data_1KB6
# 
_entry.id   1KB6 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1KB6         
NDB   PD0270       
RCSB  RCSB014772   
WWPDB D_1000014772 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1KB2 'Crystal Structure of VDR DNA-binding Domain Bound to Mouse Osteopontin (SPP) Response Element' unspecified 
PDB 1KB4 
'Crystal Structure of VDR DNA-binding Domain Bound to a Canonical Direct Repeat with Three Base Pair Spacer (DR3) Response Element' 
unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1KB6 
_pdbx_database_status.recvd_initial_deposition_date   2001-11-05 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Shaffer, P.L.' 1 
'Gewirth, D.T.' 2 
# 
_citation.id                        primary 
_citation.title                     'Structural basis of VDR-DNA interactions on direct repeat response elements.' 
_citation.journal_abbrev            'EMBO J.' 
_citation.journal_volume            21 
_citation.page_first                2242 
_citation.page_last                 2252 
_citation.year                      2002 
_citation.journal_id_ASTM           EMJODG 
_citation.country                   UK 
_citation.journal_id_ISSN           0261-4189 
_citation.journal_id_CSD            0897 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11980721 
_citation.pdbx_database_id_DOI      10.1093/emboj/21.9.2242 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Shaffer, P.L.' 1 
primary 'Gewirth, D.T.' 2 
# 
_cell.entry_id           1KB6 
_cell.length_a           61.15 
_cell.length_b           61.15 
_cell.length_c           241.80 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1KB6 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                96 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn "5'-D(*CP*AP*CP*GP*GP*GP*TP*GP*AP*AP*TP*GP*AP*GP*GP*AP*CP*A)-3'" 5614.655  1  ? ? ? 
'Rat Osteocalcin (OC) Response Element' 
2 polymer     syn "5'-D(*TP*GP*TP*CP*CP*TP*CP*AP*TP*TP*CP*AP*CP*CP*CP*GP*TP*G)-3'" 5418.503  1  ? ? ? 
'Rat Osteocalcin (OC) Response Element' 
3 polymer     man 'Vitamin D3 Receptor'                                            12953.305 2  ? ? 
'DNA-binding Domain (Residues 16-125)' ?                                       
4 non-polymer syn 'ZINC ION'                                                       65.409    4  ? ? ? ? 
5 water       nat water                                                            18.015    34 ? ? ? ? 
# 
_entity_name_com.entity_id   3 
_entity_name_com.name        'VDR, 1,25-DIHYDROXYVITAMIN D3 RECEPTOR' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DC)(DA)(DC)(DG)(DG)(DG)(DT)(DG)(DA)(DA)(DT)(DG)(DA)(DG)(DG)(DA)(DC)(DA)' CACGGGTGAATGAGGACA C   
? 
2 polydeoxyribonucleotide no no '(DT)(DG)(DT)(DC)(DC)(DT)(DC)(DA)(DT)(DT)(DC)(DA)(DC)(DC)(DC)(DG)(DT)(DG)' TGTCCTCATTCACCCGTG D   
? 
3 'polypeptide(L)'        no no 
;FDRNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALFTCPFNGDCRITKDNRRHCQACRLKRCVDIGMMKEFIL
TDEEVQRKREMILKRKEEEALKDSLRPKLS
;
;FDRNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALFTCPFNGDCRITKDNRRHCQACRLKRCVDIGMMKEFIL
TDEEVQRKREMILKRKEEEALKDSLRPKLS
;
A,B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DC  n 
1 2   DA  n 
1 3   DC  n 
1 4   DG  n 
1 5   DG  n 
1 6   DG  n 
1 7   DT  n 
1 8   DG  n 
1 9   DA  n 
1 10  DA  n 
1 11  DT  n 
1 12  DG  n 
1 13  DA  n 
1 14  DG  n 
1 15  DG  n 
1 16  DA  n 
1 17  DC  n 
1 18  DA  n 
2 1   DT  n 
2 2   DG  n 
2 3   DT  n 
2 4   DC  n 
2 5   DC  n 
2 6   DT  n 
2 7   DC  n 
2 8   DA  n 
2 9   DT  n 
2 10  DT  n 
2 11  DC  n 
2 12  DA  n 
2 13  DC  n 
2 14  DC  n 
2 15  DC  n 
2 16  DG  n 
2 17  DT  n 
2 18  DG  n 
3 1   PHE n 
3 2   ASP n 
3 3   ARG n 
3 4   ASN n 
3 5   VAL n 
3 6   PRO n 
3 7   ARG n 
3 8   ILE n 
3 9   CYS n 
3 10  GLY n 
3 11  VAL n 
3 12  CYS n 
3 13  GLY n 
3 14  ASP n 
3 15  ARG n 
3 16  ALA n 
3 17  THR n 
3 18  GLY n 
3 19  PHE n 
3 20  HIS n 
3 21  PHE n 
3 22  ASN n 
3 23  ALA n 
3 24  MET n 
3 25  THR n 
3 26  CYS n 
3 27  GLU n 
3 28  GLY n 
3 29  CYS n 
3 30  LYS n 
3 31  GLY n 
3 32  PHE n 
3 33  PHE n 
3 34  ARG n 
3 35  ARG n 
3 36  SER n 
3 37  MET n 
3 38  LYS n 
3 39  ARG n 
3 40  LYS n 
3 41  ALA n 
3 42  LEU n 
3 43  PHE n 
3 44  THR n 
3 45  CYS n 
3 46  PRO n 
3 47  PHE n 
3 48  ASN n 
3 49  GLY n 
3 50  ASP n 
3 51  CYS n 
3 52  ARG n 
3 53  ILE n 
3 54  THR n 
3 55  LYS n 
3 56  ASP n 
3 57  ASN n 
3 58  ARG n 
3 59  ARG n 
3 60  HIS n 
3 61  CYS n 
3 62  GLN n 
3 63  ALA n 
3 64  CYS n 
3 65  ARG n 
3 66  LEU n 
3 67  LYS n 
3 68  ARG n 
3 69  CYS n 
3 70  VAL n 
3 71  ASP n 
3 72  ILE n 
3 73  GLY n 
3 74  MET n 
3 75  MET n 
3 76  LYS n 
3 77  GLU n 
3 78  PHE n 
3 79  ILE n 
3 80  LEU n 
3 81  THR n 
3 82  ASP n 
3 83  GLU n 
3 84  GLU n 
3 85  VAL n 
3 86  GLN n 
3 87  ARG n 
3 88  LYS n 
3 89  ARG n 
3 90  GLU n 
3 91  MET n 
3 92  ILE n 
3 93  LEU n 
3 94  LYS n 
3 95  ARG n 
3 96  LYS n 
3 97  GLU n 
3 98  GLU n 
3 99  GLU n 
3 100 ALA n 
3 101 LEU n 
3 102 LYS n 
3 103 ASP n 
3 104 SER n 
3 105 LEU n 
3 106 ARG n 
3 107 PRO n 
3 108 LYS n 
3 109 LEU n 
3 110 SER n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 VDR 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET11A-VDR-N1-RPLKS 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP VDR_HUMAN 3 
;FDRNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALFTCPFNGDCRITKDNRRHCQACRLKRCVDIGMMKEFIL
TDEEVQRKREMILKRKEEEALKDSLRPKLS
;
16 P11473 ? 
2 PDB 1KB6      1 ? ?  1KB6   ? 
3 PDB 1KB6      2 ? ?  1KB6   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1KB6 A 1 ? 110 ? P11473 16  ? 125 ? 16  125 
2 1 1KB6 B 1 ? 110 ? P11473 16  ? 125 ? 216 325 
3 2 1KB6 C 1 ? 18  ? 1KB6   401 ? 418 ? 401 418 
4 3 1KB6 D 1 ? 18  ? 1KB6   419 ? 436 ? 419 436 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                           ? 'Zn 2'            65.409  
# 
_exptl.entry_id          1KB6 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.02 
_exptl_crystal.density_percent_sol   59.30 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.6 
_exptl_crystal_grow.pdbx_details    
'PEG 8000, magnesium chloride, MES, glycerol, DTT, pH 5.6, VAPOR DIFFUSION, HANGING DROP, temperature 291K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 'PEG 8000' ? ? ? 
1 2 1 MgCl2      ? ? ? 
1 3 1 MES        ? ? ? 
1 4 1 glycerol   ? ? ? 
1 5 1 DTT        ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   APS-1 
_diffrn_detector.pdbx_collection_date   2001-09-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0332 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 19-BM' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   19-BM 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0332 
# 
_reflns.entry_id                     1KB6 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.7 
_reflns.number_obs                   13127 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         96.7 
_reflns.pdbx_Rmerge_I_obs            0.0710000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        34.4 
_reflns.B_iso_Wilson_estimate        44.9 
_reflns.pdbx_redundancy              12.5 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.7 
_reflns_shell.d_res_low              2.8 
_reflns_shell.percent_possible_all   77.6 
_reflns_shell.Rmerge_I_obs           0.3200000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.9 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1027 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1KB6 
_refine.ls_number_reflns_obs                     11999 
_refine.ls_number_reflns_all                     11999 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               682827.51 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.ls_d_res_low                             50 
_refine.ls_d_res_high                            2.70 
_refine.ls_percent_reflns_obs                    89.1 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2230000 
_refine.ls_R_factor_R_free                       0.2750000 
_refine.ls_R_factor_R_free_error                 0.008 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.2 
_refine.ls_number_reflns_R_free                  1222 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               77.6 
_refine.aniso_B[1][1]                            22.99 
_refine.aniso_B[2][2]                            22.99 
_refine.aniso_B[3][3]                            -45.98 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.29935 
_refine.solvent_model_param_bsol                 43.1547 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1KB4' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD FUNCTION' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1KB6 
_refine_analyze.Luzzati_coordinate_error_obs    0.42 
_refine_analyze.Luzzati_sigma_a_obs             0.63 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.48 
_refine_analyze.Luzzati_sigma_a_free            0.81 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1501 
_refine_hist.pdbx_number_atoms_nucleic_acid   732 
_refine_hist.pdbx_number_atoms_ligand         4 
_refine_hist.number_atoms_solvent             34 
_refine_hist.number_atoms_total               2271 
_refine_hist.d_res_high                       2.70 
_refine_hist.d_res_low                        50 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.016 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.8   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      21.5  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      1.37  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.10  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            1.96  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             1.49  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            2.42  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   10 
_refine_ls_shell.d_res_high                       2.70 
_refine_ls_shell.d_res_low                        2.80 
_refine_ls_shell.number_reflns_R_work             723 
_refine_ls_shell.R_factor_R_work                  0.4200000 
_refine_ls_shell.percent_reflns_obs               61.2 
_refine_ls_shell.R_factor_R_free                  0.4770000 
_refine_ls_shell.R_factor_R_free_error            0.051 
_refine_ls_shell.percent_reflns_R_free            11.0 
_refine_ls_shell.number_reflns_R_free             89 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 DNA-RNA_REP.PARAM DNA-RNA.TOP 'X-RAY DIFFRACTION' 
3 WATER_REP.PARAM   WATER.TOP   'X-RAY DIFFRACTION' 
4 ION.PARAM         ION.TOP     'X-RAY DIFFRACTION' 
5 PARAM_ZN          ?           'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1KB6 
_struct.title                     'Crystal Structure of VDR DNA-binding Domain Bound to Rat Osteocalcin (OC) Response Element' 
_struct.pdbx_descriptor           'VITAMIN D3 RECEPTOR/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1KB6 
_struct_keywords.pdbx_keywords   TRANSCRIPTION/DNA 
_struct_keywords.text            'VDR, NUCLEAR RECEPTOR, PROTEIN-DNA COMPLEX, VITAMIN D, TRANSCRIPTION-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 4 ? 
F N N 4 ? 
G N N 4 ? 
H N N 4 ? 
I N N 5 ? 
J N N 5 ? 
K N N 5 ? 
L N N 5 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 CYS C 26 ? ARG C 39  ? CYS A 41  ARG A 54  1 ? 14 
HELX_P HELX_P2 2 CYS C 61 ? ILE C 72  ? CYS A 76  ILE A 87  1 ? 12 
HELX_P HELX_P3 3 MET C 75 ? ILE C 79  ? MET A 90  ILE A 94  5 ? 5  
HELX_P HELX_P4 4 THR C 81 ? LEU C 93  ? THR A 96  LEU A 108 1 ? 13 
HELX_P HELX_P5 5 CYS D 26 ? LYS D 40  ? CYS B 241 LYS B 255 1 ? 15 
HELX_P HELX_P6 6 ASP D 56 ? HIS D 60  ? ASP B 271 HIS B 275 5 ? 5  
HELX_P HELX_P7 7 CYS D 61 ? GLY D 73  ? CYS B 276 GLY B 288 1 ? 13 
HELX_P HELX_P8 8 MET D 75 ? ILE D 79  ? MET B 290 ILE B 294 5 ? 5  
HELX_P HELX_P9 9 THR D 81 ? LEU D 105 ? THR B 296 LEU B 320 1 ? 25 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? E ZN .  ZN ? ? ? 1_555 C CYS 9  SG ? ? A ZN 150 A CYS 24  1_555 ? ? ? ? ? ? ?            2.225 ? 
metalc2  metalc ? ? E ZN .  ZN ? ? ? 1_555 C CYS 12 SG ? ? A ZN 150 A CYS 27  1_555 ? ? ? ? ? ? ?            2.252 ? 
metalc3  metalc ? ? E ZN .  ZN ? ? ? 1_555 C CYS 29 SG ? ? A ZN 150 A CYS 44  1_555 ? ? ? ? ? ? ?            2.316 ? 
metalc4  metalc ? ? E ZN .  ZN ? ? ? 1_555 C CYS 26 SG ? ? A ZN 150 A CYS 41  1_555 ? ? ? ? ? ? ?            2.367 ? 
metalc5  metalc ? ? F ZN .  ZN ? ? ? 1_555 C CYS 45 SG ? ? A ZN 151 A CYS 60  1_555 ? ? ? ? ? ? ?            2.177 ? 
metalc6  metalc ? ? F ZN .  ZN ? ? ? 1_555 C CYS 64 SG ? ? A ZN 151 A CYS 79  1_555 ? ? ? ? ? ? ?            2.217 ? 
metalc7  metalc ? ? F ZN .  ZN ? ? ? 1_555 C CYS 51 SG ? ? A ZN 151 A CYS 66  1_555 ? ? ? ? ? ? ?            2.297 ? 
metalc8  metalc ? ? F ZN .  ZN ? ? ? 1_555 C CYS 61 SG ? ? A ZN 151 A CYS 76  1_555 ? ? ? ? ? ? ?            2.261 ? 
metalc9  metalc ? ? G ZN .  ZN ? ? ? 1_555 D CYS 12 SG ? ? B ZN 350 B CYS 227 1_555 ? ? ? ? ? ? ?            2.206 ? 
metalc10 metalc ? ? G ZN .  ZN ? ? ? 1_555 D CYS 29 SG ? ? B ZN 350 B CYS 244 1_555 ? ? ? ? ? ? ?            2.425 ? 
metalc11 metalc ? ? G ZN .  ZN ? ? ? 1_555 D CYS 26 SG ? ? B ZN 350 B CYS 241 1_555 ? ? ? ? ? ? ?            2.362 ? 
metalc12 metalc ? ? G ZN .  ZN ? ? ? 1_555 D CYS 9  SG ? ? B ZN 350 B CYS 224 1_555 ? ? ? ? ? ? ?            2.223 ? 
metalc13 metalc ? ? H ZN .  ZN ? ? ? 1_555 D CYS 51 SG ? ? B ZN 351 B CYS 266 1_555 ? ? ? ? ? ? ?            2.422 ? 
metalc14 metalc ? ? H ZN .  ZN ? ? ? 1_555 D CYS 64 SG ? ? B ZN 351 B CYS 279 1_555 ? ? ? ? ? ? ?            2.418 ? 
metalc15 metalc ? ? H ZN .  ZN ? ? ? 1_555 D CYS 61 SG ? ? B ZN 351 B CYS 276 1_555 ? ? ? ? ? ? ?            2.366 ? 
metalc16 metalc ? ? H ZN .  ZN ? ? ? 1_555 D CYS 45 SG ? ? B ZN 351 B CYS 260 1_555 ? ? ? ? ? ? ?            2.265 ? 
hydrog1  hydrog ? ? A DC 1  N3 ? ? ? 1_555 B DG  18 N1 ? ? C DC 401 D DG  436 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? A DC 1  N4 ? ? ? 1_555 B DG  18 O6 ? ? C DC 401 D DG  436 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? A DC 1  O2 ? ? ? 1_555 B DG  18 N2 ? ? C DC 401 D DG  436 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? A DA 2  N1 ? ? ? 1_555 B DT  17 N3 ? ? C DA 402 D DT  435 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? A DA 2  N6 ? ? ? 1_555 B DT  17 O4 ? ? C DA 402 D DT  435 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? A DC 3  N3 ? ? ? 1_555 B DG  16 N1 ? ? C DC 403 D DG  434 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? A DC 3  N4 ? ? ? 1_555 B DG  16 O6 ? ? C DC 403 D DG  434 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? A DC 3  O2 ? ? ? 1_555 B DG  16 N2 ? ? C DC 403 D DG  434 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? A DG 4  N1 ? ? ? 1_555 B DC  15 N3 ? ? C DG 404 D DC  433 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? A DG 4  N2 ? ? ? 1_555 B DC  15 O2 ? ? C DG 404 D DC  433 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? A DG 4  O6 ? ? ? 1_555 B DC  15 N4 ? ? C DG 404 D DC  433 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? A DG 5  N1 ? ? ? 1_555 B DC  14 N3 ? ? C DG 405 D DC  432 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? A DG 5  N2 ? ? ? 1_555 B DC  14 O2 ? ? C DG 405 D DC  432 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? A DG 5  O6 ? ? ? 1_555 B DC  14 N4 ? ? C DG 405 D DC  432 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? A DG 6  N1 ? ? ? 1_555 B DC  13 N3 ? ? C DG 406 D DC  431 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? A DG 6  N2 ? ? ? 1_555 B DC  13 O2 ? ? C DG 406 D DC  431 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? A DG 6  O6 ? ? ? 1_555 B DC  13 N4 ? ? C DG 406 D DC  431 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? A DT 7  N3 ? ? ? 1_555 B DA  12 N1 ? ? C DT 407 D DA  430 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? A DT 7  O4 ? ? ? 1_555 B DA  12 N6 ? ? C DT 407 D DA  430 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? A DG 8  N1 ? ? ? 1_555 B DC  11 N3 ? ? C DG 408 D DC  429 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? A DG 8  N2 ? ? ? 1_555 B DC  11 O2 ? ? C DG 408 D DC  429 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? A DG 8  O6 ? ? ? 1_555 B DC  11 N4 ? ? C DG 408 D DC  429 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? A DA 9  N1 ? ? ? 1_555 B DT  10 N3 ? ? C DA 409 D DT  428 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? A DA 9  N6 ? ? ? 1_555 B DT  10 O4 ? ? C DA 409 D DT  428 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? A DA 10 N1 ? ? ? 1_555 B DT  9  N3 ? ? C DA 410 D DT  427 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? A DA 10 N6 ? ? ? 1_555 B DT  9  O4 ? ? C DA 410 D DT  427 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? A DT 11 N3 ? ? ? 1_555 B DA  8  N1 ? ? C DT 411 D DA  426 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? A DT 11 O4 ? ? ? 1_555 B DA  8  N6 ? ? C DT 411 D DA  426 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? A DG 12 N1 ? ? ? 1_555 B DC  7  N3 ? ? C DG 412 D DC  425 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? A DG 12 N2 ? ? ? 1_555 B DC  7  O2 ? ? C DG 412 D DC  425 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? A DG 12 O6 ? ? ? 1_555 B DC  7  N4 ? ? C DG 412 D DC  425 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? A DA 13 N1 ? ? ? 1_555 B DT  6  N3 ? ? C DA 413 D DT  424 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? A DA 13 N6 ? ? ? 1_555 B DT  6  O4 ? ? C DA 413 D DT  424 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? A DG 14 N1 ? ? ? 1_555 B DC  5  N3 ? ? C DG 414 D DC  423 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? A DG 14 N2 ? ? ? 1_555 B DC  5  O2 ? ? C DG 414 D DC  423 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? A DG 14 O6 ? ? ? 1_555 B DC  5  N4 ? ? C DG 414 D DC  423 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? A DG 15 N1 ? ? ? 1_555 B DC  4  N3 ? ? C DG 415 D DC  422 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ? ? A DG 15 N2 ? ? ? 1_555 B DC  4  O2 ? ? C DG 415 D DC  422 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ? ? A DG 15 O6 ? ? ? 1_555 B DC  4  N4 ? ? C DG 415 D DC  422 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ? ? A DA 16 N1 ? ? ? 1_555 B DT  3  N3 ? ? C DA 416 D DT  421 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ? ? A DA 16 N6 ? ? ? 1_555 B DT  3  O4 ? ? C DA 416 D DT  421 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ? ? A DC 17 N3 ? ? ? 1_555 B DG  2  N1 ? ? C DC 417 D DG  420 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ? ? A DC 17 N4 ? ? ? 1_555 B DG  2  O6 ? ? C DC 417 D DG  420 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ? ? A DC 17 O2 ? ? ? 1_555 B DG  2  N2 ? ? C DC 417 D DG  420 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45 hydrog ? ? A DA 18 N1 ? ? ? 1_555 B DT  1  N3 ? ? C DA 418 D DT  419 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46 hydrog ? ? A DA 18 N6 ? ? ? 1_555 B DT  1  O4 ? ? C DA 418 D DT  419 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLY C 18 ? HIS C 20 ? GLY A 33  HIS A 35  
A 2 ALA C 23 ? THR C 25 ? ALA A 38  THR A 40  
B 1 GLY D 18 ? HIS D 20 ? GLY B 233 HIS B 235 
B 2 ALA D 23 ? THR D 25 ? ALA B 238 THR B 240 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLY C 18 ? N GLY A 33  O THR C 25 ? O THR A 40  
B 1 2 N HIS D 20 ? N HIS B 235 O ALA D 23 ? O ALA B 238 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 150' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 151' 
AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN B 350' 
AC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN B 351' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 CYS C 9  ? CYS A 24  . ? 1_555 ? 
2  AC1 4 CYS C 12 ? CYS A 27  . ? 1_555 ? 
3  AC1 4 CYS C 26 ? CYS A 41  . ? 1_555 ? 
4  AC1 4 CYS C 29 ? CYS A 44  . ? 1_555 ? 
5  AC2 4 CYS C 45 ? CYS A 60  . ? 1_555 ? 
6  AC2 4 CYS C 51 ? CYS A 66  . ? 1_555 ? 
7  AC2 4 CYS C 61 ? CYS A 76  . ? 1_555 ? 
8  AC2 4 CYS C 64 ? CYS A 79  . ? 1_555 ? 
9  AC3 4 CYS D 9  ? CYS B 224 . ? 1_555 ? 
10 AC3 4 CYS D 12 ? CYS B 227 . ? 1_555 ? 
11 AC3 4 CYS D 26 ? CYS B 241 . ? 1_555 ? 
12 AC3 4 CYS D 29 ? CYS B 244 . ? 1_555 ? 
13 AC4 4 CYS D 45 ? CYS B 260 . ? 1_555 ? 
14 AC4 4 CYS D 51 ? CYS B 266 . ? 1_555 ? 
15 AC4 4 CYS D 61 ? CYS B 276 . ? 1_555 ? 
16 AC4 4 CYS D 64 ? CYS B 279 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1KB6 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1KB6 
_atom_sites.fract_transf_matrix[1][1]   0.016353 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016353 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004136 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O  "O5'" . DC  A 1 1   ? -4.773  37.643 15.486 1.00 76.97  ? 401 DC  C "O5'" 1 
ATOM   2    C  "C5'" . DC  A 1 1   ? -5.539  36.867 14.540 1.00 78.56  ? 401 DC  C "C5'" 1 
ATOM   3    C  "C4'" . DC  A 1 1   ? -5.100  35.447 14.239 1.00 79.25  ? 401 DC  C "C4'" 1 
ATOM   4    O  "O4'" . DC  A 1 1   ? -3.822  35.441 13.551 1.00 78.91  ? 401 DC  C "O4'" 1 
ATOM   5    C  "C3'" . DC  A 1 1   ? -4.930  34.551 15.468 1.00 79.84  ? 401 DC  C "C3'" 1 
ATOM   6    O  "O3'" . DC  A 1 1   ? -5.461  33.241 15.265 1.00 81.49  ? 401 DC  C "O3'" 1 
ATOM   7    C  "C2'" . DC  A 1 1   ? -3.430  34.461 15.658 1.00 79.24  ? 401 DC  C "C2'" 1 
ATOM   8    C  "C1'" . DC  A 1 1   ? -2.897  34.611 14.242 1.00 78.03  ? 401 DC  C "C1'" 1 
ATOM   9    N  N1    . DC  A 1 1   ? -1.575  35.260 14.212 1.00 76.62  ? 401 DC  C N1    1 
ATOM   10   C  C2    . DC  A 1 1   ? -0.481  34.504 13.833 1.00 76.43  ? 401 DC  C C2    1 
ATOM   11   O  O2    . DC  A 1 1   ? -0.659  33.361 13.437 1.00 77.59  ? 401 DC  C O2    1 
ATOM   12   N  N3    . DC  A 1 1   ? 0.750   35.032 13.890 1.00 76.34  ? 401 DC  C N3    1 
ATOM   13   C  C4    . DC  A 1 1   ? 0.912   36.288 14.281 1.00 76.12  ? 401 DC  C C4    1 
ATOM   14   N  N4    . DC  A 1 1   ? 2.166   36.749 14.354 1.00 75.42  ? 401 DC  C N4    1 
ATOM   15   C  C5    . DC  A 1 1   ? -0.200  37.115 14.624 1.00 75.79  ? 401 DC  C C5    1 
ATOM   16   C  C6    . DC  A 1 1   ? -1.416  36.562 14.579 1.00 75.44  ? 401 DC  C C6    1 
ATOM   17   P  P     . DA  A 1 2   ? -5.534  32.225 16.521 1.00 82.96  ? 402 DA  C P     1 
ATOM   18   O  OP1   . DA  A 1 2   ? -6.667  31.249 16.390 1.00 81.42  ? 402 DA  C OP1   1 
ATOM   19   O  OP2   . DA  A 1 2   ? -5.351  33.012 17.779 1.00 83.31  ? 402 DA  C OP2   1 
ATOM   20   O  "O5'" . DA  A 1 2   ? -4.214  31.369 16.382 1.00 80.23  ? 402 DA  C "O5'" 1 
ATOM   21   C  "C5'" . DA  A 1 2   ? -4.203  30.249 15.544 1.00 75.62  ? 402 DA  C "C5'" 1 
ATOM   22   C  "C4'" . DA  A 1 2   ? -2.945  29.476 15.798 1.00 73.81  ? 402 DA  C "C4'" 1 
ATOM   23   O  "O4'" . DA  A 1 2   ? -1.840  30.404 15.738 1.00 73.45  ? 402 DA  C "O4'" 1 
ATOM   24   C  "C3'" . DA  A 1 2   ? -2.890  28.854 17.182 1.00 72.04  ? 402 DA  C "C3'" 1 
ATOM   25   O  "O3'" . DA  A 1 2   ? -2.239  27.611 17.002 1.00 69.68  ? 402 DA  C "O3'" 1 
ATOM   26   C  "C2'" . DA  A 1 2   ? -2.054  29.835 17.987 1.00 72.52  ? 402 DA  C "C2'" 1 
ATOM   27   C  "C1'" . DA  A 1 2   ? -1.108  30.389 16.945 1.00 73.53  ? 402 DA  C "C1'" 1 
ATOM   28   N  N9    . DA  A 1 2   ? -0.596  31.743 17.155 1.00 73.40  ? 402 DA  C N9    1 
ATOM   29   C  C8    . DA  A 1 2   ? -1.262  32.902 17.451 1.00 73.18  ? 402 DA  C C8    1 
ATOM   30   N  N7    . DA  A 1 2   ? -0.484  33.954 17.497 1.00 73.23  ? 402 DA  C N7    1 
ATOM   31   C  C5    . DA  A 1 2   ? 0.778   33.447 17.229 1.00 73.81  ? 402 DA  C C5    1 
ATOM   32   C  C6    . DA  A 1 2   ? 2.044   34.058 17.087 1.00 75.11  ? 402 DA  C C6    1 
ATOM   33   N  N6    . DA  A 1 2   ? 2.272   35.359 17.264 1.00 75.65  ? 402 DA  C N6    1 
ATOM   34   N  N1    . DA  A 1 2   ? 3.089   33.271 16.752 1.00 75.59  ? 402 DA  C N1    1 
ATOM   35   C  C2    . DA  A 1 2   ? 2.874   31.965 16.596 1.00 75.69  ? 402 DA  C C2    1 
ATOM   36   N  N3    . DA  A 1 2   ? 1.737   31.275 16.718 1.00 75.37  ? 402 DA  C N3    1 
ATOM   37   C  C4    . DA  A 1 2   ? 0.721   32.089 17.032 1.00 73.73  ? 402 DA  C C4    1 
ATOM   38   P  P     . DC  A 1 3   ? -2.363  26.484 18.106 1.00 68.63  ? 403 DC  C P     1 
ATOM   39   O  OP1   . DC  A 1 3   ? -2.151  25.186 17.414 1.00 67.15  ? 403 DC  C OP1   1 
ATOM   40   O  OP2   . DC  A 1 3   ? -3.583  26.702 18.923 1.00 66.74  ? 403 DC  C OP2   1 
ATOM   41   O  "O5'" . DC  A 1 3   ? -1.038  26.724 18.938 1.00 67.17  ? 403 DC  C "O5'" 1 
ATOM   42   C  "C5'" . DC  A 1 3   ? 0.189   26.324 18.366 1.00 63.85  ? 403 DC  C "C5'" 1 
ATOM   43   C  "C4'" . DC  A 1 3   ? 1.347   26.839 19.174 1.00 62.71  ? 403 DC  C "C4'" 1 
ATOM   44   O  "O4'" . DC  A 1 3   ? 1.355   28.278 19.132 1.00 63.73  ? 403 DC  C "O4'" 1 
ATOM   45   C  "C3'" . DC  A 1 3   ? 1.398   26.474 20.656 1.00 60.95  ? 403 DC  C "C3'" 1 
ATOM   46   O  "O3'" . DC  A 1 3   ? 2.690   25.989 20.956 1.00 60.38  ? 403 DC  C "O3'" 1 
ATOM   47   C  "C2'" . DC  A 1 3   ? 1.250   27.815 21.352 1.00 60.63  ? 403 DC  C "C2'" 1 
ATOM   48   C  "C1'" . DC  A 1 3   ? 1.911   28.691 20.346 1.00 61.91  ? 403 DC  C "C1'" 1 
ATOM   49   N  N1    . DC  A 1 3   ? 1.736   30.130 20.457 1.00 62.81  ? 403 DC  C N1    1 
ATOM   50   C  C2    . DC  A 1 3   ? 2.811   30.961 20.067 1.00 63.80  ? 403 DC  C C2    1 
ATOM   51   O  O2    . DC  A 1 3   ? 3.853   30.438 19.632 1.00 64.04  ? 403 DC  C O2    1 
ATOM   52   N  N3    . DC  A 1 3   ? 2.679   32.302 20.163 1.00 64.43  ? 403 DC  C N3    1 
ATOM   53   C  C4    . DC  A 1 3   ? 1.527   32.826 20.602 1.00 64.87  ? 403 DC  C C4    1 
ATOM   54   N  N4    . DC  A 1 3   ? 1.423   34.160 20.645 1.00 63.51  ? 403 DC  C N4    1 
ATOM   55   C  C5    . DC  A 1 3   ? 0.425   32.000 21.007 1.00 64.53  ? 403 DC  C C5    1 
ATOM   56   C  C6    . DC  A 1 3   ? 0.574   30.672 20.916 1.00 63.32  ? 403 DC  C C6    1 
ATOM   57   P  P     . DG  A 1 4   ? 2.878   24.477 21.466 1.00 61.99  ? 404 DG  C P     1 
ATOM   58   O  OP1   . DG  A 1 4   ? 2.512   23.552 20.383 1.00 61.62  ? 404 DG  C OP1   1 
ATOM   59   O  OP2   . DG  A 1 4   ? 2.204   24.339 22.789 1.00 61.44  ? 404 DG  C OP2   1 
ATOM   60   O  "O5'" . DG  A 1 4   ? 4.461   24.362 21.669 1.00 60.23  ? 404 DG  C "O5'" 1 
ATOM   61   C  "C5'" . DG  A 1 4   ? 5.067   24.916 22.806 1.00 58.08  ? 404 DG  C "C5'" 1 
ATOM   62   C  "C4'" . DG  A 1 4   ? 6.294   25.700 22.436 1.00 59.61  ? 404 DG  C "C4'" 1 
ATOM   63   O  "O4'" . DG  A 1 4   ? 5.845   26.839 21.694 1.00 59.51  ? 404 DG  C "O4'" 1 
ATOM   64   C  "C3'" . DG  A 1 4   ? 6.916   26.306 23.674 1.00 61.85  ? 404 DG  C "C3'" 1 
ATOM   65   O  "O3'" . DG  A 1 4   ? 8.017   25.642 24.163 1.00 62.38  ? 404 DG  C "O3'" 1 
ATOM   66   C  "C2'" . DG  A 1 4   ? 7.292   27.724 23.326 1.00 61.65  ? 404 DG  C "C2'" 1 
ATOM   67   C  "C1'" . DG  A 1 4   ? 6.531   28.022 22.077 1.00 61.19  ? 404 DG  C "C1'" 1 
ATOM   68   N  N9    . DG  A 1 4   ? 5.514   28.971 22.457 1.00 62.39  ? 404 DG  C N9    1 
ATOM   69   C  C8    . DG  A 1 4   ? 4.194   28.700 22.614 1.00 64.33  ? 404 DG  C C8    1 
ATOM   70   N  N7    . DG  A 1 4   ? 3.493   29.743 22.959 1.00 65.72  ? 404 DG  C N7    1 
ATOM   71   C  C5    . DG  A 1 4   ? 4.415   30.757 23.025 1.00 65.14  ? 404 DG  C C5    1 
ATOM   72   C  C6    . DG  A 1 4   ? 4.229   32.098 23.285 1.00 66.48  ? 404 DG  C C6    1 
ATOM   73   O  O6    . DG  A 1 4   ? 3.176   32.691 23.508 1.00 68.60  ? 404 DG  C O6    1 
ATOM   74   N  N1    . DG  A 1 4   ? 5.424   32.794 23.245 1.00 67.46  ? 404 DG  C N1    1 
ATOM   75   C  C2    . DG  A 1 4   ? 6.644   32.246 22.963 1.00 67.50  ? 404 DG  C C2    1 
ATOM   76   N  N2    . DG  A 1 4   ? 7.666   33.094 22.937 1.00 69.30  ? 404 DG  C N2    1 
ATOM   77   N  N3    . DG  A 1 4   ? 6.833   30.970 22.711 1.00 66.66  ? 404 DG  C N3    1 
ATOM   78   C  C4    . DG  A 1 4   ? 5.676   30.291 22.743 1.00 64.71  ? 404 DG  C C4    1 
ATOM   79   P  P     . DG  A 1 5   ? 8.099   25.485 25.728 1.00 64.55  ? 405 DG  C P     1 
ATOM   80   O  OP1   . DG  A 1 5   ? 8.682   24.143 26.032 1.00 62.27  ? 405 DG  C OP1   1 
ATOM   81   O  OP2   . DG  A 1 5   ? 6.720   25.822 26.162 1.00 62.51  ? 405 DG  C OP2   1 
ATOM   82   O  "O5'" . DG  A 1 5   ? 9.028   26.702 26.160 1.00 65.48  ? 405 DG  C "O5'" 1 
ATOM   83   C  "C5'" . DG  A 1 5   ? 10.023  27.210 25.275 1.00 69.42  ? 405 DG  C "C5'" 1 
ATOM   84   C  "C4'" . DG  A 1 5   ? 10.459  28.591 25.704 1.00 71.97  ? 405 DG  C "C4'" 1 
ATOM   85   O  "O4'" . DG  A 1 5   ? 9.428   29.543 25.362 1.00 72.34  ? 405 DG  C "O4'" 1 
ATOM   86   C  "C3'" . DG  A 1 5   ? 10.688  28.716 27.201 1.00 73.45  ? 405 DG  C "C3'" 1 
ATOM   87   O  "O3'" . DG  A 1 5   ? 11.875  29.403 27.529 1.00 76.17  ? 405 DG  C "O3'" 1 
ATOM   88   C  "C2'" . DG  A 1 5   ? 9.506   29.517 27.696 1.00 73.62  ? 405 DG  C "C2'" 1 
ATOM   89   C  "C1'" . DG  A 1 5   ? 9.067   30.310 26.486 1.00 72.80  ? 405 DG  C "C1'" 1 
ATOM   90   N  N9    . DG  A 1 5   ? 7.617   30.461 26.465 1.00 72.45  ? 405 DG  C N9    1 
ATOM   91   C  C8    . DG  A 1 5   ? 6.682   29.460 26.324 1.00 72.78  ? 405 DG  C C8    1 
ATOM   92   N  N7    . DG  A 1 5   ? 5.453   29.892 26.385 1.00 72.38  ? 405 DG  C N7    1 
ATOM   93   C  C5    . DG  A 1 5   ? 5.583   31.261 26.567 1.00 71.09  ? 405 DG  C C5    1 
