data_1K9V
# 
_entry.id   1K9V 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1K9V         
RCSB  RCSB014741   
WWPDB D_1000014741 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1K9V 
_pdbx_database_status.recvd_initial_deposition_date   2001-10-31 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Douangamath, A.'        1 
'Walker, M.'             2 
'Beismann-Driemeyer, S.' 3 
'Vega-Fernandez, M.C.'   4 
'Sterner, R.'            5 
'Wilmanns, M.'           6 
# 
_citation.id                        primary 
_citation.title                     
;Structural evidence for ammonia tunneling across the (beta alpha)(8) barrel of the imidazole glycerol phosphate synthase bienzyme complex.
;
_citation.journal_abbrev            Structure 
_citation.journal_volume            10 
_citation.page_first                185 
_citation.page_last                 193 
_citation.year                      2002 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11839304 
_citation.pdbx_database_id_DOI      '10.1016/S0969-2126(02)00702-5' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Douangamath, A.'        1 
primary 'Walker, M.'             2 
primary 'Beismann-Driemeyer, S.' 3 
primary 'Vega-Fernandez, M.C.'   4 
primary 'Sterner, R.'            5 
primary 'Wilmanns, M.'           6 
# 
_cell.entry_id           1K9V 
_cell.length_a           126.008 
_cell.length_b           35.837 
_cell.length_c           42.507 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1K9V 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Amidotransferase hisH' 23130.564 1  2.4.2.- ? ? ? 
2 non-polymer syn 'ACETIC ACID'           60.052    1  ?       ? ? ? 
3 water       nat water                   18.015    65 ?       ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MRIGIISVGPGNIMNLYRGVKRASENFEDVSIELVESPRNDLYDLLFIPGVGHFGEGMRRLRENDLIDFVRKHVEDERYV
VGVCLGMQLLFEESEEAPGVKGLSLIEGNVVKLRSRRLPHMGWNEVIFKDTFPNGYYYFVHTYRAVCEEEHVLGTTEYDG
EIFPSAVRKGRILGFQFHPEKSSKIGRKLLEKVIECSLSRR
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MRIGIISVGPGNIMNLYRGVKRASENFEDVSIELVESPRNDLYDLLFIPGVGHFGEGMRRLRENDLIDFVRKHVEDERYV
VGVCLGMQLLFEESEEAPGVKGLSLIEGNVVKLRSRRLPHMGWNEVIFKDTFPNGYYYFVHTYRAVCEEEHVLGTTEYDG
EIFPSAVRKGRILGFQFHPEKSSKIGRKLLEKVIECSLSRR
;
_entity_poly.pdbx_strand_id                 F 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ARG n 
1 3   ILE n 
1 4   GLY n 
1 5   ILE n 
1 6   ILE n 
1 7   SER n 
1 8   VAL n 
1 9   GLY n 
1 10  PRO n 
1 11  GLY n 
1 12  ASN n 
1 13  ILE n 
1 14  MET n 
1 15  ASN n 
1 16  LEU n 
1 17  TYR n 
1 18  ARG n 
1 19  GLY n 
1 20  VAL n 
1 21  LYS n 
1 22  ARG n 
1 23  ALA n 
1 24  SER n 
1 25  GLU n 
1 26  ASN n 
1 27  PHE n 
1 28  GLU n 
1 29  ASP n 
1 30  VAL n 
1 31  SER n 
1 32  ILE n 
1 33  GLU n 
1 34  LEU n 
1 35  VAL n 
1 36  GLU n 
1 37  SER n 
1 38  PRO n 
1 39  ARG n 
1 40  ASN n 
1 41  ASP n 
1 42  LEU n 
1 43  TYR n 
1 44  ASP n 
1 45  LEU n 
1 46  LEU n 
1 47  PHE n 
1 48  ILE n 
1 49  PRO n 
1 50  GLY n 
1 51  VAL n 
1 52  GLY n 
1 53  HIS n 
1 54  PHE n 
1 55  GLY n 
1 56  GLU n 
1 57  GLY n 
1 58  MET n 
1 59  ARG n 
1 60  ARG n 
1 61  LEU n 
1 62  ARG n 
1 63  GLU n 
1 64  ASN n 
1 65  ASP n 
1 66  LEU n 
1 67  ILE n 
1 68  ASP n 
1 69  PHE n 
1 70  VAL n 
1 71  ARG n 
1 72  LYS n 
1 73  HIS n 
1 74  VAL n 
1 75  GLU n 
1 76  ASP n 
1 77  GLU n 
1 78  ARG n 
1 79  TYR n 
1 80  VAL n 
1 81  VAL n 
1 82  GLY n 
1 83  VAL n 
1 84  CYS n 
1 85  LEU n 
1 86  GLY n 
1 87  MET n 
1 88  GLN n 
1 89  LEU n 
1 90  LEU n 
1 91  PHE n 
1 92  GLU n 
1 93  GLU n 
1 94  SER n 
1 95  GLU n 
1 96  GLU n 
1 97  ALA n 
1 98  PRO n 
1 99  GLY n 
1 100 VAL n 
1 101 LYS n 
1 102 GLY n 
1 103 LEU n 
1 104 SER n 
1 105 LEU n 
1 106 ILE n 
1 107 GLU n 
1 108 GLY n 
1 109 ASN n 
1 110 VAL n 
1 111 VAL n 
1 112 LYS n 
1 113 LEU n 
1 114 ARG n 
1 115 SER n 
1 116 ARG n 
1 117 ARG n 
1 118 LEU n 
1 119 PRO n 
1 120 HIS n 
1 121 MET n 
1 122 GLY n 
1 123 TRP n 
1 124 ASN n 
1 125 GLU n 
1 126 VAL n 
1 127 ILE n 
1 128 PHE n 
1 129 LYS n 
1 130 ASP n 
1 131 THR n 
1 132 PHE n 
1 133 PRO n 
1 134 ASN n 
1 135 GLY n 
1 136 TYR n 
1 137 TYR n 
1 138 TYR n 
1 139 PHE n 
1 140 VAL n 
1 141 HIS n 
1 142 THR n 
1 143 TYR n 
1 144 ARG n 
1 145 ALA n 
1 146 VAL n 
1 147 CYS n 
1 148 GLU n 
1 149 GLU n 
1 150 GLU n 
1 151 HIS n 
1 152 VAL n 
1 153 LEU n 
1 154 GLY n 
1 155 THR n 
1 156 THR n 
1 157 GLU n 
1 158 TYR n 
1 159 ASP n 
1 160 GLY n 
1 161 GLU n 
1 162 ILE n 
1 163 PHE n 
1 164 PRO n 
1 165 SER n 
1 166 ALA n 
1 167 VAL n 
1 168 ARG n 
1 169 LYS n 
1 170 GLY n 
1 171 ARG n 
1 172 ILE n 
1 173 LEU n 
1 174 GLY n 
1 175 PHE n 
1 176 GLN n 
1 177 PHE n 
1 178 HIS n 
1 179 PRO n 
1 180 GLU n 
1 181 LYS n 
1 182 SER n 
1 183 SER n 
1 184 LYS n 
1 185 ILE n 
1 186 GLY n 
1 187 ARG n 
1 188 LYS n 
1 189 LEU n 
1 190 LEU n 
1 191 GLU n 
1 192 LYS n 
1 193 VAL n 
1 194 ILE n 
1 195 GLU n 
1 196 CYS n 
1 197 SER n 
1 198 LEU n 
1 199 SER n 
1 200 ARG n 
1 201 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Thermotoga 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Thermotoga maritima' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     2336 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    HIS5_THEMA 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MRIGIISVGPGNIMNLYRGVKRASENFEDVSIELVESPRNDLYDLLFIPGVGHFGEGMRRLRENDLIDFVRKHVEDERYV
VGVCLGMQLLFEESEEAPGVKGLSLIEGNVVKLRSRRLPHMGWNEVIFKDTFPNGYYYFVHTYRAVCEEEHVLGTTEYDG
EIFPSAVRKGRILGFQFHPEKSSKIGRKLLEKVIECSLSRR
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_accession          Q9X0C8 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1K9V 
_struct_ref_seq.pdbx_strand_id                F 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 201 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9X0C8 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  201 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       301 
_struct_ref_seq.pdbx_auth_seq_align_end       501 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACY non-polymer         . 'ACETIC ACID'   ? 'C2 H4 O2'       60.052  
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1K9V 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.07 
_exptl_crystal.density_percent_sol   40.69 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.0 
_exptl_crystal_grow.pdbx_details    
'PEG 200, sodium acetate, DTT, calcium chloride, pH 5.0, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2000-08-25 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.91 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'EMBL/DESY, HAMBURG BEAMLINE X11' 
_diffrn_source.pdbx_synchrotron_site       'EMBL/DESY, Hamburg' 
_diffrn_source.pdbx_synchrotron_beamline   X11 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.91 
# 
_reflns.entry_id                     1K9V 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20 
_reflns.d_resolution_high            2.4 
_reflns.number_obs                   32780 
_reflns.number_all                   32978 
_reflns.percent_possible_obs         99.4 
_reflns.pdbx_Rmerge_I_obs            0.042 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        31.7 
_reflns.B_iso_Wilson_estimate        49.6 
_reflns.pdbx_redundancy              4.1 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.40 
_reflns_shell.d_res_low              2.44 
_reflns_shell.percent_possible_all   97.1 
_reflns_shell.Rmerge_I_obs           0.215 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    6.3 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1K9V 
_refine.ls_number_reflns_obs                     7530 
_refine.ls_number_reflns_all                     7530 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             15 
_refine.ls_d_res_high                            2.4 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.224 
_refine.ls_R_factor_all                          0.224 
_refine.ls_R_factor_R_work                       0.224 
_refine.ls_R_factor_R_free                       0.278 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.67 
_refine.ls_number_reflns_R_free                  427 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               42.6 
_refine.aniso_B[1][1]                            10.871 
_refine.aniso_B[2][2]                            -10.320 
_refine.aniso_B[3][3]                            -0.552 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'His H from the complex structure HisH-HisF' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             isotropic 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1574 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             69 
_refine_hist.number_atoms_total               1643 
_refine_hist.d_res_high                       2.4 
_refine_hist.d_res_low                        15 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_angle_deg 1.236 ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d    0.006 ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1K9V 
_struct.title                     
;Structural evidence for ammonia tunelling across the (beta-alpha)8-barrel of the imidazole glycerol phosphate synthase bienzyme complex
;
_struct.pdbx_descriptor           'Amidotransferase hisH' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1K9V 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            
'glutaminase, imidazole glycerol phosphate synthase, (beta-alpha)8-barrel, ammonia tunnel, TRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ILE A 13  ? SER A 24  ? ILE F 313 SER F 324 1 ? 12 
HELX_P HELX_P2 2 HIS A 53  ? ASN A 64  ? HIS F 353 ASN F 364 1 ? 12 
HELX_P HELX_P3 3 LEU A 66  ? ASP A 76  ? LEU F 366 ASP F 376 1 ? 11 
HELX_P HELX_P4 4 CYS A 84  ? LEU A 89  ? CYS F 384 LEU F 389 1 ? 6  
HELX_P HELX_P5 5 HIS A 178 ? LYS A 181 ? HIS F 478 LYS F 481 5 ? 4  
HELX_P HELX_P6 6 SER A 182 ? SER A 199 ? SER F 482 SER F 499 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          LEU 
_struct_mon_prot_cis.label_seq_id           118 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           LEU 
_struct_mon_prot_cis.auth_seq_id            418 
_struct_mon_prot_cis.auth_asym_id           F 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    119 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     419 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    F 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       0.00 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 9 ? 
B ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
A 7 8 ? anti-parallel 
A 8 9 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER A 31  ? VAL A 35  ? SER F 331 VAL F 335 
A 2 ARG A 2   ? ILE A 6   ? ARG F 302 ILE F 306 
A 3 LEU A 45  ? ILE A 48  ? LEU F 345 ILE F 348 
A 4 TYR A 79  ? VAL A 83  ? TYR F 379 VAL F 383 
A 5 ILE A 172 ? PHE A 175 ? ILE F 472 PHE F 475 
A 6 GLU A 161 ? LYS A 169 ? GLU F 461 LYS F 469 
A 7 VAL A 152 ? TYR A 158 ? VAL F 452 TYR F 458 
A 8 HIS A 120 ? PHE A 128 ? HIS F 420 PHE F 428 
A 9 GLY A 135 ? HIS A 141 ? GLY F 435 HIS F 441 
B 1 PHE A 91  ? SER A 94  ? PHE F 391 SER F 394 
B 2 ILE A 106 ? LYS A 112 ? ILE F 406 LYS F 412 
B 3 TYR A 143 ? CYS A 147 ? TYR F 443 CYS F 447 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O SER A 31  ? O SER F 331 N ILE A 3   ? N ILE F 303 
A 2 3 N GLY A 4   ? N GLY F 304 O LEU A 45  ? O LEU F 345 
A 3 4 N LEU A 46  ? N LEU F 346 O VAL A 81  ? O VAL F 381 
A 4 5 N GLY A 82  ? N GLY F 382 O LEU A 173 ? O LEU F 473 
A 5 6 O GLY A 174 ? O GLY F 474 N VAL A 167 ? N VAL F 467 
A 6 7 O PHE A 163 ? O PHE F 463 N THR A 156 ? N THR F 456 
A 7 8 O THR A 155 ? O THR F 455 N ILE A 127 ? N ILE F 427 
A 8 9 N GLY A 122 ? N GLY F 422 O PHE A 139 ? O PHE F 439 
B 1 2 N GLU A 93  ? N GLU F 393 O VAL A 110 ? O VAL F 410 
B 2 3 N VAL A 111 ? N VAL F 411 O ARG A 144 ? O ARG F 444 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    7 
_struct_site.details              'BINDING SITE FOR RESIDUE ACY F 1001' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 7 HOH C .   ? HOH F 10  . ? 1_555 ? 
2 AC1 7 GLY A 50  ? GLY F 350 . ? 1_555 ? 
3 AC1 7 CYS A 84  ? CYS F 384 . ? 1_555 ? 
4 AC1 7 LEU A 85  ? LEU F 385 . ? 1_555 ? 
5 AC1 7 VAL A 140 ? VAL F 440 . ? 1_555 ? 
6 AC1 7 HIS A 141 ? HIS F 441 . ? 1_555 ? 
7 AC1 7 GLN A 176 ? GLN F 476 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1K9V 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1K9V 
_atom_sites.fract_transf_matrix[1][1]   0.007936 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.027904 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.023526 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . MET A 1 1   ? 36.726 5.821   -2.889  1.00 66.27  ? 301  MET F N   1 
ATOM   2    C CA  . MET A 1 1   ? 35.355 5.553   -2.365  1.00 65.47  ? 301  MET F CA  1 
ATOM   3    C C   . MET A 1 1   ? 34.972 6.630   -1.351  1.00 62.70  ? 301  MET F C   1 
ATOM   4    O O   . MET A 1 1   ? 35.149 7.823   -1.593  1.00 62.52  ? 301  MET F O   1 
ATOM   5    C CB  . MET A 1 1   ? 35.307 4.176   -1.683  1.00 82.89  ? 301  MET F CB  1 
ATOM   6    C CG  . MET A 1 1   ? 33.898 3.667   -1.364  1.00 86.70  ? 301  MET F CG  1 
ATOM   7    S SD  . MET A 1 1   ? 33.827 2.494   0.023   1.00 89.51  ? 301  MET F SD  1 
ATOM   8    C CE  . MET A 1 1   ? 34.517 1.003   -0.705  1.00 90.17  ? 301  MET F CE  1 
ATOM   9    N N   . ARG A 1 2   ? 34.453 6.188   -0.212  1.00 48.83  ? 302  ARG F N   1 
ATOM   10   C CA  . ARG A 1 2   ? 34.034 7.075   0.860   1.00 44.92  ? 302  ARG F CA  1 
ATOM   11   C C   . ARG A 1 2   ? 35.030 7.057   2.012   1.00 40.94  ? 302  ARG F C   1 
ATOM   12   O O   . ARG A 1 2   ? 35.253 6.019   2.633   1.00 37.86  ? 302  ARG F O   1 
ATOM   13   C CB  . ARG A 1 2   ? 32.664 6.646   1.386   1.00 55.53  ? 302  ARG F CB  1 
ATOM   14   C CG  . ARG A 1 2   ? 31.523 6.852   0.414   1.00 57.45  ? 302  ARG F CG  1 
ATOM   15   C CD  . ARG A 1 2   ? 30.361 5.914   0.723   1.00 60.29  ? 302  ARG F CD  1 
ATOM   16   N NE  . ARG A 1 2   ? 29.996 5.872   2.145   1.00 62.74  ? 302  ARG F NE  1 
ATOM   17   C CZ  . ARG A 1 2   ? 29.608 6.923   2.867   1.00 62.02  ? 302  ARG F CZ  1 
ATOM   18   N NH1 . ARG A 1 2   ? 29.532 8.129   2.315   1.00 62.65  ? 302  ARG F NH1 1 
ATOM   19   N NH2 . ARG A 1 2   ? 29.282 6.765   4.142   1.00 60.20  ? 302  ARG F NH2 1 
ATOM   20   N N   . ILE A 1 3   ? 35.626 8.215   2.278   1.00 47.39  ? 303  ILE F N   1 
ATOM   21   C CA  . ILE A 1 3   ? 36.572 8.374   3.376   1.00 44.61  ? 303  ILE F CA  1 
ATOM   22   C C   . ILE A 1 3   ? 35.848 9.053   4.533   1.00 43.15  ? 303  ILE F C   1 
ATOM   23   O O   . ILE A 1 3   ? 35.167 10.059  4.337   1.00 43.55  ? 303  ILE F O   1 
ATOM   24   C CB  . ILE A 1 3   ? 37.768 9.275   2.991   1.00 32.56  ? 303  ILE F CB  1 
ATOM   25   C CG1 . ILE A 1 3   ? 38.656 8.578   1.962   1.00 31.51  ? 303  ILE F CG1 1 
ATOM   26   C CG2 . ILE A 1 3   ? 38.577 9.612   4.227   1.00 30.43  ? 303  ILE F CG2 1 
ATOM   27   C CD1 . ILE A 1 3   ? 39.841 9.417   1.550   1.00 29.44  ? 303  ILE F CD1 1 
ATOM   28   N N   . GLY A 1 4   ? 36.003 8.510   5.737   1.00 38.15  ? 304  GLY F N   1 
ATOM   29   C CA  . GLY A 1 4   ? 35.362 9.108   6.893   1.00 34.37  ? 304  GLY F CA  1 
ATOM   30   C C   . GLY A 1 4   ? 36.389 9.503   7.937   1.00 32.87  ? 304  GLY F C   1 
ATOM   31   O O   . GLY A 1 4   ? 37.370 8.797   8.148   1.00 32.77  ? 304  GLY F O   1 
ATOM   32   N N   . ILE A 1 5   ? 36.175 10.635  8.591   1.00 31.20  ? 305  ILE F N   1 
ATOM   33   C CA  . ILE A 1 5   ? 37.096 11.089  9.618   1.00 30.27  ? 305  ILE F CA  1 
ATOM   34   C C   . ILE A 1 5   ? 36.319 11.357  10.900  1.00 29.76  ? 305  ILE F C   1 
ATOM   35   O O   . ILE A 1 5   ? 35.474 12.254  10.943  1.00 28.50  ? 305  ILE F O   1 
ATOM   36   C CB  . ILE A 1 5   ? 37.807 12.388  9.214   1.00 27.15  ? 305  ILE F CB  1 
ATOM   37   C CG1 . ILE A 1 5   ? 38.485 12.215  7.862   1.00 25.61  ? 305  ILE F CG1 1 
ATOM   38   C CG2 . ILE A 1 5   ? 38.836 12.758  10.264  1.00 27.97  ? 305  ILE F CG2 1 
ATOM   39   C CD1 . ILE A 1 5   ? 39.308 13.406  7.457   1.00 27.11  ? 305  ILE F CD1 1 
ATOM   40   N N   . ILE A 1 6   ? 36.591 10.571  11.935  1.00 24.56  ? 306  ILE F N   1 
ATOM   41   C CA  . ILE A 1 6   ? 35.905 10.751  13.200  1.00 23.72  ? 306  ILE F CA  1 
ATOM   42   C C   . ILE A 1 6   ? 36.270 12.122  13.758  1.00 25.73  ? 306  ILE F C   1 
ATOM   43   O O   . ILE A 1 6   ? 37.445 12.443  13.973  1.00 24.54  ? 306  ILE F O   1 
ATOM   44   C CB  . ILE A 1 6   ? 36.262 9.621   14.172  1.00 21.95  ? 306  ILE F CB  1 
ATOM   45   C CG1 . ILE A 1 6   ? 35.680 8.308   13.614  1.00 20.03  ? 306  ILE F CG1 1 
ATOM   46   C CG2 . ILE A 1 6   ? 35.735 9.947   15.572  1.00 19.30  ? 306  ILE F CG2 1 
ATOM   47   C CD1 . ILE A 1 6   ? 35.857 7.096   14.486  1.00 18.39  ? 306  ILE F CD1 1 
ATOM   48   N N   . SER A 1 7   ? 35.241 12.927  13.986  1.00 29.51  ? 307  SER F N   1 
ATOM   49   C CA  . SER A 1 7   ? 35.411 14.301  14.446  1.00 33.58  ? 307  SER F CA  1 
ATOM   50   C C   . SER A 1 7   ? 35.017 14.643  15.883  1.00 34.74  ? 307  SER F C   1 
ATOM   51   O O   . SER A 1 7   ? 34.930 15.811  16.234  1.00 34.21  ? 307  SER F O   1 
ATOM   52   C CB  . SER A 1 7   ? 34.643 15.208  13.494  1.00 31.65  ? 307  SER F CB  1 
ATOM   53   O OG  . SER A 1 7   ? 33.313 14.743  13.384  1.00 32.01  ? 307  SER F OG  1 
ATOM   54   N N   . VAL A 1 8   ? 34.793 13.640  16.717  1.00 43.91  ? 308  VAL F N   1 
ATOM   55   C CA  . VAL A 1 8   ? 34.400 13.892  18.098  1.00 44.63  ? 308  VAL F CA  1 
ATOM   56   C C   . VAL A 1 8   ? 35.593 13.951  19.039  1.00 47.84  ? 308  VAL F C   1 
ATOM   57   O O   . VAL A 1 8   ? 35.725 14.889  19.833  1.00 47.93  ? 308  VAL F O   1 
ATOM   58   C CB  . VAL A 1 8   ? 33.446 12.792  18.607  1.00 30.88  ? 308  VAL F CB  1 
ATOM   59   C CG1 . VAL A 1 8   ? 32.309 12.603  17.616  1.00 30.88  ? 308  VAL F CG1 1 
ATOM   60   C CG2 . VAL A 1 8   ? 34.202 11.484  18.813  1.00 27.39  ? 308  VAL F CG2 1 
ATOM   61   N N   . GLY A 1 9   ? 36.443 12.926  18.934  1.00 50.50  ? 309  GLY F N   1 
ATOM   62   C CA  . GLY A 1 9   ? 37.623 12.774  19.769  1.00 48.63  ? 309  GLY F CA  1 
ATOM   63   C C   . GLY A 1 9   ? 38.361 14.045  20.094  1.00 50.05  ? 309  GLY F C   1 
ATOM   64   O O   . GLY A 1 9   ? 38.284 15.024  19.342  1.00 51.19  ? 309  GLY F O   1 
ATOM   65   N N   . PRO A 1 10  ? 39.101 14.053  21.215  1.00 36.29  ? 310  PRO F N   1 
ATOM   66   C CA  . PRO A 1 10  ? 39.885 15.199  21.689  1.00 36.39  ? 310  PRO F CA  1 
ATOM   67   C C   . PRO A 1 10  ? 40.718 15.798  20.558  1.00 36.90  ? 310  PRO F C   1 
ATOM   68   O O   . PRO A 1 10  ? 41.105 15.097  19.619  1.00 34.82  ? 310  PRO F O   1 
ATOM   69   C CB  . PRO A 1 10  ? 40.769 14.586  22.770  1.00 48.59  ? 310  PRO F CB  1 
ATOM   70   C CG  . PRO A 1 10  ? 39.963 13.442  23.272  1.00 49.20  ? 310  PRO F CG  1 
ATOM   71   C CD  . PRO A 1 10  ? 39.379 12.856  22.027  1.00 48.12  ? 310  PRO F CD  1 
ATOM   72   N N   . GLY A 1 11  ? 40.988 17.094  20.651  1.00 51.15  ? 311  GLY F N   1 
ATOM   73   C CA  . GLY A 1 11  ? 41.790 17.760  19.636  1.00 53.90  ? 311  GLY F CA  1 
ATOM   74   C C   . GLY A 1 11  ? 41.037 18.156  18.381  1.00 54.29  ? 311  GLY F C   1 
ATOM   75   O O   . GLY A 1 11  ? 40.044 17.531  18.010  1.00 55.36  ? 311  GLY F O   1 
ATOM   76   N N   . ASN A 1 12  ? 41.516 19.204  17.723  1.00 46.02  ? 312  ASN F N   1 
ATOM   77   C CA  . ASN A 1 12  ? 40.891 19.685  16.500  1.00 47.30  ? 312  ASN F CA  1 
ATOM   78   C C   . ASN A 1 12  ? 41.286 18.736  15.373  1.00 46.76  ? 312  ASN F C   1 
ATOM   79   O O   . ASN A 1 12  ? 42.433 18.297  15.291  1.00 45.50  ? 312  ASN F O   1 
ATOM   80   C CB  . ASN A 1 12  ? 41.356 21.113  16.200  1.00 71.23  ? 312  ASN F CB  1 
ATOM   81   C CG  . ASN A 1 12  ? 40.418 21.850  15.265  1.00 73.86  ? 312  ASN F CG  1 
ATOM   82   O OD1 . ASN A 1 12  ? 40.307 21.519  14.082  1.00 78.07  ? 312  ASN F OD1 1 
ATOM   83   N ND2 . ASN A 1 12  ? 39.731 22.856  15.793  1.00 74.28  ? 312  ASN F ND2 1 
ATOM   84   N N   . ILE A 1 13  ? 40.333 18.420  14.507  1.00 49.78  ? 313  ILE F N   1 
ATOM   85   C CA  . ILE A 1 13  ? 40.589 17.489  13.420  1.00 50.51  ? 313  ILE F CA  1 
ATOM   86   C C   . ILE A 1 13  ? 40.533 18.117  12.035  1.00 51.31  ? 313  ILE F C   1 
ATOM   87   O O   . ILE A 1 13  ? 40.728 17.434  11.031  1.00 50.76  ? 313  ILE F O   1 
ATOM   88   C CB  . ILE A 1 13  ? 39.598 16.293  13.490  1.00 46.84  ? 313  ILE F CB  1 
ATOM   89   C CG1 . ILE A 1 13  ? 38.153 16.781  13.334  1.00 46.42  ? 313  ILE F CG1 1 
ATOM   90   C CG2 . ILE A 1 13  ? 39.744 15.581  14.835  1.00 45.86  ? 313  ILE F CG2 1 
ATOM   91   C CD1 . ILE A 1 13  ? 37.762 17.163  11.922  1.00 45.35  ? 313  ILE F CD1 1 
ATOM   92   N N   . MET A 1 14  ? 40.271 19.416  11.976  1.00 52.30  ? 314  MET F N   1 
ATOM   93   C CA  . MET A 1 14  ? 40.198 20.085  10.692  1.00 53.63  ? 314  MET F CA  1 
ATOM   94   C C   . MET A 1 14  ? 41.513 20.016  9.933   1.00 52.36  ? 314  MET F C   1 
ATOM   95   O O   . MET A 1 14  ? 41.521 19.927  8.704   1.00 52.86  ? 314  MET F O   1 
ATOM   96   C CB  . MET A 1 14  ? 39.748 21.535  10.870  1.00 77.53  ? 314  MET F CB  1 
ATOM   97   C CG  . MET A 1 14  ? 38.242 21.669  11.088  1.00 82.54  ? 314  MET F CG  1 
ATOM   98   S SD  . MET A 1 14  ? 37.277 20.767  9.829   1.00 86.96  ? 314  MET F SD  1 
ATOM   99   C CE  . MET A 1 14  ? 37.423 21.889  8.438   1.00 86.68  ? 314  MET F CE  1 
ATOM   100  N N   . ASN A 1 15  ? 42.626 20.050  10.656  1.00 48.16  ? 315  ASN F N   1 
