1_555 A  U   1000 N3    ? ? A U   967  A U   1001 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog1076 hydrog ? ? A  G   967  N1    ? ? ? 1_555 A  C   999  N3    ? ? A G   968  A C   1000 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1077 hydrog ? ? A  G   968  N1    ? ? ? 1_555 A  C   998  N3    ? ? A G   969  A C   999  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1078 hydrog ? ? A  G   968  N2    ? ? ? 1_555 A  C   998  O2    ? ? A G   969  A C   999  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1079 hydrog ? ? A  G   968  O6    ? ? ? 1_555 A  C   998  N4    ? ? A G   969  A C   999  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1080 hydrog ? ? A  G   968  N1    ? ? ? 1_555 A  C   999  N3    ? ? A G   969  A C   1000 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1081 hydrog ? ? A  U   1008 O2    ? ? ? 1_555 A  C   1009 N4    ? ? A U   1009 A C   1010 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog1082 hydrog ? ? A  A   1013 N6    ? ? ? 1_555 A  A   2301 N7    ? ? A A   1014 A A   2302 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1083 hydrog ? ? A  A   1013 N7    ? ? ? 1_555 A  A   2301 N6    ? ? A A   1014 A A   2302 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1084 hydrog ? ? A  G   1044 N1    ? ? ? 1_555 A  C   1068 N3    ? ? A G   1045 A C   1069 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1085 hydrog ? ? A  G   1044 N2    ? ? ? 1_555 A  C   1068 O2    ? ? A G   1045 A C   1069 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1086 hydrog ? ? A  G   1044 O6    ? ? ? 1_555 A  C   1068 N4    ? ? A G   1045 A C   1069 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1087 hydrog ? ? A  G   1045 N1    ? ? ? 1_555 A  C   1067 N3    ? ? A G   1046 A C   1068 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1088 hydrog ? ? A  G   1045 N2    ? ? ? 1_555 A  C   1067 O2    ? ? A G   1046 A C   1068 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1089 hydrog ? ? A  G   1045 O6    ? ? ? 1_555 A  C   1067 N4    ? ? A G   1046 A C   1068 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1090 hydrog ? ? A  G   1045 N2    ? ? ? 1_555 A  A   1081 N3    ? ? A G   1046 A A   1082 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1091 hydrog ? ? A  U   1046 N3    ? ? ? 1_555 A  A   1066 N1    ? ? A U   1047 A A   1067 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1092 hydrog ? ? A  U   1046 O4    ? ? ? 1_555 A  A   1066 N6    ? ? A U   1047 A A   1067 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1093 hydrog ? ? A  G   1047 N1    ? ? ? 1_555 A  U   1065 O2    ? ? A G   1048 A U   1066 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1094 hydrog ? ? A  G   1047 O6    ? ? ? 1_555 A  U   1065 N3    ? ? A G   1048 A U   1066 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1095 hydrog ? ? A  C   1048 N3    ? ? ? 1_555 A  G   1064 N1    ? ? A C   1049 A G   1065 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1096 hydrog ? ? A  C   1048 N4    ? ? ? 1_555 A  G   1064 O6    ? ? A C   1049 A G   1065 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1097 hydrog ? ? A  C   1048 O2    ? ? ? 1_555 A  G   1064 N2    ? ? A C   1049 A G   1065 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1098 hydrog ? ? A  G   1049 N1    ? ? ? 1_555 A  U   1063 O2    ? ? A G   1050 A U   1064 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1099 hydrog ? ? A  G   1049 O6    ? ? ? 1_555 A  U   1063 N3    ? ? A G   1050 A U   1064 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1100 hydrog ? ? A  C   1050 N3    ? ? ? 1_555 A  G   1062 N1    ? ? A C   1051 A G   1063 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1101 hydrog ? ? A  C   1050 N4    ? ? ? 1_555 A  G   1062 O6    ? ? A C   1051 A G   1063 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1102 hydrog ? ? A  C   1050 O2    ? ? ? 1_555 A  G   1062 N2    ? ? A C   1051 A G   1063 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1103 hydrog ? ? A  G   1051 N1    ? ? ? 1_555 A  U   1061 O2    ? ? A G   1052 A U   1062 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1104 hydrog ? ? A  G   1051 O6    ? ? ? 1_555 A  U   1061 N3    ? ? A G   1052 A U   1062 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1105 hydrog ? ? A  G   1052 N1    ? ? ? 1_555 A  C   1060 N3    ? ? A G   1053 A C   1061 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1106 hydrog ? ? A  G   1052 N2    ? ? ? 1_555 A  C   1060 O2    ? ? A G   1053 A C   1061 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1107 hydrog ? ? A  G   1052 O6    ? ? ? 1_555 A  C   1060 N4    ? ? A G   1053 A C   1061 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1108 hydrog ? ? A  G   1052 N2    ? ? ? 1_555 A  U   2307 O2    ? ? A G   1053 A U   2308 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1109 hydrog ? ? A  G   1053 N1    ? ? ? 1_555 A  C   1059 N3    ? ? A G   1054 A C   1060 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1110 hydrog ? ? A  G   1053 N2    ? ? ? 1_555 A  C   1059 O2    ? ? A G   1054 A C   1060 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1111 hydrog ? ? A  G   1053 O6    ? ? ? 1_555 A  C   1059 N4    ? ? A G   1054 A C   1060 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1112 hydrog ? ? A  G   1053 N2    ? ? ? 1_555 A  G   2282 O6    ? ? A G   1054 A G   2283 1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog1113 hydrog ? ? A  G   1054 N2    ? ? ? 1_555 A  A   1057 N7    ? ? A G   1055 A A   1058 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1114 hydrog ? ? A  U   1055 O4    ? ? ? 1_555 A  G   2528 N2    ? ? A U   1056 A G   2529 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog1115 hydrog ? ? A  A   1057 N3    ? ? ? 1_555 A  G   2490 N2    ? ? A A   1058 A G   2491 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1116 hydrog ? ? A  G   1062 N2    ? ? ? 1_555 A  A   2300 N7    ? ? A G   1063 A A   2301 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1117 hydrog ? ? A  G   1071 N2    ? ? ? 1_555 A  A   1087 N7    ? ? A G   1072 A A   1088 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1118 hydrog ? ? A  G   1071 N3    ? ? ? 1_555 A  A   1087 N6    ? ? A G   1072 A A   1088 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1119 hydrog ? ? A  A   1072 N6    ? ? ? 1_555 A  A   1085 N3    ? ? A A   1073 A A   1086 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog1120 hydrog ? ? A  A   1072 N7    ? ? ? 1_555 A  G   1086 N2    ? ? A A   1073 A G   1087 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1121 hydrog ? ? A  G   1073 N1    ? ? ? 1_555 A  C   1084 N3    ? ? A G   1074 A C   1085 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1122 hydrog ? ? A  G   1073 N2    ? ? ? 1_555 A  C   1084 O2    ? ? A G   1074 A C   1085 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1123 hydrog ? ? A  G   1073 O6    ? ? ? 1_555 A  C   1084 N4    ? ? A G   1074 A C   1085 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1124 hydrog ? ? A  G   1074 N1    ? ? ? 1_555 A  C   1083 N3    ? ? A G   1075 A C   1084 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1125 hydrog ? ? A  G   1074 N2    ? ? ? 1_555 A  C   1083 O2    ? ? A G   1075 A C   1084 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1126 hydrog ? ? A  G   1074 O6    ? ? ? 1_555 A  C   1083 N4    ? ? A G   1075 A C   1084 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1127 hydrog ? ? A  G   1074 N2    ? ? ? 1_555 A  A   1097 N3    ? ? A G   1075 A A   1098 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1128 hydrog ? ? A  G   1075 N1    ? ? ? 1_555 A  C   1082 N3    ? ? A G   1076 A C   1083 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1129 hydrog ? ? A  G   1075 N2    ? ? ? 1_555 A  C   1082 O2    ? ? A G   1076 A C   1083 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1130 hydrog ? ? A  G   1075 O6    ? ? ? 1_555 A  C   1082 N4    ? ? A G   1076 A C   1083 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1131 hydrog ? ? A  G   1075 N2    ? ? ? 1_555 B  U   87   O4    ? ? A G   1076 B U   3087 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1132 hydrog ? ? A  A   1078 N3    ? ? ? 1_555 A  G   2067 N2    ? ? A A   1079 A G   2068 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1133 hydrog ? ? A  C   1082 O2    ? ? ? 1_555 A  A   1123 N6    ? ? A C   1083 A A   1124 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog1134 hydrog ? ? A  G   1088 N1    ? ? ? 1_555 A  C   1266 N3    ? ? A G   1089 A C   1267 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1135 hydrog ? ? A  G   1088 N2    ? ? ? 1_555 A  C   1266 O2    ? ? A G   1089 A C   1267 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1136 hydrog ? ? A  G   1088 O6    ? ? ? 1_555 A  C   1266 N4    ? ? A G   1089 A C   1267 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1137 hydrog ? ? A  A   1089 N1    ? ? ? 1_555 A  U   1265 N3    ? ? A A   1090 A U   1266 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1138 hydrog ? ? A  A   1089 N6    ? ? ? 1_555 A  U   1265 O4    ? ? A A   1090 A U   1266 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1139 hydrog ? ? A  U   1090 N3    ? ? ? 1_555 A  G   1264 O6    ? ? A U   1091 A G   1265 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1140 hydrog ? ? A  U   1090 O2    ? ? ? 1_555 A  G   1264 N1    ? ? A U   1091 A G   1265 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1141 hydrog ? ? A  A   1091 N1    ? ? ? 1_555 A  U   1263 N3    ? ? A A   1092 A U   1264 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1142 hydrog ? ? A  A   1091 N6    ? ? ? 1_555 A  U   1263 O4    ? ? A A   1092 A U   1264 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1143 hydrog ? ? A  G   1092 N1    ? ? ? 1_555 A  C   1262 N3    ? ? A G   1093 A C   1263 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1144 hydrog ? ? A  G   1092 N2    ? ? ? 1_555 A  C   1262 O2    ? ? A G   1093 A C   1263 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1145 hydrog ? ? A  G   1092 O6    ? ? ? 1_555 A  C   1262 N4    ? ? A G   1093 A C   1263 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1146 hydrog ? ? A  G   1093 N1    ? ? ? 1_555 A  C   1261 N3    ? ? A G   1094 A C   1262 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1147 hydrog ? ? A  G   1093 N2    ? ? ? 1_555 A  C   1261 O2    ? ? A G   1094 A C   1262 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1148 hydrog ? ? A  G   1093 O6    ? ? ? 1_555 A  C   1261 N4    ? ? A G   1094 A C   1262 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1149 hydrog ? ? A  U   1094 N3    ? ? ? 1_555 A  A   1260 N1    ? ? A U   1095 A A   1261 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1150 hydrog ? ? A  U   1094 O4    ? ? ? 1_555 A  A   1260 N6    ? ? A U   1095 A A   1261 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1151 hydrog ? ? A  U   1095 N3    ? ? ? 1_555 A  A   1258 N7    ? ? A U   1096 A A   1259 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1152 hydrog ? ? A  U   1095 O2    ? ? ? 1_555 A  A   1258 N6    ? ? A U   1096 A A   1259 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1153 hydrog ? ? A  A   1097 N6    ? ? ? 1_555 A  G   1257 N3    ? ? A A   1098 A G   1258 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1154 hydrog ? ? A  A   1097 N7    ? ? ? 1_555 A  G   1257 N2    ? ? A A   1098 A G   1258 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1155 hydrog ? ? A  G   1098 N1    ? ? ? 1_555 A  C   1256 N3    ? ? A G   1099 A C   1257 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1156 hydrog ? ? A  G   1098 N2    ? ? ? 1_555 A  C   1256 O2    ? ? A G   1099 A C   1257 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1157 hydrog ? ? A  G   1098 O6    ? ? ? 1_555 A  C   1256 N4    ? ? A G   1099 A C   1257 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1158 hydrog ? ? A  G   1099 N2    ? ? ? 1_555 A  A   1106 N3    ? ? A G   1100 A A   1107 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1159 hydrog ? ? A  G   1099 N1    ? ? ? 1_555 A  C   1255 N3    ? ? A G   1100 A C   1256 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1160 hydrog ? ? A  G   1099 N2    ? ? ? 1_555 A  C   1255 O2    ? ? A G   1100 A C   1256 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1161 hydrog ? ? A  G   1099 O6    ? ? ? 1_555 A  C   1255 N4    ? ? A G   1100 A C   1256 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1162 hydrog ? ? A  U   1100 N3    ? ? ? 1_555 A  A   1254 N1    ? ? A U   1101 A A   1255 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1163 hydrog ? ? A  U   1100 O4    ? ? ? 1_555 A  A   1254 N6    ? ? A U   1101 A A   1255 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1164 hydrog ? ? A  C   1101 N3    ? ? ? 1_555 A  G   1240 N1    ? ? A C   1102 A G   1241 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1165 hydrog ? ? A  C   1101 N4    ? ? ? 1_555 A  G   1240 O6    ? ? A C   1102 A G   1241 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1166 hydrog ? ? A  C   1101 O2    ? ? ? 1_555 A  G   1240 N2    ? ? A C   1102 A G   1241 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1167 hydrog ? ? A  C   1102 N3    ? ? ? 1_555 A  G   1239 N1    ? ? A C   1103 A G   1240 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1168 hydrog ? ? A  C   1102 N4    ? ? ? 1_555 A  G   1239 O6    ? ? A C   1103 A G   1240 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1169 hydrog ? ? A  C   1102 O2    ? ? ? 1_555 A  G   1239 N2    ? ? A C   1103 A G   1240 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1170 hydrog ? ? A  C   1103 N3    ? ? ? 1_555 A  G   1238 N1    ? ? A C   1104 A G   1239 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1171 hydrog ? ? A  C   1103 N4    ? ? ? 1_555 A  G   1238 O6    ? ? A C   1104 A G   1239 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1172 hydrog ? ? A  C   1103 O2    ? ? ? 1_555 A  G   1238 N2    ? ? A C   1104 A G   1239 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1173 hydrog ? ? A  C   1104 O2    ? ? ? 1_555 A  A   1105 N6    ? ? A C   1105 A A   1106 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog1174 hydrog ? ? A  C   1104 O2    ? ? ? 1_555 A  A   1106 N6    ? ? A C   1105 A A   1107 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog1175 hydrog ? ? A  G   1107 N1    ? ? ? 1_555 A  C   1253 N3    ? ? A G   1108 A C   1254 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1176 hydrog ? ? A  G   1107 N2    ? ? ? 1_555 A  C   1253 O2    ? ? A G   1108 A C   1254 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1177 hydrog ? ? A  G   1107 O6    ? ? ? 1_555 A  C   1253 N4    ? ? A G   1108 A C   1254 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1178 hydrog ? ? A  U   1108 N3    ? ? ? 1_555 A  A   1246 N7    ? ? A U   1109 A A   1247 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog1179 hydrog ? ? A  U   1108 O4    ? ? ? 1_555 A  A   1246 N6    ? ? A U   1109 A A   1247 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog1180 hydrog ? ? A  G   1109 N1    ? ? ? 1_555 A  C   1252 N3    ? ? A G   1110 A C   1253 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1181 hydrog ? ? A  G   1109 N2    ? ? ? 1_555 A  C   1252 O2    ? ? A G   1110 A C   1253 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1182 hydrog ? ? A  G   1109 O6    ? ? ? 1_555 A  C   1252 N4    ? ? A G   1110 A C   1253 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1183 hydrog ? ? A  U   1110 N3    ? ? ? 1_555 A  A   1251 N1    ? ? A U   1111 A A   1252 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1184 hydrog ? ? A  U   1110 O4    ? ? ? 1_555 A  A   1251 N6    ? ? A U   1111 A A   1252 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1185 hydrog ? ? A  G   1111 N1    ? ? ? 1_555 A  C   1250 N3    ? ? A G   1112 A C   1251 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1186 hydrog ? ? A  G   1111 N2    ? ? ? 1_555 A  C   1250 O2    ? ? A G   1112 A C   1251 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1187 hydrog ? ? A  G   1111 O6    ? ? ? 1_555 A  C   1250 N4    ? ? A G   1112 A C   1251 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1188 hydrog ? ? A  G   1112 N1    ? ? ? 1_555 A  C   1249 N3    ? ? A G   1113 A C   1250 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1189 hydrog ? ? A  G   1112 N2    ? ? ? 1_555 A  C   1249 O2    ? ? A G   1113 A C   1250 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1190 hydrog ? ? A  G   1112 O6    ? ? ? 1_555 A  C   1249 N4    ? ? A G   1113 A C   1250 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1191 hydrog ? ? A  A   1113 N1    ? ? ? 1_555 A  U   1248 N3    ? ? A A   1114 A U   1249 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1192 hydrog ? ? A  U   1114 N3    ? ? ? 1_555 A  A   1247 N1    ? ? A U   1115 A A   1248 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1193 hydrog ? ? A  U   1114 O4    ? ? ? 1_555 A  A   1247 N6    ? ? A U   1115 A A   1248 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1194 hydrog ? ? A  U   1115 O2    ? ? ? 1_555 A  A   1245 N6    ? ? A U   1116 A A   1246 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog1195 hydrog ? ? A  A   1117 N6    ? ? ? 1_555 A  U   1243 O2    ? ? A A   1118 A U   1244 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1196 hydrog ? ? A  G   1118 N2    ? ? ? 1_555 A  U   1119 O4    ? ? A G   1119 A U   1120 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1197 hydrog ? ? A  G   1120 N1    ? ? ? 1_555 A  C   1242 N3    ? ? A G   1121 A C   1243 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1198 hydrog ? ? A  G   1120 N2    ? ? ? 1_555 A  C   1242 O2    ? ? A G   1121 A C   1243 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1199 hydrog ? ? A  G   1120 O6    ? ? ? 1_555 A  C   1242 N4    ? ? A G   1121 A C   1243 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1200 hydrog ? ? A  U   1121 N3    ? ? ? 1_555 A  A   1241 N1    ? ? A U   1122 A A   1242 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1201 hydrog ? ? A  U   1121 O4    ? ? ? 1_555 A  A   1241 N6    ? ? A U   1122 A A   1242 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1202 hydrog ? ? A  A   1131 N6    ? ? ? 1_555 A  A   1229 N7    ? ? A A   1132 A A   1230 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1203 hydrog ? ? A  A   1131 N7    ? ? ? 1_555 A  A   1229 N6    ? ? A A   1132 A A   1230 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1204 hydrog ? ? A  A   1132 N6    ? ? ? 1_555 A  C   1228 O2    ? ? A A   1133 A C   1229 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog1205 hydrog ? ? A  A   1132 N3    ? ? ? 1_555 A  G   2519 N2    ? ? A A   1133 A G   2520 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1206 hydrog ? ? A  G   1133 N1    ? ? ? 1_555 A  C   1227 N3    ? ? A G   1134 A C   1228 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1207 hydrog ? ? A  G   1133 N2    ? ? ? 1_555 A  C   1227 O2    ? ? A G   1134 A C   1228 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1208 hydrog ? ? A  G   1133 O6    ? ? ? 1_555 A  C   1227 N4    ? ? A G   1134 A C   1228 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1209 hydrog ? ? A  G   1134 N1    ? ? ? 1_555 A  C   1226 N3    ? ? A G   1135 A C   1227 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1210 hydrog ? ? A  G   1134 N2    ? ? ? 1_555 A  C   1226 O2    ? ? A G   1135 A C   1227 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1211 hydrog ? ? A  G   1134 O6    ? ? ? 1_555 A  C   1226 N4    ? ? A G   1135 A C   1227 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1212 hydrog ? ? A  U   1135 N3    ? ? ? 1_555 A  G   1225 O6    ? ? A U   1136 A G   1226 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1213 hydrog ? ? A  U   1135 O2    ? ? ? 1_555 A  G   1225 N1    ? ? A U   1136 A G   1226 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1214 hydrog ? ? A  G   1137 N1    ? ? ? 1_555 A  C   1224 N3    ? ? A G   1138 A C   1225 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1215 hydrog ? ? A  G   1137 N2    ? ? ? 1_555 A  C   1224 O2    ? ? A G   1138 A C   1225 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1216 hydrog ? ? A  G   1137 O6    ? ? ? 1_555 A  C   1224 N4    ? ? A G   1138 A C   1225 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1217 hydrog ? ? A  U   1138 N3    ? ? ? 1_555 A  G   1223 O6    ? ? A U   1139 A G   1224 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1218 hydrog ? ? A  U   1138 O2    ? ? ? 1_555 A  G   1223 N1    ? ? A U   1139 A G   1224 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1219 hydrog ? ? A  C   1139 N3    ? ? ? 1_555 A  G   1222 N1    ? ? A C   1140 A G   1223 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1220 hydrog ? ? A  C   1139 N4    ? ? ? 1_555 A  G   1222 O6    ? ? A C   1140 A G   1223 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1221 hydrog ? ? A  C   1139 O2    ? ? ? 1_555 A  G   1222 N2    ? ? A C   1140 A G   1223 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1222 hydrog ? ? A  U   1140 N3    ? ? ? 1_555 A  A   1221 N1    ? ? A U   1141 A A   1222 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1223 hydrog ? ? A  U   1140 O4    ? ? ? 1_555 A  A   1221 N6    ? ? A U   1141 A A   1222 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1224 hydrog ? ? A  C   1141 N3    ? ? ? 1_555 A  G   1220 N1    ? ? A C   1142 A G   1221 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1225 hydrog ? ? A  C   1141 N4    ? ? ? 1_555 A  G   1220 O6    ? ? A C   1142 A G   1221 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1226 hydrog ? ? A  C   1141 O2    ? ? ? 1_555 A  G   1220 N2    ? ? A C   1142 A G   1221 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1227 hydrog ? ? A  G   1142 N1    ? ? ? 1_555 A  U   1219 O2    ? ? A G   1143 A U   1220 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1228 hydrog ? ? A  G   1142 O6    ? ? ? 1_555 A  U   1219 N3    ? ? A G   1143 A U   1220 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1229 hydrog ? ? A  A   1143 N1    ? ? ? 1_555 A  U   1218 N3    ? ? A A   1144 A U   1219 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1230 hydrog ? ? A  A   1143 N6    ? ? ? 1_555 A  U   1218 O4    ? ? A A   1144 A U   1219 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1231 hydrog ? ? A  G   1144 N1    ? ? ? 1_555 A  U   1217 O2    ? ? A G   1145 A U   1218 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1232 hydrog ? ? A  G   1144 O6    ? ? ? 1_555 A  U   1217 N3    ? ? A G   1145 A U   1218 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1233 hydrog ? ? A  C   1145 N3    ? ? ? 1_555 A  G   1216 N1    ? ? A C   1146 A G   1217 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1234 hydrog ? ? A  C   1145 N4    ? ? ? 1_555 A  G   1216 O6    ? ? A C   1146 A G   1217 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1235 hydrog ? ? A  C   1145 O2    ? ? ? 1_555 A  G   1216 N2    ? ? A C   1146 A G   1217 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1236 hydrog ? ? A  C   1146 N3    ? ? ? 1_555 A  G   1215 N1    ? ? A C   1147 A G   1216 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1237 hydrog ? ? A  C   1146 N4    ? ? ? 1_555 A  G   1215 O6    ? ? A C   1147 A G   1216 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1238 hydrog ? ? A  C   1146 O2    ? ? ? 1_555 A  G   1215 N2    ? ? A C   1147 A G   1216 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1239 hydrog ? ? A  G   1150 N2    ? ? ? 1_555 A  A   1214 N7    ? ? A G   1151 A A   1215 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1240 hydrog ? ? A  G   1150 N3    ? ? ? 1_555 A  A   1214 N6    ? ? A G   1151 A A   1215 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1241 hydrog ? ? A  A   1151 N7    ? ? ? 1_555 A  G   1213 N2    ? ? A A   1152 A G   1214 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1242 hydrog ? ? A  A   1151 N3    ? ? ? 1_555 A  G   1215 N2    ? ? A A   1152 A G   1216 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1243 hydrog ? ? A  A   1151 N6    ? ? ? 1_555 A  G   2785 O6    ? ? A A   1152 A G   2786 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1244 hydrog ? ? A  C   1152 N4    ? ? ? 1_555 A  G   2785 O6    ? ? A C   1153 A G   2786 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog1245 hydrog ? ? A  A   1153 N6    ? ? ? 1_555 A  C   1212 O2    ? ? A A   1154 A C   1213 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog1246 hydrog ? ? A  G   1154 N1    ? ? ? 1_555 A  C   1211 N3    ? ? A G   1155 A C   1212 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1247 hydrog ? ? A  G   1154 N2    ? ? ? 1_555 A  C   1211 O2    ? ? A G   1155 A C   1212 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1248 hydrog ? ? A  G   1154 O6    ? ? ? 1_555 A  C   1211 N4    ? ? A G   1155 A C   1212 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1249 hydrog ? ? A  C   1155 N3    ? ? ? 1_555 A  G   1210 N1    ? ? A C   1156 A G   1211 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1250 hydrog ? ? A  C   1155 N4    ? ? ? 1_555 A  G   1210 O6    ? ? A C   1156 A G   1211 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1251 hydrog ? ? A  C   1155 O2    ? ? ? 1_555 A  G   1210 N2    ? ? A C   1156 A G   1211 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1252 hydrog ? ? A  C   1156 N3    ? ? ? 1_555 A  G   1209 N1    ? ? A C   1157 A G   1210 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1253 hydrog ? ? A  C   1156 N4    ? ? ? 1_555 A  G   1209 O6    ? ? A C   1157 A G   1210 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1254 hydrog ? ? A  C   1156 O2    ? ? ? 1_555 A  G   1209 N2    ? ? A C   1157 A G   1210 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1255 hydrog ? ? A  G   1157 N1    ? ? ? 1_555 A  C   1208 N3    ? ? A G   1158 A C   1209 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1256 hydrog ? ? A  G   1157 N2    ? ? ? 1_555 A  C   1208 O2    ? ? A G   1158 A C   1209 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1257 hydrog ? ? A  G   1157 O6    ? ? ? 1_555 A  C   1208 N4    ? ? A G   1158 A C   1209 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1258 hydrog ? ? A  G   1158 N1    ? ? ? 1_555 A  C   1207 N3    ? ? A G   1159 A C   1208 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1259 hydrog ? ? A  G   1158 N2    ? ? ? 1_555 A  C   1207 O2    ? ? A G   1159 A C   1208 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1260 hydrog ? ? A  G   1158 O6    ? ? ? 1_555 A  C   1207 N4    ? ? A G   1159 A C   1208 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1261 hydrog ? ? A  A   1160 N1    ? ? ? 1_555 A  U   1184 N3    ? ? A A   1161 A U   1185 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1262 hydrog ? ? A  G   1161 N1    ? ? ? 1_555 A  C   1183 N3    ? ? A G   1162 A C   1184 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1263 hydrog ? ? A  G   1161 N2    ? ? ? 1_555 A  C   1183 O2    ? ? A G   1162 A C   1184 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1264 hydrog ? ? A  G   1161 O6    ? ? ? 1_555 A  C   1183 N4    ? ? A G   1162 A C   1184 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1265 hydrog ? ? A  G   1162 N2    ? ? ? 1_555 A  C   1182 O2    ? ? A G   1163 A C   1183 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1266 hydrog ? ? A  A   1165 N6    ? ? ? 1_555 A  U   1179 O4    ? ? A A   1166 A U   1180 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1267 hydrog ? ? A  G   1166 N1    ? ? ? 1_555 A  C   1178 N3    ? ? A G   1167 A C   1179 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1268 hydrog ? ? A  G   1166 N2    ? ? ? 1_555 A  C   1178 O2    ? ? A G   1167 A C   1179 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1269 hydrog ? ? A  G   1166 O6    ? ? ? 1_555 A  C   1178 N4    ? ? A G   1167 A C   1179 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1270 hydrog ? ? A  C   1167 O2    ? ? ? 1_555 A  G   1177 N1    ? ? A C   1168 A G   1178 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog1271 hydrog ? ? A  A   1173 N6    ? ? ? 1_555 A  A   1199 N3    ? ? A A   1174 A A   1200 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog1272 hydrog ? ? A  G   1174 O6    ? ? ? 1_555 A  C   1203 N4    ? ? A G   1175 A C   1204 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1273 hydrog ? ? A  C   1175 N3    ? ? ? 1_555 A  C   1195 N4    ? ? A C   1176 A C   1196 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1274 hydrog ? ? A  C   1175 N4    ? ? ? 1_555 A  G   1202 O6    ? ? A C   1176 A G   1203 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog1275 hydrog ? ? A  C   1185 N3    ? ? ? 1_555 A  G   1189 N2    ? ? A C   1186 A G   1190 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog1276 hydrog ? ? A  C   1185 O2    ? ? ? 1_555 A  G   1189 N1    ? ? A C   1186 A G   1190 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog1277 hydrog ? ? A  A   1192 N3    ? ? ? 1_555 A  A   1193 N6    ? ? A A   1193 A A   1194 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog1278 hydrog ? ? A  G   1194 N2    ? ? ? 1_555 A  C   1203 O2    ? ? A G   1195 A C   1204 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1279 hydrog ? ? A  C   1195 N3    ? ? ? 1_555 A  G   1202 N1    ? ? A C   1196 A G   1203 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1280 hydrog ? ? A  C   1195 N4    ? ? ? 1_555 A  G   1202 O6    ? ? A C   1196 A G   1203 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1281 hydrog ? ? A  C   1195 O2    ? ? ? 1_555 A  G   1202 N2    ? ? A C   1196 A G   1203 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1282 hydrog ? ? A  G   1196 N2    ? ? ? 1_555 A  A   1201 N7    ? ? A G   1197 A A   1202 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1283 hydrog ? ? A  G   1196 N3    ? ? ? 1_555 A  A   1201 N6    ? ? A G   1197 A A   1202 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1284 hydrog ? ? A  A   1230 N6    ? ? ? 1_555 A  C   2497 O2    ? ? A A   1231 A C   2498 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog1285 hydrog ? ? A  A   1230 N6    ? ? ? 1_555 A  U   2522 O2    ? ? A A   1231 A U   2523 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1286 hydrog ? ? A  G   1234 N2    ? ? ? 1_555 A  A   1235 N7    ? ? A G   1235 A A   1236 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1287 hydrog ? ? A  G   1234 O6    ? ? ? 1_555 A  G   2079 N2    ? ? A G   1235 A G   2080 1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog1288 hydrog ? ? A  C   1237 N4    ? ? ? 1_555 A  G   1240 N7    ? ? A C   1238 A G   1241 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog1289 hydrog ? ? A  C   1267 N3    ? ? ? 1_555 A  G   1289 N1    ? ? A C   1268 A G   1290 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1290 hydrog ? ? A  C   1267 N4    ? ? ? 1_555 A  G   1289 O6    ? ? A C   1268 A G   1290 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1291 hydrog ? ? A  C   1267 O2    ? ? ? 1_555 A  G   1289 N2    ? ? A C   1268 A G   1290 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1292 hydrog ? ? A  G   1268 N1    ? ? ? 1_555 A  C   1288 N3    ? ? A G   1269 A C   1289 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1293 hydrog ? ? A  G   1268 N2    ? ? ? 1_555 A  C   1288 O2    ? ? A G   1269 A C   1289 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1294 hydrog ? ? A  G   1268 O6    ? ? ? 1_555 A  C   1288 N4    ? ? A G   1269 A C   1289 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1295 hydrog ? ? A  U   1269 N3    ? ? ? 1_555 A  A   1285 N1    ? ? A U   1270 A A   1286 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1296 hydrog ? ? A  U   1269 O4    ? ? ? 1_555 A  A   1285 N6    ? ? A U   1270 A A   1286 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1297 hydrog ? ? A  A   1270 N1    ? ? ? 1_555 A  U   1284 N3    ? ? A A   1271 A U   1285 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1298 hydrog ? ? A  A   1270 N6    ? ? ? 1_555 A  U   1284 O4    ? ? A A   1271 A U   1285 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1299 hydrog ? ? A  C   1271 N3    ? ? ? 1_555 A  G   1283 N1    ? ? A C   1272 A G   1284 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1300 hydrog ? ? A  C   1271 N4    ? ? ? 1_555 A  G   1283 O6    ? ? A C   1272 A G   1284 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1301 hydrog ? ? A  C   1271 O2    ? ? ? 1_555 A  G   1283 N2    ? ? A C   1272 A G   1284 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1302 hydrog ? ? A  C   1272 N3    ? ? ? 1_555 A  G   1282 N1    ? ? A C   1273 A G   1283 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1303 hydrog ? ? A  C   1272 N4    ? ? ? 1_555 A  G   1282 O6    ? ? A C   1273 A G   1283 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1304 hydrog ? ? A  C   1272 O2    ? ? ? 1_555 A  G   1282 N2    ? ? A C   1273 A G   1283 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1305 hydrog ? ? A  A   1273 N1    ? ? ? 1_555 A  U   1281 N3    ? ? A A   1274 A U   1282 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1306 hydrog ? ? A  A   1273 N6    ? ? ? 1_555 A  U   1281 O4    ? ? A A   1274 A U   1282 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1307 hydrog ? ? A  C   1274 O2    ? ? ? 1_555 A  C   1280 N4    ? ? A C   1275 A C   1281 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1308 hydrog ? ? A  U   1275 O2    ? ? ? 1_555 A  A   1279 N6    ? ? A U   1276 A A   1280 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog1309 hydrog ? ? A  G   1291 N2    ? ? ? 1_555 A  U   1292 O4    ? ? A G   1292 A U   1293 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1310 hydrog ? ? A  G   1299 N2    ? ? ? 1_555 A  A   1329 N3    ? ? A G   1300 A A   1330 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1311 hydrog ? ? A  C   1300 N3    ? ? ? 1_555 A  G   1353 N1    ? ? A C   1301 A G   1354 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1312 hydrog ? ? A  C   1300 N4    ? ? ? 1_555 A  G   1353 O6    ? ? A C   1301 A G   1354 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1313 hydrog ? ? A  C   1300 O2    ? ? ? 1_555 A  G   1353 N2    ? ? A C   1301 A G   1354 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1314 hydrog ? ? A  G   1301 N1    ? ? ? 1_555 A  C   1352 O2    ? ? A G   1302 A C   1353 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1315 hydrog ? ? A  C   1302 N3    ? ? ? 1_555 A  G   1350 N1    ? ? A C   1303 A G   1351 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1316 hydrog ? ? A  C   1302 N4    ? ? ? 1_555 A  G   1350 O6    ? ? A C   1303 A G   1351 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1317 hydrog ? ? A  C   1302 O2    ? ? ? 1_555 A  G   1350 N2    ? ? A C   1303 A G   1351 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1318 hydrog ? ? A  U   1303 N3    ? ? ? 1_555 A  U   1349 O2    ? ? A U   1304 A U   1350 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog1319 hydrog ? ? A  U   1303 O4    ? ? ? 1_555 A  U   1349 N3    ? ? A U   1304 A U   1350 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog1320 hydrog ? ? A  C   1304 N3    ? ? ? 1_555 A  G   1348 N1    ? ? A C   1305 A G   1349 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1321 hydrog ? ? A  C   1304 N4    ? ? ? 1_555 A  G   1348 O6    ? ? A C   1305 A G   1349 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1322 hydrog ? ? A  C   1304 O2    ? ? ? 1_555 A  G   1348 N2    ? ? A C   1305 A G   1349 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1323 hydrog ? ? A  U   1305 N3    ? ? ? 1_555 A  A   1347 N1    ? ? A U   1306 A A   1348 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1324 hydrog ? ? A  U   1305 O4    ? ? ? 1_555 A  A   1347 N6    ? ? A U   1306 A A   1348 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1325 hydrog ? ? A  A   1306 N1    ? ? ? 1_555 A  U   1346 N3    ? ? A A   1307 A U   1347 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1326 hydrog ? ? A  A   1306 N6    ? ? ? 1_555 A  U   1346 O4    ? ? A A   1307 A U   1347 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1327 hydrog ? ? A  A   1307 N1    ? ? ? 1_555 A  U   1345 N3    ? ? A A   1308 A U   1346 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1328 hydrog ? ? A  A   1307 N6    ? ? ? 1_555 A  U   1345 O4    ? ? A A   1308 A U   1346 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1329 hydrog ? ? A  U   1308 N3    ? ? ? 1_555 A  A   1344 N1    ? ? A U   1309 A A   1345 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1330 hydrog ? ? A  U   1308 O4    ? ? ? 1_555 A  A   1344 N6    ? ? A U   1309 A A   1345 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1331 hydrog ? ? A  U   1309 N3    ? ? ? 1_555 A  G   1343 O6    ? ? A U   1310 A G   1344 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1332 hydrog ? ? A  U   1309 O2    ? ? ? 1_555 A  G   1343 N1    ? ? A U   1310 A G   1344 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1333 hydrog ? ? A  G   1310 N1    ? ? ? 1_555 A  C   1342 N3    ? ? A G   1311 A C   1343 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1334 hydrog ? ? A  G   1310 N2    ? ? ? 1_555 A  C   1342 O2    ? ? A G   1311 A C   1343 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1335 hydrog ? ? A  G   1310 O6    ? ? ? 1_555 A  C   1342 N4    ? ? A G   1311 A C   1343 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1336 hydrog ? ? A  G   1311 N1    ? ? ? 1_555 A  C   1341 N3    ? ? A G   1312 A C   1342 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1337 hydrog ? ? A  G   1311 N2    ? ? ? 1_555 A  C   1341 O2    ? ? A G   1312 A C   1342 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1338 hydrog ? ? A  G   1311 O6    ? ? ? 1_555 A  C   1341 N4    ? ? A G   1312 A C   1342 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1339 hydrog ? ? A  G   1315 N2    ? ? ? 1_555 A  A   1340 N7    ? ? A G   1316 A A   1341 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1340 hydrog ? ? A  G   1315 N3    ? ? ? 1_555 A  A   1340 N6    ? ? A G   1316 A A   1341 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1341 hydrog ? ? A  A   1316 N6    ? ? ? 1_555 A  G   1339 N3    ? ? A A   1317 A G   1340 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1342 hydrog ? ? A  A   1316 N7    ? ? ? 1_555 A  G   1339 N2    ? ? A A   1317 A G   1340 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1343 hydrog ? ? A  A   1317 N6    ? ? ? 1_555 A  G   1338 N3    ? ? A A   1318 A G   1339 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1344 hydrog ? ? A  A   1317 N7    ? ? ? 1_555 A  G   1338 N2    ? ? A A   1318 A G   1339 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1345 hydrog ? ? A  G   1318 N1    ? ? ? 1_555 A  U   1337 O2    ? ? A G   1319 A U   1338 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1346 hydrog ? ? A  G   1318 O6    ? ? ? 1_555 A  U   1337 N3    ? ? A G   1319 A U   1338 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1347 hydrog ? ? A  U   1319 N3    ? ? ? 1_555 A  A   1336 N1    ? ? A U   1320 A A   1337 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1348 hydrog ? ? A  U   1319 O4    ? ? ? 1_555 A  A   1336 N6    ? ? A U   1320 A A   1337 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1349 hydrog ? ? A  A   1320 N1    ? ? ? 1_555 A  U   1335 N3    ? ? A A   1321 A U   1336 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1350 hydrog ? ? A  A   1320 N6    ? ? ? 1_555 A  U   1335 O4    ? ? A A   1321 A U   1336 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1351 hydrog ? ? A  G   1321 N1    ? ? ? 1_555 A  C   1334 N3    ? ? A G   1322 A C   1335 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1352 hydrog ? ? A  G   1321 N2    ? ? ? 1_555 A  C   1334 O2    ? ? A G   1322 A C   1335 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1353 hydrog ? ? A  G   1321 O6    ? ? ? 1_555 A  C   1334 N4    ? ? A G   1322 A C   1335 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1354 hydrog ? ? A  G   1322 N1    ? ? ? 1_555 A  C   1333 N3    ? ? A G   1323 A C   1334 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1355 hydrog ? ? A  G   1322 N2    ? ? ? 1_555 A  C   1333 O2    ? ? A G   1323 A C   1334 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1356 hydrog ? ? A  G   1322 O6    ? ? ? 1_555 A  C   1333 N4    ? ? A G   1323 A C   1334 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1357 hydrog ? ? A  G   1323 N1    ? ? ? 1_555 A  U   1332 O2    ? ? A G   1324 A U   1333 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1358 hydrog ? ? A  G   1323 O6    ? ? ? 1_555 A  U   1332 N3    ? ? A G   1324 A U   1333 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1359 hydrog ? ? A  G   1324 N1    ? ? ? 1_555 A  C   1331 N3    ? ? A G   1325 A C   1332 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1360 hydrog ? ? A  G   1324 N2    ? ? ? 1_555 A  C   1331 O2    ? ? A G   1325 A C   1332 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1361 hydrog ? ? A  G   1324 O6    ? ? ? 1_555 A  C   1331 N4    ? ? A G   1325 A C   1332 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1362 hydrog ? ? A  U   1325 N3    ? ? ? 1_555 A  A   1330 N1    ? ? A U   1326 A A   1331 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1363 hydrog ? ? A  U   1325 O4    ? ? ? 1_555 A  A   1330 N6    ? ? A U   1326 A A   1331 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1364 hydrog ? ? A  G   1326 N2    ? ? ? 1_555 A  A   1329 N7    ? ? A G   1327 A A   1330 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1365 hydrog ? ? A  C   1365 N3    ? ? ? 1_555 A  G   2057 N1    ? ? A C   1366 A G   2058 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1366 hydrog ? ? A  C   1365 N4    ? ? ? 1_555 A  G   2057 O6    ? ? A C   1366 A G   2058 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1367 hydrog ? ? A  C   1365 O2    ? ? ? 1_555 A  G   2057 N2    ? ? A C   1366 A G   2058 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1368 hydrog ? ? A  A   1366 N1    ? ? ? 1_555 A  U   2056 N3    ? ? A A   1367 A U   2057 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1369 hydrog ? ? A  A   1366 N6    ? ? ? 1_555 A  U   2056 O4    ? ? A A   1367 A U   2057 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1370 hydrog ? ? A  U   1367 O2    ? ? ? 1_555 A  C   2055 N4    ? ? A U   1368 A C   2056 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog1371 hydrog ? ? A  A   1368 N6    ? ? ? 1_555 A  A   2054 N7    ? ? A A   1369 A A   2055 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1372 hydrog ? ? A  A   1368 N7    ? ? ? 1_555 A  A   2054 N6    ? ? A A   1369 A A   2055 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1373 hydrog ? ? A  G   1369 N2    ? ? ? 1_555 A  U   1370 O4    ? ? A G   1370 A U   1371 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1374 hydrog ? ? A  U   1370 N3    ? ? ? 1_555 A  A   2053 N7    ? ? A U   1371 A A   2054 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1375 hydrog ? ? A  U   1370 O2    ? ? ? 1_555 A  A   2053 N6    ? ? A U   1371 A A   2054 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1376 hydrog ? ? A  A   1371 N6    ? ? ? 1_555 A  G   2052 N3    ? ? A A   1372 A G   2053 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1377 hydrog ? ? A  A   1371 N7    ? ? ? 1_555 A  G   2052 N2    ? ? A A   1372 A G   2053 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1378 hydrog ? ? A  G   1372 N2    ? ? ? 1_555 A  C   1430 O2    ? ? A G   1373 A C   1431 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1379 hydrog ? ? A  G   1372 N1    ? ? ? 1_555 A  U   2051 O2    ? ? A G   1373 A U   2052 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1380 hydrog ? ? A  G   1372 O6    ? ? ? 1_555 A  U   2051 N3    ? ? A G   1373 A U   2052 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1381 hydrog ? ? A  C   1373 N3    ? ? ? 1_555 A  G   2050 N1    ? ? A C   1374 A G   2051 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1382 hydrog ? ? A  C   1373 N4    ? ? ? 1_555 A  G   2050 O6    ? ? A C   1374 A G   2051 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1383 hydrog ? ? A  C   1373 O2    ? ? ? 1_555 A  G   2050 N2    ? ? A C   1374 A G   2051 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1384 hydrog ? ? A  C   1376 N3    ? ? ? 1_555 A  G   1682 N2    ? ? A C   1377 A G   1683 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog1385 hydrog ? ? A  C   1376 O2    ? ? ? 1_555 A  G   1682 N1    ? ? A C   1377 A G   1683 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog1386 hydrog ? ? A  A   1380 N3    ? ? ? 1_555 A  G   1400 N2    ? ? A A   1381 A G   1401 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1387 hydrog ? ? A  G   1381 N1    ? ? ? 1_555 A  C   1399 N3    ? ? A G   1382 A C   1400 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1388 hydrog ? ? A  G   1381 N2    ? ? ? 1_555 A  C   1399 O2    ? ? A G   1382 A C   1400 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1389 hydrog ? ? A  G   1381 O6    ? ? ? 1_555 A  C   1399 N4    ? ? A G   1382 A C   1400 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1390 hydrog ? ? A  U   1382 N3    ? ? ? 1_555 A  A   1398 N1    ? ? A U   1383 A A   1399 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1391 hydrog ? ? A  U   1382 O4    ? ? ? 1_555 A  A   1398 N6    ? ? A U   1383 A A   1399 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1392 hydrog ? ? A  C   1383 N3    ? ? ? 1_555 A  G   1397 N1    ? ? A C   1384 A G   1398 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1393 hydrog ? ? A  C   1383 N4    ? ? ? 1_555 A  G   1397 O6    ? ? A C   1384 A G   1398 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1394 hydrog ? ? A  C   1383 O2    ? ? ? 1_555 A  G   1397 N2    ? ? A C   1384 A G   1398 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1395 hydrog ? ? A  G   1384 N1    ? ? ? 1_555 A  C   1396 N3    ? ? A G   1385 A C   1397 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1396 hydrog ? ? A  G   1384 N2    ? ? ? 1_555 A  C   1396 O2    ? ? A G   1385 A C   1397 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1397 hydrog ? ? A  G   1384 O6    ? ? ? 1_555 A  C   1396 N4    ? ? A G   1385 A C   1397 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1398 hydrog ? ? A  G   1385 N1    ? ? ? 1_555 A  C   1395 N3    ? ? A G   1386 A C   1396 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1399 hydrog ? ? A  G   1385 N2    ? ? ? 1_555 A  C   1395 O2    ? ? A G   1386 A C   1396 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1400 hydrog ? ? A  G   1385 O6    ? ? ? 1_555 A  C   1395 N4    ? ? A G   1386 A C   1396 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1401 hydrog ? ? A  G   1386 N1    ? ? ? 1_555 A  C   1394 N3    ? ? A G   1387 A C   1395 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1402 hydrog ? ? A  G   1386 N2    ? ? ? 1_555 A  C   1394 O2    ? ? A G   1387 A C   1395 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1403 hydrog ? ? A  G   1386 O6    ? ? ? 1_555 A  C   1394 N4    ? ? A G   1387 A C   1395 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1404 hydrog ? ? A  U   1387 N3    ? ? ? 1_555 A  A   1391 N7    ? ? A U   1388 A A   1392 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1405 hydrog ? ? A  U   1387 O2    ? ? ? 1_555 A  A   1391 N6    ? ? A U   1388 A A   1392 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1406 hydrog ? ? A  G   1388 N2    ? ? ? 1_555 A  U   1434 O4    ? ? A G   1389 A U   1435 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1407 hydrog ? ? A  A   1392 N6    ? ? ? 1_555 A  C   1724 O2    ? ? A A   1393 A C   1725 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog1408 hydrog ? ? A  C   1393 N3    ? ? ? 1_555 A  U   1431 N3    ? ? A C   1394 A U   1432 1_555 ? ? ? ? ? ? TYPE_17_PAIR ? ? 
hydrog1409 hydrog ? ? A  C   1393 N4    ? ? ? 1_555 A  U   1431 O2    ? ? A C   1394 A U   1432 1_555 ? ? ? ? ? ? TYPE_17_PAIR ? ? 
hydrog1410 hydrog ? ? A  G   1400 N1    ? ? ? 1_555 A  C   1720 N3    ? ? A G   1401 A C   1721 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1411 hydrog ? ? A  G   1400 N2    ? ? ? 1_555 A  C   1720 O2    ? ? A G   1401 A C   1721 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1412 hydrog ? ? A  G   1400 O6    ? ? ? 1_555 A  C   1720 N4    ? ? A G   1401 A C   1721 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1413 hydrog ? ? A  G   1401 N1    ? ? ? 1_555 A  C   1719 N3    ? ? A G   1402 A C   1720 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1414 hydrog ? ? A  G   1401 N2    ? ? ? 1_555 A  C   1719 O2    ? ? A G   1402 A C   1720 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1415 hydrog ? ? A  G   1401 O6    ? ? ? 1_555 A  C   1719 N4    ? ? A G   1402 A C   1720 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1416 hydrog ? ? A  C   1402 N3    ? ? ? 1_555 A  G   1718 N1    ? ? A C   1403 A G   1719 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1417 hydrog ? ? A  C   1402 N4    ? ? ? 1_555 A  G   1718 O6    ? ? A C   1403 A G   1719 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1418 hydrog ? ? A  C   1402 O2    ? ? ? 1_555 A  G   1718 N2    ? ? A C   1403 A G   1719 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1419 hydrog ? ? A  C   1403 N3    ? ? ? 1_555 A  G   1717 N1    ? ? A C   1404 A G   1718 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1420 hydrog ? ? A  C   1403 N4    ? ? ? 1_555 A  G   1717 O6    ? ? A C   1404 A G   1718 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1421 hydrog ? ? A  C   1403 O2    ? ? ? 1_555 A  G   1717 N2    ? ? A C   1404 A G   1718 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1422 hydrog ? ? A  U   1404 N3    ? ? ? 1_555 A  A   1715 N7    ? ? A U   1405 A A   1716 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1423 hydrog ? ? A  U   1404 O2    ? ? ? 1_555 A  A   1715 N6    ? ? A U   1405 A A   1716 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1424 hydrog ? ? A  A   1406 N1    ? ? ? 1_555 A  A   1716 N6    ? ? A A   1407 A A   1717 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog1425 hydrog ? ? A  A   1406 N6    ? ? ? 1_555 A  A   1716 N1    ? ? A A   1407 A A   1717 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog1426 hydrog ? ? A  G   1408 N1    ? ? ? 1_555 A  C   1699 N3    ? ? A G   1409 A C   1700 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1427 hydrog ? ? A  G   1408 N2    ? ? ? 1_555 A  C   1699 O2    ? ? A G   1409 A C   1700 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1428 hydrog ? ? A  G   1408 O6    ? ? ? 1_555 A  C   1699 N4    ? ? A G   1409 A C   1700 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1429 hydrog ? ? A  G   1409 N1    ? ? ? 1_555 A  C   1698 N3    ? ? A G   1410 A C   1699 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1430 hydrog ? ? A  G   1409 N2    ? ? ? 1_555 A  C   1698 O2    ? ? A G   1410 A C   1699 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1431 hydrog ? ? A  G   1409 O6    ? ? ? 1_555 A  C   1698 N4    ? ? A G   1410 A C   1699 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1432 hydrog ? ? A  A   1410 N1    ? ? ? 1_555 A  U   1697 N3    ? ? A A   1411 A U   1698 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1433 hydrog ? ? A  A   1410 N6    ? ? ? 1_555 A  U   1697 O4    ? ? A A   1411 A U   1698 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1434 hydrog ? ? A  U   1411 N3    ? ? ? 1_555 A  G   1696 O6    ? ? A U   1412 A G   1697 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1435 hydrog ? ? A  U   1411 O2    ? ? ? 1_555 A  G   1696 N1    ? ? A U   1412 A G   1697 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1436 hydrog ? ? A  A   1413 N6    ? ? ? 1_555 A  G   1680 N3    ? ? A A   1414 A G   1681 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1437 hydrog ? ? A  A   1413 N7    ? ? ? 1_555 A  G   1680 N2    ? ? A A   1414 A G   1681 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1438 hydrog ? ? A  A   1413 N1    ? ? ? 1_555 A  A   1681 N6    ? ? A A   1414 A A   1682 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog1439 hydrog ? ? A  A   1413 N6    ? ? ? 1_555 A  A   1681 N1    ? ? A A   1414 A A   1682 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog1440 hydrog ? ? A  G   1414 N1    ? ? ? 1_555 A  C   1679 N3    ? ? A G   1415 A C   1680 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1441 hydrog ? ? A  G   1414 N2    ? ? ? 1_555 A  C   1679 O2    ? ? A G   1415 A C   1680 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1442 hydrog ? ? A  G   1414 O6    ? ? ? 1_555 A  C   1679 N4    ? ? A G   1415 A C   1680 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1443 hydrog ? ? A  G   1415 N1    ? ? ? 1_555 A  C   1678 N3    ? ? A G   1416 A C   1679 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1444 hydrog ? ? A  G   1415 N2    ? ? ? 1_555 A  C   1678 O2    ? ? A G   1416 A C   1679 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1445 hydrog ? ? A  G   1415 O6    ? ? ? 1_555 A  C   1678 N4    ? ? A G   1416 A C   1679 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1446 hydrog ? ? A  G   1415 N2    ? ? ? 1_555 A  A   1684 N3    ? ? A G   1416 A A   1685 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1447 hydrog ? ? A  U   1417 N3    ? ? ? 1_555 A  U   1445 O4    ? ? A U   1418 A U   1446 1_555 ? ? ? ? ? ? 'U-U MISPAIR' ? 
? 
hydrog1448 hydrog ? ? A  U   1418 N3    ? ? ? 1_555 A  A   1677 N1    ? ? A U   1419 A A   1678 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1449 hydrog ? ? A  U   1418 O4    ? ? ? 1_555 A  A   1677 N6    ? ? A U   1419 A A   1678 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1450 hydrog ? ? A  C   1419 N3    ? ? ? 1_555 A  G   1443 N1    ? ? A C   1420 A G   1444 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1451 hydrog ? ? A  C   1419 N4    ? ? ? 1_555 A  G   1443 O6    ? ? A C   1420 A G   1444 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1452 hydrog ? ? A  C   1419 O2    ? ? ? 1_555 A  G   1443 N2    ? ? A C   1420 A G   1444 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1453 hydrog ? ? A  C   1420 N3    ? ? ? 1_555 A  G   1442 N1    ? ? A C   1421 A G   1443 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1454 hydrog ? ? A  C   1420 N4    ? ? ? 1_555 A  G   1442 O6    ? ? A C   1421 A G   1443 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1455 hydrog ? ? A  C   1420 O2    ? ? ? 1_555 A  G   1442 N2    ? ? A C   1421 A G   1443 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1456 hydrog ? ? A  U   1421 N3    ? ? ? 1_555 A  A   1441 N1    ? ? A U   1422 A A   1442 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1457 hydrog ? ? A  U   1421 O4    ? ? ? 1_555 A  A   1441 N6    ? ? A U   1422 A A   1442 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1458 hydrog ? ? A  C   1422 N3    ? ? ? 1_555 A  G   1440 N1    ? ? A C   1423 A G   1441 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1459 hydrog ? ? A  C   1422 N4    ? ? ? 1_555 A  G   1440 O6    ? ? A C   1423 A G   1441 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1460 hydrog ? ? A  C   1422 O2    ? ? ? 1_555 A  G   1440 N2    ? ? A C   1423 A G   1441 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1461 hydrog ? ? A  A   1423 N1    ? ? ? 1_555 A  U   1439 N3    ? ? A A   1424 A U   1440 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1462 hydrog ? ? A  A   1423 N6    ? ? ? 1_555 A  U   1439 O4    ? ? A A   1424 A U   1440 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1463 hydrog ? ? A  G   1424 N1    ? ? ? 1_555 A  C   1438 N3    ? ? A G   1425 A C   1439 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1464 hydrog ? ? A  G   1424 N2    ? ? ? 1_555 A  C   1438 O2    ? ? A G   1425 A C   1439 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1465 hydrog ? ? A  G   1424 O6    ? ? ? 1_555 A  C   1438 N4    ? ? A G   1425 A C   1439 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1466 hydrog ? ? A  C   1425 N3    ? ? ? 1_555 A  A   1436 N6    ? ? A C   1426 A A   1437 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1467 hydrog ? ? A  C   1425 N4    ? ? ? 1_555 A  A   1436 N7    ? ? A C   1426 A A   1437 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1468 hydrog ? ? A  C   1427 N4    ? ? ? 1_555 A  C   1438 O2    ? ? A C   1428 A C   1439 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1469 hydrog ? ? A  U   1428 N3    ? ? ? 1_555 A  A   1436 N1    ? ? A U   1429 A A   1437 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1470 hydrog ? ? A  U   1428 O4    ? ? ? 1_555 A  A   1436 N6    ? ? A U   1429 A A   1437 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1471 hydrog ? ? A  G   1429 N1    ? ? ? 1_555 A  C   1435 N3    ? ? A G   1430 A C   1436 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1472 hydrog ? ? A  G   1429 N2    ? ? ? 1_555 A  C   1435 O2    ? ? A G   1430 A C   1436 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1473 hydrog ? ? A  G   1429 O6    ? ? ? 1_555 A  C   1435 N4    ? ? A G   1430 A C   1436 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1474 hydrog ? ? A  G   1429 N3    ? ? ? 1_555 A  A   1690 N6    ? ? A G   1430 A A   1691 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1475 hydrog ? ? A  G   1443 N2    ? ? ? 1_555 A  A   1501 N3    ? ? A G   1444 A A   1502 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1476 hydrog ? ? A  A   1447 N6    ? ? ? 1_555 A  U   1676 O2    ? ? A A   1448 A U   1677 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1477 hydrog ? ? A  A   1447 N7    ? ? ? 1_555 A  U   1676 N3    ? ? A A   1448 A U   1677 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1478 hydrog ? ? A  G   1448 N2    ? ? ? 1_555 A  A   1492 N3    ? ? A G   1449 A A   1493 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1479 hydrog ? ? A  G   1448 N1    ? ? ? 1_555 A  C   1512 N3    ? ? A G   1449 A C   1513 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1480 hydrog ? ? A  G   1448 N2    ? ? ? 1_555 A  C   1512 O2    ? ? A G   1449 A C   1513 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1481 hydrog ? ? A  G   1448 O6    ? ? ? 1_555 A  C   1512 N4    ? ? A G   1449 A C   1513 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1482 hydrog ? ? A  C   1449 N3    ? ? ? 1_555 A  G   1511 N1    ? ? A C   1450 A G   1512 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1483 hydrog ? ? A  C   1449 N4    ? ? ? 1_555 A  G   1511 O6    ? ? A C   1450 A G   1512 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1484 hydrog ? ? A  C   1449 O2    ? ? ? 1_555 A  G   1511 N2    ? ? A C   1450 A G   1512 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1485 hydrog ? ? A  C   1450 N3    ? ? ? 1_555 A  G   1675 N1    ? ? A C   1451 A G   1676 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1486 hydrog ? ? A  C   1450 N4    ? ? ? 1_555 A  G   1675 O6    ? ? A C   1451 A G   1676 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1487 hydrog ? ? A  C   1450 O2    ? ? ? 1_555 A  G   1675 N2    ? ? A C   1451 A G   1676 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1488 hydrog ? ? A  G   1451 N2    ? ? ? 1_555 A  A   1485 N1    ? ? A G   1452 A A   1486 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1489 hydrog ? ? A  G   1451 N1    ? ? ? 1_555 A  C   1674 N3    ? ? A G   1452 A C   1675 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1490 hydrog ? ? A  G   1451 N2    ? ? ? 1_555 A  C   1674 O2    ? ? A G   1452 A C   1675 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1491 hydrog ? ? A  G   1451 O6    ? ? ? 1_555 A  C   1674 N4    ? ? A G   1452 A C   1675 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1492 hydrog ? ? A  G   1452 N1    ? ? ? 1_555 A  C   1673 N3    ? ? A G   1453 A C   1674 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1493 hydrog ? ? A  G   1452 N2    ? ? ? 1_555 A  C   1673 O2    ? ? A G   1453 A C   1674 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1494 hydrog ? ? A  G   1452 O6    ? ? ? 1_555 A  C   1673 N4    ? ? A G   1453 A C   1674 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1495 hydrog ? ? A  U   1453 O4    ? ? ? 1_555 A  G   1490 N2    ? ? A U   1454 A G   1491 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog1496 hydrog ? ? A  C   1454 N3    ? ? ? 1_555 A  G   1489 N1    ? ? A C   1455 A G   1490 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1497 hydrog ? ? A  C   1454 N4    ? ? ? 1_555 A  G   1489 O6    ? ? A C   1455 A G   1490 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1498 hydrog ? ? A  C   1454 O2    ? ? ? 1_555 A  G   1489 N2    ? ? A C   1455 A G   1490 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1499 hydrog ? ? A  C   1455 N3    ? ? ? 1_555 A  G   1488 N1    ? ? A C   1456 A G   1489 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1500 hydrog ? ? A  C   1455 N4    ? ? ? 1_555 A  G   1488 O6    ? ? A C   1456 A G   1489 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1501 hydrog ? ? A  C   1455 O2    ? ? ? 1_555 A  G   1488 N2    ? ? A C   1456 A G   1489 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1502 hydrog ? ? A  U   1456 N3    ? ? ? 1_555 A  A   1484 N7    ? ? A U   1457 A A   1485 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1503 hydrog ? ? A  U   1456 O2    ? ? ? 1_555 A  A   1484 N6    ? ? A U   1457 A A   1485 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1504 hydrog ? ? A  A   1458 N6    ? ? ? 1_555 A  G   1483 N3    ? ? A A   1459 A G   1484 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1505 hydrog ? ? A  A   1458 N7    ? ? ? 1_555 A  G   1483 N2    ? ? A A   1459 A G   1484 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1506 hydrog ? ? A  G   1459 N1    ? ? ? 1_555 A  C   1482 N3    ? ? A G   1460 A C   1483 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1507 hydrog ? ? A  G   1459 N2    ? ? ? 1_555 A  C   1482 O2    ? ? A G   1460 A C   1483 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1508 hydrog ? ? A  G   1459 O6    ? ? ? 1_555 A  C   1482 N4    ? ? A G   1460 A C   1483 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1509 hydrog ? ? A  U   1460 N3    ? ? ? 1_555 A  A   1481 N1    ? ? A U   1461 A A   1482 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1510 hydrog ? ? A  U   1460 O4    ? ? ? 1_555 A  A   1481 N6    ? ? A U   1461 A A   1482 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1511 hydrog ? ? A  C   1461 N3    ? ? ? 1_555 A  G   1480 N1    ? ? A C   1462 A G   1481 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1512 hydrog ? ? A  C   1461 N4    ? ? ? 1_555 A  G   1480 O6    ? ? A C   1462 A G   1481 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1513 hydrog ? ? A  C   1461 O2    ? ? ? 1_555 A  G   1480 N2    ? ? A C   1462 A G   1481 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1514 hydrog ? ? A  A   1462 N1    ? ? ? 1_555 A  U   1479 N3    ? ? A A   1463 A U   1480 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1515 hydrog ? ? A  A   1462 N6    ? ? ? 1_555 A  U   1479 O4    ? ? A A   1463 A U   1480 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1516 hydrog ? ? A  U   1463 N3    ? ? ? 1_555 A  A   1478 N1    ? ? A U   1464 A A   1479 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1517 hydrog ? ? A  U   1463 O4    ? ? ? 1_555 A  A   1478 N6    ? ? A U   1464 A A   1479 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1518 hydrog ? ? A  A   1464 N1    ? ? ? 1_555 A  U   1477 N3    ? ? A A   1465 A U   1478 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1519 hydrog ? ? A  A   1464 N6    ? ? ? 1_555 A  U   1477 O4    ? ? A A   1465 A U   1478 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1520 hydrog ? ? A  C   1465 O2    ? ? ? 1_555 A  C   1476 N4    ? ? A C   1466 A C   1477 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1521 hydrog ? ? A  C   1466 N3    ? ? ? 1_555 A  G   1474 N1    ? ? A C   1467 A G   1475 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1522 hydrog ? ? A  C   1466 N4    ? ? ? 1_555 A  G   1474 O6    ? ? A C   1467 A G   1475 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1523 hydrog ? ? A  C   1466 O2    ? ? ? 1_555 A  G   1474 N2    ? ? A C   1467 A G   1475 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1524 hydrog ? ? A  C   1466 O2    ? ? ? 1_555 A  A   1475 N6    ? ? A C   1467 A A   1476 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog1525 hydrog ? ? A  G   1467 N1    ? ? ? 1_555 A  C   1473 N3    ? ? A G   1468 A C   1474 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1526 hydrog ? ? A  G   1467 N2    ? ? ? 1_555 A  C   1473 O2    ? ? A G   1468 A C   1474 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1527 hydrog ? ? A  G   1467 O6    ? ? ? 1_555 A  C   1473 N4    ? ? A G   1468 A C   1474 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1528 hydrog ? ? A  G   1474 N2    ? ? ? 1_555 A  A   1865 N3    ? ? A G   1475 A A   1866 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1529 hydrog ? ? A  A   1484 N6    ? ? ? 1_555 A  A   1655 N1    ? ? A A   1485 A A   1656 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog1530 hydrog ? ? A  A   1486 N3    ? ? ? 1_555 A  G   1696 N2    ? ? A A   1487 A G   1697 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1531 hydrog ? ? A  G   1488 N2    ? ? ? 1_555 A  A   1656 N1    ? ? A G   1489 A A   1657 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1532 hydrog ? ? A  A   1493 N1    ? ? ? 1_555 A  U   1510 N3    ? ? A A   1494 A U   1511 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1533 hydrog ? ? A  A   1493 N6    ? ? ? 1_555 A  U   1510 O4    ? ? A A   1494 A U   1511 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1534 hydrog ? ? A  C   1494 N3    ? ? ? 1_555 A  G   1509 N1    ? ? A C   1495 A G   1510 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1535 hydrog ? ? A  C   1494 N4    ? ? ? 1_555 A  G   1509 O6    ? ? A C   1495 A G   1510 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1536 hydrog ? ? A  C   1494 O2    ? ? ? 1_555 A  G   1509 N2    ? ? A C   1495 A G   1510 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1537 hydrog ? ? A  G   1495 N1    ? ? ? 1_555 A  C   1508 N3    ? ? A G   1496 A C   1509 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1538 hydrog ? ? A  G   1495 N2    ? ? ? 1_555 A  C   1508 O2    ? ? A G   1496 A C   1509 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1539 hydrog ? ? A  G   1495 O6    ? ? ? 1_555 A  C   1508 N4    ? ? A G   1496 A C   1509 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1540 hydrog ? ? A  G   1496 N1    ? ? ? 1_555 A  C   1507 N3    ? ? A G   1497 A C   1508 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1541 hydrog ? ? A  G   1496 N2    ? ? ? 1_555 A  C   1507 O2    ? ? A G   1497 A C   1508 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1542 hydrog ? ? A  G   1496 O6    ? ? ? 1_555 A  C   1507 N4    ? ? A G   1497 A C   1508 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1543 hydrog ? ? A  G   1497 N1    ? ? ? 1_555 A  C   1506 N3    ? ? A G   1498 A C   1507 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1544 hydrog ? ? A  G   1497 N2    ? ? ? 1_555 A  C   1506 O2    ? ? A G   1498 A C   1507 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1545 hydrog ? ? A  G   1497 O6    ? ? ? 1_555 A  C   1506 N4    ? ? A G   1498 A C   1507 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1546 hydrog ? ? A  U   1498 N3    ? ? ? 1_555 A  A   1503 N7    ? ? A U   1499 A A   1504 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1547 hydrog ? ? A  U   1498 O2    ? ? ? 1_555 A  A   1503 N6    ? ? A U   1499 A A   1504 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1548 hydrog ? ? A  C   1513 N3    ? ? ? 1_555 A  G   1671 N1    ? ? A C   1514 A G   1672 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1549 hydrog ? ? A  C   1513 N4    ? ? ? 1_555 A  G   1671 O6    ? ? A C   1514 A G   1672 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1550 hydrog ? ? A  C   1513 O2    ? ? ? 1_555 A  G   1671 N2    ? ? A C   1514 A G   1672 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1551 hydrog ? ? A  A   1514 N1    ? ? ? 1_555 A  U   1670 N3    ? ? A A   1515 A U   1671 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1552 hydrog ? ? A  A   1514 N6    ? ? ? 1_555 A  U   1670 O4    ? ? A A   1515 A U   1671 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1553 hydrog ? ? A  C   1515 N3    ? ? ? 1_555 A  G   1669 N1    ? ? A C   1516 A G   1670 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1554 hydrog ? ? A  C   1515 N4    ? ? ? 1_555 A  G   1669 O6    ? ? A C   1516 A G   1670 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1555 hydrog ? ? A  C   1515 O2    ? ? ? 1_555 A  G   1669 N2    ? ? A C   1516 A G   1670 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1556 hydrog ? ? A  U   1516 N3    ? ? ? 1_555 A  A   1668 N1    ? ? A U   1517 A A   1669 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1557 hydrog ? ? A  U   1516 O4    ? ? ? 1_555 A  A   1668 N6    ? ? A U   1517 A A   1669 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1558 hydrog ? ? A  A   1517 N1    ? ? ? 1_555 A  U   1667 N3    ? ? A A   1518 A U   1668 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1559 hydrog ? ? A  A   1517 N6    ? ? ? 1_555 A  U   1667 O4    ? ? A A   1518 A U   1668 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1560 hydrog ? ? A  U   1518 N3    ? ? ? 1_555 A  A   1666 N1    ? ? A U   1519 A A   1667 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1561 hydrog ? ? A  U   1518 O4    ? ? ? 1_555 A  A   1666 N6    ? ? A U   1519 A A   1667 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1562 hydrog ? ? A  G   1519 N1    ? ? ? 1_555 A  C   1665 N3    ? ? A G   1520 A C   1666 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1563 hydrog ? ? A  G   1519 N2    ? ? ? 1_555 A  C   1665 O2    ? ? A G   1520 A C   1666 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1564 hydrog ? ? A  G   1519 O6    ? ? ? 1_555 A  C   1665 N4    ? ? A G   1520 A C   1666 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1565 hydrog ? ? A  C   1520 N3    ? ? ? 1_555 A  G   1664 N1    ? ? A C   1521 A G   1665 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1566 hydrog ? ? A  C   1520 N4    ? ? ? 1_555 A  G   1664 O6    ? ? A C   1521 A G   1665 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1567 hydrog ? ? A  C   1520 O2    ? ? ? 1_555 A  G   1664 N2    ? ? A C   1521 A G   1665 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1568 hydrog ? ? A  A   1526 N6    ? ? ? 1_555 A  A   1663 N7    ? ? A A   1527 A A   1664 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1569 hydrog ? ? A  A   1526 N7    ? ? ? 1_555 A  A   1663 N6    ? ? A A   1527 A A   1664 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1570 hydrog ? ? A  A   1527 N6    ? ? ? 1_555 A  G   1662 N3    ? ? A A   1528 A G   1663 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1571 hydrog ? ? A  A   1527 N7    ? ? ? 1_555 A  G   1662 N2    ? ? A A   1528 A G   1663 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1572 hydrog ? ? A  G   1528 N1    ? ? ? 1_555 A  C   1661 N3    ? ? A G   1529 A C   1662 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1573 hydrog ? ? A  G   1528 N2    ? ? ? 1_555 A  C   1661 O2    ? ? A G   1529 A C   1662 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1574 hydrog ? ? A  G   1528 O6    ? ? ? 1_555 A  C   1661 N4    ? ? A G   1529 A C   1662 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1575 hydrog ? ? A  U   1529 N3    ? ? ? 1_555 A  A   1660 N1    ? ? A U   1530 A A   1661 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1576 hydrog ? ? A  U   1529 O4    ? ? ? 1_555 A  A   1660 N6    ? ? A U   1530 A A   1661 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1577 hydrog ? ? A  U   1530 N3    ? ? ? 1_555 A  G   1659 O6    ? ? A U   1531 A G   1660 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1578 hydrog ? ? A  U   1530 O2    ? ? ? 1_555 A  G   1659 N1    ? ? A U   1531 A G   1660 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1579 hydrog ? ? A  G   1531 N2    ? ? ? 1_555 A  A   1658 N7    ? ? A G   1532 A A   1659 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1580 hydrog ? ? A  G   1531 N3    ? ? ? 1_555 A  A   1658 N6    ? ? A G   1532 A A   1659 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1581 hydrog ? ? A  A   1532 N6    ? ? ? 1_555 A  A   1657 N7    ? ? A A   1533 A A   1658 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1582 hydrog ? ? A  A   1532 N7    ? ? ? 1_555 A  A   1657 N6    ? ? A A   1533 A A   1658 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1583 hydrog ? ? A  C   1533 N4    ? ? ? 1_555 A  A   1656 N7    ? ? A C   1534 A A   1657 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog1584 hydrog ? ? A  G   1534 N1    ? ? ? 1_555 A  C   1649 N3    ? ? A G   1535 A C   1650 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1585 hydrog ? ? A  G   1534 N2    ? ? ? 1_555 A  C   1649 O2    ? ? A G   1535 A C   1650 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1586 hydrog ? ? A  G   1534 O6    ? ? ? 1_555 A  C   1649 N4    ? ? A G   1535 A C   1650 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1587 hydrog ? ? A  C   1535 N3    ? ? ? 1_555 A  G   1648 N1    ? ? A C   1536 A G   1649 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1588 hydrog ? ? A  C   1535 N4    ? ? ? 1_555 A  G   1648 O6    ? ? A C   1536 A G   1649 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1589 hydrog ? ? A  C   1535 O2    ? ? ? 1_555 A  G   1648 N2    ? ? A C   1536 A G   1649 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1590 hydrog ? ? A  C   1536 N3    ? ? ? 1_555 A  G   1647 N1    ? ? A C   1537 A G   1648 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1591 hydrog ? ? A  C   1536 N4    ? ? ? 1_555 A  G   1647 O6    ? ? A C   1537 A G   1648 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1592 hydrog ? ? A  C   1536 O2    ? ? ? 1_555 A  G   1647 N2    ? ? A C   1537 A G   1648 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1593 hydrog ? ? A  C   1537 N3    ? ? ? 1_555 A  G   1646 N1    ? ? A C   1538 A G   1647 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1594 hydrog ? ? A  C   1537 N4    ? ? ? 1_555 A  G   1646 O6    ? ? A C   1538 A G   1647 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1595 hydrog ? ? A  C   1537 O2    ? ? ? 1_555 A  G   1646 N2    ? ? A C   1538 A G   1647 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1596 hydrog ? ? A  U   1538 N3    ? ? ? 1_555 A  G   1645 O6    ? ? A U   1539 A G   1646 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1597 hydrog ? ? A  U   1538 O2    ? ? ? 1_555 A  G   1645 N1    ? ? A U   1539 A G   1646 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1598 hydrog ? ? A  G   1539 N1    ? ? ? 1_555 A  U   1644 O2    ? ? A G   1540 A U   1645 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1599 hydrog ? ? A  G   1539 O6    ? ? ? 1_555 A  U   1644 N3    ? ? A G   1540 A U   1645 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1600 hydrog ? ? A  G   1540 N1    ? ? ? 1_555 A  C   1643 N3    ? ? A G   1541 A C   1644 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1601 hydrog ? ? A  G   1540 N2    ? ? ? 1_555 A  C   1643 O2    ? ? A G   1541 A C   1644 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1602 hydrog ? ? A  G   1540 O6    ? ? ? 1_555 A  C   1643 N4    ? ? A G   1541 A C   1644 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1603 hydrog ? ? A  G   1541 N2    ? ? ? 1_555 A  A   1615 N3    ? ? A G   1542 A A   1616 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1604 hydrog ? ? A  G   1541 N1    ? ? ? 1_555 A  C   1642 N3    ? ? A G   1542 A C   1643 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1605 hydrog ? ? A  G   1541 N2    ? ? ? 1_555 A  C   1642 O2    ? ? A G   1542 A C   1643 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1606 hydrog ? ? A  G   1541 O6    ? ? ? 1_555 A  C   1642 N4    ? ? A G   1542 A C   1643 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1607 hydrog ? ? A  G   1542 N2    ? ? ? 1_555 A  A   1641 N7    ? ? A G   1543 A A   1642 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1608 hydrog ? ? A  G   1542 N3    ? ? ? 1_555 A  A   1641 N6    ? ? A G   1543 A A   1642 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1609 hydrog ? ? A  U   1543 N3    ? ? ? 1_555 A  A   1640 N7    ? ? A U   1544 A A   1641 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1610 hydrog ? ? A  U   1543 O2    ? ? ? 1_555 A  A   1640 N6    ? ? A U   1544 A A   1641 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1611 hydrog ? ? A  C   1544 N4    ? ? ? 1_555 A  C   1639 O2    ? ? A C   1545 A C   1640 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1612 hydrog ? ? A  C   1544 N3    ? ? ? 1_555 A  U   1701 N3    ? ? A C   1545 A U   1702 1_555 ? ? ? ? ? ? TYPE_18_PAIR ? ? 
hydrog1613 hydrog ? ? A  C   1544 N4    ? ? ? 1_555 A  U   1701 O4    ? ? A C   1545 A U   1702 1_555 ? ? ? ? ? ? TYPE_18_PAIR ? ? 
hydrog1614 hydrog ? ? A  G   1545 N1    ? ? ? 1_555 A  U   1638 O2    ? ? A G   1546 A U   1639 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1615 hydrog ? ? A  G   1545 O6    ? ? ? 1_555 A  U   1638 N3    ? ? A G   1546 A U   1639 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1616 hydrog ? ? A  A   1546 N1    ? ? ? 1_555 A  U   1637 N3    ? ? A A   1547 A U   1638 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1617 hydrog ? ? A  A   1546 N6    ? ? ? 1_555 A  U   1637 O4    ? ? A A   1547 A U   1638 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1618 hydrog ? ? A  U   1547 N3    ? ? ? 1_555 A  A   1636 N1    ? ? A U   1548 A A   1637 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1619 hydrog ? ? A  U   1547 O4    ? ? ? 1_555 A  A   1636 N6    ? ? A U   1548 A A   1637 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1620 hydrog ? ? A  C   1548 N3    ? ? ? 1_555 A  G   1635 N1    ? ? A C   1549 A G   1636 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1621 hydrog ? ? A  C   1548 N4    ? ? ? 1_555 A  G   1635 O6    ? ? A C   1549 A G   1636 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1622 hydrog ? ? A  C   1548 O2    ? ? ? 1_555 A  G   1635 N2    ? ? A C   1549 A G   1636 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1623 hydrog ? ? A  A   1549 N1    ? ? ? 1_555 A  U   1634 N3    ? ? A A   1550 A U   1635 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1624 hydrog ? ? A  A   1549 N6    ? ? ? 1_555 A  U   1634 O4    ? ? A A   1550 A U   1635 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1625 hydrog ? ? A  C   1550 N3    ? ? ? 1_555 A  G   1633 N1    ? ? A C   1551 A G   1634 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1626 hydrog ? ? A  C   1550 N4    ? ? ? 1_555 A  G   1633 O6    ? ? A C   1551 A G   1634 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1627 hydrog ? ? A  C   1550 O2    ? ? ? 1_555 A  G   1633 N2    ? ? A C   1551 A G   1634 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1628 hydrog ? ? A  G   1551 N1    ? ? ? 1_555 A  U   1568 O2    ? ? A G   1552 A U   1569 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1629 hydrog ? ? A  G   1551 O6    ? ? ? 1_555 A  U   1568 N3    ? ? A G   1552 A U   1569 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1630 hydrog ? ? A  C   1552 N3    ? ? ? 1_555 A  G   1567 N1    ? ? A C   1553 A G   1568 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1631 hydrog ? ? A  C   1552 N4    ? ? ? 1_555 A  G   1567 O6    ? ? A C   1553 A G   1568 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1632 hydrog ? ? A  C   1552 O2    ? ? ? 1_555 A  G   1567 N2    ? ? A C   1553 A G   1568 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1633 hydrog ? ? A  U   1553 N3    ? ? ? 1_555 A  A   1566 N1    ? ? A U   1554 A A   1567 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1634 hydrog ? ? A  U   1553 O4    ? ? ? 1_555 A  A   1566 N6    ? ? A U   1554 A A   1567 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1635 hydrog ? ? A  G   1554 N1    ? ? ? 1_555 A  C   1565 N3    ? ? A G   1555 A C   1566 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1636 hydrog ? ? A  G   1554 N2    ? ? ? 1_555 A  C   1565 O2    ? ? A G   1555 A C   1566 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1637 hydrog ? ? A  G   1554 O6    ? ? ? 1_555 A  C   1565 N4    ? ? A G   1555 A C   1566 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1638 hydrog ? ? A  G   1555 N1    ? ? ? 1_555 A  C   1564 N3    ? ? A G   1556 A C   1565 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1639 hydrog ? ? A  G   1555 N2    ? ? ? 1_555 A  C   1564 O2    ? ? A G   1556 A C   1565 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1640 hydrog ? ? A  G   1555 O6    ? ? ? 1_555 A  C   1564 N4    ? ? A G   1556 A C   1565 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1641 hydrog ? ? A  G   1556 N1    ? ? ? 1_555 A  C   1563 N3    ? ? A G   1557 A C   1564 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1642 hydrog ? ? A  G   1556 N2    ? ? ? 1_555 A  C   1563 O2    ? ? A G   1557 A C   1564 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1643 hydrog ? ? A  G   1556 O6    ? ? ? 1_555 A  C   1563 N4    ? ? A G   1557 A C   1564 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1644 hydrog ? ? A  U   1560 N3    ? ? ? 1_555 A  A   2738 N1    ? ? A U   1561 A A   2739 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1645 hydrog ? ? A  U   1560 O4    ? ? ? 1_555 A  A   2738 N6    ? ? A U   1561 A A   2739 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1646 hydrog ? ? A  C   1561 N3    ? ? ? 1_555 A  G   2737 N1    ? ? A C   1562 A G   2738 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1647 hydrog ? ? A  C   1561 N4    ? ? ? 1_555 A  G   2737 O6    ? ? A C   1562 A G   2738 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1648 hydrog ? ? A  C   1561 O2    ? ? ? 1_555 A  G   2737 N2    ? ? A C   1562 A G   2738 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1649 hydrog ? ? A  G   1567 N2    ? ? ? 1_555 A  A   1631 N3    ? ? A G   1568 A A   1632 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1650 hydrog ? ? A  C   1569 N3    ? ? ? 1_555 A  G   1626 N1    ? ? A C   1570 A G   1627 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1651 hydrog ? ? A  C   1569 N4    ? ? ? 1_555 A  G   1626 O6    ? ? A C   1570 A G   1627 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1652 hydrog ? ? A  C   1569 O2    ? ? ? 1_555 A  G   1626 N2    ? ? A C   1570 A G   1627 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1653 hydrog ? ? A  G   1570 N2    ? ? ? 1_555 A  A   1625 N7    ? ? A G   1571 A A   1626 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1654 hydrog ? ? A  G   1570 N3    ? ? ? 1_555 A  A   1625 N6    ? ? A G   1571 A A   1626 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1655 hydrog ? ? A  A   1571 N6    ? ? ? 1_555 A  A   1623 N7    ? ? A A   1572 A A   1624 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1656 hydrog ? ? A  A   1571 N7    ? ? ? 1_555 A  A   1623 N6    ? ? A A   1572 A A   1624 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1657 hydrog ? ? A  A   1572 N6    ? ? ? 1_555 A  C   1622 O2    ? ? A A   1573 A C   1623 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog1658 hydrog ? ? A  C   1573 N3    ? ? ? 1_555 A  G   1621 N1    ? ? A C   1574 A G   1622 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1659 hydrog ? ? A  C   1573 N4    ? ? ? 1_555 A  G   1621 O6    ? ? A C   1574 A G   1622 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1660 hydrog ? ? A  C   1573 O2    ? ? ? 1_555 A  G   1621 N2    ? ? A C   1574 A G   1622 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1661 hydrog ? ? A  C   1574 N3    ? ? ? 1_555 A  G   1620 N1    ? ? A C   1575 A G   1621 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1662 hydrog ? ? A  C   1574 N4    ? ? ? 1_555 A  G   1620 O6    ? ? A C   1575 A G   1621 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1663 hydrog ? ? A  C   1574 O2    ? ? ? 1_555 A  G   1620 N2    ? ? A C   1575 A G   1621 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1664 hydrog ? ? A  G   1575 N1    ? ? ? 1_555 A  C   1619 N3    ? ? A G   1576 A C   1620 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1665 hydrog ? ? A  G   1575 N2    ? ? ? 1_555 A  C   1619 O2    ? ? A G   1576 A C   1620 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1666 hydrog ? ? A  G   1575 O6    ? ? ? 1_555 A  C   1619 N4    ? ? A G   1576 A C   1620 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1667 hydrog ? ? A  U   1576 N3    ? ? ? 1_555 A  G   1618 O6    ? ? A U   1577 A G   1619 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1668 hydrog ? ? A  U   1576 O2    ? ? ? 1_555 A  G   1618 N1    ? ? A U   1577 A G   1619 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1669 hydrog ? ? A  C   1577 N3    ? ? ? 1_555 A  G   1617 N1    ? ? A C   1578 A G   1618 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1670 hydrog ? ? A  C   1577 N4    ? ? ? 1_555 A  G   1617 O6    ? ? A C   1578 A G   1618 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1671 hydrog ? ? A  C   1577 O2    ? ? ? 1_555 A  G   1617 N2    ? ? A C   1578 A G   1618 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1672 hydrog ? ? A  C   1578 N3    ? ? ? 1_555 A  A   1615 N6    ? ? A C   1579 A A   1616 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1673 hydrog ? ? A  C   1578 N4    ? ? ? 1_555 A  A   1615 N7    ? ? A C   1579 A A   1616 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1674 hydrog ? ? A  C   1578 N4    ? ? ? 1_555 A  G   1617 O6    ? ? A C   1579 A G   1618 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog1675 hydrog ? ? A  A   1580 N6    ? ? ? 1_555 A  G   1613 N3    ? ? A A   1581 A G   1614 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1676 hydrog ? ? A  A   1580 N7    ? ? ? 1_555 A  G   1613 N2    ? ? A A   1581 A G   1614 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1677 hydrog ? ? A  C   1581 N4    ? ? ? 1_555 A  C   1612 N3    ? ? A C   1582 A C   1613 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1678 hydrog ? ? A  U   1582 N3    ? ? ? 1_555 A  A   1611 N1    ? ? A U   1583 A A   1612 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1679 hydrog ? ? A  U   1582 O4    ? ? ? 1_555 A  A   1611 N6    ? ? A U   1583 A A   1612 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1680 hydrog ? ? A  C   1583 N3    ? ? ? 1_555 A  G   1610 N1    ? ? A C   1584 A G   1611 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1681 hydrog ? ? A  C   1583 N4    ? ? ? 1_555 A  G   1610 O6    ? ? A C   1584 A G   1611 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1682 hydrog ? ? A  C   1583 O2    ? ? ? 1_555 A  G   1610 N2    ? ? A C   1584 A G   1611 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1683 hydrog ? ? A  C   1584 N3    ? ? ? 1_555 A  G   1609 N1    ? ? A C   1585 A G   1610 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1684 hydrog ? ? A  C   1584 N4    ? ? ? 1_555 A  G   1609 O6    ? ? A C   1585 A G   1610 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1685 hydrog ? ? A  C   1584 O2    ? ? ? 1_555 A  G   1609 N2    ? ? A C   1585 A G   1610 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1686 hydrog ? ? A  G   1585 N1    ? ? ? 1_555 A  C   1608 N3    ? ? A G   1586 A C   1609 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1687 hydrog ? ? A  G   1585 N2    ? ? ? 1_555 A  C   1608 O2    ? ? A G   1586 A C   1609 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1688 hydrog ? ? A  G   1585 O6    ? ? ? 1_555 A  C   1608 N4    ? ? A G   1586 A C   1609 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1689 hydrog ? ? A  U   1586 N3    ? ? ? 1_555 A  G   1607 O6    ? ? A U   1587 A G   1608 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1690 hydrog ? ? A  U   1586 O2    ? ? ? 1_555 A  G   1607 N1    ? ? A U   1587 A G   1608 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1691 hydrog ? ? A  G   1587 N2    ? ? ? 1_555 A  A   1606 N7    ? ? A G   1588 A A   1607 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1692 hydrog ? ? A  G   1587 N3    ? ? ? 1_555 A  A   1606 N6    ? ? A G   1588 A A   1607 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1693 hydrog ? ? A  G   1588 N2    ? ? ? 1_555 A  A   1605 N7    ? ? A G   1589 A A   1606 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1694 hydrog ? ? A  A   1589 N6    ? ? ? 1_555 A  G   1604 N3    ? ? A A   1590 A G   1605 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1695 hydrog ? ? A  A   1589 N7    ? ? ? 1_555 A  G   1604 N2    ? ? A A   1590 A G   1605 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1696 hydrog ? ? A  G   1591 N1    ? ? ? 1_555 A  C   1601 N3    ? ? A G   1592 A C   1602 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1697 hydrog ? ? A  G   1591 N2    ? ? ? 1_555 A  C   1601 O2    ? ? A G   1592 A C   1602 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1698 hydrog ? ? A  G   1591 O6    ? ? ? 1_555 A  C   1601 N4    ? ? A G   1592 A C   1602 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1699 hydrog ? ? A  C   1592 N3    ? ? ? 1_555 A  G   1600 N1    ? ? A C   1593 A G   1601 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1700 hydrog ? ? A  C   1592 N4    ? ? ? 1_555 A  G   1600 O6    ? ? A C   1593 A G   1601 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1701 hydrog ? ? A  C   1592 O2    ? ? ? 1_555 A  G   1600 N2    ? ? A C   1593 A G   1601 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1702 hydrog ? ? A  C   1593 N3    ? ? ? 1_555 A  G   1599 N1    ? ? A C   1594 A G   1600 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1703 hydrog ? ? A  C   1593 N4    ? ? ? 1_555 A  G   1599 O6    ? ? A C   1594 A G   1600 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1704 hydrog ? ? A  C   1593 O2    ? ? ? 1_555 A  G   1599 N2    ? ? A C   1594 A G   1600 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1705 hydrog ? ? A  A   1596 N6    ? ? ? 1_555 A  G   1646 N3    ? ? A A   1597 A G   1647 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1706 hydrog ? ? A  G   1627 N1    ? ? ? 1_555 A  C   1632 N3    ? ? A G   1628 A C   1633 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1707 hydrog ? ? A  G   1627 N2    ? ? ? 1_555 A  C   1632 O2    ? ? A G   1628 A C   1633 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1708 hydrog ? ? A  G   1627 O6    ? ? ? 1_555 A  C   1632 N4    ? ? A G   1628 A C   1633 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1709 hydrog ? ? A  G   1628 N2    ? ? ? 1_555 A  A   1631 N7    ? ? A G   1629 A A   1632 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1710 hydrog ? ? A  G   1628 N1    ? ? ? 1_555 A  C   1632 N3    ? ? A G   1629 A C   1633 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1711 hydrog ? ? A  C   1650 N3    ? ? ? 1_555 A  G   1654 N1    ? ? A C   1651 A G   1655 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1712 hydrog ? ? A  C   1650 N4    ? ? ? 1_555 A  G   1654 O6    ? ? A C   1651 A G   1655 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1713 hydrog ? ? A  C   1650 O2    ? ? ? 1_555 A  G   1654 N2    ? ? A C   1651 A G   1655 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1714 hydrog ? ? A  A   1681 N6    ? ? ? 1_555 A  U   1695 O2    ? ? A A   1682 A U   1696 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1715 hydrog ? ? A  A   1681 N7    ? ? ? 1_555 A  U   1695 N3    ? ? A A   1682 A U   1696 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1716 hydrog ? ? A  A   1683 N6    ? ? ? 1_555 A  U   1721 O4    ? ? A A   1684 A U   1722 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog1717 hydrog ? ? A  A   1683 N7    ? ? ? 1_555 A  U   1721 N3    ? ? A A   1684 A U   1722 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog1718 hydrog ? ? A  C   1685 N3    ? ? ? 1_555 A  G   1694 N1    ? ? A C   1686 A G   1695 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1719 hydrog ? ? A  C   1685 N4    ? ? ? 1_555 A  G   1694 O6    ? ? A C   1686 A G   1695 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1720 hydrog ? ? A  C   1685 O2    ? ? ? 1_555 A  G   1694 N2    ? ? A C   1686 A G   1695 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1721 hydrog ? ? A  C   1686 N3    ? ? ? 1_555 A  G   1693 N1    ? ? A C   1687 A G   1694 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1722 hydrog ? ? A  C   1686 N4    ? ? ? 1_555 A  G   1693 O6    ? ? A C   1687 A G   1694 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1723 hydrog ? ? A  C   1686 O2    ? ? ? 1_555 A  G   1693 N2    ? ? A C   1687 A G   1694 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1724 hydrog ? ? A  G   1702 N1    ? ? ? 1_555 A  C   1714 N3    ? ? A G   1703 A C   1715 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1725 hydrog ? ? A  G   1702 N2    ? ? ? 1_555 A  C   1714 O2    ? ? A G   1703 A C   1715 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1726 hydrog ? ? A  G   1702 O6    ? ? ? 1_555 A  C   1714 N4    ? ? A G   1703 A C   1715 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1727 hydrog ? ? A  G   1703 N1    ? ? ? 1_555 A  C   1713 N3    ? ? A G   1704 A C   1714 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1728 hydrog ? ? A  G   1703 N2    ? ? ? 1_555 A  C   1713 O2    ? ? A G   1704 A C   1714 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1729 hydrog ? ? A  G   1703 O6    ? ? ? 1_555 A  C   1713 N4    ? ? A G   1704 A C   1714 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1730 hydrog ? ? A  C   1704 N3    ? ? ? 1_555 A  G   1712 N1    ? ? A C   1705 A G   1713 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1731 hydrog ? ? A  C   1704 N4    ? ? ? 1_555 A  G   1712 O6    ? ? A C   1705 A G   1713 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1732 hydrog ? ? A  C   1704 O2    ? ? ? 1_555 A  G   1712 N2    ? ? A C   1705 A G   1713 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1733 hydrog ? ? A  G   1705 N2    ? ? ? 1_555 A  A   1711 N7    ? ? A G   1706 A A   1712 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1734 hydrog ? ? A  G   1705 N3    ? ? ? 1_555 A  A   1711 N6    ? ? A G   1706 A A   1712 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1735 hydrog ? ? A  G   1706 N2    ? ? ? 1_555 A  A   1710 N7    ? ? A G   1707 A A   1711 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1736 hydrog ? ? A  C   1724 N3    ? ? ? 1_555 A  G   2049 N1    ? ? A C   1725 A G   2050 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1737 hydrog ? ? A  C   1724 N4    ? ? ? 1_555 A  G   2049 O6    ? ? A C   1725 A G   2050 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1738 hydrog ? ? A  C   1724 O2    ? ? ? 1_555 A  G   2049 N2    ? ? A C   1725 A G   2050 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1739 hydrog ? ? A  G   1725 N1    ? ? ? 1_555 A  C   2048 N3    ? ? A G   1726 A C   2049 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1740 hydrog ? ? A  G   1725 N2    ? ? ? 1_555 A  C   2048 O2    ? ? A G   1726 A C   2049 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1741 hydrog ? ? A  G   1725 O6    ? ? ? 1_555 A  C   2048 N4    ? ? A G   1726 A C   2049 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1742 hydrog ? ? A  G   1726 N1    ? ? ? 1_555 A  C   2047 N3    ? ? A G   1727 A C   2048 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1743 hydrog ? ? A  G   1726 N2    ? ? ? 1_555 A  C   2047 O2    ? ? A G   1727 A C   2048 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1744 hydrog ? ? A  G   1726 O6    ? ? ? 1_555 A  C   2047 N4    ? ? A G   1727 A C   2048 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1745 hydrog ? ? A  G   1727 N1    ? ? ? 1_555 A  C   2046 N3    ? ? A G   1728 A C   2047 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1746 hydrog ? ? A  G   1727 N2    ? ? ? 1_555 A  C   2046 O2    ? ? A G   1728 A C   2047 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1747 hydrog ? ? A  G   1727 O6    ? ? ? 1_555 A  C   2046 N4    ? ? A G   1728 A C   2047 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1748 hydrog ? ? A  A   1732 N6    ? ? ? 1_555 A  G   2045 N3    ? ? A A   1733 A G   2046 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1749 hydrog ? ? A  A   1732 N7    ? ? ? 1_555 A  G   2045 N2    ? ? A A   1733 A G   2046 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1750 hydrog ? ? A  C   1733 N3    ? ? ? 1_555 A  G   2044 N1    ? ? A C   1734 A G   2045 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1751 hydrog ? ? A  C   1733 N4    ? ? ? 1_555 A  G   2044 O6    ? ? A C   1734 A G   2045 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1752 hydrog ? ? A  C   1733 O2    ? ? ? 1_555 A  G   2044 N2    ? ? A C   1734 A G   2045 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1753 hydrog ? ? A  C   1734 N3    ? ? ? 1_555 A  G   2043 N1    ? ? A C   1735 A G   2044 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1754 hydrog ? ? A  C   1734 N4    ? ? ? 1_555 A  G   2043 O6    ? ? A C   1735 A G   2044 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1755 hydrog ? ? A  C   1734 O2    ? ? ? 1_555 A  G   2043 N2    ? ? A C   1735 A G   2044 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1756 hydrog ? ? A  A   1735 N1    ? ? ? 1_555 A  U   2042 N3    ? ? A A   1736 A U   2043 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1757 hydrog ? ? A  A   1735 N6    ? ? ? 1_555 A  U   2042 O4    ? ? A A   1736 A U   2043 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1758 hydrog ? ? A  A   1736 N1    ? ? ? 1_555 A  U   2041 N3    ? ? A A   1737 A U   2042 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1759 hydrog ? ? A  A   1736 N6    ? ? ? 1_555 A  U   2041 O4    ? ? A A   1737 A U   2042 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1760 hydrog ? ? A  C   1737 N3    ? ? ? 1_555 A  G   2040 N1    ? ? A C   1738 A G   2041 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1761 hydrog ? ? A  C   1737 N4    ? ? ? 1_555 A  G   2040 O6    ? ? A C   1738 A G   2041 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1762 hydrog ? ? A  C   1737 O2    ? ? ? 1_555 A  G   2040 N2    ? ? A C   1738 A G   2041 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1763 hydrog ? ? A  G   1738 N1    ? ? ? 1_555 A  C   2039 N3    ? ? A G   1739 A C   2040 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1764 hydrog ? ? A  G   1738 N2    ? ? ? 1_555 A  C   2039 O2    ? ? A G   1739 A C   2040 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1765 hydrog ? ? A  G   1738 O6    ? ? ? 1_555 A  C   2039 N4    ? ? A G   1739 A C   2040 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1766 hydrog ? ? A  U   1739 N3    ? ? ? 1_555 A  A   2038 N1    ? ? A U   1740 A A   2039 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1767 hydrog ? ? A  U   1739 O4    ? ? ? 1_555 A  A   2038 N6    ? ? A U   1740 A A   2039 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1768 hydrog ? ? A  U   1740 N3    ? ? ? 1_555 A  A   2037 N1    ? ? A U   1741 A A   2038 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1769 hydrog ? ? A  U   1740 O4    ? ? ? 1_555 A  A   2037 N6    ? ? A U   1741 A A   2038 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1770 hydrog ? ? A  U   1740 N3    ? ? ? 1_555 A  A   2038 N1    ? ? A U   1741 A A   2039 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1771 hydrog ? ? A  U   1740 O4    ? ? ? 1_555 A  A   2038 N6    ? ? A U   1741 A A   2039 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1772 hydrog ? ? A  A   1741 N6    ? ? ? 1_555 A  G   2032 O6    ? ? A A   1742 A G   2033 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1773 hydrog ? ? A  A   1741 N1    ? ? ? 1_555 A  C   2036 N4    ? ? A A   1742 A C   2037 1_555 ? ? ? ? ? ? TYPE_26_PAIR ? ? 
hydrog1774 hydrog ? ? A  A   1741 N6    ? ? ? 1_555 A  C   2036 N3    ? ? A A   1742 A C   2037 1_555 ? ? ? ? ? ? TYPE_26_PAIR ? ? 
hydrog1775 hydrog ? ? A  G   1742 N1    ? ? ? 1_555 A  C   2035 N3    ? ? A G   1743 A C   2036 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1776 hydrog ? ? A  G   1742 N2    ? ? ? 1_555 A  C   2035 O2    ? ? A G   1743 A C   2036 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1777 hydrog ? ? A  G   1742 O6    ? ? ? 1_555 A  C   2035 N4    ? ? A G   1743 A C   2036 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1778 hydrog ? ? A  G   1743 N1    ? ? ? 1_555 A  C   2034 N3    ? ? A G   1744 A C   2035 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1779 hydrog ? ? A  G   1743 N2    ? ? ? 1_555 A  C   2034 O2    ? ? A G   1744 A C   2035 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1780 hydrog ? ? A  G   1743 O6    ? ? ? 1_555 A  C   2034 N4    ? ? A G   1744 A C   2035 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1781 hydrog ? ? A  G   1744 N2    ? ? ? 1_555 A  U   2033 O4    ? ? A G   1745 A U   2034 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1782 hydrog ? ? A  A   1745 N6    ? ? ? 1_555 A  U   2031 O2    ? ? A A   1746 A U   2032 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1783 hydrog ? ? A  A   1745 N7    ? ? ? 1_555 A  U   2031 N3    ? ? A A   1746 A U   2032 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1784 hydrog ? ? A  A   1746 N1    ? ? ? 1_555 A  U   2033 N3    ? ? A A   1747 A U   2034 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1785 hydrog ? ? A  A   1746 N6    ? ? ? 1_555 A  U   2033 O4    ? ? A A   1747 A U   2034 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1786 hydrog ? ? A  G   1751 N1    ? ? ? 1_555 A  C   2030 N3    ? ? A G   1752 A C   2031 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1787 hydrog ? ? A  G   1751 N2    ? ? ? 1_555 A  C   2030 O2    ? ? A G   1752 A C   2031 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1788 hydrog ? ? A  G   1751 O6    ? ? ? 1_555 A  C   2030 N4    ? ? A G   1752 A C   2031 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1789 hydrog ? ? A  G   1759 N1    ? ? ? 1_555 A  U   1783 O2    ? ? A G   1760 A U   1784 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1790 hydrog ? ? A  G   1759 O6    ? ? ? 1_555 A  U   1783 N3    ? ? A G   1760 A U   1784 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1791 hydrog ? ? A  U   1760 N3    ? ? ? 1_555 A  A   1782 N1    ? ? A U   1761 A A   1783 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1792 hydrog ? ? A  U   1760 O4    ? ? ? 1_555 A  A   1782 N6    ? ? A U   1761 A A   1783 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1793 hydrog ? ? A  C   1761 N3    ? ? ? 1_555 A  G   1781 N1    ? ? A C   1762 A G   1782 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1794 hydrog ? ? A  C   1761 N4    ? ? ? 1_555 A  G   1781 O6    ? ? A C   1762 A G   1782 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1795 hydrog ? ? A  C   1761 O2    ? ? ? 1_555 A  G   1781 N2    ? ? A C   1762 A G   1782 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1796 hydrog ? ? A  C   1762 N3    ? ? ? 1_555 A  G   1780 N1    ? ? A C   1763 A G   1781 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1797 hydrog ? ? A  C   1762 N4    ? ? ? 1_555 A  G   1780 O6    ? ? A C   1763 A G   1781 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1798 hydrog ? ? A  C   1762 O2    ? ? ? 1_555 A  G   1780 N2    ? ? A C   1763 A G   1781 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1799 hydrog ? ? A  C   1763 N3    ? ? ? 1_555 A  G   1779 N1    ? ? A C   1764 A G   1780 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1800 hydrog ? ? A  C   1763 N4    ? ? ? 1_555 A  G   1779 O6    ? ? A C   1764 A G   1780 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1801 hydrog ? ? A  C   1763 O2    ? ? ? 1_555 A  G   1779 N2    ? ? A C   1764 A G   1780 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1802 hydrog ? ? A  G   1764 N2    ? ? ? 1_555 A  A   1778 N7    ? ? A G   1765 A A   1779 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1803 hydrog ? ? A  G   1764 N3    ? ? ? 1_555 A  A   1778 N6    ? ? A G   1765 A A   1779 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1804 hydrog ? ? A  A   1766 N6    ? ? ? 1_555 A  A   1775 N7    ? ? A A   1767 A A   1776 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1805 hydrog ? ? A  A   1766 N7    ? ? ? 1_555 A  A   1775 N6    ? ? A A   1767 A A   1776 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1806 hydrog ? ? A  C   1767 N4    ? ? ? 1_555 A  A   1774 N3    ? ? A C   1768 A A   1775 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog1807 hydrog ? ? A  C   1768 N3    ? ? ? 1_555 A  G   1773 N1    ? ? A C   1769 A G   1774 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1808 hydrog ? ? A  C   1768 N4    ? ? ? 1_555 A  G   1773 O6    ? ? A C   1769 A G   1774 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1809 hydrog ? ? A  C   1768 O2    ? ? ? 1_555 A  G   1773 N2    ? ? A C   1769 A G   1774 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1810 hydrog ? ? A  U   1769 O2    ? ? ? 1_555 A  G   1772 N1    ? ? A U   1770 A G   1773 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog1811 hydrog ? ? A  U   1770 N3    ? ? ? 1_555 A  A   1884 N1    ? ? A U   1771 A A   1885 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1812 hydrog ? ? A  U   1770 O4    ? ? ? 1_555 A  A   1884 N6    ? ? A U   1771 A A   1885 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1813 hydrog ? ? A  G   1784 N1    ? ? ? 1_555 A  U   1806 O2    ? ? A G   1785 A U   1807 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1814 hydrog ? ? A  G   1784 O6    ? ? ? 1_555 A  U   1806 N3    ? ? A G   1785 A U   1807 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1815 hydrog ? ? A  C   1785 N3    ? ? ? 1_555 A  G   1805 N1    ? ? A C   1786 A G   1806 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1816 hydrog ? ? A  C   1785 N4    ? ? ? 1_555 A  G   1805 O6    ? ? A C   1786 A G   1806 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1817 hydrog ? ? A  C   1785 O2    ? ? ? 1_555 A  G   1805 N2    ? ? A C   1786 A G   1806 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1818 hydrog ? ? A  C   1786 N3    ? ? ? 1_555 A  G   1804 N1    ? ? A C   1787 A G   1805 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1819 hydrog ? ? A  C   1786 N4    ? ? ? 1_555 A  G   1804 O6    ? ? A C   1787 A G   1805 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1820 hydrog ? ? A  C   1786 O2    ? ? ? 1_555 A  G   1804 N2    ? ? A C   1787 A G   1805 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1821 hydrog ? ? A  U   1787 N3    ? ? ? 1_555 A  A   1803 N1    ? ? A U   1788 A A   1804 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1822 hydrog ? ? A  U   1787 O4    ? ? ? 1_555 A  A   1803 N6    ? ? A U   1788 A A   1804 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1823 hydrog ? ? A  G   1788 N1    ? ? ? 1_555 A  C   1802 N3    ? ? A G   1789 A C   1803 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1824 hydrog ? ? A  G   1788 N2    ? ? ? 1_555 A  C   1802 O2    ? ? A G   1789 A C   1803 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1825 hydrog ? ? A  G   1788 O6    ? ? ? 1_555 A  C   1802 N4    ? ? A G   1789 A C   1803 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1826 hydrog ? ? A  C   1789 N3    ? ? ? 1_555 A  G   1801 N1    ? ? A C   1790 A G   1802 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1827 hydrog ? ? A  C   1789 N4    ? ? ? 1_555 A  G   1801 O6    ? ? A C   1790 A G   1802 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1828 hydrog ? ? A  C   1789 O2    ? ? ? 1_555 A  G   1801 N2    ? ? A C   1790 A G   1802 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1829 hydrog ? ? A  U   1790 N3    ? ? ? 1_555 A  A   1800 N1    ? ? A U   1791 A A   1801 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1830 hydrog ? ? A  U   1790 O4    ? ? ? 1_555 A  A   1800 N6    ? ? A U   1791 A A   1801 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1831 hydrog ? ? A  C   1791 N3    ? ? ? 1_555 A  G   1799 N1    ? ? A C   1792 A G   1800 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1832 hydrog ? ? A  C   1791 N4    ? ? ? 1_555 A  G   1799 O6    ? ? A C   1792 A G   1800 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1833 hydrog ? ? A  C   1791 O2    ? ? ? 1_555 A  G   1799 N2    ? ? A C   1792 A G   1800 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1834 hydrog ? ? A  C   1792 N3    ? ? ? 1_555 A  G   1798 N1    ? ? A C   1793 A G   1799 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1835 hydrog ? ? A  C   1792 N4    ? ? ? 1_555 A  G   1798 O6    ? ? A C   1793 A G   1799 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1836 hydrog ? ? A  C   1792 O2    ? ? ? 1_555 A  G   1798 N2    ? ? A C   1793 A G   1799 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1837 hydrog ? ? A  G   1793 N2    ? ? ? 1_555 A  A   1796 N7    ? ? A G   1794 A A   1797 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1838 hydrog ? ? A  G   1804 N2    ? ? ? 1_555 A  A   2874 N3    ? ? A G   1805 A A   2875 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1839 hydrog ? ? A  G   1805 N2    ? ? ? 1_555 A  A   2882 N3    ? ? A G   1806 A A   2883 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1840 hydrog ? ? A  C   1807 N3    ? ? ? 1_555 A  G   1811 N1    ? ? A C   1808 A G   1812 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1841 hydrog ? ? A  C   1807 N4    ? ? ? 1_555 A  G   1811 O6    ? ? A C   1808 A G   1812 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1842 hydrog ? ? A  C   1807 O2    ? ? ? 1_555 A  G   1811 N2    ? ? A C   1808 A G   1812 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1843 hydrog ? ? A  C   1809 N4    ? ? ? 1_555 A  C   2751 O2    ? ? A C   1810 A C   2752 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1844 hydrog ? ? A  A   1810 N1    ? ? ? 1_555 A  G   2730 N2    ? ? A A   1811 A G   2731 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog1845 hydrog ? ? A  A   1810 N6    ? ? ? 1_555 A  G   2730 N3    ? ? A A   1811 A G   2731 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog1846 hydrog ? ? A  U   1812 O2    ? ? ? 1_555 A  U   1816 N3    ? ? A U   1813 A U   1817 1_555 ? ? ? ? ? ? 'U-U MISPAIR' ? 