ATOM   94   C  C6    . DG  A 1 5   ? 4.595   32.260 26.711 1.00 69.83  ? 405 DG  C C6    1 
ATOM   95   O  O6    . DG  A 1 5   ? 3.366   32.126 26.720 1.00 69.06  ? 405 DG  C O6    1 
ATOM   96   N  N1    . DG  A 1 5   ? 5.165   33.525 26.869 1.00 69.56  ? 405 DG  C N1    1 
ATOM   97   C  C2    . DG  A 1 5   ? 6.523   33.788 26.907 1.00 70.07  ? 405 DG  C C2    1 
ATOM   98   N  N2    . DG  A 1 5   ? 6.883   35.072 27.079 1.00 69.74  ? 405 DG  C N2    1 
ATOM   99   N  N3    . DG  A 1 5   ? 7.454   32.859 26.785 1.00 70.37  ? 405 DG  C N3    1 
ATOM   100  C  C4    . DG  A 1 5   ? 6.916   31.628 26.613 1.00 71.68  ? 405 DG  C C4    1 
ATOM   101  P  P     . DG  A 1 6   ? 12.333  29.448 29.075 1.00 79.88  ? 406 DG  C P     1 
ATOM   102  O  OP1   . DG  A 1 6   ? 13.810  29.597 29.128 1.00 80.61  ? 406 DG  C OP1   1 
ATOM   103  O  OP2   . DG  A 1 6   ? 11.702  28.283 29.783 1.00 78.25  ? 406 DG  C OP2   1 
ATOM   104  O  "O5'" . DG  A 1 6   ? 11.703  30.847 29.499 1.00 78.38  ? 406 DG  C "O5'" 1 
ATOM   105  C  "C5'" . DG  A 1 6   ? 11.798  31.937 28.593 1.00 77.67  ? 406 DG  C "C5'" 1 
ATOM   106  C  "C4'" . DG  A 1 6   ? 11.530  33.227 29.315 1.00 78.69  ? 406 DG  C "C4'" 1 
ATOM   107  O  "O4'" . DG  A 1 6   ? 10.143  33.586 29.156 1.00 77.96  ? 406 DG  C "O4'" 1 
ATOM   108  C  "C3'" . DG  A 1 6   ? 11.781  33.133 30.818 1.00 80.55  ? 406 DG  C "C3'" 1 
ATOM   109  O  "O3'" . DG  A 1 6   ? 12.214  34.432 31.299 1.00 85.15  ? 406 DG  C "O3'" 1 
ATOM   110  C  "C2'" . DG  A 1 6   ? 10.406  32.764 31.345 1.00 78.55  ? 406 DG  C "C2'" 1 
ATOM   111  C  "C1'" . DG  A 1 6   ? 9.490   33.562 30.419 1.00 76.68  ? 406 DG  C "C1'" 1 
ATOM   112  N  N9    . DG  A 1 6   ? 8.164   32.973 30.239 1.00 73.70  ? 406 DG  C N9    1 
ATOM   113  C  C8    . DG  A 1 6   ? 7.880   31.649 30.008 1.00 72.99  ? 406 DG  C C8    1 
ATOM   114  N  N7    . DG  A 1 6   ? 6.604   31.409 29.933 1.00 71.77  ? 406 DG  C N7    1 
ATOM   115  C  C5    . DG  A 1 6   ? 6.011   32.650 30.115 1.00 69.94  ? 406 DG  C C5    1 
ATOM   116  C  C6    . DG  A 1 6   ? 4.654   33.013 30.122 1.00 68.93  ? 406 DG  C C6    1 
ATOM   117  O  O6    . DG  A 1 6   ? 3.676   32.300 29.951 1.00 67.98  ? 406 DG  C O6    1 
ATOM   118  N  N1    . DG  A 1 6   ? 4.484   34.369 30.345 1.00 69.06  ? 406 DG  C N1    1 
ATOM   119  C  C2    . DG  A 1 6   ? 5.493   35.263 30.533 1.00 69.04  ? 406 DG  C C2    1 
ATOM   120  N  N2    . DG  A 1 6   ? 5.120   36.525 30.770 1.00 68.23  ? 406 DG  C N2    1 
ATOM   121  N  N3    . DG  A 1 6   ? 6.779   34.939 30.500 1.00 69.61  ? 406 DG  C N3    1 
ATOM   122  C  C4    . DG  A 1 6   ? 6.959   33.624 30.294 1.00 70.52  ? 406 DG  C C4    1 
ATOM   123  P  P     . DT  A 1 7   ? 12.837  34.611 32.798 1.00 87.73  ? 407 DT  C P     1 
ATOM   124  O  OP1   . DT  A 1 7   ? 14.310  34.826 32.604 1.00 86.98  ? 407 DT  C OP1   1 
ATOM   125  O  OP2   . DT  A 1 7   ? 12.381  33.505 33.724 1.00 86.04  ? 407 DT  C OP2   1 
ATOM   126  O  "O5'" . DT  A 1 7   ? 12.166  35.992 33.268 1.00 86.37  ? 407 DT  C "O5'" 1 
ATOM   127  C  "C5'" . DT  A 1 7   ? 11.332  36.753 32.376 1.00 86.65  ? 407 DT  C "C5'" 1 
ATOM   128  C  "C4'" . DT  A 1 7   ? 10.272  37.508 33.152 1.00 86.13  ? 407 DT  C "C4'" 1 
ATOM   129  O  "O4'" . DT  A 1 7   ? 8.908   37.023 32.986 1.00 84.69  ? 407 DT  C "O4'" 1 
ATOM   130  C  "C3'" . DT  A 1 7   ? 10.511  37.577 34.655 1.00 86.82  ? 407 DT  C "C3'" 1 
ATOM   131  O  "O3'" . DT  A 1 7   ? 10.165  38.905 35.068 1.00 89.02  ? 407 DT  C "O3'" 1 
ATOM   132  C  "C2'" . DT  A 1 7   ? 9.536   36.540 35.202 1.00 85.24  ? 407 DT  C "C2'" 1 
ATOM   133  C  "C1'" . DT  A 1 7   ? 8.346   36.707 34.263 1.00 83.59  ? 407 DT  C "C1'" 1 
ATOM   134  N  N1    . DT  A 1 7   ? 7.466   35.510 34.110 1.00 82.43  ? 407 DT  C N1    1 
ATOM   135  C  C2    . DT  A 1 7   ? 6.097   35.721 34.040 1.00 81.32  ? 407 DT  C C2    1 
ATOM   136  O  O2    . DT  A 1 7   ? 5.600   36.815 34.115 1.00 81.72  ? 407 DT  C O2    1 
ATOM   137  N  N3    . DT  A 1 7   ? 5.336   34.591 33.872 1.00 80.50  ? 407 DT  C N3    1 
ATOM   138  C  C4    . DT  A 1 7   ? 5.789   33.288 33.751 1.00 80.70  ? 407 DT  C C4    1 
ATOM   139  O  O4    . DT  A 1 7   ? 4.977   32.369 33.593 1.00 80.96  ? 407 DT  C O4    1 
ATOM   140  C  C5    . DT  A 1 7   ? 7.236   33.129 33.825 1.00 80.87  ? 407 DT  C C5    1 
ATOM   141  C  C7    . DT  A 1 7   ? 7.821   31.763 33.669 1.00 79.97  ? 407 DT  C C7    1 
ATOM   142  C  C6    . DT  A 1 7   ? 7.991   34.230 34.020 1.00 81.52  ? 407 DT  C C6    1 
ATOM   143  P  P     . DG  A 1 8   ? 10.828  39.546 36.393 1.00 90.41  ? 408 DG  C P     1 
ATOM   144  O  OP1   . DG  A 1 8   ? 11.361  40.856 35.918 1.00 89.65  ? 408 DG  C OP1   1 
ATOM   145  O  OP2   . DG  A 1 8   ? 11.723  38.582 37.119 1.00 88.98  ? 408 DG  C OP2   1 
ATOM   146  O  "O5'" . DG  A 1 8   ? 9.553   39.817 37.303 1.00 89.74  ? 408 DG  C "O5'" 1 
ATOM   147  C  "C5'" . DG  A 1 8   ? 8.401   40.447 36.745 1.00 90.20  ? 408 DG  C "C5'" 1 
ATOM   148  C  "C4'" . DG  A 1 8   ? 7.227   40.239 37.666 1.00 90.58  ? 408 DG  C "C4'" 1 
ATOM   149  O  "O4'" . DG  A 1 8   ? 6.645   38.930 37.453 1.00 90.87  ? 408 DG  C "O4'" 1 
ATOM   150  C  "C3'" . DG  A 1 8   ? 7.618   40.286 39.143 1.00 90.51  ? 408 DG  C "C3'" 1 
ATOM   151  O  "O3'" . DG  A 1 8   ? 6.525   40.868 39.858 1.00 91.00  ? 408 DG  C "O3'" 1 
ATOM   152  C  "C2'" . DG  A 1 8   ? 7.787   38.815 39.497 1.00 89.65  ? 408 DG  C "C2'" 1 
ATOM   153  C  "C1'" . DG  A 1 8   ? 6.660   38.202 38.675 1.00 89.13  ? 408 DG  C "C1'" 1 
ATOM   154  N  N9    . DG  A 1 8   ? 6.789   36.785 38.354 1.00 86.64  ? 408 DG  C N9    1 
ATOM   155  C  C8    . DG  A 1 8   ? 7.936   36.041 38.391 1.00 86.75  ? 408 DG  C C8    1 
ATOM   156  N  N7    . DG  A 1 8   ? 7.750   34.795 38.051 1.00 86.24  ? 408 DG  C N7    1 
ATOM   157  C  C5    . DG  A 1 8   ? 6.396   34.710 37.775 1.00 84.79  ? 408 DG  C C5    1 
ATOM   158  C  C6    . DG  A 1 8   ? 5.621   33.603 37.359 1.00 83.71  ? 408 DG  C C6    1 
ATOM   159  O  O6    . DG  A 1 8   ? 5.995   32.443 37.148 1.00 83.52  ? 408 DG  C O6    1 
ATOM   160  N  N1    . DG  A 1 8   ? 4.282   33.949 37.187 1.00 82.81  ? 408 DG  C N1    1 
ATOM   161  C  C2    . DG  A 1 8   ? 3.763   35.207 37.386 1.00 82.78  ? 408 DG  C C2    1 
ATOM   162  N  N2    . DG  A 1 8   ? 2.453   35.342 37.167 1.00 81.42  ? 408 DG  C N2    1 
ATOM   163  N  N3    . DG  A 1 8   ? 4.485   36.254 37.774 1.00 83.13  ? 408 DG  C N3    1 
ATOM   164  C  C4    . DG  A 1 8   ? 5.785   35.932 37.951 1.00 84.82  ? 408 DG  C C4    1 
ATOM   165  P  P     . DA  A 1 9   ? 6.771   41.610 41.266 1.00 91.45  ? 409 DA  C P     1 
ATOM   166  O  OP1   . DA  A 1 9   ? 7.407   42.911 40.941 1.00 92.19  ? 409 DA  C OP1   1 
ATOM   167  O  OP2   . DA  A 1 9   ? 7.400   40.703 42.278 1.00 89.62  ? 409 DA  C OP2   1 
ATOM   168  O  "O5'" . DA  A 1 9   ? 5.282   41.922 41.722 1.00 90.24  ? 409 DA  C "O5'" 1 
ATOM   169  C  "C5'" . DA  A 1 9   ? 4.226   42.062 40.758 1.00 88.99  ? 409 DA  C "C5'" 1 
ATOM   170  C  "C4'" . DA  A 1 9   ? 3.031   41.241 41.194 1.00 88.92  ? 409 DA  C "C4'" 1 
ATOM   171  O  "O4'" . DA  A 1 9   ? 3.260   39.834 40.919 1.00 87.92  ? 409 DA  C "O4'" 1 
ATOM   172  C  "C3'" . DA  A 1 9   ? 2.761   41.325 42.698 1.00 88.49  ? 409 DA  C "C3'" 1 
ATOM   173  O  "O3'" . DA  A 1 9   ? 1.365   41.243 42.970 1.00 89.76  ? 409 DA  C "O3'" 1 
ATOM   174  C  "C2'" . DA  A 1 9   ? 3.466   40.100 43.241 1.00 86.91  ? 409 DA  C "C2'" 1 
ATOM   175  C  "C1'" . DA  A 1 9   ? 3.187   39.103 42.143 1.00 85.99  ? 409 DA  C "C1'" 1 
ATOM   176  N  N9    . DA  A 1 9   ? 4.125   37.989 42.066 1.00 83.73  ? 409 DA  C N9    1 
ATOM   177  C  C8    . DA  A 1 9   ? 5.456   37.946 42.393 1.00 82.44  ? 409 DA  C C8    1 
ATOM   178  N  N7    . DA  A 1 9   ? 6.017   36.786 42.163 1.00 81.73  ? 409 DA  C N7    1 
ATOM   179  C  C5    . DA  A 1 9   ? 4.981   36.002 41.658 1.00 81.55  ? 409 DA  C C5    1 
ATOM   180  C  C6    . DA  A 1 9   ? 4.918   34.663 41.209 1.00 80.06  ? 409 DA  C C6    1 
ATOM   181  N  N6    . DA  A 1 9   ? 5.957   33.834 41.176 1.00 79.53  ? 409 DA  C N6    1 
ATOM   182  N  N1    . DA  A 1 9   ? 3.727   34.206 40.787 1.00 79.31  ? 409 DA  C N1    1 
ATOM   183  C  C2    . DA  A 1 9   ? 2.675   35.029 40.804 1.00 79.43  ? 409 DA  C C2    1 
ATOM   184  N  N3    . DA  A 1 9   ? 2.601   36.292 41.185 1.00 80.94  ? 409 DA  C N3    1 
ATOM   185  C  C4    . DA  A 1 9   ? 3.806   36.729 41.607 1.00 82.59  ? 409 DA  C C4    1 
ATOM   186  P  P     . DA  A 1 10  ? 0.835   41.365 44.498 1.00 93.29  ? 410 DA  C P     1 
ATOM   187  O  OP1   . DA  A 1 10  ? -0.210  42.431 44.460 1.00 92.97  ? 410 DA  C OP1   1 
ATOM   188  O  OP2   . DA  A 1 10  ? 1.935   41.448 45.517 1.00 90.80  ? 410 DA  C OP2   1 
ATOM   189  O  "O5'" . DA  A 1 10  ? 0.054   39.988 44.718 1.00 90.77  ? 410 DA  C "O5'" 1 
ATOM   190  C  "C5'" . DA  A 1 10  ? -0.937  39.581 43.774 1.00 86.44  ? 410 DA  C "C5'" 1 
ATOM   191  C  "C4'" . DA  A 1 10  ? -1.288  38.124 43.956 1.00 83.29  ? 410 DA  C "C4'" 1 
ATOM   192  O  "O4'" . DA  A 1 10  ? -0.137  37.298 43.671 1.00 82.67  ? 410 DA  C "O4'" 1 
ATOM   193  C  "C3'" . DA  A 1 10  ? -1.792  37.700 45.341 1.00 82.20  ? 410 DA  C "C3'" 1 
ATOM   194  O  "O3'" . DA  A 1 10  ? -2.957  36.865 45.141 1.00 79.56  ? 410 DA  C "O3'" 1 
ATOM   195  C  "C2'" . DA  A 1 10  ? -0.605  36.953 45.944 1.00 80.69  ? 410 DA  C "C2'" 1 
ATOM   196  C  "C1'" . DA  A 1 10  ? 0.035   36.353 44.709 1.00 80.59  ? 410 DA  C "C1'" 1 
ATOM   197  N  N9    . DA  A 1 10  ? 1.455   36.046 44.795 1.00 78.87  ? 410 DA  C N9    1 
ATOM   198  C  C8    . DA  A 1 10  ? 2.492   36.816 45.232 1.00 78.10  ? 410 DA  C C8    1 
ATOM   199  N  N7    . DA  A 1 10  ? 3.657   36.211 45.172 1.00 77.65  ? 410 DA  C N7    1 
ATOM   200  C  C5    . DA  A 1 10  ? 3.359   34.957 44.661 1.00 77.14  ? 410 DA  C C5    1 
ATOM   201  C  C6    . DA  A 1 10  ? 4.157   33.834 44.350 1.00 77.11  ? 410 DA  C C6    1 
ATOM   202  N  N6    . DA  A 1 10  ? 5.484   33.787 44.488 1.00 76.07  ? 410 DA  C N6    1 
ATOM   203  N  N1    . DA  A 1 10  ? 3.532   32.742 43.865 1.00 76.98  ? 410 DA  C N1    1 
ATOM   204  C  C2    . DA  A 1 10  ? 2.204   32.786 43.686 1.00 77.48  ? 410 DA  C C2    1 
ATOM   205  N  N3    . DA  A 1 10  ? 1.355   33.782 43.923 1.00 77.37  ? 410 DA  C N3    1 
ATOM   206  C  C4    . DA  A 1 10  ? 2.005   34.847 44.420 1.00 78.09  ? 410 DA  C C4    1 
ATOM   207  P  P     . DT  A 1 11  ? -3.888  36.441 46.379 1.00 77.18  ? 411 DT  C P     1 
ATOM   208  O  OP1   . DT  A 1 11  ? -5.277  36.846 46.081 1.00 76.41  ? 411 DT  C OP1   1 
ATOM   209  O  OP2   . DT  A 1 11  ? -3.223  36.857 47.645 1.00 75.55  ? 411 DT  C OP2   1 
ATOM   210  O  "O5'" . DT  A 1 11  ? -3.858  34.865 46.290 1.00 76.31  ? 411 DT  C "O5'" 1 
ATOM   211  C  "C5'" . DT  A 1 11  ? -2.622  34.220 46.111 1.00 73.53  ? 411 DT  C "C5'" 1 
ATOM   212  C  "C4'" . DT  A 1 11  ? -2.811  32.730 46.098 1.00 71.71  ? 411 DT  C "C4'" 1 
ATOM   213  O  "O4'" . DT  A 1 11  ? -1.496  32.217 45.847 1.00 72.56  ? 411 DT  C "O4'" 1 
ATOM   214  C  "C3'" . DT  A 1 11  ? -3.252  32.147 47.432 1.00 70.23  ? 411 DT  C "C3'" 1 
ATOM   215  O  "O3'" . DT  A 1 11  ? -4.093  31.019 47.198 1.00 69.27  ? 411 DT  C "O3'" 1 
ATOM   216  C  "C2'" . DT  A 1 11  ? -1.945  31.827 48.138 1.00 70.44  ? 411 DT  C "C2'" 1 
ATOM   217  C  "C1'" . DT  A 1 11  ? -0.931  31.655 47.009 1.00 71.90  ? 411 DT  C "C1'" 1 
ATOM   218  N  N1    . DT  A 1 11  ? 0.390   32.289 47.202 1.00 72.19  ? 411 DT  C N1    1 
ATOM   219  C  C2    . DT  A 1 11  ? 1.503   31.508 46.965 1.00 72.96  ? 411 DT  C C2    1 
ATOM   220  O  O2    . DT  A 1 11  ? 1.435   30.380 46.534 1.00 73.85  ? 411 DT  C O2    1 
ATOM   221  N  N3    . DT  A 1 11  ? 2.708   32.104 47.238 1.00 73.02  ? 411 DT  C N3    1 
ATOM   222  C  C4    . DT  A 1 11  ? 2.910   33.392 47.690 1.00 74.01  ? 411 DT  C C4    1 
ATOM   223  O  O4    . DT  A 1 11  ? 4.056   33.794 47.909 1.00 74.25  ? 411 DT  C O4    1 
ATOM   224  C  C5    . DT  A 1 11  ? 1.695   34.185 47.877 1.00 74.09  ? 411 DT  C C5    1 
ATOM   225  C  C7    . DT  A 1 11  ? 1.832   35.605 48.340 1.00 72.69  ? 411 DT  C C7    1 
ATOM   226  C  C6    . DT  A 1 11  ? 0.507   33.597 47.622 1.00 72.40  ? 411 DT  C C6    1 
ATOM   227  P  P     . DG  A 1 12  ? -4.859  30.332 48.422 1.00 68.23  ? 412 DG  C P     1 
ATOM   228  O  OP1   . DG  A 1 12  ? -5.886  29.395 47.918 1.00 66.72  ? 412 DG  C OP1   1 
ATOM   229  O  OP2   . DG  A 1 12  ? -5.260  31.416 49.356 1.00 69.19  ? 412 DG  C OP2   1 
ATOM   230  O  "O5'" . DG  A 1 12  ? -3.683  29.500 49.099 1.00 68.05  ? 412 DG  C "O5'" 1 
ATOM   231  C  "C5'" . DG  A 1 12  ? -3.253  28.260 48.547 1.00 66.82  ? 412 DG  C "C5'" 1 
ATOM   232  C  "C4'" . DG  A 1 12  ? -2.122  27.680 49.368 1.00 68.24  ? 412 DG  C "C4'" 1 
ATOM   233  O  "O4'" . DG  A 1 12  ? -0.948  28.523 49.286 1.00 69.22  ? 412 DG  C "O4'" 1 
ATOM   234  C  "C3'" . DG  A 1 12  ? -2.376  27.486 50.870 1.00 68.88  ? 412 DG  C "C3'" 1 
ATOM   235  O  "O3'" . DG  A 1 12  ? -1.711  26.294 51.307 1.00 70.33  ? 412 DG  C "O3'" 1 
ATOM   236  C  "C2'" . DG  A 1 12  ? -1.663  28.671 51.485 1.00 67.89  ? 412 DG  C "C2'" 1 
ATOM   237  C  "C1'" . DG  A 1 12  ? -0.437  28.683 50.601 1.00 69.14  ? 412 DG  C "C1'" 1 
ATOM   238  N  N9    . DG  A 1 12  ? 0.378   29.887 50.638 1.00 68.79  ? 412 DG  C N9    1 
ATOM   239  C  C8    . DG  A 1 12  ? -0.055  31.167 50.839 1.00 69.17  ? 412 DG  C C8    1 
ATOM   240  N  N7    . DG  A 1 12  ? 0.911   32.043 50.838 1.00 69.02  ? 412 DG  C N7    1 
ATOM   241  C  C5    . DG  A 1 12  ? 2.057   31.291 50.625 1.00 70.30  ? 412 DG  C C5    1 
ATOM   242  C  C6    . DG  A 1 12  ? 3.456   31.691 50.532 1.00 71.20  ? 412 DG  C C6    1 
ATOM   243  O  O6    . DG  A 1 12  ? 3.964   32.822 50.652 1.00 71.12  ? 412 DG  C O6    1 
ATOM   244  N  N1    . DG  A 1 12  ? 4.280   30.602 50.286 1.00 71.00  ? 412 DG  C N1    1 
ATOM   245  C  C2    . DG  A 1 12  ? 3.856   29.312 50.159 1.00 70.63  ? 412 DG  C C2    1 
ATOM   246  N  N2    . DG  A 1 12  ? 4.832   28.438 49.933 1.00 70.81  ? 412 DG  C N2    1 
ATOM   247  N  N3    . DG  A 1 12  ? 2.577   28.918 50.250 1.00 70.00  ? 412 DG  C N3    1 
ATOM   248  C  C4    . DG  A 1 12  ? 1.741   29.956 50.485 1.00 69.60  ? 412 DG  C C4    1 
ATOM   249  P  P     . DA  A 1 13  ? -2.569  25.000 51.767 1.00 71.68  ? 413 DA  C P     1 
ATOM   250  O  OP1   . DA  A 1 13  ? -3.118  24.200 50.633 1.00 67.92  ? 413 DA  C OP1   1 
ATOM   251  O  OP2   . DA  A 1 13  ? -3.504  25.479 52.804 1.00 72.29  ? 413 DA  C OP2   1 
ATOM   252  O  "O5'" . DA  A 1 13  ? -1.446  24.126 52.469 1.00 70.64  ? 413 DA  C "O5'" 1 
ATOM   253  C  "C5'" . DA  A 1 13  ? -0.693  23.200 51.701 1.00 69.61  ? 413 DA  C "C5'" 1 
ATOM   254  C  "C4'" . DA  A 1 13  ? 0.762   23.189 52.125 1.00 67.07  ? 413 DA  C "C4'" 1 
ATOM   255  O  "O4'" . DA  A 1 13  ? 1.358   24.433 51.705 1.00 63.92  ? 413 DA  C "O4'" 1 
ATOM   256  C  "C3'" . DA  A 1 13  ? 0.986   23.124 53.626 1.00 66.86  ? 413 DA  C "C3'" 1 
ATOM   257  O  "O3'" . DA  A 1 13  ? 1.536   21.925 54.136 1.00 67.13  ? 413 DA  C "O3'" 1 
ATOM   258  C  "C2'" . DA  A 1 13  ? 2.001   24.207 53.901 1.00 66.54  ? 413 DA  C "C2'" 1 
ATOM   259  C  "C1'" . DA  A 1 13  ? 2.399   24.754 52.559 1.00 63.12  ? 413 DA  C "C1'" 1 
ATOM   260  N  N9    . DA  A 1 13  ? 2.368   26.181 52.734 1.00 62.04  ? 413 DA  C N9    1 
ATOM   261  C  C8    . DA  A 1 13  ? 1.247   26.937 52.843 1.00 61.45  ? 413 DA  C C8    1 
ATOM   262  N  N7    . DA  A 1 13  ? 1.484   28.175 53.191 1.00 61.75  ? 413 DA  C N7    1 
ATOM   263  C  C5    . DA  A 1 13  ? 2.866   28.250 53.262 1.00 60.38  ? 413 DA  C C5    1 
ATOM   264  C  C6    . DA  A 1 13  ? 3.749   29.306 53.558 1.00 59.91  ? 413 DA  C C6    1 
ATOM   265  N  N6    . DA  A 1 13  ? 3.368   30.548 53.853 1.00 56.96  ? 413 DA  C N6    1 
ATOM   266  N  N1    . DA  A 1 13  ? 5.069   29.036 53.521 1.00 60.85  ? 413 DA  C N1    1 
ATOM   267  C  C2    . DA  A 1 13  ? 5.469   27.795 53.179 1.00 60.96  ? 413 DA  C C2    1 
ATOM   268  N  N3    . DA  A 1 13  ? 4.734   26.728 52.873 1.00 60.97  ? 413 DA  C N3    1 
ATOM   269  C  C4    . DA  A 1 13  ? 3.425   27.027 52.942 1.00 61.44  ? 413 DA  C C4    1 
ATOM   270  P  P     . DG  A 1 14  ? 1.528   21.720 55.737 1.00 67.35  ? 414 DG  C P     1 
ATOM   271  O  OP1   . DG  A 1 14  ? 1.141   20.315 56.050 1.00 65.99  ? 414 DG  C OP1   1 
ATOM   272  O  OP2   . DG  A 1 14  ? 0.787   22.867 56.329 1.00 63.07  ? 414 DG  C OP2   1 
ATOM   273  O  "O5'" . DG  A 1 14  ? 3.042   21.931 56.158 1.00 67.66  ? 414 DG  C "O5'" 1 
ATOM   274  C  "C5'" . DG  A 1 14  ? 4.100   21.437 55.363 1.00 69.59  ? 414 DG  C "C5'" 1 
ATOM   275  C  "C4'" . DG  A 1 14  ? 5.401   22.031 55.836 1.00 70.02  ? 414 DG  C "C4'" 1 
ATOM   276  O  "O4'" . DG  A 1 14  ? 5.342   23.442 55.609 1.00 69.23  ? 414 DG  C "O4'" 1 
ATOM   277  C  "C3'" . DG  A 1 14  ? 5.634   21.875 57.330 1.00 70.97  ? 414 DG  C "C3'" 1 
ATOM   278  O  "O3'" . DG  A 1 14  ? 7.003   21.717 57.570 1.00 75.30  ? 414 DG  C "O3'" 1 
ATOM   279  C  "C2'" . DG  A 1 14  ? 5.196   23.195 57.920 1.00 69.18  ? 414 DG  C "C2'" 1 
ATOM   280  C  "C1'" . DG  A 1 14  ? 5.572   24.150 56.820 1.00 68.52  ? 414 DG  C "C1'" 1 
ATOM   281  N  N9    . DG  A 1 14  ? 4.755   25.357 56.770 1.00 67.47  ? 414 DG  C N9    1 
ATOM   282  C  C8    . DG  A 1 14  ? 3.406   25.418 56.534 1.00 67.87  ? 414 DG  C C8    1 
ATOM   283  N  N7    . DG  A 1 14  ? 2.940   26.634 56.539 1.00 67.74  ? 414 DG  C N7    1 
ATOM   284  C  C5    . DG  A 1 14  ? 4.050   27.425 56.798 1.00 66.24  ? 414 DG  C C5    1 
ATOM   285  C  C6    . DG  A 1 14  ? 4.160   28.825 56.929 1.00 65.05  ? 414 DG  C C6    1 
ATOM   286  O  O6    . DG  A 1 14  ? 3.268   29.668 56.851 1.00 63.28  ? 414 DG  C O6    1 
ATOM   287  N  N1    . DG  A 1 14  ? 5.475   29.216 57.182 1.00 64.61  ? 414 DG  C N1    1 
ATOM   288  C  C2    . DG  A 1 14  ? 6.546   28.363 57.295 1.00 65.09  ? 414 DG  C C2    1 
ATOM   289  N  N2    . DG  A 1 14  ? 7.740   28.921 57.541 1.00 63.19  ? 414 DG  C N2    1 
ATOM   290  N  N3    . DG  A 1 14  ? 6.450   27.049 57.176 1.00 66.61  ? 414 DG  C N3    1 
ATOM   291  C  C4    . DG  A 1 14  ? 5.180   26.652 56.937 1.00 66.69  ? 414 DG  C C4    1 
ATOM   292  P  P     . DG  A 1 15  ? 7.468   21.192 58.996 1.00 79.45  ? 415 DG  C P     1 
ATOM   293  O  OP1   . DG  A 1 15  ? 8.495   20.151 58.748 1.00 79.59  ? 415 DG  C OP1   1 
ATOM   294  O  OP2   . DG  A 1 15  ? 6.254   20.846 59.799 1.00 78.60  ? 415 DG  C OP2   1 
ATOM   295  O  "O5'" . DG  A 1 15  ? 8.174   22.479 59.594 1.00 79.21  ? 415 DG  C "O5'" 1 
ATOM   296  C  "C5'" . DG  A 1 15  ? 9.131   23.187 58.822 1.00 80.70  ? 415 DG  C "C5'" 1 
ATOM   297  C  "C4'" . DG  A 1 15  ? 9.693   24.325 59.636 1.00 81.58  ? 415 DG  C "C4'" 1 
ATOM   298  O  "O4'" . DG  A 1 15  ? 8.835   25.488 59.564 1.00 79.81  ? 415 DG  C "O4'" 1 
ATOM   299  C  "C3'" . DG  A 1 15  ? 9.800   23.971 61.116 1.00 82.66  ? 415 DG  C "C3'" 1 
ATOM   300  O  "O3'" . DG  A 1 15  ? 10.958  24.624 61.638 1.00 86.31  ? 415 DG  C "O3'" 1 
ATOM   301  C  "C2'" . DG  A 1 15  ? 8.515   24.542 61.692 1.00 79.52  ? 415 DG  C "C2'" 1 
ATOM   302  C  "C1'" . DG  A 1 15  ? 8.367   25.809 60.866 1.00 78.03  ? 415 DG  C "C1'" 1 
ATOM   303  N  N9    . DG  A 1 15  ? 7.022   26.372 60.739 1.00 75.22  ? 415 DG  C N9    1 
ATOM   304  C  C8    . DG  A 1 15  ? 5.821   25.705 60.626 1.00 74.17  ? 415 DG  C C8    1 
ATOM   305  N  N7    . DG  A 1 15  ? 4.798   26.506 60.502 1.00 72.41  ? 415 DG  C N7    1 
ATOM   306  C  C5    . DG  A 1 15  ? 5.354   27.774 60.551 1.00 71.87  ? 415 DG  C C5    1 
ATOM   307  C  C6    . DG  A 1 15  ? 4.744   29.043 60.486 1.00 70.95  ? 415 DG  C C6    1 
ATOM   308  O  O6    . DG  A 1 15  ? 3.557   29.318 60.382 1.00 69.29  ? 415 DG  C O6    1 
ATOM   309  N  N1    . DG  A 1 15  ? 5.679   30.066 60.570 1.00 71.16  ? 415 DG  C N1    1 
ATOM   310  C  C2    . DG  A 1 15  ? 7.027   29.889 60.712 1.00 71.07  ? 415 DG  C C2    1 
ATOM   311  N  N2    . DG  A 1 15  ? 7.749   31.004 60.791 1.00 70.99  ? 415 DG  C N2    1 
ATOM   312  N  N3    . DG  A 1 15  ? 7.615   28.712 60.778 1.00 71.43  ? 415 DG  C N3    1 
ATOM   313  C  C4    . DG  A 1 15  ? 6.725   27.705 60.694 1.00 72.81  ? 415 DG  C C4    1 
ATOM   314  P  P     . DA  A 1 16  ? 11.644  24.102 62.993 1.00 88.81  ? 416 DA  C P     1 
ATOM   315  O  OP1   . DA  A 1 16  ? 12.771  23.248 62.569 1.00 89.29  ? 416 DA  C OP1   1 
ATOM   316  O  OP2   . DA  A 1 16  ? 10.611  23.540 63.904 1.00 88.60  ? 416 DA  C OP2   1 
ATOM   317  O  "O5'" . DA  A 1 16  ? 12.220  25.468 63.570 1.00 89.51  ? 416 DA  C "O5'" 1 
ATOM   318  C  "C5'" . DA  A 1 16  ? 12.737  26.441 62.669 1.00 92.56  ? 416 DA  C "C5'" 1 
ATOM   319  C  "C4'" . DA  A 1 16  ? 12.799  27.799 63.327 1.00 95.19  ? 416 DA  C "C4'" 1 
ATOM   320  O  "O4'" . DA  A 1 16  ? 11.530  28.483 63.308 1.00 95.00  ? 416 DA  C "O4'" 1 
ATOM   321  C  "C3'" . DA  A 1 16  ? 13.231  27.766 64.784 1.00 97.49  ? 416 DA  C "C3'" 1 
ATOM   322  O  "O3'" . DA  A 1 16  ? 14.035  28.911 65.047 1.00 101.36 ? 416 DA  C "O3'" 1 
ATOM   323  C  "C2'" . DA  A 1 16  ? 11.918  27.814 65.544 1.00 95.93  ? 416 DA  C "C2'" 1 
ATOM   324  C  "C1'" . DA  A 1 16  ? 11.029  28.648 64.634 1.00 94.70  ? 416 DA  C "C1'" 1 
ATOM   325  N  N9    . DA  A 1 16  ? 9.646   28.194 64.607 1.00 93.29  ? 416 DA  C N9    1 
ATOM   326  C  C8    . DA  A 1 16  ? 9.202   26.900 64.622 1.00 92.34  ? 416 DA  C C8    1 
ATOM   327  N  N7    . DA  A 1 16  ? 7.910   26.786 64.462 1.00 92.04  ? 416 DA  C N7    1 
ATOM   328  C  C5    . DA  A 1 16  ? 7.472   28.095 64.362 1.00 91.71  ? 416 DA  C C5    1 
ATOM   329  C  C6    . DA  A 1 16  ? 6.207   28.643 64.159 1.00 91.45  ? 416 DA  C C6    1 
ATOM   330  N  N6    . DA  A 1 16  ? 5.110   27.905 63.988 1.00 91.53  ? 416 DA  C N6    1 
ATOM   331  N  N1    . DA  A 1 16  ? 6.103   29.987 64.124 1.00 91.52  ? 416 DA  C N1    1 
ATOM   332  C  C2    . DA  A 1 16  ? 7.217   30.717 64.276 1.00 91.78  ? 416 DA  C C2    1 
ATOM   333  N  N3    . DA  A 1 16  ? 8.471   30.312 64.459 1.00 91.97  ? 416 DA  C N3    1 
ATOM   334  C  C4    . DA  A 1 16  ? 8.528   28.974 64.488 1.00 92.09  ? 416 DA  C C4    1 
ATOM   335  P  P     . DC  A 1 17  ? 14.571  29.166 66.527 1.00 103.94 ? 417 DC  C P     1 
ATOM   336  O  OP1   . DC  A 1 17  ? 15.719  30.096 66.374 1.00 103.34 ? 417 DC  C OP1   1 
ATOM   337  O  OP2   . DC  A 1 17  ? 14.766  27.854 67.199 1.00 104.10 ? 417 DC  C OP2   1 
ATOM   338  O  "O5'" . DC  A 1 17  ? 13.341  29.915 67.201 1.00 104.61 ? 417 DC  C "O5'" 1 
ATOM   339  C  "C5'" . DC  A 1 17  ? 12.893  31.162 66.670 1.00 105.60 ? 417 DC  C "C5'" 1 
ATOM   340  C  "C4'" . DC  A 1 17  ? 11.831  31.757 67.563 1.00 105.94 ? 417 DC  C "C4'" 1 
ATOM   341  O  "O4'" . DC  A 1 17  ? 10.531  31.171 67.305 1.00 106.95 ? 417 DC  C "O4'" 1 
ATOM   342  C  "C3'" . DC  A 1 17  ? 12.092  31.568 69.060 1.00 105.60 ? 417 DC  C "C3'" 1 
ATOM   343  O  "O3'" . DC  A 1 17  ? 11.655  32.750 69.737 1.00 104.25 ? 417 DC  C "O3'" 1 
ATOM   344  C  "C2'" . DC  A 1 17  ? 11.186  30.401 69.416 1.00 105.67 ? 417 DC  C "C2'" 1 
ATOM   345  C  "C1'" . DC  A 1 17  ? 9.987   30.714 68.538 1.00 106.46 ? 417 DC  C "C1'" 1 
ATOM   346  N  N1    . DC  A 1 17  ? 9.074   29.595 68.258 1.00 106.22 ? 417 DC  C N1    1 
ATOM   347  C  C2    . DC  A 1 17  ? 7.722   29.881 67.993 1.00 105.62 ? 417 DC  C C2    1 
ATOM   348  O  O2    . DC  A 1 17  ? 7.343   31.059 68.004 1.00 104.71 ? 417 DC  C O2    1 
ATOM   349  N  N3    . DC  A 1 17  ? 6.871   28.871 67.738 1.00 105.31 ? 417 DC  C N3    1 
ATOM   350  C  C4    . DC  A 1 17  ? 7.313   27.613 67.749 1.00 105.99 ? 417 DC  C C4    1 
ATOM   351  N  N4    . DC  A 1 17  ? 6.427   26.633 67.499 1.00 106.17 ? 417 DC  C N4    1 
ATOM   352  C  C5    . DC  A 1 17  ? 8.682   27.293 68.017 1.00 106.24 ? 417 DC  C C5    1 
ATOM   353  C  C6    . DC  A 1 17  ? 9.519   28.306 68.260 1.00 106.06 ? 417 DC  C C6    1 
ATOM   354  P  P     . DA  A 1 18  ? 12.436  33.283 71.042 1.00 102.96 ? 418 DA  C P     1 
ATOM   355  O  OP1   . DA  A 1 18  ? 13.605  34.063 70.559 1.00 102.27 ? 418 DA  C OP1   1 
ATOM   356  O  OP2   . DA  A 1 18  ? 12.614  32.176 72.042 1.00 101.95 ? 418 DA  C OP2   1 
ATOM   357  O  "O5'" . DA  A 1 18  ? 11.396  34.333 71.622 1.00 101.02 ? 418 DA  C "O5'" 1 
ATOM   358  C  "C5'" . DA  A 1 18  ? 10.696  35.212 70.738 1.00 97.33  ? 418 DA  C "C5'" 1 
ATOM   359  C  "C4'" . DA  A 1 18  ? 9.313   35.488 71.278 1.00 95.00  ? 418 DA  C "C4'" 1 
ATOM   360  O  "O4'" . DA  A 1 18  ? 8.452   34.352 71.031 1.00 93.41  ? 418 DA  C "O4'" 1 
ATOM   361  C  "C3'" . DA  A 1 18  ? 9.275   35.719 72.789 1.00 93.91  ? 418 DA  C "C3'" 1 
ATOM   362  O  "O3'" . DA  A 1 18  ? 8.194   36.617 73.091 1.00 93.48  ? 418 DA  C "O3'" 1 
ATOM   363  C  "C2'" . DA  A 1 18  ? 8.957   34.333 73.321 1.00 92.45  ? 418 DA  C "C2'" 1 
ATOM   364  C  "C1'" . DA  A 1 18  ? 7.995   33.817 72.264 1.00 91.16  ? 418 DA  C "C1'" 1 
ATOM   365  N  N9    . DA  A 1 18  ? 7.940   32.367 72.112 1.00 88.72  ? 418 DA  C N9    1 
ATOM   366  C  C8    . DA  A 1 18  ? 8.960   31.465 72.273 1.00 87.64  ? 418 DA  C C8    1 
ATOM   367  N  N7    . DA  A 1 18  ? 8.621   30.230 72.007 1.00 86.71  ? 418 DA  C N7    1 
ATOM   368  C  C5    . DA  A 1 18  ? 7.278   30.321 71.660 1.00 86.42  ? 418 DA  C C5    1 
ATOM   369  C  C6    . DA  A 1 18  ? 6.343   29.359 71.263 1.00 85.80  ? 418 DA  C C6    1 
ATOM   370  N  N6    . DA  A 1 18  ? 6.628   28.063 71.170 1.00 85.07  ? 418 DA  C N6    1 
ATOM   371  N  N1    . DA  A 1 18  ? 5.093   29.779 70.971 1.00 85.09  ? 418 DA  C N1    1 
ATOM   372  C  C2    . DA  A 1 18  ? 4.806   31.076 71.096 1.00 85.23  ? 418 DA  C C2    1 
ATOM   373  N  N3    . DA  A 1 18  ? 5.593   32.077 71.472 1.00 86.44  ? 418 DA  C N3    1 
ATOM   374  C  C4    . DA  A 1 18  ? 6.839   31.628 71.736 1.00 87.32  ? 418 DA  C C4    1 
ATOM   375  O  "O5'" . DT  B 2 1   ? -3.722  25.872 71.232 1.00 77.46  ? 419 DT  D "O5'" 1 
ATOM   376  C  "C5'" . DT  B 2 1   ? -2.639  26.569 71.899 1.00 77.67  ? 419 DT  D "C5'" 1 
ATOM   377  C  "C4'" . DT  B 2 1   ? -2.671  28.060 71.654 1.00 76.21  ? 419 DT  D "C4'" 1 
ATOM   378  O  "O4'" . DT  B 2 1   ? -1.326  28.552 71.743 1.00 74.77  ? 419 DT  D "O4'" 1 
ATOM   379  C  "C3'" . DT  B 2 1   ? -3.144  28.474 70.265 1.00 77.14  ? 419 DT  D "C3'" 1 
ATOM   380  O  "O3'" . DT  B 2 1   ? -3.685  29.795 70.325 1.00 79.38  ? 419 DT  D "O3'" 1 
ATOM   381  C  "C2'" . DT  B 2 1   ? -1.864  28.467 69.448 1.00 75.86  ? 419 DT  D "C2'" 1 
ATOM   382  C  "C1'" . DT  B 2 1   ? -0.851  28.952 70.456 1.00 73.36  ? 419 DT  D "C1'" 1 
ATOM   383  N  N1    . DT  B 2 1   ? 0.482   28.373 70.306 1.00 70.81  ? 419 DT  D N1    1 
ATOM   384  C  C2    . DT  B 2 1   ? 1.573   29.207 70.439 1.00 69.72  ? 419 DT  D C2    1 
ATOM   385  O  O2    . DT  B 2 1   ? 1.480   30.429 70.545 1.00 68.75  ? 419 DT  D O2    1 
ATOM   386  N  N3    . DT  B 2 1   ? 2.786   28.552 70.434 1.00 68.17  ? 419 DT  D N3    1 
ATOM   387  C  C4    . DT  B 2 1   ? 2.998   27.195 70.268 1.00 66.80  ? 419 DT  D C4    1 
ATOM   388  O  O4    . DT  B 2 1   ? 4.127   26.737 70.308 1.00 65.40  ? 419 DT  D O4    1 
ATOM   389  C  C5    . DT  B 2 1   ? 1.824   26.411 70.055 1.00 67.27  ? 419 DT  D C5    1 
ATOM   390  C  C7    . DT  B 2 1   ? 1.986   24.947 69.795 1.00 66.80  ? 419 DT  D C7    1 
ATOM   391  C  C6    . DT  B 2 1   ? 0.636   27.026 70.090 1.00 68.33  ? 419 DT  D C6    1 
ATOM   392  P  P     . DG  B 2 2   ? -4.584  30.347 69.115 1.00 81.06  ? 420 DG  D P     1 
ATOM   393  O  OP1   . DG  B 2 2   ? -5.842  30.884 69.707 1.00 80.63  ? 420 DG  D OP1   1 
ATOM   394  O  OP2   . DG  B 2 2   ? -4.658  29.303 68.045 1.00 81.08  ? 420 DG  D OP2   1 
ATOM   395  O  "O5'" . DG  B 2 2   ? -3.718  31.543 68.507 1.00 80.47  ? 420 DG  D "O5'" 1 
ATOM   396  C  "C5'" . DG  B 2 2   ? -2.830  32.308 69.302 1.00 80.13  ? 420 DG  D "C5'" 1 
ATOM   397  C  "C4'" . DG  B 2 2   ? -1.726  32.888 68.445 1.00 81.01  ? 420 DG  D "C4'" 1 
ATOM   398  O  "O4'" . DG  B 2 2   ? -0.609  31.966 68.342 1.00 80.36  ? 420 DG  D "O4'" 1 
ATOM   399  C  "C3'" . DG  B 2 2   ? -2.102  33.258 67.010 1.00 82.11  ? 420 DG  D "C3'" 1 
ATOM   400  O  "O3'" . DG  B 2 2   ? -1.568  34.554 66.680 1.00 85.82  ? 420 DG  D "O3'" 1 
ATOM   401  C  "C2'" . DG  B 2 2   ? -1.422  32.160 66.189 1.00 80.86  ? 420 DG  D "C2'" 1 
ATOM   402  C  "C1'" . DG  B 2 2   ? -0.170  31.914 67.004 1.00 78.67  ? 420 DG  D "C1'" 1 
ATOM   403  N  N9    . DG  B 2 2   ? 0.604   30.685 66.829 1.00 76.37  ? 420 DG  D N9    1 
ATOM   404  C  C8    . DG  B 2 2   ? 0.160   29.419 66.518 1.00 76.17  ? 420 DG  D C8    1 
ATOM   405  N  N7    . DG  B 2 2   ? 1.114   28.517 66.529 1.00 74.81  ? 420 DG  D N7    1 
ATOM   406  C  C5    . DG  B 2 2   ? 2.258   29.237 66.849 1.00 76.21  ? 420 DG  D C5    1 
ATOM   407  C  C6    . DG  B 2 2   ? 3.623   28.807 67.035 1.00 76.18  ? 420 DG  D C6    1 
ATOM   408  O  O6    . DG  B 2 2   ? 4.095   27.662 66.966 1.00 76.09  ? 420 DG  D O6    1 
ATOM   409  N  N1    . DG  B 2 2   ? 4.461   29.881 67.338 1.00 75.85  ? 420 DG  D N1    1 
ATOM   410  C  C2    . DG  B 2 2   ? 4.054   31.194 67.440 1.00 76.21  ? 420 DG  D C2    1 
ATOM   411  N  N2    . DG  B 2 2   ? 5.008   32.094 67.697 1.00 76.30  ? 420 DG  D N2    1 