ATOM   101  C CA  . ASN A 1 15  ? 43.928 19.961  10.010  1.00 46.89  ? 315  ASN F CA  1 
ATOM   102  C C   . ASN A 1 15  ? 44.065 18.630  9.288   1.00 44.64  ? 315  ASN F C   1 
ATOM   103  O O   . ASN A 1 15  ? 44.455 18.583  8.118   1.00 44.07  ? 315  ASN F O   1 
ATOM   104  C CB  . ASN A 1 15  ? 45.057 20.101  11.031  1.00 69.55  ? 315  ASN F CB  1 
ATOM   105  C CG  . ASN A 1 15  ? 45.363 21.544  11.358  1.00 72.69  ? 315  ASN F CG  1 
ATOM   106  O OD1 . ASN A 1 15  ? 45.571 22.362  10.460  1.00 74.47  ? 315  ASN F OD1 1 
ATOM   107  N ND2 . ASN A 1 15  ? 45.400 21.866  12.646  1.00 73.65  ? 315  ASN F ND2 1 
ATOM   108  N N   . LEU A 1 16  ? 43.745 17.545  9.982   1.00 39.99  ? 316  LEU F N   1 
ATOM   109  C CA  . LEU A 1 16  ? 43.849 16.234  9.364   1.00 39.39  ? 316  LEU F CA  1 
ATOM   110  C C   . LEU A 1 16  ? 42.864 16.166  8.204   1.00 40.60  ? 316  LEU F C   1 
ATOM   111  O O   . LEU A 1 16  ? 43.116 15.487  7.208   1.00 40.04  ? 316  LEU F O   1 
ATOM   112  C CB  . LEU A 1 16  ? 43.571 15.125  10.391  1.00 35.95  ? 316  LEU F CB  1 
ATOM   113  C CG  . LEU A 1 16  ? 43.785 13.658  9.986   1.00 32.27  ? 316  LEU F CG  1 
ATOM   114  C CD1 . LEU A 1 16  ? 42.557 13.121  9.333   1.00 30.75  ? 316  LEU F CD1 1 
ATOM   115  C CD2 . LEU A 1 16  ? 44.978 13.528  9.057   1.00 29.46  ? 316  LEU F CD2 1 
ATOM   116  N N   . TYR A 1 17  ? 41.751 16.886  8.326   1.00 35.34  ? 317  TYR F N   1 
ATOM   117  C CA  . TYR A 1 17  ? 40.744 16.904  7.272   1.00 37.65  ? 317  TYR F CA  1 
ATOM   118  C C   . TYR A 1 17  ? 41.304 17.561  6.021   1.00 37.74  ? 317  TYR F C   1 
ATOM   119  O O   . TYR A 1 17  ? 41.174 17.035  4.920   1.00 35.41  ? 317  TYR F O   1 
ATOM   120  C CB  . TYR A 1 17  ? 39.494 17.666  7.719   1.00 69.55  ? 317  TYR F CB  1 
ATOM   121  C CG  . TYR A 1 17  ? 38.496 17.874  6.600   1.00 72.44  ? 317  TYR F CG  1 
ATOM   122  C CD1 . TYR A 1 17  ? 37.903 16.788  5.957   1.00 74.21  ? 317  TYR F CD1 1 
ATOM   123  C CD2 . TYR A 1 17  ? 38.163 19.156  6.164   1.00 75.41  ? 317  TYR F CD2 1 
ATOM   124  C CE1 . TYR A 1 17  ? 37.002 16.972  4.907   1.00 76.14  ? 317  TYR F CE1 1 
ATOM   125  C CE2 . TYR A 1 17  ? 37.263 19.353  5.112   1.00 77.09  ? 317  TYR F CE2 1 
ATOM   126  C CZ  . TYR A 1 17  ? 36.686 18.256  4.491   1.00 77.37  ? 317  TYR F CZ  1 
ATOM   127  O OH  . TYR A 1 17  ? 35.785 18.441  3.467   1.00 78.08  ? 317  TYR F OH  1 
ATOM   128  N N   . ARG A 1 18  ? 41.918 18.725  6.200   1.00 56.38  ? 318  ARG F N   1 
ATOM   129  C CA  . ARG A 1 18  ? 42.504 19.450  5.085   1.00 58.07  ? 318  ARG F CA  1 
ATOM   130  C C   . ARG A 1 18  ? 43.557 18.561  4.432   1.00 58.17  ? 318  ARG F C   1 
ATOM   131  O O   . ARG A 1 18  ? 43.565 18.381  3.210   1.00 57.86  ? 318  ARG F O   1 
ATOM   132  C CB  . ARG A 1 18  ? 43.137 20.754  5.580   1.00 64.25  ? 318  ARG F CB  1 
ATOM   133  C CG  . ARG A 1 18  ? 42.140 21.706  6.235   1.00 68.22  ? 318  ARG F CG  1 
ATOM   134  C CD  . ARG A 1 18  ? 42.784 23.041  6.621   1.00 70.07  ? 318  ARG F CD  1 
ATOM   135  N NE  . ARG A 1 18  ? 41.817 23.973  7.201   1.00 72.63  ? 318  ARG F NE  1 
ATOM   136  C CZ  . ARG A 1 18  ? 41.320 23.881  8.432   1.00 74.37  ? 318  ARG F CZ  1 
ATOM   137  N NH1 . ARG A 1 18  ? 41.697 22.896  9.237   1.00 75.19  ? 318  ARG F NH1 1 
ATOM   138  N NH2 . ARG A 1 18  ? 40.435 24.772  8.860   1.00 75.02  ? 318  ARG F NH2 1 
ATOM   139  N N   . GLY A 1 19  ? 44.430 17.993  5.261   1.00 51.68  ? 319  GLY F N   1 
ATOM   140  C CA  . GLY A 1 19  ? 45.473 17.119  4.757   1.00 50.33  ? 319  GLY F CA  1 
ATOM   141  C C   . GLY A 1 19  ? 44.916 15.987  3.919   1.00 49.74  ? 319  GLY F C   1 
ATOM   142  O O   . GLY A 1 19  ? 45.371 15.766  2.801   1.00 51.48  ? 319  GLY F O   1 
ATOM   143  N N   . VAL A 1 20  ? 43.930 15.272  4.454   1.00 43.39  ? 320  VAL F N   1 
ATOM   144  C CA  . VAL A 1 20  ? 43.311 14.152  3.746   1.00 42.67  ? 320  VAL F CA  1 
ATOM   145  C C   . VAL A 1 20  ? 42.591 14.620  2.490   1.00 43.97  ? 320  VAL F C   1 
ATOM   146  O O   . VAL A 1 20  ? 42.562 13.917  1.476   1.00 42.36  ? 320  VAL F O   1 
ATOM   147  C CB  . VAL A 1 20  ? 42.293 13.413  4.646   1.00 35.27  ? 320  VAL F CB  1 
ATOM   148  C CG1 . VAL A 1 20  ? 41.497 12.414  3.825   1.00 35.85  ? 320  VAL F CG1 1 
ATOM   149  C CG2 . VAL A 1 20  ? 43.018 12.695  5.770   1.00 34.13  ? 320  VAL F CG2 1 
ATOM   150  N N   . LYS A 1 21  ? 42.005 15.811  2.568   1.00 57.11  ? 321  LYS F N   1 
ATOM   151  C CA  . LYS A 1 21  ? 41.284 16.387  1.442   1.00 60.06  ? 321  LYS F CA  1 
ATOM   152  C C   . LYS A 1 21  ? 42.243 16.630  0.273   1.00 60.50  ? 321  LYS F C   1 
ATOM   153  O O   . LYS A 1 21  ? 42.068 16.079  -0.820  1.00 59.67  ? 321  LYS F O   1 
ATOM   154  C CB  . LYS A 1 21  ? 40.628 17.706  1.866   1.00 67.16  ? 321  LYS F CB  1 
ATOM   155  C CG  . LYS A 1 21  ? 39.702 18.306  0.829   1.00 68.31  ? 321  LYS F CG  1 
ATOM   156  C CD  . LYS A 1 21  ? 39.029 19.565  1.348   1.00 69.95  ? 321  LYS F CD  1 
ATOM   157  C CE  . LYS A 1 21  ? 38.024 20.097  0.339   1.00 70.87  ? 321  LYS F CE  1 
ATOM   158  N NZ  . LYS A 1 21  ? 38.661 20.392  -0.972  1.00 71.12  ? 321  LYS F NZ  1 
ATOM   159  N N   . ARG A 1 22  ? 43.259 17.451  0.522   1.00 60.73  ? 322  ARG F N   1 
ATOM   160  C CA  . ARG A 1 22  ? 44.253 17.782  -0.485  1.00 61.64  ? 322  ARG F CA  1 
ATOM   161  C C   . ARG A 1 22  ? 44.933 16.532  -1.036  1.00 63.23  ? 322  ARG F C   1 
ATOM   162  O O   . ARG A 1 22  ? 45.330 16.494  -2.202  1.00 65.21  ? 322  ARG F O   1 
ATOM   163  C CB  . ARG A 1 22  ? 45.295 18.726  0.108   1.00 48.86  ? 322  ARG F CB  1 
ATOM   164  N N   . ALA A 1 23  ? 45.063 15.505  -0.202  1.00 54.12  ? 323  ALA F N   1 
ATOM   165  C CA  . ALA A 1 23  ? 45.711 14.271  -0.629  1.00 54.71  ? 323  ALA F CA  1 
ATOM   166  C C   . ALA A 1 23  ? 44.822 13.444  -1.546  1.00 55.41  ? 323  ALA F C   1 
ATOM   167  O O   . ALA A 1 23  ? 45.313 12.749  -2.436  1.00 55.67  ? 323  ALA F O   1 
ATOM   168  C CB  . ALA A 1 23  ? 46.116 13.445  0.587   1.00 51.46  ? 323  ALA F CB  1 
ATOM   169  N N   . SER A 1 24  ? 43.514 13.521  -1.327  1.00 67.36  ? 324  SER F N   1 
ATOM   170  C CA  . SER A 1 24  ? 42.569 12.768  -2.141  1.00 68.52  ? 324  SER F CA  1 
ATOM   171  C C   . SER A 1 24  ? 42.292 13.485  -3.456  1.00 69.01  ? 324  SER F C   1 
ATOM   172  O O   . SER A 1 24  ? 41.522 12.998  -4.286  1.00 69.34  ? 324  SER F O   1 
ATOM   173  C CB  . SER A 1 24  ? 41.259 12.566  -1.377  1.00 62.61  ? 324  SER F CB  1 
ATOM   174  O OG  . SER A 1 24  ? 40.668 13.811  -1.056  1.00 64.53  ? 324  SER F OG  1 
ATOM   175  N N   . GLU A 1 25  ? 42.930 14.640  -3.639  1.00 59.31  ? 325  GLU F N   1 
ATOM   176  C CA  . GLU A 1 25  ? 42.757 15.444  -4.848  1.00 59.09  ? 325  GLU F CA  1 
ATOM   177  C C   . GLU A 1 25  ? 43.207 14.711  -6.110  1.00 58.76  ? 325  GLU F C   1 
ATOM   178  O O   . GLU A 1 25  ? 42.425 14.530  -7.042  1.00 57.04  ? 325  GLU F O   1 
ATOM   179  C CB  . GLU A 1 25  ? 43.524 16.765  -4.711  1.00 57.02  ? 325  GLU F CB  1 
ATOM   180  N N   . ASN A 1 26  ? 44.470 14.289  -6.123  1.00 61.99  ? 326  ASN F N   1 
ATOM   181  C CA  . ASN A 1 26  ? 45.064 13.590  -7.263  1.00 62.00  ? 326  ASN F CA  1 
ATOM   182  C C   . ASN A 1 26  ? 44.290 12.361  -7.749  1.00 61.87  ? 326  ASN F C   1 
ATOM   183  O O   . ASN A 1 26  ? 44.609 11.799  -8.797  1.00 61.75  ? 326  ASN F O   1 
ATOM   184  C CB  . ASN A 1 26  ? 46.503 13.202  -6.929  1.00 62.63  ? 326  ASN F CB  1 
ATOM   185  N N   . PHE A 1 27  ? 43.284 11.939  -6.990  1.00 57.73  ? 327  PHE F N   1 
ATOM   186  C CA  . PHE A 1 27  ? 42.472 10.786  -7.373  1.00 59.86  ? 327  PHE F CA  1 
ATOM   187  C C   . PHE A 1 27  ? 41.071 11.311  -7.659  1.00 61.44  ? 327  PHE F C   1 
ATOM   188  O O   . PHE A 1 27  ? 40.885 12.513  -7.838  1.00 61.68  ? 327  PHE F O   1 
ATOM   189  C CB  . PHE A 1 27  ? 42.401 9.753   -6.236  1.00 60.81  ? 327  PHE F CB  1 
ATOM   190  C CG  . PHE A 1 27  ? 43.736 9.417   -5.622  1.00 60.49  ? 327  PHE F CG  1 
ATOM   191  C CD1 . PHE A 1 27  ? 44.333 10.277  -4.706  1.00 59.17  ? 327  PHE F CD1 1 
ATOM   192  C CD2 . PHE A 1 27  ? 44.398 8.240   -5.963  1.00 60.24  ? 327  PHE F CD2 1 
ATOM   193  C CE1 . PHE A 1 27  ? 45.564 9.973   -4.140  1.00 57.63  ? 327  PHE F CE1 1 
ATOM   194  C CE2 . PHE A 1 27  ? 45.631 7.925   -5.402  1.00 59.03  ? 327  PHE F CE2 1 
ATOM   195  C CZ  . PHE A 1 27  ? 46.215 8.795   -4.488  1.00 58.31  ? 327  PHE F CZ  1 
ATOM   196  N N   . GLU A 1 28  ? 40.084 10.424  -7.707  1.00 57.24  ? 328  GLU F N   1 
ATOM   197  C CA  . GLU A 1 28  ? 38.723 10.874  -7.945  1.00 59.79  ? 328  GLU F CA  1 
ATOM   198  C C   . GLU A 1 28  ? 37.655 9.899   -7.470  1.00 59.95  ? 328  GLU F C   1 
ATOM   199  O O   . GLU A 1 28  ? 37.922 8.712   -7.272  1.00 59.13  ? 328  GLU F O   1 
ATOM   200  C CB  . GLU A 1 28  ? 38.518 11.200  -9.422  1.00 99.24  ? 328  GLU F CB  1 
ATOM   201  C CG  . GLU A 1 28  ? 37.240 11.980  -9.673  1.00 100.00 ? 328  GLU F CG  1 
ATOM   202  C CD  . GLU A 1 28  ? 37.042 13.070  -8.636  1.00 100.00 ? 328  GLU F CD  1 
ATOM   203  O OE1 . GLU A 1 28  ? 37.913 13.964  -8.547  1.00 100.00 ? 328  GLU F OE1 1 
ATOM   204  O OE2 . GLU A 1 28  ? 36.025 13.025  -7.904  1.00 100.00 ? 328  GLU F OE2 1 
ATOM   205  N N   . ASP A 1 29  ? 36.441 10.423  -7.301  1.00 69.83  ? 329  ASP F N   1 
ATOM   206  C CA  . ASP A 1 29  ? 35.298 9.659   -6.809  1.00 70.04  ? 329  ASP F CA  1 
ATOM   207  C C   . ASP A 1 29  ? 35.570 9.427   -5.332  1.00 69.08  ? 329  ASP F C   1 
ATOM   208  O O   . ASP A 1 29  ? 35.114 8.447   -4.738  1.00 68.03  ? 329  ASP F O   1 
ATOM   209  C CB  . ASP A 1 29  ? 35.158 8.321   -7.543  1.00 92.66  ? 329  ASP F CB  1 
ATOM   210  C CG  . ASP A 1 29  ? 34.812 8.496   -9.011  1.00 94.97  ? 329  ASP F CG  1 
ATOM   211  O OD1 . ASP A 1 29  ? 35.652 9.048   -9.759  1.00 97.41  ? 329  ASP F OD1 1 
ATOM   212  O OD2 . ASP A 1 29  ? 33.699 8.087   -9.416  1.00 95.05  ? 329  ASP F OD2 1 
ATOM   213  N N   . VAL A 1 30  ? 36.325 10.358  -4.756  1.00 75.96  ? 330  VAL F N   1 
ATOM   214  C CA  . VAL A 1 30  ? 36.704 10.298  -3.353  1.00 75.43  ? 330  VAL F CA  1 
ATOM   215  C C   . VAL A 1 30  ? 35.876 11.274  -2.513  1.00 73.77  ? 330  VAL F C   1 
ATOM   216  O O   . VAL A 1 30  ? 36.034 12.492  -2.609  1.00 73.67  ? 330  VAL F O   1 
ATOM   217  C CB  . VAL A 1 30  ? 38.211 10.624  -3.168  1.00 63.98  ? 330  VAL F CB  1 
ATOM   218  C CG1 . VAL A 1 30  ? 38.638 10.316  -1.746  1.00 64.10  ? 330  VAL F CG1 1 
ATOM   219  C CG2 . VAL A 1 30  ? 39.044 9.821   -4.150  1.00 63.58  ? 330  VAL F CG2 1 
ATOM   220  N N   . SER A 1 31  ? 34.995 10.717  -1.690  1.00 66.55  ? 331  SER F N   1 
ATOM   221  C CA  . SER A 1 31  ? 34.137 11.505  -0.817  1.00 64.81  ? 331  SER F CA  1 
ATOM   222  C C   . SER A 1 31  ? 34.751 11.526  0.582   1.00 63.08  ? 331  SER F C   1 
ATOM   223  O O   . SER A 1 31  ? 35.261 10.509  1.054   1.00 62.66  ? 331  SER F O   1 
ATOM   224  C CB  . SER A 1 31  ? 32.738 10.881  -0.770  1.00 62.86  ? 331  SER F CB  1 
ATOM   225  O OG  . SER A 1 31  ? 31.835 11.687  -0.033  1.00 64.73  ? 331  SER F OG  1 
ATOM   226  N N   . ILE A 1 32  ? 34.716 12.686  1.231   1.00 60.12  ? 332  ILE F N   1 
ATOM   227  C CA  . ILE A 1 32  ? 35.262 12.832  2.578   1.00 58.21  ? 332  ILE F CA  1 
ATOM   228  C C   . ILE A 1 32  ? 34.169 13.378  3.476   1.00 58.08  ? 332  ILE F C   1 
ATOM   229  O O   . ILE A 1 32  ? 33.546 14.390  3.151   1.00 59.33  ? 332  ILE F O   1 
ATOM   230  C CB  . ILE A 1 32  ? 36.438 13.832  2.628   1.00 57.71  ? 332  ILE F CB  1 
ATOM   231  C CG1 . ILE A 1 32  ? 37.479 13.486  1.564   1.00 59.09  ? 332  ILE F CG1 1 
ATOM   232  C CG2 . ILE A 1 32  ? 37.092 13.789  4.000   1.00 56.47  ? 332  ILE F CG2 1 
ATOM   233  C CD1 . ILE A 1 32  ? 38.683 14.414  1.568   1.00 58.47  ? 332  ILE F CD1 1 
ATOM   234  N N   . GLU A 1 33  ? 33.935 12.720  4.607   1.00 60.05  ? 333  GLU F N   1 
ATOM   235  C CA  . GLU A 1 33  ? 32.902 13.177  5.534   1.00 57.57  ? 333  GLU F CA  1 
ATOM   236  C C   . GLU A 1 33  ? 33.398 13.131  6.971   1.00 55.40  ? 333  GLU F C   1 
ATOM   237  O O   . GLU A 1 33  ? 34.299 12.356  7.302   1.00 55.73  ? 333  GLU F O   1 
ATOM   238  C CB  . GLU A 1 33  ? 31.650 12.297  5.425   1.00 53.41  ? 333  GLU F CB  1 
ATOM   239  C CG  . GLU A 1 33  ? 31.297 11.857  4.017   1.00 54.64  ? 333  GLU F CG  1 
ATOM   240  C CD  . GLU A 1 33  ? 29.955 11.156  3.948   1.00 54.40  ? 333  GLU F CD  1 
ATOM   241  O OE1 . GLU A 1 33  ? 29.683 10.292  4.808   1.00 54.57  ? 333  GLU F OE1 1 
ATOM   242  O OE2 . GLU A 1 33  ? 29.175 11.465  3.027   1.00 53.15  ? 333  GLU F OE2 1 
ATOM   243  N N   . LEU A 1 34  ? 32.817 13.971  7.821   1.00 43.00  ? 334  LEU F N   1 
ATOM   244  C CA  . LEU A 1 34  ? 33.181 13.971  9.229   1.00 40.16  ? 334  LEU F CA  1 
ATOM   245  C C   . LEU A 1 34  ? 32.203 13.009  9.883   1.00 38.84  ? 334  LEU F C   1 
ATOM   246  O O   . LEU A 1 34  ? 31.012 13.017  9.572   1.00 38.47  ? 334  LEU F O   1 
ATOM   247  C CB  . LEU A 1 34  ? 33.047 15.369  9.842   1.00 40.21  ? 334  LEU F CB  1 
ATOM   248  C CG  . LEU A 1 34  ? 33.958 16.483  9.307   1.00 39.11  ? 334  LEU F CG  1 
ATOM   249  C CD1 . LEU A 1 34  ? 33.789 17.711  10.186  1.00 38.22  ? 334  LEU F CD1 1 
ATOM   250  C CD2 . LEU A 1 34  ? 35.418 16.043  9.307   1.00 37.75  ? 334  LEU F CD2 1 
ATOM   251  N N   . VAL A 1 35  ? 32.705 12.161  10.769  1.00 38.94  ? 335  VAL F N   1 
ATOM   252  C CA  . VAL A 1 35  ? 31.854 11.189  11.435  1.00 37.85  ? 335  VAL F CA  1 
ATOM   253  C C   . VAL A 1 35  ? 31.653 11.540  12.901  1.00 39.61  ? 335  VAL F C   1 
ATOM   254  O O   . VAL A 1 35  ? 32.614 11.659  13.655  1.00 39.74  ? 335  VAL F O   1 
ATOM   255  C CB  . VAL A 1 35  ? 32.453 9.784   11.330  1.00 28.20  ? 335  VAL F CB  1 
ATOM   256  C CG1 . VAL A 1 35  ? 31.532 8.779   11.979  1.00 28.41  ? 335  VAL F CG1 1 
ATOM   257  C CG2 . VAL A 1 35  ? 32.693 9.434   9.872   1.00 25.57  ? 335  VAL F CG2 1 
ATOM   258  N N   . GLU A 1 36  ? 30.391 11.705  13.292  1.00 44.76  ? 336  GLU F N   1 
ATOM   259  C CA  . GLU A 1 36  ? 30.037 12.045  14.668  1.00 47.17  ? 336  GLU F CA  1 
ATOM   260  C C   . GLU A 1 36  ? 29.209 10.930  15.290  1.00 46.99  ? 336  GLU F C   1 
ATOM   261  O O   . GLU A 1 36  ? 29.137 10.811  16.506  1.00 46.93  ? 336  GLU F O   1 
ATOM   262  C CB  . GLU A 1 36  ? 29.215 13.339  14.713  1.00 62.87  ? 336  GLU F CB  1 
ATOM   263  C CG  . GLU A 1 36  ? 29.834 14.523  13.996  1.00 67.74  ? 336  GLU F CG  1 
ATOM   264  C CD  . GLU A 1 36  ? 28.975 15.774  14.085  1.00 71.47  ? 336  GLU F CD  1 
ATOM   265  O OE1 . GLU A 1 36  ? 27.820 15.749  13.604  1.00 73.15  ? 336  GLU F OE1 1 
ATOM   266  O OE2 . GLU A 1 36  ? 29.456 16.788  14.638  1.00 73.98  ? 336  GLU F OE2 1 
ATOM   267  N N   . SER A 1 37  ? 28.582 10.118  14.448  1.00 41.13  ? 337  SER F N   1 
ATOM   268  C CA  . SER A 1 37  ? 27.741 9.034   14.933  1.00 42.49  ? 337  SER F CA  1 
ATOM   269  C C   . SER A 1 37  ? 27.655 7.882   13.939  1.00 43.02  ? 337  SER F C   1 
ATOM   270  O O   . SER A 1 37  ? 28.083 8.008   12.791  1.00 42.67  ? 337  SER F O   1 
ATOM   271  C CB  . SER A 1 37  ? 26.334 9.568   15.222  1.00 57.27  ? 337  SER F CB  1 
ATOM   272  O OG  . SER A 1 37  ? 25.712 10.045  14.042  1.00 56.99  ? 337  SER F OG  1 
ATOM   273  N N   . PRO A 1 38  ? 27.100 6.736   14.370  1.00 44.91  ? 338  PRO F N   1 
ATOM   274  C CA  . PRO A 1 38  ? 26.965 5.563   13.494  1.00 47.00  ? 338  PRO F CA  1 
ATOM   275  C C   . PRO A 1 38  ? 25.952 5.821   12.387  1.00 48.98  ? 338  PRO F C   1 
ATOM   276  O O   . PRO A 1 38  ? 25.839 5.042   11.442  1.00 47.45  ? 338  PRO F O   1 
ATOM   277  C CB  . PRO A 1 38  ? 26.476 4.465   14.438  1.00 39.29  ? 338  PRO F CB  1 
ATOM   278  C CG  . PRO A 1 38  ? 26.890 4.927   15.778  1.00 39.63  ? 338  PRO F CG  1 
ATOM   279  C CD  . PRO A 1 38  ? 26.665 6.412   15.737  1.00 37.96  ? 338  PRO F CD  1 
ATOM   280  N N   . ARG A 1 39  ? 25.214 6.919   12.527  1.00 64.62  ? 339  ARG F N   1 
ATOM   281  C CA  . ARG A 1 39  ? 24.188 7.303   11.565  1.00 68.76  ? 339  ARG F CA  1 
ATOM   282  C C   . ARG A 1 39  ? 24.811 7.642   10.211  1.00 69.76  ? 339  ARG F C   1 
ATOM   283  O O   . ARG A 1 39  ? 24.570 8.711   9.642   1.00 70.19  ? 339  ARG F O   1 
ATOM   284  C CB  . ARG A 1 39  ? 23.391 8.497   12.098  1.00 84.90  ? 339  ARG F CB  1 
ATOM   285  C CG  . ARG A 1 39  ? 23.166 8.465   13.607  1.00 89.18  ? 339  ARG F CG  1 
ATOM   286  C CD  . ARG A 1 39  ? 21.808 9.027   13.973  1.00 93.27  ? 339  ARG F CD  1 
ATOM   287  N NE  . ARG A 1 39  ? 20.745 8.121   13.545  1.00 98.30  ? 339  ARG F NE  1 
ATOM   288  C CZ  . ARG A 1 39  ? 19.446 8.388   13.628  1.00 99.44  ? 339  ARG F CZ  1 
ATOM   289  N NH1 . ARG A 1 39  ? 19.036 9.547   14.125  1.00 100.00 ? 339  ARG F NH1 1 
ATOM   290  N NH2 . ARG A 1 39  ? 18.559 7.490   13.218  1.00 99.76  ? 339  ARG F NH2 1 
ATOM   291  N N   . ASN A 1 40  ? 25.617 6.707   9.717   1.00 70.07  ? 340  ASN F N   1 
ATOM   292  C CA  . ASN A 1 40  ? 26.312 6.810   8.438   1.00 70.49  ? 340  ASN F CA  1 
ATOM   293  C C   . ASN A 1 40  ? 26.572 5.369   8.039   1.00 70.04  ? 340  ASN F C   1 
ATOM   294  O O   . ASN A 1 40  ? 26.697 4.499   8.904   1.00 71.13  ? 340  ASN F O   1 
ATOM   295  C CB  . ASN A 1 40  ? 27.657 7.524   8.600   1.00 69.88  ? 340  ASN F CB  1 
ATOM   296  C CG  . ASN A 1 40  ? 27.511 8.971   9.028   1.00 71.17  ? 340  ASN F CG  1 
ATOM   297  O OD1 . ASN A 1 40  ? 27.177 9.815   8.168   1.00 72.03  ? 340  ASN F OD1 1 
ATOM   298  N ND2 . ASN A 1 40  ? 27.728 9.258   10.227  1.00 71.38  ? 340  ASN F ND2 1 
ATOM   299  N N   . ASP A 1 41  ? 26.643 5.100   6.743   1.00 69.91  ? 341  ASP F N   1 
ATOM   300  C CA  . ASP A 1 41  ? 26.912 3.740   6.309   1.00 68.56  ? 341  ASP F CA  1 
ATOM   301  C C   . ASP A 1 41  ? 28.412 3.600   6.082   1.00 65.65  ? 341  ASP F C   1 
ATOM   302  O O   . ASP A 1 41  ? 29.095 4.573   5.761   1.00 64.92  ? 341  ASP F O   1 
ATOM   303  C CB  . ASP A 1 41  ? 26.113 3.395   5.038   1.00 85.84  ? 341  ASP F CB  1 
ATOM   304  C CG  . ASP A 1 41  ? 26.360 4.370   3.899   1.00 88.47  ? 341  ASP F CG  1 
ATOM   305  O OD1 . ASP A 1 41  ? 26.246 5.594   4.124   1.00 91.54  ? 341  ASP F OD1 1 
ATOM   306  O OD2 . ASP A 1 41  ? 26.652 3.910   2.774   1.00 88.77  ? 341  ASP F OD2 1 
ATOM   307  N N   . LEU A 1 42  ? 28.916 2.387   6.281   1.00 62.11  ? 342  LEU F N   1 
ATOM   308  C CA  . LEU A 1 42  ? 30.333 2.082   6.127   1.00 58.20  ? 342  LEU F CA  1 
ATOM   309  C C   . LEU A 1 42  ? 31.126 2.924   5.131   1.00 55.80  ? 342  LEU F C   1 
ATOM   310  O O   . LEU A 1 42  ? 30.643 3.270   4.055   1.00 56.37  ? 342  LEU F O   1 
ATOM   311  C CB  . LEU A 1 42  ? 30.499 0.605   5.769   1.00 51.67  ? 342  LEU F CB  1 
ATOM   312  C CG  . LEU A 1 42  ? 30.748 -0.351  6.937   1.00 53.16  ? 342  LEU F CG  1 
ATOM   313  C CD1 . LEU A 1 42  ? 29.816 -0.023  8.092   1.00 50.87  ? 342  LEU F CD1 1 
ATOM   314  C CD2 . LEU A 1 42  ? 30.565 -1.795  6.462   1.00 52.32  ? 342  LEU F CD2 1 
ATOM   315  N N   . TYR A 1 43  ? 32.351 3.261   5.516   1.00 44.65  ? 343  TYR F N   1 
ATOM   316  C CA  . TYR A 1 43  ? 33.245 4.014   4.656   1.00 42.39  ? 343  TYR F CA  1 
ATOM   317  C C   . TYR A 1 43  ? 34.287 2.999   4.188   1.00 42.71  ? 343  TYR F C   1 
ATOM   318  O O   . TYR A 1 43  ? 34.325 1.874   4.685   1.00 43.10  ? 343  TYR F O   1 
ATOM   319  C CB  . TYR A 1 43  ? 33.929 5.143   5.427   1.00 37.41  ? 343  TYR F CB  1 
ATOM   320  C CG  . TYR A 1 43  ? 32.987 6.198   5.952   1.00 35.45  ? 343  TYR F CG  1 
ATOM   321  C CD1 . TYR A 1 43  ? 32.293 6.012   7.148   1.00 34.39  ? 343  TYR F CD1 1 
ATOM   322  C CD2 . TYR A 1 43  ? 32.779 7.380   5.245   1.00 33.71  ? 343  TYR F CD2 1 
ATOM   323  C CE1 . TYR A 1 43  ? 31.417 6.975   7.624   1.00 32.44  ? 343  TYR F CE1 1 
ATOM   324  C CE2 . TYR A 1 43  ? 31.909 8.349   5.707   1.00 32.72  ? 343  TYR F CE2 1 
ATOM   325  C CZ  . TYR A 1 43  ? 31.229 8.144   6.896   1.00 34.38  ? 343  TYR F CZ  1 
ATOM   326  O OH  . TYR A 1 43  ? 30.354 9.107   7.346   1.00 35.60  ? 343  TYR F OH  1 
ATOM   327  N N   . ASP A 1 44  ? 35.120 3.378   3.228   1.00 46.63  ? 344  ASP F N   1 
ATOM   328  C CA  . ASP A 1 44  ? 36.147 2.467   2.742   1.00 46.08  ? 344  ASP F CA  1 
ATOM   329  C C   . ASP A 1 44  ? 37.408 2.741   3.523   1.00 44.52  ? 344  ASP F C   1 
ATOM   330  O O   . ASP A 1 44  ? 38.247 1.862   3.696   1.00 45.06  ? 344  ASP F O   1 
ATOM   331  C CB  . ASP A 1 44  ? 36.408 2.702   1.267   1.00 74.31  ? 344  ASP F CB  1 
ATOM   332  N N   . LEU A 1 45  ? 37.525 3.987   3.971   1.00 43.63  ? 345  LEU F N   1 
ATOM   333  C CA  . LEU A 1 45  ? 38.664 4.456   4.736   1.00 40.86  ? 345  LEU F CA  1 
ATOM   334  C C   . LEU A 1 45  ? 38.099 5.230   5.903   1.00 39.15  ? 345  LEU F C   1 
ATOM   335  O O   . LEU A 1 45  ? 37.415 6.236   5.717   1.00 40.20  ? 345  LEU F O   1 
ATOM   336  C CB  . LEU A 1 45  ? 39.524 5.400   3.896   1.00 32.43  ? 345  LEU F CB  1 
ATOM   337  C CG  . LEU A 1 45  ? 41.044 5.391   4.084   1.00 31.96  ? 345  LEU F CG  1 
ATOM   338  C CD1 . LEU A 1 45  ? 41.620 6.619   3.414   1.00 28.45  ? 345  LEU F CD1 1 
ATOM   339  C CD2 . LEU A 1 45  ? 41.412 5.364   5.553   1.00 31.59  ? 345  LEU F CD2 1 
ATOM   340  N N   . LEU A 1 46  ? 38.378 4.756   7.108   1.00 31.62  ? 346  LEU F N   1 
ATOM   341  C CA  . LEU A 1 46  ? 37.900 5.417   8.309   1.00 27.09  ? 346  LEU F CA  1 
ATOM   342  C C   . LEU A 1 46  ? 39.102 5.861   9.138   1.00 25.73  ? 346  LEU F C   1 