? 
hydrog1847 hydrog ? ? A  U   1812 N3    ? ? ? 1_555 A  C   1817 O2    ? ? A U   1813 A C   1818 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog1848 hydrog ? ? A  G   1819 N1    ? ? ? 1_555 A  C   2028 N3    ? ? A G   1820 A C   2029 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1849 hydrog ? ? A  G   1819 N2    ? ? ? 1_555 A  C   2028 O2    ? ? A G   1820 A C   2029 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1850 hydrog ? ? A  G   1819 O6    ? ? ? 1_555 A  C   2028 N4    ? ? A G   1820 A C   2029 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1851 hydrog ? ? A  A   1820 N1    ? ? ? 1_555 A  U   2027 N3    ? ? A A   1821 A U   2028 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1852 hydrog ? ? A  A   1820 N6    ? ? ? 1_555 A  U   2027 O4    ? ? A A   1821 A U   2028 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1853 hydrog ? ? A  A   1820 N1    ? ? ? 1_555 A  C   2028 N4    ? ? A A   1821 A C   2029 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog1854 hydrog ? ? A  A   1821 N1    ? ? ? 1_555 A  U   2026 N3    ? ? A A   1822 A U   2027 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1855 hydrog ? ? A  A   1821 N6    ? ? ? 1_555 A  U   2026 O4    ? ? A A   1822 A U   2027 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1856 hydrog ? ? A  G   1822 N1    ? ? ? 1_555 A  C   2025 N3    ? ? A G   1823 A C   2026 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1857 hydrog ? ? A  G   1822 N2    ? ? ? 1_555 A  C   2025 O2    ? ? A G   1823 A C   2026 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1858 hydrog ? ? A  G   1822 O6    ? ? ? 1_555 A  C   2025 N4    ? ? A G   1823 A C   2026 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1859 hydrog ? ? A  C   1823 N3    ? ? ? 1_555 A  G   2024 N1    ? ? A C   1824 A G   2025 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1860 hydrog ? ? A  C   1823 N4    ? ? ? 1_555 A  G   2024 O6    ? ? A C   1824 A G   2025 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1861 hydrog ? ? A  C   1823 O2    ? ? ? 1_555 A  G   2024 N2    ? ? A C   1824 A G   2025 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1862 hydrog ? ? A  U   1824 N3    ? ? ? 1_555 A  A   2023 N1    ? ? A U   1825 A A   2024 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1863 hydrog ? ? A  U   1824 O4    ? ? ? 1_555 A  A   2023 N6    ? ? A U   1825 A A   2024 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1864 hydrog ? ? A  U   1824 N3    ? ? ? 1_555 A  G   2024 O6    ? ? A U   1825 A G   2025 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1865 hydrog ? ? A  U   1824 O2    ? ? ? 1_555 A  G   2024 N1    ? ? A U   1825 A G   2025 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1866 hydrog ? ? A  C   1825 N3    ? ? ? 1_555 A  G   2022 N1    ? ? A C   1826 A G   2023 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1867 hydrog ? ? A  C   1825 N4    ? ? ? 1_555 A  G   2022 O6    ? ? A C   1826 A G   2023 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1868 hydrog ? ? A  C   1825 O2    ? ? ? 1_555 A  G   2022 N2    ? ? A C   1826 A G   2023 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1869 hydrog ? ? A  G   1826 N1    ? ? ? 1_555 A  C   2020 N3    ? ? A G   1827 A C   2021 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1870 hydrog ? ? A  G   1826 N2    ? ? ? 1_555 A  C   2020 O2    ? ? A G   1827 A C   2021 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1871 hydrog ? ? A  G   1826 O6    ? ? ? 1_555 A  C   2020 N4    ? ? A G   1827 A C   2021 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1872 hydrog ? ? A  G   1827 N1    ? ? ? 1_555 A  C   2019 N3    ? ? A G   1828 A C   2020 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1873 hydrog ? ? A  G   1827 N2    ? ? ? 1_555 A  C   2019 O2    ? ? A G   1828 A C   2020 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1874 hydrog ? ? A  G   1827 O6    ? ? ? 1_555 A  C   2019 N4    ? ? A G   1828 A C   2020 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1875 hydrog ? ? A  A   1828 N3    ? ? ? 1_555 A  A   2017 N6    ? ? A A   1829 A A   2018 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog1876 hydrog ? ? A  C   1829 N4    ? ? ? 1_555 A  U   1845 O2    ? ? A C   1830 A U   1846 1_555 ? ? ? ? ? ? 'C-U MISPAIR' ? 
? 
hydrog1877 hydrog ? ? A  G   1831 N1    ? ? ? 1_555 A  C   1843 N3    ? ? A G   1832 A C   1844 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1878 hydrog ? ? A  G   1831 N2    ? ? ? 1_555 A  C   1843 O2    ? ? A G   1832 A C   1844 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1879 hydrog ? ? A  G   1831 O6    ? ? ? 1_555 A  C   1843 N4    ? ? A G   1832 A C   1844 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1880 hydrog ? ? A  U   1832 N3    ? ? ? 1_555 A  A   1842 N1    ? ? A U   1833 A A   1843 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1881 hydrog ? ? A  U   1832 O4    ? ? ? 1_555 A  A   1842 N6    ? ? A U   1833 A A   1843 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1882 hydrog ? ? A  C   1833 O2    ? ? ? 1_555 A  C   1840 N4    ? ? A C   1834 A C   1841 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1883 hydrog ? ? A  U   1834 O4    ? ? ? 1_555 A  C   1840 N4    ? ? A U   1835 A C   1841 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog1884 hydrog ? ? A  U   1837 N3    ? ? ? 1_555 A  U   2620 O4    ? ? A U   1838 A U   2621 1_555 ? ? ? ? ? ? TYPE_12_PAIR ? ? 
hydrog1885 hydrog ? ? A  U   1837 O4    ? ? ? 1_555 A  U   2620 N3    ? ? A U   1838 A U   2621 1_555 ? ? ? ? ? ? TYPE_12_PAIR ? ? 
hydrog1886 hydrog ? ? A  A   1838 N3    ? ? ? 1_555 A  G   2641 N2    ? ? A A   1839 A G   2642 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1887 hydrog ? ? A  C   1840 O2    ? ? ? 1_555 A  G   2622 N2    ? ? A C   1841 A G   2623 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog1888 hydrog ? ? A  A   1846 N6    ? ? ? 1_555 A  G   1883 N3    ? ? A A   1847 A G   1884 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1889 hydrog ? ? A  A   1846 N7    ? ? ? 1_555 A  G   1883 N2    ? ? A A   1847 A G   1884 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1890 hydrog ? ? A  G   1847 N1    ? ? ? 1_555 A  U   1882 O2    ? ? A G   1848 A U   1883 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1891 hydrog ? ? A  G   1847 O6    ? ? ? 1_555 A  U   1882 N3    ? ? A G   1848 A U   1883 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1892 hydrog ? ? A  G   1848 N1    ? ? ? 1_555 A  C   1881 N3    ? ? A G   1849 A C   1882 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1893 hydrog ? ? A  G   1848 N2    ? ? ? 1_555 A  C   1881 O2    ? ? A G   1849 A C   1882 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1894 hydrog ? ? A  G   1848 O6    ? ? ? 1_555 A  C   1881 N4    ? ? A G   1849 A C   1882 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1895 hydrog ? ? A  U   1849 N3    ? ? ? 1_555 A  A   1880 N1    ? ? A U   1850 A A   1881 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1896 hydrog ? ? A  U   1849 O4    ? ? ? 1_555 A  A   1880 N6    ? ? A U   1850 A A   1881 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1897 hydrog ? ? A  G   1850 N1    ? ? ? 1_555 A  C   1879 N3    ? ? A G   1851 A C   1880 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1898 hydrog ? ? A  G   1850 N2    ? ? ? 1_555 A  C   1879 O2    ? ? A G   1851 A C   1880 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1899 hydrog ? ? A  G   1850 O6    ? ? ? 1_555 A  C   1879 N4    ? ? A G   1851 A C   1880 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1900 hydrog ? ? A  A   1851 N1    ? ? ? 1_555 A  U   1878 N3    ? ? A A   1852 A U   1879 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1901 hydrog ? ? A  A   1851 N6    ? ? ? 1_555 A  U   1878 O4    ? ? A A   1852 A U   1879 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1902 hydrog ? ? A  C   1852 N3    ? ? ? 1_555 A  G   1877 N1    ? ? A C   1853 A G   1878 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1903 hydrog ? ? A  C   1852 N4    ? ? ? 1_555 A  G   1877 O6    ? ? A C   1853 A G   1878 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1904 hydrog ? ? A  C   1852 O2    ? ? ? 1_555 A  G   1877 N2    ? ? A C   1853 A G   1878 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1905 hydrog ? ? A  C   1853 N3    ? ? ? 1_555 A  G   1876 N1    ? ? A C   1854 A G   1877 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1906 hydrog ? ? A  C   1853 N4    ? ? ? 1_555 A  G   1876 O6    ? ? A C   1854 A G   1877 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1907 hydrog ? ? A  C   1853 O2    ? ? ? 1_555 A  G   1876 N2    ? ? A C   1854 A G   1877 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1908 hydrog ? ? A  C   1853 N3    ? ? ? 1_555 A  G   1877 N1    ? ? A C   1854 A G   1878 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1909 hydrog ? ? A  C   1853 N4    ? ? ? 1_555 A  G   1877 O6    ? ? A C   1854 A G   1878 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1910 hydrog ? ? A  C   1853 O2    ? ? ? 1_555 A  G   1877 N2    ? ? A C   1854 A G   1878 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1911 hydrog ? ? A  G   1854 N2    ? ? ? 1_555 A  U   1873 O2    ? ? A G   1855 A U   1874 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1912 hydrog ? ? A  C   1855 N3    ? ? ? 1_555 A  G   1872 N2    ? ? A C   1856 A G   1873 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog1913 hydrog ? ? A  C   1855 O2    ? ? ? 1_555 A  G   1872 N1    ? ? A C   1856 A G   1873 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog1914 hydrog ? ? A  C   1855 N4    ? ? ? 1_555 A  A   1874 N7    ? ? A C   1856 A A   1875 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog1915 hydrog ? ? A  A   1856 N6    ? ? ? 1_555 A  U   2245 O2    ? ? A A   1857 A U   2246 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1916 hydrog ? ? A  A   1857 N6    ? ? ? 1_555 A  U   1870 O4    ? ? A A   1858 A U   1871 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1917 hydrog ? ? A  A   1858 N6    ? ? ? 1_555 A  C   1869 O2    ? ? A A   1859 A C   1870 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog1918 hydrog ? ? A  A   1858 N3    ? ? ? 1_555 A  G   1877 N2    ? ? A A   1859 A G   1878 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1919 hydrog ? ? A  U   1859 N3    ? ? ? 1_555 A  A   1868 N1    ? ? A U   1860 A A   1869 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1920 hydrog ? ? A  U   1859 O4    ? ? ? 1_555 A  A   1868 N6    ? ? A U   1860 A A   1869 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1921 hydrog ? ? A  C   1860 N3    ? ? ? 1_555 A  G   1867 N1    ? ? A C   1861 A G   1868 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1922 hydrog ? ? A  C   1860 N4    ? ? ? 1_555 A  G   1867 O6    ? ? A C   1861 A G   1868 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1923 hydrog ? ? A  C   1860 O2    ? ? ? 1_555 A  G   1867 N2    ? ? A C   1861 A G   1868 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1924 hydrog ? ? A  C   1861 N3    ? ? ? 1_555 A  G   1866 N1    ? ? A C   1862 A G   1867 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1925 hydrog ? ? A  C   1861 N4    ? ? ? 1_555 A  G   1866 O6    ? ? A C   1862 A G   1867 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1926 hydrog ? ? A  C   1861 O2    ? ? ? 1_555 A  G   1866 N2    ? ? A C   1862 A G   1867 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1927 hydrog ? ? A  G   1862 N2    ? ? ? 1_555 A  A   1865 N7    ? ? A G   1863 A A   1866 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1928 hydrog ? ? A  A   1884 N6    ? ? ? 1_555 A  U   2016 O2    ? ? A A   1885 A U   2017 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1929 hydrog ? ? A  A   1885 N6    ? ? ? 1_555 A  U   2015 O2    ? ? A A   1886 A U   2016 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1930 hydrog ? ? A  U   1886 N3    ? ? ? 1_555 A  A   2014 N1    ? ? A U   1887 A A   2015 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1931 hydrog ? ? A  U   1886 O4    ? ? ? 1_555 A  A   2014 N6    ? ? A U   1887 A A   2015 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1932 hydrog ? ? A  C   1887 N3    ? ? ? 1_555 A  G   2013 N1    ? ? A C   1888 A G   2014 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1933 hydrog ? ? A  C   1887 N4    ? ? ? 1_555 A  G   2013 O6    ? ? A C   1888 A G   2014 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1934 hydrog ? ? A  C   1887 O2    ? ? ? 1_555 A  G   2013 N2    ? ? A C   1888 A G   2014 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1935 hydrog ? ? A  C   1888 N3    ? ? ? 1_555 A  G   2012 N1    ? ? A C   1889 A G   2013 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1936 hydrog ? ? A  C   1888 N4    ? ? ? 1_555 A  G   2012 O6    ? ? A C   1889 A G   2013 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1937 hydrog ? ? A  C   1888 O2    ? ? ? 1_555 A  G   2012 N2    ? ? A C   1889 A G   2013 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1938 hydrog ? ? A  U   1889 O4    ? ? ? 1_555 A  A   1940 N6    ? ? A U   1890 A A   1941 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog1939 hydrog ? ? A  U   1889 N3    ? ? ? 1_555 A  A   2010 N7    ? ? A U   1890 A A   2011 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog1940 hydrog ? ? A  U   1889 O4    ? ? ? 1_555 A  A   2010 N6    ? ? A U   1890 A A   2011 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog1941 hydrog ? ? A  G   1890 N1    ? ? ? 1_555 A  C   1945 N3    ? ? A G   1891 A C   1946 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1942 hydrog ? ? A  G   1890 N2    ? ? ? 1_555 A  C   1945 O2    ? ? A G   1891 A C   1946 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1943 hydrog ? ? A  G   1890 O6    ? ? ? 1_555 A  C   1945 N4    ? ? A G   1891 A C   1946 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1944 hydrog ? ? A  C   1891 N3    ? ? ? 1_555 A  G   1944 N1    ? ? A C   1892 A G   1945 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1945 hydrog ? ? A  C   1891 N4    ? ? ? 1_555 A  G   1944 O6    ? ? A C   1892 A G   1945 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1946 hydrog ? ? A  C   1891 O2    ? ? ? 1_555 A  G   1944 N2    ? ? A C   1892 A G   1945 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1947 hydrog ? ? A  C   1892 N3    ? ? ? 1_555 A  G   1943 N1    ? ? A C   1893 A G   1944 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1948 hydrog ? ? A  C   1892 N4    ? ? ? 1_555 A  G   1943 O6    ? ? A C   1893 A G   1944 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1949 hydrog ? ? A  C   1892 O2    ? ? ? 1_555 A  G   1943 N2    ? ? A C   1893 A G   1944 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1950 hydrog ? ? A  C   1893 N3    ? ? ? 1_555 A  A   1941 N6    ? ? A C   1894 A A   1942 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1951 hydrog ? ? A  C   1893 N4    ? ? ? 1_555 A  A   1941 N7    ? ? A C   1894 A A   1942 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1952 hydrog ? ? A  G   1895 N1    ? ? ? 1_555 A  C   1942 N3    ? ? A G   1896 A C   1943 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1953 hydrog ? ? A  G   1895 N2    ? ? ? 1_555 A  C   1942 O2    ? ? A G   1896 A C   1943 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1954 hydrog ? ? A  G   1895 O6    ? ? ? 1_555 A  C   1942 N4    ? ? A G   1896 A C   1943 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1955 hydrog ? ? A  U   1896 N3    ? ? ? 1_555 A  A   1941 N1    ? ? A U   1897 A A   1942 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1956 hydrog ? ? A  U   1896 O4    ? ? ? 1_555 A  A   1941 N6    ? ? A U   1897 A A   1942 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1957 hydrog ? ? A  G   1897 N1    ? ? ? 1_555 A  U   1938 O2    ? ? A G   1898 A U   1939 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1958 hydrog ? ? A  G   1897 O6    ? ? ? 1_555 A  U   1938 N3    ? ? A G   1898 A U   1939 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1959 hydrog ? ? A  C   1898 N3    ? ? ? 1_555 A  G   1937 N1    ? ? A C   1899 A G   1938 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1960 hydrog ? ? A  C   1898 N4    ? ? ? 1_555 A  G   1937 O6    ? ? A C   1899 A G   1938 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1961 hydrog ? ? A  C   1898 O2    ? ? ? 1_555 A  G   1937 N2    ? ? A C   1899 A G   1938 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1962 hydrog ? ? A  A   1899 N1    ? ? ? 1_555 A  U   1936 N3    ? ? A A   1900 A U   1937 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1963 hydrog ? ? A  A   1899 N6    ? ? ? 1_555 A  U   1936 O4    ? ? A A   1900 A U   1937 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1964 hydrog ? ? A  G   1900 N1    ? ? ? 1_555 A  C   1935 N3    ? ? A G   1901 A C   1936 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1965 hydrog ? ? A  G   1900 N2    ? ? ? 1_555 A  C   1935 O2    ? ? A G   1901 A C   1936 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1966 hydrog ? ? A  G   1900 O6    ? ? ? 1_555 A  C   1935 N4    ? ? A G   1901 A C   1936 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1967 hydrog ? ? A  G   1901 N1    ? ? ? 1_555 A  C   1934 N3    ? ? A G   1902 A C   1935 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1968 hydrog ? ? A  G   1901 N2    ? ? ? 1_555 A  C   1934 O2    ? ? A G   1902 A C   1935 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1969 hydrog ? ? A  G   1901 O6    ? ? ? 1_555 A  C   1934 N4    ? ? A G   1902 A C   1935 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1970 hydrog ? ? A  U   1902 O2    ? ? ? 1_555 A  A   1933 N6    ? ? A U   1903 A A   1934 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog1971 hydrog ? ? A  U   1904 N3    ? ? ? 1_555 A  A   1933 N1    ? ? A U   1905 A A   1934 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1972 hydrog ? ? A  U   1904 O4    ? ? ? 1_555 A  A   1933 N6    ? ? A U   1905 A A   1934 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1973 hydrog ? ? A  C   1905 N3    ? ? ? 1_555 A  G   1932 N1    ? ? A C   1906 A G   1933 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1974 hydrog ? ? A  C   1905 N4    ? ? ? 1_555 A  G   1932 O6    ? ? A C   1906 A G   1933 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1975 hydrog ? ? A  C   1905 O2    ? ? ? 1_555 A  G   1932 N2    ? ? A C   1906 A G   1933 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1976 hydrog ? ? A  U   1906 N3    ? ? ? 1_555 A  G   1931 O6    ? ? A U   1907 A G   1932 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1977 hydrog ? ? A  U   1906 O2    ? ? ? 1_555 A  G   1931 N1    ? ? A U   1907 A G   1932 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1978 hydrog ? ? A  G   1907 N2    ? ? ? 1_555 A  A   1930 N7    ? ? A G   1908 A A   1931 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1979 hydrog ? ? A  G   1907 N3    ? ? ? 1_555 A  A   1930 N6    ? ? A G   1908 A A   1931 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1980 hydrog ? ? A  A   1909 N3    ? ? ? 1_555 A  G   2127 N2    ? ? A A   1910 A G   2128 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1981 hydrog ? ? A  A   1911 N6    ? ? ? 1_555 A  A   1926 N1    ? ? A A   1912 A A   1927 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog1982 hydrog ? ? A  C   1912 N3    ? ? ? 1_555 A  G   1925 N1    ? ? A C   1913 A G   1926 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1983 hydrog ? ? A  C   1912 N4    ? ? ? 1_555 A  G   1925 O6    ? ? A C   1913 A G   1926 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1984 hydrog ? ? A  C   1912 O2    ? ? ? 1_555 A  G   1925 N2    ? ? A C   1913 A G   1926 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1985 hydrog ? ? A  C   1913 N3    ? ? ? 1_555 A  G   1924 N1    ? ? A C   1914 A G   1925 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1986 hydrog ? ? A  C   1913 N4    ? ? ? 1_555 A  G   1924 O6    ? ? A C   1914 A G   1925 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1987 hydrog ? ? A  C   1913 O2    ? ? ? 1_555 A  G   1924 N2    ? ? A C   1914 A G   1925 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1988 hydrog ? ? A  U   1914 N3    ? ? ? 1_555 A  A   1923 N1    ? ? A U   1915 A A   1924 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1989 hydrog ? ? A  U   1914 O4    ? ? ? 1_555 A  A   1923 N6    ? ? A U   1915 A A   1924 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1990 hydrog ? ? A  C   1915 N3    ? ? ? 1_555 A  G   1922 N1    ? ? A C   1916 A G   1923 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1991 hydrog ? ? A  C   1915 N4    ? ? ? 1_555 A  G   1922 O6    ? ? A C   1916 A G   1923 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1992 hydrog ? ? A  C   1915 O2    ? ? ? 1_555 A  G   1922 N2    ? ? A C   1916 A G   1923 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1993 hydrog ? ? A  G   1916 N2    ? ? ? 1_555 A  A   1921 N7    ? ? A G   1917 A A   1922 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1994 hydrog ? ? A  A   1920 N1    ? ? ? 1_555 A  G   2448 N2    ? ? A A   1921 A G   2449 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog1995 hydrog ? ? A  A   1920 N6    ? ? ? 1_555 A  G   2448 N3    ? ? A A   1921 A G   2449 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog1996 hydrog ? ? A  A   1930 N3    ? ? ? 1_555 A  G   2266 N2    ? ? A A   1931 A G   2267 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1997 hydrog ? ? A  C   1939 O2    ? ? ? 1_555 A  C   1942 N4    ? ? A C   1940 A C   1943 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1998 hydrog ? ? A  G   1944 N2    ? ? ? 1_555 A  A   1968 N3    ? ? A G   1945 A A   1969 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1999 hydrog ? ? A  G   1946 N1    ? ? ? 1_555 A  C   1964 N3    ? ? A G   1947 A C   1965 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2000 hydrog ? ? A  G   1946 N2    ? ? ? 1_555 A  C   1964 O2    ? ? A G   1947 A C   1965 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2001 hydrog ? ? A  G   1946 O6    ? ? ? 1_555 A  C   1964 N4    ? ? A G   1947 A C   1965 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2002 hydrog ? ? A  G   1947 N1    ? ? ? 1_555 A  U   1963 O2    ? ? A G   1948 A U   1964 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2003 hydrog ? ? A  G   1947 O6    ? ? ? 1_555 A  U   1963 N3    ? ? A G   1948 A U   1964 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2004 hydrog ? ? A  U   1965 N3    ? ? ? 1_555 A  G   1969 O6    ? ? A U   1966 A G   1970 1_555 ? ? ? ? ? ? TYPE_27_PAIR ? ? 
hydrog2005 hydrog ? ? A  U   1965 O4    ? ? ? 1_555 A  G   1969 N1    ? ? A U   1966 A G   1970 1_555 ? ? ? ? ? ? TYPE_27_PAIR ? ? 
hydrog2006 hydrog ? ? A  G   1970 N2    ? ? ? 1_555 A  U   1971 O4    ? ? A G   1971 A U   1972 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2007 hydrog ? ? A  U   1971 N3    ? ? ? 1_555 A  A   2009 N7    ? ? A U   1972 A A   2010 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2008 hydrog ? ? A  U   1971 O2    ? ? ? 1_555 A  A   2009 N6    ? ? A U   1972 A A   2010 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2009 hydrog ? ? A  A   1972 N6    ? ? ? 1_555 A  G   2008 N3    ? ? A A   1973 A G   2009 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2010 hydrog ? ? A  A   1972 N7    ? ? ? 1_555 A  G   2008 N2    ? ? A A   1973 A G   2009 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2011 hydrog ? ? A  G   1973 N1    ? ? ? 1_555 A  U   2007 O2    ? ? A G   1974 A U   2008 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2012 hydrog ? ? A  G   1973 O6    ? ? ? 1_555 A  U   2007 N3    ? ? A G   1974 A U   2008 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2013 hydrog ? ? A  C   1974 N3    ? ? ? 1_555 A  G   2004 N1    ? ? A C   1975 A G   2005 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2014 hydrog ? ? A  C   1974 N4    ? ? ? 1_555 A  G   2004 O6    ? ? A C   1975 A G   2005 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2015 hydrog ? ? A  C   1974 O2    ? ? ? 1_555 A  G   2004 N2    ? ? A C   1975 A G   2005 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2016 hydrog ? ? A  U   1976 N3    ? ? ? 1_555 A  U   1983 O4    ? ? A U   1977 A U   1984 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2017 hydrog ? ? A  U   1976 O2    ? ? ? 1_555 A  U   1983 N3    ? ? A U   1977 A U   1984 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2018 hydrog ? ? A  A   1977 N1    ? ? ? 1_555 A  G   2004 N2    ? ? A A   1978 A G   2005 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2019 hydrog ? ? A  A   1980 N3    ? ? ? 1_555 A  C   1982 N4    ? ? A A   1981 A C   1983 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog2020 hydrog ? ? A  G   1985 N1    ? ? ? 1_555 A  C   2001 N3    ? ? A G   1986 A C   2002 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2021 hydrog ? ? A  G   1985 N2    ? ? ? 1_555 A  C   2001 O2    ? ? A G   1986 A C   2002 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2022 hydrog ? ? A  G   1985 O6    ? ? ? 1_555 A  C   2001 N4    ? ? A G   1986 A C   2002 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2023 hydrog ? ? A  C   1986 N3    ? ? ? 1_555 A  G   2000 N1    ? ? A C   1987 A G   2001 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2024 hydrog ? ? A  C   1986 N4    ? ? ? 1_555 A  G   2000 O6    ? ? A C   1987 A G   2001 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2025 hydrog ? ? A  C   1986 O2    ? ? ? 1_555 A  G   2000 N2    ? ? A C   1987 A G   2001 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2026 hydrog ? ? A  C   1987 N3    ? ? ? 1_555 A  G   1999 N1    ? ? A C   1988 A G   2000 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2027 hydrog ? ? A  C   1987 N4    ? ? ? 1_555 A  G   1999 O6    ? ? A C   1988 A G   2000 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2028 hydrog ? ? A  C   1987 O2    ? ? ? 1_555 A  G   1999 N2    ? ? A C   1988 A G   2000 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2029 hydrog ? ? A  G   1988 N1    ? ? ? 1_555 A  C   1998 N3    ? ? A G   1989 A C   1999 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2030 hydrog ? ? A  G   1988 N2    ? ? ? 1_555 A  C   1998 O2    ? ? A G   1989 A C   1999 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2031 hydrog ? ? A  G   1988 O6    ? ? ? 1_555 A  C   1998 N4    ? ? A G   1989 A C   1999 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2032 hydrog ? ? A  C   1989 N3    ? ? ? 1_555 A  G   1997 N1    ? ? A C   1990 A G   1998 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2033 hydrog ? ? A  C   1989 N4    ? ? ? 1_555 A  G   1997 O6    ? ? A C   1990 A G   1998 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2034 hydrog ? ? A  C   1989 O2    ? ? ? 1_555 A  G   1997 N2    ? ? A C   1990 A G   1998 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2035 hydrog ? ? A  A   1993 N3    ? ? ? 1_555 A  G   2583 N2    ? ? A A   1994 A G   2584 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2036 hydrog ? ? A  U   1995 O4    ? ? ? 1_555 A  C   2590 N4    ? ? A U   1996 A C   2591 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog2037 hydrog ? ? A  A   2009 N3    ? ? ? 1_555 A  G   2012 N2    ? ? A A   2010 A G   2013 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2038 hydrog ? ? A  G   2032 N1    ? ? ? 1_555 A  C   2036 O2    ? ? A G   2033 A C   2037 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog2039 hydrog ? ? A  G   2040 N2    ? ? ? 1_555 A  U   2725 O4    ? ? A G   2041 A U   2726 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2040 hydrog ? ? A  A   2053 N1    ? ? ? 1_555 A  U   2647 N3    ? ? A A   2054 A U   2648 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2041 hydrog ? ? A  A   2053 N6    ? ? ? 1_555 A  U   2647 O2    ? ? A A   2054 A U   2648 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2042 hydrog ? ? A  A   2059 N1    ? ? ? 1_555 A  U   2075 N3    ? ? A A   2060 A U   2076 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2043 hydrog ? ? A  A   2059 N6    ? ? ? 1_555 A  U   2075 O4    ? ? A A   2060 A U   2076 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2044 hydrog ? ? A  C   2060 N3    ? ? ? 1_555 A  G   2074 N1    ? ? A C   2061 A G   2075 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2045 hydrog ? ? A  C   2060 N4    ? ? ? 1_555 A  G   2074 O6    ? ? A C   2061 A G   2075 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2046 hydrog ? ? A  C   2060 O2    ? ? ? 1_555 A  G   2074 N2    ? ? A C   2061 A G   2075 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2047 hydrog ? ? A  U   2062 N3    ? ? ? 1_555 A  A   2082 N3    ? ? A U   2063 A A   2083 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2048 hydrog ? ? A  U   2063 N3    ? ? ? 1_555 A  A   2080 N1    ? ? A U   2064 A A   2081 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2049 hydrog ? ? A  U   2063 O4    ? ? ? 1_555 A  A   2080 N6    ? ? A U   2064 A A   2081 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2050 hydrog ? ? A  C   2064 N3    ? ? ? 1_555 A  G   2079 N1    ? ? A C   2065 A G   2080 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2051 hydrog ? ? A  C   2064 N4    ? ? ? 1_555 A  G   2079 O6    ? ? A C   2065 A G   2080 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2052 hydrog ? ? A  C   2064 O2    ? ? ? 1_555 A  G   2079 N2    ? ? A C   2065 A G   2080 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2053 hydrog ? ? A  C   2065 N3    ? ? ? 1_555 A  G   2078 N1    ? ? A C   2066 A G   2079 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2054 hydrog ? ? A  C   2065 N4    ? ? ? 1_555 A  G   2078 O6    ? ? A C   2066 A G   2079 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2055 hydrog ? ? A  C   2065 O2    ? ? ? 1_555 A  G   2078 N2    ? ? A C   2066 A G   2079 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2056 hydrog ? ? A  A   2066 N1    ? ? ? 1_555 A  U   2077 N3    ? ? A A   2067 A U   2078 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2057 hydrog ? ? A  A   2066 N6    ? ? ? 1_555 A  U   2077 O4    ? ? A A   2067 A U   2078 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2058 hydrog ? ? A  G   2067 N1    ? ? ? 1_555 A  C   2076 N3    ? ? A G   2068 A C   2077 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2059 hydrog ? ? A  G   2067 N2    ? ? ? 1_555 A  C   2076 O2    ? ? A G   2068 A C   2077 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2060 hydrog ? ? A  G   2067 O6    ? ? ? 1_555 A  C   2076 N4    ? ? A G   2068 A C   2077 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2061 hydrog ? ? A  U   2068 N3    ? ? ? 1_555 A  A   2073 N7    ? ? A U   2069 A A   2074 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2062 hydrog ? ? A  U   2068 O2    ? ? ? 1_555 A  A   2073 N6    ? ? A U   2069 A A   2074 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2063 hydrog ? ? A  G   2071 N2    ? ? ? 1_555 A  A   2489 N3    ? ? A G   2072 A A   2490 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2064 hydrog ? ? A  C   2083 N3    ? ? ? 1_555 A  G   2659 N1    ? ? A C   2084 A G   2660 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2065 hydrog ? ? A  C   2083 N4    ? ? ? 1_555 A  G   2659 O6    ? ? A C   2084 A G   2660 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2066 hydrog ? ? A  C   2083 O2    ? ? ? 1_555 A  G   2659 N2    ? ? A C   2084 A G   2660 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2067 hydrog ? ? A  A   2084 N1    ? ? ? 1_555 A  U   2658 N3    ? ? A A   2085 A U   2659 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2068 hydrog ? ? A  A   2084 N6    ? ? ? 1_555 A  U   2658 O4    ? ? A A   2085 A U   2659 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2069 hydrog ? ? A  C   2085 N3    ? ? ? 1_555 A  G   2657 N1    ? ? A C   2086 A G   2658 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2070 hydrog ? ? A  C   2085 N4    ? ? ? 1_555 A  G   2657 O6    ? ? A C   2086 A G   2658 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2071 hydrog ? ? A  C   2085 O2    ? ? ? 1_555 A  G   2657 N2    ? ? A C   2086 A G   2658 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2072 hydrog ? ? A  C   2086 N3    ? ? ? 1_555 A  G   2656 N1    ? ? A C   2087 A G   2657 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2073 hydrog ? ? A  C   2086 N4    ? ? ? 1_555 A  G   2656 O6    ? ? A C   2087 A G   2657 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2074 hydrog ? ? A  C   2086 O2    ? ? ? 1_555 A  G   2656 N2    ? ? A C   2087 A G   2657 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2075 hydrog ? ? A  C   2087 N3    ? ? ? 1_555 A  G   2655 N1    ? ? A C   2088 A G   2656 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2076 hydrog ? ? A  C   2087 N4    ? ? ? 1_555 A  G   2655 O6    ? ? A C   2088 A G   2656 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2077 hydrog ? ? A  C   2087 O2    ? ? ? 1_555 A  G   2655 N2    ? ? A C   2088 A G   2656 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2078 hydrog ? ? A  C   2087 O2    ? ? ? 1_555 A  A   2839 N6    ? ? A C   2088 A A   2840 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2079 hydrog ? ? A  A   2088 N1    ? ? ? 1_555 A  U   2654 N3    ? ? A A   2089 A U   2655 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2080 hydrog ? ? A  A   2088 N6    ? ? ? 1_555 A  U   2654 O4    ? ? A A   2089 A U   2655 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2081 hydrog ? ? A  G   2089 N1    ? ? ? 1_555 A  C   2653 N3    ? ? A G   2090 A C   2654 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2082 hydrog ? ? A  G   2089 N2    ? ? ? 1_555 A  C   2653 O2    ? ? A G   2090 A C   2654 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2083 hydrog ? ? A  G   2089 O6    ? ? ? 1_555 A  C   2653 N4    ? ? A G   2090 A C   2654 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2084 hydrog ? ? A  G   2090 N1    ? ? ? 1_555 A  A   2652 N1    ? ? A G   2091 A A   2653 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2085 hydrog ? ? A  G   2090 O6    ? ? ? 1_555 A  A   2652 N6    ? ? A G   2091 A A   2653 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2086 hydrog ? ? A  G   2090 N2    ? ? ? 1_555 A  C   2653 O2    ? ? A G   2091 A C   2654 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog2087 hydrog ? ? A  G   2091 N2    ? ? ? 1_555 A  G   2092 O6    ? ? A G   2092 A G   2093 1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog2088 hydrog ? ? A  G   2091 N2    ? ? ? 1_555 A  U   2651 O4    ? ? A G   2092 A U   2652 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2089 hydrog ? ? A  G   2092 N1    ? ? ? 1_555 A  U   2651 O2    ? ? A G   2093 A U   2652 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2090 hydrog ? ? A  G   2092 O6    ? ? ? 1_555 A  U   2651 N3    ? ? A G   2093 A U   2652 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2091 hydrog ? ? A  G   2093 N1    ? ? ? 1_555 A  C   2650 N3    ? ? A G   2094 A C   2651 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2092 hydrog ? ? A  G   2093 N2    ? ? ? 1_555 A  C   2650 O2    ? ? A G   2094 A C   2651 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2093 hydrog ? ? A  G   2093 O6    ? ? ? 1_555 A  C   2650 N4    ? ? A G   2094 A C   2651 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2094 hydrog ? ? A  A   2094 N6    ? ? ? 1_555 A  A   2611 N1    ? ? A A   2095 A A   2612 1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
hydrog2095 hydrog ? ? A  A   2094 N7    ? ? ? 1_555 A  A   2611 N6    ? ? A A   2095 A A   2612 1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
hydrog2096 hydrog ? ? A  A   2094 N1    ? ? ? 1_555 A  U   2649 N3    ? ? A A   2095 A U   2650 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2097 hydrog ? ? A  A   2094 N6    ? ? ? 1_555 A  U   2649 O4    ? ? A A   2095 A U   2650 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2098 hydrog ? ? A  G   2096 N1    ? ? ? 1_555 A  C   2646 N3    ? ? A G   2097 A C   2647 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2099 hydrog ? ? A  G   2096 N2    ? ? ? 1_555 A  C   2646 O2    ? ? A G   2097 A C   2647 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2100 hydrog ? ? A  G   2096 O6    ? ? ? 1_555 A  C   2646 N4    ? ? A G   2097 A C   2647 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2101 hydrog ? ? A  C   2097 N3    ? ? ? 1_555 A  G   2645 N1    ? ? A C   2098 A G   2646 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2102 hydrog ? ? A  C   2097 N4    ? ? ? 1_555 A  G   2645 O6    ? ? A C   2098 A G   2646 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2103 hydrog ? ? A  C   2097 O2    ? ? ? 1_555 A  G   2645 N2    ? ? A C   2098 A G   2646 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2104 hydrog ? ? A  G   2101 O6    ? ? ? 1_555 A  A   2485 N6    ? ? A G   2102 A A   2486 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2105 hydrog ? ? A  C   2103 N3    ? ? ? 1_555 A  A   2484 N6    ? ? A C   2104 A A   2485 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2106 hydrog ? ? A  C   2103 N4    ? ? ? 1_555 A  C   2535 O2    ? ? A C   2104 A C   2536 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog2107 hydrog ? ? A  C   2104 N3    ? ? ? 1_555 A  G   2480 N1    ? ? A C   2105 A G   2481 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2108 hydrog ? ? A  C   2104 N4    ? ? ? 1_555 A  G   2480 O6    ? ? A C   2105 A G   2481 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2109 hydrog ? ? A  C   2104 O2    ? ? ? 1_555 A  G   2480 N2    ? ? A C   2105 A G   2481 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2110 hydrog ? ? A  C   2105 N3    ? ? ? 1_555 A  G   2479 N1    ? ? A C   2106 A G   2480 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2111 hydrog ? ? A  C   2105 N4    ? ? ? 1_555 A  G   2479 O6    ? ? A C   2106 A G   2480 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2112 hydrog ? ? A  C   2105 O2    ? ? ? 1_555 A  G   2479 N2    ? ? A C   2106 A G   2480 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2113 hydrog ? ? A  U   2106 N3    ? ? ? 1_555 A  A   2478 N1    ? ? A U   2107 A A   2479 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2114 hydrog ? ? A  U   2106 O4    ? ? ? 1_555 A  A   2478 N6    ? ? A U   2107 A A   2479 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2115 hydrog ? ? A  A   2107 N1    ? ? ? 1_555 A  U   2477 N3    ? ? A A   2108 A U   2478 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2116 hydrog ? ? A  A   2107 N6    ? ? ? 1_555 A  U   2477 O4    ? ? A A   2108 A U   2478 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2117 hydrog ? ? A  U   2108 N3    ? ? ? 1_555 A  A   2466 N1    ? ? A U   2109 A A   2467 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2118 hydrog ? ? A  U   2108 O2    ? ? ? 1_555 A  A   2466 N6    ? ? A U   2109 A A   2467 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2119 hydrog ? ? A  G   2109 N1    ? ? ? 1_555 A  C   2476 N3    ? ? A G   2110 A C   2477 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2120 hydrog ? ? A  G   2109 N2    ? ? ? 1_555 A  C   2476 O2    ? ? A G   2110 A C   2477 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2121 hydrog ? ? A  G   2109 O6    ? ? ? 1_555 A  C   2476 N4    ? ? A G   2110 A C   2477 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2122 hydrog ? ? A  G   2110 N1    ? ? ? 1_555 A  C   2475 N3    ? ? A G   2111 A C   2476 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2123 hydrog ? ? A  G   2110 N2    ? ? ? 1_555 A  C   2475 O2    ? ? A G   2111 A C   2476 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2124 hydrog ? ? A  G   2110 O6    ? ? ? 1_555 A  C   2475 N4    ? ? A G   2111 A C   2476 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2125 hydrog ? ? A  A   2111 N1    ? ? ? 1_555 A  U   2472 N3    ? ? A A   2112 A U   2473 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2126 hydrog ? ? A  A   2111 N6    ? ? ? 1_555 A  U   2472 O4    ? ? A A   2112 A U   2473 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2127 hydrog ? ? A  G   2112 N1    ? ? ? 1_555 A  C   2471 N3    ? ? A G   2113 A C   2472 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2128 hydrog ? ? A  G   2112 N2    ? ? ? 1_555 A  C   2471 O2    ? ? A G   2113 A C   2472 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2129 hydrog ? ? A  G   2112 O6    ? ? ? 1_555 A  C   2471 N4    ? ? A G   2113 A C   2472 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2130 hydrog ? ? A  G   2112 N3    ? ? ? 1_555 A  C   2474 N4    ? ? A G   2113 A C   2475 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog2131 hydrog ? ? A  C   2113 N3    ? ? ? 1_555 A  G   2470 N1    ? ? A C   2114 A G   2471 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2132 hydrog ? ? A  C   2113 N4    ? ? ? 1_555 A  G   2470 O6    ? ? A C   2114 A G   2471 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2133 hydrog ? ? A  C   2113 O2    ? ? ? 1_555 A  G   2470 N2    ? ? A C   2114 A G   2471 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2134 hydrog ? ? A  U   2114 N3    ? ? ? 1_555 A  A   2469 N1    ? ? A U   2115 A A   2470 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2135 hydrog ? ? A  U   2114 O4    ? ? ? 1_555 A  A   2469 N6    ? ? A U   2115 A A   2470 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2136 hydrog ? ? A  U   2114 O2    ? ? ? 1_555 A  G   2631 N2    ? ? A U   2115 A G   2632 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog2137 hydrog ? ? A  U   2115 N3    ? ? ? 1_555 A  A   2117 N7    ? ? A U   2116 A A   2118 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog2138 hydrog ? ? A  U   2115 O4    ? ? ? 1_555 A  A   2117 N6    ? ? A U   2116 A A   2118 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog2139 hydrog ? ? A  A   2117 N6    ? ? ? 1_555 A  G   2270 O6    ? ? A A   2118 A G   2271 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2140 hydrog ? ? A  A   2117 N1    ? ? ? 1_555 A  U   2275 N3    ? ? A A   2118 A U   2276 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2141 hydrog ? ? A  A   2117 N6    ? ? ? 1_555 A  U   2275 O4    ? ? A A   2118 A U   2276 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2142 hydrog ? ? A  C   2118 N4    ? ? ? 1_555 A  G   2270 O6    ? ? A C   2119 A G   2271 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog2143 hydrog ? ? A  C   2118 N3    ? ? ? 1_555 A  G   2274 N1    ? ? A C   2119 A G   2275 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2144 hydrog ? ? A  C   2118 N4    ? ? ? 1_555 A  G   2274 O6    ? ? A C   2119 A G   2275 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2145 hydrog ? ? A  C   2118 O2    ? ? ? 1_555 A  G   2274 N2    ? ? A C   2119 A G   2275 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2146 hydrog ? ? A  U   2119 N3    ? ? ? 1_555 A  A   2273 N1    ? ? A U   2120 A A   2274 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2147 hydrog ? ? A  U   2119 O4    ? ? ? 1_555 A  A   2273 N6    ? ? A U   2120 A A   2274 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2148 hydrog ? ? A  G   2120 N1    ? ? ? 1_555 A  C   2272 N3    ? ? A G   2121 A C   2273 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2149 hydrog ? ? A  G   2120 N2    ? ? ? 1_555 A  C   2272 O2    ? ? A G   2121 A C   2273 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2150 hydrog ? ? A  G   2120 O6    ? ? ? 1_555 A  C   2272 N4    ? ? A G   2121 A C   2273 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2151 hydrog ? ? A  C   2121 N3    ? ? ? 1_555 A  G   2271 N1    ? ? A C   2122 A G   2272 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2152 hydrog ? ? A  C   2121 N4    ? ? ? 1_555 A  G   2271 O6    ? ? A C   2122 A G   2272 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2153 hydrog ? ? A  C   2121 O2    ? ? ? 1_555 A  G   2271 N2    ? ? A C   2122 A G   2272 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2154 hydrog ? ? A  A   2122 N6    ? ? ? 1_555 A  G   2269 N3    ? ? A A   2123 A G   2270 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2155 hydrog ? ? A  A   2122 N7    ? ? ? 1_555 A  G   2269 N2    ? ? A A   2123 A G   2270 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2156 hydrog ? ? A  G   2123 N1    ? ? ? 1_555 A  C   2268 N3    ? ? A G   2124 A C   2269 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2157 hydrog ? ? A  G   2123 N2    ? ? ? 1_555 A  C   2268 O2    ? ? A G   2124 A C   2269 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2158 hydrog ? ? A  G   2123 O6    ? ? ? 1_555 A  C   2268 N4    ? ? A G   2124 A C   2269 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2159 hydrog ? ? A  G   2124 N1    ? ? ? 1_555 A  C   2267 N3    ? ? A G   2125 A C   2268 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2160 hydrog ? ? A  G   2124 N2    ? ? ? 1_555 A  C   2267 O2    ? ? A G   2125 A C   2268 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2161 hydrog ? ? A  G   2124 O6    ? ? ? 1_555 A  C   2267 N4    ? ? A G   2125 A C   2268 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2162 hydrog ? ? A  C   2125 N3    ? ? ? 1_555 A  G   2266 N1    ? ? A C   2126 A G   2267 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2163 hydrog ? ? A  C   2125 N4    ? ? ? 1_555 A  G   2266 O6    ? ? A C   2126 A G   2267 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2164 hydrog ? ? A  C   2125 O2    ? ? ? 1_555 A  G   2266 N2    ? ? A C   2126 A G   2267 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2165 hydrog ? ? A  U   2126 N3    ? ? ? 1_555 A  A   2265 N1    ? ? A U   2127 A A   2266 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2166 hydrog ? ? A  U   2126 O4    ? ? ? 1_555 A  A   2265 N6    ? ? A U   2127 A A   2266 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2167 hydrog ? ? A  G   2127 N1    ? ? ? 1_555 A  U   2264 O2    ? ? A G   2128 A U   2265 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2168 hydrog ? ? A  G   2127 O6    ? ? ? 1_555 A  U   2264 N3    ? ? A G   2128 A U   2265 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2169 hydrog ? ? A  U   2128 N3    ? ? ? 1_555 A  A   2263 N1    ? ? A U   2129 A A   2264 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2170 hydrog ? ? A  U   2128 O4    ? ? ? 1_555 A  A   2263 N6    ? ? A U   2129 A A   2264 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2171 hydrog ? ? A  C   2129 N3    ? ? ? 1_555 A  G   2262 N1    ? ? A C   2130 A G   2263 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2172 hydrog ? ? A  C   2129 N4    ? ? ? 1_555 A  G   2262 O6    ? ? A C   2130 A G   2263 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2173 hydrog ? ? A  C   2129 O2    ? ? ? 1_555 A  G   2262 N2    ? ? A C   2130 A G   2263 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2174 hydrog ? ? A  G   2130 N1    ? ? ? 1_555 A  C   2261 N3    ? ? A G   2131 A C   2262 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2175 hydrog ? ? A  G   2130 N2    ? ? ? 1_555 A  C   2261 O2    ? ? A G   2131 A C   2262 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2176 hydrog ? ? A  G   2130 O6    ? ? ? 1_555 A  C   2261 N4    ? ? A G   2131 A C   2262 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2177 hydrog ? ? A  C   2131 O2    ? ? ? 1_555 A  C   2260 N4    ? ? A C   2132 A C   2261 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog2178 hydrog ? ? A  U   2132 O4    ? ? ? 1_555 A  A   2259 N6    ? ? A U   2133 A A   2260 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2179 hydrog ? ? A  G   2133 N1    ? ? ? 1_555 A  C   2240 N3    ? ? A G   2134 A C   2241 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2180 hydrog ? ? A  G   2133 N2    ? ? ? 1_555 A  C   2240 O2    ? ? A G   2134 A C   2241 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2181 hydrog ? ? A  G   2133 O6    ? ? ? 1_555 A  C   2240 N4    ? ? A G   2134 A C   2241 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2182 hydrog ? ? A  A   2134 N1    ? ? ? 1_555 A  U   2239 N3    ? ? A A   2135 A U   2240 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2183 hydrog ? ? A  A   2134 N6    ? ? ? 1_555 A  U   2239 O4    ? ? A A   2135 A U   2240 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2184 hydrog ? ? A  G   2135 N1    ? ? ? 1_555 A  C   2238 N3    ? ? A G   2136 A C   2239 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog2185 hydrog ? ? A  U   2241 N3    ? ? ? 1_555 A  A   2257 N7    ? ? A U   2242 A A   2258 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2186 hydrog ? ? A  U   2241 O2    ? ? ? 1_555 A  A   2257 N6    ? ? A U   2242 A A   2258 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2187 hydrog ? ? A  A   2243 N6    ? ? ? 1_555 A  G   2256 N3    ? ? A A   2244 A G   2257 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2188 hydrog ? ? A  A   2243 N7    ? ? ? 1_555 A  G   2256 N2    ? ? A A   2244 A G   2257 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2189 hydrog ? ? A  C   2244 N3    ? ? ? 1_555 A  G   2255 N1    ? ? A C   2245 A G   2256 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2190 hydrog ? ? A  C   2244 N4    ? ? ? 1_555 A  G   2255 O6    ? ? A C   2245 A G   2256 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2191 hydrog ? ? A  C   2244 O2    ? ? ? 1_555 A  G   2255 N2    ? ? A C   2245 A G   2256 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2192 hydrog ? ? A  U   2245 N3    ? ? ? 1_555 A  A   2254 N1    ? ? A U   2246 A A   2255 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2193 hydrog ? ? A  U   2245 O4    ? ? ? 1_555 A  A   2254 N6    ? ? A U   2246 A A   2255 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2194 hydrog ? ? A  C   2246 N3    ? ? ? 1_555 A  G   2253 N1    ? ? A C   2247 A G   2254 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2195 hydrog ? ? A  C   2246 N4    ? ? ? 1_555 A  G   2253 O6    ? ? A C   2247 A G   2254 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2196 hydrog ? ? A  C   2246 O2    ? ? ? 1_555 A  G   2253 N2    ? ? A C   2247 A G   2254 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2197 hydrog ? ? A  C   2247 N3    ? ? ? 1_555 A  G   2252 N1    ? ? A C   2248 A G   2253 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2198 hydrog ? ? A  C   2247 N4    ? ? ? 1_555 A  G   2252 O6    ? ? A C   2248 A G   2253 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2199 hydrog ? ? A  C   2247 O2    ? ? ? 1_555 A  G   2252 N2    ? ? A C   2248 A G   2253 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2200 hydrog ? ? A  G   2248 N2    ? ? ? 1_555 A  A   2251 N7    ? ? A G   2249 A A   2252 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2201 hydrog ? ? A  U   2276 N3    ? ? ? 1_555 A  A   2469 N7    ? ? A U   2277 A A   2470 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog2202 hydrog ? ? A  U   2276 O4    ? ? ? 1_555 A  A   2469 N6    ? ? A U   2277 A A   2470 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog2203 hydrog ? ? A  U   2277 N3    ? ? ? 1_555 A  G   2470 N7    ? ? A U   2278 A G   2471 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog2204 hydrog ? ? A  G   2278 N1    ? ? ? 1_555 A  C   2291 N3    ? ? A G   2279 A C   2292 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2205 hydrog ? ? A  G   2278 N2    ? ? ? 1_555 A  C   2291 O2    ? ? A G   2279 A C   2292 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2206 hydrog ? ? A  G   2278 O6    ? ? ? 1_555 A  C   2291 N4    ? ? A G   2279 A C   2292 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2207 hydrog ? ? A  A   2279 N1    ? ? ? 1_555 A  U   2289 N3    ? ? A A   2280 A U   2290 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2208 hydrog ? ? A  A   2279 N6    ? ? ? 1_555 A  U   2289 O4    ? ? A A   2280 A U   2290 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2209 hydrog ? ? A  C   2280 N3    ? ? ? 1_555 A  G   2288 N1    ? ? A C   2281 A G   2289 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2210 hydrog ? ? A  C   2280 N4    ? ? ? 1_555 A  G   2288 O6    ? ? A C   2281 A G   2289 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2211 hydrog ? ? A  C   2280 O2    ? ? ? 1_555 A  G   2288 N2    ? ? A C   2281 A G   2289 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2212 hydrog ? ? A  G   2287 N1    ? ? ? 1_555 A  C   2308 N3    ? ? A G   2288 A C   2309 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2213 hydrog ? ? A  G   2287 N2    ? ? ? 1_555 A  C   2308 O2    ? ? A G   2288 A C   2309 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2214 hydrog ? ? A  G   2287 O6    ? ? ? 1_555 A  C   2308 N4    ? ? A G   2288 A C   2309 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2215 hydrog ? ? A  G   2288 N2    ? ? ? 1_555 A  A   2290 N1    ? ? A G   2289 A A   2291 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2216 hydrog ? ? A  G   2292 N1    ? ? ? 1_555 A  C   2314 N3    ? ? A G   2293 A C   2315 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2217 hydrog ? ? A  G   2292 N2    ? ? ? 1_555 A  C   2314 O2    ? ? A G   2293 A C   2315 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2218 hydrog ? ? A  G   2292 O6    ? ? ? 1_555 A  C   2314 N4    ? ? A G   2293 A C   2315 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2219 hydrog ? ? A  C   2293 N3    ? ? ? 1_555 A  G   2313 N1    ? ? A C   2294 A G   2314 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2220 hydrog ? ? A  C   2293 N4    ? ? ? 1_555 A  G   2313 O6    ? ? A C   2294 A G   2314 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2221 hydrog ? ? A  C   2293 O2    ? ? ? 1_555 A  G   2313 N2    ? ? A C   2294 A G   2314 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2222 hydrog ? ? A  G   2294 N1    ? ? ? 1_555 A  C   2312 N3    ? ? A G   2295 A C   2313 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2223 hydrog ? ? A  G   2294 N2    ? ? ? 1_555 A  C   2312 O2    ? ? A G   2295 A C   2313 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2224 hydrog ? ? A  G   2294 O6    ? ? ? 1_555 A  C   2312 N4    ? ? A G   2295 A C   2313 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2225 hydrog ? ? A  G   2294 N2    ? ? ? 1_555 A  A   2360 N3    ? ? A G   2295 A A   2361 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2226 hydrog ? ? A  C   2295 N3    ? ? ? 1_555 A  G   2311 N1    ? ? A C   2296 A G   2312 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2227 hydrog ? ? A  C   2295 N4    ? ? ? 1_555 A  G   2311 O6    ? ? A C   2296 A G   2312 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2228 hydrog ? ? A  C   2295 O2    ? ? ? 1_555 A  G   2311 N2    ? ? A C   2296 A G   2312 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2229 hydrog ? ? A  U   2296 N3    ? ? ? 1_555 A  A   2310 N1    ? ? A U   2297 A A   2311 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2230 hydrog ? ? A  U   2296 O4    ? ? ? 1_555 A  A   2310 N6    ? ? A U   2297 A A   2311 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2231 hydrog ? ? A  C   2297 N3    ? ? ? 1_555 A  G   2309 N1    ? ? A C   2298 A G   2310 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2232 hydrog ? ? A  C   2297 N4    ? ? ? 1_555 A  G   2309 O6    ? ? A C   2298 A G   2310 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2233 hydrog ? ? A  C   2297 O2    ? ? ? 1_555 A  G   2309 N2    ? ? A C   2298 A G   2310 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2234 hydrog ? ? A  G   2298 N2    ? ? ? 1_555 A  U   2307 O4    ? ? A G   2299 A U   2308 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2235 hydrog ? ? A  A   2299 N6    ? ? ? 1_555 A  A   2306 N7    ? ? A A   2300 A A   2307 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2236 hydrog ? ? A  A   2299 N7    ? ? ? 1_555 A  A   2306 N6    ? ? A A   2300 A A   2307 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2237 hydrog ? ? A  A   2300 N1    ? ? ? 1_555 A  U   2305 N3    ? ? A A   2301 A U   2306 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2238 hydrog ? ? A  A   2300 N6    ? ? ? 1_555 A  U   2305 O2    ? ? A A   2301 A U   2306 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2239 hydrog ? ? A  G   2313 N2    ? ? ? 1_555 A  A   2424 N3    ? ? A G   2314 A A   2425 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2240 hydrog ? ? A  G   2315 N1    ? ? ? 1_555 A  C   2463 N3    ? ? A G   2316 A C   2464 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2241 hydrog ? ? A  G   2315 N2    ? ? ? 1_555 A  C   2463 O2    ? ? A G   2316 A C   2464 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2242 hydrog ? ? A  G   2315 O6    ? ? ? 1_555 A  C   2463 N4    ? ? A G   2316 A C   2464 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2243 hydrog ? ? A  C   2316 N3    ? ? ? 1_555 A  G   2358 N1    ? ? A C   2317 A G   2359 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2244 hydrog ? ? A  C   2316 N4    ? ? ? 1_555 A  G   2358 O6    ? ? A C   2317 A G   2359 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2245 hydrog ? ? A  C   2316 O2    ? ? ? 1_555 A  G   2358 N2    ? ? A C   2317 A G   2359 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2246 hydrog ? ? A  C   2317 N3    ? ? ? 1_555 A  G   2420 N1    ? ? A C   2318 A G   2421 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2247 hydrog ? ? A  C   2317 N4    ? ? ? 1_555 A  G   2420 O6    ? ? A C   2318 A G   2421 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2248 hydrog ? ? A  C   2317 O2    ? ? ? 1_555 A  G   2420 N2    ? ? A C   2318 A G   2421 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2249 hydrog ? ? A  C   2318 N3    ? ? ? 1_555 A  G   2419 N1    ? ? A C   2319 A G   2420 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2250 hydrog ? ? A  C   2318 N4    ? ? ? 1_555 A  G   2419 O6    ? ? A C   2319 A G   2420 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2251 hydrog ? ? A  C   2318 O2    ? ? ? 1_555 A  G   2419 N2    ? ? A C   2319 A G   2420 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2252 hydrog ? ? A  A   2320 N1    ? ? ? 1_555 A  U   2377 N3    ? ? A A   2321 A U   2378 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2253 hydrog ? ? A  A   2320 N6    ? ? ? 1_555 A  U   2377 O2    ? ? A A   2321 A U   2378 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2254 hydrog ? ? A  A   2320 N6    ? ? ? 1_555 A  A   2379 N7    ? ? A A   2321 A A   2380 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2255 hydrog ? ? A  A   2320 N7    ? ? ? 1_555 A  A   2379 N6    ? ? A A   2321 A A   2380 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2256 hydrog ? ? A  U   2321 O2    ? ? ? 1_555 A  G   2420 N2    ? ? A U   2322 A G   2421 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog2257 hydrog ? ? A  G   2322 N1    ? ? ? 1_555 A  U   2376 O2    ? ? A G   2323 A U   2377 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2258 hydrog ? ? A  G   2322 O6    ? ? ? 1_555 A  U   2376 N3    ? ? A G   2323 A U   2377 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2259 hydrog ? ? A  G   2323 N1    ? ? ? 1_555 A  C   2375 N3    ? ? A G   2324 A C   2376 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2260 hydrog ? ? A  G   2323 N2    ? ? ? 1_555 A  C   2375 O2    ? ? A G   2324 A C   2376 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2261 hydrog ? ? A  G   2323 O6    ? ? ? 1_555 A  C   2375 N4    ? ? A G   2324 A C   2376 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2262 hydrog ? ? A  C   2324 N3    ? ? ? 1_555 A  G   2374 N1    ? ? A C   2325 A G   2375 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2263 hydrog ? ? A  C   2324 N4    ? ? ? 1_555 A  G   2374 O6    ? ? A C   2325 A G   2375 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2264 hydrog ? ? A  C   2324 O2    ? ? ? 1_555 A  G   2374 N2    ? ? A C   2325 A G   2375 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2265 hydrog ? ? A  U   2325 N3    ? ? ? 1_555 A  A   2373 N1    ? ? A U   2326 A A   2374 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2266 hydrog ? ? A  U   2325 O4    ? ? ? 1_555 A  A   2373 N6    ? ? A U   2326 A A   2374 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2267 hydrog ? ? A  A   2326 N1    ? ? ? 1_555 A  U   2372 N3    ? ? A A   2327 A U   2373 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2268 hydrog ? ? A  A   2326 N6    ? ? ? 1_555 A  U   2372 O4    ? ? A A   2327 A U   2373 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2269 hydrog ? ? A  U   2327 N3    ? ? ? 1_555 A  A   2371 N1    ? ? A U   2328 A A   2372 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2270 hydrog ? ? A  U   2327 O4    ? ? ? 1_555 A  A   2371 N6    ? ? A U   2328 A A   2372 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2271 hydrog ? ? A  C   2328 N3    ? ? ? 1_555 A  G   2370 N1    ? ? A C   2329 A G   2371 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2272 hydrog ? ? A  C   2328 N4    ? ? ? 1_555 A  G   2370 O6    ? ? A C   2329 A G   2371 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2273 hydrog ? ? A  C   2328 O2    ? ? ? 1_555 A  G   2370 N2    ? ? A C   2329 A G   2371 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2274 hydrog ? ? A  U   2329 N3    ? ? ? 1_555 A  A   2368 N7    ? ? A U   2330 A A   2369 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2275 hydrog ? ? A  U   2329 O2    ? ? ? 1_555 A  A   2368 N6    ? ? A U   2330 A A   2369 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2276 hydrog ? ? A  C   2330 N3    ? ? ? 1_555 A  G   2354 N1    ? ? A C   2331 A G   2355 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2277 hydrog ? ? A  C   2330 N4    ? ? ? 1_555 A  G   2354 O6    ? ? A C   2331 A G   2355 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2278 hydrog ? ? A  C   2330 O2    ? ? ? 1_555 A  G   2354 N2    ? ? A C   2331 A G   2355 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2279 hydrog ? ? A  A   2331 N6    ? ? ? 1_555 A  G   2351 N3    ? ? A A   2332 A G   2352 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2280 hydrog ? ? A  A   2331 N7    ? ? ? 1_555 A  G   2351 N2    ? ? A A   2332 A G   2352 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2281 hydrog ? ? A  G   2332 N1    ? ? ? 1_555 A  C   2350 N3    ? ? A G   2333 A C   2351 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2282 hydrog ? ? A  G   2332 N2    ? ? ? 1_555 A  C   2350 O2    ? ? A G   2333 A C   2351 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2283 hydrog ? ? A  G   2332 O6    ? ? ? 1_555 A  C   2350 N4    ? ? A G   2333 A C   2351 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2284 hydrog ? ? A  C   2333 N3    ? ? ? 1_555 A  G   2349 N1    ? ? A C   2334 A G   2350 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2285 hydrog ? ? A  C   2333 N4    ? ? ? 1_555 A  G   2349 O6    ? ? A C   2334 A G   2350 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2286 hydrog ? ? A  C   2333 O2    ? ? ? 1_555 A  G   2349 N2    ? ? A C   2334 A G   2350 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2287 hydrog ? ? A  C   2334 N3    ? ? ? 1_555 A  G   2348 N1    ? ? A C   2335 A G   2349 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2288 hydrog ? ? A  C   2334 N4    ? ? ? 1_555 A  G   2348 O6    ? ? A C   2335 A G   2349 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2289 hydrog ? ? A  C   2334 O2    ? ? ? 1_555 A  G   2348 N2    ? ? A C   2335 A G   2349 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2290 hydrog ? ? A  G   2335 N1    ? ? ? 1_555 A  C   2347 N3    ? ? A G   2336 A C   2348 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2291 hydrog ? ? A  G   2335 N2    ? ? ? 1_555 A  C   2347 O2    ? ? A G   2336 A C   2348 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2292 hydrog ? ? A  G   2335 O6    ? ? ? 1_555 A  C   2347 N4    ? ? A G   2336 A C   2348 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2293 hydrog ? ? A  G   2336 N1    ? ? ? 1_555 A  C   2346 N3    ? ? A G   2337 A C   2347 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2294 hydrog ? ? A  G   2336 N2    ? ? ? 1_555 A  C   2346 O2    ? ? A G   2337 A C   2347 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2295 hydrog ? ? A  G   2336 O6    ? ? ? 1_555 A  C   2346 N4    ? ? A G   2337 A C   2347 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2296 hydrog ? ? A  G   2337 N1    ? ? ? 1_555 A  C   2345 N3    ? ? A G   2338 A C   2346 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2297 hydrog ? ? A  G   2337 N2    ? ? ? 1_555 A  C   2345 O2    ? ? A G   2338 A C   2346 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2298 hydrog ? ? A  G   2337 O6    ? ? ? 1_555 A  C   2345 N4    ? ? A G   2338 A C   2346 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2299 hydrog ? ? A  A   2355 N1    ? ? ? 1_555 A  A   2368 N6    ? ? A A   2356 A A   2369 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog2300 hydrog ? ? A  A   2355 N6    ? ? ? 1_555 A  A   2368 N1    ? ? A A   2356 A A   2369 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog2301 hydrog ? ? A  G   2356 N1    ? ? ? 1_555 A  C   2365 N3    ? ? A G   2357 A C   2366 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2302 hydrog ? ? A  G   2356 N2    ? ? ? 1_555 A  C   2365 O2    ? ? A G   2357 A C   2366 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2303 hydrog ? ? A  G   2356 O6    ? ? ? 1_555 A  C   2365 N4    ? ? A G   2357 A C   2366 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2304 hydrog ? ? A  U   2357 N3    ? ? ? 1_555 A  G   2364 O6    ? ? A U   2358 A G   2365 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2305 hydrog ? ? A  U   2357 O2    ? ? ? 1_555 A  G   2364 N1    ? ? A U   2358 A G   2365 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2306 hydrog ? ? A  C   2359 O2    ? ? ? 1_555 A  A   2424 N6    ? ? A C   2360 A A   2425 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2307 hydrog ? ? A  C   2359 N3    ? ? ? 1_555 A  G   2425 N1    ? ? A C   2360 A G   2426 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2308 hydrog ? ? A  C   2359 N4    ? ? ? 1_555 A  G   2425 O6    ? ? A C   2360 A G   2426 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2309 hydrog ? ? A  C   2359 O2    ? ? ? 1_555 A  G   2425 N2    ? ? A C   2360 A G   2426 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2310 hydrog ? ? A  A   2361 N1    ? ? ? 1_555 A  U   2423 N3    ? ? A A   2362 A U   2424 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2311 hydrog ? ? A  A   2361 N6    ? ? ? 1_555 A  U   2423 O4    ? ? A A   2362 A U   2424 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2312 hydrog ? ? A  G   2362 N1    ? ? ? 1_555 A  C   2422 N3    ? ? A G   2363 A C   2423 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2313 hydrog ? ? A  G   2362 N2    ? ? ? 1_555 A  C   2422 O2    ? ? A G   2363 A C   2423 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2314 hydrog ? ? A  G   2362 O6    ? ? ? 1_555 A  C   2422 N4    ? ? A G   2363 A C   2423 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2315 hydrog ? ? A  A   2363 N1    ? ? ? 1_555 A  U   2421 N3    ? ? A A   2364 A U   2422 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2316 hydrog ? ? A  A   2363 N6    ? ? ? 1_555 A  U   2421 O4    ? ? A A   2364 A U   2422 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2317 hydrog ? ? A  G   2364 N2    ? ? ? 1_555 A  A   2369 N3    ? ? A G   2365 A A   2370 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2318 hydrog ? ? A  G   2378 O6    ? ? ? 1_555 A  A   2407 N6    ? ? A G   2379 A A   2408 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2319 hydrog ? ? A  C   2380 N3    ? ? ? 1_555 A  G   2406 N1    ? ? A C   2381 A G   2407 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2320 hydrog ? ? A  C   2380 N4    ? ? ? 1_555 A  G   2406 O6    ? ? A C   2381 A G   2407 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2321 hydrog ? ? A  C   2380 O2    ? ? ? 1_555 A  G   2406 N2    ? ? A C   2381 A G   2407 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2322 hydrog ? ? A  A   2381 N1    ? ? ? 1_555 A  U   2405 N3    ? ? A A   2382 A U   2406 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2323 hydrog ? ? A  A   2381 N6    ? ? ? 1_555 A  U   2405 O4    ? ? A A   2382 A U   2406 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2324 hydrog ? ? A  G   2382 N1    ? ? ? 1_555 A  C   2404 N3    ? ? A G   2383 A C   2405 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2325 hydrog ? ? A  G   2382 N2    ? ? ? 1_555 A  C   2404 O2    ? ? A G   2383 A C   2405 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2326 hydrog ? ? A  G   2382 O6    ? ? ? 1_555 A  C   2404 N4    ? ? A G   2383 A C   2405 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2327 hydrog ? ? A  U   2383 N3    ? ? ? 1_555 A  G   2403 O6    ? ? A U   2384 A G   2404 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2328 hydrog ? ? A  U   2383 O2    ? ? ? 1_555 A  G   2403 N1    ? ? A U   2384 A G   2404 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2329 hydrog ? ? A  G   2384 N1    ? ? ? 1_555 A  C   2402 N3    ? ? A G   2385 A C   2403 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2330 hydrog ? ? A  G   2384 N2    ? ? ? 1_555 A  C   2402 O2    ? ? A G   2385 A C   2403 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2331 hydrog ? ? A  G   2384 O6    ? ? ? 1_555 A  C   2402 N4    ? ? A G   2385 A C   2403 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2332 hydrog ? ? A  U   2385 N3    ? ? ? 1_555 A  A   2401 N1    ? ? A U   2386 A A   2402 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2333 hydrog ? ? A  U   2385 O4    ? ? ? 1_555 A  A   2401 N6    ? ? A U   2386 A A   2402 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2334 hydrog ? ? A  U   2386 N3    ? ? ? 1_555 A  A   2400 N1    ? ? A U   2387 A A   2401 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2335 hydrog ? ? A  U   2386 O4    ? ? ? 1_555 A  A   2400 N6    ? ? A U   2387 A A   2401 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2336 hydrog ? ? A  C   2387 N3    ? ? ? 1_555 A  G   2399 N1    ? ? A C   2388 A G   2400 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2337 hydrog ? ? A  C   2387 N4    ? ? ? 1_555 A  G   2399 O6    ? ? A C   2388 A G   2400 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2338 hydrog ? ? A  C   2387 O2    ? ? ? 1_555 A  G   2399 N2    ? ? A C   2388 A G   2400 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2339 hydrog ? ? A  U   2388 N3    ? ? ? 1_555 A  G   2398 O6    ? ? A U   2389 A G   2399 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2340 hydrog ? ? A  U   2388 O2    ? ? ? 1_555 A  G   2398 N1    ? ? A U   2389 A G   2399 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2341 hydrog ? ? A  U   2389 O2    ? ? ? 1_555 A  A   2397 N6    ? ? A U   2390 A A   2398 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2342 hydrog ? ? A  C   2390 N4    ? ? ? 1_555 A  G   2396 N7    ? ? A C   2391 A G   2397 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog2343 hydrog ? ? A  C   2408 N3    ? ? ? 1_555 A  G   2417 N1    ? ? A C   2409 A G   2418 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2344 hydrog ? ? A  C   2408 N4    ? ? ? 1_555 A  G   2417 O6    ? ? A C   2409 A G   2418 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2345 hydrog ? ? A  C   2408 O2    ? ? ? 1_555 A  G   2417 N2    ? ? A C   2409 A G   2418 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2346 hydrog ? ? A  G   2409 N1    ? ? ? 1_555 A  C   2416 N3    ? ? A G   2410 A C   2417 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2347 hydrog ? ? A  G   2409 N2    ? ? ? 1_555 A  C   2416 O2    ? ? A G   2410 A C   2417 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2348 hydrog ? ? A  G   2409 O6    ? ? ? 1_555 A  C   2416 N4    ? ? A G   2410 A C   2417 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2349 hydrog ? ? A  C   2410 N3    ? ? ? 1_555 A  G   2415 N1    ? ? A C   2411 A G   2416 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2350 hydrog ? ? A  C   2410 N4    ? ? ? 1_555 A  G   2415 O6    ? ? A C   2411 A G   2416 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2351 hydrog ? ? A  C   2410 O2    ? ? ? 1_555 A  G   2415 N2    ? ? A C   2411 A G   2416 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2352 hydrog ? ? A  G   2411 N2    ? ? ? 1_555 A  A   2414 N7    ? ? A G   2412 A A   2415 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2353 hydrog ? ? A  C   2426 N4    ? ? ? 1_555 A  G   2461 O6    ? ? A C   2427 A G   2462 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog2354 hydrog ? ? A  G   2427 N2    ? ? ? 1_555 A  G   2465 N3    ? ? A G   2428 A G   2466 1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog2355 hydrog ? ? A  G   2427 N3    ? ? ? 1_555 A  G   2465 N2    ? ? A G   2428 A G   2466 1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog2356 hydrog ? ? A  A   2428 N6    ? ? ? 1_555 A  U   2460 O2    ? ? A A   2429 A U   2461 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2357 hydrog ? ? A  A   2428 N7    ? ? ? 1_555 A  U   2460 N3    ? ? A A   2429 A U   2461 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2358 hydrog ? ? A  A   2429 N6    ? ? ? 1_555 A  A   2459 N1    ? ? A A   2430 A A   2460 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2359 hydrog ? ? A  C   2431 N3    ? ? ? 1_555 A  G   2458 N1    ? ? A C   2432 A G   2459 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2360 hydrog ? ? A  C   2431 N4    ? ? ? 1_555 A  G   2458 O6    ? ? A C   2432 A G   2459 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2361 hydrog ? ? A  C   2431 O2    ? ? ? 1_555 A  G   2458 N2    ? ? A C   2432 A G   2459 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2362 hydrog ? ? A  A   2432 N1    ? ? ? 1_555 A  U   2457 N3    ? ? A A   2433 A U   2458 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2363 hydrog ? ? A  A   2432 N6    ? ? ? 1_555 A  U   2457 O4    ? ? A A   2433 A U   2458 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2364 hydrog ? ? A  A   2433 N1    ? ? ? 1_555 A  U   2456 N3    ? ? A A   2434 A U   2457 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2365 hydrog ? ? A  A   2433 N6    ? ? ? 1_555 A  U   2456 O4    ? ? A A   2434 A U   2457 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2366 hydrog ? ? A  U   2434 N3    ? ? ? 1_555 A  A   2455 N1    ? ? A U   2435 A A   2456 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2367 hydrog ? ? A  U   2434 O4    ? ? ? 1_555 A  A   2455 N6    ? ? A U   2435 A A   2456 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2368 hydrog ? ? A  U   2435 N3    ? ? ? 1_555 A  A   2454 N1    ? ? A U   2436 A A   2455 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2369 hydrog ? ? A  U   2435 O4    ? ? ? 1_555 A  A   2454 N6    ? ? A U   2436 A A   2455 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2370 hydrog ? ? A  G   2437 N1    ? ? ? 1_555 A  C   2453 N3    ? ? A G   2438 A C   2454 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2371 hydrog ? ? A  G   2437 N2    ? ? ? 1_555 A  C   2453 O2    ? ? A G   2438 A C   2454 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2372 hydrog ? ? A  G   2437 O6    ? ? ? 1_555 A  C   2453 N4    ? ? A G   2438 A C   2454 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2373 hydrog ? ? A  C   2438 N3    ? ? ? 1_555 A  G   2452 N1    ? ? A C   2439 A G   2453 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2374 hydrog ? ? A  C   2438 N4    ? ? ? 1_555 A  G   2452 O6    ? ? A C   2439 A G   2453 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2375 hydrog ? ? A  C   2438 O2    ? ? ? 1_555 A  G   2452 N2    ? ? A C   2439 A G   2453 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2376 hydrog ? ? A  C   2439 N3    ? ? ? 1_555 A  G   2451 N1    ? ? A C   2440 A G   2452 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2377 hydrog ? ? A  C   2439 N4    ? ? ? 1_555 A  G   2451 O6    ? ? A C   2440 A G   2452 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2378 hydrog ? ? A  C   2439 O2    ? ? ? 1_555 A  G   2451 N2    ? ? A C   2440 A G   2452 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2379 hydrog ? ? A  U   2440 N3    ? ? ? 1_555 A  G   2450 O6    ? ? A U   2441 A G   2451 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2380 hydrog ? ? A  U   2440 O2    ? ? ? 1_555 A  G   2450 N1    ? ? A U   2441 A G   2451 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2381 hydrog ? ? A  G   2441 N1    ? ? ? 1_555 A  C   2449 N3    ? ? A G   2442 A C   2450 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2382 hydrog ? ? A  G   2441 N2    ? ? ? 1_555 A  C   2449 O2    ? ? A G   2442 A C   2450 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2383 hydrog ? ? A  G   2441 O6    ? ? ? 1_555 A  C   2449 N4    ? ? A G   2442 A C   2450 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2384 hydrog ? ? A  G   2470 N2    ? ? ? 1_555 A  A   2632 N3    ? ? A G   2471 A A   2633 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2385 hydrog ? ? A  U   2472 O2    ? ? ? 1_555 A  C   2474 N4    ? ? A U   2473 A C   2475 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog2386 hydrog ? ? A  G   2481 O6    ? ? ? 1_555 A  A   2485 N6    ? ? A G   2482 A A   2486 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2387 hydrog ? ? A  A   2484 N6    ? ? ? 1_555 A  C   2535 N3    ? ? A A   2485 A C   2536 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog2388 hydrog ? ? A  A   2484 N7    ? ? ? 1_555 A  C   2535 N4    ? ? A A   2485 A C   2536 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog2389 hydrog ? ? A  A   2487 N6    ? ? ? 1_555 A  C   2533 N3    ? ? A A   2488 A C   2534 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog2390 hydrog ? ? A  G   2488 N1    ? ? ? 1_555 A  C   2532 N3    ? ? A G   2489 A C   2533 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2391 hydrog ? ? A  G   2488 N2    ? ? ? 1_555 A  C   2532 O2    ? ? A G   2489 A C   2533 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2392 hydrog ? ? A  G   2488 O6    ? ? ? 1_555 A  C   2532 N4    ? ? A G   2489 A C   2533 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2393 hydrog ? ? A  A   2489 N1    ? ? ? 1_555 A  U   2530 N3    ? ? A A   2490 A U   2531 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2394 hydrog ? ? A  A   2489 N6    ? ? ? 1_555 A  U   2530 O4    ? ? A A   2490 A U   2531 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2395 hydrog ? ? A  G   2490 N1    ? ? ? 1_555 A  C   2529 N3    ? ? A G   2491 A C   2530 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2396 hydrog ? ? A  G   2490 N2    ? ? ? 1_555 A  C   2529 O2    ? ? A G   2491 A C   2530 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2397 hydrog ? ? A  G   2490 O6    ? ? ? 1_555 A  C   2529 N4    ? ? A G   2491 A C   2530 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2398 hydrog ? ? A  U   2491 N3    ? ? ? 1_555 A  G   2528 O6    ? ? A U   2492 A G   2529 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2399 hydrog ? ? A  U   2491 O2    ? ? ? 1_555 A  G   2528 N1    ? ? A U   2492 A G   2529 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2400 hydrog ? ? A  G   2493 N1    ? ? ? 1_555 A  U   2527 O2    ? ? A G   2494 A U   2528 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2401 hydrog ? ? A  G   2493 O6    ? ? ? 1_555 A  U   2527 N3    ? ? A G   2494 A U   2528 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2402 hydrog ? ? A  U   2494 O4    ? ? ? 1_555 A  G   2524 N2    ? ? A U   2495 A G   2525 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog2403 hydrog ? ? A  U   2494 N3    ? ? ? 1_555 A  U   2526 O4    ? ? A U   2495 A U   2527 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2404 hydrog ? ? A  U   2494 O2    ? ? ? 1_555 A  U   2526 N3    ? ? A U   2495 A U   2527 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2405 hydrog ? ? A  C   2495 N3    ? ? ? 1_555 A  G   2523 N1    ? ? A C   2496 A G   2524 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2406 hydrog ? ? A  C   2495 N4    ? ? ? 1_555 A  G   2523 O6    ? ? A C   2496 A G   2524 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2407 hydrog ? ? A  C   2495 O2    ? ? ? 1_555 A  G   2523 N2    ? ? A C   2496 A G   2524 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2408 hydrog ? ? A  A   2496 N1    ? ? ? 1_555 A  U   2522 N3    ? ? A A   2497 A U   2523 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2409 hydrog ? ? A  A   2496 N6    ? ? ? 1_555 A  U   2522 O4    ? ? A A   2497 A U   2523 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2410 hydrog ? ? A  C   2497 N3    ? ? ? 1_555 A  G   2521 N1    ? ? A C   2498 A G   2522 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2411 hydrog ? ? A  C   2497 N4    ? ? ? 1_555 A  G   2521 O6    ? ? A C   2498 A G   2522 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2412 hydrog ? ? A  C   2497 O2    ? ? ? 1_555 A  G   2521 N2    ? ? A C   2498 A G   2522 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2413 hydrog ? ? A  U   2498 N3    ? ? ? 1_555 A  A   2520 N1    ? ? A U   2499 A A   2521 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2414 hydrog ? ? A  U   2498 O4    ? ? ? 1_555 A  A   2520 N6    ? ? A U   2499 A A   2521 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2415 hydrog ? ? A  C   2499 N3    ? ? ? 1_555 A  G   2519 N1    ? ? A C   2500 A G   2520 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2416 hydrog ? ? A  C   2499 N4    ? ? ? 1_555 A  G   2519 O6    ? ? A C   2500 A G   2520 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2417 hydrog ? ? A  C   2499 O2    ? ? ? 1_555 A  G   2519 N2    ? ? A C   2500 A G   2520 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2418 hydrog ? ? A  G   2500 N1    ? ? ? 1_555 A  C   2518 N3    ? ? A G   2501 A C   2519 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2419 hydrog ? ? A  G   2500 N2    ? ? ? 1_555 A  C   2518 O2    ? ? A G   2501 A C   2519 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2420 hydrog ? ? A  G   2500 O6    ? ? ? 1_555 A  C   2518 N4    ? ? A G   2501 A C   2519 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2421 hydrog ? ? A  C   2501 O2    ? ? ? 1_555 A  C   2517 N4    ? ? A C   2502 A C   2518 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog2422 hydrog ? ? A  A   2502 N3    ? ? ? 1_555 A  A   2516 N6    ? ? A A   2503 A A   2517 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2423 hydrog ? ? A  A   2503 N6    ? ? ? 1_555 A  G   2515 N3    ? ? A A   2504 A G   2516 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2424 hydrog ? ? A  A   2503 N7    ? ? ? 1_555 A  G   2515 N2    ? ? A A   2504 A G   2516 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2425 hydrog ? ? A  G   2504 N1    ? ? ? 1_555 A  C   2514 N3    ? ? A G   2505 A C   2515 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2426 hydrog ? ? A  G   2504 N2    ? ? ? 1_555 A  C   2514 O2    ? ? A G   2505 A C   2515 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2427 hydrog ? ? A  G   2504 O6    ? ? ? 1_555 A  C   2514 N4    ? ? A G   2505 A C   2515 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2428 hydrog ? ? A  A   2505 N1    ? ? ? 1_555 A  U   2513 N3    ? ? A A   2506 A U   2514 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2429 hydrog ? ? A  A   2505 N6    ? ? ? 1_555 A  U   2513 O4    ? ? A A   2506 A U   2514 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2430 hydrog ? ? A  G   2506 N2    ? ? ? 1_555 A  A   2512 N7    ? ? A G   2507 A A   2513 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2431 hydrog ? ? A  G   2506 N3    ? ? ? 1_555 A  A   2512 N6    ? ? A G   2507 A A   2513 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2432 hydrog ? ? A  G   2506 N2    ? ? ? 1_555 A  G   2563 O6    ? ? A G   2507 A G   2564 1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog2433 hydrog ? ? A  C   2509 N3    ? ? ? 1_555 A  G   2563 N2    ? ? A C   2510 A G   2564 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2434 hydrog ? ? A  C   2509 O2    ? ? ? 1_555 A  G   2563 N1    ? ? A C   2510 A G   2564 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2435 hydrog ? ? A  G   2524 N2    ? ? ? 1_555 A  U   2526 O4    ? ? A G   2525 A U   2527 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2436 hydrog ? ? A  A   2531 N3    ? ? ? 1_555 A  C   2532 N4    ? ? A A   2532 A C   2533 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog2437 hydrog ? ? A  G   2539 N1    ? ? ? 1_555 A  U   2644 O2    ? ? A G   2540 A U   2645 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2438 hydrog ? ? A  U   2540 N3    ? ? ? 1_555 A  G   2617 O6    ? ? A U   2541 A G   2618 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2439 hydrog ? ? A  U   2540 O2    ? ? ? 1_555 A  G   2617 N1    ? ? A U   2541 A G   2618 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2440 hydrog ? ? A  C   2541 O2    ? ? ? 1_555 A  G   2587 N2    ? ? A C   2542 A G   2588 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog2441 hydrog ? ? A  C   2541 N3    ? ? ? 1_555 A  G   2616 N1    ? ? A C   2542 A G   2617 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2442 hydrog ? ? A  C   2541 N4    ? ? ? 1_555 A  G   2616 O6    ? ? A C   2542 A G   2617 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2443 hydrog ? ? A  C   2541 O2    ? ? ? 1_555 A  G   2616 N2    ? ? A C   2542 A G   2617 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2444 hydrog ? ? A  G   2542 N1    ? ? ? 1_555 A  U   2614 O2    ? ? A G   2543 A U   2615 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2445 hydrog ? ? A  G   2542 O6    ? ? ? 1_555 A  U   2614 N3    ? ? A G   2543 A U   2615 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2446 hydrog ? ? A  G   2543 N1    ? ? ? 1_555 A  C   2613 N3    ? ? A G   2544 A C   2614 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2447 hydrog ? ? A  G   2543 N2    ? ? ? 1_555 A  C   2613 O2    ? ? A G   2544 A C   2614 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2448 hydrog ? ? A  G   2543 O6    ? ? ? 1_555 A  C   2613 N4    ? ? A G   2544 A C   2614 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2449 hydrog ? ? A  U   2544 N3    ? ? ? 1_555 A  G   2612 O6    ? ? A U   2545 A G   2613 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2450 hydrog ? ? A  U   2544 O2    ? ? ? 1_555 A  G   2612 N1    ? ? A U   2545 A G   2613 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2451 hydrog ? ? A  U   2545 N3    ? ? ? 1_555 A  U   2609 O2    ? ? A U   2546 A U   2610 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2452 hydrog ? ? A  U   2545 O4    ? ? ? 1_555 A  U   2609 N3    ? ? A U   2546 A U   2610 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2453 hydrog ? ? A  C   2546 N3    ? ? ? 1_555 A  G   2608 N1    ? ? A C   2547 A G   2609 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2454 hydrog ? ? A  C   2546 N4    ? ? ? 1_555 A  G   2608 O6    ? ? A C   2547 A G   2609 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2455 hydrog ? ? A  C   2546 O2    ? ? ? 1_555 A  G   2608 N2    ? ? A C   2547 A G   2609 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2456 hydrog ? ? A  C   2547 N3    ? ? ? 1_555 A  G   2605 N1    ? ? A C   2548 A G   2606 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2457 hydrog ? ? A  C   2547 N4    ? ? ? 1_555 A  G   2605 O6    ? ? A C   2548 A G   2606 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2458 hydrog ? ? A  C   2547 O2    ? ? ? 1_555 A  G   2605 N2    ? ? A C   2548 A G   2606 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2459 hydrog ? ? A  C   2548 N3    ? ? ? 1_555 A  G   2604 N1    ? ? A C   2549 A G   2605 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2460 hydrog ? ? A  C   2548 N4    ? ? ? 1_555 A  G   2604 O6    ? ? A C   2549 A G   2605 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2461 hydrog ? ? A  C   2548 O2    ? ? ? 1_555 A  G   2604 N2    ? ? A C   2549 A G   2605 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2462 hydrog ? ? A  U   2549 N3    ? ? ? 1_555 A  A   2603 N1    ? ? A U   2550 A A   2604 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2463 hydrog ? ? A  U   2549 O4    ? ? ? 1_555 A  A   2603 N6    ? ? A U   2550 A A   2604 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2464 hydrog ? ? A  C   2550 N3    ? ? ? 1_555 A  G   2602 N1    ? ? A C   2551 A G   2603 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2465 hydrog ? ? A  C   2550 N4    ? ? ? 1_555 A  G   2602 O6    ? ? A C   2551 A G   2603 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2466 hydrog ? ? A  C   2550 O2    ? ? ? 1_555 A  G   2602 N2    ? ? A C   2551 A G   2603 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2467 hydrog ? ? A  C   2551 N3    ? ? ? 1_555 A  G   2601 N1    ? ? A C   2552 A G   2602 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2468 hydrog ? ? A  C   2551 N4    ? ? ? 1_555 A  G   2601 O6    ? ? A C   2552 A G   2602 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2469 hydrog ? ? A  C   2551 O2    ? ? ? 1_555 A  G   2601 N2    ? ? A C   2552 A G   2602 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2470 hydrog ? ? A  C   2551 N3    ? ? ? 1_555 A  G   2602 N1    ? ? A C   2552 A G   2603 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog2471 hydrog ? ? A  U   2553 O2    ? ? ? 1_555 A  C   2555 N4    ? ? A U   2554 A C   2556 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog2472 hydrog ? ? A  C   2554 N4    ? ? ? 1_555 A  A   2576 N1    ? ? A C   2555 A A   2577 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2473 hydrog ? ? A  C   2554 N3    ? ? ? 1_555 A  G   2579 N1    ? ? A C   2555 A G   2580 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2474 hydrog ? ? A  C   2554 N4    ? ? ? 1_555 A  G   2579 O6    ? ? A C   2555 A G   2580 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2475 hydrog ? ? A  C   2554 O2    ? ? ? 1_555 A  G   2579 N2    ? ? A C   2555 A G   2580 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2476 hydrog ? ? A  C   2555 N3    ? ? ? 1_555 A  G   2578 N1    ? ? A C   2556 A G   2579 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2477 hydrog ? ? A  C   2555 N4    ? ? ? 1_555 A  G   2578 O6    ? ? A C   2556 A G   2579 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2478 hydrog ? ? A  C   2555 O2    ? ? ? 1_555 A  G   2578 N2    ? ? A C   2556 A G   2579 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2479 hydrog ? ? A  U   2556 N3    ? ? ? 1_555 A  G   2577 O6    ? ? A U   2557 A G   2578 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2480 hydrog ? ? A  U   2556 O2    ? ? ? 1_555 A  G   2577 N1    ? ? A U   2557 A G   2578 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2481 hydrog ? ? A  G   2557 N1    ? ? ? 1_555 A  C   2574 N3    ? ? A G   2558 A C   2575 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2482 hydrog ? ? A  G   2557 N2    ? ? ? 1_555 A  C   2574 O2    ? ? A G   2558 A C   2575 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2483 hydrog ? ? A  G   2557 O6    ? ? ? 1_555 A  C   2574 N4    ? ? A G   2558 A C   2575 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2484 hydrog ? ? A  C   2558 N3    ? ? ? 1_555 A  G   2573 N1    ? ? A C   2559 A G   2574 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2485 hydrog ? ? A  C   2558 N4    ? ? ? 1_555 A  G   2573 O6    ? ? A C   2559 A G   2574 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2486 hydrog ? ? A  C   2558 O2    ? ? ? 1_555 A  G   2573 N2    ? ? A C   2559 A G   2574 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2487 hydrog ? ? A  C   2559 N3    ? ? ? 1_555 A  G   2572 N1    ? ? A C   2560 A G   2573 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2488 hydrog ? ? A  C   2559 N4    ? ? ? 1_555 A  G   2572 O6    ? ? A C   2560 A G   2573 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2489 hydrog ? ? A  C   2559 O2    ? ? ? 1_555 A  G   2572 N2    ? ? A C   2560 A G   2573 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2490 hydrog ? ? A  C   2560 N3    ? ? ? 1_555 A  G   2571 N1    ? ? A C   2561 A G   2572 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2491 hydrog ? ? A  C   2560 N4    ? ? ? 1_555 A  G   2571 O6    ? ? A C   2561 A G   2572 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2492 hydrog ? ? A  C   2560 O2    ? ? ? 1_555 A  G   2571 N2    ? ? A C   2561 A G   2572 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2493 hydrog ? ? A  G   2561 N1    ? ? ? 1_555 A  C   2570 N3    ? ? A G   2562 A C   2571 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2494 hydrog ? ? A  G   2561 N2    ? ? ? 1_555 A  C   2570 O2    ? ? A G   2562 A C   2571 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2495 hydrog ? ? A  G   2561 O6    ? ? ? 1_555 A  C   2570 N4    ? ? A G   2562 A C   2571 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2496 hydrog ? ? A  U   2562 N3    ? ? ? 1_555 A  G   2569 O6    ? ? A U   2563 A G   2570 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2497 hydrog ? ? A  U   2562 O2    ? ? ? 1_555 A  G   2569 N1    ? ? A U   2563 A G   2570 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2498 hydrog ? ? A  A   2565 N1    ? ? ? 1_555 A  A   2698 N6    ? ? A A   2566 A A   2699 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog2499 hydrog ? ? A  A   2565 N6    ? ? ? 1_555 A  A   2698 N1    ? ? A A   2566 A A   2699 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog2500 hydrog ? ? A  G   2566 N2    ? ? ? 1_555 A  G   2699 N3    ? ? A G   2567 A G   2700 1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog2501 hydrog ? ? A  G   2566 N3    ? ? ? 1_555 A  G   2699 N2    ? ? A G   2567 A G   2700 1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog2502 hydrog ? ? A  G   2573 N2    ? ? ? 1_555 A  A   2775 N3    ? ? A G   2574 A A   2776 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2503 hydrog ? ? A  A   2575 N3    ? ? ? 1_555 A  A   2799 N6    ? ? A A   2576 A A   2800 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2504 hydrog ? ? A  G   2579 N2    ? ? ? 1_555 A  A   2599 N3    ? ? A G   2580 A A   2600 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2505 hydrog ? ? A  U   2580 N3    ? ? ? 1_555 A  G   2601 N7    ? ? A U   2581 A G   2602 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog2506 hydrog ? ? A  G   2581 N1    ? ? ? 1_555 A  A   2595 N1    ? ? A G   2582 A A   2596 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2507 hydrog ? ? A  G   2581 O6    ? ? ? 1_555 A  A   2595 N6    ? ? A G   2582 A A   2596 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2508 hydrog ? ? A  A   2582 N1    ? ? ? 1_555 A  U   2594 N3    ? ? A A   2583 A U   2595 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2509 hydrog ? ? A  A   2582 N6    ? ? ? 1_555 A  U   2594 O4    ? ? A A   2583 A U   2595 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2510 hydrog ? ? A  G   2583 N1    ? ? ? 1_555 A  C   2593 N3    ? ? A G   2584 A C   2594 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2511 hydrog ? ? A  G   2583 N2    ? ? ? 1_555 A  C   2593 O2    ? ? A G   2584 A C   2594 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2512 hydrog ? ? A  G   2583 O6    ? ? ? 1_555 A  C   2593 N4    ? ? A G   2584 A C   2594 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2513 hydrog ? ? A  G   2584 N1    ? ? ? 1_555 A  C   2592 N3    ? ? A G   2585 A C   2593 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2514 hydrog ? ? A  G   2584 N2    ? ? ? 1_555 A  C   2592 O2    ? ? A G   2585 A C   2593 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2515 hydrog ? ? A  G   2584 O6    ? ? ? 1_555 A  C   2592 N4    ? ? A G   2585 A C   2593 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2516 hydrog ? ? A  U   2585 O4    ? ? ? 1_555 A  G   2591 N1    ? ? A U   2586 A G   2592 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog2517 hydrog ? ? A  U   2586 O2    ? ? ? 1_555 A  C   2590 N4    ? ? A U   2587 A C   2591 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog2518 hydrog ? ? A  U   2596 N3    ? ? ? 1_555 A  A   2600 N7    ? ? A U   2597 A A   2601 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2519 hydrog ? ? A  U   2596 O2    ? ? ? 1_555 A  A   2600 N6    ? ? A U   2597 A A   2601 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2520 hydrog ? ? A  A   2621 N6    ? ? ? 1_555 A  G   2642 N3    ? ? A A   2622 A G   2643 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2521 hydrog ? ? A  A   2621 N7    ? ? ? 1_555 A  G   2642 N2    ? ? A A   2622 A G   2643 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2522 hydrog ? ? A  G   2622 N1    ? ? ? 1_555 A  C   2640 N3    ? ? A G   2623 A C   2641 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2523 hydrog ? ? A  G   2622 N2    ? ? ? 1_555 A  C   2640 O2    ? ? A G   2623 A C   2641 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2524 hydrog ? ? A  G   2622 O6    ? ? ? 1_555 A  C   2640 N4    ? ? A G   2623 A C   2641 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2525 hydrog ? ? A  A   2623 N1    ? ? ? 1_555 A  U   2639 N3    ? ? A A   2624 A U   2640 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog2526 hydrog ? ? A  C   2624 N3    ? ? ? 1_555 A  G   2638 N1    ? ? A C   2625 A G   2639 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2527 hydrog ? ? A  C   2624 N4    ? ? ? 1_555 A  G   2638 O6    ? ? A C   2625 A G   2639 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2528 hydrog ? ? A  C   2624 O2    ? ? ? 1_555 A  G   2638 N2    ? ? A C   2625 A G   2639 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2529 hydrog ? ? A  C   2625 N3    ? ? ? 1_555 A  G   2637 N1    ? ? A C   2626 A G   2638 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2530 hydrog ? ? A  C   2625 N4    ? ? ? 1_555 A  G   2637 O6    ? ? A C   2626 A G   2638 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2531 hydrog ? ? A  C   2625 O2    ? ? ? 1_555 A  G   2637 N2    ? ? A C   2626 A G   2638 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2532 hydrog ? ? A  G   2626 N1    ? ? ? 1_555 A  C   2635 N3    ? ? A G   2627 A C   2636 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2533 hydrog ? ? A  G   2626 N2    ? ? ? 1_555 A  C   2635 O2    ? ? A G   2627 A C   2636 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2534 hydrog ? ? A  G   2626 O6    ? ? ? 1_555 A  C   2635 N4    ? ? A G   2627 A C   2636 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2535 hydrog ? ? A  U   2627 N3    ? ? ? 1_555 A  A   2634 N1    ? ? A U   2628 A A   2635 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2536 hydrog ? ? A  U   2627 O4    ? ? ? 1_555 A  A   2634 N6    ? ? A U   2628 A A   2635 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2537 hydrog ? ? A  C   2628 N3    ? ? ? 1_555 A  G   2633 N1    ? ? A C   2629 A G   2634 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2538 hydrog ? ? A  C   2628 N4    ? ? ? 1_555 A  G   2633 O6    ? ? A C   2629 A G   2634 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2539 hydrog ? ? A  C   2628 O2    ? ? ? 1_555 A  G   2633 N2    ? ? A C   2629 A G   2634 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2540 hydrog ? ? A  G   2629 N2    ? ? ? 1_555 A  A   2632 N7    ? ? A G   2630 A A   2633 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2541 hydrog ? ? A  A   2648 N3    ? ? ? 1_555 A  C   2650 N4    ? ? A A   2649 A C   2651 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog2542 hydrog ? ? A  G   2656 N2    ? ? ? 1_555 A  A   2840 N1    ? ? A G   2657 A A   2841 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog2543 hydrog ? ? A  G   2656 N3    ? ? ? 1_555 A  A   2840 N6    ? ? A G   2657 A A   2841 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog2544 hydrog ? ? A  U   2660 O2    ? ? ? 1_555 A  A   2811 N6    ? ? A U   2661 A A   2812 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2545 hydrog ? ? A  G   2661 N2    ? ? ? 1_555 A  A   2815 N3    ? ? A G   2662 A A   2816 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2546 hydrog ? ? A  G   2666 N1    ? ? ? 1_555 A  C   2821 N3    ? ? A G   2667 A C   2822 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2547 hydrog ? ? A  G   2666 N2    ? ? ? 1_555 A  C   2821 O2    ? ? A G   2667 A C   2822 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2548 hydrog ? ? A  G   2666 O6    ? ? ? 1_555 A  C   2821 N4    ? ? A G   2667 A C   2822 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2549 hydrog ? ? A  G   2666 N2    ? ? ? 1_555 A  A   2826 N3    ? ? A G   2667 A A   2827 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2550 hydrog ? ? A  G   2667 N1    ? ? ? 1_555 A  C   2820 N3    ? ? A G   2668 A C   2821 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2551 hydrog ? ? A  G   2667 N2    ? ? ? 1_555 A  C   2820 O2    ? ? A G   2668 A C   2821 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2552 hydrog ? ? A  G   2667 O6    ? ? ? 1_555 A  C   2820 N4    ? ? A G   2668 A C   2821 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2553 hydrog ? ? A  U   2668 N3    ? ? ? 1_555 A  A   2819 N1    ? ? A U   2669 A A   2820 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2554 hydrog ? ? A  U   2668 O4    ? ? ? 1_555 A  A   2819 N6    ? ? A U   2669 A A   2820 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2555 hydrog ? ? A  G   2669 N1    ? ? ? 1_555 A  C   2818 N3    ? ? A G   2670 A C   2819 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2556 hydrog ? ? A  G   2669 N2    ? ? ? 1_555 A  C   2818 O2    ? ? A G   2670 A C   2819 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2557 hydrog ? ? A  G   2669 O6    ? ? ? 1_555 A  C   2818 N4    ? ? A G   2670 A C   2819 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2558 hydrog ? ? A  U   2670 N3    ? ? ? 1_555 A  A   2817 N1    ? ? A U   2671 A A   2818 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2559 hydrog ? ? A  U   2670 O4    ? ? ? 1_555 A  A   2817 N6    ? ? A U   2671 A A   2818 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2560 hydrog ? ? A  C   2671 N3    ? ? ? 1_555 A  G   2816 N1    ? ? A C   2672 A G   2817 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2561 hydrog ? ? A  C   2671 N4    ? ? ? 1_555 A  G   2816 O6    ? ? A C   2672 A G   2817 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2562 hydrog ? ? A  C   2671 O2    ? ? ? 1_555 A  G   2816 N2    ? ? A C   2672 A G   2817 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2563 hydrog ? ? A  U   2672 N3    ? ? ? 1_555 A  A   2810 N7    ? ? A U   2673 A A   2811 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2564 hydrog ? ? A  U   2672 O2    ? ? ? 1_555 A  A   2810 N6    ? ? A U   2673 A A   2811 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2565 hydrog ? ? A  G   2673 N2    ? ? ? 1_555 A  A   2812 N7    ? ? A G   2674 A A   2813 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2566 hydrog ? ? A  G   2673 N3    ? ? ? 1_555 A  A   2812 N6    ? ? A G   2674 A A   2813 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2567 hydrog ? ? A  A   2674 N6    ? ? ? 1_555 A  G   2809 N3    ? ? A A   2675 A G   2810 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2568 hydrog ? ? A  A   2674 N7    ? ? ? 1_555 A  G   2809 N2    ? ? A A   2675 A G   2810 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2569 hydrog ? ? A  C   2675 N3    ? ? ? 1_555 A  G   2808 N1    ? ? A C   2676 A G   2809 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2570 hydrog ? ? A  C   2675 N4    ? ? ? 1_555 A  G   2808 O6    ? ? A C   2676 A G   2809 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2571 hydrog ? ? A  C   2675 O2    ? ? ? 1_555 A  G   2808 N2    ? ? A C   2676 A G   2809 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2572 hydrog ? ? A  A   2676 N1    ? ? ? 1_555 A  U   2807 N3    ? ? A A   2677 A U   2808 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2573 hydrog ? ? A  A   2676 N6    ? ? ? 1_555 A  U   2807 O4    ? ? A A   2677 A U   2808 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2574 hydrog ? ? A  A   2677 N1    ? ? ? 1_555 A  U   2806 N3    ? ? A A   2678 A U   2807 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2575 hydrog ? ? A  A   2677 N6    ? ? ? 1_555 A  U   2806 O4    ? ? A A   2678 A U   2807 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2576 hydrog ? ? A  G   2678 N1    ? ? ? 1_555 A  C   2805 N3    ? ? A G   2679 A C   2806 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2577 hydrog ? ? A  G   2678 N2    ? ? ? 1_555 A  C   2805 O2    ? ? A G   2679 A C   2806 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2578 hydrog ? ? A  G   2678 O6    ? ? ? 1_555 A  C   2805 N4    ? ? A G   2679 A C   2806 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2579 hydrog ? ? A  A   2679 N1    ? ? ? 1_555 A  G   2711 N2    ? ? A A   2680 A G   2712 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2580 hydrog ? ? A  A   2680 N3    ? ? ? 1_555 A  G   2712 N2    ? ? A A   2681 A G   2713 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2581 hydrog ? ? A  C   2681 N3    ? ? ? 1_555 A  G   2711 N1    ? ? A C   2682 A G   2712 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2582 hydrog ? ? A  C   2681 N4    ? ? ? 1_555 A  G   2711 O6    ? ? A C   2682 A G   2712 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2583 hydrog ? ? A  C   2681 O2    ? ? ? 1_555 A  G   2711 N2    ? ? A C   2682 A G   2712 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2584 hydrog ? ? A  G   2682 N1    ? ? ? 1_555 A  U   2710 O2    ? ? A G   2683 A U   2711 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2585 hydrog ? ? A  G   2682 O6    ? ? ? 1_555 A  U   2710 N3    ? ? A G   2683 A U   2711 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2586 hydrog ? ? A  A   2683 N1    ? ? ? 1_555 A  U   2709 N3    ? ? A A   2684 A U   2710 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2587 hydrog ? ? A  A   2683 N6    ? ? ? 1_555 A  U   2709 O4    ? ? A A   2684 A U   2710 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2588 hydrog ? ? A  C   2684 N3    ? ? ? 1_555 A  G   2708 N1    ? ? A C   2685 A G   2709 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2589 hydrog ? ? A  C   2684 N4    ? ? ? 1_555 A  G   2708 O6    ? ? A C   2685 A G   2709 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2590 hydrog ? ? A  C   2684 O2    ? ? ? 1_555 A  G   2708 N2    ? ? A C   2685 A G   2709 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2591 hydrog ? ? A  C   2685 N3    ? ? ? 1_555 A  G   2707 N1    ? ? A C   2686 A G   2708 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2592 hydrog ? ? A  C   2685 N4    ? ? ? 1_555 A  G   2707 O6    ? ? A C   2686 A G   2708 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2593 hydrog ? ? A  C   2685 O2    ? ? ? 1_555 A  G   2707 N2    ? ? A C   2686 A G   2708 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2594 hydrog ? ? A  G   2686 N1    ? ? ? 1_555 A  C   2706 N3    ? ? A G   2687 A C   2707 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2595 hydrog ? ? A  G   2686 N2    ? ? ? 1_555 A  C   2706 O2    ? ? A G   2687 A C   2707 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2596 hydrog ? ? A  G   2686 O6    ? ? ? 1_555 A  C   2706 N4    ? ? A G   2687 A C   2707 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2597 hydrog ? ? A  U   2687 N3    ? ? ? 1_555 A  A   2705 N1    ? ? A U   2688 A A   2706 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2598 hydrog ? ? A  U   2687 O4    ? ? ? 1_555 A  A   2705 N6    ? ? A U   2688 A A   2706 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2599 hydrog ? ? A  A   2688 N1    ? ? ? 1_555 A  U   2704 N3    ? ? A A   2689 A U   2705 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2600 hydrog ? ? A  A   2688 N6    ? ? ? 1_555 A  U   2704 O4    ? ? A A   2689 A U   2705 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2601 hydrog ? ? A  U   2689 O2    ? ? ? 1_555 A  C   2703 N4    ? ? A U   2690 A C   2704 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog2602 hydrog ? ? A  A   2690 N6    ? ? ? 1_555 A  A   2702 N7    ? ? A A   2691 A A   2703 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2603 hydrog ? ? A  A   2690 N7    ? ? ? 1_555 A  A   2702 N6    ? ? A A   2691 A A   2703 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2604 hydrog ? ? A  G   2691 N2    ? ? ? 1_555 A  U   2692 O4    ? ? A G   2692 A U   2693 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2605 hydrog ? ? A  U   2692 N3    ? ? ? 1_555 A  A   2701 N7    ? ? A U   2693 A A   2702 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2606 hydrog ? ? A  U   2692 O2    ? ? ? 1_555 A  A   2701 N6    ? ? A U   2693 A A   2702 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2607 hydrog ? ? A  A   2693 N6    ? ? ? 1_555 A  G   2700 N3    ? ? A A   2694 A G   2701 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2608 hydrog ? ? A  A   2693 N7    ? ? ? 1_555 A  G   2700 N2    ? ? A A   2694 A G   2701 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2609 hydrog ? ? A  C   2694 N3    ? ? ? 1_555 A  G   2699 N1    ? ? A C   2695 A G   2700 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2610 hydrog ? ? A  C   2694 N4    ? ? ? 1_555 A  G   2699 O6    ? ? A C   2695 A G   2700 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2611 hydrog ? ? A  C   2694 O2    ? ? ? 1_555 A  G   2699 N2    ? ? A C   2695 A G   2700 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2612 hydrog ? ? A  G   2695 N2    ? ? ? 1_555 A  A   2698 N7    ? ? A G   2696 A A   2699 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2613 hydrog ? ? A  G   2712 N1    ? ? ? 1_555 A  C   2766 N3    ? ? A G   2713 A C   2767 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2614 hydrog ? ? A  G   2712 N2    ? ? ? 1_555 A  C   2766 O2    ? ? A G   2713 A C   2767 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2615 hydrog ? ? A  G   2712 O6    ? ? ? 1_555 A  C   2766 N4    ? ? A G   2713 A C   2767 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2616 hydrog ? ? A  U   2713 N3    ? ? ? 1_555 A  A   2765 N1    ? ? A U   2714 A A   2766 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2617 hydrog ? ? A  U   2713 O4    ? ? ? 1_555 A  A   2765 N6    ? ? A U   2714 A A   2766 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2618 hydrog ? ? A  G   2714 N1    ? ? ? 1_555 A  C   2764 N3    ? ? A G   2715 A C   2765 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2619 hydrog ? ? A  G   2714 N2    ? ? ? 1_555 A  C   2764 O2    ? ? A G   2715 A C   2765 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2620 hydrog ? ? A  G   2714 O6    ? ? ? 1_555 A  C   2764 N4    ? ? A G   2715 A C   2765 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2621 hydrog ? ? A  G   2715 N1    ? ? ? 1_555 A  C   2763 N3    ? ? A G   2716 A C   2764 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2622 hydrog ? ? A  G   2715 N2    ? ? ? 1_555 A  C   2763 O2    ? ? A G   2716 A C   2764 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2623 hydrog ? ? A  G   2715 O6    ? ? ? 1_555 A  C   2763 N4    ? ? A G   2716 A C   2764 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2624 hydrog ? ? A  C   2716 N3    ? ? ? 1_555 A  G   2762 N1    ? ? A C   2717 A G   2763 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2625 hydrog ? ? A  C   2716 N4    ? ? ? 1_555 A  G   2762 O6    ? ? A C   2717 A G   2763 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2626 hydrog ? ? A  C   2716 O2    ? ? ? 1_555 A  G   2762 N2    ? ? A C   2717 A G   2763 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2627 hydrog ? ? A  C   2717 O2    ? ? ? 1_555 A  C   2719 N4    ? ? A C   2718 A C   2720 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog2628 hydrog ? ? A  C   2717 N3    ? ? ? 1_555 A  A   2760 N6    ? ? A C   2718 A A   2761 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog2629 hydrog ? ? A  C   2717 N4    ? ? ? 1_555 A  A   2760 N7    ? ? A C   2718 A A   2761 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog2630 hydrog ? ? A  C   2719 N4    ? ? ? 1_555 A  G   2762 N3    ? ? A C   2720 A G   2763 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog2631 hydrog ? ? A  U   2720 N3    ? ? ? 1_555 A  A   2760 N1    ? ? A U   2721 A A   2761 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2632 hydrog ? ? A  U   2720 O4    ? ? ? 1_555 A  A   2760 N6    ? ? A U   2721 A A   2761 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2633 hydrog ? ? A  G   2721 N1    ? ? ? 1_555 A  C   2759 N3    ? ? A G   2722 A C   2760 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2634 hydrog ? ? A  G   2721 N2    ? ? ? 1_555 A  C   2759 O2    ? ? A G   2722 A C   2760 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2635 hydrog ? ? A  G   2721 O6    ? ? ? 1_555 A  C   2759 N4    ? ? A G   2722 A C   2760 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2636 hydrog ? ? A  G   2722 N1    ? ? ? 1_555 A  C   2758 N3    ? ? A G   2723 A C   2759 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2637 hydrog ? ? A  G   2722 N2    ? ? ? 1_555 A  C   2758 O2    ? ? A G   2723 A C   2759 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2638 hydrog ? ? A  G   2722 O6    ? ? ? 1_555 A  C   2758 N4    ? ? A G   2723 A C   2759 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2639 hydrog ? ? A  U   2723 N3    ? ? ? 1_555 A  G   2757 O6    ? ? A U   2724 A G   2758 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2640 hydrog ? ? A  U   2723 O2    ? ? ? 1_555 A  G   2757 N1    ? ? A U   2724 A G   2758 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2641 hydrog ? ? A  G   2724 N2    ? ? ? 1_555 A  A   2756 N7    ? ? A G   2725 A A   2757 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2642 hydrog ? ? A  G   2724 N3    ? ? ? 1_555 A  A   2756 N6    ? ? A G   2725 A A   2757 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2643 hydrog ? ? A  A   2726 N7    ? ? ? 1_555 A  G   2754 N2    ? ? A A   2727 A G   2755 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2644 hydrog ? ? A  C   2727 N3    ? ? ? 1_555 A  G   2753 N1    ? ? A C   2728 A G   2754 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2645 hydrog ? ? A  C   2727 N4    ? ? ? 1_555 A  G   2753 O6    ? ? A C   2728 A G   2754 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2646 hydrog ? ? A  C   2727 O2    ? ? ? 1_555 A  G   2753 N2    ? ? A C   2728 A G   2754 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2647 hydrog ? ? A  C   2728 N3    ? ? ? 1_555 A  G   2752 N1    ? ? A C   2729 A G   2753 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2648 hydrog ? ? A  C   2728 N4    ? ? ? 1_555 A  G   2752 O6    ? ? A C   2729 A G   2753 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2649 hydrog ? ? A  C   2728 O2    ? ? ? 1_555 A  G   2752 N2    ? ? A C   2729 A G   2753 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2650 hydrog ? ? A  G   2729 N1    ? ? ? 1_555 A  C   2751 N3    ? ? A G   2730 A C   2752 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2651 hydrog ? ? A  G   2729 N2    ? ? ? 1_555 A  C   2751 O2    ? ? A G   2730 A C   2752 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2652 hydrog ? ? A  G   2729 O6    ? ? ? 1_555 A  C   2751 N4    ? ? A G   2730 A C   2752 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2653 hydrog ? ? A  G   2730 N1    ? ? ? 1_555 A  C   2750 N3    ? ? A G   2731 A C   2751 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2654 hydrog ? ? A  G   2730 N2    ? ? ? 1_555 A  C   2750 O2    ? ? A G   2731 A C   2751 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2655 hydrog ? ? A  G   2730 O6    ? ? ? 1_555 A  C   2750 N4    ? ? A G   2731 A C   2751 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2656 hydrog ? ? A  U   2731 N3    ? ? ? 1_555 A  G   2749 O6    ? ? A U   2732 A G   2750 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2657 hydrog ? ? A  U   2731 O2    ? ? ? 1_555 A  G   2749 N1    ? ? A U   2732 A G   2750 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2658 hydrog ? ? A  U   2732 N3    ? ? ? 1_555 A  A   2745 N1    ? ? A U   2733 A A   2746 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2659 hydrog ? ? A  U   2732 O4    ? ? ? 1_555 A  A   2745 N6    ? ? A U   2733 A A   2746 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2660 hydrog ? ? A  G   2733 N1    ? ? ? 1_555 A  C   2744 N3    ? ? A G   2734 A C   2745 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2661 hydrog ? ? A  G   2733 N2    ? ? ? 1_555 A  C   2744 O2    ? ? A G   2734 A C   2745 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2662 hydrog ? ? A  G   2733 O6    ? ? ? 1_555 A  C   2744 N4    ? ? A G   2734 A C   2745 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2663 hydrog ? ? A  U   2734 N3    ? ? ? 1_555 A  G   2743 O6    ? ? A U   2735 A G   2744 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2664 hydrog ? ? A  U   2734 O2    ? ? ? 1_555 A  G   2743 N1    ? ? A U   2735 A G   2744 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2665 hydrog ? ? A  U   2735 N3    ? ? ? 1_555 A  A   2742 N1    ? ? A U   2736 A A   2743 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2666 hydrog ? ? A  U   2735 O4    ? ? ? 1_555 A  A   2742 N6    ? ? A U   2736 A A   2743 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2667 hydrog ? ? A  C   2736 N3    ? ? ? 1_555 A  G   2741 N1    ? ? A C   2737 A G   2742 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2668 hydrog ? ? A  C   2736 N4    ? ? ? 1_555 A  G   2741 O6    ? ? A C   2737 A G   2742 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2669 hydrog ? ? A  C   2736 O2    ? ? ? 1_555 A  G   2741 N2    ? ? A C   2737 A G   2742 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2670 hydrog ? ? A  U   2755 N3    ? ? ? 1_555 A  A   2895 N1    ? ? A U   2756 A A   2896 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2671 hydrog ? ? A  A   2767 N6    ? ? ? 1_555 A  A   2804 N3    ? ? A A   2768 A A   2805 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2672 hydrog ? ? A  C   2768 N4    ? ? ? 1_555 A  A   2804 N3    ? ? A C   2769 A A   2805 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2673 hydrog ? ? A  G   2769 N1    ? ? ? 1_555 A  C   2803 N3    ? ? A G   2770 A C   2804 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2674 hydrog ? ? A  G   2769 N2    ? ? ? 1_555 A  C   2803 O2    ? ? A G   2770 A C   2804 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2675 hydrog ? ? A  G   2769 O6    ? ? ? 1_555 A  C   2803 N4    ? ? A G   2770 A C   2804 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2676 hydrog ? ? A  G   2770 N1    ? ? ? 1_555 A  C   2802 N3    ? ? A G   2771 A C   2803 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2677 hydrog ? ? A  G   2770 N2    ? ? ? 1_555 A  C   2802 O2    ? ? A G   2771 A C   2803 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2678 hydrog ? ? A  G   2770 O6    ? ? ? 1_555 A  C   2802 N4    ? ? A G   2771 A C   2803 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2679 hydrog ? ? A  G   2771 N1    ? ? ? 1_555 A  C   2801 N3    ? ? A G   2772 A C   2802 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2680 hydrog ? ? A  G   2771 N2    ? ? ? 1_555 A  C   2801 O2    ? ? A G   2772 A C   2802 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2681 hydrog ? ? A  G   2771 O6    ? ? ? 1_555 A  C   2801 N4    ? ? A G   2772 A C   2802 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2682 hydrog ? ? A  G   2772 N1    ? ? ? 1_555 A  A   2800 N1    ? ? A G   2773 A A   2801 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2683 hydrog ? ? A  G   2772 O6    ? ? ? 1_555 A  A   2800 N6    ? ? A G   2773 A A   2801 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2684 hydrog ? ? A  U   2773 N3    ? ? ? 1_555 A  A   2798 N7    ? ? A U   2774 A A   2799 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2685 hydrog ? ? A  U   2773 O2    ? ? ? 1_555 A  A   2798 N6    ? ? A U   2774 A A   2799 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2686 hydrog ? ? A  A   2775 N6    ? ? ? 1_555 A  G   2797 N3    ? ? A A   2776 A G   2798 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2687 hydrog ? ? A  A   2775 N7    ? ? ? 1_555 A  G   2797 N2    ? ? A A   2776 A G   2798 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2688 hydrog ? ? A  G   2776 N1    ? ? ? 1_555 A  C   2796 N3    ? ? A G   2777 A C   2797 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2689 hydrog ? ? A  G   2776 N2    ? ? ? 1_555 A  C   2796 O2    ? ? A G   2777 A C   2797 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2690 hydrog ? ? A  G   2776 O6    ? ? ? 1_555 A  C   2796 N4    ? ? A G   2777 A C   2797 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2691 hydrog ? ? A  A   2777 N1    ? ? ? 1_555 A  U   2795 N3    ? ? A A   2778 A U   2796 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2692 hydrog ? ? A  A   2777 N6    ? ? ? 1_555 A  U   2795 O4    ? ? A A   2778 A U   2796 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2693 hydrog ? ? A  G   2778 N1    ? ? ? 1_555 A  C   2794 N3    ? ? A G   2779 A C   2795 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2694 hydrog ? ? A  G   2778 N2    ? ? ? 1_555 A  C   2794 O2    ? ? A G   2779 A C   2795 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2695 hydrog ? ? A  G   2778 O6    ? ? ? 1_555 A  C   2794 N4    ? ? A G   2779 A C   2795 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2696 hydrog ? ? A  C   2779 N3    ? ? ? 1_555 A  G   2793 N1    ? ? A C   2780 A G   2794 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2697 hydrog ? ? A  C   2779 N4    ? ? ? 1_555 A  G   2793 O6    ? ? A C   2780 A G   2794 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2698 hydrog ? ? A  C   2779 O2    ? ? ? 1_555 A  G   2793 N2    ? ? A C   2780 A G   2794 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2699 hydrog ? ? A  U   2780 N3    ? ? ? 1_555 A  U   2790 O4    ? ? A U   2781 A U   2791 1_555 ? ? ? ? ? ? 'U-U MISPAIR' ? 