ATOM   412  N  N3    . DG  B 2 2   ? 2.800   31.600 67.290 1.00 76.60  ? 420 DG  D N3    1 
ATOM   413  C  C4    . DG  B 2 2   ? 1.962   30.580 67.005 1.00 76.58  ? 420 DG  D C4    1 
ATOM   414  P  P     . DT  B 2 3   ? -2.478  35.637 65.886 1.00 89.71  ? 421 DT  D P     1 
ATOM   415  O  OP1   . DT  B 2 3   ? -2.884  36.626 66.909 1.00 89.49  ? 421 DT  D OP1   1 
ATOM   416  O  OP2   . DT  B 2 3   ? -3.508  35.016 65.009 1.00 89.75  ? 421 DT  D OP2   1 
ATOM   417  O  "O5'" . DT  B 2 3   ? -1.461  36.331 64.889 1.00 90.21  ? 421 DT  D "O5'" 1 
ATOM   418  C  "C5'" . DT  B 2 3   ? -0.316  35.617 64.455 1.00 91.15  ? 421 DT  D "C5'" 1 
ATOM   419  C  "C4'" . DT  B 2 3   ? 0.921   36.198 65.097 1.00 90.81  ? 421 DT  D "C4'" 1 
ATOM   420  O  "O4'" . DT  B 2 3   ? 1.747   35.129 65.593 1.00 89.51  ? 421 DT  D "O4'" 1 
ATOM   421  C  "C3'" . DT  B 2 3   ? 1.785   36.969 64.116 1.00 91.21  ? 421 DT  D "C3'" 1 
ATOM   422  O  "O3'" . DT  B 2 3   ? 2.386   38.100 64.745 1.00 93.04  ? 421 DT  D "O3'" 1 
ATOM   423  C  "C2'" . DT  B 2 3   ? 2.785   35.933 63.629 1.00 89.21  ? 421 DT  D "C2'" 1 
ATOM   424  C  "C1'" . DT  B 2 3   ? 2.878   34.935 64.766 1.00 87.24  ? 421 DT  D "C1'" 1 
ATOM   425  N  N1    . DT  B 2 3   ? 2.878   33.518 64.365 1.00 84.08  ? 421 DT  D N1    1 
ATOM   426  C  C2    . DT  B 2 3   ? 4.075   32.879 64.334 1.00 83.22  ? 421 DT  D C2    1 
ATOM   427  O  O2    . DT  B 2 3   ? 5.119   33.449 64.519 1.00 84.26  ? 421 DT  D O2    1 
ATOM   428  N  N3    . DT  B 2 3   ? 4.019   31.550 64.069 1.00 81.33  ? 421 DT  D N3    1 
ATOM   429  C  C4    . DT  B 2 3   ? 2.912   30.811 63.815 1.00 80.17  ? 421 DT  D C4    1 
ATOM   430  O  O4    . DT  B 2 3   ? 3.020   29.610 63.635 1.00 78.33  ? 421 DT  D O4    1 
ATOM   431  C  C5    . DT  B 2 3   ? 1.680   31.551 63.799 1.00 80.89  ? 421 DT  D C5    1 
ATOM   432  C  C7    . DT  B 2 3   ? 0.412   30.827 63.482 1.00 81.21  ? 421 DT  D C7    1 
ATOM   433  C  C6    . DT  B 2 3   ? 1.721   32.858 64.070 1.00 81.69  ? 421 DT  D C6    1 
ATOM   434  P  P     . DC  B 2 4   ? 2.770   39.387 63.849 1.00 94.00  ? 422 DC  D P     1 
ATOM   435  O  OP1   . DC  B 2 4   ? 3.292   40.426 64.777 1.00 93.71  ? 422 DC  D OP1   1 
ATOM   436  O  OP2   . DC  B 2 4   ? 1.622   39.707 62.944 1.00 92.62  ? 422 DC  D OP2   1 
ATOM   437  O  "O5'" . DC  B 2 4   ? 4.001   38.846 63.003 1.00 92.44  ? 422 DC  D "O5'" 1 
ATOM   438  C  "C5'" . DC  B 2 4   ? 5.097   38.223 63.667 1.00 91.33  ? 422 DC  D "C5'" 1 
ATOM   439  C  "C4'" . DC  B 2 4   ? 5.992   37.551 62.658 1.00 90.59  ? 422 DC  D "C4'" 1 
ATOM   440  O  "O4'" . DC  B 2 4   ? 5.604   36.180 62.396 1.00 89.79  ? 422 DC  D "O4'" 1 
ATOM   441  C  "C3'" . DC  B 2 4   ? 6.057   38.244 61.296 1.00 90.85  ? 422 DC  D "C3'" 1 
ATOM   442  O  "O3'" . DC  B 2 4   ? 7.424   38.251 60.909 1.00 92.63  ? 422 DC  D "O3'" 1 
ATOM   443  C  "C2'" . DC  B 2 4   ? 5.254   37.323 60.388 1.00 88.97  ? 422 DC  D "C2'" 1 
ATOM   444  C  "C1'" . DC  B 2 4   ? 5.580   35.963 60.992 1.00 87.88  ? 422 DC  D "C1'" 1 
ATOM   445  N  N1    . DC  B 2 4   ? 4.630   34.871 60.726 1.00 85.89  ? 422 DC  D N1    1 
ATOM   446  C  C2    . DC  B 2 4   ? 5.070   33.541 60.882 1.00 84.50  ? 422 DC  D C2    1 
ATOM   447  O  O2    . DC  B 2 4   ? 6.235   33.331 61.199 1.00 83.90  ? 422 DC  D O2    1 
ATOM   448  N  N3    . DC  B 2 4   ? 4.211   32.528 60.674 1.00 83.72  ? 422 DC  D N3    1 
ATOM   449  C  C4    . DC  B 2 4   ? 2.956   32.790 60.315 1.00 83.86  ? 422 DC  D C4    1 
ATOM   450  N  N4    . DC  B 2 4   ? 2.141   31.758 60.131 1.00 83.39  ? 422 DC  D N4    1 
ATOM   451  C  C5    . DC  B 2 4   ? 2.480   34.131 60.131 1.00 84.10  ? 422 DC  D C5    1 
ATOM   452  C  C6    . DC  B 2 4   ? 3.343   35.130 60.344 1.00 84.72  ? 422 DC  D C6    1 
ATOM   453  P  P     . DC  B 2 5   ? 7.879   39.045 59.604 1.00 94.01  ? 423 DC  D P     1 
ATOM   454  O  OP1   . DC  B 2 5   ? 8.784   40.140 60.083 1.00 92.30  ? 423 DC  D OP1   1 
ATOM   455  O  OP2   . DC  B 2 5   ? 6.663   39.369 58.787 1.00 92.98  ? 423 DC  D OP2   1 
ATOM   456  O  "O5'" . DC  B 2 5   ? 8.777   37.945 58.900 1.00 92.88  ? 423 DC  D "O5'" 1 
ATOM   457  C  "C5'" . DC  B 2 5   ? 9.777   37.298 59.672 1.00 92.83  ? 423 DC  D "C5'" 1 
ATOM   458  C  "C4'" . DC  B 2 5   ? 10.250  36.051 58.970 1.00 91.76  ? 423 DC  D "C4'" 1 
ATOM   459  O  "O4'" . DC  B 2 5   ? 9.275   34.978 59.102 1.00 90.32  ? 423 DC  D "O4'" 1 
ATOM   460  C  "C3'" . DC  B 2 5   ? 10.454  36.276 57.474 1.00 91.02  ? 423 DC  D "C3'" 1 
ATOM   461  O  "O3'" . DC  B 2 5   ? 11.663  35.655 57.031 1.00 91.01  ? 423 DC  D "O3'" 1 
ATOM   462  C  "C2'" . DC  B 2 5   ? 9.246   35.596 56.864 1.00 90.28  ? 423 DC  D "C2'" 1 
ATOM   463  C  "C1'" . DC  B 2 5   ? 9.034   34.432 57.822 1.00 88.24  ? 423 DC  D "C1'" 1 
ATOM   464  N  N1    . DC  B 2 5   ? 7.659   33.894 57.771 1.00 85.50  ? 423 DC  D N1    1 
ATOM   465  C  C2    . DC  B 2 5   ? 7.479   32.501 57.743 1.00 83.20  ? 423 DC  D C2    1 
ATOM   466  O  O2    . DC  B 2 5   ? 8.473   31.771 57.895 1.00 81.48  ? 423 DC  D O2    1 
ATOM   467  N  N3    . DC  B 2 5   ? 6.230   32.000 57.551 1.00 81.23  ? 423 DC  D N3    1 
ATOM   468  C  C4    . DC  B 2 5   ? 5.192   32.834 57.405 1.00 80.78  ? 423 DC  D C4    1 
ATOM   469  N  N4    . DC  B 2 5   ? 3.992   32.316 57.159 1.00 78.31  ? 423 DC  D N4    1 
ATOM   470  C  C5    . DC  B 2 5   ? 5.341   34.248 57.495 1.00 81.73  ? 423 DC  D C5    1 
ATOM   471  C  C6    . DC  B 2 5   ? 6.577   34.732 57.688 1.00 84.04  ? 423 DC  D C6    1 
ATOM   472  P  P     . DT  B 2 6   ? 12.060  35.696 55.467 1.00 91.84  ? 424 DT  D P     1 
ATOM   473  O  OP1   . DT  B 2 6   ? 13.509  36.011 55.470 1.00 92.03  ? 424 DT  D OP1   1 
ATOM   474  O  OP2   . DT  B 2 6   ? 11.123  36.525 54.636 1.00 90.20  ? 424 DT  D OP2   1 
ATOM   475  O  "O5'" . DT  B 2 6   ? 11.927  34.166 55.057 1.00 90.41  ? 424 DT  D "O5'" 1 
ATOM   476  C  "C5'" . DT  B 2 6   ? 12.380  33.158 55.960 1.00 88.45  ? 424 DT  D "C5'" 1 
ATOM   477  C  "C4'" . DT  B 2 6   ? 12.496  31.842 55.236 1.00 87.90  ? 424 DT  D "C4'" 1 
ATOM   478  O  "O4'" . DT  B 2 6   ? 11.229  31.150 55.139 1.00 87.83  ? 424 DT  D "O4'" 1 
ATOM   479  C  "C3'" . DT  B 2 6   ? 12.954  32.028 53.808 1.00 87.76  ? 424 DT  D "C3'" 1 
ATOM   480  O  "O3'" . DT  B 2 6   ? 13.688  30.872 53.469 1.00 88.50  ? 424 DT  D "O3'" 1 
ATOM   481  C  "C2'" . DT  B 2 6   ? 11.648  32.120 53.038 1.00 86.87  ? 424 DT  D "C2'" 1 
ATOM   482  C  "C1'" . DT  B 2 6   ? 10.756  31.150 53.796 1.00 86.07  ? 424 DT  D "C1'" 1 
ATOM   483  N  N1    . DT  B 2 6   ? 9.318   31.504 53.837 1.00 84.87  ? 424 DT  D N1    1 
ATOM   484  C  C2    . DT  B 2 6   ? 8.396   30.472 53.825 1.00 84.04  ? 424 DT  D C2    1 
ATOM   485  O  O2    . DT  B 2 6   ? 8.706   29.298 53.775 1.00 83.83  ? 424 DT  D O2    1 
ATOM   486  N  N3    . DT  B 2 6   ? 7.091   30.869 53.878 1.00 83.36  ? 424 DT  D N3    1 
ATOM   487  C  C4    . DT  B 2 6   ? 6.612   32.161 53.941 1.00 84.19  ? 424 DT  D C4    1 
ATOM   488  O  O4    . DT  B 2 6   ? 5.394   32.359 53.970 1.00 84.24  ? 424 DT  D O4    1 
ATOM   489  C  C5    . DT  B 2 6   ? 7.626   33.199 53.962 1.00 84.24  ? 424 DT  D C5    1 
ATOM   490  C  C7    . DT  B 2 6   ? 7.193   34.631 54.062 1.00 84.06  ? 424 DT  D C7    1 
ATOM   491  C  C6    . DT  B 2 6   ? 8.913   32.823 53.899 1.00 84.17  ? 424 DT  D C6    1 
ATOM   492  P  P     . DC  B 2 7   ? 14.185  30.679 51.976 1.00 89.51  ? 425 DC  D P     1 
ATOM   493  O  OP1   . DC  B 2 7   ? 15.349  29.745 52.025 1.00 88.12  ? 425 DC  D OP1   1 
ATOM   494  O  OP2   . DC  B 2 7   ? 14.303  32.020 51.325 1.00 88.12  ? 425 DC  D OP2   1 
ATOM   495  O  "O5'" . DC  B 2 7   ? 12.958  29.931 51.317 1.00 89.03  ? 425 DC  D "O5'" 1 
ATOM   496  C  "C5'" . DC  B 2 7   ? 12.688  28.590 51.657 1.00 88.06  ? 425 DC  D "C5'" 1 
ATOM   497  C  "C4'" . DC  B 2 7   ? 11.731  28.018 50.649 1.00 87.06  ? 425 DC  D "C4'" 1 
ATOM   498  O  "O4'" . DC  B 2 7   ? 10.452  28.664 50.835 1.00 86.90  ? 425 DC  D "O4'" 1 
ATOM   499  C  "C3'" . DC  B 2 7   ? 12.151  28.324 49.213 1.00 86.68  ? 425 DC  D "C3'" 1 
ATOM   500  O  "O3'" . DC  B 2 7   ? 11.749  27.229 48.394 1.00 86.21  ? 425 DC  D "O3'" 1 
ATOM   501  C  "C2'" . DC  B 2 7   ? 11.358  29.579 48.891 1.00 86.85  ? 425 DC  D "C2'" 1 
ATOM   502  C  "C1'" . DC  B 2 7   ? 10.067  29.282 49.631 1.00 86.63  ? 425 DC  D "C1'" 1 
ATOM   503  N  N1    . DC  B 2 7   ? 9.172   30.399 49.956 1.00 86.53  ? 425 DC  D N1    1 
ATOM   504  C  C2    . DC  B 2 7   ? 7.796   30.128 50.134 1.00 86.99  ? 425 DC  D C2    1 
ATOM   505  O  O2    . DC  B 2 7   ? 7.396   28.955 50.067 1.00 86.59  ? 425 DC  D O2    1 
ATOM   506  N  N3    . DC  B 2 7   ? 6.947   31.145 50.394 1.00 87.02  ? 425 DC  D N3    1 
ATOM   507  C  C4    . DC  B 2 7   ? 7.416   32.385 50.516 1.00 87.05  ? 425 DC  D C4    1 
ATOM   508  N  N4    . DC  B 2 7   ? 6.543   33.351 50.791 1.00 87.01  ? 425 DC  D N4    1 
ATOM   509  C  C5    . DC  B 2 7   ? 8.807   32.687 50.363 1.00 86.75  ? 425 DC  D C5    1 
ATOM   510  C  C6    . DC  B 2 7   ? 9.641   31.672 50.079 1.00 86.64  ? 425 DC  D C6    1 
ATOM   511  P  P     . DA  B 2 8   ? 12.395  27.035 46.943 1.00 86.15  ? 426 DA  D P     1 
ATOM   512  O  OP1   . DA  B 2 8   ? 13.754  26.471 47.138 1.00 85.22  ? 426 DA  D OP1   1 
ATOM   513  O  OP2   . DA  B 2 8   ? 12.206  28.269 46.135 1.00 85.13  ? 426 DA  D OP2   1 
ATOM   514  O  "O5'" . DA  B 2 8   ? 11.477  25.908 46.301 1.00 85.30  ? 426 DA  D "O5'" 1 
ATOM   515  C  "C5'" . DA  B 2 8   ? 10.824  24.945 47.125 1.00 83.05  ? 426 DA  D "C5'" 1 
ATOM   516  C  "C4'" . DA  B 2 8   ? 9.391   24.749 46.678 1.00 80.27  ? 426 DA  D "C4'" 1 
ATOM   517  O  "O4'" . DA  B 2 8   ? 8.583   25.882 47.057 1.00 79.15  ? 426 DA  D "O4'" 1 
ATOM   518  C  "C3'" . DA  B 2 8   ? 9.144   24.539 45.187 1.00 78.97  ? 426 DA  D "C3'" 1 
ATOM   519  O  "O3'" . DA  B 2 8   ? 8.124   23.545 45.037 1.00 78.96  ? 426 DA  D "O3'" 1 
ATOM   520  C  "C2'" . DA  B 2 8   ? 8.652   25.900 44.730 1.00 77.58  ? 426 DA  D "C2'" 1 
ATOM   521  C  "C1'" . DA  B 2 8   ? 7.885   26.382 45.945 1.00 77.66  ? 426 DA  D "C1'" 1 
ATOM   522  N  N9    . DA  B 2 8   ? 7.780   27.825 46.129 1.00 77.11  ? 426 DA  D N9    1 
ATOM   523  C  C8    . DA  B 2 8   ? 8.785   28.748 46.196 1.00 77.75  ? 426 DA  D C8    1 
ATOM   524  N  N7    . DA  B 2 8   ? 8.369   29.968 46.442 1.00 77.89  ? 426 DA  D N7    1 
ATOM   525  C  C5    . DA  B 2 8   ? 6.995   29.836 46.522 1.00 77.33  ? 426 DA  D C5    1 
ATOM   526  C  C6    . DA  B 2 8   ? 5.972   30.761 46.767 1.00 77.19  ? 426 DA  D C6    1 
ATOM   527  N  N6    . DA  B 2 8   ? 6.178   32.048 46.982 1.00 77.28  ? 426 DA  D N6    1 
ATOM   528  N  N1    . DA  B 2 8   ? 4.706   30.308 46.785 1.00 77.85  ? 426 DA  D N1    1 
ATOM   529  C  C2    . DA  B 2 8   ? 4.495   29.009 46.561 1.00 77.96  ? 426 DA  D C2    1 
ATOM   530  N  N3    . DA  B 2 8   ? 5.375   28.040 46.319 1.00 77.75  ? 426 DA  D N3    1 
ATOM   531  C  C4    . DA  B 2 8   ? 6.620   28.526 46.317 1.00 77.43  ? 426 DA  D C4    1 
ATOM   532  P  P     . DT  B 2 9   ? 7.862   22.856 43.601 1.00 80.01  ? 427 DT  D P     1 
ATOM   533  O  OP1   . DT  B 2 9   ? 7.937   21.377 43.754 1.00 80.70  ? 427 DT  D OP1   1 
ATOM   534  O  OP2   . DT  B 2 9   ? 8.658   23.544 42.549 1.00 78.49  ? 427 DT  D OP2   1 
ATOM   535  O  "O5'" . DT  B 2 9   ? 6.347   23.205 43.325 1.00 77.39  ? 427 DT  D "O5'" 1 
ATOM   536  C  "C5'" . DT  B 2 9   ? 5.893   24.453 43.725 1.00 74.78  ? 427 DT  D "C5'" 1 
ATOM   537  C  "C4'" . DT  B 2 9   ? 4.421   24.575 43.490 1.00 73.04  ? 427 DT  D "C4'" 1 
ATOM   538  O  "O4'" . DT  B 2 9   ? 4.167   25.930 43.891 1.00 72.87  ? 427 DT  D "O4'" 1 
ATOM   539  C  "C3'" . DT  B 2 9   ? 3.998   24.474 42.028 1.00 72.93  ? 427 DT  D "C3'" 1 
ATOM   540  O  "O3'" . DT  B 2 9   ? 2.634   24.028 42.001 1.00 73.27  ? 427 DT  D "O3'" 1 
ATOM   541  C  "C2'" . DT  B 2 9   ? 4.184   25.894 41.526 1.00 72.29  ? 427 DT  D "C2'" 1 
ATOM   542  C  "C1'" . DT  B 2 9   ? 3.904   26.744 42.760 1.00 71.20  ? 427 DT  D "C1'" 1 
ATOM   543  N  N1    . DT  B 2 9   ? 4.706   27.975 42.902 1.00 68.84  ? 427 DT  D N1    1 
ATOM   544  C  C2    . DT  B 2 9   ? 4.029   29.169 43.113 1.00 69.17  ? 427 DT  D C2    1 
ATOM   545  O  O2    . DT  B 2 9   ? 2.815   29.263 43.226 1.00 68.00  ? 427 DT  D O2    1 
ATOM   546  N  N3    . DT  B 2 9   ? 4.828   30.262 43.197 1.00 69.45  ? 427 DT  D N3    1 
ATOM   547  C  C4    . DT  B 2 9   ? 6.199   30.308 43.102 1.00 69.90  ? 427 DT  D C4    1 
ATOM   548  O  O4    . DT  B 2 9   ? 6.773   31.397 43.191 1.00 70.58  ? 427 DT  D O4    1 
ATOM   549  C  C5    . DT  B 2 9   ? 6.850   29.024 42.892 1.00 69.00  ? 427 DT  D C5    1 
ATOM   550  C  C7    . DT  B 2 9   ? 8.338   28.986 42.748 1.00 67.59  ? 427 DT  D C7    1 
ATOM   551  C  C6    . DT  B 2 9   ? 6.077   27.933 42.818 1.00 67.92  ? 427 DT  D C6    1 
ATOM   552  P  P     . DT  B 2 10  ? 1.792   23.983 40.616 1.00 74.50  ? 428 DT  D P     1 
ATOM   553  O  OP1   . DT  B 2 10  ? 0.736   22.975 40.882 1.00 74.91  ? 428 DT  D OP1   1 
ATOM   554  O  OP2   . DT  B 2 10  ? 2.632   23.835 39.398 1.00 75.52  ? 428 DT  D OP2   1 
ATOM   555  O  "O5'" . DT  B 2 10  ? 1.116   25.422 40.553 1.00 71.77  ? 428 DT  D "O5'" 1 
ATOM   556  C  "C5'" . DT  B 2 10  ? 0.281   25.861 41.604 1.00 67.62  ? 428 DT  D "C5'" 1 
ATOM   557  C  "C4'" . DT  B 2 10  ? -0.397  27.144 41.218 1.00 65.45  ? 428 DT  D "C4'" 1 
ATOM   558  O  "O4'" . DT  B 2 10  ? 0.584   28.201 41.302 1.00 65.46  ? 428 DT  D "O4'" 1 
ATOM   559  C  "C3'" . DT  B 2 10  ? -0.935  27.158 39.784 1.00 65.29  ? 428 DT  D "C3'" 1 
ATOM   560  O  "O3'" . DT  B 2 10  ? -2.286  27.640 39.771 1.00 62.98  ? 428 DT  D "O3'" 1 
ATOM   561  C  "C2'" . DT  B 2 10  ? 0.029   28.084 39.028 1.00 65.89  ? 428 DT  D "C2'" 1 
ATOM   562  C  "C1'" . DT  B 2 10  ? 0.546   29.008 40.125 1.00 65.31  ? 428 DT  D "C1'" 1 
ATOM   563  N  N1    . DT  B 2 10  ? 1.895   29.604 39.952 1.00 64.86  ? 428 DT  D N1    1 
ATOM   564  C  C2    . DT  B 2 10  ? 2.072   30.966 40.202 1.00 64.51  ? 428 DT  D C2    1 
ATOM   565  O  O2    . DT  B 2 10  ? 1.164   31.747 40.455 1.00 63.32  ? 428 DT  D O2    1 
ATOM   566  N  N3    . DT  B 2 10  ? 3.376   31.375 40.147 1.00 64.79  ? 428 DT  D N3    1 
ATOM   567  C  C4    . DT  B 2 10  ? 4.494   30.594 39.878 1.00 65.58  ? 428 DT  D C4    1 
ATOM   568  O  O4    . DT  B 2 10  ? 5.617   31.074 39.949 1.00 67.24  ? 428 DT  D O4    1 
ATOM   569  C  C5    . DT  B 2 10  ? 4.233   29.233 39.558 1.00 65.09  ? 428 DT  D C5    1 
ATOM   570  C  C7    . DT  B 2 10  ? 5.391   28.359 39.198 1.00 65.41  ? 428 DT  D C7    1 
ATOM   571  C  C6    . DT  B 2 10  ? 2.962   28.804 39.602 1.00 64.73  ? 428 DT  D C6    1 
ATOM   572  P  P     . DC  B 2 11  ? -3.142  27.583 38.421 1.00 62.35  ? 429 DC  D P     1 
ATOM   573  O  OP1   . DC  B 2 11  ? -4.555  27.653 38.828 1.00 61.95  ? 429 DC  D OP1   1 
ATOM   574  O  OP2   . DC  B 2 11  ? -2.686  26.526 37.489 1.00 60.00  ? 429 DC  D OP2   1 
ATOM   575  O  "O5'" . DC  B 2 11  ? -2.833  28.980 37.777 1.00 62.22  ? 429 DC  D "O5'" 1 
ATOM   576  C  "C5'" . DC  B 2 11  ? -3.441  30.123 38.296 1.00 62.60  ? 429 DC  D "C5'" 1 
ATOM   577  C  "C4'" . DC  B 2 11  ? -3.065  31.314 37.462 1.00 64.55  ? 429 DC  D "C4'" 1 
ATOM   578  O  "O4'" . DC  B 2 11  ? -1.623  31.381 37.448 1.00 64.49  ? 429 DC  D "O4'" 1 
ATOM   579  C  "C3'" . DC  B 2 11  ? -3.486  31.275 35.994 1.00 66.52  ? 429 DC  D "C3'" 1 
ATOM   580  O  "O3'" . DC  B 2 11  ? -3.931  32.592 35.672 1.00 70.57  ? 429 DC  D "O3'" 1 
ATOM   581  C  "C2'" . DC  B 2 11  ? -2.183  30.962 35.256 1.00 65.28  ? 429 DC  D "C2'" 1 
ATOM   582  C  "C1'" . DC  B 2 11  ? -1.200  31.681 36.141 1.00 63.83  ? 429 DC  D "C1'" 1 
ATOM   583  N  N1    . DC  B 2 11  ? 0.205   31.356 36.092 1.00 62.55  ? 429 DC  D N1    1 
ATOM   584  C  C2    . DC  B 2 11  ? 1.106   32.366 36.369 1.00 63.10  ? 429 DC  D C2    1 
ATOM   585  O  O2    . DC  B 2 11  ? 0.680   33.528 36.440 1.00 63.93  ? 429 DC  D O2    1 
ATOM   586  N  N3    . DC  B 2 11  ? 2.420   32.072 36.525 1.00 62.00  ? 429 DC  D N3    1 
ATOM   587  C  C4    . DC  B 2 11  ? 2.836   30.824 36.342 1.00 61.91  ? 429 DC  D C4    1 
ATOM   588  N  N4    . DC  B 2 11  ? 4.115   30.554 36.529 1.00 59.40  ? 429 DC  D N4    1 
ATOM   589  C  C5    . DC  B 2 11  ? 1.943   29.787 35.968 1.00 63.11  ? 429 DC  D C5    1 
ATOM   590  C  C6    . DC  B 2 11  ? 0.640   30.097 35.855 1.00 63.16  ? 429 DC  D C6    1 
ATOM   591  P  P     . DA  B 2 12  ? -5.244  32.798 34.797 1.00 73.37  ? 430 DA  D P     1 
ATOM   592  O  OP1   . DA  B 2 12  ? -6.352  32.252 35.639 1.00 74.54  ? 430 DA  D OP1   1 
ATOM   593  O  OP2   . DA  B 2 12  ? -5.015  32.282 33.424 1.00 71.57  ? 430 DA  D OP2   1 
ATOM   594  O  "O5'" . DA  B 2 12  ? -5.383  34.376 34.712 1.00 73.76  ? 430 DA  D "O5'" 1 
ATOM   595  C  "C5'" . DA  B 2 12  ? -4.918  35.203 35.767 1.00 75.25  ? 430 DA  D "C5'" 1 
ATOM   596  C  "C4'" . DA  B 2 12  ? -4.098  36.338 35.204 1.00 77.63  ? 430 DA  D "C4'" 1 
ATOM   597  O  "O4'" . DA  B 2 12  ? -2.713  35.957 35.037 1.00 77.99  ? 430 DA  D "O4'" 1 
ATOM   598  C  "C3'" . DA  B 2 12  ? -4.553  36.870 33.849 1.00 79.38  ? 430 DA  D "C3'" 1 
ATOM   599  O  "O3'" . DA  B 2 12  ? -4.424  38.298 33.884 1.00 82.23  ? 430 DA  D "O3'" 1 
ATOM   600  C  "C2'" . DA  B 2 12  ? -3.588  36.210 32.865 1.00 78.38  ? 430 DA  D "C2'" 1 
ATOM   601  C  "C1'" . DA  B 2 12  ? -2.296  36.116 33.675 1.00 77.60  ? 430 DA  D "C1'" 1 
ATOM   602  N  N9    . DA  B 2 12  ? -1.435  34.970 33.363 1.00 75.47  ? 430 DA  D N9    1 
ATOM   603  C  C8    . DA  B 2 12  ? -1.860  33.731 32.955 1.00 75.11  ? 430 DA  D C8    1 
ATOM   604  N  N7    . DA  B 2 12  ? -0.895  32.839 32.876 1.00 75.55  ? 430 DA  D N7    1 
ATOM   605  C  C5    . DA  B 2 12  ? 0.252   33.548 33.227 1.00 73.44  ? 430 DA  D C5    1 
ATOM   606  C  C6    . DA  B 2 12  ? 1.605   33.163 33.361 1.00 71.90  ? 430 DA  D C6    1 
ATOM   607  N  N6    . DA  B 2 12  ? 2.051   31.921 33.208 1.00 69.62  ? 430 DA  D N6    1 
ATOM   608  N  N1    . DA  B 2 12  ? 2.492   34.117 33.691 1.00 72.49  ? 430 DA  D N1    1 
ATOM   609  C  C2    . DA  B 2 12  ? 2.048   35.355 33.903 1.00 72.29  ? 430 DA  D C2    1 
ATOM   610  N  N3    . DA  B 2 12  ? 0.803   35.834 33.836 1.00 72.92  ? 430 DA  D N3    1 
ATOM   611  C  C4    . DA  B 2 12  ? -0.060  34.871 33.490 1.00 73.44  ? 430 DA  D C4    1 
ATOM   612  P  P     . DC  B 2 13  ? -4.945  39.202 32.649 1.00 85.61  ? 431 DC  D P     1 
ATOM   613  O  OP1   . DC  B 2 13  ? -5.718  40.305 33.282 1.00 83.64  ? 431 DC  D OP1   1 
ATOM   614  O  OP2   . DC  B 2 13  ? -5.605  38.353 31.594 1.00 84.07  ? 431 DC  D OP2   1 
ATOM   615  O  "O5'" . DC  B 2 13  ? -3.564  39.765 32.075 1.00 82.15  ? 431 DC  D "O5'" 1 
ATOM   616  C  "C5'" . DC  B 2 13  ? -2.425  38.942 32.127 1.00 80.64  ? 431 DC  D "C5'" 1 
ATOM   617  C  "C4'" . DC  B 2 13  ? -1.213  39.655 31.602 1.00 80.46  ? 431 DC  D "C4'" 1 
ATOM   618  O  "O4'" . DC  B 2 13  ? -0.145  38.681 31.623 1.00 80.40  ? 431 DC  D "O4'" 1 
ATOM   619  C  "C3'" . DC  B 2 13  ? -1.309  40.126 30.152 1.00 81.68  ? 431 DC  D "C3'" 1 
ATOM   620  O  "O3'" . DC  B 2 13  ? -0.397  41.230 29.979 1.00 83.40  ? 431 DC  D "O3'" 1 
ATOM   621  C  "C2'" . DC  B 2 13  ? -0.817  38.920 29.376 1.00 80.52  ? 431 DC  D "C2'" 1 
ATOM   622  C  "C1'" . DC  B 2 13  ? 0.258   38.359 30.294 1.00 79.48  ? 431 DC  D "C1'" 1 
ATOM   623  N  N1    . DC  B 2 13  ? 0.404   36.893 30.202 1.00 77.64  ? 431 DC  D N1    1 
ATOM   624  C  C2    . DC  B 2 13  ? 1.600   36.314 30.592 1.00 76.15  ? 431 DC  D C2    1 
ATOM   625  O  O2    . DC  B 2 13  ? 2.493   37.039 31.011 1.00 75.60  ? 431 DC  D O2    1 
ATOM   626  N  N3    . DC  B 2 13  ? 1.752   34.984 30.496 1.00 75.65  ? 431 DC  D N3    1 
ATOM   627  C  C4    . DC  B 2 13  ? 0.759   34.231 30.032 1.00 75.97  ? 431 DC  D C4    1 
ATOM   628  N  N4    . DC  B 2 13  ? 0.948   32.922 29.973 1.00 76.65  ? 431 DC  D N4    1 
ATOM   629  C  C5    . DC  B 2 13  ? -0.478  34.788 29.616 1.00 76.18  ? 431 DC  D C5    1 
ATOM   630  C  C6    . DC  B 2 13  ? -0.616  36.111 29.723 1.00 77.03  ? 431 DC  D C6    1 
ATOM   631  P  P     . DC  B 2 14  ? -0.462  42.165 28.663 1.00 84.52  ? 432 DC  D P     1 
ATOM   632  O  OP1   . DC  B 2 14  ? -0.773  43.454 29.282 1.00 84.78  ? 432 DC  D OP1   1 
ATOM   633  O  OP2   . DC  B 2 14  ? -1.308  41.675 27.537 1.00 83.01  ? 432 DC  D OP2   1 
ATOM   634  O  "O5'" . DC  B 2 14  ? 1.056   42.161 28.195 1.00 82.72  ? 432 DC  D "O5'" 1 
ATOM   635  C  "C5'" . DC  B 2 14  ? 2.092   42.134 29.169 1.00 82.17  ? 432 DC  D "C5'" 1 
ATOM   636  C  "C4'" . DC  B 2 14  ? 3.311   41.446 28.605 1.00 82.65  ? 432 DC  D "C4'" 1 
ATOM   637  O  "O4'" . DC  B 2 14  ? 3.264   40.001 28.804 1.00 81.46  ? 432 DC  D "O4'" 1 
ATOM   638  C  "C3'" . DC  B 2 14  ? 3.442   41.672 27.095 1.00 83.23  ? 432 DC  D "C3'" 1 
ATOM   639  O  "O3'" . DC  B 2 14  ? 4.807   41.866 26.688 1.00 85.06  ? 432 DC  D "O3'" 1 
ATOM   640  C  "C2'" . DC  B 2 14  ? 2.999   40.345 26.530 1.00 82.44  ? 432 DC  D "C2'" 1 
ATOM   641  C  "C1'" . DC  B 2 14  ? 3.603   39.407 27.562 1.00 80.73  ? 432 DC  D "C1'" 1 
ATOM   642  N  N1    . DC  B 2 14  ? 3.061   38.036 27.473 1.00 79.03  ? 432 DC  D N1    1 
ATOM   643  C  C2    . DC  B 2 14  ? 3.953   36.953 27.472 1.00 77.73  ? 432 DC  D C2    1 
ATOM   644  O  O2    . DC  B 2 14  ? 5.148   37.164 27.689 1.00 76.31  ? 432 DC  D O2    1 
ATOM   645  N  N3    . DC  B 2 14  ? 3.480   35.707 27.226 1.00 77.72  ? 432 DC  D N3    1 
ATOM   646  C  C4    . DC  B 2 14  ? 2.174   35.520 27.001 1.00 77.88  ? 432 DC  D C4    1 
ATOM   647  N  N4    . DC  B 2 14  ? 1.750   34.282 26.703 1.00 77.41  ? 432 DC  D N4    1 
ATOM   648  C  C5    . DC  B 2 14  ? 1.238   36.598 27.061 1.00 78.07  ? 432 DC  D C5    1 
ATOM   649  C  C6    . DC  B 2 14  ? 1.718   37.824 27.314 1.00 78.67  ? 432 DC  D C6    1 
ATOM   650  P  P     . DC  B 2 15  ? 5.126   42.501 25.229 1.00 86.51  ? 433 DC  D P     1 
ATOM   651  O  OP1   . DC  B 2 15  ? 5.556   43.896 25.509 1.00 87.00  ? 433 DC  D OP1   1 
ATOM   652  O  OP2   . DC  B 2 15  ? 3.981   42.248 24.287 1.00 85.23  ? 433 DC  D OP2   1 
ATOM   653  O  "O5'" . DC  B 2 15  ? 6.413   41.711 24.736 1.00 83.88  ? 433 DC  D "O5'" 1 
ATOM   654  C  "C5'" . DC  B 2 15  ? 7.464   41.430 25.645 1.00 82.21  ? 433 DC  D "C5'" 1 
ATOM   655  C  "C4'" . DC  B 2 15  ? 8.358   40.359 25.070 1.00 82.05  ? 433 DC  D "C4'" 1 
ATOM   656  O  "O4'" . DC  B 2 15  ? 7.726   39.048 25.108 1.00 81.31  ? 433 DC  D "O4'" 1 
ATOM   657  C  "C3'" . DC  B 2 15  ? 8.659   40.626 23.606 1.00 81.98  ? 433 DC  D "C3'" 1 
ATOM   658  O  "O3'" . DC  B 2 15  ? 10.002  40.237 23.342 1.00 82.23  ? 433 DC  D "O3'" 1 
ATOM   659  C  "C2'" . DC  B 2 15  ? 7.634   39.770 22.876 1.00 80.82  ? 433 DC  D "C2'" 1 
ATOM   660  C  "C1'" . DC  B 2 15  ? 7.548   38.557 23.792 1.00 79.47  ? 433 DC  D "C1'" 1 
ATOM   661  N  N1    . DC  B 2 15  ? 6.288   37.805 23.756 1.00 76.90  ? 433 DC  D N1    1 
ATOM   662  C  C2    . DC  B 2 15  ? 6.356   36.416 23.598 1.00 75.81  ? 433 DC  D C2    1 
ATOM   663  O  O2    . DC  B 2 15  ? 7.479   35.880 23.506 1.00 74.87  ? 433 DC  D O2    1 
ATOM   664  N  N3    . DC  B 2 15  ? 5.206   35.697 23.547 1.00 74.66  ? 433 DC  D N3    1 
ATOM   665  C  C4    . DC  B 2 15  ? 4.026   36.321 23.642 1.00 74.54  ? 433 DC  D C4    1 
ATOM   666  N  N4    . DC  B 2 15  ? 2.922   35.577 23.578 1.00 72.01  ? 433 DC  D N4    1 
ATOM   667  C  C5    . DC  B 2 15  ? 3.932   37.741 23.806 1.00 74.85  ? 433 DC  D C5    1 
ATOM   668  C  C6    . DC  B 2 15  ? 5.078   38.434 23.864 1.00 75.77  ? 433 DC  D C6    1 
ATOM   669  P  P     . DG  B 2 16  ? 10.640  40.566 21.918 1.00 83.13  ? 434 DG  D P     1 
ATOM   670  O  OP1   . DG  B 2 16  ? 12.100  40.717 22.162 1.00 82.90  ? 434 DG  D OP1   1 
ATOM   671  O  OP2   . DG  B 2 16  ? 9.874   41.630 21.234 1.00 81.67  ? 434 DG  D OP2   1 
ATOM   672  O  "O5'" . DG  B 2 16  ? 10.481  39.200 21.152 1.00 82.84  ? 434 DG  D "O5'" 1 
ATOM   673  C  "C5'" . DG  B 2 16  ? 11.188  38.073 21.645 1.00 82.38  ? 434 DG  D "C5'" 1 
ATOM   674  C  "C4'" . DG  B 2 16  ? 11.118  36.965 20.640 1.00 81.67  ? 434 DG  D "C4'" 1 
ATOM   675  O  "O4'" . DG  B 2 16  ? 9.827   36.318 20.716 1.00 81.37  ? 434 DG  D "O4'" 1 
ATOM   676  C  "C3'" . DG  B 2 16  ? 11.247  37.501 19.225 1.00 81.45  ? 434 DG  D "C3'" 1 
ATOM   677  O  "O3'" . DG  B 2 16  ? 11.997  36.552 18.513 1.00 82.74  ? 434 DG  D "O3'" 1 
ATOM   678  C  "C2'" . DG  B 2 16  ? 9.808   37.577 18.749 1.00 80.57  ? 434 DG  D "C2'" 1 
ATOM   679  C  "C1'" . DG  B 2 16  ? 9.162   36.409 19.469 1.00 79.66  ? 434 DG  D "C1'" 1 
ATOM   680  N  N9    . DG  B 2 16  ? 7.735   36.559 19.743 1.00 78.21  ? 434 DG  D N9    1 
ATOM   681  C  C8    . DG  B 2 16  ? 7.052   37.722 20.013 1.00 76.68  ? 434 DG  D C8    1 
ATOM   682  N  N7    . DG  B 2 16  ? 5.774   37.534 20.208 1.00 75.71  ? 434 DG  D N7    1 
ATOM   683  C  C5    . DG  B 2 16  ? 5.597   36.163 20.053 1.00 75.91  ? 434 DG  D C5    1 
ATOM   684  C  C6    . DG  B 2 16  ? 4.414   35.356 20.136 1.00 75.24  ? 434 DG  D C6    1 
ATOM   685  O  O6    . DG  B 2 16  ? 3.253   35.704 20.354 1.00 75.01  ? 434 DG  D O6    1 
ATOM   686  N  N1    . DG  B 2 16  ? 4.695   34.013 19.932 1.00 74.90  ? 434 DG  D N1    1 
ATOM   687  C  C2    . DG  B 2 16  ? 5.932   33.498 19.687 1.00 75.07  ? 434 DG  D C2    1 
ATOM   688  N  N2    . DG  B 2 16  ? 5.964   32.200 19.549 1.00 73.67  ? 434 DG  D N2    1 
ATOM   689  N  N3    . DG  B 2 16  ? 7.045   34.218 19.594 1.00 76.27  ? 434 DG  D N3    1 
ATOM   690  C  C4    . DG  B 2 16  ? 6.801   35.542 19.781 1.00 77.08  ? 434 DG  D C4    1 
ATOM   691  P  P     . DT  B 2 17  ? 12.116  36.650 16.932 1.00 83.67  ? 435 DT  D P     1 
ATOM   692  O  OP1   . DT  B 2 17  ? 13.580  36.670 16.722 1.00 84.06  ? 435 DT  D OP1   1 
ATOM   693  O  OP2   . DT  B 2 17  ? 11.277  37.739 16.378 1.00 83.30  ? 435 DT  D OP2   1 
ATOM   694  O  "O5'" . DT  B 2 17  ? 11.569  35.225 16.474 1.00 82.84  ? 435 DT  D "O5'" 1 
ATOM   695  C  "C5'" . DT  B 2 17  ? 12.128  34.047 17.054 1.00 80.68  ? 435 DT  D "C5'" 1 
ATOM   696  C  "C4'" . DT  B 2 17  ? 11.471  32.806 16.500 1.00 80.46  ? 435 DT  D "C4'" 1 
ATOM   697  O  "O4'" . DT  B 2 17  ? 10.072  32.831 16.826 1.00 79.88  ? 435 DT  D "O4'" 1 
ATOM   698  C  "C3'" . DT  B 2 17  ? 11.547  32.573 14.996 1.00 80.95  ? 435 DT  D "C3'" 1 
ATOM   699  O  "O3'" . DT  B 2 17  ? 11.751  31.162 14.790 1.00 82.49  ? 435 DT  D "O3'" 1 
ATOM   700  C  "C2'" . DT  B 2 17  ? 10.204  33.087 14.506 1.00 79.53  ? 435 DT  D "C2'" 1 
ATOM   701  C  "C1'" . DT  B 2 17  ? 9.279   32.777 15.670 1.00 78.56  ? 435 DT  D "C1'" 1 
ATOM   702  N  N1    . DT  B 2 17  ? 8.161   33.715 15.877 1.00 77.62  ? 435 DT  D N1    1 
ATOM   703  C  C2    . DT  B 2 17  ? 6.896   33.180 16.001 1.00 77.95  ? 435 DT  D C2    1 
ATOM   704  O  O2    . DT  B 2 17  ? 6.667   31.989 15.898 1.00 79.13  ? 435 DT  D O2    1 
ATOM   705  N  N3    . DT  B 2 17  ? 5.909   34.083 16.242 1.00 77.52  ? 435 DT  D N3    1 
ATOM   706  C  C4    . DT  B 2 17  ? 6.048   35.435 16.361 1.00 78.08  ? 435 DT  D C4    1 
ATOM   707  O  O4    . DT  B 2 17  ? 5.064   36.125 16.612 1.00 78.14  ? 435 DT  D O4    1 
ATOM   708  C  C5    . DT  B 2 17  ? 7.396   35.936 16.184 1.00 78.13  ? 435 DT  D C5    1 
ATOM   709  C  C7    . DT  B 2 17  ? 7.629   37.408 16.254 1.00 78.62  ? 435 DT  D C7    1 
ATOM   710  C  C6    . DT  B 2 17  ? 8.374   35.061 15.959 1.00 76.78  ? 435 DT  D C6    1 
ATOM   711  P  P     . DG  B 2 18  ? 11.568  30.508 13.329 1.00 83.99  ? 436 DG  D P     1 
ATOM   712  O  OP1   . DG  B 2 18  ? 12.130  29.136 13.406 1.00 83.03  ? 436 DG  D OP1   1 
ATOM   713  O  OP2   . DG  B 2 18  ? 12.001  31.418 12.218 1.00 84.09  ? 436 DG  D OP2   1 
ATOM   714  O  "O5'" . DG  B 2 18  ? 9.985   30.300 13.224 1.00 83.52  ? 436 DG  D "O5'" 1 
ATOM   715  C  "C5'" . DG  B 2 18  ? 9.359   29.222 13.914 1.00 80.84  ? 436 DG  D "C5'" 1 
ATOM   716  C  "C4'" . DG  B 2 18  ? 8.048   28.872 13.265 1.00 78.56  ? 436 DG  D "C4'" 1 
ATOM   717  O  "O4'" . DG  B 2 18  ? 7.125   29.954 13.518 1.00 77.60  ? 436 DG  D "O4'" 1 
ATOM   718  C  "C3'" . DG  B 2 18  ? 8.125   28.716 11.750 1.00 77.99  ? 436 DG  D "C3'" 1 
ATOM   719  O  "O3'" . DG  B 2 18  ? 7.206   27.772 11.184 1.00 78.09  ? 436 DG  D "O3'" 1 
ATOM   720  C  "C2'" . DG  B 2 18  ? 7.646   30.067 11.256 1.00 77.25  ? 436 DG  D "C2'" 1 
ATOM   721  C  "C1'" . DG  B 2 18  ? 6.600   30.426 12.293 1.00 75.85  ? 436 DG  D "C1'" 1 
ATOM   722  N  N9    . DG  B 2 18  ? 6.375   31.856 12.428 1.00 73.38  ? 436 DG  D N9    1 
ATOM   723  C  C8    . DG  B 2 18  ? 7.322   32.837 12.358 1.00 73.00  ? 436 DG  D C8    1 
ATOM   724  N  N7    . DG  B 2 18  ? 6.838   34.032 12.540 1.00 72.62  ? 436 DG  D N7    1 
ATOM   725  C  C5    . DG  B 2 18  ? 5.490   33.822 12.742 1.00 73.03  ? 436 DG  D C5    1 
ATOM   726  C  C6    . DG  B 2 18  ? 4.454   34.755 13.023 1.00 74.42  ? 436 DG  D C6    1 
ATOM   727  O  O6    . DG  B 2 18  ? 4.544   36.002 13.167 1.00 74.40  ? 436 DG  D O6    1 
ATOM   728  N  N1    . DG  B 2 18  ? 3.212   34.114 13.156 1.00 74.11  ? 436 DG  D N1    1 