ATOM   343  O O   . LEU A 1 46  ? 39.937 5.043   9.525   1.00 23.73  ? 346  LEU F O   1 
ATOM   344  C CB  . LEU A 1 46  ? 37.015 4.459   9.111   1.00 23.07  ? 346  LEU F CB  1 
ATOM   345  C CG  . LEU A 1 46  ? 36.414 5.012   10.404  1.00 23.20  ? 346  LEU F CG  1 
ATOM   346  C CD1 . LEU A 1 46  ? 35.656 6.307   10.130  1.00 22.88  ? 346  LEU F CD1 1 
ATOM   347  C CD2 . LEU A 1 46  ? 35.503 3.980   11.007  1.00 22.71  ? 346  LEU F CD2 1 
ATOM   348  N N   . PHE A 1 47  ? 39.202 7.165   9.377   1.00 25.53  ? 347  PHE F N   1 
ATOM   349  C CA  . PHE A 1 47  ? 40.296 7.718   10.166  1.00 25.66  ? 347  PHE F CA  1 
ATOM   350  C C   . PHE A 1 47  ? 39.861 7.962   11.611  1.00 25.79  ? 347  PHE F C   1 
ATOM   351  O O   . PHE A 1 47  ? 38.784 8.498   11.862  1.00 23.31  ? 347  PHE F O   1 
ATOM   352  C CB  . PHE A 1 47  ? 40.781 9.057   9.599   1.00 26.39  ? 347  PHE F CB  1 
ATOM   353  C CG  . PHE A 1 47  ? 41.648 8.941   8.372   1.00 28.62  ? 347  PHE F CG  1 
ATOM   354  C CD1 . PHE A 1 47  ? 41.080 8.894   7.095   1.00 26.59  ? 347  PHE F CD1 1 
ATOM   355  C CD2 . PHE A 1 47  ? 43.041 8.920   8.488   1.00 28.13  ? 347  PHE F CD2 1 
ATOM   356  C CE1 . PHE A 1 47  ? 41.887 8.834   5.951   1.00 26.05  ? 347  PHE F CE1 1 
ATOM   357  C CE2 . PHE A 1 47  ? 43.858 8.860   7.344   1.00 27.52  ? 347  PHE F CE2 1 
ATOM   358  C CZ  . PHE A 1 47  ? 43.274 8.819   6.074   1.00 25.89  ? 347  PHE F CZ  1 
ATOM   359  N N   . ILE A 1 48  ? 40.708 7.548   12.550  1.00 28.00  ? 348  ILE F N   1 
ATOM   360  C CA  . ILE A 1 48  ? 40.454 7.762   13.961  1.00 27.39  ? 348  ILE F CA  1 
ATOM   361  C C   . ILE A 1 48  ? 41.619 8.622   14.430  1.00 28.33  ? 348  ILE F C   1 
ATOM   362  O O   . ILE A 1 48  ? 42.705 8.106   14.715  1.00 27.25  ? 348  ILE F O   1 
ATOM   363  C CB  . ILE A 1 48  ? 40.470 6.460   14.759  1.00 18.91  ? 348  ILE F CB  1 
ATOM   364  C CG1 . ILE A 1 48  ? 39.508 5.456   14.128  1.00 18.73  ? 348  ILE F CG1 1 
ATOM   365  C CG2 . ILE A 1 48  ? 40.095 6.755   16.220  1.00 15.65  ? 348  ILE F CG2 1 
ATOM   366  C CD1 . ILE A 1 48  ? 39.571 4.072   14.767  1.00 19.82  ? 348  ILE F CD1 1 
ATOM   367  N N   . PRO A 1 49  ? 41.420 9.948   14.468  1.00 22.52  ? 349  PRO F N   1 
ATOM   368  C CA  . PRO A 1 49  ? 42.443 10.908  14.895  1.00 24.40  ? 349  PRO F CA  1 
ATOM   369  C C   . PRO A 1 49  ? 42.350 11.235  16.384  1.00 24.80  ? 349  PRO F C   1 
ATOM   370  O O   . PRO A 1 49  ? 41.695 10.531  17.149  1.00 24.04  ? 349  PRO F O   1 
ATOM   371  C CB  . PRO A 1 49  ? 42.147 12.119  14.026  1.00 28.23  ? 349  PRO F CB  1 
ATOM   372  C CG  . PRO A 1 49  ? 40.644 12.104  14.005  1.00 29.81  ? 349  PRO F CG  1 
ATOM   373  C CD  . PRO A 1 49  ? 40.313 10.637  13.782  1.00 27.48  ? 349  PRO F CD  1 
ATOM   374  N N   . GLY A 1 50  ? 43.009 12.310  16.789  1.00 24.45  ? 350  GLY F N   1 
ATOM   375  C CA  . GLY A 1 50  ? 42.965 12.693  18.180  1.00 25.70  ? 350  GLY F CA  1 
ATOM   376  C C   . GLY A 1 50  ? 44.296 13.095  18.770  1.00 27.65  ? 350  GLY F C   1 
ATOM   377  O O   . GLY A 1 50  ? 45.358 12.666  18.323  1.00 25.66  ? 350  GLY F O   1 
ATOM   378  N N   . VAL A 1 51  ? 44.214 13.947  19.784  1.00 43.96  ? 351  VAL F N   1 
ATOM   379  C CA  . VAL A 1 51  ? 45.366 14.444  20.518  1.00 45.51  ? 351  VAL F CA  1 
ATOM   380  C C   . VAL A 1 51  ? 44.852 14.643  21.934  1.00 47.56  ? 351  VAL F C   1 
ATOM   381  O O   . VAL A 1 51  ? 43.992 15.487  22.175  1.00 49.15  ? 351  VAL F O   1 
ATOM   382  C CB  . VAL A 1 51  ? 45.872 15.788  19.944  1.00 35.39  ? 351  VAL F CB  1 
ATOM   383  C CG1 . VAL A 1 51  ? 46.880 16.421  20.886  1.00 33.63  ? 351  VAL F CG1 1 
ATOM   384  C CG2 . VAL A 1 51  ? 46.516 15.556  18.594  1.00 34.83  ? 351  VAL F CG2 1 
ATOM   385  N N   . GLY A 1 52  ? 45.357 13.836  22.862  1.00 45.41  ? 352  GLY F N   1 
ATOM   386  C CA  . GLY A 1 52  ? 44.924 13.933  24.241  1.00 44.69  ? 352  GLY F CA  1 
ATOM   387  C C   . GLY A 1 52  ? 45.265 12.682  25.019  1.00 45.84  ? 352  GLY F C   1 
ATOM   388  O O   . GLY A 1 52  ? 46.200 11.962  24.675  1.00 47.62  ? 352  GLY F O   1 
ATOM   389  N N   . HIS A 1 53  ? 44.497 12.413  26.067  1.00 41.49  ? 353  HIS F N   1 
ATOM   390  C CA  . HIS A 1 53  ? 44.728 11.251  26.908  1.00 40.81  ? 353  HIS F CA  1 
ATOM   391  C C   . HIS A 1 53  ? 43.865 10.073  26.483  1.00 38.59  ? 353  HIS F C   1 
ATOM   392  O O   . HIS A 1 53  ? 42.716 10.251  26.079  1.00 36.13  ? 353  HIS F O   1 
ATOM   393  C CB  . HIS A 1 53  ? 44.443 11.607  28.372  1.00 67.19  ? 353  HIS F CB  1 
ATOM   394  C CG  . HIS A 1 53  ? 45.234 12.778  28.871  1.00 72.42  ? 353  HIS F CG  1 
ATOM   395  N ND1 . HIS A 1 53  ? 45.440 13.021  30.212  1.00 74.90  ? 353  HIS F ND1 1 
ATOM   396  C CD2 . HIS A 1 53  ? 45.886 13.763  28.205  1.00 74.32  ? 353  HIS F CD2 1 
ATOM   397  C CE1 . HIS A 1 53  ? 46.188 14.101  30.351  1.00 77.35  ? 353  HIS F CE1 1 
ATOM   398  N NE2 . HIS A 1 53  ? 46.472 14.570  29.149  1.00 77.31  ? 353  HIS F NE2 1 
ATOM   399  N N   . PHE A 1 54  ? 44.436 8.874   26.592  1.00 37.10  ? 354  PHE F N   1 
ATOM   400  C CA  . PHE A 1 54  ? 43.778 7.617   26.221  1.00 33.91  ? 354  PHE F CA  1 
ATOM   401  C C   . PHE A 1 54  ? 42.345 7.586   26.722  1.00 33.06  ? 354  PHE F C   1 
ATOM   402  O O   . PHE A 1 54  ? 41.415 7.313   25.960  1.00 33.15  ? 354  PHE F O   1 
ATOM   403  C CB  . PHE A 1 54  ? 44.546 6.442   26.831  1.00 29.18  ? 354  PHE F CB  1 
ATOM   404  C CG  . PHE A 1 54  ? 44.248 5.107   26.200  1.00 28.58  ? 354  PHE F CG  1 
ATOM   405  C CD1 . PHE A 1 54  ? 44.985 4.662   25.104  1.00 27.73  ? 354  PHE F CD1 1 
ATOM   406  C CD2 . PHE A 1 54  ? 43.280 4.262   26.741  1.00 28.62  ? 354  PHE F CD2 1 
ATOM   407  C CE1 . PHE A 1 54  ? 44.770 3.390   24.562  1.00 28.32  ? 354  PHE F CE1 1 
ATOM   408  C CE2 . PHE A 1 54  ? 43.053 2.983   26.205  1.00 29.10  ? 354  PHE F CE2 1 
ATOM   409  C CZ  . PHE A 1 54  ? 43.803 2.547   25.113  1.00 29.49  ? 354  PHE F CZ  1 
ATOM   410  N N   . GLY A 1 55  ? 42.183 7.871   28.010  1.00 26.69  ? 355  GLY F N   1 
ATOM   411  C CA  . GLY A 1 55  ? 40.874 7.869   28.633  1.00 26.03  ? 355  GLY F CA  1 
ATOM   412  C C   . GLY A 1 55  ? 39.807 8.745   28.006  1.00 25.38  ? 355  GLY F C   1 
ATOM   413  O O   . GLY A 1 55  ? 38.679 8.301   27.834  1.00 26.91  ? 355  GLY F O   1 
ATOM   414  N N   . GLU A 1 56  ? 40.137 9.989   27.682  1.00 23.69  ? 356  GLU F N   1 
ATOM   415  C CA  . GLU A 1 56  ? 39.153 10.867  27.068  1.00 26.48  ? 356  GLU F CA  1 
ATOM   416  C C   . GLU A 1 56  ? 38.866 10.402  25.639  1.00 26.51  ? 356  GLU F C   1 
ATOM   417  O O   . GLU A 1 56  ? 37.726 10.465  25.168  1.00 24.59  ? 356  GLU F O   1 
ATOM   418  C CB  . GLU A 1 56  ? 39.646 12.315  27.067  1.00 34.17  ? 356  GLU F CB  1 
ATOM   419  C CG  . GLU A 1 56  ? 38.751 13.246  26.283  1.00 41.85  ? 356  GLU F CG  1 
ATOM   420  C CD  . GLU A 1 56  ? 39.114 14.707  26.463  1.00 47.05  ? 356  GLU F CD  1 
ATOM   421  O OE1 . GLU A 1 56  ? 40.313 15.011  26.629  1.00 49.22  ? 356  GLU F OE1 1 
ATOM   422  O OE2 . GLU A 1 56  ? 38.197 15.557  26.424  1.00 50.65  ? 356  GLU F OE2 1 
ATOM   423  N N   . GLY A 1 57  ? 39.909 9.930   24.959  1.00 27.65  ? 357  GLY F N   1 
ATOM   424  C CA  . GLY A 1 57  ? 39.745 9.443   23.605  1.00 28.48  ? 357  GLY F CA  1 
ATOM   425  C C   . GLY A 1 57  ? 38.661 8.381   23.529  1.00 29.75  ? 357  GLY F C   1 
ATOM   426  O O   . GLY A 1 57  ? 37.769 8.464   22.684  1.00 29.13  ? 357  GLY F O   1 
ATOM   427  N N   . MET A 1 58  ? 38.723 7.388   24.413  1.00 30.43  ? 358  MET F N   1 
ATOM   428  C CA  . MET A 1 58  ? 37.721 6.329   24.415  1.00 32.40  ? 358  MET F CA  1 
ATOM   429  C C   . MET A 1 58  ? 36.370 6.857   24.875  1.00 33.92  ? 358  MET F C   1 
ATOM   430  O O   . MET A 1 58  ? 35.336 6.387   24.415  1.00 34.03  ? 358  MET F O   1 
ATOM   431  C CB  . MET A 1 58  ? 38.139 5.170   25.328  1.00 30.31  ? 358  MET F CB  1 
ATOM   432  C CG  . MET A 1 58  ? 39.405 4.424   24.913  1.00 28.00  ? 358  MET F CG  1 
ATOM   433  S SD  . MET A 1 58  ? 39.354 3.762   23.232  1.00 30.28  ? 358  MET F SD  1 
ATOM   434  C CE  . MET A 1 58  ? 38.089 2.467   23.393  1.00 27.95  ? 358  MET F CE  1 
ATOM   435  N N   . ARG A 1 59  ? 36.375 7.829   25.785  1.00 42.74  ? 359  ARG F N   1 
ATOM   436  C CA  . ARG A 1 59  ? 35.120 8.386   26.277  1.00 43.85  ? 359  ARG F CA  1 
ATOM   437  C C   . ARG A 1 59  ? 34.348 9.107   25.173  1.00 44.24  ? 359  ARG F C   1 
ATOM   438  O O   . ARG A 1 59  ? 33.128 8.955   25.061  1.00 45.89  ? 359  ARG F O   1 
ATOM   439  C CB  . ARG A 1 59  ? 35.349 9.363   27.438  1.00 34.52  ? 359  ARG F CB  1 
ATOM   440  C CG  . ARG A 1 59  ? 34.050 10.030  27.904  1.00 33.14  ? 359  ARG F CG  1 
ATOM   441  C CD  . ARG A 1 59  ? 34.198 10.783  29.211  1.00 33.55  ? 359  ARG F CD  1 
ATOM   442  N NE  . ARG A 1 59  ? 35.142 11.897  29.133  1.00 35.29  ? 359  ARG F NE  1 
ATOM   443  C CZ  . ARG A 1 59  ? 34.958 12.993  28.406  1.00 34.85  ? 359  ARG F CZ  1 
ATOM   444  N NH1 . ARG A 1 59  ? 33.855 13.139  27.682  1.00 34.35  ? 359  ARG F NH1 1 
ATOM   445  N NH2 . ARG A 1 59  ? 35.887 13.940  28.400  1.00 33.94  ? 359  ARG F NH2 1 
ATOM   446  N N   . ARG A 1 60  ? 35.049 9.902   24.370  1.00 30.85  ? 360  ARG F N   1 
ATOM   447  C CA  . ARG A 1 60  ? 34.384 10.614  23.294  1.00 29.56  ? 360  ARG F CA  1 
ATOM   448  C C   . ARG A 1 60  ? 33.902 9.625   22.248  1.00 29.21  ? 360  ARG F C   1 
ATOM   449  O O   . ARG A 1 60  ? 32.935 9.894   21.540  1.00 27.03  ? 360  ARG F O   1 
ATOM   450  C CB  . ARG A 1 60  ? 35.311 11.659  22.668  1.00 31.90  ? 360  ARG F CB  1 
ATOM   451  C CG  . ARG A 1 60  ? 35.745 12.723  23.663  1.00 33.06  ? 360  ARG F CG  1 
ATOM   452  C CD  . ARG A 1 60  ? 36.071 14.030  22.966  1.00 33.47  ? 360  ARG F CD  1 
ATOM   453  N NE  . ARG A 1 60  ? 36.540 15.041  23.908  1.00 33.05  ? 360  ARG F NE  1 
ATOM   454  C CZ  . ARG A 1 60  ? 36.681 16.327  23.611  1.00 33.87  ? 360  ARG F CZ  1 
ATOM   455  N NH1 . ARG A 1 60  ? 36.385 16.765  22.395  1.00 33.26  ? 360  ARG F NH1 1 
ATOM   456  N NH2 . ARG A 1 60  ? 37.122 17.174  24.531  1.00 34.16  ? 360  ARG F NH2 1 
ATOM   457  N N   . LEU A 1 61  ? 34.562 8.472   22.162  1.00 31.59  ? 361  LEU F N   1 
ATOM   458  C CA  . LEU A 1 61  ? 34.140 7.465   21.205  1.00 33.39  ? 361  LEU F CA  1 
ATOM   459  C C   . LEU A 1 61  ? 32.870 6.773   21.687  1.00 35.03  ? 361  LEU F C   1 
ATOM   460  O O   . LEU A 1 61  ? 31.900 6.661   20.933  1.00 33.13  ? 361  LEU F O   1 
ATOM   461  C CB  . LEU A 1 61  ? 35.243 6.433   20.955  1.00 38.25  ? 361  LEU F CB  1 
ATOM   462  C CG  . LEU A 1 61  ? 36.432 6.874   20.083  1.00 39.63  ? 361  LEU F CG  1 
ATOM   463  C CD1 . LEU A 1 61  ? 37.249 5.649   19.678  1.00 37.64  ? 361  LEU F CD1 1 
ATOM   464  C CD2 . LEU A 1 61  ? 35.928 7.589   18.834  1.00 38.16  ? 361  LEU F CD2 1 
ATOM   465  N N   . ARG A 1 62  ? 32.855 6.321   22.939  1.00 36.57  ? 362  ARG F N   1 
ATOM   466  C CA  . ARG A 1 62  ? 31.660 5.654   23.438  1.00 39.90  ? 362  ARG F CA  1 
ATOM   467  C C   . ARG A 1 62  ? 30.495 6.624   23.651  1.00 37.76  ? 362  ARG F C   1 
ATOM   468  O O   . ARG A 1 62  ? 29.366 6.298   23.323  1.00 37.29  ? 362  ARG F O   1 
ATOM   469  C CB  . ARG A 1 62  ? 31.962 4.851   24.713  1.00 58.88  ? 362  ARG F CB  1 
ATOM   470  C CG  . ARG A 1 62  ? 32.618 5.611   25.844  1.00 64.81  ? 362  ARG F CG  1 
ATOM   471  C CD  . ARG A 1 62  ? 33.141 4.644   26.907  1.00 69.38  ? 362  ARG F CD  1 
ATOM   472  N NE  . ARG A 1 62  ? 33.802 5.358   27.996  1.00 73.12  ? 362  ARG F NE  1 
ATOM   473  C CZ  . ARG A 1 62  ? 33.156 6.018   28.951  1.00 74.86  ? 362  ARG F CZ  1 
ATOM   474  N NH1 . ARG A 1 62  ? 31.829 6.049   28.956  1.00 76.13  ? 362  ARG F NH1 1 
ATOM   475  N NH2 . ARG A 1 62  ? 33.834 6.661   29.893  1.00 74.22  ? 362  ARG F NH2 1 
ATOM   476  N N   . GLU A 1 63  ? 30.767 7.818   24.169  1.00 42.61  ? 363  GLU F N   1 
ATOM   477  C CA  . GLU A 1 63  ? 29.714 8.814   24.379  1.00 42.45  ? 363  GLU F CA  1 
ATOM   478  C C   . GLU A 1 63  ? 28.922 9.089   23.105  1.00 42.83  ? 363  GLU F C   1 
ATOM   479  O O   . GLU A 1 63  ? 27.758 9.506   23.161  1.00 44.32  ? 363  GLU F O   1 
ATOM   480  C CB  . GLU A 1 63  ? 30.308 10.131  24.884  1.00 41.42  ? 363  GLU F CB  1 
ATOM   481  C CG  . GLU A 1 63  ? 30.408 10.206  26.395  1.00 46.20  ? 363  GLU F CG  1 
ATOM   482  C CD  . GLU A 1 63  ? 31.148 11.430  26.877  1.00 47.29  ? 363  GLU F CD  1 
ATOM   483  O OE1 . GLU A 1 63  ? 31.206 11.626  28.110  1.00 46.40  ? 363  GLU F OE1 1 
ATOM   484  O OE2 . GLU A 1 63  ? 31.675 12.187  26.029  1.00 48.23  ? 363  GLU F OE2 1 
ATOM   485  N N   . ASN A 1 64  ? 29.565 8.864   21.962  1.00 33.88  ? 364  ASN F N   1 
ATOM   486  C CA  . ASN A 1 64  ? 28.953 9.084   20.664  1.00 31.02  ? 364  ASN F CA  1 
ATOM   487  C C   . ASN A 1 64  ? 28.683 7.765   19.947  1.00 31.40  ? 364  ASN F C   1 
ATOM   488  O O   . ASN A 1 64  ? 28.489 7.734   18.734  1.00 32.01  ? 364  ASN F O   1 
ATOM   489  C CB  . ASN A 1 64  ? 29.855 9.985   19.820  1.00 37.17  ? 364  ASN F CB  1 
ATOM   490  C CG  . ASN A 1 64  ? 29.917 11.412  20.355  1.00 38.37  ? 364  ASN F CG  1 
ATOM   491  O OD1 . ASN A 1 64  ? 29.002 12.204  20.140  1.00 39.88  ? 364  ASN F OD1 1 
ATOM   492  N ND2 . ASN A 1 64  ? 30.991 11.738  21.068  1.00 38.19  ? 364  ASN F ND2 1 
ATOM   493  N N   . ASP A 1 65  ? 28.659 6.680   20.717  1.00 32.24  ? 365  ASP F N   1 
ATOM   494  C CA  . ASP A 1 65  ? 28.404 5.340   20.192  1.00 33.34  ? 365  ASP F CA  1 
ATOM   495  C C   . ASP A 1 65  ? 29.147 5.142   18.876  1.00 32.21  ? 365  ASP F C   1 
ATOM   496  O O   . ASP A 1 65  ? 28.535 4.930   17.843  1.00 32.19  ? 365  ASP F O   1 
ATOM   497  C CB  . ASP A 1 65  ? 26.892 5.138   19.976  1.00 46.07  ? 365  ASP F CB  1 
ATOM   498  C CG  . ASP A 1 65  ? 26.519 3.685   19.685  1.00 48.93  ? 365  ASP F CG  1 
ATOM   499  O OD1 . ASP A 1 65  ? 25.405 3.446   19.166  1.00 51.81  ? 365  ASP F OD1 1 
ATOM   500  O OD2 . ASP A 1 65  ? 27.324 2.780   19.978  1.00 51.23  ? 365  ASP F OD2 1 
ATOM   501  N N   . LEU A 1 66  ? 30.470 5.212   18.917  1.00 32.03  ? 366  LEU F N   1 
ATOM   502  C CA  . LEU A 1 66  ? 31.261 5.042   17.714  1.00 30.56  ? 366  LEU F CA  1 
ATOM   503  C C   . LEU A 1 66  ? 32.146 3.816   17.789  1.00 31.31  ? 366  LEU F C   1 
ATOM   504  O O   . LEU A 1 66  ? 32.682 3.375   16.770  1.00 30.33  ? 366  LEU F O   1 
ATOM   505  C CB  . LEU A 1 66  ? 32.124 6.285   17.465  1.00 27.17  ? 366  LEU F CB  1 
ATOM   506  C CG  . LEU A 1 66  ? 31.396 7.547   17.013  1.00 25.37  ? 366  LEU F CG  1 
ATOM   507  C CD1 . LEU A 1 66  ? 32.367 8.721   16.962  1.00 24.79  ? 366  LEU F CD1 1 
ATOM   508  C CD2 . LEU A 1 66  ? 30.764 7.300   15.652  1.00 24.55  ? 366  LEU F CD2 1 
ATOM   509  N N   . ILE A 1 67  ? 32.304 3.270   18.995  1.00 36.80  ? 367  ILE F N   1 
ATOM   510  C CA  . ILE A 1 67  ? 33.144 2.087   19.183  1.00 38.62  ? 367  ILE F CA  1 
ATOM   511  C C   . ILE A 1 67  ? 32.723 0.940   18.261  1.00 38.58  ? 367  ILE F C   1 
ATOM   512  O O   . ILE A 1 67  ? 33.515 0.499   17.427  1.00 39.22  ? 367  ILE F O   1 
ATOM   513  C CB  . ILE A 1 67  ? 33.143 1.618   20.671  1.00 38.72  ? 367  ILE F CB  1 
ATOM   514  C CG1 . ILE A 1 67  ? 33.941 2.612   21.519  1.00 38.94  ? 367  ILE F CG1 1 
ATOM   515  C CG2 . ILE A 1 67  ? 33.756 0.222   20.801  1.00 37.43  ? 367  ILE F CG2 1 
ATOM   516  C CD1 . ILE A 1 67  ? 33.935 2.314   22.992  1.00 38.36  ? 367  ILE F CD1 1 
ATOM   517  N N   . ASP A 1 68  ? 31.483 0.467   18.389  1.00 34.96  ? 368  ASP F N   1 
ATOM   518  C CA  . ASP A 1 68  ? 31.019 -0.620  17.526  1.00 35.29  ? 368  ASP F CA  1 
ATOM   519  C C   . ASP A 1 68  ? 31.133 -0.243  16.054  1.00 34.19  ? 368  ASP F C   1 
ATOM   520  O O   . ASP A 1 68  ? 31.462 -1.084  15.222  1.00 31.72  ? 368  ASP F O   1 
ATOM   521  C CB  . ASP A 1 68  ? 29.566 -0.997  17.826  1.00 40.69  ? 368  ASP F CB  1 
ATOM   522  C CG  . ASP A 1 68  ? 29.062 -2.124  16.923  1.00 43.20  ? 368  ASP F CG  1 
ATOM   523  O OD1 . ASP A 1 68  ? 28.292 -1.846  15.973  1.00 42.36  ? 368  ASP F OD1 1 
ATOM   524  O OD2 . ASP A 1 68  ? 29.453 -3.288  17.156  1.00 42.05  ? 368  ASP F OD2 1 
ATOM   525  N N   . PHE A 1 69  ? 30.852 1.020   15.738  1.00 37.45  ? 369  PHE F N   1 
ATOM   526  C CA  . PHE A 1 69  ? 30.929 1.483   14.358  1.00 37.59  ? 369  PHE F CA  1 
ATOM   527  C C   . PHE A 1 69  ? 32.335 1.236   13.828  1.00 37.80  ? 369  PHE F C   1 
ATOM   528  O O   . PHE A 1 69  ? 32.514 0.867   12.666  1.00 38.85  ? 369  PHE F O   1 
ATOM   529  C CB  . PHE A 1 69  ? 30.594 2.972   14.261  1.00 32.36  ? 369  PHE F CB  1 
ATOM   530  C CG  . PHE A 1 69  ? 30.467 3.479   12.842  1.00 32.29  ? 369  PHE F CG  1 
ATOM   531  C CD1 . PHE A 1 69  ? 29.532 2.924   11.968  1.00 30.25  ? 369  PHE F CD1 1 
ATOM   532  C CD2 . PHE A 1 69  ? 31.267 4.532   12.385  1.00 31.77  ? 369  PHE F CD2 1 
ATOM   533  C CE1 . PHE A 1 69  ? 29.390 3.410   10.657  1.00 29.51  ? 369  PHE F CE1 1 
ATOM   534  C CE2 . PHE A 1 69  ? 31.135 5.025   11.077  1.00 30.01  ? 369  PHE F CE2 1 
ATOM   535  C CZ  . PHE A 1 69  ? 30.194 4.462   10.214  1.00 30.52  ? 369  PHE F CZ  1 
ATOM   536  N N   . VAL A 1 70  ? 33.333 1.429   14.683  1.00 32.29  ? 370  VAL F N   1 
ATOM   537  C CA  . VAL A 1 70  ? 34.706 1.202   14.260  1.00 31.08  ? 370  VAL F CA  1 
ATOM   538  C C   . VAL A 1 70  ? 34.958 -0.296  14.172  1.00 32.31  ? 370  VAL F C   1 
ATOM   539  O O   . VAL A 1 70  ? 35.500 -0.770  13.186  1.00 31.36  ? 370  VAL F O   1 
ATOM   540  C CB  . VAL A 1 70  ? 35.721 1.841   15.232  1.00 20.40  ? 370  VAL F CB  1 
ATOM   541  C CG1 . VAL A 1 70  ? 37.135 1.418   14.865  1.00 17.22  ? 370  VAL F CG1 1 
ATOM   542  C CG2 . VAL A 1 70  ? 35.600 3.351   15.182  1.00 17.97  ? 370  VAL F CG2 1 
ATOM   543  N N   . ARG A 1 71  ? 34.553 -1.044  15.194  1.00 35.94  ? 371  ARG F N   1 
ATOM   544  C CA  . ARG A 1 71  ? 34.766 -2.494  15.167  1.00 39.12  ? 371  ARG F CA  1 
ATOM   545  C C   . ARG A 1 71  ? 34.047 -3.093  13.962  1.00 38.24  ? 371  ARG F C   1 
ATOM   546  O O   . ARG A 1 71  ? 34.477 -4.095  13.391  1.00 35.64  ? 371  ARG F O   1 
ATOM   547  C CB  . ARG A 1 71  ? 34.251 -3.150  16.461  1.00 43.88  ? 371  ARG F CB  1 
ATOM   548  C CG  . ARG A 1 71  ? 35.070 -2.838  17.713  1.00 46.89  ? 371  ARG F CG  1 
ATOM   549  C CD  . ARG A 1 71  ? 34.406 -3.434  18.950  1.00 51.85  ? 371  ARG F CD  1 
ATOM   550  N NE  . ARG A 1 71  ? 34.838 -2.803  20.199  1.00 53.65  ? 371  ARG F NE  1 
ATOM   551  C CZ  . ARG A 1 71  ? 35.785 -3.285  20.997  1.00 55.85  ? 371  ARG F CZ  1 
ATOM   552  N NH1 . ARG A 1 71  ? 36.410 -4.416  20.682  1.00 57.85  ? 371  ARG F NH1 1 
ATOM   553  N NH2 . ARG A 1 71  ? 36.108 -2.639  22.111  1.00 55.25  ? 371  ARG F NH2 1 
ATOM   554  N N   . LYS A 1 72  ? 32.953 -2.448  13.578  1.00 42.16  ? 372  LYS F N   1 
ATOM   555  C CA  . LYS A 1 72  ? 32.138 -2.892  12.457  1.00 44.20  ? 372  LYS F CA  1 
ATOM   556  C C   . LYS A 1 72  ? 32.902 -2.783  11.138  1.00 43.89  ? 372  LYS F C   1 
ATOM   557  O O   . LYS A 1 72  ? 32.747 -3.627  10.260  1.00 41.78  ? 372  LYS F O   1 
ATOM   558  C CB  . LYS A 1 72  ? 30.865 -2.049  12.400  1.00 53.07  ? 372  LYS F CB  1 
ATOM   559  C CG  . LYS A 1 72  ? 29.737 -2.630  11.569  1.00 54.93  ? 372  LYS F CG  1 
ATOM   560  C CD  . LYS A 1 72  ? 28.525 -1.714  11.665  1.00 57.77  ? 372  LYS F CD  1 
ATOM   561  C CE  . LYS A 1 72  ? 27.341 -2.219  10.863  1.00 58.94  ? 372  LYS F CE  1 
ATOM   562  N NZ  . LYS A 1 72  ? 26.227 -1.223  10.909  1.00 59.28  ? 372  LYS F NZ  1 
ATOM   563  N N   . HIS A 1 73  ? 33.727 -1.743  11.016  1.00 34.10  ? 373  HIS F N   1 
ATOM   564  C CA  . HIS A 1 73  ? 34.524 -1.501  9.816   1.00 33.73  ? 373  HIS F CA  1 
ATOM   565  C C   . HIS A 1 73  ? 35.639 -2.504  9.612   1.00 34.68  ? 373  HIS F C   1 
ATOM   566  O O   . HIS A 1 73  ? 35.963 -2.875  8.481   1.00 30.51  ? 373  HIS F O   1 
ATOM   567  C CB  . HIS A 1 73  ? 35.133 -0.111  9.874   1.00 36.34  ? 373  HIS F CB  1 
ATOM   568  C CG  . HIS A 1 73  ? 34.197 0.965   9.448   1.00 35.16  ? 373  HIS F CG  1 
ATOM   569  N ND1 . HIS A 1 73  ? 34.175 1.461   8.164   1.00 33.61  ? 373  HIS F ND1 1 
ATOM   570  C CD2 . HIS A 1 73  ? 33.241 1.635   10.131  1.00 35.25  ? 373  HIS F CD2 1 
ATOM   571  C CE1 . HIS A 1 73  ? 33.248 2.397   8.076   1.00 36.05  ? 373  HIS F CE1 1 
ATOM   572  N NE2 . HIS A 1 73  ? 32.666 2.522   9.256   1.00 36.52  ? 373  HIS F NE2 1 
ATOM   573  N N   . VAL A 1 74  ? 36.249 -2.919  10.715  1.00 47.94  ? 374  VAL F N   1 
ATOM   574  C CA  . VAL A 1 74  ? 37.323 -3.886  10.635  1.00 51.10  ? 374  VAL F CA  1 
ATOM   575  C C   . VAL A 1 74  ? 36.731 -5.224  10.183  1.00 54.51  ? 374  VAL F C   1 
ATOM   576  O O   . VAL A 1 74  ? 37.104 -5.751  9.130   1.00 55.22  ? 374  VAL F O   1 
ATOM   577  C CB  . VAL A 1 74  ? 38.025 -4.041  11.995  1.00 34.81  ? 374  VAL F CB  1 
ATOM   578  C CG1 . VAL A 1 74  ? 39.138 -5.071  11.895  1.00 34.23  ? 374  VAL F CG1 1 
ATOM   579  C CG2 . VAL A 1 74  ? 38.590 -2.704  12.432  1.00 32.52  ? 374  VAL F CG2 1 
ATOM   580  N N   . GLU A 1 75  ? 35.789 -5.753  10.960  1.00 50.81  ? 375  GLU F N   1 
ATOM   581  C CA  . GLU A 1 75  ? 35.161 -7.024  10.622  1.00 54.22  ? 375  GLU F CA  1 
ATOM   582  C C   . GLU A 1 75  ? 34.715 -7.038  9.160   1.00 55.15  ? 375  GLU F C   1 
ATOM   583  O O   . GLU A 1 75  ? 34.895 -8.029  8.455   1.00 55.77  ? 375  GLU F O   1 