? 
hydrog2700 hydrog ? ? A  U   2780 O2    ? ? ? 1_555 A  A   2792 N6    ? ? A U   2781 A A   2793 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2701 hydrog ? ? A  G   2781 N2    ? ? ? 1_555 A  A   2791 N7    ? ? A G   2782 A A   2792 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2702 hydrog ? ? A  G   2781 N3    ? ? ? 1_555 A  A   2791 N6    ? ? A G   2782 A A   2792 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2703 hydrog ? ? A  A   2782 N6    ? ? ? 1_555 A  U   2788 O2    ? ? A A   2783 A U   2789 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2704 hydrog ? ? A  A   2782 N7    ? ? ? 1_555 A  U   2788 N3    ? ? A A   2783 A U   2789 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2705 hydrog ? ? A  A   2783 N6    ? ? ? 1_555 A  A   2787 N1    ? ? A A   2784 A A   2788 1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
hydrog2706 hydrog ? ? A  A   2783 N7    ? ? ? 1_555 A  A   2787 N6    ? ? A A   2784 A A   2788 1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
hydrog2707 hydrog ? ? A  A   2783 N6    ? ? ? 1_555 A  U   2788 O2    ? ? A A   2784 A U   2789 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog2708 hydrog ? ? A  C   2784 O2    ? ? ? 1_555 A  C   2786 N4    ? ? A C   2785 A C   2787 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog2709 hydrog ? ? A  U   2790 N3    ? ? ? 1_555 A  A   2792 N7    ? ? A U   2791 A A   2793 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog2710 hydrog ? ? A  U   2790 O4    ? ? ? 1_555 A  A   2792 N6    ? ? A U   2791 A A   2793 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog2711 hydrog ? ? A  A   2811 N1    ? ? ? 1_555 A  A   2813 N6    ? ? A A   2812 A A   2814 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2712 hydrog ? ? A  G   2825 N2    ? ? ? 1_555 A  A   2913 N7    ? ? A G   2826 A A   2914 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2713 hydrog ? ? A  G   2825 N3    ? ? ? 1_555 A  A   2913 N6    ? ? A G   2826 A A   2914 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2714 hydrog ? ? A  A   2826 N6    ? ? ? 1_555 A  A   2912 N3    ? ? A A   2827 A A   2913 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2715 hydrog ? ? A  G   2827 N1    ? ? ? 1_555 A  C   2911 N3    ? ? A G   2828 A C   2912 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2716 hydrog ? ? A  G   2827 N2    ? ? ? 1_555 A  C   2911 O2    ? ? A G   2828 A C   2912 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2717 hydrog ? ? A  G   2827 O6    ? ? ? 1_555 A  C   2911 N4    ? ? A G   2828 A C   2912 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2718 hydrog ? ? A  G   2828 N1    ? ? ? 1_555 A  C   2910 N3    ? ? A G   2829 A C   2911 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2719 hydrog ? ? A  G   2828 N2    ? ? ? 1_555 A  C   2910 O2    ? ? A G   2829 A C   2911 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2720 hydrog ? ? A  G   2828 O6    ? ? ? 1_555 A  C   2910 N4    ? ? A G   2829 A C   2911 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2721 hydrog ? ? A  U   2829 N3    ? ? ? 1_555 A  A   2909 N1    ? ? A U   2830 A A   2910 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2722 hydrog ? ? A  U   2829 O4    ? ? ? 1_555 A  A   2909 N6    ? ? A U   2830 A A   2910 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2723 hydrog ? ? A  C   2830 O2    ? ? ? 1_555 A  G   2908 N2    ? ? A C   2831 A G   2909 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog2724 hydrog ? ? A  C   2831 N3    ? ? ? 1_555 A  G   2847 N1    ? ? A C   2832 A G   2848 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2725 hydrog ? ? A  C   2831 N4    ? ? ? 1_555 A  G   2847 O6    ? ? A C   2832 A G   2848 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2726 hydrog ? ? A  C   2831 O2    ? ? ? 1_555 A  G   2847 N2    ? ? A C   2832 A G   2848 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2727 hydrog ? ? A  C   2831 O2    ? ? ? 1_555 A  A   2907 N6    ? ? A C   2832 A A   2908 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2728 hydrog ? ? A  C   2832 N3    ? ? ? 1_555 A  G   2846 N1    ? ? A C   2833 A G   2847 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2729 hydrog ? ? A  C   2832 N4    ? ? ? 1_555 A  G   2846 O6    ? ? A C   2833 A G   2847 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2730 hydrog ? ? A  C   2832 O2    ? ? ? 1_555 A  G   2846 N2    ? ? A C   2833 A G   2847 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2731 hydrog ? ? A  G   2833 N1    ? ? ? 1_555 A  C   2845 N3    ? ? A G   2834 A C   2846 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2732 hydrog ? ? A  G   2833 N2    ? ? ? 1_555 A  C   2845 O2    ? ? A G   2834 A C   2846 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2733 hydrog ? ? A  G   2833 O6    ? ? ? 1_555 A  C   2845 N4    ? ? A G   2834 A C   2846 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2734 hydrog ? ? A  C   2834 N3    ? ? ? 1_555 A  G   2844 N1    ? ? A C   2835 A G   2845 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2735 hydrog ? ? A  C   2834 N4    ? ? ? 1_555 A  G   2844 O6    ? ? A C   2835 A G   2845 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2736 hydrog ? ? A  C   2834 O2    ? ? ? 1_555 A  G   2844 N2    ? ? A C   2835 A G   2845 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2737 hydrog ? ? A  G   2835 N1    ? ? ? 1_555 A  C   2843 N3    ? ? A G   2836 A C   2844 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2738 hydrog ? ? A  G   2835 N2    ? ? ? 1_555 A  C   2843 O2    ? ? A G   2836 A C   2844 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2739 hydrog ? ? A  G   2835 O6    ? ? ? 1_555 A  C   2843 N4    ? ? A G   2836 A C   2844 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2740 hydrog ? ? A  A   2837 N3    ? ? ? 1_555 A  A   2842 N6    ? ? A A   2838 A A   2843 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2741 hydrog ? ? A  G   2846 N2    ? ? ? 1_555 A  A   2905 N3    ? ? A G   2847 A A   2906 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2742 hydrog ? ? A  G   2850 N2    ? ? ? 1_555 A  A   2905 N7    ? ? A G   2851 A A   2906 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2743 hydrog ? ? A  G   2850 N3    ? ? ? 1_555 A  A   2905 N6    ? ? A G   2851 A A   2906 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2744 hydrog ? ? A  A   2851 N1    ? ? ? 1_555 A  C   2902 N4    ? ? A A   2852 A C   2903 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog2745 hydrog ? ? A  U   2852 O4    ? ? ? 1_555 A  A   2901 N6    ? ? A U   2853 A A   2902 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2746 hydrog ? ? A  U   2852 N3    ? ? ? 1_555 A  A   2904 N1    ? ? A U   2853 A A   2905 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2747 hydrog ? ? A  U   2852 O4    ? ? ? 1_555 A  A   2904 N6    ? ? A U   2853 A A   2905 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2748 hydrog ? ? A  A   2853 N1    ? ? ? 1_555 A  U   2903 N3    ? ? A A   2854 A U   2904 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2749 hydrog ? ? A  A   2853 N6    ? ? ? 1_555 A  U   2903 O4    ? ? A A   2854 A U   2904 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2750 hydrog ? ? A  G   2854 N1    ? ? ? 1_555 A  C   2902 N3    ? ? A G   2855 A C   2903 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2751 hydrog ? ? A  G   2854 N2    ? ? ? 1_555 A  C   2902 O2    ? ? A G   2855 A C   2903 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2752 hydrog ? ? A  G   2854 O6    ? ? ? 1_555 A  C   2902 N4    ? ? A G   2855 A C   2903 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2753 hydrog ? ? A  A   2855 N6    ? ? ? 1_555 A  C   2900 O2    ? ? A A   2856 A C   2901 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog2754 hydrog ? ? A  C   2856 N3    ? ? ? 1_555 A  G   2899 N1    ? ? A C   2857 A G   2900 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2755 hydrog ? ? A  C   2856 N4    ? ? ? 1_555 A  G   2899 O6    ? ? A C   2857 A G   2900 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2756 hydrog ? ? A  C   2856 O2    ? ? ? 1_555 A  G   2899 N2    ? ? A C   2857 A G   2900 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2757 hydrog ? ? A  U   2857 N3    ? ? ? 1_555 A  A   2898 N1    ? ? A U   2858 A A   2899 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2758 hydrog ? ? A  U   2857 O4    ? ? ? 1_555 A  A   2898 N6    ? ? A U   2858 A A   2899 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2759 hydrog ? ? A  C   2858 N3    ? ? ? 1_555 A  G   2897 N1    ? ? A C   2859 A G   2898 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2760 hydrog ? ? A  C   2858 N4    ? ? ? 1_555 A  G   2897 O6    ? ? A C   2859 A G   2898 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2761 hydrog ? ? A  C   2858 O2    ? ? ? 1_555 A  G   2897 N2    ? ? A C   2859 A G   2898 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2762 hydrog ? ? A  G   2859 N1    ? ? ? 1_555 A  C   2896 N3    ? ? A G   2860 A C   2897 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2763 hydrog ? ? A  G   2859 N2    ? ? ? 1_555 A  C   2896 O2    ? ? A G   2860 A C   2897 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2764 hydrog ? ? A  G   2859 O6    ? ? ? 1_555 A  C   2896 N4    ? ? A G   2860 A C   2897 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2765 hydrog ? ? A  G   2860 N1    ? ? ? 1_555 A  C   2894 N3    ? ? A G   2861 A C   2895 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2766 hydrog ? ? A  G   2860 N2    ? ? ? 1_555 A  C   2894 O2    ? ? A G   2861 A C   2895 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2767 hydrog ? ? A  G   2860 O6    ? ? ? 1_555 A  C   2894 N4    ? ? A G   2861 A C   2895 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2768 hydrog ? ? A  G   2861 N1    ? ? ? 1_555 A  C   2893 N3    ? ? A G   2862 A C   2894 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2769 hydrog ? ? A  G   2861 N2    ? ? ? 1_555 A  C   2893 O2    ? ? A G   2862 A C   2894 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2770 hydrog ? ? A  G   2861 O6    ? ? ? 1_555 A  C   2893 N4    ? ? A G   2862 A C   2894 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2771 hydrog ? ? A  G   2862 N1    ? ? ? 1_555 A  C   2892 N3    ? ? A G   2863 A C   2893 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2772 hydrog ? ? A  G   2862 N2    ? ? ? 1_555 A  C   2892 O2    ? ? A G   2863 A C   2893 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2773 hydrog ? ? A  G   2862 O6    ? ? ? 1_555 A  C   2892 N4    ? ? A G   2863 A C   2893 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2774 hydrog ? ? A  U   2863 N3    ? ? ? 1_555 A  G   2891 O6    ? ? A U   2864 A G   2892 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2775 hydrog ? ? A  U   2863 O2    ? ? ? 1_555 A  G   2891 N1    ? ? A U   2864 A G   2892 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2776 hydrog ? ? A  G   2864 N2    ? ? ? 1_555 A  A   2890 N7    ? ? A G   2865 A A   2891 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2777 hydrog ? ? A  G   2864 N3    ? ? ? 1_555 A  A   2890 N6    ? ? A G   2865 A A   2891 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2778 hydrog ? ? A  C   2867 N4    ? ? ? 1_555 A  U   2888 O4    ? ? A C   2868 A U   2889 1_555 ? ? ? ? ? ? 'C-U MISPAIR' ? 
? 
hydrog2779 hydrog ? ? A  G   2868 N1    ? ? ? 1_555 A  U   2887 O2    ? ? A G   2869 A U   2888 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2780 hydrog ? ? A  G   2868 O6    ? ? ? 1_555 A  U   2887 N3    ? ? A G   2869 A U   2888 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2781 hydrog ? ? A  C   2869 N3    ? ? ? 1_555 A  G   2886 N1    ? ? A C   2870 A G   2887 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2782 hydrog ? ? A  C   2869 N4    ? ? ? 1_555 A  G   2886 O6    ? ? A C   2870 A G   2887 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2783 hydrog ? ? A  C   2869 O2    ? ? ? 1_555 A  G   2886 N2    ? ? A C   2870 A G   2887 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2784 hydrog ? ? A  G   2870 N1    ? ? ? 1_555 A  C   2885 N3    ? ? A G   2871 A C   2886 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2785 hydrog ? ? A  G   2870 N2    ? ? ? 1_555 A  C   2885 O2    ? ? A G   2871 A C   2886 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2786 hydrog ? ? A  G   2870 O6    ? ? ? 1_555 A  C   2885 N4    ? ? A G   2871 A C   2886 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2787 hydrog ? ? A  U   2871 N3    ? ? ? 1_555 A  A   2884 N1    ? ? A U   2872 A A   2885 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2788 hydrog ? ? A  U   2871 O4    ? ? ? 1_555 A  A   2884 N6    ? ? A U   2872 A A   2885 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2789 hydrog ? ? A  C   2872 O2    ? ? ? 1_555 A  G   2883 N2    ? ? A C   2873 A G   2884 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog2790 hydrog ? ? A  G   2873 N2    ? ? ? 1_555 A  A   2882 N7    ? ? A G   2874 A A   2883 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2791 hydrog ? ? A  G   2873 N3    ? ? ? 1_555 A  A   2882 N6    ? ? A G   2874 A A   2883 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2792 hydrog ? ? A  A   2874 N6    ? ? ? 1_555 A  G   2881 N3    ? ? A A   2875 A G   2882 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2793 hydrog ? ? A  A   2874 N7    ? ? ? 1_555 A  G   2881 N2    ? ? A A   2875 A G   2882 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2794 hydrog ? ? A  G   2875 N1    ? ? ? 1_555 A  C   2880 N3    ? ? A G   2876 A C   2881 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2795 hydrog ? ? A  G   2875 N2    ? ? ? 1_555 A  C   2880 O2    ? ? A G   2876 A C   2881 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2796 hydrog ? ? A  G   2875 O6    ? ? ? 1_555 A  C   2880 N4    ? ? A G   2876 A C   2881 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2797 hydrog ? ? A  G   2876 N2    ? ? ? 1_555 A  A   2879 N7    ? ? A G   2877 A A   2880 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2798 hydrog ? ? A  A   2901 N7    ? ? ? 1_555 A  A   2904 N6    ? ? A A   2902 A A   2905 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2799 hydrog ? ? B  A   3    N3    ? ? ? 1_555 B  G   21   N2    ? ? B A   3003 B G   3021 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2800 hydrog ? ? B  A   3    N6    ? ? ? 1_555 B  G   25   O6    ? ? B A   3003 B G   3025 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2801 hydrog ? ? B  G   4    N1    ? ? ? 1_555 B  C   119  N3    ? ? B G   3004 B C   3119 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2802 hydrog ? ? B  G   4    N2    ? ? ? 1_555 B  C   119  O2    ? ? B G   3004 B C   3119 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2803 hydrog ? ? B  G   4    O6    ? ? ? 1_555 B  C   119  N4    ? ? B G   3004 B C   3119 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2804 hydrog ? ? B  G   5    N1    ? ? ? 1_555 B  C   118  N3    ? ? B G   3005 B C   3118 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2805 hydrog ? ? B  G   5    N2    ? ? ? 1_555 B  C   118  O2    ? ? B G   3005 B C   3118 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2806 hydrog ? ? B  G   5    O6    ? ? ? 1_555 B  C   118  N4    ? ? B G   3005 B C   3118 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2807 hydrog ? ? B  C   6    N3    ? ? ? 1_555 B  G   117  N1    ? ? B C   3006 B G   3117 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2808 hydrog ? ? B  C   6    N4    ? ? ? 1_555 B  G   117  O6    ? ? B C   3006 B G   3117 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2809 hydrog ? ? B  C   6    O2    ? ? ? 1_555 B  G   117  N2    ? ? B C   3006 B G   3117 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2810 hydrog ? ? B  G   7    N1    ? ? ? 1_555 B  C   116  N3    ? ? B G   3007 B C   3116 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2811 hydrog ? ? B  G   7    N2    ? ? ? 1_555 B  C   116  O2    ? ? B G   3007 B C   3116 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2812 hydrog ? ? B  G   7    O6    ? ? ? 1_555 B  C   116  N4    ? ? B G   3007 B C   3116 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2813 hydrog ? ? B  G   8    N1    ? ? ? 1_555 B  C   115  N3    ? ? B G   3008 B C   3115 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2814 hydrog ? ? B  G   8    N2    ? ? ? 1_555 B  C   115  O2    ? ? B G   3008 B C   3115 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2815 hydrog ? ? B  G   8    O6    ? ? ? 1_555 B  C   115  N4    ? ? B G   3008 B C   3115 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2816 hydrog ? ? B  C   9    N3    ? ? ? 1_555 B  G   114  N1    ? ? B C   3009 B G   3114 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2817 hydrog ? ? B  C   9    N4    ? ? ? 1_555 B  G   114  O6    ? ? B C   3009 B G   3114 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2818 hydrog ? ? B  C   9    O2    ? ? ? 1_555 B  G   114  N2    ? ? B C   3009 B G   3114 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2819 hydrog ? ? B  A   11   N3    ? ? ? 1_555 B  G   68   N2    ? ? B A   3011 B G   3068 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2820 hydrog ? ? B  G   14   N1    ? ? ? 1_555 B  C   67   N3    ? ? B G   3014 B C   3067 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2821 hydrog ? ? B  G   14   N2    ? ? ? 1_555 B  C   67   O2    ? ? B G   3014 B C   3067 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2822 hydrog ? ? B  G   14   O6    ? ? ? 1_555 B  C   67   N4    ? ? B G   3014 B C   3067 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2823 hydrog ? ? B  C   15   N3    ? ? ? 1_555 B  G   66   N1    ? ? B C   3015 B G   3066 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2824 hydrog ? ? B  C   15   N4    ? ? ? 1_555 B  G   66   O6    ? ? B C   3015 B G   3066 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2825 hydrog ? ? B  C   15   O2    ? ? ? 1_555 B  G   66   N2    ? ? B C   3015 B G   3066 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2826 hydrog ? ? B  C   15   N4    ? ? ? 1_555 B  C   113  O2    ? ? B C   3015 B C   3113 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog2827 hydrog ? ? B  G   16   N1    ? ? ? 1_555 B  C   64   N3    ? ? B G   3016 B C   3064 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2828 hydrog ? ? B  G   16   N2    ? ? ? 1_555 B  C   64   O2    ? ? B G   3016 B C   3064 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2829 hydrog ? ? B  G   16   O6    ? ? ? 1_555 B  C   64   N4    ? ? B G   3016 B C   3064 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2830 hydrog ? ? B  G   17   N1    ? ? ? 1_555 B  C   63   N3    ? ? B G   3017 B C   3063 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2831 hydrog ? ? B  G   17   N2    ? ? ? 1_555 B  C   63   O2    ? ? B G   3017 B C   3063 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2832 hydrog ? ? B  G   17   O6    ? ? ? 1_555 B  C   63   N4    ? ? B G   3017 B C   3063 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2833 hydrog ? ? B  U   18   N3    ? ? ? 1_555 B  A   62   N1    ? ? B U   3018 B A   3062 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2834 hydrog ? ? B  U   18   O4    ? ? ? 1_555 B  A   62   N6    ? ? B U   3018 B A   3062 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2835 hydrog ? ? B  G   19   N1    ? ? ? 1_555 B  C   61   N3    ? ? B G   3019 B C   3061 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2836 hydrog ? ? B  G   19   N2    ? ? ? 1_555 B  C   61   O2    ? ? B G   3019 B C   3061 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2837 hydrog ? ? B  G   19   O6    ? ? ? 1_555 B  C   61   N4    ? ? B G   3019 B C   3061 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2838 hydrog ? ? B  G   20   N1    ? ? ? 1_555 B  C   60   N3    ? ? B G   3020 B C   3060 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2839 hydrog ? ? B  G   20   N2    ? ? ? 1_555 B  C   60   O2    ? ? B G   3020 B C   3060 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2840 hydrog ? ? B  G   20   O6    ? ? ? 1_555 B  C   60   N4    ? ? B G   3020 B C   3060 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2841 hydrog ? ? B  G   21   N1    ? ? ? 1_555 B  C   59   N3    ? ? B G   3021 B C   3059 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2842 hydrog ? ? B  G   21   N2    ? ? ? 1_555 B  C   59   O2    ? ? B G   3021 B C   3059 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2843 hydrog ? ? B  G   21   O6    ? ? ? 1_555 B  C   59   N4    ? ? B G   3021 B C   3059 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2844 hydrog ? ? B  G   22   N1    ? ? ? 1_555 B  G   58   O6    ? ? B G   3022 B G   3058 1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog2845 hydrog ? ? B  C   27   N4    ? ? ? 1_555 B  U   55   O4    ? ? B C   3027 B U   3055 1_555 ? ? ? ? ? ? 'C-U MISPAIR' ? 
? 
hydrog2846 hydrog ? ? B  C   27   O2    ? ? ? 1_555 B  G   58   N1    ? ? B C   3027 B G   3058 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog2847 hydrog ? ? B  U   28   N3    ? ? ? 1_555 B  A   54   N1    ? ? B U   3028 B A   3054 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2848 hydrog ? ? B  U   28   O4    ? ? ? 1_555 B  A   54   N6    ? ? B U   3028 B A   3054 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2849 hydrog ? ? B  U   28   O2    ? ? ? 1_555 B  A   57   N6    ? ? B U   3028 B A   3057 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2850 hydrog ? ? B  C   29   N3    ? ? ? 1_555 B  G   53   N1    ? ? B C   3029 B G   3053 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2851 hydrog ? ? B  C   29   N4    ? ? ? 1_555 B  G   53   O6    ? ? B C   3029 B G   3053 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2852 hydrog ? ? B  C   29   O2    ? ? ? 1_555 B  G   53   N2    ? ? B C   3029 B G   3053 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2853 hydrog ? ? B  C   29   O2    ? ? ? 1_555 B  A   56   N6    ? ? B C   3029 B A   3056 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2854 hydrog ? ? B  C   30   N3    ? ? ? 1_555 B  G   50   N1    ? ? B C   3030 B G   3050 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2855 hydrog ? ? B  C   30   N4    ? ? ? 1_555 B  G   50   O6    ? ? B C   3030 B G   3050 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2856 hydrog ? ? B  C   30   O2    ? ? ? 1_555 B  G   50   N2    ? ? B C   3030 B G   3050 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2857 hydrog ? ? B  C   30   O2    ? ? ? 1_555 B  A   52   N6    ? ? B C   3030 B A   3052 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2858 hydrog ? ? B  C   31   N3    ? ? ? 1_555 B  G   49   N1    ? ? B C   3031 B G   3049 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2859 hydrog ? ? B  C   31   N4    ? ? ? 1_555 B  G   49   O6    ? ? B C   3031 B G   3049 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2860 hydrog ? ? B  C   31   O2    ? ? ? 1_555 B  G   49   N2    ? ? B C   3031 B G   3049 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2861 hydrog ? ? B  G   32   N1    ? ? ? 1_555 B  C   48   N3    ? ? B G   3032 B C   3048 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2862 hydrog ? ? B  G   32   N2    ? ? ? 1_555 B  C   48   O2    ? ? B G   3032 B C   3048 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2863 hydrog ? ? B  G   32   O6    ? ? ? 1_555 B  C   48   N4    ? ? B G   3032 B C   3048 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2864 hydrog ? ? B  U   33   O2    ? ? ? 1_555 B  C   35   N4    ? ? B U   3033 B C   3035 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog2865 hydrog ? ? B  U   33   N3    ? ? ? 1_555 B  A   47   N1    ? ? B U   3033 B A   3047 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2866 hydrog ? ? B  U   33   O4    ? ? ? 1_555 B  A   47   N6    ? ? B U   3033 B A   3047 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2867 hydrog ? ? B  C   35   N4    ? ? ? 1_555 B  C   48   O2    ? ? B C   3035 B C   3048 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog2868 hydrog ? ? B  C   36   N4    ? ? ? 1_555 B  A   47   N3    ? ? B C   3036 B A   3047 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2869 hydrog ? ? B  C   37   N3    ? ? ? 1_555 B  G   43   N1    ? ? B C   3037 B G   3043 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2870 hydrog ? ? B  C   37   N4    ? ? ? 1_555 B  G   43   O6    ? ? B C   3037 B G   3043 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2871 hydrog ? ? B  C   37   O2    ? ? ? 1_555 B  G   43   N2    ? ? B C   3037 B G   3043 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2872 hydrog ? ? B  A   38   N3    ? ? ? 1_555 B  A   45   N6    ? ? B A   3038 B A   3045 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2873 hydrog ? ? B  U   39   O2    ? ? ? 1_555 B  A   44   N6    ? ? B U   3039 B A   3044 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2874 hydrog ? ? B  G   43   N2    ? ? ? 1_555 B  C   46   O2    ? ? B G   3043 B C   3046 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog2875 hydrog ? ? B  A   51   N3    ? ? ? 1_555 B  A   52   N6    ? ? B A   3051 B A   3052 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2876 hydrog ? ? B  A   54   N3    ? ? ? 1_555 B  A   56   N6    ? ? B A   3054 B A   3056 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2877 hydrog ? ? B  A   65   N3    ? ? ? 1_555 B  C   67   N4    ? ? B A   3065 B C   3067 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog2878 hydrog ? ? B  G   66   O6    ? ? ? 1_555 B  C   113  N4    ? ? B G   3066 B C   3113 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog2879 hydrog ? ? B  U   69   N3    ? ? ? 1_555 B  U   112  O2    ? ? B U   3069 B U   3112 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2880 hydrog ? ? B  U   69   O4    ? ? ? 1_555 B  U   112  N3    ? ? B U   3069 B U   3112 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2881 hydrog ? ? B  U   70   N3    ? ? ? 1_555 B  U   111  O2    ? ? B U   3070 B U   3111 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2882 hydrog ? ? B  U   70   O4    ? ? ? 1_555 B  U   111  N3    ? ? B U   3070 B U   3111 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2883 hydrog ? ? B  C   71   N3    ? ? ? 1_555 B  G   110  N1    ? ? B C   3071 B G   3110 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2884 hydrog ? ? B  C   71   N4    ? ? ? 1_555 B  G   110  O6    ? ? B C   3071 B G   3110 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2885 hydrog ? ? B  C   71   O2    ? ? ? 1_555 B  G   110  N2    ? ? B C   3071 B G   3110 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2886 hydrog ? ? B  C   72   N3    ? ? ? 1_555 B  G   109  N1    ? ? B C   3072 B G   3109 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2887 hydrog ? ? B  C   72   N4    ? ? ? 1_555 B  G   109  O6    ? ? B C   3072 B G   3109 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2888 hydrog ? ? B  C   72   O2    ? ? ? 1_555 B  G   109  N2    ? ? B C   3072 B G   3109 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2889 hydrog ? ? B  G   73   N1    ? ? ? 1_555 B  C   108  N3    ? ? B G   3073 B C   3108 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2890 hydrog ? ? B  G   73   N2    ? ? ? 1_555 B  C   108  O2    ? ? B G   3073 B C   3108 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2891 hydrog ? ? B  G   73   O6    ? ? ? 1_555 B  C   108  N4    ? ? B G   3073 B C   3108 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2892 hydrog ? ? B  G   74   N1    ? ? ? 1_555 B  C   107  N3    ? ? B G   3074 B C   3107 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2893 hydrog ? ? B  G   74   N2    ? ? ? 1_555 B  C   107  O2    ? ? B G   3074 B C   3107 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2894 hydrog ? ? B  G   74   O6    ? ? ? 1_555 B  C   107  N4    ? ? B G   3074 B C   3107 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2895 hydrog ? ? B  G   75   N1    ? ? ? 1_555 B  C   106  N3    ? ? B G   3075 B C   3106 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2896 hydrog ? ? B  G   75   N2    ? ? ? 1_555 B  C   106  O2    ? ? B G   3075 B C   3106 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2897 hydrog ? ? B  G   75   O6    ? ? ? 1_555 B  C   106  N4    ? ? B G   3075 B C   3106 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2898 hydrog ? ? B  G   76   N2    ? ? ? 1_555 B  A   105  N7    ? ? B G   3076 B A   3105 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2899 hydrog ? ? B  G   76   N3    ? ? ? 1_555 B  A   105  N6    ? ? B G   3076 B A   3105 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2900 hydrog ? ? B  A   77   N6    ? ? ? 1_555 B  A   104  N7    ? ? B A   3077 B A   3104 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2901 hydrog ? ? B  A   77   N7    ? ? ? 1_555 B  A   104  N6    ? ? B A   3077 B A   3104 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2902 hydrog ? ? B  G   78   N2    ? ? ? 1_555 B  U   79   O4    ? ? B G   3078 B U   3079 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2903 hydrog ? ? B  U   79   N3    ? ? ? 1_555 B  A   103  N7    ? ? B U   3079 B A   3103 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2904 hydrog ? ? B  U   79   O2    ? ? ? 1_555 B  A   103  N6    ? ? B U   3079 B A   3103 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2905 hydrog ? ? B  A   80   N6    ? ? ? 1_555 B  G   102  N3    ? ? B A   3080 B G   3102 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2906 hydrog ? ? B  A   80   N7    ? ? ? 1_555 B  G   102  N2    ? ? B A   3080 B G   3102 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2907 hydrog ? ? B  C   81   N3    ? ? ? 1_555 B  G   101  N1    ? ? B C   3081 B G   3101 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2908 hydrog ? ? B  C   81   N4    ? ? ? 1_555 B  G   101  O6    ? ? B C   3081 B G   3101 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2909 hydrog ? ? B  C   81   O2    ? ? ? 1_555 B  G   101  N2    ? ? B C   3081 B G   3101 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2910 hydrog ? ? B  U   82   N3    ? ? ? 1_555 B  G   100  O6    ? ? B U   3082 B G   3100 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2911 hydrog ? ? B  U   82   O2    ? ? ? 1_555 B  G   100  N1    ? ? B U   3082 B G   3100 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2912 hydrog ? ? B  G   83   N1    ? ? ? 1_555 B  U   99   O2    ? ? B G   3083 B U   3099 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2913 hydrog ? ? B  G   83   O6    ? ? ? 1_555 B  U   99   N3    ? ? B G   3083 B U   3099 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2914 hydrog ? ? B  G   84   N1    ? ? ? 1_555 B  C   98   N3    ? ? B G   3084 B C   3098 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2915 hydrog ? ? B  G   84   N2    ? ? ? 1_555 B  C   98   O2    ? ? B G   3084 B C   3098 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2916 hydrog ? ? B  G   84   O6    ? ? ? 1_555 B  C   98   N4    ? ? B G   3084 B C   3098 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2917 hydrog ? ? B  A   85   N1    ? ? ? 1_555 B  U   97   N3    ? ? B A   3085 B U   3097 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2918 hydrog ? ? B  A   85   N6    ? ? ? 1_555 B  U   97   O4    ? ? B A   3085 B U   3097 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2919 hydrog ? ? B  G   86   N1    ? ? ? 1_555 B  C   96   N3    ? ? B G   3086 B C   3096 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2920 hydrog ? ? B  G   86   N2    ? ? ? 1_555 B  C   96   O2    ? ? B G   3086 B C   3096 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2921 hydrog ? ? B  G   86   O6    ? ? ? 1_555 B  C   96   N4    ? ? B G   3086 B C   3096 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2922 hydrog ? ? B  G   88   N1    ? ? ? 1_555 B  C   95   N3    ? ? B G   3088 B C   3095 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2923 hydrog ? ? B  G   88   N2    ? ? ? 1_555 B  C   95   O2    ? ? B G   3088 B C   3095 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2924 hydrog ? ? B  G   88   O6    ? ? ? 1_555 B  C   95   N4    ? ? B G   3088 B C   3095 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2925 hydrog ? ? B  C   89   N3    ? ? ? 1_555 B  G   94   N1    ? ? B C   3089 B G   3094 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2926 hydrog ? ? B  C   89   N4    ? ? ? 1_555 B  G   94   O6    ? ? B C   3089 B G   3094 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2927 hydrog ? ? B  C   89   O2    ? ? ? 1_555 B  G   94   N2    ? ? B C   3089 B G   3094 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2928 hydrog ? ? B  G   90   N2    ? ? ? 1_555 B  A   93   N7    ? ? B G   3090 B A   3093 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TRP 186 C . ? TRP 186 C PRO 187 C ? PRO 187 C 1 6.59  
2 GLY 14  D . ? GLY 14  D PRO 15  D ? PRO 15  D 1 -0.13 
3 ASN 243 D . ? ASN 243 D PRO 244 D ? PRO 244 D 1 3.90  
4 VAL 136 E . ? VAL 136 E PRO 137 E ? PRO 137 E 1 0.55  
5 GLN 55  H . ? GLN 55  H PRO 56  H ? PRO 56  H 1 2.38  
6 ARG 184 N . ? ARG 184 N PRO 185 N ? PRO 185 N 1 -8.57 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 4 ? 
B  ? 6 ? 
C  ? 2 ? 
D  ? 5 ? 
E  ? 5 ? 
F  ? 8 ? 
G  ? 2 ? 
H  ? 6 ? 
I  ? 3 ? 
J  ? 2 ? 
K  ? 4 ? 
L  ? 2 ? 
M  ? 3 ? 
N  ? 3 ? 
O  ? 4 ? 
P  ? 3 ? 
Q  ? 4 ? 
R  ? 5 ? 
S  ? 3 ? 
T  ? 3 ? 
U  ? 2 ? 
V  ? 5 ? 
W  ? 2 ? 
X  ? 6 ? 
Y  ? 2 ? 
Z  ? 3 ? 
AA ? 3 ? 
AB ? 4 ? 
AC ? 4 ? 
AD ? 4 ? 
AE ? 3 ? 
AF ? 2 ? 
AG ? 5 ? 
AH ? 3 ? 
AI ? 2 ? 
AJ ? 2 ? 
AK ? 4 ? 
AL ? 6 ? 
AM ? 2 ? 
AN ? 5 ? 
AO ? 4 ? 
AP ? 2 ? 
AQ ? 2 ? 
AR ? 3 ? 
AS ? 3 ? 
AT ? 2 ? 
AU ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? anti-parallel 
A  2 3 ? anti-parallel 
A  3 4 ? anti-parallel 
B  1 2 ? anti-parallel 
B  2 3 ? anti-parallel 
B  3 4 ? anti-parallel 
B  4 5 ? anti-parallel 
B  5 6 ? anti-parallel 
C  1 2 ? parallel      
D  1 2 ? anti-parallel 
D  2 3 ? anti-parallel 
D  3 4 ? anti-parallel 
D  4 5 ? anti-parallel 
E  1 2 ? anti-parallel 
E  2 3 ? anti-parallel 
E  3 4 ? anti-parallel 
E  4 5 ? anti-parallel 
F  1 2 ? anti-parallel 
F  2 3 ? anti-parallel 
F  3 4 ? anti-parallel 
F  4 5 ? anti-parallel 
F  5 6 ? anti-parallel 
F  6 7 ? anti-parallel 
F  7 8 ? anti-parallel 
G  1 2 ? anti-parallel 
H  1 2 ? anti-parallel 
H  2 3 ? parallel      
H  3 4 ? parallel      
H  4 5 ? parallel      
H  5 6 ? parallel      
I  1 2 ? anti-parallel 
I  2 3 ? anti-parallel 
J  1 2 ? anti-parallel 
K  1 2 ? anti-parallel 
K  2 3 ? anti-parallel 
K  3 4 ? anti-parallel 
L  1 2 ? anti-parallel 
M  1 2 ? anti-parallel 
M  2 3 ? anti-parallel 
N  1 2 ? anti-parallel 
N  2 3 ? anti-parallel 
O  1 2 ? anti-parallel 
O  2 3 ? anti-parallel 
O  3 4 ? anti-parallel 
P  1 2 ? anti-parallel 
P  2 3 ? anti-parallel 
Q  1 2 ? anti-parallel 
Q  2 3 ? anti-parallel 
Q  3 4 ? parallel      
R  1 2 ? anti-parallel 
R  2 3 ? anti-parallel 
R  3 4 ? anti-parallel 
R  4 5 ? anti-parallel 
S  1 2 ? anti-parallel 
S  2 3 ? anti-parallel 
T  1 2 ? parallel      
T  2 3 ? parallel      
U  1 2 ? anti-parallel 
V  1 2 ? anti-parallel 
V  2 3 ? anti-parallel 
V  3 4 ? parallel      
V  4 5 ? anti-parallel 
W  1 2 ? anti-parallel 
X  1 2 ? anti-parallel 
X  2 3 ? anti-parallel 
X  3 4 ? anti-parallel 
X  4 5 ? anti-parallel 
X  5 6 ? parallel      
Y  1 2 ? parallel      
Z  1 2 ? parallel      
Z  2 3 ? parallel      
AA 1 2 ? parallel      
AA 2 3 ? parallel      
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AC 3 4 ? parallel      
AD 1 2 ? parallel      
AD 2 3 ? parallel      
AD 3 4 ? parallel      
AE 1 2 ? parallel      
AE 2 3 ? parallel      
AF 1 2 ? anti-parallel 
AG 1 2 ? anti-parallel 
AG 2 3 ? anti-parallel 
AG 3 4 ? anti-parallel 
AG 4 5 ? anti-parallel 
AH 1 2 ? anti-parallel 
AH 2 3 ? anti-parallel 
AI 1 2 ? anti-parallel 
AJ 1 2 ? anti-parallel 
AK 1 2 ? anti-parallel 
AK 2 3 ? anti-parallel 
AK 3 4 ? anti-parallel 
AL 1 2 ? anti-parallel 
AL 2 3 ? parallel      
AL 3 4 ? anti-parallel 
AL 4 5 ? anti-parallel 
AL 5 6 ? anti-parallel 
AM 1 2 ? anti-parallel 
AN 1 2 ? anti-parallel 
AN 2 3 ? anti-parallel 
AN 3 4 ? anti-parallel 
AN 4 5 ? parallel      
AO 1 2 ? anti-parallel 
AO 2 3 ? anti-parallel 
AO 3 4 ? parallel      
AP 1 2 ? anti-parallel 
AQ 1 2 ? parallel      
AR 1 2 ? anti-parallel 
AR 2 3 ? anti-parallel 
AS 1 2 ? anti-parallel 
AS 2 3 ? anti-parallel 
AT 1 2 ? parallel      
AU 1 2 ? anti-parallel 
AU 2 3 ? anti-parallel 
AU 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 ARG C  65  ? ILE C  68  ? ARG C 65  ILE C 68  
A  2 PRO C  54  ? PHE C  60  ? PRO C 54  PHE C 60  
A  3 ALA C  39  ? HIS C  47  ? ALA C 39  HIS C 47  
A  4 GLU C  79  ? GLN C  81  ? GLU C 79  GLN C 81  
B  1 THR C  93  ? PRO C  95  ? THR C 93  PRO C 95  
B  2 ARG C  153 ? ILE C  156 ? ARG C 153 ILE C 156 
B  3 PRO C  104 ? CYS C  106 ? PRO C 104 CYS C 106 
B  4 ALA C  126 ? THR C  130 ? ALA C 126 THR C 130 
B  5 ALA C  136 ? LYS C  139 ? ALA C 136 LYS C 139 
B  6 MET C  145 ? LEU C  148 ? MET C 145 LEU C 148 
C  1 SER C  214 ? ILE C  215 ? SER C 214 ILE C 215 
C  2 ASP C  227 ? ILE C  228 ? ASP C 227 ILE C 228 
D  1 GLY D  37  ? VAL D  38  ? GLY D 37  VAL D 38  
D  2 VAL D  161 ? GLY D  167 ? VAL D 161 GLY D 167 
D  3 LEU D  137 ? HIS D  145 ? LEU D 137 HIS D 145 
D  4 MET D  79  ? THR D  90  ? MET D 79  THR D 90  
D  5 GLY D  93  ? TRP D  101 ? GLY D 93  TRP D 101 
E  1 GLY D  37  ? VAL D  38  ? GLY D 37  VAL D 38  
E  2 VAL D  161 ? GLY D  167 ? VAL D 161 GLY D 167 
E  3 LEU D  137 ? HIS D  145 ? LEU D 137 HIS D 145 
E  4 MET D  79  ? THR D  90  ? MET D 79  THR D 90  
E  5 GLU D  187 ? HIS D  188 ? GLU D 187 HIS D 188 
F  1 VAL D  327 ? VAL D  330 ? VAL D 327 VAL D 330 
F  2 PHE D  41  ? LEU D  53  ? PHE D 41  LEU D 53  
F  3 LEU D  308 ? PRO D  313 ? LEU D 308 PRO D 313 
F  4 TYR D  199 ? VAL D  205 ? TYR D 199 VAL D 205 
F  5 GLN D  261 ? GLY D  275 ? GLN D 261 GLY D 275 
F  6 GLY D  292 ? LYS D  298 ? GLY D 292 LYS D 298 
F  7 THR D  68  ? GLU D  75  ? THR D 68  GLU D 75  
F  8 PHE D  41  ? LEU D  53  ? PHE D 41  LEU D 53  
G  1 THR D  211 ? GLN D  212 ? THR D 211 GLN D 212 
G  2 GLY D  255 ? GLN D  256 ? GLY D 255 GLN D 256 
H  1 THR E  12  ? ASP E  17  ? THR E 12  ASP E 17  
H  2 GLN E  2   ? TYR E  6   ? GLN E 2   TYR E 6   
H  3 VAL E  138 ? VAL E  140 ? VAL E 138 VAL E 140 
H  4 THR E  233 ? THR E  236 ? THR E 233 THR E 236 
H  5 LEU E  193 ? THR E  196 ? LEU E 193 THR E 196 
H  6 ASP E  211 ? THR E  214 ? ASP E 211 THR E 214 
I  1 GLU E  59  ? SER E  60  ? GLU E 59  SER E 60  
I  2 PRO E  71  ? LEU E  73  ? PRO E 71  LEU E 73  
I  3 ARG E  76  ? ALA E  77  ? ARG E 76  ALA E 77  
J  1 LYS E  173 ? ILE E  174 ? LYS E 173 ILE E 174 
J  2 TYR E  186 ? ARG E  187 ? TYR E 186 ARG E 187 
K  1 THR F  74  ? LEU F  75  ? THR F 74  LEU F 75  
K  2 ARG F  17  ? HIS F  24  ? ARG F 17  HIS F 24  
K  3 ASP F  129 ? VAL F  135 ? ASP F 129 VAL F 135 
K  4 PHE F  104 ? PHE F  106 ? PHE F 104 PHE F 106 
L  1 VAL F  50  ? ARG F  51  ? VAL F 50  ARG F 51  
L  2 ALA F  71  ? LYS F  72  ? ALA F 71  LYS F 72  
M  1 ARG G  2   ? GLU G  6   ? ARG G 2   GLU G 6   
M  2 THR G  46  ? SER G  51  ? THR G 46  SER G 51  
M  3 ILE G  38  ? ASP G  43  ? ILE G 38  ASP G 43  
N  1 ASP G  12  ? ASP G  16  ? ASP G 12  ASP G 16  
N  2 ASP G  19  ? GLY G  24  ? ASP G 19  GLY G 24  
N  3 GLY G  27  ? ARG G  32  ? GLY G 27  ARG G 32  
O  1 ASP G  123 ? ASP G  127 ? ASP G 123 ASP G 127 
O  2 GLU G  130 ? GLY G  135 ? GLU G 130 GLY G 135 
O  3 TRP G  80  ? PHE G  87  ? TRP G 80  PHE G 87  
O  4 GLY G  165 ? ARG G  170 ? GLY G 165 ARG G 170 
P  1 GLN G  94  ? GLU G  98  ? GLN G 94  GLU G 98  
P  2 GLU G  101 ? GLU G  105 ? GLU G 101 GLU G 105 
P  3 ARG G  114 ? THR G  117 ? ARG G 114 THR G 117 
Q  1 VAL H  29  ? LYS H  31  ? VAL H 29  LYS H 31  
Q  2 ALA H  95  ? VAL H  98  ? ALA H 95  VAL H 98  
Q  3 VAL H  48  ? ALA H  51  ? VAL H 48  ALA H 51  
Q  4 PHE H  74  ? VAL H  77  ? PHE H 74  VAL H 77  
R  1 ASP J  32  ? GLY J  34  ? ASP J 32  GLY J 34  
R  2 LYS J  82  ? ILE J  85  ? LYS J 82  ILE J 85  
R  3 HIS J  130 ? VAL J  136 ? HIS J 130 VAL J 136 
R  4 ALA J  44  ? VAL J  50  ? ALA J 44  VAL J 50  
R  5 ILE J  157 ? SER J  161 ? ILE J 157 SER J 161 
S  1 VAL J  54  ? ARG J  57  ? VAL J 54  ARG J 57  
S  2 LYS J  117 ? VAL J  125 ? LYS J 117 VAL J 125 
S  3 HIS J  91  ? GLU J  95  ? HIS J 91  GLU J 95  
T  1 VAL K  10  ? ASP K  13  ? VAL K 10  ASP K 13  
T  2 VAL K  36  ? VAL K  39  ? VAL K 36  VAL K 39  
T  3 VAL K  101 ? VAL K  103 ? VAL K 101 VAL K 103 
U  1 VAL K  45  ? THR K  47  ? VAL K 45  THR K 47  
U  2 PHE K  129 ? THR K  131 ? PHE K 129 THR K 131 
V  1 ASP L  7   ? VAL L  8   ? ASP L 7   VAL L 8   
V  2 ILE L  80  ? ARG L  81  ? ILE L 80  ARG L 81  
V  3 ARG L  87  ? PHE L  90  ? ARG L 87  PHE L 90  
V  4 THR V  19  ? VAL V  22  ? THR V 19  VAL V 22  
V  5 THR V  28  ? PHE V  31  ? THR V 28  PHE V 31  
W  1 LEU L  12  ? GLU L  13  ? LEU L 12  GLU L 13  
W  2 LYS L  46  ? ALA L  47  ? LYS L 46  ALA L 47  
X  1 LEU L  17  ? CYS L  20  ? LEU L 17  CYS L 20  
X  2 ALA L  26  ? VAL L  34  ? ALA L 26  VAL L 34  
X  3 LYS L  52  ? GLY L  60  ? LYS L 52  GLY L 60  
X  4 VAL L  68  ? ARG L  75  ? VAL L 68  ARG L 75  
X  5 ALA L  94  ? VAL L  98  ? ALA L 94  VAL L 98  
X  6 LEU L  17  ? CYS L  20  ? LEU L 17  CYS L 20  
Y  1 PRO L  112 ? ALA L  114 ? PRO L 112 ALA L 114 
Y  2 MET L  130 ? VAL L  132 ? MET L 130 VAL L 132 
Z  1 ALA M  61  ? ASP M  65  ? ALA M 61  ASP M 65  
Z  2 TYR M  105 ? LEU M  109 ? TYR M 105 LEU M 109 
Z  3 ASP M  124 ? PHE M  125 ? ASP M 124 PHE M 125 
AA 1 ARG M  90  ? ASP M  92  ? ARG M 90  ASP M 92  
AA 2 THR M  119 ? ALA M  122 ? THR M 119 ALA M 122 
AA 3 SER M  139 ? LEU M  142 ? SER M 139 LEU M 142 
AB 1 VAL N  37  ? ARG N  39  ? VAL N 37  ARG N 39  
AB 2 ILE N  60  ? ARG N  68  ? ILE N 60  ARG N 68  
AB 3 HIS N  126 ? ILE N  134 ? HIS N 126 ILE N 134 
AB 4 ARG N  113 ? GLU N  122 ? ARG N 113 GLU N 122 
AC 1 ASP O  56  ? HIS O  62  ? ASP O 56  HIS O 62  
AC 2 VAL O  43  ? THR O  49  ? VAL O 43  THR O 49  
AC 3 ARG O  33  ? LYS O  38  ? ARG O 33  LYS O 38  
AC 4 VAL O  101 ? ASP O  103 ? VAL O 101 ASP O 103 
AD 1 ALA P  41  ? ASN P  44  ? ALA P 41  ASN P 44  
AD 2 THR P  57  ? LEU P  65  ? THR P 57  LEU P 65  
AD 3 THR P  75  ? PHE P  81  ? THR P 75  PHE P 81  
AD 4 GLU P  94  ? SER P  97  ? GLU P 94  SER P 97  
AE 1 ALA P  41  ? ASN P  44  ? ALA P 41  ASN P 44  
AE 2 THR P  57  ? LEU P  65  ? THR P 57  LEU P 65  
AE 3 VAL P  111 ? VAL P  113 ? VAL P 111 VAL P 113 
AF 1 VAL Q  21  ? PHE Q  23  ? VAL Q 21  PHE Q 23  
AF 2 ILE Q  49  ? ALA Q  51  ? ILE Q 49  ALA Q 51  
AG 1 LYS R  80  ? VAL R  86  ? LYS R 80  VAL R 86  
AG 2 ALA R  70  ? ASP R  77  ? ALA R 70  ASP R 77  
AG 3 THR R  60  ? GLN R  67  ? THR R 60  GLN R 67  
AG 4 LYS R  38  ? LEU R  41  ? LYS R 38  LEU R 41  
AG 5 LEU R  91  ? ARG R  93  ? LEU R 91  ARG R 93  
AH 1 THR S  13  ? ARG S  21  ? THR S 13  ARG S 21  
AH 2 SER S  138 ? GLU S  148 ? SER S 138 GLU S 148 
AH 3 THR S  110 ? GLN S  122 ? THR S 110 GLN S 122 
AI 1 VAL S  57  ? PRO S  58  ? VAL S 57  PRO S 58  
AI 2 GLY S  78  ? ARG S  79  ? GLY S 78  ARG S 79  
AJ 1 ARG S  125 ? PRO S  127 ? ARG S 125 PRO S 127 
AJ 2 ALA S  133 ? ALA S  135 ? ALA S 133 ALA S 135 
AK 1 ILE T  5   ? PRO T  8   ? ILE T 5   PRO T 8   
AK 2 LYS T  23  ? VAL T  28  ? LYS T 23  VAL T 28  
AK 3 LYS T  62  ? LEU T  68  ? LYS T 62  LEU T 68  
AK 4 VAL T  49  ? ASN T  56  ? VAL T 49  ASN T 56  
AL 1 ASN U  39  ? ARG U  41  ? ASN U 39  ARG U 41  
AL 2 ARG U  24  ? LEU U  27  ? ARG U 24  LEU U 27  
AL 3 VAL U  96  ? ASP U  100 ? VAL U 96  ASP U 100 
AL 4 THR U  47  ? VAL U  50  ? THR U 47  VAL U 50  
AL 5 GLU U  59  ? ASP U  66  ? GLU U 59  ASP U 66  
AL 6 VAL U  71  ? VAL U  74  ? VAL U 71  VAL U 74  
AM 1 THR U  78  ? GLU U  80  ? THR U 78  GLU U 80  
AM 2 GLU U  86  ? PRO U  88  ? GLU U 86  PRO U 88  
AN 1 LEU X  116 ? ARG X  117 ? LEU X 116 ARG X 117 
AN 2 HIS X  31  ? VAL X  35  ? HIS X 31  VAL X 35  
AN 3 HIS X  2   ? GLN X  6   ? HIS X 2   GLN X 6   
AN 4 VAL X  52  ? GLY X  55  ? VAL X 52  GLY X 55  
AN 5 GLY X  139 ? LYS X  140 ? GLY X 139 LYS X 140 
AO 1 ARG Y  8   ? PRO Y  13  ? ARG Y 8   PRO Y 13  
AO 2 LYS Y  69  ? PHE Y  77  ? LYS Y 69  PHE Y 77  
AO 3 GLU Y  82  ? GLU Y  86  ? GLU Y 82  GLU Y 86  
AO 4 VAL Y  48  ? LEU Y  50  ? VAL Y 48  LEU Y 50  
AP 1 GLU Z  96  ? ALA Z  99  ? GLU Z 96  ALA Z 99  
AP 2 TYR Z  233 ? VAL Z  236 ? TYR Z 233 VAL Z 236 
AQ 1 GLU Z  183 ? VAL Z  187 ? GLU Z 183 VAL Z 187 
AQ 2 GLU Z  201 ? ILE Z  205 ? GLU Z 201 ILE Z 205 
AR 1 LEU AA 38  ? GLY AA 42  ? LEU 1 47  GLY 1 51  
AR 2 ILE AA 45  ? CYS AA 48  ? ILE 1 54  CYS 1 57  
AR 3 LYS AA 54  ? ALA AA 56  ? LYS 1 63  ALA 1 65  
AS 1 HIS BA 16  ? LYS BA 18  ? HIS 2 16  LYS 2 18  
AS 2 LYS BA 25  ? HIS BA 28  ? LYS 2 25  HIS 2 28  
AS 3 VAL BA 33  ? CYS BA 34  ? VAL 2 33  CYS 2 34  
AT 1 GLN DA 2   ? PRO DA 4   ? GLN 4 2   PRO 4 4   
AT 2 GLU DA 89  ? GLN DA 91  ? GLU 4 89  GLN 4 91  
AU 1 ARG DA 6   ? CYS DA 11  ? ARG 4 6   CYS 4 11  
AU 2 GLU DA 16  ? LYS DA 24  ? GLU 4 16  LYS 4 24  
AU 3 LEU DA 67  ? CYS DA 71  ? LEU 4 67  CYS 4 71  
AU 4 ALA DA 77  ? HIS DA 78  ? ALA 4 77  HIS 4 78  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 O ILE C  68  ? O ILE C 68  N ALA C  56  ? N ALA C 56  
A  2 3 O ALA C  57  ? O ALA C 57  N ASP C  44  ? N ASP C 44  
A  3 4 N GLY C  40  ? N GLY C 40  O LEU C  80  ? O LEU C 80  
B  1 2 N LEU C  94  ? N LEU C 94  O ALA C  154 ? O ALA C 154 
B  2 3 O THR C  155 ? O THR C 155 N CYS C  106 ? N CYS C 106 
B  3 4 N VAL C  105 ? N VAL C 105 O ALA C  126 ? O ALA C 126 
B  4 5 N GLN C  127 ? N GLN C 127 O LYS C  139 ? O LYS C 139 
B  5 6 N VAL C  138 ? N VAL C 138 O LYS C  146 ? O LYS C 146 
C  1 2 N ILE C  215 ? N ILE C 215 O ASP C  227 ? O ASP C 227 
D  1 2 N GLY D  37  ? N GLY D 37  O GLY D  167 ? O GLY D 167 
D  2 3 O MET D  162 ? O MET D 162 N THR D  144 ? N THR D 144 
D  3 4 O GLY D  138 ? O GLY D 138 N TYR D  87  ? N TYR D 87  
D  4 5 N ALA D  86  ? N ALA D 86  O LEU D  97  ? O LEU D 97  
E  1 2 N GLY D  37  ? N GLY D 37  O GLY D  167 ? O GLY D 167 
E  2 3 O MET D  162 ? O MET D 162 N THR D  144 ? N THR D 144 
E  3 4 O GLY D  138 ? O GLY D 138 N TYR D  87  ? N TYR D 87  
E  4 5 N MET D  79  ? N MET D 79  O HIS D  188 ? O HIS D 188 
F  1 2 O TYR D  329 ? O TYR D 329 N VAL D  52  ? N VAL D 52  
F  2 3 N PHE D  41  ? N PHE D 41  O PHE D  311 ? O PHE D 311 
F  3 4 O ARG D  312 ? O ARG D 312 N ASP D  201 ? N ASP D 201 
F  4 5 N ALA D  200 ? N ALA D 200 O LYS D  267 ? O LYS D 267 
F  5 6 N ASP D  271 ? N ASP D 271 O LEU D  296 ? O LEU D 296 
F  6 7 O VAL D  297 ? O VAL D 297 N THR D  72  ? N THR D 72  
F  7 8 O VAL D  73  ? O VAL D 73  N GLY D  47  ? N GLY D 47  
G  1 2 N GLN D  212 ? N GLN D 212 O GLY D  255 ? O GLY D 255 
H  1 2 O VAL E  16  ? O VAL E 16  N ALA E  3   ? N ALA E 3   
H  2 3 N TYR E  6   ? N TYR E 6   O VAL E  139 ? O VAL E 139 
H  3 4 N VAL E  138 ? N VAL E 138 O THR E  233 ? O THR E 233 
H  4 5 O VAL E  234 ? O VAL E 234 N LEU E  193 ? N LEU E 193 
H  5 6 N PHE E  194 ? N PHE E 194 O ALA E  213 ? O ALA E 213 
I  1 2 N GLU E  59  ? N GLU E 59  O LYS E  72  ? O LYS E 72  
I  2 3 N LEU E  73  ? N LEU E 73  O ARG E  76  ? O ARG E 76  
J  1 2 N LYS E  173 ? N LYS E 173 O ARG E  187 ? O ARG E 187 
K  1 2 O LEU F  75  ? O LEU F 75  N VAL F  21  ? N VAL F 21  
K  2 3 N VAL F  22  ? N VAL F 22  O THR F  131 ? O THR F 131 
K  3 4 O VAL F  130 ? O VAL F 130 N PHE F  106 ? N PHE F 106 
L  1 2 N VAL F  50  ? N VAL F 50  O LYS F  72  ? O LYS F 72  
M  1 2 N LEU G  5   ? N LEU G 5   O VAL G  47  ? O VAL G 47  
M  2 3 O VAL G  48  ? O VAL G 48  N SER G  41  ? N SER G 41  
N  1 2 N ASP G  12  ? N ASP G 12  O GLU G  23  ? O GLU G 23  
N  2 3 N GLY G  24  ? N GLY G 24  O GLY G  27  ? O GLY G 27  
O  1 2 N ASP G  123 ? N ASP G 123 O SER G  134 ? O SER G 134 
O  2 3 O VAL G  133 ? O VAL G 133 N TYR G  82  ? N TYR G 82  
O  3 4 N GLY G  83  ? N GLY G 83  O THR G  169 ? O THR G 169 
P  1 2 N ASN G  96  ? N ASN G 96  O VAL G  103 ? O VAL G 103 
P  2 3 N ILE G  104 ? N ILE G 104 O ARG G  114 ? O ARG G 114 
Q  1 2 N LYS H  30  ? N LYS H 30  O ALA H  97  ? O ALA H 97  
Q  2 3 O ALA H  96  ? O ALA H 96  N PHE H  49  ? N PHE H 49  
Q  3 4 N VAL H  48  ? N VAL H 48  O ILE H  75  ? O ILE H 75  
R  1 2 N MET J  33  ? N MET J 33  O PHE J  83  ? O PHE J 83  
R  2 3 N ARG J  84  ? N ARG J 84  O ILE J  133 ? O ILE J 133 
R  3 4 O PHE J  132 ? O PHE J 132 N LEU J  48  ? N LEU J 48  
R  4 5 N GLU J  47  ? N GLU J 47  O ASP J  160 ? O ASP J 160 
S  1 2 N VAL J  54  ? N VAL J 54  O VAL J  125 ? O VAL J 125 
S  2 3 O VAL J  119 ? O VAL J 119 N ILE J  93  ? N ILE J 93  
T  1 2 N VAL K  12  ? N VAL K 12  O VAL K  39  ? O VAL K 39  
T  2 3 N VAL K  38  ? N VAL K 38  O ARG K  102 ? O ARG K 102 
U  1 2 N ILE K  46  ? N ILE K 46  O VAL K  130 ? O VAL K 130 
V  1 2 N ASP L  7   ? N ASP L 7   O ARG L  81  ? O ARG L 81  
V  2 3 N ILE L  80  ? N ILE L 80  O VAL L  88  ? O VAL L 88  
V  3 4 N LYS L  89  ? N LYS L 89  O VAL V  22  ? O VAL V 22  
V  4 5 N THR V  19  ? N THR V 19  O PHE V  31  ? O PHE V 31  
W  1 2 N LEU L  12  ? N LEU L 12  O ALA L  47  ? O ALA L 47  
X  1 2 N ILE L  18  ? N ILE L 18  O LEU L  29  ? O LEU L 29  
X  2 3 N SER L  33  ? N SER L 33  O THR L  54  ? O THR L 54  
X  3 4 N VAL L  55  ? N VAL L 55  O LEU L  69  ? O LEU L 69  
X  4 5 N ARG L  75  ? N ARG L 75  O ALA L  94  ? O ALA L 94  
X  5 6 O ALA L  95  ? O ALA L 95  N THR L  19  ? N THR L 19  
Y  1 2 N ILE L  113 ? N ILE L 113 O VAL L  132 ? O VAL L 132 
Z  1 2 N ALA M  62  ? N ALA M 62  O TYR M  105 ? O TYR M 105 
Z  2 3 N VAL M  108 ? N VAL M 108 O ASP M  124 ? O ASP M 124 
AA 1 2 N VAL M  91  ? N VAL M 91  O THR M  119 ? O THR M 119 
AA 2 3 N LEU M  120 ? N LEU M 120 O GLU M  141 ? O GLU M 141 
AB 1 2 N VAL N  38  ? N VAL N 38  O ARG N  64  ? O ARG N 64  
AB 2 3 N VAL N  63  ? N VAL N 63  O VAL N  131 ? O VAL N 131 
AB 3 4 O ILE N  132 ? O ILE N 132 N ASN N  116 ? N ASN N 116 
AC 1 2 O ASP O  56  ? O ASP O 56  N THR O  49  ? N THR O 49  
AC 2 3 O VAL O  48  ? O VAL O 48  N ARG O  33  ? N ARG O 33  
AC 3 4 N LEU O  34  ? N LEU O 34  O VAL O  101 ? O VAL O 101 
AD 1 2 N VAL P  43  ? N VAL P 43  O LEU P  65  ? O LEU P 65  
AD 2 3 N VAL P  58  ? N VAL P 58  O ALA P  77  ? O ALA P 77  
AD 3 4 N VAL P  76  ? N VAL P 76  O VAL P  96  ? O VAL P 96  
AE 1 2 N VAL P  43  ? N VAL P 43  O LEU P  65  ? O LEU P 65  
AE 2 3 N VAL P  59  ? N VAL P 59  O ARG P  112 ? O ARG P 112 
AF 1 2 N TRP Q  22  ? N TRP Q 22  O GLN Q  50  ? O GLN Q 50  
AG 1 2 O ILE R  84  ? O ILE R 84  N VAL R  73  ? N VAL R 73  
AG 2 3 O ALA R  70  ? O ALA R 70  N GLN R  67  ? N GLN R 67  
AG 3 4 O GLY R  61  ? O GLY R 61  N VAL R  39  ? N VAL R 39  
AG 4 5 N HIS R  40  ? N HIS R 40  O ARG R  92  ? O ARG R 92  
AH 1 2 N ARG S  21  ? N ARG S 21  O VAL S  141 ? O VAL S 141 
AH 2 3 O SER S  138 ? O SER S 138 N GLN S  122 ? N GLN S 122 
AI 1 2 N VAL S  57  ? N VAL S 57  O ARG S  79  ? O ARG S 79  
AJ 1 2 N LYS S  126 ? N LYS S 126 O SER S  134 ? O SER S 134 
AK 1 2 N HIS T  7   ? N HIS T 7   O ALA T  27  ? O ALA T 27  
AK 2 3 N LEU T  24  ? N LEU T 24  O VAL T  66  ? O VAL T 66  
AK 3 4 O LYS T  63  ? O LYS T 63  N GLN T  55  ? N GLN T 55  
AL 1 2 O VAL U  40  ? O VAL U 40  N ALA U  25  ? N ALA U 25  
AL 2 3 N THR U  26  ? N THR U 26  O VAL U  98  ? O VAL U 98  
AL 3 4 O ARG U  97  ? O ARG U 97  N GLU U  49  ? N GLU U 49  
AL 4 5 N VAL U  48  ? N VAL U 48  O GLY U  60  ? O GLY U 60  
AL 5 6 N ASP U  66  ? N ASP U 66  O VAL U  71  ? O VAL U 71  
AM 1 2 N LEU U  79  ? N LEU U 79  O VAL U  87  ? O VAL U 87  
AN 1 2 O LEU X  116 ? O LEU X 116 N CYS X  32  ? N CYS X 32  
AN 2 3 O THR X  33  ? O THR X 33  N LEU X  4   ? N LEU X 4   
AN 3 4 N ALA X  3   ? N ALA X 3   O GLY X  55  ? O GLY X 55  
AN 4 5 N PHE X  54  ? N PHE X 54  O GLY X  139 ? O GLY X 139 
AO 1 2 N VAL Y  10  ? N VAL Y 10  O VAL Y  72  ? O VAL Y 72  
AO 2 3 N ARG Y  73  ? N ARG Y 73  O GLU Y  86  ? O GLU Y 86  
AO 3 4 O ALA Y  83  ? O ALA Y 83  N ARG Y  49  ? N ARG Y 49  
AP 1 2 N GLU Z  96  ? N GLU Z 96  O VAL Z  236 ? O VAL Z 236 
AQ 1 2 N VAL Z  187 ? N VAL Z 187 O ARG Z  204 ? O ARG Z 204 
AR 1 2 N LYS AA 39  ? N LYS 1 48  O MET AA 47  ? O MET 1 56  
AR 2 3 N TRP AA 46  ? N TRP 1 55  O ILE AA 55  ? O ILE 1 64  
AS 1 2 N THR BA 17  ? N THR 2 17  O TYR BA 27  ? O TYR 2 27  
AS 2 3 N HIS BA 28  ? N HIS 2 28  O VAL BA 33  ? O VAL 2 33  
AT 1 2 N MET DA 3   ? N MET 4 3   O GLU DA 89  ? O GLU 4 89  
AU 1 2 N PHE DA 7   ? N PHE 4 7   O HIS DA 20  ? O HIS 4 20  
AU 2 3 N GLU DA 21  ? N GLU 4 21  O ARG DA 70  ? O ARG 4 70  
AU 3 4 N TYR DA 69  ? N TYR 4 69  O HIS DA 78  ? O HIS 4 78  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE TYK A 9000' 
AC2 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE MG A 8001'  
AC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 8002'  
AC4 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE MG A 8003'  
AC5 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 8004'  
AC6 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 8005'  
AC7 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 8006'  
AC8 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 8007'  
AC9 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 8008'  
BC1 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE MG A 8009'  
BC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 8010'  
BC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 8011'  
BC4 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE MG A 8012'  
BC5 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 8013'  
BC6 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE MG A 8014'  
BC7 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 8015'  
BC8 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 8016'  
BC9 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 8017'  
CC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 8018'  
CC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 8019'  
CC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 8020'  
CC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 8021'  
CC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG A 8022'  
CC6 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 8023'  
CC7 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG A 8024'  
CC8 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 8025'  
CC9 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 8026'  
DC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 8027'  
DC2 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE MG A 8028'  
DC3 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE MG A 8029'  
DC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 8030'  
DC5 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE MG A 8031'  
DC6 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 8032'  
DC7 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 8033'  
DC8 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 8034'  
DC9 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 8035'  
EC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 8036'  
EC2 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE MG A 8037'  
EC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 8038'  
EC4 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE MG A 8039'  
EC5 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 8040'  
EC6 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE MG A 8041'  
EC7 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 8042'  
EC8 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG A 8043'  
EC9 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 8044'  
FC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG A 8045'  
FC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG A 8046'  
FC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG A 8047'  
FC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 8048'  
FC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG A 8049'  
FC6 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG A 8050'  
FC7 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG A 8051'  
FC8 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE MG A 8052'  
FC9 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 8053'  
GC1 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE MG A 8054'  
GC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 8056'  
GC3 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE MG A 8057'  
GC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 8058'  
GC5 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE MG A 8059'  
GC6 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 8060'  
GC7 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 8061'  
GC8 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 8062'  
GC9 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 8063'  
HC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG A 8064'  
HC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG A 8066'  
HC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 8067'  
HC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 8068'  
HC5 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 8070'  
HC6 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 8071'  
HC7 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE MG A 8072'  
HC8 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 8074'  
HC9 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 8075'  
IC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG A 8076'  
IC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 8077'  
IC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 8079'  
IC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 8080'  
IC5 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG A 8081'  
IC6 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 8082'  
IC7 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 8083'  
IC8 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE MG A 8084'  
IC9 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE MG A 8085'  
JC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 8086'  
JC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG A 8087'  
JC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 8088'  
JC4 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE MG A 8089'  
JC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG A 8090'  
JC6 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 8091'  
JC7 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG A 8092'  
JC8 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 8093'  
JC9 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG A 8094'  
KC1 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE MG A 8096'  
KC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 8097'  
KC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 8098'  
KC4 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG A 8099'  
KC5 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 8100'  
KC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG A 8101'  
KC7 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG A 8102'  
KC8 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG A 8103'  
KC9 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG A 8104'  
LC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 8106'  
LC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 8107'  
LC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG A 8108'  
LC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 8110'  
LC5 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 8111'  
LC6 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 8112'  
LC7 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 8113'  
LC8 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE MG A 8114'  
LC9 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 8115'  
MC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 8116'  
MC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 8117'  
MC3 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG A 8118'  
MC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG A 8119'  
MC5 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE NA A 8301'  
MC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA A 8302'  
MC7 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NA A 8303'  
MC8 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE NA A 8305'  
MC9 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA A 8306'  
NC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA A 8307'  
NC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NA A 8308'  
NC3 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE NA A 8310'  
NC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA A 8311'  
NC5 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NA A 8313'  
NC6 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE NA A 8314'  
NC7 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA A 8315'  
NC8 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NA A 8316'  
NC9 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE NA A 8317'  
OC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA A 8318'  
OC2 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE NA A 8319'  
OC3 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE NA A 8320'  
OC4 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NA A 8321'  
OC5 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE NA A 8323'  
OC6 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE NA A 8324'  
OC7 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE NA A 8325'  
OC8 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA A 8326'  
OC9 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE NA A 8327'  
PC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE NA A 8328'  
PC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA A 8329'  
PC3 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE NA A 8330'  
PC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE NA A 8331'  
PC5 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NA A 8332'  
PC6 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NA A 8333'  
PC7 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE NA A 8334'  
PC8 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE NA A 8335'  
PC9 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE NA A 8336'  
QC1 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE NA A 8338'  
QC2 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE NA A 8339'  
QC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NA A 8340'  
QC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA A 8341'  
QC5 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE NA A 8342'  
QC6 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE NA A 8343'  
QC7 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE NA A 8344'  
QC8 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA A 8349'  
QC9 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NA A 8350'  
RC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NA A 8352'  
RC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE NA A 8353'  
RC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NA A 8354'  
RC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA A 8355'  
RC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA A 8356'  
RC6 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NA A 8357'  
RC7 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE NA A 8359'  
RC8 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA A 8360'  
RC9 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE NA A 8361'  
SC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NA A 8362'  
SC2 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE NA A 8363'  
SC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NA A 8364'  
SC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE NA A 8365'  
SC5 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE NA A 8366'  
SC6 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE NA A 8367'  
SC7 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA A 8368'  
SC8 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NA A 8369'  
SC9 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA A 8370'  
TC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA A 8371'  
TC2 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE NA A 8372'  
TC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE NA A 8373'  
TC4 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NA A 8374'  
TC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA A 8375'  
TC6 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE NA A 8376'  
TC7 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NA A 8377'  
TC8 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE NA A 8378'  
TC9 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NA A 8379'  
UC1 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE NA A 8381'  
UC2 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE NA A 8382'  
UC3 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE NA A 8384'  
UC4 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE NA A 8385'  
UC5 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CL A 8503'  
UC6 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE CL A 8505'  
UC7 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CL A 8512'  
UC8 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CL A 8513'  
UC9 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE CL A 8514'  
VC1 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CL A 8515'  
VC2 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE CL A 8517'  
VC3 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE CL A 8522'  
VC4 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE K A 8601'   
VC5 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE K A 8602'   
VC6 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE K A 8603'   
VC7 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG B 8095'  
VC8 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE NA B 8351'  
VC9 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE NA B 8383'  
WC1 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE MG C 8065'  
WC2 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE NA C 8345'  
WC3 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE CL C 8509'  
WC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG D 8055'  
WC5 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CL D 8519'  
WC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA E 8304'  
WC7 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE NA J 8309'  
WC8 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE NA J 8322'  
WC9 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE NA K 8346'  
XC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CL K 8501'  
XC2 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE CL K 8502'  
XC3 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CL K 8516'  
XC4 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE CL K 8521'  
XC5 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG L 8069'  
XC6 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE NA M 8380'  
XC7 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CL M 8510'  
XC8 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NA N 8347'  
XC9 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CL N 8518'  
YC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CL O 8507'  
YC2 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CD P 8405'  
YC3 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CL P 8508'  
YC4 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NA R 8348'  
YC5 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE CL R 8511'  
YC6 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE NA S 8337'  
YC7 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE NA S 8386'  
YC8 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE CL S 8506'  
YC9 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE NA T 8312'  
ZC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG U 8073'  
ZC2 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE CD V 8401'  
ZC3 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE MG Z 8109'  
ZC4 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CL Z 8520'  
ZC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG 1 8105'  
ZC6 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE CD 1 8403'  
ZC7 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CD 2 8402'  
ZC8 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG 4 8078'  
ZC9 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CD 4 8404'  
AD1 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE CL 4 8504'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1    AC1 14 C   A  838  ? C   A 839  . ? 1_555 ? 