ATOM   729  C  C2    . DG  B 2 18  ? 3.009   32.756 13.047 1.00 73.30  ? 436 DG  D C2    1 
ATOM   730  N  N2    . DG  B 2 18  ? 1.743   32.341 13.225 1.00 72.20  ? 436 DG  D N2    1 
ATOM   731  N  N3    . DG  B 2 18  ? 3.983   31.877 12.789 1.00 73.02  ? 436 DG  D N3    1 
ATOM   732  C  C4    . DG  B 2 18  ? 5.185   32.481 12.658 1.00 72.76  ? 436 DG  D C4    1 
ATOM   733  N  N     . PRO C 3 6   ? -13.526 24.715 19.930 1.00 83.13  ? 21  PRO A N     1 
ATOM   734  C  CA    . PRO C 3 6   ? -14.268 24.675 21.252 1.00 82.82  ? 21  PRO A CA    1 
ATOM   735  C  C     . PRO C 3 6   ? -13.362 25.030 22.461 1.00 81.77  ? 21  PRO A C     1 
ATOM   736  O  O     . PRO C 3 6   ? -12.877 24.151 23.199 1.00 81.42  ? 21  PRO A O     1 
ATOM   737  C  CB    . PRO C 3 6   ? -14.900 23.281 21.391 1.00 82.85  ? 21  PRO A CB    1 
ATOM   738  C  CG    . PRO C 3 6   ? -14.206 22.479 20.176 1.00 83.64  ? 21  PRO A CG    1 
ATOM   739  C  CD    . PRO C 3 6   ? -13.837 23.529 19.106 1.00 82.99  ? 21  PRO A CD    1 
ATOM   740  N  N     . ARG C 3 7   ? -13.181 26.347 22.645 1.00 80.68  ? 22  ARG A N     1 
ATOM   741  C  CA    . ARG C 3 7   ? -12.339 26.966 23.688 1.00 78.63  ? 22  ARG A CA    1 
ATOM   742  C  C     . ARG C 3 7   ? -12.497 26.676 25.188 1.00 75.44  ? 22  ARG A C     1 
ATOM   743  O  O     . ARG C 3 7   ? -12.407 27.600 25.996 1.00 75.63  ? 22  ARG A O     1 
ATOM   744  C  CB    . ARG C 3 7   ? -12.329 28.488 23.492 1.00 79.38  ? 22  ARG A CB    1 
ATOM   745  C  CG    . ARG C 3 7   ? -11.789 28.917 22.123 1.00 81.30  ? 22  ARG A CG    1 
ATOM   746  C  CD    . ARG C 3 7   ? -10.331 29.439 22.167 1.00 83.68  ? 22  ARG A CD    1 
ATOM   747  N  NE    . ARG C 3 7   ? -9.703  29.451 20.836 1.00 85.34  ? 22  ARG A NE    1 
ATOM   748  C  CZ    . ARG C 3 7   ? -9.548  28.360 20.071 1.00 86.48  ? 22  ARG A CZ    1 
ATOM   749  N  NH1   . ARG C 3 7   ? -9.969  27.174 20.509 1.00 86.39  ? 22  ARG A NH1   1 
ATOM   750  N  NH2   . ARG C 3 7   ? -8.995  28.440 18.857 1.00 86.91  ? 22  ARG A NH2   1 
ATOM   751  N  N     . ILE C 3 8   ? -12.717 25.423 25.580 1.00 72.47  ? 23  ILE A N     1 
ATOM   752  C  CA    . ILE C 3 8   ? -12.761 25.146 27.010 1.00 70.47  ? 23  ILE A CA    1 
ATOM   753  C  C     . ILE C 3 8   ? -11.653 24.143 27.332 1.00 67.00  ? 23  ILE A C     1 
ATOM   754  O  O     . ILE C 3 8   ? -11.478 23.143 26.658 1.00 66.57  ? 23  ILE A O     1 
ATOM   755  C  CB    . ILE C 3 8   ? -14.158 24.659 27.491 1.00 70.59  ? 23  ILE A CB    1 
ATOM   756  C  CG1   . ILE C 3 8   ? -14.053 23.279 28.136 1.00 71.66  ? 23  ILE A CG1   1 
ATOM   757  C  CG2   . ILE C 3 8   ? -15.137 24.686 26.342 1.00 70.73  ? 23  ILE A CG2   1 
ATOM   758  C  CD1   . ILE C 3 8   ? -14.783 22.119 27.358 1.00 73.18  ? 23  ILE A CD1   1 
ATOM   759  N  N     . CYS C 3 9   ? -10.865 24.454 28.344 1.00 64.85  ? 24  CYS A N     1 
ATOM   760  C  CA    . CYS C 3 9   ? -9.764  23.577 28.714 1.00 61.42  ? 24  CYS A CA    1 
ATOM   761  C  C     . CYS C 3 9   ? -10.215 22.160 28.999 1.00 60.38  ? 24  CYS A C     1 
ATOM   762  O  O     . CYS C 3 9   ? -11.103 21.935 29.825 1.00 60.72  ? 24  CYS A O     1 
ATOM   763  C  CB    . CYS C 3 9   ? -9.021  24.139 29.938 1.00 61.16  ? 24  CYS A CB    1 
ATOM   764  S  SG    . CYS C 3 9   ? -7.771  23.035 30.648 1.00 59.00  ? 24  CYS A SG    1 
ATOM   765  N  N     . GLY C 3 10  ? -9.568  21.213 28.327 1.00 58.93  ? 25  GLY A N     1 
ATOM   766  C  CA    . GLY C 3 10  ? -9.863  19.801 28.477 1.00 56.48  ? 25  GLY A CA    1 
ATOM   767  C  C     . GLY C 3 10  ? -9.372  19.194 29.763 1.00 55.76  ? 25  GLY A C     1 
ATOM   768  O  O     . GLY C 3 10  ? -9.580  18.029 30.058 1.00 55.47  ? 25  GLY A O     1 
ATOM   769  N  N     . VAL C 3 11  ? -8.726  19.994 30.573 1.00 56.31  ? 26  VAL A N     1 
ATOM   770  C  CA    . VAL C 3 11  ? -8.196  19.454 31.794 1.00 57.72  ? 26  VAL A CA    1 
ATOM   771  C  C     . VAL C 3 11  ? -9.018  19.892 32.953 1.00 57.76  ? 26  VAL A C     1 
ATOM   772  O  O     . VAL C 3 11  ? -9.523  19.061 33.685 1.00 57.85  ? 26  VAL A O     1 
ATOM   773  C  CB    . VAL C 3 11  ? -6.680  19.871 31.981 1.00 57.16  ? 26  VAL A CB    1 
ATOM   774  C  CG1   . VAL C 3 11  ? -6.166  19.431 33.349 1.00 55.70  ? 26  VAL A CG1   1 
ATOM   775  C  CG2   . VAL C 3 11  ? -5.833  19.251 30.850 1.00 54.40  ? 26  VAL A CG2   1 
ATOM   776  N  N     . CYS C 3 12  ? -9.179  21.198 33.097 1.00 58.72  ? 27  CYS A N     1 
ATOM   777  C  CA    . CYS C 3 12  ? -9.935  21.739 34.211 1.00 60.24  ? 27  CYS A CA    1 
ATOM   778  C  C     . CYS C 3 12  ? -11.248 22.430 33.843 1.00 61.95  ? 27  CYS A C     1 
ATOM   779  O  O     . CYS C 3 12  ? -12.051 22.766 34.711 1.00 62.44  ? 27  CYS A O     1 
ATOM   780  C  CB    . CYS C 3 12  ? -9.079  22.730 34.963 1.00 59.09  ? 27  CYS A CB    1 
ATOM   781  S  SG    . CYS C 3 12  ? -8.828  24.162 34.012 1.00 57.11  ? 27  CYS A SG    1 
ATOM   782  N  N     . GLY C 3 13  ? -11.474 22.675 32.571 1.00 63.54  ? 28  GLY A N     1 
ATOM   783  C  CA    . GLY C 3 13  ? -12.720 23.321 32.241 1.00 65.13  ? 28  GLY A CA    1 
ATOM   784  C  C     . GLY C 3 13  ? -12.713 24.832 32.226 1.00 66.68  ? 28  GLY A C     1 
ATOM   785  O  O     . GLY C 3 13  ? -13.691 25.430 31.816 1.00 66.61  ? 28  GLY A O     1 
ATOM   786  N  N     . ASP C 3 14  ? -11.638 25.450 32.694 1.00 68.60  ? 29  ASP A N     1 
ATOM   787  C  CA    . ASP C 3 14  ? -11.505 26.906 32.662 1.00 70.66  ? 29  ASP A CA    1 
ATOM   788  C  C     . ASP C 3 14  ? -11.564 27.371 31.182 1.00 71.68  ? 29  ASP A C     1 
ATOM   789  O  O     . ASP C 3 14  ? -11.686 26.569 30.242 1.00 71.72  ? 29  ASP A O     1 
ATOM   790  C  CB    . ASP C 3 14  ? -10.153 27.299 33.276 1.00 71.83  ? 29  ASP A CB    1 
ATOM   791  C  CG    . ASP C 3 14  ? -10.086 28.753 33.683 1.00 73.58  ? 29  ASP A CG    1 
ATOM   792  O  OD1   . ASP C 3 14  ? -10.918 29.547 33.209 1.00 75.23  ? 29  ASP A OD1   1 
ATOM   793  O  OD2   . ASP C 3 14  ? -9.192  29.107 34.481 1.00 74.10  ? 29  ASP A OD2   1 
ATOM   794  N  N     . ARG C 3 15  ? -11.451 28.665 30.962 1.00 72.29  ? 30  ARG A N     1 
ATOM   795  C  CA    . ARG C 3 15  ? -11.529 29.171 29.612 1.00 74.33  ? 30  ARG A CA    1 
ATOM   796  C  C     . ARG C 3 15  ? -10.217 28.894 28.865 1.00 75.25  ? 30  ARG A C     1 
ATOM   797  O  O     . ARG C 3 15  ? -9.124  29.322 29.302 1.00 76.38  ? 30  ARG A O     1 
ATOM   798  C  CB    . ARG C 3 15  ? -11.854 30.656 29.684 1.00 75.75  ? 30  ARG A CB    1 
ATOM   799  C  CG    . ARG C 3 15  ? -12.447 31.209 28.427 1.00 78.99  ? 30  ARG A CG    1 
ATOM   800  C  CD    . ARG C 3 15  ? -11.359 31.783 27.551 1.00 81.83  ? 30  ARG A CD    1 
ATOM   801  N  NE    . ARG C 3 15  ? -10.650 32.902 28.181 1.00 83.97  ? 30  ARG A NE    1 
ATOM   802  C  CZ    . ARG C 3 15  ? -9.682  33.605 27.585 1.00 85.54  ? 30  ARG A CZ    1 
ATOM   803  N  NH1   . ARG C 3 15  ? -9.300  33.313 26.341 1.00 85.82  ? 30  ARG A NH1   1 
ATOM   804  N  NH2   . ARG C 3 15  ? -9.085  34.602 28.231 1.00 86.50  ? 30  ARG A NH2   1 
ATOM   805  N  N     . ALA C 3 16  ? -10.310 28.174 27.749 1.00 74.34  ? 31  ALA A N     1 
ATOM   806  C  CA    . ALA C 3 16  ? -9.097  27.834 26.994 1.00 74.08  ? 31  ALA A CA    1 
ATOM   807  C  C     . ALA C 3 16  ? -8.484  28.907 26.054 1.00 74.06  ? 31  ALA A C     1 
ATOM   808  O  O     . ALA C 3 16  ? -9.184  29.522 25.251 1.00 74.71  ? 31  ALA A O     1 
ATOM   809  C  CB    . ALA C 3 16  ? -9.335  26.524 26.205 1.00 73.48  ? 31  ALA A CB    1 
ATOM   810  N  N     . THR C 3 17  ? -7.169  29.114 26.127 1.00 73.18  ? 32  THR A N     1 
ATOM   811  C  CA    . THR C 3 17  ? -6.549  30.098 25.242 1.00 72.66  ? 32  THR A CA    1 
ATOM   812  C  C     . THR C 3 17  ? -6.072  29.484 23.927 1.00 72.28  ? 32  THR A C     1 
ATOM   813  O  O     . THR C 3 17  ? -5.577  30.191 23.050 1.00 72.60  ? 32  THR A O     1 
ATOM   814  C  CB    . THR C 3 17  ? -5.357  30.824 25.895 1.00 72.07  ? 32  THR A CB    1 
ATOM   815  O  OG1   . THR C 3 17  ? -4.295  29.901 26.099 1.00 72.48  ? 32  THR A OG1   1 
ATOM   816  C  CG2   . THR C 3 17  ? -5.743  31.432 27.226 1.00 72.41  ? 32  THR A CG2   1 
ATOM   817  N  N     . GLY C 3 18  ? -6.214  28.167 23.786 1.00 71.75  ? 33  GLY A N     1 
ATOM   818  C  CA    . GLY C 3 18  ? -5.812  27.503 22.548 1.00 69.68  ? 33  GLY A CA    1 
ATOM   819  C  C     . GLY C 3 18  ? -5.188  26.143 22.763 1.00 68.28  ? 33  GLY A C     1 
ATOM   820  O  O     . GLY C 3 18  ? -5.370  25.532 23.823 1.00 67.80  ? 33  GLY A O     1 
ATOM   821  N  N     . PHE C 3 19  ? -4.478  25.655 21.751 1.00 66.65  ? 34  PHE A N     1 
ATOM   822  C  CA    . PHE C 3 19  ? -3.771  24.391 21.876 1.00 65.15  ? 34  PHE A CA    1 
ATOM   823  C  C     . PHE C 3 19  ? -2.397  24.652 22.450 1.00 64.24  ? 34  PHE A C     1 
ATOM   824  O  O     . PHE C 3 19  ? -1.688  25.602 22.072 1.00 63.46  ? 34  PHE A O     1 
ATOM   825  C  CB    . PHE C 3 19  ? -3.548  23.720 20.557 1.00 66.38  ? 34  PHE A CB    1 
ATOM   826  C  CG    . PHE C 3 19  ? -4.733  23.043 20.030 1.00 68.16  ? 34  PHE A CG    1 
ATOM   827  C  CD1   . PHE C 3 19  ? -4.899  21.677 20.217 1.00 67.52  ? 34  PHE A CD1   1 
ATOM   828  C  CD2   . PHE C 3 19  ? -5.716  23.772 19.352 1.00 69.48  ? 34  PHE A CD2   1 
ATOM   829  C  CE1   . PHE C 3 19  ? -6.019  21.047 19.747 1.00 67.63  ? 34  PHE A CE1   1 
ATOM   830  C  CE2   . PHE C 3 19  ? -6.855  23.138 18.872 1.00 69.20  ? 34  PHE A CE2   1 
ATOM   831  C  CZ    . PHE C 3 19  ? -7.004  21.776 19.073 1.00 68.94  ? 34  PHE A CZ    1 
ATOM   832  N  N     . HIS C 3 20  ? -2.049  23.762 23.366 1.00 62.71  ? 35  HIS A N     1 
ATOM   833  C  CA    . HIS C 3 20  ? -0.805  23.781 24.073 1.00 60.86  ? 35  HIS A CA    1 
ATOM   834  C  C     . HIS C 3 20  ? -0.304  22.343 24.223 1.00 59.19  ? 35  HIS A C     1 
ATOM   835  O  O     . HIS C 3 20  ? -0.979  21.490 24.768 1.00 57.28  ? 35  HIS A O     1 
ATOM   836  C  CB    . HIS C 3 20  ? -1.022  24.493 25.404 1.00 61.39  ? 35  HIS A CB    1 
ATOM   837  C  CG    . HIS C 3 20  ? -1.351  25.939 25.235 1.00 64.25  ? 35  HIS A CG    1 
ATOM   838  N  ND1   . HIS C 3 20  ? -0.399  26.882 24.902 1.00 65.54  ? 35  HIS A ND1   1 
ATOM   839  C  CD2   . HIS C 3 20  ? -2.539  26.590 25.238 1.00 65.10  ? 35  HIS A CD2   1 
ATOM   840  C  CE1   . HIS C 3 20  ? -0.987  28.049 24.703 1.00 65.96  ? 35  HIS A CE1   1 
ATOM   841  N  NE2   . HIS C 3 20  ? -2.285  27.899 24.898 1.00 65.33  ? 35  HIS A NE2   1 
ATOM   842  N  N     . PHE C 3 21  ? 0.885   22.093 23.698 1.00 58.20  ? 36  PHE A N     1 
ATOM   843  C  CA    . PHE C 3 21  ? 1.459   20.779 23.755 1.00 58.14  ? 36  PHE A CA    1 
ATOM   844  C  C     . PHE C 3 21  ? 0.505   19.746 23.194 1.00 58.45  ? 36  PHE A C     1 
ATOM   845  O  O     . PHE C 3 21  ? 0.468   18.601 23.659 1.00 57.97  ? 36  PHE A O     1 
ATOM   846  C  CB    . PHE C 3 21  ? 1.834   20.429 25.176 1.00 58.52  ? 36  PHE A CB    1 
ATOM   847  C  CG    . PHE C 3 21  ? 2.713   21.442 25.818 1.00 58.25  ? 36  PHE A CG    1 
ATOM   848  C  CD1   . PHE C 3 21  ? 3.986   21.669 25.329 1.00 57.89  ? 36  PHE A CD1   1 
ATOM   849  C  CD2   . PHE C 3 21  ? 2.242   22.222 26.873 1.00 57.65  ? 36  PHE A CD2   1 
ATOM   850  C  CE1   . PHE C 3 21  ? 4.782   22.659 25.871 1.00 57.56  ? 36  PHE A CE1   1 
ATOM   851  C  CE2   . PHE C 3 21  ? 3.019   23.205 27.419 1.00 57.34  ? 36  PHE A CE2   1 
ATOM   852  C  CZ    . PHE C 3 21  ? 4.309   23.431 26.911 1.00 57.76  ? 36  PHE A CZ    1 
ATOM   853  N  N     . ASN C 3 22  ? -0.265  20.180 22.196 1.00 58.38  ? 37  ASN A N     1 
ATOM   854  C  CA    . ASN C 3 22  ? -1.200  19.337 21.470 1.00 58.97  ? 37  ASN A CA    1 
ATOM   855  C  C     . ASN C 3 22  ? -2.624  19.192 22.006 1.00 59.63  ? 37  ASN A C     1 
ATOM   856  O  O     . ASN C 3 22  ? -3.305  18.235 21.651 1.00 60.03  ? 37  ASN A O     1 
ATOM   857  C  CB    . ASN C 3 22  ? -0.577  17.963 21.303 1.00 59.59  ? 37  ASN A CB    1 
ATOM   858  C  CG    . ASN C 3 22  ? -1.172  17.167 20.152 1.00 60.58  ? 37  ASN A CG    1 
ATOM   859  O  OD1   . ASN C 3 22  ? -1.406  17.693 19.050 1.00 59.32  ? 37  ASN A OD1   1 
ATOM   860  N  ND2   . ASN C 3 22  ? -1.385  15.863 20.398 1.00 61.44  ? 37  ASN A ND2   1 
ATOM   861  N  N     . ALA C 3 23  ? -3.088  20.123 22.838 1.00 59.23  ? 38  ALA A N     1 
ATOM   862  C  CA    . ALA C 3 23  ? -4.439  20.040 23.353 1.00 58.94  ? 38  ALA A CA    1 
ATOM   863  C  C     . ALA C 3 23  ? -5.004  21.366 23.856 1.00 60.06  ? 38  ALA A C     1 
ATOM   864  O  O     . ALA C 3 23  ? -4.311  22.185 24.456 1.00 60.53  ? 38  ALA A O     1 
ATOM   865  C  CB    . ALA C 3 23  ? -4.504  19.014 24.435 1.00 58.67  ? 38  ALA A CB    1 
ATOM   866  N  N     . MET C 3 24  ? -6.299  21.551 23.615 1.00 61.24  ? 39  MET A N     1 
ATOM   867  C  CA    . MET C 3 24  ? -7.011  22.747 24.005 1.00 61.10  ? 39  MET A CA    1 
ATOM   868  C  C     . MET C 3 24  ? -6.894  22.903 25.502 1.00 59.80  ? 39  MET A C     1 
ATOM   869  O  O     . MET C 3 24  ? -7.544  22.207 26.240 1.00 59.12  ? 39  MET A O     1 
ATOM   870  C  CB    . MET C 3 24  ? -8.481  22.615 23.600 1.00 63.84  ? 39  MET A CB    1 
ATOM   871  C  CG    . MET C 3 24  ? -9.305  23.887 23.707 1.00 68.20  ? 39  MET A CG    1 
ATOM   872  S  SD    . MET C 3 24  ? -8.538  25.309 22.804 1.00 75.31  ? 39  MET A SD    1 
ATOM   873  C  CE    . MET C 3 24  ? -8.207  24.568 21.177 1.00 71.87  ? 39  MET A CE    1 
ATOM   874  N  N     . THR C 3 25  ? -6.062  23.826 25.961 1.00 58.86  ? 40  THR A N     1 
ATOM   875  C  CA    . THR C 3 25  ? -5.920  24.026 27.399 1.00 57.50  ? 40  THR A CA    1 
ATOM   876  C  C     . THR C 3 25  ? -5.911  25.526 27.801 1.00 57.47  ? 40  THR A C     1 
ATOM   877  O  O     . THR C 3 25  ? -5.843  26.429 26.952 1.00 56.22  ? 40  THR A O     1 
ATOM   878  C  CB    . THR C 3 25  ? -4.632  23.372 27.883 1.00 57.40  ? 40  THR A CB    1 
ATOM   879  O  OG1   . THR C 3 25  ? -3.545  23.992 27.209 1.00 56.35  ? 40  THR A OG1   1 
ATOM   880  C  CG2   . THR C 3 25  ? -4.619  21.894 27.578 1.00 55.63  ? 40  THR A CG2   1 
ATOM   881  N  N     . CYS C 3 26  ? -5.978  25.753 29.111 1.00 57.84  ? 41  CYS A N     1 
ATOM   882  C  CA    . CYS C 3 26  ? -6.000  27.078 29.695 1.00 58.42  ? 41  CYS A CA    1 
ATOM   883  C  C     . CYS C 3 26  ? -4.570  27.436 29.958 1.00 60.09  ? 41  CYS A C     1 
ATOM   884  O  O     . CYS C 3 26  ? -3.700  26.564 29.854 1.00 61.24  ? 41  CYS A O     1 
ATOM   885  C  CB    . CYS C 3 26  ? -6.806  27.091 31.023 1.00 57.28  ? 41  CYS A CB    1 
ATOM   886  S  SG    . CYS C 3 26  ? -6.173  26.196 32.546 1.00 57.20  ? 41  CYS A SG    1 
ATOM   887  N  N     . GLU C 3 27  ? -4.311  28.700 30.291 1.00 59.66  ? 42  GLU A N     1 
ATOM   888  C  CA    . GLU C 3 27  ? -2.952  29.074 30.591 1.00 59.47  ? 42  GLU A CA    1 
ATOM   889  C  C     . GLU C 3 27  ? -2.445  28.294 31.800 1.00 57.81  ? 42  GLU A C     1 
ATOM   890  O  O     . GLU C 3 27  ? -1.321  27.868 31.826 1.00 57.90  ? 42  GLU A O     1 
ATOM   891  C  CB    . GLU C 3 27  ? -2.830  30.584 30.830 1.00 61.41  ? 42  GLU A CB    1 
ATOM   892  C  CG    . GLU C 3 27  ? -2.903  31.366 29.537 1.00 65.00  ? 42  GLU A CG    1 
ATOM   893  C  CD    . GLU C 3 27  ? -1.802  30.988 28.522 1.00 67.21  ? 42  GLU A CD    1 
ATOM   894  O  OE1   . GLU C 3 27  ? -0.603  31.089 28.886 1.00 67.59  ? 42  GLU A OE1   1 
ATOM   895  O  OE2   . GLU C 3 27  ? -2.137  30.605 27.365 1.00 66.81  ? 42  GLU A OE2   1 
ATOM   896  N  N     . GLY C 3 28  ? -3.276  28.078 32.794 1.00 56.70  ? 43  GLY A N     1 
ATOM   897  C  CA    . GLY C 3 28  ? -2.801  27.350 33.938 1.00 57.28  ? 43  GLY A CA    1 
ATOM   898  C  C     . GLY C 3 28  ? -2.414  25.906 33.643 1.00 58.40  ? 43  GLY A C     1 
ATOM   899  O  O     . GLY C 3 28  ? -1.460  25.347 34.199 1.00 59.37  ? 43  GLY A O     1 
ATOM   900  N  N     . CYS C 3 29  ? -3.115  25.248 32.759 1.00 57.80  ? 44  CYS A N     1 
ATOM   901  C  CA    . CYS C 3 29  ? -2.728  23.882 32.595 1.00 57.48  ? 44  CYS A CA    1 
ATOM   902  C  C     . CYS C 3 29  ? -1.514  23.740 31.671 1.00 59.09  ? 44  CYS A C     1 
ATOM   903  O  O     . CYS C 3 29  ? -0.787  22.747 31.751 1.00 61.05  ? 44  CYS A O     1 
ATOM   904  C  CB    . CYS C 3 29  ? -3.951  23.063 32.168 1.00 56.55  ? 44  CYS A CB    1 
ATOM   905  S  SG    . CYS C 3 29  ? -5.293  22.999 33.479 1.00 55.89  ? 44  CYS A SG    1 
ATOM   906  N  N     . LYS C 3 30  ? -1.254  24.712 30.807 1.00 57.41  ? 45  LYS A N     1 
ATOM   907  C  CA    . LYS C 3 30  ? -0.077  24.602 29.973 1.00 55.49  ? 45  LYS A CA    1 
ATOM   908  C  C     . LYS C 3 30  ? 1.090   24.752 30.937 1.00 55.68  ? 45  LYS A C     1 
ATOM   909  O  O     . LYS C 3 30  ? 1.996   23.924 30.995 1.00 54.79  ? 45  LYS A O     1 
ATOM   910  C  CB    . LYS C 3 30  ? -0.111  25.697 28.897 1.00 56.17  ? 45  LYS A CB    1 
ATOM   911  C  CG    . LYS C 3 30  ? 1.043   26.674 28.794 1.00 55.42  ? 45  LYS A CG    1 
ATOM   912  C  CD    . LYS C 3 30  ? 0.603   27.834 27.904 1.00 54.76  ? 45  LYS A CD    1 
ATOM   913  C  CE    . LYS C 3 30  ? 1.732   28.844 27.661 1.00 56.29  ? 45  LYS A CE    1 
ATOM   914  N  NZ    . LYS C 3 30  ? 1.279   30.144 27.020 1.00 55.80  ? 45  LYS A NZ    1 
ATOM   915  N  N     . GLY C 3 31  ? 1.037   25.803 31.733 1.00 55.94  ? 46  GLY A N     1 
ATOM   916  C  CA    . GLY C 3 31  ? 2.084   26.047 32.706 1.00 56.41  ? 46  GLY A CA    1 
ATOM   917  C  C     . GLY C 3 31  ? 2.257   24.884 33.666 1.00 56.51  ? 46  GLY A C     1 
ATOM   918  O  O     . GLY C 3 31  ? 3.346   24.393 33.910 1.00 58.46  ? 46  GLY A O     1 
ATOM   919  N  N     . PHE C 3 32  ? 1.179   24.439 34.252 1.00 55.28  ? 47  PHE A N     1 
ATOM   920  C  CA    . PHE C 3 32  ? 1.304   23.320 35.139 1.00 54.01  ? 47  PHE A CA    1 
ATOM   921  C  C     . PHE C 3 32  ? 1.965   22.133 34.454 1.00 53.68  ? 47  PHE A C     1 
ATOM   922  O  O     . PHE C 3 32  ? 2.882   21.525 34.977 1.00 53.40  ? 47  PHE A O     1 
ATOM   923  C  CB    . PHE C 3 32  ? -0.071  22.867 35.590 1.00 52.28  ? 47  PHE A CB    1 
ATOM   924  C  CG    . PHE C 3 32  ? -0.033  21.610 36.328 1.00 49.27  ? 47  PHE A CG    1 
ATOM   925  C  CD1   . PHE C 3 32  ? 0.290   21.597 37.645 1.00 49.25  ? 47  PHE A CD1   1 
ATOM   926  C  CD2   . PHE C 3 32  ? -0.295  20.433 35.696 1.00 48.30  ? 47  PHE A CD2   1 
ATOM   927  C  CE1   . PHE C 3 32  ? 0.336   20.427 38.314 1.00 49.95  ? 47  PHE A CE1   1 
ATOM   928  C  CE2   . PHE C 3 32  ? -0.251  19.257 36.361 1.00 47.21  ? 47  PHE A CE2   1 
ATOM   929  C  CZ    . PHE C 3 32  ? 0.058   19.245 37.670 1.00 47.64  ? 47  PHE A CZ    1 
ATOM   930  N  N     . PHE C 3 33  ? 1.444   21.780 33.290 1.00 53.27  ? 48  PHE A N     1 
ATOM   931  C  CA    . PHE C 3 33  ? 1.954   20.642 32.550 1.00 54.94  ? 48  PHE A CA    1 
ATOM   932  C  C     . PHE C 3 33  ? 3.436   20.693 32.111 1.00 56.00  ? 48  PHE A C     1 
ATOM   933  O  O     . PHE C 3 33  ? 4.143   19.661 32.125 1.00 56.54  ? 48  PHE A O     1 
ATOM   934  C  CB    . PHE C 3 33  ? 1.107   20.396 31.312 1.00 52.09  ? 48  PHE A CB    1 
ATOM   935  C  CG    . PHE C 3 33  ? 1.641   19.327 30.452 1.00 49.34  ? 48  PHE A CG    1 
ATOM   936  C  CD1   . PHE C 3 33  ? 1.456   17.998 30.799 1.00 48.61  ? 48  PHE A CD1   1 
ATOM   937  C  CD2   . PHE C 3 33  ? 2.304   19.644 29.284 1.00 49.53  ? 48  PHE A CD2   1 
ATOM   938  C  CE1   . PHE C 3 33  ? 1.903   16.985 30.006 1.00 49.15  ? 48  PHE A CE1   1 
ATOM   939  C  CE2   . PHE C 3 33  ? 2.773   18.639 28.446 1.00 50.58  ? 48  PHE A CE2   1 
ATOM   940  C  CZ    . PHE C 3 33  ? 2.570   17.294 28.808 1.00 50.17  ? 48  PHE A CZ    1 
ATOM   941  N  N     . ARG C 3 34  ? 3.896   21.862 31.682 1.00 56.63  ? 49  ARG A N     1 
ATOM   942  C  CA    . ARG C 3 34  ? 5.273   21.953 31.255 1.00 57.42  ? 49  ARG A CA    1 
ATOM   943  C  C     . ARG C 3 34  ? 6.211   21.779 32.435 1.00 57.43  ? 49  ARG A C     1 
ATOM   944  O  O     . ARG C 3 34  ? 7.134   20.947 32.402 1.00 57.59  ? 49  ARG A O     1 
ATOM   945  C  CB    . ARG C 3 34  ? 5.541   23.294 30.580 1.00 57.71  ? 49  ARG A CB    1 
ATOM   946  C  CG    . ARG C 3 34  ? 6.974   23.465 30.116 1.00 58.27  ? 49  ARG A CG    1 
ATOM   947  C  CD    . ARG C 3 34  ? 7.081   24.671 29.237 1.00 59.17  ? 49  ARG A CD    1 
ATOM   948  N  NE    . ARG C 3 34  ? 7.033   25.921 29.970 1.00 61.42  ? 49  ARG A NE    1 
ATOM   949  C  CZ    . ARG C 3 34  ? 6.254   26.941 29.640 1.00 64.02  ? 49  ARG A CZ    1 
ATOM   950  N  NH1   . ARG C 3 34  ? 6.269   28.079 30.336 1.00 65.41  ? 49  ARG A NH1   1 
ATOM   951  N  NH2   . ARG C 3 34  ? 5.418   26.814 28.628 1.00 67.47  ? 49  ARG A NH2   1 
ATOM   952  N  N     . ARG C 3 35  ? 5.954   22.567 33.475 1.00 57.51  ? 50  ARG A N     1 
ATOM   953  C  CA    . ARG C 3 35  ? 6.768   22.558 34.670 1.00 57.84  ? 50  ARG A CA    1 
ATOM   954  C  C     . ARG C 3 35  ? 6.778   21.201 35.294 1.00 57.34  ? 50  ARG A C     1 
ATOM   955  O  O     . ARG C 3 35  ? 7.760   20.703 35.727 1.00 56.92  ? 50  ARG A O     1 
ATOM   956  C  CB    . ARG C 3 35  ? 6.243   23.585 35.636 1.00 59.10  ? 50  ARG A CB    1 
ATOM   957  C  CG    . ARG C 3 35  ? 7.157   23.832 36.774 1.00 63.87  ? 50  ARG A CG    1 
ATOM   958  C  CD    . ARG C 3 35  ? 6.584   24.862 37.729 1.00 67.37  ? 50  ARG A CD    1 
ATOM   959  N  NE    . ARG C 3 35  ? 7.065   24.645 39.094 1.00 70.25  ? 50  ARG A NE    1 
ATOM   960  C  CZ    . ARG C 3 35  ? 8.090   25.287 39.659 1.00 71.45  ? 50  ARG A CZ    1 
ATOM   961  N  NH1   . ARG C 3 35  ? 8.768   26.221 38.978 1.00 71.24  ? 50  ARG A NH1   1 
ATOM   962  N  NH2   . ARG C 3 35  ? 8.428   24.997 40.920 1.00 71.78  ? 50  ARG A NH2   1 
ATOM   963  N  N     . SER C 3 36  ? 5.655   20.562 35.294 1.00 58.42  ? 51  SER A N     1 
ATOM   964  C  CA    . SER C 3 36  ? 5.606   19.264 35.883 1.00 59.34  ? 51  SER A CA    1 
ATOM   965  C  C     . SER C 3 36  ? 6.462   18.275 35.121 1.00 60.19  ? 51  SER A C     1 
ATOM   966  O  O     . SER C 3 36  ? 7.165   17.492 35.728 1.00 60.60  ? 51  SER A O     1 
ATOM   967  C  CB    . SER C 3 36  ? 4.145   18.806 35.956 1.00 57.42  ? 51  SER A CB    1 
ATOM   968  O  OG    . SER C 3 36  ? 3.467   19.719 36.767 1.00 54.64  ? 51  SER A OG    1 
ATOM   969  N  N     . MET C 3 37  ? 6.382   18.305 33.797 1.00 61.91  ? 52  MET A N     1 
ATOM   970  C  CA    . MET C 3 37  ? 7.155   17.382 32.981 1.00 63.83  ? 52  MET A CA    1 
ATOM   971  C  C     . MET C 3 37  ? 8.649   17.659 33.054 1.00 65.45  ? 52  MET A C     1 
ATOM   972  O  O     . MET C 3 37  ? 9.465   16.726 33.088 1.00 65.41  ? 52  MET A O     1 
ATOM   973  C  CB    . MET C 3 37  ? 6.698   17.433 31.527 1.00 62.79  ? 52  MET A CB    1 
ATOM   974  C  CG    . MET C 3 37  ? 5.340   16.815 31.310 1.00 62.22  ? 52  MET A CG    1 
ATOM   975  S  SD    . MET C 3 37  ? 5.264   15.290 32.206 1.00 59.30  ? 52  MET A SD    1 
ATOM   976  C  CE    . MET C 3 37  ? 4.429   14.294 31.186 1.00 61.08  ? 52  MET A CE    1 
ATOM   977  N  N     . LYS C 3 38  ? 9.009   18.945 33.071 1.00 66.83  ? 53  LYS A N     1 
ATOM   978  C  CA    . LYS C 3 38  ? 10.410  19.300 33.157 1.00 67.28  ? 53  LYS A CA    1 
ATOM   979  C  C     . LYS C 3 38  ? 10.916  18.778 34.467 1.00 68.00  ? 53  LYS A C     1 
ATOM   980  O  O     . LYS C 3 38  ? 11.529  17.726 34.491 1.00 68.90  ? 53  LYS A O     1 
ATOM   981  C  CB    . LYS C 3 38  ? 10.594  20.795 33.029 1.00 66.89  ? 53  LYS A CB    1 
ATOM   982  C  CG    . LYS C 3 38  ? 10.461  21.191 31.598 1.00 66.33  ? 53  LYS A CG    1 
ATOM   983  C  CD    . LYS C 3 38  ? 10.565  22.667 31.365 1.00 67.11  ? 53  LYS A CD    1 
ATOM   984  C  CE    . LYS C 3 38  ? 11.959  23.105 30.924 1.00 67.97  ? 53  LYS A CE    1 
ATOM   985  N  NZ    . LYS C 3 38  ? 11.937  24.585 30.584 1.00 67.14  ? 53  LYS A NZ    1 
ATOM   986  N  N     . ARG C 3 39  ? 10.634  19.462 35.563 1.00 68.29  ? 54  ARG A N     1 
ATOM   987  C  CA    . ARG C 3 39  ? 11.098  18.967 36.838 1.00 68.70  ? 54  ARG A CA    1 
ATOM   988  C  C     . ARG C 3 39  ? 10.763  17.526 37.141 1.00 68.81  ? 54  ARG A C     1 
ATOM   989  O  O     . ARG C 3 39  ? 10.792  17.154 38.299 1.00 68.74  ? 54  ARG A O     1 
ATOM   990  C  CB    . ARG C 3 39  ? 10.535  19.801 37.954 1.00 69.58  ? 54  ARG A CB    1 
ATOM   991  C  CG    . ARG C 3 39  ? 10.816  21.214 37.754 1.00 72.30  ? 54  ARG A CG    1 
ATOM   992  C  CD    . ARG C 3 39  ? 10.482  22.055 38.984 1.00 76.33  ? 54  ARG A CD    1 
ATOM   993  N  NE    . ARG C 3 39  ? 11.097  23.373 38.816 1.00 80.16  ? 54  ARG A NE    1 
ATOM   994  C  CZ    . ARG C 3 39  ? 11.258  23.982 37.631 1.00 81.69  ? 54  ARG A CZ    1 
ATOM   995  N  NH1   . ARG C 3 39  ? 10.852  23.400 36.486 1.00 82.74  ? 54  ARG A NH1   1 
ATOM   996  N  NH2   . ARG C 3 39  ? 11.836  25.183 37.576 1.00 82.70  ? 54  ARG A NH2   1 
ATOM   997  N  N     . LYS C 3 40  ? 10.440  16.721 36.135 1.00 70.08  ? 55  LYS A N     1 
ATOM   998  C  CA    . LYS C 3 40  ? 10.076  15.328 36.349 1.00 72.25  ? 55  LYS A CA    1 
ATOM   999  C  C     . LYS C 3 40  ? 9.437   15.128 37.725 1.00 73.33  ? 55  LYS A C     1 
ATOM   1000 O  O     . LYS C 3 40  ? 10.008  14.448 38.573 1.00 74.45  ? 55  LYS A O     1 
ATOM   1001 C  CB    . LYS C 3 40  ? 11.315  14.481 36.211 1.00 73.70  ? 55  LYS A CB    1 
ATOM   1002 C  CG    . LYS C 3 40  ? 11.999  14.754 34.871 1.00 77.07  ? 55  LYS A CG    1 
ATOM   1003 C  CD    . LYS C 3 40  ? 13.172  13.796 34.569 1.00 79.32  ? 55  LYS A CD    1 
ATOM   1004 C  CE    . LYS C 3 40  ? 13.581  13.852 33.067 1.00 81.32  ? 55  LYS A CE    1 
ATOM   1005 N  NZ    . LYS C 3 40  ? 14.293  12.607 32.554 1.00 80.81  ? 55  LYS A NZ    1 
ATOM   1006 N  N     . ALA C 3 41  ? 8.259   15.735 37.952 1.00 73.46  ? 56  ALA A N     1 
ATOM   1007 C  CA    . ALA C 3 41  ? 7.562   15.648 39.243 1.00 72.71  ? 56  ALA A CA    1 
ATOM   1008 C  C     . ALA C 3 41  ? 6.752   14.391 39.435 1.00 73.02  ? 56  ALA A C     1 
ATOM   1009 O  O     . ALA C 3 41  ? 6.063   13.910 38.536 1.00 72.18  ? 56  ALA A O     1 
ATOM   1010 C  CB    . ALA C 3 41  ? 6.665   16.852 39.462 1.00 71.17  ? 56  ALA A CB    1 
ATOM   1011 N  N     . LEU C 3 42  ? 6.868   13.870 40.648 1.00 73.57  ? 57  LEU A N     1 
ATOM   1012 C  CA    . LEU C 3 42  ? 6.169   12.676 41.077 1.00 73.91  ? 57  LEU A CA    1 
ATOM   1013 C  C     . LEU C 3 42  ? 5.046   13.141 41.969 1.00 72.82  ? 57  LEU A C     1 
ATOM   1014 O  O     . LEU C 3 42  ? 5.296   13.698 43.050 1.00 72.19  ? 57  LEU A O     1 
ATOM   1015 C  CB    . LEU C 3 42  ? 7.101   11.776 41.882 1.00 76.30  ? 57  LEU A CB    1 
ATOM   1016 C  CG    . LEU C 3 42  ? 7.752   10.649 41.082 1.00 78.21  ? 57  LEU A CG    1 
ATOM   1017 C  CD1   . LEU C 3 42  ? 8.679   9.785  42.007 1.00 77.87  ? 57  LEU A CD1   1 
ATOM   1018 C  CD2   . LEU C 3 42  ? 6.604   9.821  40.444 1.00 79.11  ? 57  LEU A CD2   1 
ATOM   1019 N  N     . PHE C 3 43  ? 3.815   12.916 41.512 1.00 71.06  ? 58  PHE A N     1 
ATOM   1020 C  CA    . PHE C 3 43  ? 2.651   13.344 42.280 1.00 69.25  ? 58  PHE A CA    1 
ATOM   1021 C  C     . PHE C 3 43  ? 1.822   12.153 42.785 1.00 68.52  ? 58  PHE A C     1 
ATOM   1022 O  O     . PHE C 3 43  ? 1.838   11.087 42.190 1.00 68.46  ? 58  PHE A O     1 
ATOM   1023 C  CB    . PHE C 3 43  ? 1.760   14.228 41.406 1.00 66.32  ? 58  PHE A CB    1 
ATOM   1024 C  CG    . PHE C 3 43  ? 2.360   15.539 41.019 1.00 63.48  ? 58  PHE A CG    1 
ATOM   1025 C  CD1   . PHE C 3 43  ? 2.787   16.434 41.967 1.00 62.39  ? 58  PHE A CD1   1 
ATOM   1026 C  CD2   . PHE C 3 43  ? 2.355   15.949 39.692 1.00 63.14  ? 58  PHE A CD2   1 
ATOM   1027 C  CE1   . PHE C 3 43  ? 3.187   17.731 41.600 1.00 61.79  ? 58  PHE A CE1   1 
ATOM   1028 C  CE2   . PHE C 3 43  ? 2.757   17.246 39.321 1.00 61.65  ? 58  PHE A CE2   1 
ATOM   1029 C  CZ    . PHE C 3 43  ? 3.166   18.126 40.281 1.00 61.82  ? 58  PHE A CZ    1 
ATOM   1030 N  N     . THR C 3 44  ? 1.093   12.326 43.881 1.00 68.22  ? 59  THR A N     1 
ATOM   1031 C  CA    . THR C 3 44  ? 0.233   11.226 44.355 1.00 68.18  ? 59  THR A CA    1 
ATOM   1032 C  C     . THR C 3 44  ? -1.136  11.752 44.837 1.00 66.69  ? 59  THR A C     1 
ATOM   1033 O  O     . THR C 3 44  ? -1.232  12.790 45.513 1.00 66.25  ? 59  THR A O     1 
ATOM   1034 C  CB    . THR C 3 44  ? 0.878   10.431 45.500 1.00 68.53  ? 59  THR A CB    1 
ATOM   1035 O  OG1   . THR C 3 44  ? 0.503   11.027 46.751 1.00 68.82  ? 59  THR A OG1   1 
ATOM   1036 C  CG2   . THR C 3 44  ? 2.407   10.430 45.361 1.00 69.38  ? 59  THR A CG2   1 
ATOM   1037 N  N     . CYS C 3 45  ? -2.196  11.033 44.504 1.00 64.13  ? 60  CYS A N     1 
ATOM   1038 C  CA    . CYS C 3 45  ? -3.497  11.509 44.899 1.00 62.79  ? 60  CYS A CA    1 
ATOM   1039 C  C     . CYS C 3 45  ? -3.719  11.359 46.376 1.00 62.70  ? 60  CYS A C     1 
ATOM   1040 O  O     . CYS C 3 45  ? -3.556  10.295 46.924 1.00 64.59  ? 60  CYS A O     1 
ATOM   1041 C  CB    . CYS C 3 45  ? -4.592  10.767 44.152 1.00 61.17  ? 60  CYS A CB    1 
ATOM   1042 S  SG    . CYS C 3 45  ? -6.120  11.632 44.204 1.00 59.32  ? 60  CYS A SG    1 
ATOM   1043 N  N     . PRO C 3 46  ? -4.081  12.435 47.058 1.00 62.32  ? 61  PRO A N     1 
ATOM   1044 C  CA    . PRO C 3 46  ? -4.292  12.222 48.479 1.00 61.66  ? 61  PRO A CA    1 
ATOM   1045 C  C     . PRO C 3 46  ? -5.740  11.748 48.679 1.00 62.25  ? 61  PRO A C     1 
ATOM   1046 O  O     . PRO C 3 46  ? -6.244  11.790 49.789 1.00 62.90  ? 61  PRO A O     1 