ATOM   584  C CB  . GLU A 1 75  ? 33.959 -7.286  11.530  1.00 59.36  ? 375  GLU F CB  1 
ATOM   585  C CG  . GLU A 1 75  ? 33.463 -8.721  11.466  1.00 64.16  ? 375  GLU F CG  1 
ATOM   586  C CD  . GLU A 1 75  ? 32.227 -8.965  12.316  1.00 66.76  ? 375  GLU F CD  1 
ATOM   587  O OE1 . GLU A 1 75  ? 31.154 -8.423  11.980  1.00 67.76  ? 375  GLU F OE1 1 
ATOM   588  O OE2 . GLU A 1 75  ? 32.331 -9.699  13.321  1.00 68.84  ? 375  GLU F OE2 1 
ATOM   589  N N   . ASP A 1 76  ? 34.147 -5.926  8.708   1.00 56.23  ? 376  ASP F N   1 
ATOM   590  C CA  . ASP A 1 76  ? 33.669 -5.801  7.334   1.00 56.97  ? 376  ASP F CA  1 
ATOM   591  C C   . ASP A 1 76  ? 34.799 -5.540  6.327   1.00 55.72  ? 376  ASP F C   1 
ATOM   592  O O   . ASP A 1 76  ? 34.575 -4.974  5.257   1.00 55.76  ? 376  ASP F O   1 
ATOM   593  C CB  . ASP A 1 76  ? 32.617 -4.686  7.258   1.00 82.40  ? 376  ASP F CB  1 
ATOM   594  C CG  . ASP A 1 76  ? 31.284 -5.082  7.909   1.00 86.27  ? 376  ASP F CG  1 
ATOM   595  O OD1 . ASP A 1 76  ? 31.296 -5.675  9.013   1.00 88.27  ? 376  ASP F OD1 1 
ATOM   596  O OD2 . ASP A 1 76  ? 30.218 -4.789  7.318   1.00 88.36  ? 376  ASP F OD2 1 
ATOM   597  N N   . GLU A 1 77  ? 36.010 -5.960  6.683   1.00 57.43  ? 377  GLU F N   1 
ATOM   598  C CA  . GLU A 1 77  ? 37.194 -5.807  5.835   1.00 55.41  ? 377  GLU F CA  1 
ATOM   599  C C   . GLU A 1 77  ? 37.434 -4.424  5.201   1.00 53.87  ? 377  GLU F C   1 
ATOM   600  O O   . GLU A 1 77  ? 37.757 -4.335  4.017   1.00 54.13  ? 377  GLU F O   1 
ATOM   601  C CB  . GLU A 1 77  ? 37.178 -6.879  4.749   1.00 46.15  ? 377  GLU F CB  1 
ATOM   602  N N   . ARG A 1 78  ? 37.296 -3.354  5.985   1.00 48.42  ? 378  ARG F N   1 
ATOM   603  C CA  . ARG A 1 78  ? 37.517 -1.987  5.485   1.00 46.73  ? 378  ARG F CA  1 
ATOM   604  C C   . ARG A 1 78  ? 38.787 -1.396  6.115   1.00 42.99  ? 378  ARG F C   1 
ATOM   605  O O   . ARG A 1 78  ? 39.261 -1.894  7.137   1.00 42.73  ? 378  ARG F O   1 
ATOM   606  C CB  . ARG A 1 78  ? 36.325 -1.078  5.830   1.00 58.53  ? 378  ARG F CB  1 
ATOM   607  C CG  . ARG A 1 78  ? 34.948 -1.622  5.458   1.00 61.16  ? 378  ARG F CG  1 
ATOM   608  C CD  . ARG A 1 78  ? 34.854 -2.031  3.994   1.00 65.82  ? 378  ARG F CD  1 
ATOM   609  N NE  . ARG A 1 78  ? 33.489 -2.415  3.637   1.00 70.39  ? 378  ARG F NE  1 
ATOM   610  C CZ  . ARG A 1 78  ? 32.521 -1.554  3.331   1.00 71.46  ? 378  ARG F CZ  1 
ATOM   611  N NH1 . ARG A 1 78  ? 32.760 -0.249  3.325   1.00 71.49  ? 378  ARG F NH1 1 
ATOM   612  N NH2 . ARG A 1 78  ? 31.304 -1.999  3.046   1.00 71.80  ? 378  ARG F NH2 1 
ATOM   613  N N   . TYR A 1 79  ? 39.332 -0.338  5.521   1.00 36.66  ? 379  TYR F N   1 
ATOM   614  C CA  . TYR A 1 79  ? 40.547 0.286   6.060   1.00 35.33  ? 379  TYR F CA  1 
ATOM   615  C C   . TYR A 1 79  ? 40.280 1.270   7.196   1.00 30.70  ? 379  TYR F C   1 
ATOM   616  O O   . TYR A 1 79  ? 39.555 2.254   7.026   1.00 28.96  ? 379  TYR F O   1 
ATOM   617  C CB  . TYR A 1 79  ? 41.334 1.010   4.965   1.00 63.46  ? 379  TYR F CB  1 
ATOM   618  C CG  . TYR A 1 79  ? 42.110 0.109   4.026   1.00 71.18  ? 379  TYR F CG  1 
ATOM   619  C CD1 . TYR A 1 79  ? 41.451 -0.688  3.085   1.00 73.51  ? 379  TYR F CD1 1 
ATOM   620  C CD2 . TYR A 1 79  ? 43.508 0.076   4.055   1.00 74.24  ? 379  TYR F CD2 1 
ATOM   621  C CE1 . TYR A 1 79  ? 42.162 -1.491  2.193   1.00 75.88  ? 379  TYR F CE1 1 
ATOM   622  C CE2 . TYR A 1 79  ? 44.230 -0.725  3.168   1.00 76.14  ? 379  TYR F CE2 1 
ATOM   623  C CZ  . TYR A 1 79  ? 43.550 -1.504  2.238   1.00 78.09  ? 379  TYR F CZ  1 
ATOM   624  O OH  . TYR A 1 79  ? 44.254 -2.293  1.345   1.00 81.51  ? 379  TYR F OH  1 
ATOM   625  N N   . VAL A 1 80  ? 40.881 0.988   8.350   1.00 29.25  ? 380  VAL F N   1 
ATOM   626  C CA  . VAL A 1 80  ? 40.753 1.812   9.552   1.00 26.19  ? 380  VAL F CA  1 
ATOM   627  C C   . VAL A 1 80  ? 42.143 2.350   9.864   1.00 24.21  ? 380  VAL F C   1 
ATOM   628  O O   . VAL A 1 80  ? 43.088 1.576   10.036  1.00 24.53  ? 380  VAL F O   1 
ATOM   629  C CB  . VAL A 1 80  ? 40.280 0.978   10.768  1.00 28.41  ? 380  VAL F CB  1 
ATOM   630  C CG1 . VAL A 1 80  ? 40.135 1.872   11.996  1.00 27.71  ? 380  VAL F CG1 1 
ATOM   631  C CG2 . VAL A 1 80  ? 38.962 0.281   10.452  1.00 29.06  ? 380  VAL F CG2 1 
ATOM   632  N N   . VAL A 1 81  ? 42.275 3.668   9.935   1.00 19.91  ? 381  VAL F N   1 
ATOM   633  C CA  . VAL A 1 81  ? 43.571 4.251   10.216  1.00 18.55  ? 381  VAL F CA  1 
ATOM   634  C C   . VAL A 1 81  ? 43.579 5.140   11.444  1.00 18.59  ? 381  VAL F C   1 
ATOM   635  O O   . VAL A 1 81  ? 42.873 6.141   11.509  1.00 19.50  ? 381  VAL F O   1 
ATOM   636  C CB  . VAL A 1 81  ? 44.095 5.050   9.000   1.00 21.46  ? 381  VAL F CB  1 
ATOM   637  C CG1 . VAL A 1 81  ? 45.435 5.729   9.341   1.00 20.40  ? 381  VAL F CG1 1 
ATOM   638  C CG2 . VAL A 1 81  ? 44.273 4.101   7.811   1.00 20.52  ? 381  VAL F CG2 1 
ATOM   639  N N   . GLY A 1 82  ? 44.393 4.756   12.419  1.00 18.38  ? 382  GLY F N   1 
ATOM   640  C CA  . GLY A 1 82  ? 44.504 5.524   13.636  1.00 19.66  ? 382  GLY F CA  1 
ATOM   641  C C   . GLY A 1 82  ? 45.662 6.492   13.512  1.00 21.98  ? 382  GLY F C   1 
ATOM   642  O O   . GLY A 1 82  ? 46.766 6.114   13.115  1.00 22.73  ? 382  GLY F O   1 
ATOM   643  N N   . VAL A 1 83  ? 45.405 7.746   13.855  1.00 24.28  ? 383  VAL F N   1 
ATOM   644  C CA  . VAL A 1 83  ? 46.417 8.789   13.792  1.00 25.13  ? 383  VAL F CA  1 
ATOM   645  C C   . VAL A 1 83  ? 46.628 9.376   15.179  1.00 25.80  ? 383  VAL F C   1 
ATOM   646  O O   . VAL A 1 83  ? 45.671 9.721   15.874  1.00 24.41  ? 383  VAL F O   1 
ATOM   647  C CB  . VAL A 1 83  ? 45.997 9.937   12.853  1.00 25.54  ? 383  VAL F CB  1 
ATOM   648  C CG1 . VAL A 1 83  ? 47.128 10.917  12.726  1.00 28.41  ? 383  VAL F CG1 1 
ATOM   649  C CG2 . VAL A 1 83  ? 45.619 9.403   11.489  1.00 25.78  ? 383  VAL F CG2 1 
ATOM   650  N N   . CYS A 1 84  ? 47.886 9.484   15.581  1.00 26.34  ? 384  CYS F N   1 
ATOM   651  C CA  . CYS A 1 84  ? 48.209 10.043  16.876  1.00 28.12  ? 384  CYS F CA  1 
ATOM   652  C C   . CYS A 1 84  ? 47.573 9.266   18.011  1.00 26.74  ? 384  CYS F C   1 
ATOM   653  O O   . CYS A 1 84  ? 47.831 8.074   18.173  1.00 27.67  ? 384  CYS F O   1 
ATOM   654  C CB  . CYS A 1 84  ? 47.766 11.498  16.919  1.00 49.94  ? 384  CYS F CB  1 
ATOM   655  S SG  . CYS A 1 84  ? 48.921 12.596  16.099  1.00 66.11  ? 384  CYS F SG  1 
ATOM   656  N N   . LEU A 1 85  ? 46.750 9.939   18.807  1.00 30.01  ? 385  LEU F N   1 
ATOM   657  C CA  . LEU A 1 85  ? 46.088 9.265   19.911  1.00 29.77  ? 385  LEU F CA  1 
ATOM   658  C C   . LEU A 1 85  ? 45.211 8.138   19.375  1.00 28.01  ? 385  LEU F C   1 
ATOM   659  O O   . LEU A 1 85  ? 45.051 7.109   20.030  1.00 28.40  ? 385  LEU F O   1 
ATOM   660  C CB  . LEU A 1 85  ? 45.235 10.251  20.713  1.00 28.88  ? 385  LEU F CB  1 
ATOM   661  C CG  . LEU A 1 85  ? 44.379 9.651   21.832  1.00 29.03  ? 385  LEU F CG  1 
ATOM   662  C CD1 . LEU A 1 85  ? 45.290 9.049   22.899  1.00 29.14  ? 385  LEU F CD1 1 
ATOM   663  C CD2 . LEU A 1 85  ? 43.478 10.735  22.429  1.00 27.09  ? 385  LEU F CD2 1 
ATOM   664  N N   . GLY A 1 86  ? 44.647 8.349   18.185  1.00 21.41  ? 386  GLY F N   1 
ATOM   665  C CA  . GLY A 1 86  ? 43.784 7.358   17.565  1.00 18.16  ? 386  GLY F CA  1 
ATOM   666  C C   . GLY A 1 86  ? 44.538 6.066   17.320  1.00 19.10  ? 386  GLY F C   1 
ATOM   667  O O   . GLY A 1 86  ? 43.950 4.981   17.324  1.00 15.47  ? 386  GLY F O   1 
ATOM   668  N N   . MET A 1 87  ? 45.844 6.186   17.088  1.00 23.46  ? 387  MET F N   1 
ATOM   669  C CA  . MET A 1 87  ? 46.679 5.012   16.872  1.00 25.21  ? 387  MET F CA  1 
ATOM   670  C C   . MET A 1 87  ? 46.773 4.215   18.172  1.00 26.46  ? 387  MET F C   1 
ATOM   671  O O   . MET A 1 87  ? 46.742 2.986   18.148  1.00 29.09  ? 387  MET F O   1 
ATOM   672  C CB  . MET A 1 87  ? 48.098 5.392   16.438  1.00 21.42  ? 387  MET F CB  1 
ATOM   673  C CG  . MET A 1 87  ? 49.000 4.157   16.430  1.00 25.15  ? 387  MET F CG  1 
ATOM   674  S SD  . MET A 1 87  ? 50.709 4.318   15.883  1.00 25.74  ? 387  MET F SD  1 
ATOM   675  C CE  . MET A 1 87  ? 51.552 3.545   17.240  1.00 26.76  ? 387  MET F CE  1 
ATOM   676  N N   . GLN A 1 88  ? 46.916 4.917   19.298  1.00 21.31  ? 388  GLN F N   1 
ATOM   677  C CA  . GLN A 1 88  ? 46.999 4.261   20.598  1.00 22.74  ? 388  GLN F CA  1 
ATOM   678  C C   . GLN A 1 88  ? 45.670 3.605   20.967  1.00 22.55  ? 388  GLN F C   1 
ATOM   679  O O   . GLN A 1 88  ? 45.634 2.509   21.531  1.00 22.27  ? 388  GLN F O   1 
ATOM   680  C CB  . GLN A 1 88  ? 47.397 5.273   21.672  1.00 30.43  ? 388  GLN F CB  1 
ATOM   681  C CG  . GLN A 1 88  ? 48.890 5.502   21.748  1.00 32.82  ? 388  GLN F CG  1 
ATOM   682  C CD  . GLN A 1 88  ? 49.256 6.709   22.572  1.00 36.58  ? 388  GLN F CD  1 
ATOM   683  O OE1 . GLN A 1 88  ? 48.596 7.023   23.560  1.00 36.22  ? 388  GLN F OE1 1 
ATOM   684  N NE2 . GLN A 1 88  ? 50.335 7.389   22.179  1.00 39.12  ? 388  GLN F NE2 1 
ATOM   685  N N   . LEU A 1 89  ? 44.575 4.271   20.626  1.00 24.46  ? 389  LEU F N   1 
ATOM   686  C CA  . LEU A 1 89  ? 43.259 3.737   20.925  1.00 25.29  ? 389  LEU F CA  1 
ATOM   687  C C   . LEU A 1 89  ? 43.057 2.387   20.255  1.00 26.21  ? 389  LEU F C   1 
ATOM   688  O O   . LEU A 1 89  ? 42.137 1.656   20.613  1.00 25.62  ? 389  LEU F O   1 
ATOM   689  C CB  . LEU A 1 89  ? 42.162 4.702   20.462  1.00 19.43  ? 389  LEU F CB  1 
ATOM   690  C CG  . LEU A 1 89  ? 42.090 6.078   21.110  1.00 23.09  ? 389  LEU F CG  1 
ATOM   691  C CD1 . LEU A 1 89  ? 40.852 6.814   20.583  1.00 20.92  ? 389  LEU F CD1 1 
ATOM   692  C CD2 . LEU A 1 89  ? 42.023 5.936   22.637  1.00 20.74  ? 389  LEU F CD2 1 
ATOM   693  N N   . LEU A 1 90  ? 43.909 2.060   19.283  1.00 25.70  ? 390  LEU F N   1 
ATOM   694  C CA  . LEU A 1 90  ? 43.787 0.796   18.573  1.00 28.02  ? 390  LEU F CA  1 
ATOM   695  C C   . LEU A 1 90  ? 44.126 -0.391  19.474  1.00 31.00  ? 390  LEU F C   1 
ATOM   696  O O   . LEU A 1 90  ? 43.674 -1.513  19.224  1.00 31.98  ? 390  LEU F O   1 
ATOM   697  C CB  . LEU A 1 90  ? 44.718 0.757   17.352  1.00 21.34  ? 390  LEU F CB  1 
ATOM   698  C CG  . LEU A 1 90  ? 44.555 1.721   16.163  1.00 21.56  ? 390  LEU F CG  1 
ATOM   699  C CD1 . LEU A 1 90  ? 45.625 1.396   15.098  1.00 14.38  ? 390  LEU F CD1 1 
ATOM   700  C CD2 . LEU A 1 90  ? 43.151 1.605   15.578  1.00 18.69  ? 390  LEU F CD2 1 
ATOM   701  N N   . PHE A 1 91  ? 44.918 -0.148  20.516  1.00 28.95  ? 391  PHE F N   1 
ATOM   702  C CA  . PHE A 1 91  ? 45.327 -1.228  21.401  1.00 31.06  ? 391  PHE F CA  1 
ATOM   703  C C   . PHE A 1 91  ? 44.424 -1.507  22.591  1.00 34.12  ? 391  PHE F C   1 
ATOM   704  O O   . PHE A 1 91  ? 43.412 -0.843  22.794  1.00 34.68  ? 391  PHE F O   1 
ATOM   705  C CB  . PHE A 1 91  ? 46.771 -1.007  21.852  1.00 26.86  ? 391  PHE F CB  1 
ATOM   706  C CG  . PHE A 1 91  ? 47.752 -1.049  20.720  1.00 25.55  ? 391  PHE F CG  1 
ATOM   707  C CD1 . PHE A 1 91  ? 47.984 0.082   19.938  1.00 23.49  ? 391  PHE F CD1 1 
ATOM   708  C CD2 . PHE A 1 91  ? 48.394 -2.241  20.384  1.00 23.58  ? 391  PHE F CD2 1 
ATOM   709  C CE1 . PHE A 1 91  ? 48.840 0.026   18.834  1.00 21.55  ? 391  PHE F CE1 1 
ATOM   710  C CE2 . PHE A 1 91  ? 49.248 -2.310  19.286  1.00 21.12  ? 391  PHE F CE2 1 
ATOM   711  C CZ  . PHE A 1 91  ? 49.473 -1.174  18.509  1.00 22.16  ? 391  PHE F CZ  1 
ATOM   712  N N   . GLU A 1 92  ? 44.813 -2.503  23.379  1.00 39.46  ? 392  GLU F N   1 
ATOM   713  C CA  . GLU A 1 92  ? 44.029 -2.961  24.521  1.00 40.65  ? 392  GLU F CA  1 
ATOM   714  C C   . GLU A 1 92  ? 43.973 -2.067  25.740  1.00 40.76  ? 392  GLU F C   1 
ATOM   715  O O   . GLU A 1 92  ? 42.922 -1.932  26.357  1.00 40.96  ? 392  GLU F O   1 
ATOM   716  C CB  . GLU A 1 92  ? 44.512 -4.352  24.934  1.00 45.26  ? 392  GLU F CB  1 
ATOM   717  C CG  . GLU A 1 92  ? 44.439 -5.380  23.818  1.00 49.97  ? 392  GLU F CG  1 
ATOM   718  C CD  . GLU A 1 92  ? 45.009 -6.728  24.223  1.00 52.87  ? 392  GLU F CD  1 
ATOM   719  O OE1 . GLU A 1 92  ? 44.528 -7.299  25.227  1.00 57.32  ? 392  GLU F OE1 1 
ATOM   720  O OE2 . GLU A 1 92  ? 45.933 -7.218  23.539  1.00 53.37  ? 392  GLU F OE2 1 
ATOM   721  N N   . GLU A 1 93  ? 45.091 -1.458  26.100  1.00 41.80  ? 393  GLU F N   1 
ATOM   722  C CA  . GLU A 1 93  ? 45.103 -0.603  27.277  1.00 45.06  ? 393  GLU F CA  1 
ATOM   723  C C   . GLU A 1 93  ? 46.271 0.363   27.251  1.00 43.70  ? 393  GLU F C   1 
ATOM   724  O O   . GLU A 1 93  ? 47.109 0.318   26.355  1.00 42.94  ? 393  GLU F O   1 
ATOM   725  C CB  . GLU A 1 93  ? 45.201 -1.464  28.536  1.00 73.90  ? 393  GLU F CB  1 
ATOM   726  C CG  . GLU A 1 93  ? 46.510 -2.249  28.610  1.00 81.50  ? 393  GLU F CG  1 
ATOM   727  C CD  . GLU A 1 93  ? 46.563 -3.233  29.763  1.00 86.18  ? 393  GLU F CD  1 
ATOM   728  O OE1 . GLU A 1 93  ? 46.447 -2.799  30.933  1.00 89.96  ? 393  GLU F OE1 1 
ATOM   729  O OE2 . GLU A 1 93  ? 46.727 -4.445  29.495  1.00 89.28  ? 393  GLU F OE2 1 
ATOM   730  N N   . SER A 1 94  ? 46.322 1.225   28.257  1.00 43.02  ? 394  SER F N   1 
ATOM   731  C CA  . SER A 1 94  ? 47.384 2.203   28.376  1.00 42.51  ? 394  SER F CA  1 
ATOM   732  C C   . SER A 1 94  ? 47.605 2.563   29.833  1.00 45.25  ? 394  SER F C   1 
ATOM   733  O O   . SER A 1 94  ? 46.669 2.579   30.634  1.00 46.70  ? 394  SER F O   1 
ATOM   734  C CB  . SER A 1 94  ? 47.040 3.467   27.595  1.00 31.05  ? 394  SER F CB  1 
ATOM   735  O OG  . SER A 1 94  ? 47.960 4.502   27.898  1.00 26.46  ? 394  SER F OG  1 
ATOM   736  N N   . GLU A 1 95  ? 48.853 2.854   30.170  1.00 53.82  ? 395  GLU F N   1 
ATOM   737  C CA  . GLU A 1 95  ? 49.201 3.226   31.524  1.00 55.03  ? 395  GLU F CA  1 
ATOM   738  C C   . GLU A 1 95  ? 48.573 4.569   31.833  1.00 55.44  ? 395  GLU F C   1 
ATOM   739  O O   . GLU A 1 95  ? 48.249 4.857   32.982  1.00 58.04  ? 395  GLU F O   1 
ATOM   740  C CB  . GLU A 1 95  ? 50.718 3.343   31.677  1.00 51.72  ? 395  GLU F CB  1 
ATOM   741  C CG  . GLU A 1 95  ? 51.502 2.155   31.143  1.00 52.01  ? 395  GLU F CG  1 
ATOM   742  C CD  . GLU A 1 95  ? 52.897 2.071   31.732  1.00 51.96  ? 395  GLU F CD  1 
ATOM   743  O OE1 . GLU A 1 95  ? 53.587 3.115   31.806  1.00 49.37  ? 395  GLU F OE1 1 
ATOM   744  O OE2 . GLU A 1 95  ? 53.299 0.951   32.115  1.00 52.70  ? 395  GLU F OE2 1 
ATOM   745  N N   . GLU A 1 96  ? 48.406 5.385   30.799  1.00 46.86  ? 396  GLU F N   1 
ATOM   746  C CA  . GLU A 1 96  ? 47.833 6.717   30.949  1.00 46.33  ? 396  GLU F CA  1 
ATOM   747  C C   . GLU A 1 96  ? 46.412 6.707   31.517  1.00 47.26  ? 396  GLU F C   1 
ATOM   748  O O   . GLU A 1 96  ? 45.931 7.718   32.032  1.00 47.96  ? 396  GLU F O   1 
ATOM   749  C CB  . GLU A 1 96  ? 47.850 7.438   29.598  1.00 43.87  ? 396  GLU F CB  1 
ATOM   750  C CG  . GLU A 1 96  ? 47.348 8.875   29.648  1.00 43.09  ? 396  GLU F CG  1 
ATOM   751  C CD  . GLU A 1 96  ? 47.633 9.645   28.368  1.00 43.22  ? 396  GLU F CD  1 
ATOM   752  O OE1 . GLU A 1 96  ? 47.269 9.150   27.276  1.00 44.05  ? 396  GLU F OE1 1 
ATOM   753  O OE2 . GLU A 1 96  ? 48.216 10.749  28.457  1.00 40.81  ? 396  GLU F OE2 1 
ATOM   754  N N   . ALA A 1 97  ? 45.741 5.565   31.437  1.00 39.29  ? 397  ALA F N   1 
ATOM   755  C CA  . ALA A 1 97  ? 44.380 5.472   31.939  1.00 39.59  ? 397  ALA F CA  1 
ATOM   756  C C   . ALA A 1 97  ? 44.045 4.031   32.287  1.00 39.91  ? 397  ALA F C   1 
ATOM   757  O O   . ALA A 1 97  ? 43.485 3.301   31.469  1.00 37.95  ? 397  ALA F O   1 
ATOM   758  C CB  . ALA A 1 97  ? 43.411 6.006   30.894  1.00 59.86  ? 397  ALA F CB  1 
ATOM   759  N N   . PRO A 1 98  ? 44.386 3.608   33.520  1.00 51.71  ? 398  PRO F N   1 
ATOM   760  C CA  . PRO A 1 98  ? 44.156 2.255   34.052  1.00 51.31  ? 398  PRO F CA  1 
ATOM   761  C C   . PRO A 1 98  ? 42.682 1.857   34.066  1.00 51.08  ? 398  PRO F C   1 
ATOM   762  O O   . PRO A 1 98  ? 41.810 2.680   34.342  1.00 50.56  ? 398  PRO F O   1 
ATOM   763  C CB  . PRO A 1 98  ? 44.727 2.329   35.471  1.00 58.51  ? 398  PRO F CB  1 
ATOM   764  C CG  . PRO A 1 98  ? 45.731 3.454   35.398  1.00 60.40  ? 398  PRO F CG  1 
ATOM   765  C CD  . PRO A 1 98  ? 45.024 4.467   34.537  1.00 58.67  ? 398  PRO F CD  1 
ATOM   766  N N   . GLY A 1 99  ? 42.409 0.593   33.774  1.00 52.68  ? 399  GLY F N   1 
ATOM   767  C CA  . GLY A 1 99  ? 41.038 0.128   33.778  1.00 53.83  ? 399  GLY F CA  1 
ATOM   768  C C   . GLY A 1 99  ? 40.262 0.454   32.517  1.00 55.48  ? 399  GLY F C   1 
ATOM   769  O O   . GLY A 1 99  ? 39.325 -0.269  32.174  1.00 56.93  ? 399  GLY F O   1 
ATOM   770  N N   . VAL A 1 100 ? 40.638 1.531   31.824  1.00 52.41  ? 400  VAL F N   1 
ATOM   771  C CA  . VAL A 1 100 ? 39.948 1.929   30.594  1.00 50.00  ? 400  VAL F CA  1 
ATOM   772  C C   . VAL A 1 100 ? 40.379 1.045   29.429  1.00 50.09  ? 400  VAL F C   1 
ATOM   773  O O   . VAL A 1 100 ? 41.550 1.022   29.064  1.00 52.05  ? 400  VAL F O   1 
ATOM   774  C CB  . VAL A 1 100 ? 40.248 3.398   30.226  1.00 44.24  ? 400  VAL F CB  1 
ATOM   775  C CG1 . VAL A 1 100 ? 39.342 3.840   29.084  1.00 43.24  ? 400  VAL F CG1 1 
ATOM   776  C CG2 . VAL A 1 100 ? 40.060 4.295   31.441  1.00 41.59  ? 400  VAL F CG2 1 
ATOM   777  N N   . LYS A 1 101 ? 39.428 0.317   28.852  1.00 50.02  ? 401  LYS F N   1 
ATOM   778  C CA  . LYS A 1 101 ? 39.708 -0.578  27.731  1.00 50.75  ? 401  LYS F CA  1 
ATOM   779  C C   . LYS A 1 101 ? 39.818 0.177   26.407  1.00 50.16  ? 401  LYS F C   1 
ATOM   780  O O   . LYS A 1 101 ? 39.055 1.104   26.145  1.00 50.83  ? 401  LYS F O   1 
ATOM   781  C CB  . LYS A 1 101 ? 38.610 -1.640  27.625  1.00 55.28  ? 401  LYS F CB  1 
ATOM   782  C CG  . LYS A 1 101 ? 38.777 -2.630  26.475  1.00 57.56  ? 401  LYS F CG  1 
ATOM   783  C CD  . LYS A 1 101 ? 37.720 -3.728  26.562  1.00 59.03  ? 401  LYS F CD  1 
ATOM   784  C CE  . LYS A 1 101 ? 37.863 -4.761  25.451  1.00 59.30  ? 401  LYS F CE  1 
ATOM   785  N NZ  . LYS A 1 101 ? 37.453 -4.232  24.125  1.00 60.65  ? 401  LYS F NZ  1 
ATOM   786  N N   . GLY A 1 102 ? 40.779 -0.217  25.578  1.00 53.33  ? 402  GLY F N   1 
ATOM   787  C CA  . GLY A 1 102 ? 40.944 0.441   24.295  1.00 52.04  ? 402  GLY F CA  1 
ATOM   788  C C   . GLY A 1 102 ? 40.093 -0.249  23.252  1.00 50.77  ? 402  GLY F C   1 
ATOM   789  O O   . GLY A 1 102 ? 39.348 -1.175  23.573  1.00 52.91  ? 402  GLY F O   1 
ATOM   790  N N   . LEU A 1 103 ? 40.185 0.197   22.006  1.00 36.37  ? 403  LEU F N   1 
ATOM   791  C CA  . LEU A 1 103 ? 39.417 -0.427  20.940  1.00 34.75  ? 403  LEU F CA  1 
ATOM   792  C C   . LEU A 1 103 ? 39.822 -1.892  20.817  1.00 33.96  ? 403  LEU F C   1 
ATOM   793  O O   . LEU A 1 103 ? 39.077 -2.710  20.287  1.00 34.07  ? 403  LEU F O   1 
ATOM   794  C CB  . LEU A 1 103 ? 39.666 0.290   19.613  1.00 34.45  ? 403  LEU F CB  1 
ATOM   795  C CG  . LEU A 1 103 ? 39.262 1.765   19.615  1.00 35.32  ? 403  LEU F CG  1 
ATOM   796  C CD1 . LEU A 1 103 ? 39.679 2.428   18.304  1.00 34.32  ? 403  LEU F CD1 1 
ATOM   797  C CD2 . LEU A 1 103 ? 37.756 1.867   19.826  1.00 33.84  ? 403  LEU F CD2 1 
ATOM   798  N N   . SER A 1 104 ? 41.012 -2.208  21.312  1.00 36.32  ? 404  SER F N   1 
ATOM   799  C CA  . SER A 1 104 ? 41.536 -3.567  21.272  1.00 36.62  ? 404  SER F CA  1 
ATOM   800  C C   . SER A 1 104 ? 41.525 -4.138  19.862  1.00 34.95  ? 404  SER F C   1 
ATOM   801  O O   . SER A 1 104 ? 41.276 -5.326  19.673  1.00 34.38  ? 404  SER F O   1 
ATOM   802  C CB  . SER A 1 104 ? 40.719 -4.476  22.199  1.00 47.81  ? 404  SER F CB  1 
ATOM   803  O OG  . SER A 1 104 ? 40.692 -3.966  23.521  1.00 50.93  ? 404  SER F OG  1 
ATOM   804  N N   . LEU A 1 105 ? 41.795 -3.288  18.876  1.00 41.69  ? 405  LEU F N   1 
ATOM   805  C CA  . LEU A 1 105 ? 41.817 -3.713  17.478  1.00 41.16  ? 405  LEU F CA  1 
ATOM   806  C C   . LEU A 1 105 ? 43.157 -4.351  17.132  1.00 40.44  ? 405  LEU F C   1 
ATOM   807  O O   . LEU A 1 105 ? 43.292 -5.030  16.112  1.00 41.35  ? 405  LEU F O   1 
ATOM   808  C CB  . LEU A 1 105 ? 41.559 -2.518  16.553  1.00 40.86  ? 405  LEU F CB  1 
ATOM   809  C CG  . LEU A 1 105 ? 40.163 -1.889  16.624  1.00 41.55  ? 405  LEU F CG  1 
ATOM   810  C CD1 . LEU A 1 105 ? 40.077 -0.698  15.689  1.00 38.90  ? 405  LEU F CD1 1 
ATOM   811  C CD2 . LEU A 1 105 ? 39.120 -2.936  16.251  1.00 42.72  ? 405  LEU F CD2 1 
ATOM   812  N N   . ILE A 1 106 ? 44.149 -4.113  17.980  1.00 31.99  ? 406  ILE F N   1 
ATOM   813  C CA  . ILE A 1 106 ? 45.472 -4.674  17.770  1.00 30.91  ? 406  ILE F CA  1 
ATOM   814  C C   . ILE A 1 106 ? 46.050 -5.135  19.102  1.00 31.31  ? 406  ILE F C   1 
ATOM   815  O O   . ILE A 1 106 ? 46.018 -4.413  20.097  1.00 33.43  ? 406  ILE F O   1 
ATOM   816  C CB  . ILE A 1 106 ? 46.437 -3.649  17.107  1.00 27.20  ? 406  ILE F CB  1 
ATOM   817  C CG1 . ILE A 1 106 ? 45.858 -3.165  15.767  1.00 24.84  ? 406  ILE F CG1 1 
ATOM   818  C CG2 . ILE A 1 106 ? 47.796 -4.300  16.883  1.00 26.88  ? 406  ILE F CG2 1 
ATOM   819  C CD1 . ILE A 1 106 ? 46.787 -2.233  14.958  1.00 16.89  ? 406  ILE F CD1 1 
ATOM   820  N N   . GLU A 1 107 ? 46.574 -6.351  19.117  1.00 32.38  ? 407  GLU F N   1 
ATOM   821  C CA  . GLU A 1 107 ? 47.146 -6.905  20.326  1.00 34.93  ? 407  GLU F CA  1 
ATOM   822  C C   . GLU A 1 107 ? 48.366 -6.124  20.779  1.00 33.36  ? 407  GLU F C   1 
ATOM   823  O O   . GLU A 1 107 ? 49.340 -5.992  20.044  1.00 33.13  ? 407  GLU F O   1 
ATOM   824  C CB  . GLU A 1 107 ? 47.517 -8.374  20.112  1.00 56.65  ? 407  GLU F CB  1 
ATOM   825  C CG  . GLU A 1 107 ? 47.929 -8.718  18.687  1.00 63.07  ? 407  GLU F CG  1 