2    AC1 14 A   A  840  ? A   A 841  . ? 1_555 ? 
3    AC1 14 A   A  843  ? A   A 844  . ? 1_555 ? 
4    AC1 14 U   A  844  ? U   A 845  . ? 1_555 ? 
5    AC1 14 G   A  2098 ? G   A 2099 . ? 1_555 ? 
6    AC1 14 A   A  2099 ? A   A 2100 . ? 1_555 ? 
7    AC1 14 A   A  2102 ? A   A 2103 . ? 1_555 ? 
8    AC1 14 A   A  2537 ? A   A 2538 . ? 1_555 ? 
9    AC1 14 G   A  2539 ? G   A 2540 . ? 1_555 ? 
10   AC1 14 G   A  2645 ? G   A 2646 . ? 1_555 ? 
11   AC1 14 HOH FJ .    ? HOH A 6045 . ? 1_555 ? 
12   AC1 14 HOH FJ .    ? HOH A 6429 . ? 1_555 ? 
13   AC1 14 MG  LE .    ? MG  A 8119 . ? 1_555 ? 
14   AC1 14 MET S  130  ? MET S 130  . ? 1_555 ? 
15   AC2 7  G   A  2481 ? G   A 2482 . ? 1_555 ? 
16   AC2 7  A   A  2482 ? A   A 2483 . ? 1_555 ? 
17   AC2 7  C   A  2532 ? C   A 2533 . ? 1_555 ? 
18   AC2 7  C   A  2533 ? C   A 2534 . ? 1_555 ? 
19   AC2 7  HOH FJ .    ? HOH A 3608 . ? 1_555 ? 
20   AC2 7  HOH FJ .    ? HOH A 7788 . ? 1_555 ? 
21   AC2 7  HOH FJ .    ? HOH A 9178 . ? 1_555 ? 
22   AC3 6  G   A  626  ? G   A 627  . ? 1_555 ? 
23   AC3 6  A   A  2482 ? A   A 2483 . ? 1_555 ? 
24   AC3 6  C   A  2533 ? C   A 2534 . ? 1_555 ? 
25   AC3 6  HOH FJ .    ? HOH A 4317 . ? 1_555 ? 
26   AC3 6  HOH FJ .    ? HOH A 7766 . ? 1_555 ? 
27   AC3 6  HOH FJ .    ? HOH A 7767 . ? 1_555 ? 
28   AC4 7  A   A  875  ? A   A 876  . ? 1_555 ? 
29   AC4 7  G   A  876  ? G   A 877  . ? 1_555 ? 
30   AC4 7  G   A  2622 ? G   A 2623 . ? 1_555 ? 
31   AC4 7  A   A  2623 ? A   A 2624 . ? 1_555 ? 
32   AC4 7  HOH FJ .    ? HOH A 3657 . ? 1_555 ? 
33   AC4 7  HOH FJ .    ? HOH A 9021 . ? 1_555 ? 
34   AC4 7  HOH HJ .    ? HOH C 8537 . ? 1_555 ? 
35   AC5 6  G   A  455  ? G   A 456  . ? 1_555 ? 
36   AC5 6  A   A  458  ? A   A 459  . ? 1_555 ? 
37   AC5 6  HOH FJ .    ? HOH A 3774 . ? 1_555 ? 
38   AC5 6  HOH FJ .    ? HOH A 7773 . ? 1_555 ? 
39   AC5 6  HOH FJ .    ? HOH A 9047 . ? 1_555 ? 
40   AC5 6  HOH FJ .    ? HOH A 9767 . ? 1_555 ? 
41   AC6 6  A   A  1835 ? A   A 1836 . ? 1_555 ? 
42   AC6 6  U   A  1837 ? U   A 1838 . ? 1_555 ? 
43   AC6 6  A   A  1838 ? A   A 1839 . ? 1_555 ? 
44   AC6 6  HOH FJ .    ? HOH A 3604 . ? 1_555 ? 
45   AC6 6  HOH FJ .    ? HOH A 7789 . ? 1_555 ? 
46   AC6 6  HOH FJ .    ? HOH A 7790 . ? 1_555 ? 
47   AC7 6  U   A  820  ? U   A 821  . ? 1_555 ? 
48   AC7 6  C   A  821  ? C   A 822  . ? 1_555 ? 
49   AC7 6  G   A  853  ? G   A 854  . ? 1_555 ? 
50   AC7 6  HOH FJ .    ? HOH A 3610 . ? 1_555 ? 
51   AC7 6  HOH FJ .    ? HOH A 3744 . ? 1_555 ? 
52   AC7 6  HOH FJ .    ? HOH A 9800 . ? 1_555 ? 
53   AC8 6  U   A  831  ? U   A 832  . ? 1_555 ? 
54   AC8 6  A   A  1838 ? A   A 1839 . ? 1_555 ? 
55   AC8 6  A   A  1839 ? A   A 1840 . ? 1_555 ? 
56   AC8 6  HOH FJ .    ? HOH A 3351 . ? 1_555 ? 
57   AC8 6  HOH FJ .    ? HOH A 7778 . ? 1_555 ? 
58   AC8 6  HOH FJ .    ? HOH A 9006 . ? 1_555 ? 
59   AC9 6  U   A  918  ? U   A 919  . ? 1_555 ? 
60   AC9 6  C   A  2463 ? C   A 2464 . ? 1_555 ? 
61   AC9 6  A   A  2464 ? A   A 2465 . ? 1_555 ? 
62   AC9 6  HOH FJ .    ? HOH A 3621 . ? 1_555 ? 
63   AC9 6  HOH FJ .    ? HOH A 7782 . ? 1_555 ? 
64   AC9 6  HOH FJ .    ? HOH A 7867 . ? 1_555 ? 
65   BC1 7  U   A  2609 ? U   A 2610 . ? 1_555 ? 
66   BC1 7  G   A  2610 ? G   A 2611 . ? 1_555 ? 
67   BC1 7  A   A  2611 ? A   A 2612 . ? 1_555 ? 
68   BC1 7  HOH FJ .    ? HOH A 3730 . ? 1_555 ? 
69   BC1 7  HOH FJ .    ? HOH A 7441 . ? 1_555 ? 
70   BC1 7  HOH FJ .    ? HOH A 7783 . ? 1_555 ? 
71   BC1 7  HOH FJ .    ? HOH A 7784 . ? 1_555 ? 
72   BC2 6  G   A  835  ? G   A 836  . ? 1_555 ? 
73   BC2 6  U   A  2614 ? U   A 2615 . ? 1_555 ? 
74   BC2 6  HOH FJ .    ? HOH A 3830 . ? 1_555 ? 
75   BC2 6  HOH FJ .    ? HOH A 9360 . ? 1_555 ? 
76   BC2 6  GLN D  230  ? GLN D 230  . ? 1_555 ? 
77   BC2 6  HOH IJ .    ? HOH D 8523 . ? 1_555 ? 
78   BC3 6  G   A  823  ? G   A 824  . ? 1_555 ? 
79   BC3 6  G   A  853  ? G   A 854  . ? 1_555 ? 
80   BC3 6  HOH FJ .    ? HOH A 3950 . ? 1_555 ? 
81   BC3 6  HOH FJ .    ? HOH A 4282 . ? 1_555 ? 
82   BC3 6  HOH FJ .    ? HOH A 4412 . ? 1_555 ? 
83   BC3 6  HOH FJ .    ? HOH A 4523 . ? 1_555 ? 
84   BC4 7  U   A  26   ? U   A 27   . ? 1_555 ? 
85   BC4 7  G   A  27   ? G   A 28   . ? 1_555 ? 
86   BC4 7  HOH FJ .    ? HOH A 3220 . ? 1_555 ? 
87   BC4 7  HOH FJ .    ? HOH A 3638 . ? 1_555 ? 
88   BC4 7  HOH FJ .    ? HOH A 7868 . ? 1_555 ? 
89   BC4 7  HOH FJ .    ? HOH A 9039 . ? 1_555 ? 
90   BC4 7  HOH FJ .    ? HOH A 9630 . ? 1_555 ? 
91   BC5 6  G   A  876  ? G   A 877  . ? 1_555 ? 
92   BC5 6  G   A  2622 ? G   A 2623 . ? 1_555 ? 
93   BC5 6  HOH FJ .    ? HOH A 3633 . ? 1_555 ? 
94   BC5 6  HOH FJ .    ? HOH A 3645 . ? 1_555 ? 
95   BC5 6  HOH FJ .    ? HOH A 7797 . ? 1_555 ? 
96   BC5 6  HOH FJ .    ? HOH A 9020 . ? 1_555 ? 
97   BC6 7  G   A  2101 ? G   A 2102 . ? 1_555 ? 
98   BC6 7  C   A  2535 ? C   A 2536 . ? 1_555 ? 
99   BC6 7  G   A  2536 ? G   A 2537 . ? 1_555 ? 
100  BC6 7  HOH FJ .    ? HOH A 3650 . ? 1_555 ? 
101  BC6 7  HOH FJ .    ? HOH A 4156 . ? 1_555 ? 
102  BC6 7  HOH FJ .    ? HOH A 7764 . ? 1_555 ? 
103  BC6 7  HOH FJ .    ? HOH A 9033 . ? 1_555 ? 
104  BC7 6  A   A  843  ? A   A 844  . ? 1_555 ? 
105  BC7 6  A   A  1688 ? A   A 1689 . ? 1_555 ? 
106  BC7 6  HOH FJ .    ? HOH A 3613 . ? 1_555 ? 
107  BC7 6  HOH FJ .    ? HOH A 7799 . ? 1_555 ? 
108  BC7 6  HOH FJ .    ? HOH A 9004 . ? 1_555 ? 
109  BC7 6  HOH FJ .    ? HOH A 9024 . ? 1_555 ? 
110  BC8 6  A   A  1503 ? A   A 1504 . ? 1_555 ? 
111  BC8 6  A   A  1677 ? A   A 1678 . ? 1_555 ? 
112  BC8 6  C   A  1678 ? C   A 1679 . ? 1_555 ? 
113  BC8 6  HOH FJ .    ? HOH A 3736 . ? 1_555 ? 
114  BC8 6  HOH FJ .    ? HOH A 7791 . ? 1_555 ? 
115  BC8 6  HOH FJ .    ? HOH A 7792 . ? 1_555 ? 
116  BC9 6  G   A  455  ? G   A 456  . ? 1_555 ? 
117  BC9 6  HOH FJ .    ? HOH A 3933 . ? 1_555 ? 
118  BC9 6  HOH FJ .    ? HOH A 7774 . ? 1_555 ? 
119  BC9 6  HOH FJ .    ? HOH A 9410 . ? 1_555 ? 
120  BC9 6  HOH JJ .    ? HOH E 8359 . ? 1_555 ? 
121  BC9 6  HOH JJ .    ? HOH E 8468 . ? 1_555 ? 
122  CC1 6  A   A  1290 ? A   A 1291 . ? 1_555 ? 
123  CC1 6  G   A  1291 ? G   A 1292 . ? 1_555 ? 
124  CC1 6  HOH FJ .    ? HOH A 3213 . ? 1_555 ? 
125  CC1 6  HOH FJ .    ? HOH A 3606 . ? 1_555 ? 
126  CC1 6  HOH FJ .    ? HOH A 7479 . ? 1_555 ? 
127  CC1 6  HOH FJ .    ? HOH A 7869 . ? 1_555 ? 
128  CC2 6  A   A  2010 ? A   A 2011 . ? 1_555 ? 
129  CC2 6  HOH FJ .    ? HOH A 4143 . ? 1_555 ? 
130  CC2 6  HOH FJ .    ? HOH A 7246 . ? 1_555 ? 
131  CC2 6  HOH FJ .    ? HOH A 7793 . ? 1_555 ? 
132  CC2 6  HOH FJ .    ? HOH A 7794 . ? 1_555 ? 
133  CC2 6  HOH FJ .    ? HOH A 7795 . ? 1_555 ? 
134  CC3 6  C   A  1829 ? C   A 1830 . ? 1_555 ? 
135  CC3 6  HOH FJ .    ? HOH A 7777 . ? 1_555 ? 
136  CC3 6  HOH FJ .    ? HOH A 7796 . ? 1_555 ? 
137  CC3 6  HOH FJ .    ? HOH A 9126 . ? 1_555 ? 
138  CC3 6  HOH FJ .    ? HOH A 9129 . ? 1_555 ? 
139  CC3 6  HOH FJ .    ? HOH A 9199 . ? 1_555 ? 
140  CC4 6  G   A  2303 ? G   A 2304 . ? 1_555 ? 
141  CC4 6  HOH FJ .    ? HOH A 3629 . ? 1_555 ? 
142  CC4 6  HOH FJ .    ? HOH A 3630 . ? 1_555 ? 
143  CC4 6  HOH FJ .    ? HOH A 7780 . ? 1_555 ? 
144  CC4 6  HOH FJ .    ? HOH A 7781 . ? 1_555 ? 
145  CC4 6  HOH FJ .    ? HOH A 9951 . ? 1_555 ? 
146  CC5 4  G   A  2096 ? G   A 2097 . ? 1_555 ? 
147  CC5 4  U   A  2538 ? U   A 2539 . ? 1_555 ? 
148  CC5 4  G   A  2539 ? G   A 2540 . ? 1_555 ? 
149  CC5 4  HOH FJ .    ? HOH A 9454 . ? 1_555 ? 
150  CC6 6  G   A  2616 ? G   A 2617 . ? 1_555 ? 
151  CC6 6  G   A  2617 ? G   A 2618 . ? 1_555 ? 
152  CC6 6  HOH FJ .    ? HOH A 3619 . ? 1_555 ? 
153  CC6 6  HOH FJ .    ? HOH A 3811 . ? 1_555 ? 
154  CC6 6  HOH FJ .    ? HOH A 7801 . ? 1_555 ? 
155  CC6 6  HOH FJ .    ? HOH A 7802 . ? 1_555 ? 
156  CC7 4  A   A  1380 ? A   A 1381 . ? 1_555 ? 
157  CC7 4  HOH FJ .    ? HOH A 7870 . ? 1_555 ? 
158  CC7 4  HOH FJ .    ? HOH A 9924 . ? 1_555 ? 
159  CC7 4  HOH DK .    ? HOH Y 7830 . ? 1_555 ? 
160  CC8 6  U   A  1119 ? U   A 1120 . ? 1_555 ? 
161  CC8 6  G   A  1120 ? G   A 1121 . ? 1_555 ? 
162  CC8 6  HOH FJ .    ? HOH A 4161 . ? 1_555 ? 
163  CC8 6  HOH FJ .    ? HOH A 7803 . ? 1_555 ? 
164  CC8 6  HOH FJ .    ? HOH A 7804 . ? 1_555 ? 
165  CC8 6  HOH FJ .    ? HOH A 7871 . ? 1_555 ? 
166  CC9 6  C   A  2607 ? C   A 2608 . ? 1_555 ? 
167  CC9 6  G   A  2608 ? G   A 2609 . ? 1_555 ? 
168  CC9 6  U   A  2609 ? U   A 2610 . ? 1_555 ? 
169  CC9 6  HOH FJ .    ? HOH A 7805 . ? 1_555 ? 
170  CC9 6  HOH FJ .    ? HOH A 7806 . ? 1_555 ? 
171  CC9 6  HOH FJ .    ? HOH A 9388 . ? 1_555 ? 
172  DC1 6  C   A  239  ? C   A 240  . ? 1_555 ? 
173  DC1 6  G   A  268  ? G   A 269  . ? 1_555 ? 
174  DC1 6  HOH FJ .    ? HOH A 3863 . ? 1_555 ? 
175  DC1 6  HOH FJ .    ? HOH A 4006 . ? 1_555 ? 
176  DC1 6  HOH FJ .    ? HOH A 4148 . ? 1_555 ? 
177  DC1 6  HOH SJ .    ? HOH N 8643 . ? 1_555 ? 
178  DC2 7  A   A  1447 ? A   A 1448 . ? 1_555 ? 
179  DC2 7  U   A  1676 ? U   A 1677 . ? 1_555 ? 
180  DC2 7  HOH FJ .    ? HOH A 3669 . ? 1_555 ? 
181  DC2 7  HOH FJ .    ? HOH A 3690 . ? 1_555 ? 
182  DC2 7  HOH FJ .    ? HOH A 3701 . ? 1_555 ? 
183  DC2 7  HOH FJ .    ? HOH A 9571 . ? 1_555 ? 
184  DC2 7  HOH YJ .    ? HOH T 8346 . ? 1_555 ? 
185  DC3 8  A   A  1501 ? A   A 1502 . ? 1_555 ? 
186  DC3 8  U   A  1502 ? U   A 1503 . ? 1_555 ? 
187  DC3 8  A   A  1503 ? A   A 1504 . ? 1_555 ? 
188  DC3 8  C   A  1678 ? C   A 1679 . ? 1_555 ? 
189  DC3 8  HOH FJ .    ? HOH A 7809 . ? 1_555 ? 
190  DC3 8  HOH FJ .    ? HOH A 7810 . ? 1_555 ? 
191  DC3 8  HOH FJ .    ? HOH A 7811 . ? 1_555 ? 
192  DC3 8  HOH FJ .    ? HOH A 7812 . ? 1_555 ? 
193  DC4 6  U   A  1747 ? U   A 1748 . ? 1_555 ? 
194  DC4 6  U   A  1748 ? U   A 1749 . ? 1_555 ? 
195  DC4 6  HOH FJ .    ? HOH A 3631 . ? 1_555 ? 
196  DC4 6  HOH FJ .    ? HOH A 7775 . ? 1_555 ? 
197  DC4 6  HOH FJ .    ? HOH A 7776 . ? 1_555 ? 
198  DC4 6  HOH FJ .    ? HOH A 7786 . ? 1_555 ? 
199  DC5 7  U   A  776  ? U   A 777  . ? 1_555 ? 
200  DC5 7  C   A  777  ? C   A 778  . ? 1_555 ? 
201  DC5 7  HOH FJ .    ? HOH A 3268 . ? 1_555 ? 
202  DC5 7  HOH FJ .    ? HOH A 7814 . ? 1_555 ? 
203  DC5 7  HOH FJ .    ? HOH A 7815 . ? 1_555 ? 
204  DC5 7  HOH FJ .    ? HOH A 7816 . ? 1_555 ? 
205  DC5 7  NA  GF .    ? NA  A 8325 . ? 1_555 ? 
206  DC6 6  U   A  2114 ? U   A 2115 . ? 1_555 ? 
207  DC6 6  HOH FJ .    ? HOH A 3716 . ? 1_555 ? 
208  DC6 6  HOH FJ .    ? HOH A 3780 . ? 1_555 ? 
209  DC6 6  HOH FJ .    ? HOH A 4182 . ? 1_555 ? 
210  DC6 6  HOH FJ .    ? HOH A 9979 . ? 1_555 ? 
211  DC6 6  HOH HJ .    ? HOH C 8631 . ? 1_555 ? 
212  DC7 6  A   A  1746 ? A   A 1747 . ? 1_555 ? 
213  DC7 6  U   A  1747 ? U   A 1748 . ? 1_555 ? 
214  DC7 6  U   A  1748 ? U   A 1749 . ? 1_555 ? 
215  DC7 6  G   A  2584 ? G   A 2585 . ? 1_555 ? 
216  DC7 6  HOH FJ .    ? HOH A 3807 . ? 1_555 ? 
217  DC7 6  HOH FJ .    ? HOH A 9668 . ? 1_555 ? 
218  DC8 6  A   A  2301 ? A   A 2302 . ? 1_555 ? 
219  DC8 6  A   A  2302 ? A   A 2303 . ? 1_555 ? 
220  DC8 6  HOH FJ .    ? HOH A 3634 . ? 1_555 ? 
221  DC8 6  HOH FJ .    ? HOH A 3762 . ? 1_555 ? 
222  DC8 6  HOH FJ .    ? HOH A 4864 . ? 1_555 ? 
223  DC8 6  HOH FJ .    ? HOH A 7817 . ? 1_555 ? 
224  DC9 6  G   A  1483 ? G   A 1484 . ? 1_555 ? 
225  DC9 6  HOH FJ .    ? HOH A 3706 . ? 1_555 ? 
226  DC9 6  HOH FJ .    ? HOH A 7818 . ? 1_555 ? 
227  DC9 6  HOH FJ .    ? HOH A 7819 . ? 1_555 ? 
228  DC9 6  HOH FJ .    ? HOH A 7873 . ? 1_555 ? 
229  DC9 6  HOH FJ .    ? HOH A 7874 . ? 1_555 ? 
230  EC1 6  G   A  955  ? G   A 956  . ? 1_555 ? 
231  EC1 6  HOH FJ .    ? HOH A 3661 . ? 1_555 ? 
232  EC1 6  HOH FJ .    ? HOH A 7820 . ? 1_555 ? 
233  EC1 6  HOH FJ .    ? HOH A 7821 . ? 1_555 ? 
234  EC1 6  HOH FJ .    ? HOH A 7822 . ? 1_555 ? 
235  EC1 6  HOH FJ .    ? HOH A 9365 . ? 1_555 ? 
236  EC2 7  A   A  2552 ? A   A 2553 . ? 1_555 ? 
237  EC2 7  A   A  2575 ? A   A 2576 . ? 1_555 ? 
238  EC2 7  HOH FJ .    ? HOH A 3124 . ? 1_555 ? 
239  EC2 7  HOH FJ .    ? HOH A 3203 . ? 1_555 ? 
240  EC2 7  HOH FJ .    ? HOH A 3639 . ? 1_555 ? 
241  EC2 7  HOH FJ .    ? HOH A 7875 . ? 1_555 ? 
242  EC2 7  HOH FJ .    ? HOH A 9081 . ? 1_555 ? 
243  EC3 6  HOH FJ .    ? HOH A 3617 . ? 1_555 ? 
244  EC3 6  HOH FJ .    ? HOH A 3640 . ? 1_555 ? 
245  EC3 6  HOH FJ .    ? HOH A 3662 . ? 1_555 ? 
246  EC3 6  HOH FJ .    ? HOH A 3664 . ? 1_555 ? 
247  EC3 6  HOH FJ .    ? HOH A 7824 . ? 1_555 ? 
248  EC3 6  HOH FJ .    ? HOH A 9281 . ? 1_555 ? 
249  EC4 7  A   A  113  ? A   A 114  . ? 1_555 ? 
250  EC4 7  U   A  114  ? U   A 115  . ? 1_555 ? 
251  EC4 7  HOH FJ .    ? HOH A 3957 . ? 1_555 ? 
252  EC4 7  HOH FJ .    ? HOH A 5102 . ? 1_555 ? 
253  EC4 7  HOH FJ .    ? HOH A 7825 . ? 1_555 ? 
254  EC4 7  HOH FJ .    ? HOH A 7826 . ? 1_555 ? 
255  EC4 7  HOH FJ .    ? HOH A 9897 . ? 1_555 ? 
256  EC5 6  U   A  391  ? U   A 392  . ? 1_555 ? 
257  EC5 6  HOH FJ .    ? HOH A 3781 . ? 1_555 ? 
258  EC5 6  HOH FJ .    ? HOH A 4640 . ? 1_555 ? 
259  EC5 6  HOH FJ .    ? HOH A 7877 . ? 1_555 ? 
260  EC5 6  HOH FJ .    ? HOH A 7878 . ? 1_555 ? 
261  EC5 6  HOH FJ .    ? HOH A 9682 . ? 1_555 ? 
262  EC6 7  C   A  194  ? C   A 195  . ? 1_555 ? 
263  EC6 7  G   A  195  ? G   A 196  . ? 1_555 ? 
264  EC6 7  A   A  226  ? A   A 227  . ? 1_555 ? 
265  EC6 7  C   A  227  ? C   A 228  . ? 1_555 ? 
266  EC6 7  HOH FJ .    ? HOH A 4103 . ? 1_555 ? 
267  EC6 7  HOH FJ .    ? HOH A 4193 . ? 1_555 ? 
268  EC6 7  HOH FJ .    ? HOH A 5377 . ? 1_555 ? 
269  EC7 6  U   A  1308 ? U   A 1309 . ? 1_555 ? 
270  EC7 6  U   A  1345 ? U   A 1346 . ? 1_555 ? 
271  EC7 6  HOH FJ .    ? HOH A 3648 . ? 1_555 ? 
272  EC7 6  HOH FJ .    ? HOH A 4409 . ? 1_555 ? 
273  EC7 6  HOH FJ .    ? HOH A 7827 . ? 1_555 ? 
274  EC7 6  HOH FJ .    ? HOH A 9432 . ? 1_555 ? 
275  EC8 5  G   A  815  ? G   A 816  . ? 1_555 ? 
276  EC8 5  G   A  816  ? G   A 817  . ? 1_555 ? 
277  EC8 5  HOH FJ .    ? HOH A 7430 . ? 1_555 ? 
278  EC8 5  HOH FJ .    ? HOH A 7879 . ? 1_555 ? 
279  EC8 5  HOH FJ .    ? HOH A 9804 . ? 1_555 ? 
280  EC9 6  C   A  2047 ? C   A 2048 . ? 1_555 ? 
281  EC9 6  C   A  2087 ? C   A 2088 . ? 1_555 ? 
282  EC9 6  A   A  2088 ? A   A 2089 . ? 1_555 ? 
283  EC9 6  HOH FJ .    ? HOH A 3287 . ? 1_555 ? 
284  EC9 6  HOH FJ .    ? HOH A 7828 . ? 1_555 ? 
285  EC9 6  GLY S  65   ? GLY S 65   . ? 1_555 ? 
286  FC1 5  G   A  1978 ? G   A 1979 . ? 1_555 ? 
287  FC1 5  HOH FJ .    ? HOH A 7829 . ? 1_555 ? 
288  FC1 5  HOH FJ .    ? HOH A 7880 . ? 1_555 ? 
289  FC1 5  HOH FJ .    ? HOH A 7881 . ? 1_555 ? 
290  FC1 5  HOH FJ .    ? HOH A 7882 . ? 1_555 ? 
291  FC2 4  G   A  1793 ? G   A 1794 . ? 1_555 ? 
292  FC2 4  HOH FJ .    ? HOH A 7310 . ? 1_555 ? 
293  FC2 4  HOH FJ .    ? HOH A 7883 . ? 1_555 ? 
294  FC2 4  HOH FJ .    ? HOH A 7884 . ? 1_555 ? 
295  FC3 4  A   A  1097 ? A   A 1098 . ? 1_555 ? 
296  FC3 4  HOH FJ .    ? HOH A 3118 . ? 1_555 ? 
297  FC3 4  HOH FJ .    ? HOH A 6280 . ? 1_555 ? 
298  FC3 4  HOH FJ .    ? HOH A 7898 . ? 1_555 ? 
299  FC4 6  A   A  2745 ? A   A 2746 . ? 1_555 ? 
300  FC4 6  G   A  2749 ? G   A 2750 . ? 1_555 ? 
301  FC4 6  HOH FJ .    ? HOH A 5879 . ? 1_555 ? 
302  FC4 6  HOH FJ .    ? HOH A 6271 . ? 1_555 ? 
303  FC4 6  HOH FJ .    ? HOH A 7885 . ? 1_555 ? 
304  FC4 6  HOH FJ .    ? HOH A 7920 . ? 1_555 ? 
305  FC5 4  G   A  2420 ? G   A 2421 . ? 1_555 ? 
306  FC5 4  U   A  2421 ? U   A 2422 . ? 1_555 ? 
307  FC5 4  C   A  2422 ? C   A 2423 . ? 1_555 ? 
308  FC5 4  HOH FJ .    ? HOH A 7886 . ? 1_555 ? 
309  FC6 2  C   A  2247 ? C   A 2248 . ? 1_555 ? 
310  FC6 2  HOH FJ .    ? HOH A 7332 . ? 1_555 ? 
311  FC7 4  G   A  640  ? G   A 641  . ? 1_555 ? 
312  FC7 4  HOH FJ .    ? HOH A 4098 . ? 1_555 ? 
313  FC7 4  HOH FJ .    ? HOH A 7830 . ? 1_555 ? 
314  FC7 4  HOH FJ .    ? HOH A 7831 . ? 1_555 ? 
315  FC8 7  U   A  1124 ? U   A 1125 . ? 1_555 ? 
316  FC8 7  C   A  1128 ? C   A 1129 . ? 1_555 ? 
317  FC8 7  HOH FJ .    ? HOH A 3615 . ? 1_555 ? 
318  FC8 7  HOH FJ .    ? HOH A 7900 . ? 1_555 ? 
319  FC8 7  HOH GJ .    ? HOH B 737  . ? 1_555 ? 
320  FC8 7  HOH GJ .    ? HOH B 2357 . ? 1_555 ? 
321  FC8 7  G   B  92   ? G   B 3092 . ? 1_555 ? 
322  FC9 6  G   A  470  ? G   A 471  . ? 1_555 ? 
323  FC9 6  HOH FJ .    ? HOH A 3031 . ? 1_555 ? 
324  FC9 6  HOH FJ .    ? HOH A 4388 . ? 1_555 ? 
325  FC9 6  HOH FJ .    ? HOH A 5618 . ? 1_555 ? 
326  FC9 6  HOH FJ .    ? HOH A 9205 . ? 1_555 ? 
327  FC9 6  HOH FJ .    ? HOH A 9240 . ? 1_555 ? 
328  GC1 7  C   A  161  ? C   A 162  . ? 1_555 ? 
329  GC1 7  A   A  168  ? A   A 169  . ? 1_555 ? 
330  GC1 7  U   A  2275 ? U   A 2276 . ? 1_555 ? 
331  GC1 7  HOH FJ .    ? HOH A 7779 . ? 1_555 ? 
332  GC1 7  HOH FJ .    ? HOH A 7832 . ? 1_555 ? 
333  GC1 7  HOH FJ .    ? HOH A 7833 . ? 1_555 ? 
334  GC1 7  HOH FJ .    ? HOH A 9428 . ? 1_555 ? 
335  GC2 6  A   A  2756 ? A   A 2757 . ? 1_555 ? 
336  GC2 6  HOH FJ .    ? HOH A 3659 . ? 1_555 ? 
337  GC2 6  HOH FJ .    ? HOH A 3966 . ? 1_555 ? 
338  GC2 6  HOH FJ .    ? HOH A 7851 . ? 1_555 ? 
339  GC2 6  HOH FJ .    ? HOH A 9971 . ? 1_555 ? 
340  GC2 6  ASN D  335  ? ASN D 335  . ? 1_555 ? 
341  GC3 7  U   A  1882 ? U   A 1883 . ? 1_555 ? 
342  GC3 7  U   A  2011 ? U   A 2012 . ? 1_555 ? 
343  GC3 7  G   A  2012 ? G   A 2013 . ? 1_555 ? 
344  GC3 7  HOH FJ .    ? HOH A 5009 . ? 1_555 ? 
345  GC3 7  HOH FJ .    ? HOH A 7834 . ? 1_555 ? 
346  GC3 7  GLN C  207  ? GLN C 207  . ? 1_555 ? 
347  GC3 7  HOH HJ .    ? HOH C 8634 . ? 1_555 ? 
348  GC4 6  G   A  2012 ? G   A 2013 . ? 1_555 ? 
349  GC4 6  HOH FJ .    ? HOH A 3756 . ? 1_555 ? 
350  GC4 6  HOH FJ .    ? HOH A 7834 . ? 1_555 ? 
351  GC4 6  HOH FJ .    ? HOH A 7835 . ? 1_555 ? 
352  GC4 6  HOH HJ .    ? HOH C 8632 . ? 1_555 ? 
353  GC4 6  HOH HJ .    ? HOH C 8634 . ? 1_555 ? 
354  GC5 7  G   A  2617 ? G   A 2618 . ? 1_555 ? 
355  GC5 7  HOH FJ .    ? HOH A 3712 . ? 1_555 ? 
356  GC5 7  HOH FJ .    ? HOH A 4042 . ? 1_555 ? 
357  GC5 7  HOH FJ .    ? HOH A 7787 . ? 1_555 ? 
358  GC5 7  MG  GD .    ? MG  A 8085 . ? 1_555 ? 
359  GC5 7  HOH FJ .    ? HOH A 9038 . ? 1_555 ? 
360  GC5 7  HOH FJ .    ? HOH A 9042 . ? 1_555 ? 
361  GC6 6  G   A  174  ? G   A 175  . ? 1_555 ? 
362  GC6 6  U   A  223  ? U   A 224  . ? 1_555 ? 
363  GC6 6  HOH FJ .    ? HOH A 7836 . ? 1_555 ? 
364  GC6 6  HOH FJ .    ? HOH A 7837 . ? 1_555 ? 
365  GC6 6  HOH FJ .    ? HOH A 7838 . ? 1_555 ? 
366  GC6 6  HOH FJ .    ? HOH A 9172 . ? 1_555 ? 
367  GC7 6  A   A  1368 ? A   A 1369 . ? 1_555 ? 
368  GC7 6  U   A  2649 ? U   A 2650 . ? 1_555 ? 
369  GC7 6  HOH FJ .    ? HOH A 7839 . ? 1_555 ? 
370  GC7 6  HOH FJ .    ? HOH A 7840 . ? 1_555 ? 
371  GC7 6  HOH FJ .    ? HOH A 7841 . ? 1_555 ? 
372  GC7 6  HOH FJ .    ? HOH A 9809 . ? 1_555 ? 
373  GC8 6  G   A  1488 ? G   A 1489 . ? 1_555 ? 
374  GC8 6  G   A  1490 ? G   A 1491 . ? 1_555 ? 
375  GC8 6  HOH FJ .    ? HOH A 3624 . ? 1_555 ? 
376  GC8 6  HOH FJ .    ? HOH A 3948 . ? 1_555 ? 
377  GC8 6  HOH FJ .    ? HOH A 6180 . ? 1_555 ? 
378  GC8 6  HOH FJ .    ? HOH A 9390 . ? 1_555 ? 
379  GC9 6  HOH FJ .    ? HOH A 4174 . ? 1_555 ? 
380  GC9 6  HOH FJ .    ? HOH A 7013 . ? 1_555 ? 
381  GC9 6  HOH FJ .    ? HOH A 7448 . ? 1_555 ? 
382  GC9 6  HOH FJ .    ? HOH A 7772 . ? 1_555 ? 
383  GC9 6  HOH FJ .    ? HOH A 7850 . ? 1_555 ? 
384  GC9 6  HOH FJ .    ? HOH A 7901 . ? 1_555 ? 
385  HC1 5  U   A  2276 ? U   A 2277 . ? 1_555 ? 
386  HC1 5  U   A  2277 ? U   A 2278 . ? 1_555 ? 
387  HC1 5  G   A  2470 ? G   A 2471 . ? 1_555 ? 
388  HC1 5  HOH FJ .    ? HOH A 3752 . ? 1_555 ? 
389  HC1 5  HOH FJ .    ? HOH A 9585 . ? 1_555 ? 
390  HC2 4  C   A  1871 ? C   A 1872 . ? 1_555 ? 
391  HC2 4  G   A  1872 ? G   A 1873 . ? 1_555 ? 
392  HC2 4  ASP C  26   ? ASP C 26   . ? 1_555 ? 
393  HC2 4  HOH HJ .    ? HOH C 8565 . ? 1_555 ? 
394  HC3 6  A   A  1844 ? A   A 1845 . ? 1_555 ? 
395  HC3 6  U   A  1845 ? U   A 1846 . ? 1_555 ? 
396  HC3 6  G   A  1883 ? G   A 1884 . ? 1_555 ? 
397  HC3 6  HOH FJ .    ? HOH A 7843 . ? 1_555 ? 
398  HC3 6  ASN C  188  ? ASN C 188  . ? 1_555 ? 
399  HC3 6  ARG C  190  ? ARG C 190  . ? 1_555 ? 
400  HC4 6  A   A  2567 ? A   A 2568 . ? 1_555 ? 
401  HC4 6  HOH FJ .    ? HOH A 3742 . ? 1_555 ? 
402  HC4 6  HOH FJ .    ? HOH A 4816 . ? 1_555 ? 
403  HC4 6  HOH FJ .    ? HOH A 6230 . ? 1_555 ? 
404  HC4 6  HOH FJ .    ? HOH A 7902 . ? 1_555 ? 
405  HC4 6  HOH FJ .    ? HOH A 9724 . ? 1_555 ? 
406  HC5 6  A   A  165  ? A   A 166  . ? 1_555 ? 
407  HC5 6  G   A  218  ? G   A 219  . ? 1_555 ? 
408  HC5 6  HOH FJ .    ? HOH A 3808 . ? 1_555 ? 
409  HC5 6  HOH FJ .    ? HOH A 4956 . ? 1_555 ? 
410  HC5 6  HOH FJ .    ? HOH A 5592 . ? 1_555 ? 
411  HC5 6  HOH FJ .    ? HOH A 9127 . ? 1_555 ? 
412  HC6 6  HOH FJ .    ? HOH A 4107 . ? 1_555 ? 
413  HC6 6  HOH FJ .    ? HOH A 6058 . ? 1_555 ? 
414  HC6 6  HOH FJ .    ? HOH A 7434 . ? 1_555 ? 
415  HC6 6  HOH FJ .    ? HOH A 7571 . ? 1_555 ? 
416  HC6 6  HOH FJ .    ? HOH A 7848 . ? 1_555 ? 
417  HC6 6  HOH FJ .    ? HOH A 7849 . ? 1_555 ? 
418  HC7 7  G   A  952  ? G   A 953  . ? 1_555 ? 
419  HC7 7  U   A  953  ? U   A 954  . ? 1_555 ? 
420  HC7 7  HOH FJ .    ? HOH A 3225 . ? 1_555 ? 
421  HC7 7  HOH FJ .    ? HOH A 3988 . ? 1_555 ? 
422  HC7 7  HOH FJ .    ? HOH A 7429 . ? 1_555 ? 
423  HC7 7  HOH FJ .    ? HOH A 7847 . ? 1_555 ? 
424  HC7 7  HOH FJ .    ? HOH A 7903 . ? 1_555 ? 
425  HC8 6  A   A  1285 ? A   A 1286 . ? 1_555 ? 
426  HC8 6  A   A  1286 ? A   A 1287 . ? 1_555 ? 
427  HC8 6  HOH FJ .    ? HOH A 7844 . ? 1_555 ? 
428  HC8 6  HOH FJ .    ? HOH A 7845 . ? 1_555 ? 
429  HC8 6  HOH FJ .    ? HOH A 7904 . ? 1_555 ? 
430  HC8 6  HOH CK .    ? HOH X 7874 . ? 1_555 ? 
431  HC9 6  A   A  906  ? A   A 907  . ? 1_555 ? 
432  HC9 6  A   A  907  ? A   A 908  . ? 1_555 ? 
433  HC9 6  HOH FJ .    ? HOH A 3628 . ? 1_555 ? 
434  HC9 6  HOH FJ .    ? HOH A 3905 . ? 1_555 ? 
435  HC9 6  HOH FJ .    ? HOH A 4935 . ? 1_555 ? 
436  HC9 6  HOH FJ .    ? HOH A 7846 . ? 1_555 ? 
437  IC1 5  HOH HK .    ? HOH 3 7875 . ? 1_555 ? 
438  IC1 5  HOH FJ .    ? HOH A 6857 . ? 1_555 ? 
439  IC1 5  HOH FJ .    ? HOH A 7853 . ? 1_555 ? 
440  IC1 5  HOH FJ .    ? HOH A 7905 . ? 1_555 ? 
441  IC1 5  HOH FJ .    ? HOH A 7906 . ? 1_555 ? 
442  IC2 6  C   A  879  ? C   A 880  . ? 1_555 ? 
443  IC2 6  U   A  882  ? U   A 883  . ? 1_555 ? 
444  IC2 6  HOH FJ .    ? HOH A 3614 . ? 1_555 ? 
445  IC2 6  HOH FJ .    ? HOH A 7854 . ? 1_555 ? 
446  IC2 6  HOH FJ .    ? HOH A 7855 . ? 1_555 ? 
447  IC2 6  HOH FJ .    ? HOH A 9239 . ? 1_555 ? 
448  IC3 6  A   A  164  ? A   A 165  . ? 1_555 ? 
449  IC3 6  A   A  166  ? A   A 167  . ? 1_555 ? 
450  IC3 6  C   A  167  ? C   A 168  . ? 1_555 ? 
451  IC3 6  HOH FJ .    ? HOH A 3603 . ? 1_555 ? 
452  IC3 6  HOH FJ .    ? HOH A 3609 . ? 1_555 ? 
453  IC3 6  HOH FJ .    ? HOH A 3620 . ? 1_555 ? 
454  IC4 6  A   A  1683 ? A   A 1684 . ? 1_555 ? 
455  IC4 6  U   A  1723 ? U   A 1724 . ? 1_555 ? 
456  IC4 6  HOH FJ .    ? HOH A 4197 . ? 1_555 ? 
457  IC4 6  HOH FJ .    ? HOH A 4485 . ? 1_555 ? 
458  IC4 6  HOH FJ .    ? HOH A 7856 . ? 1_555 ? 
459  IC4 6  HOH FJ .    ? HOH A 7907 . ? 1_555 ? 
460  IC5 5  C   A  1419 ? C   A 1420 . ? 1_555 ? 
461  IC5 5  C   A  1420 ? C   A 1421 . ? 1_555 ? 
462  IC5 5  G   A  1437 ? G   A 1438 . ? 1_555 ? 
463  IC5 5  HOH FJ .    ? HOH A 4093 . ? 1_555 ? 
464  IC5 5  HOH FJ .    ? HOH A 9605 . ? 1_555 ? 
465  IC6 6  C   A  1435 ? C   A 1436 . ? 1_555 ? 
466  IC6 6  A   A  1436 ? A   A 1437 . ? 1_555 ? 
467  IC6 6  HOH FJ .    ? HOH A 5159 . ? 1_555 ? 
468  IC6 6  HOH FJ .    ? HOH A 5244 . ? 1_555 ? 
469  IC6 6  HOH FJ .    ? HOH A 7915 . ? 1_555 ? 
470  IC6 6  HOH FJ .    ? HOH A 7916 . ? 1_555 ? 
471  IC7 6  A   A  1753 ? A   A 1754 . ? 1_555 ? 
472  IC7 6  HOH FJ .    ? HOH A 3697 . ? 1_555 ? 
473  IC7 6  HOH FJ .    ? HOH A 4144 . ? 1_555 ? 
474  IC7 6  HOH FJ .    ? HOH A 6366 . ? 1_555 ? 
475  IC7 6  HOH FJ .    ? HOH A 7857 . ? 1_555 ? 
476  IC7 6  HOH FJ .    ? HOH A 7908 . ? 1_555 ? 
477  IC8 7  A   A  1741 ? A   A 1742 . ? 1_555 ? 
478  IC8 7  G   A  1744 ? G   A 1745 . ? 1_555 ? 
479  IC8 7  HOH FJ .    ? HOH A 3626 . ? 1_555 ? 
480  IC8 7  HOH FJ .    ? HOH A 7858 . ? 1_555 ? 
481  IC8 7  HOH FJ .    ? HOH A 9249 . ? 1_555 ? 
482  IC8 7  HOH FJ .    ? HOH A 9370 . ? 1_555 ? 
483  IC8 7  HOH FJ .    ? HOH A 9741 . ? 1_555 ? 
484  IC9 9  G   A  2616 ? G   A 2617 . ? 1_555 ? 
485  IC9 9  G   A  2617 ? G   A 2618 . ? 1_555 ? 
486  IC9 9  G   A  2641 ? G   A 2642 . ? 1_555 ? 
487  IC9 9  HOH FJ .    ? HOH A 3779 . ? 1_555 ? 
488  IC9 9  HOH FJ .    ? HOH A 4349 . ? 1_555 ? 
489  IC9 9  HOH FJ .    ? HOH A 4478 . ? 1_555 ? 
490  IC9 9  MG  KC .    ? MG  A 8059 . ? 1_555 ? 
491  IC9 9  HOH FJ .    ? HOH A 9038 . ? 1_555 ? 
492  IC9 9  HOH FJ .    ? HOH A 9596 . ? 1_555 ? 
493  JC1 6  A   A  531  ? A   A 532  . ? 1_555 ? 
494  JC1 6  U   A  532  ? U   A 533  . ? 1_555 ? 
495  JC1 6  HOH FJ .    ? HOH A 3724 . ? 1_555 ? 
496  JC1 6  HOH FJ .    ? HOH A 3967 . ? 1_555 ? 
497  JC1 6  HOH FJ .    ? HOH A 7859 . ? 1_555 ? 
498  JC1 6  HOH FJ .    ? HOH A 7860 . ? 1_555 ? 
499  JC2 4  A   A  681  ? A   A 682  . ? 1_555 ? 
500  JC2 4  G   A  682  ? G   A 683  . ? 1_555 ? 
501  JC2 4  HOH FJ .    ? HOH A 3668 . ? 1_555 ? 
502  JC2 4  HOH FJ .    ? HOH A 7917 . ? 1_555 ? 
503  JC3 6  G   A  2539 ? G   A 2540 . ? 1_555 ? 
504  JC3 6  G   A  2610 ? G   A 2611 . ? 1_555 ? 
505  JC3 6  HOH FJ .    ? HOH A 3035 . ? 1_555 ? 
506  JC3 6  NA  TF .    ? NA  A 8339 . ? 1_555 ? 
507  JC3 6  HOH FJ .    ? HOH A 9066 . ? 1_555 ? 
508  JC3 6  HOH FJ .    ? HOH A 9295 . ? 1_555 ? 
509  JC4 7  C   A  514  ? C   A 515  . ? 1_555 ? 
510  JC4 7  A   A  515  ? A   A 516  . ? 1_555 ? 
511  JC4 7  U   A  516  ? U   A 517  . ? 1_555 ? 
512  JC4 7  G   A  517  ? G   A 518  . ? 1_555 ? 
513  JC4 7  HOH FJ .    ? HOH A 7861 . ? 1_555 ? 
514  JC4 7  HOH FJ .    ? HOH A 7909 . ? 1_555 ? 
515  JC4 7  HOH FJ .    ? HOH A 7910 . ? 1_555 ? 
516  JC5 4  G   A  2101 ? G   A 2102 . ? 1_555 ? 
517  JC5 4  A   A  2102 ? A   A 2103 . ? 1_555 ? 
518  JC5 4  A   A  2478 ? A   A 2479 . ? 1_555 ? 
519  JC5 4  HOH FJ .    ? HOH A 3607 . ? 1_555 ? 
520  JC6 6  G   A  917  ? G   A 918  . ? 1_555 ? 
521  JC6 6  HOH FJ .    ? HOH A 3316 . ? 1_555 ? 
522  JC6 6  HOH FJ .    ? HOH A 6491 . ? 1_555 ? 
523  JC6 6  HOH FJ .    ? HOH A 7862 . ? 1_555 ? 
524  JC6 6  HOH FJ .    ? HOH A 9095 . ? 1_555 ? 
525  JC6 6  HOH FJ .    ? HOH A 9542 . ? 1_555 ? 
526  JC7 4  C   A  1843 ? C   A 1844 . ? 1_555 ? 
527  JC7 4  HOH FJ .    ? HOH A 3636 . ? 1_555 ? 
528  JC7 4  HOH FJ .    ? HOH A 3651 . ? 1_555 ? 
529  JC7 4  HOH FJ .    ? HOH A 7911 . ? 1_555 ? 
530  JC8 6  A   A  1069 ? A   A 1070 . ? 1_555 ? 
531  JC8 6  G   A  1070 ? G   A 1071 . ? 1_555 ? 
532  JC8 6  HOH FJ .    ? HOH A 3641 . ? 1_555 ? 
533  JC8 6  HOH FJ .    ? HOH A 3713 . ? 1_555 ? 
534  JC8 6  HOH FJ .    ? HOH A 9674 . ? 1_555 ? 
535  JC8 6  HOH EK .    ? HOH Z 8543 . ? 1_555 ? 
536  JC9 4  U   A  1095 ? U   A 1096 . ? 1_555 ? 
537  JC9 4  C   A  1256 ? C   A 1257 . ? 1_555 ? 
538  JC9 4  HOH FJ .    ? HOH A 7863 . ? 1_555 ? 
539  JC9 4  HOH FJ .    ? HOH A 7912 . ? 1_555 ? 
540  KC1 7  G   A  1847 ? G   A 1848 . ? 1_555 ? 
541  KC1 7  G   A  1848 ? G   A 1849 . ? 1_555 ? 
542  KC1 7  C   A  1881 ? C   A 1882 . ? 1_555 ? 
543  KC1 7  HOH FJ .    ? HOH A 3654 . ? 1_555 ? 
544  KC1 7  HOH FJ .    ? HOH A 3691 . ? 1_555 ? 
545  KC1 7  HOH FJ .    ? HOH A 3825 . ? 1_555 ? 
546  KC1 7  MG  IE .    ? MG  A 8116 . ? 1_555 ? 
547  KC2 6  G   A  862  ? G   A 863  . ? 1_555 ? 
548  KC2 6  U   A  863  ? U   A 864  . ? 1_555 ? 
549  KC2 6  HOH FJ .    ? HOH A 3333 . ? 1_555 ? 
550  KC2 6  HOH FJ .    ? HOH A 3663 . ? 1_555 ? 
551  KC2 6  HOH FJ .    ? HOH A 3667 . ? 1_555 ? 
552  KC2 6  HOH FJ .    ? HOH A 5554 . ? 1_555 ? 
553  KC3 6  A   A  906  ? A   A 907  . ? 1_555 ? 
554  KC3 6  HOH FJ .    ? HOH A 3364 . ? 1_555 ? 
555  KC3 6  HOH FJ .    ? HOH A 3674 . ? 1_555 ? 
556  KC3 6  HOH FJ .    ? HOH A 3738 . ? 1_555 ? 
557  KC3 6  HOH FJ .    ? HOH A 9930 . ? 1_555 ? 
558  KC3 6  HOH EK .    ? HOH Z 8568 . ? 1_555 ? 
559  KC4 5  A   A  2611 ? A   A 2612 . ? 1_555 ? 
560  KC4 5  U   A  2647 ? U   A 2648 . ? 1_555 ? 
561  KC4 5  HOH FJ .    ? HOH A 3005 . ? 1_555 ? 
562  KC4 5  HOH FJ .    ? HOH A 3658 . ? 1_555 ? 
563  KC4 5  HOH FJ .    ? HOH A 3670 . ? 1_555 ? 
564  KC5 6  G   A  2079 ? G   A 2080 . ? 1_555 ? 
565  KC5 6  HOH FJ .    ? HOH A 3759 . ? 1_555 ? 
566  KC5 6  HOH FJ .    ? HOH A 4242 . ? 1_555 ? 
567  KC5 6  HOH FJ .    ? HOH A 5507 . ? 1_555 ? 
568  KC5 6  HOH FJ .    ? HOH A 7864 . ? 1_555 ? 
569  KC5 6  HOH FJ .    ? HOH A 7865 . ? 1_555 ? 
570  KC6 4  C   A  2280 ? C   A 2281 . ? 1_555 ? 
571  KC6 4  U   A  2281 ? U   A 2282 . ? 1_555 ? 
572  KC6 4  HOH FJ .    ? HOH A 3737 . ? 1_555 ? 
573  KC6 4  HOH FJ .    ? HOH A 4618 . ? 1_555 ? 
574  KC7 5  HOH IK .    ? HOH 4 8525 . ? 1_555 ? 
575  KC7 5  A   A  2433 ? A   A 2434 . ? 1_555 ? 
576  KC7 5  U   A  2457 ? U   A 2458 . ? 1_555 ? 
577  KC7 5  HOH FJ .    ? HOH A 7921 . ? 1_555 ? 
578  KC7 5  HOH FJ .    ? HOH A 9252 . ? 1_555 ? 
579  KC8 3  G   A  2577 ? G   A 2578 . ? 1_555 ? 
580  KC8 3  G   A  2578 ? G   A 2579 . ? 1_555 ? 
581  KC8 3  HOH FJ .    ? HOH A 7913 . ? 1_555 ? 
582  KC9 5  C   A  2103 ? C   A 2104 . ? 1_555 ? 
583  KC9 5  C   A  2104 ? C   A 2105 . ? 1_555 ? 
584  KC9 5  HOH FJ .    ? HOH A 7768 . ? 1_555 ? 
585  KC9 5  HOH FJ .    ? HOH A 7769 . ? 1_555 ? 
586  KC9 5  HOH FJ .    ? HOH A 7770 . ? 1_555 ? 
587  LC1 6  G   A  816  ? G   A 817  . ? 1_555 ? 
588  LC1 6  HOH FJ .    ? HOH A 3592 . ? 1_555 ? 
589  LC1 6  HOH FJ .    ? HOH A 7425 . ? 1_555 ? 
590  LC1 6  HOH FJ .    ? HOH A 7430 . ? 1_555 ? 
591  LC1 6  HOH FJ .    ? HOH A 7879 . ? 1_555 ? 
592  LC1 6  HOH VJ .    ? HOH Q 5319 . ? 1_555 ? 
593  LC2 6  A   A  1105 ? A   A 1106 . ? 1_555 ? 
594  LC2 6  A   A  1106 ? A   A 1107 . ? 1_555 ? 
595  LC2 6  HOH FJ .    ? HOH A 7888 . ? 1_555 ? 
596  LC2 6  HOH FJ .    ? HOH A 7889 . ? 1_555 ? 
597  LC2 6  HOH FJ .    ? HOH A 7890 . ? 1_555 ? 
598  LC2 6  HOH FJ .    ? HOH A 7891 . ? 1_555 ? 
599  LC3 5  HOH FJ .    ? HOH A 6103 . ? 1_555 ? 
600  LC3 5  HOH FJ .    ? HOH A 7507 . ? 1_555 ? 
601  LC3 5  HOH FJ .    ? HOH A 7893 . ? 1_555 ? 
602  LC3 5  HOH FJ .    ? HOH A 7894 . ? 1_555 ? 
603  LC3 5  HOH FJ .    ? HOH A 7895 . ? 1_555 ? 
604  LC4 6  U   A  902  ? U   A 903  . ? 1_555 ? 
605  LC4 6  A   A  1356 ? A   A 1357 . ? 1_555 ? 
606  LC4 6  HOH FJ .    ? HOH A 3915 . ? 1_555 ? 
607  LC4 6  HOH FJ .    ? HOH A 5401 . ? 1_555 ? 
608  LC4 6  HOH FJ .    ? HOH A 6036 . ? 1_555 ? 
609  LC4 6  HOH FJ .    ? HOH A 9504 . ? 1_555 ? 
610  LC5 6  G   A  2608 ? G   A 2609 . ? 1_555 ? 
611  LC5 6  HOH FJ .    ? HOH A 3291 . ? 1_555 ? 
612  LC5 6  HOH FJ .    ? HOH A 3688 . ? 1_555 ? 
613  LC5 6  HOH FJ .    ? HOH A 3711 . ? 1_555 ? 
614  LC5 6  HOH FJ .    ? HOH A 5603 . ? 1_555 ? 
615  LC5 6  HOH FJ .    ? HOH A 5752 . ? 1_555 ? 
616  LC6 6  A   A  186  ? A   A 187  . ? 1_555 ? 
617  LC6 6  HOH FJ .    ? HOH A 3718 . ? 1_555 ? 
618  LC6 6  HOH FJ .    ? HOH A 3760 . ? 1_555 ? 
619  LC6 6  HOH FJ .    ? HOH A 9132 . ? 1_555 ? 
620  LC6 6  HOH FJ .    ? HOH A 9331 . ? 1_555 ? 
621  LC6 6  HOH FJ .    ? HOH A 9564 . ? 1_555 ? 
622  LC7 6  A   A  2111 ? A   A 2112 . ? 1_555 ? 
623  LC7 6  HOH FJ .    ? HOH A 3743 . ? 1_555 ? 
624  LC7 6  HOH FJ .    ? HOH A 3913 . ? 1_555 ? 
625  LC7 6  HOH FJ .    ? HOH A 6136 . ? 1_555 ? 
626  LC7 6  HOH FJ .    ? HOH A 6410 . ? 1_555 ? 
627  LC7 6  HOH FJ .    ? HOH A 9585 . ? 1_555 ? 
628  LC8 8  LYS DA 54   ? LYS 4 54   . ? 1_555 ? 
629  LC8 8  HOH IK .    ? HOH 4 8535 . ? 1_555 ? 
630  LC8 8  HOH IK .    ? HOH 4 8539 . ? 1_555 ? 
631  LC8 8  A   A  2429 ? A   A 2430 . ? 1_555 ? 
632  LC8 8  A   A  2467 ? A   A 2468 . ? 1_555 ? 
633  LC8 8  HOH FJ .    ? HOH A 3956 . ? 1_555 ? 
634  LC8 8  HOH FJ .    ? HOH A 9348 . ? 1_555 ? 
635  LC8 8  HOH FJ .    ? HOH A 9447 . ? 1_555 ? 
636  LC9 6  HOH FJ .    ? HOH A 4277 . ? 1_555 ? 
637  LC9 6  HOH FJ .    ? HOH A 4295 . ? 1_555 ? 
638  LC9 6  HOH FJ .    ? HOH A 6420 . ? 1_555 ? 
639  LC9 6  HOH FJ .    ? HOH A 6610 . ? 1_555 ? 
640  LC9 6  HOH FJ .    ? HOH A 6741 . ? 1_555 ? 
641  LC9 6  HOH HJ .    ? HOH C 8635 . ? 1_555 ? 
642  MC1 6  G   A  1848 ? G   A 1849 . ? 1_555 ? 
643  MC1 6  U   A  1849 ? U   A 1850 . ? 1_555 ? 
644  MC1 6  HOH FJ .    ? HOH A 3654 . ? 1_555 ? 
645  MC1 6  HOH FJ .    ? HOH A 3856 . ? 1_555 ? 
646  MC1 6  MG  QD .    ? MG  A 8096 . ? 1_555 ? 
647  MC1 6  HOH HJ .    ? HOH C 8555 . ? 1_555 ? 
648  MC2 6  A   A  1839 ? A   A 1840 . ? 1_555 ? 
649  MC2 6  C   A  1840 ? C   A 1841 . ? 1_555 ? 
650  MC2 6  A   A  2021 ? A   A 2022 . ? 1_555 ? 
651  MC2 6  HOH FJ .    ? HOH A 4633 . ? 1_555 ? 
652  MC2 6  HOH FJ .    ? HOH A 6569 . ? 1_555 ? 
653  MC2 6  HOH FJ .    ? HOH A 9222 . ? 1_555 ? 
654  MC3 2  A   A  2099 ? A   A 2100 . ? 1_555 ? 
655  MC3 2  G   A  2101 ? G   A 2102 . ? 1_555 ? 
656  MC4 4  A   A  2537 ? A   A 2538 . ? 1_555 ? 
657  MC4 4  U   A  2538 ? U   A 2539 . ? 1_555 ? 
658  MC4 4  G   A  2539 ? G   A 2540 . ? 1_555 ? 
659  MC4 4  TYK EA .    ? TYK A 9000 . ? 1_555 ? 
660  MC5 6  C   A  1068 ? C   A 1069 . ? 1_555 ? 
661  MC5 6  G   A  1071 ? G   A 1072 . ? 1_555 ? 
662  MC5 6  G   A  1086 ? G   A 1087 . ? 1_555 ? 
663  MC5 6  HOH FJ .    ? HOH A 3159 . ? 1_555 ? 
664  MC5 6  HOH FJ .    ? HOH A 3193 . ? 1_555 ? 
665  MC5 6  HOH FJ .    ? HOH A 4969 . ? 1_555 ? 
666  MC6 4  G   A  1118 ? G   A 1119 . ? 1_555 ? 
667  MC6 4  U   A  1119 ? U   A 1120 . ? 1_555 ? 
668  MC6 4  G   A  1120 ? G   A 1121 . ? 1_555 ? 
669  MC6 4  HOH FJ .    ? HOH A 5686 . ? 1_555 ? 
670  MC7 5  A   A  642  ? A   A 643  . ? 1_555 ? 
671  MC7 5  G   A  643  ? G   A 644  . ? 1_555 ? 
672  MC7 5  U   A  903  ? U   A 904  . ? 1_555 ? 
673  MC7 5  G   A  1353 ? G   A 1354 . ? 1_555 ? 
674  MC7 5  ARG M  8    ? ARG M 8    . ? 1_555 ? 
675  MC8 6  A   A  629  ? A   A 630  . ? 1_555 ? 
676  MC8 6  A   A  630  ? A   A 631  . ? 1_555 ? 
677  MC8 6  A   A  2073 ? A   A 2074 . ? 1_555 ? 
678  MC8 6  HOH FJ .    ? HOH A 4083 . ? 1_555 ? 
679  MC8 6  HOH FJ .    ? HOH A 4697 . ? 1_555 ? 
680  MC8 6  HOH FJ .    ? HOH A 5788 . ? 1_555 ? 
681  MC9 4  G   A  2091 ? G   A 2092 . ? 1_555 ? 
682  MC9 4  G   A  2092 ? G   A 2093 . ? 1_555 ? 
683  MC9 4  G   A  2093 ? G   A 2094 . ? 1_555 ? 
684  MC9 4  A   A  2648 ? A   A 2649 . ? 1_555 ? 
685  NC1 4  C   A  39   ? C   A 40   . ? 1_555 ? 
686  NC1 4  G   A  40   ? G   A 41   . ? 1_555 ? 
687  NC1 4  A   A  441  ? A   A 442  . ? 1_555 ? 
688  NC1 4  C   A  442  ? C   A 443  . ? 1_555 ? 
689  NC2 5  C   A  1393 ? C   A 1394 . ? 1_555 ? 
690  NC2 5  U   A  1431 ? U   A 1432 . ? 1_555 ? 
691  NC2 5  G   A  1432 ? G   A 1433 . ? 1_555 ? 
692  NC2 5  U   A  1723 ? U   A 1724 . ? 1_555 ? 
693  NC2 5  HOH FJ .    ? HOH A 3406 . ? 1_555 ? 
694  NC3 3  A   A  2576 ? A   A 2577 . ? 1_555 ? 
695  NC3 3  G   A  2577 ? G   A 2578 . ? 1_555 ? 
696  NC3 3  G   A  2578 ? G   A 2579 . ? 1_555 ? 
697  NC4 4  G   A  2523 ? G   A 2524 . ? 1_555 ? 
698  NC4 4  G   A  2524 ? G   A 2525 . ? 1_555 ? 
699  NC4 4  HOH FJ .    ? HOH A 3567 . ? 1_555 ? 
700  NC4 4  HOH FJ .    ? HOH A 4651 . ? 1_555 ? 
701  NC5 5  G   A  2398 ? G   A 2399 . ? 1_555 ? 
702  NC5 5  HOH FJ .    ? HOH A 3826 . ? 1_555 ? 
703  NC5 5  HOH FJ .    ? HOH A 5121 . ? 1_555 ? 
704  NC5 5  HOH FJ .    ? HOH A 6517 . ? 1_555 ? 
705  NC5 5  HOH FJ .    ? HOH A 9939 . ? 1_555 ? 
706  NC6 6  U   A  2540 ? U   A 2541 . ? 1_555 ? 
707  NC6 6  U   A  2606 ? U   A 2607 . ? 1_555 ? 
708  NC6 6  C   A  2607 ? C   A 2608 . ? 1_555 ? 
709  NC6 6  HOH FJ .    ? HOH A 3119 . ? 1_555 ? 
710  NC6 6  HOH FJ .    ? HOH A 9332 . ? 1_555 ? 
711  NC6 6  TRP D  242  ? TRP D 242  . ? 1_555 ? 
712  NC7 4  A   A  164  ? A   A 165  . ? 1_555 ? 
713  NC7 4  A   A  165  ? A   A 166  . ? 1_555 ? 
714  NC7 4  A   A  166  ? A   A 167  . ? 1_555 ? 
715  NC7 4  HOH FJ .    ? HOH A 9677 . ? 1_555 ? 
716  NC8 5  C   A  895  ? C   A 896  . ? 1_555 ? 
717  NC8 5  A   A  896  ? A   A 897  . ? 1_555 ? 
718  NC8 5  HOH FJ .    ? HOH A 6324 . ? 1_555 ? 
719  NC8 5  HOH FJ .    ? HOH A 7702 . ? 1_555 ? 
720  NC8 5  HOH FJ .    ? HOH A 9030 . ? 1_555 ? 
721  NC9 6  TRP CA 41   ? TRP 3 42   . ? 1_555 ? 
722  NC9 6  ASN CA 44   ? ASN 3 45   . ? 1_555 ? 
723  NC9 6  HOH HK .    ? HOH 3 4135 . ? 1_555 ? 
724  NC9 6  G   A  1415 ? G   A 1416 . ? 1_555 ? 
725  NC9 6  G   A  1416 ? G   A 1417 . ? 1_555 ? 
726  NC9 6  HOH FJ .    ? HOH A 9277 . ? 1_555 ? 
727  OC1 4  G   A  2542 ? G   A 2543 . ? 1_555 ? 
728  OC1 4  G   A  2543 ? G   A 2544 . ? 1_555 ? 
729  OC1 4  HOH FJ .    ? HOH A 3919 . ? 1_555 ? 
730  OC1 4  NA  CF .    ? NA  A 8320 . ? 1_555 ? 
731  OC2 7  A   A  2464 ? A   A 2465 . ? 1_555 ? 
732  OC2 7  G   A  2465 ? G   A 2466 . ? 1_555 ? 
733  OC2 7  HOH FJ .    ? HOH A 4252 . ? 1_555 ? 
734  OC2 7  HOH FJ .    ? HOH A 6051 . ? 1_555 ? 
735  OC2 7  HOH FJ .    ? HOH A 9062 . ? 1_555 ? 
736  OC2 7  ASP M  36   ? ASP M 36   . ? 1_555 ? 
737  OC2 7  HOH RJ .    ? HOH M 8542 . ? 1_555 ? 
738  OC3 7  G   A  2542 ? G   A 2543 . ? 1_555 ? 
739  OC3 7  G   A  2543 ? G   A 2544 . ? 1_555 ? 
740  OC3 7  U   A  2614 ? U   A 2615 . ? 1_555 ? 
741  OC3 7  NA  AF .    ? NA  A 8318 . ? 1_555 ? 
742  OC3 7  HOH FJ .    ? HOH A 9059 . ? 1_555 ? 
743  OC3 7  HOH FJ .    ? HOH A 9090 . ? 1_555 ? 
744  OC3 7  HOH FJ .    ? HOH A 9732 . ? 1_555 ? 
745  OC4 5  G   A  835  ? G   A 836  . ? 1_555 ? 
746  OC4 5  U   A  836  ? U   A 837  . ? 1_555 ? 
747  OC4 5  A   A  1735 ? A   A 1736 . ? 1_555 ? 
748  OC4 5  A   A  1736 ? A   A 1737 . ? 1_555 ? 
749  OC4 5  ARG D  229  ? ARG D 229  . ? 1_555 ? 
750  OC5 6  G   A  884  ? G   A 885  . ? 1_555 ? 
751  OC5 6  A   A  2111 ? A   A 2112 . ? 1_555 ? 
752  OC5 6  G   A  2112 ? G   A 2113 . ? 1_555 ? 
753  OC5 6  C   A  2474 ? C   A 2475 . ? 1_555 ? 
754  OC5 6  C   A  2475 ? C   A 2476 . ? 1_555 ? 
755  OC5 6  HOH FJ .    ? HOH A 4472 . ? 1_555 ? 
756  OC6 6  A   A  44   ? A   A 45   . ? 1_555 ? 
757  OC6 6  C   A  129  ? C   A 130  . ? 1_555 ? 
758  OC6 6  U   A  145  ? U   A 146  . ? 1_555 ? 
759  OC6 6  G   A  146  ? G   A 147  . ? 1_555 ? 
760  OC6 6  HOH FJ .    ? HOH A 4124 . ? 1_555 ? 
761  OC6 6  HOH FJ .    ? HOH A 9489 . ? 1_555 ? 
762  OC7 7  A   A  775  ? A   A 776  . ? 1_555 ? 
763  OC7 7  U   A  776  ? U   A 777  . ? 1_555 ? 
764  OC7 7  U   A  778  ? U   A 779  . ? 1_555 ? 
765  OC7 7  HOH FJ .    ? HOH A 3268 . ? 1_555 ? 
766  OC7 7  HOH FJ .    ? HOH A 7678 . ? 1_555 ? 
767  OC7 7  MG  JB .    ? MG  A 8031 . ? 1_555 ? 
768  OC7 7  HOH FJ .    ? HOH A 9619 . ? 1_555 ? 
769  OC8 4  G   A  1970 ? G   A 1971 . ? 1_555 ? 
770  OC8 4  G   A  2008 ? G   A 2009 . ? 1_555 ? 
771  OC8 4  A   A  2009 ? A   A 2010 . ? 1_555 ? 
772  OC8 4  U   A  2011 ? U   A 2012 . ? 1_555 ? 
773  OC9 7  U   A  820  ? U   A 821  . ? 1_555 ? 
774  OC9 7  C   A  852  ? C   A 853  . ? 1_555 ? 
775  OC9 7  G   A  853  ? G   A 854  . ? 1_555 ? 
776  OC9 7  U   A  1830 ? U   A 1831 . ? 1_555 ? 
777  OC9 7  HOH FJ .    ? HOH A 3197 . ? 1_555 ? 
778  OC9 7  HOH FJ .    ? HOH A 9037 . ? 1_555 ? 
779  OC9 7  HOH FJ .    ? HOH A 9720 . ? 1_555 ? 
780  PC1 6  G   A  55   ? G   A 56   . ? 1_555 ? 
781  PC1 6  A   A  58   ? A   A 59   . ? 1_555 ? 
782  PC1 6  A   A  59   ? A   A 60   . ? 1_555 ? 
783  PC1 6  G   A  60   ? G   A 61   . ? 1_555 ? 
784  PC1 6  HOH FJ .    ? HOH A 5217 . ? 1_555 ? 
785  PC1 6  HOH FJ .    ? HOH A 6486 . ? 1_555 ? 
786  PC2 4  G   A  65   ? G   A 66   . ? 1_555 ? 
787  PC2 4  U   A  106  ? U   A 107  . ? 1_555 ? 
788  PC2 4  U   A  107  ? U   A 108  . ? 1_555 ? 
789  PC2 4  HOH FJ .    ? HOH A 6588 . ? 1_555 ? 
790  PC3 3  C   A  140  ? C   A 141  . ? 1_555 ? 
791  PC3 3  G   A  141  ? G   A 142  . ? 1_555 ? 
792  PC3 3  HOH FJ .    ? HOH A 9233 . ? 1_555 ? 
793  PC4 6  HOH IK .    ? HOH 4 8506 . ? 1_555 ? 
794  PC4 6  U   A  169  ? U   A 170  . ? 1_555 ? 
795  PC4 6  C   A  170  ? C   A 171  . ? 1_555 ? 
796  PC4 6  C   A  217  ? C   A 218  . ? 1_555 ? 
797  PC4 6  G   A  218  ? G   A 219  . ? 1_555 ? 
798  PC4 6  G   A  220  ? G   A 221  . ? 1_555 ? 
799  PC5 5  G   A  385  ? G   A 386  . ? 1_555 ? 
800  PC5 5  G   A  386  ? G   A 387  . ? 1_555 ? 
801  PC5 5  G   A  387  ? G   A 388  . ? 1_555 ? 
802  PC5 5  U   A  401  ? U   A 402  . ? 1_555 ? 
803  PC5 5  HOH FJ .    ? HOH A 7082 . ? 1_555 ? 
804  PC6 5  C   A  1893 ? C   A 1894 . ? 1_555 ? 
805  PC6 5  U   A  1896 ? U   A 1897 . ? 1_555 ? 
806  PC6 5  G   A  1897 ? G   A 1898 . ? 1_555 ? 
807  PC6 5  U   A  1938 ? U   A 1939 . ? 1_555 ? 
808  PC6 5  NA  PF .    ? NA  A 8334 . ? 1_555 ? 
809  PC7 6  C   A  1893 ? C   A 1894 . ? 1_555 ? 
810  PC7 6  A   A  1894 ? A   A 1895 . ? 1_555 ? 
811  PC7 6  G   A  1895 ? G   A 1896 . ? 1_555 ? 
812  PC7 6  U   A  1896 ? U   A 1897 . ? 1_555 ? 
813  PC7 6  HOH FJ .    ? HOH A 5250 . ? 1_555 ? 
814  PC7 6  NA  OF .    ? NA  A 8333 . ? 1_555 ? 
815  PC8 6  C   A  620  ? C   A 621  . ? 1_555 ? 
816  PC8 6  G   A  621  ? G   A 622  . ? 1_555 ? 
817  PC8 6  U   A  622  ? U   A 623  . ? 1_555 ? 
818  PC8 6  A   A  627  ? A   A 628  . ? 1_555 ? 
819  PC8 6  A   A  629  ? A   A 630  . ? 1_555 ? 
820  PC8 6  HOH FJ .    ? HOH A 9859 . ? 1_555 ? 
821  PC9 6  G   A  1705 ? G   A 1706 . ? 1_555 ? 
822  PC9 6  G   A  1706 ? G   A 1707 . ? 1_555 ? 
823  PC9 6  HOH FJ .    ? HOH A 5340 . ? 1_555 ? 
824  PC9 6  HOH FJ .    ? HOH A 7361 . ? 1_555 ? 
825  PC9 6  HOH FJ .    ? HOH A 7705 . ? 1_555 ? 
826  PC9 6  HOH FJ .    ? HOH A 9911 . ? 1_555 ? 
827  QC1 7  U   A  2658 ? U   A 2659 . ? 1_555 ? 
828  QC1 7  G   A  2659 ? G   A 2660 . ? 1_555 ? 
829  QC1 7  VAL S  72   ? VAL S 72   . ? 1_555 ? 
830  QC1 7  TRP S  75   ? TRP S 75   . ? 1_555 ? 
831  QC1 7  NA  RI .    ? NA  S 8337 . ? 1_555 ? 
832  QC1 7  HOH XJ .    ? HOH S 8515 . ? 1_555 ? 
833  QC1 7  HOH XJ .    ? HOH S 8527 . ? 1_555 ? 
834  QC2 7  G   A  2539 ? G   A 2540 . ? 1_555 ? 
835  QC2 7  G   A  2610 ? G   A 2611 . ? 1_555 ? 
836  QC2 7  G   A  2615 ? G   A 2616 . ? 1_555 ? 
837  QC2 7  U   A  2644 ? U   A 2645 . ? 1_555 ? 
838  QC2 7  HOH FJ .    ? HOH A 3018 . ? 1_555 ? 
839  QC2 7  HOH FJ .    ? HOH A 4285 . ? 1_555 ? 
840  QC2 7  MG  JD .    ? MG  A 8088 . ? 1_555 ? 
841  QC3 5  U   A  1739 ? U   A 1740 . ? 1_555 ? 
842  QC3 5  U   A  1740 ? U   A 1741 . ? 1_555 ? 
843  QC3 5  G   A  2032 ? G   A 2033 . ? 1_555 ? 
844  QC3 5  HOH FJ .    ? HOH A 3027 . ? 1_555 ? 
845  QC3 5  HOH FJ .    ? HOH A 6285 . ? 1_555 ? 
846  QC4 4  G   A  680  ? G   A 681  . ? 1_555 ? 
847  QC4 4  A   A  681  ? A   A 682  . ? 1_555 ? 
848  QC4 4  G   A  682  ? G   A 683  . ? 1_555 ? 
849  QC4 4  HOH FJ .    ? HOH A 7917 . ? 1_555 ? 
850  QC5 3  G   A  891  ? G   A 892  . ? 1_555 ? 
851  QC5 3  C   A  892  ? C   A 893  . ? 1_555 ? 
852  QC5 3  HOH FJ .    ? HOH A 5629 . ? 1_555 ? 
853  QC6 7  U   A  307  ? U   A 308  . ? 1_555 ? 
854  QC6 7  U   A  334  ? U   A 335  . ? 1_555 ? 
855  QC6 7  A   A  338  ? A   A 339  . ? 1_555 ? 
856  QC6 7  C   A  341  ? C   A 342  . ? 1_555 ? 
857  QC6 7  SER U  94   ? SER U 94   . ? 1_555 ? 
858  QC6 7  ASN U  95   ? ASN U 95   . ? 1_555 ? 
859  QC6 7  HOH ZJ .    ? HOH U 1124 . ? 1_555 ? 
860  QC7 6  U   A  2662 ? U   A 2663 . ? 1_555 ? 
861  QC7 6  A   A  2810 ? A   A 2811 . ? 1_555 ? 
862  QC7 6  A   A  2811 ? A   A 2812 . ? 1_555 ? 
863  QC7 6  A   A  2815 ? A   A 2816 . ? 1_555 ? 
864  QC7 6  G   A  2816 ? G   A 2817 . ? 1_555 ? 
865  QC7 6  HOH FJ .    ? HOH A 9221 . ? 1_555 ? 
866  QC8 4  A   A  913  ? A   A 914  . ? 1_555 ? 
867  QC8 4  C   A  914  ? C   A 915  . ? 1_555 ? 
868  QC8 4  C   A  1042 ? C   A 1043 . ? 1_555 ? 
869  QC8 4  G   A  1044 ? G   A 1045 . ? 1_555 ? 
870  QC9 5  U   A  622  ? U   A 623  . ? 1_555 ? 
871  QC9 5  U   A  623  ? U   A 624  . ? 1_555 ? 
872  QC9 5  G   A  900  ? G   A 901  . ? 1_555 ? 
873  QC9 5  HOH FJ .    ? HOH A 6967 . ? 1_555 ? 
874  QC9 5  HOH FJ .    ? HOH A 7765 . ? 1_555 ? 
875  RC1 5  A   A  954  ? A   A 955  . ? 1_555 ? 
876  RC1 5  HOH FJ .    ? HOH A 5258 . ? 1_555 ? 
877  RC1 5  HOH FJ .    ? HOH A 6614 . ? 1_555 ? 
878  RC1 5  C   B  81   ? C   B 3081 . ? 1_555 ? 
879  RC1 5  U   B  82   ? U   B 3082 . ? 1_555 ? 
880  RC2 6  A   A  1039 ? A   A 1040 . ? 1_555 ? 
881  RC2 6  G   A  1294 ? G   A 1295 . ? 1_555 ? 
882  RC2 6  A   A  1295 ? A   A 1296 . ? 1_555 ? 
883  RC2 6  HOH FJ .    ? HOH A 4873 . ? 1_555 ? 
884  RC2 6  GLY M  14   ? GLY M 14   . ? 1_555 ? 
885  RC2 6  HOH RJ .    ? HOH M 8516 . ? 1_555 ? 
886  RC3 5  U   A  767  ? U   A 768  . ? 1_555 ? 
887  RC3 5  C   A  768  ? C   A 769  . ? 1_555 ? 
888  RC3 5  G   A  2110 ? G   A 2111 . ? 1_555 ? 
889  RC3 5  A   A  2111 ? A   A 2112 . ? 1_555 ? 
890  RC3 5  HOH FJ .    ? HOH A 4813 . ? 1_555 ? 
891  RC4 4  G   A  1118 ? G   A 1119 . ? 1_555 ? 
892  RC4 4  C   A  1242 ? C   A 1243 . ? 1_555 ? 
893  RC4 4  HOH FJ .    ? HOH A 4806 . ? 1_555 ? 
894  RC4 4  THR K  47   ? THR K 47   . ? 1_555 ? 
895  RC5 4  C   A  919  ? C   A 920  . ? 1_555 ? 
896  RC5 4  U   A  2277 ? U   A 2278 . ? 1_555 ? 
897  RC5 4  G   A  2278 ? G   A 2279 . ? 1_555 ? 
898  RC5 4  A   A  2462 ? A   A 2463 . ? 1_555 ? 
899  RC6 5  G   A  940  ? G   A 941  . ? 1_555 ? 
900  RC6 5  U   A  941  ? U   A 942  . ? 1_555 ? 
901  RC6 5  G   A  1023 ? G   A 1024 . ? 1_555 ? 
902  RC6 5  C   A  1024 ? C   A 1025 . ? 1_555 ? 
903  RC6 5  HOH FJ .    ? HOH A 6284 . ? 1_555 ? 
904  RC7 6  G   A  897  ? G   A 898  . ? 1_555 ? 
905  RC7 6  A   A  921  ? A   A 922  . ? 1_555 ? 
906  RC7 6  A   A  922  ? A   A 923  . ? 1_555 ? 
907  RC7 6  G   A  923  ? G   A 924  . ? 1_555 ? 
908  RC7 6  U   A  2108 ? U   A 2109 . ? 1_555 ? 
909  RC7 6  HOH FJ .    ? HOH A 3180 . ? 1_555 ? 
910  RC8 4  A   A  452  ? A   A 453  . ? 1_555 ? 
911  RC8 4  U   A  453  ? U   A 454  . ? 1_555 ? 
912  RC8 4  C   A  477  ? C   A 478  . ? 1_555 ? 
913  RC8 4  G   A  478  ? G   A 479  . ? 1_555 ? 
914  RC9 6  U   A  836  ? U   A 837  . ? 1_555 ? 
915  RC9 6  HOH FJ .    ? HOH A 4903 . ? 1_555 ? 
916  RC9 6  HOH FJ .    ? HOH A 5101 . ? 1_555 ? 
917  RC9 6  HOH FJ .    ? HOH A 6830 . ? 1_555 ? 
918  RC9 6  HOH FJ .    ? HOH A 7350 . ? 1_555 ? 
919  RC9 6  GLN D  230  ? GLN D 230  . ? 1_555 ? 
920  SC1 5  A   A  166  ? A   A 167  . ? 1_555 ? 
921  SC1 5  C   A  167  ? C   A 168  . ? 1_555 ? 
922  SC1 5  G   A  2109 ? G   A 2110 . ? 1_555 ? 
923  SC1 5  G   A  2110 ? G   A 2111 . ? 1_555 ? 
924  SC1 5  U   A  2276 ? U   A 2277 . ? 1_555 ? 
925  SC2 2  U   A  1358 ? U   A 1359 . ? 1_555 ? 
926  SC2 2  C   A  1359 ? C   A 1360 . ? 1_555 ? 
927  SC3 5  G   A  635  ? G   A 636  . ? 1_555 ? 
928  SC3 5  U   A  2056 ? U   A 2057 . ? 1_555 ? 
929  SC3 5  G   A  2057 ? G   A 2058 . ? 1_555 ? 
930  SC3 5  HOH FJ .    ? HOH A 9588 . ? 1_555 ? 
931  SC3 5  HOH FJ .    ? HOH A 9807 . ? 1_555 ? 
932  SC4 6  U   A  390  ? U   A 391  . ? 1_555 ? 
933  SC4 6  U   A  391  ? U   A 392  . ? 1_555 ? 
934  SC4 6  U   A  397  ? U   A 398  . ? 1_555 ? 
935  SC4 6  C   A  398  ? C   A 399  . ? 1_555 ? 
936  SC4 6  LYS N  193  ? LYS N 193  . ? 1_555 ? 
937  SC4 6  ALA N  194  ? ALA N 194  . ? 1_555 ? 
938  SC5 8  G   A  543  ? G   A 544  . ? 1_555 ? 
939  SC5 8  G   A  544  ? G   A 545  . ? 1_555 ? 
940  SC5 8  G   A  609  ? G   A 610  . ? 1_555 ? 
941  SC5 8  U   A  610  ? U   A 611  . ? 1_555 ? 
942  SC5 8  HOH FJ .    ? HOH A 3812 . ? 1_555 ? 
943  SC5 8  HOH FJ .    ? HOH A 3871 . ? 1_555 ? 
944  SC5 8  HOH FJ .    ? HOH A 9853 . ? 1_555 ? 
945  SC5 8  HOH FJ .    ? HOH A 9872 . ? 1_555 ? 
946  SC6 6  G   A  463  ? G   A 464  . ? 1_555 ? 
947  SC6 6  G   A  474  ? G   A 475  . ? 1_555 ? 
948  SC6 6  HOH FJ .    ? HOH A 4471 . ? 1_555 ? 
949  SC6 6  HOH FJ .    ? HOH A 4599 . ? 1_555 ? 
950  SC6 6  HOH FJ .    ? HOH A 9818 . ? 1_555 ? 
951  SC6 6  ARG E  55   ? ARG E 55   . ? 1_555 ? 
952  SC7 4  G   A  797  ? G   A 798  . ? 1_555 ? 
953  SC7 4  G   A  813  ? G   A 814  . ? 1_555 ? 
954  SC7 4  U   A  814  ? U   A 815  . ? 1_555 ? 
955  SC7 4  HOH FJ .    ? HOH A 3875 . ? 1_555 ? 
956  SC8 5  HOH IK .    ? HOH 4 8547 . ? 1_555 ? 
957  SC8 5  U   A  390  ? U   A 391  . ? 1_555 ? 
958  SC8 5  U   A  391  ? U   A 392  . ? 1_555 ? 
959  SC8 5  A   A  394  ? A   A 395  . ? 1_555 ? 
960  SC8 5  U   A  397  ? U   A 398  . ? 1_555 ? 
961  SC9 4  G   A  1831 ? G   A 1832 . ? 1_555 ? 
962  SC9 4  A   A  2021 ? A   A 2022 . ? 1_555 ? 
963  SC9 4  HOH FJ .    ? HOH A 4097 . ? 1_555 ? 
964  SC9 4  HOH FJ .    ? HOH A 9107 . ? 1_555 ? 
965  TC1 4  G   A  2490 ? G   A 2491 . ? 1_555 ? 
966  TC1 4  U   A  2491 ? U   A 2492 . ? 1_555 ? 
967  TC1 4  G   A  2528 ? G   A 2529 . ? 1_555 ? 
968  TC1 4  HOH FJ .    ? HOH A 9620 . ? 1_555 ? 
969  TC2 3  U   A  918  ? U   A 919  . ? 1_555 ? 
970  TC2 3  G   A  920  ? G   A 921  . ? 1_555 ? 
971  TC2 3  G   A  923  ? G   A 924  . ? 1_555 ? 
972  TC3 6  G   A  1575 ? G   A 1576 . ? 1_555 ? 
973  TC3 6  U   A  1576 ? U   A 1577 . ? 1_555 ? 
974  TC3 6  G   A  1617 ? G   A 1618 . ? 1_555 ? 
975  TC3 6  G   A  1618 ? G   A 1619 . ? 1_555 ? 
976  TC3 6  HOH FJ .    ? HOH A 3671 . ? 1_555 ? 
977  TC3 6  HOH FJ .    ? HOH A 7314 . ? 1_555 ? 
978  TC4 5  C   A  194  ? C   A 195  . ? 1_555 ? 
979  TC4 5  G   A  195  ? G   A 196  . ? 1_555 ? 
980  TC4 5  A   A  414  ? A   A 415  . ? 1_555 ? 
981  TC4 5  G   A  415  ? G   A 416  . ? 1_555 ? 
982  TC4 5  HOH FJ .    ? HOH A 9884 . ? 1_555 ? 
983  TC5 4  G   A  867  ? G   A 868  . ? 1_555 ? 
984  TC5 4  G   A  868  ? G   A 869  . ? 1_555 ? 
985  TC5 4  A   A  885  ? A   A 886  . ? 1_555 ? 
986  TC5 4  G   A  886  ? G   A 887  . ? 1_555 ? 
987  TC6 6  A   A  631  ? A   A 632  . ? 1_555 ? 
988  TC6 6  C   A  632  ? C   A 633  . ? 1_555 ? 
989  TC6 6  U   A  2534 ? U   A 2535 . ? 1_555 ? 
990  TC6 6  C   A  2535 ? C   A 2536 . ? 1_555 ? 
991  TC6 6  A   A  2537 ? A   A 2538 . ? 1_555 ? 
992  TC6 6  HOH FJ .    ? HOH A 4853 . ? 1_555 ? 
993  TC7 5  G   A  910  ? G   A 911  . ? 1_555 ? 
994  TC7 5  U   A  1292 ? U   A 1293 . ? 1_555 ? 
995  TC7 5  A   A  1293 ? A   A 1294 . ? 1_555 ? 
996  TC7 5  G   A  1294 ? G   A 1295 . ? 1_555 ? 
997  TC7 5  HOH FJ .    ? HOH A 6353 . ? 1_555 ? 
998  TC8 7  C   A  761  ? C   A 762  . ? 1_555 ? 
999  TC8 7  G   A  901  ? G   A 902  . ? 1_555 ? 
1000 TC8 7  U   A  902  ? U   A 903  . ? 1_555 ? 
1001 TC8 7  HOH FJ .    ? HOH A 3201 . ? 1_555 ? 
1002 TC8 7  HIS M  18   ? HIS M 18   . ? 1_555 ? 
1003 TC8 7  HOH RJ .    ? HOH M 8536 . ? 1_555 ? 
1004 TC8 7  HOH RJ .    ? HOH M 8557 . ? 1_555 ? 
1005 TC9 5  U   A  830  ? U   A 831  . ? 1_555 ? 
1006 TC9 5  U   A  831  ? U   A 832  . ? 1_555 ? 
1007 TC9 5  G   A  832  ? G   A 833  . ? 1_555 ? 
1008 TC9 5  HOH FJ .    ? HOH A 3704 . ? 1_555 ? 
1009 TC9 5  HOH FJ .    ? HOH A 4416 . ? 1_555 ? 
1010 UC1 7  G   A  2584 ? G   A 2585 . ? 1_555 ? 
1011 UC1 7  U   A  2585 ? U   A 2586 . ? 1_555 ? 
1012 UC1 7  U   A  2586 ? U   A 2587 . ? 1_555 ? 
1013 UC1 7  G   A  2591 ? G   A 2592 . ? 1_555 ? 
1014 UC1 7  HOH FJ .    ? HOH A 3681 . ? 1_555 ? 
1015 UC1 7  HOH FJ .    ? HOH A 7084 . ? 1_555 ? 
1016 UC1 7  HOH FJ .    ? HOH A 9330 . ? 1_555 ? 
1017 UC2 3  G   A  2771 ? G   A 2772 . ? 1_555 ? 
1018 UC2 3  G   A  2772 ? G   A 2773 . ? 1_555 ? 
1019 UC2 3  HOH FJ .    ? HOH A 4361 . ? 1_555 ? 
1020 UC3 2  C   A  196  ? C   A 197  . ? 1_555 ? 
1021 UC3 2  HOH FJ .    ? HOH A 5018 . ? 1_555 ? 
1022 UC4 3  G   A  1076 ? G   A 1077 . ? 1_555 ? 
1023 UC4 3  A   A  1078 ? A   A 1079 . ? 1_555 ? 
1024 UC4 3  HOH FJ .    ? HOH A 7698 . ? 1_555 ? 
1025 UC5 2  G   A  1451 ? G   A 1452 . ? 1_555 ? 
1026 UC5 2  G   A  1675 ? G   A 1676 . ? 1_555 ? 
1027 UC6 3  C   A  196  ? C   A 197  . ? 1_555 ? 
1028 UC6 3  G   A  200  ? G   A 201  . ? 1_555 ? 
1029 UC6 3  HOH FJ .    ? HOH A 4906 . ? 1_555 ? 
1030 UC7 5  G   A  2581 ? G   A 2582 . ? 1_555 ? 
1031 UC7 5  A   A  2595 ? A   A 2596 . ? 1_555 ? 
1032 UC7 5  HOH FJ .    ? HOH A 5099 . ? 1_555 ? 
1033 UC7 5  LYS L  14   ? LYS L 14   . ? 1_555 ? 
1034 UC7 5  SER L  33   ? SER L 33   . ? 1_555 ? 
1035 UC8 4  G   A  1299 ? G   A 1300 . ? 1_555 ? 
1036 UC8 4  A   A  1327 ? A   A 1328 . ? 1_555 ? 
1037 UC8 4  A   A  1328 ? A   A 1329 . ? 1_555 ? 
1038 UC8 4  HOH FJ .    ? HOH A 4657 . ? 1_555 ? 
1039 UC9 3  G   A  643  ? G   A 644  . ? 1_555 ? 
1040 UC9 3  HOH FJ .    ? HOH A 7734 . ? 1_555 ? 
1041 UC9 3  HIS M  13   ? HIS M 13   . ? 1_555 ? 
1042 VC1 2  A   A  1597 ? A   A 1598 . ? 1_555 ? 
1043 VC1 2  G   A  1645 ? G   A 1646 . ? 1_555 ? 
1044 VC2 3  C   A  593  ? C   A 594  . ? 1_555 ? 
1045 VC2 3  U   A  594  ? U   A 595  . ? 1_555 ? 
1046 VC2 3  ARG Z  115  ? ARG Z 115  . ? 1_555 ? 
1047 VC3 3  G   A  1071 ? G   A 1072 . ? 1_555 ? 
1048 VC3 3  G   A  1086 ? G   A 1087 . ? 1_555 ? 
1049 VC3 3  A   A  1290 ? A   A 1291 . ? 1_555 ? 
1050 VC4 3  G   A  2101 ? G   A 2102 . ? 1_555 ? 
1051 VC4 3  G   A  2481 ? G   A 2482 . ? 1_555 ? 
1052 VC4 3  C   A  2535 ? C   A 2536 . ? 1_555 ? 
1053 VC5 7  C   A  161  ? C   A 162  . ? 1_555 ? 
1054 VC5 7  U   A  162  ? U   A 163  . ? 1_555 ? 
1055 VC5 7  U   A  171  ? U   A 172  . ? 1_555 ? 
1056 VC5 7  HOH FJ .    ? HOH A 7833 . ? 1_555 ? 
1057 VC5 7  HOH FJ .    ? HOH A 9014 . ? 1_555 ? 
1058 VC5 7  HOH FJ .    ? HOH A 9116 . ? 1_555 ? 
1059 VC5 7  ARG N  82   ? ARG N 82   . ? 1_555 ? 
1060 VC6 1  HOH FJ .    ? HOH A 5695 . ? 1_555 ? 
1061 VC7 5  G   B  21   ? G   B 3021 . ? 1_555 ? 
1062 VC7 5  U   B  55   ? U   B 3055 . ? 1_555 ? 
1063 VC7 5  A   B  56   ? A   B 3056 . ? 1_555 ? 
1064 VC7 5  A   B  57   ? A   B 3057 . ? 1_555 ? 
1065 VC7 5  HOH GJ .    ? HOH B 7361 . ? 1_555 ? 
1066 VC8 1  C   B  40   ? C   B 3040 . ? 1_555 ? 
1067 VC9 6  G   B  21   ? G   B 3021 . ? 1_555 ? 
1068 VC9 6  G   B  22   ? G   B 3022 . ? 1_555 ? 
1069 VC9 6  U   B  55   ? U   B 3055 . ? 1_555 ? 
1070 VC9 6  A   B  57   ? A   B 3057 . ? 1_555 ? 
1071 VC9 6  G   B  58   ? G   B 3058 . ? 1_555 ? 
1072 VC9 6  HOH GJ .    ? HOH B 7361 . ? 1_555 ? 
1073 WC1 8  HOH FJ .    ? HOH A 3961 . ? 1_555 ? 
1074 WC1 8  HOH FJ .    ? HOH A 9912 . ? 1_555 ? 
1075 WC1 8  ARG C  182  ? ARG C 182  . ? 1_555 ? 
1076 WC1 8  THR C  184  ? THR C 184  . ? 1_555 ? 
1077 WC1 8  HOH HJ .    ? HOH C 8522 . ? 1_555 ? 
1078 WC1 8  HOH HJ .    ? HOH C 8552 . ? 1_555 ? 
1079 WC1 8  HOH HJ .    ? HOH C 8604 . ? 1_555 ? 
1080 WC1 8  HOH HJ .    ? HOH C 8633 . ? 1_555 ? 
1081 WC2 7  A   A  2632 ? A   A 2633 . ? 1_555 ? 
1082 WC2 7  HOH FJ .    ? HOH A 5952 . ? 1_555 ? 
1083 WC2 7  PHE C  201  ? PHE C 201  . ? 1_555 ? 
1084 WC2 7  GLY C  202  ? GLY C 202  . ? 1_555 ? 
1085 WC2 7  GLY C  203  ? GLY C 203  . ? 1_555 ? 
1086 WC2 7  HIS C  208  ? HIS C 208  . ? 1_555 ? 
1087 WC2 7  HOH HJ .    ? HOH C 8558 . ? 1_555 ? 
1088 WC3 1  LYS C  178  ? LYS C 178  . ? 1_555 ? 
1089 WC4 6  HOH FJ .    ? HOH A 3749 . ? 1_555 ? 
1090 WC4 6  HOH FJ .    ? HOH A 7729 . ? 1_555 ? 
1091 WC4 6  HOH IJ .    ? HOH D 8552 . ? 1_555 ? 
1092 WC4 6  HOH IJ .    ? HOH D 8625 . ? 1_555 ? 
1093 WC4 6  HOH IJ .    ? HOH D 8663 . ? 1_555 ? 
1094 WC4 6  HOH IJ .    ? HOH D 8664 . ? 1_555 ? 
1095 WC5 5  HOH FJ .    ? HOH A 9577 . ? 1_555 ? 
1096 WC5 5  HOH FJ .    ? HOH A 9639 . ? 1_555 ? 
1097 WC5 5  ARG D  223  ? ARG D 223  . ? 1_555 ? 
1098 WC5 5  LYS D  224  ? LYS D 224  . ? 1_555 ? 
1099 WC5 5  HIS D  227  ? HIS D 227  . ? 1_555 ? 
1100 WC6 4  ASP E  45   ? ASP E 45   . ? 1_555 ? 
1101 WC6 4  THR E  94   ? THR E 94   . ? 1_555 ? 
1102 WC6 4  GLU E  95   ? GLU E 95   . ? 1_555 ? 
1103 WC6 4  LYS E  96   ? LYS E 96   . ? 1_555 ? 
1104 WC7 6  A   A  1132 ? A   A 1133 . ? 1_555 ? 
1105 WC7 6  G   A  1133 ? G   A 1134 . ? 1_555 ? 
1106 WC7 6  LYS J  150  ? LYS J 150  . ? 1_555 ? 
1107 WC7 6  VAL J  153  ? VAL J 153  . ? 1_555 ? 
1108 WC7 6  THR J  154  ? THR J 154  . ? 1_555 ? 
1109 WC7 6  PRO J  155  ? PRO J 155  . ? 1_555 ? 
1110 WC8 3  C   A  2286 ? C   A 2287 . ? 1_555 ? 
1111 WC8 3  ASP J  109  ? ASP J 109  . ? 1_555 ? 
1112 WC8 3  ARG J  112  ? ARG J 112  . ? 1_555 ? 
1113 WC9 6  HOH FJ .    ? HOH A 5761 . ? 1_555 ? 
1114 WC9 6  HOH FJ .    ? HOH A 9481 . ? 1_555 ? 
1115 WC9 6  ARG K  60   ? ARG K 60   . ? 1_555 ? 
1116 WC9 6  VAL K  61   ? VAL K 61   . ? 1_555 ? 
1117 WC9 6  ILE K  63   ? ILE K 63   . ? 1_555 ? 
1118 WC9 6  TYR K  69   ? TYR K 69   . ? 1_555 ? 
1119 XC1 5  ASN K  126  ? ASN K 126  . ? 1_555 ? 
1120 XC1 5  ILE K  127  ? ILE K 127  . ? 1_555 ? 
1121 XC1 5  LYS K  128  ? LYS K 128  . ? 1_555 ? 
1122 XC1 5  HOH PJ .    ? HOH K 8547 . ? 1_555 ? 
1123 XC1 5  HOH PJ .    ? HOH K 8548 . ? 1_555 ? 
1124 XC2 3  PRO K  88   ? PRO K 88   . ? 1_555 ? 
1125 XC2 3  HIS K  89   ? HIS K 89   . ? 1_555 ? 
1126 XC2 3  LYS K  90   ? LYS K 90   . ? 1_555 ? 
1127 XC3 2  G   A  1118 ? G   A 1119 . ? 1_555 ? 
1128 XC3 2  LYS K  56   ? LYS K 56   . ? 1_555 ? 
1129 XC4 1  ASN K  65   ? ASN K 65   . ? 1_555 ? 
1130 XC5 6  HOH FJ .    ? HOH A 4233 . ? 1_555 ? 
1131 XC5 6  HOH FJ .    ? HOH A 6049 . ? 1_555 ? 
1132 XC5 6  ASN L  42   ? ASN L 42   . ? 1_555 ? 
1133 XC5 6  HOH QJ .    ? HOH L 1797 . ? 1_555 ? 
1134 XC5 6  HOH QJ .    ? HOH L 2121 . ? 1_555 ? 
1135 XC5 6  HOH QJ .    ? HOH L 7871 . ? 1_555 ? 
1136 XC6 7  ARG M  27   ? ARG M 27   . ? 1_555 ? 
1137 XC6 7  GLY M  28   ? GLY M 28   . ? 1_555 ? 
1138 XC6 7  GLY M  29   ? GLY M 29   . ? 1_555 ? 
1139 XC6 7  GLY M  31   ? GLY M 31   . ? 1_555 ? 
1140 XC6 7  ALA M  33   ? ALA M 33   . ? 1_555 ? 
1141 XC6 7  GLU M  39   ? GLU M 39   . ? 1_555 ? 
1142 XC6 7  HOH RJ .    ? HOH M 8593 . ? 1_555 ? 
1143 XC7 2  A   A  692  ? A   A 693  . ? 1_555 ? 
1144 XC7 2  ARG M  53   ? ARG M 53   . ? 1_555 ? 
1145 XC8 5  ASN N  106  ? ASN N 106  . ? 1_555 ? 
1146 XC8 5  PHE N  109  ? PHE N 109  . ? 1_555 ? 
1147 XC8 5  PRO N  110  ? PRO N 110  . ? 1_555 ? 
1148 XC8 5  LEU N  112  ? LEU N 112  . ? 1_555 ? 
1149 XC8 5  HOH SJ .    ? HOH N 8628 . ? 1_555 ? 
1150 XC9 5  ASN N  106  ? ASN N 106  . ? 1_555 ? 
1151 XC9 5  VAL N  114  ? VAL N 114  . ? 1_555 ? 
1152 XC9 5  LEU N  157  ? LEU N 157  . ? 1_555 ? 
1153 XC9 5  ARG N  158  ? ARG N 158  . ? 1_555 ? 
1154 XC9 5  THR N  159  ? THR N 159  . ? 1_555 ? 
1155 YC1 4  LYS F  146  ? LYS F 146  . ? 1_555 ? 
1156 YC1 4  ARG O  37   ? ARG O 37   . ? 1_555 ? 
1157 YC1 4  LYS O  38   ? LYS O 38   . ? 1_555 ? 
1158 YC1 4  ASN O  107  ? ASN O 107  . ? 1_555 ? 
1159 YC2 2  HIS P  40   ? HIS P 40   . ? 1_555 ? 
1160 YC2 2  HOH UJ .    ? HOH P 5650 . ? 1_555 ? 
1161 YC3 2  HOH FJ .    ? HOH A 7038 . ? 1_555 ? 
1162 YC3 2  ASN P  44   ? ASN P 44   . ? 1_555 ? 
1163 YC4 5  ASP R  20   ? ASP R 20   . ? 1_555 ? 
1164 YC4 5  GLY R  22   ? GLY R 22   . ? 1_555 ? 
1165 YC4 5  SER R  24   ? SER R 24   . ? 1_555 ? 
1166 YC4 5  SER R  46   ? SER R 46   . ? 1_555 ? 
1167 YC4 5  HOH WJ .    ? HOH R 1795 . ? 1_555 ? 
1168 YC5 3  C   A  2387 ? C   A 2388 . ? 1_555 ? 
1169 YC5 3  HIS R  53   ? HIS R 53   . ? 1_555 ? 
1170 YC5 3  PHE R  56   ? PHE R 56   . ? 1_555 ? 
1171 YC6 6  HOH FJ .    ? HOH A 5920 . ? 1_555 ? 
1172 YC6 6  NA  SF .    ? NA  A 8338 . ? 1_555 ? 
1173 YC6 6  SER S  70   ? SER S 70   . ? 1_555 ? 
1174 YC6 6  VAL S  72   ? VAL S 72   . ? 1_555 ? 
1175 YC6 6  HOH XJ .    ? HOH S 8525 . ? 1_555 ? 
1176 YC6 6  HOH XJ .    ? HOH S 8527 . ? 1_555 ? 
1177 YC7 3  LYS S  60   ? LYS S 60   . ? 1_555 ? 
1178 YC7 3  GLN S  61   ? GLN S 61   . ? 1_555 ? 
1179 YC7 3  ASN S  63   ? ASN S 63   . ? 1_555 ? 
1180 YC8 1  LYS S  118  ? LYS S 118  . ? 1_555 ? 
1181 YC9 2  HIS T  7    ? HIS T 7    . ? 1_555 ? 
1182 YC9 2  GLU T  61   ? GLU T 61   . ? 1_555 ? 
1183 ZC1 6  GLN U  37   ? GLN U 37   . ? 1_555 ? 
1184 ZC1 6  ARG U  111  ? ARG U 111  . ? 1_555 ? 
1185 ZC1 6  LEU U  112  ? LEU U 112  . ? 1_555 ? 
1186 ZC1 6  SER U  114  ? SER U 114  . ? 1_555 ? 
1187 ZC1 6  ASP U  117  ? ASP U 117  . ? 1_555 ? 
1188 ZC1 6  HOH ZJ .    ? HOH U 2868 . ? 1_555 ? 
1189 ZC2 3  CYS V  6    ? CYS V 6    . ? 1_555 ? 
1190 ZC2 3  CYS V  9    ? CYS V 9    . ? 1_555 ? 
1191 ZC2 3  CYS V  36   ? CYS V 36   . ? 1_555 ? 
1192 ZC3 7  HIS Z  133  ? HIS Z 133  . ? 1_555 ? 
1193 ZC3 7  LYS Z  136  ? LYS Z 136  . ? 1_555 ? 
1194 ZC3 7  LYS Z  137  ? LYS Z 137  . ? 1_555 ? 
1195 ZC3 7  VAL Z  139  ? VAL Z 139  . ? 1_555 ? 
1196 ZC3 7  HOH EK .    ? HOH Z 8562 . ? 1_555 ? 
1197 ZC3 7  HOH EK .    ? HOH Z 8582 . ? 1_555 ? 
1198 ZC3 7  HOH EK .    ? HOH Z 8616 . ? 1_555 ? 
1199 ZC4 2  G   A  1268 ? G   A 1269 . ? 1_555 ? 
1200 ZC4 2  ARG Z  169  ? ARG Z 169  . ? 1_555 ? 
1201 ZC5 4  ARG AA 4    ? ARG 1 13   . ? 1_555 ? 
1202 ZC5 4  PHE AA 5    ? PHE 1 14   . ? 1_555 ? 
1203 ZC5 4  LYS C  171  ? LYS C 171  . ? 1_555 ? 
1204 ZC5 4  ASN C  174  ? ASN C 174  . ? 1_555 ? 
1205 ZC6 3  CYS AA 30   ? CYS 1 39   . ? 1_555 ? 
1206 ZC6 3  CYS AA 33   ? CYS 1 42   . ? 1_555 ? 
1207 ZC6 3  CYS AA 51   ? CYS 1 60   . ? 1_555 ? 
1208 ZC7 4  CYS BA 19   ? CYS 2 19   . ? 1_555 ? 
1209 ZC7 4  CYS BA 22   ? CYS 2 22   . ? 1_555 ? 
1210 ZC7 4  CYS BA 34   ? CYS 2 34   . ? 1_555 ? 
1211 ZC7 4  CYS BA 37   ? CYS 2 37   . ? 1_555 ? 
1212 ZC8 6  GLY DA 45   ? GLY 4 45   . ? 1_555 ? 
1213 ZC8 6  GLY DA 47   ? GLY 4 47   . ? 1_555 ? 
1214 ZC8 6  ASP DA 49   ? ASP 4 49   . ? 1_555 ? 
1215 ZC8 6  HOH IK .    ? HOH 4 8575 . ? 1_555 ? 
1216 ZC8 6  HOH IK .    ? HOH 4 8576 . ? 1_555 ? 
1217 ZC8 6  HOH FJ .    ? HOH A 3949 . ? 1_555 ? 
1218 ZC9 5  CYS DA 11   ? CYS 4 11   . ? 1_555 ? 
1219 ZC9 5  CYS DA 14   ? CYS 4 14   . ? 1_555 ? 
1220 ZC9 5  CYS DA 71   ? CYS 4 71   . ? 1_555 ? 
1221 ZC9 5  CYS DA 74   ? CYS 4 74   . ? 1_555 ? 
1222 ZC9 5  HOH IK .    ? HOH 4 8563 . ? 1_555 ? 
1223 AD1 1  ASP DA 66   ? ASP 4 66   . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1K9M 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1K9M 
_atom_sites.fract_transf_matrix[1][1]   0.004697 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.003328 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.001739 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CD 
CL 
K  
MG 
N  
NA 
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     O  "O5'" . U   A  1  9    ? 16.130  148.904 104.825 1.00 86.63  ? 10   U   A "O5'" 1 
ATOM   2     C  "C5'" . U   A  1  9    ? 17.155  149.861 104.530 1.00 86.43  ? 10   U   A "C5'" 1 
ATOM   3     C  "C4'" . U   A  1  9    ? 18.606  149.416 104.666 1.00 85.85  ? 10   U   A "C4'" 1 
ATOM   4     O  "O4'" . U   A  1  9    ? 18.820  148.778 105.953 1.00 87.07  ? 10   U   A "O4'" 1 
ATOM   5     C  "C3'" . U   A  1  9    ? 19.166  148.372 103.699 1.00 83.57  ? 10   U   A "C3'" 1 
ATOM   6     O  "O3'" . U   A  1  9    ? 19.379  148.954 102.391 1.00 77.22  ? 10   U   A "O3'" 1 
ATOM   7     C  "C2'" . U   A  1  9    ? 20.445  147.940 104.422 1.00 85.07  ? 10   U   A "C2'" 1 
ATOM   8     O  "O2'" . U   A  1  9    ? 21.489  148.866 104.236 1.00 85.98  ? 10   U   A "O2'" 1 
ATOM   9     C  "C1'" . U   A  1  9    ? 20.031  148.041 105.896 1.00 86.75  ? 10   U   A "C1'" 1 
ATOM   10    N  N1    . U   A  1  9    ? 19.910  146.799 106.689 1.00 87.92  ? 10   U   A N1    1 
ATOM   11    C  C2    . U   A  1  9    ? 19.702  146.930 108.064 1.00 89.37  ? 10   U   A C2    1 
ATOM   12    O  O2    . U   A  1  9    ? 19.580  148.010 108.628 1.00 91.96  ? 10   U   A O2    1 
ATOM   13    N  N3    . U   A  1  9    ? 19.637  145.750 108.760 1.00 88.81  ? 10   U   A N3    1 
ATOM   14    C  C4    . U   A  1  9    ? 19.737  144.480 108.253 1.00 88.23  ? 10   U   A C4    1 
ATOM   15    O  O4    . U   A  1  9    ? 19.582  143.525 109.012 1.00 88.17  ? 10   U   A O4    1 
ATOM   16    C  C5    . U   A  1  9    ? 19.941  144.413 106.833 1.00 87.59  ? 10   U   A C5    1 
ATOM   17    C  C6    . U   A  1  9    ? 20.015  145.545 106.118 1.00 87.46  ? 10   U   A C6    1 
ATOM   18    P  P     . A   A  1  10   ? 20.611  148.480 101.449 1.00 70.93  ? 11   A   A P     1 
ATOM   19    O  OP1   . A   A  1  10   ? 20.237  148.768 100.045 1.00 71.64  ? 11   A   A OP1   1 
ATOM   20    O  OP2   . A   A  1  10   ? 21.083  147.123 101.808 1.00 71.07  ? 11   A   A OP2   1 
ATOM   21    O  "O5'" . A   A  1  10   ? 21.752  149.517 101.822 1.00 67.66  ? 11   A   A "O5'" 1 
ATOM   22    C  "C5'" . A   A  1  10   ? 23.092  149.309 101.395 1.00 61.92  ? 11   A   A "C5'" 1 
ATOM   23    C  "C4'" . A   A  1  10   ? 24.038  150.096 102.267 1.00 57.96  ? 11   A   A "C4'" 1 
ATOM   24    O  "O4'" . A   A  1  10   ? 23.836  149.749 103.662 1.00 56.11  ? 11   A   A "O4'" 1 
ATOM   25    C  "C3'" . A   A  1  10   ? 25.488  149.777 101.994 1.00 56.46  ? 11   A   A "C3'" 1 
ATOM   26    O  "O3'" . A   A  1  10   ? 25.927  150.534 100.880 1.00 55.34  ? 11   A   A "O3'" 1 
ATOM   27    C  "C2'" . A   A  1  10   ? 26.152  150.072 103.331 1.00 55.41  ? 11   A   A "C2'" 1 
ATOM   28    O  "O2'" . A   A  1  10   ? 26.313  151.456 103.570 1.00 55.13  ? 11   A   A "O2'" 1 
ATOM   29    C  "C1'" . A   A  1  10   ? 25.088  149.545 104.298 1.00 54.46  ? 11   A   A "C1'" 1 
ATOM   30    N  N9    . A   A  1  10   ? 25.183  148.117 104.619 1.00 53.32  ? 11   A   A N9    1 
ATOM   31    C  C8    . A   A  1  10   ? 24.159  147.204 104.537 1.00 52.57  ? 11   A   A C8    1 
ATOM   32    N  N7    . A   A  1  10   ? 24.497  145.989 104.882 1.00 51.81  ? 11   A   A N7    1 
ATOM   33    C  C5    . A   A  1  10   ? 25.837  146.101 105.216 1.00 51.94  ? 11   A   A C5    1 
ATOM   34    C  C6    . A   A  1  10   ? 26.771  145.164 105.664 1.00 51.83  ? 11   A   A C6    1 
ATOM   35    N  N6    . A   A  1  10   ? 26.490  143.873 105.851 1.00 52.34  ? 11   A   A N6    1 
ATOM   36    N  N1    . A   A  1  10   ? 28.023  145.599 105.914 1.00 52.36  ? 11   A   A N1    1 
ATOM   37    C  C2    . A   A  1  10   ? 28.306  146.896 105.719 1.00 52.67  ? 11   A   A C2    1 
ATOM   38    N  N3    . A   A  1  10   ? 27.512  147.877 105.300 1.00 52.77  ? 11   A   A N3    1 
ATOM   39    C  C4    . A   A  1  10   ? 26.275  147.408 105.061 1.00 52.73  ? 11   A   A C4    1 
ATOM   40    P  P     . U   A  1  11   ? 26.121  149.805 99.460  1.00 57.46  ? 12   U   A P     1 
ATOM   41    O  OP1   . U   A  1  11   ? 26.524  150.871 98.492  1.00 56.87  ? 12   U   A OP1   1 
ATOM   42    O  OP2   . U   A  1  11   ? 24.946  148.928 99.155  1.00 56.00  ? 12   U   A OP2   1 
ATOM   43    O  "O5'" . U   A  1  11   ? 27.385  148.866 99.711  1.00 54.92  ? 12   U   A "O5'" 1 
ATOM   44    C  "C5'" . U   A  1  11   ? 28.670  149.444 100.018 1.00 51.52  ? 12   U   A "C5'" 1 
ATOM   45    C  "C4'" . U   A  1  11   ? 29.603  148.411 100.597 1.00 49.57  ? 12   U   A "C4'" 1 
ATOM   46    O  "O4'" . U   A  1  11   ? 29.125  147.950 101.888 1.00 49.60  ? 12   U   A "O4'" 1 
ATOM   47    C  "C3'" . U   A  1  11   ? 29.754  147.133 99.800  1.00 48.93  ? 12   U   A "C3'" 1 
ATOM   48    O  "O3'" . U   A  1  11   ? 30.593  147.256 98.675  1.00 47.38  ? 12   U   A "O3'" 1 
ATOM   49    C  "C2'" . U   A  1  11   ? 30.302  146.170 100.841 1.00 49.60  ? 12   U   A "C2'" 1 
ATOM   50    O  "O2'" . U   A  1  11   ? 31.690  146.298 101.117 1.00 50.31  ? 12   U   A "O2'" 1 
ATOM   51    C  "C1'" . U   A  1  11   ? 29.477  146.578 102.061 1.00 49.18  ? 12   U   A "C1'" 1 
ATOM   52    N  N1    . U   A  1  11   ? 28.245  145.777 102.138 1.00 48.46  ? 12   U   A N1    1 
ATOM   53    C  C2    . U   A  1  11   ? 28.355  144.458 102.565 1.00 48.91  ? 12   U   A C2    1 
ATOM   54    O  O2    . U   A  1  11   ? 29.428  143.935 102.853 1.00 49.87  ? 12   U   A O2    1 
ATOM   55    N  N3    . U   A  1  11   ? 27.169  143.768 102.633 1.00 48.12  ? 12   U   A N3    1 
ATOM   56    C  C4    . U   A  1  11   ? 25.919  144.244 102.310 1.00 47.63  ? 12   U   A C4    1 