ATOM   1047 C  CB    . PRO C 3 46  ? -4.072  13.610 49.042 1.00 60.94  ? 61  PRO A CB    1 
ATOM   1048 C  CG    . PRO C 3 46  ? -4.752  14.472 48.005 1.00 59.56  ? 61  PRO A CG    1 
ATOM   1049 C  CD    . PRO C 3 46  ? -4.226  13.863 46.715 1.00 61.07  ? 61  PRO A CD    1 
ATOM   1050 N  N     . PHE C 3 47  ? -6.405  11.339 47.597 1.00 62.61  ? 62  PHE A N     1 
ATOM   1051 C  CA    . PHE C 3 47  ? -7.800  10.877 47.643 1.00 63.30  ? 62  PHE A CA    1 
ATOM   1052 C  C     . PHE C 3 47  ? -8.027  9.512  46.976 1.00 62.82  ? 62  PHE A C     1 
ATOM   1053 O  O     . PHE C 3 47  ? -7.634  8.506  47.536 1.00 63.90  ? 62  PHE A O     1 
ATOM   1054 C  CB    . PHE C 3 47  ? -8.701  11.917 47.004 1.00 63.96  ? 62  PHE A CB    1 
ATOM   1055 C  CG    . PHE C 3 47  ? -8.771  13.209 47.768 1.00 65.43  ? 62  PHE A CG    1 
ATOM   1056 C  CD1   . PHE C 3 47  ? -9.387  13.267 49.009 1.00 67.00  ? 62  PHE A CD1   1 
ATOM   1057 C  CD2   . PHE C 3 47  ? -8.265  14.374 47.240 1.00 65.77  ? 62  PHE A CD2   1 
ATOM   1058 C  CE1   . PHE C 3 47  ? -9.500  14.466 49.705 1.00 67.35  ? 62  PHE A CE1   1 
ATOM   1059 C  CE2   . PHE C 3 47  ? -8.373  15.580 47.929 1.00 66.50  ? 62  PHE A CE2   1 
ATOM   1060 C  CZ    . PHE C 3 47  ? -8.991  15.627 49.161 1.00 67.52  ? 62  PHE A CZ    1 
ATOM   1061 N  N     . ASN C 3 48  ? -8.638  9.450  45.794 1.00 61.11  ? 63  ASN A N     1 
ATOM   1062 C  CA    . ASN C 3 48  ? -8.863  8.152  45.161 1.00 59.87  ? 63  ASN A CA    1 
ATOM   1063 C  C     . ASN C 3 48  ? -8.266  8.035  43.783 1.00 60.50  ? 63  ASN A C     1 
ATOM   1064 O  O     . ASN C 3 48  ? -8.447  7.010  43.104 1.00 60.59  ? 63  ASN A O     1 
ATOM   1065 C  CB    . ASN C 3 48  ? -10.348 7.845  45.035 1.00 60.55  ? 63  ASN A CB    1 
ATOM   1066 C  CG    . ASN C 3 48  ? -11.068 7.989  46.328 1.00 60.59  ? 63  ASN A CG    1 
ATOM   1067 O  OD1   . ASN C 3 48  ? -10.756 7.314  47.302 1.00 61.89  ? 63  ASN A OD1   1 
ATOM   1068 N  ND2   . ASN C 3 48  ? -12.026 8.883  46.361 1.00 59.60  ? 63  ASN A ND2   1 
ATOM   1069 N  N     . GLY C 3 49  ? -7.582  9.088  43.349 1.00 60.23  ? 64  GLY A N     1 
ATOM   1070 C  CA    . GLY C 3 49  ? -6.947  9.043  42.057 1.00 58.49  ? 64  GLY A CA    1 
ATOM   1071 C  C     . GLY C 3 49  ? -7.945  9.007  40.936 1.00 58.04  ? 64  GLY A C     1 
ATOM   1072 O  O     . GLY C 3 49  ? -7.814  8.247  39.981 1.00 58.40  ? 64  GLY A O     1 
ATOM   1073 N  N     . ASP C 3 50  ? -8.977  9.823  41.092 1.00 57.63  ? 65  ASP A N     1 
ATOM   1074 C  CA    . ASP C 3 50  ? -10.015 9.999  40.092 1.00 56.23  ? 65  ASP A CA    1 
ATOM   1075 C  C     . ASP C 3 50  ? -10.722 11.290 40.432 1.00 54.52  ? 65  ASP A C     1 
ATOM   1076 O  O     . ASP C 3 50  ? -11.925 11.351 40.401 1.00 54.58  ? 65  ASP A O     1 
ATOM   1077 C  CB    . ASP C 3 50  ? -11.003 8.830  40.092 1.00 57.35  ? 65  ASP A CB    1 
ATOM   1078 C  CG    . ASP C 3 50  ? -11.704 8.694  41.379 1.00 57.94  ? 65  ASP A CG    1 
ATOM   1079 O  OD1   . ASP C 3 50  ? -11.446 9.524  42.281 1.00 59.96  ? 65  ASP A OD1   1 
ATOM   1080 O  OD2   . ASP C 3 50  ? -12.508 7.772  41.497 1.00 59.54  ? 65  ASP A OD2   1 
ATOM   1081 N  N     . CYS C 3 51  ? -9.962  12.315 40.779 1.00 53.64  ? 66  CYS A N     1 
ATOM   1082 C  CA    . CYS C 3 51  ? -10.519 13.611 41.106 1.00 54.68  ? 66  CYS A CA    1 
ATOM   1083 C  C     . CYS C 3 51  ? -11.132 14.236 39.866 1.00 54.59  ? 66  CYS A C     1 
ATOM   1084 O  O     . CYS C 3 51  ? -10.705 13.985 38.751 1.00 54.85  ? 66  CYS A O     1 
ATOM   1085 C  CB    . CYS C 3 51  ? -9.453  14.558 41.676 1.00 54.53  ? 66  CYS A CB    1 
ATOM   1086 S  SG    . CYS C 3 51  ? -8.614  14.117 43.249 1.00 57.17  ? 66  CYS A SG    1 
ATOM   1087 N  N     . ARG C 3 52  ? -12.167 15.033 40.065 1.00 55.63  ? 67  ARG A N     1 
ATOM   1088 C  CA    . ARG C 3 52  ? -12.817 15.708 38.946 1.00 57.71  ? 67  ARG A CA    1 
ATOM   1089 C  C     . ARG C 3 52  ? -12.172 17.120 38.947 1.00 58.53  ? 67  ARG A C     1 
ATOM   1090 O  O     . ARG C 3 52  ? -12.398 17.919 39.844 1.00 59.46  ? 67  ARG A O     1 
ATOM   1091 C  CB    . ARG C 3 52  ? -14.353 15.714 39.174 1.00 56.01  ? 67  ARG A CB    1 
ATOM   1092 C  CG    . ARG C 3 52  ? -14.997 14.333 38.958 1.00 55.66  ? 67  ARG A CG    1 
ATOM   1093 C  CD    . ARG C 3 52  ? -16.469 14.242 39.262 1.00 55.42  ? 67  ARG A CD    1 
ATOM   1094 N  NE    . ARG C 3 52  ? -17.153 13.118 38.601 1.00 56.95  ? 67  ARG A NE    1 
ATOM   1095 C  CZ    . ARG C 3 52  ? -18.489 13.020 38.483 1.00 57.88  ? 67  ARG A CZ    1 
ATOM   1096 N  NH1   . ARG C 3 52  ? -19.271 13.965 38.976 1.00 56.90  ? 67  ARG A NH1   1 
ATOM   1097 N  NH2   . ARG C 3 52  ? -19.067 11.985 37.883 1.00 57.33  ? 67  ARG A NH2   1 
ATOM   1098 N  N     . ILE C 3 53  ? -11.343 17.409 37.959 1.00 58.46  ? 68  ILE A N     1 
ATOM   1099 C  CA    . ILE C 3 53  ? -10.636 18.675 37.975 1.00 60.75  ? 68  ILE A CA    1 
ATOM   1100 C  C     . ILE C 3 53  ? -11.529 19.793 37.545 1.00 61.52  ? 68  ILE A C     1 
ATOM   1101 O  O     . ILE C 3 53  ? -12.294 19.648 36.611 1.00 62.47  ? 68  ILE A O     1 
ATOM   1102 C  CB    . ILE C 3 53  ? -9.371  18.626 37.034 1.00 60.10  ? 68  ILE A CB    1 
ATOM   1103 C  CG1   . ILE C 3 53  ? -8.726  17.230 37.097 1.00 58.86  ? 68  ILE A CG1   1 
ATOM   1104 C  CG2   . ILE C 3 53  ? -8.302  19.620 37.478 1.00 58.53  ? 68  ILE A CG2   1 
ATOM   1105 C  CD1   . ILE C 3 53  ? -8.367  16.834 38.492 1.00 56.72  ? 68  ILE A CD1   1 
ATOM   1106 N  N     . THR C 3 54  ? -11.445 20.916 38.242 1.00 63.06  ? 69  THR A N     1 
ATOM   1107 C  CA    . THR C 3 54  ? -12.238 22.098 37.898 1.00 64.50  ? 69  THR A CA    1 
ATOM   1108 C  C     . THR C 3 54  ? -11.388 23.353 38.051 1.00 66.32  ? 69  THR A C     1 
ATOM   1109 O  O     . THR C 3 54  ? -10.334 23.350 38.712 1.00 66.03  ? 69  THR A O     1 
ATOM   1110 C  CB    . THR C 3 54  ? -13.513 22.269 38.790 1.00 63.28  ? 69  THR A CB    1 
ATOM   1111 O  OG1   . THR C 3 54  ? -13.151 22.479 40.161 1.00 62.92  ? 69  THR A OG1   1 
ATOM   1112 C  CG2   . THR C 3 54  ? -14.377 21.077 38.681 1.00 62.19  ? 69  THR A CG2   1 
ATOM   1113 N  N     . LYS C 3 55  ? -11.853 24.433 37.448 1.00 67.91  ? 70  LYS A N     1 
ATOM   1114 C  CA    . LYS C 3 55  ? -11.135 25.676 37.547 1.00 69.53  ? 70  LYS A CA    1 
ATOM   1115 C  C     . LYS C 3 55  ? -10.878 26.047 39.005 1.00 70.27  ? 70  LYS A C     1 
ATOM   1116 O  O     . LYS C 3 55  ? -9.957  26.813 39.288 1.00 71.55  ? 70  LYS A O     1 
ATOM   1117 C  CB    . LYS C 3 55  ? -11.920 26.785 36.842 1.00 69.46  ? 70  LYS A CB    1 
ATOM   1118 C  CG    . LYS C 3 55  ? -11.140 28.094 36.631 1.00 69.83  ? 70  LYS A CG    1 
ATOM   1119 C  CD    . LYS C 3 55  ? -10.977 28.963 37.910 1.00 70.01  ? 70  LYS A CD    1 
ATOM   1120 C  CE    . LYS C 3 55  ? -10.483 30.369 37.553 1.00 69.87  ? 70  LYS A CE    1 
ATOM   1121 N  NZ    . LYS C 3 55  ? -11.043 30.802 36.217 1.00 69.44  ? 70  LYS A NZ    1 
ATOM   1122 N  N     . ASP C 3 56  ? -11.646 25.512 39.947 1.00 71.19  ? 71  ASP A N     1 
ATOM   1123 C  CA    . ASP C 3 56  ? -11.396 25.926 41.305 1.00 72.27  ? 71  ASP A CA    1 
ATOM   1124 C  C     . ASP C 3 56  ? -10.729 24.928 42.174 1.00 71.75  ? 71  ASP A C     1 
ATOM   1125 O  O     . ASP C 3 56  ? -10.451 25.207 43.325 1.00 71.76  ? 71  ASP A O     1 
ATOM   1126 C  CB    . ASP C 3 56  ? -12.681 26.405 41.982 1.00 75.59  ? 71  ASP A CB    1 
ATOM   1127 C  CG    . ASP C 3 56  ? -13.287 27.617 41.281 1.00 78.92  ? 71  ASP A CG    1 
ATOM   1128 O  OD1   . ASP C 3 56  ? -14.075 27.394 40.322 1.00 80.57  ? 71  ASP A OD1   1 
ATOM   1129 O  OD2   . ASP C 3 56  ? -12.964 28.787 41.655 1.00 80.12  ? 71  ASP A OD2   1 
ATOM   1130 N  N     . ASN C 3 57  ? -10.469 23.746 41.663 1.00 71.25  ? 72  ASN A N     1 
ATOM   1131 C  CA    . ASN C 3 57  ? -9.791  22.769 42.506 1.00 70.96  ? 72  ASN A CA    1 
ATOM   1132 C  C     . ASN C 3 57  ? -8.423  22.294 41.947 1.00 70.54  ? 72  ASN A C     1 
ATOM   1133 O  O     . ASN C 3 57  ? -7.583  21.757 42.693 1.00 70.24  ? 72  ASN A O     1 
ATOM   1134 C  CB    . ASN C 3 57  ? -10.718 21.577 42.760 1.00 70.92  ? 72  ASN A CB    1 
ATOM   1135 C  CG    . ASN C 3 57  ? -10.902 20.708 41.539 1.00 72.25  ? 72  ASN A CG    1 
ATOM   1136 O  OD1   . ASN C 3 57  ? -10.571 21.093 40.410 1.00 72.45  ? 72  ASN A OD1   1 
ATOM   1137 N  ND2   . ASN C 3 57  ? -11.434 19.515 41.758 1.00 72.96  ? 72  ASN A ND2   1 
ATOM   1138 N  N     . ARG C 3 58  ? -8.199  22.520 40.652 1.00 70.29  ? 73  ARG A N     1 
ATOM   1139 C  CA    . ARG C 3 58  ? -6.975  22.089 39.988 1.00 70.02  ? 73  ARG A CA    1 
ATOM   1140 C  C     . ARG C 3 58  ? -5.740  22.294 40.807 1.00 71.12  ? 73  ARG A C     1 
ATOM   1141 O  O     . ARG C 3 58  ? -4.911  21.430 40.873 1.00 70.60  ? 73  ARG A O     1 
ATOM   1142 C  CB    . ARG C 3 58  ? -6.833  22.806 38.667 1.00 68.68  ? 73  ARG A CB    1 
ATOM   1143 C  CG    . ARG C 3 58  ? -6.863  24.288 38.794 1.00 67.67  ? 73  ARG A CG    1 
ATOM   1144 C  CD    . ARG C 3 58  ? -6.869  24.913 37.421 1.00 66.99  ? 73  ARG A CD    1 
ATOM   1145 N  NE    . ARG C 3 58  ? -6.603  26.336 37.506 1.00 67.92  ? 73  ARG A NE    1 
ATOM   1146 C  CZ    . ARG C 3 58  ? -6.911  27.199 36.554 1.00 69.44  ? 73  ARG A CZ    1 
ATOM   1147 N  NH1   . ARG C 3 58  ? -7.499  26.752 35.441 1.00 70.39  ? 73  ARG A NH1   1 
ATOM   1148 N  NH2   . ARG C 3 58  ? -6.639  28.496 36.716 1.00 68.85  ? 73  ARG A NH2   1 
ATOM   1149 N  N     . ARG C 3 59  ? -5.620  23.451 41.433 1.00 73.69  ? 74  ARG A N     1 
ATOM   1150 C  CA    . ARG C 3 59  ? -4.472  23.765 42.264 1.00 75.64  ? 74  ARG A CA    1 
ATOM   1151 C  C     . ARG C 3 59  ? -4.231  22.642 43.231 1.00 74.05  ? 74  ARG A C     1 
ATOM   1152 O  O     . ARG C 3 59  ? -3.105  22.346 43.520 1.00 74.78  ? 74  ARG A O     1 
ATOM   1153 C  CB    . ARG C 3 59  ? -4.745  25.034 43.061 1.00 80.65  ? 74  ARG A CB    1 
ATOM   1154 C  CG    . ARG C 3 59  ? -3.620  26.042 43.201 1.00 89.38  ? 74  ARG A CG    1 
ATOM   1155 C  CD    . ARG C 3 59  ? -4.244  27.455 43.242 1.00 95.29  ? 74  ARG A CD    1 
ATOM   1156 N  NE    . ARG C 3 59  ? -5.260  27.584 42.182 1.00 101.96 ? 74  ARG A NE    1 
ATOM   1157 C  CZ    . ARG C 3 59  ? -5.745  28.734 41.693 1.00 105.36 ? 74  ARG A CZ    1 
ATOM   1158 N  NH1   . ARG C 3 59  ? -5.307  29.910 42.157 1.00 107.95 ? 74  ARG A NH1   1 
ATOM   1159 N  NH2   . ARG C 3 59  ? -6.698  28.717 40.747 1.00 106.30 ? 74  ARG A NH2   1 
ATOM   1160 N  N     . HIS C 3 60  ? -5.270  21.990 43.732 1.00 73.01  ? 75  HIS A N     1 
ATOM   1161 C  CA    . HIS C 3 60  ? -5.026  20.944 44.704 1.00 71.78  ? 75  HIS A CA    1 
ATOM   1162 C  C     . HIS C 3 60  ? -4.651  19.549 44.292 1.00 70.00  ? 75  HIS A C     1 
ATOM   1163 O  O     . HIS C 3 60  ? -3.692  19.028 44.825 1.00 71.44  ? 75  HIS A O     1 
ATOM   1164 C  CB    . HIS C 3 60  ? -6.144  20.890 45.729 1.00 75.88  ? 75  HIS A CB    1 
ATOM   1165 C  CG    . HIS C 3 60  ? -6.091  22.031 46.704 1.00 80.98  ? 75  HIS A CG    1 
ATOM   1166 N  ND1   . HIS C 3 60  ? -4.956  22.327 47.446 1.00 81.34  ? 75  HIS A ND1   1 
ATOM   1167 C  CD2   . HIS C 3 60  ? -6.992  23.006 46.993 1.00 81.65  ? 75  HIS A CD2   1 
ATOM   1168 C  CE1   . HIS C 3 60  ? -5.159  23.434 48.137 1.00 82.43  ? 75  HIS A CE1   1 
ATOM   1169 N  NE2   . HIS C 3 60  ? -6.385  23.866 47.881 1.00 83.59  ? 75  HIS A NE2   1 
ATOM   1170 N  N     . CYS C 3 61  ? -5.336  18.872 43.392 1.00 66.09  ? 76  CYS A N     1 
ATOM   1171 C  CA    . CYS C 3 61  ? -4.755  17.578 43.150 1.00 62.49  ? 76  CYS A CA    1 
ATOM   1172 C  C     . CYS C 3 61  ? -3.866  17.647 41.932 1.00 60.98  ? 76  CYS A C     1 
ATOM   1173 O  O     . CYS C 3 61  ? -4.323  17.641 40.784 1.00 62.21  ? 76  CYS A O     1 
ATOM   1174 C  CB    . CYS C 3 61  ? -5.795  16.444 43.026 1.00 61.58  ? 76  CYS A CB    1 
ATOM   1175 S  SG    . CYS C 3 61  ? -5.010  14.777 42.910 1.00 57.77  ? 76  CYS A SG    1 
ATOM   1176 N  N     . GLN C 3 62  ? -2.568  17.703 42.181 1.00 57.88  ? 77  GLN A N     1 
ATOM   1177 C  CA    . GLN C 3 62  ? -1.638  17.745 41.069 1.00 55.00  ? 77  GLN A CA    1 
ATOM   1178 C  C     . GLN C 3 62  ? -1.537  16.410 40.350 1.00 52.43  ? 77  GLN A C     1 
ATOM   1179 O  O     . GLN C 3 62  ? -1.462  16.347 39.124 1.00 50.30  ? 77  GLN A O     1 
ATOM   1180 C  CB    . GLN C 3 62  ? -0.297  18.171 41.587 1.00 55.30  ? 77  GLN A CB    1 
ATOM   1181 C  CG    . GLN C 3 62  ? -0.399  19.391 42.403 1.00 56.70  ? 77  GLN A CG    1 
ATOM   1182 C  CD    . GLN C 3 62  ? 0.925   19.793 42.945 1.00 58.94  ? 77  GLN A CD    1 
ATOM   1183 O  OE1   . GLN C 3 62  ? 1.578   19.027 43.680 1.00 59.34  ? 77  GLN A OE1   1 
ATOM   1184 N  NE2   . GLN C 3 62  ? 1.352   21.005 42.597 1.00 59.57  ? 77  GLN A NE2   1 
ATOM   1185 N  N     . ALA C 3 63  ? -1.534  15.346 41.127 1.00 50.73  ? 78  ALA A N     1 
ATOM   1186 C  CA    . ALA C 3 63  ? -1.461  14.025 40.585 1.00 50.80  ? 78  ALA A CA    1 
ATOM   1187 C  C     . ALA C 3 63  ? -2.458  13.852 39.486 1.00 50.91  ? 78  ALA A C     1 
ATOM   1188 O  O     . ALA C 3 63  ? -2.095  13.554 38.343 1.00 51.98  ? 78  ALA A O     1 
ATOM   1189 C  CB    . ALA C 3 63  ? -1.737  13.039 41.637 1.00 50.66  ? 78  ALA A CB    1 
ATOM   1190 N  N     . CYS C 3 64  ? -3.728  14.064 39.833 1.00 51.02  ? 79  CYS A N     1 
ATOM   1191 C  CA    . CYS C 3 64  ? -4.845  13.885 38.895 1.00 49.96  ? 79  CYS A CA    1 
ATOM   1192 C  C     . CYS C 3 64  ? -4.827  14.890 37.795 1.00 47.93  ? 79  CYS A C     1 
ATOM   1193 O  O     . CYS C 3 64  ? -5.080  14.545 36.646 1.00 48.63  ? 79  CYS A O     1 
ATOM   1194 C  CB    . CYS C 3 64  ? -6.204  13.915 39.632 1.00 50.53  ? 79  CYS A CB    1 
ATOM   1195 S  SG    . CYS C 3 64  ? -6.639  12.437 40.640 1.00 50.71  ? 79  CYS A SG    1 
ATOM   1196 N  N     . ARG C 3 65  ? -4.538  16.138 38.135 1.00 46.54  ? 80  ARG A N     1 
ATOM   1197 C  CA    . ARG C 3 65  ? -4.457  17.149 37.107 1.00 45.70  ? 80  ARG A CA    1 
ATOM   1198 C  C     . ARG C 3 65  ? -3.415  16.705 36.097 1.00 45.80  ? 80  ARG A C     1 
ATOM   1199 O  O     . ARG C 3 65  ? -3.652  16.742 34.915 1.00 45.27  ? 80  ARG A O     1 
ATOM   1200 C  CB    . ARG C 3 65  ? -4.049  18.476 37.709 1.00 44.13  ? 80  ARG A CB    1 
ATOM   1201 C  CG    . ARG C 3 65  ? -3.920  19.624 36.719 1.00 42.19  ? 80  ARG A CG    1 
ATOM   1202 C  CD    . ARG C 3 65  ? -3.695  20.914 37.466 1.00 41.08  ? 80  ARG A CD    1 
ATOM   1203 N  NE    . ARG C 3 65  ? -3.903  22.045 36.576 1.00 40.92  ? 80  ARG A NE    1 
ATOM   1204 C  CZ    . ARG C 3 65  ? -3.556  23.318 36.826 1.00 41.41  ? 80  ARG A CZ    1 
ATOM   1205 N  NH1   . ARG C 3 65  ? -2.974  23.699 37.969 1.00 40.53  ? 80  ARG A NH1   1 
ATOM   1206 N  NH2   . ARG C 3 65  ? -3.755  24.226 35.892 1.00 42.18  ? 80  ARG A NH2   1 
ATOM   1207 N  N     . LEU C 3 66  ? -2.251  16.263 36.551 1.00 47.13  ? 81  LEU A N     1 
ATOM   1208 C  CA    . LEU C 3 66  ? -1.260  15.853 35.592 1.00 49.57  ? 81  LEU A CA    1 
ATOM   1209 C  C     . LEU C 3 66  ? -1.657  14.610 34.825 1.00 51.29  ? 81  LEU A C     1 
ATOM   1210 O  O     . LEU C 3 66  ? -1.467  14.592 33.613 1.00 52.67  ? 81  LEU A O     1 
ATOM   1211 C  CB    . LEU C 3 66  ? 0.099   15.639 36.244 1.00 49.16  ? 81  LEU A CB    1 
ATOM   1212 C  CG    . LEU C 3 66  ? 1.181   15.240 35.212 1.00 47.68  ? 81  LEU A CG    1 
ATOM   1213 C  CD1   . LEU C 3 66  ? 1.422   16.344 34.213 1.00 45.70  ? 81  LEU A CD1   1 
ATOM   1214 C  CD2   . LEU C 3 66  ? 2.433   14.925 35.937 1.00 47.29  ? 81  LEU A CD2   1 
ATOM   1215 N  N     . LYS C 3 67  ? -2.204  13.575 35.482 1.00 51.93  ? 82  LYS A N     1 
ATOM   1216 C  CA    . LYS C 3 67  ? -2.623  12.373 34.721 1.00 53.34  ? 82  LYS A CA    1 
ATOM   1217 C  C     . LYS C 3 67  ? -3.705  12.762 33.712 1.00 53.56  ? 82  LYS A C     1 
ATOM   1218 O  O     . LYS C 3 67  ? -3.843  12.159 32.639 1.00 53.70  ? 82  LYS A O     1 
ATOM   1219 C  CB    . LYS C 3 67  ? -3.169  11.253 35.610 1.00 53.10  ? 82  LYS A CB    1 
ATOM   1220 C  CG    . LYS C 3 67  ? -3.424  9.948  34.822 1.00 53.81  ? 82  LYS A CG    1 
ATOM   1221 C  CD    . LYS C 3 67  ? -4.268  8.884  35.637 1.00 55.82  ? 82  LYS A CD    1 
ATOM   1222 C  CE    . LYS C 3 67  ? -4.541  7.535  34.861 1.00 56.42  ? 82  LYS A CE    1 
ATOM   1223 N  NZ    . LYS C 3 67  ? -4.869  7.692  33.354 1.00 56.35  ? 82  LYS A NZ    1 
ATOM   1224 N  N     . ARG C 3 68  ? -4.457  13.796 34.056 1.00 53.17  ? 83  ARG A N     1 
ATOM   1225 C  CA    . ARG C 3 68  ? -5.474  14.264 33.169 1.00 54.25  ? 83  ARG A CA    1 
ATOM   1226 C  C     . ARG C 3 68  ? -4.890  14.931 31.927 1.00 53.59  ? 83  ARG A C     1 
ATOM   1227 O  O     . ARG C 3 68  ? -5.472  14.824 30.834 1.00 54.01  ? 83  ARG A O     1 
ATOM   1228 C  CB    . ARG C 3 68  ? -6.371  15.235 33.896 1.00 56.22  ? 83  ARG A CB    1 
ATOM   1229 C  CG    . ARG C 3 68  ? -7.506  15.760 33.042 1.00 58.77  ? 83  ARG A CG    1 
ATOM   1230 C  CD    . ARG C 3 68  ? -8.492  14.692 32.734 1.00 59.83  ? 83  ARG A CD    1 
ATOM   1231 N  NE    . ARG C 3 68  ? -9.435  15.189 31.746 1.00 62.63  ? 83  ARG A NE    1 
ATOM   1232 C  CZ    . ARG C 3 68  ? -10.299 14.419 31.082 1.00 63.73  ? 83  ARG A CZ    1 
ATOM   1233 N  NH1   . ARG C 3 68  ? -10.333 13.089 31.314 1.00 63.67  ? 83  ARG A NH1   1 
ATOM   1234 N  NH2   . ARG C 3 68  ? -11.111 14.977 30.182 1.00 61.38  ? 83  ARG A NH2   1 
ATOM   1235 N  N     . CYS C 3 69  ? -3.759  15.627 32.066 1.00 52.78  ? 84  CYS A N     1 
ATOM   1236 C  CA    . CYS C 3 69  ? -3.159  16.265 30.872 1.00 52.92  ? 84  CYS A CA    1 
ATOM   1237 C  C     . CYS C 3 69  ? -2.669  15.180 29.934 1.00 51.73  ? 84  CYS A C     1 
ATOM   1238 O  O     . CYS C 3 69  ? -2.802  15.243 28.715 1.00 52.37  ? 84  CYS A O     1 
ATOM   1239 C  CB    . CYS C 3 69  ? -1.968  17.146 31.205 1.00 51.26  ? 84  CYS A CB    1 
ATOM   1240 S  SG    . CYS C 3 69  ? -2.264  18.528 32.309 1.00 55.04  ? 84  CYS A SG    1 
ATOM   1241 N  N     . VAL C 3 70  ? -2.124  14.150 30.535 1.00 51.18  ? 85  VAL A N     1 
ATOM   1242 C  CA    . VAL C 3 70  ? -1.605  13.101 29.730 1.00 51.52  ? 85  VAL A CA    1 
ATOM   1243 C  C     . VAL C 3 70  ? -2.753  12.386 29.071 1.00 50.11  ? 85  VAL A C     1 
ATOM   1244 O  O     . VAL C 3 70  ? -2.667  12.097 27.880 1.00 49.21  ? 85  VAL A O     1 
ATOM   1245 C  CB    . VAL C 3 70  ? -0.671  12.205 30.570 1.00 50.80  ? 85  VAL A CB    1 
ATOM   1246 C  CG1   . VAL C 3 70  ? -0.386  10.946 29.869 1.00 51.14  ? 85  VAL A CG1   1 
ATOM   1247 C  CG2   . VAL C 3 70  ? 0.624   12.923 30.788 1.00 48.54  ? 85  VAL A CG2   1 
ATOM   1248 N  N     . ASP C 3 71  ? -3.853  12.146 29.780 1.00 50.92  ? 86  ASP A N     1 
ATOM   1249 C  CA    . ASP C 3 71  ? -4.976  11.461 29.099 1.00 53.02  ? 86  ASP A CA    1 
ATOM   1250 C  C     . ASP C 3 71  ? -5.665  12.231 27.973 1.00 52.06  ? 86  ASP A C     1 
ATOM   1251 O  O     . ASP C 3 71  ? -6.151  11.593 27.065 1.00 51.52  ? 86  ASP A O     1 
ATOM   1252 C  CB    . ASP C 3 71  ? -6.047  10.977 30.072 1.00 54.95  ? 86  ASP A CB    1 
ATOM   1253 C  CG    . ASP C 3 71  ? -5.474  10.047 31.154 1.00 59.40  ? 86  ASP A CG    1 
ATOM   1254 O  OD1   . ASP C 3 71  ? -4.496  9.287  30.847 1.00 59.99  ? 86  ASP A OD1   1 
ATOM   1255 O  OD2   . ASP C 3 71  ? -6.006  10.073 32.310 1.00 61.03  ? 86  ASP A OD2   1 
ATOM   1256 N  N     . ILE C 3 72  ? -5.724  13.569 27.996 1.00 51.83  ? 87  ILE A N     1 
ATOM   1257 C  CA    . ILE C 3 72  ? -6.369  14.269 26.873 1.00 51.84  ? 87  ILE A CA    1 
ATOM   1258 C  C     . ILE C 3 72  ? -5.389  14.465 25.715 1.00 53.28  ? 87  ILE A C     1 
ATOM   1259 O  O     . ILE C 3 72  ? -5.680  15.116 24.705 1.00 52.78  ? 87  ILE A O     1 
ATOM   1260 C  CB    . ILE C 3 72  ? -6.939  15.635 27.270 1.00 50.49  ? 87  ILE A CB    1 
ATOM   1261 C  CG1   . ILE C 3 72  ? -5.839  16.644 27.528 1.00 49.01  ? 87  ILE A CG1   1 
ATOM   1262 C  CG2   . ILE C 3 72  ? -7.728  15.496 28.517 1.00 51.41  ? 87  ILE A CG2   1 
ATOM   1263 C  CD1   . ILE C 3 72  ? -6.328  18.071 27.592 1.00 46.14  ? 87  ILE A CD1   1 
ATOM   1264 N  N     . GLY C 3 73  ? -4.198  13.916 25.883 1.00 54.57  ? 88  GLY A N     1 
ATOM   1265 C  CA    . GLY C 3 73  ? -3.213  13.990 24.833 1.00 54.83  ? 88  GLY A CA    1 
ATOM   1266 C  C     . GLY C 3 73  ? -2.156  15.064 24.830 1.00 55.56  ? 88  GLY A C     1 
ATOM   1267 O  O     . GLY C 3 73  ? -1.584  15.341 23.777 1.00 55.92  ? 88  GLY A O     1 
ATOM   1268 N  N     . MET C 3 74  ? -1.906  15.716 25.944 1.00 56.01  ? 89  MET A N     1 
ATOM   1269 C  CA    . MET C 3 74  ? -0.834  16.690 25.881 1.00 57.90  ? 89  MET A CA    1 
ATOM   1270 C  C     . MET C 3 74  ? 0.423   15.830 25.729 1.00 59.22  ? 89  MET A C     1 
ATOM   1271 O  O     . MET C 3 74  ? 0.477   14.701 26.202 1.00 59.75  ? 89  MET A O     1 
ATOM   1272 C  CB    . MET C 3 74  ? -0.788  17.555 27.132 1.00 56.80  ? 89  MET A CB    1 
ATOM   1273 C  CG    . MET C 3 74  ? -2.032  18.355 27.234 1.00 55.63  ? 89  MET A CG    1 
ATOM   1274 S  SD    . MET C 3 74  ? -2.098  19.164 28.757 1.00 58.68  ? 89  MET A SD    1 
ATOM   1275 C  CE    . MET C 3 74  ? -1.359  20.788 28.302 1.00 55.77  ? 89  MET A CE    1 
ATOM   1276 N  N     . MET C 3 75  ? 1.429   16.365 25.059 1.00 60.07  ? 90  MET A N     1 
ATOM   1277 C  CA    . MET C 3 75  ? 2.632   15.615 24.781 1.00 59.95  ? 90  MET A CA    1 
ATOM   1278 C  C     . MET C 3 75  ? 3.856   16.279 25.311 1.00 58.93  ? 90  MET A C     1 
ATOM   1279 O  O     . MET C 3 75  ? 4.153   17.374 24.862 1.00 58.90  ? 90  MET A O     1 
ATOM   1280 C  CB    . MET C 3 75  ? 2.757   15.564 23.300 1.00 61.48  ? 90  MET A CB    1 
ATOM   1281 C  CG    . MET C 3 75  ? 1.500   15.142 22.677 1.00 63.23  ? 90  MET A CG    1 
ATOM   1282 S  SD    . MET C 3 75  ? 1.718   13.455 22.192 1.00 68.14  ? 90  MET A SD    1 
ATOM   1283 C  CE    . MET C 3 75  ? 1.702   13.745 20.304 1.00 64.80  ? 90  MET A CE    1 
ATOM   1284 N  N     . LYS C 3 76  ? 4.577   15.636 26.228 1.00 58.11  ? 91  LYS A N     1 
ATOM   1285 C  CA    . LYS C 3 76  ? 5.837   16.225 26.767 1.00 57.37  ? 91  LYS A CA    1 
ATOM   1286 C  C     . LYS C 3 76  ? 6.814   16.517 25.604 1.00 56.47  ? 91  LYS A C     1 
ATOM   1287 O  O     . LYS C 3 76  ? 7.497   17.552 25.590 1.00 55.30  ? 91  LYS A O     1 
ATOM   1288 C  CB    . LYS C 3 76  ? 6.504   15.289 27.796 1.00 56.37  ? 91  LYS A CB    1 
ATOM   1289 C  CG    . LYS C 3 76  ? 6.917   13.967 27.189 1.00 56.40  ? 91  LYS A CG    1 
ATOM   1290 C  CD    . LYS C 3 76  ? 7.024   12.854 28.184 1.00 55.78  ? 91  LYS A CD    1 
ATOM   1291 C  CE    . LYS C 3 76  ? 7.097   11.539 27.401 1.00 57.04  ? 91  LYS A CE    1 
ATOM   1292 N  NZ    . LYS C 3 76  ? 7.199   10.290 28.266 1.00 58.98  ? 91  LYS A NZ    1 
ATOM   1293 N  N     . GLU C 3 77  ? 6.827   15.639 24.607 1.00 55.93  ? 92  GLU A N     1 
ATOM   1294 C  CA    . GLU C 3 77  ? 7.694   15.848 23.469 1.00 57.64  ? 92  GLU A CA    1 
ATOM   1295 C  C     . GLU C 3 77  ? 7.632   17.251 22.873 1.00 57.78  ? 92  GLU A C     1 
ATOM   1296 O  O     . GLU C 3 77  ? 8.607   17.729 22.342 1.00 58.60  ? 92  GLU A O     1 
ATOM   1297 C  CB    . GLU C 3 77  ? 7.405   14.855 22.356 1.00 59.47  ? 92  GLU A CB    1 
ATOM   1298 C  CG    . GLU C 3 77  ? 7.620   13.383 22.712 1.00 64.16  ? 92  GLU A CG    1 
ATOM   1299 C  CD    . GLU C 3 77  ? 6.456   12.757 23.500 1.00 66.34  ? 92  GLU A CD    1 
ATOM   1300 O  OE1   . GLU C 3 77  ? 5.274   13.136 23.277 1.00 66.79  ? 92  GLU A OE1   1 
ATOM   1301 O  OE2   . GLU C 3 77  ? 6.730   11.858 24.331 1.00 67.24  ? 92  GLU A OE2   1 
ATOM   1302 N  N     . PHE C 3 78  ? 6.505   17.926 22.957 1.00 57.88  ? 93  PHE A N     1 
ATOM   1303 C  CA    . PHE C 3 78  ? 6.384   19.257 22.371 1.00 57.41  ? 93  PHE A CA    1 
ATOM   1304 C  C     . PHE C 3 78  ? 6.954   20.379 23.247 1.00 58.27  ? 93  PHE A C     1 
ATOM   1305 O  O     . PHE C 3 78  ? 6.896   21.564 22.895 1.00 57.97  ? 93  PHE A O     1 
ATOM   1306 C  CB    . PHE C 3 78  ? 4.914   19.548 22.070 1.00 58.56  ? 93  PHE A CB    1 
ATOM   1307 C  CG    . PHE C 3 78  ? 4.356   18.768 20.944 1.00 58.35  ? 93  PHE A CG    1 
ATOM   1308 C  CD1   . PHE C 3 78  ? 5.095   18.558 19.798 1.00 60.45  ? 93  PHE A CD1   1 
ATOM   1309 C  CD2   . PHE C 3 78  ? 3.042   18.411 20.948 1.00 58.95  ? 93  PHE A CD2   1 
ATOM   1310 C  CE1   . PHE C 3 78  ? 4.503   18.015 18.661 1.00 62.52  ? 93  PHE A CE1   1 
ATOM   1311 C  CE2   . PHE C 3 78  ? 2.436   17.872 19.834 1.00 59.80  ? 93  PHE A CE2   1 
ATOM   1312 C  CZ    . PHE C 3 78  ? 3.148   17.676 18.696 1.00 61.59  ? 93  PHE A CZ    1 
ATOM   1313 N  N     . ILE C 3 79  ? 7.470   20.007 24.408 1.00 58.29  ? 94  ILE A N     1 
ATOM   1314 C  CA    . ILE C 3 79  ? 8.093   20.961 25.314 1.00 58.13  ? 94  ILE A CA    1 
ATOM   1315 C  C     . ILE C 3 79  ? 9.544   21.099 24.852 1.00 59.83  ? 94  ILE A C     1 
ATOM   1316 O  O     . ILE C 3 79  ? 10.276  20.087 24.828 1.00 60.52  ? 94  ILE A O     1 
ATOM   1317 C  CB    . ILE C 3 79  ? 8.142   20.357 26.715 1.00 58.41  ? 94  ILE A CB    1 
ATOM   1318 C  CG1   . ILE C 3 79  ? 6.733   20.073 27.193 1.00 58.83  ? 94  ILE A CG1   1 
ATOM   1319 C  CG2   . ILE C 3 79  ? 8.945   21.230 27.642 1.00 57.90  ? 94  ILE A CG2   1 
ATOM   1320 C  CD1   . ILE C 3 79  ? 6.651   19.396 28.527 1.00 58.98  ? 94  ILE A CD1   1 
ATOM   1321 N  N     . LEU C 3 80  ? 10.006  22.280 24.476 1.00 60.45  ? 95  LEU A N     1 
ATOM   1322 C  CA    . LEU C 3 80  ? 11.428  22.345 24.105 1.00 60.83  ? 95  LEU A CA    1 
ATOM   1323 C  C     . LEU C 3 80  ? 12.288  21.894 25.278 1.00 62.61  ? 95  LEU A C     1 
ATOM   1324 O  O     . LEU C 3 80  ? 11.853  21.980 26.430 1.00 62.91  ? 95  LEU A O     1 
ATOM   1325 C  CB    . LEU C 3 80  ? 11.872  23.753 23.783 1.00 59.12  ? 95  LEU A CB    1 
ATOM   1326 C  CG    . LEU C 3 80  ? 10.962  24.419 22.806 1.00 58.65  ? 95  LEU A CG    1 
ATOM   1327 C  CD1   . LEU C 3 80  ? 11.583  25.694 22.391 1.00 57.72  ? 95  LEU A CD1   1 
ATOM   1328 C  CD2   . LEU C 3 80  ? 10.735  23.508 21.639 1.00 58.29  ? 95  LEU A CD2   1 
ATOM   1329 N  N     . THR C 3 81  ? 13.508  21.431 24.970 1.00 64.60  ? 96  THR A N     1 
ATOM   1330 C  CA    . THR C 3 81  ? 14.514  21.003 25.957 1.00 66.01  ? 96  THR A CA    1 
ATOM   1331 C  C     . THR C 3 81  ? 15.389  22.219 26.224 1.00 67.70  ? 96  THR A C     1 
ATOM   1332 O  O     . THR C 3 81  ? 15.323  23.220 25.509 1.00 66.79  ? 96  THR A O     1 
ATOM   1333 C  CB    . THR C 3 81  ? 15.453  19.992 25.401 1.00 66.27  ? 96  THR A CB    1 
ATOM   1334 O  OG1   . THR C 3 81  ? 16.324  20.636 24.454 1.00 68.05  ? 96  THR A OG1   1 
ATOM   1335 C  CG2   . THR C 3 81  ? 14.697  18.936 24.679 1.00 66.68  ? 96  THR A CG2   1 
ATOM   1336 N  N     . ASP C 3 82  ? 16.260  22.123 27.215 1.00 70.21  ? 97  ASP A N     1 
ATOM   1337 C  CA    . ASP C 3 82  ? 17.100  23.270 27.527 1.00 72.78  ? 97  ASP A CA    1 
ATOM   1338 C  C     . ASP C 3 82  ? 18.070  23.627 26.415 1.00 72.61  ? 97  ASP A C     1 
ATOM   1339 O  O     . ASP C 3 82  ? 18.220  24.810 26.060 1.00 70.76  ? 97  ASP A O     1 
ATOM   1340 C  CB    . ASP C 3 82  ? 17.826  23.021 28.829 1.00 76.12  ? 97  ASP A CB    1 
ATOM   1341 C  CG    . ASP C 3 82  ? 16.879  22.597 29.939 1.00 80.17  ? 97  ASP A CG    1 
ATOM   1342 O  OD1   . ASP C 3 82  ? 15.699  23.090 29.955 1.00 82.30  ? 97  ASP A OD1   1 
ATOM   1343 O  OD2   . ASP C 3 82  ? 17.323  21.781 30.800 1.00 81.15  ? 97  ASP A OD2   1 
ATOM   1344 N  N     . GLU C 3 83  ? 18.702  22.589 25.871 1.00 72.97  ? 98  GLU A N     1 
ATOM   1345 C  CA    . GLU C 3 83  ? 19.635  22.745 24.774 1.00 74.62  ? 98  GLU A CA    1 
ATOM   1346 C  C     . GLU C 3 83  ? 18.882  23.442 23.659 1.00 73.99  ? 98  GLU A C     1 
ATOM   1347 O  O     . GLU C 3 83  ? 19.410  24.373 23.035 1.00 73.29  ? 98  GLU A O     1 
ATOM   1348 C  CB    . GLU C 3 83  ? 20.114  21.396 24.247 1.00 77.13  ? 98  GLU A CB    1 
ATOM   1349 C  CG    . GLU C 3 83  ? 20.721  20.451 25.260 1.00 82.96  ? 98  GLU A CG    1 
ATOM   1350 C  CD    . GLU C 3 83  ? 19.673  19.617 26.014 1.00 86.33  ? 98  GLU A CD    1 
ATOM   1351 O  OE1   . GLU C 3 83  ? 18.983  20.183 26.908 1.00 86.77  ? 98  GLU A OE1   1 
ATOM   1352 O  OE2   . GLU C 3 83  ? 19.547  18.399 25.692 1.00 88.39  ? 98  GLU A OE2   1 
ATOM   1353 N  N     . GLU C 3 84  ? 17.653  22.980 23.408 1.00 73.01  ? 99  GLU A N     1 
ATOM   1354 C  CA    . GLU C 3 84  ? 16.816  23.565 22.370 1.00 73.01  ? 99  GLU A CA    1 
ATOM   1355 C  C     . GLU C 3 84  ? 16.466  25.042 22.657 1.00 73.06  ? 99  GLU A C     1 
ATOM   1356 O  O     . GLU C 3 84  ? 16.494  25.884 21.769 1.00 71.71  ? 99  GLU A O     1 
ATOM   1357 C  CB    . GLU C 3 84  ? 15.518  22.741 22.188 1.00 72.53  ? 99  GLU A CB    1 
ATOM   1358 C  CG    . GLU C 3 84  ? 15.738  21.270 21.822 1.00 72.67  ? 99  GLU A CG    1 
ATOM   1359 C  CD    . GLU C 3 84  ? 14.456  20.494 21.488 1.00 71.92  ? 99  GLU A CD    1 
ATOM   1360 O  OE1   . GLU C 3 84  ? 13.474  20.615 22.239 1.00 71.11  ? 99  GLU A OE1   1 
ATOM   1361 O  OE2   . GLU C 3 84  ? 14.441  19.739 20.488 1.00 70.80  ? 99  GLU A OE2   1 
ATOM   1362 N  N     . VAL C 3 85  ? 16.148  25.368 23.899 1.00 74.06  ? 100 VAL A N     1 
ATOM   1363 C  CA    . VAL C 3 85  ? 15.783  26.741 24.207 1.00 75.15  ? 100 VAL A CA    1 