ATOM   826  C CD  . GLU A 1 107 ? 46.740 -9.066  17.803  1.00 65.56  ? 407  GLU F CD  1 
ATOM   827  O OE1 . GLU A 1 107 ? 46.029 -10.043 18.124  1.00 67.69  ? 407  GLU F OE1 1 
ATOM   828  O OE2 . GLU A 1 107 ? 46.520 -8.369  16.790  1.00 67.20  ? 407  GLU F OE2 1 
ATOM   829  N N   . GLY A 1 108 ? 48.298 -5.614  22.002  1.00 29.10  ? 408  GLY F N   1 
ATOM   830  C CA  . GLY A 1 108 ? 49.396 -4.857  22.551  1.00 29.08  ? 408  GLY F CA  1 
ATOM   831  C C   . GLY A 1 108 ? 48.862 -3.790  23.476  1.00 29.79  ? 408  GLY F C   1 
ATOM   832  O O   . GLY A 1 108 ? 47.654 -3.593  23.570  1.00 30.72  ? 408  GLY F O   1 
ATOM   833  N N   . ASN A 1 109 ? 49.754 -3.096  24.166  1.00 27.93  ? 409  ASN F N   1 
ATOM   834  C CA  . ASN A 1 109 ? 49.320 -2.055  25.073  1.00 28.91  ? 409  ASN F CA  1 
ATOM   835  C C   . ASN A 1 109 ? 50.124 -0.782  24.882  1.00 27.74  ? 409  ASN F C   1 
ATOM   836  O O   . ASN A 1 109 ? 51.017 -0.714  24.042  1.00 27.02  ? 409  ASN F O   1 
ATOM   837  C CB  . ASN A 1 109 ? 49.407 -2.539  26.520  1.00 48.90  ? 409  ASN F CB  1 
ATOM   838  C CG  . ASN A 1 109 ? 50.808 -2.911  26.929  1.00 53.61  ? 409  ASN F CG  1 
ATOM   839  O OD1 . ASN A 1 109 ? 51.405 -3.834  26.378  1.00 57.86  ? 409  ASN F OD1 1 
ATOM   840  N ND2 . ASN A 1 109 ? 51.347 -2.191  27.907  1.00 57.43  ? 409  ASN F ND2 1 
ATOM   841  N N   . VAL A 1 110 ? 49.792 0.233   25.667  1.00 38.61  ? 410  VAL F N   1 
ATOM   842  C CA  . VAL A 1 110 ? 50.449 1.517   25.562  1.00 35.04  ? 410  VAL F CA  1 
ATOM   843  C C   . VAL A 1 110 ? 51.100 1.893   26.878  1.00 36.87  ? 410  VAL F C   1 
ATOM   844  O O   . VAL A 1 110 ? 50.485 1.778   27.947  1.00 39.03  ? 410  VAL F O   1 
ATOM   845  C CB  . VAL A 1 110 ? 49.428 2.587   25.123  1.00 19.32  ? 410  VAL F CB  1 
ATOM   846  C CG1 . VAL A 1 110 ? 50.102 3.946   24.990  1.00 17.49  ? 410  VAL F CG1 1 
ATOM   847  C CG2 . VAL A 1 110 ? 48.804 2.175   23.793  1.00 13.91  ? 410  VAL F CG2 1 
ATOM   848  N N   . VAL A 1 111 ? 52.354 2.331   26.797  1.00 29.50  ? 411  VAL F N   1 
ATOM   849  C CA  . VAL A 1 111 ? 53.114 2.711   27.975  1.00 27.37  ? 411  VAL F CA  1 
ATOM   850  C C   . VAL A 1 111 ? 53.837 4.014   27.704  1.00 29.14  ? 411  VAL F C   1 
ATOM   851  O O   . VAL A 1 111 ? 54.089 4.356   26.552  1.00 31.62  ? 411  VAL F O   1 
ATOM   852  C CB  . VAL A 1 111 ? 54.153 1.618   28.344  1.00 25.97  ? 411  VAL F CB  1 
ATOM   853  C CG1 . VAL A 1 111 ? 53.455 0.261   28.502  1.00 24.17  ? 411  VAL F CG1 1 
ATOM   854  C CG2 . VAL A 1 111 ? 55.229 1.534   27.282  1.00 22.31  ? 411  VAL F CG2 1 
ATOM   855  N N   . LYS A 1 112 ? 54.169 4.742   28.763  1.00 26.89  ? 412  LYS F N   1 
ATOM   856  C CA  . LYS A 1 112 ? 54.864 6.018   28.628  1.00 28.91  ? 412  LYS F CA  1 
ATOM   857  C C   . LYS A 1 112 ? 56.289 5.857   28.109  1.00 29.55  ? 412  LYS F C   1 
ATOM   858  O O   . LYS A 1 112 ? 56.959 4.861   28.388  1.00 28.95  ? 412  LYS F O   1 
ATOM   859  C CB  . LYS A 1 112 ? 54.905 6.753   29.981  1.00 35.19  ? 412  LYS F CB  1 
ATOM   860  C CG  . LYS A 1 112 ? 55.603 8.104   29.916  1.00 38.92  ? 412  LYS F CG  1 
ATOM   861  C CD  . LYS A 1 112 ? 55.773 8.764   31.283  1.00 41.70  ? 412  LYS F CD  1 
ATOM   862  C CE  . LYS A 1 112 ? 54.460 9.286   31.851  1.00 44.36  ? 412  LYS F CE  1 
ATOM   863  N NZ  . LYS A 1 112 ? 54.659 10.041  33.132  1.00 45.59  ? 412  LYS F NZ  1 
ATOM   864  N N   . LEU A 1 113 ? 56.742 6.838   27.337  1.00 29.63  ? 413  LEU F N   1 
ATOM   865  C CA  . LEU A 1 113 ? 58.100 6.828   26.823  1.00 32.06  ? 413  LEU F CA  1 
ATOM   866  C C   . LEU A 1 113 ? 59.018 6.814   28.044  1.00 35.14  ? 413  LEU F C   1 
ATOM   867  O O   . LEU A 1 113 ? 58.679 7.374   29.089  1.00 33.88  ? 413  LEU F O   1 
ATOM   868  C CB  . LEU A 1 113 ? 58.356 8.082   25.981  1.00 31.95  ? 413  LEU F CB  1 
ATOM   869  C CG  . LEU A 1 113 ? 57.738 8.094   24.578  1.00 33.58  ? 413  LEU F CG  1 
ATOM   870  C CD1 . LEU A 1 113 ? 57.920 9.449   23.922  1.00 31.12  ? 413  LEU F CD1 1 
ATOM   871  C CD2 . LEU A 1 113 ? 58.389 7.011   23.738  1.00 33.15  ? 413  LEU F CD2 1 
ATOM   872  N N   . ARG A 1 114 ? 60.175 6.177   27.914  1.00 45.34  ? 414  ARG F N   1 
ATOM   873  C CA  . ARG A 1 114 ? 61.117 6.078   29.023  1.00 49.96  ? 414  ARG F CA  1 
ATOM   874  C C   . ARG A 1 114 ? 61.868 7.370   29.324  1.00 50.85  ? 414  ARG F C   1 
ATOM   875  O O   . ARG A 1 114 ? 62.257 7.613   30.465  1.00 51.48  ? 414  ARG F O   1 
ATOM   876  C CB  . ARG A 1 114 ? 62.132 4.979   28.750  1.00 60.63  ? 414  ARG F CB  1 
ATOM   877  C CG  . ARG A 1 114 ? 62.447 4.136   29.961  1.00 65.88  ? 414  ARG F CG  1 
ATOM   878  C CD  . ARG A 1 114 ? 61.564 2.907   29.991  1.00 68.02  ? 414  ARG F CD  1 
ATOM   879  N NE  . ARG A 1 114 ? 61.602 2.217   28.706  1.00 73.35  ? 414  ARG F NE  1 
ATOM   880  C CZ  . ARG A 1 114 ? 62.719 1.858   28.073  1.00 75.32  ? 414  ARG F CZ  1 
ATOM   881  N NH1 . ARG A 1 114 ? 63.905 2.121   28.609  1.00 75.56  ? 414  ARG F NH1 1 
ATOM   882  N NH2 . ARG A 1 114 ? 62.650 1.242   26.895  1.00 75.58  ? 414  ARG F NH2 1 
ATOM   883  N N   . SER A 1 115 ? 62.075 8.188   28.298  1.00 40.29  ? 415  SER F N   1 
ATOM   884  C CA  . SER A 1 115 ? 62.793 9.450   28.443  1.00 43.16  ? 415  SER F CA  1 
ATOM   885  C C   . SER A 1 115 ? 62.387 10.285  29.652  1.00 46.50  ? 415  SER F C   1 
ATOM   886  O O   . SER A 1 115 ? 61.241 10.239  30.106  1.00 45.39  ? 415  SER F O   1 
ATOM   887  C CB  . SER A 1 115 ? 62.619 10.302  27.193  1.00 46.55  ? 415  SER F CB  1 
ATOM   888  O OG  . SER A 1 115 ? 63.287 11.538  27.351  1.00 45.84  ? 415  SER F OG  1 
ATOM   889  N N   . ARG A 1 116 ? 63.345 11.055  30.162  1.00 79.93  ? 416  ARG F N   1 
ATOM   890  C CA  . ARG A 1 116 ? 63.112 11.926  31.310  1.00 83.58  ? 416  ARG F CA  1 
ATOM   891  C C   . ARG A 1 116 ? 62.507 13.246  30.837  1.00 83.55  ? 416  ARG F C   1 
ATOM   892  O O   . ARG A 1 116 ? 61.798 13.908  31.593  1.00 84.60  ? 416  ARG F O   1 
ATOM   893  C CB  . ARG A 1 116 ? 64.423 12.212  32.054  1.00 76.84  ? 416  ARG F CB  1 
ATOM   894  C CG  . ARG A 1 116 ? 65.137 10.985  32.607  1.00 80.81  ? 416  ARG F CG  1 
ATOM   895  C CD  . ARG A 1 116 ? 66.434 11.393  33.309  1.00 85.50  ? 416  ARG F CD  1 
ATOM   896  N NE  . ARG A 1 116 ? 67.206 10.254  33.813  1.00 89.17  ? 416  ARG F NE  1 
ATOM   897  C CZ  . ARG A 1 116 ? 67.783 9.331   33.044  1.00 90.58  ? 416  ARG F CZ  1 
ATOM   898  N NH1 . ARG A 1 116 ? 67.681 9.400   31.723  1.00 91.16  ? 416  ARG F NH1 1 
ATOM   899  N NH2 . ARG A 1 116 ? 68.468 8.337   33.598  1.00 90.36  ? 416  ARG F NH2 1 
ATOM   900  N N   . ARG A 1 117 ? 62.789 13.626  29.589  1.00 64.97  ? 417  ARG F N   1 
ATOM   901  C CA  . ARG A 1 117 ? 62.262 14.875  29.042  1.00 65.00  ? 417  ARG F CA  1 
ATOM   902  C C   . ARG A 1 117 ? 61.059 14.664  28.124  1.00 64.14  ? 417  ARG F C   1 
ATOM   903  O O   . ARG A 1 117 ? 61.197 14.525  26.907  1.00 63.93  ? 417  ARG F O   1 
ATOM   904  C CB  . ARG A 1 117 ? 63.357 15.663  28.293  1.00 70.40  ? 417  ARG F CB  1 
ATOM   905  C CG  . ARG A 1 117 ? 63.895 15.018  27.017  1.00 72.30  ? 417  ARG F CG  1 
ATOM   906  C CD  . ARG A 1 117 ? 64.667 16.025  26.156  1.00 73.97  ? 417  ARG F CD  1 
ATOM   907  N NE  . ARG A 1 117 ? 65.073 15.454  24.870  1.00 74.47  ? 417  ARG F NE  1 
ATOM   908  C CZ  . ARG A 1 117 ? 65.434 16.170  23.805  1.00 74.25  ? 417  ARG F CZ  1 
ATOM   909  N NH1 . ARG A 1 117 ? 65.444 17.495  23.865  1.00 73.62  ? 417  ARG F NH1 1 
ATOM   910  N NH2 . ARG A 1 117 ? 65.769 15.562  22.673  1.00 72.46  ? 417  ARG F NH2 1 
ATOM   911  N N   . LEU A 1 118 ? 59.875 14.644  28.722  1.00 78.64  ? 418  LEU F N   1 
ATOM   912  C CA  . LEU A 1 118 ? 58.639 14.467  27.972  1.00 77.16  ? 418  LEU F CA  1 
ATOM   913  C C   . LEU A 1 118 ? 57.889 15.800  27.887  1.00 77.53  ? 418  LEU F C   1 
ATOM   914  O O   . LEU A 1 118 ? 58.138 16.714  28.673  1.00 79.65  ? 418  LEU F O   1 
ATOM   915  C CB  . LEU A 1 118 ? 57.769 13.409  28.652  1.00 43.24  ? 418  LEU F CB  1 
ATOM   916  C CG  . LEU A 1 118 ? 58.416 12.025  28.714  1.00 41.10  ? 418  LEU F CG  1 
ATOM   917  C CD1 . LEU A 1 118 ? 57.524 11.061  29.478  1.00 38.72  ? 418  LEU F CD1 1 
ATOM   918  C CD2 . LEU A 1 118 ? 58.667 11.526  27.294  1.00 38.15  ? 418  LEU F CD2 1 
ATOM   919  N N   . PRO A 1 119 ? 56.958 15.925  26.931  1.00 76.09  ? 419  PRO F N   1 
ATOM   920  C CA  . PRO A 1 119 ? 56.609 14.881  25.966  1.00 75.14  ? 419  PRO F CA  1 
ATOM   921  C C   . PRO A 1 119 ? 57.542 14.892  24.758  1.00 74.14  ? 419  PRO F C   1 
ATOM   922  O O   . PRO A 1 119 ? 58.225 15.886  24.491  1.00 74.90  ? 419  PRO F O   1 
ATOM   923  C CB  . PRO A 1 119 ? 55.187 15.252  25.581  1.00 51.08  ? 419  PRO F CB  1 
ATOM   924  C CG  . PRO A 1 119 ? 55.287 16.752  25.516  1.00 51.30  ? 419  PRO F CG  1 
ATOM   925  C CD  . PRO A 1 119 ? 56.054 17.082  26.792  1.00 51.53  ? 419  PRO F CD  1 
ATOM   926  N N   . HIS A 1 120 ? 57.570 13.780  24.031  1.00 45.70  ? 420  HIS F N   1 
ATOM   927  C CA  . HIS A 1 120 ? 58.394 13.698  22.840  1.00 42.08  ? 420  HIS F CA  1 
ATOM   928  C C   . HIS A 1 120 ? 57.807 14.666  21.821  1.00 40.40  ? 420  HIS F C   1 
ATOM   929  O O   . HIS A 1 120 ? 56.667 14.510  21.393  1.00 40.09  ? 420  HIS F O   1 
ATOM   930  C CB  . HIS A 1 120 ? 58.387 12.268  22.284  1.00 40.59  ? 420  HIS F CB  1 
ATOM   931  C CG  . HIS A 1 120 ? 58.949 12.158  20.902  1.00 36.85  ? 420  HIS F CG  1 
ATOM   932  N ND1 . HIS A 1 120 ? 59.994 12.941  20.461  1.00 36.52  ? 420  HIS F ND1 1 
ATOM   933  C CD2 . HIS A 1 120 ? 58.616 11.357  19.865  1.00 34.02  ? 420  HIS F CD2 1 
ATOM   934  C CE1 . HIS A 1 120 ? 60.278 12.628  19.211  1.00 34.79  ? 420  HIS F CE1 1 
ATOM   935  N NE2 . HIS A 1 120 ? 59.457 11.668  18.825  1.00 33.62  ? 420  HIS F NE2 1 
ATOM   936  N N   . MET A 1 121 ? 58.582 15.672  21.437  1.00 47.74  ? 421  MET F N   1 
ATOM   937  C CA  . MET A 1 121 ? 58.099 16.652  20.473  1.00 47.33  ? 421  MET F CA  1 
ATOM   938  C C   . MET A 1 121 ? 59.187 16.980  19.468  1.00 45.31  ? 421  MET F C   1 
ATOM   939  O O   . MET A 1 121 ? 60.364 17.019  19.815  1.00 46.90  ? 421  MET F O   1 
ATOM   940  C CB  . MET A 1 121 ? 57.662 17.917  21.211  1.00 57.77  ? 421  MET F CB  1 
ATOM   941  C CG  . MET A 1 121 ? 56.835 18.880  20.389  1.00 59.89  ? 421  MET F CG  1 
ATOM   942  S SD  . MET A 1 121 ? 56.111 20.140  21.462  1.00 63.59  ? 421  MET F SD  1 
ATOM   943  C CE  . MET A 1 121 ? 57.083 21.579  20.985  1.00 64.25  ? 421  MET F CE  1 
ATOM   944  N N   . GLY A 1 122 ? 58.793 17.203  18.220  1.00 42.50  ? 422  GLY F N   1 
ATOM   945  C CA  . GLY A 1 122 ? 59.761 17.522  17.186  1.00 39.59  ? 422  GLY F CA  1 
ATOM   946  C C   . GLY A 1 122 ? 59.713 16.557  16.020  1.00 38.44  ? 422  GLY F C   1 
ATOM   947  O O   . GLY A 1 122 ? 58.817 15.716  15.933  1.00 38.72  ? 422  GLY F O   1 
ATOM   948  N N   . TRP A 1 123 ? 60.674 16.682  15.114  1.00 41.07  ? 423  TRP F N   1 
ATOM   949  C CA  . TRP A 1 123 ? 60.746 15.805  13.953  1.00 40.78  ? 423  TRP F CA  1 
ATOM   950  C C   . TRP A 1 123 ? 61.735 14.688  14.217  1.00 39.58  ? 423  TRP F C   1 
ATOM   951  O O   . TRP A 1 123 ? 62.766 14.900  14.849  1.00 39.02  ? 423  TRP F O   1 
ATOM   952  C CB  . TRP A 1 123 ? 61.204 16.563  12.705  1.00 37.93  ? 423  TRP F CB  1 
ATOM   953  C CG  . TRP A 1 123 ? 60.364 17.740  12.365  1.00 40.10  ? 423  TRP F CG  1 
ATOM   954  C CD1 . TRP A 1 123 ? 60.301 18.929  13.037  1.00 38.95  ? 423  TRP F CD1 1 
ATOM   955  C CD2 . TRP A 1 123 ? 59.456 17.848  11.266  1.00 39.63  ? 423  TRP F CD2 1 
ATOM   956  N NE1 . TRP A 1 123 ? 59.409 19.772  12.419  1.00 39.99  ? 423  TRP F NE1 1 
ATOM   957  C CE2 . TRP A 1 123 ? 58.875 19.134  11.331  1.00 39.26  ? 423  TRP F CE2 1 
ATOM   958  C CE3 . TRP A 1 123 ? 59.077 16.984  10.233  1.00 38.43  ? 423  TRP F CE3 1 
ATOM   959  C CZ2 . TRP A 1 123 ? 57.932 19.576  10.404  1.00 39.18  ? 423  TRP F CZ2 1 
ATOM   960  C CZ3 . TRP A 1 123 ? 58.140 17.423  9.308   1.00 38.95  ? 423  TRP F CZ3 1 
ATOM   961  C CH2 . TRP A 1 123 ? 57.578 18.709  9.400   1.00 39.63  ? 423  TRP F CH2 1 
ATOM   962  N N   . ASN A 1 124 ? 61.410 13.498  13.728  1.00 31.99  ? 424  ASN F N   1 
ATOM   963  C CA  . ASN A 1 124 ? 62.270 12.344  13.889  1.00 31.07  ? 424  ASN F CA  1 
ATOM   964  C C   . ASN A 1 124 ? 62.024 11.440  12.708  1.00 31.70  ? 424  ASN F C   1 
ATOM   965  O O   . ASN A 1 124 ? 60.970 11.494  12.067  1.00 30.55  ? 424  ASN F O   1 
ATOM   966  C CB  . ASN A 1 124 ? 61.950 11.606  15.179  1.00 34.36  ? 424  ASN F CB  1 
ATOM   967  C CG  . ASN A 1 124 ? 62.114 12.480  16.394  1.00 34.96  ? 424  ASN F CG  1 
ATOM   968  O OD1 . ASN A 1 124 ? 63.151 12.469  17.052  1.00 37.07  ? 424  ASN F OD1 1 
ATOM   969  N ND2 . ASN A 1 124 ? 61.093 13.260  16.688  1.00 34.89  ? 424  ASN F ND2 1 
ATOM   970  N N   . GLU A 1 125 ? 63.000 10.603  12.418  1.00 33.55  ? 425  GLU F N   1 
ATOM   971  C CA  . GLU A 1 125 ? 62.860 9.708   11.301  1.00 34.40  ? 425  GLU F CA  1 
ATOM   972  C C   . GLU A 1 125 ? 61.933 8.546   11.611  1.00 31.72  ? 425  GLU F C   1 
ATOM   973  O O   . GLU A 1 125 ? 61.798 8.115   12.761  1.00 27.86  ? 425  GLU F O   1 
ATOM   974  C CB  . GLU A 1 125 ? 64.233 9.179   10.891  1.00 61.66  ? 425  GLU F CB  1 
ATOM   975  C CG  . GLU A 1 125 ? 64.260 8.602   9.502   1.00 68.50  ? 425  GLU F CG  1 
ATOM   976  C CD  . GLU A 1 125 ? 65.663 8.474   8.965   1.00 74.12  ? 425  GLU F CD  1 
ATOM   977  O OE1 . GLU A 1 125 ? 65.812 8.109   7.778   1.00 79.53  ? 425  GLU F OE1 1 
ATOM   978  O OE2 . GLU A 1 125 ? 66.617 8.738   9.727   1.00 77.65  ? 425  GLU F OE2 1 
ATOM   979  N N   . VAL A 1 126 ? 61.272 8.072   10.562  1.00 33.57  ? 426  VAL F N   1 
ATOM   980  C CA  . VAL A 1 126 ? 60.394 6.925   10.649  1.00 30.50  ? 426  VAL F CA  1 
ATOM   981  C C   . VAL A 1 126 ? 60.910 6.028   9.540   1.00 31.33  ? 426  VAL F C   1 
ATOM   982  O O   . VAL A 1 126 ? 60.959 6.435   8.377   1.00 32.79  ? 426  VAL F O   1 
ATOM   983  C CB  . VAL A 1 126 ? 58.912 7.265   10.352  1.00 20.92  ? 426  VAL F CB  1 
ATOM   984  C CG1 . VAL A 1 126 ? 58.100 5.979   10.287  1.00 14.63  ? 426  VAL F CG1 1 
ATOM   985  C CG2 . VAL A 1 126 ? 58.349 8.192   11.422  1.00 19.44  ? 426  VAL F CG2 1 
ATOM   986  N N   . ILE A 1 127 ? 61.314 4.820   9.902   1.00 20.99  ? 427  ILE F N   1 
ATOM   987  C CA  . ILE A 1 127 ? 61.825 3.861   8.937   1.00 20.45  ? 427  ILE F CA  1 
ATOM   988  C C   . ILE A 1 127 ? 60.749 2.803   8.761   1.00 20.98  ? 427  ILE F C   1 
ATOM   989  O O   . ILE A 1 127 ? 60.415 2.090   9.711   1.00 17.17  ? 427  ILE F O   1 
ATOM   990  C CB  . ILE A 1 127 ? 63.109 3.191   9.464   1.00 31.69  ? 427  ILE F CB  1 
ATOM   991  C CG1 . ILE A 1 127 ? 64.159 4.258   9.768   1.00 33.77  ? 427  ILE F CG1 1 
ATOM   992  C CG2 . ILE A 1 127 ? 63.617 2.176   8.472   1.00 33.43  ? 427  ILE F CG2 1 
ATOM   993  C CD1 . ILE A 1 127 ? 64.441 5.218   8.618   1.00 33.07  ? 427  ILE F CD1 1 
ATOM   994  N N   . PHE A 1 128 ? 60.206 2.707   7.550   1.00 26.32  ? 428  PHE F N   1 
ATOM   995  C CA  . PHE A 1 128 ? 59.152 1.748   7.274   1.00 27.89  ? 428  PHE F CA  1 
ATOM   996  C C   . PHE A 1 128 ? 59.655 0.394   6.800   1.00 30.77  ? 428  PHE F C   1 
ATOM   997  O O   . PHE A 1 128 ? 60.705 0.282   6.167   1.00 32.41  ? 428  PHE F O   1 
ATOM   998  C CB  . PHE A 1 128 ? 58.160 2.303   6.237   1.00 23.80  ? 428  PHE F CB  1 
ATOM   999  C CG  . PHE A 1 128 ? 57.300 3.438   6.750   1.00 24.78  ? 428  PHE F CG  1 
ATOM   1000 C CD1 . PHE A 1 128 ? 57.650 4.766   6.506   1.00 24.24  ? 428  PHE F CD1 1 
ATOM   1001 C CD2 . PHE A 1 128 ? 56.142 3.177   7.476   1.00 23.72  ? 428  PHE F CD2 1 
ATOM   1002 C CE1 . PHE A 1 128 ? 56.855 5.820   6.978   1.00 25.52  ? 428  PHE F CE1 1 
ATOM   1003 C CE2 . PHE A 1 128 ? 55.341 4.221   7.952   1.00 25.43  ? 428  PHE F CE2 1 
ATOM   1004 C CZ  . PHE A 1 128 ? 55.700 5.551   7.700   1.00 24.80  ? 428  PHE F CZ  1 
ATOM   1005 N N   . LYS A 1 129 ? 58.885 -0.637  7.126   1.00 33.33  ? 429  LYS F N   1 
ATOM   1006 C CA  . LYS A 1 129 ? 59.200 -1.990  6.712   1.00 35.59  ? 429  LYS F CA  1 
ATOM   1007 C C   . LYS A 1 129 ? 58.940 -2.069  5.210   1.00 37.16  ? 429  LYS F C   1 
ATOM   1008 O O   . LYS A 1 129 ? 59.671 -2.736  4.478   1.00 37.91  ? 429  LYS F O   1 
ATOM   1009 C CB  . LYS A 1 129 ? 58.302 -2.979  7.446   1.00 33.72  ? 429  LYS F CB  1 
ATOM   1010 C CG  . LYS A 1 129 ? 58.391 -4.389  6.945   1.00 34.02  ? 429  LYS F CG  1 
ATOM   1011 C CD  . LYS A 1 129 ? 57.562 -5.314  7.824   1.00 36.27  ? 429  LYS F CD  1 
ATOM   1012 C CE  . LYS A 1 129 ? 57.509 -6.717  7.251   1.00 36.69  ? 429  LYS F CE  1 
ATOM   1013 N NZ  . LYS A 1 129 ? 56.786 -7.666  8.145   1.00 40.12  ? 429  LYS F NZ  1 
ATOM   1014 N N   . ASP A 1 130 ? 57.894 -1.373  4.763   1.00 39.79  ? 430  ASP F N   1 
ATOM   1015 C CA  . ASP A 1 130 ? 57.515 -1.350  3.348   1.00 39.94  ? 430  ASP F CA  1 
ATOM   1016 C C   . ASP A 1 130 ? 56.383 -0.355  3.083   1.00 40.81  ? 430  ASP F C   1 
ATOM   1017 O O   . ASP A 1 130 ? 55.880 0.289   3.997   1.00 41.02  ? 430  ASP F O   1 
ATOM   1018 C CB  . ASP A 1 130 ? 57.047 -2.740  2.905   1.00 34.17  ? 430  ASP F CB  1 
ATOM   1019 C CG  . ASP A 1 130 ? 55.821 -3.209  3.667   1.00 34.60  ? 430  ASP F CG  1 
ATOM   1020 O OD1 . ASP A 1 130 ? 55.960 -3.935  4.670   1.00 36.88  ? 430  ASP F OD1 1 
ATOM   1021 O OD2 . ASP A 1 130 ? 54.703 -2.835  3.272   1.00 35.74  ? 430  ASP F OD2 1 
ATOM   1022 N N   . THR A 1 131 ? 55.993 -0.246  1.815   1.00 43.75  ? 431  THR F N   1 
ATOM   1023 C CA  . THR A 1 131 ? 54.899 0.622   1.383   1.00 42.49  ? 431  THR F CA  1 
ATOM   1024 C C   . THR A 1 131 ? 55.056 2.136   1.532   1.00 42.22  ? 431  THR F C   1 
ATOM   1025 O O   . THR A 1 131 ? 55.031 2.850   0.531   1.00 43.74  ? 431  THR F O   1 
ATOM   1026 C CB  . THR A 1 131 ? 53.564 0.206   2.062   1.00 36.79  ? 431  THR F CB  1 
ATOM   1027 O OG1 . THR A 1 131 ? 53.228 -1.132  1.680   1.00 35.36  ? 431  THR F OG1 1 
ATOM   1028 C CG2 . THR A 1 131 ? 52.433 1.121   1.633   1.00 37.56  ? 431  THR F CG2 1 
ATOM   1029 N N   . PHE A 1 132 ? 55.216 2.637   2.756   1.00 35.89  ? 432  PHE F N   1 
ATOM   1030 C CA  . PHE A 1 132 ? 55.323 4.085   2.956   1.00 34.82  ? 432  PHE F CA  1 
ATOM   1031 C C   . PHE A 1 132 ? 56.729 4.682   2.921   1.00 35.06  ? 432  PHE F C   1 
ATOM   1032 O O   . PHE A 1 132 ? 57.720 3.961   3.007   1.00 36.54  ? 432  PHE F O   1 
ATOM   1033 C CB  . PHE A 1 132 ? 54.588 4.475   4.241   1.00 27.09  ? 432  PHE F CB  1 
ATOM   1034 C CG  . PHE A 1 132 ? 53.197 3.923   4.310   1.00 24.21  ? 432  PHE F CG  1 
ATOM   1035 C CD1 . PHE A 1 132 ? 52.967 2.648   4.823   1.00 22.39  ? 432  PHE F CD1 1 
ATOM   1036 C CD2 . PHE A 1 132 ? 52.125 4.634   3.783   1.00 21.97  ? 432  PHE F CD2 1 
ATOM   1037 C CE1 . PHE A 1 132 ? 51.694 2.087   4.807   1.00 22.29  ? 432  PHE F CE1 1 
ATOM   1038 C CE2 . PHE A 1 132 ? 50.845 4.081   3.761   1.00 21.13  ? 432  PHE F CE2 1 
ATOM   1039 C CZ  . PHE A 1 132 ? 50.630 2.803   4.273   1.00 22.19  ? 432  PHE F CZ  1 
ATOM   1040 N N   . PRO A 1 133 ? 56.824 6.019   2.786   1.00 38.60  ? 433  PRO F N   1 
ATOM   1041 C CA  . PRO A 1 133 ? 58.058 6.814   2.715   1.00 40.71  ? 433  PRO F CA  1 
ATOM   1042 C C   . PRO A 1 133 ? 58.871 7.048   3.983   1.00 42.07  ? 433  PRO F C   1 
ATOM   1043 O O   . PRO A 1 133 ? 58.393 7.688   4.925   1.00 42.30  ? 433  PRO F O   1 
ATOM   1044 C CB  . PRO A 1 133 ? 57.584 8.161   2.145   1.00 39.30  ? 433  PRO F CB  1 
ATOM   1045 C CG  . PRO A 1 133 ? 56.226 7.878   1.585   1.00 40.75  ? 433  PRO F CG  1 
ATOM   1046 C CD  . PRO A 1 133 ? 55.662 6.888   2.557   1.00 38.39  ? 433  PRO F CD  1 
ATOM   1047 N N   . ASN A 1 134 ? 60.110 6.557   3.986   1.00 39.49  ? 434  ASN F N   1 
ATOM   1048 C CA  . ASN A 1 134 ? 61.019 6.768   5.105   1.00 37.70  ? 434  ASN F CA  1 
ATOM   1049 C C   . ASN A 1 134 ? 61.237 8.283   5.145   1.00 37.49  ? 434  ASN F C   1 
ATOM   1050 O O   . ASN A 1 134 ? 61.133 8.944   4.119   1.00 38.51  ? 434  ASN F O   1 
ATOM   1051 C CB  . ASN A 1 134 ? 62.358 6.079   4.839   1.00 34.74  ? 434  ASN F CB  1 
ATOM   1052 C CG  . ASN A 1 134 ? 62.307 4.579   5.050   1.00 35.89  ? 434  ASN F CG  1 
ATOM   1053 O OD1 . ASN A 1 134 ? 61.239 3.963   5.048   1.00 36.22  ? 434  ASN F OD1 1 
ATOM   1054 N ND2 . ASN A 1 134 ? 63.476 3.978   5.220   1.00 35.79  ? 434  ASN F ND2 1 
ATOM   1055 N N   . GLY A 1 135 ? 61.532 8.835   6.314   1.00 35.38  ? 435  GLY F N   1 
ATOM   1056 C CA  . GLY A 1 135 ? 61.752 10.264  6.398   1.00 34.40  ? 435  GLY F CA  1 
ATOM   1057 C C   . GLY A 1 135 ? 61.382 10.837  7.750   1.00 36.06  ? 435  GLY F C   1 
ATOM   1058 O O   . GLY A 1 135 ? 61.066 10.091  8.684   1.00 35.00  ? 435  GLY F O   1 
ATOM   1059 N N   . TYR A 1 136 ? 61.416 12.164  7.857   1.00 35.11  ? 436  TYR F N   1 
ATOM   1060 C CA  . TYR A 1 136 ? 61.089 12.820  9.113   1.00 36.53  ? 436  TYR F CA  1 
ATOM   1061 C C   . TYR A 1 136 ? 59.645 13.283  9.214   1.00 36.24  ? 436  TYR F C   1 
ATOM   1062 O O   . TYR A 1 136 ? 59.106 13.893  8.293   1.00 37.01  ? 436  TYR F O   1 
ATOM   1063 C CB  . TYR A 1 136 ? 62.013 14.015  9.352   1.00 37.60  ? 436  TYR F CB  1 
ATOM   1064 C CG  . TYR A 1 136 ? 63.446 13.619  9.588   1.00 38.69  ? 436  TYR F CG  1 
ATOM   1065 C CD1 . TYR A 1 136 ? 64.267 13.229  8.530   1.00 38.77  ? 436  TYR F CD1 1 
ATOM   1066 C CD2 . TYR A 1 136 ? 63.970 13.595  10.878  1.00 38.14  ? 436  TYR F CD2 1 
ATOM   1067 C CE1 . TYR A 1 136 ? 65.577 12.823  8.751   1.00 39.40  ? 436  TYR F CE1 1 