ATOM   57    O  O4    . U   A  1  11   ? 24.943  143.509 102.423 1.00 47.61  ? 12   U   A O4    1 
ATOM   58    C  C5    . U   A  1  11   ? 25.894  145.604 101.866 1.00 47.74  ? 12   U   A C5    1 
ATOM   59    C  C6    . U   A  1  11   ? 27.025  146.305 101.801 1.00 47.32  ? 12   U   A C6    1 
ATOM   60    P  P     . G   A  1  12   ? 30.075  146.729 97.257  1.00 46.87  ? 13   G   A P     1 
ATOM   61    O  OP1   . G   A  1  12   ? 31.290  146.516 96.450  1.00 46.68  ? 13   G   A OP1   1 
ATOM   62    O  OP2   . G   A  1  12   ? 29.027  147.664 96.787  1.00 47.91  ? 13   G   A OP2   1 
ATOM   63    O  "O5'" . G   A  1  12   ? 29.404  145.313 97.569  1.00 44.16  ? 13   G   A "O5'" 1 
ATOM   64    C  "C5'" . G   A  1  12   ? 30.207  144.216 98.021  1.00 41.28  ? 13   G   A "C5'" 1 
ATOM   65    C  "C4'" . G   A  1  12   ? 29.360  143.008 98.388  1.00 40.40  ? 13   G   A "C4'" 1 
ATOM   66    O  "O4'" . G   A  1  12   ? 28.245  143.408 99.211  1.00 39.45  ? 13   G   A "O4'" 1 
ATOM   67    C  "C3'" . G   A  1  12   ? 28.631  142.236 97.303  1.00 39.29  ? 13   G   A "C3'" 1 
ATOM   68    O  "O3'" . G   A  1  12   ? 29.496  141.395 96.551  1.00 40.31  ? 13   G   A "O3'" 1 
ATOM   69    C  "C2'" . G   A  1  12   ? 27.696  141.372 98.140  1.00 38.74  ? 13   G   A "C2'" 1 
ATOM   70    O  "O2'" . G   A  1  12   ? 28.344  140.246 98.704  1.00 40.18  ? 13   G   A "O2'" 1 
ATOM   71    C  "C1'" . G   A  1  12   ? 27.328  142.331 99.268  1.00 37.90  ? 13   G   A "C1'" 1 
ATOM   72    N  N9    . G   A  1  12   ? 25.970  142.829 99.119  1.00 37.98  ? 13   G   A N9    1 
ATOM   73    C  C8    . G   A  1  12   ? 25.572  144.110 98.819  1.00 38.76  ? 13   G   A C8    1 
ATOM   74    N  N7    . G   A  1  12   ? 24.279  144.239 98.747  1.00 39.28  ? 13   G   A N7    1 
ATOM   75    C  C5    . G   A  1  12   ? 23.796  142.961 99.009  1.00 38.26  ? 13   G   A C5    1 
ATOM   76    C  C6    . G   A  1  12   ? 22.474  142.478 99.069  1.00 37.70  ? 13   G   A C6    1 
ATOM   77    O  O6    . G   A  1  12   ? 21.427  143.097 98.895  1.00 37.50  ? 13   G   A O6    1 
ATOM   78    N  N1    . G   A  1  12   ? 22.439  141.124 99.369  1.00 36.98  ? 13   G   A N1    1 
ATOM   79    C  C2    . G   A  1  12   ? 23.539  140.334 99.579  1.00 36.67  ? 13   G   A C2    1 
ATOM   80    N  N2    . G   A  1  12   ? 23.303  139.032 99.836  1.00 39.60  ? 13   G   A N2    1 
ATOM   81    N  N3    . G   A  1  12   ? 24.774  140.774 99.534  1.00 36.57  ? 13   G   A N3    1 
ATOM   82    C  C4    . G   A  1  12   ? 24.829  142.086 99.246  1.00 37.41  ? 13   G   A C4    1 
ATOM   83    P  P     . C   A  1  13   ? 28.962  140.710 95.200  1.00 39.61  ? 14   C   A P     1 
ATOM   84    O  OP1   . C   A  1  13   ? 30.135  140.157 94.487  1.00 38.47  ? 14   C   A OP1   1 
ATOM   85    O  OP2   . C   A  1  13   ? 28.071  141.672 94.508  1.00 40.28  ? 14   C   A OP2   1 
ATOM   86    O  "O5'" . C   A  1  13   ? 28.099  139.480 95.719  1.00 39.20  ? 14   C   A "O5'" 1 
ATOM   87    C  "C5'" . C   A  1  13   ? 28.749  138.297 96.221  1.00 39.98  ? 14   C   A "C5'" 1 
ATOM   88    C  "C4'" . C   A  1  13   ? 27.751  137.197 96.396  1.00 40.00  ? 14   C   A "C4'" 1 
ATOM   89    O  "O4'" . C   A  1  13   ? 26.771  137.634 97.361  1.00 41.42  ? 14   C   A "O4'" 1 
ATOM   90    C  "C3'" . C   A  1  13   ? 26.938  136.893 95.158  1.00 40.20  ? 14   C   A "C3'" 1 
ATOM   91    O  "O3'" . C   A  1  13   ? 27.668  136.030 94.305  1.00 42.58  ? 14   C   A "O3'" 1 
ATOM   92    C  "C2'" . C   A  1  13   ? 25.684  136.276 95.753  1.00 40.87  ? 14   C   A "C2'" 1 
ATOM   93    O  "O2'" . C   A  1  13   ? 25.867  134.949 96.200  1.00 43.86  ? 14   C   A "O2'" 1 
ATOM   94    C  "C1'" . C   A  1  13   ? 25.490  137.163 96.984  1.00 41.76  ? 14   C   A "C1'" 1 
ATOM   95    N  N1    . C   A  1  13   ? 24.623  138.322 96.704  1.00 42.05  ? 14   C   A N1    1 
ATOM   96    C  C2    . C   A  1  13   ? 23.265  138.088 96.515  1.00 42.12  ? 14   C   A C2    1 
ATOM   97    O  O2    . C   A  1  13   ? 22.840  136.925 96.610  1.00 42.29  ? 14   C   A O2    1 
ATOM   98    N  N3    . C   A  1  13   ? 22.445  139.122 96.228  1.00 41.45  ? 14   C   A N3    1 
ATOM   99    C  C4    . C   A  1  13   ? 22.938  140.353 96.133  1.00 41.12  ? 14   C   A C4    1 
ATOM   100   N  N4    . C   A  1  13   ? 22.088  141.338 95.850  1.00 39.59  ? 14   C   A N4    1 
ATOM   101   C  C5    . C   A  1  13   ? 24.326  140.628 96.327  1.00 41.39  ? 14   C   A C5    1 
ATOM   102   C  C6    . C   A  1  13   ? 25.125  139.594 96.612  1.00 41.49  ? 14   C   A C6    1 
ATOM   103   P  P     . C   A  1  14   ? 27.488  136.131 92.709  1.00 45.35  ? 15   C   A P     1 
ATOM   104   O  OP1   . C   A  1  14   ? 28.523  135.259 92.086  1.00 44.38  ? 15   C   A OP1   1 
ATOM   105   O  OP2   . C   A  1  14   ? 27.364  137.544 92.274  1.00 44.36  ? 15   C   A OP2   1 
ATOM   106   O  "O5'" . C   A  1  14   ? 26.072  135.457 92.481  1.00 47.52  ? 15   C   A "O5'" 1 
ATOM   107   C  "C5'" . C   A  1  14   ? 25.828  134.106 92.894  1.00 49.39  ? 15   C   A "C5'" 1 
ATOM   108   C  "C4'" . C   A  1  14   ? 24.407  133.737 92.594  1.00 50.71  ? 15   C   A "C4'" 1 
ATOM   109   O  "O4'" . C   A  1  14   ? 23.547  134.429 93.526  1.00 50.94  ? 15   C   A "O4'" 1 
ATOM   110   C  "C3'" . C   A  1  14   ? 23.898  134.210 91.243  1.00 52.08  ? 15   C   A "C3'" 1 
ATOM   111   O  "O3'" . C   A  1  14   ? 24.222  133.343 90.180  1.00 54.73  ? 15   C   A "O3'" 1 
ATOM   112   C  "C2'" . C   A  1  14   ? 22.407  134.186 91.464  1.00 52.57  ? 15   C   A "C2'" 1 
ATOM   113   O  "O2'" . C   A  1  14   ? 21.971  132.836 91.451  1.00 53.83  ? 15   C   A "O2'" 1 
ATOM   114   C  "C1'" . C   A  1  14   ? 22.327  134.756 92.878  1.00 51.45  ? 15   C   A "C1'" 1 
ATOM   115   N  N1    . C   A  1  14   ? 22.158  136.225 92.865  1.00 49.47  ? 15   C   A N1    1 
ATOM   116   C  C2    . C   A  1  14   ? 20.865  136.739 92.922  1.00 49.30  ? 15   C   A C2    1 
ATOM   117   O  O2    . C   A  1  14   ? 19.914  135.954 92.923  1.00 50.40  ? 15   C   A O2    1 
ATOM   118   N  N3    . C   A  1  14   ? 20.681  138.078 92.968  1.00 48.49  ? 15   C   A N3    1 
ATOM   119   C  C4    . C   A  1  14   ? 21.735  138.896 92.941  1.00 48.14  ? 15   C   A C4    1 
ATOM   120   N  N4    . C   A  1  14   ? 21.515  140.210 93.007  1.00 48.22  ? 15   C   A N4    1 
ATOM   121   C  C5    . C   A  1  14   ? 23.067  138.402 92.848  1.00 48.53  ? 15   C   A C5    1 
ATOM   122   C  C6    . C   A  1  14   ? 23.232  137.072 92.813  1.00 48.86  ? 15   C   A C6    1 
ATOM   123   P  P     . A   A  1  15   ? 24.318  133.932 88.692  1.00 58.46  ? 16   A   A P     1 
ATOM   124   O  OP1   . A   A  1  15   ? 24.934  132.843 87.888  1.00 59.18  ? 16   A   A OP1   1 
ATOM   125   O  OP2   . A   A  1  15   ? 24.990  135.255 88.777  1.00 57.26  ? 16   A   A OP2   1 
ATOM   126   O  "O5'" . A   A  1  15   ? 22.803  134.192 88.225  1.00 60.22  ? 16   A   A "O5'" 1 
ATOM   127   C  "C5'" . A   A  1  15   ? 21.907  133.090 87.886  1.00 60.71  ? 16   A   A "C5'" 1 
ATOM   128   C  "C4'" . A   A  1  15   ? 20.486  133.583 87.664  1.00 60.30  ? 16   A   A "C4'" 1 
ATOM   129   O  "O4'" . A   A  1  15   ? 20.018  134.264 88.858  1.00 59.71  ? 16   A   A "O4'" 1 
ATOM   130   C  "C3'" . A   A  1  15   ? 20.285  134.617 86.567  1.00 61.09  ? 16   A   A "C3'" 1 
ATOM   131   O  "O3'" . A   A  1  15   ? 20.186  134.042 85.267  1.00 61.99  ? 16   A   A "O3'" 1 
ATOM   132   C  "C2'" . A   A  1  15   ? 18.977  135.279 86.982  1.00 61.07  ? 16   A   A "C2'" 1 
ATOM   133   O  "O2'" . A   A  1  15   ? 17.811  134.558 86.629  1.00 62.16  ? 16   A   A "O2'" 1 
ATOM   134   C  "C1'" . A   A  1  15   ? 19.137  135.321 88.501  1.00 59.49  ? 16   A   A "C1'" 1 
ATOM   135   N  N9    . A   A  1  15   ? 19.738  136.584 88.924  1.00 58.25  ? 16   A   A N9    1 
ATOM   136   C  C8    . A   A  1  15   ? 21.071  136.847 89.099  1.00 58.46  ? 16   A   A C8    1 
ATOM   137   N  N7    . A   A  1  15   ? 21.325  138.088 89.437  1.00 57.84  ? 16   A   A N7    1 
ATOM   138   C  C5    . A   A  1  15   ? 20.072  138.679 89.507  1.00 55.81  ? 16   A   A C5    1 
ATOM   139   C  C6    . A   A  1  15   ? 19.659  139.977 89.829  1.00 54.41  ? 16   A   A C6    1 
ATOM   140   N  N6    . A   A  1  15   ? 20.498  140.957 90.173  1.00 54.27  ? 16   A   A N6    1 
ATOM   141   N  N1    . A   A  1  15   ? 18.337  140.240 89.792  1.00 53.13  ? 16   A   A N1    1 
ATOM   142   C  C2    . A   A  1  15   ? 17.501  139.256 89.464  1.00 53.56  ? 16   A   A C2    1 
ATOM   143   N  N3    . A   A  1  15   ? 17.766  137.993 89.155  1.00 55.33  ? 16   A   A N3    1 
ATOM   144   C  C4    . A   A  1  15   ? 19.086  137.765 89.195  1.00 56.62  ? 16   A   A C4    1 
ATOM   145   P  P     . G   A  1  16   ? 20.552  134.922 83.961  1.00 62.33  ? 17   G   A P     1 
ATOM   146   O  OP1   . G   A  1  16   ? 20.377  134.015 82.790  1.00 61.78  ? 17   G   A OP1   1 
ATOM   147   O  OP2   . G   A  1  16   ? 21.855  135.582 84.182  1.00 64.08  ? 17   G   A OP2   1 
ATOM   148   O  "O5'" . G   A  1  16   ? 19.425  136.047 83.888  1.00 58.36  ? 17   G   A "O5'" 1 
ATOM   149   C  "C5'" . G   A  1  16   ? 18.070  135.684 83.559  1.00 56.55  ? 17   G   A "C5'" 1 
ATOM   150   C  "C4'" . G   A  1  16   ? 17.128  136.840 83.790  1.00 54.79  ? 17   G   A "C4'" 1 
ATOM   151   O  "O4'" . G   A  1  16   ? 17.350  137.403 85.110  1.00 55.04  ? 17   G   A "O4'" 1 
ATOM   152   C  "C3'" . G   A  1  16   ? 17.248  138.057 82.889  1.00 53.65  ? 17   G   A "C3'" 1 
ATOM   153   O  "O3'" . G   A  1  16   ? 16.655  137.819 81.611  1.00 53.22  ? 17   G   A "O3'" 1 
ATOM   154   C  "C2'" . G   A  1  16   ? 16.474  139.100 83.696  1.00 53.01  ? 17   G   A "C2'" 1 
ATOM   155   O  "O2'" . G   A  1  16   ? 15.074  138.946 83.628  1.00 52.86  ? 17   G   A "O2'" 1 
ATOM   156   C  "C1'" . G   A  1  16   ? 16.894  138.752 85.125  1.00 52.86  ? 17   G   A "C1'" 1 
ATOM   157   N  N9    . G   A  1  16   ? 17.932  139.629 85.673  1.00 50.94  ? 17   G   A N9    1 
ATOM   158   C  C8    . G   A  1  16   ? 19.245  139.324 85.968  1.00 50.33  ? 17   G   A C8    1 
ATOM   159   N  N7    . G   A  1  16   ? 19.903  140.337 86.463  1.00 49.37  ? 17   G   A N7    1 
ATOM   160   C  C5    . G   A  1  16   ? 18.974  141.372 86.487  1.00 48.62  ? 17   G   A C5    1 
ATOM   161   C  C6    . G   A  1  16   ? 19.104  142.715 86.922  1.00 47.81  ? 17   G   A C6    1 
ATOM   162   O  O6    . G   A  1  16   ? 20.103  143.293 87.364  1.00 46.27  ? 17   G   A O6    1 
ATOM   163   N  N1    . G   A  1  16   ? 17.909  143.405 86.802  1.00 48.07  ? 17   G   A N1    1 
ATOM   164   C  C2    . G   A  1  16   ? 16.739  142.880 86.320  1.00 48.18  ? 17   G   A C2    1 
ATOM   165   N  N2    . G   A  1  16   ? 15.671  143.697 86.330  1.00 47.77  ? 17   G   A N2    1 
ATOM   166   N  N3    . G   A  1  16   ? 16.615  141.646 85.879  1.00 48.24  ? 17   G   A N3    1 
ATOM   167   C  C4    . G   A  1  16   ? 17.759  140.950 86.002  1.00 48.91  ? 17   G   A C4    1 
ATOM   168   P  P     . C   A  1  17   ? 16.879  138.869 80.407  1.00 52.85  ? 18   C   A P     1 
ATOM   169   O  OP1   . C   A  1  17   ? 16.076  138.403 79.239  1.00 52.25  ? 18   C   A OP1   1 
ATOM   170   O  OP2   . C   A  1  17   ? 18.320  139.088 80.244  1.00 54.83  ? 18   C   A OP2   1 
ATOM   171   O  "O5'" . C   A  1  17   ? 16.287  140.235 80.968  1.00 49.56  ? 18   C   A "O5'" 1 
ATOM   172   C  "C5'" . C   A  1  17   ? 14.895  140.568 80.833  1.00 47.06  ? 18   C   A "C5'" 1 
ATOM   173   C  "C4'" . C   A  1  17   ? 14.681  142.014 81.205  1.00 45.84  ? 18   C   A "C4'" 1 
ATOM   174   O  "O4'" . C   A  1  17   ? 15.201  142.205 82.548  1.00 45.94  ? 18   C   A "O4'" 1 
ATOM   175   C  "C3'" . C   A  1  17   ? 15.445  143.055 80.388  1.00 45.89  ? 18   C   A "C3'" 1 
ATOM   176   O  "O3'" . C   A  1  17   ? 14.811  143.397 79.150  1.00 45.35  ? 18   C   A "O3'" 1 
ATOM   177   C  "C2'" . C   A  1  17   ? 15.459  144.235 81.345  1.00 45.55  ? 18   C   A "C2'" 1 
ATOM   178   O  "O2'" . C   A  1  17   ? 14.207  144.887 81.398  1.00 47.31  ? 18   C   A "O2'" 1 
ATOM   179   C  "C1'" . C   A  1  17   ? 15.704  143.526 82.678  1.00 45.35  ? 18   C   A "C1'" 1 
ATOM   180   N  N1    . C   A  1  17   ? 17.140  143.478 83.046  1.00 44.08  ? 18   C   A N1    1 
ATOM   181   C  C2    . C   A  1  17   ? 17.702  144.615 83.598  1.00 43.86  ? 18   C   A C2    1 
ATOM   182   O  O2    . C   A  1  17   ? 17.000  145.629 83.723  1.00 44.57  ? 18   C   A O2    1 
ATOM   183   N  N3    . C   A  1  17   ? 18.996  144.599 83.977  1.00 42.93  ? 18   C   A N3    1 
ATOM   184   C  C4    . C   A  1  17   ? 19.728  143.503 83.810  1.00 41.51  ? 18   C   A C4    1 
ATOM   185   N  N4    . C   A  1  17   ? 20.989  143.535 84.226  1.00 41.47  ? 18   C   A N4    1 
ATOM   186   C  C5    . C   A  1  17   ? 19.195  142.328 83.220  1.00 41.66  ? 18   C   A C5    1 
ATOM   187   C  C6    . C   A  1  17   ? 17.905  142.355 82.860  1.00 43.66  ? 18   C   A C6    1 
ATOM   188   P  P     . U   A  1  18   ? 15.710  143.782 77.861  1.00 46.37  ? 19   U   A P     1 
ATOM   189   O  OP1   . U   A  1  18   ? 14.829  143.936 76.669  1.00 43.37  ? 19   U   A OP1   1 
ATOM   190   O  OP2   . U   A  1  18   ? 16.859  142.829 77.806  1.00 44.52  ? 19   U   A OP2   1 
ATOM   191   O  "O5'" . U   A  1  18   ? 16.209  145.255 78.190  1.00 44.34  ? 19   U   A "O5'" 1 
ATOM   192   C  "C5'" . U   A  1  18   ? 15.273  146.340 78.139  1.00 43.36  ? 19   U   A "C5'" 1 
ATOM   193   C  "C4'" . U   A  1  18   ? 15.946  147.639 78.484  1.00 43.07  ? 19   U   A "C4'" 1 
ATOM   194   O  "O4'" . U   A  1  18   ? 16.335  147.635 79.880  1.00 44.31  ? 19   U   A "O4'" 1 
ATOM   195   C  "C3'" . U   A  1  18   ? 17.249  147.894 77.760  1.00 42.30  ? 19   U   A "C3'" 1 
ATOM   196   O  "O3'" . U   A  1  18   ? 17.079  148.371 76.450  1.00 41.03  ? 19   U   A "O3'" 1 
ATOM   197   C  "C2'" . U   A  1  18   ? 17.895  148.927 78.653  1.00 43.15  ? 19   U   A "C2'" 1 
ATOM   198   O  "O2'" . U   A  1  18   ? 17.315  150.206 78.477  1.00 43.09  ? 19   U   A "O2'" 1 
ATOM   199   C  "C1'" . U   A  1  18   ? 17.543  148.357 80.026  1.00 43.74  ? 19   U   A "C1'" 1 
ATOM   200   N  N1    . U   A  1  18   ? 18.602  147.429 80.449  1.00 44.72  ? 19   U   A N1    1 
ATOM   201   C  C2    . U   A  1  18   ? 19.719  147.994 81.037  1.00 46.43  ? 19   U   A C2    1 
ATOM   202   O  O2    . U   A  1  18   ? 19.824  149.201 81.250  1.00 48.16  ? 19   U   A O2    1 
ATOM   203   N  N3    . U   A  1  18   ? 20.706  147.108 81.366  1.00 47.04  ? 19   U   A N3    1 
ATOM   204   C  C4    . U   A  1  18   ? 20.697  145.751 81.180  1.00 47.53  ? 19   U   A C4    1 
ATOM   205   O  O4    . U   A  1  18   ? 21.687  145.102 81.513  1.00 47.44  ? 19   U   A O4    1 
ATOM   206   C  C5    . U   A  1  18   ? 19.500  145.231 80.588  1.00 46.68  ? 19   U   A C5    1 
ATOM   207   C  C6    . U   A  1  18   ? 18.515  146.066 80.255  1.00 44.79  ? 19   U   A C6    1 
ATOM   208   P  P     . G   A  1  19   ? 18.192  148.026 75.365  1.00 41.62  ? 20   G   A P     1 
ATOM   209   O  OP1   . G   A  1  19   ? 17.718  148.505 74.048  1.00 42.46  ? 20   G   A OP1   1 
ATOM   210   O  OP2   . G   A  1  19   ? 18.487  146.576 75.560  1.00 41.69  ? 20   G   A OP2   1 
ATOM   211   O  "O5'" . G   A  1  19   ? 19.450  148.905 75.821  1.00 40.37  ? 20   G   A "O5'" 1 
ATOM   212   C  "C5'" . G   A  1  19   ? 19.448  150.341 75.685  1.00 37.25  ? 20   G   A "C5'" 1 
ATOM   213   C  "C4'" . G   A  1  19   ? 20.697  150.949 76.294  1.00 37.58  ? 20   G   A "C4'" 1 
ATOM   214   O  "O4'" . G   A  1  19   ? 20.760  150.537 77.681  1.00 36.96  ? 20   G   A "O4'" 1 
ATOM   215   C  "C3'" . G   A  1  19   ? 22.057  150.537 75.744  1.00 36.50  ? 20   G   A "C3'" 1 
ATOM   216   O  "O3'" . G   A  1  19   ? 22.495  151.235 74.572  1.00 36.90  ? 20   G   A "O3'" 1 
ATOM   217   C  "C2'" . G   A  1  19   ? 22.963  150.863 76.913  1.00 36.37  ? 20   G   A "C2'" 1 
ATOM   218   O  "O2'" . G   A  1  19   ? 23.165  152.254 77.023  1.00 35.04  ? 20   G   A "O2'" 1 
ATOM   219   C  "C1'" . G   A  1  19   ? 22.110  150.383 78.080  1.00 36.60  ? 20   G   A "C1'" 1 
ATOM   220   N  N9    . G   A  1  19   ? 22.354  148.976 78.391  1.00 37.06  ? 20   G   A N9    1 
ATOM   221   C  C8    . G   A  1  19   ? 21.579  147.889 78.051  1.00 36.80  ? 20   G   A C8    1 
ATOM   222   N  N7    . G   A  1  19   ? 22.079  146.753 78.453  1.00 36.48  ? 20   G   A N7    1 
ATOM   223   C  C5    . G   A  1  19   ? 23.258  147.112 79.097  1.00 38.09  ? 20   G   A C5    1 
ATOM   224   C  C6    . G   A  1  19   ? 24.240  146.314 79.740  1.00 38.19  ? 20   G   A C6    1 
ATOM   225   O  O6    . G   A  1  19   ? 24.277  145.079 79.853  1.00 39.83  ? 20   G   A O6    1 
ATOM   226   N  N1    . G   A  1  19   ? 25.261  147.099 80.284  1.00 36.58  ? 20   G   A N1    1 
ATOM   227   C  C2    . G   A  1  19   ? 25.331  148.472 80.209  1.00 35.84  ? 20   G   A C2    1 
ATOM   228   N  N2    . G   A  1  19   ? 26.379  149.060 80.792  1.00 37.16  ? 20   G   A N2    1 
ATOM   229   N  N3    . G   A  1  19   ? 24.434  149.218 79.606  1.00 36.46  ? 20   G   A N3    1 
ATOM   230   C  C4    . G   A  1  19   ? 23.432  148.482 79.077  1.00 37.55  ? 20   G   A C4    1 
ATOM   231   P  P     . G   A  1  20   ? 23.372  150.451 73.457  1.00 37.83  ? 21   G   A P     1 
ATOM   232   O  OP1   . G   A  1  20   ? 23.695  151.381 72.359  1.00 37.49  ? 21   G   A OP1   1 
ATOM   233   O  OP2   . G   A  1  20   ? 22.651  149.206 73.164  1.00 35.34  ? 21   G   A OP2   1 
ATOM   234   O  "O5'" . G   A  1  20   ? 24.765  150.149 74.169  1.00 38.93  ? 21   G   A "O5'" 1 
ATOM   235   C  "C5'" . G   A  1  20   ? 25.601  151.255 74.540  1.00 38.87  ? 21   G   A "C5'" 1 
ATOM   236   C  "C4'" . G   A  1  20   ? 26.687  150.853 75.512  1.00 38.52  ? 21   G   A "C4'" 1 
ATOM   237   O  "O4'" . G   A  1  20   ? 26.193  149.956 76.538  1.00 38.31  ? 21   G   A "O4'" 1 
ATOM   238   C  "C3'" . G   A  1  20   ? 27.871  150.066 74.995  1.00 37.99  ? 21   G   A "C3'" 1 
ATOM   239   O  "O3'" . G   A  1  20   ? 28.766  150.878 74.234  1.00 37.77  ? 21   G   A "O3'" 1 
ATOM   240   C  "C2'" . G   A  1  20   ? 28.526  149.659 76.313  1.00 39.19  ? 21   G   A "C2'" 1 
ATOM   241   O  "O2'" . G   A  1  20   ? 29.255  150.710 76.917  1.00 41.07  ? 21   G   A "O2'" 1 
ATOM   242   C  "C1'" . G   A  1  20   ? 27.309  149.393 77.200  1.00 38.70  ? 21   G   A "C1'" 1 
ATOM   243   N  N9    . G   A  1  20   ? 27.114  147.964 77.396  1.00 39.76  ? 21   G   A N9    1 
ATOM   244   C  C8    . G   A  1  20   ? 26.111  147.166 76.904  1.00 41.69  ? 21   G   A C8    1 
ATOM   245   N  N7    . G   A  1  20   ? 26.240  145.910 77.249  1.00 41.24  ? 21   G   A N7    1 
ATOM   246   C  C5    . G   A  1  20   ? 27.396  145.885 78.019  1.00 40.25  ? 21   G   A C5    1 
ATOM   247   C  C6    . G   A  1  20   ? 28.043  144.809 78.670  1.00 39.55  ? 21   G   A C6    1 
ATOM   248   O  O6    . G   A  1  20   ? 27.699  143.627 78.721  1.00 39.34  ? 21   G   A O6    1 
ATOM   249   N  N1    . G   A  1  20   ? 29.202  145.223 79.317  1.00 38.63  ? 21   G   A N1    1 
ATOM   250   C  C2    . G   A  1  20   ? 29.674  146.507 79.346  1.00 39.09  ? 21   G   A C2    1 
ATOM   251   N  N2    . G   A  1  20   ? 30.825  146.696 80.013  1.00 40.16  ? 21   G   A N2    1 
ATOM   252   N  N3    . G   A  1  20   ? 29.068  147.528 78.763  1.00 39.09  ? 21   G   A N3    1 
ATOM   253   C  C4    . G   A  1  20   ? 27.945  147.145 78.118  1.00 39.80  ? 21   G   A C4    1 
ATOM   254   P  P     . U   A  1  21   ? 29.704  150.193 73.127  1.00 36.96  ? 22   U   A P     1 
ATOM   255   O  OP1   . U   A  1  21   ? 30.524  151.214 72.438  1.00 35.51  ? 22   U   A OP1   1 
ATOM   256   O  OP2   . U   A  1  21   ? 28.826  149.302 72.332  1.00 38.70  ? 22   U   A OP2   1 
ATOM   257   O  "O5'" . U   A  1  21   ? 30.684  149.268 73.974  1.00 37.24  ? 22   U   A "O5'" 1 
ATOM   258   C  "C5'" . U   A  1  21   ? 31.727  149.833 74.799  1.00 37.38  ? 22   U   A "C5'" 1 
ATOM   259   C  "C4'" . U   A  1  21   ? 32.511  148.727 75.463  1.00 37.71  ? 22   U   A "C4'" 1 
ATOM   260   O  "O4'" . U   A  1  21   ? 31.636  147.981 76.338  1.00 37.18  ? 22   U   A "O4'" 1 
ATOM   261   C  "C3'" . U   A  1  21   ? 33.063  147.686 74.504  1.00 38.27  ? 22   U   A "C3'" 1 
ATOM   262   O  "O3'" . U   A  1  21   ? 34.342  148.099 74.035  1.00 38.00  ? 22   U   A "O3'" 1 
ATOM   263   C  "C2'" . U   A  1  21   ? 33.214  146.467 75.390  1.00 38.33  ? 22   U   A "C2'" 1 
ATOM   264   O  "O2'" . U   A  1  21   ? 34.413  146.599 76.129  1.00 39.66  ? 22   U   A "O2'" 1 
ATOM   265   C  "C1'" . U   A  1  21   ? 32.000  146.609 76.314  1.00 38.60  ? 22   U   A "C1'" 1 
ATOM   266   N  N1    . U   A  1  21   ? 30.824  145.814 75.922  1.00 39.22  ? 22   U   A N1    1 
ATOM   267   C  C2    . U   A  1  21   ? 30.789  144.471 76.280  1.00 40.26  ? 22   U   A C2    1 
ATOM   268   O  O2    . U   A  1  21   ? 31.704  143.904 76.849  1.00 39.90  ? 22   U   A O2    1 
ATOM   269   N  N3    . U   A  1  21   ? 29.641  143.810 75.934  1.00 41.05  ? 22   U   A N3    1 
ATOM   270   C  C4    . U   A  1  21   ? 28.549  144.329 75.272  1.00 41.16  ? 22   U   A C4    1 
ATOM   271   O  O4    . U   A  1  21   ? 27.560  143.614 75.073  1.00 40.14  ? 22   U   A O4    1 
ATOM   272   C  C5    . U   A  1  21   ? 28.679  145.707 74.907  1.00 41.72  ? 22   U   A C5    1 
ATOM   273   C  C6    . U   A  1  21   ? 29.781  146.382 75.235  1.00 40.36  ? 22   U   A C6    1 
ATOM   274   P  P     . G   A  1  22   ? 34.861  147.634 72.586  1.00 37.84  ? 23   G   A P     1 
ATOM   275   O  OP1   . G   A  1  22   ? 36.257  148.087 72.437  1.00 39.32  ? 23   G   A OP1   1 
ATOM   276   O  OP2   . G   A  1  22   ? 33.830  148.070 71.603  1.00 39.82  ? 23   G   A OP2   1 
ATOM   277   O  "O5'" . G   A  1  22   ? 34.865  146.044 72.626  1.00 37.41  ? 23   G   A "O5'" 1 
ATOM   278   C  "C5'" . G   A  1  22   ? 35.875  145.291 73.342  1.00 35.82  ? 23   G   A "C5'" 1 
ATOM   279   C  "C4'" . G   A  1  22   ? 35.515  143.829 73.307  1.00 34.48  ? 23   G   A "C4'" 1 
ATOM   280   O  "O4'" . G   A  1  22   ? 34.225  143.639 73.947  1.00 34.27  ? 23   G   A "O4'" 1 
ATOM   281   C  "C3'" . G   A  1  22   ? 35.305  143.339 71.889  1.00 31.42  ? 23   G   A "C3'" 1 
ATOM   282   O  "O3'" . G   A  1  22   ? 36.552  142.986 71.350  1.00 29.80  ? 23   G   A "O3'" 1 
ATOM   283   C  "C2'" . G   A  1  22   ? 34.321  142.191 72.060  1.00 32.09  ? 23   G   A "C2'" 1 
ATOM   284   O  "O2'" . G   A  1  22   ? 34.885  140.981 72.495  1.00 31.41  ? 23   G   A "O2'" 1 
ATOM   285   C  "C1'" . G   A  1  22   ? 33.455  142.719 73.197  1.00 32.93  ? 23   G   A "C1'" 1 
ATOM   286   N  N9    . G   A  1  22   ? 32.277  143.406 72.693  1.00 32.91  ? 23   G   A N9    1 
ATOM   287   C  C8    . G   A  1  22   ? 32.189  144.674 72.169  1.00 34.15  ? 23   G   A C8    1 
ATOM   288   N  N7    . G   A  1  22   ? 30.976  145.003 71.838  1.00 34.91  ? 23   G   A N7    1 
ATOM   289   C  C5    . G   A  1  22   ? 30.227  143.880 72.161  1.00 33.71  ? 23   G   A C5    1 
ATOM   290   C  C6    . G   A  1  22   ? 28.849  143.641 72.051  1.00 33.41  ? 23   G   A C6    1 
ATOM   291   O  O6    . G   A  1  22   ? 27.976  144.405 71.638  1.00 34.06  ? 23   G   A O6    1 
ATOM   292   N  N1    . G   A  1  22   ? 28.515  142.360 72.489  1.00 33.24  ? 23   G   A N1    1 
ATOM   293   C  C2    . G   A  1  22   ? 29.404  141.433 72.970  1.00 32.94  ? 23   G   A C2    1 
ATOM   294   N  N2    . G   A  1  22   ? 28.896  140.248 73.344  1.00 32.37  ? 23   G   A N2    1 
ATOM   295   N  N3    . G   A  1  22   ? 30.688  141.651 73.079  1.00 33.61  ? 23   G   A N3    1 
ATOM   296   C  C4    . G   A  1  22   ? 31.027  142.887 72.667  1.00 33.34  ? 23   G   A C4    1 
ATOM   297   P  P     . G   A  1  23   ? 36.817  143.141 69.785  1.00 30.54  ? 24   G   A P     1 
ATOM   298   O  OP1   . G   A  1  23   ? 38.268  142.971 69.575  1.00 29.48  ? 24   G   A OP1   1 
ATOM   299   O  OP2   . G   A  1  23   ? 36.155  144.391 69.319  1.00 32.66  ? 24   G   A OP2   1 
ATOM   300   O  "O5'" . G   A  1  23   ? 36.075  141.878 69.169  1.00 28.50  ? 24   G   A "O5'" 1 
ATOM   301   C  "C5'" . G   A  1  23   ? 36.268  140.572 69.714  1.00 28.56  ? 24   G   A "C5'" 1 
ATOM   302   C  "C4'" . G   A  1  23   ? 35.201  139.651 69.200  1.00 29.03  ? 24   G   A "C4'" 1 
ATOM   303   O  "O4'" . G   A  1  23   ? 33.912  140.253 69.478  1.00 30.84  ? 24   G   A "O4'" 1 
ATOM   304   C  "C3'" . G   A  1  23   ? 35.242  139.485 67.700  1.00 29.43  ? 24   G   A "C3'" 1 
ATOM   305   O  "O3'" . G   A  1  23   ? 34.614  138.267 67.419  1.00 32.30  ? 24   G   A "O3'" 1 
ATOM   306   C  "C2'" . G   A  1  23   ? 34.378  140.632 67.213  1.00 28.92  ? 24   G   A "C2'" 1 
ATOM   307   O  "O2'" . G   A  1  23   ? 33.841  140.421 65.928  1.00 28.81  ? 24   G   A "O2'" 1 
ATOM   308   C  "C1'" . G   A  1  23   ? 33.283  140.621 68.272  1.00 30.05  ? 24   G   A "C1'" 1 
ATOM   309   N  N9    . G   A  1  23   ? 32.620  141.909 68.456  1.00 30.64  ? 24   G   A N9    1 
ATOM   310   C  C8    . G   A  1  23   ? 33.141  143.160 68.225  1.00 31.79  ? 24   G   A C8    1 
ATOM   311   N  N7    . G   A  1  23   ? 32.255  144.111 68.328  1.00 32.80  ? 24   G   A N7    1 
ATOM   312   C  C5    . G   A  1  23   ? 31.087  143.447 68.680  1.00 31.43  ? 24   G   A C5    1 
ATOM   313   C  C6    . G   A  1  23   ? 29.781  143.938 68.883  1.00 30.45  ? 24   G   A C6    1 
ATOM   314   O  O6    . G   A  1  23   ? 29.364  145.087 68.743  1.00 32.87  ? 24   G   A O6    1 
ATOM   315   N  N1    . G   A  1  23   ? 28.908  142.927 69.265  1.00 28.96  ? 24   G   A N1    1 
ATOM   316   C  C2    . G   A  1  23   ? 29.245  141.610 69.422  1.00 30.37  ? 24   G   A C2    1 
ATOM   317   N  N2    . G   A  1  23   ? 28.267  140.798 69.852  1.00 30.62  ? 24   G   A N2    1 
ATOM   318   N  N3    . G   A  1  23   ? 30.453  141.128 69.187  1.00 31.04  ? 24   G   A N3    1 
ATOM   319   C  C4    . G   A  1  23   ? 31.316  142.096 68.819  1.00 30.90  ? 24   G   A C4    1 
ATOM   320   P  P     . A   A  1  24   ? 34.963  137.498 66.069  1.00 34.18  ? 25   A   A P     1 
ATOM   321   O  OP1   . A   A  1  24   ? 36.433  137.327 66.077  1.00 32.52  ? 25   A   A OP1   1 
ATOM   322   O  OP2   . A   A  1  24   ? 34.311  138.214 64.951  1.00 34.36  ? 25   A   A OP2   1 
ATOM   323   O  "O5'" . A   A  1  24   ? 34.271  136.087 66.288  1.00 30.48  ? 25   A   A "O5'" 1 
ATOM   324   C  "C5'" . A   A  1  24   ? 34.772  135.187 67.285  1.00 27.82  ? 25   A   A "C5'" 1 
ATOM   325   C  "C4'" . A   A  1  24   ? 33.638  134.467 67.939  1.00 28.75  ? 25   A   A "C4'" 1 
ATOM   326   O  "O4'" . A   A  1  24   ? 32.843  135.431 68.671  1.00 29.64  ? 25   A   A "O4'" 1 
ATOM   327   C  "C3'" . A   A  1  24   ? 32.645  133.795 67.010  1.00 29.10  ? 25   A   A "C3'" 1 
ATOM   328   O  "O3'" . A   A  1  24   ? 33.111  132.521 66.509  1.00 30.45  ? 25   A   A "O3'" 1 
ATOM   329   C  "C2'" . A   A  1  24   ? 31.407  133.715 67.900  1.00 29.69  ? 25   A   A "C2'" 1 
ATOM   330   O  "O2'" . A   A  1  24   ? 31.479  132.700 68.869  1.00 30.88  ? 25   A   A "O2'" 1 
ATOM   331   C  "C1'" . A   A  1  24   ? 31.477  135.043 68.653  1.00 30.10  ? 25   A   A "C1'" 1 
ATOM   332   N  N9    . A   A  1  24   ? 30.675  136.124 68.063  1.00 32.41  ? 25   A   A N9    1 
ATOM   333   C  C8    . A   A  1  24   ? 31.144  137.251 67.420  1.00 34.03  ? 25   A   A C8    1 
ATOM   334   N  N7    . A   A  1  24   ? 30.196  138.038 66.975  1.00 34.97  ? 25   A   A N7    1 
ATOM   335   C  C5    . A   A  1  24   ? 29.022  137.394 67.349  1.00 33.65  ? 25   A   A C5    1 
ATOM   336   C  C6    . A   A  1  24   ? 27.676  137.710 67.155  1.00 33.73  ? 25   A   A C6    1 
ATOM   337   N  N6    . A   A  1  24   ? 27.261  138.813 66.518  1.00 30.90  ? 25   A   A N6    1 
ATOM   338   N  N1    . A   A  1  24   ? 26.752  136.845 67.642  1.00 33.88  ? 25   A   A N1    1 
ATOM   339   C  C2    . A   A  1  24   ? 27.166  135.748 68.279  1.00 30.29  ? 25   A   A C2    1 
ATOM   340   N  N3    . A   A  1  24   ? 28.403  135.344 68.525  1.00 31.97  ? 25   A   A N3    1 
ATOM   341   C  C4    . A   A  1  24   ? 29.298  136.219 68.027  1.00 33.01  ? 25   A   A C4    1 
ATOM   342   P  P     . U   A  1  25   ? 32.604  131.978 65.062  1.00 31.09  ? 26   U   A P     1 
ATOM   343   O  OP1   . U   A  1  25   ? 32.902  130.529 64.920  1.00 30.20  ? 26   U   A OP1   1 
ATOM   344   O  OP2   . U   A  1  25   ? 33.081  132.916 64.035  1.00 31.38  ? 26   U   A OP2   1 
ATOM   345   O  "O5'" . U   A  1  25   ? 31.024  132.108 65.139  1.00 30.99  ? 26   U   A "O5'" 1 
ATOM   346   C  "C5'" . U   A  1  25   ? 30.279  131.330 66.101  1.00 31.08  ? 26   U   A "C5'" 1 
ATOM   347   C  "C4'" . U   A  1  25   ? 28.801  131.617 65.992  1.00 32.77  ? 26   U   A "C4'" 1 
ATOM   348   O  "O4'" . U   A  1  25   ? 28.518  132.951 66.464  1.00 32.99  ? 26   U   A "O4'" 1 
ATOM   349   C  "C3'" . U   A  1  25   ? 28.183  131.557 64.604  1.00 32.52  ? 26   U   A "C3'" 1 
ATOM   350   O  "O3'" . U   A  1  25   ? 27.868  130.231 64.222  1.00 32.17  ? 26   U   A "O3'" 1 
ATOM   351   C  "C2'" . U   A  1  25   ? 26.944  132.416 64.770  1.00 33.92  ? 26   U   A "C2'" 1 
ATOM   352   O  "O2'" . U   A  1  25   ? 25.893  131.736 65.435  1.00 34.27  ? 26   U   A "O2'" 1 
ATOM   353   C  "C1'" . U   A  1  25   ? 27.480  133.513 65.685  1.00 34.63  ? 26   U   A "C1'" 1 
ATOM   354   N  N1    . U   A  1  25   ? 28.029  134.689 64.997  1.00 35.54  ? 26   U   A N1    1 
ATOM   355   C  C2    . U   A  1  25   ? 27.161  135.675 64.564  1.00 36.64  ? 26   U   A C2    1 
ATOM   356   O  O2    . U   A  1  25   ? 25.956  135.555 64.566  1.00 37.03  ? 26   U   A O2    1 
ATOM   357   N  N3    . U   A  1  25   ? 27.772  136.812 64.098  1.00 37.48  ? 26   U   A N3    1 
ATOM   358   C  C4    . U   A  1  25   ? 29.124  137.038 63.969  1.00 37.36  ? 26   U   A C4    1 
ATOM   359   O  O4    . U   A  1  25   ? 29.518  138.117 63.513  1.00 38.24  ? 26   U   A O4    1 
ATOM   360   C  C5    . U   A  1  25   ? 29.948  135.937 64.355  1.00 36.51  ? 26   U   A C5    1 
ATOM   361   C  C6    . U   A  1  25   ? 29.389  134.831 64.839  1.00 35.73  ? 26   U   A C6    1 
ATOM   362   P  P     . U   A  1  26   ? 28.201  129.738 62.737  1.00 33.48  ? 27   U   A P     1 
ATOM   363   O  OP1   . U   A  1  26   ? 27.985  128.274 62.741  1.00 31.82  ? 27   U   A OP1   1 
ATOM   364   O  OP2   . U   A  1  26   ? 29.502  130.272 62.315  1.00 35.15  ? 27   U   A OP2   1 
ATOM   365   O  "O5'" . U   A  1  26   ? 27.059  130.411 61.857  1.00 34.61  ? 27   U   A "O5'" 1 
ATOM   366   C  "C5'" . U   A  1  26   ? 25.696  130.023 62.040  1.00 34.07  ? 27   U   A "C5'" 1 
ATOM   367   C  "C4'" . U   A  1  26   ? 24.768  130.953 61.319  1.00 32.14  ? 27   U   A "C4'" 1 
ATOM   368   O  "O4'" . U   A  1  26   ? 24.804  132.261 61.931  1.00 31.66  ? 27   U   A "O4'" 1 
ATOM   369   C  "C3'" . U   A  1  26   ? 25.070  131.226 59.867  1.00 31.97  ? 27   U   A "C3'" 1 
ATOM   370   O  "O3'" . U   A  1  26   ? 24.638  130.175 59.018  1.00 30.06  ? 27   U   A "O3'" 1 
ATOM   371   C  "C2'" . U   A  1  26   ? 24.297  132.509 59.641  1.00 33.94  ? 27   U   A "C2'" 1 
ATOM   372   O  "O2'" . U   A  1  26   ? 22.913  132.199 59.584  1.00 35.40  ? 27   U   A "O2'" 1 
ATOM   373   C  "C1'" . U   A  1  26   ? 24.583  133.255 60.946  1.00 33.38  ? 27   U   A "C1'" 1 
ATOM   374   N  N1    . U   A  1  26   ? 25.757  134.151 60.914  1.00 35.54  ? 27   U   A N1    1 
ATOM   375   C  C2    . U   A  1  26   ? 25.559  135.460 60.528  1.00 36.01  ? 27   U   A C2    1 
ATOM   376   O  O2    . U   A  1  26   ? 24.479  135.887 60.180  1.00 38.25  ? 27   U   A O2    1 
ATOM   377   N  N3    . U   A  1  26   ? 26.679  136.253 60.561  1.00 35.58  ? 27   U   A N3    1 
ATOM   378   C  C4    . U   A  1  26   ? 27.955  135.886 60.918  1.00 34.78  ? 27   U   A C4    1 
ATOM   379   O  O4    . U   A  1  26   ? 28.845  136.734 60.925  1.00 35.31  ? 27   U   A O4    1 
ATOM   380   C  C5    . U   A  1  26   ? 28.098  134.518 61.285  1.00 34.17  ? 27   U   A C5    1 
ATOM   381   C  C6    . U   A  1  26   ? 27.026  133.714 61.272  1.00 35.81  ? 27   U   A C6    1 
ATOM   382   P  P     . G   A  1  27   ? 25.503  129.824 57.711  1.00 31.31  ? 28   G   A P     1 
ATOM   383   O  OP1   . G   A  1  27   ? 24.982  128.593 57.084  1.00 27.09  ? 28   G   A OP1   1 
ATOM   384   O  OP2   . G   A  1  27   ? 26.916  129.880 58.132  1.00 32.56  ? 28   G   A OP2   1 
ATOM   385   O  "O5'" . G   A  1  27   ? 25.227  131.084 56.782  1.00 31.59  ? 28   G   A "O5'" 1 
ATOM   386   C  "C5'" . G   A  1  27   ? 23.865  131.469 56.485  1.00 32.98  ? 28   G   A "C5'" 1 
ATOM   387   C  "C4'" . G   A  1  27   ? 23.789  132.862 55.878  1.00 35.33  ? 28   G   A "C4'" 1 
ATOM   388   O  "O4'" . G   A  1  27   ? 23.950  133.888 56.885  1.00 37.00  ? 28   G   A "O4'" 1 
ATOM   389   C  "C3'" . G   A  1  27   ? 24.797  133.239 54.810  1.00 36.42  ? 28   G   A "C3'" 1 
ATOM   390   O  "O3'" . G   A  1  27   ? 24.413  132.685 53.569  1.00 37.50  ? 28   G   A "O3'" 1 
ATOM   391   C  "C2'" . G   A  1  27   ? 24.681  134.756 54.795  1.00 36.25  ? 28   G   A "C2'" 1 
ATOM   392   O  "O2'" . G   A  1  27   ? 23.541  135.212 54.100  1.00 37.52  ? 28   G   A "O2'" 1 
ATOM   393   C  "C1'" . G   A  1  27   ? 24.521  135.044 56.289  1.00 37.30  ? 28   G   A "C1'" 1 
ATOM   394   N  N9    . G   A  1  27   ? 25.854  135.240 56.839  1.00 38.47  ? 28   G   A N9    1 
ATOM   395   C  C8    . G   A  1  27   ? 26.681  134.305 57.407  1.00 38.33  ? 28   G   A C8    1 
ATOM   396   N  N7    . G   A  1  27   ? 27.858  134.782 57.696  1.00 39.16  ? 28   G   A N7    1 
ATOM   397   C  C5    . G   A  1  27   ? 27.790  136.117 57.317  1.00 38.96  ? 28   G   A C5    1 
ATOM   398   C  C6    . G   A  1  27   ? 28.760  137.137 57.373  1.00 38.28  ? 28   G   A C6    1 
ATOM   399   O  O6    . G   A  1  27   ? 29.915  137.062 57.763  1.00 37.15  ? 28   G   A O6    1 
ATOM   400   N  N1    . G   A  1  27   ? 28.259  138.348 56.898  1.00 39.69  ? 28   G   A N1    1 
ATOM   401   C  C2    . G   A  1  27   ? 26.980  138.543 56.422  1.00 40.50  ? 28   G   A C2    1 
ATOM   402   N  N2    . G   A  1  27   ? 26.666  139.781 56.027  1.00 40.97  ? 28   G   A N2    1 
ATOM   403   N  N3    . G   A  1  27   ? 26.080  137.594 56.349  1.00 40.52  ? 28   G   A N3    1 
ATOM   404   C  C4    . G   A  1  27   ? 26.551  136.415 56.813  1.00 39.72  ? 28   G   A C4    1 
ATOM   405   P  P     . C   A  1  28   ? 25.532  132.215 52.527  1.00 36.78  ? 29   C   A P     1 
ATOM   406   O  OP1   . C   A  1  28   ? 24.804  131.746 51.337  1.00 38.35  ? 29   C   A OP1   1 
ATOM   407   O  OP2   . C   A  1  28   ? 26.486  131.308 53.209  1.00 34.82  ? 29   C   A OP2   1 
ATOM   408   O  "O5'" . C   A  1  28   ? 26.214  133.589 52.116  1.00 34.06  ? 29   C   A "O5'" 1 
ATOM   409   C  "C5'" . C   A  1  28   ? 25.404  134.632 51.579  1.00 31.86  ? 29   C   A "C5'" 1 
ATOM   410   C  "C4'" . C   A  1  28   ? 26.211  135.877 51.329  1.00 33.68  ? 29   C   A "C4'" 1 
ATOM   411   O  "O4'" . C   A  1  28   ? 26.587  136.524 52.563  1.00 34.51  ? 29   C   A "O4'" 1 
ATOM   412   C  "C3'" . C   A  1  28   ? 27.517  135.669 50.595  1.00 34.23  ? 29   C   A "C3'" 1 
ATOM   413   O  "O3'" . C   A  1  28   ? 27.272  135.602 49.211  1.00 35.79  ? 29   C   A "O3'" 1 
ATOM   414   C  "C2'" . C   A  1  28   ? 28.278  136.938 50.929  1.00 34.08  ? 29   C   A "C2'" 1 
ATOM   415   O  "O2'" . C   A  1  28   ? 27.881  138.011 50.100  1.00 31.98  ? 29   C   A "O2'" 1 
ATOM   416   C  "C1'" . C   A  1  28   ? 27.841  137.172 52.381  1.00 35.33  ? 29   C   A "C1'" 1 
ATOM   417   N  N1    . C   A  1  28   ? 28.813  136.604 53.337  1.00 37.73  ? 29   C   A N1    1 
ATOM   418   C  C2    . C   A  1  28   ? 29.969  137.329 53.625  1.00 39.05  ? 29   C   A C2    1 
ATOM   419   O  O2    . C   A  1  28   ? 30.130  138.428 53.083  1.00 41.36  ? 29   C   A O2    1 
ATOM   420   N  N3    . C   A  1  28   ? 30.879  136.815 54.478  1.00 39.05  ? 29   C   A N3    1 
ATOM   421   C  C4    . C   A  1  28   ? 30.663  135.622 55.044  1.00 39.48  ? 29   C   A C4    1 
ATOM   422   N  N4    . C   A  1  28   ? 31.579  135.154 55.889  1.00 39.52  ? 29   C   A N4    1 
ATOM   423   C  C5    . C   A  1  28   ? 29.488  134.858 54.770  1.00 40.07  ? 29   C   A C5    1 
ATOM   424   C  C6    . C   A  1  28   ? 28.599  135.384 53.919  1.00 38.73  ? 29   C   A C6    1 
ATOM   425   P  P     . U   A  1  29   ? 28.214  134.719 48.276  1.00 38.28  ? 30   U   A P     1 
ATOM   426   O  OP1   . U   A  1  29   ? 27.522  134.716 46.971  1.00 38.09  ? 30   U   A OP1   1 
ATOM   427   O  OP2   . U   A  1  29   ? 28.500  133.440 48.965  1.00 36.34  ? 30   U   A OP2   1 
ATOM   428   O  "O5'" . U   A  1  29   ? 29.575  135.542 48.155  1.00 38.15  ? 30   U   A "O5'" 1 
ATOM   429   C  "C5'" . U   A  1  29   ? 29.600  136.920 47.735  1.00 40.11  ? 30   U   A "C5'" 1 
ATOM   430   C  "C4'" . U   A  1  29   ? 31.021  137.430 47.718  1.00 42.17  ? 30   U   A "C4'" 1 
ATOM   431   O  "O4'" . U   A  1  29   ? 31.579  137.350 49.067  1.00 42.33  ? 30   U   A "O4'" 1 
ATOM   432   C  "C3'" . U   A  1  29   ? 31.976  136.653 46.816  1.00 43.31  ? 30   U   A "C3'" 1 
ATOM   433   O  "O3'" . U   A  1  29   ? 32.944  137.545 46.267  1.00 44.11  ? 30   U   A "O3'" 1 
ATOM   434   C  "C2'" . U   A  1  29   ? 32.679  135.728 47.805  1.00 43.87  ? 30   U   A "C2'" 1 
ATOM   435   O  "O2'" . U   A  1  29   ? 33.960  135.304 47.374  1.00 45.21  ? 30   U   A "O2'" 1 
ATOM   436   C  "C1'" . U   A  1  29   ? 32.795  136.633 49.027  1.00 43.39  ? 30   U   A "C1'" 1 
ATOM   437   N  N1    . U   A  1  29   ? 33.030  135.966 50.322  1.00 44.16  ? 30   U   A N1    1 
ATOM   438   C  C2    . U   A  1  29   ? 33.954  136.552 51.183  1.00 44.81  ? 30   U   A C2    1 
ATOM   439   O  O2    . U   A  1  29   ? 34.549  137.594 50.923  1.00 46.07  ? 30   U   A O2    1 
ATOM   440   N  N3    . U   A  1  29   ? 34.153  135.882 52.366  1.00 44.42  ? 30   U   A N3    1 
ATOM   441   C  C4    . U   A  1  29   ? 33.538  134.727 52.778  1.00 43.78  ? 30   U   A C4    1 
ATOM   442   O  O4    . U   A  1  29   ? 33.796  134.275 53.890  1.00 42.76  ? 30   U   A O4    1 
ATOM   443   C  C5    . U   A  1  29   ? 32.594  134.184 51.843  1.00 44.07  ? 30   U   A C5    1 
ATOM   444   C  C6    . U   A  1  29   ? 32.379  134.805 50.680  1.00 44.00  ? 30   U   A C6    1 
ATOM   445   P  P     . C   A  1  30   ? 32.768  138.104 44.772  1.00 43.51  ? 31   C   A P     1 
ATOM   446   O  OP1   . C   A  1  30   ? 32.424  139.533 44.917  1.00 43.33  ? 31   C   A OP1   1 
ATOM   447   O  OP2   . C   A  1  30   ? 31.884  137.208 43.979  1.00 43.29  ? 31   C   A OP2   1 
ATOM   448   O  "O5'" . C   A  1  30   ? 34.227  138.023 44.147  1.00 46.46  ? 31   C   A "O5'" 1 
ATOM   449   C  "C5'" . C   A  1  30   ? 35.390  138.001 44.991  1.00 50.97  ? 31   C   A "C5'" 1 
ATOM   450   C  "C4'" . C   A  1  30   ? 36.458  138.937 44.457  1.00 53.29  ? 31   C   A "C4'" 1 
ATOM   451   O  "O4'" . C   A  1  30   ? 35.995  140.313 44.535  1.00 57.20  ? 31   C   A "O4'" 1 
ATOM   452   C  "C3'" . C   A  1  30   ? 37.784  138.916 45.208  1.00 53.44  ? 31   C   A "C3'" 1 
ATOM   453   O  "O3'" . C   A  1  30   ? 38.809  139.268 44.295  1.00 50.02  ? 31   C   A "O3'" 1 
ATOM   454   C  "C2'" . C   A  1  30   ? 37.633  140.061 46.194  1.00 56.29  ? 31   C   A "C2'" 1 
ATOM   455   O  "O2'" . C   A  1  30   ? 38.883  140.573 46.610  1.00 56.67  ? 31   C   A "O2'" 1 
ATOM   456   C  "C1'" . C   A  1  30   ? 36.887  141.076 45.333  1.00 59.97  ? 31   C   A "C1'" 1 
ATOM   457   N  N1    . C   A  1  30   ? 36.104  142.071 46.097  1.00 65.33  ? 31   C   A N1    1 
ATOM   458   C  C2    . C   A  1  30   ? 36.760  143.202 46.650  1.00 68.66  ? 31   C   A C2    1 
ATOM   459   O  O2    . C   A  1  30   ? 37.995  143.342 46.494  1.00 70.41  ? 31   C   A O2    1 
ATOM   460   N  N3    . C   A  1  30   ? 36.025  144.108 47.339  1.00 70.58  ? 31   C   A N3    1 
ATOM   461   C  C4    . C   A  1  30   ? 34.706  143.933 47.487  1.00 70.56  ? 31   C   A C4    1 
ATOM   462   N  N4    . C   A  1  30   ? 34.026  144.858 48.176  1.00 71.59  ? 31   C   A N4    1 
ATOM   463   C  C5    . C   A  1  30   ? 34.027  142.807 46.940  1.00 69.42  ? 31   C   A C5    1 
ATOM   464   C  C6    . C   A  1  30   ? 34.755  141.910 46.266  1.00 67.00  ? 31   C   A C6    1 
ATOM   465   P  P     . G   A  1  31   ? 39.767  138.137 43.716  1.00 47.92  ? 32   G   A P     1 
ATOM   466   O  OP1   . G   A  1  31   ? 40.722  138.794 42.791  1.00 49.14  ? 32   G   A OP1   1 
ATOM   467   O  OP2   . G   A  1  31   ? 38.883  137.050 43.221  1.00 48.18  ? 32   G   A OP2   1 
ATOM   468   O  "O5'" . G   A  1  31   ? 40.550  137.610 44.999  1.00 47.76  ? 32   G   A "O5'" 1 
ATOM   469   C  "C5'" . G   A  1  31   ? 41.375  138.483 45.806  1.00 44.80  ? 32   G   A "C5'" 1 
ATOM   470   C  "C4'" . G   A  1  31   ? 41.925  137.733 47.002  1.00 43.04  ? 32   G   A "C4'" 1 
ATOM   471   O  "O4'" . G   A  1  31   ? 40.825  137.312 47.846  1.00 44.43  ? 32   G   A "O4'" 1 
ATOM   472   C  "C3'" . G   A  1  31   ? 42.680  136.448 46.691  1.00 42.27  ? 32   G   A "C3'" 1 
ATOM   473   O  "O3'" . G   A  1  31   ? 44.046  136.731 46.360  1.00 40.33  ? 32   G   A "O3'" 1 
ATOM   474   C  "C2'" . G   A  1  31   ? 42.514  135.647 47.979  1.00 42.69  ? 32   G   A "C2'" 1 
ATOM   475   O  "O2'" . G   A  1  31   ? 43.357  136.091 49.015  1.00 43.38  ? 32   G   A "O2'" 1 
ATOM   476   C  "C1'" . G   A  1  31   ? 41.092  136.021 48.389  1.00 43.87  ? 32   G   A "C1'" 1 
ATOM   477   N  N9    . G   A  1  31   ? 40.084  135.080 47.900  1.00 45.74  ? 32   G   A N9    1 
ATOM   478   C  C8    . G   A  1  31   ? 39.310  135.199 46.771  1.00 45.63  ? 32   G   A C8    1 
ATOM   479   N  N7    . G   A  1  31   ? 38.540  134.168 46.568  1.00 46.57  ? 32   G   A N7    1 
ATOM   480   C  C5    . G   A  1  31   ? 38.817  133.317 47.629  1.00 47.23  ? 32   G   A C5    1 
ATOM   481   C  C6    . G   A  1  31   ? 38.309  132.026 47.932  1.00 47.18  ? 32   G   A C6    1 
ATOM   482   O  O6    . G   A  1  31   ? 37.514  131.333 47.284  1.00 46.99  ? 32   G   A O6    1 
ATOM   483   N  N1    . G   A  1  31   ? 38.840  131.538 49.117  1.00 47.75  ? 32   G   A N1    1 
ATOM   484   C  C2    . G   A  1  31   ? 39.755  132.192 49.899  1.00 47.44  ? 32   G   A C2    1 
ATOM   485   N  N2    . G   A  1  31   ? 40.151  131.562 51.010  1.00 48.75  ? 32   G   A N2    1 
ATOM   486   N  N3    . G   A  1  31   ? 40.250  133.376 49.616  1.00 47.50  ? 32   G   A N3    1 
ATOM   487   C  C4    . G   A  1  31   ? 39.745  133.877 48.474  1.00 46.55  ? 32   G   A C4    1 
ATOM   488   P  P     . G   A  1  32   ? 45.019  135.571 45.785  1.00 40.25  ? 33   G   A P     1 
ATOM   489   O  OP1   . G   A  1  32   ? 46.307  136.243 45.484  1.00 40.03  ? 33   G   A OP1   1 
ATOM   490   O  OP2   . G   A  1  32   ? 44.346  134.777 44.735  1.00 38.68  ? 33   G   A OP2   1 
ATOM   491   O  "O5'" . G   A  1  32   ? 45.259  134.599 47.020  1.00 39.78  ? 33   G   A "O5'" 1 
ATOM   492   C  "C5'" . G   A  1  32   ? 45.439  133.190 46.815  1.00 38.22  ? 33   G   A "C5'" 1 
ATOM   493   C  "C4'" . G   A  1  32   ? 45.040  132.427 48.046  1.00 37.49  ? 33   G   A "C4'" 1 
ATOM   494   O  "O4'" . G   A  1  32   ? 43.626  132.590 48.327  1.00 37.71  ? 33   G   A "O4'" 1 
ATOM   495   C  "C3'" . G   A  1  32   ? 45.250  130.936 47.914  1.00 36.75  ? 33   G   A "C3'" 1 
ATOM   496   O  "O3'" . G   A  1  32   ? 46.611  130.652 48.251  1.00 35.20  ? 33   G   A "O3'" 1 
ATOM   497   C  "C2'" . G   A  1  32   ? 44.266  130.390 48.945  1.00 38.04  ? 33   G   A "C2'" 1 
ATOM   498   O  "O2'" . G   A  1  32   ? 44.776  130.492 50.259  1.00 38.57  ? 33   G   A "O2'" 1 
ATOM   499   C  "C1'" . G   A  1  32   ? 43.095  131.369 48.820  1.00 39.76  ? 33   G   A "C1'" 1 
ATOM   500   N  N9    . G   A  1  32   ? 42.057  130.917 47.899  1.00 43.10  ? 33   G   A N9    1 
ATOM   501   C  C8    . G   A  1  32   ? 41.647  131.567 46.759  1.00 45.22  ? 33   G   A C8    1 
ATOM   502   N  N7    . G   A  1  32   ? 40.741  130.913 46.092  1.00 44.88  ? 33   G   A N7    1 
ATOM   503   C  C5    . G   A  1  32   ? 40.526  129.765 46.840  1.00 44.77  ? 33   G   A C5    1 
ATOM   504   C  C6    . G   A  1  32   ? 39.659  128.674 46.603  1.00 45.74  ? 33   G   A C6    1 
ATOM   505   O  O6    . G   A  1  32   ? 38.874  128.510 45.658  1.00 45.53  ? 33   G   A O6    1 
ATOM   506   N  N1    . G   A  1  32   ? 39.762  127.712 47.606  1.00 45.38  ? 33   G   A N1    1 
ATOM   507   C  C2    . G   A  1  32   ? 40.584  127.800 48.700  1.00 44.74  ? 33   G   A C2    1 
ATOM   508   N  N2    . G   A  1  32   ? 40.553  126.761 49.547  1.00 45.86  ? 33   G   A N2    1 
ATOM   509   N  N3    . G   A  1  32   ? 41.385  128.826 48.944  1.00 44.53  ? 33   G   A N3    1 
ATOM   510   C  C4    . G   A  1  32   ? 41.314  129.760 47.973  1.00 43.83  ? 33   G   A C4    1 
ATOM   511   P  P     . C   A  1  33   ? 47.525  129.757 47.279  1.00 34.82  ? 34   C   A P     1 
ATOM   512   O  OP1   . C   A  1  33   ? 48.870  129.664 47.877  1.00 38.09  ? 34   C   A OP1   1 
ATOM   513   O  OP2   . C   A  1  33   ? 47.394  130.209 45.879  1.00 35.82  ? 34   C   A OP2   1 
ATOM   514   O  "O5'" . C   A  1  33   ? 46.910  128.310 47.463  1.00 35.12  ? 34   C   A "O5'" 1 
ATOM   515   C  "C5'" . C   A  1  33   ? 46.894  127.721 48.761  1.00 35.59  ? 34   C   A "C5'" 1 
ATOM   516   C  "C4'" . C   A  1  33   ? 46.014  126.505 48.780  1.00 36.12  ? 34   C   A "C4'" 1 
ATOM   517   O  "O4'" . C   A  1  33   ? 44.615  126.887 48.720  1.00 35.85  ? 34   C   A "O4'" 1 
ATOM   518   C  "C3'" . C   A  1  33   ? 46.189  125.535 47.629  1.00 34.92  ? 34   C   A "C3'" 1 
ATOM   519   O  "O3'" . C   A  1  33   ? 47.287  124.657 47.813  1.00 32.86  ? 34   C   A "O3'" 1 
ATOM   520   C  "C2'" . C   A  1  33   ? 44.883  124.777 47.695  1.00 36.74  ? 34   C   A "C2'" 1 
ATOM   521   O  "O2'" . C   A  1  33   ? 44.928  123.885 48.791  1.00 36.43  ? 34   C   A "O2'" 1 
ATOM   522   C  "C1'" . C   A  1  33   ? 43.899  125.912 47.993  1.00 37.37  ? 34   C   A "C1'" 1 
ATOM   523   N  N1    . C   A  1  33   ? 43.389  126.534 46.753  1.00 40.80  ? 34   C   A N1    1 
ATOM   524   C  C2    . C   A  1  33   ? 42.416  125.849 46.001  1.00 42.11  ? 34   C   A C2    1 
ATOM   525   O  O2    . C   A  1  33   ? 42.036  124.733 46.385  1.00 43.42  ? 34   C   A O2    1 
ATOM   526   N  N3    . C   A  1  33   ? 41.927  126.422 44.872  1.00 41.63  ? 34   C   A N3    1 
ATOM   527   C  C4    . C   A  1  33   ? 42.373  127.617 44.482  1.00 42.84  ? 34   C   A C4    1 
ATOM   528   N  N4    . C   A  1  33   ? 41.850  128.139 43.369  1.00 42.98  ? 34   C   A N4    1 
ATOM   529   C  C5    . C   A  1  33   ? 43.372  128.329 45.217  1.00 42.61  ? 34   C   A C5    1 
ATOM   530   C  C6    . C   A  1  33   ? 43.848  127.755 46.331  1.00 41.00  ? 34   C   A C6    1 
ATOM   531   P  P     . U   A  1  34   ? 48.173  124.221 46.549  1.00 30.84  ? 35   U   A P     1 
ATOM   532   O  OP1   . U   A  1  34   ? 49.368  123.495 47.029  1.00 32.29  ? 35   U   A OP1   1 
ATOM   533   O  OP2   . U   A  1  34   ? 48.332  125.445 45.753  1.00 32.24  ? 35   U   A OP2   1 
ATOM   534   O  "O5'" . U   A  1  34   ? 47.249  123.201 45.759  1.00 33.33  ? 35   U   A "O5'" 1 
ATOM   535   C  "C5'" . U   A  1  34   ? 46.885  121.933 46.338  1.00 34.53  ? 35   U   A "C5'" 1 
ATOM   536   C  "C4'" . U   A  1  34   ? 45.785  121.283 45.527  1.00 35.34  ? 35   U   A "C4'" 1 
ATOM   537   O  "O4'" . U   A  1  34   ? 44.593  122.110 45.551  1.00 34.55  ? 35   U   A "O4'" 1 
ATOM   538   C  "C3'" . U   A  1  34   ? 46.059  121.101 44.046  1.00 35.85  ? 35   U   A "C3'" 1 
ATOM   539   O  "O3'" . U   A  1  34   ? 46.884  119.971 43.791  1.00 36.82  ? 35   U   A "O3'" 1 
ATOM   540   C  "C2'" . U   A  1  34   ? 44.656  120.909 43.505  1.00 35.31  ? 35   U   A "C2'" 1 
ATOM   541   O  "O2'" . U   A  1  34   ? 44.167  119.605 43.759  1.00 35.29  ? 35   U   A "O2'" 1 
ATOM   542   C  "C1'" . U   A  1  34   ? 43.880  121.924 44.342  1.00 35.41  ? 35   U   A "C1'" 1 
ATOM   543   N  N1    . U   A  1  34   ? 43.787  123.211 43.643  1.00 37.01  ? 35   U   A N1    1 
ATOM   544   C  C2    . U   A  1  34   ? 42.782  123.373 42.698  1.00 37.85  ? 35   U   A C2    1 
ATOM   545   O  O2    . U   A  1  34   ? 41.975  122.511 42.431  1.00 36.71  ? 35   U   A O2    1 
ATOM   546   N  N3    . U   A  1  34   ? 42.776  124.596 42.074  1.00 38.65  ? 35   U   A N3    1 
ATOM   547   C  C4    . U   A  1  34   ? 43.650  125.646 42.282  1.00 38.49  ? 35   U   A C4    1 
ATOM   548   O  O4    . U   A  1  34   ? 43.535  126.674 41.610  1.00 38.29  ? 35   U   A O4    1 
ATOM   549   C  C5    . U   A  1  34   ? 44.648  125.400 43.268  1.00 39.36  ? 35   U   A C5    1 
ATOM   550   C  C6    . U   A  1  34   ? 44.680  124.224 43.901  1.00 38.24  ? 35   U   A C6    1 
ATOM   551   P  P     . C   A  1  35   ? 47.577  119.805 42.344  1.00 36.56  ? 36   C   A P     1 
ATOM   552   O  OP1   . C   A  1  35   ? 48.468  118.624 42.412  1.00 34.95  ? 36   C   A OP1   1 
ATOM   553   O  OP2   . C   A  1  35   ? 48.124  121.124 41.943  1.00 34.89  ? 36   C   A OP2   1 
ATOM   554   O  "O5'" . C   A  1  35   ? 46.363  119.445 41.384  1.00 38.95  ? 36   C   A "O5'" 1 
ATOM   555   C  "C5'" . C   A  1  35   ? 45.618  118.236 41.592  1.00 38.73  ? 36   C   A "C5'" 1 
ATOM   556   C  "C4'" . C   A  1  35   ? 44.509  118.133 40.583  1.00 38.68  ? 36   C   A "C4'" 1 
ATOM   557   O  "O4'" . C   A  1  35   ? 43.594  119.243 40.788  1.00 37.39  ? 36   C   A "O4'" 1 
ATOM   558   C  "C3'" . C   A  1  35   ? 44.908  118.260 39.120  1.00 38.76  ? 36   C   A "C3'" 1 
ATOM   559   O  "O3'" . C   A  1  35   ? 45.408  117.066 38.521  1.00 39.47  ? 36   C   A "O3'" 1 
ATOM   560   C  "C2'" . C   A  1  35   ? 43.601  118.689 38.488  1.00 38.45  ? 36   C   A "C2'" 1 
ATOM   561   O  "O2'" . C   A  1  35   ? 42.730  117.581 38.402  1.00 39.23  ? 36   C   A "O2'" 1 
ATOM   562   C  "C1'" . C   A  1  35   ? 43.074  119.663 39.540  1.00 38.04  ? 36   C   A "C1'" 1 
ATOM   563   N  N1    . C   A  1  35   ? 43.464  121.071 39.314  1.00 38.55  ? 36   C   A N1    1 
ATOM   564   C  C2    . C   A  1  35   ? 42.673  121.858 38.476  1.00 39.29  ? 36   C   A C2    1 
ATOM   565   O  O2    . C   A  1  35   ? 41.715  121.334 37.894  1.00 40.62  ? 36   C   A O2    1 
ATOM   566   N  N3    . C   A  1  35   ? 42.973  123.175 38.323  1.00 40.05  ? 36   C   A N3    1 
ATOM   567   C  C4    . C   A  1  35   ? 44.022  123.702 38.966  1.00 39.81  ? 36   C   A C4    1 
ATOM   568   N  N4    . C   A  1  35   ? 44.260  125.010 38.814  1.00 40.23  ? 36   C   A N4    1 
ATOM   569   C  C5    . C   A  1  35   ? 44.868  122.912 39.795  1.00 39.01  ? 36   C   A C5    1 
ATOM   570   C  C6    . C   A  1  35   ? 44.558  121.615 39.935  1.00 39.67  ? 36   C   A C6    1 
ATOM   571   P  P     . A   A  1  36   ? 46.419  117.185 37.270  1.00 41.07  ? 37   A   A P     1 
ATOM   572   O  OP1   . A   A  1  36   ? 46.911  115.824 36.907  1.00 40.95  ? 37   A   A OP1   1 
ATOM   573   O  OP2   . A   A  1  36   ? 47.389  118.233 37.618  1.00 40.68  ? 37   A   A OP2   1 
ATOM   574   O  "O5'" . A   A  1  36   ? 45.538  117.793 36.088  1.00 42.23  ? 37   A   A "O5'" 1 
ATOM   575   C  "C5'" . A   A  1  36   ? 44.370  117.112 35.606  1.00 45.00  ? 37   A   A "C5'" 1 
ATOM   576   C  "C4'" . A   A  1  36   ? 43.660  117.939 34.550  1.00 46.70  ? 37   A   A "C4'" 1 
ATOM   577   O  "O4'" . A   A  1  36   ? 43.093  119.130 35.163  1.00 46.95  ? 37   A   A "O4'" 1 
ATOM   578   C  "C3'" . A   A  1  36   ? 44.435  118.464 33.341  1.00 46.51  ? 37   A   A "C3'" 1 
ATOM   579   O  "O3'" . A   A  1  36   ? 44.648  117.477 32.316  1.00 45.15  ? 37   A   A "O3'" 1 
ATOM   580   C  "C2'" . A   A  1  36   ? 43.513  119.586 32.869  1.00 48.36  ? 37   A   A "C2'" 1 
ATOM   581   O  "O2'" . A   A  1  36   ? 42.393  119.080 32.166  1.00 50.79  ? 37   A   A "O2'" 1 
ATOM   582   C  "C1'" . A   A  1  36   ? 43.006  120.157 34.198  1.00 48.46  ? 37   A   A "C1'" 1 
ATOM   583   N  N9    . A   A  1  36   ? 43.767  121.315 34.670  1.00 49.80  ? 37   A   A N9    1 
ATOM   584   C  C8    . A   A  1  36   ? 44.750  121.361 35.630  1.00 50.27  ? 37   A   A C8    1 
ATOM   585   N  N7    . A   A  1  36   ? 45.253  122.561 35.815  1.00 49.79  ? 37   A   A N7    1 
ATOM   586   C  C5    . A   A  1  36   ? 44.552  123.358 34.923  1.00 49.90  ? 37   A   A C5    1 
ATOM   587   C  C6    . A   A  1  36   ? 44.614  124.735 34.628  1.00 51.04  ? 37   A   A C6    1 
ATOM   588   N  N6    . A   A  1  36   ? 45.455  125.590 35.218  1.00 51.35  ? 37   A   A N6    1 
ATOM   589   N  N1    . A   A  1  36   ? 43.771  125.214 33.686  1.00 51.34  ? 37   A   A N1    1 
ATOM   590   C  C2    . A   A  1  36   ? 42.938  124.363 33.088  1.00 51.13  ? 37   A   A C2    1 
ATOM   591   N  N3    . A   A  1  36   ? 42.786  123.053 33.278  1.00 50.89  ? 37   A   A N3    1 
ATOM   592   C  C4    . A   A  1  36   ? 43.632  122.606 34.216  1.00 49.92  ? 37   A   A C4    1 
ATOM   593   P  P     . G   A  1  37   ? 45.928  117.598 31.336  1.00 44.76  ? 38   G   A P     1 
ATOM   594   O  OP1   . G   A  1  37   ? 46.095  116.329 30.584  1.00 44.51  ? 38   G   A OP1   1 
ATOM   595   O  OP2   . G   A  1  37   ? 47.066  118.115 32.128  1.00 47.31  ? 38   G   A OP2   1 
ATOM   596   O  "O5'" . G   A  1  37   ? 45.477  118.709 30.286  1.00 46.09  ? 38   G   A "O5'" 1 
ATOM   597   C  "C5'" . G   A  1  37   ? 44.432  118.419 29.333  1.00 45.73  ? 38   G   A "C5'" 1 
ATOM   598   C  "C4'" . G   A  1  37   ? 44.016  119.667 28.584  1.00 45.94  ? 38   G   A "C4'" 1 
ATOM   599   O  "O4'" . G   A  1  37   ? 43.414  120.639 29.479  1.00 46.75  ? 38   G   A "O4'" 1 
ATOM   600   C  "C3'" . G   A  1  37   ? 45.126  120.453 27.919  1.00 46.04  ? 38   G   A "C3'" 1 
ATOM   601   O  "O3'" . G   A  1  37   ? 45.556  119.855 26.725  1.00 45.80  ? 38   G   A "O3'" 1 
ATOM   602   C  "C2'" . G   A  1  37   ? 44.467  121.804 27.700  1.00 46.72  ? 38   G   A "C2'" 1 
ATOM   603   O  "O2'" . G   A  1  37   ? 43.585  121.866 26.596  1.00 46.91  ? 38   G   A "O2'" 1 
ATOM   604   C  "C1'" . G   A  1  37   ? 43.704  121.951 29.015  1.00 47.07  ? 38   G   A "C1'" 1 
ATOM   605   N  N9    . G   A  1  37   ? 44.602  122.581 29.971  1.00 47.48  ? 38   G   A N9    1 
ATOM   606   C  C8    . G   A  1  37   ? 45.312  121.980 30.986  1.00 47.39  ? 38   G   A C8    1 
ATOM   607   N  N7    . G   A  1  37   ? 46.063  122.820 31.645  1.00 48.07  ? 38   G   A N7    1 
ATOM   608   C  C5    . G   A  1  37   ? 45.829  124.046 31.034  1.00 47.14  ? 38   G   A C5    1 
ATOM   609   C  C6    . G   A  1  37   ? 46.364  125.334 31.316  1.00 46.72  ? 38   G   A C6    1 
ATOM   610   O  O6    . G   A  1  37   ? 47.189  125.655 32.192  1.00 46.75  ? 38   G   A O6    1 
ATOM   611   N  N1    . G   A  1  37   ? 45.848  126.298 30.454  1.00 46.22  ? 38   G   A N1    1 
ATOM   612   C  C2    . G   A  1  37   ? 44.942  126.053 29.448  1.00 46.96  ? 38   G   A C2    1 
ATOM   613   N  N2    . G   A  1  37   ? 44.554  127.111 28.730  1.00 47.29  ? 38   G   A N2    1 
ATOM   614   N  N3    . G   A  1  37   ? 44.447  124.859 29.171  1.00 46.94  ? 38   G   A N3    1 
ATOM   615   C  C4    . G   A  1  37   ? 44.927  123.912 30.001  1.00 47.47  ? 38   G   A C4    1 
ATOM   616   P  P     . G   A  1  38   ? 47.050  120.101 26.224  1.00 46.04  ? 39   G   A P     1 
ATOM   617   O  OP1   . G   A  1  38   ? 47.111  119.365 24.948  1.00 47.76  ? 39   G   A OP1   1 
ATOM   618   O  OP2   . G   A  1  38   ? 48.037  119.789 27.288  1.00 45.62  ? 39   G   A OP2   1 
ATOM   619   O  "O5'" . G   A  1  38   ? 47.085  121.666 25.917  1.00 45.41  ? 39   G   A "O5'" 1 
ATOM   620   C  "C5'" . G   A  1  38   ? 46.339  122.198 24.817  1.00 46.79  ? 39   G   A "C5'" 1 
ATOM   621   C  "C4'" . G   A  1  38   ? 46.466  123.697 24.752  1.00 49.31  ? 39   G   A "C4'" 1 
ATOM   622   O  "O4'" . G   A  1  38   ? 46.045  124.260 26.016  1.00 50.80  ? 39   G   A "O4'" 1 
ATOM   623   C  "C3'" . G   A  1  38   ? 47.851  124.282 24.526  1.00 50.28  ? 39   G   A "C3'" 1 
ATOM   624   O  "O3'" . G   A  1  38   ? 48.214  124.297 23.144  1.00 50.59  ? 39   G   A "O3'" 1 
ATOM   625   C  "C2'" . G   A  1  38   ? 47.666  125.694 25.069  1.00 51.15  ? 39   G   A "C2'" 1 
ATOM   626   O  "O2'" . G   A  1  38   ? 46.878  126.512 24.219  1.00 52.00  ? 39   G   A "O2'" 1 
ATOM   627   C  "C1'" . G   A  1  38   ? 46.830  125.406 26.314  1.00 51.49  ? 39   G   A "C1'" 1 
ATOM   628   N  N9    . G   A  1  38   ? 47.653  125.094 27.481  1.00 52.17  ? 39   G   A N9    1 
ATOM   629   C  C8    . G   A  1  38   ? 47.872  123.855 28.046  1.00 51.16  ? 39   G   A C8    1 
ATOM   630   N  N7    . G   A  1  38   ? 48.636  123.902 29.101  1.00 50.29  ? 39   G   A N7    1 
ATOM   631   C  C5    . G   A  1  38   ? 48.952  125.247 29.233  1.00 51.15  ? 39   G   A C5    1 
ATOM   632   C  C6    . G   A  1  38   ? 49.739  125.915 30.196  1.00 50.95  ? 39   G   A C6    1 
ATOM   633   O  O6    . G   A  1  38   ? 50.349  125.440 31.157  1.00 49.01  ? 39   G   A O6    1 
ATOM   634   N  N1    . G   A  1  38   ? 49.774  127.287 29.958  1.00 51.90  ? 39   G   A N1    1 
ATOM   635   C  C2    . G   A  1  38   ? 49.131  127.934 28.930  1.00 51.78  ? 39   G   A C2    1 
ATOM   636   N  N2    . G   A  1  38   ? 49.266  129.260 28.887  1.00 51.95  ? 39   G   A N2    1 
ATOM   637   N  N3    . G   A  1  38   ? 48.408  127.327 28.024  1.00 51.55  ? 39   G   A N3    1 
ATOM   638   C  C4    . G   A  1  38   ? 48.355  125.993 28.236  1.00 51.69  ? 39   G   A C4    1 
ATOM   639   P  P     . C   A  1  39   ? 49.761  124.149 22.716  1.00 49.95  ? 40   C   A P     1 
ATOM   640   O  OP1   . C   A  1  39   ? 49.771  124.308 21.250  1.00 51.49  ? 40   C   A OP1   1 
ATOM   641   O  OP2   . C   A  1  39   ? 50.319  122.908 23.321  1.00 48.72  ? 40   C   A OP2   1 
ATOM   642   O  "O5'" . C   A  1  39   ? 50.479  125.427 23.356  1.00 50.59  ? 40   C   A "O5'" 1 
ATOM   643   C  "C5'" . C   A  1  39   ? 50.114  126.766 22.948  1.00 51.34  ? 40   C   A "C5'" 1 
ATOM   644   C  "C4'" . C   A  1  39   ? 50.802  127.818 23.808  1.00 51.68  ? 40   C   A "C4'" 1 
ATOM   645   O  "O4'" . C   A  1  39   ? 50.380  127.675 25.188  1.00 53.35  ? 40   C   A "O4'" 1 
ATOM   646   C  "C3'" . C   A  1  39   ? 52.322  127.783 23.856  1.00 51.51  ? 40   C   A "C3'" 1 
ATOM   647   O  "O3'" . C   A  1  39   ? 52.930  128.463 22.747  1.00 49.40  ? 40   C   A "O3'" 1 
ATOM   648   C  "C2'" . C   A  1  39   ? 52.630  128.414 25.213  1.00 52.15  ? 40   C   A "C2'" 1 
ATOM   649   O  "O2'" . C   A  1  39   ? 52.557  129.832 25.231  1.00 52.53  ? 40   C   A "O2'" 1 
ATOM   650   C  "C1'" . C   A  1  39   ? 51.489  127.855 26.060  1.00 53.19  ? 40   C   A "C1'" 1 
ATOM   651   N  N1    . C   A  1  39   ? 51.794  126.548 26.686  1.00 54.48  ? 40   C   A N1    1 
ATOM   652   C  C2    . C   A  1  39   ? 52.438  126.512 27.936  1.00 54.88  ? 40   C   A C2    1 
ATOM   653   O  O2    . C   A  1  39   ? 52.791  127.580 28.471  1.00 53.82  ? 40   C   A O2    1 
ATOM   654   N  N3    . C   A  1  39   ? 52.661  125.314 28.521  1.00 55.08  ? 40   C   A N3    1 
ATOM   655   C  C4    . C   A  1  39   ? 52.280  124.186 27.909  1.00 55.79  ? 40   C   A C4    1 
ATOM   656   N  N4    . C   A  1  39   ? 52.497  123.031 28.535  1.00 56.39  ? 40   C   A N4    1 
ATOM   657   C  C5    . C   A  1  39   ? 51.654  124.194 26.631  1.00 55.51  ? 40   C   A C5    1 
ATOM   658   C  C6    . C   A  1  39   ? 51.436  125.383 26.062  1.00 54.95  ? 40   C   A C6    1 
ATOM   659   P  P     . G   A  1  40   ? 54.502  128.254 22.449  1.00 48.94  ? 41   G   A P     1 
ATOM   660   O  OP1   . G   A  1  40   ? 54.859  129.192 21.359  1.00 48.40  ? 41   G   A OP1   1 
ATOM   661   O  OP2   . G   A  1  40   ? 54.785  126.785 22.288  1.00 45.70  ? 41   G   A OP2   1 
ATOM   662   O  "O5'" . G   A  1  40   ? 55.196  128.727 23.802  1.00 48.92  ? 41   G   A "O5'" 1 
ATOM   663   C  "C5'" . G   A  1  40   ? 55.502  130.105 24.080  1.00 48.80  ? 41   G   A "C5'" 1 
ATOM   664   C  "C4'" . G   A  1  40   ? 56.447  130.153 25.260  1.00 49.50  ? 41   G   A "C4'" 1 
ATOM   665   O  "O4'" . G   A  1  40   ? 55.809  129.485 26.388  1.00 50.02  ? 41   G   A "O4'" 1 
ATOM   666   C  "C3'" . G   A  1  40   ? 57.743  129.370 25.066  1.00 48.50  ? 41   G   A "C3'" 1 
ATOM   667   O  "O3'" . G   A  1  40   ? 58.746  130.150 24.402  1.00 45.86  ? 41   G   A "O3'" 1 
ATOM   668   C  "C2'" . G   A  1  40   ? 58.134  129.034 26.494  1.00 48.92  ? 41   G   A "C2'" 1 
ATOM   669   O  "O2'" . G   A  1  40   ? 58.696  130.149 27.146  1.00 50.75  ? 41   G   A "O2'" 1 
ATOM   670   C  "C1'" . G   A  1  40   ? 56.769  128.735 27.111  1.00 49.80  ? 41   G   A "C1'" 1 
ATOM   671   N  N9    . G   A  1  40   ? 56.372  127.327 27.083  1.00 50.82  ? 41   G   A N9    1 
ATOM   672   C  C8    . G   A  1  40   ? 55.852  126.635 26.016  1.00 51.59  ? 41   G   A C8    1 
ATOM   673   N  N7    . G   A  1  40   ? 55.555  125.395 26.300  1.00 51.74  ? 41   G   A N7    1 
ATOM   674   C  C5    . G   A  1  40   ? 55.913  125.250 27.635  1.00 52.14  ? 41   G   A C5    1 
ATOM   675   C  C6    . G   A  1  40   ? 55.819  124.116 28.499  1.00 52.33  ? 41   G   A C6    1 
ATOM   676   O  O6    . G   A  1  40   ? 55.372  122.993 28.249  1.00 51.57  ? 41   G   A O6    1 
ATOM   677   N  N1    . G   A  1  40   ? 56.308  124.399 29.772  1.00 52.20  ? 41   G   A N1    1 
ATOM   678   C  C2    . G   A  1  40   ? 56.813  125.612 30.166  1.00 51.79  ? 41   G   A C2    1 
ATOM   679   N  N2    . G   A  1  40   ? 57.250  125.684 31.425  1.00 51.51  ? 41   G   A N2    1 
ATOM   680   N  N3    . G   A  1  40   ? 56.888  126.680 29.379  1.00 51.64  ? 41   G   A N3    1 
ATOM   681   C  C4    . G   A  1  40   ? 56.426  126.429 28.135  1.00 51.55  ? 41   G   A C4    1 
ATOM   682   P  P     . C   A  1  41   ? 59.552  129.525 23.164  1.00 45.05  ? 42   C   A P     1 
ATOM   683   O  OP1   . C   A  1  41   ? 59.493  130.601 22.156  1.00 45.98  ? 42   C   A OP1   1 
ATOM   684   O  OP2   . C   A  1  41   ? 59.031  128.172 22.826  1.00 45.11  ? 42   C   A OP2   1 
ATOM   685   O  "O5'" . C   A  1  41   ? 61.055  129.349 23.687  1.00 44.15  ? 42   C   A "O5'" 1 
ATOM   686   C  "C5'" . C   A  1  41   ? 61.997  130.461 23.688  1.00 43.19  ? 42   C   A "C5'" 1 
ATOM   687   C  "C4'" . C   A  1  41   ? 61.729  131.373 24.864  1.00 42.53  ? 42   C   A "C4'" 1 
ATOM   688   O  "O4'" . C   A  1  41   ? 61.954  130.649 26.096  1.00 41.78  ? 42   C   A "O4'" 1 
ATOM   689   C  "C3'" . C   A  1  41   ? 62.608  132.605 25.002  1.00 41.99  ? 42   C   A "C3'" 1 
ATOM   690   O  "O3'" . C   A  1  41   ? 62.142  133.652 24.148  1.00 43.54  ? 42   C   A "O3'" 1 
ATOM   691   C  "C2'" . C   A  1  41   ? 62.411  132.937 26.473  1.00 41.34  ? 42   C   A "C2'" 1 
ATOM   692   O  "O2'" . C   A  1  41   ? 61.133  133.490 26.718  1.00 42.07  ? 42   C   A "O2'" 1 
ATOM   693   C  "C1'" . C   A  1  41   ? 62.429  131.540 27.088  1.00 41.15  ? 42   C   A "C1'" 1 
ATOM   694   N  N1    . C   A  1  41   ? 63.789  131.133 27.472  1.00 40.24  ? 42   C   A N1    1 
ATOM   695   C  C2    . C   A  1  41   ? 64.329  131.626 28.653  1.00 39.36  ? 42   C   A C2    1 
ATOM   696   O  O2    . C   A  1  41   ? 63.656  132.409 29.334  1.00 38.52  ? 42   C   A O2    1 
ATOM   697   N  N3    . C   A  1  41   ? 65.573  131.245 29.017  1.00 38.75  ? 42   C   A N3    1 
ATOM   698   C  C4    . C   A  1  41   ? 66.268  130.407 28.244  1.00 39.67  ? 42   C   A C4    1 
ATOM   699   N  N4    . C   A  1  41   ? 67.484  130.036 28.646  1.00 40.21  ? 42   C   A N4    1 
ATOM   700   C  C5    . C   A  1  41   ? 65.747  129.906 27.029  1.00 40.36  ? 42   C   A C5    1 
ATOM   701   C  C6    . C   A  1  41   ? 64.514  130.288 26.684  1.00 40.43  ? 42   C   A C6    1 
ATOM   702   P  P     . U   A  1  42   ? 63.180  134.716 23.546  1.00 43.06  ? 43   U   A P     1 
ATOM   703   O  OP1   . U   A  1  42   ? 62.455  135.623 22.617  1.00 40.79  ? 43   U   A OP1   1 
ATOM   704   O  OP2   . U   A  1  42   ? 64.354  133.932 23.065  1.00 43.99  ? 43   U   A OP2   1 
ATOM   705   O  "O5'" . U   A  1  42   ? 63.542  135.586 24.814  1.00 40.11  ? 43   U   A "O5'" 1 
ATOM   706   C  "C5'" . U   A  1  42   ? 62.584  136.507 25.324  1.00 38.50  ? 43   U   A "C5'" 1 
ATOM   707   C  "C4'" . U   A  1  42   ? 63.195  137.299 26.438  1.00 37.68  ? 43   U   A "C4'" 1 
ATOM   708   O  "O4'" . U   A  1  42   ? 63.565  136.403 27.518  1.00 36.11  ? 43   U   A "O4'" 1 
ATOM   709   C  "C3'" . U   A  1  42   ? 64.517  137.947 26.094  1.00 37.28  ? 43   U   A "C3'" 1 
ATOM   710   O  "O3'" . U   A  1  42   ? 64.373  139.105 25.281  1.00 36.83  ? 43   U   A "O3'" 1 
ATOM   711   C  "C2'" . U   A  1  42   ? 65.068  138.221 27.475  1.00 35.42  ? 43   U   A "C2'" 1 
ATOM   712   O  "O2'" . U   A  1  42   ? 64.331  139.292 28.033  1.00 36.10  ? 43   U   A "O2'" 1 
ATOM   713   C  "C1'" . U   A  1  42   ? 64.701  136.917 28.188  1.00 32.97  ? 43   U   A "C1'" 1 
ATOM   714   N  N1    . U   A  1  42   ? 65.772  135.907 28.143  1.00 29.60  ? 43   U   A N1    1 
ATOM   715   C  C2    . U   A  1  42   ? 66.731  135.953 29.117  1.00 27.80  ? 43   U   A C2    1 
ATOM   716   O  O2    . U   A  1  42   ? 66.737  136.795 29.993  1.00 26.81  ? 43   U   A O2    1 
ATOM   717   N  N3    . U   A  1  42   ? 67.698  134.978 29.023  1.00 26.60  ? 43   U   A N3    1 
ATOM   718   C  C4    . U   A  1  42   ? 67.806  133.988 28.067  1.00 26.80  ? 43   U   A C4    1 
ATOM   719   O  O4    . U   A  1  42   ? 68.754  133.200 28.101  1.00 25.38  ? 43   U   A O4    1 
ATOM   720   C  C5    . U   A  1  42   ? 66.777  134.008 27.086  1.00 28.81  ? 43   U   A C5    1 
ATOM   721   C  C6    . U   A  1  42   ? 65.817  134.940 27.154  1.00 28.96  ? 43   U   A C6    1 
ATOM   722   P  P     . G   A  1  43   ? 65.557  139.493 24.263  1.00 36.38  ? 44   G   A P     1 
ATOM   723   O  OP1   . G   A  1  43   ? 65.132  140.755 23.597  1.00 35.85  ? 44   G   A OP1   1 
ATOM   724   O  OP2   . G   A  1  43   ? 65.911  138.296 23.451  1.00 35.05  ? 44   G   A OP2   1 
ATOM   725   O  "O5'" . G   A  1  43   ? 66.797  139.759 25.224  1.00 37.50  ? 44   G   A "O5'" 1 
ATOM   726   C  "C5'" . G   A  1  43   ? 66.851  140.927 26.061  1.00 39.75  ? 44   G   A "C5'" 1 
ATOM   727   C  "C4'" . G   A  1  43   ? 68.201  141.026 26.732  1.00 41.19  ? 44   G   A "C4'" 1 
ATOM   728   O  "O4'" . G   A  1  43   ? 68.348  139.968 27.717  1.00 40.59  ? 44   G   A "O4'" 1 
ATOM   729   C  "C3'" . G   A  1  43   ? 69.419  140.874 25.832  1.00 41.69  ? 44   G   A "C3'" 1 
ATOM   730   O  "O3'" . G   A  1  43   ? 69.721  142.080 25.132  1.00 46.45  ? 44   G   A "O3'" 1 
ATOM   731   C  "C2'" . G   A  1  43   ? 70.503  140.482 26.827  1.00 40.51  ? 44   G   A "C2'" 1 
ATOM   732   O  "O2'" . G   A  1  43   ? 71.037  141.583 27.523  1.00 41.09  ? 44   G   A "O2'" 1 
ATOM   733   C  "C1'" . G   A  1  43   ? 69.717  139.602 27.807  1.00 40.41  ? 44   G   A "C1'" 1 
ATOM   734   N  N9    . G   A  1  43   ? 69.869  138.184 27.492  1.00 40.17  ? 44   G   A N9    1 