ATOM   1364 C  C     . VAL C 3 85  ? 16.956  27.636 23.961 1.00 76.01  ? 100 VAL A C     1 
ATOM   1365 O  O     . VAL C 3 85  ? 16.849  28.658 23.308 1.00 74.64  ? 100 VAL A O     1 
ATOM   1366 C  CB    . VAL C 3 85  ? 15.397  26.907 25.665 1.00 75.39  ? 100 VAL A CB    1 
ATOM   1367 C  CG1   . VAL C 3 85  ? 14.755  28.264 25.853 1.00 75.31  ? 100 VAL A CG1   1 
ATOM   1368 C  CG2   . VAL C 3 85  ? 14.478  25.790 26.104 1.00 75.02  ? 100 VAL A CG2   1 
ATOM   1369 N  N     . GLN C 3 86  ? 18.076  27.222 24.538 1.00 78.13  ? 101 GLN A N     1 
ATOM   1370 C  CA    . GLN C 3 86  ? 19.354  27.905 24.424 1.00 80.44  ? 101 GLN A CA    1 
ATOM   1371 C  C     . GLN C 3 86  ? 19.781  28.127 22.973 1.00 81.30  ? 101 GLN A C     1 
ATOM   1372 O  O     . GLN C 3 86  ? 20.230  29.208 22.643 1.00 80.80  ? 101 GLN A O     1 
ATOM   1373 C  CB    . GLN C 3 86  ? 20.420  27.099 25.169 1.00 82.19  ? 101 GLN A CB    1 
ATOM   1374 C  CG    . GLN C 3 86  ? 21.795  27.754 25.275 1.00 84.80  ? 101 GLN A CG    1 
ATOM   1375 C  CD    . GLN C 3 86  ? 21.729  29.183 25.814 1.00 86.56  ? 101 GLN A CD    1 
ATOM   1376 O  OE1   . GLN C 3 86  ? 20.975  29.476 26.770 1.00 87.72  ? 101 GLN A OE1   1 
ATOM   1377 N  NE2   . GLN C 3 86  ? 22.526  30.080 25.216 1.00 85.84  ? 101 GLN A NE2   1 
ATOM   1378 N  N     . ARG C 3 87  ? 19.672  27.131 22.099 1.00 83.22  ? 102 ARG A N     1 
ATOM   1379 C  CA    . ARG C 3 87  ? 20.058  27.398 20.734 1.00 85.83  ? 102 ARG A CA    1 
ATOM   1380 C  C     . ARG C 3 87  ? 19.162  28.456 20.190 1.00 86.54  ? 102 ARG A C     1 
ATOM   1381 O  O     . ARG C 3 87  ? 19.577  29.239 19.350 1.00 87.50  ? 102 ARG A O     1 
ATOM   1382 C  CB    . ARG C 3 87  ? 19.932  26.191 19.856 1.00 87.51  ? 102 ARG A CB    1 
ATOM   1383 C  CG    . ARG C 3 87  ? 21.042  25.276 20.019 1.00 93.06  ? 102 ARG A CG    1 
ATOM   1384 C  CD    . ARG C 3 87  ? 22.344  26.017 20.074 1.00 96.00  ? 102 ARG A CD    1 
ATOM   1385 N  NE    . ARG C 3 87  ? 23.314  25.208 20.814 1.00 99.78  ? 102 ARG A NE    1 
ATOM   1386 C  CZ    . ARG C 3 87  ? 23.374  25.103 22.142 1.00 102.13 ? 102 ARG A CZ    1 
ATOM   1387 N  NH1   . ARG C 3 87  ? 22.527  25.766 22.917 1.00 103.70 ? 102 ARG A NH1   1 
ATOM   1388 N  NH2   . ARG C 3 87  ? 24.272  24.303 22.705 1.00 103.76 ? 102 ARG A NH2   1 
ATOM   1389 N  N     . LYS C 3 88  ? 17.920  28.477 20.661 1.00 88.17  ? 103 LYS A N     1 
ATOM   1390 C  CA    . LYS C 3 88  ? 16.947  29.459 20.206 1.00 89.48  ? 103 LYS A CA    1 
ATOM   1391 C  C     . LYS C 3 88  ? 17.439  30.850 20.657 1.00 91.23  ? 103 LYS A C     1 
ATOM   1392 O  O     . LYS C 3 88  ? 17.692  31.724 19.812 1.00 91.75  ? 103 LYS A O     1 
ATOM   1393 C  CB    . LYS C 3 88  ? 15.566  29.132 20.795 1.00 89.16  ? 103 LYS A CB    1 
ATOM   1394 C  CG    . LYS C 3 88  ? 14.338  29.644 19.998 1.00 88.47  ? 103 LYS A CG    1 
ATOM   1395 C  CD    . LYS C 3 88  ? 13.045  29.600 20.867 1.00 87.95  ? 103 LYS A CD    1 
ATOM   1396 C  CE    . LYS C 3 88  ? 11.762  30.050 20.125 1.00 87.03  ? 103 LYS A CE    1 
ATOM   1397 N  NZ    . LYS C 3 88  ? 10.632  30.257 21.108 1.00 85.19  ? 103 LYS A NZ    1 
ATOM   1398 N  N     . ARG C 3 89  ? 17.590  31.060 21.971 1.00 92.58  ? 104 ARG A N     1 
ATOM   1399 C  CA    . ARG C 3 89  ? 18.078  32.343 22.469 1.00 93.90  ? 104 ARG A CA    1 
ATOM   1400 C  C     . ARG C 3 89  ? 19.260  32.760 21.613 1.00 95.10  ? 104 ARG A C     1 
ATOM   1401 O  O     . ARG C 3 89  ? 19.394  33.935 21.283 1.00 95.63  ? 104 ARG A O     1 
ATOM   1402 C  CB    . ARG C 3 89  ? 18.504  32.254 23.938 1.00 94.00  ? 104 ARG A CB    1 
ATOM   1403 C  CG    . ARG C 3 89  ? 17.374  32.506 24.905 1.00 95.58  ? 104 ARG A CG    1 
ATOM   1404 C  CD    . ARG C 3 89  ? 17.813  32.531 26.368 1.00 97.58  ? 104 ARG A CD    1 
ATOM   1405 N  NE    . ARG C 3 89  ? 18.075  31.203 26.939 1.00 98.94  ? 104 ARG A NE    1 
ATOM   1406 C  CZ    . ARG C 3 89  ? 17.529  30.720 28.067 1.00 99.45  ? 104 ARG A CZ    1 
ATOM   1407 N  NH1   . ARG C 3 89  ? 16.662  31.433 28.793 1.00 97.89  ? 104 ARG A NH1   1 
ATOM   1408 N  NH2   . ARG C 3 89  ? 17.864  29.500 28.480 1.00 99.30  ? 104 ARG A NH2   1 
ATOM   1409 N  N     . GLU C 3 90  ? 20.095  31.786 21.236 1.00 96.16  ? 105 GLU A N     1 
ATOM   1410 C  CA    . GLU C 3 90  ? 21.289  32.004 20.399 1.00 97.29  ? 105 GLU A CA    1 
ATOM   1411 C  C     . GLU C 3 90  ? 20.954  32.239 18.939 1.00 99.31  ? 105 GLU A C     1 
ATOM   1412 O  O     . GLU C 3 90  ? 21.708  31.872 18.046 1.00 99.25  ? 105 GLU A O     1 
ATOM   1413 C  CB    . GLU C 3 90  ? 22.227  30.801 20.485 1.00 95.21  ? 105 GLU A CB    1 
ATOM   1414 C  CG    . GLU C 3 90  ? 23.209  30.844 21.612 1.00 92.85  ? 105 GLU A CG    1 
ATOM   1415 C  CD    . GLU C 3 90  ? 23.694  29.467 21.972 1.00 92.11  ? 105 GLU A CD    1 
ATOM   1416 O  OE1   . GLU C 3 90  ? 23.931  28.665 21.048 1.00 92.03  ? 105 GLU A OE1   1 
ATOM   1417 O  OE2   . GLU C 3 90  ? 23.840  29.178 23.175 1.00 91.27  ? 105 GLU A OE2   1 
ATOM   1418 N  N     . MET C 3 91  ? 19.815  32.854 18.701 1.00 101.77 ? 106 MET A N     1 
ATOM   1419 C  CA    . MET C 3 91  ? 19.372  33.117 17.347 1.00 104.64 ? 106 MET A CA    1 
ATOM   1420 C  C     . MET C 3 91  ? 18.452  34.311 17.459 1.00 105.98 ? 106 MET A C     1 
ATOM   1421 O  O     . MET C 3 91  ? 18.236  35.036 16.485 1.00 106.24 ? 106 MET A O     1 
ATOM   1422 C  CB    . MET C 3 91  ? 18.606  31.909 16.808 1.00 105.71 ? 106 MET A CB    1 
ATOM   1423 C  CG    . MET C 3 91  ? 19.479  30.725 16.463 1.00 106.95 ? 106 MET A CG    1 
ATOM   1424 S  SD    . MET C 3 91  ? 19.938  30.800 14.727 1.00 109.67 ? 106 MET A SD    1 
ATOM   1425 C  CE    . MET C 3 91  ? 18.787  29.557 13.984 1.00 108.34 ? 106 MET A CE    1 
ATOM   1426 N  N     . ILE C 3 92  ? 17.908  34.484 18.668 1.00 107.54 ? 107 ILE A N     1 
ATOM   1427 C  CA    . ILE C 3 92  ? 17.013  35.593 19.003 1.00 108.71 ? 107 ILE A CA    1 
ATOM   1428 C  C     . ILE C 3 92  ? 17.919  36.800 19.287 1.00 109.65 ? 107 ILE A C     1 
ATOM   1429 O  O     . ILE C 3 92  ? 17.455  37.938 19.440 1.00 109.74 ? 107 ILE A O     1 
ATOM   1430 C  CB    . ILE C 3 92  ? 16.157  35.265 20.265 1.00 109.09 ? 107 ILE A CB    1 
ATOM   1431 C  CG1   . ILE C 3 92  ? 15.401  33.955 20.058 1.00 109.12 ? 107 ILE A CG1   1 
ATOM   1432 C  CG2   . ILE C 3 92  ? 15.130  36.348 20.507 1.00 109.70 ? 107 ILE A CG2   1 
ATOM   1433 C  CD1   . ILE C 3 92  ? 14.578  33.928 18.798 1.00 108.83 ? 107 ILE A CD1   1 
ATOM   1434 N  N     . LEU C 3 93  ? 19.224  36.517 19.339 1.00 110.20 ? 108 LEU A N     1 
ATOM   1435 C  CA    . LEU C 3 93  ? 20.275  37.509 19.575 1.00 110.56 ? 108 LEU A CA    1 
ATOM   1436 C  C     . LEU C 3 93  ? 21.415  37.254 18.570 1.00 110.55 ? 108 LEU A C     1 
ATOM   1437 O  O     . LEU C 3 93  ? 22.480  37.867 18.641 1.00 110.12 ? 108 LEU A O     1 
ATOM   1438 C  CB    . LEU C 3 93  ? 20.779  37.409 21.023 1.00 110.93 ? 108 LEU A CB    1 
ATOM   1439 C  CG    . LEU C 3 93  ? 19.745  37.599 22.150 1.00 111.22 ? 108 LEU A CG    1 
ATOM   1440 C  CD1   . LEU C 3 93  ? 20.316  37.011 23.432 1.00 111.14 ? 108 LEU A CD1   1 
ATOM   1441 C  CD2   . LEU C 3 93  ? 19.377  39.088 22.327 1.00 111.06 ? 108 LEU A CD2   1 
ATOM   1442 N  N     . LYS C 3 94  ? 21.171  36.318 17.652 1.00 110.64 ? 109 LYS A N     1 
ATOM   1443 C  CA    . LYS C 3 94  ? 22.094  35.976 16.572 1.00 110.80 ? 109 LYS A CA    1 
ATOM   1444 C  C     . LYS C 3 94  ? 21.331  36.490 15.361 1.00 111.25 ? 109 LYS A C     1 
ATOM   1445 O  O     . LYS C 3 94  ? 21.769  36.361 14.221 1.00 110.70 ? 109 LYS A O     1 
ATOM   1446 C  CB    . LYS C 3 94  ? 22.291  34.466 16.479 1.00 110.51 ? 109 LYS A CB    1 
ATOM   1447 N  N     . ARG C 3 95  ? 20.157  37.054 15.665 1.00 112.41 ? 110 ARG A N     1 
ATOM   1448 C  CA    . ARG C 3 95  ? 19.228  37.666 14.705 1.00 113.81 ? 110 ARG A CA    1 
ATOM   1449 C  C     . ARG C 3 95  ? 19.083  39.150 15.069 1.00 114.51 ? 110 ARG A C     1 
ATOM   1450 O  O     . ARG C 3 95  ? 18.885  39.983 14.190 1.00 115.29 ? 110 ARG A O     1 
ATOM   1451 C  CB    . ARG C 3 95  ? 17.863  36.983 14.745 1.00 113.09 ? 110 ARG A CB    1 
ATOM   1452 N  N     . LYS C 3 96  ? 19.165  39.479 16.361 1.00 115.09 ? 111 LYS A N     1 
ATOM   1453 C  CA    . LYS C 3 96  ? 19.107  40.882 16.808 1.00 115.80 ? 111 LYS A CA    1 
ATOM   1454 C  C     . LYS C 3 96  ? 20.571  41.415 16.739 1.00 116.28 ? 111 LYS A C     1 
ATOM   1455 O  O     . LYS C 3 96  ? 20.941  42.426 17.364 1.00 116.95 ? 111 LYS A O     1 
ATOM   1456 C  CB    . LYS C 3 96  ? 18.531  40.979 18.262 1.00 114.74 ? 111 LYS A CB    1 
ATOM   1457 N  N     . GLU C 3 97  ? 21.381  40.685 15.962 1.00 116.35 ? 112 GLU A N     1 
ATOM   1458 C  CA    . GLU C 3 97  ? 22.801  40.960 15.697 1.00 115.73 ? 112 GLU A CA    1 
ATOM   1459 C  C     . GLU C 3 97  ? 23.075  40.483 14.241 1.00 115.77 ? 112 GLU A C     1 
ATOM   1460 O  O     . GLU C 3 97  ? 24.216  40.279 13.810 1.00 115.61 ? 112 GLU A O     1 
ATOM   1461 C  CB    . GLU C 3 97  ? 23.695  40.211 16.711 1.00 115.08 ? 112 GLU A CB    1 
ATOM   1462 N  N     . GLU C 3 98  ? 21.983  40.271 13.516 1.00 115.41 ? 113 GLU A N     1 
ATOM   1463 C  CA    . GLU C 3 98  ? 21.992  39.891 12.112 1.00 115.38 ? 113 GLU A CA    1 
ATOM   1464 C  C     . GLU C 3 98  ? 21.201  41.088 11.546 1.00 116.00 ? 113 GLU A C     1 
ATOM   1465 O  O     . GLU C 3 98  ? 21.212  41.360 10.331 1.00 116.69 ? 113 GLU A O     1 
ATOM   1466 C  CB    . GLU C 3 98  ? 21.229  38.573 11.893 1.00 114.02 ? 113 GLU A CB    1 
ATOM   1467 N  N     . GLU C 3 99  ? 20.536  41.805 12.471 1.00 115.86 ? 114 GLU A N     1 
ATOM   1468 C  CA    . GLU C 3 99  ? 19.721  43.003 12.192 1.00 115.70 ? 114 GLU A CA    1 
ATOM   1469 C  C     . GLU C 3 99  ? 20.407  44.235 12.789 1.00 115.25 ? 114 GLU A C     1 
ATOM   1470 O  O     . GLU C 3 99  ? 21.231  44.117 13.701 1.00 115.16 ? 114 GLU A O     1 
ATOM   1471 C  CB    . GLU C 3 99  ? 18.307  42.851 12.798 1.00 114.39 ? 114 GLU A CB    1 
ATOM   1472 N  N     . PRO D 3 6   ? -13.557 36.363 50.477 1.00 104.50 ? 221 PRO B N     1 
ATOM   1473 C  CA    . PRO D 3 6   ? -14.336 37.239 51.402 1.00 104.17 ? 221 PRO B CA    1 
ATOM   1474 C  C     . PRO D 3 6   ? -13.678 37.639 52.745 1.00 103.18 ? 221 PRO B C     1 
ATOM   1475 O  O     . PRO D 3 6   ? -14.167 38.546 53.420 1.00 103.73 ? 221 PRO B O     1 
ATOM   1476 C  CB    . PRO D 3 6   ? -15.668 36.532 51.626 1.00 104.29 ? 221 PRO B CB    1 
ATOM   1477 C  CG    . PRO D 3 6   ? -15.854 35.830 50.242 1.00 104.75 ? 221 PRO B CG    1 
ATOM   1478 C  CD    . PRO D 3 6   ? -14.440 35.351 49.850 1.00 104.79 ? 221 PRO B CD    1 
ATOM   1479 N  N     . ARG D 3 7   ? -12.568 36.989 53.107 1.00 101.27 ? 222 ARG B N     1 
ATOM   1480 C  CA    . ARG D 3 7   ? -11.826 37.240 54.371 1.00 98.96  ? 222 ARG B CA    1 
ATOM   1481 C  C     . ARG D 3 7   ? -12.580 36.798 55.627 1.00 96.59  ? 222 ARG B C     1 
ATOM   1482 O  O     . ARG D 3 7   ? -13.633 36.196 55.522 1.00 97.14  ? 222 ARG B O     1 
ATOM   1483 C  CB    . ARG D 3 7   ? -11.379 38.705 54.488 1.00 99.25  ? 222 ARG B CB    1 
ATOM   1484 C  CG    . ARG D 3 7   ? -9.922  38.907 54.036 1.00 100.40 ? 222 ARG B CG    1 
ATOM   1485 C  CD    . ARG D 3 7   ? -9.675  38.460 52.575 1.00 101.25 ? 222 ARG B CD    1 
ATOM   1486 N  NE    . ARG D 3 7   ? -8.260  38.177 52.309 1.00 101.37 ? 222 ARG B NE    1 
ATOM   1487 C  CZ    . ARG D 3 7   ? -7.795  37.569 51.211 1.00 101.39 ? 222 ARG B CZ    1 
ATOM   1488 N  NH1   . ARG D 3 7   ? -8.622  37.175 50.248 1.00 100.67 ? 222 ARG B NH1   1 
ATOM   1489 N  NH2   . ARG D 3 7   ? -6.495  37.312 51.093 1.00 100.21 ? 222 ARG B NH2   1 
ATOM   1490 N  N     . ILE D 3 8   ? -12.056 37.065 56.812 1.00 94.21  ? 223 ILE B N     1 
ATOM   1491 C  CA    . ILE D 3 8   ? -12.731 36.609 58.028 1.00 91.76  ? 223 ILE B CA    1 
ATOM   1492 C  C     . ILE D 3 8   ? -12.722 35.080 58.155 1.00 89.97  ? 223 ILE B C     1 
ATOM   1493 O  O     . ILE D 3 8   ? -13.372 34.353 57.398 1.00 89.45  ? 223 ILE B O     1 
ATOM   1494 C  CB    . ILE D 3 8   ? -14.220 37.107 58.118 1.00 91.31  ? 223 ILE B CB    1 
ATOM   1495 C  CG1   . ILE D 3 8   ? -14.274 38.532 58.689 1.00 90.74  ? 223 ILE B CG1   1 
ATOM   1496 C  CG2   . ILE D 3 8   ? -15.044 36.176 59.012 1.00 90.02  ? 223 ILE B CG2   1 
ATOM   1497 C  CD1   . ILE D 3 8   ? -13.650 39.593 57.804 1.00 90.82  ? 223 ILE B CD1   1 
ATOM   1498 N  N     . CYS D 3 9   ? -11.969 34.606 59.135 1.00 87.84  ? 224 CYS B N     1 
ATOM   1499 C  CA    . CYS D 3 9   ? -11.862 33.182 59.418 1.00 85.53  ? 224 CYS B CA    1 
ATOM   1500 C  C     . CYS D 3 9   ? -13.267 32.590 59.543 1.00 84.54  ? 224 CYS B C     1 
ATOM   1501 O  O     . CYS D 3 9   ? -14.180 33.196 60.077 1.00 84.08  ? 224 CYS B O     1 
ATOM   1502 C  CB    . CYS D 3 9   ? -11.072 32.980 60.726 1.00 84.53  ? 224 CYS B CB    1 
ATOM   1503 S  SG    . CYS D 3 9   ? -10.801 31.285 61.240 1.00 82.02  ? 224 CYS B SG    1 
ATOM   1504 N  N     . GLY D 3 10  ? -13.446 31.391 59.038 1.00 83.46  ? 225 GLY B N     1 
ATOM   1505 C  CA    . GLY D 3 10  ? -14.750 30.796 59.137 1.00 82.42  ? 225 GLY B CA    1 
ATOM   1506 C  C     . GLY D 3 10  ? -14.861 29.944 60.371 1.00 82.04  ? 225 GLY B C     1 
ATOM   1507 O  O     . GLY D 3 10  ? -15.944 29.525 60.739 1.00 82.70  ? 225 GLY B O     1 
ATOM   1508 N  N     . VAL D 3 11  ? -13.749 29.662 61.022 1.00 81.79  ? 226 VAL B N     1 
ATOM   1509 C  CA    . VAL D 3 11  ? -13.825 28.840 62.209 1.00 81.60  ? 226 VAL B CA    1 
ATOM   1510 C  C     . VAL D 3 11  ? -13.898 29.691 63.440 1.00 81.77  ? 226 VAL B C     1 
ATOM   1511 O  O     . VAL D 3 11  ? -14.744 29.473 64.290 1.00 81.81  ? 226 VAL B O     1 
ATOM   1512 C  CB    . VAL D 3 11  ? -12.603 27.913 62.362 1.00 80.72  ? 226 VAL B CB    1 
ATOM   1513 C  CG1   . VAL D 3 11  ? -12.532 27.364 63.802 1.00 79.64  ? 226 VAL B CG1   1 
ATOM   1514 C  CG2   . VAL D 3 11  ? -12.696 26.780 61.366 1.00 80.05  ? 226 VAL B CG2   1 
ATOM   1515 N  N     . CYS D 3 12  ? -13.017 30.672 63.532 1.00 82.46  ? 227 CYS B N     1 
ATOM   1516 C  CA    . CYS D 3 12  ? -12.996 31.485 64.721 1.00 83.10  ? 227 CYS B CA    1 
ATOM   1517 C  C     . CYS D 3 12  ? -13.583 32.871 64.591 1.00 82.49  ? 227 CYS B C     1 
ATOM   1518 O  O     . CYS D 3 12  ? -13.836 33.523 65.597 1.00 82.75  ? 227 CYS B O     1 
ATOM   1519 C  CB    . CYS D 3 12  ? -11.570 31.589 65.245 1.00 83.46  ? 227 CYS B CB    1 
ATOM   1520 S  SG    . CYS D 3 12  ? -10.590 32.827 64.429 1.00 85.32  ? 227 CYS B SG    1 
ATOM   1521 N  N     . GLY D 3 13  ? -13.821 33.330 63.376 1.00 82.00  ? 228 GLY B N     1 
ATOM   1522 C  CA    . GLY D 3 13  ? -14.358 34.672 63.242 1.00 82.59  ? 228 GLY B CA    1 
ATOM   1523 C  C     . GLY D 3 13  ? -13.305 35.765 63.105 1.00 82.76  ? 228 GLY B C     1 
ATOM   1524 O  O     . GLY D 3 13  ? -13.629 36.875 62.700 1.00 82.00  ? 228 GLY B O     1 
ATOM   1525 N  N     . ASP D 3 14  ? -12.052 35.442 63.427 1.00 83.25  ? 229 ASP B N     1 
ATOM   1526 C  CA    . ASP D 3 14  ? -10.920 36.371 63.335 1.00 84.32  ? 229 ASP B CA    1 
ATOM   1527 C  C     . ASP D 3 14  ? -10.706 36.873 61.865 1.00 85.29  ? 229 ASP B C     1 
ATOM   1528 O  O     . ASP D 3 14  ? -11.555 36.637 61.002 1.00 85.63  ? 229 ASP B O     1 
ATOM   1529 C  CB    . ASP D 3 14  ? -9.674  35.628 63.848 1.00 84.73  ? 229 ASP B CB    1 
ATOM   1530 C  CG    . ASP D 3 14  ? -8.504  36.560 64.193 1.00 85.95  ? 229 ASP B CG    1 
ATOM   1531 O  OD1   . ASP D 3 14  ? -7.460  36.043 64.644 1.00 86.47  ? 229 ASP B OD1   1 
ATOM   1532 O  OD2   . ASP D 3 14  ? -8.609  37.797 64.020 1.00 85.99  ? 229 ASP B OD2   1 
ATOM   1533 N  N     . ARG D 3 15  ? -9.603  37.587 61.589 1.00 85.40  ? 230 ARG B N     1 
ATOM   1534 C  CA    . ARG D 3 15  ? -9.285  38.028 60.216 1.00 85.26  ? 230 ARG B CA    1 
ATOM   1535 C  C     . ARG D 3 15  ? -8.473  36.869 59.608 1.00 85.24  ? 230 ARG B C     1 
ATOM   1536 O  O     . ARG D 3 15  ? -7.521  36.352 60.238 1.00 85.59  ? 230 ARG B O     1 
ATOM   1537 C  CB    . ARG D 3 15  ? -8.428  39.330 60.211 1.00 84.62  ? 230 ARG B CB    1 
ATOM   1538 N  N     . ALA D 3 16  ? -8.842  36.447 58.399 1.00 83.95  ? 231 ALA B N     1 
ATOM   1539 C  CA    . ALA D 3 16  ? -8.136  35.341 57.754 1.00 81.62  ? 231 ALA B CA    1 
ATOM   1540 C  C     . ALA D 3 16  ? -7.005  35.843 56.874 1.00 80.53  ? 231 ALA B C     1 
ATOM   1541 O  O     . ALA D 3 16  ? -7.029  36.990 56.420 1.00 79.66  ? 231 ALA B O     1 
ATOM   1542 C  CB    . ALA D 3 16  ? -9.118  34.490 56.929 1.00 81.99  ? 231 ALA B CB    1 
ATOM   1543 N  N     . THR D 3 17  ? -6.008  34.989 56.658 1.00 79.25  ? 232 THR B N     1 
ATOM   1544 C  CA    . THR D 3 17  ? -4.888  35.342 55.805 1.00 79.36  ? 232 THR B CA    1 
ATOM   1545 C  C     . THR D 3 17  ? -5.083  34.765 54.382 1.00 79.54  ? 232 THR B C     1 
ATOM   1546 O  O     . THR D 3 17  ? -4.441  35.210 53.420 1.00 80.06  ? 232 THR B O     1 
ATOM   1547 C  CB    . THR D 3 17  ? -3.544  34.843 56.384 1.00 79.01  ? 232 THR B CB    1 
ATOM   1548 O  OG1   . THR D 3 17  ? -3.559  33.420 56.507 1.00 79.88  ? 232 THR B OG1   1 
ATOM   1549 C  CG2   . THR D 3 17  ? -3.291  35.440 57.712 1.00 78.25  ? 232 THR B CG2   1 
ATOM   1550 N  N     . GLY D 3 18  ? -5.974  33.788 54.253 1.00 79.41  ? 233 GLY B N     1 
ATOM   1551 C  CA    . GLY D 3 18  ? -6.242  33.196 52.960 1.00 78.68  ? 233 GLY B CA    1 
ATOM   1552 C  C     . GLY D 3 18  ? -6.844  31.825 53.113 1.00 78.72  ? 233 GLY B C     1 
ATOM   1553 O  O     . GLY D 3 18  ? -7.338  31.482 54.174 1.00 79.40  ? 233 GLY B O     1 
ATOM   1554 N  N     . PHE D 3 19  ? -6.819  31.018 52.070 1.00 78.19  ? 234 PHE B N     1 
ATOM   1555 C  CA    . PHE D 3 19  ? -7.388  29.695 52.223 1.00 78.03  ? 234 PHE B CA    1 
ATOM   1556 C  C     . PHE D 3 19  ? -6.358  28.763 52.816 1.00 77.25  ? 234 PHE B C     1 
ATOM   1557 O  O     . PHE D 3 19  ? -5.213  28.770 52.392 1.00 77.79  ? 234 PHE B O     1 
ATOM   1558 C  CB    . PHE D 3 19  ? -7.847  29.124 50.882 1.00 79.40  ? 234 PHE B CB    1 
ATOM   1559 C  CG    . PHE D 3 19  ? -9.057  29.797 50.318 1.00 81.10  ? 234 PHE B CG    1 
ATOM   1560 C  CD1   . PHE D 3 19  ? -10.287 29.692 50.946 1.00 81.04  ? 234 PHE B CD1   1 
ATOM   1561 C  CD2   . PHE D 3 19  ? -8.967  30.570 49.164 1.00 82.25  ? 234 PHE B CD2   1 
ATOM   1562 C  CE1   . PHE D 3 19  ? -11.413 30.357 50.433 1.00 80.97  ? 234 PHE B CE1   1 
ATOM   1563 C  CE2   . PHE D 3 19  ? -10.102 31.233 48.651 1.00 82.49  ? 234 PHE B CE2   1 
ATOM   1564 C  CZ    . PHE D 3 19  ? -11.321 31.121 49.296 1.00 80.99  ? 234 PHE B CZ    1 
ATOM   1565 N  N     . HIS D 3 20  ? -6.751  27.974 53.808 1.00 75.35  ? 235 HIS B N     1 
ATOM   1566 C  CA    . HIS D 3 20  ? -5.841  27.007 54.388 1.00 73.27  ? 235 HIS B CA    1 
ATOM   1567 C  C     . HIS D 3 20  ? -6.552  25.682 54.369 1.00 72.07  ? 235 HIS B C     1 
ATOM   1568 O  O     . HIS D 3 20  ? -7.710  25.597 54.743 1.00 70.96  ? 235 HIS B O     1 
ATOM   1569 C  CB    . HIS D 3 20  ? -5.460  27.430 55.777 1.00 73.26  ? 235 HIS B CB    1 
ATOM   1570 C  CG    . HIS D 3 20  ? -4.785  28.755 55.797 1.00 74.06  ? 235 HIS B CG    1 
ATOM   1571 N  ND1   . HIS D 3 20  ? -3.526  28.946 55.278 1.00 74.63  ? 235 HIS B ND1   1 
ATOM   1572 C  CD2   . HIS D 3 20  ? -5.229  29.980 56.165 1.00 75.16  ? 235 HIS B CD2   1 
ATOM   1573 C  CE1   . HIS D 3 20  ? -3.223  30.231 55.320 1.00 75.42  ? 235 HIS B CE1   1 
ATOM   1574 N  NE2   . HIS D 3 20  ? -4.240  30.882 55.853 1.00 75.11  ? 235 HIS B NE2   1 
ATOM   1575 N  N     . PHE D 3 21  ? -5.854  24.665 53.868 1.00 70.95  ? 236 PHE B N     1 
ATOM   1576 C  CA    . PHE D 3 21  ? -6.381  23.326 53.731 1.00 69.62  ? 236 PHE B CA    1 
ATOM   1577 C  C     . PHE D 3 21  ? -7.805  23.405 53.223 1.00 70.24  ? 236 PHE B C     1 
ATOM   1578 O  O     . PHE D 3 21  ? -8.681  22.630 53.615 1.00 71.14  ? 236 PHE B O     1 
ATOM   1579 C  CB    . PHE D 3 21  ? -6.291  22.606 55.037 1.00 67.53  ? 236 PHE B CB    1 
ATOM   1580 C  CG    . PHE D 3 21  ? -4.935  22.707 55.663 1.00 67.23  ? 236 PHE B CG    1 
ATOM   1581 C  CD1   . PHE D 3 21  ? -3.827  22.136 55.051 1.00 66.23  ? 236 PHE B CD1   1 
ATOM   1582 C  CD2   . PHE D 3 21  ? -4.751  23.365 56.880 1.00 67.03  ? 236 PHE B CD2   1 
ATOM   1583 C  CE1   . PHE D 3 21  ? -2.572  22.208 55.636 1.00 65.11  ? 236 PHE B CE1   1 
ATOM   1584 C  CE2   . PHE D 3 21  ? -3.484  23.437 57.469 1.00 65.58  ? 236 PHE B CE2   1 
ATOM   1585 C  CZ    . PHE D 3 21  ? -2.404  22.855 56.845 1.00 64.71  ? 236 PHE B CZ    1 
ATOM   1586 N  N     . ASN D 3 22  ? -8.020  24.392 52.352 1.00 69.98  ? 237 ASN B N     1 
ATOM   1587 C  CA    . ASN D 3 22  ? -9.276  24.587 51.671 1.00 68.78  ? 237 ASN B CA    1 
ATOM   1588 C  C     . ASN D 3 22  ? -10.384 25.441 52.255 1.00 68.32  ? 237 ASN B C     1 
ATOM   1589 O  O     . ASN D 3 22  ? -11.508 25.410 51.738 1.00 68.63  ? 237 ASN B O     1 
ATOM   1590 C  CB    . ASN D 3 22  ? -9.832  23.228 51.264 1.00 69.27  ? 237 ASN B CB    1 
ATOM   1591 C  CG    . ASN D 3 22  ? -10.601 23.286 49.958 1.00 70.43  ? 237 ASN B CG    1 
ATOM   1592 O  OD1   . ASN D 3 22  ? -10.267 24.062 49.034 1.00 69.77  ? 237 ASN B OD1   1 
ATOM   1593 N  ND2   . ASN D 3 22  ? -11.630 22.449 49.859 1.00 70.41  ? 237 ASN B ND2   1 
ATOM   1594 N  N     . ALA D 3 23  ? -10.102 26.227 53.289 1.00 66.99  ? 238 ALA B N     1 
ATOM   1595 C  CA    . ALA D 3 23  ? -11.145 27.095 53.830 1.00 65.62  ? 238 ALA B CA    1 
ATOM   1596 C  C     . ALA D 3 23  ? -10.565 28.416 54.297 1.00 65.38  ? 238 ALA B C     1 
ATOM   1597 O  O     . ALA D 3 23  ? -9.488  28.454 54.845 1.00 65.88  ? 238 ALA B O     1 
ATOM   1598 C  CB    . ALA D 3 23  ? -11.861 26.399 54.950 1.00 65.69  ? 238 ALA B CB    1 
ATOM   1599 N  N     . MET D 3 24  ? -11.257 29.513 54.065 1.00 65.11  ? 239 MET B N     1 
ATOM   1600 C  CA    . MET D 3 24  ? -10.743 30.813 54.461 1.00 66.03  ? 239 MET B CA    1 
ATOM   1601 C  C     . MET D 3 24  ? -10.574 30.844 55.988 1.00 66.53  ? 239 MET B C     1 
ATOM   1602 O  O     . MET D 3 24  ? -11.547 30.815 56.720 1.00 66.83  ? 239 MET B O     1 
ATOM   1603 C  CB    . MET D 3 24  ? -11.727 31.870 53.983 1.00 66.65  ? 239 MET B CB    1 
ATOM   1604 C  CG    . MET D 3 24  ? -11.414 33.251 54.361 1.00 69.66  ? 239 MET B CG    1 
ATOM   1605 S  SD    . MET D 3 24  ? -9.974  33.782 53.493 1.00 74.08  ? 239 MET B SD    1 
ATOM   1606 C  CE    . MET D 3 24  ? -10.535 33.685 51.808 1.00 74.41  ? 239 MET B CE    1 
ATOM   1607 N  N     . THR D 3 25  ? -9.346  30.895 56.494 1.00 66.51  ? 240 THR B N     1 
ATOM   1608 C  CA    . THR D 3 25  ? -9.182  30.898 57.944 1.00 66.08  ? 240 THR B CA    1 
ATOM   1609 C  C     . THR D 3 25  ? -8.093  31.838 58.415 1.00 66.65  ? 240 THR B C     1 
ATOM   1610 O  O     . THR D 3 25  ? -7.342  32.348 57.613 1.00 66.28  ? 240 THR B O     1 
ATOM   1611 C  CB    . THR D 3 25  ? -8.824  29.508 58.479 1.00 64.69  ? 240 THR B CB    1 
ATOM   1612 O  OG1   . THR D 3 25  ? -7.542  29.145 57.972 1.00 64.02  ? 240 THR B OG1   1 
ATOM   1613 C  CG2   . THR D 3 25  ? -9.843  28.471 58.089 1.00 62.34  ? 240 THR B CG2   1 
ATOM   1614 N  N     . CYS D 3 26  ? -8.027  32.041 59.733 1.00 68.30  ? 241 CYS B N     1 
ATOM   1615 C  CA    . CYS D 3 26  ? -7.051  32.917 60.399 1.00 70.45  ? 241 CYS B CA    1 
ATOM   1616 C  C     . CYS D 3 26  ? -5.754  32.136 60.517 1.00 71.41  ? 241 CYS B C     1 
ATOM   1617 O  O     . CYS D 3 26  ? -5.776  30.908 60.489 1.00 72.82  ? 241 CYS B O     1 
ATOM   1618 C  CB    . CYS D 3 26  ? -7.536  33.298 61.808 1.00 70.30  ? 241 CYS B CB    1 
ATOM   1619 S  SG    . CYS D 3 26  ? -7.300  32.000 63.106 1.00 71.72  ? 241 CYS B SG    1 
ATOM   1620 N  N     . GLU D 3 27  ? -4.624  32.816 60.674 1.00 71.22  ? 242 GLU B N     1 
ATOM   1621 C  CA    . GLU D 3 27  ? -3.387  32.065 60.754 1.00 70.24  ? 242 GLU B CA    1 
ATOM   1622 C  C     . GLU D 3 27  ? -3.465  31.025 61.866 1.00 69.39  ? 242 GLU B C     1 
ATOM   1623 O  O     . GLU D 3 27  ? -3.010  29.906 61.689 1.00 69.14  ? 242 GLU B O     1 
ATOM   1624 C  CB    . GLU D 3 27  ? -2.183  32.990 60.960 1.00 70.76  ? 242 GLU B CB    1 
ATOM   1625 C  CG    . GLU D 3 27  ? -0.886  32.388 60.419 1.00 70.67  ? 242 GLU B CG    1 
ATOM   1626 C  CD    . GLU D 3 27  ? -0.916  32.193 58.896 1.00 72.36  ? 242 GLU B CD    1 
ATOM   1627 O  OE1   . GLU D 3 27  ? -0.168  31.312 58.385 1.00 72.17  ? 242 GLU B OE1   1 
ATOM   1628 O  OE2   . GLU D 3 27  ? -1.679  32.930 58.209 1.00 72.31  ? 242 GLU B OE2   1 
ATOM   1629 N  N     . GLY D 3 28  ? -4.085  31.375 62.986 1.00 68.09  ? 243 GLY B N     1 
ATOM   1630 C  CA    . GLY D 3 28  ? -4.183  30.445 64.106 1.00 67.76  ? 243 GLY B CA    1 
ATOM   1631 C  C     . GLY D 3 28  ? -4.970  29.147 63.958 1.00 67.74  ? 243 GLY B C     1 
ATOM   1632 O  O     . GLY D 3 28  ? -4.656  28.120 64.595 1.00 67.26  ? 243 GLY B O     1 
ATOM   1633 N  N     . CYS D 3 29  ? -6.004  29.172 63.127 1.00 67.69  ? 244 CYS B N     1 
ATOM   1634 C  CA    . CYS D 3 29  ? -6.819  27.971 62.934 1.00 67.63  ? 244 CYS B CA    1 
ATOM   1635 C  C     . CYS D 3 29  ? -6.114  27.026 61.966 1.00 66.67  ? 244 CYS B C     1 
ATOM   1636 O  O     . CYS D 3 29  ? -6.226  25.798 62.073 1.00 65.49  ? 244 CYS B O     1 
ATOM   1637 C  CB    . CYS D 3 29  ? -8.224  28.377 62.485 1.00 67.42  ? 244 CYS B CB    1 
ATOM   1638 S  SG    . CYS D 3 29  ? -9.112  29.144 63.889 1.00 71.03  ? 244 CYS B SG    1 
ATOM   1639 N  N     . LYS D 3 30  ? -5.374  27.631 61.039 1.00 66.05  ? 245 LYS B N     1 
ATOM   1640 C  CA    . LYS D 3 30  ? -4.544  26.917 60.101 1.00 65.94  ? 245 LYS B CA    1 
ATOM   1641 C  C     . LYS D 3 30  ? -3.619  26.100 61.016 1.00 65.95  ? 245 LYS B C     1 
ATOM   1642 O  O     . LYS D 3 30  ? -3.566  24.880 60.950 1.00 66.21  ? 245 LYS B O     1 
ATOM   1643 C  CB    . LYS D 3 30  ? -3.719  27.927 59.305 1.00 66.71  ? 245 LYS B CB    1 
ATOM   1644 C  CG    . LYS D 3 30  ? -2.582  27.330 58.517 1.00 67.84  ? 245 LYS B CG    1 
ATOM   1645 C  CD    . LYS D 3 30  ? -1.518  28.365 58.245 1.00 69.41  ? 245 LYS B CD    1 
ATOM   1646 C  CE    . LYS D 3 30  ? -0.487  27.859 57.205 1.00 71.04  ? 245 LYS B CE    1 
ATOM   1647 N  NZ    . LYS D 3 30  ? 0.399   29.010 56.761 1.00 70.85  ? 245 LYS B NZ    1 
ATOM   1648 N  N     . GLY D 3 31  ? -2.916  26.789 61.907 1.00 65.55  ? 246 GLY B N     1 
ATOM   1649 C  CA    . GLY D 3 31  ? -2.005  26.108 62.798 1.00 66.09  ? 246 GLY B CA    1 
ATOM   1650 C  C     . GLY D 3 31  ? -2.650  25.020 63.623 1.00 66.92  ? 246 GLY B C     1 
ATOM   1651 O  O     . GLY D 3 31  ? -2.157  23.876 63.673 1.00 66.66  ? 246 GLY B O     1 
ATOM   1652 N  N     . PHE D 3 32  ? -3.750  25.392 64.286 1.00 67.28  ? 247 PHE B N     1 
ATOM   1653 C  CA    . PHE D 3 32  ? -4.502  24.465 65.130 1.00 67.54  ? 247 PHE B CA    1 
ATOM   1654 C  C     . PHE D 3 32  ? -4.912  23.204 64.399 1.00 67.63  ? 247 PHE B C     1 
ATOM   1655 O  O     . PHE D 3 32  ? -4.684  22.103 64.899 1.00 67.45  ? 247 PHE B O     1 
ATOM   1656 C  CB    . PHE D 3 32  ? -5.769  25.126 65.668 1.00 68.68  ? 247 PHE B CB    1 
ATOM   1657 C  CG    . PHE D 3 32  ? -6.653  24.173 66.421 1.00 69.03  ? 247 PHE B CG    1 
ATOM   1658 C  CD1   . PHE D 3 32  ? -6.295  23.741 67.692 1.00 69.50  ? 247 PHE B CD1   1 
ATOM   1659 C  CD2   . PHE D 3 32  ? -7.773  23.609 65.806 1.00 69.74  ? 247 PHE B CD2   1 
ATOM   1660 C  CE1   . PHE D 3 32  ? -7.020  22.759 68.331 1.00 70.89  ? 247 PHE B CE1   1 
ATOM   1661 C  CE2   . PHE D 3 32  ? -8.503  22.631 66.425 1.00 70.72  ? 247 PHE B CE2   1 
ATOM   1662 C  CZ    . PHE D 3 32  ? -8.128  22.195 67.694 1.00 71.42  ? 247 PHE B CZ    1 
ATOM   1663 N  N     . PHE D 3 33  ? -5.526  23.395 63.222 1.00 67.15  ? 248 PHE B N     1 
ATOM   1664 C  CA    . PHE D 3 33  ? -6.013  22.316 62.375 1.00 66.97  ? 248 PHE B CA    1 
ATOM   1665 C  C     . PHE D 3 33  ? -4.913  21.376 61.905 1.00 67.65  ? 248 PHE B C     1 
ATOM   1666 O  O     . PHE D 3 33  ? -5.097  20.147 61.912 1.00 67.09  ? 248 PHE B O     1 
ATOM   1667 C  CB    . PHE D 3 33  ? -6.757  22.869 61.168 1.00 66.79  ? 248 PHE B CB    1 
ATOM   1668 C  CG    . PHE D 3 33  ? -7.254  21.808 60.241 1.00 67.27  ? 248 PHE B CG    1 
ATOM   1669 C  CD1   . PHE D 3 33  ? -8.380  21.073 60.547 1.00 67.92  ? 248 PHE B CD1   1 
ATOM   1670 C  CD2   . PHE D 3 33  ? -6.535  21.468 59.102 1.00 66.62  ? 248 PHE B CD2   1 
ATOM   1671 C  CE1   . PHE D 3 33  ? -8.771  20.012 59.736 1.00 67.67  ? 248 PHE B CE1   1 
ATOM   1672 C  CE2   . PHE D 3 33  ? -6.929  20.406 58.293 1.00 66.13  ? 248 PHE B CE2   1 
ATOM   1673 C  CZ    . PHE D 3 33  ? -8.038  19.679 58.606 1.00 66.09  ? 248 PHE B CZ    1 
ATOM   1674 N  N     . ARG D 3 34  ? -3.771  21.917 61.495 1.00 67.99  ? 249 ARG B N     1 
ATOM   1675 C  CA    . ARG D 3 34  ? -2.729  21.017 61.086 1.00 69.42  ? 249 ARG B CA    1 
ATOM   1676 C  C     . ARG D 3 34  ? -2.193  20.201 62.267 1.00 70.97  ? 249 ARG B C     1 
ATOM   1677 O  O     . ARG D 3 34  ? -2.006  18.977 62.149 1.00 70.08  ? 249 ARG B O     1 
ATOM   1678 C  CB    . ARG D 3 34  ? -1.581  21.748 60.422 1.00 68.91  ? 249 ARG B CB    1 
ATOM   1679 C  CG    . ARG D 3 34  ? -0.551  20.788 59.822 1.00 69.24  ? 249 ARG B CG    1 
ATOM   1680 C  CD    . ARG D 3 34  ? 0.782   21.409 59.818 1.00 69.26  ? 249 ARG B CD    1 
ATOM   1681 N  NE    . ARG D 3 34  ? 0.568   22.785 59.432 1.00 70.65  ? 249 ARG B NE    1 