ATOM   1068 C CE2 . TYR A 1 136 ? 65.270 13.191  11.112  1.00 40.15  ? 436  TYR F CE2 1 
ATOM   1069 C CZ  . TYR A 1 136 ? 66.070 12.805  10.046  1.00 41.23  ? 436  TYR F CZ  1 
ATOM   1070 O OH  . TYR A 1 136 ? 67.361 12.396  10.290  1.00 43.91  ? 436  TYR F OH  1 
ATOM   1071 N N   . TYR A 1 137 ? 59.021 12.977  10.344  1.00 30.89  ? 437  TYR F N   1 
ATOM   1072 C CA  . TYR A 1 137 ? 57.652 13.391  10.581  1.00 29.63  ? 437  TYR F CA  1 
ATOM   1073 C C   . TYR A 1 137 ? 57.589 14.116  11.911  1.00 30.71  ? 437  TYR F C   1 
ATOM   1074 O O   . TYR A 1 137 ? 58.512 14.018  12.727  1.00 29.49  ? 437  TYR F O   1 
ATOM   1075 C CB  . TYR A 1 137 ? 56.719 12.191  10.594  1.00 28.60  ? 437  TYR F CB  1 
ATOM   1076 C CG  . TYR A 1 137 ? 56.691 11.437  9.292   1.00 26.78  ? 437  TYR F CG  1 
ATOM   1077 C CD1 . TYR A 1 137 ? 57.729 10.583  8.936   1.00 23.87  ? 437  TYR F CD1 1 
ATOM   1078 C CD2 . TYR A 1 137 ? 55.589 11.526  8.444   1.00 26.95  ? 437  TYR F CD2 1 
ATOM   1079 C CE1 . TYR A 1 137 ? 57.662 9.826   7.777   1.00 25.51  ? 437  TYR F CE1 1 
ATOM   1080 C CE2 . TYR A 1 137 ? 55.514 10.776  7.287   1.00 26.39  ? 437  TYR F CE2 1 
ATOM   1081 C CZ  . TYR A 1 137 ? 56.550 9.923   6.961   1.00 24.52  ? 437  TYR F CZ  1 
ATOM   1082 O OH  . TYR A 1 137 ? 56.446 9.141   5.833   1.00 26.31  ? 437  TYR F OH  1 
ATOM   1083 N N   . TYR A 1 138 ? 56.499 14.844  12.128  1.00 33.49  ? 438  TYR F N   1 
ATOM   1084 C CA  . TYR A 1 138 ? 56.340 15.606  13.354  1.00 34.82  ? 438  TYR F CA  1 
ATOM   1085 C C   . TYR A 1 138 ? 55.561 14.852  14.426  1.00 32.71  ? 438  TYR F C   1 
ATOM   1086 O O   . TYR A 1 138 ? 54.387 14.524  14.238  1.00 34.76  ? 438  TYR F O   1 
ATOM   1087 C CB  . TYR A 1 138 ? 55.652 16.941  13.044  1.00 46.10  ? 438  TYR F CB  1 
ATOM   1088 C CG  . TYR A 1 138 ? 55.651 17.892  14.213  1.00 49.28  ? 438  TYR F CG  1 
ATOM   1089 C CD1 . TYR A 1 138 ? 56.850 18.368  14.748  1.00 51.27  ? 438  TYR F CD1 1 
ATOM   1090 C CD2 . TYR A 1 138 ? 54.461 18.274  14.820  1.00 52.25  ? 438  TYR F CD2 1 
ATOM   1091 C CE1 . TYR A 1 138 ? 56.864 19.191  15.864  1.00 51.78  ? 438  TYR F CE1 1 
ATOM   1092 C CE2 . TYR A 1 138 ? 54.461 19.101  15.942  1.00 54.02  ? 438  TYR F CE2 1 
ATOM   1093 C CZ  . TYR A 1 138 ? 55.666 19.551  16.460  1.00 54.30  ? 438  TYR F CZ  1 
ATOM   1094 O OH  . TYR A 1 138 ? 55.670 20.329  17.597  1.00 56.75  ? 438  TYR F OH  1 
ATOM   1095 N N   . PHE A 1 139 ? 56.225 14.582  15.546  1.00 28.05  ? 439  PHE F N   1 
ATOM   1096 C CA  . PHE A 1 139 ? 55.610 13.878  16.671  1.00 25.16  ? 439  PHE F CA  1 
ATOM   1097 C C   . PHE A 1 139 ? 55.369 14.798  17.849  1.00 25.86  ? 439  PHE F C   1 
ATOM   1098 O O   . PHE A 1 139 ? 56.093 15.775  18.065  1.00 27.24  ? 439  PHE F O   1 
ATOM   1099 C CB  . PHE A 1 139 ? 56.505 12.765  17.219  1.00 25.20  ? 439  PHE F CB  1 
ATOM   1100 C CG  . PHE A 1 139 ? 56.902 11.713  16.218  1.00 24.59  ? 439  PHE F CG  1 
ATOM   1101 C CD1 . PHE A 1 139 ? 57.799 12.005  15.192  1.00 23.32  ? 439  PHE F CD1 1 
ATOM   1102 C CD2 . PHE A 1 139 ? 56.481 10.399  16.386  1.00 21.81  ? 439  PHE F CD2 1 
ATOM   1103 C CE1 . PHE A 1 139 ? 58.282 11.005  14.363  1.00 22.68  ? 439  PHE F CE1 1 
ATOM   1104 C CE2 . PHE A 1 139 ? 56.958 9.388   15.560  1.00 23.11  ? 439  PHE F CE2 1 
ATOM   1105 C CZ  . PHE A 1 139 ? 57.864 9.690   14.548  1.00 23.10  ? 439  PHE F CZ  1 
ATOM   1106 N N   . VAL A 1 140 ? 54.353 14.446  18.622  1.00 28.72  ? 440  VAL F N   1 
ATOM   1107 C CA  . VAL A 1 140 ? 53.976 15.138  19.844  1.00 26.73  ? 440  VAL F CA  1 
ATOM   1108 C C   . VAL A 1 140 ? 53.230 14.072  20.626  1.00 26.72  ? 440  VAL F C   1 
ATOM   1109 O O   . VAL A 1 140 ? 52.045 13.838  20.385  1.00 26.65  ? 440  VAL F O   1 
ATOM   1110 C CB  . VAL A 1 140 ? 53.007 16.311  19.617  1.00 32.82  ? 440  VAL F CB  1 
ATOM   1111 C CG1 . VAL A 1 140 ? 52.907 17.129  20.898  1.00 32.98  ? 440  VAL F CG1 1 
ATOM   1112 C CG2 . VAL A 1 140 ? 53.472 17.181  18.473  1.00 34.94  ? 440  VAL F CG2 1 
ATOM   1113 N N   . HIS A 1 141 ? 53.924 13.405  21.542  1.00 27.37  ? 441  HIS F N   1 
ATOM   1114 C CA  . HIS A 1 141 ? 53.288 12.355  22.333  1.00 28.40  ? 441  HIS F CA  1 
ATOM   1115 C C   . HIS A 1 141 ? 54.117 12.030  23.549  1.00 29.08  ? 441  HIS F C   1 
ATOM   1116 O O   . HIS A 1 141 ? 55.296 12.355  23.611  1.00 31.32  ? 441  HIS F O   1 
ATOM   1117 C CB  . HIS A 1 141 ? 53.099 11.074  21.501  1.00 22.68  ? 441  HIS F CB  1 
ATOM   1118 C CG  . HIS A 1 141 ? 54.384 10.423  21.083  1.00 19.80  ? 441  HIS F CG  1 
ATOM   1119 N ND1 . HIS A 1 141 ? 54.712 9.129   21.431  1.00 16.35  ? 441  HIS F ND1 1 
ATOM   1120 C CD2 . HIS A 1 141 ? 55.414 10.883  20.331  1.00 17.73  ? 441  HIS F CD2 1 
ATOM   1121 C CE1 . HIS A 1 141 ? 55.887 8.819   20.912  1.00 16.57  ? 441  HIS F CE1 1 
ATOM   1122 N NE2 . HIS A 1 141 ? 56.334 9.864   20.238  1.00 16.09  ? 441  HIS F NE2 1 
ATOM   1123 N N   . THR A 1 142 ? 53.488 11.373  24.511  1.00 35.12  ? 442  THR F N   1 
ATOM   1124 C CA  . THR A 1 142 ? 54.158 10.993  25.739  1.00 36.15  ? 442  THR F CA  1 
ATOM   1125 C C   . THR A 1 142 ? 54.118 9.481   25.875  1.00 36.47  ? 442  THR F C   1 
ATOM   1126 O O   . THR A 1 142 ? 54.908 8.903   26.610  1.00 39.49  ? 442  THR F O   1 
ATOM   1127 C CB  . THR A 1 142 ? 53.464 11.623  26.958  1.00 34.33  ? 442  THR F CB  1 
ATOM   1128 O OG1 . THR A 1 142 ? 53.287 13.024  26.725  1.00 35.60  ? 442  THR F OG1 1 
ATOM   1129 C CG2 . THR A 1 142 ? 54.305 11.427  28.216  1.00 34.57  ? 442  THR F CG2 1 
ATOM   1130 N N   . TYR A 1 143 ? 53.191 8.843   25.166  1.00 30.00  ? 443  TYR F N   1 
ATOM   1131 C CA  . TYR A 1 143 ? 53.069 7.393   25.221  1.00 29.14  ? 443  TYR F CA  1 
ATOM   1132 C C   . TYR A 1 143 ? 53.397 6.722   23.899  1.00 29.34  ? 443  TYR F C   1 
ATOM   1133 O O   . TYR A 1 143 ? 53.341 7.346   22.836  1.00 28.21  ? 443  TYR F O   1 
ATOM   1134 C CB  . TYR A 1 143 ? 51.667 6.992   25.662  1.00 34.10  ? 443  TYR F CB  1 
ATOM   1135 C CG  . TYR A 1 143 ? 51.411 7.299   27.111  1.00 38.36  ? 443  TYR F CG  1 
ATOM   1136 C CD1 . TYR A 1 143 ? 51.210 8.610   27.542  1.00 40.65  ? 443  TYR F CD1 1 
ATOM   1137 C CD2 . TYR A 1 143 ? 51.445 6.291   28.066  1.00 38.43  ? 443  TYR F CD2 1 
ATOM   1138 C CE1 . TYR A 1 143 ? 51.057 8.903   28.896  1.00 40.68  ? 443  TYR F CE1 1 
ATOM   1139 C CE2 . TYR A 1 143 ? 51.296 6.572   29.410  1.00 39.20  ? 443  TYR F CE2 1 
ATOM   1140 C CZ  . TYR A 1 143 ? 51.106 7.876   29.820  1.00 40.25  ? 443  TYR F CZ  1 
ATOM   1141 O OH  . TYR A 1 143 ? 50.995 8.155   31.163  1.00 44.12  ? 443  TYR F OH  1 
ATOM   1142 N N   . ARG A 1 144 ? 53.734 5.439   23.988  1.00 30.27  ? 444  ARG F N   1 
ATOM   1143 C CA  . ARG A 1 144 ? 54.094 4.631   22.829  1.00 29.30  ? 444  ARG F CA  1 
ATOM   1144 C C   . ARG A 1 144 ? 53.363 3.302   22.921  1.00 29.99  ? 444  ARG F C   1 
ATOM   1145 O O   . ARG A 1 144 ? 52.951 2.878   24.006  1.00 27.69  ? 444  ARG F O   1 
ATOM   1146 C CB  . ARG A 1 144 ? 55.589 4.331   22.839  1.00 25.71  ? 444  ARG F CB  1 
ATOM   1147 C CG  . ARG A 1 144 ? 55.998 3.706   24.166  1.00 27.58  ? 444  ARG F CG  1 
ATOM   1148 C CD  . ARG A 1 144 ? 57.239 2.877   24.082  1.00 29.06  ? 444  ARG F CD  1 
ATOM   1149 N NE  . ARG A 1 144 ? 57.059 1.670   23.279  1.00 31.03  ? 444  ARG F NE  1 
ATOM   1150 C CZ  . ARG A 1 144 ? 58.051 0.837   22.994  1.00 30.57  ? 444  ARG F CZ  1 
ATOM   1151 N NH1 . ARG A 1 144 ? 59.265 1.098   23.455  1.00 31.01  ? 444  ARG F NH1 1 
ATOM   1152 N NH2 . ARG A 1 144 ? 57.843 -0.240  22.247  1.00 30.96  ? 444  ARG F NH2 1 
ATOM   1153 N N   . ALA A 1 145 ? 53.216 2.648   21.774  1.00 29.54  ? 445  ALA F N   1 
ATOM   1154 C CA  . ALA A 1 145 ? 52.575 1.349   21.721  1.00 28.61  ? 445  ALA F CA  1 
ATOM   1155 C C   . ALA A 1 145 ? 53.654 0.294   21.911  1.00 29.08  ? 445  ALA F C   1 
ATOM   1156 O O   . ALA A 1 145 ? 54.833 0.534   21.634  1.00 27.81  ? 445  ALA F O   1 
ATOM   1157 C CB  . ALA A 1 145 ? 51.897 1.145   20.374  1.00 19.27  ? 445  ALA F CB  1 
ATOM   1158 N N   . VAL A 1 146 ? 53.242 -0.862  22.417  1.00 28.63  ? 446  VAL F N   1 
ATOM   1159 C CA  . VAL A 1 146 ? 54.130 -1.994  22.611  1.00 27.18  ? 446  VAL F CA  1 
ATOM   1160 C C   . VAL A 1 146 ? 53.348 -3.151  22.020  1.00 29.52  ? 446  VAL F C   1 
ATOM   1161 O O   . VAL A 1 146 ? 52.353 -3.596  22.597  1.00 30.01  ? 446  VAL F O   1 
ATOM   1162 C CB  . VAL A 1 146 ? 54.418 -2.260  24.096  1.00 27.74  ? 446  VAL F CB  1 
ATOM   1163 C CG1 . VAL A 1 146 ? 55.231 -3.545  24.242  1.00 26.13  ? 446  VAL F CG1 1 
ATOM   1164 C CG2 . VAL A 1 146 ? 55.188 -1.088  24.698  1.00 23.48  ? 446  VAL F CG2 1 
ATOM   1165 N N   . CYS A 1 147 ? 53.783 -3.604  20.848  1.00 33.40  ? 447  CYS F N   1 
ATOM   1166 C CA  . CYS A 1 147 ? 53.128 -4.695  20.142  1.00 36.11  ? 447  CYS F CA  1 
ATOM   1167 C C   . CYS A 1 147 ? 54.170 -5.685  19.626  1.00 38.68  ? 447  CYS F C   1 
ATOM   1168 O O   . CYS A 1 147 ? 55.363 -5.490  19.838  1.00 42.83  ? 447  CYS F O   1 
ATOM   1169 C CB  . CYS A 1 147 ? 52.325 -4.137  18.966  1.00 28.41  ? 447  CYS F CB  1 
ATOM   1170 S SG  . CYS A 1 147 ? 53.344 -3.281  17.757  1.00 25.59  ? 447  CYS F SG  1 
ATOM   1171 N N   . GLU A 1 148 ? 53.721 -6.736  18.945  1.00 31.70  ? 448  GLU F N   1 
ATOM   1172 C CA  . GLU A 1 148 ? 54.627 -7.747  18.404  1.00 32.21  ? 448  GLU F CA  1 
ATOM   1173 C C   . GLU A 1 148 ? 55.142 -7.306  17.039  1.00 32.65  ? 448  GLU F C   1 
ATOM   1174 O O   . GLU A 1 148 ? 54.447 -6.593  16.322  1.00 33.12  ? 448  GLU F O   1 
ATOM   1175 C CB  . GLU A 1 148 ? 53.901 -9.094  18.288  1.00 45.36  ? 448  GLU F CB  1 
ATOM   1176 N N   . GLU A 1 149 ? 56.352 -7.739  16.687  1.00 30.54  ? 449  GLU F N   1 
ATOM   1177 C CA  . GLU A 1 149 ? 56.986 -7.380  15.416  1.00 33.14  ? 449  GLU F CA  1 
ATOM   1178 C C   . GLU A 1 149 ? 56.037 -7.478  14.236  1.00 32.90  ? 449  GLU F C   1 
ATOM   1179 O O   . GLU A 1 149 ? 56.040 -6.631  13.344  1.00 32.71  ? 449  GLU F O   1 
ATOM   1180 C CB  . GLU A 1 149 ? 58.194 -8.285  15.145  1.00 70.57  ? 449  GLU F CB  1 
ATOM   1181 C CG  . GLU A 1 149 ? 59.102 -7.815  13.989  1.00 80.54  ? 449  GLU F CG  1 
ATOM   1182 C CD  . GLU A 1 149 ? 58.409 -7.761  12.624  1.00 85.63  ? 449  GLU F CD  1 
ATOM   1183 O OE1 . GLU A 1 149 ? 57.946 -8.819  12.138  1.00 90.25  ? 449  GLU F OE1 1 
ATOM   1184 O OE2 . GLU A 1 149 ? 58.331 -6.657  12.032  1.00 89.29  ? 449  GLU F OE2 1 
ATOM   1185 N N   . GLU A 1 150 ? 55.252 -8.544  14.228  1.00 38.51  ? 450  GLU F N   1 
ATOM   1186 C CA  . GLU A 1 150 ? 54.276 -8.815  13.183  1.00 38.98  ? 450  GLU F CA  1 
ATOM   1187 C C   . GLU A 1 150 ? 53.499 -7.549  12.807  1.00 38.21  ? 450  GLU F C   1 
ATOM   1188 O O   . GLU A 1 150 ? 53.250 -7.274  11.625  1.00 38.08  ? 450  GLU F O   1 
ATOM   1189 C CB  . GLU A 1 150 ? 53.314 -9.880  13.706  1.00 53.17  ? 450  GLU F CB  1 
ATOM   1190 C CG  . GLU A 1 150 ? 52.326 -10.444 12.713  1.00 57.38  ? 450  GLU F CG  1 
ATOM   1191 C CD  . GLU A 1 150 ? 51.304 -11.329 13.406  1.00 59.99  ? 450  GLU F CD  1 
ATOM   1192 O OE1 . GLU A 1 150 ? 51.668 -11.951 14.428  1.00 60.91  ? 450  GLU F OE1 1 
ATOM   1193 O OE2 . GLU A 1 150 ? 50.148 -11.407 12.930  1.00 63.13  ? 450  GLU F OE2 1 
ATOM   1194 N N   . HIS A 1 151 ? 53.137 -6.767  13.817  1.00 32.50  ? 451  HIS F N   1 
ATOM   1195 C CA  . HIS A 1 151 ? 52.364 -5.561  13.585  1.00 30.80  ? 451  HIS F CA  1 
ATOM   1196 C C   . HIS A 1 151 ? 53.155 -4.259  13.522  1.00 28.11  ? 451  HIS F C   1 
ATOM   1197 O O   . HIS A 1 151 ? 52.572 -3.188  13.585  1.00 27.14  ? 451  HIS F O   1 
ATOM   1198 C CB  . HIS A 1 151 ? 51.268 -5.442  14.648  1.00 30.60  ? 451  HIS F CB  1 
ATOM   1199 C CG  . HIS A 1 151 ? 50.416 -6.664  14.767  1.00 33.32  ? 451  HIS F CG  1 
ATOM   1200 N ND1 . HIS A 1 151 ? 49.913 -7.329  13.669  1.00 34.07  ? 451  HIS F ND1 1 
ATOM   1201 C CD2 . HIS A 1 151 ? 49.968 -7.337  15.852  1.00 34.94  ? 451  HIS F CD2 1 
ATOM   1202 C CE1 . HIS A 1 151 ? 49.192 -8.358  14.073  1.00 33.61  ? 451  HIS F CE1 1 
ATOM   1203 N NE2 . HIS A 1 151 ? 49.209 -8.386  15.393  1.00 35.47  ? 451  HIS F NE2 1 
ATOM   1204 N N   . VAL A 1 152 ? 54.471 -4.328  13.398  1.00 25.86  ? 452  VAL F N   1 
ATOM   1205 C CA  . VAL A 1 152 ? 55.231 -3.088  13.328  1.00 25.73  ? 452  VAL F CA  1 
ATOM   1206 C C   . VAL A 1 152 ? 55.407 -2.657  11.871  1.00 25.77  ? 452  VAL F C   1 
ATOM   1207 O O   . VAL A 1 152 ? 55.999 -3.379  11.067  1.00 25.60  ? 452  VAL F O   1 
ATOM   1208 C CB  . VAL A 1 152 ? 56.594 -3.242  14.016  1.00 31.58  ? 452  VAL F CB  1 
ATOM   1209 C CG1 . VAL A 1 152 ? 57.327 -1.906  14.051  1.00 31.30  ? 452  VAL F CG1 1 
ATOM   1210 C CG2 . VAL A 1 152 ? 56.388 -3.766  15.433  1.00 33.18  ? 452  VAL F CG2 1 
ATOM   1211 N N   . LEU A 1 153 ? 54.868 -1.484  11.534  1.00 27.71  ? 453  LEU F N   1 
ATOM   1212 C CA  . LEU A 1 153 ? 54.948 -0.954  10.173  1.00 25.39  ? 453  LEU F CA  1 
ATOM   1213 C C   . LEU A 1 153 ? 56.166 -0.040  10.041  1.00 25.71  ? 453  LEU F C   1 
ATOM   1214 O O   . LEU A 1 153 ? 56.851 -0.037  9.009   1.00 26.08  ? 453  LEU F O   1 
ATOM   1215 C CB  . LEU A 1 153 ? 53.683 -0.158  9.838   1.00 20.74  ? 453  LEU F CB  1 
ATOM   1216 C CG  . LEU A 1 153 ? 53.154 -0.112  8.395   1.00 23.10  ? 453  LEU F CG  1 
ATOM   1217 C CD1 . LEU A 1 153 ? 52.355 1.163   8.210   1.00 20.26  ? 453  LEU F CD1 1 
ATOM   1218 C CD2 . LEU A 1 153 ? 54.281 -0.151  7.380   1.00 22.80  ? 453  LEU F CD2 1 
ATOM   1219 N N   . GLY A 1 154 ? 56.434 0.729   11.094  1.00 22.78  ? 454  GLY F N   1 
ATOM   1220 C CA  . GLY A 1 154 ? 57.563 1.648   11.082  1.00 21.86  ? 454  GLY F CA  1 
ATOM   1221 C C   . GLY A 1 154 ? 58.127 1.885   12.472  1.00 22.80  ? 454  GLY F C   1 
ATOM   1222 O O   . GLY A 1 154 ? 57.442 1.651   13.481  1.00 22.93  ? 454  GLY F O   1 
ATOM   1223 N N   . THR A 1 155 ? 59.375 2.339   12.542  1.00 20.93  ? 455  THR F N   1 
ATOM   1224 C CA  . THR A 1 155 ? 59.993 2.605   13.834  1.00 21.34  ? 455  THR F CA  1 
ATOM   1225 C C   . THR A 1 155 ? 60.604 3.993   13.883  1.00 22.17  ? 455  THR F C   1 
ATOM   1226 O O   . THR A 1 155 ? 60.902 4.598   12.856  1.00 21.94  ? 455  THR F O   1 
ATOM   1227 C CB  . THR A 1 155 ? 61.110 1.595   14.186  1.00 20.75  ? 455  THR F CB  1 
ATOM   1228 O OG1 . THR A 1 155 ? 62.188 1.737   13.257  1.00 20.55  ? 455  THR F OG1 1 
ATOM   1229 C CG2 . THR A 1 155 ? 60.585 0.176   14.167  1.00 20.36  ? 455  THR F CG2 1 
ATOM   1230 N N   . THR A 1 156 ? 60.799 4.475   15.101  1.00 19.92  ? 456  THR F N   1 
ATOM   1231 C CA  . THR A 1 156 ? 61.372 5.786   15.332  1.00 20.60  ? 456  THR F CA  1 
ATOM   1232 C C   . THR A 1 156 ? 62.096 5.760   16.676  1.00 22.32  ? 456  THR F C   1 
ATOM   1233 O O   . THR A 1 156 ? 61.680 5.054   17.608  1.00 20.61  ? 456  THR F O   1 
ATOM   1234 C CB  . THR A 1 156 ? 60.262 6.871   15.386  1.00 20.57  ? 456  THR F CB  1 
ATOM   1235 O OG1 . THR A 1 156 ? 59.634 6.993   14.102  1.00 20.10  ? 456  THR F OG1 1 
ATOM   1236 C CG2 . THR A 1 156 ? 60.839 8.200   15.804  1.00 19.18  ? 456  THR F CG2 1 
ATOM   1237 N N   . GLU A 1 157 ? 63.177 6.523   16.783  1.00 25.57  ? 457  GLU F N   1 
ATOM   1238 C CA  . GLU A 1 157 ? 63.897 6.576   18.044  1.00 28.09  ? 457  GLU F CA  1 
ATOM   1239 C C   . GLU A 1 157 ? 63.766 7.934   18.700  1.00 27.85  ? 457  GLU F C   1 
ATOM   1240 O O   . GLU A 1 157 ? 63.693 8.955   18.019  1.00 30.49  ? 457  GLU F O   1 
ATOM   1241 C CB  . GLU A 1 157 ? 65.384 6.258   17.865  1.00 30.44  ? 457  GLU F CB  1 
ATOM   1242 C CG  . GLU A 1 157 ? 66.173 6.505   19.146  1.00 36.70  ? 457  GLU F CG  1 
ATOM   1243 C CD  . GLU A 1 157 ? 67.565 5.911   19.132  1.00 41.45  ? 457  GLU F CD  1 
ATOM   1244 O OE1 . GLU A 1 157 ? 68.253 5.999   18.096  1.00 46.11  ? 457  GLU F OE1 1 
ATOM   1245 O OE2 . GLU A 1 157 ? 67.984 5.365   20.170  1.00 45.87  ? 457  GLU F OE2 1 
ATOM   1246 N N   . TYR A 1 158 ? 63.704 7.925   20.029  1.00 22.20  ? 458  TYR F N   1 
ATOM   1247 C CA  . TYR A 1 158 ? 63.635 9.135   20.830  1.00 22.97  ? 458  TYR F CA  1 
ATOM   1248 C C   . TYR A 1 158 ? 64.376 8.906   22.139  1.00 24.97  ? 458  TYR F C   1 
ATOM   1249 O O   . TYR A 1 158 ? 63.947 8.097   22.969  1.00 22.94  ? 458  TYR F O   1 
ATOM   1250 C CB  . TYR A 1 158 ? 62.197 9.540   21.160  1.00 33.99  ? 458  TYR F CB  1 
ATOM   1251 C CG  . TYR A 1 158 ? 62.140 10.754  22.079  1.00 37.26  ? 458  TYR F CG  1 
ATOM   1252 C CD1 . TYR A 1 158 ? 62.601 12.002  21.644  1.00 40.12  ? 458  TYR F CD1 1 
ATOM   1253 C CD2 . TYR A 1 158 ? 61.660 10.651  23.393  1.00 37.69  ? 458  TYR F CD2 1 
ATOM   1254 C CE1 . TYR A 1 158 ? 62.586 13.120  22.494  1.00 41.55  ? 458  TYR F CE1 1 
ATOM   1255 C CE2 . TYR A 1 158 ? 61.643 11.760  24.251  1.00 38.24  ? 458  TYR F CE2 1 
ATOM   1256 C CZ  . TYR A 1 158 ? 62.108 12.990  23.791  1.00 40.83  ? 458  TYR F CZ  1 
ATOM   1257 O OH  . TYR A 1 158 ? 62.098 14.091  24.611  1.00 40.90  ? 458  TYR F OH  1 
ATOM   1258 N N   . ASP A 1 159 ? 65.485 9.622   22.318  1.00 27.92  ? 459  ASP F N   1 
ATOM   1259 C CA  . ASP A 1 159 ? 66.284 9.514   23.534  1.00 32.21  ? 459  ASP F CA  1 
ATOM   1260 C C   . ASP A 1 159 ? 66.689 8.065   23.827  1.00 31.35  ? 459  ASP F C   1 
ATOM   1261 O O   . ASP A 1 159 ? 66.467 7.563   24.928  1.00 31.57  ? 459  ASP F O   1 
ATOM   1262 C CB  . ASP A 1 159 ? 65.491 10.081  24.725  1.00 63.28  ? 459  ASP F CB  1 
ATOM   1263 C CG  . ASP A 1 159 ? 66.387 10.725  25.779  1.00 70.10  ? 459  ASP F CG  1 
ATOM   1264 O OD1 . ASP A 1 159 ? 65.889 11.034  26.889  1.00 71.33  ? 459  ASP F OD1 1 
ATOM   1265 O OD2 . ASP A 1 159 ? 67.589 10.930  25.491  1.00 73.06  ? 459  ASP F OD2 1 
ATOM   1266 N N   . GLY A 1 160 ? 67.265 7.388   22.838  1.00 35.59  ? 460  GLY F N   1 
ATOM   1267 C CA  . GLY A 1 160 ? 67.694 6.011   23.039  1.00 35.06  ? 460  GLY F CA  1 
ATOM   1268 C C   . GLY A 1 160 ? 66.654 4.898   22.988  1.00 34.63  ? 460  GLY F C   1 
ATOM   1269 O O   . GLY A 1 160 ? 67.015 3.726   22.886  1.00 34.66  ? 460  GLY F O   1 
ATOM   1270 N N   . GLU A 1 161 ? 65.372 5.239   23.054  1.00 31.25  ? 461  GLU F N   1 
ATOM   1271 C CA  . GLU A 1 161 ? 64.323 4.221   23.016  1.00 29.19  ? 461  GLU F CA  1 
ATOM   1272 C C   . GLU A 1 161 ? 63.700 4.166   21.618  1.00 28.13  ? 461  GLU F C   1 
ATOM   1273 O O   . GLU A 1 161 ? 63.288 5.195   21.077  1.00 26.69  ? 461  GLU F O   1 
ATOM   1274 C CB  . GLU A 1 161 ? 63.252 4.549   24.062  1.00 31.94  ? 461  GLU F CB  1 
ATOM   1275 C CG  . GLU A 1 161 ? 62.058 3.594   24.136  1.00 33.11  ? 461  GLU F CG  1 
ATOM   1276 C CD  . GLU A 1 161 ? 60.975 4.109   25.087  1.00 34.34  ? 461  GLU F CD  1 
ATOM   1277 O OE1 . GLU A 1 161 ? 59.905 3.484   25.200  1.00 33.44  ? 461  GLU F OE1 1 
ATOM   1278 O OE2 . GLU A 1 161 ? 61.195 5.153   25.731  1.00 37.05  ? 461  GLU F OE2 1 
ATOM   1279 N N   . ILE A 1 162 ? 63.656 2.971   21.027  1.00 26.96  ? 462  ILE F N   1 
ATOM   1280 C CA  . ILE A 1 162 ? 63.062 2.795   19.704  1.00 24.59  ? 462  ILE F CA  1 
ATOM   1281 C C   . ILE A 1 162 ? 61.659 2.221   19.920  1.00 25.52  ? 462  ILE F C   1 
ATOM   1282 O O   . ILE A 1 162 ? 61.468 1.244   20.647  1.00 28.16  ? 462  ILE F O   1 
ATOM   1283 C CB  . ILE A 1 162 ? 63.882 1.819   18.830  1.00 18.76  ? 462  ILE F CB  1 
ATOM   1284 C CG1 . ILE A 1 162 ? 65.345 2.255   18.781  1.00 17.10  ? 462  ILE F CG1 1 
ATOM   1285 C CG2 . ILE A 1 162 ? 63.331 1.804   17.410  1.00 15.82  ? 462  ILE F CG2 1 
ATOM   1286 C CD1 . ILE A 1 162 ? 66.274 1.206   18.202  1.00 11.52  ? 462  ILE F CD1 1 
ATOM   1287 N N   . PHE A 1 163 ? 60.672 2.826   19.290  1.00 20.44  ? 463  PHE F N   1 
ATOM   1288 C CA  . PHE A 1 163 ? 59.310 2.367   19.465  1.00 18.68  ? 463  PHE F CA  1 
ATOM   1289 C C   . PHE A 1 163 ? 58.624 2.314   18.119  1.00 17.26  ? 463  PHE F C   1 
ATOM   1290 O O   . PHE A 1 163 ? 59.138 2.817   17.128  1.00 18.67  ? 463  PHE F O   1 
ATOM   1291 C CB  . PHE A 1 163 ? 58.563 3.328   20.398  1.00 19.64  ? 463  PHE F CB  1 
ATOM   1292 C CG  . PHE A 1 163 ? 58.471 4.733   19.865  1.00 17.61  ? 463  PHE F CG  1 
ATOM   1293 C CD1 . PHE A 1 163 ? 57.292 5.203   19.300  1.00 17.17  ? 463  PHE F CD1 1 
ATOM   1294 C CD2 . PHE A 1 163 ? 59.572 5.573   19.899  1.00 17.98  ? 463  PHE F CD2 1 
ATOM   1295 C CE1 . PHE A 1 163 ? 57.218 6.501   18.774  1.00 18.13  ? 463  PHE F CE1 1 
ATOM   1296 C CE2 . PHE A 1 163 ? 59.506 6.877   19.372  1.00 16.59  ? 463  PHE F CE2 1 
ATOM   1297 C CZ  . PHE A 1 163 ? 58.330 7.335   18.812  1.00 13.86  ? 463  PHE F CZ  1 
ATOM   1298 N N   . PRO A 1 164 ? 57.460 1.672   18.062  1.00 17.50  ? 464  PRO F N   1 
ATOM   1299 C CA  . PRO A 1 164 ? 56.741 1.588   16.794  1.00 18.50  ? 464  PRO F CA  1 
ATOM   1300 C C   . PRO A 1 164 ? 55.984 2.886   16.488  1.00 19.27  ? 464  PRO F C   1 
ATOM   1301 O O   . PRO A 1 164 ? 54.947 3.159   17.082  1.00 19.52  ? 464  PRO F O   1 
ATOM   1302 C CB  . PRO A 1 164 ? 55.812 0.398   17.010  1.00 17.35  ? 464  PRO F CB  1 
ATOM   1303 C CG  . PRO A 1 164 ? 55.512 0.488   18.478  1.00 18.76  ? 464  PRO F CG  1 
ATOM   1304 C CD  . PRO A 1 164 ? 56.846 0.807   19.087  1.00 17.67  ? 464  PRO F CD  1 
ATOM   1305 N N   . SER A 1 165 ? 56.519 3.694   15.572  1.00 23.89  ? 465  SER F N   1 
ATOM   1306 C CA  . SER A 1 165 ? 55.862 4.941   15.194  1.00 23.02  ? 465  SER F CA  1 
ATOM   1307 C C   . SER A 1 165 ? 54.702 4.664   14.226  1.00 22.89  ? 465  SER F C   1 
ATOM   1308 O O   . SER A 1 165 ? 53.838 5.519   14.014  1.00 24.69  ? 465  SER F O   1 