ATOM   735   C  C8    . G   A  1  43   ? 68.991  137.348 26.838  1.00 39.96  ? 44   G   A C8    1 
ATOM   736   N  N7    . G   A  1  43   ? 69.484  136.161 26.628  1.00 38.79  ? 44   G   A N7    1 
ATOM   737   C  C5    . G   A  1  43   ? 70.749  136.212 27.195  1.00 39.13  ? 44   G   A C5    1 
ATOM   738   C  C6    . G   A  1  43   ? 71.762  135.232 27.256  1.00 40.58  ? 44   G   A C6    1 
ATOM   739   O  O6    . G   A  1  43   ? 71.743  134.087 26.794  1.00 42.19  ? 44   G   A O6    1 
ATOM   740   N  N1    . G   A  1  43   ? 72.892  135.695 27.933  1.00 39.80  ? 44   G   A N1    1 
ATOM   741   C  C2    . G   A  1  43   ? 73.021  136.942 28.482  1.00 40.40  ? 44   G   A C2    1 
ATOM   742   N  N2    . G   A  1  43   ? 74.182  137.195 29.107  1.00 42.58  ? 44   G   A N2    1 
ATOM   743   N  N3    . G   A  1  43   ? 72.081  137.870 28.423  1.00 40.11  ? 44   G   A N3    1 
ATOM   744   C  C4    . G   A  1  43   ? 70.983  137.439 27.762  1.00 39.42  ? 44   G   A C4    1 
ATOM   745   P  P     . A   A  1  44   ? 70.389  142.014 23.659  1.00 48.24  ? 45   A   A P     1 
ATOM   746   O  OP1   . A   A  1  44   ? 69.341  142.431 22.685  1.00 46.85  ? 45   A   A OP1   1 
ATOM   747   O  OP2   . A   A  1  44   ? 71.034  140.681 23.519  1.00 48.65  ? 45   A   A OP2   1 
ATOM   748   O  "O5'" . A   A  1  44   ? 71.520  143.145 23.654  1.00 48.79  ? 45   A   A "O5'" 1 
ATOM   749   C  "C5'" . A   A  1  44   ? 72.382  143.357 24.801  1.00 49.67  ? 45   A   A "C5'" 1 
ATOM   750   C  "C4'" . A   A  1  44   ? 73.476  144.350 24.449  1.00 51.11  ? 45   A   A "C4'" 1 
ATOM   751   O  "O4'" . A   A  1  44   ? 74.375  144.511 25.584  1.00 51.60  ? 45   A   A "O4'" 1 
ATOM   752   C  "C3'" . A   A  1  44   ? 74.377  143.931 23.285  1.00 51.06  ? 45   A   A "C3'" 1 
ATOM   753   O  "O3'" . A   A  1  44   ? 74.917  145.086 22.672  1.00 50.72  ? 45   A   A "O3'" 1 
ATOM   754   C  "C2'" . A   A  1  44   ? 75.493  143.168 23.987  1.00 50.96  ? 45   A   A "C2'" 1 
ATOM   755   O  "O2'" . A   A  1  44   ? 76.698  143.101 23.248  1.00 49.39  ? 45   A   A "O2'" 1 
ATOM   756   C  "C1'" . A   A  1  44   ? 75.663  144.006 25.251  1.00 51.39  ? 45   A   A "C1'" 1 
ATOM   757   N  N9    . A   A  1  44   ? 76.171  143.229 26.381  1.00 50.76  ? 45   A   A N9    1 
ATOM   758   C  C8    . A   A  1  44   ? 77.307  143.503 27.091  1.00 50.11  ? 45   A   A C8    1 
ATOM   759   N  N7    . A   A  1  44   ? 77.547  142.655 28.055  1.00 49.73  ? 45   A   A N7    1 
ATOM   760   C  C5    . A   A  1  44   ? 76.491  141.760 27.983  1.00 49.53  ? 45   A   A C5    1 
ATOM   761   C  C6    . A   A  1  44   ? 76.168  140.627 28.746  1.00 49.17  ? 45   A   A C6    1 
ATOM   762   N  N6    . A   A  1  44   ? 76.898  140.210 29.786  1.00 47.78  ? 45   A   A N6    1 
ATOM   763   N  N1    . A   A  1  44   ? 75.058  139.935 28.406  1.00 48.87  ? 45   A   A N1    1 
ATOM   764   C  C2    . A   A  1  44   ? 74.327  140.375 27.375  1.00 48.86  ? 45   A   A C2    1 
ATOM   765   N  N3    . A   A  1  44   ? 74.524  141.438 26.586  1.00 48.61  ? 45   A   A N3    1 
ATOM   766   C  C4    . A   A  1  44   ? 75.638  142.094 26.950  1.00 49.49  ? 45   A   A C4    1 
ATOM   767   P  P     . U   A  1  45   ? 74.708  145.324 21.110  1.00 50.76  ? 46   U   A P     1 
ATOM   768   O  OP1   . U   A  1  45   ? 74.854  144.005 20.431  1.00 50.37  ? 46   U   A OP1   1 
ATOM   769   O  OP2   . U   A  1  45   ? 75.600  146.447 20.733  1.00 49.89  ? 46   U   A OP2   1 
ATOM   770   O  "O5'" . U   A  1  45   ? 73.205  145.830 21.004  1.00 51.29  ? 46   U   A "O5'" 1 
ATOM   771   C  "C5'" . U   A  1  45   ? 72.863  147.151 21.436  1.00 56.94  ? 46   U   A "C5'" 1 
ATOM   772   C  "C4'" . U   A  1  45   ? 71.375  147.359 21.365  1.00 61.45  ? 46   U   A "C4'" 1 
ATOM   773   O  "O4'" . U   A  1  45   ? 70.946  147.254 19.980  1.00 64.65  ? 46   U   A "O4'" 1 
ATOM   774   C  "C3'" . U   A  1  45   ? 70.522  146.367 22.151  1.00 62.62  ? 46   U   A "C3'" 1 
ATOM   775   O  "O3'" . U   A  1  45   ? 69.353  147.032 22.597  1.00 59.49  ? 46   U   A "O3'" 1 
ATOM   776   C  "C2'" . U   A  1  45   ? 70.099  145.367 21.088  1.00 65.58  ? 46   U   A "C2'" 1 
ATOM   777   O  "O2'" . U   A  1  45   ? 68.870  144.738 21.396  1.00 67.43  ? 46   U   A "O2'" 1 
ATOM   778   C  "C1'" . U   A  1  45   ? 69.921  146.286 19.882  1.00 66.86  ? 46   U   A "C1'" 1 
ATOM   779   N  N1    . U   A  1  45   ? 70.074  145.566 18.614  1.00 69.15  ? 46   U   A N1    1 
ATOM   780   C  C2    . U   A  1  45   ? 68.965  145.493 17.791  1.00 70.37  ? 46   U   A C2    1 
ATOM   781   O  O2    . U   A  1  45   ? 67.891  146.010 18.072  1.00 72.11  ? 46   U   A O2    1 
ATOM   782   N  N3    . U   A  1  45   ? 69.157  144.796 16.631  1.00 70.37  ? 46   U   A N3    1 
ATOM   783   C  C4    . U   A  1  45   ? 70.324  144.183 16.220  1.00 70.33  ? 46   U   A C4    1 
ATOM   784   O  O4    . U   A  1  45   ? 70.366  143.645 15.110  1.00 71.26  ? 46   U   A O4    1 
ATOM   785   C  C5    . U   A  1  45   ? 71.422  144.306 17.130  1.00 69.09  ? 46   U   A C5    1 
ATOM   786   C  C6    . U   A  1  45   ? 71.265  144.978 18.264  1.00 68.55  ? 46   U   A C6    1 
ATOM   787   P  P     . G   A  1  46   ? 69.377  147.789 23.995  1.00 57.42  ? 47   G   A P     1 
ATOM   788   O  OP1   . G   A  1  46   ? 67.975  147.823 24.506  1.00 57.79  ? 47   G   A OP1   1 
ATOM   789   O  OP2   . G   A  1  46   ? 70.130  149.050 23.797  1.00 58.47  ? 47   G   A OP2   1 
ATOM   790   O  "O5'" . G   A  1  46   ? 70.254  146.831 24.914  1.00 55.99  ? 47   G   A "O5'" 1 
ATOM   791   C  "C5'" . G   A  1  46   ? 69.689  145.668 25.514  1.00 52.94  ? 47   G   A "C5'" 1 
ATOM   792   C  "C4'" . G   A  1  46   ? 70.060  145.621 26.968  1.00 52.63  ? 47   G   A "C4'" 1 
ATOM   793   O  "O4'" . G   A  1  46   ? 71.505  145.494 27.086  1.00 53.44  ? 47   G   A "O4'" 1 
ATOM   794   C  "C3'" . G   A  1  46   ? 69.658  146.827 27.804  1.00 52.58  ? 47   G   A "C3'" 1 
ATOM   795   O  "O3'" . G   A  1  46   ? 69.222  146.358 29.066  1.00 53.02  ? 47   G   A "O3'" 1 
ATOM   796   C  "C2'" . G   A  1  46   ? 70.949  147.646 27.920  1.00 52.20  ? 47   G   A "C2'" 1 
ATOM   797   O  "O2'" . G   A  1  46   ? 71.007  148.382 29.139  1.00 48.65  ? 47   G   A "O2'" 1 
ATOM   798   C  "C1'" . G   A  1  46   ? 72.034  146.560 27.858  1.00 52.80  ? 47   G   A "C1'" 1 
ATOM   799   N  N9    . G   A  1  46   ? 73.249  147.000 27.171  1.00 54.00  ? 47   G   A N9    1 
ATOM   800   C  C8    . G   A  1  46   ? 73.299  147.707 25.993  1.00 54.65  ? 47   G   A C8    1 
ATOM   801   N  N7    . G   A  1  46   ? 74.516  147.957 25.593  1.00 55.31  ? 47   G   A N7    1 
ATOM   802   C  C5    . G   A  1  46   ? 75.327  147.375 26.557  1.00 55.42  ? 47   G   A C5    1 
ATOM   803   C  C6    . G   A  1  46   ? 76.751  147.334 26.660  1.00 56.19  ? 47   G   A C6    1 
ATOM   804   O  O6    . G   A  1  46   ? 77.602  147.807 25.883  1.00 56.49  ? 47   G   A O6    1 
ATOM   805   N  N1    . G   A  1  46   ? 77.159  146.669 27.816  1.00 55.95  ? 47   G   A N1    1 
ATOM   806   C  C2    . G   A  1  46   ? 76.318  146.130 28.763  1.00 54.56  ? 47   G   A C2    1 
ATOM   807   N  N2    . G   A  1  46   ? 76.911  145.582 29.834  1.00 53.62  ? 47   G   A N2    1 
ATOM   808   N  N3    . G   A  1  46   ? 74.992  146.143 28.670  1.00 54.63  ? 47   G   A N3    1 
ATOM   809   C  C4    . G   A  1  46   ? 74.566  146.783 27.549  1.00 54.73  ? 47   G   A C4    1 
ATOM   810   P  P     . A   A  1  47   ? 67.885  146.960 29.693  1.00 52.64  ? 48   A   A P     1 
ATOM   811   O  OP1   . A   A  1  47   ? 67.216  147.772 28.642  1.00 53.02  ? 48   A   A OP1   1 
ATOM   812   O  OP2   . A   A  1  47   ? 68.282  147.596 30.976  1.00 54.60  ? 48   A   A OP2   1 
ATOM   813   O  "O5'" . A   A  1  47   ? 66.967  145.689 29.946  1.00 52.18  ? 48   A   A "O5'" 1 
ATOM   814   C  "C5'" . A   A  1  47   ? 66.300  145.039 28.839  1.00 49.21  ? 48   A   A "C5'" 1 
ATOM   815   C  "C4'" . A   A  1  47   ? 66.180  143.569 29.112  1.00 46.40  ? 48   A   A "C4'" 1 
ATOM   816   O  "O4'" . A   A  1  47   ? 67.500  142.974 29.178  1.00 45.92  ? 48   A   A "O4'" 1 
ATOM   817   C  "C3'" . A   A  1  47   ? 65.593  143.302 30.483  1.00 45.99  ? 48   A   A "C3'" 1 
ATOM   818   O  "O3'" . A   A  1  47   ? 64.187  143.393 30.437  1.00 45.45  ? 48   A   A "O3'" 1 
ATOM   819   C  "C2'" . A   A  1  47   ? 66.113  141.913 30.796  1.00 45.73  ? 48   A   A "C2'" 1 
ATOM   820   O  "O2'" . A   A  1  47   ? 65.409  140.932 30.071  1.00 46.71  ? 48   A   A "O2'" 1 
ATOM   821   C  "C1'" . A   A  1  47   ? 67.526  142.007 30.217  1.00 45.77  ? 48   A   A "C1'" 1 
ATOM   822   N  N9    . A   A  1  47   ? 68.559  142.408 31.174  1.00 46.46  ? 48   A   A N9    1 
ATOM   823   C  C8    . A   A  1  47   ? 69.252  143.592 31.223  1.00 46.72  ? 48   A   A C8    1 
ATOM   824   N  N7    . A   A  1  47   ? 70.197  143.608 32.128  1.00 47.29  ? 48   A   A N7    1 
ATOM   825   C  C5    . A   A  1  47   ? 70.105  142.366 32.734  1.00 46.65  ? 48   A   A C5    1 
ATOM   826   C  C6    . A   A  1  47   ? 70.847  141.756 33.759  1.00 47.17  ? 48   A   A C6    1 
ATOM   827   N  N6    . A   A  1  47   ? 71.894  142.332 34.353  1.00 46.96  ? 48   A   A N6    1 
ATOM   828   N  N1    . A   A  1  47   ? 70.483  140.508 34.147  1.00 47.88  ? 48   A   A N1    1 
ATOM   829   C  C2    . A   A  1  47   ? 69.451  139.920 33.523  1.00 48.36  ? 48   A   A C2    1 
ATOM   830   N  N3    . A   A  1  47   ? 68.691  140.389 32.536  1.00 48.27  ? 48   A   A N3    1 
ATOM   831   C  C4    . A   A  1  47   ? 69.077  141.630 32.183  1.00 47.03  ? 48   A   A C4    1 
ATOM   832   P  P     . A   A  1  48   ? 63.415  144.138 31.617  1.00 45.96  ? 49   A   A P     1 
ATOM   833   O  OP1   . A   A  1  48   ? 61.983  144.175 31.269  1.00 46.25  ? 49   A   A OP1   1 
ATOM   834   O  OP2   . A   A  1  48   ? 64.147  145.413 31.927  1.00 47.47  ? 49   A   A OP2   1 
ATOM   835   O  "O5'" . A   A  1  48   ? 63.569  143.114 32.812  1.00 43.51  ? 49   A   A "O5'" 1 
ATOM   836   C  "C5'" . A   A  1  48   ? 62.933  141.839 32.731  1.00 42.38  ? 49   A   A "C5'" 1 
ATOM   837   C  "C4'" . A   A  1  48   ? 63.394  140.970 33.861  1.00 42.34  ? 49   A   A "C4'" 1 
ATOM   838   O  "O4'" . A   A  1  48   ? 64.802  140.682 33.704  1.00 42.57  ? 49   A   A "O4'" 1 
ATOM   839   C  "C3'" . A   A  1  48   ? 63.295  141.588 35.245  1.00 41.57  ? 49   A   A "C3'" 1 
ATOM   840   O  "O3'" . A   A  1  48   ? 61.996  141.450 35.781  1.00 40.63  ? 49   A   A "O3'" 1 
ATOM   841   C  "C2'" . A   A  1  48   ? 64.282  140.736 36.015  1.00 41.88  ? 49   A   A "C2'" 1 
ATOM   842   O  "O2'" . A   A  1  48   ? 63.724  139.473 36.304  1.00 41.34  ? 49   A   A "O2'" 1 
ATOM   843   C  "C1'" . A   A  1  48   ? 65.403  140.599 34.984  1.00 42.99  ? 49   A   A "C1'" 1 
ATOM   844   N  N9    . A   A  1  48   ? 66.344  141.708 35.122  1.00 44.72  ? 49   A   A N9    1 
ATOM   845   C  C8    . A   A  1  48   ? 66.348  142.934 34.495  1.00 46.30  ? 49   A   A C8    1 
ATOM   846   N  N7    . A   A  1  48   ? 67.333  143.714 34.872  1.00 46.77  ? 49   A   A N7    1 
ATOM   847   C  C5    . A   A  1  48   ? 68.024  142.946 35.800  1.00 47.37  ? 49   A   A C5    1 
ATOM   848   C  C6    . A   A  1  48   ? 69.166  143.192 36.575  1.00 48.62  ? 49   A   A C6    1 
ATOM   849   N  N6    . A   A  1  48   ? 69.863  144.330 36.539  1.00 49.84  ? 49   A   A N6    1 
ATOM   850   N  N1    . A   A  1  48   ? 69.578  142.211 37.408  1.00 49.54  ? 49   A   A N1    1 
ATOM   851   C  C2    . A   A  1  48   ? 68.884  141.070 37.452  1.00 49.32  ? 49   A   A C2    1 
ATOM   852   N  N3    . A   A  1  48   ? 67.805  140.724 36.776  1.00 48.04  ? 49   A   A N3    1 
ATOM   853   C  C4    . A   A  1  48   ? 67.422  141.714 35.960  1.00 46.36  ? 49   A   A C4    1 
ATOM   854   P  P     . G   A  1  49   ? 61.330  142.659 36.592  1.00 39.05  ? 50   G   A P     1 
ATOM   855   O  OP1   . G   A  1  49   ? 60.112  142.054 37.187  1.00 41.07  ? 50   G   A OP1   1 
ATOM   856   O  OP2   . G   A  1  49   ? 61.209  143.838 35.703  1.00 41.17  ? 50   G   A OP2   1 
ATOM   857   O  "O5'" . G   A  1  49   ? 62.348  143.002 37.762  1.00 38.15  ? 50   G   A "O5'" 1 
ATOM   858   C  "C5'" . G   A  1  49   ? 62.577  142.078 38.824  1.00 37.26  ? 50   G   A "C5'" 1 
ATOM   859   C  "C4'" . G   A  1  49   ? 63.706  142.556 39.707  1.00 38.30  ? 50   G   A "C4'" 1 
ATOM   860   O  "O4'" . G   A  1  49   ? 64.954  142.548 38.957  1.00 38.67  ? 50   G   A "O4'" 1 
ATOM   861   C  "C3'" . G   A  1  49   ? 63.633  143.975 40.257  1.00 39.11  ? 50   G   A "C3'" 1 
ATOM   862   O  "O3'" . G   A  1  49   ? 62.793  144.065 41.389  1.00 42.65  ? 50   G   A "O3'" 1 
ATOM   863   C  "C2'" . G   A  1  49   ? 65.076  144.178 40.652  1.00 38.08  ? 50   G   A "C2'" 1 
ATOM   864   O  "O2'" . G   A  1  49   ? 65.349  143.366 41.780  1.00 37.33  ? 50   G   A "O2'" 1 
ATOM   865   C  "C1'" . G   A  1  49   ? 65.784  143.595 39.423  1.00 38.17  ? 50   G   A "C1'" 1 
ATOM   866   N  N9    . G   A  1  49   ? 65.890  144.593 38.358  1.00 38.51  ? 50   G   A N9    1 
ATOM   867   C  C8    . G   A  1  49   ? 65.163  144.658 37.188  1.00 38.50  ? 50   G   A C8    1 
ATOM   868   N  N7    . G   A  1  49   ? 65.458  145.698 36.458  1.00 38.96  ? 50   G   A N7    1 
ATOM   869   C  C5    . G   A  1  49   ? 66.444  146.357 37.182  1.00 40.14  ? 50   G   A C5    1 
ATOM   870   C  C6    . G   A  1  49   ? 67.155  147.563 36.900  1.00 40.11  ? 50   G   A C6    1 
ATOM   871   O  O6    . G   A  1  49   ? 67.043  148.316 35.921  1.00 41.14  ? 50   G   A O6    1 
ATOM   872   N  N1    . G   A  1  49   ? 68.072  147.861 37.904  1.00 39.89  ? 50   G   A N1    1 
ATOM   873   C  C2    . G   A  1  49   ? 68.281  147.105 39.030  1.00 39.46  ? 50   G   A C2    1 
ATOM   874   N  N2    . G   A  1  49   ? 69.219  147.539 39.872  1.00 41.40  ? 50   G   A N2    1 
ATOM   875   N  N3    . G   A  1  49   ? 67.624  145.998 39.309  1.00 39.71  ? 50   G   A N3    1 
ATOM   876   C  C4    . G   A  1  49   ? 66.729  145.682 38.350  1.00 39.62  ? 50   G   A C4    1 
ATOM   877   P  P     . G   A  1  50   ? 62.015  145.446 41.721  1.00 47.95  ? 51   G   A P     1 
ATOM   878   O  OP1   . G   A  1  50   ? 61.085  145.106 42.841  1.00 49.76  ? 51   G   A OP1   1 
ATOM   879   O  OP2   . G   A  1  50   ? 61.482  146.052 40.478  1.00 47.69  ? 51   G   A OP2   1 
ATOM   880   O  "O5'" . G   A  1  50   ? 63.128  146.471 42.234  1.00 46.78  ? 51   G   A "O5'" 1 
ATOM   881   C  "C5'" . G   A  1  50   ? 63.864  146.257 43.467  1.00 45.16  ? 51   G   A "C5'" 1 
ATOM   882   C  "C4'" . G   A  1  50   ? 65.050  147.187 43.522  1.00 44.11  ? 51   G   A "C4'" 1 
ATOM   883   O  "O4'" . G   A  1  50   ? 65.852  147.007 42.328  1.00 45.11  ? 51   G   A "O4'" 1 
ATOM   884   C  "C3'" . G   A  1  50   ? 64.760  148.680 43.522  1.00 43.97  ? 51   G   A "C3'" 1 
ATOM   885   O  "O3'" . G   A  1  50   ? 64.413  149.091 44.826  1.00 43.31  ? 51   G   A "O3'" 1 
ATOM   886   C  "C2'" . G   A  1  50   ? 66.103  149.238 43.086  1.00 43.94  ? 51   G   A "C2'" 1 
ATOM   887   O  "O2'" . G   A  1  50   ? 67.079  149.155 44.105  1.00 45.41  ? 51   G   A "O2'" 1 
ATOM   888   C  "C1'" . G   A  1  50   ? 66.481  148.235 41.996  1.00 44.45  ? 51   G   A "C1'" 1 
ATOM   889   N  N9    . G   A  1  50   ? 66.004  148.670 40.684  1.00 44.69  ? 51   G   A N9    1 
ATOM   890   C  C8    . G   A  1  50   ? 65.001  148.116 39.920  1.00 45.24  ? 51   G   A C8    1 
ATOM   891   N  N7    . G   A  1  50   ? 64.781  148.771 38.814  1.00 45.04  ? 51   G   A N7    1 
ATOM   892   C  C5    . G   A  1  50   ? 65.692  149.816 38.848  1.00 44.98  ? 51   G   A C5    1 
ATOM   893   C  C6    . G   A  1  50   ? 65.915  150.876 37.927  1.00 45.89  ? 51   G   A C6    1 
ATOM   894   O  O6    . G   A  1  50   ? 65.301  151.136 36.885  1.00 45.17  ? 51   G   A O6    1 
ATOM   895   N  N1    . G   A  1  50   ? 66.969  151.686 38.331  1.00 46.25  ? 51   G   A N1    1 
ATOM   896   C  C2    . G   A  1  50   ? 67.703  151.510 39.476  1.00 45.87  ? 51   G   A C2    1 
ATOM   897   N  N2    . G   A  1  50   ? 68.731  152.352 39.664  1.00 46.00  ? 51   G   A N2    1 
ATOM   898   N  N3    . G   A  1  50   ? 67.470  150.563 40.362  1.00 45.45  ? 51   G   A N3    1 
ATOM   899   C  C4    . G   A  1  50   ? 66.467  149.753 39.983  1.00 44.41  ? 51   G   A C4    1 
ATOM   900   P  P     . A   A  1  51   ? 63.582  150.454 45.061  1.00 43.88  ? 52   A   A P     1 
ATOM   901   O  OP1   . A   A  1  51   ? 63.341  150.480 46.538  1.00 40.90  ? 52   A   A OP1   1 
ATOM   902   O  OP2   . A   A  1  51   ? 62.427  150.557 44.126  1.00 44.26  ? 52   A   A OP2   1 
ATOM   903   O  "O5'" . A   A  1  51   ? 64.598  151.606 44.635  1.00 42.51  ? 52   A   A "O5'" 1 
ATOM   904   C  "C5'" . A   A  1  51   ? 65.921  151.699 45.216  1.00 41.86  ? 52   A   A "C5'" 1 
ATOM   905   C  "C4'" . A   A  1  51   ? 66.671  152.860 44.602  1.00 41.75  ? 52   A   A "C4'" 1 
ATOM   906   O  "O4'" . A   A  1  51   ? 66.993  152.553 43.220  1.00 41.81  ? 52   A   A "O4'" 1 
ATOM   907   C  "C3'" . A   A  1  51   ? 65.919  154.184 44.538  1.00 41.88  ? 52   A   A "C3'" 1 
ATOM   908   O  "O3'" . A   A  1  51   ? 65.993  154.907 45.777  1.00 40.68  ? 52   A   A "O3'" 1 
ATOM   909   C  "C2'" . A   A  1  51   ? 66.632  154.895 43.392  1.00 42.13  ? 52   A   A "C2'" 1 
ATOM   910   O  "O2'" . A   A  1  51   ? 67.871  155.448 43.772  1.00 43.27  ? 52   A   A "O2'" 1 
ATOM   911   C  "C1'" . A   A  1  51   ? 66.919  153.733 42.439  1.00 42.48  ? 52   A   A "C1'" 1 
ATOM   912   N  N9    . A   A  1  51   ? 65.917  153.534 41.386  1.00 43.75  ? 52   A   A N9    1 
ATOM   913   C  C8    . A   A  1  51   ? 64.968  152.548 41.329  1.00 44.80  ? 52   A   A C8    1 
ATOM   914   N  N7    . A   A  1  51   ? 64.220  152.591 40.254  1.00 45.28  ? 52   A   A N7    1 
ATOM   915   C  C5    . A   A  1  51   ? 64.700  153.688 39.560  1.00 44.22  ? 52   A   A C5    1 
ATOM   916   C  C6    . A   A  1  51   ? 64.322  154.263 38.351  1.00 44.43  ? 52   A   A C6    1 
ATOM   917   N  N6    . A   A  1  51   ? 63.324  153.801 37.598  1.00 44.62  ? 52   A   A N6    1 
ATOM   918   N  N1    . A   A  1  51   ? 65.004  155.344 37.932  1.00 44.44  ? 52   A   A N1    1 
ATOM   919   C  C2    . A   A  1  51   ? 65.990  155.816 38.695  1.00 43.12  ? 52   A   A C2    1 
ATOM   920   N  N3    . A   A  1  51   ? 66.435  155.372 39.860  1.00 43.98  ? 52   A   A N3    1 
ATOM   921   C  C4    . A   A  1  51   ? 65.743  154.285 40.244  1.00 44.17  ? 52   A   A C4    1 
ATOM   922   P  P     . C   A  1  52   ? 64.735  155.783 46.278  1.00 41.17  ? 53   C   A P     1 
ATOM   923   O  OP1   . C   A  1  52   ? 65.113  156.421 47.572  1.00 41.22  ? 53   C   A OP1   1 
ATOM   924   O  OP2   . C   A  1  52   ? 63.504  154.960 46.203  1.00 40.78  ? 53   C   A OP2   1 
ATOM   925   O  "O5'" . C   A  1  52   ? 64.631  156.940 45.190  1.00 40.65  ? 53   C   A "O5'" 1 
ATOM   926   C  "C5'" . C   A  1  52   ? 65.650  157.938 45.107  1.00 38.83  ? 53   C   A "C5'" 1 
ATOM   927   C  "C4'" . C   A  1  52   ? 65.548  158.710 43.816  1.00 39.90  ? 53   C   A "C4'" 1 
ATOM   928   O  "O4'" . C   A  1  52   ? 65.702  157.835 42.664  1.00 40.87  ? 53   C   A "O4'" 1 
ATOM   929   C  "C3'" . C   A  1  52   ? 64.225  159.386 43.531  1.00 39.03  ? 53   C   A "C3'" 1 
ATOM   930   O  "O3'" . C   A  1  52   ? 64.015  160.566 44.276  1.00 37.99  ? 53   C   A "O3'" 1 
ATOM   931   C  "C2'" . C   A  1  52   ? 64.356  159.687 42.049  1.00 40.05  ? 53   C   A "C2'" 1 
ATOM   932   O  "O2'" . C   A  1  52   ? 65.222  160.778 41.810  1.00 39.41  ? 53   C   A "O2'" 1 
ATOM   933   C  "C1'" . C   A  1  52   ? 65.003  158.396 41.550  1.00 41.41  ? 53   C   A "C1'" 1 
ATOM   934   N  N1    . C   A  1  52   ? 63.967  157.451 41.099  1.00 43.65  ? 53   C   A N1    1 
ATOM   935   C  C2    . C   A  1  52   ? 63.450  157.562 39.781  1.00 44.04  ? 53   C   A C2    1 
ATOM   936   O  O2    . C   A  1  52   ? 63.896  158.442 39.023  1.00 42.42  ? 53   C   A O2    1 
ATOM   937   N  N3    . C   A  1  52   ? 62.472  156.714 39.386  1.00 45.08  ? 53   C   A N3    1 
ATOM   938   C  C4    . C   A  1  52   ? 62.006  155.794 40.238  1.00 45.21  ? 53   C   A C4    1 
ATOM   939   N  N4    . C   A  1  52   ? 61.031  154.987 39.822  1.00 46.02  ? 53   C   A N4    1 
ATOM   940   C  C5    . C   A  1  52   ? 62.518  155.659 41.565  1.00 45.01  ? 53   C   A C5    1 
ATOM   941   C  C6    . C   A  1  52   ? 63.487  156.493 41.948  1.00 44.44  ? 53   C   A C6    1 
ATOM   942   P  P     . G   A  1  53   ? 62.587  161.280 44.206  1.00 37.13  ? 54   G   A P     1 
ATOM   943   O  OP1   . G   A  1  53   ? 62.510  162.157 45.389  1.00 38.64  ? 54   G   A OP1   1 
ATOM   944   O  OP2   . G   A  1  53   ? 61.576  160.204 44.034  1.00 38.91  ? 54   G   A OP2   1 
ATOM   945   O  "O5'" . G   A  1  53   ? 62.698  162.132 42.863  1.00 38.94  ? 54   G   A "O5'" 1 
ATOM   946   C  "C5'" . G   A  1  53   ? 61.538  162.555 42.121  1.00 41.98  ? 54   G   A "C5'" 1 
ATOM   947   C  "C4'" . G   A  1  53   ? 61.868  162.589 40.643  1.00 45.18  ? 54   G   A "C4'" 1 
ATOM   948   O  "O4'" . G   A  1  53   ? 62.356  161.287 40.223  1.00 45.89  ? 54   G   A "O4'" 1 
ATOM   949   C  "C3'" . G   A  1  53   ? 60.706  162.925 39.715  1.00 46.42  ? 54   G   A "C3'" 1 
ATOM   950   O  "O3'" . G   A  1  53   ? 60.584  164.339 39.501  1.00 46.80  ? 54   G   A "O3'" 1 
ATOM   951   C  "C2'" . G   A  1  53   ? 61.034  162.130 38.459  1.00 47.36  ? 54   G   A "C2'" 1 
ATOM   952   O  "O2'" . G   A  1  53   ? 61.994  162.771 37.642  1.00 49.14  ? 54   G   A "O2'" 1 
ATOM   953   C  "C1'" . G   A  1  53   ? 61.662  160.871 39.066  1.00 47.47  ? 54   G   A "C1'" 1 
ATOM   954   N  N9    . G   A  1  53   ? 60.734  159.805 39.452  1.00 48.88  ? 54   G   A N9    1 
ATOM   955   C  C8    . G   A  1  53   ? 60.587  159.248 40.707  1.00 49.55  ? 54   G   A C8    1 
ATOM   956   N  N7    . G   A  1  53   ? 59.703  158.289 40.747  1.00 50.40  ? 54   G   A N7    1 
ATOM   957   C  C5    . G   A  1  53   ? 59.229  158.207 39.444  1.00 50.54  ? 54   G   A C5    1 
ATOM   958   C  C6    . G   A  1  53   ? 58.249  157.341 38.873  1.00 50.75  ? 54   G   A C6    1 
ATOM   959   O  O6    . G   A  1  53   ? 57.585  156.444 39.427  1.00 49.58  ? 54   G   A O6    1 
ATOM   960   N  N1    . G   A  1  53   ? 58.074  157.601 37.518  1.00 49.75  ? 54   G   A N1    1 
ATOM   961   C  C2    . G   A  1  53   ? 58.746  158.557 36.805  1.00 50.07  ? 54   G   A C2    1 
ATOM   962   N  N2    . G   A  1  53   ? 58.437  158.629 35.503  1.00 51.46  ? 54   G   A N2    1 
ATOM   963   N  N3    . G   A  1  53   ? 59.653  159.371 37.320  1.00 49.99  ? 54   G   A N3    1 
ATOM   964   C  C4    . G   A  1  53   ? 59.848  159.141 38.634  1.00 49.67  ? 54   G   A C4    1 
ATOM   965   P  P     . U   A  1  54   ? 59.198  165.078 39.837  1.00 47.49  ? 55   U   A P     1 
ATOM   966   O  OP1   . U   A  1  54   ? 59.342  166.546 39.628  1.00 48.80  ? 55   U   A OP1   1 
ATOM   967   O  OP2   . U   A  1  54   ? 58.748  164.575 41.157  1.00 46.35  ? 55   U   A OP2   1 
ATOM   968   O  "O5'" . U   A  1  54   ? 58.228  164.539 38.701  1.00 48.03  ? 55   U   A "O5'" 1 
ATOM   969   C  "C5'" . U   A  1  54   ? 58.524  164.768 37.315  1.00 48.87  ? 55   U   A "C5'" 1 
ATOM   970   C  "C4'" . U   A  1  54   ? 57.612  163.936 36.444  1.00 48.19  ? 55   U   A "C4'" 1 
ATOM   971   O  "O4'" . U   A  1  54   ? 57.903  162.537 36.665  1.00 48.37  ? 55   U   A "O4'" 1 
ATOM   972   C  "C3'" . U   A  1  54   ? 56.135  164.075 36.784  1.00 47.57  ? 55   U   A "C3'" 1 
ATOM   973   O  "O3'" . U   A  1  54   ? 55.540  165.212 36.165  1.00 46.57  ? 55   U   A "O3'" 1 
ATOM   974   C  "C2'" . U   A  1  54   ? 55.556  162.763 36.287  1.00 48.50  ? 55   U   A "C2'" 1 
ATOM   975   O  "O2'" . U   A  1  54   ? 55.316  162.766 34.897  1.00 48.61  ? 55   U   A "O2'" 1 
ATOM   976   C  "C1'" . U   A  1  54   ? 56.698  161.794 36.608  1.00 49.42  ? 55   U   A "C1'" 1 
ATOM   977   N  N1    . U   A  1  54   ? 56.518  161.058 37.872  1.00 50.93  ? 55   U   A N1    1 
ATOM   978   C  C2    . U   A  1  54   ? 55.742  159.923 37.808  1.00 51.06  ? 55   U   A C2    1 
ATOM   979   O  O2    . U   A  1  54   ? 55.211  159.550 36.777  1.00 51.38  ? 55   U   A O2    1 
ATOM   980   N  N3    . U   A  1  54   ? 55.607  159.241 38.991  1.00 52.54  ? 55   U   A N3    1 
ATOM   981   C  C4    . U   A  1  54   ? 56.161  159.567 40.211  1.00 53.36  ? 55   U   A C4    1 
ATOM   982   O  O4    . U   A  1  54   ? 56.059  158.766 41.145  1.00 53.11  ? 55   U   A O4    1 
ATOM   983   C  C5    . U   A  1  54   ? 56.940  160.770 40.209  1.00 52.80  ? 55   U   A C5    1 
ATOM   984   C  C6    . U   A  1  54   ? 57.090  161.460 39.069  1.00 51.64  ? 55   U   A C6    1 
ATOM   985   P  P     . G   A  1  55   ? 54.586  166.165 37.026  1.00 47.57  ? 56   G   A P     1 
ATOM   986   O  OP1   . G   A  1  55   ? 54.298  167.391 36.240  1.00 47.87  ? 56   G   A OP1   1 
ATOM   987   O  OP2   . G   A  1  55   ? 55.194  166.277 38.369  1.00 47.96  ? 56   G   A OP2   1 
ATOM   988   O  "O5'" . G   A  1  55   ? 53.220  165.357 37.134  1.00 47.72  ? 56   G   A "O5'" 1 
ATOM   989   C  "C5'" . G   A  1  55   ? 52.462  165.061 35.955  1.00 48.15  ? 56   G   A "C5'" 1 
ATOM   990   C  "C4'" . G   A  1  55   ? 50.992  165.060 36.252  1.00 49.51  ? 56   G   A "C4'" 1 
ATOM   991   O  "O4'" . G   A  1  55   ? 50.694  163.943 37.132  1.00 50.46  ? 56   G   A "O4'" 1 
ATOM   992   C  "C3'" . G   A  1  55   ? 50.419  166.307 36.915  1.00 50.05  ? 56   G   A "C3'" 1 
ATOM   993   O  "O3'" . G   A  1  55   ? 49.168  166.602 36.301  1.00 50.35  ? 56   G   A "O3'" 1 
ATOM   994   C  "C2'" . G   A  1  55   ? 50.245  165.861 38.370  1.00 50.16  ? 56   G   A "C2'" 1 
ATOM   995   O  "O2'" . G   A  1  55   ? 49.216  166.546 39.058  1.00 50.67  ? 56   G   A "O2'" 1 
ATOM   996   C  "C1'" . G   A  1  55   ? 49.878  164.389 38.185  1.00 50.74  ? 56   G   A "C1'" 1 
ATOM   997   N  N9    . G   A  1  55   ? 50.065  163.481 39.316  1.00 51.76  ? 56   G   A N9    1 
ATOM   998   C  C8    . G   A  1  55   ? 50.852  163.651 40.429  1.00 51.96  ? 56   G   A C8    1 
ATOM   999   N  N7    . G   A  1  55   ? 50.772  162.656 41.270  1.00 51.64  ? 56   G   A N7    1 
ATOM   1000  C  C5    . G   A  1  55   ? 49.886  161.773 40.673  1.00 51.97  ? 56   G   A C5    1 
ATOM   1001  C  C6    . G   A  1  55   ? 49.396  160.519 41.115  1.00 52.28  ? 56   G   A C6    1 
ATOM   1002  O  O6    . G   A  1  55   ? 49.628  159.926 42.174  1.00 51.49  ? 56   G   A O6    1 
ATOM   1003  N  N1    . G   A  1  55   ? 48.538  159.953 40.181  1.00 52.91  ? 56   G   A N1    1 
ATOM   1004  C  C2    . G   A  1  55   ? 48.180  160.524 38.990  1.00 52.47  ? 56   G   A C2    1 
ATOM   1005  N  N2    . G   A  1  55   ? 47.361  159.809 38.216  1.00 53.09  ? 56   G   A N2    1 
ATOM   1006  N  N3    . G   A  1  55   ? 48.600  161.702 38.582  1.00 52.09  ? 56   G   A N3    1 
ATOM   1007  C  C4    . G   A  1  55   ? 49.451  162.264 39.462  1.00 52.02  ? 56   G   A C4    1 
ATOM   1008  P  P     . C   A  1  56   ? 48.958  168.029 35.602  1.00 49.62  ? 57   C   A P     1 
ATOM   1009  O  OP1   . C   A  1  56   ? 47.604  168.017 34.986  1.00 48.53  ? 57   C   A OP1   1 
ATOM   1010  O  OP2   . C   A  1  56   ? 50.155  168.308 34.749  1.00 48.40  ? 57   C   A OP2   1 
ATOM   1011  O  "O5'" . C   A  1  56   ? 48.938  169.029 36.842  1.00 49.89  ? 57   C   A "O5'" 1 
ATOM   1012  C  "C5'" . C   A  1  56   ? 49.358  170.390 36.719  1.00 50.29  ? 57   C   A "C5'" 1 
ATOM   1013  C  "C4'" . C   A  1  56   ? 48.677  171.250 37.774  1.00 49.92  ? 57   C   A "C4'" 1 
ATOM   1014  O  "O4'" . C   A  1  56   ? 47.258  171.369 37.523  1.00 48.14  ? 57   C   A "O4'" 1 
ATOM   1015  C  "C3'" . C   A  1  56   ? 48.745  170.741 39.199  1.00 51.14  ? 57   C   A "C3'" 1 
ATOM   1016  O  "O3'" . C   A  1  56   ? 50.006  171.046 39.751  1.00 54.48  ? 57   C   A "O3'" 1 
ATOM   1017  C  "C2'" . C   A  1  56   ? 47.605  171.489 39.877  1.00 50.30  ? 57   C   A "C2'" 1 
ATOM   1018  O  "O2'" . C   A  1  56   ? 47.919  172.841 40.192  1.00 51.30  ? 57   C   A "O2'" 1 
ATOM   1019  C  "C1'" . C   A  1  56   ? 46.563  171.478 38.758  1.00 48.23  ? 57   C   A "C1'" 1 
ATOM   1020  N  N1    . C   A  1  56   ? 45.582  170.377 38.833  1.00 45.47  ? 57   C   A N1    1 
ATOM   1021  C  C2    . C   A  1  56   ? 44.418  170.548 39.607  1.00 43.90  ? 57   C   A C2    1 
ATOM   1022  O  O2    . C   A  1  56   ? 44.274  171.593 40.261  1.00 42.77  ? 57   C   A O2    1 
ATOM   1023  N  N3    . C   A  1  56   ? 43.486  169.571 39.625  1.00 43.52  ? 57   C   A N3    1 
ATOM   1024  C  C4    . C   A  1  56   ? 43.679  168.450 38.922  1.00 44.58  ? 57   C   A C4    1 
ATOM   1025  N  N4    . C   A  1  56   ? 42.717  167.515 38.952  1.00 44.14  ? 57   C   A N4    1 
ATOM   1026  C  C5    . C   A  1  56   ? 44.867  168.235 38.152  1.00 44.66  ? 57   C   A C5    1 
ATOM   1027  C  C6    . C   A  1  56   ? 45.784  169.212 38.141  1.00 44.82  ? 57   C   A C6    1 
ATOM   1028  P  P     . C   A  1  57   ? 50.681  170.018 40.758  1.00 58.27  ? 58   C   A P     1 
ATOM   1029  O  OP1   . C   A  1  57   ? 51.979  170.610 41.161  1.00 58.70  ? 58   C   A OP1   1 
ATOM   1030  O  OP2   . C   A  1  57   ? 50.641  168.661 40.147  1.00 58.09  ? 58   C   A OP2   1 
ATOM   1031  O  "O5'" . C   A  1  57   ? 49.692  170.055 41.993  1.00 57.98  ? 58   C   A "O5'" 1 
ATOM   1032  C  "C5'" . C   A  1  57   ? 49.531  171.257 42.731  1.00 61.31  ? 58   C   A "C5'" 1 
ATOM   1033  C  "C4'" . C   A  1  57   ? 48.496  171.062 43.784  1.00 64.15  ? 58   C   A "C4'" 1 
ATOM   1034  O  "O4'" . C   A  1  57   ? 47.200  170.892 43.174  1.00 64.16  ? 58   C   A "O4'" 1 
ATOM   1035  C  "C3'" . C   A  1  57   ? 48.650  169.783 44.576  1.00 65.81  ? 58   C   A "C3'" 1 
ATOM   1036  O  "O3'" . C   A  1  57   ? 49.687  169.910 45.532  1.00 68.48  ? 58   C   A "O3'" 1 
ATOM   1037  C  "C2'" . C   A  1  57   ? 47.273  169.652 45.202  1.00 65.81  ? 58   C   A "C2'" 1 
ATOM   1038  O  "O2'" . C   A  1  57   ? 47.105  170.534 46.299  1.00 67.18  ? 58   C   A "O2'" 1 
ATOM   1039  C  "C1'" . C   A  1  57   ? 46.390  170.123 44.045  1.00 63.98  ? 58   C   A "C1'" 1 
ATOM   1040  N  N1    . C   A  1  57   ? 45.795  169.013 43.292  1.00 61.23  ? 58   C   A N1    1 
ATOM   1041  C  C2    . C   A  1  57   ? 44.475  168.668 43.564  1.00 59.80  ? 58   C   A C2    1 
ATOM   1042  O  O2    . C   A  1  57   ? 43.867  169.302 44.438  1.00 59.98  ? 58   C   A O2    1 
ATOM   1043  N  N3    . C   A  1  57   ? 43.899  167.656 42.878  1.00 57.81  ? 58   C   A N3    1 
ATOM   1044  C  C4    . C   A  1  57   ? 44.605  166.992 41.960  1.00 58.75  ? 58   C   A C4    1 
ATOM   1045  N  N4    . C   A  1  57   ? 44.008  165.991 41.301  1.00 58.36  ? 58   C   A N4    1 
ATOM   1046  C  C5    . C   A  1  57   ? 45.963  167.320 41.670  1.00 59.38  ? 58   C   A C5    1 
ATOM   1047  C  C6    . C   A  1  57   ? 46.510  168.329 42.349  1.00 60.26  ? 58   C   A C6    1 
ATOM   1048  P  P     . A   A  1  58   ? 50.983  168.972 45.408  1.00 70.02  ? 59   A   A P     1 
ATOM   1049  O  OP1   . A   A  1  58   ? 51.760  169.156 46.669  1.00 71.22  ? 59   A   A OP1   1 
ATOM   1050  O  OP2   . A   A  1  58   ? 51.654  169.187 44.095  1.00 69.02  ? 59   A   A OP2   1 
ATOM   1051  O  "O5'" . A   A  1  58   ? 50.370  167.500 45.393  1.00 67.74  ? 59   A   A "O5'" 1 
ATOM   1052  C  "C5'" . A   A  1  58   ? 49.869  166.893 46.589  1.00 63.05  ? 59   A   A "C5'" 1 
ATOM   1053  C  "C4'" . A   A  1  58   ? 49.980  165.397 46.486  1.00 61.05  ? 59   A   A "C4'" 1 
ATOM   1054  O  "O4'" . A   A  1  58   ? 48.904  164.910 45.627  1.00 61.26  ? 59   A   A "O4'" 1 
ATOM   1055  C  "C3'" . A   A  1  58   ? 51.293  164.880 45.879  1.00 59.18  ? 59   A   A "C3'" 1 
ATOM   1056  O  "O3'" . A   A  1  58   ? 51.841  163.790 46.635  1.00 57.40  ? 59   A   A "O3'" 1 
ATOM   1057  C  "C2'" . A   A  1  58   ? 50.839  164.359 44.509  1.00 60.16  ? 59   A   A "C2'" 1 
ATOM   1058  O  "O2'" . A   A  1  58   ? 51.631  163.278 44.082  1.00 59.58  ? 59   A   A "O2'" 1 
ATOM   1059  C  "C1'" . A   A  1  58   ? 49.414  163.883 44.802  1.00 61.60  ? 59   A   A "C1'" 1 
ATOM   1060  N  N9    . A   A  1  58   ? 48.528  163.702 43.636  1.00 62.91  ? 59   A   A N9    1 
ATOM   1061  C  C8    . A   A  1  58   ? 48.373  164.568 42.578  1.00 63.36  ? 59   A   A C8    1 
ATOM   1062  N  N7    . A   A  1  58   ? 47.528  164.150 41.661  1.00 64.00  ? 59   A   A N7    1 
ATOM   1063  C  C5    . A   A  1  58   ? 47.092  162.921 42.142  1.00 64.28  ? 59   A   A C5    1 
ATOM   1064  C  C6    . A   A  1  58   ? 46.190  161.955 41.619  1.00 64.44  ? 59   A   A C6    1 
ATOM   1065  N  N6    . A   A  1  58   ? 45.558  162.076 40.441  1.00 63.46  ? 59   A   A N6    1 
ATOM   1066  N  N1    . A   A  1  58   ? 45.964  160.844 42.356  1.00 63.86  ? 59   A   A N1    1 
ATOM   1067  C  C2    . A   A  1  58   ? 46.608  160.707 43.523  1.00 63.05  ? 59   A   A C2    1 
ATOM   1068  N  N3    . A   A  1  58   ? 47.487  161.528 44.112  1.00 63.61  ? 59   A   A N3    1 
ATOM   1069  C  C4    . A   A  1  58   ? 47.690  162.633 43.365  1.00 63.67  ? 59   A   A C4    1 
ATOM   1070  P  P     . A   A  1  59   ? 53.321  163.898 47.299  1.00 54.46  ? 60   A   A P     1 
ATOM   1071  O  OP1   . A   A  1  59   ? 53.716  165.314 47.464  1.00 54.93  ? 60   A   A OP1   1 
ATOM   1072  O  OP2   . A   A  1  59   ? 54.255  162.966 46.616  1.00 54.13  ? 60   A   A OP2   1 
ATOM   1073  O  "O5'" . A   A  1  59   ? 53.061  163.307 48.751  1.00 53.41  ? 60   A   A "O5'" 1 
ATOM   1074  C  "C5'" . A   A  1  59   ? 54.083  162.602 49.472  1.00 51.29  ? 60   A   A "C5'" 1 
ATOM   1075  C  "C4'" . A   A  1  59   ? 53.475  161.441 50.233  1.00 50.19  ? 60   A   A "C4'" 1 
ATOM   1076  O  "O4'" . A   A  1  59   ? 52.153  161.821 50.713  1.00 51.24  ? 60   A   A "O4'" 1 
ATOM   1077  C  "C3'" . A   A  1  59   ? 53.236  160.152 49.461  1.00 48.41  ? 60   A   A "C3'" 1 
ATOM   1078  O  "O3'" . A   A  1  59   ? 54.435  159.389 49.439  1.00 47.41  ? 60   A   A "O3'" 1 
ATOM   1079  C  "C2'" . A   A  1  59   ? 52.169  159.493 50.316  1.00 49.36  ? 60   A   A "C2'" 1 
ATOM   1080  O  "O2'" . A   A  1  59   ? 52.736  158.987 51.505  1.00 49.35  ? 60   A   A "O2'" 1 
ATOM   1081  C  "C1'" . A   A  1  59   ? 51.291  160.698 50.659  1.00 51.11  ? 60   A   A "C1'" 1 
ATOM   1082  N  N9    . A   A  1  59   ? 50.298  160.943 49.614  1.00 53.54  ? 60   A   A N9    1 
ATOM   1083  C  C8    . A   A  1  59   ? 50.221  161.990 48.723  1.00 52.96  ? 60   A   A C8    1 
ATOM   1084  N  N7    . A   A  1  59   ? 49.231  161.879 47.871  1.00 52.79  ? 60   A   A N7    1 
ATOM   1085  C  C5    . A   A  1  59   ? 48.611  160.687 48.228  1.00 53.64  ? 60   A   A C5    1 
ATOM   1086  C  C6    . A   A  1  59   ? 47.510  159.996 47.699  1.00 53.62  ? 60   A   A C6    1 
ATOM   1087  N  N6    . A   A  1  59   ? 46.796  160.418 46.657  1.00 54.46  ? 60   A   A N6    1 
ATOM   1088  N  N1    . A   A  1  59   ? 47.157  158.837 48.285  1.00 53.89  ? 60   A   A N1    1 
ATOM   1089  C  C2    . A   A  1  59   ? 47.863  158.409 49.336  1.00 53.84  ? 60   A   A C2    1 
ATOM   1090  N  N3    . A   A  1  59   ? 48.921  158.966 49.924  1.00 53.41  ? 60   A   A N3    1 
ATOM   1091  C  C4    . A   A  1  59   ? 49.246  160.113 49.311  1.00 53.55  ? 60   A   A C4    1 
ATOM   1092  P  P     . G   A  1  60   ? 54.659  158.258 48.314  1.00 47.40  ? 61   G   A P     1 
ATOM   1093  O  OP1   . G   A  1  60   ? 55.992  157.655 48.517  1.00 48.45  ? 61   G   A OP1   1 
ATOM   1094  O  OP2   . G   A  1  60   ? 54.290  158.790 46.978  1.00 47.38  ? 61   G   A OP2   1 
ATOM   1095  O  "O5'" . G   A  1  60   ? 53.590  157.153 48.686  1.00 47.31  ? 61   G   A "O5'" 1 
ATOM   1096  C  "C5'" . G   A  1  60   ? 53.691  156.399 49.892  1.00 45.72  ? 61   G   A "C5'" 1 
ATOM   1097  C  "C4'" . G   A  1  60   ? 52.612  155.359 49.892  1.00 46.18  ? 61   G   A "C4'" 1 
ATOM   1098  O  "O4'" . G   A  1  60   ? 51.316  156.022 49.877  1.00 45.21  ? 61   G   A "O4'" 1 
ATOM   1099  C  "C3'" . G   A  1  60   ? 52.596  154.510 48.632  1.00 45.91  ? 61   G   A "C3'" 1 
ATOM   1100  O  "O3'" . G   A  1  60   ? 53.544  153.451 48.688  1.00 45.49  ? 61   G   A "O3'" 1 
ATOM   1101  C  "C2'" . G   A  1  60   ? 51.153  154.034 48.569  1.00 46.52  ? 61   G   A "C2'" 1 
ATOM   1102  O  "O2'" . G   A  1  60   ? 50.900  152.930 49.403  1.00 46.50  ? 61   G   A "O2'" 1 
ATOM   1103  C  "C1'" . G   A  1  60   ? 50.403  155.263 49.096  1.00 47.19  ? 61   G   A "C1'" 1 
ATOM   1104  N  N9    . G   A  1  60   ? 49.871  156.110 48.031  1.00 48.31  ? 61   G   A N9    1 
ATOM   1105  C  C8    . G   A  1  60   ? 50.316  157.353 47.664  1.00 49.13  ? 61   G   A C8    1 
ATOM   1106  N  N7    . G   A  1  60   ? 49.675  157.847 46.639  1.00 49.68  ? 61   G   A N7    1 
ATOM   1107  C  C5    . G   A  1  60   ? 48.746  156.873 46.308  1.00 49.54  ? 61   G   A C5    1 
ATOM   1108  C  C6    . G   A  1  60   ? 47.796  156.838 45.262  1.00 49.43  ? 61   G   A C6    1 
ATOM   1109  O  O6    . G   A  1  60   ? 47.590  157.681 44.387  1.00 48.97  ? 61   G   A O6    1 
ATOM   1110  N  N1    . G   A  1  60   ? 47.048  155.666 45.286  1.00 49.21  ? 61   G   A N1    1 
ATOM   1111  C  C2    . G   A  1  60   ? 47.199  154.651 46.194  1.00 49.64  ? 61   G   A C2    1 
ATOM   1112  N  N2    . G   A  1  60   ? 46.388  153.599 46.035  1.00 50.34  ? 61   G   A N2    1 
ATOM   1113  N  N3    . G   A  1  60   ? 48.088  154.667 47.180  1.00 49.44  ? 61   G   A N3    1 
ATOM   1114  C  C4    . G   A  1  60   ? 48.830  155.802 47.172  1.00 48.92  ? 61   G   A C4    1 
ATOM   1115  P  P     . C   A  1  61   ? 54.236  152.936 47.332  1.00 46.07  ? 62   C   A P     1 
ATOM   1116  O  OP1   . C   A  1  61   ? 55.212  151.870 47.683  1.00 46.31  ? 62   C   A OP1   1 
ATOM   1117  O  OP2   . C   A  1  61   ? 54.690  154.095 46.540  1.00 46.49  ? 62   C   A OP2   1 
ATOM   1118  O  "O5'" . C   A  1  61   ? 53.026  152.278 46.534  1.00 48.23  ? 62   C   A "O5'" 1 
ATOM   1119  C  "C5'" . C   A  1  61   ? 52.336  151.133 47.064  1.00 49.14  ? 62   C   A "C5'" 1 
ATOM   1120  C  "C4'" . C   A  1  61   ? 51.154  150.771 46.193  1.00 49.40  ? 62   C   A "C4'" 1 
ATOM   1121  O  "O4'" . C   A  1  61   ? 50.150  151.821 46.235  1.00 49.06  ? 62   C   A "O4'" 1 
ATOM   1122  C  "C3'" . C   A  1  61   ? 51.408  150.576 44.710  1.00 48.05  ? 62   C   A "C3'" 1 
ATOM   1123  O  "O3'" . C   A  1  61   ? 51.908  149.291 44.421  1.00 47.86  ? 62   C   A "O3'" 1 
ATOM   1124  C  "C2'" . C   A  1  61   ? 50.013  150.724 44.130  1.00 49.44  ? 62   C   A "C2'" 1 
ATOM   1125  O  "O2'" . C   A  1  61   ? 49.240  149.548 44.246  1.00 51.35  ? 62   C   A "O2'" 1 
ATOM   1126  C  "C1'" . C   A  1  61   ? 49.428  151.829 45.013  1.00 49.65  ? 62   C   A "C1'" 1 
ATOM   1127  N  N1    . C   A  1  61   ? 49.578  153.151 44.378  1.00 50.03  ? 62   C   A N1    1 
ATOM   1128  C  C2    . C   A  1  61   ? 48.623  153.571 43.432  1.00 50.47  ? 62   C   A C2    1 
ATOM   1129  O  O2    . C   A  1  61   ? 47.650  152.837 43.185  1.00 51.29  ? 62   C   A O2    1 
ATOM   1130  N  N3    . C   A  1  61   ? 48.796  154.766 42.819  1.00 49.78  ? 62   C   A N3    1 
ATOM   1131  C  C4    . C   A  1  61   ? 49.855  155.527 43.118  1.00 48.96  ? 62   C   A C4    1 
ATOM   1132  N  N4    . C   A  1  61   ? 49.998  156.682 42.477  1.00 49.09  ? 62   C   A N4    1 
ATOM   1133  C  C5    . C   A  1  61   ? 50.816  155.134 44.085  1.00 49.18  ? 62   C   A C5    1 
ATOM   1134  C  C6    . C   A  1  61   ? 50.641  153.955 44.686  1.00 50.12  ? 62   C   A C6    1 
ATOM   1135  P  P     . U   A  1  62   ? 52.816  149.079 43.119  1.00 48.63  ? 63   U   A P     1 
ATOM   1136  O  OP1   . U   A  1  62   ? 53.151  147.629 43.018  1.00 50.45  ? 63   U   A OP1   1 
ATOM   1137  O  OP2   . U   A  1  62   ? 53.908  150.072 43.224  1.00 49.85  ? 63   U   A OP2   1 
ATOM   1138  O  "O5'" . U   A  1  62   ? 51.878  149.484 41.888  1.00 50.49  ? 63   U   A "O5'" 1 
ATOM   1139  C  "C5'" . U   A  1  62   ? 50.859  148.574 41.396  1.00 51.42  ? 63   U   A "C5'" 1 
ATOM   1140  C  "C4'" . U   A  1  62   ? 50.083  149.189 40.246  1.00 51.46  ? 63   U   A "C4'" 1 
ATOM   1141  O  "O4'" . U   A  1  62   ? 49.434  150.415 40.690  1.00 51.42  ? 63   U   A "O4'" 1 
ATOM   1142  C  "C3'" . U   A  1  62   ? 50.860  149.635 39.019  1.00 50.61  ? 63   U   A "C3'" 1 
ATOM   1143  O  "O3'" . U   A  1  62   ? 51.203  148.567 38.158  1.00 49.52  ? 63   U   A "O3'" 1 
ATOM   1144  C  "C2'" . U   A  1  62   ? 49.854  150.564 38.370  1.00 51.32  ? 63   U   A "C2'" 1 
ATOM   1145  O  "O2'" . U   A  1  62   ? 48.792  149.812 37.811  1.00 50.78  ? 63   U   A "O2'" 1 
ATOM   1146  C  "C1'" . U   A  1  62   ? 49.334  151.314 39.598  1.00 51.88  ? 63   U   A "C1'" 1 
ATOM   1147  N  N1    . U   A  1  62   ? 50.145  152.507 39.902  1.00 53.71  ? 63   U   A N1    1 
ATOM   1148  C  C2    . U   A  1  62   ? 49.793  153.727 39.321  1.00 54.13  ? 63   U   A C2    1 
ATOM   1149  O  O2    . U   A  1  62   ? 48.856  153.859 38.556  1.00 55.29  ? 63   U   A O2    1 
ATOM   1150  N  N3    . U   A  1  62   ? 50.599  154.786 39.674  1.00 54.16  ? 63   U   A N3    1 
ATOM   1151  C  C4    . U   A  1  62   ? 51.697  154.758 40.511  1.00 54.18  ? 63   U   A C4    1 
ATOM   1152  O  O4    . U   A  1  62   ? 52.342  155.792 40.703  1.00 53.85  ? 63   U   A O4    1 
ATOM   1153  C  C5    . U   A  1  62   ? 51.994  153.479 41.057  1.00 53.76  ? 63   U   A C5    1 
ATOM   1154  C  C6    . U   A  1  62   ? 51.233  152.425 40.746  1.00 53.73  ? 63   U   A C6    1 
ATOM   1155  P  P     . G   A  1  63   ? 52.573  148.641 37.320  1.00 49.53  ? 64   G   A P     1 
ATOM   1156  O  OP1   . G   A  1  63   ? 52.774  147.324 36.668  1.00 50.20  ? 64   G   A OP1   1 
ATOM   1157  O  OP2   . G   A  1  63   ? 53.620  149.167 38.224  1.00 50.85  ? 64   G   A OP2   1 
ATOM   1158  O  "O5'" . G   A  1  63   ? 52.295  149.758 36.220  1.00 50.37  ? 64   G   A "O5'" 1 
ATOM   1159  C  "C5'" . G   A  1  63   ? 51.175  149.661 35.324  1.00 50.25  ? 64   G   A "C5'" 1 
ATOM   1160  C  "C4'" . G   A  1  63   ? 51.002  150.959 34.574  1.00 51.81  ? 64   G   A "C4'" 1 
ATOM   1161  O  "O4'" . G   A  1  63   ? 50.643  152.015 35.500  1.00 52.92  ? 64   G   A "O4'" 1 
ATOM   1162  C  "C3'" . G   A  1  63   ? 52.244  151.494 33.883  1.00 51.80  ? 64   G   A "C3'" 1 
ATOM   1163  O  "O3'" . G   A  1  63   ? 52.443  150.902 32.622  1.00 51.28  ? 64   G   A "O3'" 1 
ATOM   1164  C  "C2'" . G   A  1  63   ? 51.933  152.970 33.743  1.00 52.35  ? 64   G   A "C2'" 1 
ATOM   1165  O  "O2'" . G   A  1  63   ? 51.089  153.278 32.660  1.00 53.31  ? 64   G   A "O2'" 1 
ATOM   1166  C  "C1'" . G   A  1  63   ? 51.200  153.236 35.050  1.00 53.50  ? 64   G   A "C1'" 1 
ATOM   1167  N  N9    . G   A  1  63   ? 52.138  153.721 36.046  1.00 55.53  ? 64   G   A N9    1 
ATOM   1168  C  C8    . G   A  1  63   ? 52.729  153.017 37.069  1.00 56.65  ? 64   G   A C8    1 
ATOM   1169  N  N7    . G   A  1  63   ? 53.508  153.755 37.811  1.00 56.77  ? 64   G   A N7    1 
ATOM   1170  C  C5    . G   A  1  63   ? 53.429  155.018 37.235  1.00 56.80  ? 64   G   A C5    1 
ATOM   1171  C  C6    . G   A  1  63   ? 54.035  156.231 37.605  1.00 57.90  ? 64   G   A C6    1 
ATOM   1172  O  O6    . G   A  1  63   ? 54.789  156.450 38.559  1.00 60.70  ? 64   G   A O6    1 
ATOM   1173  N  N1    . G   A  1  63   ? 53.684  157.267 36.738  1.00 56.91  ? 64   G   A N1    1 
ATOM   1174  C  C2    . G   A  1  63   ? 52.854  157.146 35.657  1.00 55.02  ? 64   G   A C2    1 
ATOM   1175  N  N2    . G   A  1  63   ? 52.649  158.249 34.937  1.00 53.78  ? 64   G   A N2    1 
ATOM   1176  N  N3    . G   A  1  63   ? 52.270  156.022 35.309  1.00 55.94  ? 64   G   A N3    1 
ATOM   1177  C  C4    . G   A  1  63   ? 52.599  155.005 36.138  1.00 56.02  ? 64   G   A C4    1 
ATOM   1178  P  P     . C   A  1  64   ? 53.934  150.628 32.111  1.00 52.10  ? 65   C   A P     1 
ATOM   1179  O  OP1   . C   A  1  64   ? 53.862  149.769 30.904  1.00 52.59  ? 65   C   A OP1   1 
ATOM   1180  O  OP2   . C   A  1  64   ? 54.692  150.163 33.298  1.00 52.37  ? 65   C   A OP2   1 
ATOM   1181  O  "O5'" . C   A  1  64   ? 54.492  152.066 31.697  1.00 54.13  ? 65   C   A "O5'" 1 
ATOM   1182  C  "C5'" . C   A  1  64   ? 53.772  152.930 30.781  1.00 54.52  ? 65   C   A "C5'" 1 
ATOM   1183  C  "C4'" . C   A  1  64   ? 54.251  154.364 30.928  1.00 54.88  ? 65   C   A "C4'" 1 
ATOM   1184  O  "O4'" . C   A  1  64   ? 53.830  154.878 32.223  1.00 54.95  ? 65   C   A "O4'" 1 
ATOM   1185  C  "C3'" . C   A  1  64   ? 55.757  154.619 30.888  1.00 54.93  ? 65   C   A "C3'" 1 
ATOM   1186  O  "O3'" . C   A  1  64   ? 56.269  154.724 29.555  1.00 54.89  ? 65   C   A "O3'" 1 
ATOM   1187  C  "C2'" . C   A  1  64   ? 55.847  155.960 31.597  1.00 55.95  ? 65   C   A "C2'" 1 
ATOM   1188  O  "O2'" . C   A  1  64   ? 55.462  157.020 30.739  1.00 57.29  ? 65   C   A "O2'" 1 
ATOM   1189  C  "C1'" . C   A  1  64   ? 54.799  155.793 32.707  1.00 55.94  ? 65   C   A "C1'" 1 
ATOM   1190  N  N1    . C   A  1  64   ? 55.368  155.260 33.969  1.00 57.05  ? 65   C   A N1    1 
ATOM   1191  C  C2    . C   A  1  64   ? 55.980  156.145 34.899  1.00 57.79  ? 65   C   A C2    1 
ATOM   1192  O  O2    . C   A  1  64   ? 56.006  157.357 34.665  1.00 58.09  ? 65   C   A O2    1 
ATOM   1193  N  N3    . C   A  1  64   ? 56.522  155.636 36.028  1.00 57.16  ? 65   C   A N3    1 
ATOM   1194  C  C4    . C   A  1  64   ? 56.480  154.319 36.257  1.00 57.17  ? 65   C   A C4    1 
ATOM   1195  N  N4    . C   A  1  64   ? 57.049  153.858 37.373  1.00 57.65  ? 65   C   A N4    1 
ATOM   1196  C  C5    . C   A  1  64   ? 55.859  153.414 35.353  1.00 57.61  ? 65   C   A C5    1 
ATOM   1197  C  C6    . C   A  1  64   ? 55.320  153.920 34.235  1.00 57.43  ? 65   C   A C6    1 
ATOM   1198  P  P     . G   A  1  65   ? 57.832  154.425 29.256  1.00 55.68  ? 66   G   A P     1 
ATOM   1199  O  OP1   . G   A  1  65   ? 57.979  154.303 27.784  1.00 56.97  ? 66   G   A OP1   1 
ATOM   1200  O  OP2   . G   A  1  65   ? 58.282  153.311 30.123  1.00 56.20  ? 66   G   A OP2   1 
ATOM   1201  O  "O5'" . G   A  1  65   ? 58.617  155.740 29.704  1.00 55.18  ? 66   G   A "O5'" 1 
ATOM   1202  C  "C5'" . G   A  1  65   ? 58.189  157.052 29.275  1.00 54.37  ? 66   G   A "C5'" 1 
ATOM   1203  C  "C4'" . G   A  1  65   ? 59.055  158.120 29.912  1.00 53.78  ? 66   G   A "C4'" 1 
ATOM   1204  O  "O4'" . G   A  1  65   ? 58.988  157.978 31.359  1.00 53.69  ? 66   G   A "O4'" 1 
ATOM   1205  C  "C3'" . G   A  1  65   ? 60.542  158.080 29.558  1.00 52.50  ? 66   G   A "C3'" 1 
ATOM   1206  O  "O3'" . G   A  1  65   ? 61.053  159.418 29.636  1.00 52.18  ? 66   G   A "O3'" 1 
ATOM   1207  C  "C2'" . G   A  1  65   ? 61.114  157.215 30.682  1.00 52.29  ? 66   G   A "C2'" 1 
ATOM   1208  O  "O2'" . G   A  1  65   ? 62.482  157.446 30.915  1.00 52.33  ? 66   G   A "O2'" 1 
ATOM   1209  C  "C1'" . G   A  1  65   ? 60.281  157.699 31.871  1.00 53.09  ? 66   G   A "C1'" 1 
ATOM   1210  N  N9    . G   A  1  65   ? 60.148  156.775 32.998  1.00 52.72  ? 66   G   A N9    1 
ATOM   1211  C  C8    . G   A  1  65   ? 59.365  155.644 33.078  1.00 53.50  ? 66   G   A C8    1 
ATOM   1212  N  N7    . G   A  1  65   ? 59.437  155.053 34.240  1.00 53.19  ? 66   G   A N7    1 
ATOM   1213  C  C5    . G   A  1  65   ? 60.325  155.838 34.969  1.00 52.58  ? 66   G   A C5    1 
ATOM   1214  C  C6    . G   A  1  65   ? 60.800  155.708 36.311  1.00 51.08  ? 66   G   A C6    1 
ATOM   1215  O  O6    . G   A  1  65   ? 60.516  154.857 37.157  1.00 50.16  ? 66   G   A O6    1 
ATOM   1216  N  N1    . G   A  1  65   ? 61.696  156.714 36.631  1.00 51.27  ? 66   G   A N1    1 
ATOM   1217  C  C2    . G   A  1  65   ? 62.093  157.718 35.788  1.00 52.03  ? 66   G   A C2    1 
ATOM   1218  N  N2    . G   A  1  65   ? 62.999  158.579 36.281  1.00 52.45  ? 66   G   A N2    1 
ATOM   1219  N  N3    . G   A  1  65   ? 61.648  157.864 34.556  1.00 52.13  ? 66   G   A N3    1 
ATOM   1220  C  C4    . G   A  1  65   ? 60.777  156.895 34.213  1.00 52.29  ? 66   G   A C4    1 
ATOM   1221  P  P     . A   A  1  66   ? 60.952  160.411 28.364  1.00 50.85  ? 67   A   A P     1 
ATOM   1222  O  OP1   . A   A  1  66   ? 60.047  159.820 27.351  1.00 52.06  ? 67   A   A OP1   1 
ATOM   1223  O  OP2   . A   A  1  66   ? 62.323  160.816 27.975  1.00 50.47  ? 67   A   A OP2   1 
ATOM   1224  O  "O5'" . A   A  1  66   ? 60.207  161.703 28.918  1.00 50.28  ? 67   A   A "O5'" 1 
ATOM   1225  C  "C5'" . A   A  1  66   ? 60.579  162.283 30.177  1.00 51.54  ? 67   A   A "C5'" 1 
ATOM   1226  C  "C4'" . A   A  1  66   ? 60.984  163.728 29.980  1.00 53.11  ? 67   A   A "C4'" 1 
ATOM   1227  O  "O4'" . A   A  1  66   ? 61.424  164.269 31.257  1.00 54.34  ? 67   A   A "O4'" 1 
ATOM   1228  C  "C3'" . A   A  1  66   ? 62.148  163.937 29.011  1.00 53.83  ? 67   A   A "C3'" 1 
ATOM   1229  O  "O3'" . A   A  1  66   ? 62.003  165.194 28.338  1.00 52.46  ? 67   A   A "O3'" 1 
ATOM   1230  C  "C2'" . A   A  1  66   ? 63.357  163.940 29.943  1.00 54.45  ? 67   A   A "C2'" 1 
ATOM   1231  O  "O2'" . A   A  1  66   ? 64.460  164.652 29.427  1.00 55.83  ? 67   A   A "O2'" 1 
ATOM   1232  C  "C1'" . A   A  1  66   ? 62.792  164.647 31.175  1.00 55.53  ? 67   A   A "C1'" 1 
ATOM   1233  N  N9    . A   A  1  66   ? 63.454  164.255 32.427  1.00 56.71  ? 67   A   A N9    1 
ATOM   1234  C  C8    . A   A  1  66   ? 64.125  165.054 33.323  1.00 57.03  ? 67   A   A C8    1 
ATOM   1235  N  N7    . A   A  1  66   ? 64.597  164.406 34.359  1.00 56.82  ? 67   A   A N7    1 
ATOM   1236  C  C5    . A   A  1  66   ? 64.219  163.090 34.131  1.00 57.71  ? 67   A   A C5    1 
ATOM   1237  C  C6    . A   A  1  66   ? 64.424  161.898 34.859  1.00 57.83  ? 67   A   A C6    1 
ATOM   1238  N  N6    . A   A  1  66   ? 65.054  161.835 36.031  1.00 58.47  ? 67   A   A N6    1 
ATOM   1239  N  N1    . A   A  1  66   ? 63.943  160.754 34.336  1.00 57.71  ? 67   A   A N1    1 
ATOM   1240  C  C2    . A   A  1  66   ? 63.284  160.809 33.179  1.00 57.44  ? 67   A   A C2    1 
ATOM   1241  N  N3    . A   A  1  66   ? 63.011  161.860 32.411  1.00 57.81  ? 67   A   A N3    1 
ATOM   1242  C  C4    . A   A  1  66   ? 63.518  162.982 32.946  1.00 57.61  ? 67   A   A C4    1 
ATOM   1243  P  P     . U   A  1  67   ? 61.980  165.248 26.722  1.00 51.18  ? 68   U   A P     1 
ATOM   1244  O  OP1   . U   A  1  67   ? 62.896  164.185 26.191  1.00 49.27  ? 68   U   A OP1   1 
ATOM   1245  O  OP2   . U   A  1  67   ? 62.207  166.669 26.343  1.00 51.60  ? 68   U   A OP2   1 
ATOM   1246  O  "O5'" . U   A  1  67   ? 60.478  164.863 26.331  1.00 49.96  ? 68   U   A "O5'" 1 
ATOM   1247  C  "C5'" . U   A  1  67   ? 59.384  165.809 26.485  1.00 48.73  ? 68   U   A "C5'" 1 
ATOM   1248  C  "C4'" . U   A  1  67   ? 58.047  165.124 26.238  1.00 48.58  ? 68   U   A "C4'" 1 
ATOM   1249  O  "O4'" . U   A  1  67   ? 58.002  164.587 24.883  1.00 49.57  ? 68   U   A "O4'" 1 
ATOM   1250  C  "C3'" . U   A  1  67   ? 57.702  163.946 27.144  1.00 47.96  ? 68   U   A "C3'" 1 
ATOM   1251  O  "O3'" . U   A  1  67   ? 56.283  163.834 27.169  1.00 46.62  ? 68   U   A "O3'" 1 
ATOM   1252  C  "C2'" . U   A  1  67   ? 58.235  162.779 26.325  1.00 49.37  ? 68   U   A "C2'" 1 
ATOM   1253  O  "O2'" . U   A  1  67   ? 57.740  161.510 26.684  1.00 50.13  ? 68   U   A "O2'" 1 
ATOM   1254  C  "C1'" . U   A  1  67   ? 57.760  163.192 24.936  1.00 49.82  ? 68   U   A "C1'" 1 
ATOM   1255  N  N1    . U   A  1  67   ? 58.452  162.541 23.815  1.00 51.28  ? 68   U   A N1    1 
ATOM   1256  C  C2    . U   A  1  67   ? 57.726  161.669 22.998  1.00 51.61  ? 68   U   A C2    1 
ATOM   1257  O  O2    . U   A  1  67   ? 56.541  161.420 23.165  1.00 51.55  ? 68   U   A O2    1 
ATOM   1258  N  N3    . U   A  1  67   ? 58.450  161.107 21.972  1.00 50.72  ? 68   U   A N3    1 
ATOM   1259  C  C4    . U   A  1  67   ? 59.780  161.331 21.678  1.00 51.59  ? 68   U   A C4    1 
ATOM   1260  O  O4    . U   A  1  67   ? 60.261  160.849 20.656  1.00 52.18  ? 68   U   A O4    1 
ATOM   1261  C  C5    . U   A  1  67   ? 60.449  162.230 22.565  1.00 51.92  ? 68   U   A C5    1 
ATOM   1262  C  C6    . U   A  1  67   ? 59.782  162.788 23.576  1.00 52.10  ? 68   U   A C6    1 
ATOM   1263  P  P     . A   A  1  68   ? 55.449  164.249 28.474  1.00 45.13  ? 69   A   A P     1 
ATOM   1264  O  OP1   . A   A  1  68   ? 54.114  164.722 28.017  1.00 46.11  ? 69   A   A OP1   1 
ATOM   1265  O  OP2   . A   A  1  68   ? 56.299  165.156 29.279  1.00 45.02  ? 69   A   A OP2   1 
ATOM   1266  O  "O5'" . A   A  1  68   ? 55.222  162.852 29.212  1.00 45.90  ? 69   A   A "O5'" 1 
ATOM   1267  C  "C5'" . A   A  1  68   ? 56.314  161.935 29.372  1.00 47.46  ? 69   A   A "C5'" 1 
ATOM   1268  C  "C4'" . A   A  1  68   ? 55.959  160.793 30.309  1.00 47.91  ? 69   A   A "C4'" 1 
ATOM   1269  O  "O4'" . A   A  1  68   ? 57.238  160.304 30.810  1.00 48.68  ? 69   A   A "O4'" 1 
ATOM   1270  C  "C3'" . A   A  1  68   ? 55.136  161.142 31.553  1.00 47.99  ? 69   A   A "C3'" 1 
ATOM   1271  O  "O3'" . A   A  1  68   ? 53.751  160.775 31.447  1.00 47.00  ? 69   A   A "O3'" 1 
ATOM   1272  C  "C2'" . A   A  1  68   ? 55.811  160.358 32.671  1.00 48.77  ? 69   A   A "C2'" 1 
ATOM   1273  O  "O2'" . A   A  1  68   ? 55.343  159.033 32.774  1.00 48.33  ? 69   A   A "O2'" 1 
ATOM   1274  C  "C1'" . A   A  1  68   ? 57.270  160.384 32.226  1.00 49.82  ? 69   A   A "C1'" 1 
ATOM   1275  N  N9    . A   A  1  68   ? 57.973  161.614 32.604  1.00 50.69  ? 69   A   A N9    1 
ATOM   1276  C  C8    . A   A  1  68   ? 57.761  162.873 32.095  1.00 50.73  ? 69   A   A C8    1 
ATOM   1277  N  N7    . A   A  1  68   ? 58.528  163.795 32.627  1.00 51.60  ? 69   A   A N7    1 
ATOM   1278  C  C5    . A   A  1  68   ? 59.300  163.100 33.552  1.00 51.36  ? 69   A   A C5    1 
ATOM   1279  C  C6    . A   A  1  68   ? 60.300  163.515 34.453  1.00 50.58  ? 69   A   A C6    1 
ATOM   1280  N  N6    . A   A  1  68   ? 60.710  164.782 34.573  1.00 51.00  ? 69   A   A N6    1 
ATOM   1281  N  N1    . A   A  1  68   ? 60.872  162.578 35.235  1.00 51.31  ? 69   A   A N1    1 
ATOM   1282  C  C2    . A   A  1  68   ? 60.467  161.314 35.118  1.00 51.37  ? 69   A   A C2    1 
ATOM   1283  N  N3    . A   A  1  68   ? 59.537  160.795 34.313  1.00 52.38  ? 69   A   A N3    1 
ATOM   1284  C  C4    . A   A  1  68   ? 58.978  161.753 33.545  1.00 51.50  ? 69   A   A C4    1 
ATOM   1285  P  P     . A   A  1  69   ? 52.751  161.063 32.684  1.00 48.15  ? 70   A   A P     1 
ATOM   1286  O  OP1   . A   A  1  69   ? 52.066  162.358 32.474  1.00 47.74  ? 70   A   A OP1   1 
ATOM   1287  O  OP2   . A   A  1  69   ? 53.497  160.843 33.930  1.00 48.31  ? 70   A   A OP2   1 
ATOM   1288  O  "O5'" . A   A  1  69   ? 51.638  159.932 32.582  1.00 50.37  ? 70   A   A "O5'" 1 
ATOM   1289  C  "C5'" . A   A  1  69   ? 50.252  160.266 32.750  1.00 53.75  ? 70   A   A "C5'" 1 
ATOM   1290  C  "C4'" . A   A  1  69   ? 49.402  159.020 32.745  1.00 54.73  ? 70   A   A "C4'" 1 
ATOM   1291  O  "O4'" . A   A  1  69   ? 49.886  158.108 33.752  1.00 54.19  ? 70   A   A "O4'" 1 
ATOM   1292  C  "C3'" . A   A  1  69   ? 47.922  159.225 33.039  1.00 56.29  ? 70   A   A "C3'" 1 
ATOM   1293  O  "O3'" . A   A  1  69   ? 47.207  158.195 32.379  1.00 58.06  ? 70   A   A "O3'" 1 
ATOM   1294  C  "C2'" . A   A  1  69   ? 47.830  158.957 34.530  1.00 56.19  ? 70   A   A "C2'" 1 
ATOM   1295  O  "O2'" . A   A  1  69   ? 46.540  158.468 34.855  1.00 58.26  ? 70   A   A "O2'" 1 
ATOM   1296  C  "C1'" . A   A  1  69   ? 48.871  157.851 34.697  1.00 55.49  ? 70   A   A "C1'" 1 
ATOM   1297  N  N9    . A   A  1  69   ? 49.511  157.828 36.009  1.00 56.24  ? 70   A   A N9    1 
ATOM   1298  C  C8    . A   A  1  69   ? 49.614  156.767 36.866  1.00 56.38  ? 70   A   A C8    1 
ATOM   1299  N  N7    . A   A  1  69   ? 50.313  157.023 37.941  1.00 56.86  ? 70   A   A N7    1 
ATOM   1300  C  C5    . A   A  1  69   ? 50.679  158.352 37.794  1.00 56.45  ? 70   A   A C5    1 
ATOM   1301  C  C6    . A   A  1  69   ? 51.446  159.212 38.595  1.00 55.52  ? 70   A   A C6    1 
ATOM   1302  N  N6    . A   A  1  69   ? 52.006  158.843 39.749  1.00 54.23  ? 70   A   A N6    1 
ATOM   1303  N  N1    . A   A  1  69   ? 51.626  160.476 38.163  1.00 55.13  ? 70   A   A N1    1 
ATOM   1304  C  C2    . A   A  1  69   ? 51.073  160.840 37.002  1.00 56.02  ? 70   A   A C2    1 
ATOM   1305  N  N3    . A   A  1  69   ? 50.336  160.121 36.155  1.00 56.25  ? 70   A   A N3    1 
ATOM   1306  C  C4    . A   A  1  69   ? 50.176  158.868 36.616  1.00 56.62  ? 70   A   A C4    1 
ATOM   1307  P  P     . G   A  1  70   ? 46.781  158.388 30.849  1.00 60.23  ? 71   G   A P     1 
ATOM   1308  O  OP1   . G   A  1  70   ? 46.217  159.771 30.665  1.00 57.67  ? 71   G   A OP1   1 
ATOM   1309  O  OP2   . G   A  1  70   ? 45.983  157.192 30.468  1.00 59.79  ? 71   G   A OP2   1 
ATOM   1310  O  "O5'" . G   A  1  70   ? 48.166  158.307 30.076  1.00 57.16  ? 71   G   A "O5'" 1 
ATOM   1311  C  "C5'" . G   A  1  70   ? 48.296  158.754 28.725  1.00 54.51  ? 71   G   A "C5'" 1 
ATOM   1312  C  "C4'" . G   A  1  70   ? 49.469  159.679 28.625  1.00 52.83  ? 71   G   A "C4'" 1 
ATOM   1313  O  "O4'" . G   A  1  70   ? 50.569  159.154 29.404  1.00 49.78  ? 71   G   A "O4'" 1 
ATOM   1314  C  "C3'" . G   A  1  70   ? 50.022  159.889 27.230  1.00 53.58  ? 71   G   A "C3'" 1 
ATOM   1315  O  "O3'" . G   A  1  70   ? 49.314  160.922 26.552  1.00 56.33  ? 71   G   A "O3'" 1 
ATOM   1316  C  "C2'" . G   A  1  70   ? 51.482  160.221 27.513  1.00 51.24  ? 71   G   A "C2'" 1 
ATOM   1317  O  "O2'" . G   A  1  70   ? 51.689  161.539 27.989  1.00 54.28  ? 71   G   A "O2'" 1 
ATOM   1318  C  "C1'" . G   A  1  70   ? 51.764  159.285 28.678  1.00 47.93  ? 71   G   A "C1'" 1 
ATOM   1319  N  N9    . G   A  1  70   ? 52.169  157.954 28.265  1.00 45.39  ? 71   G   A N9    1 
ATOM   1320  C  C8    . G   A  1  70   ? 51.461  156.787 28.426  1.00 45.66  ? 71   G   A C8    1 
ATOM   1321  N  N7    . G   A  1  70   ? 52.109  155.731 28.016  1.00 45.97  ? 71   G   A N7    1 
ATOM   1322  C  C5    . G   A  1  70   ? 53.312  156.234 27.543  1.00 45.24  ? 71   G   A C5    1 
ATOM   1323  C  C6    . G   A  1  70   ? 54.426  155.565 27.006  1.00 45.47  ? 71   G   A C6    1 
ATOM   1324  O  O6    . G   A  1  70   ? 54.581  154.347 26.845  1.00 45.65  ? 71   G   A O6    1 
ATOM   1325  N  N1    . G   A  1  70   ? 55.439  156.457 26.654  1.00 45.13  ? 71   G   A N1    1 
ATOM   1326  C  C2    . G   A  1  70   ? 55.382  157.816 26.815  1.00 45.04  ? 71   G   A C2    1 
ATOM   1327  N  N2    . G   A  1  70   ? 56.459  158.505 26.432  1.00 44.58  ? 71   G   A N2    1 
ATOM   1328  N  N3    . G   A  1  70   ? 54.344  158.455 27.324  1.00 45.27  ? 71   G   A N3    1 
ATOM   1329  C  C4    . G   A  1  70   ? 53.354  157.609 27.670  1.00 45.04  ? 71   G   A C4    1 
ATOM   1330  P  P     . C   A  1  71   ? 48.740  160.660 25.077  1.00 57.44  ? 72   C   A P     1 
ATOM   1331  O  OP1   . C   A  1  71   ? 47.780  161.770 24.819  1.00 56.47  ? 72   C   A OP1   1 
ATOM   1332  O  OP2   . C   A  1  71   ? 48.283  159.251 24.966  1.00 57.18  ? 72   C   A OP2   1 
ATOM   1333  O  "O5'" . C   A  1  71   ? 50.012  160.834 24.135  1.00 55.53  ? 72   C   A "O5'" 1 
ATOM   1334  C  "C5'" . C   A  1  71   ? 50.555  162.135 23.869  1.00 54.25  ? 72   C   A "C5'" 1 
ATOM   1335  C  "C4'" . C   A  1  71   ? 51.589  162.050 22.780  1.00 53.34  ? 72   C   A "C4'" 1 
ATOM   1336  O  "O4'" . C   A  1  71   ? 52.712  161.250 23.235  1.00 53.13  ? 72   C   A "O4'" 1 
ATOM   1337  C  "C3'" . C   A  1  71   ? 51.140  161.335 21.524  1.00 53.06  ? 72   C   A "C3'" 1 
ATOM   1338  O  "O3'" . C   A  1  71   ? 50.303  162.128 20.687  1.00 53.67  ? 72   C   A "O3'" 1 
ATOM   1339  C  "C2'" . C   A  1  71   ? 52.469  160.941 20.906  1.00 52.26  ? 72   C   A "C2'" 1 
ATOM   1340  O  "O2'" . C   A  1  71   ? 53.118  162.073 20.360  1.00 53.01  ? 72   C   A "O2'" 1 
ATOM   1341  C  "C1'" . C   A  1  71   ? 53.232  160.488 22.151  1.00 51.80  ? 72   C   A "C1'" 1 
ATOM   1342  N  N1    . C   A  1  71   ? 53.089  159.046 22.481  1.00 51.12  ? 72   C   A N1    1 
ATOM   1343  C  C2    . C   A  1  71   ? 53.775  158.089 21.705  1.00 50.66  ? 72   C   A C2    1 
ATOM   1344  O  O2    . C   A  1  71   ? 54.464  158.471 20.746  1.00 50.91  ? 72   C   A O2    1 
ATOM   1345  N  N3    . C   A  1  71   ? 53.665  156.773 22.024  1.00 49.70  ? 72   C   A N3    1 
ATOM   1346  C  C4    . C   A  1  71   ? 52.916  156.399 23.065  1.00 49.93  ? 72   C   A C4    1 
ATOM   1347  N  N4    . C   A  1  71   ? 52.846  155.101 23.352  1.00 50.26  ? 72   C   A N4    1 
ATOM   1348  C  C5    . C   A  1  71   ? 52.202  157.346 23.862  1.00 49.72  ? 72   C   A C5    1 
ATOM   1349  C  C6    . C   A  1  71   ? 52.312  158.643 23.535  1.00 50.09  ? 72   C   A C6    1 
ATOM   1350  P  P     . C   A  1  72   ? 49.130  161.408 19.853  1.00 53.86  ? 73   C   A P     1 
ATOM   1351  O  OP1   . C   A  1  72   ? 48.299  162.462 19.236  1.00 52.62  ? 73   C   A OP1   1 
ATOM   1352  O  OP2   . C   A  1  72   ? 48.488  160.375 20.712  1.00 52.23  ? 73   C   A OP2   1 
ATOM   1353  O  "O5'" . C   A  1  72   ? 49.922  160.640 18.708  1.00 52.08  ? 73   C   A "O5'" 1 
ATOM   1354  C  "C5'" . C   A  1  72   ? 50.671  161.349 17.712  1.00 53.28  ? 73   C   A "C5'" 1 
ATOM   1355  C  "C4'" . C   A  1  72   ? 51.274  160.366 16.750  1.00 54.00  ? 73   C   A "C4'" 1 
ATOM   1356  O  "O4'" . C   A  1  72   ? 52.164  159.482 17.469  1.00 54.17  ? 73   C   A "O4'" 1 
ATOM   1357  C  "C3'" . C   A  1  72   ? 50.277  159.428 16.094  1.00 55.54  ? 73   C   A "C3'" 1 
ATOM   1358  O  "O3'" . C   A  1  72   ? 49.653  160.047 14.975  1.00 56.64  ? 73   C   A "O3'" 1 
ATOM   1359  C  "C2'" . C   A  1  72   ? 51.160  158.263 15.687  1.00 56.08  ? 73   C   A "C2'" 1 
ATOM   1360  O  "O2'" . C   A  1  72   ? 51.885  158.539 14.506  1.00 56.43  ? 73   C   A "O2'" 1 
ATOM   1361  C  "C1'" . C   A  1  72   ? 52.130  158.200 16.872  1.00 55.88  ? 73   C   A "C1'" 1 
ATOM   1362  N  N1    . C   A  1  72   ? 51.768  157.191 17.889  1.00 55.73  ? 73   C   A N1    1 
ATOM   1363  C  C2    . C   A  1  72   ? 51.959  155.835 17.577  1.00 55.58  ? 73   C   A C2    1 
ATOM   1364  O  O2    . C   A  1  72   ? 52.443  155.538 16.476  1.00 55.26  ? 73   C   A O2    1 
ATOM   1365  N  N3    . C   A  1  72   ? 51.610  154.890 18.481  1.00 56.12  ? 73   C   A N3    1 
ATOM   1366  C  C4    . C   A  1  72   ? 51.095  155.256 19.659  1.00 56.51  ? 73   C   A C4    1 
ATOM   1367  N  N4    . C   A  1  72   ? 50.764  154.290 20.526  1.00 57.41  ? 73   C   A N4    1 
ATOM   1368  C  C5    . C   A  1  72   ? 50.898  156.628 20.004  1.00 55.96  ? 73   C   A C5    1 
ATOM   1369  C  C6    . C   A  1  72   ? 51.246  157.551 19.102  1.00 56.00  ? 73   C   A C6    1 
ATOM   1370  P  P     . A   A  1  73   ? 48.215  159.534 14.473  1.00 58.27  ? 74   A   A P     1 
ATOM   1371  O  OP1   . A   A  1  73   ? 47.800  160.462 13.394  1.00 59.72  ? 74   A   A OP1   1 
ATOM   1372  O  OP2   . A   A  1  73   ? 47.312  159.317 15.637  1.00 58.47  ? 74   A   A OP2   1 
ATOM   1373  O  "O5'" . A   A  1  73   ? 48.541  158.135 13.790  1.00 57.51  ? 74   A   A "O5'" 1 
ATOM   1374  C  "C5'" . A   A  1  73   ? 49.383  158.077 12.620  1.00 58.26  ? 74   A   A "C5'" 1 
ATOM   1375  C  "C4'" . A   A  1  73   ? 49.512  156.656 12.150  1.00 58.67  ? 74   A   A "C4'" 1 
ATOM   1376  O  "O4'" . A   A  1  73   ? 50.266  155.886 13.121  1.00 60.12  ? 74   A   A "O4'" 1 
ATOM   1377  C  "C3'" . A   A  1  73   ? 48.193  155.919 12.011  1.00 58.48  ? 74   A   A "C3'" 1 
ATOM   1378  O  "O3'" . A   A  1  73   ? 47.593  156.229 10.757  1.00 57.75  ? 74   A   A "O3'" 1 
ATOM   1379  C  "C2'" . A   A  1  73   ? 48.632  154.468 12.115  1.00 59.02  ? 74   A   A "C2'" 1 
ATOM   1380  O  "O2'" . A   A  1  73   ? 49.143  154.002 10.890  1.00 58.91  ? 74   A   A "O2'" 1 
ATOM   1381  C  "C1'" . A   A  1  73   ? 49.762  154.558 13.159  1.00 59.77  ? 74   A   A "C1'" 1 
ATOM   1382  N  N9    . A   A  1  73   ? 49.349  154.261 14.539  1.00 58.49  ? 74   A   A N9    1 
ATOM   1383  C  C8    . A   A  1  73   ? 48.958  155.152 15.512  1.00 57.98  ? 74   A   A C8    1 
ATOM   1384  N  N7    . A   A  1  73   ? 48.590  154.579 16.633  1.00 57.68  ? 74   A   A N7    1 
ATOM   1385  C  C5    . A   A  1  73   ? 48.762  153.220 16.390  1.00 57.34  ? 74   A   A C5    1 
ATOM   1386  C  C6    . A   A  1  73   ? 48.526  152.071 17.180  1.00 57.41  ? 74   A   A C6    1 
ATOM   1387  N  N6    . A   A  1  73   ? 48.022  152.111 18.420  1.00 57.10  ? 74   A   A N6    1 
ATOM   1388  N  N1    . A   A  1  73   ? 48.818  150.861 16.637  1.00 56.67  ? 74   A   A N1    1 
ATOM   1389  C  C2    . A   A  1  73   ? 49.299  150.819 15.388  1.00 56.62  ? 74   A   A C2    1 
ATOM   1390  N  N3    . A   A  1  73   ? 49.548  151.826 14.547  1.00 57.24  ? 74   A   A N3    1 
ATOM   1391  C  C4    . A   A  1  73   ? 49.250  153.011 15.114  1.00 57.28  ? 74   A   A C4    1 
ATOM   1392  P  P     . U   A  1  74   ? 45.996  156.197 10.595  1.00 57.42  ? 75   U   A P     1 
ATOM   1393  O  OP1   . U   A  1  74   ? 45.744  156.750 9.240   1.00 57.74  ? 75   U   A OP1   1 
ATOM   1394  O  OP2   . U   A  1  74   ? 45.351  156.849 11.760  1.00 57.44  ? 75   U   A OP2   1 
ATOM   1395  O  "O5'" . U   A  1  74   ? 45.663  154.632 10.606  1.00 57.64  ? 75   U   A "O5'" 1 
ATOM   1396  C  "C5'" . U   A  1  74   ? 46.125  153.766 9.533   1.00 58.54  ? 75   U   A "C5'" 1 
ATOM   1397  C  "C4'" . U   A  1  74   ? 45.890  152.297 9.856   1.00 60.23  ? 75   U   A "C4'" 1 
ATOM   1398  O  "O4'" . U   A  1  74   ? 46.794  151.832 10.899  1.00 61.42  ? 75   U   A "O4'" 1 
ATOM   1399  C  "C3'" . U   A  1  74   ? 44.512  151.916 10.366  1.00 60.70  ? 75   U   A "C3'" 1 
ATOM   1400  O  "O3'" . U   A  1  74   ? 43.531  151.808 9.355   1.00 61.87  ? 75   U   A "O3'" 1 
ATOM   1401  C  "C2'" . U   A  1  74   ? 44.764  150.586 11.063  1.00 61.68  ? 75   U   A "C2'" 1 
ATOM   1402  O  "O2'" . U   A  1  74   ? 44.743  149.454 10.217  1.00 61.39  ? 75   U   A "O2'" 1 
ATOM   1403  C  "C1'" . U   A  1  74   ? 46.141  150.835 11.689  1.00 62.02  ? 75   U   A "C1'" 1 
ATOM   1404  N  N1    . U   A  1  74   ? 45.963  151.357 13.055  1.00 63.31  ? 75   U   A N1    1 
ATOM   1405  C  C2    . U   A  1  74   ? 45.896  150.449 14.110  1.00 63.98  ? 75   U   A C2    1 
ATOM   1406  O  O2    . U   A  1  74   ? 46.041  149.237 13.967  1.00 65.47  ? 75   U   A O2    1 
ATOM   1407  N  N3    . U   A  1  74   ? 45.652  151.010 15.339  1.00 62.12  ? 75   U   A N3    1 
ATOM   1408  C  C4    . U   A  1  74   ? 45.484  152.339 15.622  1.00 60.56  ? 75   U   A C4    1 
ATOM   1409  O  O4    . U   A  1  74   ? 45.215  152.679 16.769  1.00 58.54  ? 75   U   A O4    1 
ATOM   1410  C  C5    . U   A  1  74   ? 45.599  153.207 14.496  1.00 61.74  ? 75   U   A C5    1 
ATOM   1411  C  C6    . U   A  1  74   ? 45.831  152.701 13.285  1.00 62.65  ? 75   U   A C6    1 