ATOM   1682 C  CZ    . ARG D 3 34  ? 1.372   23.799 59.727 1.00 71.33  ? 249 ARG B CZ    1 
ATOM   1683 N  NH1   . ARG D 3 34  ? 1.052   25.023 59.322 1.00 71.95  ? 249 ARG B NH1   1 
ATOM   1684 N  NH2   . ARG D 3 34  ? 2.487   23.599 60.412 1.00 72.30  ? 249 ARG B NH2   1 
ATOM   1685 N  N     . ARG D 3 35  ? -1.942  20.840 63.410 1.00 72.85  ? 250 ARG B N     1 
ATOM   1686 C  CA    . ARG D 3 35  ? -1.426  20.056 64.533 1.00 75.40  ? 250 ARG B CA    1 
ATOM   1687 C  C     . ARG D 3 35  ? -2.374  18.947 64.926 1.00 75.37  ? 250 ARG B C     1 
ATOM   1688 O  O     . ARG D 3 35  ? -1.972  17.784 64.986 1.00 75.26  ? 250 ARG B O     1 
ATOM   1689 C  CB    . ARG D 3 35  ? -1.134  20.921 65.734 1.00 77.48  ? 250 ARG B CB    1 
ATOM   1690 C  CG    . ARG D 3 35  ? 0.017   21.789 65.463 1.00 82.94  ? 250 ARG B CG    1 
ATOM   1691 C  CD    . ARG D 3 35  ? 0.565   22.387 66.705 1.00 88.27  ? 250 ARG B CD    1 
ATOM   1692 N  NE    . ARG D 3 35  ? 1.371   23.584 66.425 1.00 93.90  ? 250 ARG B NE    1 
ATOM   1693 C  CZ    . ARG D 3 35  ? 0.864   24.792 66.170 1.00 95.80  ? 250 ARG B CZ    1 
ATOM   1694 N  NH1   . ARG D 3 35  ? -0.459  24.971 66.148 1.00 96.77  ? 250 ARG B NH1   1 
ATOM   1695 N  NH2   . ARG D 3 35  ? 1.679   25.831 65.983 1.00 95.25  ? 250 ARG B NH2   1 
ATOM   1696 N  N     . SER D 3 36  ? -3.631  19.311 65.176 1.00 74.76  ? 251 SER B N     1 
ATOM   1697 C  CA    . SER D 3 36  ? -4.647  18.354 65.551 1.00 74.02  ? 251 SER B CA    1 
ATOM   1698 C  C     . SER D 3 36  ? -4.619  17.114 64.665 1.00 75.07  ? 251 SER B C     1 
ATOM   1699 O  O     . SER D 3 36  ? -4.360  16.007 65.143 1.00 74.96  ? 251 SER B O     1 
ATOM   1700 C  CB    . SER D 3 36  ? -6.003  19.002 65.457 1.00 72.00  ? 251 SER B CB    1 
ATOM   1701 O  OG    . SER D 3 36  ? -6.028  20.147 66.249 1.00 69.84  ? 251 SER B OG    1 
ATOM   1702 N  N     . MET D 3 37  ? -4.878  17.290 63.374 1.00 76.04  ? 252 MET B N     1 
ATOM   1703 C  CA    . MET D 3 37  ? -4.907  16.152 62.458 1.00 77.13  ? 252 MET B CA    1 
ATOM   1704 C  C     . MET D 3 37  ? -3.618  15.373 62.445 1.00 78.09  ? 252 MET B C     1 
ATOM   1705 O  O     . MET D 3 37  ? -3.624  14.161 62.318 1.00 77.73  ? 252 MET B O     1 
ATOM   1706 C  CB    . MET D 3 37  ? -5.226  16.610 61.038 1.00 77.39  ? 252 MET B CB    1 
ATOM   1707 C  CG    . MET D 3 37  ? -6.581  17.267 60.893 1.00 78.87  ? 252 MET B CG    1 
ATOM   1708 S  SD    . MET D 3 37  ? -7.861  16.231 61.620 1.00 80.07  ? 252 MET B SD    1 
ATOM   1709 C  CE    . MET D 3 37  ? -9.413  17.312 61.434 1.00 79.43  ? 252 MET B CE    1 
ATOM   1710 N  N     . LYS D 3 38  ? -2.504  16.068 62.577 1.00 79.57  ? 253 LYS B N     1 
ATOM   1711 C  CA    . LYS D 3 38  ? -1.240  15.394 62.556 1.00 81.76  ? 253 LYS B CA    1 
ATOM   1712 C  C     . LYS D 3 38  ? -1.045  14.505 63.777 1.00 84.03  ? 253 LYS B C     1 
ATOM   1713 O  O     . LYS D 3 38  ? -0.142  13.691 63.788 1.00 84.98  ? 253 LYS B O     1 
ATOM   1714 C  CB    . LYS D 3 38  ? -0.116  16.410 62.468 1.00 81.24  ? 253 LYS B CB    1 
ATOM   1715 C  CG    . LYS D 3 38  ? 0.696   16.357 61.192 1.00 80.35  ? 253 LYS B CG    1 
ATOM   1716 C  CD    . LYS D 3 38  ? 2.087   16.923 61.437 1.00 80.61  ? 253 LYS B CD    1 
ATOM   1717 C  CE    . LYS D 3 38  ? 2.722   17.443 60.170 1.00 80.92  ? 253 LYS B CE    1 
ATOM   1718 N  NZ    . LYS D 3 38  ? 2.707   16.400 59.092 1.00 82.97  ? 253 LYS B NZ    1 
ATOM   1719 N  N     . ARG D 3 39  ? -1.866  14.649 64.813 1.00 86.52  ? 254 ARG B N     1 
ATOM   1720 C  CA    . ARG D 3 39  ? -1.727  13.805 66.014 1.00 88.98  ? 254 ARG B CA    1 
ATOM   1721 C  C     . ARG D 3 39  ? -2.787  12.723 66.063 1.00 89.20  ? 254 ARG B C     1 
ATOM   1722 O  O     . ARG D 3 39  ? -2.624  11.712 66.736 1.00 88.59  ? 254 ARG B O     1 
ATOM   1723 C  CB    . ARG D 3 39  ? -1.843  14.647 67.290 1.00 91.52  ? 254 ARG B CB    1 
ATOM   1724 C  CG    . ARG D 3 39  ? -0.742  15.653 67.400 1.00 96.16  ? 254 ARG B CG    1 
ATOM   1725 C  CD    . ARG D 3 39  ? 0.603   14.997 66.986 1.00 100.59 ? 254 ARG B CD    1 
ATOM   1726 N  NE    . ARG D 3 39  ? 1.668   15.968 66.693 1.00 104.16 ? 254 ARG B NE    1 
ATOM   1727 C  CZ    . ARG D 3 39  ? 2.172   16.835 67.580 1.00 106.22 ? 254 ARG B CZ    1 
ATOM   1728 N  NH1   . ARG D 3 39  ? 1.711   16.871 68.839 1.00 107.46 ? 254 ARG B NH1   1 
ATOM   1729 N  NH2   . ARG D 3 39  ? 3.153   17.663 67.216 1.00 106.43 ? 254 ARG B NH2   1 
ATOM   1730 N  N     . LYS D 3 40  ? -3.865  12.968 65.320 1.00 89.81  ? 255 LYS B N     1 
ATOM   1731 C  CA    . LYS D 3 40  ? -5.037  12.108 65.230 1.00 89.72  ? 255 LYS B CA    1 
ATOM   1732 C  C     . LYS D 3 40  ? -5.875  12.538 66.404 1.00 89.29  ? 255 LYS B C     1 
ATOM   1733 O  O     . LYS D 3 40  ? -7.025  12.147 66.550 1.00 90.32  ? 255 LYS B O     1 
ATOM   1734 C  CB    . LYS D 3 40  ? -4.664  10.630 65.326 1.00 90.27  ? 255 LYS B CB    1 
ATOM   1735 C  CG    . LYS D 3 40  ? -3.961  10.123 64.069 1.00 91.33  ? 255 LYS B CG    1 
ATOM   1736 C  CD    . LYS D 3 40  ? -4.824  10.357 62.819 1.00 92.69  ? 255 LYS B CD    1 
ATOM   1737 C  CE    . LYS D 3 40  ? -4.040  10.148 61.503 1.00 93.96  ? 255 LYS B CE    1 
ATOM   1738 N  NZ    . LYS D 3 40  ? -3.380  8.806  61.384 1.00 92.96  ? 255 LYS B NZ    1 
ATOM   1739 N  N     . ALA D 3 41  ? -5.270  13.391 67.218 1.00 88.07  ? 256 ALA B N     1 
ATOM   1740 C  CA    . ALA D 3 41  ? -5.896  13.927 68.407 1.00 86.81  ? 256 ALA B CA    1 
ATOM   1741 C  C     . ALA D 3 41  ? -7.411  13.820 68.406 1.00 85.98  ? 256 ALA B C     1 
ATOM   1742 O  O     . ALA D 3 41  ? -8.082  14.364 67.536 1.00 85.64  ? 256 ALA B O     1 
ATOM   1743 C  CB    . ALA D 3 41  ? -5.481  15.379 68.591 1.00 87.17  ? 256 ALA B CB    1 
ATOM   1744 N  N     . LEU D 3 42  ? -7.937  13.093 69.386 1.00 85.01  ? 257 LEU B N     1 
ATOM   1745 C  CA    . LEU D 3 42  ? -9.378  12.927 69.561 1.00 83.16  ? 257 LEU B CA    1 
ATOM   1746 C  C     . LEU D 3 42  ? -9.714  13.890 70.674 1.00 81.38  ? 257 LEU B C     1 
ATOM   1747 O  O     . LEU D 3 42  ? -9.060  13.890 71.698 1.00 81.46  ? 257 LEU B O     1 
ATOM   1748 C  CB    . LEU D 3 42  ? -9.703  11.502 70.034 1.00 84.15  ? 257 LEU B CB    1 
ATOM   1749 C  CG    . LEU D 3 42  ? -9.289  10.290 69.172 1.00 85.12  ? 257 LEU B CG    1 
ATOM   1750 C  CD1   . LEU D 3 42  ? -8.318  9.346  69.929 1.00 83.93  ? 257 LEU B CD1   1 
ATOM   1751 C  CD2   . LEU D 3 42  ? -10.562 9.572  68.751 1.00 84.75  ? 257 LEU B CD2   1 
ATOM   1752 N  N     . PHE D 3 43  ? -10.694 14.741 70.495 1.00 79.62  ? 258 PHE B N     1 
ATOM   1753 C  CA    . PHE D 3 43  ? -11.008 15.630 71.597 1.00 78.66  ? 258 PHE B CA    1 
ATOM   1754 C  C     . PHE D 3 43  ? -12.367 15.289 72.117 1.00 79.12  ? 258 PHE B C     1 
ATOM   1755 O  O     . PHE D 3 43  ? -13.105 14.503 71.501 1.00 78.15  ? 258 PHE B O     1 
ATOM   1756 C  CB    . PHE D 3 43  ? -10.991 17.096 71.171 1.00 77.22  ? 258 PHE B CB    1 
ATOM   1757 C  CG    . PHE D 3 43  ? -9.641  17.589 70.824 1.00 75.09  ? 258 PHE B CG    1 
ATOM   1758 C  CD1   . PHE D 3 43  ? -8.692  17.779 71.816 1.00 74.02  ? 258 PHE B CD1   1 
ATOM   1759 C  CD2   . PHE D 3 43  ? -9.272  17.742 69.508 1.00 74.65  ? 258 PHE B CD2   1 
ATOM   1760 C  CE1   . PHE D 3 43  ? -7.403  18.097 71.502 1.00 73.42  ? 258 PHE B CE1   1 
ATOM   1761 C  CE2   . PHE D 3 43  ? -7.979  18.058 69.182 1.00 74.86  ? 258 PHE B CE2   1 
ATOM   1762 C  CZ    . PHE D 3 43  ? -7.039  18.234 70.186 1.00 74.40  ? 258 PHE B CZ    1 
ATOM   1763 N  N     . THR D 3 44  ? -12.685 15.878 73.264 1.00 79.46  ? 259 THR B N     1 
ATOM   1764 C  CA    . THR D 3 44  ? -13.977 15.682 73.904 1.00 79.83  ? 259 THR B CA    1 
ATOM   1765 C  C     . THR D 3 44  ? -14.327 17.025 74.529 1.00 80.48  ? 259 THR B C     1 
ATOM   1766 O  O     . THR D 3 44  ? -13.521 17.637 75.221 1.00 80.53  ? 259 THR B O     1 
ATOM   1767 C  CB    . THR D 3 44  ? -13.929 14.524 74.961 1.00 79.58  ? 259 THR B CB    1 
ATOM   1768 O  OG1   . THR D 3 44  ? -13.135 14.914 76.091 1.00 80.35  ? 259 THR B OG1   1 
ATOM   1769 C  CG2   . THR D 3 44  ? -13.346 13.238 74.333 1.00 77.74  ? 259 THR B CG2   1 
ATOM   1770 N  N     . CYS D 3 45  ? -15.530 17.492 74.259 1.00 80.89  ? 260 CYS B N     1 
ATOM   1771 C  CA    . CYS D 3 45  ? -15.964 18.788 74.736 1.00 82.03  ? 260 CYS B CA    1 
ATOM   1772 C  C     . CYS D 3 45  ? -16.396 18.870 76.213 1.00 84.20  ? 260 CYS B C     1 
ATOM   1773 O  O     . CYS D 3 45  ? -17.254 18.130 76.664 1.00 83.97  ? 260 CYS B O     1 
ATOM   1774 C  CB    . CYS D 3 45  ? -17.078 19.260 73.824 1.00 80.98  ? 260 CYS B CB    1 
ATOM   1775 S  SG    . CYS D 3 45  ? -17.891 20.648 74.451 1.00 81.73  ? 260 CYS B SG    1 
ATOM   1776 N  N     . PRO D 3 46  ? -15.806 19.800 76.982 1.00 86.34  ? 261 PRO B N     1 
ATOM   1777 C  CA    . PRO D 3 46  ? -16.115 19.988 78.411 1.00 86.55  ? 261 PRO B CA    1 
ATOM   1778 C  C     . PRO D 3 46  ? -17.471 20.606 78.715 1.00 87.76  ? 261 PRO B C     1 
ATOM   1779 O  O     . PRO D 3 46  ? -17.807 20.838 79.884 1.00 87.66  ? 261 PRO B O     1 
ATOM   1780 C  CB    . PRO D 3 46  ? -14.982 20.885 78.909 1.00 86.93  ? 261 PRO B CB    1 
ATOM   1781 C  CG    . PRO D 3 46  ? -13.862 20.618 77.931 1.00 86.99  ? 261 PRO B CG    1 
ATOM   1782 C  CD    . PRO D 3 46  ? -14.609 20.568 76.611 1.00 86.49  ? 261 PRO B CD    1 
ATOM   1783 N  N     . PHE D 3 47  ? -18.239 20.887 77.669 1.00 88.55  ? 262 PHE B N     1 
ATOM   1784 C  CA    . PHE D 3 47  ? -19.548 21.481 77.852 1.00 89.31  ? 262 PHE B CA    1 
ATOM   1785 C  C     . PHE D 3 47  ? -20.654 20.664 77.205 1.00 90.20  ? 262 PHE B C     1 
ATOM   1786 O  O     . PHE D 3 47  ? -20.889 19.545 77.653 1.00 90.36  ? 262 PHE B O     1 
ATOM   1787 C  CB    . PHE D 3 47  ? -19.537 22.911 77.341 1.00 89.32  ? 262 PHE B CB    1 
ATOM   1788 C  CG    . PHE D 3 47  ? -18.408 23.717 77.889 1.00 89.40  ? 262 PHE B CG    1 
ATOM   1789 C  CD1   . PHE D 3 47  ? -17.122 23.561 77.378 1.00 89.72  ? 262 PHE B CD1   1 
ATOM   1790 C  CD2   . PHE D 3 47  ? -18.610 24.569 78.971 1.00 88.81  ? 262 PHE B CD2   1 
ATOM   1791 C  CE1   . PHE D 3 47  ? -16.056 24.236 77.939 1.00 89.54  ? 262 PHE B CE1   1 
ATOM   1792 C  CE2   . PHE D 3 47  ? -17.557 25.248 79.545 1.00 89.01  ? 262 PHE B CE2   1 
ATOM   1793 C  CZ    . PHE D 3 47  ? -16.271 25.084 79.028 1.00 89.44  ? 262 PHE B CZ    1 
ATOM   1794 N  N     . ASN D 3 48  ? -21.305 21.179 76.154 1.00 91.03  ? 263 ASN B N     1 
ATOM   1795 C  CA    . ASN D 3 48  ? -22.411 20.451 75.529 1.00 91.62  ? 263 ASN B CA    1 
ATOM   1796 C  C     . ASN D 3 48  ? -22.296 20.046 74.059 1.00 91.87  ? 263 ASN B C     1 
ATOM   1797 O  O     . ASN D 3 48  ? -23.295 19.595 73.463 1.00 92.38  ? 263 ASN B O     1 
ATOM   1798 C  CB    . ASN D 3 48  ? -23.707 21.236 75.706 1.00 92.72  ? 263 ASN B CB    1 
ATOM   1799 C  CG    . ASN D 3 48  ? -23.696 22.090 76.950 1.00 94.23  ? 263 ASN B CG    1 
ATOM   1800 O  OD1   . ASN D 3 48  ? -23.711 23.331 76.860 1.00 94.42  ? 263 ASN B OD1   1 
ATOM   1801 N  ND2   . ASN D 3 48  ? -23.653 21.440 78.131 1.00 94.70  ? 263 ASN B ND2   1 
ATOM   1802 N  N     . GLY D 3 49  ? -21.105 20.199 73.477 1.00 91.14  ? 264 GLY B N     1 
ATOM   1803 C  CA    . GLY D 3 49  ? -20.889 19.834 72.076 1.00 89.94  ? 264 GLY B CA    1 
ATOM   1804 C  C     . GLY D 3 49  ? -21.451 20.839 71.079 1.00 88.96  ? 264 GLY B C     1 
ATOM   1805 O  O     . GLY D 3 49  ? -21.565 20.554 69.891 1.00 88.15  ? 264 GLY B O     1 
ATOM   1806 N  N     . ASP D 3 50  ? -21.746 22.034 71.575 1.00 88.82  ? 265 ASP B N     1 
ATOM   1807 C  CA    . ASP D 3 50  ? -22.353 23.099 70.791 1.00 88.65  ? 265 ASP B CA    1 
ATOM   1808 C  C     . ASP D 3 50  ? -21.701 24.481 70.979 1.00 87.32  ? 265 ASP B C     1 
ATOM   1809 O  O     . ASP D 3 50  ? -22.350 25.496 70.703 1.00 86.19  ? 265 ASP B O     1 
ATOM   1810 C  CB    . ASP D 3 50  ? -23.826 23.179 71.196 1.00 91.53  ? 265 ASP B CB    1 
ATOM   1811 C  CG    . ASP D 3 50  ? -24.021 23.167 72.754 1.00 94.55  ? 265 ASP B CG    1 
ATOM   1812 O  OD1   . ASP D 3 50  ? -25.203 23.210 73.202 1.00 95.83  ? 265 ASP B OD1   1 
ATOM   1813 O  OD2   . ASP D 3 50  ? -23.005 23.118 73.531 1.00 95.39  ? 265 ASP B OD2   1 
ATOM   1814 N  N     . CYS D 3 51  ? -20.439 24.517 71.441 1.00 85.97  ? 266 CYS B N     1 
ATOM   1815 C  CA    . CYS D 3 51  ? -19.708 25.778 71.693 1.00 84.90  ? 266 CYS B CA    1 
ATOM   1816 C  C     . CYS D 3 51  ? -19.678 26.774 70.543 1.00 85.15  ? 266 CYS B C     1 
ATOM   1817 O  O     . CYS D 3 51  ? -19.186 26.455 69.456 1.00 85.61  ? 266 CYS B O     1 
ATOM   1818 C  CB    . CYS D 3 51  ? -18.260 25.510 72.072 1.00 82.67  ? 266 CYS B CB    1 
ATOM   1819 S  SG    . CYS D 3 51  ? -18.019 24.686 73.583 1.00 79.74  ? 266 CYS B SG    1 
ATOM   1820 N  N     . ARG D 3 52  ? -20.184 27.982 70.772 1.00 85.14  ? 267 ARG B N     1 
ATOM   1821 C  CA    . ARG D 3 52  ? -20.139 29.005 69.732 1.00 85.40  ? 267 ARG B CA    1 
ATOM   1822 C  C     . ARG D 3 52  ? -18.678 29.504 69.734 1.00 84.99  ? 267 ARG B C     1 
ATOM   1823 O  O     . ARG D 3 52  ? -18.225 30.023 70.745 1.00 85.38  ? 267 ARG B O     1 
ATOM   1824 C  CB    . ARG D 3 52  ? -21.110 30.141 70.077 1.00 85.24  ? 267 ARG B CB    1 
ATOM   1825 N  N     . ILE D 3 53  ? -17.938 29.345 68.631 1.00 84.32  ? 268 ILE B N     1 
ATOM   1826 C  CA    . ILE D 3 53  ? -16.525 29.769 68.610 1.00 83.57  ? 268 ILE B CA    1 
ATOM   1827 C  C     . ILE D 3 53  ? -16.215 31.195 68.171 1.00 83.75  ? 268 ILE B C     1 
ATOM   1828 O  O     . ILE D 3 53  ? -16.818 31.747 67.245 1.00 83.33  ? 268 ILE B O     1 
ATOM   1829 C  CB    . ILE D 3 53  ? -15.656 28.811 67.779 1.00 81.31  ? 268 ILE B CB    1 
ATOM   1830 C  CG1   . ILE D 3 53  ? -15.832 27.386 68.307 1.00 80.04  ? 268 ILE B CG1   1 
ATOM   1831 C  CG2   . ILE D 3 53  ? -14.200 29.220 67.888 1.00 80.05  ? 268 ILE B CG2   1 
ATOM   1832 C  CD1   . ILE D 3 53  ? -15.194 26.319 67.482 1.00 77.46  ? 268 ILE B CD1   1 
ATOM   1833 N  N     . THR D 3 54  ? -15.228 31.772 68.843 1.00 84.60  ? 269 THR B N     1 
ATOM   1834 C  CA    . THR D 3 54  ? -14.830 33.149 68.592 1.00 86.79  ? 269 THR B CA    1 
ATOM   1835 C  C     . THR D 3 54  ? -13.345 33.368 68.765 1.00 87.77  ? 269 THR B C     1 
ATOM   1836 O  O     . THR D 3 54  ? -12.671 32.613 69.461 1.00 88.38  ? 269 THR B O     1 
ATOM   1837 C  CB    . THR D 3 54  ? -15.473 34.123 69.597 1.00 86.50  ? 269 THR B CB    1 
ATOM   1838 O  OG1   . THR D 3 54  ? -14.596 34.273 70.736 1.00 85.81  ? 269 THR B OG1   1 
ATOM   1839 C  CG2   . THR D 3 54  ? -16.844 33.606 70.055 1.00 85.12  ? 269 THR B CG2   1 
ATOM   1840 N  N     . LYS D 3 55  ? -12.874 34.466 68.182 1.00 89.47  ? 270 LYS B N     1 
ATOM   1841 C  CA    . LYS D 3 55  ? -11.481 34.879 68.242 1.00 91.25  ? 270 LYS B CA    1 
ATOM   1842 C  C     . LYS D 3 55  ? -10.965 34.874 69.681 1.00 91.58  ? 270 LYS B C     1 
ATOM   1843 O  O     . LYS D 3 55  ? -9.778  35.089 69.946 1.00 91.52  ? 270 LYS B O     1 
ATOM   1844 C  CB    . LYS D 3 55  ? -11.366 36.282 67.639 1.00 92.13  ? 270 LYS B CB    1 
ATOM   1845 C  CG    . LYS D 3 55  ? -9.937  36.858 67.563 1.00 94.05  ? 270 LYS B CG    1 
ATOM   1846 C  CD    . LYS D 3 55  ? -9.471  37.603 68.850 1.00 94.50  ? 270 LYS B CD    1 
ATOM   1847 C  CE    . LYS D 3 55  ? -8.102  38.244 68.632 1.00 94.26  ? 270 LYS B CE    1 
ATOM   1848 N  NZ    . LYS D 3 55  ? -8.098  38.983 67.331 1.00 94.09  ? 270 LYS B NZ    1 
ATOM   1849 N  N     . ASP D 3 56  ? -11.856 34.609 70.622 1.00 92.22  ? 271 ASP B N     1 
ATOM   1850 C  CA    . ASP D 3 56  ? -11.452 34.616 72.015 1.00 92.33  ? 271 ASP B CA    1 
ATOM   1851 C  C     . ASP D 3 56  ? -11.494 33.220 72.635 1.00 91.82  ? 271 ASP B C     1 
ATOM   1852 O  O     . ASP D 3 56  ? -10.443 32.569 72.778 1.00 91.87  ? 271 ASP B O     1 
ATOM   1853 C  CB    . ASP D 3 56  ? -12.336 35.609 72.798 1.00 93.00  ? 271 ASP B CB    1 
ATOM   1854 C  CG    . ASP D 3 56  ? -12.378 37.012 72.150 1.00 93.48  ? 271 ASP B CG    1 
ATOM   1855 O  OD1   . ASP D 3 56  ? -13.138 37.214 71.155 1.00 93.89  ? 271 ASP B OD1   1 
ATOM   1856 O  OD2   . ASP D 3 56  ? -11.639 37.900 72.636 1.00 93.01  ? 271 ASP B OD2   1 
ATOM   1857 N  N     . ASN D 3 57  ? -12.694 32.759 72.978 1.00 90.96  ? 272 ASN B N     1 
ATOM   1858 C  CA    . ASN D 3 57  ? -12.877 31.452 73.600 1.00 90.40  ? 272 ASN B CA    1 
ATOM   1859 C  C     . ASN D 3 57  ? -12.190 30.334 72.839 1.00 90.03  ? 272 ASN B C     1 
ATOM   1860 O  O     . ASN D 3 57  ? -12.074 29.204 73.309 1.00 90.27  ? 272 ASN B O     1 
ATOM   1861 C  CB    . ASN D 3 57  ? -14.338 31.132 73.672 1.00 91.04  ? 272 ASN B CB    1 
ATOM   1862 C  CG    . ASN D 3 57  ? -14.942 31.001 72.323 1.00 91.18  ? 272 ASN B CG    1 
ATOM   1863 O  OD1   . ASN D 3 57  ? -14.375 30.366 71.441 1.00 91.50  ? 272 ASN B OD1   1 
ATOM   1864 N  ND2   . ASN D 3 57  ? -16.109 31.594 72.142 1.00 91.94  ? 272 ASN B ND2   1 
ATOM   1865 N  N     . ARG D 3 58  ? -11.774 30.672 71.633 1.00 89.22  ? 273 ARG B N     1 
ATOM   1866 C  CA    . ARG D 3 58  ? -11.067 29.793 70.708 1.00 88.07  ? 273 ARG B CA    1 
ATOM   1867 C  C     . ARG D 3 58  ? -10.225 28.655 71.313 1.00 87.92  ? 273 ARG B C     1 
ATOM   1868 O  O     . ARG D 3 58  ? -10.580 27.487 71.182 1.00 87.32  ? 273 ARG B O     1 
ATOM   1869 C  CB    . ARG D 3 58  ? -10.202 30.694 69.842 1.00 87.05  ? 273 ARG B CB    1 
ATOM   1870 C  CG    . ARG D 3 58  ? -9.526  30.072 68.679 1.00 85.98  ? 273 ARG B CG    1 
ATOM   1871 C  CD    . ARG D 3 58  ? -9.157  31.193 67.704 1.00 84.91  ? 273 ARG B CD    1 
ATOM   1872 N  NE    . ARG D 3 58  ? -7.880  31.852 67.957 1.00 82.50  ? 273 ARG B NE    1 
ATOM   1873 C  CZ    . ARG D 3 58  ? -7.516  32.964 67.334 1.00 81.02  ? 273 ARG B CZ    1 
ATOM   1874 N  NH1   . ARG D 3 58  ? -8.349  33.514 66.462 1.00 79.63  ? 273 ARG B NH1   1 
ATOM   1875 N  NH2   . ARG D 3 58  ? -6.316  33.488 67.537 1.00 79.82  ? 273 ARG B NH2   1 
ATOM   1876 N  N     . ARG D 3 59  ? -9.127  28.993 71.992 1.00 88.07  ? 274 ARG B N     1 
ATOM   1877 C  CA    . ARG D 3 59  ? -8.251  27.965 72.549 1.00 88.15  ? 274 ARG B CA    1 
ATOM   1878 C  C     . ARG D 3 59  ? -8.847  27.118 73.647 1.00 88.42  ? 274 ARG B C     1 
ATOM   1879 O  O     . ARG D 3 59  ? -8.212  26.163 74.089 1.00 88.08  ? 274 ARG B O     1 
ATOM   1880 C  CB    . ARG D 3 59  ? -6.907  28.558 73.029 1.00 88.48  ? 274 ARG B CB    1 
ATOM   1881 C  CG    . ARG D 3 59  ? -6.944  29.711 74.042 1.00 89.98  ? 274 ARG B CG    1 
ATOM   1882 C  CD    . ARG D 3 59  ? -5.814  29.561 75.103 1.00 90.72  ? 274 ARG B CD    1 
ATOM   1883 N  NE    . ARG D 3 59  ? -4.484  29.979 74.632 1.00 92.73  ? 274 ARG B NE    1 
ATOM   1884 C  CZ    . ARG D 3 59  ? -3.319  29.502 75.093 1.00 93.61  ? 274 ARG B CZ    1 
ATOM   1885 N  NH1   . ARG D 3 59  ? -3.297  28.574 76.041 1.00 94.37  ? 274 ARG B NH1   1 
ATOM   1886 N  NH2   . ARG D 3 59  ? -2.160  29.950 74.616 1.00 93.82  ? 274 ARG B NH2   1 
ATOM   1887 N  N     . HIS D 3 60  ? -10.082 27.430 74.051 1.00 89.08  ? 275 HIS B N     1 
ATOM   1888 C  CA    . HIS D 3 60  ? -10.735 26.695 75.133 1.00 89.31  ? 275 HIS B CA    1 
ATOM   1889 C  C     . HIS D 3 60  ? -11.343 25.348 74.791 1.00 87.19  ? 275 HIS B C     1 
ATOM   1890 O  O     . HIS D 3 60  ? -11.213 24.418 75.574 1.00 86.96  ? 275 HIS B O     1 
ATOM   1891 C  CB    . HIS D 3 60  ? -11.785 27.574 75.842 1.00 93.07  ? 275 HIS B CB    1 
ATOM   1892 C  CG    . HIS D 3 60  ? -11.196 28.738 76.603 1.00 98.06  ? 275 HIS B CG    1 
ATOM   1893 N  ND1   . HIS D 3 60  ? -10.029 28.641 77.346 1.00 99.88  ? 275 HIS B ND1   1 
ATOM   1894 C  CD2   . HIS D 3 60  ? -11.610 30.027 76.727 1.00 99.49  ? 275 HIS B CD2   1 
ATOM   1895 C  CE1   . HIS D 3 60  ? -9.748  29.819 77.883 1.00 100.97 ? 275 HIS B CE1   1 
ATOM   1896 N  NE2   . HIS D 3 60  ? -10.691 30.678 77.524 1.00 100.98 ? 275 HIS B NE2   1 
ATOM   1897 N  N     . CYS D 3 61  ? -12.010 25.219 73.651 1.00 85.25  ? 276 CYS B N     1 
ATOM   1898 C  CA    . CYS D 3 61  ? -12.589 23.913 73.310 1.00 82.94  ? 276 CYS B CA    1 
ATOM   1899 C  C     . CYS D 3 61  ? -11.995 23.346 72.018 1.00 81.95  ? 276 CYS B C     1 
ATOM   1900 O  O     . CYS D 3 61  ? -12.444 23.626 70.891 1.00 80.90  ? 276 CYS B O     1 
ATOM   1901 C  CB    . CYS D 3 61  ? -14.135 23.962 73.211 1.00 81.73  ? 276 CYS B CB    1 
ATOM   1902 S  SG    . CYS D 3 61  ? -14.870 22.314 72.987 1.00 77.64  ? 276 CYS B SG    1 
ATOM   1903 N  N     . GLN D 3 62  ? -10.972 22.527 72.204 1.00 80.46  ? 277 GLN B N     1 
ATOM   1904 C  CA    . GLN D 3 62  ? -10.312 21.918 71.070 1.00 79.03  ? 277 GLN B CA    1 
ATOM   1905 C  C     . GLN D 3 62  ? -11.259 20.994 70.361 1.00 77.74  ? 277 GLN B C     1 
ATOM   1906 O  O     . GLN D 3 62  ? -11.154 20.774 69.162 1.00 77.74  ? 277 GLN B O     1 
ATOM   1907 C  CB    . GLN D 3 62  ? -9.099  21.135 71.526 1.00 78.76  ? 277 GLN B CB    1 
ATOM   1908 C  CG    . GLN D 3 62  ? -8.206  21.892 72.458 1.00 78.68  ? 277 GLN B CG    1 
ATOM   1909 C  CD    . GLN D 3 62  ? -6.955  21.117 72.719 1.00 79.09  ? 277 GLN B CD    1 
ATOM   1910 O  OE1   . GLN D 3 62  ? -6.085  21.010 71.842 1.00 79.13  ? 277 GLN B OE1   1 
ATOM   1911 N  NE2   . GLN D 3 62  ? -6.853  20.538 73.918 1.00 79.14  ? 277 GLN B NE2   1 
ATOM   1912 N  N     . ALA D 3 63  ? -12.195 20.444 71.112 1.00 77.33  ? 278 ALA B N     1 
ATOM   1913 C  CA    . ALA D 3 63  ? -13.146 19.531 70.515 1.00 75.85  ? 278 ALA B CA    1 
ATOM   1914 C  C     . ALA D 3 63  ? -13.995 20.273 69.518 1.00 74.42  ? 278 ALA B C     1 
ATOM   1915 O  O     . ALA D 3 63  ? -13.967 20.001 68.330 1.00 73.52  ? 278 ALA B O     1 
ATOM   1916 C  CB    . ALA D 3 63  ? -14.015 18.889 71.601 1.00 76.78  ? 278 ALA B CB    1 
ATOM   1917 N  N     . CYS D 3 64  ? -14.733 21.243 70.012 1.00 73.42  ? 279 CYS B N     1 
ATOM   1918 C  CA    . CYS D 3 64  ? -15.605 21.997 69.157 1.00 73.24  ? 279 CYS B CA    1 
ATOM   1919 C  C     . CYS D 3 64  ? -14.874 22.737 68.061 1.00 71.99  ? 279 CYS B C     1 
ATOM   1920 O  O     . CYS D 3 64  ? -15.330 22.740 66.923 1.00 72.87  ? 279 CYS B O     1 
ATOM   1921 C  CB    . CYS D 3 64  ? -16.458 22.943 70.000 1.00 74.78  ? 279 CYS B CB    1 
ATOM   1922 S  SG    . CYS D 3 64  ? -17.834 22.105 70.903 1.00 77.78  ? 279 CYS B SG    1 
ATOM   1923 N  N     . ARG D 3 65  ? -13.747 23.360 68.370 1.00 70.95  ? 280 ARG B N     1 
ATOM   1924 C  CA    . ARG D 3 65  ? -13.012 24.066 67.322 1.00 69.67  ? 280 ARG B CA    1 
ATOM   1925 C  C     . ARG D 3 65  ? -12.650 23.122 66.160 1.00 68.60  ? 280 ARG B C     1 
ATOM   1926 O  O     . ARG D 3 65  ? -12.844 23.429 64.975 1.00 67.61  ? 280 ARG B O     1 
ATOM   1927 C  CB    . ARG D 3 65  ? -11.736 24.672 67.890 1.00 69.90  ? 280 ARG B CB    1 
ATOM   1928 C  CG    . ARG D 3 65  ? -10.967 25.521 66.897 1.00 70.04  ? 280 ARG B CG    1 
ATOM   1929 C  CD    . ARG D 3 65  ? -9.528  25.710 67.365 1.00 71.03  ? 280 ARG B CD    1 
ATOM   1930 N  NE    . ARG D 3 65  ? -8.938  26.934 66.822 1.00 71.69  ? 280 ARG B NE    1 
ATOM   1931 C  CZ    . ARG D 3 65  ? -7.831  27.512 67.275 1.00 71.32  ? 280 ARG B CZ    1 
ATOM   1932 N  NH1   . ARG D 3 65  ? -7.160  26.994 68.292 1.00 70.00  ? 280 ARG B NH1   1 
ATOM   1933 N  NH2   . ARG D 3 65  ? -7.404  28.626 66.712 1.00 71.52  ? 280 ARG B NH2   1 
ATOM   1934 N  N     . LEU D 3 66  ? -12.123 21.963 66.514 1.00 67.57  ? 281 LEU B N     1 
ATOM   1935 C  CA    . LEU D 3 66  ? -11.736 21.009 65.509 1.00 67.47  ? 281 LEU B CA    1 
ATOM   1936 C  C     . LEU D 3 66  ? -12.932 20.564 64.676 1.00 68.56  ? 281 LEU B C     1 
ATOM   1937 O  O     . LEU D 3 66  ? -12.862 20.511 63.453 1.00 68.34  ? 281 LEU B O     1 
ATOM   1938 C  CB    . LEU D 3 66  ? -11.077 19.836 66.179 1.00 65.96  ? 281 LEU B CB    1 
ATOM   1939 C  CG    . LEU D 3 66  ? -10.521 18.888 65.151 1.00 64.62  ? 281 LEU B CG    1 
ATOM   1940 C  CD1   . LEU D 3 66  ? -9.756  19.662 64.120 1.00 63.32  ? 281 LEU B CD1   1 
ATOM   1941 C  CD2   . LEU D 3 66  ? -9.658  17.876 65.846 1.00 64.14  ? 281 LEU B CD2   1 
ATOM   1942 N  N     . LYS D 3 67  ? -14.035 20.242 65.351 1.00 69.63  ? 282 LYS B N     1 
ATOM   1943 C  CA    . LYS D 3 67  ? -15.278 19.859 64.689 1.00 69.81  ? 282 LYS B CA    1 
ATOM   1944 C  C     . LYS D 3 67  ? -15.776 21.002 63.839 1.00 70.44  ? 282 LYS B C     1 
ATOM   1945 O  O     . LYS D 3 67  ? -16.274 20.766 62.774 1.00 70.77  ? 282 LYS B O     1 
ATOM   1946 C  CB    . LYS D 3 67  ? -16.360 19.507 65.698 1.00 68.86  ? 282 LYS B CB    1 
ATOM   1947 C  CG    . LYS D 3 67  ? -17.702 19.167 65.073 1.00 68.73  ? 282 LYS B CG    1 
ATOM   1948 C  CD    . LYS D 3 67  ? -18.725 18.780 66.161 1.00 69.50  ? 282 LYS B CD    1 
ATOM   1949 C  CE    . LYS D 3 67  ? -20.105 18.383 65.585 1.00 69.67  ? 282 LYS B CE    1 
ATOM   1950 N  NZ    . LYS D 3 67  ? -20.556 19.259 64.463 1.00 69.52  ? 282 LYS B NZ    1 
ATOM   1951 N  N     . ARG D 3 68  ? -15.665 22.243 64.296 1.00 71.57  ? 283 ARG B N     1 
ATOM   1952 C  CA    . ARG D 3 68  ? -16.120 23.346 63.456 1.00 73.70  ? 283 ARG B CA    1 
ATOM   1953 C  C     . ARG D 3 68  ? -15.250 23.450 62.210 1.00 75.10  ? 283 ARG B C     1 
ATOM   1954 O  O     . ARG D 3 68  ? -15.769 23.718 61.136 1.00 75.52  ? 283 ARG B O     1 
ATOM   1955 C  CB    . ARG D 3 68  ? -16.104 24.662 64.223 1.00 74.72  ? 283 ARG B CB    1 
ATOM   1956 C  CG    . ARG D 3 68  ? -16.101 25.941 63.363 1.00 76.72  ? 283 ARG B CG    1 
ATOM   1957 C  CD    . ARG D 3 68  ? -17.436 26.319 62.779 1.00 78.95  ? 283 ARG B CD    1 
ATOM   1958 N  NE    . ARG D 3 68  ? -17.496 27.756 62.465 1.00 81.10  ? 283 ARG B NE    1 
ATOM   1959 C  CZ    . ARG D 3 68  ? -18.382 28.319 61.627 1.00 82.21  ? 283 ARG B CZ    1 
ATOM   1960 N  NH1   . ARG D 3 68  ? -19.297 27.570 60.994 1.00 81.53  ? 283 ARG B NH1   1 
ATOM   1961 N  NH2   . ARG D 3 68  ? -18.370 29.644 61.433 1.00 81.75  ? 283 ARG B NH2   1 
ATOM   1962 N  N     . CYS D 3 69  ? -13.936 23.234 62.349 1.00 75.99  ? 284 CYS B N     1 
ATOM   1963 C  CA    . CYS D 3 69  ? -12.996 23.269 61.212 1.00 76.61  ? 284 CYS B CA    1 
ATOM   1964 C  C     . CYS D 3 69  ? -13.499 22.401 60.076 1.00 78.18  ? 284 CYS B C     1 
ATOM   1965 O  O     . CYS D 3 69  ? -13.573 22.834 58.937 1.00 77.56  ? 284 CYS B O     1 
ATOM   1966 C  CB    . CYS D 3 69  ? -11.619 22.709 61.597 1.00 77.25  ? 284 CYS B CB    1 
ATOM   1967 S  SG    . CYS D 3 69  ? -10.421 23.844 62.312 1.00 76.53  ? 284 CYS B SG    1 
ATOM   1968 N  N     . VAL D 3 70  ? -13.817 21.154 60.396 1.00 79.05  ? 285 VAL B N     1 
ATOM   1969 C  CA    . VAL D 3 70  ? -14.303 20.230 59.398 1.00 80.39  ? 285 VAL B CA    1 
ATOM   1970 C  C     . VAL D 3 70  ? -15.620 20.627 58.719 1.00 82.77  ? 285 VAL B C     1 
ATOM   1971 O  O     . VAL D 3 70  ? -15.793 20.360 57.530 1.00 83.24  ? 285 VAL B O     1 
ATOM   1972 C  CB    . VAL D 3 70  ? -14.455 18.846 59.988 1.00 80.57  ? 285 VAL B CB    1 
ATOM   1973 C  CG1   . VAL D 3 70  ? -14.948 17.887 58.930 1.00 80.38  ? 285 VAL B CG1   1 
ATOM   1974 C  CG2   . VAL D 3 70  ? -13.132 18.384 60.512 1.00 81.53  ? 285 VAL B CG2   1 
ATOM   1975 N  N     . ASP D 3 71  ? -16.545 21.258 59.439 1.00 83.76  ? 286 ASP B N     1 
ATOM   1976 C  CA    . ASP D 3 71  ? -17.799 21.638 58.804 1.00 85.16  ? 286 ASP B CA    1 
ATOM   1977 C  C     . ASP D 3 71  ? -17.524 22.798 57.863 1.00 84.61  ? 286 ASP B C     1 
ATOM   1978 O  O     . ASP D 3 71  ? -18.144 22.876 56.803 1.00 85.28  ? 286 ASP B O     1 
ATOM   1979 C  CB    . ASP D 3 71  ? -18.881 22.045 59.821 1.00 88.99  ? 286 ASP B CB    1 
ATOM   1980 C  CG    . ASP D 3 71  ? -18.925 21.109 61.056 1.00 93.81  ? 286 ASP B CG    1 
ATOM   1981 O  OD1   . ASP D 3 71  ? -18.597 19.886 60.892 1.00 95.87  ? 286 ASP B OD1   1 
ATOM   1982 O  OD2   . ASP D 3 71  ? -19.293 21.587 62.188 1.00 95.24  ? 286 ASP B OD2   1 
ATOM   1983 N  N     . ILE D 3 72  ? -16.593 23.684 58.235 1.00 82.74  ? 287 ILE B N     1 
ATOM   1984 C  CA    . ILE D 3 72  ? -16.242 24.843 57.411 1.00 80.74  ? 287 ILE B CA    1 
ATOM   1985 C  C     . ILE D 3 72  ? -15.602 24.364 56.090 1.00 80.55  ? 287 ILE B C     1 
ATOM   1986 O  O     . ILE D 3 72  ? -15.536 25.095 55.089 1.00 79.28  ? 287 ILE B O     1 
ATOM   1987 C  CB    . ILE D 3 72  ? -15.274 25.788 58.176 1.00 81.41  ? 287 ILE B CB    1 
ATOM   1988 C  CG1   . ILE D 3 72  ? -15.269 27.163 57.538 1.00 82.45  ? 287 ILE B CG1   1 
ATOM   1989 C  CG2   . ILE D 3 72  ? -13.847 25.315 58.080 1.00 80.94  ? 287 ILE B CG2   1 
ATOM   1990 C  CD1   . ILE D 3 72  ? -16.598 27.880 57.617 1.00 84.41  ? 287 ILE B CD1   1 
ATOM   1991 N  N     . GLY D 3 73  ? -15.128 23.120 56.102 1.00 79.45  ? 288 GLY B N     1 
ATOM   1992 C  CA    . GLY D 3 73  ? -14.529 22.549 54.918 1.00 78.23  ? 288 GLY B CA    1 
ATOM   1993 C  C     . GLY D 3 73  ? -13.030 22.322 54.892 1.00 78.03  ? 288 GLY B C     1 
ATOM   1994 O  O     . GLY D 3 73  ? -12.444 22.276 53.815 1.00 78.71  ? 288 GLY B O     1 
ATOM   1995 N  N     . MET D 3 74  ? -12.382 22.176 56.038 1.00 77.35  ? 289 MET B N     1 
ATOM   1996 C  CA    . MET D 3 74  ? -10.947 21.946 56.011 1.00 76.16  ? 289 MET B CA    1 
ATOM   1997 C  C     . MET D 3 74  ? -10.697 20.482 55.793 1.00 76.83  ? 289 MET B C     1 
ATOM   1998 O  O     . MET D 3 74  ? -11.526 19.619 56.117 1.00 76.53  ? 289 MET B O     1 