ATOM   1309 C CB  . SER A 1 165 ? 56.874 5.889   14.571  1.00 17.17  ? 465  SER F CB  1 
ATOM   1310 O OG  . SER A 1 165 ? 57.652 5.210   13.605  1.00 19.37  ? 465  SER F OG  1 
ATOM   1311 N N   . ALA A 1 166 ? 54.686 3.468   13.646  1.00 17.60  ? 466  ALA F N   1 
ATOM   1312 C CA  . ALA A 1 166 ? 53.611 3.054   12.737  1.00 20.48  ? 466  ALA F CA  1 
ATOM   1313 C C   . ALA A 1 166 ? 53.340 1.578   12.944  1.00 20.79  ? 466  ALA F C   1 
ATOM   1314 O O   . ALA A 1 166 ? 54.267 0.789   13.112  1.00 22.08  ? 466  ALA F O   1 
ATOM   1315 C CB  . ALA A 1 166 ? 53.997 3.293   11.271  1.00 18.19  ? 466  ALA F CB  1 
ATOM   1316 N N   . VAL A 1 167 ? 52.070 1.203   12.931  1.00 21.13  ? 467  VAL F N   1 
ATOM   1317 C CA  . VAL A 1 167 ? 51.702 -0.194  13.100  1.00 20.69  ? 467  VAL F CA  1 
ATOM   1318 C C   . VAL A 1 167 ? 50.739 -0.685  12.022  1.00 22.28  ? 467  VAL F C   1 
ATOM   1319 O O   . VAL A 1 167 ? 50.088 0.111   11.339  1.00 18.97  ? 467  VAL F O   1 
ATOM   1320 C CB  . VAL A 1 167 ? 51.057 -0.427  14.459  1.00 15.26  ? 467  VAL F CB  1 
ATOM   1321 C CG1 . VAL A 1 167 ? 52.110 -0.330  15.549  1.00 14.27  ? 467  VAL F CG1 1 
ATOM   1322 C CG2 . VAL A 1 167 ? 49.933 0.593   14.672  1.00 13.20  ? 467  VAL F CG2 1 
ATOM   1323 N N   . ARG A 1 168 ? 50.642 -2.008  11.890  1.00 27.20  ? 468  ARG F N   1 
ATOM   1324 C CA  . ARG A 1 168 ? 49.763 -2.611  10.896  1.00 30.31  ? 468  ARG F CA  1 
ATOM   1325 C C   . ARG A 1 168 ? 49.264 -4.014  11.233  1.00 32.43  ? 468  ARG F C   1 
ATOM   1326 O O   . ARG A 1 168 ? 50.023 -4.876  11.680  1.00 33.82  ? 468  ARG F O   1 
ATOM   1327 C CB  . ARG A 1 168 ? 50.467 -2.664  9.541   1.00 28.80  ? 468  ARG F CB  1 
ATOM   1328 C CG  . ARG A 1 168 ? 49.877 -3.704  8.595   1.00 30.28  ? 468  ARG F CG  1 
ATOM   1329 C CD  . ARG A 1 168 ? 50.987 -4.358  7.783   1.00 32.25  ? 468  ARG F CD  1 
ATOM   1330 N NE  . ARG A 1 168 ? 51.291 -3.600  6.582   1.00 31.96  ? 468  ARG F NE  1 
ATOM   1331 C CZ  . ARG A 1 168 ? 52.479 -3.578  5.987   1.00 35.11  ? 468  ARG F CZ  1 
ATOM   1332 N NH1 . ARG A 1 168 ? 53.497 -4.269  6.484   1.00 33.27  ? 468  ARG F NH1 1 
ATOM   1333 N NH2 . ARG A 1 168 ? 52.644 -2.862  4.879   1.00 36.35  ? 468  ARG F NH2 1 
ATOM   1334 N N   . LYS A 1 169 ? 47.975 -4.227  11.002  1.00 34.54  ? 469  LYS F N   1 
ATOM   1335 C CA  . LYS A 1 169 ? 47.342 -5.524  11.207  1.00 35.70  ? 469  LYS F CA  1 
ATOM   1336 C C   . LYS A 1 169 ? 46.236 -5.604  10.169  1.00 37.78  ? 469  LYS F C   1 
ATOM   1337 O O   . LYS A 1 169 ? 45.128 -5.104  10.383  1.00 39.51  ? 469  LYS F O   1 
ATOM   1338 C CB  . LYS A 1 169 ? 46.742 -5.655  12.604  1.00 27.97  ? 469  LYS F CB  1 
ATOM   1339 C CG  . LYS A 1 169 ? 46.055 -6.991  12.825  1.00 28.48  ? 469  LYS F CG  1 
ATOM   1340 C CD  . LYS A 1 169 ? 45.418 -7.082  14.199  1.00 30.64  ? 469  LYS F CD  1 
ATOM   1341 C CE  . LYS A 1 169 ? 44.652 -8.394  14.380  1.00 31.06  ? 469  LYS F CE  1 
ATOM   1342 N NZ  . LYS A 1 169 ? 44.143 -8.582  15.784  1.00 31.42  ? 469  LYS F NZ  1 
ATOM   1343 N N   . GLY A 1 170 ? 46.547 -6.218  9.032   1.00 32.46  ? 470  GLY F N   1 
ATOM   1344 C CA  . GLY A 1 170 ? 45.565 -6.330  7.970   1.00 33.02  ? 470  GLY F CA  1 
ATOM   1345 C C   . GLY A 1 170 ? 45.324 -4.964  7.357   1.00 34.51  ? 470  GLY F C   1 
ATOM   1346 O O   . GLY A 1 170 ? 46.260 -4.303  6.904   1.00 32.98  ? 470  GLY F O   1 
ATOM   1347 N N   . ARG A 1 171 ? 44.068 -4.537  7.340   1.00 46.21  ? 471  ARG F N   1 
ATOM   1348 C CA  . ARG A 1 171 ? 43.730 -3.235  6.782   1.00 48.53  ? 471  ARG F CA  1 
ATOM   1349 C C   . ARG A 1 171 ? 43.709 -2.169  7.884   1.00 46.11  ? 471  ARG F C   1 
ATOM   1350 O O   . ARG A 1 171 ? 43.211 -1.063  7.685   1.00 47.80  ? 471  ARG F O   1 
ATOM   1351 C CB  . ARG A 1 171 ? 42.371 -3.300  6.073   1.00 65.24  ? 471  ARG F CB  1 
ATOM   1352 C CG  . ARG A 1 171 ? 42.292 -4.382  5.004   1.00 70.73  ? 471  ARG F CG  1 
ATOM   1353 C CD  . ARG A 1 171 ? 40.978 -4.321  4.250   1.00 76.15  ? 471  ARG F CD  1 
ATOM   1354 N NE  . ARG A 1 171 ? 40.795 -5.457  3.345   1.00 80.73  ? 471  ARG F NE  1 
ATOM   1355 C CZ  . ARG A 1 171 ? 40.625 -6.716  3.743   1.00 82.53  ? 471  ARG F CZ  1 
ATOM   1356 N NH1 . ARG A 1 171 ? 40.617 -7.015  5.039   1.00 82.49  ? 471  ARG F NH1 1 
ATOM   1357 N NH2 . ARG A 1 171 ? 40.447 -7.676  2.844   1.00 82.22  ? 471  ARG F NH2 1 
ATOM   1358 N N   . ILE A 1 172 ? 44.246 -2.510  9.049   1.00 30.39  ? 472  ILE F N   1 
ATOM   1359 C CA  . ILE A 1 172 ? 44.295 -1.557  10.146  1.00 28.04  ? 472  ILE F CA  1 
ATOM   1360 C C   . ILE A 1 172 ? 45.683 -0.922  10.202  1.00 26.85  ? 472  ILE F C   1 
ATOM   1361 O O   . ILE A 1 172 ? 46.697 -1.625  10.300  1.00 27.82  ? 472  ILE F O   1 
ATOM   1362 C CB  . ILE A 1 172 ? 44.008 -2.234  11.504  1.00 27.57  ? 472  ILE F CB  1 
ATOM   1363 C CG1 . ILE A 1 172 ? 42.685 -3.009  11.438  1.00 24.48  ? 472  ILE F CG1 1 
ATOM   1364 C CG2 . ILE A 1 172 ? 43.976 -1.174  12.604  1.00 26.93  ? 472  ILE F CG2 1 
ATOM   1365 C CD1 . ILE A 1 172 ? 42.370 -3.839  12.679  1.00 19.84  ? 472  ILE F CD1 1 
ATOM   1366 N N   . LEU A 1 173 ? 45.728 0.403   10.115  1.00 25.94  ? 473  LEU F N   1 
ATOM   1367 C CA  . LEU A 1 173 ? 46.992 1.131   10.175  1.00 24.26  ? 473  LEU F CA  1 
ATOM   1368 C C   . LEU A 1 173 ? 46.977 2.129   11.319  1.00 21.94  ? 473  LEU F C   1 
ATOM   1369 O O   . LEU A 1 173 ? 45.926 2.620   11.732  1.00 22.29  ? 473  LEU F O   1 
ATOM   1370 C CB  . LEU A 1 173 ? 47.251 1.903   8.882   1.00 32.11  ? 473  LEU F CB  1 
ATOM   1371 C CG  . LEU A 1 173 ? 47.232 1.179   7.535   1.00 35.38  ? 473  LEU F CG  1 
ATOM   1372 C CD1 . LEU A 1 173 ? 47.460 2.198   6.437   1.00 33.56  ? 473  LEU F CD1 1 
ATOM   1373 C CD2 . LEU A 1 173 ? 48.304 0.095   7.500   1.00 36.16  ? 473  LEU F CD2 1 
ATOM   1374 N N   . GLY A 1 174 ? 48.160 2.440   11.814  1.00 23.05  ? 474  GLY F N   1 
ATOM   1375 C CA  . GLY A 1 174 ? 48.272 3.401   12.882  1.00 23.92  ? 474  GLY F CA  1 
ATOM   1376 C C   . GLY A 1 174 ? 49.556 4.182   12.690  1.00 24.04  ? 474  GLY F C   1 
ATOM   1377 O O   . GLY A 1 174 ? 50.590 3.593   12.369  1.00 23.59  ? 474  GLY F O   1 
ATOM   1378 N N   . PHE A 1 175 ? 49.482 5.497   12.869  1.00 15.29  ? 475  PHE F N   1 
ATOM   1379 C CA  . PHE A 1 175 ? 50.647 6.352   12.739  1.00 18.93  ? 475  PHE F CA  1 
ATOM   1380 C C   . PHE A 1 175 ? 50.700 7.219   13.983  1.00 20.40  ? 475  PHE F C   1 
ATOM   1381 O O   . PHE A 1 175 ? 49.754 7.961   14.282  1.00 20.65  ? 475  PHE F O   1 
ATOM   1382 C CB  . PHE A 1 175 ? 50.554 7.223   11.489  1.00 21.67  ? 475  PHE F CB  1 
ATOM   1383 C CG  . PHE A 1 175 ? 50.424 6.437   10.220  1.00 22.22  ? 475  PHE F CG  1 
ATOM   1384 C CD1 . PHE A 1 175 ? 49.206 6.380   9.541   1.00 21.30  ? 475  PHE F CD1 1 
ATOM   1385 C CD2 . PHE A 1 175 ? 51.515 5.729   9.714   1.00 21.45  ? 475  PHE F CD2 1 
ATOM   1386 C CE1 . PHE A 1 175 ? 49.075 5.619   8.369   1.00 22.40  ? 475  PHE F CE1 1 
ATOM   1387 C CE2 . PHE A 1 175 ? 51.402 4.966   8.551   1.00 21.61  ? 475  PHE F CE2 1 
ATOM   1388 C CZ  . PHE A 1 175 ? 50.181 4.906   7.873   1.00 22.09  ? 475  PHE F CZ  1 
ATOM   1389 N N   . GLN A 1 176 ? 51.797 7.099   14.722  1.00 22.65  ? 476  GLN F N   1 
ATOM   1390 C CA  . GLN A 1 176 ? 51.968 7.850   15.960  1.00 25.68  ? 476  GLN F CA  1 
ATOM   1391 C C   . GLN A 1 176 ? 52.279 9.322   15.712  1.00 24.55  ? 476  GLN F C   1 
ATOM   1392 O O   . GLN A 1 176 ? 52.145 10.140  16.608  1.00 24.47  ? 476  GLN F O   1 
ATOM   1393 C CB  . GLN A 1 176 ? 53.097 7.245   16.799  1.00 31.53  ? 476  GLN F CB  1 
ATOM   1394 C CG  . GLN A 1 176 ? 53.337 7.980   18.097  1.00 31.85  ? 476  GLN F CG  1 
ATOM   1395 C CD  . GLN A 1 176 ? 52.253 7.688   19.096  1.00 33.95  ? 476  GLN F CD  1 
ATOM   1396 O OE1 . GLN A 1 176 ? 52.239 6.621   19.704  1.00 32.95  ? 476  GLN F OE1 1 
ATOM   1397 N NE2 . GLN A 1 176 ? 51.319 8.624   19.257  1.00 33.04  ? 476  GLN F NE2 1 
ATOM   1398 N N   . PHE A 1 177 ? 52.696 9.655   14.499  1.00 22.37  ? 477  PHE F N   1 
ATOM   1399 C CA  . PHE A 1 177 ? 53.023 11.036  14.188  1.00 24.88  ? 477  PHE F CA  1 
ATOM   1400 C C   . PHE A 1 177 ? 51.844 11.699  13.492  1.00 26.63  ? 477  PHE F C   1 
ATOM   1401 O O   . PHE A 1 177 ? 50.850 11.037  13.170  1.00 23.59  ? 477  PHE F O   1 
ATOM   1402 C CB  . PHE A 1 177 ? 54.246 11.094  13.281  1.00 21.40  ? 477  PHE F CB  1 
ATOM   1403 C CG  . PHE A 1 177 ? 54.128 10.213  12.090  1.00 23.71  ? 477  PHE F CG  1 
ATOM   1404 C CD1 . PHE A 1 177 ? 54.648 8.924   12.112  1.00 24.06  ? 477  PHE F CD1 1 
ATOM   1405 C CD2 . PHE A 1 177 ? 53.439 10.641  10.959  1.00 21.23  ? 477  PHE F CD2 1 
ATOM   1406 C CE1 . PHE A 1 177 ? 54.480 8.078   11.031  1.00 21.84  ? 477  PHE F CE1 1 
ATOM   1407 C CE2 . PHE A 1 177 ? 53.267 9.801   9.883   1.00 21.94  ? 477  PHE F CE2 1 
ATOM   1408 C CZ  . PHE A 1 177 ? 53.790 8.513   9.918   1.00 21.28  ? 477  PHE F CZ  1 
ATOM   1409 N N   . HIS A 1 178 ? 51.970 13.006  13.267  1.00 24.40  ? 478  HIS F N   1 
ATOM   1410 C CA  . HIS A 1 178 ? 50.934 13.790  12.602  1.00 28.41  ? 478  HIS F CA  1 
ATOM   1411 C C   . HIS A 1 178 ? 51.213 13.868  11.114  1.00 27.99  ? 478  HIS F C   1 
ATOM   1412 O O   . HIS A 1 178 ? 52.098 14.599  10.686  1.00 28.87  ? 478  HIS F O   1 
ATOM   1413 C CB  . HIS A 1 178 ? 50.908 15.206  13.167  1.00 50.33  ? 478  HIS F CB  1 
ATOM   1414 C CG  . HIS A 1 178 ? 50.300 15.308  14.530  1.00 54.66  ? 478  HIS F CG  1 
ATOM   1415 N ND1 . HIS A 1 178 ? 48.943 15.437  14.731  1.00 58.19  ? 478  HIS F ND1 1 
ATOM   1416 C CD2 . HIS A 1 178 ? 50.865 15.314  15.761  1.00 57.22  ? 478  HIS F CD2 1 
ATOM   1417 C CE1 . HIS A 1 178 ? 48.697 15.523  16.027  1.00 60.10  ? 478  HIS F CE1 1 
ATOM   1418 N NE2 . HIS A 1 178 ? 49.847 15.449  16.675  1.00 59.96  ? 478  HIS F NE2 1 
ATOM   1419 N N   . PRO A 1 179 ? 50.463 13.118  10.300  1.00 35.49  ? 479  PRO F N   1 
ATOM   1420 C CA  . PRO A 1 179 ? 50.717 13.183  8.858   1.00 37.52  ? 479  PRO F CA  1 
ATOM   1421 C C   . PRO A 1 179 ? 50.458 14.601  8.346   1.00 39.49  ? 479  PRO F C   1 
ATOM   1422 O O   . PRO A 1 179 ? 51.250 15.156  7.587   1.00 39.92  ? 479  PRO F O   1 
ATOM   1423 C CB  . PRO A 1 179 ? 49.720 12.178  8.280   1.00 32.89  ? 479  PRO F CB  1 
ATOM   1424 C CG  . PRO A 1 179 ? 49.451 11.251  9.416   1.00 32.98  ? 479  PRO F CG  1 
ATOM   1425 C CD  . PRO A 1 179 ? 49.386 12.163  10.601  1.00 32.21  ? 479  PRO F CD  1 
ATOM   1426 N N   . GLU A 1 180 ? 49.347 15.180  8.790   1.00 38.02  ? 480  GLU F N   1 
ATOM   1427 C CA  . GLU A 1 180 ? 48.946 16.517  8.376   1.00 41.66  ? 480  GLU F CA  1 
ATOM   1428 C C   . GLU A 1 180 ? 49.905 17.635  8.797   1.00 42.78  ? 480  GLU F C   1 
ATOM   1429 O O   . GLU A 1 180 ? 49.764 18.770  8.354   1.00 42.72  ? 480  GLU F O   1 
ATOM   1430 C CB  . GLU A 1 180 ? 47.523 16.823  8.880   1.00 43.60  ? 480  GLU F CB  1 
ATOM   1431 C CG  . GLU A 1 180 ? 47.389 17.155  10.368  1.00 44.80  ? 480  GLU F CG  1 
ATOM   1432 C CD  . GLU A 1 180 ? 47.673 15.982  11.299  1.00 46.15  ? 480  GLU F CD  1 
ATOM   1433 O OE1 . GLU A 1 180 ? 47.885 14.847  10.819  1.00 46.67  ? 480  GLU F OE1 1 
ATOM   1434 O OE2 . GLU A 1 180 ? 47.678 16.201  12.530  1.00 46.99  ? 480  GLU F OE2 1 
ATOM   1435 N N   . LYS A 1 181 ? 50.871 17.322  9.652   1.00 55.99  ? 481  LYS F N   1 
ATOM   1436 C CA  . LYS A 1 181 ? 51.848 18.320  10.088  1.00 57.42  ? 481  LYS F CA  1 
ATOM   1437 C C   . LYS A 1 181 ? 53.255 17.953  9.632   1.00 59.28  ? 481  LYS F C   1 
ATOM   1438 O O   . LYS A 1 181 ? 54.236 18.498  10.143  1.00 61.64  ? 481  LYS F O   1 
ATOM   1439 C CB  . LYS A 1 181 ? 51.854 18.455  11.609  1.00 50.66  ? 481  LYS F CB  1 
ATOM   1440 C CG  . LYS A 1 181 ? 50.694 19.233  12.173  1.00 52.80  ? 481  LYS F CG  1 
ATOM   1441 C CD  . LYS A 1 181 ? 50.895 19.486  13.648  1.00 55.16  ? 481  LYS F CD  1 
ATOM   1442 C CE  . LYS A 1 181 ? 49.763 20.333  14.208  1.00 57.87  ? 481  LYS F CE  1 
ATOM   1443 N NZ  . LYS A 1 181 ? 49.638 21.626  13.483  1.00 58.63  ? 481  LYS F NZ  1 
ATOM   1444 N N   . SER A 1 182 ? 53.350 17.036  8.674   1.00 49.10  ? 482  SER F N   1 
ATOM   1445 C CA  . SER A 1 182 ? 54.641 16.581  8.166   1.00 48.72  ? 482  SER F CA  1 
ATOM   1446 C C   . SER A 1 182 ? 54.921 16.989  6.722   1.00 50.06  ? 482  SER F C   1 
ATOM   1447 O O   . SER A 1 182 ? 55.553 16.247  5.963   1.00 49.87  ? 482  SER F O   1 
ATOM   1448 C CB  . SER A 1 182 ? 54.748 15.058  8.301   1.00 40.87  ? 482  SER F CB  1 
ATOM   1449 O OG  . SER A 1 182 ? 54.851 14.682  9.661   1.00 37.39  ? 482  SER F OG  1 
ATOM   1450 N N   . SER A 1 183 ? 54.436 18.169  6.352   1.00 54.94  ? 483  SER F N   1 
ATOM   1451 C CA  . SER A 1 183 ? 54.643 18.724  5.023   1.00 55.34  ? 483  SER F CA  1 
ATOM   1452 C C   . SER A 1 183 ? 54.600 17.730  3.862   1.00 55.72  ? 483  SER F C   1 
ATOM   1453 O O   . SER A 1 183 ? 53.686 16.918  3.749   1.00 56.46  ? 483  SER F O   1 
ATOM   1454 C CB  . SER A 1 183 ? 55.966 19.496  4.998   1.00 58.06  ? 483  SER F CB  1 
ATOM   1455 N N   . LYS A 1 184 ? 55.609 17.813  3.001   1.00 62.17  ? 484  LYS F N   1 
ATOM   1456 C CA  . LYS A 1 184 ? 55.712 16.978  1.809   1.00 61.50  ? 484  LYS F CA  1 
ATOM   1457 C C   . LYS A 1 184 ? 55.557 15.471  2.013   1.00 61.02  ? 484  LYS F C   1 
ATOM   1458 O O   . LYS A 1 184 ? 54.658 14.843  1.439   1.00 60.16  ? 484  LYS F O   1 
ATOM   1459 C CB  . LYS A 1 184 ? 57.035 17.271  1.104   1.00 64.03  ? 484  LYS F CB  1 
ATOM   1460 N N   . ILE A 1 185 ? 56.442 14.892  2.818   1.00 46.54  ? 485  ILE F N   1 
ATOM   1461 C CA  . ILE A 1 185 ? 56.408 13.460  3.064   1.00 43.68  ? 485  ILE F CA  1 
ATOM   1462 C C   . ILE A 1 185 ? 55.091 13.052  3.730   1.00 43.00  ? 485  ILE F C   1 
ATOM   1463 O O   . ILE A 1 185 ? 54.657 11.903  3.628   1.00 41.16  ? 485  ILE F O   1 
ATOM   1464 C CB  . ILE A 1 185 ? 57.621 13.037  3.917   1.00 41.22  ? 485  ILE F CB  1 
ATOM   1465 C CG1 . ILE A 1 185 ? 57.673 11.515  4.034   1.00 41.48  ? 485  ILE F CG1 1 
ATOM   1466 C CG2 . ILE A 1 185 ? 57.564 13.709  5.270   1.00 40.35  ? 485  ILE F CG2 1 
ATOM   1467 C CD1 . ILE A 1 185 ? 58.947 11.002  4.676   1.00 41.05  ? 485  ILE F CD1 1 
ATOM   1468 N N   . GLY A 1 186 ? 54.449 14.013  4.388   1.00 43.45  ? 486  GLY F N   1 
ATOM   1469 C CA  . GLY A 1 186 ? 53.177 13.748  5.036   1.00 43.98  ? 486  GLY F CA  1 
ATOM   1470 C C   . GLY A 1 186 ? 52.071 13.548  4.013   1.00 45.14  ? 486  GLY F C   1 
ATOM   1471 O O   . GLY A 1 186 ? 51.395 12.512  4.013   1.00 44.55  ? 486  GLY F O   1 
ATOM   1472 N N   . ARG A 1 187 ? 51.888 14.537  3.136   1.00 47.35  ? 487  ARG F N   1 
ATOM   1473 C CA  . ARG A 1 187 ? 50.866 14.464  2.090   1.00 46.60  ? 487  ARG F CA  1 
ATOM   1474 C C   . ARG A 1 187 ? 51.081 13.191  1.294   1.00 45.24  ? 487  ARG F C   1 
ATOM   1475 O O   . ARG A 1 187 ? 50.134 12.529  0.878   1.00 46.30  ? 487  ARG F O   1 
ATOM   1476 C CB  . ARG A 1 187 ? 50.959 15.685  1.166   1.00 49.48  ? 487  ARG F CB  1 
ATOM   1477 N N   . LYS A 1 188 ? 52.346 12.854  1.090   1.00 43.06  ? 488  LYS F N   1 
ATOM   1478 C CA  . LYS A 1 188 ? 52.720 11.659  0.347   1.00 42.16  ? 488  LYS F CA  1 
ATOM   1479 C C   . LYS A 1 188 ? 52.245 10.405  1.088   1.00 40.75  ? 488  LYS F C   1 
ATOM   1480 O O   . LYS A 1 188 ? 51.769 9.443   0.472   1.00 38.93  ? 488  LYS F O   1 
ATOM   1481 C CB  . LYS A 1 188 ? 54.236 11.651  0.176   1.00 49.86  ? 488  LYS F CB  1 
ATOM   1482 C CG  . LYS A 1 188 ? 54.798 10.491  -0.595  1.00 53.18  ? 488  LYS F CG  1 
ATOM   1483 C CD  . LYS A 1 188 ? 56.292 10.707  -0.788  1.00 55.67  ? 488  LYS F CD  1 
ATOM   1484 C CE  . LYS A 1 188 ? 56.936 9.609   -1.612  1.00 54.52  ? 488  LYS F CE  1 
ATOM   1485 N NZ  . LYS A 1 188 ? 58.366 9.923   -1.823  1.00 55.37  ? 488  LYS F NZ  1 
ATOM   1486 N N   . LEU A 1 189 ? 52.376 10.432  2.414   1.00 38.62  ? 489  LEU F N   1 
ATOM   1487 C CA  . LEU A 1 189 ? 51.961 9.327   3.273   1.00 36.07  ? 489  LEU F CA  1 
ATOM   1488 C C   . LEU A 1 189 ? 50.455 9.165   3.134   1.00 35.27  ? 489  LEU F C   1 
ATOM   1489 O O   . LEU A 1 189 ? 49.951 8.075   2.831   1.00 32.64  ? 489  LEU F O   1 
ATOM   1490 C CB  . LEU A 1 189 ? 52.315 9.642   4.730   1.00 37.70  ? 489  LEU F CB  1 
ATOM   1491 C CG  . LEU A 1 189 ? 52.095 8.605   5.836   1.00 37.04  ? 489  LEU F CG  1 
ATOM   1492 C CD1 . LEU A 1 189 ? 50.613 8.386   6.097   1.00 35.48  ? 489  LEU F CD1 1 
ATOM   1493 C CD2 . LEU A 1 189 ? 52.774 7.316   5.440   1.00 37.58  ? 489  LEU F CD2 1 
ATOM   1494 N N   . LEU A 1 190 ? 49.742 10.264  3.361   1.00 33.74  ? 490  LEU F N   1 
ATOM   1495 C CA  . LEU A 1 190 ? 48.286 10.276  3.260   1.00 33.13  ? 490  LEU F CA  1 
ATOM   1496 C C   . LEU A 1 190 ? 47.845 9.763   1.901   1.00 33.91  ? 490  LEU F C   1 
ATOM   1497 O O   . LEU A 1 190 ? 46.867 9.024   1.799   1.00 32.71  ? 490  LEU F O   1 
ATOM   1498 C CB  . LEU A 1 190 ? 47.753 11.690  3.477   1.00 30.50  ? 490  LEU F CB  1 
ATOM   1499 C CG  . LEU A 1 190 ? 47.903 12.260  4.888   1.00 29.53  ? 490  LEU F CG  1 
ATOM   1500 C CD1 . LEU A 1 190 ? 47.344 13.677  4.922   1.00 27.95  ? 490  LEU F CD1 1 
ATOM   1501 C CD2 . LEU A 1 190 ? 47.162 11.366  5.886   1.00 28.87  ? 490  LEU F CD2 1 
ATOM   1502 N N   . GLU A 1 191 ? 48.571 10.159  0.855   1.00 39.69  ? 491  GLU F N   1 
ATOM   1503 C CA  . GLU A 1 191 ? 48.257 9.713   -0.498  1.00 41.36  ? 491  GLU F CA  1 
ATOM   1504 C C   . GLU A 1 191 ? 48.396 8.207   -0.595  1.00 41.04  ? 491  GLU F C   1 
ATOM   1505 O O   . GLU A 1 191 ? 47.497 7.517   -1.091  1.00 40.63  ? 491  GLU F O   1 
ATOM   1506 C CB  . GLU A 1 191 ? 49.189 10.371  -1.505  1.00 61.15  ? 491  GLU F CB  1 
ATOM   1507 C CG  . GLU A 1 191 ? 48.833 11.810  -1.805  1.00 66.90  ? 491  GLU F CG  1 
ATOM   1508 C CD  . GLU A 1 191 ? 49.855 12.476  -2.692  1.00 70.66  ? 491  GLU F CD  1 
ATOM   1509 O OE1 . GLU A 1 191 ? 50.190 11.890  -3.748  1.00 72.81  ? 491  GLU F OE1 1 
ATOM   1510 O OE2 . GLU A 1 191 ? 50.321 13.583  -2.334  1.00 72.34  ? 491  GLU F OE2 1 
ATOM   1511 N N   . LYS A 1 192 ? 49.527 7.698   -0.116  1.00 37.43  ? 492  LYS F N   1 
ATOM   1512 C CA  . LYS A 1 192 ? 49.776 6.267   -0.141  1.00 35.71  ? 492  LYS F CA  1 
ATOM   1513 C C   . LYS A 1 192 ? 48.658 5.532   0.601   1.00 34.35  ? 492  LYS F C   1 
ATOM   1514 O O   . LYS A 1 192 ? 48.245 4.447   0.196   1.00 34.12  ? 492  LYS F O   1 
ATOM   1515 C CB  . LYS A 1 192 ? 51.131 5.956   0.500   1.00 47.66  ? 492  LYS F CB  1 
ATOM   1516 C CG  . LYS A 1 192 ? 51.617 4.536   0.241   1.00 50.79  ? 492  LYS F CG  1 
ATOM   1517 C CD  . LYS A 1 192 ? 51.865 4.312   -1.242  1.00 53.71  ? 492  LYS F CD  1 
ATOM   1518 C CE  . LYS A 1 192 ? 52.181 2.859   -1.538  1.00 57.12  ? 492  LYS F CE  1 
ATOM   1519 N NZ  . LYS A 1 192 ? 52.320 2.600   -3.003  1.00 56.92  ? 492  LYS F NZ  1 
ATOM   1520 N N   . VAL A 1 193 ? 48.159 6.124   1.685   1.00 37.43  ? 493  VAL F N   1 
ATOM   1521 C CA  . VAL A 1 193 ? 47.079 5.492   2.446   1.00 35.49  ? 493  VAL F CA  1 
ATOM   1522 C C   . VAL A 1 193 ? 45.825 5.383   1.589   1.00 36.15  ? 493  VAL F C   1 
ATOM   1523 O O   . VAL A 1 193 ? 45.205 4.323   1.516   1.00 35.41  ? 493  VAL F O   1 
ATOM   1524 C CB  . VAL A 1 193 ? 46.718 6.284   3.746   1.00 22.39  ? 493  VAL F CB  1 
ATOM   1525 C CG1 . VAL A 1 193 ? 45.483 5.679   4.390   1.00 17.72  ? 493  VAL F CG1 1 
ATOM   1526 C CG2 . VAL A 1 193 ? 47.878 6.252   4.731   1.00 17.30  ? 493  VAL F CG2 1 
ATOM   1527 N N   . ILE A 1 194 ? 45.450 6.488   0.952   1.00 35.34  ? 494  ILE F N   1 
ATOM   1528 C CA  . ILE A 1 194 ? 44.264 6.518   0.094   1.00 37.86  ? 494  ILE F CA  1 
ATOM   1529 C C   . ILE A 1 194 ? 44.459 5.509   -1.024  1.00 40.88  ? 494  ILE F C   1 
ATOM   1530 O O   . ILE A 1 194 ? 43.564 4.723   -1.344  1.00 40.69  ? 494  ILE F O   1 
ATOM   1531 C CB  . ILE A 1 194 ? 44.065 7.925   -0.510  1.00 33.43  ? 494  ILE F CB  1 
ATOM   1532 C CG1 . ILE A 1 194 ? 43.751 8.912   0.609   1.00 29.50  ? 494  ILE F CG1 1 
ATOM   1533 C CG2 . ILE A 1 194 ? 42.959 7.908   -1.552  1.00 31.06  ? 494  ILE F CG2 1 
ATOM   1534 C CD1 . ILE A 1 194 ? 43.672 10.334  0.156   1.00 32.70  ? 494  ILE F CD1 1 
ATOM   1535 N N   . GLU A 1 195 ? 45.658 5.538   -1.591  1.00 47.02  ? 495  GLU F N   1 
ATOM   1536 C CA  . GLU A 1 195 ? 46.068 4.651   -2.669  1.00 51.08  ? 495  GLU F CA  1 
ATOM   1537 C C   . GLU A 1 195 ? 45.827 3.179   -2.310  1.00 51.29  ? 495  GLU F C   1 
ATOM   1538 O O   . GLU A 1 195 ? 45.281 2.417   -3.113  1.00 51.67  ? 495  GLU F O   1 
ATOM   1539 C CB  . GLU A 1 195 ? 47.547 4.889   -2.946  1.00 72.04  ? 495  GLU F CB  1 
ATOM   1540 C CG  . GLU A 1 195 ? 48.014 4.547   -4.333  1.00 78.36  ? 495  GLU F CG  1 
ATOM   1541 C CD  . GLU A 1 195 ? 49.470 4.915   -4.528  1.00 82.62  ? 495  GLU F CD  1 
ATOM   1542 O OE1 . GLU A 1 195 ? 49.823 6.097   -4.304  1.00 82.84  ? 495  GLU F OE1 1 
ATOM   1543 O OE2 . GLU A 1 195 ? 50.262 4.021   -4.898  1.00 86.53  ? 495  GLU F OE2 1 
ATOM   1544 N N   . CYS A 1 196 ? 46.237 2.790   -1.103  1.00 43.79  ? 496  CYS F N   1 
ATOM   1545 C CA  . CYS A 1 196 ? 46.069 1.419   -0.622  1.00 44.37  ? 496  CYS F CA  1 
ATOM   1546 C C   . CYS A 1 196 ? 44.612 1.017   -0.451  1.00 46.12  ? 496  CYS F C   1 
ATOM   1547 O O   . CYS A 1 196 ? 44.234 -0.115  -0.752  1.00 46.19  ? 496  CYS F O   1 
ATOM   1548 C CB  . CYS A 1 196 ? 46.776 1.228   0.724   1.00 47.82  ? 496  CYS F CB  1 
ATOM   1549 S SG  . CYS A 1 196 ? 48.562 1.069   0.641   1.00 44.84  ? 496  CYS F SG  1 
ATOM   1550 N N   . SER A 1 197 ? 43.799 1.940   0.056   1.00 54.57  ? 497  SER F N   1 