ATOM   1412  P  P     . G   A  1  75   ? 41.998  152.079 9.733   1.00 63.10  ? 76   G   A P     1 
ATOM   1413  O  OP1   . G   A  1  75   ? 41.227  152.079 8.465   1.00 63.30  ? 76   G   A OP1   1 
ATOM   1414  O  OP2   . G   A  1  75   ? 41.967  153.276 10.619  1.00 62.18  ? 76   G   A OP2   1 
ATOM   1415  O  "O5'" . G   A  1  75   ? 41.594  150.788 10.576  1.00 63.75  ? 76   G   A "O5'" 1 
ATOM   1416  C  "C5'" . G   A  1  75   ? 41.542  149.490 9.952   1.00 65.21  ? 76   G   A "C5'" 1 
ATOM   1417  C  "C4'" . G   A  1  75   ? 41.347  148.406 10.988  1.00 65.00  ? 76   G   A "C4'" 1 
ATOM   1418  O  "O4'" . G   A  1  75   ? 42.463  148.450 11.923  1.00 65.31  ? 76   G   A "O4'" 1 
ATOM   1419  C  "C3'" . G   A  1  75   ? 40.120  148.541 11.883  1.00 64.48  ? 76   G   A "C3'" 1 
ATOM   1420  O  "O3'" . G   A  1  75   ? 38.899  148.072 11.307  1.00 63.66  ? 76   G   A "O3'" 1 
ATOM   1421  C  "C2'" . G   A  1  75   ? 40.530  147.709 13.080  1.00 65.10  ? 76   G   A "C2'" 1 
ATOM   1422  O  "O2'" . G   A  1  75   ? 40.387  146.330 12.819  1.00 66.99  ? 76   G   A "O2'" 1 
ATOM   1423  C  "C1'" . G   A  1  75   ? 42.008  148.090 13.220  1.00 65.66  ? 76   G   A "C1'" 1 
ATOM   1424  N  N9    . G   A  1  75   ? 42.161  149.237 14.116  1.00 65.92  ? 76   G   A N9    1 
ATOM   1425  C  C8    . G   A  1  75   ? 42.485  150.535 13.785  1.00 66.13  ? 76   G   A C8    1 
ATOM   1426  N  N7    . G   A  1  75   ? 42.487  151.340 14.815  1.00 65.73  ? 76   G   A N7    1 
ATOM   1427  C  C5    . G   A  1  75   ? 42.161  150.523 15.894  1.00 65.23  ? 76   G   A C5    1 
ATOM   1428  C  C6    . G   A  1  75   ? 41.998  150.830 17.280  1.00 63.76  ? 76   G   A C6    1 
ATOM   1429  O  O6    . G   A  1  75   ? 42.121  151.917 17.851  1.00 62.26  ? 76   G   A O6    1 
ATOM   1430  N  N1    . G   A  1  75   ? 41.651  149.703 18.013  1.00 63.32  ? 76   G   A N1    1 
ATOM   1431  C  C2    . G   A  1  75   ? 41.485  148.444 17.495  1.00 64.48  ? 76   G   A C2    1 
ATOM   1432  N  N2    . G   A  1  75   ? 41.144  147.484 18.361  1.00 64.16  ? 76   G   A N2    1 
ATOM   1433  N  N3    . G   A  1  75   ? 41.638  148.142 16.221  1.00 65.36  ? 76   G   A N3    1 
ATOM   1434  C  C4    . G   A  1  75   ? 41.969  149.222 15.480  1.00 65.89  ? 76   G   A C4    1 
ATOM   1435  P  P     . G   A  1  76   ? 37.503  148.787 11.694  1.00 63.63  ? 77   G   A P     1 
ATOM   1436  O  OP1   . G   A  1  76   ? 36.465  148.240 10.788  1.00 64.28  ? 77   G   A OP1   1 
ATOM   1437  O  OP2   . G   A  1  76   ? 37.700  150.258 11.771  1.00 63.14  ? 77   G   A OP2   1 
ATOM   1438  O  "O5'" . G   A  1  76   ? 37.181  148.279 13.169  1.00 64.09  ? 77   G   A "O5'" 1 
ATOM   1439  C  "C5'" . G   A  1  76   ? 37.054  146.886 13.465  1.00 64.09  ? 77   G   A "C5'" 1 
ATOM   1440  C  "C4'" . G   A  1  76   ? 37.027  146.667 14.961  1.00 64.61  ? 77   G   A "C4'" 1 
ATOM   1441  O  "O4'" . G   A  1  76   ? 38.241  147.213 15.548  1.00 64.86  ? 77   G   A "O4'" 1 
ATOM   1442  C  "C3'" . G   A  1  76   ? 35.925  147.370 15.746  1.00 64.90  ? 77   G   A "C3'" 1 
ATOM   1443  O  "O3'" . G   A  1  76   ? 34.665  146.702 15.736  1.00 64.34  ? 77   G   A "O3'" 1 
ATOM   1444  C  "C2'" . G   A  1  76   ? 36.492  147.350 17.153  1.00 65.73  ? 77   G   A "C2'" 1 
ATOM   1445  O  "O2'" . G   A  1  76   ? 36.341  146.069 17.727  1.00 66.42  ? 77   G   A "O2'" 1 
ATOM   1446  C  "C1'" . G   A  1  76   ? 37.977  147.616 16.887  1.00 65.13  ? 77   G   A "C1'" 1 
ATOM   1447  N  N9    . G   A  1  76   ? 38.356  149.022 17.075  1.00 64.36  ? 77   G   A N9    1 
ATOM   1448  C  C8    . G   A  1  76   ? 38.711  149.944 16.115  1.00 63.46  ? 77   G   A C8    1 
ATOM   1449  N  N7    . G   A  1  76   ? 38.989  151.119 16.613  1.00 63.67  ? 77   G   A N7    1 
ATOM   1450  C  C5    . G   A  1  76   ? 38.807  150.968 17.985  1.00 63.76  ? 77   G   A C5    1 
ATOM   1451  C  C6    . G   A  1  76   ? 38.958  151.909 19.064  1.00 63.49  ? 77   G   A C6    1 
ATOM   1452  O  O6    . G   A  1  76   ? 39.269  153.107 19.019  1.00 62.60  ? 77   G   A O6    1 
ATOM   1453  N  N1    . G   A  1  76   ? 38.691  151.320 20.293  1.00 63.39  ? 77   G   A N1    1 
ATOM   1454  C  C2    . G   A  1  76   ? 38.323  150.015 20.480  1.00 63.39  ? 77   G   A C2    1 
ATOM   1455  N  N2    . G   A  1  76   ? 38.139  149.637 21.753  1.00 63.14  ? 77   G   A N2    1 
ATOM   1456  N  N3    . G   A  1  76   ? 38.156  149.143 19.498  1.00 63.34  ? 77   G   A N3    1 
ATOM   1457  C  C4    . G   A  1  76   ? 38.419  149.682 18.286  1.00 63.66  ? 77   G   A C4    1 
ATOM   1458  P  P     . G   A  1  77   ? 33.325  147.546 16.002  1.00 63.78  ? 78   G   A P     1 
ATOM   1459  O  OP1   . G   A  1  77   ? 32.178  146.614 16.165  1.00 64.75  ? 78   G   A OP1   1 
ATOM   1460  O  OP2   . G   A  1  77   ? 33.289  148.564 14.931  1.00 63.67  ? 78   G   A OP2   1 
ATOM   1461  O  "O5'" . G   A  1  77   ? 33.592  148.286 17.391  1.00 62.26  ? 78   G   A "O5'" 1 
ATOM   1462  C  "C5'" . G   A  1  77   ? 33.526  147.591 18.653  1.00 57.68  ? 78   G   A "C5'" 1 
ATOM   1463  C  "C4'" . G   A  1  77   ? 33.633  148.582 19.792  1.00 57.14  ? 78   G   A "C4'" 1 
ATOM   1464  O  "O4'" . G   A  1  77   ? 34.914  149.268 19.712  1.00 57.29  ? 78   G   A "O4'" 1 
ATOM   1465  C  "C3'" . G   A  1  77   ? 32.609  149.698 19.743  1.00 56.80  ? 78   G   A "C3'" 1 
ATOM   1466  O  "O3'" . G   A  1  77   ? 31.377  149.297 20.323  1.00 56.76  ? 78   G   A "O3'" 1 
ATOM   1467  C  "C2'" . G   A  1  77   ? 33.298  150.842 20.481  1.00 57.21  ? 78   G   A "C2'" 1 
ATOM   1468  O  "O2'" . G   A  1  77   ? 33.166  150.748 21.883  1.00 55.65  ? 78   G   A "O2'" 1 
ATOM   1469  C  "C1'" . G   A  1  77   ? 34.765  150.640 20.070  1.00 57.21  ? 78   G   A "C1'" 1 
ATOM   1470  N  N9    . G   A  1  77   ? 35.241  151.466 18.951  1.00 57.43  ? 78   G   A N9    1 
ATOM   1471  C  C8    . G   A  1  77   ? 35.220  151.109 17.625  1.00 56.88  ? 78   G   A C8    1 
ATOM   1472  N  N7    . G   A  1  77   ? 35.695  152.030 16.832  1.00 56.50  ? 78   G   A N7    1 
ATOM   1473  C  C5    . G   A  1  77   ? 36.061  153.068 17.679  1.00 56.63  ? 78   G   A C5    1 
ATOM   1474  C  C6    . G   A  1  77   ? 36.638  154.348 17.387  1.00 57.01  ? 78   G   A C6    1 
ATOM   1475  O  O6    . G   A  1  77   ? 36.944  154.838 16.287  1.00 57.65  ? 78   G   A O6    1 
ATOM   1476  N  N1    . G   A  1  77   ? 36.846  155.086 18.544  1.00 57.06  ? 78   G   A N1    1 
ATOM   1477  C  C2    . G   A  1  77   ? 36.551  154.670 19.814  1.00 56.89  ? 78   G   A C2    1 
ATOM   1478  N  N2    . G   A  1  77   ? 36.834  155.542 20.793  1.00 56.45  ? 78   G   A N2    1 
ATOM   1479  N  N3    . G   A  1  77   ? 36.018  153.488 20.104  1.00 57.92  ? 78   G   A N3    1 
ATOM   1480  C  C4    . G   A  1  77   ? 35.796  152.742 18.996  1.00 56.98  ? 78   G   A C4    1 
ATOM   1481  P  P     . G   A  1  78   ? 29.999  149.774 19.655  1.00 56.30  ? 79   G   A P     1 
ATOM   1482  O  OP1   . G   A  1  78   ? 28.870  148.984 20.213  1.00 55.93  ? 79   G   A OP1   1 
ATOM   1483  O  OP2   . G   A  1  78   ? 30.228  149.793 18.182  1.00 57.13  ? 79   G   A OP2   1 
ATOM   1484  O  "O5'" . G   A  1  78   ? 29.844  151.266 20.195  1.00 54.83  ? 79   G   A "O5'" 1 
ATOM   1485  C  "C5'" . G   A  1  78   ? 29.789  151.524 21.614  1.00 53.15  ? 79   G   A "C5'" 1 
ATOM   1486  C  "C4'" . G   A  1  78   ? 30.167  152.947 21.913  1.00 51.44  ? 79   G   A "C4'" 1 
ATOM   1487  O  "O4'" . G   A  1  78   ? 31.515  153.234 21.479  1.00 51.12  ? 79   G   A "O4'" 1 
ATOM   1488  C  "C3'" . G   A  1  78   ? 29.300  153.986 21.243  1.00 50.86  ? 79   G   A "C3'" 1 
ATOM   1489  O  "O3'" . G   A  1  78   ? 28.123  154.141 22.033  1.00 48.56  ? 79   G   A "O3'" 1 
ATOM   1490  C  "C2'" . G   A  1  78   ? 30.215  155.206 21.217  1.00 52.55  ? 79   G   A "C2'" 1 
ATOM   1491  O  "O2'" . G   A  1  78   ? 30.250  155.907 22.448  1.00 54.64  ? 79   G   A "O2'" 1 
ATOM   1492  C  "C1'" . G   A  1  78   ? 31.582  154.556 20.988  1.00 53.46  ? 79   G   A "C1'" 1 
ATOM   1493  N  N9    . G   A  1  78   ? 31.983  154.496 19.583  1.00 56.21  ? 79   G   A N9    1 
ATOM   1494  C  C8    . G   A  1  78   ? 31.577  153.578 18.646  1.00 57.56  ? 79   G   A C8    1 
ATOM   1495  N  N7    . G   A  1  78   ? 32.124  153.761 17.472  1.00 58.39  ? 79   G   A N7    1 
ATOM   1496  C  C5    . G   A  1  78   ? 32.942  154.863 17.637  1.00 57.89  ? 79   G   A C5    1 
ATOM   1497  C  C6    . G   A  1  78   ? 33.792  155.515 16.706  1.00 58.10  ? 79   G   A C6    1 
ATOM   1498  O  O6    . G   A  1  78   ? 34.001  155.223 15.521  1.00 56.15  ? 79   G   A O6    1 
ATOM   1499  N  N1    . G   A  1  78   ? 34.437  156.610 17.281  1.00 58.52  ? 79   G   A N1    1 
ATOM   1500  C  C2    . G   A  1  78   ? 34.278  157.019 18.581  1.00 59.00  ? 79   G   A C2    1 
ATOM   1501  N  N2    . G   A  1  78   ? 34.959  158.106 18.944  1.00 59.72  ? 79   G   A N2    1 
ATOM   1502  N  N3    . G   A  1  78   ? 33.499  156.409 19.465  1.00 59.17  ? 79   G   A N3    1 
ATOM   1503  C  C4    . G   A  1  78   ? 32.862  155.345 18.929  1.00 57.62  ? 79   G   A C4    1 
ATOM   1504  P  P     . A   A  1  79   ? 27.016  155.230 21.644  1.00 46.98  ? 80   A   A P     1 
ATOM   1505  O  OP1   . A   A  1  79   ? 25.719  154.683 22.105  1.00 47.52  ? 80   A   A OP1   1 
ATOM   1506  O  OP2   . A   A  1  79   ? 27.176  155.605 20.212  1.00 47.44  ? 80   A   A OP2   1 
ATOM   1507  O  "O5'" . A   A  1  79   ? 27.400  156.480 22.563  1.00 47.67  ? 80   A   A "O5'" 1 
ATOM   1508  C  "C5'" . A   A  1  79   ? 27.528  156.335 23.996  1.00 50.66  ? 80   A   A "C5'" 1 
ATOM   1509  C  "C4'" . A   A  1  79   ? 28.011  157.624 24.643  1.00 53.03  ? 80   A   A "C4'" 1 
ATOM   1510  O  "O4'" . A   A  1  79   ? 29.313  157.968 24.090  1.00 53.94  ? 80   A   A "O4'" 1 
ATOM   1511  C  "C3'" . A   A  1  79   ? 27.124  158.860 24.466  1.00 53.20  ? 80   A   A "C3'" 1 
ATOM   1512  O  "O3'" . A   A  1  79   ? 27.241  159.756 25.574  1.00 51.83  ? 80   A   A "O3'" 1 
ATOM   1513  C  "C2'" . A   A  1  79   ? 27.789  159.564 23.291  1.00 55.12  ? 80   A   A "C2'" 1 
ATOM   1514  O  "O2'" . A   A  1  79   ? 27.563  160.962 23.287  1.00 57.46  ? 80   A   A "O2'" 1 
ATOM   1515  C  "C1'" . A   A  1  79   ? 29.262  159.278 23.573  1.00 55.62  ? 80   A   A "C1'" 1 
ATOM   1516  N  N9    . A   A  1  79   ? 30.133  159.363 22.404  1.00 57.10  ? 80   A   A N9    1 
ATOM   1517  C  C8    . A   A  1  79   ? 29.977  158.853 21.139  1.00 57.47  ? 80   A   A C8    1 
ATOM   1518  N  N7    . A   A  1  79   ? 30.955  159.162 20.323  1.00 58.55  ? 80   A   A N7    1 
ATOM   1519  C  C5    . A   A  1  79   ? 31.817  159.915 21.109  1.00 58.44  ? 80   A   A C5    1 
ATOM   1520  C  C6    . A   A  1  79   ? 33.037  160.549 20.839  1.00 58.38  ? 80   A   A C6    1 
ATOM   1521  N  N6    . A   A  1  79   ? 33.646  160.503 19.658  1.00 57.11  ? 80   A   A N6    1 
ATOM   1522  N  N1    . A   A  1  79   ? 33.622  161.241 21.847  1.00 59.64  ? 80   A   A N1    1 
ATOM   1523  C  C2    . A   A  1  79   ? 33.015  161.278 23.041  1.00 60.16  ? 80   A   A C2    1 
ATOM   1524  N  N3    . A   A  1  79   ? 31.877  160.719 23.413  1.00 60.46  ? 80   A   A N3    1 
ATOM   1525  C  C4    . A   A  1  79   ? 31.322  160.043 22.390  1.00 58.74  ? 80   A   A C4    1 
ATOM   1526  P  P     . G   A  1  80   ? 26.438  159.477 26.937  1.00 52.07  ? 81   G   A P     1 
ATOM   1527  O  OP1   . G   A  1  80   ? 25.165  158.762 26.649  1.00 52.42  ? 81   G   A OP1   1 
ATOM   1528  O  OP2   . G   A  1  80   ? 26.415  160.722 27.758  1.00 50.89  ? 81   G   A OP2   1 
ATOM   1529  O  "O5'" . G   A  1  80   ? 27.388  158.443 27.672  1.00 50.81  ? 81   G   A "O5'" 1 
ATOM   1530  C  "C5'" . G   A  1  80   ? 28.462  158.902 28.502  1.00 48.21  ? 81   G   A "C5'" 1 
ATOM   1531  C  "C4'" . G   A  1  80   ? 29.776  158.530 27.880  1.00 45.25  ? 81   G   A "C4'" 1 
ATOM   1532  O  "O4'" . G   A  1  80   ? 29.975  159.300 26.658  1.00 42.83  ? 81   G   A "O4'" 1 
ATOM   1533  C  "C3'" . G   A  1  80   ? 31.022  158.793 28.711  1.00 44.31  ? 81   G   A "C3'" 1 
ATOM   1534  O  "O3'" . G   A  1  80   ? 31.275  157.775 29.689  1.00 44.73  ? 81   G   A "O3'" 1 
ATOM   1535  C  "C2'" . G   A  1  80   ? 32.062  158.920 27.614  1.00 42.60  ? 81   G   A "C2'" 1 
ATOM   1536  O  "O2'" . G   A  1  80   ? 32.269  157.655 27.002  1.00 41.92  ? 81   G   A "O2'" 1 
ATOM   1537  C  "C1'" . G   A  1  80   ? 31.293  159.820 26.640  1.00 40.37  ? 81   G   A "C1'" 1 
ATOM   1538  N  N9    . G   A  1  80   ? 31.233  161.222 27.074  1.00 36.72  ? 81   G   A N9    1 
ATOM   1539  C  C8    . G   A  1  80   ? 30.147  161.911 27.581  1.00 34.76  ? 81   G   A C8    1 
ATOM   1540  N  N7    . G   A  1  80   ? 30.429  163.140 27.913  1.00 34.67  ? 81   G   A N7    1 
ATOM   1541  C  C5    . G   A  1  80   ? 31.775  163.272 27.606  1.00 35.10  ? 81   G   A C5    1 
ATOM   1542  C  C6    . G   A  1  80   ? 32.655  164.373 27.772  1.00 36.21  ? 81   G   A C6    1 
ATOM   1543  O  O6    . G   A  1  80   ? 32.421  165.493 28.271  1.00 36.16  ? 81   G   A O6    1 
ATOM   1544  N  N1    . G   A  1  80   ? 33.931  164.070 27.304  1.00 36.20  ? 81   G   A N1    1 
ATOM   1545  C  C2    . G   A  1  80   ? 34.315  162.871 26.769  1.00 36.22  ? 81   G   A C2    1 
ATOM   1546  N  N2    . G   A  1  80   ? 35.592  162.794 26.359  1.00 34.03  ? 81   G   A N2    1 
ATOM   1547  N  N3    . G   A  1  80   ? 33.518  161.836 26.639  1.00 35.41  ? 81   G   A N3    1 
ATOM   1548  C  C4    . G   A  1  80   ? 32.275  162.102 27.070  1.00 35.42  ? 81   G   A C4    1 
ATOM   1549  P  P     . C   A  1  81   ? 31.708  158.199 31.189  1.00 46.21  ? 82   C   A P     1 
ATOM   1550  O  OP1   . C   A  1  81   ? 31.557  156.996 32.065  1.00 44.66  ? 82   C   A OP1   1 
ATOM   1551  O  OP2   . C   A  1  81   ? 30.986  159.456 31.550  1.00 43.72  ? 82   C   A OP2   1 
ATOM   1552  O  "O5'" . C   A  1  81   ? 33.263  158.532 31.039  1.00 44.73  ? 82   C   A "O5'" 1 
ATOM   1553  C  "C5'" . C   A  1  81   ? 34.137  157.648 30.306  1.00 42.94  ? 82   C   A "C5'" 1 
ATOM   1554  C  "C4'" . C   A  1  81   ? 35.393  158.372 29.863  1.00 44.13  ? 82   C   A "C4'" 1 
ATOM   1555  O  "O4'" . C   A  1  81   ? 35.040  159.567 29.112  1.00 43.29  ? 82   C   A "O4'" 1 
ATOM   1556  C  "C3'" . C   A  1  81   ? 36.301  158.899 30.962  1.00 45.09  ? 82   C   A "C3'" 1 
ATOM   1557  O  "O3'" . C   A  1  81   ? 37.147  157.892 31.524  1.00 47.18  ? 82   C   A "O3'" 1 
ATOM   1558  C  "C2'" . C   A  1  81   ? 37.082  160.003 30.251  1.00 44.20  ? 82   C   A "C2'" 1 
ATOM   1559  O  "O2'" . C   A  1  81   ? 38.149  159.568 29.423  1.00 43.11  ? 82   C   A "O2'" 1 
ATOM   1560  C  "C1'" . C   A  1  81   ? 36.003  160.589 29.343  1.00 42.47  ? 82   C   A "C1'" 1 
ATOM   1561  N  N1    . C   A  1  81   ? 35.318  161.780 29.887  1.00 39.09  ? 82   C   A N1    1 
ATOM   1562  C  C2    . C   A  1  81   ? 36.023  162.997 29.962  1.00 38.73  ? 82   C   A C2    1 
ATOM   1563  O  O2    . C   A  1  81   ? 37.221  163.031 29.614  1.00 38.49  ? 82   C   A O2    1 
ATOM   1564  N  N3    . C   A  1  81   ? 35.378  164.100 30.414  1.00 37.93  ? 82   C   A N3    1 
ATOM   1565  C  C4    . C   A  1  81   ? 34.096  164.025 30.783  1.00 36.02  ? 82   C   A C4    1 
ATOM   1566  N  N4    . C   A  1  81   ? 33.500  165.146 31.181  1.00 35.08  ? 82   C   A N4    1 
ATOM   1567  C  C5    . C   A  1  81   ? 33.370  162.799 30.747  1.00 36.06  ? 82   C   A C5    1 
ATOM   1568  C  C6    . C   A  1  81   ? 34.014  161.714 30.299  1.00 37.78  ? 82   C   A C6    1 
ATOM   1569  P  P     . C   A  1  82   ? 37.633  158.027 33.059  1.00 47.52  ? 83   C   A P     1 
ATOM   1570  O  OP1   . C   A  1  82   ? 38.503  156.860 33.360  1.00 44.94  ? 83   C   A OP1   1 
ATOM   1571  O  OP2   . C   A  1  82   ? 36.449  158.306 33.923  1.00 46.86  ? 83   C   A OP2   1 
ATOM   1572  O  "O5'" . C   A  1  82   ? 38.560  159.322 33.041  1.00 46.95  ? 83   C   A "O5'" 1 
ATOM   1573  C  "C5'" . C   A  1  82   ? 39.847  159.283 32.394  1.00 46.60  ? 83   C   A "C5'" 1 
ATOM   1574  C  "C4'" . C   A  1  82   ? 40.606  160.560 32.639  1.00 44.45  ? 83   C   A "C4'" 1 
ATOM   1575  O  "O4'" . C   A  1  82   ? 39.908  161.652 32.004  1.00 42.38  ? 83   C   A "O4'" 1 
ATOM   1576  C  "C3'" . C   A  1  82   ? 40.772  161.015 34.082  1.00 45.07  ? 83   C   A "C3'" 1 
ATOM   1577  O  "O3'" . C   A  1  82   ? 41.832  160.311 34.762  1.00 46.54  ? 83   C   A "O3'" 1 
ATOM   1578  C  "C2'" . C   A  1  82   ? 41.104  162.490 33.883  1.00 44.63  ? 83   C   A "C2'" 1 
ATOM   1579  O  "O2'" . C   A  1  82   ? 42.453  162.710 33.503  1.00 46.10  ? 83   C   A "O2'" 1 
ATOM   1580  C  "C1'" . C   A  1  82   ? 40.204  162.849 32.695  1.00 43.05  ? 83   C   A "C1'" 1 
ATOM   1581  N  N1    . C   A  1  82   ? 38.949  163.558 33.047  1.00 40.35  ? 83   C   A N1    1 
ATOM   1582  C  C2    . C   A  1  82   ? 38.999  164.962 33.199  1.00 39.97  ? 83   C   A C2    1 
ATOM   1583  O  O2    . C   A  1  82   ? 40.081  165.549 33.022  1.00 39.82  ? 83   C   A O2    1 
ATOM   1584  N  N3    . C   A  1  82   ? 37.875  165.633 33.535  1.00 39.73  ? 83   C   A N3    1 
ATOM   1585  C  C4    . C   A  1  82   ? 36.732  164.966 33.720  1.00 39.06  ? 83   C   A C4    1 
ATOM   1586  N  N4    . C   A  1  82   ? 35.644  165.671 34.067  1.00 38.40  ? 83   C   A N4    1 
ATOM   1587  C  C5    . C   A  1  82   ? 36.651  163.547 33.563  1.00 37.26  ? 83   C   A C5    1 
ATOM   1588  C  C6    . C   A  1  82   ? 37.770  162.890 33.230  1.00 38.19  ? 83   C   A C6    1 
ATOM   1589  P  P     . G   A  1  83   ? 41.613  159.746 36.269  1.00 48.56  ? 84   G   A P     1 
ATOM   1590  O  OP1   . G   A  1  83   ? 40.175  159.690 36.630  1.00 48.38  ? 84   G   A OP1   1 
ATOM   1591  O  OP2   . G   A  1  83   ? 42.551  160.448 37.175  1.00 49.80  ? 84   G   A OP2   1 
ATOM   1592  O  "O5'" . G   A  1  83   ? 42.133  158.247 36.175  1.00 50.13  ? 84   G   A "O5'" 1 
ATOM   1593  C  "C5'" . G   A  1  83   ? 41.498  157.276 35.322  1.00 51.83  ? 84   G   A "C5'" 1 
ATOM   1594  C  "C4'" . G   A  1  83   ? 41.826  155.877 35.803  1.00 53.20  ? 84   G   A "C4'" 1 
ATOM   1595  O  "O4'" . G   A  1  83   ? 43.249  155.616 35.679  1.00 52.53  ? 84   G   A "O4'" 1 
ATOM   1596  C  "C3'" . G   A  1  83   ? 41.523  155.674 37.269  1.00 53.86  ? 84   G   A "C3'" 1 
ATOM   1597  O  "O3'" . G   A  1  83   ? 40.161  155.341 37.421  1.00 56.41  ? 84   G   A "O3'" 1 
ATOM   1598  C  "C2'" . G   A  1  83   ? 42.471  154.549 37.651  1.00 53.89  ? 84   G   A "C2'" 1 
ATOM   1599  O  "O2'" . G   A  1  83   ? 42.004  153.280 37.246  1.00 55.80  ? 84   G   A "O2'" 1 
ATOM   1600  C  "C1'" . G   A  1  83   ? 43.707  154.903 36.819  1.00 54.07  ? 84   G   A "C1'" 1 
ATOM   1601  N  N9    . G   A  1  83   ? 44.666  155.745 37.539  1.00 54.56  ? 84   G   A N9    1 
ATOM   1602  C  C8    . G   A  1  83   ? 44.933  157.071 37.311  1.00 54.97  ? 84   G   A C8    1 
ATOM   1603  N  N7    . G   A  1  83   ? 45.823  157.565 38.124  1.00 55.09  ? 84   G   A N7    1 
ATOM   1604  C  C5    . G   A  1  83   ? 46.176  156.501 38.935  1.00 55.38  ? 84   G   A C5    1 
ATOM   1605  C  C6    . G   A  1  83   ? 47.107  156.429 40.010  1.00 55.69  ? 84   G   A C6    1 
ATOM   1606  O  O6    . G   A  1  83   ? 47.841  157.314 40.460  1.00 54.25  ? 84   G   A O6    1 
ATOM   1607  N  N1    . G   A  1  83   ? 47.138  155.161 40.567  1.00 56.40  ? 84   G   A N1    1 
ATOM   1608  C  C2    . G   A  1  83   ? 46.385  154.098 40.144  1.00 56.14  ? 84   G   A C2    1 
ATOM   1609  N  N2    . G   A  1  83   ? 46.550  152.954 40.823  1.00 56.19  ? 84   G   A N2    1 
ATOM   1610  N  N3    . G   A  1  83   ? 45.532  154.146 39.137  1.00 55.57  ? 84   G   A N3    1 
ATOM   1611  C  C4    . G   A  1  83   ? 45.473  155.369 38.586  1.00 54.67  ? 84   G   A C4    1 
ATOM   1612  P  P     . C   A  1  84   ? 39.443  155.597 38.824  1.00 59.18  ? 85   C   A P     1 
ATOM   1613  O  OP1   . C   A  1  84   ? 38.034  155.151 38.691  1.00 61.15  ? 85   C   A OP1   1 
ATOM   1614  O  OP2   . C   A  1  84   ? 39.726  156.989 39.239  1.00 59.68  ? 85   C   A OP2   1 
ATOM   1615  O  "O5'" . C   A  1  84   ? 40.187  154.582 39.795  1.00 60.41  ? 85   C   A "O5'" 1 
ATOM   1616  C  "C5'" . C   A  1  84   ? 40.072  153.165 39.587  1.00 61.99  ? 85   C   A "C5'" 1 
ATOM   1617  C  "C4'" . C   A  1  84   ? 40.753  152.422 40.705  1.00 63.11  ? 85   C   A "C4'" 1 
ATOM   1618  O  "O4'" . C   A  1  84   ? 42.184  152.643 40.636  1.00 62.21  ? 85   C   A "O4'" 1 
ATOM   1619  C  "C3'" . C   A  1  84   ? 40.380  152.894 42.101  1.00 64.12  ? 85   C   A "C3'" 1 
ATOM   1620  O  "O3'" . C   A  1  84   ? 39.140  152.341 42.529  1.00 66.18  ? 85   C   A "O3'" 1 
ATOM   1621  C  "C2'" . C   A  1  84   ? 41.571  152.419 42.922  1.00 63.44  ? 85   C   A "C2'" 1 
ATOM   1622  O  "O2'" . C   A  1  84   ? 41.535  151.031 43.188  1.00 63.90  ? 85   C   A "O2'" 1 
ATOM   1623  C  "C1'" . C   A  1  84   ? 42.719  152.693 41.951  1.00 62.38  ? 85   C   A "C1'" 1 
ATOM   1624  N  N1    . C   A  1  84   ? 43.345  154.013 42.160  1.00 62.34  ? 85   C   A N1    1 
ATOM   1625  C  C2    . C   A  1  84   ? 44.366  154.127 43.103  1.00 62.91  ? 85   C   A C2    1 
ATOM   1626  O  O2    . C   A  1  84   ? 44.692  153.125 43.762  1.00 63.22  ? 85   C   A O2    1 
ATOM   1627  N  N3    . C   A  1  84   ? 44.972  155.325 43.281  1.00 62.81  ? 85   C   A N3    1 
ATOM   1628  C  C4    . C   A  1  84   ? 44.583  156.386 42.572  1.00 61.98  ? 85   C   A C4    1 
ATOM   1629  N  N4    . C   A  1  84   ? 45.214  157.540 42.784  1.00 60.84  ? 85   C   A N4    1 
ATOM   1630  C  C5    . C   A  1  84   ? 43.533  156.307 41.617  1.00 62.58  ? 85   C   A C5    1 
ATOM   1631  C  C6    . C   A  1  84   ? 42.947  155.111 41.443  1.00 62.79  ? 85   C   A C6    1 
ATOM   1632  P  P     . A   A  1  85   ? 38.259  153.111 43.630  1.00 68.68  ? 86   A   A P     1 
ATOM   1633  O  OP1   . A   A  1  85   ? 39.002  153.110 44.919  1.00 69.75  ? 86   A   A OP1   1 
ATOM   1634  O  OP2   . A   A  1  85   ? 36.895  152.541 43.579  1.00 70.40  ? 86   A   A OP2   1 
ATOM   1635  O  "O5'" . A   A  1  85   ? 38.185  154.615 43.112  1.00 69.35  ? 86   A   A "O5'" 1 
ATOM   1636  C  "C5'" . A   A  1  85   ? 37.220  155.531 43.659  1.00 71.11  ? 86   A   A "C5'" 1 
ATOM   1637  C  "C4'" . A   A  1  85   ? 37.762  156.932 43.620  1.00 73.66  ? 86   A   A "C4'" 1 
ATOM   1638  O  "O4'" . A   A  1  85   ? 38.831  157.077 44.594  1.00 73.91  ? 86   A   A "O4'" 1 
ATOM   1639  C  "C3'" . A   A  1  85   ? 38.363  157.354 42.283  1.00 74.73  ? 86   A   A "C3'" 1 
ATOM   1640  O  "O3'" . A   A  1  85   ? 38.141  158.738 42.111  1.00 76.14  ? 86   A   A "O3'" 1 
ATOM   1641  C  "C2'" . A   A  1  85   ? 39.851  157.117 42.494  1.00 74.45  ? 86   A   A "C2'" 1 
ATOM   1642  O  "O2'" . A   A  1  85   ? 40.659  157.927 41.667  1.00 74.64  ? 86   A   A "O2'" 1 
ATOM   1643  C  "C1'" . A   A  1  85   ? 39.991  157.561 43.943  1.00 73.64  ? 86   A   A "C1'" 1 
ATOM   1644  N  N9    . A   A  1  85   ? 41.167  157.050 44.636  1.00 72.15  ? 86   A   A N9    1 
ATOM   1645  C  C8    . A   A  1  85   ? 41.424  155.768 45.040  1.00 71.98  ? 86   A   A C8    1 
ATOM   1646  N  N7    . A   A  1  85   ? 42.537  155.642 45.714  1.00 71.29  ? 86   A   A N7    1 
ATOM   1647  C  C5    . A   A  1  85   ? 43.058  156.928 45.740  1.00 71.23  ? 86   A   A C5    1 
ATOM   1648  C  C6    . A   A  1  85   ? 44.217  157.470 46.320  1.00 70.99  ? 86   A   A C6    1 
ATOM   1649  N  N6    . A   A  1  85   ? 45.085  156.758 47.041  1.00 70.33  ? 86   A   A N6    1 
ATOM   1650  N  N1    . A   A  1  85   ? 44.452  158.790 46.141  1.00 70.69  ? 86   A   A N1    1 
ATOM   1651  C  C2    . A   A  1  85   ? 43.567  159.507 45.434  1.00 70.84  ? 86   A   A C2    1 
ATOM   1652  N  N3    . A   A  1  85   ? 42.437  159.112 44.857  1.00 70.76  ? 86   A   A N3    1 
ATOM   1653  C  C4    . A   A  1  85   ? 42.238  157.799 45.053  1.00 71.28  ? 86   A   A C4    1 
ATOM   1654  P  P     . C   A  1  86   ? 37.003  159.221 41.105  1.00 76.96  ? 87   C   A P     1 
ATOM   1655  O  OP1   . C   A  1  86   ? 36.719  158.063 40.199  1.00 75.41  ? 87   C   A OP1   1 
ATOM   1656  O  OP2   . C   A  1  86   ? 37.441  160.521 40.514  1.00 75.78  ? 87   C   A OP2   1 
ATOM   1657  O  "O5'" . C   A  1  86   ? 35.741  159.452 42.057  1.00 77.25  ? 87   C   A "O5'" 1 
ATOM   1658  C  "C5'" . C   A  1  86   ? 34.522  159.988 41.509  1.00 81.08  ? 87   C   A "C5'" 1 
ATOM   1659  C  "C4'" . C   A  1  86   ? 33.488  160.234 42.587  1.00 82.08  ? 87   C   A "C4'" 1 
ATOM   1660  O  "O4'" . C   A  1  86   ? 33.070  158.967 43.159  1.00 83.66  ? 87   C   A "O4'" 1 
ATOM   1661  C  "C3'" . C   A  1  86   ? 33.834  161.152 43.759  1.00 81.72  ? 87   C   A "C3'" 1 
ATOM   1662  O  "O3'" . C   A  1  86   ? 32.741  162.033 43.983  1.00 79.70  ? 87   C   A "O3'" 1 
ATOM   1663  C  "C2'" . C   A  1  86   ? 33.964  160.177 44.930  1.00 82.91  ? 87   C   A "C2'" 1 
ATOM   1664  O  "O2'" . C   A  1  86   ? 33.634  160.758 46.176  1.00 83.09  ? 87   C   A "O2'" 1 
ATOM   1665  C  "C1'" . C   A  1  86   ? 32.936  159.111 44.553  1.00 84.37  ? 87   C   A "C1'" 1 
ATOM   1666  N  N1    . C   A  1  86   ? 33.132  157.784 45.168  1.00 86.15  ? 87   C   A N1    1 
ATOM   1667  C  C2    . C   A  1  86   ? 32.005  157.001 45.472  1.00 87.26  ? 87   C   A C2    1 
ATOM   1668  O  O2    . C   A  1  86   ? 30.872  157.446 45.228  1.00 87.64  ? 87   C   A O2    1 
ATOM   1669  N  N3    . C   A  1  86   ? 32.181  155.778 46.024  1.00 88.43  ? 87   C   A N3    1 
ATOM   1670  C  C4    . C   A  1  86   ? 33.414  155.331 46.274  1.00 88.97  ? 87   C   A C4    1 
ATOM   1671  N  N4    . C   A  1  86   ? 33.542  154.120 46.822  1.00 89.95  ? 87   C   A N4    1 
ATOM   1672  C  C5    . C   A  1  86   ? 34.573  156.105 45.977  1.00 88.68  ? 87   C   A C5    1 
ATOM   1673  C  C6    . C   A  1  86   ? 34.387  157.312 45.432  1.00 87.15  ? 87   C   A C6    1 
ATOM   1674  P  P     . G   A  1  87   ? 32.849  163.569 43.511  1.00 79.47  ? 88   G   A P     1 
ATOM   1675  O  OP1   . G   A  1  87   ? 31.496  164.007 43.063  1.00 80.49  ? 88   G   A OP1   1 
ATOM   1676  O  OP2   . G   A  1  87   ? 34.001  163.687 42.576  1.00 78.00  ? 88   G   A OP2   1 
ATOM   1677  O  "O5'" . G   A  1  87   ? 33.175  164.377 44.848  1.00 76.61  ? 88   G   A "O5'" 1 
ATOM   1678  C  "C5'" . G   A  1  87   ? 34.465  164.261 45.481  1.00 72.76  ? 88   G   A "C5'" 1 
ATOM   1679  C  "C4'" . G   A  1  87   ? 34.815  165.532 46.217  1.00 70.08  ? 88   G   A "C4'" 1 
ATOM   1680  O  "O4'" . G   A  1  87   ? 36.151  165.405 46.769  1.00 68.10  ? 88   G   A "O4'" 1 
ATOM   1681  C  "C3'" . G   A  1  87   ? 34.835  166.781 45.348  1.00 69.44  ? 88   G   A "C3'" 1 
ATOM   1682  O  "O3'" . G   A  1  87   ? 33.566  167.424 45.460  1.00 70.97  ? 88   G   A "O3'" 1 
ATOM   1683  C  "C2'" . G   A  1  87   ? 36.002  167.581 45.921  1.00 67.54  ? 88   G   A "C2'" 1 
ATOM   1684  O  "O2'" . G   A  1  87   ? 35.648  168.285 47.092  1.00 67.07  ? 88   G   A "O2'" 1 
ATOM   1685  C  "C1'" . G   A  1  87   ? 36.969  166.457 46.300  1.00 65.37  ? 88   G   A "C1'" 1 
ATOM   1686  N  N9    . G   A  1  87   ? 37.792  165.945 45.200  1.00 61.65  ? 88   G   A N9    1 
ATOM   1687  C  C8    . G   A  1  87   ? 37.542  164.851 44.400  1.00 59.56  ? 88   G   A C8    1 
ATOM   1688  N  N7    . G   A  1  87   ? 38.445  164.674 43.477  1.00 58.34  ? 88   G   A N7    1 
ATOM   1689  C  C5    . G   A  1  87   ? 39.348  165.706 43.678  1.00 59.71  ? 88   G   A C5    1 
ATOM   1690  C  C6    . G   A  1  87   ? 40.526  166.047 42.966  1.00 60.89  ? 88   G   A C6    1 
ATOM   1691  O  O6    . G   A  1  87   ? 40.992  165.522 41.943  1.00 62.20  ? 88   G   A O6    1 
ATOM   1692  N  N1    . G   A  1  87   ? 41.168  167.143 43.539  1.00 60.97  ? 88   G   A N1    1 
ATOM   1693  C  C2    . G   A  1  87   ? 40.711  167.838 44.632  1.00 60.51  ? 88   G   A C2    1 
ATOM   1694  N  N2    . G   A  1  87   ? 41.469  168.845 45.053  1.00 60.12  ? 88   G   A N2    1 
ATOM   1695  N  N3    . G   A  1  87   ? 39.594  167.559 45.270  1.00 60.21  ? 88   G   A N3    1 
ATOM   1696  C  C4    . G   A  1  87   ? 38.971  166.485 44.751  1.00 60.13  ? 88   G   A C4    1 
ATOM   1697  P  P     . G   A  1  88   ? 33.101  168.498 44.362  1.00 71.54  ? 89   G   A P     1 
ATOM   1698  O  OP1   . G   A  1  88   ? 31.827  169.059 44.891  1.00 70.26  ? 89   G   A OP1   1 
ATOM   1699  O  OP2   . G   A  1  88   ? 33.128  167.883 43.001  1.00 71.57  ? 89   G   A OP2   1 
ATOM   1700  O  "O5'" . G   A  1  88   ? 34.231  169.624 44.393  1.00 71.12  ? 89   G   A "O5'" 1 
ATOM   1701  C  "C5'" . G   A  1  88   ? 34.245  170.644 45.409  1.00 71.06  ? 89   G   A "C5'" 1 
ATOM   1702  C  "C4'" . G   A  1  88   ? 35.430  171.562 45.208  1.00 70.46  ? 89   G   A "C4'" 1 
ATOM   1703  O  "O4'" . G   A  1  88   ? 36.667  170.802 45.318  1.00 68.59  ? 89   G   A "O4'" 1 
ATOM   1704  C  "C3'" . G   A  1  88   ? 35.532  172.177 43.825  1.00 70.68  ? 89   G   A "C3'" 1 
ATOM   1705  O  "O3'" . G   A  1  88   ? 34.693  173.293 43.620  1.00 71.73  ? 89   G   A "O3'" 1 
ATOM   1706  C  "C2'" . G   A  1  88   ? 37.005  172.535 43.735  1.00 69.98  ? 89   G   A "C2'" 1 
ATOM   1707  O  "O2'" . G   A  1  88   ? 37.356  173.720 44.436  1.00 71.52  ? 89   G   A "O2'" 1 
ATOM   1708  C  "C1'" . G   A  1  88   ? 37.628  171.313 44.402  1.00 67.55  ? 89   G   A "C1'" 1 
ATOM   1709  N  N9    . G   A  1  88   ? 37.937  170.275 43.423  1.00 64.40  ? 89   G   A N9    1 
ATOM   1710  C  C8    . G   A  1  88   ? 37.160  169.200 43.063  1.00 62.90  ? 89   G   A C8    1 
ATOM   1711  N  N7    . G   A  1  88   ? 37.734  168.429 42.178  1.00 62.09  ? 89   G   A N7    1 
ATOM   1712  C  C5    . G   A  1  88   ? 38.959  169.033 41.934  1.00 60.75  ? 89   G   A C5    1 
ATOM   1713  C  C6    . G   A  1  88   ? 40.028  168.642 41.080  1.00 59.21  ? 89   G   A C6    1 
ATOM   1714  O  O6    . G   A  1  88   ? 40.110  167.649 40.356  1.00 57.20  ? 89   G   A O6    1 
ATOM   1715  N  N1    . G   A  1  88   ? 41.078  169.546 41.133  1.00 59.61  ? 89   G   A N1    1 
ATOM   1716  C  C2    . G   A  1  88   ? 41.103  170.675 41.911  1.00 61.41  ? 89   G   A C2    1 
ATOM   1717  N  N2    . G   A  1  88   ? 42.191  171.435 41.820  1.00 62.43  ? 89   G   A N2    1 
ATOM   1718  N  N3    . G   A  1  88   ? 40.127  171.039 42.721  1.00 61.80  ? 89   G   A N3    1 
ATOM   1719  C  C4    . G   A  1  88   ? 39.093  170.180 42.682  1.00 62.23  ? 89   G   A C4    1 
ATOM   1720  P  P     . A   A  1  89   ? 34.070  173.533 42.163  1.00 73.39  ? 90   A   A P     1 
ATOM   1721  O  OP1   . A   A  1  89   ? 33.124  174.673 42.279  1.00 74.36  ? 90   A   A OP1   1 
ATOM   1722  O  OP2   . A   A  1  89   ? 33.588  172.225 41.642  1.00 73.29  ? 90   A   A OP2   1 
ATOM   1723  O  "O5'" . A   A  1  89   ? 35.304  174.005 41.273  1.00 71.35  ? 90   A   A "O5'" 1 
ATOM   1724  C  "C5'" . A   A  1  89   ? 35.896  175.299 41.486  1.00 70.82  ? 90   A   A "C5'" 1 
ATOM   1725  C  "C4'" . A   A  1  89   ? 37.232  175.392 40.789  1.00 70.38  ? 90   A   A "C4'" 1 
ATOM   1726  O  "O4'" . A   A  1  89   ? 38.032  174.230 41.143  1.00 69.77  ? 90   A   A "O4'" 1 
ATOM   1727  C  "C3'" . A   A  1  89   ? 37.231  175.338 39.271  1.00 70.29  ? 90   A   A "C3'" 1 
ATOM   1728  O  "O3'" . A   A  1  89   ? 36.889  176.577 38.651  1.00 70.61  ? 90   A   A "O3'" 1 
ATOM   1729  C  "C2'" . A   A  1  89   ? 38.670  174.940 38.975  1.00 69.26  ? 90   A   A "C2'" 1 
ATOM   1730  O  "O2'" . A   A  1  89   ? 39.583  176.009 39.126  1.00 68.75  ? 90   A   A "O2'" 1 
ATOM   1731  C  "C1'" . A   A  1  89   ? 38.917  173.911 40.076  1.00 67.21  ? 90   A   A "C1'" 1 
ATOM   1732  N  N9    . A   A  1  89   ? 38.650  172.548 39.616  1.00 63.61  ? 90   A   A N9    1 
ATOM   1733  C  C8    . A   A  1  89   ? 37.512  171.782 39.745  1.00 61.44  ? 90   A   A C8    1 
ATOM   1734  N  N7    . A   A  1  89   ? 37.597  170.610 39.161  1.00 60.82  ? 90   A   A N7    1 
ATOM   1735  C  C5    . A   A  1  89   ? 38.878  170.600 38.616  1.00 60.97  ? 90   A   A C5    1 
ATOM   1736  C  C6    . A   A  1  89   ? 39.580  169.649 37.853  1.00 59.82  ? 90   A   A C6    1 
ATOM   1737  N  N6    . A   A  1  89   ? 39.058  168.484 37.467  1.00 59.32  ? 90   A   A N6    1 
ATOM   1738  N  N1    . A   A  1  89   ? 40.851  169.949 37.487  1.00 59.07  ? 90   A   A N1    1 
ATOM   1739  C  C2    . A   A  1  89   ? 41.363  171.131 37.853  1.00 59.21  ? 90   A   A C2    1 
ATOM   1740  N  N3    . A   A  1  89   ? 40.799  172.111 38.554  1.00 59.75  ? 90   A   A N3    1 
ATOM   1741  C  C4    . A   A  1  89   ? 39.543  171.779 38.909  1.00 61.74  ? 90   A   A C4    1 
ATOM   1742  P  P     . G   A  1  90   ? 36.120  176.564 37.237  1.00 71.16  ? 91   G   A P     1 
ATOM   1743  O  OP1   . G   A  1  90   ? 36.007  177.986 36.812  1.00 71.83  ? 91   G   A OP1   1 
ATOM   1744  O  OP2   . G   A  1  90   ? 34.888  175.738 37.386  1.00 69.80  ? 91   G   A OP2   1 
ATOM   1745  O  "O5'" . G   A  1  90   ? 37.127  175.823 36.238  1.00 68.19  ? 91   G   A "O5'" 1 
ATOM   1746  C  "C5'" . G   A  1  90   ? 38.300  176.505 35.747  1.00 64.88  ? 91   G   A "C5'" 1 
ATOM   1747  C  "C4'" . G   A  1  90   ? 39.281  175.538 35.111  1.00 63.80  ? 91   G   A "C4'" 1 
ATOM   1748  O  "O4'" . G   A  1  90   ? 39.458  174.378 35.971  1.00 62.73  ? 91   G   A "O4'" 1 
ATOM   1749  C  "C3'" . G   A  1  90   ? 38.901  174.917 33.776  1.00 63.67  ? 91   G   A "C3'" 1 
ATOM   1750  O  "O3'" . G   A  1  90   ? 39.105  175.764 32.654  1.00 64.55  ? 91   G   A "O3'" 1 
ATOM   1751  C  "C2'" . G   A  1  90   ? 39.813  173.702 33.728  1.00 62.48  ? 91   G   A "C2'" 1 
ATOM   1752  O  "O2'" . G   A  1  90   ? 41.156  173.998 33.398  1.00 62.26  ? 91   G   A "O2'" 1 
ATOM   1753  C  "C1'" . G   A  1  90   ? 39.720  173.232 35.174  1.00 61.31  ? 91   G   A "C1'" 1 
ATOM   1754  N  N9    . G   A  1  90   ? 38.603  172.306 35.306  1.00 59.21  ? 91   G   A N9    1 
ATOM   1755  C  C8    . G   A  1  90   ? 37.353  172.536 35.833  1.00 58.67  ? 91   G   A C8    1 
ATOM   1756  N  N7    . G   A  1  90   ? 36.577  171.487 35.777  1.00 57.23  ? 91   G   A N7    1 
ATOM   1757  C  C5    . G   A  1  90   ? 37.366  170.514 35.180  1.00 56.48  ? 91   G   A C5    1 
ATOM   1758  C  C6    . G   A  1  90   ? 37.076  169.177 34.853  1.00 56.12  ? 91   G   A C6    1 
ATOM   1759  O  O6    . G   A  1  90   ? 36.026  168.553 35.023  1.00 56.89  ? 91   G   A O6    1 
ATOM   1760  N  N1    . G   A  1  90   ? 38.166  168.548 34.266  1.00 55.35  ? 91   G   A N1    1 
ATOM   1761  C  C2    . G   A  1  90   ? 39.379  169.135 34.027  1.00 55.57  ? 91   G   A C2    1 
ATOM   1762  N  N2    . G   A  1  90   ? 40.316  168.365 33.465  1.00 55.75  ? 91   G   A N2    1 
ATOM   1763  N  N3    . G   A  1  90   ? 39.659  170.386 34.321  1.00 56.05  ? 91   G   A N3    1 
ATOM   1764  C  C4    . G   A  1  90   ? 38.616  171.009 34.891  1.00 56.99  ? 91   G   A C4    1 
ATOM   1765  P  P     . G   A  1  91   ? 38.220  175.537 31.339  1.00 64.69  ? 92   G   A P     1 
ATOM   1766  O  OP1   . G   A  1  91   ? 38.485  176.673 30.424  1.00 63.82  ? 92   G   A OP1   1 
ATOM   1767  O  OP2   . G   A  1  91   ? 36.834  175.268 31.801  1.00 64.97  ? 92   G   A OP2   1 
ATOM   1768  O  "O5'" . G   A  1  91   ? 38.793  174.193 30.689  1.00 61.77  ? 92   G   A "O5'" 1 
ATOM   1769  C  "C5'" . G   A  1  91   ? 40.174  174.090 30.305  1.00 57.85  ? 92   G   A "C5'" 1 
ATOM   1770  C  "C4'" . G   A  1  91   ? 40.581  172.643 30.115  1.00 55.97  ? 92   G   A "C4'" 1 
ATOM   1771  O  "O4'" . G   A  1  91   ? 40.130  171.834 31.238  1.00 54.88  ? 92   G   A "O4'" 1 
ATOM   1772  C  "C3'" . G   A  1  91   ? 40.008  171.879 28.932  1.00 54.82  ? 92   G   A "C3'" 1 
ATOM   1773  O  "O3'" . G   A  1  91   ? 40.617  172.213 27.692  1.00 55.33  ? 92   G   A "O3'" 1 
ATOM   1774  C  "C2'" . G   A  1  91   ? 40.319  170.442 29.333  1.00 53.06  ? 92   G   A "C2'" 1 
ATOM   1775  O  "O2'" . G   A  1  91   ? 41.696  170.124 29.221  1.00 53.48  ? 92   G   A "O2'" 1 
ATOM   1776  C  "C1'" . G   A  1  91   ? 39.951  170.480 30.813  1.00 50.73  ? 92   G   A "C1'" 1 
ATOM   1777  N  N9    . G   A  1  91   ? 38.560  170.087 31.038  1.00 46.37  ? 92   G   A N9    1 
ATOM   1778  C  C8    . G   A  1  91   ? 37.524  170.885 31.442  1.00 45.82  ? 92   G   A C8    1 
ATOM   1779  N  N7    . G   A  1  91   ? 36.401  170.236 31.575  1.00 44.25  ? 92   G   A N7    1 
ATOM   1780  C  C5    . G   A  1  91   ? 36.715  168.935 31.238  1.00 43.27  ? 92   G   A C5    1 
ATOM   1781  C  C6    . G   A  1  91   ? 35.900  167.778 31.213  1.00 43.32  ? 92   G   A C6    1 
ATOM   1782  O  O6    . G   A  1  91   ? 34.708  167.666 31.520  1.00 43.86  ? 92   G   A O6    1 
ATOM   1783  N  N1    . G   A  1  91   ? 36.611  166.663 30.793  1.00 41.04  ? 92   G   A N1    1 
ATOM   1784  C  C2    . G   A  1  91   ? 37.941  166.659 30.462  1.00 42.53  ? 92   G   A C2    1 
ATOM   1785  N  N2    . G   A  1  91   ? 38.454  165.475 30.091  1.00 40.83  ? 92   G   A N2    1 
ATOM   1786  N  N3    . G   A  1  91   ? 38.715  167.734 30.494  1.00 44.23  ? 92   G   A N3    1 
ATOM   1787  C  C4    . G   A  1  91   ? 38.038  168.828 30.890  1.00 44.12  ? 92   G   A C4    1 
ATOM   1788  P  P     . C   A  1  92   ? 39.817  171.955 26.319  1.00 55.04  ? 93   C   A P     1 
ATOM   1789  O  OP1   . C   A  1  92   ? 40.614  172.530 25.211  1.00 56.05  ? 93   C   A OP1   1 
ATOM   1790  O  OP2   . C   A  1  92   ? 38.392  172.362 26.500  1.00 53.60  ? 93   C   A OP2   1 
ATOM   1791  O  "O5'" . C   A  1  92   ? 39.892  170.383 26.132  1.00 52.42  ? 93   C   A "O5'" 1 
ATOM   1792  C  "C5'" . C   A  1  92   ? 41.146  169.751 25.884  1.00 50.28  ? 93   C   A "C5'" 1 
ATOM   1793  C  "C4'" . C   A  1  92   ? 40.951  168.273 25.760  1.00 50.88  ? 93   C   A "C4'" 1 
ATOM   1794  O  "O4'" . C   A  1  92   ? 40.320  167.785 26.975  1.00 48.84  ? 93   C   A "O4'" 1 
ATOM   1795  C  "C3'" . C   A  1  92   ? 39.972  167.845 24.681  1.00 51.97  ? 93   C   A "C3'" 1 
ATOM   1796  O  "O3'" . C   A  1  92   ? 40.509  167.849 23.359  1.00 54.73  ? 93   C   A "O3'" 1 
ATOM   1797  C  "C2'" . C   A  1  92   ? 39.588  166.460 25.161  1.00 50.09  ? 93   C   A "C2'" 1 
ATOM   1798  O  "O2'" . C   A  1  92   ? 40.640  165.534 24.951  1.00 50.93  ? 93   C   A "O2'" 1 
ATOM   1799  C  "C1'" . C   A  1  92   ? 39.433  166.721 26.657  1.00 47.58  ? 93   C   A "C1'" 1 
ATOM   1800  N  N1    . C   A  1  92   ? 38.050  167.093 27.040  1.00 44.32  ? 93   C   A N1    1 
ATOM   1801  C  C2    . C   A  1  92   ? 37.077  166.084 27.079  1.00 43.64  ? 93   C   A C2    1 
ATOM   1802  O  O2    . C   A  1  92   ? 37.399  164.930 26.780  1.00 42.45  ? 93   C   A O2    1 
ATOM   1803  N  N3    . C   A  1  92   ? 35.816  166.388 27.434  1.00 42.01  ? 93   C   A N3    1 
ATOM   1804  C  C4    . C   A  1  92   ? 35.495  167.641 27.740  1.00 42.71  ? 93   C   A C4    1 
ATOM   1805  N  N4    . C   A  1  92   ? 34.232  167.881 28.084  1.00 43.62  ? 93   C   A N4    1 
ATOM   1806  C  C5    . C   A  1  92   ? 36.456  168.700 27.704  1.00 42.54  ? 93   C   A C5    1 
ATOM   1807  C  C6    . C   A  1  92   ? 37.712  168.382 27.350  1.00 43.10  ? 93   C   A C6    1 
ATOM   1808  P  P     . G   A  1  93   ? 39.522  168.124 22.110  1.00 55.47  ? 94   G   A P     1 
ATOM   1809  O  OP1   . G   A  1  93   ? 40.330  168.037 20.865  1.00 53.98  ? 94   G   A OP1   1 
ATOM   1810  O  OP2   . G   A  1  93   ? 38.712  169.346 22.383  1.00 55.53  ? 94   G   A OP2   1 
ATOM   1811  O  "O5'" . G   A  1  93   ? 38.510  166.900 22.149  1.00 56.18  ? 94   G   A "O5'" 1 
ATOM   1812  C  "C5'" . G   A  1  93   ? 38.952  165.559 21.856  1.00 56.10  ? 94   G   A "C5'" 1 
ATOM   1813  C  "C4'" . G   A  1  93   ? 37.768  164.624 21.840  1.00 57.05  ? 94   G   A "C4'" 1 
ATOM   1814  O  "O4'" . G   A  1  93   ? 37.176  164.573 23.166  1.00 56.15  ? 94   G   A "O4'" 1 
ATOM   1815  C  "C3'" . G   A  1  93   ? 36.585  165.055 20.989  1.00 59.40  ? 94   G   A "C3'" 1 
ATOM   1816  O  "O3'" . G   A  1  93   ? 36.796  164.854 19.601  1.00 64.53  ? 94   G   A "O3'" 1 
ATOM   1817  C  "C2'" . G   A  1  93   ? 35.477  164.195 21.569  1.00 56.63  ? 94   G   A "C2'" 1 
ATOM   1818  O  "O2'" . G   A  1  93   ? 35.630  162.836 21.209  1.00 55.08  ? 94   G   A "O2'" 1 
ATOM   1819  C  "C1'" . G   A  1  93   ? 35.776  164.353 23.053  1.00 54.14  ? 94   G   A "C1'" 1 
ATOM   1820  N  N9    . G   A  1  93   ? 35.070  165.496 23.620  1.00 51.28  ? 94   G   A N9    1 
ATOM   1821  C  C8    . G   A  1  93   ? 35.561  166.749 23.911  1.00 51.77  ? 94   G   A C8    1 
ATOM   1822  N  N7    . G   A  1  93   ? 34.673  167.530 24.467  1.00 50.59  ? 94   G   A N7    1 
ATOM   1823  C  C5    . G   A  1  93   ? 33.531  166.744 24.532  1.00 49.48  ? 94   G   A C5    1 
ATOM   1824  C  C6    . G   A  1  93   ? 32.259  167.026 25.055  1.00 49.61  ? 94   G   A C6    1 
ATOM   1825  O  O6    . G   A  1  93   ? 31.866  168.058 25.612  1.00 51.81  ? 94   G   A O6    1 
ATOM   1826  N  N1    . G   A  1  93   ? 31.394  165.944 24.900  1.00 48.36  ? 94   G   A N1    1 
ATOM   1827  C  C2    . G   A  1  93   ? 31.723  164.740 24.321  1.00 47.72  ? 94   G   A C2    1 
ATOM   1828  N  N2    . G   A  1  93   ? 30.749  163.817 24.240  1.00 46.92  ? 94   G   A N2    1 
ATOM   1829  N  N3    . G   A  1  93   ? 32.918  164.462 23.850  1.00 47.95  ? 94   G   A N3    1 
ATOM   1830  C  C4    . G   A  1  93   ? 33.763  165.498 23.989  1.00 49.50  ? 94   G   A C4    1 
ATOM   1831  P  P     . A   A  1  94   ? 36.512  166.071 18.581  1.00 68.02  ? 95   A   A P     1 
ATOM   1832  O  OP1   . A   A  1  94   ? 37.820  166.673 18.195  1.00 66.58  ? 95   A   A OP1   1 
ATOM   1833  O  OP2   . A   A  1  94   ? 35.436  166.942 19.154  1.00 67.46  ? 95   A   A OP2   1 
ATOM   1834  O  "O5'" . A   A  1  94   ? 35.923  165.338 17.305  1.00 68.40  ? 95   A   A "O5'" 1 
ATOM   1835  C  "C5'" . A   A  1  94   ? 34.729  164.548 17.405  1.00 69.82  ? 95   A   A "C5'" 1 
ATOM   1836  C  "C4'" . A   A  1  94   ? 33.928  164.684 16.139  1.00 71.33  ? 95   A   A "C4'" 1 
ATOM   1837  O  "O4'" . A   A  1  94   ? 32.821  163.744 16.195  1.00 70.50  ? 95   A   A "O4'" 1 
ATOM   1838  C  "C3'" . A   A  1  94   ? 33.315  166.069 15.928  1.00 72.15  ? 95   A   A "C3'" 1 
ATOM   1839  O  "O3'" . A   A  1  94   ? 33.240  166.399 14.537  1.00 72.57  ? 95   A   A "O3'" 1 
ATOM   1840  C  "C2'" . A   A  1  94   ? 31.924  165.895 16.533  1.00 71.99  ? 95   A   A "C2'" 1 
ATOM   1841  O  "O2'" . A   A  1  94   ? 30.966  166.816 16.046  1.00 72.79  ? 95   A   A "O2'" 1 
ATOM   1842  C  "C1'" . A   A  1  94   ? 31.601  164.456 16.124  1.00 71.44  ? 95   A   A "C1'" 1 
ATOM   1843  N  N9    . A   A  1  94   ? 30.634  163.786 16.987  1.00 70.72  ? 95   A   A N9    1 
ATOM   1844  C  C8    . A   A  1  94   ? 29.450  163.212 16.594  1.00 70.83  ? 95   A   A C8    1 
ATOM   1845  N  N7    . A   A  1  94   ? 28.765  162.684 17.577  1.00 70.89  ? 95   A   A N7    1 
ATOM   1846  C  C5    . A   A  1  94   ? 29.550  162.926 18.696  1.00 70.94  ? 95   A   A C5    1 
ATOM   1847  C  C6    . A   A  1  94   ? 29.370  162.625 20.052  1.00 70.94  ? 95   A   A C6    1 
ATOM   1848  N  N6    . A   A  1  94   ? 28.299  161.983 20.526  1.00 69.96  ? 95   A   A N6    1 
ATOM   1849  N  N1    . A   A  1  94   ? 30.339  163.010 20.914  1.00 70.59  ? 95   A   A N1    1 
ATOM   1850  C  C2    . A   A  1  94   ? 31.411  163.650 20.431  1.00 69.28  ? 95   A   A C2    1 
ATOM   1851  N  N3    . A   A  1  94   ? 31.694  163.992 19.178  1.00 69.45  ? 95   A   A N3    1 
ATOM   1852  C  C4    . A   A  1  94   ? 30.709  163.599 18.348  1.00 70.57  ? 95   A   A C4    1 
ATOM   1853  P  P     . A   A  1  95   ? 33.953  167.742 13.989  1.00 73.19  ? 96   A   A P     1 
ATOM   1854  O  OP1   . A   A  1  95   ? 33.890  168.796 15.050  1.00 72.79  ? 96   A   A OP1   1 
ATOM   1855  O  OP2   . A   A  1  95   ? 33.402  168.036 12.641  1.00 73.59  ? 96   A   A OP2   1 
ATOM   1856  O  "O5'" . A   A  1  95   ? 35.462  167.289 13.776  1.00 72.65  ? 96   A   A "O5'" 1 
ATOM   1857  C  "C5'" . A   A  1  95   ? 35.770  166.233 12.857  1.00 71.74  ? 96   A   A "C5'" 1 
ATOM   1858  C  "C4'" . A   A  1  95   ? 37.226  165.868 12.968  1.00 71.49  ? 96   A   A "C4'" 1 
ATOM   1859  O  "O4'" . A   A  1  95   ? 38.021  167.077 12.769  1.00 71.87  ? 96   A   A "O4'" 1 
ATOM   1860  C  "C3'" . A   A  1  95   ? 37.671  165.278 14.308  1.00 70.88  ? 96   A   A "C3'" 1 
ATOM   1861  O  "O3'" . A   A  1  95   ? 38.696  164.285 14.090  1.00 68.64  ? 96   A   A "O3'" 1 
ATOM   1862  C  "C2'" . A   A  1  95   ? 38.265  166.498 15.011  1.00 72.26  ? 96   A   A "C2'" 1 
ATOM   1863  O  "O2'" . A   A  1  95   ? 39.211  166.147 16.002  1.00 73.79  ? 96   A   A "O2'" 1 
ATOM   1864  C  "C1'" . A   A  1  95   ? 38.922  167.217 13.833  1.00 73.53  ? 96   A   A "C1'" 1 
ATOM   1865  N  N9    . A   A  1  95   ? 39.302  168.631 13.966  1.00 75.91  ? 96   A   A N9    1 
ATOM   1866  C  C8    . A   A  1  95   ? 38.634  169.686 14.563  1.00 76.75  ? 96   A   A C8    1 
ATOM   1867  N  N7    . A   A  1  95   ? 39.305  170.817 14.543  1.00 78.05  ? 96   A   A N7    1 
ATOM   1868  C  C5    . A   A  1  95   ? 40.487  170.495 13.877  1.00 78.50  ? 96   A   A C5    1 
ATOM   1869  C  C6    . A   A  1  95   ? 41.638  171.262 13.538  1.00 79.20  ? 96   A   A C6    1 
ATOM   1870  N  N6    . A   A  1  95   ? 41.794  172.559 13.842  1.00 78.90  ? 96   A   A N6    1 
ATOM   1871  N  N1    . A   A  1  95   ? 42.637  170.633 12.872  1.00 79.38  ? 96   A   A N1    1 
ATOM   1872  C  C2    . A   A  1  95   ? 42.493  169.331 12.574  1.00 78.16  ? 96   A   A C2    1 
ATOM   1873  N  N3    . A   A  1  95   ? 41.472  168.509 12.840  1.00 76.96  ? 96   A   A N3    1 
ATOM   1874  C  C4    . A   A  1  95   ? 40.492  169.158 13.503  1.00 77.39  ? 96   A   A C4    1 
ATOM   1875  P  P     . G   A  1  96   ? 38.300  162.718 13.917  1.00 66.69  ? 97   G   A P     1 
ATOM   1876  O  OP1   . G   A  1  96   ? 39.523  161.885 14.052  1.00 66.49  ? 97   G   A OP1   1 
ATOM   1877  O  OP2   . G   A  1  96   ? 37.434  162.551 12.728  1.00 66.97  ? 97   G   A OP2   1 
ATOM   1878  O  "O5'" . G   A  1  96   ? 37.384  162.422 15.172  1.00 66.52  ? 97   G   A "O5'" 1 
ATOM   1879  C  "C5'" . G   A  1  96   ? 37.869  162.607 16.506  1.00 64.72  ? 97   G   A "C5'" 1 
ATOM   1880  C  "C4'" . G   A  1  96   ? 37.242  161.571 17.397  1.00 63.24  ? 97   G   A "C4'" 1 
ATOM   1881  O  "O4'" . G   A  1  96   ? 35.795  161.686 17.259  1.00 63.63  ? 97   G   A "O4'" 1 
ATOM   1882  C  "C3'" . G   A  1  96   ? 37.596  160.141 16.981  1.00 61.94  ? 97   G   A "C3'" 1 
ATOM   1883  O  "O3'" . G   A  1  96   ? 37.606  159.274 18.114  1.00 59.53  ? 97   G   A "O3'" 1 
ATOM   1884  C  "C2'" . G   A  1  96   ? 36.464  159.779 16.022  1.00 62.01  ? 97   G   A "C2'" 1 
ATOM   1885  O  "O2'" . G   A  1  96   ? 36.248  158.386 15.924  1.00 58.91  ? 97   G   A "O2'" 1 
ATOM   1886  C  "C1'" . G   A  1  96   ? 35.272  160.498 16.667  1.00 63.87  ? 97   G   A "C1'" 1 
ATOM   1887  N  N9    . G   A  1  96   ? 34.205  160.874 15.731  1.00 66.17  ? 97   G   A N9    1 
ATOM   1888  C  C8    . G   A  1  96   ? 34.345  161.600 14.576  1.00 66.63  ? 97   G   A C8    1 
ATOM   1889  N  N7    . G   A  1  96   ? 33.222  161.769 13.934  1.00 67.16  ? 97   G   A N7    1 
ATOM   1890  C  C5    . G   A  1  96   ? 32.273  161.119 14.707  1.00 67.72  ? 97   G   A C5    1 
ATOM   1891  C  C6    . G   A  1  96   ? 30.855  160.957 14.505  1.00 68.35  ? 97   G   A C6    1 
ATOM   1892  O  O6    . G   A  1  96   ? 30.146  161.358 13.565  1.00 68.66  ? 97   G   A O6    1 
ATOM   1893  N  N1    . G   A  1  96   ? 30.271  160.242 15.542  1.00 67.90  ? 97   G   A N1    1 
ATOM   1894  C  C2    . G   A  1  96   ? 30.943  159.737 16.628  1.00 67.56  ? 97   G   A C2    1 
ATOM   1895  N  N2    . G   A  1  96   ? 30.188  159.093 17.534  1.00 66.41  ? 97   G   A N2    1 
ATOM   1896  N  N3    . G   A  1  96   ? 32.258  159.860 16.818  1.00 67.94  ? 97   G   A N3    1 
ATOM   1897  C  C4    . G   A  1  96   ? 32.854  160.564 15.827  1.00 67.30  ? 97   G   A C4    1 
ATOM   1898  P  P     . A   A  1  97   ? 38.914  158.393 18.461  1.00 57.52  ? 98   A   A P     1 
ATOM   1899  O  OP1   . A   A  1  97   ? 40.035  158.724 17.541  1.00 56.66  ? 98   A   A OP1   1 
ATOM   1900  O  OP2   . A   A  1  97   ? 38.516  156.985 18.643  1.00 57.30  ? 98   A   A OP2   1 
ATOM   1901  O  "O5'" . A   A  1  97   ? 39.313  158.927 19.899  1.00 57.03  ? 98   A   A "O5'" 1 
ATOM   1902  C  "C5'" . A   A  1  97   ? 40.083  160.123 20.038  1.00 54.95  ? 98   A   A "C5'" 1 
ATOM   1903  C  "C4'" . A   A  1  97   ? 39.855  160.724 21.398  1.00 54.58  ? 98   A   A "C4'" 1 
ATOM   1904  O  "O4'" . A   A  1  97   ? 38.503  161.247 21.504  1.00 55.37  ? 98   A   A "O4'" 1 
ATOM   1905  C  "C3'" . A   A  1  97   ? 39.952  159.745 22.547  1.00 53.82  ? 98   A   A "C3'" 1 
ATOM   1906  O  "O3'" . A   A  1  97   ? 41.295  159.522 22.904  1.00 54.07  ? 98   A   A "O3'" 1 
ATOM   1907  C  "C2'" . A   A  1  97   ? 39.194  160.485 23.628  1.00 54.19  ? 98   A   A "C2'" 1 
ATOM   1908  O  "O2'" . A   A  1  97   ? 39.969  161.564 24.128  1.00 52.57  ? 98   A   A "O2'" 1 
ATOM   1909  C  "C1'" . A   A  1  97   ? 38.016  161.029 22.817  1.00 54.70  ? 98   A   A "C1'" 1 
ATOM   1910  N  N9    . A   A  1  97   ? 36.956  160.029 22.725  1.00 55.96  ? 98   A   A N9    1 
ATOM   1911  C  C8    . A   A  1  97   ? 36.613  159.283 21.621  1.00 55.51  ? 98   A   A C8    1 
ATOM   1912  N  N7    . A   A  1  97   ? 35.639  158.433 21.838  1.00 56.41  ? 98   A   A N7    1 
ATOM   1913  C  C5    . A   A  1  97   ? 35.312  158.634 23.172  1.00 56.90  ? 98   A   A C5    1 
ATOM   1914  C  C6    . A   A  1  97   ? 34.356  158.036 24.009  1.00 57.30  ? 98   A   A C6    1 
ATOM   1915  N  N6    . A   A  1  97   ? 33.529  157.073 23.604  1.00 58.21  ? 98   A   A N6    1 
ATOM   1916  N  N1    . A   A  1  97   ? 34.281  158.465 25.293  1.00 57.53  ? 98   A   A N1    1 
ATOM   1917  C  C2    . A   A  1  97   ? 35.114  159.435 25.695  1.00 57.52  ? 98   A   A C2    1 
ATOM   1918  N  N3    . A   A  1  97   ? 36.055  160.078 25.001  1.00 57.91  ? 98   A   A N3    1 
ATOM   1919  C  C4    . A   A  1  97   ? 36.107  159.622 23.731  1.00 57.22  ? 98   A   A C4    1 
ATOM   1920  P  P     . A   A  1  98   ? 41.773  158.036 23.279  1.00 54.82  ? 99   A   A P     1 
ATOM   1921  O  OP1   . A   A  1  98   ? 43.185  158.146 23.727  1.00 55.12  ? 99   A   A OP1   1 
ATOM   1922  O  OP2   . A   A  1  98   ? 41.435  157.113 22.165  1.00 56.02  ? 99   A   A OP2   1 
ATOM   1923  O  "O5'" . A   A  1  98   ? 40.852  157.644 24.528  1.00 56.22  ? 99   A   A "O5'" 1 
ATOM   1924  C  "C5'" . A   A  1  98   ? 40.860  158.449 25.733  1.00 55.02  ? 99   A   A "C5'" 1 
ATOM   1925  C  "C4'" . A   A  1  98   ? 39.813  157.973 26.721  1.00 54.36  ? 99   A   A "C4'" 1 
ATOM   1926  O  "O4'" . A   A  1  98   ? 38.490  158.136 26.164  1.00 54.91  ? 99   A   A "O4'" 1 
ATOM   1927  C  "C3'" . A   A  1  98   ? 39.871  156.520 27.162  1.00 53.44  ? 99   A   A "C3'" 1 
ATOM   1928  O  "O3'" . A   A  1  98   ? 40.827  156.371 28.211  1.00 53.89  ? 99   A   A "O3'" 1 
ATOM   1929  C  "C2'" . A   A  1  98   ? 38.448  156.292 27.664  1.00 53.52  ? 99   A   A "C2'" 1 
ATOM   1930  O  "O2'" . A   A  1  98   ? 38.190  156.814 28.950  1.00 52.20  ? 99   A   A "O2'" 1 
ATOM   1931  C  "C1'" . A   A  1  98   ? 37.647  157.120 26.662  1.00 54.67  ? 99   A   A "C1'" 1 
ATOM   1932  N  N9    . A   A  1  98   ? 37.235  156.279 25.551  1.00 54.91  ? 99   A   A N9    1 
ATOM   1933  C  C8    . A   A  1  98   ? 37.837  156.035 24.346  1.00 54.73  ? 99   A   A C8    1 
ATOM   1934  N  N7    . A   A  1  98   ? 37.201  155.150 23.618  1.00 54.75  ? 99   A   A N7    1 
ATOM   1935  C  C5    . A   A  1  98   ? 36.109  154.805 24.395  1.00 55.42  ? 99   A   A C5    1 
ATOM   1936  C  C6    . A   A  1  98   ? 35.064  153.901 24.202  1.00 56.15  ? 99   A   A C6    1 
ATOM   1937  N  N6    . A   A  1  98   ? 34.950  153.128 23.127  1.00 57.02  ? 99   A   A N6    1 
ATOM   1938  N  N1    . A   A  1  98   ? 34.129  153.807 25.166  1.00 56.91  ? 99   A   A N1    1 
ATOM   1939  C  C2    . A   A  1  98   ? 34.256  154.570 26.252  1.00 57.19  ? 99   A   A C2    1 
ATOM   1940  N  N3    . A   A  1  98   ? 35.204  155.446 26.554  1.00 57.04  ? 99   A   A N3    1 
ATOM   1941  C  C4    . A   A  1  98   ? 36.109  155.511 25.572  1.00 55.42  ? 99   A   A C4    1 
ATOM   1942  P  P     . C   A  1  99   ? 42.064  155.368 28.035  1.00 53.19  ? 100  C   A P     1 
ATOM   1943  O  OP1   . C   A  1  99   ? 42.802  155.390 29.321  1.00 54.87  ? 100  C   A OP1   1 
ATOM   1944  O  OP2   . C   A  1  99   ? 42.792  155.659 26.770  1.00 53.24  ? 100  C   A OP2   1 
ATOM   1945  O  "O5'" . C   A  1  99   ? 41.372  153.947 27.903  1.00 54.62  ? 100  C   A "O5'" 1 
ATOM   1946  C  "C5'" . C   A  1  99   ? 40.455  153.481 28.888  1.00 56.54  ? 100  C   A "C5'" 1 
ATOM   1947  C  "C4'" . C   A  1  99   ? 39.546  152.458 28.271  1.00 57.84  ? 100  C   A "C4'" 1 
ATOM   1948  O  "O4'" . C   A  1  99   ? 38.700  153.098 27.283  1.00 58.54  ? 100  C   A "O4'" 1 
ATOM   1949  C  "C3'" . C   A  1  99   ? 40.294  151.398 27.483  1.00 57.67  ? 100  C   A "C3'" 1 
ATOM   1950  O  "O3'" . C   A  1  99   ? 40.769  150.367 28.333  1.00 58.26  ? 100  C   A "O3'" 1 
ATOM   1951  C  "C2'" . C   A  1  99   ? 39.238  150.913 26.511  1.00 58.71  ? 100  C   A "C2'" 1 
ATOM   1952  O  "O2'" . C   A  1  99   ? 38.339  150.032 27.139  1.00 58.22  ? 100  C   A "O2'" 1 
ATOM   1953  C  "C1'" . C   A  1  99   ? 38.518  152.222 26.182  1.00 59.70  ? 100  C   A "C1'" 1 
ATOM   1954  N  N1    . C   A  1  99   ? 39.056  152.860 24.972  1.00 62.07  ? 100  C   A N1    1 
ATOM   1955  C  C2    . C   A  1  99   ? 38.511  152.514 23.724  1.00 62.35  ? 100  C   A C2    1 
ATOM   1956  O  O2    . C   A  1  99   ? 37.574  151.711 23.679  1.00 61.51  ? 100  C   A O2    1 
ATOM   1957  N  N3    . C   A  1  99   ? 39.020  153.070 22.607  1.00 63.95  ? 100  C   A N3    1 
ATOM   1958  C  C4    . C   A  1  99   ? 40.023  153.949 22.696  1.00 64.81  ? 100  C   A C4    1 
ATOM   1959  N  N4    . C   A  1  99   ? 40.504  154.467 21.562  1.00 65.34  ? 100  C   A N4    1 
ATOM   1960  C  C5    . C   A  1  99   ? 40.581  154.335 23.950  1.00 64.37  ? 100  C   A C5    1 
ATOM   1961  C  C6    . C   A  1  99   ? 40.075  153.769 25.052  1.00 63.91  ? 100  C   A C6    1 
ATOM   1962  P  P     . C   A  1  100  ? 42.223  149.742 28.084  1.00 57.77  ? 101  C   A P     1 
ATOM   1963  O  OP1   . C   A  1  100  ? 42.621  149.001 29.316  1.00 57.78  ? 101  C   A OP1   1 
ATOM   1964  O  OP2   . C   A  1  100  ? 43.095  150.822 27.568  1.00 59.44  ? 101  C   A OP2   1 
ATOM   1965  O  "O5'" . C   A  1  100  ? 41.986  148.690 26.918  1.00 58.21  ? 101  C   A "O5'" 1 
ATOM   1966  C  "C5'" . C   A  1  100  ? 41.263  147.471 27.154  1.00 58.44  ? 101  C   A "C5'" 1 
ATOM   1967  C  "C4'" . C   A  1  100  ? 41.105  146.712 25.859  1.00 57.48  ? 101  C   A "C4'" 1 
ATOM   1968  O  "O4'" . C   A  1  100  ? 40.316  147.522 24.946  1.00 57.80  ? 101  C   A "O4'" 1 
ATOM   1969  C  "C3'" . C   A  1  100  ? 42.388  146.439 25.086  1.00 57.12  ? 101  C   A "C3'" 1 
ATOM   1970  O  "O3'" . C   A  1  100  ? 43.049  145.279 25.567  1.00 57.67  ? 101  C   A "O3'" 1 
ATOM   1971  C  "C2'" . C   A  1  100  ? 41.876  146.248 23.666  1.00 57.17  ? 101  C   A "C2'" 1 
ATOM   1972  O  "O2'" . C   A  1  100  ? 41.375  144.956 23.409  1.00 58.11  ? 101  C   A "O2'" 1 
ATOM   1973  C  "C1'" . C   A  1  100  ? 40.733  147.270 23.610  1.00 57.56  ? 101  C   A "C1'" 1 
ATOM   1974  N  N1    . C   A  1  100  ? 41.138  148.541 22.979  1.00 56.89  ? 101  C   A N1    1 
ATOM   1975  C  C2    . C   A  1  100  ? 41.295  148.577 21.591  1.00 56.52  ? 101  C   A C2    1 
ATOM   1976  O  O2    . C   A  1  100  ? 41.043  147.554 20.926  1.00 54.95  ? 101  C   A O2    1 
ATOM   1977  N  N3    . C   A  1  100  ? 41.718  149.721 21.007  1.00 57.20  ? 101  C   A N3    1 
ATOM   1978  C  C4    . C   A  1  100  ? 41.970  150.800 21.750  1.00 57.50  ? 101  C   A C4    1 
ATOM   1979  N  N4    . C   A  1  100  ? 42.407  151.899 21.131  1.00 57.77  ? 101  C   A N4    1 
ATOM   1980  C  C5    . C   A  1  100  ? 41.791  150.801 23.157  1.00 57.17  ? 101  C   A C5    1 
ATOM   1981  C  C6    . C   A  1  100  ? 41.378  149.660 23.728  1.00 57.17  ? 101  C   A C6    1 
ATOM   1982  P  P     . A   A  1  101  ? 44.603  145.025 25.217  1.00 59.03  ? 102  A   A P     1 
ATOM   1983  O  OP1   . A   A  1  101  ? 45.030  143.848 26.012  1.00 58.65  ? 102  A   A OP1   1 
ATOM   1984  O  OP2   . A   A  1  101  ? 45.352  146.304 25.331  1.00 60.25  ? 102  A   A OP2   1 
ATOM   1985  O  "O5'" . A   A  1  101  ? 44.612  144.646 23.674  1.00 59.65  ? 102  A   A "O5'" 1 
ATOM   1986  C  "C5'" . A   A  1  101  ? 44.018  143.424 23.198  1.00 61.45  ? 102  A   A "C5'" 1 
ATOM   1987  C  "C4'" . A   A  1  101  ? 44.264  143.292 21.720  1.00 61.93  ? 102  A   A "C4'" 1 
ATOM   1988  O  "O4'" . A   A  1  101  ? 43.470  144.272 21.007  1.00 61.63  ? 102  A   A "O4'" 1 
ATOM   1989  C  "C3'" . A   A  1  101  ? 45.694  143.553 21.276  1.00 62.04  ? 102  A   A "C3'" 1 
ATOM   1990  O  "O3'" . A   A  1  101  ? 46.525  142.404 21.460  1.00 63.43  ? 102  A   A "O3'" 1 
ATOM   1991  C  "C2'" . A   A  1  101  ? 45.500  143.947 19.822  1.00 61.51  ? 102  A   A "C2'" 1 
ATOM   1992  O  "O2'" . A   A  1  101  ? 45.259  142.831 19.003  1.00 61.98  ? 102  A   A "O2'" 1 
ATOM   1993  C  "C1'" . A   A  1  101  ? 44.201  144.752 19.900  1.00 61.33  ? 102  A   A "C1'" 1 
ATOM   1994  N  N9    . A   A  1  101  ? 44.368  146.200 20.054  1.00 61.00  ? 102  A   A N9    1 
ATOM   1995  C  C8    . A   A  1  101  ? 44.251  146.947 21.198  1.00 60.79  ? 102  A   A C8    1 
ATOM   1996  N  N7    . A   A  1  101  ? 44.411  148.233 21.008  1.00 61.44  ? 102  A   A N7    1 
ATOM   1997  C  C5    . A   A  1  101  ? 44.671  148.341 19.649  1.00 60.61  ? 102  A   A C5    1 
ATOM   1998  C  C6    . A   A  1  101  ? 44.932  149.446 18.817  1.00 60.02  ? 102  A   A C6    1 
ATOM   1999  N  N6    . A   A  1  101  ? 44.965  150.710 19.250  1.00 58.99  ? 102  A   A N6    1 
ATOM   2000  N  N1    . A   A  1  101  ? 45.150  149.204 17.507  1.00 59.76  ? 102  A   A N1    1 
ATOM   2001  C  C2    . A   A  1  101  ? 45.095  147.941 17.071  1.00 59.37  ? 102  A   A C2    1 
ATOM   2002  N  N3    . A   A  1  101  ? 44.857  146.827 17.751  1.00 60.83  ? 102  A   A N3    1 
ATOM   2003  C  C4    . A   A  1  101  ? 44.653  147.097 19.050  1.00 60.83  ? 102  A   A C4    1 
ATOM   2004  P  P     . U   A  1  102  ? 48.099  142.597 21.762  1.00 64.01  ? 103  U   A P     1 
ATOM   2005  O  OP1   . U   A  1  102  ? 48.704  141.287 22.089  1.00 62.72  ? 103  U   A OP1   1 
ATOM   2006  O  OP2   . U   A  1  102  ? 48.234  143.733 22.717  1.00 64.08  ? 103  U   A OP2   1 
ATOM   2007  O  "O5'" . U   A  1  102  ? 48.705  143.018 20.352  1.00 64.86  ? 103  U   A "O5'" 1 
ATOM   2008  C  "C5'" . U   A  1  102  ? 48.592  142.132 19.217  1.00 64.91  ? 103  U   A "C5'" 1 
ATOM   2009  C  "C4'" . U   A  1  102  ? 48.876  142.879 17.931  1.00 64.99  ? 103  U   A "C4'" 1 
ATOM   2010  O  "O4'" . U   A  1  102  ? 47.887  143.927 17.714  1.00 64.99  ? 103  U   A "O4'" 1 
ATOM   2011  C  "C3'" . U   A  1  102  ? 50.198  143.623 17.859  1.00 65.55  ? 103  U   A "C3'" 1 
ATOM   2012  O  "O3'" . U   A  1  102  ? 51.294  142.757 17.573  1.00 66.45  ? 103  U   A "O3'" 1 
ATOM   2013  C  "C2'" . U   A  1  102  ? 49.942  144.604 16.725  1.00 65.97  ? 103  U   A "C2'" 1 
ATOM   2014  O  "O2'" . U   A  1  102  ? 50.090  144.001 15.459  1.00 67.64  ? 103  U   A "O2'" 1 
ATOM   2015  C  "C1'" . U   A  1  102  ? 48.477  144.987 16.971  1.00 65.88  ? 103  U   A "C1'" 1 
ATOM   2016  N  N1    . U   A  1  102  ? 48.354  146.233 17.746  1.00 67.52  ? 103  U   A N1    1 
ATOM   2017  C  C2    . U   A  1  102  ? 48.241  147.446 17.061  1.00 68.04  ? 103  U   A C2    1 
ATOM   2018  O  O2    . U   A  1  102  ? 48.169  147.532 15.850  1.00 68.87  ? 103  U   A O2    1 
ATOM   2019  N  N3    . U   A  1  102  ? 48.204  148.560 17.864  1.00 68.70  ? 103  U   A N3    1 
ATOM   2020  C  C4    . U   A  1  102  ? 48.244  148.595 19.246  1.00 68.70  ? 103  U   A C4    1 
ATOM   2021  O  O4    . U   A  1  102  ? 48.246  149.679 19.831  1.00 69.33  ? 103  U   A O4    1 
ATOM   2022  C  C5    . U   A  1  102  ? 48.324  147.316 19.871  1.00 69.14  ? 103  U   A C5    1 
ATOM   2023  C  C6    . U   A  1  102  ? 48.375  146.208 19.123  1.00 68.85  ? 103  U   A C6    1 
ATOM   2024  P  P     . G   A  1  103  ? 52.745  143.066 18.208  1.00 69.00  ? 104  G   A P     1 
ATOM   2025  O  OP1   . G   A  1  103  ? 53.648  141.926 17.884  1.00 68.19  ? 104  G   A OP1   1 
ATOM   2026  O  OP2   . G   A  1  103  ? 52.573  143.496 19.626  1.00 69.19  ? 104  G   A OP2   1 
ATOM   2027  O  "O5'" . G   A  1  103  ? 53.265  144.324 17.391  1.00 68.44  ? 104  G   A "O5'" 1 
ATOM   2028  C  "C5'" . G   A  1  103  ? 53.678  144.182 16.035  1.00 67.83  ? 104  G   A "C5'" 1 
ATOM   2029  C  "C4'" . G   A  1  103  ? 53.695  145.524 15.361  1.00 67.64  ? 104  G   A "C4'" 1 
ATOM   2030  O  "O4'" . G   A  1  103  ? 52.440  146.220 15.606  1.00 68.37  ? 104  G   A "O4'" 1 
ATOM   2031  C  "C3'" . G   A  1  103  ? 54.700  146.520 15.894  1.00 67.08  ? 104  G   A "C3'" 1 
ATOM   2032  O  "O3'" . G   A  1  103  ? 56.008  146.232 15.445  1.00 65.39  ? 104  G   A "O3'" 1 
ATOM   2033  C  "C2'" . G   A  1  103  ? 54.168  147.811 15.298  1.00 67.89  ? 104  G   A "C2'" 1 
ATOM   2034  O  "O2'" . G   A  1  103  ? 54.440  147.876 13.912  1.00 67.42  ? 104  G   A "O2'" 1 
ATOM   2035  C  "C1'" . G   A  1  103  ? 52.665  147.623 15.514  1.00 68.44  ? 104  G   A "C1'" 1 
ATOM   2036  N  N9    . G   A  1  103  ? 52.205  148.271 16.740  1.00 69.22  ? 104  G   A N9    1 
ATOM   2037  C  C8    . G   A  1  103  ? 51.845  147.675 17.928  1.00 70.44  ? 104  G   A C8    1 
ATOM   2038  N  N7    . G   A  1  103  ? 51.493  148.536 18.846  1.00 70.82  ? 104  G   A N7    1 
ATOM   2039  C  C5    . G   A  1  103  ? 51.625  149.773 18.225  1.00 69.65  ? 104  G   A C5    1 
ATOM   2040  C  C6    . G   A  1  103  ? 51.396  151.083 18.725  1.00 69.53  ? 104  G   A C6    1 
ATOM   2041  O  O6    . G   A  1  103  ? 51.017  151.427 19.850  1.00 70.00  ? 104  G   A O6    1 
ATOM   2042  N  N1    . G   A  1  103  ? 51.662  152.047 17.765  1.00 69.09  ? 104  G   A N1    1 
ATOM   2043  C  C2    . G   A  1  103  ? 52.097  151.793 16.492  1.00 69.58  ? 104  G   A C2    1 
ATOM   2044  N  N2    . G   A  1  103  ? 52.311  152.869 15.717  1.00 70.71  ? 104  G   A N2    1 
ATOM   2045  N  N3    . G   A  1  103  ? 52.310  150.579 16.011  1.00 69.25  ? 104  G   A N3    1 
ATOM   2046  C  C4    . G   A  1  103  ? 52.058  149.625 16.927  1.00 69.12  ? 104  G   A C4    1 
ATOM   2047  P  P     . G   A  1  104  ? 57.255  146.667 16.350  1.00 64.94  ? 105  G   A P     1 
ATOM   2048  O  OP1   . G   A  1  104  ? 58.467  146.126 15.661  1.00 64.79  ? 105  G   A OP1   1 
ATOM   2049  O  OP2   . G   A  1  104  ? 56.973  146.278 17.754  1.00 63.92  ? 105  G   A OP2   1 
ATOM   2050  O  "O5'" . G   A  1  104  ? 57.244  148.266 16.304  1.00 61.92  ? 105  G   A "O5'" 1 
ATOM   2051  C  "C5'" . G   A  1  104  ? 57.646  148.974 15.127  1.00 57.90  ? 105  G   A "C5'" 1 
ATOM   2052  C  "C4'" . G   A  1  104  ? 57.414  150.461 15.279  1.00 55.98  ? 105  G   A "C4'" 1 
ATOM   2053  O  "O4'" . G   A  1  104  ? 56.054  150.721 15.712  1.00 55.47  ? 105  G   A "O4'" 1 
ATOM   2054  C  "C3'" . G   A  1  104  ? 58.204  151.191 16.347  1.00 54.99  ? 105  G   A "C3'" 1 
ATOM   2055  O  "O3'" . G   A  1  104  ? 59.548  151.471 15.989  1.00 54.58  ? 105  G   A "O3'" 1 
ATOM   2056  C  "C2'" . G   A  1  104  ? 57.438  152.503 16.434  1.00 55.22  ? 105  G   A "C2'" 1 
ATOM   2057  O  "O2'" . G   A  1  104  ? 57.732  153.387 15.370  1.00 55.26  ? 105  G   A "O2'" 1 
ATOM   2058  C  "C1'" . G   A  1  104  ? 55.997  152.020 16.286  1.00 55.16  ? 105  G   A "C1'" 1 
ATOM   2059  N  N9    . G   A  1  104  ? 55.364  151.951 17.596  1.00 54.69  ? 105  G   A N9    1 
ATOM   2060  C  C8    . G   A  1  104  ? 55.010  150.831 18.306  1.00 55.21  ? 105  G   A C8    1 
ATOM   2061  N  N7    . G   A  1  104  ? 54.509  151.108 19.479  1.00 54.75  ? 105  G   A N7    1 
ATOM   2062  C  C5    . G   A  1  104  ? 54.524  152.493 19.541  1.00 54.75  ? 105  G   A C5    1 
ATOM   2063  C  C6    . G   A  1  104  ? 54.115  153.363 20.574  1.00 54.50  ? 105  G   A C6    1 
ATOM   2064  O  O6    . G   A  1  104  ? 53.648  153.077 21.674  1.00 56.17  ? 105  G   A O6    1 
ATOM   2065  N  N1    . G   A  1  104  ? 54.298  154.694 20.228  1.00 55.03  ? 105  G   A N1    1 
ATOM   2066  C  C2    . G   A  1  104  ? 54.811  155.131 19.036  1.00 55.37  ? 105  G   A C2    1 
ATOM   2067  N  N2    . G   A  1  104  ? 54.907  156.459 18.885  1.00 55.44  ? 105  G   A N2    1 
ATOM   2068  N  N3    . G   A  1  104  ? 55.202  154.327 18.061  1.00 54.46  ? 105  G   A N3    1 
ATOM   2069  C  C4    . G   A  1  104  ? 55.033  153.029 18.381  1.00 54.58  ? 105  G   A C4    1 
ATOM   2070  P  P     . A   A  1  105  ? 60.588  151.890 17.134  1.00 54.51  ? 106  A   A P     1 
ATOM   2071  O  OP1   . A   A  1  105  ? 61.935  152.070 16.526  1.00 52.70  ? 106  A   A OP1   1 
ATOM   2072  O  OP2   . A   A  1  105  ? 60.395  150.885 18.208  1.00 56.46  ? 106  A   A OP2   1 
ATOM   2073  O  "O5'" . A   A  1  105  ? 60.061  153.302 17.662  1.00 51.73  ? 106  A   A "O5'" 1 
ATOM   2074  C  "C5'" . A   A  1  105  ? 60.126  154.468 16.837  1.00 50.13  ? 106  A   A "C5'" 1 
ATOM   2075  C  "C4'" . A   A  1  105  ? 59.734  155.703 17.618  1.00 50.03  ? 106  A   A "C4'" 1 
ATOM   2076  O  "O4'" . A   A  1  105  ? 58.358  155.622 18.061  1.00 50.20  ? 106  A   A "O4'" 1 
ATOM   2077  C  "C3'" . A   A  1  105  ? 60.499  155.993 18.896  1.00 49.93  ? 106  A   A "C3'" 1 
ATOM   2078  O  "O3'" . A   A  1  105  ? 61.759  156.597 18.649  1.00 51.35  ? 106  A   A "O3'" 1 
ATOM   2079  C  "C2'" . A   A  1  105  ? 59.567  156.960 19.606  1.00 48.92  ? 106  A   A "C2'" 1 
ATOM   2080  O  "O2'" . A   A  1  105  ? 59.631  158.264 19.076  1.00 47.37  ? 106  A   A "O2'" 1 
ATOM   2081  C  "C1'" . A   A  1  105  ? 58.209  156.355 19.265  1.00 50.15  ? 106  A   A "C1'" 1 
ATOM   2082  N  N9    . A   A  1  105  ? 57.772  155.437 20.309  1.00 51.20  ? 106  A   A N9    1 
ATOM   2083  C  C8    . A   A  1  105  ? 57.813  154.066 20.301  1.00 51.73  ? 106  A   A C8    1 
ATOM   2084  N  N7    . A   A  1  105  ? 57.357  153.512 21.401  1.00 52.16  ? 106  A   A N7    1 
ATOM   2085  C  C5    . A   A  1  105  ? 56.986  154.593 22.186  1.00 53.39  ? 106  A   A C5    1 
ATOM   2086  C  C6    . A   A  1  105  ? 56.424  154.679 23.478  1.00 53.69  ? 106  A   A C6    1 
ATOM   2087  N  N6    . A   A  1  105  ? 56.130  153.618 24.236  1.00 53.20  ? 106  A   A N6    1 
ATOM   2088  N  N1    . A   A  1  105  ? 56.176  155.911 23.970  1.00 54.66  ? 106  A   A N1    1 
ATOM   2089  C  C2    . A   A  1  105  ? 56.476  156.976 23.219  1.00 54.59  ? 106  A   A C2    1 
ATOM   2090  N  N3    . A   A  1  105  ? 57.004  157.029 21.996  1.00 53.69  ? 106  A   A N3    1 
ATOM   2091  C  C4    . A   A  1  105  ? 57.237  155.789 21.526  1.00 52.97  ? 106  A   A C4    1 
ATOM   2092  P  P     . U   A  1  106  ? 63.012  156.189 19.557  1.00 51.81  ? 107  U   A P     1 
ATOM   2093  O  OP1   . U   A  1  106  ? 64.204  156.793 18.924  1.00 51.53  ? 107  U   A OP1   1 
ATOM   2094  O  OP2   . U   A  1  106  ? 62.943  154.724 19.744  1.00 51.11  ? 107  U   A OP2   1 
ATOM   2095  O  "O5'" . U   A  1  106  ? 62.722  156.913 20.949  1.00 50.62  ? 107  U   A "O5'" 1 
ATOM   2096  C  "C5'" . U   A  1  106  ? 62.412  158.316 20.985  1.00 50.47  ? 107  U   A "C5'" 1 
ATOM   2097  C  "C4'" . U   A  1  106  ? 61.808  158.710 22.315  1.00 50.69  ? 107  U   A "C4'" 1 
ATOM   2098  O  "O4'" . U   A  1  106  ? 60.464  158.181 22.434  1.00 51.06  ? 107  U   A "O4'" 1 
ATOM   2099  C  "C3'" . U   A  1  106  ? 62.492  158.265 23.599  1.00 50.45  ? 107  U   A "C3'" 1 
ATOM   2100  O  "O3'" . U   A  1  106  ? 63.654  159.047 23.887  1.00 51.50  ? 107  U   A "O3'" 1 
ATOM   2101  C  "C2'" . U   A  1  106  ? 61.365  158.479 24.606  1.00 50.88  ? 107  U   A "C2'" 1 
ATOM   2102  O  "O2'" . U   A  1  106  ? 61.107  159.851 24.867  1.00 51.31  ? 107  U   A "O2'" 1 
ATOM   2103  C  "C1'" . U   A  1  106  ? 60.164  157.957 23.808  1.00 50.69  ? 107  U   A "C1'" 1 
ATOM   2104  N  N1    . U   A  1  106  ? 59.907  156.517 24.004  1.00 50.57  ? 107  U   A N1    1 
ATOM   2105  C  C2    . U   A  1  106  ? 59.092  156.129 25.063  1.00 51.00  ? 107  U   A C2    1 
ATOM   2106  O  O2    . U   A  1  106  ? 58.492  156.923 25.778  1.00 51.11  ? 107  U   A O2    1 
ATOM   2107  N  N3    . U   A  1  106  ? 58.991  154.773 25.246  1.00 51.29  ? 107  U   A N3    1 
ATOM   2108  C  C4    . U   A  1  106  ? 59.570  153.784 24.483  1.00 52.02  ? 107  U   A C4    1 
ATOM   2109  O  O4    . U   A  1  106  ? 59.449  152.604 24.828  1.00 53.56  ? 107  U   A O4    1 
ATOM   2110  C  C5    . U   A  1  106  ? 60.340  154.261 23.373  1.00 50.50  ? 107  U   A C5    1 
ATOM   2111  C  C6    . U   A  1  106  ? 60.481  155.575 23.180  1.00 50.33  ? 107  U   A C6    1 
ATOM   2112  P  P     . U   A  1  107  ? 65.060  158.321 24.276  1.00 52.17  ? 108  U   A P     1 
ATOM   2113  O  OP1   . U   A  1  107  ? 66.045  159.378 24.608  1.00 52.13  ? 108  U   A OP1   1 
ATOM   2114  O  OP2   . U   A  1  107  ? 65.417  157.289 23.282  1.00 50.98  ? 108  U   A OP2   1 
ATOM   2115  O  "O5'" . U   A  1  107  ? 64.738  157.525 25.619  1.00 53.21  ? 108  U   A "O5'" 1 
ATOM   2116  C  "C5'" . U   A  1  107  ? 64.004  158.147 26.707  1.00 52.98  ? 108  U   A "C5'" 1 
ATOM   2117  C  "C4'" . U   A  1  107  ? 63.483  157.093 27.649  1.00 52.42  ? 108  U   A "C4'" 1 
ATOM   2118  O  "O4'" . U   A  1  107  ? 62.416  156.329 27.031  1.00 52.84  ? 108  U   A "O4'" 1 
ATOM   2119  C  "C3'" . U   A  1  107  ? 64.516  156.059 28.042  1.00 52.43  ? 108  U   A "C3'" 1 
ATOM   2120  O  "O3'" . U   A  1  107  ? 65.318  156.545 29.098  1.00 50.39  ? 108  U   A "O3'" 1 
ATOM   2121  C  "C2'" . U   A  1  107  ? 63.658  154.873 28.454  1.00 53.81  ? 108  U   A "C2'" 1 
ATOM   2122  O  "O2'" . U   A  1  107  ? 63.186  154.942 29.784  1.00 55.95  ? 108  U   A "O2'" 1 
ATOM   2123  C  "C1'" . U   A  1  107  ? 62.481  154.983 27.474  1.00 54.53  ? 108  U   A "C1'" 1 
ATOM   2124  N  N1    . U   A  1  107  ? 62.631  154.100 26.308  1.00 56.07  ? 108  U   A N1    1 
ATOM   2125  C  C2    . U   A  1  107  ? 62.094  152.820 26.388  1.00 56.98  ? 108  U   A C2    1 
ATOM   2126  O  O2    . U   A  1  107  ? 61.465  152.419 27.354  1.00 57.42  ? 108  U   A O2    1 
ATOM   2127  N  N3    . U   A  1  107  ? 62.320  152.025 25.288  1.00 58.76  ? 108  U   A N3    1 
ATOM   2128  C  C4    . U   A  1  107  ? 63.007  152.370 24.137  1.00 58.59  ? 108  U   A C4    1 
ATOM   2129  O  O4    . U   A  1  107  ? 63.188  151.523 23.251  1.00 58.85  ? 108  U   A O4    1 
ATOM   2130  C  C5    . U   A  1  107  ? 63.503  153.714 24.125  1.00 57.92  ? 108  U   A C5    1 
ATOM   2131  C  C6    . U   A  1  107  ? 63.302  154.512 25.179  1.00 57.20  ? 108  U   A C6    1 
ATOM   2132  P  P     . U   A  1  108  ? 66.850  156.090 29.214  1.00 50.20  ? 109  U   A P     1 
ATOM   2133  O  OP1   . U   A  1  108  ? 67.508  156.362 27.902  1.00 50.68  ? 109  U   A OP1   1 
ATOM   2134  O  OP2   . U   A  1  108  ? 66.815  154.710 29.731  1.00 50.30  ? 109  U   A OP2   1 
ATOM   2135  O  "O5'" . U   A  1  108  ? 67.448  157.063 30.334  1.00 49.06  ? 109  U   A "O5'" 1 
ATOM   2136  C  "C5'" . U   A  1  108  ? 67.715  158.464 30.057  1.00 48.11  ? 109  U   A "C5'" 1 
ATOM   2137  C  "C4'" . U   A  1  108  ? 67.948  159.222 31.349  1.00 48.13  ? 109  U   A "C4'" 1 
ATOM   2138  O  "O4'" . U   A  1  108  ? 66.679  159.431 32.020  1.00 48.55  ? 109  U   A "O4'" 1 
ATOM   2139  C  "C3'" . U   A  1  108  ? 68.831  158.521 32.371  1.00 47.70  ? 109  U   A "C3'" 1 
ATOM   2140  O  "O3'" . U   A  1  108  ? 70.208  158.808 32.168  1.00 46.58  ? 109  U   A "O3'" 1 
ATOM   2141  C  "C2'" . U   A  1  108  ? 68.335  159.090 33.686  1.00 48.73  ? 109  U   A "C2'" 1 
ATOM   2142  O  "O2'" . U   A  1  108  ? 68.904  160.365 33.935  1.00 49.03  ? 109  U   A "O2'" 1 
ATOM   2143  C  "C1'" . U   A  1  108  ? 66.830  159.207 33.413  1.00 49.52  ? 109  U   A "C1'" 1 
ATOM   2144  N  N1    . U   A  1  108  ? 66.027  158.023 33.792  1.00 50.32  ? 109  U   A N1    1 
ATOM   2145  C  C2    . U   A  1  108  ? 66.041  157.616 35.122  1.00 50.47  ? 109  U   A C2    1 
ATOM   2146  O  O2    . U   A  1  108  ? 66.722  158.162 35.975  1.00 52.87  ? 109  U   A O2    1 
ATOM   2147  N  N3    . U   A  1  108  ? 65.233  156.540 35.410  1.00 49.27  ? 109  U   A N3    1 
ATOM   2148  C  C4    . U   A  1  108  ? 64.443  155.828 34.537  1.00 49.44  ? 109  U   A C4    1 
ATOM   2149  O  O4    . U   A  1  108  ? 63.771  154.882 34.955  1.00 50.09  ? 109  U   A O4    1 
ATOM   2150  C  C5    . U   A  1  108  ? 64.493  156.285 33.190  1.00 50.04  ? 109  U   A C5    1 
ATOM   2151  C  C6    . U   A  1  108  ? 65.262  157.338 32.866  1.00 50.57  ? 109  U   A C6    1 
ATOM   2152  P  P     . C   A  1  109  ? 71.237  157.600 31.957  1.00 46.61  ? 110  C   A P     1 
ATOM   2153  O  OP1   . C   A  1  109  ? 72.464  158.135 31.337  1.00 49.22  ? 110  C   A OP1   1 
ATOM   2154  O  OP2   . C   A  1  109  ? 70.496  156.502 31.285  1.00 46.16  ? 110  C   A OP2   1 
ATOM   2155  O  "O5'" . C   A  1  109  ? 71.628  157.171 33.435  1.00 46.39  ? 110  C   A "O5'" 1 
ATOM   2156  C  "C5'" . C   A  1  109  ? 72.231  158.122 34.327  1.00 45.38  ? 110  C   A "C5'" 1 
ATOM   2157  C  "C4'" . C   A  1  109  ? 72.132  157.630 35.744  1.00 45.09  ? 110  C   A "C4'" 1 
ATOM   2158  O  "O4'" . C   A  1  109  ? 70.743  157.600 36.154  1.00 45.44  ? 110  C   A "O4'" 1 
ATOM   2159  C  "C3'" . C   A  1  109  ? 72.606  156.206 35.964  1.00 43.49  ? 110  C   A "C3'" 1 
ATOM   2160  O  "O3'" . C   A  1  109  ? 74.011  156.159 36.107  1.00 42.00  ? 110  C   A "O3'" 1 
ATOM   2161  C  "C2'" . C   A  1  109  ? 71.892  155.836 37.247  1.00 44.50  ? 110  C   A "C2'" 1 
ATOM   2162  O  "O2'" . C   A  1  109  ? 72.514  156.453 38.357  1.00 43.94  ? 110  C   A "O2'" 1 
ATOM   2163  C  "C1'" . C   A  1  109  ? 70.532  156.499 37.019  1.00 46.03  ? 110  C   A "C1'" 1 
ATOM   2164  N  N1    . C   A  1  109  ? 69.534  155.598 36.405  1.00 48.54  ? 110  C   A N1    1 
ATOM   2165  C  C2    . C   A  1  109  ? 68.825  154.713 37.234  1.00 50.16  ? 110  C   A C2    1 
ATOM   2166  O  O2    . C   A  1  109  ? 69.081  154.690 38.449  1.00 50.34  ? 110  C   A O2    1 
ATOM   2167  N  N3    . C   A  1  109  ? 67.886  153.905 36.692  1.00 51.64  ? 110  C   A N3    1 
ATOM   2168  C  C4    . C   A  1  109  ? 67.643  153.950 35.378  1.00 52.01  ? 110  C   A C4    1 
ATOM   2169  N  N4    . C   A  1  109  ? 66.690  153.146 34.891  1.00 51.55  ? 110  C   A N4    1 
ATOM   2170  C  C5    . C   A  1  109  ? 68.364  154.828 34.505  1.00 51.78  ? 110  C   A C5    1 
ATOM   2171  C  C6    . C   A  1  109  ? 69.291  155.623 35.058  1.00 49.69  ? 110  C   A C6    1 
ATOM   2172  P  P     . C   A  1  110  ? 74.800  154.839 35.670  1.00 42.27  ? 111  C   A P     1 
ATOM   2173  O  OP1   . C   A  1  110  ? 76.263  155.039 35.805  1.00 40.64  ? 111  C   A OP1   1 
ATOM   2174  O  OP2   . C   A  1  110  ? 74.235  154.413 34.365  1.00 43.37  ? 111  C   A OP2   1 
ATOM   2175  O  "O5'" . C   A  1  110  ? 74.383  153.802 36.796  1.00 40.24  ? 111  C   A "O5'" 1 
ATOM   2176  C  "C5'" . C   A  1  110  ? 74.885  153.947 38.129  1.00 36.40  ? 111  C   A "C5'" 1 
ATOM   2177  C  "C4'" . C   A  1  110  ? 74.306  152.887 39.019  1.00 35.18  ? 111  C   A "C4'" 1 
ATOM   2178  O  "O4'" . C   A  1  110  ? 72.874  153.034 39.070  1.00 35.15  ? 111  C   A "O4'" 1 
ATOM   2179  C  "C3'" . C   A  1  110  ? 74.532  151.444 38.614  1.00 33.14  ? 111  C   A "C3'" 1 
ATOM   2180  O  "O3'" . C   A  1  110  ? 75.795  151.004 39.087  1.00 32.56  ? 111  C   A "O3'" 1 
ATOM   2181  C  "C2'" . C   A  1  110  ? 73.414  150.739 39.354  1.00 32.75  ? 111  C   A "C2'" 1 
ATOM   2182  O  "O2'" . C   A  1  110  ? 73.743  150.565 40.705  1.00 31.73  ? 111  C   A "O2'" 1 
ATOM   2183  C  "C1'" . C   A  1  110  ? 72.288  151.766 39.257  1.00 35.59  ? 111  C   A "C1'" 1 
ATOM   2184  N  N1    . C   A  1  110  ? 71.395  151.483 38.131  1.00 38.11  ? 111  C   A N1    1 
ATOM   2185  C  C2    . C   A  1  110  ? 70.376  150.568 38.316  1.00 38.03  ? 111  C   A C2    1 
ATOM   2186  O  O2    . C   A  1  110  ? 70.242  150.049 39.432  1.00 36.76  ? 111  C   A O2    1 
ATOM   2187  N  N3    . C   A  1  110  ? 69.552  150.274 37.281  1.00 39.98  ? 111  C   A N3    1 
ATOM   2188  C  C4    . C   A  1  110  ? 69.719  150.877 36.100  1.00 41.11  ? 111  C   A C4    1 
ATOM   2189  N  N4    . C   A  1  110  ? 68.881  150.570 35.106  1.00 39.58  ? 111  C   A N4    1 
ATOM   2190  C  C5    . C   A  1  110  ? 70.752  151.825 35.887  1.00 41.28  ? 111  C   A C5    1 
ATOM   2191  C  C6    . C   A  1  110  ? 71.562  152.096 36.920  1.00 40.07  ? 111  C   A C6    1 
ATOM   2192  P  P     . G   A  1  111  ? 76.516  149.754 38.403  1.00 31.32  ? 112  G   A P     1 
ATOM   2193  O  OP1   . G   A  1  111  ? 77.561  149.292 39.324  1.00 30.18  ? 112  G   A OP1   1 
ATOM   2194  O  OP2   . G   A  1  111  ? 76.878  150.160 37.031  1.00 31.97  ? 112  G   A OP2   1 
ATOM   2195  O  "O5'" . G   A  1  111  ? 75.371  148.656 38.338  1.00 33.05  ? 112  G   A "O5'" 1 
ATOM   2196  C  "C5'" . G   A  1  111  ? 74.927  147.967 39.511  1.00 34.26  ? 112  G   A "C5'" 1 
ATOM   2197  C  "C4'" . G   A  1  111  ? 73.787  147.049 39.155  1.00 34.62  ? 112  G   A "C4'" 1 
ATOM   2198  O  "O4'" . G   A  1  111  ? 72.700  147.816 38.578  1.00 36.02  ? 112  G   A "O4'" 1 
ATOM   2199  C  "C3'" . G   A  1  111  ? 74.125  146.018 38.093  1.00 33.64  ? 112  G   A "C3'" 1 
ATOM   2200  O  "O3'" . G   A  1  111  ? 74.759  144.910 38.691  1.00 31.71  ? 112  G   A "O3'" 1 
ATOM   2201  C  "C2'" . G   A  1  111  ? 72.757  145.674 37.540  1.00 35.66  ? 112  G   A "C2'" 1 
ATOM   2202  O  "O2'" . G   A  1  111  ? 72.048  144.807 38.401  1.00 36.20  ? 112  G   A "O2'" 1 
ATOM   2203  C  "C1'" . G   A  1  111  ? 72.091  147.052 37.553  1.00 37.99  ? 112  G   A "C1'" 1 
ATOM   2204  N  N9    . G   A  1  111  ? 72.218  147.780 36.292  1.00 41.68  ? 112  G   A N9    1 
ATOM   2205  C  C8    . G   A  1  111  ? 73.228  148.626 35.895  1.00 42.17  ? 112  G   A C8    1 
ATOM   2206  N  N7    . G   A  1  111  ? 72.990  149.199 34.750  1.00 43.10  ? 112  G   A N7    1 
ATOM   2207  C  C5    . G   A  1  111  ? 71.760  148.682 34.362  1.00 43.25  ? 112  G   A C5    1 
ATOM   2208  C  C6    . G   A  1  111  ? 70.948  148.952 33.228  1.00 44.12  ? 112  G   A C6    1 
ATOM   2209  O  O6    . G   A  1  111  ? 71.125  149.767 32.328  1.00 44.75  ? 112  G   A O6    1 
ATOM   2210  N  N1    . G   A  1  111  ? 69.801  148.165 33.224  1.00 43.75  ? 112  G   A N1    1 
ATOM   2211  C  C2    . G   A  1  111  ? 69.456  147.258 34.189  1.00 42.52  ? 112  G   A C2    1 
ATOM   2212  N  N2    . G   A  1  111  ? 68.331  146.570 33.977  1.00 41.71  ? 112  G   A N2    1 
ATOM   2213  N  N3    . G   A  1  111  ? 70.167  147.038 35.269  1.00 43.05  ? 112  G   A N3    1 
ATOM   2214  C  C4    . G   A  1  111  ? 71.299  147.774 35.288  1.00 42.79  ? 112  G   A C4    1 
ATOM   2215  P  P     . A   A  1  112  ? 76.049  144.272 38.007  1.00 31.88  ? 113  A   A P     1 
ATOM   2216  O  OP1   . A   A  1  112  ? 76.630  143.405 39.031  1.00 29.16  ? 113  A   A OP1   1 
ATOM   2217  O  OP2   . A   A  1  112  ? 76.860  145.344 37.402  1.00 33.62  ? 113  A   A OP2   1 
ATOM   2218  O  "O5'" . A   A  1  112  ? 75.467  143.372 36.832  1.00 33.88  ? 113  A   A "O5'" 1 
ATOM   2219  C  "C5'" . A   A  1  112  ? 75.245  141.971 37.043  1.00 35.61  ? 113  A   A "C5'" 1 
ATOM   2220  C  "C4'" . A   A  1  112  ? 75.823  141.161 35.907  1.00 36.59  ? 113  A   A "C4'" 1 
ATOM   2221  O  "O4'" . A   A  1  112  ? 74.981  141.302 34.744  1.00 37.02  ? 113  A   A "O4'" 1 
ATOM   2222  C  "C3'" . A   A  1  112  ? 77.178  141.557 35.346  1.00 37.38  ? 113  A   A "C3'" 1 
ATOM   2223  O  "O3'" . A   A  1  112  ? 78.276  141.196 36.178  1.00 37.47  ? 113  A   A "O3'" 1 
ATOM   2224  C  "C2'" . A   A  1  112  ? 77.183  140.783 34.032  1.00 37.16  ? 113  A   A "C2'" 1 
ATOM   2225  O  "O2'" . A   A  1  112  ? 77.498  139.422 34.264  1.00 35.28  ? 113  A   A "O2'" 1 
ATOM   2226  C  "C1'" . A   A  1  112  ? 75.707  140.882 33.611  1.00 38.19  ? 113  A   A "C1'" 1 
ATOM   2227  N  N9    . A   A  1  112  ? 75.384  141.783 32.499  1.00 40.69  ? 113  A   A N9    1 
ATOM   2228  C  C8    . A   A  1  112  ? 76.061  142.891 32.062  1.00 40.84  ? 113  A   A C8    1 
ATOM   2229  N  N7    . A   A  1  112  ? 75.510  143.468 31.019  1.00 42.11  ? 113  A   A N7    1 
ATOM   2230  C  C5    . A   A  1  112  ? 74.393  142.692 30.753  1.00 41.57  ? 113  A   A C5    1 
ATOM   2231  C  C6    . A   A  1  112  ? 73.396  142.767 29.763  1.00 41.94  ? 113  A   A C6    1 
ATOM   2232  N  N6    . A   A  1  112  ? 73.363  143.693 28.803  1.00 41.54  ? 113  A   A N6    1 
ATOM   2233  N  N1    . A   A  1  112  ? 72.421  141.837 29.787  1.00 41.51  ? 113  A   A N1    1 
ATOM   2234  C  C2    . A   A  1  112  ? 72.453  140.904 30.734  1.00 41.83  ? 113  A   A C2    1 
ATOM   2235  N  N3    . A   A  1  112  ? 73.336  140.725 31.710  1.00 42.66  ? 113  A   A N3    1 
ATOM   2236  C  C4    . A   A  1  112  ? 74.296  141.659 31.661  1.00 41.68  ? 113  A   A C4    1 
ATOM   2237  P  P     . A   A  1  113  ? 79.733  141.828 35.888  1.00 38.53  ? 114  A   A P     1 
ATOM   2238  O  OP1   . A   A  1  113  ? 80.466  140.930 34.943  1.00 39.36  ? 114  A   A OP1   1 
ATOM   2239  O  OP2   . A   A  1  113  ? 80.377  142.184 37.179  1.00 39.71  ? 114  A   A OP2   1 
ATOM   2240  O  "O5'" . A   A  1  113  ? 79.407  143.163 35.084  1.00 37.87  ? 114  A   A "O5'" 1 
ATOM   2241  C  "C5'" . A   A  1  113  ? 79.049  144.379 35.754  1.00 39.06  ? 114  A   A "C5'" 1 
ATOM   2242  C  "C4'" . A   A  1  113  ? 79.046  145.511 34.754  1.00 40.04  ? 114  A   A "C4'" 1 
ATOM   2243  O  "O4'" . A   A  1  113  ? 77.908  145.346 33.860  1.00 40.37  ? 114  A   A "O4'" 1 
ATOM   2244  C  "C3'" . A   A  1  113  ? 78.943  146.928 35.319  1.00 40.86  ? 114  A   A "C3'" 1 
ATOM   2245  O  "O3'" . A   A  1  113  ? 79.669  147.852 34.472  1.00 42.60  ? 114  A   A "O3'" 1 
ATOM   2246  C  "C2'" . A   A  1  113  ? 77.439  147.197 35.212  1.00 39.84  ? 114  A   A "C2'" 1 
ATOM   2247  O  "O2'" . A   A  1  113  ? 77.149  148.579 35.224  1.00 39.89  ? 114  A   A "O2'" 1 
ATOM   2248  C  "C1'" . A   A  1  113  ? 77.132  146.531 33.862  1.00 40.68  ? 114  A   A "C1'" 1 
ATOM   2249  N  N9    . A   A  1  113  ? 75.743  146.184 33.512  1.00 41.58  ? 114  A   A N9    1 
ATOM   2250  C  C8    . A   A  1  113  ? 74.927  145.231 34.072  1.00 43.07  ? 114  A   A C8    1 
ATOM   2251  N  N7    . A   A  1  113  ? 73.734  145.173 33.527  1.00 44.81  ? 114  A   A N7    1 
ATOM   2252  C  C5    . A   A  1  113  ? 73.761  146.153 32.549  1.00 43.55  ? 114  A   A C5    1 
ATOM   2253  C  C6    . A   A  1  113  ? 72.779  146.617 31.641  1.00 45.07  ? 114  A   A C6    1 
ATOM   2254  N  N6    . A   A  1  113  ? 71.521  146.161 31.592  1.00 46.39  ? 114  A   A N6    1 
ATOM   2255  N  N1    . A   A  1  113  ? 73.130  147.593 30.786  1.00 45.76  ? 114  A   A N1    1 
ATOM   2256  C  C2    . A   A  1  113  ? 74.374  148.081 30.861  1.00 46.13  ? 114  A   A C2    1 
ATOM   2257  N  N3    . A   A  1  113  ? 75.375  147.746 31.686  1.00 44.34  ? 114  A   A N3    1 
ATOM   2258  C  C4    . A   A  1  113  ? 74.995  146.768 32.514  1.00 42.28  ? 114  A   A C4    1 
ATOM   2259  P  P     . U   A  1  114  ? 81.299  147.884 34.462  1.00 43.98  ? 115  U   A P     1 
ATOM   2260  O  OP1   . U   A  1  114  ? 81.897  146.669 35.086  1.00 42.67  ? 115  U   A OP1   1 
ATOM   2261  O  OP2   . U   A  1  114  ? 81.752  149.235 34.895  1.00 44.18  ? 115  U   A OP2   1 
ATOM   2262  O  "O5'" . U   A  1  114  ? 81.653  147.776 32.918  1.00 47.13  ? 115  U   A "O5'" 1 
ATOM   2263  C  "C5'" . U   A  1  114  ? 82.929  148.185 32.409  1.00 50.24  ? 115  U   A "C5'" 1 
ATOM   2264  C  "C4'" . U   A  1  114  ? 82.922  148.071 30.913  1.00 51.16  ? 115  U   A "C4'" 1 
ATOM   2265  O  "O4'" . U   A  1  114  ? 82.718  146.677 30.579  1.00 50.91  ? 115  U   A "O4'" 1 
ATOM   2266  C  "C3'" . U   A  1  114  ? 81.764  148.816 30.261  1.00 52.36  ? 115  U   A "C3'" 1 
ATOM   2267  O  "O3'" . U   A  1  114  ? 82.117  149.123 28.923  1.00 54.48  ? 115  U   A "O3'" 1 
ATOM   2268  C  "C2'" . U   A  1  114  ? 80.668  147.765 30.251  1.00 52.27  ? 115  U   A "C2'" 1 
ATOM   2269  O  "O2'" . U   A  1  114  ? 79.675  147.980 29.271  1.00 54.50  ? 115  U   A "O2'" 1 
ATOM   2270  C  "C1'" . U   A  1  114  ? 81.485  146.532 29.904  1.00 51.93  ? 115  U   A "C1'" 1 
ATOM   2271  N  N1    . U   A  1  114  ? 80.848  145.286 30.334  1.00 52.50  ? 115  U   A N1    1 
ATOM   2272  C  C2    . U   A  1  114  ? 79.937  144.724 29.474  1.00 52.51  ? 115  U   A C2    1 
ATOM   2273  O  O2    . U   A  1  114  ? 79.604  145.245 28.420  1.00 53.26  ? 115  U   A O2    1 
ATOM   2274  N  N3    . U   A  1  114  ? 79.419  143.531 29.891  1.00 53.63  ? 115  U   A N3    1 
ATOM   2275  C  C4    . U   A  1  114  ? 79.690  142.871 31.067  1.00 54.02  ? 115  U   A C4    1 
ATOM   2276  O  O4    . U   A  1  114  ? 79.108  141.815 31.316  1.00 53.45  ? 115  U   A O4    1 
ATOM   2277  C  C5    . U   A  1  114  ? 80.620  143.531 31.920  1.00 53.69  ? 115  U   A C5    1 
ATOM   2278  C  C6    . U   A  1  114  ? 81.156  144.688 31.536  1.00 52.49  ? 115  U   A C6    1 
ATOM   2279  P  P     . G   A  1  115  ? 82.392  150.639 28.516  1.00 55.14  ? 116  G   A P     1 
ATOM   2280  O  OP1   . G   A  1  115  ? 81.312  151.409 29.173  1.00 55.49  ? 116  G   A OP1   1 
ATOM   2281  O  OP2   . G   A  1  115  ? 82.560  150.714 27.045  1.00 55.15  ? 116  G   A OP2   1 
ATOM   2282  O  "O5'" . G   A  1  115  ? 83.797  150.947 29.203  1.00 53.67  ? 116  G   A "O5'" 1 
ATOM   2283  C  "C5'" . G   A  1  115  ? 85.017  150.408 28.640  1.00 51.60  ? 116  G   A "C5'" 1 
ATOM   2284  C  "C4'" . G   A  1  115  ? 86.196  151.223 29.094  1.00 49.82  ? 116  G   A "C4'" 1 
ATOM   2285  O  "O4'" . G   A  1  115  ? 85.965  152.597 28.703  1.00 48.42  ? 116  G   A "O4'" 1 
ATOM   2286  C  "C3'" . G   A  1  115  ? 86.374  151.260 30.600  1.00 49.15  ? 116  G   A "C3'" 1 
ATOM   2287  O  "O3'" . G   A  1  115  ? 87.194  150.168 31.017  1.00 51.76  ? 116  G   A "O3'" 1 
ATOM   2288  C  "C2'" . G   A  1  115  ? 87.024  152.618 30.827  1.00 47.92  ? 116  G   A "C2'" 1 
ATOM   2289  O  "O2'" . G   A  1  115  ? 88.415  152.644 30.572  1.00 49.02  ? 116  G   A "O2'" 1 
ATOM   2290  C  "C1'" . G   A  1  115  ? 86.344  153.461 29.750  1.00 46.94  ? 116  G   A "C1'" 1 
ATOM   2291  N  N9    . G   A  1  115  ? 85.172  154.231 30.157  1.00 45.50  ? 116  G   A N9    1 
ATOM   2292  C  C8    . G   A  1  115  ? 83.857  154.025 29.790  1.00 44.53  ? 116  G   A C8    1 
ATOM   2293  N  N7    . G   A  1  115  ? 83.044  154.922 30.276  1.00 44.08  ? 116  G   A N7    1 
ATOM   2294  C  C5    . G   A  1  115  ? 83.867  155.754 31.029  1.00 44.69  ? 116  G   A C5    1 
ATOM   2295  C  C6    . G   A  1  115  ? 83.558  156.908 31.795  1.00 44.83  ? 116  G   A C6    1 
ATOM   2296  O  O6    . G   A  1  115  ? 82.457  157.436 31.986  1.00 45.91  ? 116  G   A O6    1 
ATOM   2297  N  N1    . G   A  1  115  ? 84.697  157.457 32.369  1.00 45.12  ? 116  G   A N1    1 
ATOM   2298  C  C2    . G   A  1  115  ? 85.966  156.958 32.230  1.00 45.41  ? 116  G   A C2    1 
ATOM   2299  N  N2    . G   A  1  115  ? 86.940  157.624 32.850  1.00 47.08  ? 116  G   A N2    1 
ATOM   2300  N  N3    . G   A  1  115  ? 86.264  155.886 31.532  1.00 44.07  ? 116  G   A N3    1 
ATOM   2301  C  C4    . G   A  1  115  ? 85.179  155.338 30.962  1.00 44.59  ? 116  G   A C4    1 
ATOM   2302  P  P     . A   A  1  116  ? 87.106  149.610 32.530  1.00 53.69  ? 117  A   A P     1 
ATOM   2303  O  OP1   . A   A  1  116  ? 88.125  148.530 32.647  1.00 52.22  ? 117  A   A OP1   1 
ATOM   2304  O  OP2   . A   A  1  116  ? 85.702  149.310 32.866  1.00 56.25  ? 117  A   A OP2   1 
ATOM   2305  O  "O5'" . A   A  1  116  ? 87.507  150.862 33.439  1.00 53.29  ? 117  A   A "O5'" 1 
ATOM   2306  C  "C5'" . A   A  1  116  ? 88.876  151.329 33.537  1.00 51.68  ? 117  A   A "C5'" 1 
ATOM   2307  C  "C4'" . A   A  1  116  ? 88.970  152.479 34.525  1.00 50.16  ? 117  A   A "C4'" 1 
ATOM   2308  O  "O4'" . A   A  1  116  ? 88.340  153.674 33.984  1.00 49.29  ? 117  A   A "O4'" 1 
ATOM   2309  C  "C3'" . A   A  1  116  ? 88.260  152.279 35.853  1.00 50.50  ? 117  A   A "C3'" 1 
ATOM   2310  O  "O3'" . A   A  1  116  ? 88.995  151.451 36.748  1.00 51.56  ? 117  A   A "O3'" 1 
ATOM   2311  C  "C2'" . A   A  1  116  ? 88.086  153.711 36.349  1.00 49.79  ? 117  A   A "C2'" 1 
ATOM   2312  O  "O2'" . A   A  1  116  ? 89.237  154.297 36.917  1.00 50.91  ? 117  A   A "O2'" 1 
ATOM   2313  C  "C1'" . A   A  1  116  ? 87.774  154.438 35.045  1.00 48.56  ? 117  A   A "C1'" 1 
ATOM   2314  N  N9    . A   A  1  116  ? 86.336  154.542 34.831  1.00 46.84  ? 117  A   A N9    1 
ATOM   2315  C  C8    . A   A  1  116  ? 85.550  153.721 34.068  1.00 47.61  ? 117  A   A C8    1 
ATOM   2316  N  N7    . A   A  1  116  ? 84.284  154.049 34.070  1.00 47.04  ? 117  A   A N7    1 
ATOM   2317  C  C5    . A   A  1  116  ? 84.233  155.167 34.887  1.00 46.57  ? 117  A   A C5    1 
ATOM   2318  C  C6    . A   A  1  116  ? 83.167  155.994 35.292  1.00 47.47  ? 117  A   A C6    1 
ATOM   2319  N  N6    . A   A  1  116  ? 81.905  155.820 34.888  1.00 47.10  ? 117  A   A N6    1 
ATOM   2320  N  N1    . A   A  1  116  ? 83.449  157.021 36.129  1.00 47.69  ? 117  A   A N1    1 
ATOM   2321  C  C2    . A   A  1  116  ? 84.718  157.199 36.512  1.00 47.53  ? 117  A   A C2    1 
ATOM   2322  N  N3    . A   A  1  116  ? 85.805  156.496 36.189  1.00 46.66  ? 117  A   A N3    1 
ATOM   2323  C  C4    . A   A  1  116  ? 85.490  155.482 35.365  1.00 46.57  ? 117  A   A C4    1 
ATOM   2324  P  P     . G   A  1  117  ? 88.200  150.490 37.768  1.00 52.33  ? 118  G   A P     1 
ATOM   2325  O  OP1   . G   A  1  117  ? 89.195  149.652 38.491  1.00 51.15  ? 118  G   A OP1   1 
ATOM   2326  O  OP2   . G   A  1  117  ? 87.065  149.843 37.059  1.00 52.73  ? 118  G   A OP2   1 
ATOM   2327  O  "O5'" . G   A  1  117  ? 87.590  151.488 38.839  1.00 48.56  ? 118  G   A "O5'" 1 
ATOM   2328  C  "C5'" . G   A  1  117  ? 88.433  152.023 39.849  1.00 47.23  ? 118  G   A "C5'" 1 
ATOM   2329  C  "C4'" . G   A  1  117  ? 87.775  153.201 40.486  1.00 46.31  ? 118  G   A "C4'" 1 
ATOM   2330  O  "O4'" . G   A  1  117  ? 87.220  154.057 39.456  1.00 45.43  ? 118  G   A "O4'" 1 
ATOM   2331  C  "C3'" . G   A  1  117  ? 86.548  152.911 41.315  1.00 45.86  ? 118  G   A "C3'" 1 
ATOM   2332  O  "O3'" . G   A  1  117  ? 86.903  152.365 42.566  1.00 47.32  ? 118  G   A "O3'" 1 
ATOM   2333  C  "C2'" . G   A  1  117  ? 85.966  154.309 41.436  1.00 44.13  ? 118  G   A "C2'" 1 
ATOM   2334  O  "O2'" . G   A  1  117  ? 86.759  155.141 42.262  1.00 45.85  ? 118  G   A "O2'" 1 
ATOM   2335  C  "C1'" . G   A  1  117  ? 86.159  154.809 40.009  1.00 42.41  ? 118  G   A "C1'" 1 
ATOM   2336  N  N9    . G   A  1  117  ? 84.958  154.616 39.205  1.00 40.10  ? 118  G   A N9    1 
ATOM   2337  C  C8    . G   A  1  117  ? 84.758  153.743 38.165  1.00 38.71  ? 118  G   A C8    1 
ATOM   2338  N  N7    . G   A  1  117  ? 83.556  153.821 37.657  1.00 38.37  ? 118  G   A N7    1 
ATOM   2339  C  C5    . G   A  1  117  ? 82.928  154.799 38.408  1.00 38.67  ? 118  G   A C5    1 
ATOM   2340  C  C6    . G   A  1  117  ? 81.615  155.309 38.329  1.00 39.55  ? 118  G   A C6    1 
ATOM   2341  O  O6    . G   A  1  117  ? 80.707  154.971 37.565  1.00 40.35  ? 118  G   A O6    1 
ATOM   2342  N  N1    . G   A  1  117  ? 81.395  156.312 39.275  1.00 39.32  ? 118  G   A N1    1 
ATOM   2343  C  C2    . G   A  1  117  ? 82.322  156.755 40.183  1.00 38.21  ? 118  G   A C2    1 
ATOM   2344  N  N2    . G   A  1  117  ? 81.944  157.741 40.988  1.00 37.63  ? 118  G   A N2    1 
ATOM   2345  N  N3    . G   A  1  117  ? 83.543  156.268 40.281  1.00 38.06  ? 118  G   A N3    1 
ATOM   2346  C  C4    . G   A  1  117  ? 83.780  155.304 39.365  1.00 38.98  ? 118  G   A C4    1 
ATOM   2347  P  P     . A   A  1  118  ? 85.821  151.505 43.378  1.00 49.62  ? 119  A   A P     1 
ATOM   2348  O  OP1   . A   A  1  118  ? 86.520  151.170 44.647  1.00 49.76  ? 119  A   A OP1   1 
ATOM   2349  O  OP2   . A   A  1  118  ? 85.283  150.411 42.517  1.00 50.09  ? 119  A   A OP2   1 
ATOM   2350  O  "O5'" . A   A  1  118  ? 84.613  152.522 43.654  1.00 46.85  ? 119  A   A "O5'" 1 
ATOM   2351  C  "C5'" . A   A  1  118  ? 84.727  153.560 44.651  1.00 43.91  ? 119  A   A "C5'" 1 
ATOM   2352  C  "C4'" . A   A  1  118  ? 83.427  154.321 44.798  1.00 42.29  ? 119  A   A "C4'" 1 
ATOM   2353  O  "O4'" . A   A  1  118  ? 83.091  154.942 43.542  1.00 41.84  ? 119  A   A "O4'" 1 
ATOM   2354  C  "C3'" . A   A  1  118  ? 82.169  153.560 45.191  1.00 42.07  ? 119  A   A "C3'" 1 
ATOM   2355  O  "O3'" . A   A  1  118  ? 82.122  153.390 46.604  1.00 43.69  ? 119  A   A "O3'" 1 
ATOM   2356  C  "C2'" . A   A  1  118  ? 81.080  154.517 44.730  1.00 40.44  ? 119  A   A "C2'" 1 
ATOM   2357  O  "O2'" . A   A  1  118  ? 80.910  155.617 45.593  1.00 39.97  ? 119  A   A "O2'" 1 
ATOM   2358  C  "C1'" . A   A  1  118  ? 81.683  155.054 43.438  1.00 40.26  ? 119  A   A "C1'" 1 
ATOM   2359  N  N9    . A   A  1  118  ? 81.246  154.295 42.271  1.00 38.54  ? 119  A   A N9    1 
ATOM   2360  C  C8    . A   A  1  118  ? 81.990  153.434 41.509  1.00 37.01  ? 119  A   A C8    1 
ATOM   2361  N  N7    . A   A  1  118  ? 81.343  152.931 40.497  1.00 36.25  ? 119  A   A N7    1 
ATOM   2362  C  C5    . A   A  1  118  ? 80.078  153.489 40.605  1.00 37.16  ? 119  A   A C5    1 
ATOM   2363  C  C6    . A   A  1  118  ? 78.927  153.360 39.833  1.00 37.41  ? 119  A   A C6    1 
ATOM   2364  N  N6    . A   A  1  118  ? 78.863  152.630 38.720  1.00 36.82  ? 119  A   A N6    1 
ATOM   2365  N  N1    . A   A  1  118  ? 77.822  154.028 40.238  1.00 37.96  ? 119  A   A N1    1 
ATOM   2366  C  C2    . A   A  1  118  ? 77.894  154.789 41.339  1.00 38.69  ? 119  A   A C2    1 
ATOM   2367  N  N3    . A   A  1  118  ? 78.927  155.008 42.128  1.00 38.67  ? 119  A   A N3    1 
ATOM   2368  C  C4    . A   A  1  118  ? 80.000  154.318 41.703  1.00 38.11  ? 119  A   A C4    1 
ATOM   2369  P  P     . A   A  1  119  ? 81.060  152.386 47.260  1.00 43.19  ? 120  A   A P     1 
ATOM   2370  O  OP1   . A   A  1  119  ? 81.486  152.228 48.675  1.00 43.41  ? 120  A   A OP1   1 
ATOM   2371  O  OP2   . A   A  1  119  ? 80.956  151.191 46.390  1.00 43.30  ? 120  A   A OP2   1 
ATOM   2372  O  "O5'" . A   A  1  119  ? 79.678  153.185 47.227  1.00 41.85  ? 120  A   A "O5'" 1 
ATOM   2373  C  "C5'" . A   A  1  119  ? 78.686  152.869 46.236  1.00 42.90  ? 120  A   A "C5'" 1 
ATOM   2374  C  "C4'" . A   A  1  119  ? 77.313  152.808 46.851  1.00 41.40  ? 120  A   A "C4'" 1 
ATOM   2375  O  "O4'" . A   A  1  119  ? 77.386  152.120 48.120  1.00 40.82  ? 120  A   A "O4'" 1 
ATOM   2376  C  "C3'" . A   A  1  119  ? 76.706  154.146 47.216  1.00 40.11  ? 120  A   A "C3'" 1 
ATOM   2377  O  "O3'" . A   A  1  119  ? 76.091  154.761 46.097  1.00 39.37  ? 120  A   A "O3'" 1 
ATOM   2378  C  "C2'" . A   A  1  119  ? 75.670  153.752 48.253  1.00 40.93  ? 120  A   A "C2'" 1 
ATOM   2379  O  "O2'" . A   A  1  119  ? 74.493  153.222 47.681  1.00 40.09  ? 120  A   A "O2'" 1 
ATOM   2380  C  "C1'" . A   A  1  119  ? 76.413  152.653 49.008  1.00 41.68  ? 120  A   A "C1'" 1 
ATOM   2381  N  N9    . A   A  1  119  ? 77.098  153.181 50.187  1.00 42.72  ? 120  A   A N9    1 
ATOM   2382  C  C8    . A   A  1  119  ? 78.364  152.891 50.638  1.00 41.37  ? 120  A   A C8    1 
ATOM   2383  N  N7    . A   A  1  119  ? 78.684  153.520 51.737  1.00 41.60  ? 120  A   A N7    1 
ATOM   2384  C  C5    . A   A  1  119  ? 77.560  154.281 52.028  1.00 41.92  ? 120  A   A C5    1 
ATOM   2385  C  C6    . A   A  1  119  ? 77.269  155.157 53.072  1.00 43.18  ? 120  A   A C6    1 
ATOM   2386  N  N6    . A   A  1  119  ? 78.120  155.424 54.067  1.00 43.42  ? 120  A   A N6    1 
ATOM   2387  N  N1    . A   A  1  119  ? 76.055  155.758 53.073  1.00 44.61  ? 120  A   A N1    1 
ATOM   2388  C  C2    . A   A  1  119  ? 75.196  155.476 52.084  1.00 44.73  ? 120  A   A C2    1 
ATOM   2389  N  N3    . A   A  1  119  ? 75.354  154.659 51.052  1.00 42.77  ? 120  A   A N3    1 
ATOM   2390  C  C4    . A   A  1  119  ? 76.576  154.087 51.083  1.00 42.19  ? 120  A   A C4    1 
ATOM   2391  P  P     . U   A  1  120  ? 75.571  156.267 46.211  1.00 36.52  ? 121  U   A P     1 
ATOM   2392  O  OP1   . U   A  1  120  ? 76.753  157.135 46.086  1.00 37.60  ? 121  U   A OP1   1 
ATOM   2393  O  OP2   . U   A  1  120  ? 74.753  156.340 47.423  1.00 37.54  ? 121  U   A OP2   1 
ATOM   2394  O  "O5'" . U   A  1  120  ? 74.645  156.467 44.928  1.00 38.94  ? 121  U   A "O5'" 1 
ATOM   2395  C  "C5'" . U   A  1  120  ? 75.187  156.354 43.593  1.00 39.99  ? 121  U   A "C5'" 1 
ATOM   2396  C  "C4'" . U   A  1  120  ? 74.102  155.995 42.607  1.00 41.37  ? 121  U   A "C4'" 1 
ATOM   2397  O  "O4'" . U   A  1  120  ? 73.665  154.641 42.837  1.00 43.54  ? 121  U   A "O4'" 1 
ATOM   2398  C  "C3'" . U   A  1  120  ? 72.831  156.818 42.681  1.00 42.35  ? 121  U   A "C3'" 1 
ATOM   2399  O  "O3'" . U   A  1  120  ? 73.001  158.026 41.931  1.00 41.66  ? 121  U   A "O3'" 1 
ATOM   2400  C  "C2'" . U   A  1  120  ? 71.779  155.884 42.080  1.00 44.53  ? 121  U   A "C2'" 1 
ATOM   2401  O  "O2'" . U   A  1  120  ? 71.647  155.911 40.677  1.00 47.59  ? 121  U   A "O2'" 1 
ATOM   2402  C  "C1'" . U   A  1  120  ? 72.316  154.506 42.448  1.00 45.91  ? 121  U   A "C1'" 1 
ATOM   2403  N  N1    . U   A  1  120  ? 71.578  153.791 43.498  1.00 49.47  ? 121  U   A N1    1 
ATOM   2404  C  C2    . U   A  1  120  ? 70.522  152.962 43.120  1.00 50.68  ? 121  U   A C2    1 
ATOM   2405  O  O2    . U   A  1  120  ? 70.176  152.809 41.958  1.00 52.29  ? 121  U   A O2    1 
ATOM   2406  N  N3    . U   A  1  120  ? 69.898  152.315 44.168  1.00 50.33  ? 121  U   A N3    1 
ATOM   2407  C  C4    . U   A  1  120  ? 70.209  152.407 45.508  1.00 49.67  ? 121  U   A C4    1 
ATOM   2408  O  O4    . U   A  1  120  ? 69.578  151.740 46.321  1.00 50.64  ? 121  U   A O4    1 
ATOM   2409  C  C5    . U   A  1  120  ? 71.291  153.276 45.812  1.00 50.20  ? 121  U   A C5    1 
ATOM   2410  C  C6    . U   A  1  120  ? 71.923  153.923 44.828  1.00 50.58  ? 121  U   A C6    1 
ATOM   2411  P  P     . C   A  1  121  ? 72.045  159.296 42.186  1.00 41.36  ? 122  C   A P     1 
ATOM   2412  O  OP1   . C   A  1  121  ? 71.045  158.982 43.236  1.00 42.77  ? 122  C   A OP1   1 
ATOM   2413  O  OP2   . C   A  1  121  ? 71.593  159.764 40.856  1.00 40.21  ? 122  C   A OP2   1 
ATOM   2414  O  "O5'" . C   A  1  121  ? 73.053  160.389 42.737  1.00 41.23  ? 122  C   A "O5'" 1 
ATOM   2415  C  "C5'" . C   A  1  121  ? 73.994  161.008 41.855  1.00 41.78  ? 122  C   A "C5'" 1 
ATOM   2416  C  "C4'" . C   A  1  121  ? 75.391  160.879 42.409  1.00 41.51  ? 122  C   A "C4'" 1 
ATOM   2417  O  "O4'" . C   A  1  121  ? 75.785  159.489 42.461  1.00 40.91  ? 122  C   A "O4'" 1 
ATOM   2418  C  "C3'" . C   A  1  121  ? 76.427  161.480 41.497  1.00 41.93  ? 122  C   A "C3'" 1 
ATOM   2419  O  "O3'" . C   A  1  121  ? 76.507  162.872 41.666  1.00 45.84  ? 122  C   A "O3'" 1 
ATOM   2420  C  "C2'" . C   A  1  121  ? 77.700  160.789 41.926  1.00 39.81  ? 122  C   A "C2'" 1 
ATOM   2421  O  "O2'" . C   A  1  121  ? 78.223  161.349 43.118  1.00 38.81  ? 122  C   A "O2'" 1 
ATOM   2422  C  "C1'" . C   A  1  121  ? 77.176  159.384 42.197  1.00 39.04  ? 122  C   A "C1'" 1 
ATOM   2423  N  N1    . C   A  1  121  ? 77.407  158.482 41.051  1.00 38.12  ? 122  C   A N1    1 
ATOM   2424  C  C2    . C   A  1  121  ? 78.706  158.003 40.845  1.00 37.90  ? 122  C   A C2    1 
ATOM   2425  O  O2    . C   A  1  121  ? 79.598  158.356 41.624  1.00 39.01  ? 122  C   A O2    1 
ATOM   2426  N  N3    . C   A  1  121  ? 78.954  157.169 39.812  1.00 35.96  ? 122  C   A N3    1 
ATOM   2427  C  C4    . C   A  1  121  ? 77.962  156.803 39.002  1.00 36.23  ? 122  C   A C4    1 
ATOM   2428  N  N4    . C   A  1  121  ? 78.251  155.962 38.009  1.00 35.16  ? 122  C   A N4    1 
ATOM   2429  C  C5    . C   A  1  121  ? 76.627  157.279 39.180  1.00 36.50  ? 122  C   A C5    1 
ATOM   2430  C  C6    . C   A  1  121  ? 76.397  158.108 40.206  1.00 37.60  ? 122  C   A C6    1 
ATOM   2431  P  P     . U   A  1  122  ? 76.991  163.764 40.432  1.00 49.07  ? 123  U   A P     1 
ATOM   2432  O  OP1   . U   A  1  122  ? 76.945  165.174 40.912  1.00 49.16  ? 123  U   A OP1   1 
ATOM   2433  O  OP2   . U   A  1  122  ? 76.162  163.354 39.267  1.00 48.95  ? 123  U   A OP2   1 
ATOM   2434  O  "O5'" . U   A  1  122  ? 78.502  163.291 40.168  1.00 46.50  ? 123  U   A "O5'" 1 
ATOM   2435  C  "C5'" . U   A  1  122  ? 79.570  163.723 41.047  1.00 47.08  ? 123  U   A "C5'" 1 
ATOM   2436  C  "C4'" . U   A  1  122  ? 80.888  163.034 40.720  1.00 47.03  ? 123  U   A "C4'" 1 
ATOM   2437  O  "O4'" . U   A  1  122  ? 80.679  161.617 40.529  1.00 46.62  ? 123  U   A "O4'" 1 
ATOM   2438  C  "C3'" . U   A  1  122  ? 81.637  163.420 39.453  1.00 47.98  ? 123  U   A "C3'" 1 
ATOM   2439  O  "O3'" . U   A  1  122  ? 82.352  164.660 39.596  1.00 52.15  ? 123  U   A "O3'" 1 
ATOM   2440  C  "C2'" . U   A  1  122  ? 82.605  162.248 39.295  1.00 46.29  ? 123  U   A "C2'" 1 
ATOM   2441  O  "O2'" . U   A  1  122  ? 83.714  162.275 40.177  1.00 45.31  ? 123  U   A "O2'" 1 
ATOM   2442  C  "C1'" . U   A  1  122  ? 81.731  161.083 39.735  1.00 45.99  ? 123  U   A "C1'" 1 
ATOM   2443  N  N1    . U   A  1  122  ? 81.184  160.299 38.611  1.00 45.84  ? 123  U   A N1    1 
ATOM   2444  C  C2    . U   A  1  122  ? 82.019  159.345 38.056  1.00 45.38  ? 123  U   A C2    1 
ATOM   2445  O  O2    . U   A  1  122  ? 83.159  159.165 38.440  1.00 45.18  ? 123  U   A O2    1 
ATOM   2446  N  N3    . U   A  1  122  ? 81.476  158.619 37.027  1.00 44.10  ? 123  U   A N3    1 
ATOM   2447  C  C4    . U   A  1  122  ? 80.215  158.752 36.487  1.00 46.16  ? 123  U   A C4    1 
ATOM   2448  O  O4    . U   A  1  122  ? 79.934  158.133 35.461  1.00 47.25  ? 123  U   A O4    1 
ATOM   2449  C  C5    . U   A  1  122  ? 79.406  159.762 37.103  1.00 45.89  ? 123  U   A C5    1 
ATOM   2450  C  C6    . U   A  1  122  ? 79.902  160.485 38.115  1.00 46.27  ? 123  U   A C6    1 
ATOM   2451  P  P     . C   A  1  123  ? 82.940  165.418 38.287  1.00 52.40  ? 124  C   A P     1 
ATOM   2452  O  OP1   . C   A  1  123  ? 83.530  166.703 38.745  1.00 53.01  ? 124  C   A OP1   1 
ATOM   2453  O  OP2   . C   A  1  123  ? 81.904  165.428 37.223  1.00 51.57  ? 124  C   A OP2   1 
ATOM   2454  O  "O5'" . C   A  1  123  ? 84.149  164.500 37.811  1.00 51.07  ? 124  C   A "O5'" 1 
ATOM   2455  C  "C5'" . C   A  1  123  ? 85.341  164.383 38.610  1.00 52.84  ? 124  C   A "C5'" 1 
ATOM   2456  C  "C4'" . C   A  1  123  ? 86.322  163.446 37.953  1.00 54.26  ? 124  C   A "C4'" 1 
ATOM   2457  O  "O4'" . C   A  1  123  ? 85.747  162.117 37.864  1.00 53.11  ? 124  C   A "O4'" 1 
ATOM   2458  C  "C3'" . C   A  1  123  ? 86.674  163.780 36.514  1.00 56.06  ? 124  C   A "C3'" 1 
ATOM   2459  O  "O3'" . C   A  1  123  ? 87.645  164.834 36.411  1.00 60.52  ? 124  C   A "O3'" 1 
ATOM   2460  C  "C2'" . C   A  1  123  ? 87.190  162.438 36.020  1.00 54.87  ? 124  C   A "C2'" 1 
ATOM   2461  O  "O2'" . C   A  1  123  ? 88.475  162.142 36.545  1.00 55.30  ? 124  C   A "O2'" 1 
ATOM   2462  C  "C1'" . C   A  1  123  ? 86.183  161.487 36.669  1.00 51.99  ? 124  C   A "C1'" 1 
ATOM   2463  N  N1    . C   A  1  123  ? 84.998  161.178 35.824  1.00 48.80  ? 124  C   A N1    1 
ATOM   2464  C  C2    . C   A  1  123  ? 85.112  160.200 34.824  1.00 46.64  ? 124  C   A C2    1 
ATOM   2465  O  O2    . C   A  1  123  ? 86.206  159.641 34.657  1.00 46.05  ? 124  C   A O2    1 
ATOM   2466  N  N3    . C   A  1  123  ? 84.029  159.893 34.064  1.00 43.51  ? 124  C   A N3    1 
ATOM   2467  C  C4    . C   A  1  123  ? 82.865  160.516 34.279  1.00 43.63  ? 124  C   A C4    1 
ATOM   2468  N  N4    . C   A  1  123  ? 81.816  160.166 33.539  1.00 41.57  ? 124  C   A N4    1 
ATOM   2469  C  C5    . C   A  1  123  ? 82.724  161.525 35.275  1.00 45.35  ? 124  C   A C5    1 
ATOM   2470  C  C6    . C   A  1  123  ? 83.806  161.825 36.014  1.00 47.97  ? 124  C   A C6    1 
ATOM   2471  P  P     . U   A  1  124  ? 87.639  165.814 35.127  1.00 63.79  ? 125  U   A P     1 
ATOM   2472  O  OP1   . U   A  1  124  ? 88.640  166.872 35.418  1.00 63.41  ? 125  U   A OP1   1 
ATOM   2473  O  OP2   . U   A  1  124  ? 86.248  166.201 34.744  1.00 64.11  ? 125  U   A OP2   1 
ATOM   2474  O  "O5'" . U   A  1  124  ? 88.185  164.899 33.947  1.00 64.30  ? 125  U   A "O5'" 1 
ATOM   2475  C  "C5'" . U   A  1  124  ? 89.582  164.570 33.841  1.00 65.36  ? 125  U   A "C5'" 1 
ATOM   2476  C  "C4'" . U   A  1  124  ? 89.840  163.830 32.551  1.00 66.69  ? 125  U   A "C4'" 1 
ATOM   2477  O  "O4'" . U   A  1  124  ? 89.186  162.533 32.593  1.00 66.49  ? 125  U   A "O4'" 1 
ATOM   2478  C  "C3'" . U   A  1  124  ? 89.256  164.456 31.291  1.00 67.18  ? 125  U   A "C3'" 1 
ATOM   2479  O  "O3'" . U   A  1  124  ? 89.903  165.643 30.809  1.00 67.77  ? 125  U   A "O3'" 1 
ATOM   2480  C  "C2'" . U   A  1  124  ? 89.282  163.279 30.328  1.00 66.78  ? 125  U   A "C2'" 1 
ATOM   2481  O  "O2'" . U   A  1  124  ? 90.578  163.067 29.806  1.00 66.75  ? 125  U   A "O2'" 1 
ATOM   2482  C  "C1'" . U   A  1  124  ? 88.908  162.120 31.261  1.00 66.57  ? 125  U   A "C1'" 1 
ATOM   2483  N  N1    . U   A  1  124  ? 87.508  161.670 31.168  1.00 65.42  ? 125  U   A N1    1 
ATOM   2484  C  C2    . U   A  1  124  ? 87.268  160.502 30.475  1.00 64.65  ? 125  U   A C2    1 
ATOM   2485  O  O2    . U   A  1  124  ? 88.154  159.868 29.926  1.00 65.44  ? 125  U   A O2    1 
ATOM   2486  N  N3    . U   A  1  124  ? 85.955  160.104 30.434  1.00 62.60  ? 125  U   A N3    1 
ATOM   2487  C  C4    . U   A  1  124  ? 84.876  160.748 30.981  1.00 62.27  ? 125  U   A C4    1 
ATOM   2488  O  O4    . U   A  1  124  ? 83.745  160.308 30.775  1.00 61.86  ? 125  U   A O4    1 
ATOM   2489  C  C5    . U   A  1  124  ? 85.194  161.959 31.673  1.00 63.66  ? 125  U   A C5    1 
ATOM   2490  C  C6    . U   A  1  124  ? 86.469  162.370 31.744  1.00 64.52  ? 125  U   A C6    1 
ATOM   2491  O  "O5'" . A   A  1  127  ? 85.580  160.845 21.464  1.00 96.63  ? 128  A   A "O5'" 1 
ATOM   2492  C  "C5'" . A   A  1  127  ? 86.760  160.100 21.117  1.00 94.43  ? 128  A   A "C5'" 1 
ATOM   2493  C  "C4'" . A   A  1  127  ? 87.128  158.960 22.056  1.00 93.64  ? 128  A   A "C4'" 1 
ATOM   2494  O  "O4'" . A   A  1  127  ? 87.343  159.465 23.412  1.00 93.49  ? 128  A   A "O4'" 1 
ATOM   2495  C  "C3'" . A   A  1  127  ? 86.075  157.880 22.249  1.00 92.15  ? 128  A   A "C3'" 1 
ATOM   2496  O  "O3'" . A   A  1  127  ? 85.965  156.947 21.184  1.00 90.34  ? 128  A   A "O3'" 1 
ATOM   2497  C  "C2'" . A   A  1  127  ? 86.500  157.274 23.581  1.00 92.02  ? 128  A   A "C2'" 1 
ATOM   2498  O  "O2'" . A   A  1  127  ? 87.672  156.480 23.476  1.00 90.82  ? 128  A   A "O2'" 1 
ATOM   2499  C  "C1'" . A   A  1  127  ? 86.798  158.553 24.364  1.00 91.92  ? 128  A   A "C1'" 1 
ATOM   2500  N  N9    . A   A  1  127  ? 85.565  159.149 24.899  1.00 91.15  ? 128  A   A N9    1 
ATOM   2501  C  C8    . A   A  1  127  ? 84.273  158.889 24.493  1.00 90.88  ? 128  A   A C8    1 
ATOM   2502  N  N7    . A   A  1  127  ? 83.365  159.577 25.134  1.00 91.00  ? 128  A   A N7    1 
ATOM   2503  C  C5    . A   A  1  127  ? 84.098  160.342 26.030  1.00 91.10  ? 128  A   A C5    1 
ATOM   2504  C  C6    . A   A  1  127  ? 83.713  161.283 27.000  1.00 91.23  ? 128  A   A C6    1 
ATOM   2505  N  N6    . A   A  1  127  ? 82.440  161.616 27.239  1.00 91.00  ? 128  A   A N6    1 
ATOM   2506  N  N1    . A   A  1  127  ? 84.692  161.876 27.728  1.00 91.08  ? 128  A   A N1    1 
ATOM   2507  C  C2    . A   A  1  127  ? 85.966  161.532 27.488  1.00 90.71  ? 128  A   A C2    1 
ATOM   2508  N  N3    . A   A  1  127  ? 86.452  160.657 26.606  1.00 90.81  ? 128  A   A N3    1 
ATOM   2509  C  C4    . A   A  1  127  ? 85.456  160.089 25.899  1.00 91.01  ? 128  A   A C4    1 
ATOM   2510  P  P     . A   A  1  128  ? 84.662  156.014 21.106  1.00 88.16  ? 129  A   A P     1 
ATOM   2511  O  OP1   . A   A  1  128  ? 84.637  155.343 19.768  1.00 87.39  ? 129  A   A OP1   1 
ATOM   2512  O  OP2   . A   A  1  128  ? 83.493  156.826 21.550  1.00 87.37  ? 129  A   A OP2   1 
ATOM   2513  O  "O5'" . A   A  1  128  ? 84.971  154.933 22.230  1.00 85.80  ? 129  A   A "O5'" 1 
ATOM   2514  C  "C5'" . A   A  1  128  ? 86.206  154.194 22.194  1.00 81.10  ? 129  A   A "C5'" 1 
ATOM   2515  C  "C4'" . A   A  1  128  ? 86.291  153.244 23.358  1.00 77.10  ? 129  A   A "C4'" 1 
ATOM   2516  O  "O4'" . A   A  1  128  ? 86.678  153.962 24.570  1.00 74.85  ? 129  A   A "O4'" 1 
ATOM   2517  C  "C3'" . A   A  1  128  ? 84.982  152.583 23.743  1.00 76.19  ? 129  A   A "C3'" 1 
ATOM   2518  O  "O3'" . A   A  1  128  ? 84.406  151.676 22.771  1.00 76.33  ? 129  A   A "O3'" 1 
ATOM   2519  C  "C2'" . A   A  1  128  ? 85.239  152.177 25.193  1.00 73.76  ? 129  A   A "C2'" 1 
ATOM   2520  O  "O2'" . A   A  1  128  ? 86.035  151.019 25.365  1.00 73.00  ? 129  A   A "O2'" 1 
ATOM   2521  C  "C1'" . A   A  1  128  ? 86.000  153.410 25.698  1.00 71.70  ? 129  A   A "C1'" 1 
ATOM   2522  N  N9    . A   A  1  128  ? 85.123  154.446 26.265  1.00 67.56  ? 129  A   A N9    1 
ATOM   2523  C  C8    . A   A  1  128  ? 83.757  154.554 26.129  1.00 66.48  ? 129  A   A C8    1 
ATOM   2524  N  N7    . A   A  1  128  ? 83.240  155.587 26.759  1.00 65.62  ? 129  A   A N7    1 
ATOM   2525  C  C5    . A   A  1  128  ? 84.332  156.202 27.346  1.00 64.19  ? 129  A   A C5    1 
ATOM   2526  C  C6    . A   A  1  128  ? 84.438  157.343 28.157  1.00 62.62  ? 129  A   A C6    1 
ATOM   2527  N  N6    . A   A  1  128  ? 83.400  158.105 28.514  1.00 61.53  ? 129  A   A N6    1 
ATOM   2528  N  N1    . A   A  1  128  ? 85.660  157.684 28.594  1.00 63.07  ? 129  A   A N1    1 
ATOM   2529  C  C2    . A   A  1  128  ? 86.704  156.930 28.225  1.00 64.32  ? 129  A   A C2    1 
ATOM   2530  N  N3    . A   A  1  128  ? 86.735  155.838 27.457  1.00 64.63  ? 129  A   A N3    1 
ATOM   2531  C  C4    . A   A  1  128  ? 85.500  155.516 27.049  1.00 65.42  ? 129  A   A C4    1 
ATOM   2532  P  P     . C   A  1  129  ? 85.190  150.351 22.273  1.00 77.26  ? 130  C   A P     1 
ATOM   2533  O  OP1   . C   A  1  129  ? 86.490  150.243 22.997  1.00 78.22  ? 130  C   A OP1   1 
ATOM   2534  O  OP2   . C   A  1  129  ? 85.183  150.349 20.776  1.00 76.76  ? 130  C   A OP2   1 
ATOM   2535  O  "O5'" . C   A  1  129  ? 84.243  149.147 22.723  1.00 74.42  ? 130  C   A "O5'" 1 
ATOM   2536  C  "C5'" . C   A  1  129  ? 83.593  149.147 24.012  1.00 69.21  ? 130  C   A "C5'" 1 
ATOM   2537  C  "C4'" . C   A  1  129  ? 83.288  147.732 24.450  1.00 65.00  ? 130  C   A "C4'" 1 
ATOM   2538  O  "O4'" . C   A  1  129  ? 82.408  147.090 23.490  1.00 65.35  ? 130  C   A "O4'" 1 
ATOM   2539  C  "C3'" . C   A  1  129  ? 84.476  146.792 24.515  1.00 62.48  ? 130  C   A "C3'" 1 
ATOM   2540  O  "O3'" . C   A  1  129  ? 85.214  146.941 25.712  1.00 57.68  ? 130  C   A "O3'" 1 
ATOM   2541  C  "C2'" . C   A  1  129  ? 83.799  145.434 24.461  1.00 64.16  ? 130  C   A "C2'" 1 
ATOM   2542  O  "O2'" . C   A  1  129  ? 83.187  145.077 25.687  1.00 65.39  ? 130  C   A "O2'" 1 
ATOM   2543  C  "C1'" . C   A  1  129  ? 82.701  145.700 23.436  1.00 65.83  ? 130  C   A "C1'" 1 
ATOM   2544  N  N1    . C   A  1  129  ? 83.114  145.331 22.064  1.00 67.86  ? 130  C   A N1    1 
ATOM   2545  C  C2    . C   A  1  129  ? 83.315  143.974 21.771  1.00 68.66  ? 130  C   A C2    1 
ATOM   2546  O  O2    . C   A  1  129  ? 83.148  143.133 22.664  1.00 68.83  ? 130  C   A O2    1 
ATOM   2547  N  N3    . C   A  1  129  ? 83.687  143.609 20.524  1.00 69.98  ? 130  C   A N3    1 
ATOM   2548  C  C4    . C   A  1  129  ? 83.862  144.535 19.580  1.00 70.04  ? 130  C   A C4    1 
ATOM   2549  N  N4    . C   A  1  129  ? 84.224  144.117 18.358  1.00 69.62  ? 130  C   A N4    1 
ATOM   2550  C  C5    . C   A  1  129  ? 83.670  145.927 19.846  1.00 70.05  ? 130  C   A C5    1 
ATOM   2551  C  C6    . C   A  1  129  ? 83.301  146.277 21.092  1.00 68.88  ? 130  C   A C6    1 
ATOM   2552  P  P     . A   A  1  130  ? 86.807  147.084 25.639  1.00 54.44  ? 131  A   A P     1 
ATOM   2553  O  OP1   . A   A  1  130  ? 87.049  148.505 25.349  1.00 55.38  ? 131  A   A OP1   1 
ATOM   2554  O  OP2   . A   A  1  130  ? 87.406  146.056 24.761  1.00 55.05  ? 131  A   A OP2   1 
ATOM   2555  O  "O5'" . A   A  1  130  ? 87.292  146.772 27.117  1.00 52.13  ? 131  A   A "O5'" 1 
ATOM   2556  C  "C5'" . A   A  1  130  ? 87.693  147.823 27.996  1.00 49.12  ? 131  A   A "C5'" 1 
ATOM   2557  C  "C4'" . A   A  1  130  ? 87.661  147.332 29.407  1.00 47.19  ? 131  A   A "C4'" 1 
ATOM   2558  O  "O4'" . A   A  1  130  ? 86.301  147.306 29.886  1.00 46.44  ? 131  A   A "O4'" 1 
ATOM   2559  C  "C3'" . A   A  1  130  ? 88.153  145.908 29.522  1.00 46.20  ? 131  A   A "C3'" 1 
ATOM   2560  O  "O3'" . A   A  1  130  ? 89.553  145.938 29.674  1.00 48.11  ? 131  A   A "O3'" 1 
ATOM   2561  C  "C2'" . A   A  1  130  ? 87.440  145.446 30.773  1.00 45.95  ? 131  A   A "C2'" 1 
ATOM   2562  O  "O2'" . A   A  1  130  ? 88.036  146.081 31.900  1.00 46.20  ? 131  A   A "O2'" 1 
ATOM   2563  C  "C1'" . A   A  1  130  ? 86.069  146.095 30.569  1.00 45.56  ? 131  A   A "C1'" 1 
ATOM   2564  N  N9    . A   A  1  130  ? 85.085  145.319 29.798  1.00 44.66  ? 131  A   A N9    1 
ATOM   2565  C  C8    . A   A  1  130  ? 84.451  145.678 28.622  1.00 44.36  ? 131  A   A C8    1 
ATOM   2566  N  N7    . A   A  1  130  ? 83.550  144.819 28.224  1.00 44.14  ? 131  A   A N7    1 
ATOM   2567  C  C5    . A   A  1  130  ? 83.606  143.813 29.181  1.00 44.02  ? 131  A   A C5    1 
ATOM   2568  C  C6    . A   A  1  130  ? 82.892  142.616 29.334  1.00 42.69  ? 131  A   A C6    1 
ATOM   2569  N  N6    . A   A  1  130  ? 81.935  142.213 28.500  1.00 40.63  ? 131  A   A N6    1 
ATOM   2570  N  N1    . A   A  1  130  ? 83.198  141.835 30.388  1.00 41.98  ? 131  A   A N1    1 
ATOM   2571  C  C2    . A   A  1  130  ? 84.165  142.231 31.219  1.00 42.84  ? 131  A   A C2    1 
ATOM   2572  N  N3    . A   A  1  130  ? 84.909  143.331 31.183  1.00 43.35  ? 131  A   A N3    1 
ATOM   2573  C  C4    . A   A  1  130  ? 84.568  144.094 30.135  1.00 44.12  ? 131  A   A C4    1 
ATOM   2574  P  P     . A   A  1  131  ? 90.455  144.821 28.970  1.00 50.03  ? 132  A   A P     1 
ATOM   2575  O  OP1   . A   A  1  131  ? 91.850  144.989 29.460  1.00 50.05  ? 132  A   A OP1   1 
ATOM   2576  O  OP2   . A   A  1  131  ? 90.166  144.829 27.505  1.00 49.70  ? 132  A   A OP2   1 
ATOM   2577  O  "O5'" . A   A  1  131  ? 89.923  143.471 29.604  1.00 50.34  ? 132  A   A "O5'" 1 
ATOM   2578  C  "C5'" . A   A  1  131  ? 90.288  143.088 30.935  1.00 49.21  ? 132  A   A "C5'" 1 
ATOM   2579  C  "C4'" . A   A  1  131  ? 89.638  141.782 31.246  1.00 49.19  ? 132  A   A "C4'" 1 
ATOM   2580  O  "O4'" . A   A  1  131  ? 88.202  141.955 31.133  1.00 48.13  ? 132  A   A "O4'" 1 
ATOM   2581  C  "C3'" . A   A  1  131  ? 89.937  140.720 30.207  1.00 49.50  ? 132  A   A "C3'" 1 
ATOM   2582  O  "O3'" . A   A  1  131  ? 91.201  140.118 30.432  1.00 51.66  ? 132  A   A "O3'" 1 
ATOM   2583  C  "C2'" . A   A  1  131  ? 88.756  139.789 30.381  1.00 49.16  ? 132  A   A "C2'" 1 
ATOM   2584  O  "O2'" . A   A  1  131  ? 88.862  139.053 31.587  1.00 50.43  ? 132  A   A "O2'" 1 
ATOM   2585  C  "C1'" . A   A  1  131  ? 87.631  140.807 30.540  1.00 47.88  ? 132  A   A "C1'" 1 
ATOM   2586  N  N9    . A   A  1  131  ? 86.990  141.217 29.289  1.00 47.19  ? 132  A   A N9    1 
ATOM   2587  C  C8    . A   A  1  131  ? 87.223  142.334 28.523  1.00 48.00  ? 132  A   A C8    1 
ATOM   2588  N  N7    . A   A  1  131  ? 86.412  142.451 27.499  1.00 47.10  ? 132  A   A N7    1 
ATOM   2589  C  C5    . A   A  1  131  ? 85.606  141.330 27.588  1.00 47.28  ? 132  A   A C5    1 
ATOM   2590  C  C6    . A   A  1  131  ? 84.533  140.879 26.808  1.00 47.65  ? 132  A   A C6    1 
ATOM   2591  N  N6    . A   A  1  131  ? 84.063  141.535 25.742  1.00 48.20  ? 132  A   A N6    1 
ATOM   2592  N  N1    . A   A  1  131  ? 83.949  139.719 27.163  1.00 47.94  ? 132  A   A N1    1 
ATOM   2593  C  C2    . A   A  1  131  ? 84.426  139.065 28.230  1.00 47.65  ? 132  A   A C2    1 
ATOM   2594  N  N3    . A   A  1  131  ? 85.423  139.390 29.041  1.00 46.64  ? 132  A   A N3    1 
ATOM   2595  C  C4    . A   A  1  131  ? 85.971  140.549 28.666  1.00 47.16  ? 132  A   A C4    1 
ATOM   2596  P  P     . U   A  1  132  ? 92.043  139.538 29.192  1.00 53.09  ? 133  U   A P     1 
ATOM   2597  O  OP1   . U   A  1  132  ? 93.356  139.141 29.753  1.00 53.78  ? 133  U   A OP1   1 
ATOM   2598  O  OP2   . U   A  1  132  ? 91.982  140.470 28.028  1.00 53.78  ? 133  U   A OP2   1 
ATOM   2599  O  "O5'" . U   A  1  132  ? 91.242  138.234 28.785  1.00 51.83  ? 133  U   A "O5'" 1 
ATOM   2600  C  "C5'" . U   A  1  132  ? 90.993  137.182 29.726  1.00 52.67  ? 133  U   A "C5'" 1 
ATOM   2601  C  "C4'" . U   A  1  132  ? 90.130  136.145 29.069  1.00 53.01  ? 133  U   A "C4'" 1 
ATOM   2602  O  "O4'" . U   A  1  132  ? 88.796  136.687 28.886  1.00 52.75  ? 133  U   A "O4'" 1 
ATOM   2603  C  "C3'" . U   A  1  132  ? 90.557  135.799 27.654  1.00 53.17  ? 133  U   A "C3'" 1 
ATOM   2604  O  "O3'" . U   A  1  132  ? 91.659  134.907 27.563  1.00 51.79  ? 133  U   A "O3'" 1 
ATOM   2605  C  "C2'" . U   A  1  132  ? 89.277  135.243 27.062  1.00 52.69  ? 133  U   A "C2'" 1 
ATOM   2606  O  "O2'" . U   A  1  132  ? 89.067  133.910 27.489  1.00 53.34  ? 133  U   A "O2'" 1 
ATOM   2607  C  "C1'" . U   A  1  132  ? 88.244  136.186 27.678  1.00 52.08  ? 133  U   A "C1'" 1 
ATOM   2608  N  N1    . U   A  1  132  ? 87.838  137.317 26.824  1.00 51.32  ? 133  U   A N1    1 
ATOM   2609  C  C2    . U   A  1  132  ? 86.781  137.108 25.958  1.00 51.35  ? 133  U   A C2    1 
ATOM   2610  O  O2    . U   A  1  132  ? 86.232  136.028 25.841  1.00 52.20  ? 133  U   A O2    1 
ATOM   2611  N  N3    . U   A  1  132  ? 86.392  138.207 25.228  1.00 51.01  ? 133  U   A N3    1 
ATOM   2612  C  C4    . U   A  1  132  ? 86.953  139.457 25.254  1.00 51.71  ? 133  U   A C4    1 
ATOM   2613  O  O4    . U   A  1  132  ? 86.517  140.326 24.497  1.00 52.53  ? 133  U   A O4    1 
ATOM   2614  C  C5    . U   A  1  132  ? 88.064  139.594 26.156  1.00 52.20  ? 133  U   A C5    1 
ATOM   2615  C  C6    . U   A  1  132  ? 88.457  138.543 26.888  1.00 51.60  ? 133  U   A C6    1 
ATOM   2616  P  P     . U   A  1  133  ? 92.435  134.779 26.161  1.00 52.21  ? 134  U   A P     1 
ATOM   2617  O  OP1   . U   A  1  133  ? 93.666  133.964 26.385  1.00 51.95  ? 134  U   A OP1   1 
ATOM   2618  O  OP2   . U   A  1  133  ? 92.534  136.108 25.482  1.00 48.93  ? 134  U   A OP2   1 
ATOM   2619  O  "O5'" . U   A  1  133  ? 91.432  133.930 25.279  1.00 48.52  ? 134  U   A "O5'" 1 
ATOM   2620  C  "C5'" . U   A  1  133  ? 91.282  134.234 23.909  1.00 45.27  ? 134  U   A "C5'" 1 
ATOM   2621  C  "C4'" . U   A  1  133  ? 90.017  133.641 23.386  1.00 42.94  ? 134  U   A "C4'" 1 
ATOM   2622  O  "O4'" . U   A  1  133  ? 88.877  134.392 23.862  1.00 41.34  ? 134  U   A "O4'" 1 
ATOM   2623  C  "C3'" . U   A  1  133  ? 89.927  133.757 21.887  1.00 42.52  ? 134  U   A "C3'" 1 
ATOM   2624  O  "O3'" . U   A  1  133  ? 90.694  132.732 21.287  1.00 41.33  ? 134  U   A "O3'" 1 
ATOM   2625  C  "C2'" . U   A  1  133  ? 88.433  133.676 21.653  1.00 41.54  ? 134  U   A "C2'" 1 
ATOM   2626  O  "O2'" . U   A  1  133  ? 87.967  132.353 21.816  1.00 42.06  ? 134  U   A "O2'" 1 
ATOM   2627  C  "C1'" . U   A  1  133  ? 87.942  134.541 22.809  1.00 41.56  ? 134  U   A "C1'" 1 
ATOM   2628  N  N1    . U   A  1  133  ? 87.854  135.971 22.471  1.00 43.27  ? 134  U   A N1    1 
ATOM   2629  C  C2    . U   A  1  133  ? 86.808  136.383 21.655  1.00 44.93  ? 134  U   A C2    1 
ATOM   2630  O  O2    . U   A  1  133  ? 86.003  135.608 21.174  1.00 46.32  ? 134  U   A O2    1 
ATOM   2631  N  N3    . U   A  1  133  ? 86.748  137.734 21.415  1.00 44.20  ? 134  U   A N3    1 
ATOM   2632  C  C4    . U   A  1  133  ? 87.619  138.694 21.869  1.00 45.13  ? 134  U   A C4    1 
ATOM   2633  O  O4    . U   A  1  133  ? 87.504  139.848 21.446  1.00 46.13  ? 134  U   A O4    1 
ATOM   2634  C  C5    . U   A  1  133  ? 88.690  138.192 22.695  1.00 44.25  ? 134  U   A C5    1 
ATOM   2635  C  C6    . U   A  1  133  ? 88.766  136.881 22.957  1.00 43.48  ? 134  U   A C6    1 
ATOM   2636  P  P     . G   A  1  134  ? 91.466  133.039 19.925  1.00 41.88  ? 135  G   A P     1 
ATOM   2637  O  OP1   . G   A  1  134  ? 92.501  131.984 19.814  1.00 41.66  ? 135  G   A OP1   1 
ATOM   2638  O  OP2   . G   A  1  134  ? 91.868  134.471 19.884  1.00 40.53  ? 135  G   A OP2   1 
ATOM   2639  O  "O5'" . G   A  1  134  ? 90.343  132.854 18.808  1.00 40.34  ? 135  G   A "O5'" 1 
ATOM   2640  C  "C5'" . G   A  1  134  ? 89.580  131.636 18.701  1.00 39.98  ? 135  G   A "C5'" 1 
ATOM   2641  C  "C4'" . G   A  1  134  ? 88.494  131.798 17.669  1.00 41.23  ? 135  G   A "C4'" 1 
ATOM   2642  O  "O4'" . G   A  1  134  ? 87.458  132.691 18.155  1.00 41.00  ? 135  G   A "O4'" 1 
ATOM   2643  C  "C3'" . G   A  1  134  ? 88.955  132.476 16.396  1.00 42.28  ? 135  G   A "C3'" 1 
ATOM   2644  O  "O3'" . G   A  1  134  ? 89.667  131.588 15.555  1.00 44.32  ? 135  G   A "O3'" 1 
ATOM   2645  C  "C2'" . G   A  1  134  ? 87.648  132.979 15.812  1.00 41.16  ? 135  G   A "C2'" 1 
ATOM   2646  O  "O2'" . G   A  1  134  ? 86.893  131.929 15.257  1.00 41.66  ? 135  G   A "O2'" 1 
ATOM   2647  C  "C1'" . G   A  1  134  ? 86.958  133.479 17.077  1.00 40.92  ? 135  G   A "C1'" 1 
ATOM   2648  N  N9    . G   A  1  134  ? 87.247  134.886 17.353  1.00 41.99  ? 135  G   A N9    1 
ATOM   2649  C  C8    . G   A  1  134  ? 88.164  135.386 18.246  1.00 43.37  ? 135  G   A C8    1 
ATOM   2650  N  N7    . G   A  1  134  ? 88.212  136.692 18.259  1.00 43.61  ? 135  G   A N7    1 
ATOM   2651  C  C5    . G   A  1  134  ? 87.270  137.079 17.317  1.00 43.77  ? 135  G   A C5    1 
ATOM   2652  C  C6    . G   A  1  134  ? 86.890  138.374 16.881  1.00 45.19  ? 135  G   A C6    1 
ATOM   2653  O  O6    . G   A  1  134  ? 87.343  139.471 17.234  1.00 46.23  ? 135  G   A O6    1 
ATOM   2654  N  N1    . G   A  1  134  ? 85.881  138.316 15.925  1.00 44.71  ? 135  G   A N1    1 
ATOM   2655  C  C2    . G   A  1  134  ? 85.327  137.157 15.434  1.00 43.33  ? 135  G   A C2    1 
ATOM   2656  N  N2    . G   A  1  134  ? 84.365  137.299 14.526  1.00 42.23  ? 135  G   A N2    1 
ATOM   2657  N  N3    . G   A  1  134  ? 85.693  135.941 15.815  1.00 43.80  ? 135  G   A N3    1 
ATOM   2658  C  C4    . G   A  1  134  ? 86.657  135.978 16.756  1.00 42.91  ? 135  G   A C4    1 
ATOM   2659  P  P     . C   A  1  135  ? 90.813  132.167 14.599  1.00 44.84  ? 136  C   A P     1 
ATOM   2660  O  OP1   . C   A  1  135  ? 91.388  130.969 13.933  1.00 45.91  ? 136  C   A OP1   1 
ATOM   2661  O  OP2   . C   A  1  135  ? 91.705  133.062 15.380  1.00 45.36  ? 136  C   A OP2   1 
ATOM   2662  O  "O5'" . C   A  1  135  ? 90.023  133.079 13.547  1.00 43.88  ? 136  C   A "O5'" 1 
ATOM   2663  C  "C5'" . C   A  1  135  ? 89.077  132.509 12.614  1.00 45.41  ? 136  C   A "C5'" 1 
ATOM   2664  C  "C4'" . C   A  1  135  ? 88.365  133.602 11.838  1.00 48.30  ? 136  C   A "C4'" 1 
ATOM   2665  O  "O4'" . C   A  1  135  ? 87.637  134.473 12.755  1.00 48.85  ? 136  C   A "O4'" 1 
ATOM   2666  C  "C3'" . C   A  1  135  ? 89.241  134.575 11.063  1.00 50.57  ? 136  C   A "C3'" 1 
ATOM   2667  O  "O3'" . C   A  1  135  ? 89.730  134.014 9.842   1.00 54.89  ? 136  C   A "O3'" 1 
ATOM   2668  C  "C2'" . C   A  1  135  ? 88.304  135.773 10.884  1.00 49.28  ? 136  C   A "C2'" 1 
ATOM   2669  O  "O2'" . C   A  1  135  ? 87.303  135.618 9.896   1.00 47.49  ? 136  C   A "O2'" 1 
ATOM   2670  C  "C1'" . C   A  1  135  ? 87.615  135.805 12.247  1.00 47.81  ? 136  C   A "C1'" 1 
ATOM   2671  N  N1    . C   A  1  135  ? 88.290  136.702 13.209  1.00 48.43  ? 136  C   A N1    1 
ATOM   2672  C  C2    . C   A  1  135  ? 87.997  138.077 13.169  1.00 48.43  ? 136  C   A C2    1 
ATOM   2673  O  O2    . C   A  1  135  ? 87.175  138.496 12.329  1.00 49.98  ? 136  C   A O2    1 
ATOM   2674  N  N3    . C   A  1  135  ? 88.613  138.913 14.048  1.00 46.76  ? 136  C   A N3    1 
ATOM   2675  C  C4    . C   A  1  135  ? 89.484  138.424 14.932  1.00 46.88  ? 136  C   A C4    1 
ATOM   2676  N  N4    . C   A  1  135  ? 90.067  139.284 15.780  1.00 47.89  ? 136  C   A N4    1 
ATOM   2677  C  C5    . C   A  1  135  ? 89.798  137.031 14.993  1.00 46.69  ? 136  C   A C5    1 
ATOM   2678  C  C6    . C   A  1  135  ? 89.187  136.217 14.125  1.00 47.29  ? 136  C   A C6    1 
ATOM   2679  P  P     . U   A  1  136  ? 91.228  134.364 9.336   1.00 57.60  ? 137  U   A P     1 
ATOM   2680  O  OP1   . U   A  1  136  ? 91.289  133.900 7.937   1.00 57.71  ? 137  U   A OP1   1 
ATOM   2681  O  OP2   . U   A  1  136  ? 92.295  133.944 10.298  1.00 57.44  ? 137  U   A OP2   1 
ATOM   2682  O  "O5'" . U   A  1  136  ? 91.241  135.948 9.273   1.00 58.89  ? 137  U   A "O5'" 1 
ATOM   2683  C  "C5'" . U   A  1  136  ? 90.353  136.645 8.391   1.00 63.04  ? 137  U   A "C5'" 1 
ATOM   2684  C  "C4'" . U   A  1  136  ? 90.295  138.098 8.776   1.00 66.03  ? 137  U   A "C4'" 1 
ATOM   2685  O  "O4'" . U   A  1  136  ? 89.975  138.175 10.193  1.00 65.41  ? 137  U   A "O4'" 1 
ATOM   2686  C  "C3'" . U   A  1  136  ? 91.595  138.883 8.625   1.00 67.99  ? 137  U   A "C3'" 1 
ATOM   2687  O  "O3'" . U   A  1  136  ? 91.696  139.388 7.279   1.00 72.42  ? 137  U   A "O3'" 1 
ATOM   2688  C  "C2'" . U   A  1  136  ? 91.396  139.987 9.658   1.00 66.69  ? 137  U   A "C2'" 1 
ATOM   2689  O  "O2'" . U   A  1  136  ? 90.449  140.930 9.197   1.00 65.74  ? 137  U   A "O2'" 1 
ATOM   2690  C  "C1'" . U   A  1  136  ? 90.706  139.224 10.793  1.00 64.46  ? 137  U   A "C1'" 1 
ATOM   2691  N  N1    . U   A  1  136  ? 91.577  138.653 11.840  1.00 62.30  ? 137  U   A N1    1 
ATOM   2692  C  C2    . U   A  1  136  ? 92.002  139.499 12.843  1.00 61.57  ? 137  U   A C2    1 
ATOM   2693  O  O2    . U   A  1  136  ? 91.703  140.675 12.885  1.00 62.07  ? 137  U   A O2    1 
ATOM   2694  N  N3    . U   A  1  136  ? 92.795  138.919 13.802  1.00 61.49  ? 137  U   A N3    1 
ATOM   2695  C  C4    . U   A  1  136  ? 93.213  137.606 13.861  1.00 62.03  ? 137  U   A C4    1 
ATOM   2696  O  O4    . U   A  1  136  ? 94.049  137.278 14.707  1.00 62.49  ? 137  U   A O4    1 
ATOM   2697  C  C5    . U   A  1  136  ? 92.730  136.783 12.794  1.00 61.89  ? 137  U   A C5    1 
ATOM   2698  C  C6    . U   A  1  136  ? 91.954  137.321 11.839  1.00 61.99  ? 137  U   A C6    1 
ATOM   2699  P  P     . U   A  1  137  ? 93.130  139.802 6.654   1.00 75.63  ? 138  U   A P     1 
ATOM   2700  O  OP1   . U   A  1  137  ? 92.968  139.601 5.190   1.00 75.19  ? 138  U   A OP1   1 
ATOM   2701  O  OP2   . U   A  1  137  ? 94.218  139.077 7.373   1.00 75.41  ? 138  U   A OP2   1 
ATOM   2702  O  "O5'" . U   A  1  137  ? 93.237  141.377 6.962   1.00 79.12  ? 138  U   A "O5'" 1 
ATOM   2703  C  "C5'" . U   A  1  137  ? 94.141  142.266 6.225   1.00 84.05  ? 138  U   A "C5'" 1 
ATOM   2704  C  "C4'" . U   A  1  137  ? 93.498  143.640 5.996   1.00 87.33  ? 138  U   A "C4'" 1 
ATOM   2705  O  "O4'" . U   A  1  137  ? 92.224  143.453 5.336   1.00 90.22  ? 138  U   A "O4'" 1 
ATOM   2706  C  "C3'" . U   A  1  137  ? 93.201  144.515 7.215   1.00 88.51  ? 138  U   A "C3'" 1 
ATOM   2707  O  "O3'" . U   A  1  137  ? 94.268  145.438 7.439   1.00 86.63  ? 138  U   A "O3'" 1 
ATOM   2708  C  "C2'" . U   A  1  137  ? 92.002  145.360 6.771   1.00 90.69  ? 138  U   A "C2'" 1 
ATOM   2709  O  "O2'" . U   A  1  137  ? 92.338  146.581 6.139   1.00 91.20  ? 138  U   A "O2'" 1 
ATOM   2710  C  "C1'" . U   A  1  137  ? 91.296  144.433 5.776   1.00 92.73  ? 138  U   A "C1'" 1 
ATOM   2711  N  N1    . U   A  1  137  ? 90.098  143.733 6.264   1.00 96.89  ? 138  U   A N1    1 
ATOM   2712  C  C2    . U   A  1  137  ? 89.457  142.877 5.371   1.00 98.91  ? 138  U   A C2    1 
ATOM   2713  O  O2    . U   A  1  137  ? 89.792  142.762 4.194   1.00 99.05  ? 138  U   A O2    1 
ATOM   2714  N  N3    . U   A  1  137  ? 88.402  142.171 5.903   1.00 100.47 ? 138  U   A N3    1 
ATOM   2715  C  C4    . U   A  1  137  ? 87.913  142.243 7.196   1.00 100.63 ? 138  U   A C4    1 
ATOM   2716  O  O4    . U   A  1  137  ? 87.058  141.432 7.565   1.00 101.09 ? 138  U   A O4    1 
ATOM   2717  C  C5    . U   A  1  137  ? 88.585  143.193 8.037   1.00 100.29 ? 138  U   A C5    1 
ATOM   2718  C  C6    . U   A  1  137  ? 89.629  143.885 7.559   1.00 98.63  ? 138  U   A C6    1 
ATOM   2719  P  P     . C   A  1  138  ? 95.610  144.967 8.172   1.00 85.40  ? 139  C   A P     1 
ATOM   2720  O  OP1   . C   A  1  138  ? 96.369  146.219 8.413   1.00 86.16  ? 139  C   A OP1   1 
ATOM   2721  O  OP2   . C   A  1  138  ? 96.249  143.853 7.425   1.00 86.26  ? 139  C   A OP2   1 
ATOM   2722  O  "O5'" . C   A  1  138  ? 95.110  144.382 9.562   1.00 84.28  ? 139  C   A "O5'" 1 
ATOM   2723  C  "C5'" . C   A  1  138  ? 94.559  145.237 10.567  1.00 80.99  ? 139  C   A "C5'" 1 
ATOM   2724  C  "C4'" . C   A  1  138  ? 95.063  144.823 11.926  1.00 79.58  ? 139  C   A "C4'" 1 
ATOM   2725  O  "O4'" . C   A  1  138  ? 94.686  143.443 12.171  1.00 78.85  ? 139  C   A "O4'" 1 
ATOM   2726  C  "C3'" . C   A  1  138  ? 96.573  144.892 12.156  1.00 78.57  ? 139  C   A "C3'" 1 
ATOM   2727  O  "O3'" . C   A  1  138  ? 96.783  145.185 13.527  1.00 76.58  ? 139  C   A "O3'" 1 
ATOM   2728  C  "C2'" . C   A  1  138  ? 97.016  143.455 11.902  1.00 78.83  ? 139  C   A "C2'" 1 
ATOM   2729  O  "O2'" . C   A  1  138  ? 98.210  143.105 12.578  1.00 78.96  ? 139  C   A "O2'" 1 
ATOM   2730  C  "C1'" . C   A  1  138  ? 95.835  142.695 12.496  1.00 78.72  ? 139  C   A "C1'" 1 
ATOM   2731  N  N1    . C   A  1  138  ? 95.664  141.338 11.976  1.00 78.95  ? 139  C   A N1    1 
ATOM   2732  C  C2    . C   A  1  138  ? 96.034  140.258 12.789  1.00 79.20  ? 139  C   A C2    1 
ATOM   2733  O  O2    . C   A  1  138  ? 96.494  140.483 13.921  1.00 78.86  ? 139  C   A O2    1 
ATOM   2734  N  N3    . C   A  1  138  ? 95.876  138.999 12.320  1.00 79.33  ? 139  C   A N3    1 
ATOM   2735  C  C4    . C   A  1  138  ? 95.370  138.801 11.098  1.00 79.58  ? 139  C   A C4    1 
ATOM   2736  N  N4    . C   A  1  138  ? 95.222  137.541 10.683  1.00 79.43  ? 139  C   A N4    1 
ATOM   2737  C  C5    . C   A  1  138  ? 94.989  139.884 10.252  1.00 79.16  ? 139  C   A C5    1 
ATOM   2738  C  C6    . C   A  1  138  ? 95.152  141.122 10.725  1.00 78.69  ? 139  C   A C6    1 
ATOM   2739  P  P     . G   A  1  139  ? 96.998  146.699 13.998  1.00 74.81  ? 140  G   A P     1 
ATOM   2740  O  OP1   . G   A  1  139  ? 97.974  147.326 13.062  1.00 76.37  ? 140  G   A OP1   1 
ATOM   2741  O  OP2   . G   A  1  139  ? 97.305  146.641 15.453  1.00 74.64  ? 140  G   A OP2   1 
ATOM   2742  O  "O5'" . G   A  1  139  ? 95.571  147.373 13.770  1.00 72.24  ? 140  G   A "O5'" 1 
ATOM   2743  C  "C5'" . G   A  1  139  ? 95.405  148.802 13.865  1.00 69.47  ? 140  G   A "C5'" 1 
ATOM   2744  C  "C4'" . G   A  1  139  ? 93.947  149.149 14.071  1.00 68.07  ? 140  G   A "C4'" 1 
ATOM   2745  O  "O4'" . G   A  1  139  ? 93.196  148.914 12.853  1.00 68.54  ? 140  G   A "O4'" 1 
ATOM   2746  C  "C3'" . G   A  1  139  ? 93.201  148.293 15.082  1.00 67.24  ? 140  G   A "C3'" 1 
ATOM   2747  O  "O3'" . G   A  1  139  ? 93.527  148.681 16.415  1.00 66.01  ? 140  G   A "O3'" 1 
ATOM   2748  C  "C2'" . G   A  1  139  ? 91.736  148.542 14.710  1.00 67.03  ? 140  G   A "C2'" 1 
ATOM   2749  O  "O2'" . G   A  1  139  ? 91.212  149.757 15.223  1.00 67.45  ? 140  G   A "O2'" 1 
ATOM   2750  C  "C1'" . G   A  1  139  ? 91.833  148.660 13.185  1.00 66.34  ? 140  G   A "C1'" 1 
ATOM   2751  N  N9    . G   A  1  139  ? 91.337  147.541 12.380  1.00 64.28  ? 140  G   A N9    1 
ATOM   2752  C  C8    . G   A  1  139  ? 90.609  147.661 11.225  1.00 62.92  ? 140  G   A C8    1 
ATOM   2753  N  N7    . G   A  1  139  ? 90.315  146.516 10.676  1.00 62.47  ? 140  G   A N7    1 
ATOM   2754  C  C5    . G   A  1  139  ? 90.883  145.571 11.519  1.00 62.92  ? 140  G   A C5    1 
ATOM   2755  C  C6    . G   A  1  139  ? 90.910  144.154 11.418  1.00 62.48  ? 140  G   A C6    1 
ATOM   2756  O  O6    . G   A  1  139  ? 90.466  143.441 10.519  1.00 61.85  ? 140  G   A O6    1 
ATOM   2757  N  N1    . G   A  1  139  ? 91.553  143.575 12.501  1.00 62.83  ? 140  G   A N1    1 
ATOM   2758  C  C2    . G   A  1  139  ? 92.119  144.265 13.539  1.00 64.18  ? 140  G   A C2    1 
ATOM   2759  N  N2    . G   A  1  139  ? 92.658  143.511 14.518  1.00 63.92  ? 140  G   A N2    1 
ATOM   2760  N  N3    . G   A  1  139  ? 92.146  145.594 13.623  1.00 64.41  ? 140  G   A N3    1 
ATOM   2761  C  C4    . G   A  1  139  ? 91.505  146.179 12.589  1.00 63.44  ? 140  G   A C4    1 
ATOM   2762  P  P     . C   A  1  140  ? 92.884  147.891 17.658  1.00 64.22  ? 141  C   A P     1 
ATOM   2763  O  OP1   . C   A  1  140  ? 93.533  148.378 18.910  1.00 64.66  ? 141  C   A OP1   1 
ATOM   2764  O  OP2   . C   A  1  140  ? 92.874  146.428 17.365  1.00 63.93  ? 141  C   A OP2   1 
ATOM   2765  O  "O5'" . C   A  1  140  ? 91.380  148.405 17.674  1.00 63.72  ? 141  C   A "O5'" 1 
ATOM   2766  C  "C5'" . C   A  1  140  ? 90.408  147.696 18.423  1.00 63.21  ? 141  C   A "C5'" 1 
ATOM   2767  C  "C4'" . C   A