ATOM   1551 C CA  . SER A 1 197 ? 42.385 1.664   0.273   1.00 56.46  ? 497  SER F CA  1 
ATOM   1552 C C   . SER A 1 197 ? 41.611 1.649   -1.041  1.00 57.30  ? 497  SER F C   1 
ATOM   1553 O O   . SER A 1 197 ? 40.505 1.114   -1.107  1.00 57.43  ? 497  SER F O   1 
ATOM   1554 C CB  . SER A 1 197 ? 41.781 2.702   1.230   1.00 58.71  ? 497  SER F CB  1 
ATOM   1555 O OG  . SER A 1 197 ? 41.956 4.020   0.742   1.00 59.81  ? 497  SER F OG  1 
ATOM   1556 N N   . LEU A 1 198 ? 42.198 2.233   -2.084  1.00 52.01  ? 498  LEU F N   1 
ATOM   1557 C CA  . LEU A 1 198 ? 41.563 2.277   -3.402  1.00 53.79  ? 498  LEU F CA  1 
ATOM   1558 C C   . LEU A 1 198 ? 41.611 0.923   -4.103  1.00 55.91  ? 498  LEU F C   1 
ATOM   1559 O O   . LEU A 1 198 ? 40.729 0.598   -4.897  1.00 56.62  ? 498  LEU F O   1 
ATOM   1560 C CB  . LEU A 1 198 ? 42.232 3.333   -4.293  1.00 41.39  ? 498  LEU F CB  1 
ATOM   1561 C CG  . LEU A 1 198 ? 41.895 4.809   -4.041  1.00 40.06  ? 498  LEU F CG  1 
ATOM   1562 C CD1 . LEU A 1 198 ? 42.706 5.688   -4.968  1.00 36.81  ? 498  LEU F CD1 1 
ATOM   1563 C CD2 . LEU A 1 198 ? 40.408 5.042   -4.259  1.00 39.18  ? 498  LEU F CD2 1 
ATOM   1564 N N   . SER A 1 199 ? 42.640 0.136   -3.802  1.00 62.64  ? 499  SER F N   1 
ATOM   1565 C CA  . SER A 1 199 ? 42.809 -1.185  -4.399  1.00 64.70  ? 499  SER F CA  1 
ATOM   1566 C C   . SER A 1 199 ? 42.144 -2.286  -3.570  1.00 66.59  ? 499  SER F C   1 
ATOM   1567 O O   . SER A 1 199 ? 41.042 -2.108  -3.045  1.00 66.90  ? 499  SER F O   1 
ATOM   1568 C CB  . SER A 1 199 ? 44.297 -1.497  -4.543  1.00 66.70  ? 499  SER F CB  1 
ATOM   1569 O OG  . SER A 1 199 ? 44.912 -1.602  -3.269  1.00 67.09  ? 499  SER F OG  1 
ATOM   1570 N N   . ARG A 1 200 ? 42.831 -3.422  -3.465  1.00 81.04  ? 500  ARG F N   1 
ATOM   1571 C CA  . ARG A 1 200 ? 42.358 -4.582  -2.710  1.00 82.80  ? 500  ARG F CA  1 
ATOM   1572 C C   . ARG A 1 200 ? 41.255 -5.353  -3.436  1.00 83.43  ? 500  ARG F C   1 
ATOM   1573 O O   . ARG A 1 200 ? 40.886 -4.946  -4.558  1.00 83.86  ? 500  ARG F O   1 
ATOM   1574 C CB  . ARG A 1 200 ? 41.873 -4.150  -1.326  1.00 75.48  ? 500  ARG F CB  1 
HETATM 1575 C C   . ACY B 2 .   ? 49.447 11.743  19.685  1.00 42.14  ? 1001 ACY F C   1 
HETATM 1576 O O   . ACY B 2 .   ? 48.585 12.719  19.778  1.00 41.99  ? 1001 ACY F O   1 
HETATM 1577 O OXT . ACY B 2 .   ? 50.228 11.502  18.702  1.00 40.81  ? 1001 ACY F OXT 1 
HETATM 1578 C CH3 . ACY B 2 .   ? 49.471 10.819  20.903  1.00 39.56  ? 1001 ACY F CH3 1 
HETATM 1579 O O   . HOH C 3 .   ? 53.801 4.233   19.390  1.00 21.67  ? 1    HOH F O   1 
HETATM 1580 O O   . HOH C 3 .   ? 28.005 11.751  11.780  1.00 38.52  ? 2    HOH F O   1 
HETATM 1581 O O   . HOH C 3 .   ? 47.924 6.829   26.294  1.00 35.30  ? 3    HOH F O   1 
HETATM 1582 O O   . HOH C 3 .   ? 37.967 12.773  16.507  1.00 26.81  ? 4    HOH F O   1 
HETATM 1583 O O   . HOH C 3 .   ? 63.963 7.956   14.699  1.00 27.71  ? 5    HOH F O   1 
HETATM 1584 O O   . HOH C 3 .   ? 69.202 12.804  12.785  1.00 48.44  ? 6    HOH F O   1 
HETATM 1585 O O   . HOH C 3 .   ? 62.419 7.722   25.519  1.00 35.71  ? 7    HOH F O   1 
HETATM 1586 O O   . HOH C 3 .   ? 57.254 -6.077  3.970   1.00 34.99  ? 8    HOH F O   1 
HETATM 1587 O O   . HOH C 3 .   ? 49.825 -1.464  4.170   1.00 41.32  ? 9    HOH F O   1 
HETATM 1588 O O   . HOH C 3 .   ? 52.466 12.402  17.670  1.00 28.96  ? 10   HOH F O   1 
HETATM 1589 O O   . HOH C 3 .   ? 39.168 27.342  8.633   1.00 43.28  ? 11   HOH F O   1 
HETATM 1590 O O   . HOH C 3 .   ? 64.819 7.003   26.907  1.00 39.42  ? 12   HOH F O   1 
HETATM 1591 O O   . HOH C 3 .   ? 67.046 2.437   25.810  1.00 44.78  ? 13   HOH F O   1 
HETATM 1592 O O   . HOH C 3 .   ? 39.169 -2.860  31.086  1.00 54.03  ? 14   HOH F O   1 
HETATM 1593 O O   . HOH C 3 .   ? 54.778 -11.094 16.049  1.00 48.57  ? 15   HOH F O   1 
HETATM 1594 O O   . HOH C 3 .   ? 42.525 -7.817  19.234  1.00 53.06  ? 16   HOH F O   1 
HETATM 1595 O O   . HOH C 3 .   ? 55.544 4.962   -0.540  1.00 51.28  ? 17   HOH F O   1 
HETATM 1596 O O   . HOH C 3 .   ? 54.382 21.669  1.120   1.00 43.37  ? 18   HOH F O   1 
HETATM 1597 O O   . HOH C 3 .   ? 60.314 18.449  29.859  1.00 45.59  ? 19   HOH F O   1 
HETATM 1598 O O   . HOH C 3 .   ? 47.066 24.207  14.121  1.00 48.55  ? 20   HOH F O   1 
HETATM 1599 O O   . HOH C 3 .   ? 61.279 4.737   1.951   1.00 35.00  ? 21   HOH F O   1 
HETATM 1600 O O   . HOH C 3 .   ? 29.697 2.208   20.380  1.00 51.12  ? 22   HOH F O   1 
HETATM 1601 O O   . HOH C 3 .   ? 23.796 11.403  10.561  1.00 43.96  ? 23   HOH F O   1 
HETATM 1602 O O   . HOH C 3 .   ? 47.648 -2.592  5.055   1.00 41.95  ? 24   HOH F O   1 
HETATM 1603 O O   . HOH C 3 .   ? 54.656 -5.245  9.175   1.00 52.74  ? 25   HOH F O   1 
HETATM 1604 O O   . HOH C 3 .   ? 36.855 6.096   28.775  1.00 45.68  ? 26   HOH F O   1 
HETATM 1605 O O   . HOH C 3 .   ? 28.661 2.374   17.357  1.00 40.66  ? 27   HOH F O   1 
HETATM 1606 O O   . HOH C 3 .   ? 39.072 10.327  17.247  1.00 26.39  ? 28   HOH F O   1 
HETATM 1607 O O   . HOH C 3 .   ? 38.226 9.853   20.106  1.00 22.59  ? 29   HOH F O   1 
HETATM 1608 O O   . HOH C 3 .   ? 64.164 3.268   13.943  1.00 29.07  ? 30   HOH F O   1 
HETATM 1609 O O   . HOH C 3 .   ? 49.657 8.959   -4.275  1.00 47.38  ? 31   HOH F O   1 
HETATM 1610 O O   . HOH C 3 .   ? 58.669 3.030   27.300  1.00 36.71  ? 32   HOH F O   1 
HETATM 1611 O O   . HOH C 3 .   ? 38.199 10.476  -11.930 1.00 49.33  ? 33   HOH F O   1 
HETATM 1612 O O   . HOH C 3 .   ? 45.294 13.648  15.456  1.00 40.34  ? 34   HOH F O   1 
HETATM 1613 O O   . HOH C 3 .   ? 63.765 0.244   23.849  0.50 31.86  ? 35   HOH F O   1 
HETATM 1614 O O   . HOH C 3 .   ? 59.333 1.834   2.853   1.00 59.66  ? 36   HOH F O   1 
HETATM 1615 O O   . HOH C 3 .   ? 43.889 17.896  12.961  1.00 36.24  ? 37   HOH F O   1 
HETATM 1616 O O   . HOH C 3 .   ? 50.737 10.553  24.161  1.00 46.84  ? 38   HOH F O   1 
HETATM 1617 O O   . HOH C 3 .   ? 41.276 10.256  19.777  1.00 42.93  ? 39   HOH F O   1 
HETATM 1618 O O   . HOH C 3 .   ? 41.509 -3.261  30.138  1.00 50.75  ? 40   HOH F O   1 
HETATM 1619 O O   . HOH C 3 .   ? 38.125 4.650   -0.752  1.00 53.04  ? 41   HOH F O   1 
HETATM 1620 O O   . HOH C 3 .   ? 66.888 14.470  27.626  1.00 43.91  ? 42   HOH F O   1 
HETATM 1621 O O   . HOH C 3 .   ? 65.568 15.321  16.307  1.00 47.23  ? 43   HOH F O   1 
HETATM 1622 O O   . HOH C 3 .   ? 26.697 5.587   0.589   1.00 53.44  ? 44   HOH F O   1 
HETATM 1623 O O   . HOH C 3 .   ? 35.314 15.050  -3.983  1.00 45.46  ? 45   HOH F O   1 
HETATM 1624 O O   . HOH C 3 .   ? 65.929 10.748  14.268  1.00 30.38  ? 46   HOH F O   1 
HETATM 1625 O O   . HOH C 3 .   ? 35.714 -0.480  24.370  1.00 57.44  ? 47   HOH F O   1 
HETATM 1626 O O   . HOH C 3 .   ? 27.700 1.060   15.172  1.00 55.31  ? 48   HOH F O   1 
HETATM 1627 O O   . HOH C 3 .   ? 49.271 -0.331  30.039  1.00 69.39  ? 49   HOH F O   1 
HETATM 1628 O O   . HOH C 3 .   ? 42.549 14.402  26.499  1.00 42.23  ? 50   HOH F O   1 
HETATM 1629 O O   . HOH C 3 .   ? 71.419 14.342  11.903  1.00 42.43  ? 51   HOH F O   1 
HETATM 1630 O O   . HOH C 3 .   ? 36.121 3.158   27.344  1.00 45.10  ? 52   HOH F O   1 
HETATM 1631 O O   . HOH C 3 .   ? 25.490 13.030  12.921  1.00 50.47  ? 53   HOH F O   1 
HETATM 1632 O O   . HOH C 3 .   ? 55.816 -8.527  4.575   1.00 42.81  ? 54   HOH F O   1 
HETATM 1633 O O   . HOH C 3 .   ? 60.603 19.371  6.461   1.00 34.14  ? 55   HOH F O   1 
HETATM 1634 O O   . HOH C 3 .   ? 62.189 18.535  8.582   0.50 10.47  ? 56   HOH F O   1 
HETATM 1635 O O   . HOH C 3 .   ? 31.566 13.539  23.773  1.00 49.75  ? 57   HOH F O   1 
HETATM 1636 O O   . HOH C 3 .   ? 43.307 15.806  16.075  1.00 60.72  ? 58   HOH F O   1 
HETATM 1637 O O   . HOH C 3 .   ? 48.933 16.638  23.818  1.00 39.70  ? 59   HOH F O   1 
HETATM 1638 O O   . HOH C 3 .   ? 39.489 6.579   -1.241  1.00 38.82  ? 60   HOH F O   1 
HETATM 1639 O O   . HOH C 3 .   ? 53.577 14.355  29.570  1.00 33.60  ? 61   HOH F O   1 
HETATM 1640 O O   . HOH C 3 .   ? 65.788 4.343   27.767  1.00 43.55  ? 62   HOH F O   1 
HETATM 1641 O O   . HOH C 3 .   ? 69.056 5.695   27.226  1.00 41.57  ? 63   HOH F O   1 
HETATM 1642 O O   . HOH C 3 .   ? 53.873 0.162   -2.054  1.00 39.21  ? 64   HOH F O   1 
HETATM 1643 O O   . HOH C 3 .   ? 55.046 7.367   -1.471  1.00 56.38  ? 65   HOH F O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   301 301 MET MET F . n 
A 1 2   ARG 2   302 302 ARG ARG F . n 
A 1 3   ILE 3   303 303 ILE ILE F . n 
A 1 4   GLY 4   304 304 GLY GLY F . n 
A 1 5   ILE 5   305 305 ILE ILE F . n 
A 1 6   ILE 6   306 306 ILE ILE F . n 
A 1 7   SER 7   307 307 SER SER F . n 
A 1 8   VAL 8   308 308 VAL VAL F . n 
A 1 9   GLY 9   309 309 GLY GLY F . n 
A 1 10  PRO 10  310 310 PRO PRO F . n 
A 1 11  GLY 11  311 311 GLY GLY F . n 
A 1 12  ASN 12  312 312 ASN ASN F . n 
A 1 13  ILE 13  313 313 ILE ILE F . n 
A 1 14  MET 14  314 314 MET MET F . n 
A 1 15  ASN 15  315 315 ASN ASN F . n 
A 1 16  LEU 16  316 316 LEU LEU F . n 
A 1 17  TYR 17  317 317 TYR TYR F . n 
A 1 18  ARG 18  318 318 ARG ARG F . n 
A 1 19  GLY 19  319 319 GLY GLY F . n 
A 1 20  VAL 20  320 320 VAL VAL F . n 
A 1 21  LYS 21  321 321 LYS LYS F . n 
A 1 22  ARG 22  322 322 ARG ALA F . n 
A 1 23  ALA 23  323 323 ALA ALA F . n 
A 1 24  SER 24  324 324 SER SER F . n 
A 1 25  GLU 25  325 325 GLU ALA F . n 
A 1 26  ASN 26  326 326 ASN ALA F . n 
A 1 27  PHE 27  327 327 PHE PHE F . n 
A 1 28  GLU 28  328 328 GLU GLU F . n 
A 1 29  ASP 29  329 329 ASP ASP F . n 
A 1 30  VAL 30  330 330 VAL VAL F . n 
A 1 31  SER 31  331 331 SER SER F . n 
A 1 32  ILE 32  332 332 ILE ILE F . n 
A 1 33  GLU 33  333 333 GLU GLU F . n 
A 1 34  LEU 34  334 334 LEU LEU F . n 
A 1 35  VAL 35  335 335 VAL VAL F . n 
A 1 36  GLU 36  336 336 GLU GLU F . n 
A 1 37  SER 37  337 337 SER SER F . n 
A 1 38  PRO 38  338 338 PRO PRO F . n 
A 1 39  ARG 39  339 339 ARG ARG F . n 
A 1 40  ASN 40  340 340 ASN ASP F . n 
A 1 41  ASP 41  341 341 ASP ASP F . n 
A 1 42  LEU 42  342 342 LEU LEU F . n 
A 1 43  TYR 43  343 343 TYR TYR F . n 
A 1 44  ASP 44  344 344 ASP ALA F . n 
A 1 45  LEU 45  345 345 LEU LEU F . n 
A 1 46  LEU 46  346 346 LEU LEU F . n 
A 1 47  PHE 47  347 347 PHE PHE F . n 
A 1 48  ILE 48  348 348 ILE ILE F . n 
A 1 49  PRO 49  349 349 PRO PRO F . n 
A 1 50  GLY 50  350 350 GLY GLY F . n 
A 1 51  VAL 51  351 351 VAL VAL F . n 
A 1 52  GLY 52  352 352 GLY GLY F . n 
A 1 53  HIS 53  353 353 HIS HIS F . n 
A 1 54  PHE 54  354 354 PHE PHE F . n 
A 1 55  GLY 55  355 355 GLY GLY F . n 
A 1 56  GLU 56  356 356 GLU GLU F . n 
A 1 57  GLY 57  357 357 GLY GLY F . n 
A 1 58  MET 58  358 358 MET MET F . n 
A 1 59  ARG 59  359 359 ARG ARG F . n 
A 1 60  ARG 60  360 360 ARG ARG F . n 
A 1 61  LEU 61  361 361 LEU LEU F . n 
A 1 62  ARG 62  362 362 ARG ARG F . n 
A 1 63  GLU 63  363 363 GLU GLU F . n 
A 1 64  ASN 64  364 364 ASN ASN F . n 
A 1 65  ASP 65  365 365 ASP ASP F . n 
A 1 66  LEU 66  366 366 LEU LEU F . n 
A 1 67  ILE 67  367 367 ILE ILE F . n 
A 1 68  ASP 68  368 368 ASP ASP F . n 
A 1 69  PHE 69  369 369 PHE PHE F . n 
A 1 70  VAL 70  370 370 VAL VAL F . n 
A 1 71  ARG 71  371 371 ARG ARG F . n 
A 1 72  LYS 72  372 372 LYS LYS F . n 
A 1 73  HIS 73  373 373 HIS HIS F . n 
A 1 74  VAL 74  374 374 VAL VAL F . n 
A 1 75  GLU 75  375 375 GLU GLU F . n 
A 1 76  ASP 76  376 376 ASP ASP F . n 
A 1 77  GLU 77  377 377 GLU ALA F . n 
A 1 78  ARG 78  378 378 ARG ARG F . n 
A 1 79  TYR 79  379 379 TYR TYR F . n 
A 1 80  VAL 80  380 380 VAL VAL F . n 
A 1 81  VAL 81  381 381 VAL VAL F . n 
A 1 82  GLY 82  382 382 GLY GLY F . n 
A 1 83  VAL 83  383 383 VAL VAL F . n 
A 1 84  CYS 84  384 384 CYS CYS F . n 
A 1 85  LEU 85  385 385 LEU LEU F . n 
A 1 86  GLY 86  386 386 GLY GLY F . n 
A 1 87  MET 87  387 387 MET MET F . n 
A 1 88  GLN 88  388 388 GLN GLN F . n 
A 1 89  LEU 89  389 389 LEU LEU F . n 
A 1 90  LEU 90  390 390 LEU LEU F . n 
A 1 91  PHE 91  391 391 PHE PHE F . n 
A 1 92  GLU 92  392 392 GLU GLU F . n 
A 1 93  GLU 93  393 393 GLU GLU F . n 
A 1 94  SER 94  394 394 SER SER F . n 
A 1 95  GLU 95  395 395 GLU GLU F . n 
A 1 96  GLU 96  396 396 GLU GLU F . n 
A 1 97  ALA 97  397 397 ALA ALA F . n 
A 1 98  PRO 98  398 398 PRO PRO F . n 
A 1 99  GLY 99  399 399 GLY GLY F . n 
A 1 100 VAL 100 400 400 VAL VAL F . n 
A 1 101 LYS 101 401 401 LYS LYS F . n 
A 1 102 GLY 102 402 402 GLY GLY F . n 
A 1 103 LEU 103 403 403 LEU LEU F . n 
A 1 104 SER 104 404 404 SER SER F . n 
A 1 105 LEU 105 405 405 LEU LEU F . n 
A 1 106 ILE 106 406 406 ILE ILE F . n 
A 1 107 GLU 107 407 407 GLU GLU F . n 
A 1 108 GLY 108 408 408 GLY GLY F . n 
A 1 109 ASN 109 409 409 ASN ASN F . n 
A 1 110 VAL 110 410 410 VAL VAL F . n 
A 1 111 VAL 111 411 411 VAL VAL F . n 
A 1 112 LYS 112 412 412 LYS LYS F . n 
A 1 113 LEU 113 413 413 LEU LEU F . n 
A 1 114 ARG 114 414 414 ARG ARG F . n 
A 1 115 SER 115 415 415 SER SER F . n 
A 1 116 ARG 116 416 416 ARG ARG F . n 
A 1 117 ARG 117 417 417 ARG ARG F . n 
A 1 118 LEU 118 418 418 LEU LEU F . n 
A 1 119 PRO 119 419 419 PRO CPR F . n 
A 1 120 HIS 120 420 420 HIS HIS F . n 
A 1 121 MET 121 421 421 MET MET F . n 
A 1 122 GLY 122 422 422 GLY GLY F . n 
A 1 123 TRP 123 423 423 TRP TRP F . n 
A 1 124 ASN 124 424 424 ASN ASN F . n 
A 1 125 GLU 125 425 425 GLU GLU F . n 
A 1 126 VAL 126 426 426 VAL VAL F . n 
A 1 127 ILE 127 427 427 ILE ILE F . n 
A 1 128 PHE 128 428 428 PHE PHE F . n 
A 1 129 LYS 129 429 429 LYS LYS F . n 
A 1 130 ASP 130 430 430 ASP ASP F . n 
A 1 131 THR 131 431 431 THR THR F . n 
A 1 132 PHE 132 432 432 PHE PHE F . n 
A 1 133 PRO 133 433 433 PRO PRO F . n 
A 1 134 ASN 134 434 434 ASN ASN F . n 
A 1 135 GLY 135 435 435 GLY GLY F . n 
A 1 136 TYR 136 436 436 TYR TYR F . n 
A 1 137 TYR 137 437 437 TYR TYR F . n 
A 1 138 TYR 138 438 438 TYR TYR F . n 
A 1 139 PHE 139 439 439 PHE PHE F . n 
A 1 140 VAL 140 440 440 VAL VAL F . n 
A 1 141 HIS 141 441 441 HIS HIS F . n 
A 1 142 THR 142 442 442 THR THR F . n 
A 1 143 TYR 143 443 443 TYR TYR F . n 
A 1 144 ARG 144 444 444 ARG ARG F . n 
A 1 145 ALA 145 445 445 ALA ALA F . n 
A 1 146 VAL 146 446 446 VAL VAL F . n 
A 1 147 CYS 147 447 447 CYS CYS F . n 
A 1 148 GLU 148 448 448 GLU ALA F . n 
A 1 149 GLU 149 449 449 GLU GLU F . n 
A 1 150 GLU 150 450 450 GLU GLU F . n 
A 1 151 HIS 151 451 451 HIS HIS F . n 
A 1 152 VAL 152 452 452 VAL VAL F . n 
A 1 153 LEU 153 453 453 LEU LEU F . n 
A 1 154 GLY 154 454 454 GLY GLY F . n 
A 1 155 THR 155 455 455 THR THR F . n 
A 1 156 THR 156 456 456 THR THR F . n 
A 1 157 GLU 157 457 457 GLU GLU F . n 
A 1 158 TYR 158 458 458 TYR TYR F . n 
A 1 159 ASP 159 459 459 ASP ASP F . n 
A 1 160 GLY 160 460 460 GLY GLY F . n 
A 1 161 GLU 161 461 461 GLU GLU F . n 
A 1 162 ILE 162 462 462 ILE ILE F . n 
A 1 163 PHE 163 463 463 PHE PHE F . n 
A 1 164 PRO 164 464 464 PRO PRO F . n 
A 1 165 SER 165 465 465 SER SER F . n 
A 1 166 ALA 166 466 466 ALA ALA F . n 
A 1 167 VAL 167 467 467 VAL VAL F . n 
A 1 168 ARG 168 468 468 ARG ARG F . n 
A 1 169 LYS 169 469 469 LYS LYS F . n 
A 1 170 GLY 170 470 470 GLY GLY F . n 
A 1 171 ARG 171 471 471 ARG ARG F . n 
A 1 172 ILE 172 472 472 ILE ILE F . n 
A 1 173 LEU 173 473 473 LEU LEU F . n 
A 1 174 GLY 174 474 474 GLY GLY F . n 
A 1 175 PHE 175 475 475 PHE PHE F . n 
A 1 176 GLN 176 476 476 GLN GLN F . n 
A 1 177 PHE 177 477 477 PHE PHE F . n 
A 1 178 HIS 178 478 478 HIS HIS F . n 
A 1 179 PRO 179 479 479 PRO PRO F . n 
A 1 180 GLU 180 480 480 GLU GLU F . n 
A 1 181 LYS 181 481 481 LYS LYS F . n 
A 1 182 SER 182 482 482 SER SER F . n 
A 1 183 SER 183 483 483 SER ALA F . n 
A 1 184 LYS 184 484 484 LYS ALA F . n 
A 1 185 ILE 185 485 485 ILE ILE F . n 
A 1 186 GLY 186 486 486 GLY GLY F . n 
A 1 187 ARG 187 487 487 ARG ALA F . n 
A 1 188 LYS 188 488 488 LYS LYS F . n 
A 1 189 LEU 189 489 489 LEU LEU F . n 
A 1 190 LEU 190 490 490 LEU LEU F . n 
A 1 191 GLU 191 491 491 GLU GLU F . n 
A 1 192 LYS 192 492 492 LYS LYS F . n 
A 1 193 VAL 193 493 493 VAL VAL F . n 
A 1 194 ILE 194 494 494 ILE ILE F . n 
A 1 195 GLU 195 495 495 GLU GLU F . n 
A 1 196 CYS 196 496 496 CYS CYS F . n 
A 1 197 SER 197 497 497 SER SER F . n 
A 1 198 LEU 198 498 498 LEU LEU F . n 
A 1 199 SER 199 499 499 SER SER F . n 
A 1 200 ARG 200 500 500 ARG ALA F . n 
A 1 201 ARG 201 501 ?   ?   ?   F . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-02-20 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' . ? 1 
SCALEPACK 'data scaling'   . ? 2 
AMoRE     phasing          . ? 3 
CNS       refinement       . ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PRO F 310 ? ? -47.46  151.47  
2  1 ASN F 326 ? ? -53.35  -9.39   
3  1 PHE F 327 ? ? -113.76 -163.92 
4  1 ARG F 339 ? ? -65.39  52.49   
5  1 LEU F 342 ? ? -28.74  140.16  
6  1 ASP F 376 ? ? -78.38  24.99   
7  1 CYS F 384 ? ? 59.06   -120.83 
8  1 ALA F 397 ? ? -155.92 86.09   
9  1 SER F 415 ? ? -45.16  150.36  
10 1 THR F 431 ? ? 65.23   -61.61  
11 1 SER F 483 ? ? 37.97   -131.21 
12 1 SER F 499 ? ? -90.74  -139.62 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 F ARG 322 ? CG  ? A ARG 22  CG  
2  1 Y 1 F ARG 322 ? CD  ? A ARG 22  CD  
3  1 Y 1 F ARG 322 ? NE  ? A ARG 22  NE  
4  1 Y 1 F ARG 322 ? CZ  ? A ARG 22  CZ  
5  1 Y 1 F ARG 322 ? NH1 ? A ARG 22  NH1 
6  1 Y 1 F ARG 322 ? NH2 ? A ARG 22  NH2 
7  1 Y 1 F GLU 325 ? CG  ? A GLU 25  CG  
8  1 Y 1 F GLU 325 ? CD  ? A GLU 25  CD  
9  1 Y 1 F GLU 325 ? OE1 ? A GLU 25  OE1 
10 1 Y 1 F GLU 325 ? OE2 ? A GLU 25  OE2 
11 1 Y 1 F ASN 326 ? CG  ? A ASN 26  CG  
12 1 Y 1 F ASN 326 ? OD1 ? A ASN 26  OD1 
13 1 Y 1 F ASN 326 ? ND2 ? A ASN 26  ND2 
14 1 Y 1 F ASP 344 ? CG  ? A ASP 44  CG  
15 1 Y 1 F ASP 344 ? OD1 ? A ASP 44  OD1 
16 1 Y 1 F ASP 344 ? OD2 ? A ASP 44  OD2 
17 1 Y 1 F GLU 377 ? CG  ? A GLU 77  CG  
18 1 Y 1 F GLU 377 ? CD  ? A GLU 77  CD  
19 1 Y 1 F GLU 377 ? OE1 ? A GLU 77  OE1 
20 1 Y 1 F GLU 377 ? OE2 ? A GLU 77  OE2 
21 1 Y 1 F GLU 448 ? CG  ? A GLU 148 CG  
22 1 Y 1 F GLU 448 ? CD  ? A GLU 148 CD  
23 1 Y 1 F GLU 448 ? OE1 ? A GLU 148 OE1 
24 1 Y 1 F GLU 448 ? OE2 ? A GLU 148 OE2 
25 1 Y 1 F SER 483 ? OG  ? A SER 183 OG  
26 1 Y 1 F LYS 484 ? CG  ? A LYS 184 CG  
27 1 Y 1 F LYS 484 ? CD  ? A LYS 184 CD  
28 1 Y 1 F LYS 484 ? CE  ? A LYS 184 CE  
29 1 Y 1 F LYS 484 ? NZ  ? A LYS 184 NZ  
30 1 Y 1 F ARG 487 ? CG  ? A ARG 187 CG  
31 1 Y 1 F ARG 487 ? CD  ? A ARG 187 CD  
32 1 Y 1 F ARG 487 ? NE  ? A ARG 187 NE  
33 1 Y 1 F ARG 487 ? CZ  ? A ARG 187 CZ  
34 1 Y 1 F ARG 487 ? NH1 ? A ARG 187 NH1 
35 1 Y 1 F ARG 487 ? NH2 ? A ARG 187 NH2 
36 1 Y 1 F ARG 500 ? CG  ? A ARG 200 CG  
37 1 Y 1 F ARG 500 ? CD  ? A ARG 200 CD  
38 1 Y 1 F ARG 500 ? NE  ? A ARG 200 NE  
39 1 Y 1 F ARG 500 ? CZ  ? A ARG 200 CZ  
40 1 Y 1 F ARG 500 ? NH1 ? A ARG 200 NH1 
41 1 Y 1 F ARG 500 ? NH2 ? A ARG 200 NH2 
# 
_pdbx_unobs_or_zero_occ_residues.id               1 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num    1 
_pdbx_unobs_or_zero_occ_residues.polymer_flag     Y 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag   1 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id     F 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id     ARG 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id      501 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code     ? 
_pdbx_unobs_or_zero_occ_residues.label_asym_id    A 
_pdbx_unobs_or_zero_occ_residues.label_comp_id    ARG 
_pdbx_unobs_or_zero_occ_residues.label_seq_id     201 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'ACETIC ACID' ACY 
3 water         HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 ACY 1  1001 1  ACY ACY F . 
C 3 HOH 1  1    1  HOH WAT F . 
C 3 HOH 2  2    2  HOH WAT F . 
C 3 HOH 3  3    3  HOH WAT F . 
C 3 HOH 4  4    4  HOH WAT F . 
C 3 HOH 5  5    5  HOH WAT F . 
C 3 HOH 6  6    6  HOH WAT F . 
C 3 HOH 7  7    7  HOH WAT F . 
C 3 HOH 8  8    8  HOH WAT F . 
C 3 HOH 9  9    9  HOH WAT F . 
C 3 HOH 10 10   10 HOH WAT F . 
C 3 HOH 11 11   11 HOH WAT F . 
C 3 HOH 12 12   12 HOH WAT F . 
C 3 HOH 13 13   13 HOH WAT F . 
C 3 HOH 14 14   14 HOH WAT F . 
C 3 HOH 15 15   15 HOH WAT F . 
C 3 HOH 16 16   16 HOH WAT F . 
C 3 HOH 17 17   17 HOH WAT F . 
C 3 HOH 18 18   18 HOH WAT F . 
C 3 HOH 19 19   19 HOH WAT F . 
C 3 HOH 20 20   20 HOH WAT F . 
C 3 HOH 21 21   21 HOH WAT F . 
C 3 HOH 22 22   22 HOH WAT F . 
C 3 HOH 23 23   23 HOH WAT F . 
C 3 HOH 24 24   24 HOH WAT F . 
C 3 HOH 25 25   25 HOH WAT F . 
C 3 HOH 26 26   26 HOH WAT F . 
C 3 HOH 27 27   27 HOH WAT F . 
C 3 HOH 28 28   28 HOH WAT F . 
C 3 HOH 29 29   29 HOH WAT F . 
C 3 HOH 30 30   30 HOH WAT F . 
C 3 HOH 31 31   31 HOH WAT F . 
C 3 HOH 32 32   32 HOH WAT F . 
C 3 HOH 33 33   33 HOH WAT F . 
C 3 HOH 34 34   34 HOH WAT F . 
C 3 HOH 35 35   35 HOH WAT F . 
C 3 HOH 36 36   36 HOH WAT F . 
C 3 HOH 37 37   37 HOH WAT F . 
C 3 HOH 38 38   38 HOH WAT F . 
C 3 HOH 39 39   39 HOH WAT F . 
C 3 HOH 40 40   40 HOH WAT F . 
C 3 HOH 41 41   41 HOH WAT F . 
C 3 HOH 42 42   42 HOH WAT F . 
C 3 HOH 43 43   43 HOH WAT F . 
C 3 HOH 44 44   44 HOH WAT F . 
C 3 HOH 45 45   45 HOH WAT F . 
C 3 HOH 46 46   46 HOH WAT F . 
C 3 HOH 47 47   47 HOH WAT F . 
C 3 HOH 48 48   48 HOH WAT F . 
C 3 HOH 49 49   49 HOH WAT F . 
C 3 HOH 50 50   50 HOH WAT F . 
C 3 HOH 51 51   51 HOH WAT F . 
C 3 HOH 52 52   52 HOH WAT F . 
C 3 HOH 53 53   53 HOH WAT F . 
C 3 HOH 54 54   54 HOH WAT F . 
C 3 HOH 55 55   55 HOH WAT F . 
C 3 HOH 56 56   56 HOH WAT F . 
C 3 HOH 57 57   57 HOH WAT F . 
C 3 HOH 58 58   58 HOH WAT F . 
C 3 HOH 59 59   59 HOH WAT F . 
C 3 HOH 60 60   60 HOH WAT F . 
C 3 HOH 61 61   61 HOH WAT F . 
C 3 HOH 62 62   62 HOH WAT F . 
C 3 HOH 63 63   63 HOH WAT F . 
C 3 HOH 64 64   64 HOH WAT F . 
C 3 HOH 65 65   65 HOH WAT F . 
#