ATOM   1999 C  CB    . MET D 3 74  ? -10.269 22.441 57.285 1.00 75.29  ? 289 MET B CB    1 
ATOM   2000 C  CG    . MET D 3 74  ? -10.268 23.942 57.339 1.00 74.57  ? 289 MET B CG    1 
ATOM   2001 S  SD    . MET D 3 74  ? -9.656  24.634 58.828 1.00 74.92  ? 289 MET B SD    1 
ATOM   2002 C  CE    . MET D 3 74  ? -8.038  24.856 58.498 1.00 74.95  ? 289 MET B CE    1 
ATOM   2003 N  N     . MET D 3 75  ? -9.536  20.204 55.226 1.00 77.22  ? 290 MET B N     1 
ATOM   2004 C  CA    . MET D 3 75  ? -9.201  18.851 54.906 1.00 77.39  ? 290 MET B CA    1 
ATOM   2005 C  C     . MET D 3 75  ? -7.857  18.320 55.254 1.00 76.76  ? 290 MET B C     1 
ATOM   2006 O  O     . MET D 3 75  ? -6.833  18.732 54.721 1.00 76.87  ? 290 MET B O     1 
ATOM   2007 C  CB    . MET D 3 75  ? -9.497  18.625 53.437 1.00 78.85  ? 290 MET B CB    1 
ATOM   2008 C  CG    . MET D 3 75  ? -10.958 18.251 53.287 1.00 81.15  ? 290 MET B CG    1 
ATOM   2009 S  SD    . MET D 3 75  ? -11.662 18.691 51.754 1.00 84.15  ? 290 MET B SD    1 
ATOM   2010 C  CE    . MET D 3 75  ? -12.935 19.848 52.274 1.00 83.75  ? 290 MET B CE    1 
ATOM   2011 N  N     . LYS D 3 76  ? -7.895  17.362 56.163 1.00 76.24  ? 291 LYS B N     1 
ATOM   2012 C  CA    . LYS D 3 76  ? -6.708  16.692 56.612 1.00 75.29  ? 291 LYS B CA    1 
ATOM   2013 C  C     . LYS D 3 76  ? -5.889  16.206 55.410 1.00 74.68  ? 291 LYS B C     1 
ATOM   2014 O  O     . LYS D 3 76  ? -4.676  16.075 55.526 1.00 75.07  ? 291 LYS B O     1 
ATOM   2015 C  CB    . LYS D 3 76  ? -7.102  15.512 57.506 1.00 75.13  ? 291 LYS B CB    1 
ATOM   2016 C  CG    . LYS D 3 76  ? -7.397  14.216 56.762 1.00 75.19  ? 291 LYS B CG    1 
ATOM   2017 C  CD    . LYS D 3 76  ? -7.794  13.106 57.703 1.00 75.64  ? 291 LYS B CD    1 
ATOM   2018 C  CE    . LYS D 3 76  ? -9.322  13.084 57.923 1.00 76.75  ? 291 LYS B CE    1 
ATOM   2019 N  NZ    . LYS D 3 76  ? -10.118 12.485 56.753 1.00 76.15  ? 291 LYS B NZ    1 
ATOM   2020 N  N     . GLU D 3 77  ? -6.533  15.952 54.264 1.00 73.84  ? 292 GLU B N     1 
ATOM   2021 C  CA    . GLU D 3 77  ? -5.812  15.448 53.089 1.00 73.59  ? 292 GLU B CA    1 
ATOM   2022 C  C     . GLU D 3 77  ? -4.813  16.435 52.540 1.00 73.61  ? 292 GLU B C     1 
ATOM   2023 O  O     . GLU D 3 77  ? -3.819  16.018 51.925 1.00 74.14  ? 292 GLU B O     1 
ATOM   2024 C  CB    . GLU D 3 77  ? -6.739  15.057 51.945 1.00 74.34  ? 292 GLU B CB    1 
ATOM   2025 C  CG    . GLU D 3 77  ? -7.663  13.930 52.237 1.00 74.46  ? 292 GLU B CG    1 
ATOM   2026 C  CD    . GLU D 3 77  ? -8.808  14.364 53.126 1.00 75.20  ? 292 GLU B CD    1 
ATOM   2027 O  OE1   . GLU D 3 77  ? -9.215  15.544 53.054 1.00 73.77  ? 292 GLU B OE1   1 
ATOM   2028 O  OE2   . GLU D 3 77  ? -9.312  13.513 53.892 1.00 76.46  ? 292 GLU B OE2   1 
ATOM   2029 N  N     . PHE D 3 78  ? -5.076  17.733 52.740 1.00 72.81  ? 293 PHE B N     1 
ATOM   2030 C  CA    . PHE D 3 78  ? -4.160  18.768 52.291 1.00 71.90  ? 293 PHE B CA    1 
ATOM   2031 C  C     . PHE D 3 78  ? -2.965  18.964 53.232 1.00 72.35  ? 293 PHE B C     1 
ATOM   2032 O  O     . PHE D 3 78  ? -1.966  19.562 52.857 1.00 72.86  ? 293 PHE B O     1 
ATOM   2033 C  CB    . PHE D 3 78  ? -4.905  20.066 52.109 1.00 70.60  ? 293 PHE B CB    1 
ATOM   2034 C  CG    . PHE D 3 78  ? -5.933  20.007 51.047 1.00 69.52  ? 293 PHE B CG    1 
ATOM   2035 C  CD1   . PHE D 3 78  ? -6.755  21.093 50.797 1.00 69.06  ? 293 PHE B CD1   1 
ATOM   2036 C  CD2   . PHE D 3 78  ? -6.099  18.866 50.298 1.00 69.41  ? 293 PHE B CD2   1 
ATOM   2037 C  CE1   . PHE D 3 78  ? -7.730  21.046 49.826 1.00 68.58  ? 293 PHE B CE1   1 
ATOM   2038 C  CE2   . PHE D 3 78  ? -7.072  18.810 49.316 1.00 70.10  ? 293 PHE B CE2   1 
ATOM   2039 C  CZ    . PHE D 3 78  ? -7.886  19.904 49.087 1.00 69.51  ? 293 PHE B CZ    1 
ATOM   2040 N  N     . ILE D 3 79  ? -3.057  18.488 54.462 1.00 72.43  ? 294 ILE B N     1 
ATOM   2041 C  CA    . ILE D 3 79  ? -1.921  18.603 55.354 1.00 72.98  ? 294 ILE B CA    1 
ATOM   2042 C  C     . ILE D 3 79  ? -0.911  17.647 54.771 1.00 74.25  ? 294 ILE B C     1 
ATOM   2043 O  O     . ILE D 3 79  ? -1.265  16.492 54.535 1.00 73.76  ? 294 ILE B O     1 
ATOM   2044 C  CB    . ILE D 3 79  ? -2.255  18.101 56.744 1.00 72.25  ? 294 ILE B CB    1 
ATOM   2045 C  CG1   . ILE D 3 79  ? -3.316  18.989 57.362 1.00 72.46  ? 294 ILE B CG1   1 
ATOM   2046 C  CG2   . ILE D 3 79  ? -1.007  18.026 57.576 1.00 70.56  ? 294 ILE B CG2   1 
ATOM   2047 C  CD1   . ILE D 3 79  ? -3.714  18.561 58.720 1.00 72.01  ? 294 ILE B CD1   1 
ATOM   2048 N  N     . LEU D 3 80  ? 0.324   18.098 54.539 1.00 76.03  ? 295 LEU B N     1 
ATOM   2049 C  CA    . LEU D 3 80  ? 1.353   17.220 53.982 1.00 78.29  ? 295 LEU B CA    1 
ATOM   2050 C  C     . LEU D 3 80  ? 1.806   16.147 54.947 1.00 80.59  ? 295 LEU B C     1 
ATOM   2051 O  O     . LEU D 3 80  ? 1.942   16.397 56.153 1.00 80.28  ? 295 LEU B O     1 
ATOM   2052 C  CB    . LEU D 3 80  ? 2.585   17.996 53.590 1.00 77.65  ? 295 LEU B CB    1 
ATOM   2053 C  CG    . LEU D 3 80  ? 2.580   18.942 52.408 1.00 76.90  ? 295 LEU B CG    1 
ATOM   2054 C  CD1   . LEU D 3 80  ? 4.000   19.355 52.227 1.00 75.13  ? 295 LEU B CD1   1 
ATOM   2055 C  CD2   . LEU D 3 80  ? 2.057   18.281 51.149 1.00 76.29  ? 295 LEU B CD2   1 
ATOM   2056 N  N     . THR D 3 81  ? 2.069   14.960 54.396 1.00 83.63  ? 296 THR B N     1 
ATOM   2057 C  CA    . THR D 3 81  ? 2.523   13.795 55.170 1.00 87.34  ? 296 THR B CA    1 
ATOM   2058 C  C     . THR D 3 81  ? 4.008   13.923 55.433 1.00 89.75  ? 296 THR B C     1 
ATOM   2059 O  O     . THR D 3 81  ? 4.712   14.606 54.673 1.00 90.11  ? 296 THR B O     1 
ATOM   2060 C  CB    . THR D 3 81  ? 2.288   12.456 54.419 1.00 86.68  ? 296 THR B CB    1 
ATOM   2061 O  OG1   . THR D 3 81  ? 3.136   12.378 53.270 1.00 86.30  ? 296 THR B OG1   1 
ATOM   2062 C  CG2   . THR D 3 81  ? 0.860   12.349 53.970 1.00 86.04  ? 296 THR B CG2   1 
ATOM   2063 N  N     . ASP D 3 82  ? 4.486   13.263 56.494 1.00 92.48  ? 297 ASP B N     1 
ATOM   2064 C  CA    . ASP D 3 82  ? 5.909   13.343 56.859 1.00 95.05  ? 297 ASP B CA    1 
ATOM   2065 C  C     . ASP D 3 82  ? 6.810   12.884 55.727 1.00 96.42  ? 297 ASP B C     1 
ATOM   2066 O  O     . ASP D 3 82  ? 7.954   13.326 55.625 1.00 95.96  ? 297 ASP B O     1 
ATOM   2067 C  CB    . ASP D 3 82  ? 6.193   12.555 58.148 1.00 95.41  ? 297 ASP B CB    1 
ATOM   2068 C  CG    . ASP D 3 82  ? 5.963   13.399 59.419 1.00 96.05  ? 297 ASP B CG    1 
ATOM   2069 O  OD1   . ASP D 3 82  ? 6.687   14.404 59.605 1.00 96.02  ? 297 ASP B OD1   1 
ATOM   2070 O  OD2   . ASP D 3 82  ? 5.064   13.064 60.229 1.00 95.49  ? 297 ASP B OD2   1 
ATOM   2071 N  N     . GLU D 3 83  ? 6.276   12.022 54.867 1.00 98.51  ? 298 GLU B N     1 
ATOM   2072 C  CA    . GLU D 3 83  ? 7.025   11.536 53.729 1.00 101.10 ? 298 GLU B CA    1 
ATOM   2073 C  C     . GLU D 3 83  ? 7.096   12.664 52.723 1.00 100.77 ? 298 GLU B C     1 
ATOM   2074 O  O     . GLU D 3 83  ? 8.154   13.000 52.217 1.00 101.10 ? 298 GLU B O     1 
ATOM   2075 C  CB    . GLU D 3 83  ? 6.328   10.347 53.071 1.00 104.04 ? 298 GLU B CB    1 
ATOM   2076 C  CG    . GLU D 3 83  ? 7.001   9.909  51.744 1.00 109.26 ? 298 GLU B CG    1 
ATOM   2077 C  CD    . GLU D 3 83  ? 6.037   9.799  50.547 1.00 111.96 ? 298 GLU B CD    1 
ATOM   2078 O  OE1   . GLU D 3 83  ? 5.187   8.875  50.546 1.00 114.45 ? 298 GLU B OE1   1 
ATOM   2079 O  OE2   . GLU D 3 83  ? 6.137   10.634 49.610 1.00 112.76 ? 298 GLU B OE2   1 
ATOM   2080 N  N     . GLU D 3 84  ? 5.956   13.257 52.427 1.00 100.81 ? 299 GLU B N     1 
ATOM   2081 C  CA    . GLU D 3 84  ? 5.937   14.341 51.458 1.00 101.23 ? 299 GLU B CA    1 
ATOM   2082 C  C     . GLU D 3 84  ? 6.874   15.460 51.880 1.00 100.98 ? 299 GLU B C     1 
ATOM   2083 O  O     . GLU D 3 84  ? 7.661   15.953 51.080 1.00 100.85 ? 299 GLU B O     1 
ATOM   2084 C  CB    . GLU D 3 84  ? 4.498   14.862 51.275 1.00 102.27 ? 299 GLU B CB    1 
ATOM   2085 C  CG    . GLU D 3 84  ? 3.539   13.765 50.790 1.00 103.57 ? 299 GLU B CG    1 
ATOM   2086 C  CD    . GLU D 3 84  ? 2.091   14.191 50.702 1.00 103.84 ? 299 GLU B CD    1 
ATOM   2087 O  OE1   . GLU D 3 84  ? 1.679   14.733 49.652 1.00 104.53 ? 299 GLU B OE1   1 
ATOM   2088 O  OE2   . GLU D 3 84  ? 1.359   13.976 51.689 1.00 104.49 ? 299 GLU B OE2   1 
ATOM   2089 N  N     . VAL D 3 85  ? 6.809   15.842 53.147 1.00 101.10 ? 300 VAL B N     1 
ATOM   2090 C  CA    . VAL D 3 85  ? 7.654   16.918 53.638 1.00 101.02 ? 300 VAL B CA    1 
ATOM   2091 C  C     . VAL D 3 85  ? 9.110   16.638 53.386 1.00 100.83 ? 300 VAL B C     1 
ATOM   2092 O  O     . VAL D 3 85  ? 9.853   17.522 52.984 1.00 100.69 ? 300 VAL B O     1 
ATOM   2093 C  CB    . VAL D 3 85  ? 7.459   17.151 55.136 1.00 101.31 ? 300 VAL B CB    1 
ATOM   2094 C  CG1   . VAL D 3 85  ? 8.304   18.340 55.603 1.00 101.12 ? 300 VAL B CG1   1 
ATOM   2095 C  CG2   . VAL D 3 85  ? 5.986   17.398 55.409 1.00 101.74 ? 300 VAL B CG2   1 
ATOM   2096 N  N     . GLN D 3 86  ? 9.528   15.408 53.615 1.00 100.61 ? 301 GLN B N     1 
ATOM   2097 C  CA    . GLN D 3 86  ? 10.919  15.090 53.390 1.00 100.67 ? 301 GLN B CA    1 
ATOM   2098 C  C     . GLN D 3 86  ? 11.284  15.292 51.928 1.00 100.31 ? 301 GLN B C     1 
ATOM   2099 O  O     . GLN D 3 86  ? 12.189  16.055 51.615 1.00 100.19 ? 301 GLN B O     1 
ATOM   2100 C  CB    . GLN D 3 86  ? 11.209  13.658 53.808 1.00 101.45 ? 301 GLN B CB    1 
ATOM   2101 C  CG    . GLN D 3 86  ? 12.668  13.421 54.222 1.00 102.27 ? 301 GLN B CG    1 
ATOM   2102 C  CD    . GLN D 3 86  ? 13.106  14.245 55.450 1.00 102.88 ? 301 GLN B CD    1 
ATOM   2103 O  OE1   . GLN D 3 86  ? 14.131  13.927 56.077 1.00 103.44 ? 301 GLN B OE1   1 
ATOM   2104 N  NE2   . GLN D 3 86  ? 12.344  15.301 55.788 1.00 101.88 ? 301 GLN B NE2   1 
ATOM   2105 N  N     . ARG D 3 87  ? 10.566  14.622 51.036 1.00 100.27 ? 302 ARG B N     1 
ATOM   2106 C  CA    . ARG D 3 87  ? 10.824  14.742 49.608 1.00 100.46 ? 302 ARG B CA    1 
ATOM   2107 C  C     . ARG D 3 87  ? 10.982  16.202 49.218 1.00 100.62 ? 302 ARG B C     1 
ATOM   2108 O  O     . ARG D 3 87  ? 11.631  16.518 48.222 1.00 101.22 ? 302 ARG B O     1 
ATOM   2109 C  CB    . ARG D 3 87  ? 9.684   14.107 48.800 1.00 99.38  ? 302 ARG B CB    1 
ATOM   2110 N  N     . LYS D 3 88  ? 10.386  17.099 49.996 1.00 101.03 ? 303 LYS B N     1 
ATOM   2111 C  CA    . LYS D 3 88  ? 10.488  18.525 49.701 1.00 100.98 ? 303 LYS B CA    1 
ATOM   2112 C  C     . LYS D 3 88  ? 11.848  19.084 50.137 1.00 101.14 ? 303 LYS B C     1 
ATOM   2113 O  O     . LYS D 3 88  ? 12.577  19.623 49.300 1.00 101.35 ? 303 LYS B O     1 
ATOM   2114 C  CB    . LYS D 3 88  ? 9.335   19.304 50.373 1.00 100.57 ? 303 LYS B CB    1 
ATOM   2115 N  N     . ARG D 3 89  ? 12.199  18.941 51.422 1.00 101.06 ? 304 ARG B N     1 
ATOM   2116 C  CA    . ARG D 3 89  ? 13.477  19.453 51.930 1.00 100.98 ? 304 ARG B CA    1 
ATOM   2117 C  C     . ARG D 3 89  ? 14.632  18.946 51.050 1.00 101.03 ? 304 ARG B C     1 
ATOM   2118 O  O     . ARG D 3 89  ? 15.649  19.636 50.874 1.00 100.85 ? 304 ARG B O     1 
ATOM   2119 C  CB    . ARG D 3 89  ? 13.671  19.034 53.390 1.00 99.77  ? 304 ARG B CB    1 
ATOM   2120 N  N     . GLU D 3 90  ? 14.447  17.744 50.496 1.00 101.35 ? 305 GLU B N     1 
ATOM   2121 C  CA    . GLU D 3 90  ? 15.414  17.102 49.606 1.00 101.97 ? 305 GLU B CA    1 
ATOM   2122 C  C     . GLU D 3 90  ? 15.298  17.725 48.209 1.00 103.18 ? 305 GLU B C     1 
ATOM   2123 O  O     . GLU D 3 90  ? 16.304  18.164 47.653 1.00 103.19 ? 305 GLU B O     1 
ATOM   2124 C  CB    . GLU D 3 90  ? 15.160  15.586 49.538 1.00 101.07 ? 305 GLU B CB    1 
ATOM   2125 N  N     . MET D 3 91  ? 14.083  17.773 47.649 1.00 104.34 ? 306 MET B N     1 
ATOM   2126 C  CA    . MET D 3 91  ? 13.856  18.369 46.317 1.00 105.79 ? 306 MET B CA    1 
ATOM   2127 C  C     . MET D 3 91  ? 14.354  19.821 46.302 1.00 106.77 ? 306 MET B C     1 
ATOM   2128 O  O     . MET D 3 91  ? 14.618  20.385 45.236 1.00 107.24 ? 306 MET B O     1 
ATOM   2129 C  CB    . MET D 3 91  ? 12.362  18.309 45.926 1.00 104.61 ? 306 MET B CB    1 
ATOM   2130 N  N     . ILE D 3 92  ? 14.470  20.412 47.492 1.00 107.54 ? 307 ILE B N     1 
ATOM   2131 C  CA    . ILE D 3 92  ? 14.990  21.772 47.652 1.00 108.16 ? 307 ILE B CA    1 
ATOM   2132 C  C     . ILE D 3 92  ? 16.500  21.710 47.346 1.00 109.12 ? 307 ILE B C     1 
ATOM   2133 O  O     . ILE D 3 92  ? 17.037  22.545 46.599 1.00 109.38 ? 307 ILE B O     1 
ATOM   2134 C  CB    . ILE D 3 92  ? 14.832  22.300 49.140 1.00 108.50 ? 307 ILE B CB    1 
ATOM   2135 C  CG1   . ILE D 3 92  ? 13.364  22.633 49.454 1.00 108.27 ? 307 ILE B CG1   1 
ATOM   2136 C  CG2   . ILE D 3 92  ? 15.739  23.535 49.366 1.00 108.05 ? 307 ILE B CG2   1 
ATOM   2137 C  CD1   . ILE D 3 92  ? 13.140  23.097 50.861 1.00 105.54 ? 307 ILE B CD1   1 
ATOM   2138 N  N     . LEU D 3 93  ? 17.165  20.705 47.928 1.00 109.07 ? 308 LEU B N     1 
ATOM   2139 C  CA    . LEU D 3 93  ? 18.608  20.504 47.795 1.00 108.67 ? 308 LEU B CA    1 
ATOM   2140 C  C     . LEU D 3 93  ? 19.138  20.044 46.451 1.00 108.75 ? 308 LEU B C     1 
ATOM   2141 O  O     . LEU D 3 93  ? 20.192  20.497 46.021 1.00 108.72 ? 308 LEU B O     1 
ATOM   2142 C  CB    . LEU D 3 93  ? 19.081  19.546 48.884 1.00 108.05 ? 308 LEU B CB    1 
ATOM   2143 C  CG    . LEU D 3 93  ? 18.837  20.163 50.260 1.00 108.48 ? 308 LEU B CG    1 
ATOM   2144 C  CD1   . LEU D 3 93  ? 19.474  19.303 51.340 1.00 108.38 ? 308 LEU B CD1   1 
ATOM   2145 C  CD2   . LEU D 3 93  ? 19.415  21.580 50.286 1.00 107.34 ? 308 LEU B CD2   1 
ATOM   2146 N  N     . LYS D 3 94  ? 18.414  19.141 45.796 1.00 108.73 ? 309 LYS B N     1 
ATOM   2147 C  CA    . LYS D 3 94  ? 18.824  18.611 44.493 1.00 108.67 ? 309 LYS B CA    1 
ATOM   2148 C  C     . LYS D 3 94  ? 18.796  19.705 43.415 1.00 108.58 ? 309 LYS B C     1 
ATOM   2149 O  O     . LYS D 3 94  ? 19.724  19.808 42.594 1.00 108.02 ? 309 LYS B O     1 
ATOM   2150 C  CB    . LYS D 3 94  ? 17.913  17.432 44.087 1.00 108.30 ? 309 LYS B CB    1 
ATOM   2151 N  N     . ARG D 3 95  ? 17.732  20.512 43.415 1.00 108.95 ? 310 ARG B N     1 
ATOM   2152 C  CA    . ARG D 3 95  ? 17.605  21.605 42.448 1.00 109.27 ? 310 ARG B CA    1 
ATOM   2153 C  C     . ARG D 3 95  ? 18.710  22.614 42.773 1.00 109.89 ? 310 ARG B C     1 
ATOM   2154 O  O     . ARG D 3 95  ? 19.210  23.329 41.894 1.00 108.94 ? 310 ARG B O     1 
ATOM   2155 C  CB    . ARG D 3 95  ? 16.230  22.260 42.569 1.00 108.56 ? 310 ARG B CB    1 
ATOM   2156 N  N     . LYS D 3 96  ? 19.078  22.622 44.057 1.00 111.10 ? 311 LYS B N     1 
ATOM   2157 C  CA    . LYS D 3 96  ? 20.110  23.476 44.656 1.00 112.52 ? 311 LYS B CA    1 
ATOM   2158 C  C     . LYS D 3 96  ? 21.538  23.156 44.156 1.00 113.33 ? 311 LYS B C     1 
ATOM   2159 O  O     . LYS D 3 96  ? 22.403  24.038 44.018 1.00 113.04 ? 311 LYS B O     1 
ATOM   2160 C  CB    . LYS D 3 96  ? 20.022  23.313 46.177 1.00 112.34 ? 311 LYS B CB    1 
ATOM   2161 C  CG    . LYS D 3 96  ? 21.129  23.943 46.957 1.00 113.29 ? 311 LYS B CG    1 
ATOM   2162 C  CD    . LYS D 3 96  ? 20.713  24.055 48.399 1.00 113.66 ? 311 LYS B CD    1 
ATOM   2163 C  CE    . LYS D 3 96  ? 21.693  24.917 49.164 1.00 114.76 ? 311 LYS B CE    1 
ATOM   2164 N  NZ    . LYS D 3 96  ? 20.990  25.973 49.951 1.00 115.09 ? 311 LYS B NZ    1 
ATOM   2165 N  N     . GLU D 3 97  ? 21.766  21.879 43.888 1.00 114.71 ? 312 GLU B N     1 
ATOM   2166 C  CA    . GLU D 3 97  ? 23.043  21.418 43.404 1.00 115.69 ? 312 GLU B CA    1 
ATOM   2167 C  C     . GLU D 3 97  ? 23.030  21.407 41.881 1.00 116.21 ? 312 GLU B C     1 
ATOM   2168 O  O     . GLU D 3 97  ? 24.079  21.290 41.237 1.00 115.62 ? 312 GLU B O     1 
ATOM   2169 C  CB    . GLU D 3 97  ? 23.312  20.033 43.963 1.00 116.25 ? 312 GLU B CB    1 
ATOM   2170 C  CG    . GLU D 3 97  ? 23.371  20.018 45.487 1.00 117.57 ? 312 GLU B CG    1 
ATOM   2171 C  CD    . GLU D 3 97  ? 23.316  18.607 46.042 1.00 118.75 ? 312 GLU B CD    1 
ATOM   2172 O  OE1   . GLU D 3 97  ? 22.387  17.871 45.628 1.00 120.07 ? 312 GLU B OE1   1 
ATOM   2173 O  OE2   . GLU D 3 97  ? 24.182  18.235 46.880 1.00 118.92 ? 312 GLU B OE2   1 
ATOM   2174 N  N     . GLU D 3 98  ? 21.833  21.541 41.310 1.00 116.99 ? 313 GLU B N     1 
ATOM   2175 C  CA    . GLU D 3 98  ? 21.663  21.589 39.855 1.00 118.33 ? 313 GLU B CA    1 
ATOM   2176 C  C     . GLU D 3 98  ? 21.743  23.032 39.371 1.00 118.42 ? 313 GLU B C     1 
ATOM   2177 O  O     . GLU D 3 98  ? 21.952  23.288 38.180 1.00 118.18 ? 313 GLU B O     1 
ATOM   2178 C  CB    . GLU D 3 98  ? 20.321  20.998 39.447 1.00 119.29 ? 313 GLU B CB    1 
ATOM   2179 C  CG    . GLU D 3 98  ? 20.262  19.502 39.547 1.00 121.63 ? 313 GLU B CG    1 
ATOM   2180 C  CD    . GLU D 3 98  ? 18.884  18.979 39.236 1.00 123.16 ? 313 GLU B CD    1 
ATOM   2181 O  OE1   . GLU D 3 98  ? 17.981  19.135 40.090 1.00 123.78 ? 313 GLU B OE1   1 
ATOM   2182 O  OE2   . GLU D 3 98  ? 18.701  18.427 38.129 1.00 124.28 ? 313 GLU B OE2   1 
ATOM   2183 N  N     . GLU D 3 99  ? 21.548  23.972 40.298 1.00 118.73 ? 314 GLU B N     1 
ATOM   2184 C  CA    . GLU D 3 99  ? 21.639  25.393 39.972 1.00 118.81 ? 314 GLU B CA    1 
ATOM   2185 C  C     . GLU D 3 99  ? 23.129  25.711 40.118 1.00 118.12 ? 314 GLU B C     1 
ATOM   2186 O  O     . GLU D 3 99  ? 23.652  26.631 39.467 1.00 118.37 ? 314 GLU B O     1 
ATOM   2187 C  CB    . GLU D 3 99  ? 20.785  26.238 40.941 1.00 119.60 ? 314 GLU B CB    1 
ATOM   2188 C  CG    . GLU D 3 99  ? 20.575  27.724 40.544 1.00 121.19 ? 314 GLU B CG    1 
ATOM   2189 C  CD    . GLU D 3 99  ? 19.978  27.942 39.128 1.00 122.58 ? 314 GLU B CD    1 
ATOM   2190 O  OE1   . GLU D 3 99  ? 19.208  28.922 38.956 1.00 124.11 ? 314 GLU B OE1   1 
ATOM   2191 O  OE2   . GLU D 3 99  ? 20.286  27.163 38.185 1.00 123.16 ? 314 GLU B OE2   1 
ATOM   2192 N  N     . ALA D 3 100 ? 23.802  24.915 40.959 1.00 117.21 ? 315 ALA B N     1 
ATOM   2193 C  CA    . ALA D 3 100 ? 25.242  25.040 41.201 1.00 116.16 ? 315 ALA B CA    1 
ATOM   2194 C  C     . ALA D 3 100 ? 26.010  24.601 39.943 1.00 115.65 ? 315 ALA B C     1 
ATOM   2195 O  O     . ALA D 3 100 ? 26.772  25.387 39.363 1.00 115.45 ? 315 ALA B O     1 
ATOM   2196 C  CB    . ALA D 3 100 ? 25.651  24.181 42.402 1.00 115.17 ? 315 ALA B CB    1 
ATOM   2197 N  N     . LEU D 3 101 ? 25.795  23.349 39.532 1.00 114.92 ? 316 LEU B N     1 
ATOM   2198 C  CA    . LEU D 3 101 ? 26.427  22.788 38.340 1.00 114.69 ? 316 LEU B CA    1 
ATOM   2199 C  C     . LEU D 3 101 ? 26.062  23.563 37.073 1.00 114.01 ? 316 LEU B C     1 
ATOM   2200 O  O     . LEU D 3 101 ? 26.844  23.630 36.126 1.00 113.83 ? 316 LEU B O     1 
ATOM   2201 C  CB    . LEU D 3 101 ? 26.000  21.340 38.164 1.00 115.30 ? 316 LEU B CB    1 
ATOM   2202 C  CG    . LEU D 3 101 ? 26.136  20.849 36.727 1.00 116.06 ? 316 LEU B CG    1 
ATOM   2203 C  CD1   . LEU D 3 101 ? 27.604  20.709 36.353 1.00 115.74 ? 316 LEU B CD1   1 
ATOM   2204 C  CD2   . LEU D 3 101 ? 25.398  19.535 36.595 1.00 117.06 ? 316 LEU B CD2   1 
ATOM   2205 N  N     . LYS D 3 102 ? 24.851  24.115 37.054 1.00 113.60 ? 317 LYS B N     1 
ATOM   2206 C  CA    . LYS D 3 102 ? 24.359  24.900 35.920 1.00 112.76 ? 317 LYS B CA    1 
ATOM   2207 C  C     . LYS D 3 102 ? 25.158  26.200 35.877 1.00 112.41 ? 317 LYS B C     1 
ATOM   2208 O  O     . LYS D 3 102 ? 25.367  26.777 34.806 1.00 112.41 ? 317 LYS B O     1 
ATOM   2209 C  CB    . LYS D 3 102 ? 22.848  25.202 36.086 1.00 112.12 ? 317 LYS B CB    1 
ATOM   2210 N  N     . ASP D 3 103 ? 25.600  26.649 37.054 1.00 112.02 ? 318 ASP B N     1 
ATOM   2211 C  CA    . ASP D 3 103 ? 26.391  27.869 37.181 1.00 111.73 ? 318 ASP B CA    1 
ATOM   2212 C  C     . ASP D 3 103 ? 27.783  27.656 36.554 1.00 111.68 ? 318 ASP B C     1 
ATOM   2213 O  O     . ASP D 3 103 ? 28.169  28.356 35.600 1.00 111.37 ? 318 ASP B O     1 
ATOM   2214 C  CB    . ASP D 3 103 ? 26.518  28.269 38.676 1.00 110.65 ? 318 ASP B CB    1 
ATOM   2215 N  N     . SER D 3 104 ? 28.514  26.670 37.078 1.00 111.81 ? 319 SER B N     1 
ATOM   2216 C  CA    . SER D 3 104 ? 29.867  26.345 36.613 1.00 112.08 ? 319 SER B CA    1 
ATOM   2217 C  C     . SER D 3 104 ? 30.081  26.338 35.085 1.00 112.03 ? 319 SER B C     1 
ATOM   2218 O  O     . SER D 3 104 ? 31.030  26.949 34.568 1.00 111.99 ? 319 SER B O     1 
ATOM   2219 C  CB    . SER D 3 104 ? 30.306  24.994 37.209 1.00 111.79 ? 319 SER B CB    1 
ATOM   2220 O  OG    . SER D 3 104 ? 29.432  23.940 36.849 1.00 112.88 ? 319 SER B OG    1 
ATOM   2221 N  N     . LEU D 3 105 ? 29.193  25.654 34.371 1.00 111.88 ? 320 LEU B N     1 
ATOM   2222 C  CA    . LEU D 3 105 ? 29.280  25.539 32.918 1.00 111.74 ? 320 LEU B CA    1 
ATOM   2223 C  C     . LEU D 3 105 ? 28.800  26.806 32.173 1.00 111.18 ? 320 LEU B C     1 
ATOM   2224 O  O     . LEU D 3 105 ? 28.295  26.714 31.040 1.00 110.52 ? 320 LEU B O     1 
ATOM   2225 C  CB    . LEU D 3 105 ? 28.477  24.302 32.480 1.00 112.49 ? 320 LEU B CB    1 
ATOM   2226 C  CG    . LEU D 3 105 ? 28.614  23.115 33.457 1.00 113.04 ? 320 LEU B CG    1 
ATOM   2227 C  CD1   . LEU D 3 105 ? 27.599  22.039 33.115 1.00 113.33 ? 320 LEU B CD1   1 
ATOM   2228 C  CD2   . LEU D 3 105 ? 30.036  22.568 33.427 1.00 113.63 ? 320 LEU B CD2   1 
ATOM   2229 N  N     . ARG D 3 106 ? 28.983  27.972 32.815 1.00 110.78 ? 321 ARG B N     1 
ATOM   2230 C  CA    . ARG D 3 106 ? 28.590  29.280 32.267 1.00 110.29 ? 321 ARG B CA    1 
ATOM   2231 C  C     . ARG D 3 106 ? 29.479  29.701 31.098 1.00 110.13 ? 321 ARG B C     1 
ATOM   2232 O  O     . ARG D 3 106 ? 29.066  29.649 29.931 1.00 110.00 ? 321 ARG B O     1 
ATOM   2233 C  CB    . ARG D 3 106 ? 28.641  30.345 33.362 1.00 109.28 ? 321 ARG B CB    1 
HETATM 2234 ZN ZN    . ZN  E 4 .   ? -7.136  24.034 32.532 1.00 58.04  ? 150 ZN  A ZN    1 
HETATM 2235 ZN ZN    . ZN  F 4 .   ? -6.587  13.167 42.733 1.00 57.85  ? 151 ZN  A ZN    1 
HETATM 2236 ZN ZN    . ZN  G 4 .   ? -9.581  31.387 63.096 1.00 68.58  ? 350 ZN  B ZN    1 
HETATM 2237 ZN ZN    . ZN  H 4 .   ? -17.222 22.428 73.220 1.00 80.50  ? 351 ZN  B ZN    1 
HETATM 2238 O  O     . HOH I 5 .   ? 4.626   39.594 35.522 1.00 64.12  ? 609 HOH C O     1 
HETATM 2239 O  O     . HOH I 5 .   ? -2.211  26.647 54.486 1.00 55.52  ? 614 HOH C O     1 
HETATM 2240 O  O     . HOH I 5 .   ? 0.378   31.015 54.331 1.00 55.52  ? 634 HOH C O     1 
HETATM 2241 O  O     . HOH J 5 .   ? 8.623   30.811 39.222 1.00 65.16  ? 602 HOH D O     1 
HETATM 2242 O  O     . HOH J 5 .   ? 7.800   41.091 20.141 1.00 62.97  ? 605 HOH D O     1 
HETATM 2243 O  O     . HOH J 5 .   ? 2.553   26.048 37.362 1.00 58.75  ? 607 HOH D O     1 
HETATM 2244 O  O     . HOH J 5 .   ? -8.647  31.824 34.516 1.00 91.81  ? 612 HOH D O     1 
HETATM 2245 O  O     . HOH J 5 .   ? -5.513  29.528 33.932 1.00 53.48  ? 613 HOH D O     1 
HETATM 2246 O  O     . HOH J 5 .   ? -0.827  33.095 25.540 1.00 66.50  ? 623 HOH D O     1 
HETATM 2247 O  O     . HOH J 5 .   ? 9.404   32.287 42.641 1.00 61.35  ? 626 HOH D O     1 
HETATM 2248 O  O     . HOH J 5 .   ? 5.082   28.493 14.979 1.00 79.33  ? 629 HOH D O     1 
HETATM 2249 O  O     . HOH J 5 .   ? -4.994  23.830 71.225 1.00 78.17  ? 630 HOH D O     1 
HETATM 2250 O  O     . HOH J 5 .   ? 1.750   26.387 46.248 1.00 75.82  ? 633 HOH D O     1 
HETATM 2251 O  O     . HOH K 5 .   ? -11.835 15.545 35.606 1.00 59.51  ? 601 HOH A O     1 
HETATM 2252 O  O     . HOH K 5 .   ? -1.686  15.298 43.699 1.00 50.30  ? 603 HOH A O     1 
HETATM 2253 O  O     . HOH K 5 .   ? -7.611  11.572 33.805 1.00 71.58  ? 604 HOH A O     1 
HETATM 2254 O  O     . HOH K 5 .   ? 3.885   29.441 29.767 1.00 58.75  ? 606 HOH A O     1 
HETATM 2255 O  O     . HOH K 5 .   ? -15.201 28.413 22.329 1.00 61.03  ? 608 HOH A O     1 
HETATM 2256 O  O     . HOH K 5 .   ? 2.093   26.381 24.501 1.00 61.22  ? 610 HOH A O     1 
HETATM 2257 O  O     . HOH K 5 .   ? -6.417  30.560 30.736 1.00 61.22  ? 611 HOH A O     1 
HETATM 2258 O  O     . HOH K 5 .   ? -0.859  12.242 26.195 1.00 64.76  ? 616 HOH A O     1 
HETATM 2259 O  O     . HOH K 5 .   ? -1.837  8.596  43.046 1.00 56.36  ? 617 HOH A O     1 
HETATM 2260 O  O     . HOH K 5 .   ? 16.102  19.894 28.922 1.00 64.41  ? 619 HOH A O     1 
HETATM 2261 O  O     . HOH K 5 .   ? 7.399   14.059 36.295 1.00 66.26  ? 621 HOH A O     1 
HETATM 2262 O  O     . HOH K 5 .   ? 1.009   30.374 24.304 1.00 66.50  ? 622 HOH A O     1 
HETATM 2263 O  O     . HOH K 5 .   ? 0.040   22.355 20.577 1.00 71.38  ? 625 HOH A O     1 
HETATM 2264 O  O     . HOH K 5 .   ? -1.197  17.754 45.085 1.00 58.89  ? 628 HOH A O     1 
HETATM 2265 O  O     . HOH K 5 .   ? -6.920  12.020 36.628 1.00 68.86  ? 631 HOH A O     1 
HETATM 2266 O  O     . HOH L 5 .   ? -6.117  36.292 66.806 1.00 60.35  ? 615 HOH B O     1 
HETATM 2267 O  O     . HOH L 5 .   ? 1.797   27.494 59.622 1.00 69.20  ? 618 HOH B O     1 
HETATM 2268 O  O     . HOH L 5 .   ? -13.963 26.856 73.308 1.00 66.07  ? 620 HOH B O     1 
HETATM 2269 O  O     . HOH L 5 .   ? -10.271 12.890 65.880 1.00 79.82  ? 624 HOH B O     1 
HETATM 2270 O  O     . HOH L 5 .   ? -10.219 38.561 57.067 1.00 98.03  ? 627 HOH B O     1 
HETATM 2271 O  O     . HOH L 5 .   ? -9.312  26.802 47.503 1.00 69.82  ? 632 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DC  1   401 401 DC  C   C . n 
A 1 2   DA  2   402 402 DA  A   C . n 
A 1 3   DC  3   403 403 DC  C   C . n 
A 1 4   DG  4   404 404 DG  G   C . n 
A 1 5   DG  5   405 405 DG  G   C . n 
A 1 6   DG  6   406 406 DG  G   C . n 
A 1 7   DT  7   407 407 DT  T   C . n 
A 1 8   DG  8   408 408 DG  G   C . n 
A 1 9   DA  9   409 409 DA  A   C . n 
A 1 10  DA  10  410 410 DA  A   C . n 
A 1 11  DT  11  411 411 DT  T   C . n 
A 1 12  DG  12  412 412 DG  G   C . n 
A 1 13  DA  13  413 413 DA  A   C . n 
A 1 14  DG  14  414 414 DG  G   C . n 
A 1 15  DG  15  415 415 DG  G   C . n 
A 1 16  DA  16  416 416 DA  A   C . n 
A 1 17  DC  17  417 417 DC  C   C . n 
A 1 18  DA  18  418 418 DA  A   C . n 
B 2 1   DT  1   419 419 DT  T   D . n 
B 2 2   DG  2   420 420 DG  G   D . n 
B 2 3   DT  3   421 421 DT  T   D . n 
B 2 4   DC  4   422 422 DC  C   D . n 
B 2 5   DC  5   423 423 DC  C   D . n 
B 2 6   DT  6   424 424 DT  T   D . n 
B 2 7   DC  7   425 425 DC  C   D . n 
B 2 8   DA  8   426 426 DA  A   D . n 
B 2 9   DT  9   427 427 DT  T   D . n 
B 2 10  DT  10  428 428 DT  T   D . n 
B 2 11  DC  11  429 429 DC  C   D . n 
B 2 12  DA  12  430 430 DA  A   D . n 
B 2 13  DC  13  431 431 DC  C   D . n 
B 2 14  DC  14  432 432 DC  C   D . n 
B 2 15  DC  15  433 433 DC  C   D . n 
B 2 16  DG  16  434 434 DG  G   D . n 
B 2 17  DT  17  435 435 DT  T   D . n 
B 2 18  DG  18  436 436 DG  G   D . n 
C 3 1   PHE 1   16  ?   ?   ?   A . n 
C 3 2   ASP 2   17  ?   ?   ?   A . n 
C 3 3   ARG 3   18  ?   ?   ?   A . n 
C 3 4   ASN 4   19  ?   ?   ?   A . n 
C 3 5   VAL 5   20  ?   ?   ?   A . n 
C 3 6   PRO 6   21  21  PRO PRO A . n 
C 3 7   ARG 7   22  22  ARG ARG A . n 
C 3 8   ILE 8   23  23  ILE ILE A . n 
C 3 9   CYS 9   24  24  CYS CYS A . n 
C 3 10  GLY 10  25  25  GLY GLY A . n 
C 3 11  VAL 11  26  26  VAL VAL A . n 
C 3 12  CYS 12  27  27  CYS CYS A . n 
C 3 13  GLY 13  28  28  GLY GLY A . n 
C 3 14  ASP 14  29  29  ASP ASP A . n 
C 3 15  ARG 15  30  30  ARG ARG A . n 
C 3 16  ALA 16  31  31  ALA ALA A . n 
C 3 17  THR 17  32  32  THR THR A . n 
C 3 18  GLY 18  33  33  GLY GLY A . n 
C 3 19  PHE 19  34  34  PHE PHE A . n 
C 3 20  HIS 20  35  35  HIS HIS A . n 
C 3 21  PHE 21  36  36  PHE PHE A . n 
C 3 22  ASN 22  37  37  ASN ASN A . n 
C 3 23  ALA 23  38  38  ALA ALA A . n 
C 3 24  MET 24  39  39  MET MET A . n 
C 3 25  THR 25  40  40  THR THR A . n 
C 3 26  CYS 26  41  41  CYS CYS A . n 
C 3 27  GLU 27  42  42  GLU GLU A . n 
C 3 28  GLY 28  43  43  GLY GLY A . n 
C 3 29  CYS 29  44  44  CYS CYS A . n 
C 3 30  LYS 30  45  45  LYS LYS A . n 
C 3 31  GLY 31  46  46  GLY GLY A . n 
C 3 32  PHE 32  47  47  PHE PHE A . n 
C 3 33  PHE 33  48  48  PHE PHE A . n 
C 3 34  ARG 34  49  49  ARG ARG A . n 
C 3 35  ARG 35  50  50  ARG ARG A . n 
C 3 36  SER 36  51  51  SER SER A . n 
C 3 37  MET 37  52  52  MET MET A . n 
C 3 38  LYS 38  53  53  LYS LYS A . n 
C 3 39  ARG 39  54  54  ARG ARG A . n 
C 3 40  LYS 40  55  55  LYS LYS A . n 
C 3 41  ALA 41  56  56  ALA ALA A . n 
C 3 42  LEU 42  57  57  LEU LEU A . n 
C 3 43  PHE 43  58  58  PHE PHE A . n 
C 3 44  THR 44  59  59  THR THR A . n 
C 3 45  CYS 45  60  60  CYS CYS A . n 
C 3 46  PRO 46  61  61  PRO PRO A . n 
C 3 47  PHE 47  62  62  PHE PHE A . n 
C 3 48  ASN 48  63  63  ASN ASN A . n 
C 3 49  GLY 49  64  64  GLY GLY A . n 
C 3 50  ASP 50  65  65  ASP ASP A . n 
C 3 51  CYS 51  66  66  CYS CYS A . n 
C 3 52  ARG 52  67  67  ARG ARG A . n 
C 3 53  ILE 53  68  68  ILE ILE A . n 
C 3 54  THR 54  69  69  THR THR A . n 
C 3 55  LYS 55  70  70  LYS LYS A . n 
C 3 56  ASP 56  71  71  ASP ASP A . n 
C 3 57  ASN 57  72  72  ASN ASN A . n 
C 3 58  ARG 58  73  73  ARG ARG A . n 
C 3 59  ARG 59  74  74  ARG ARG A . n 
C 3 60  HIS 60  75  75  HIS HIS A . n 
C 3 61  CYS 61  76  76  CYS CYS A . n 
C 3 62  GLN 62  77  77  GLN GLN A . n 
C 3 63  ALA 63  78  78  ALA ALA A . n 
C 3 64  CYS 64  79  79  CYS CYS A . n 
C 3 65  ARG 65  80  80  ARG ARG A . n 
C 3 66  LEU 66  81  81  LEU LEU A . n 
C 3 67  LYS 67  82  82  LYS LYS A . n 
C 3 68  ARG 68  83  83  ARG ARG A . n 
C 3 69  CYS 69  84  84  CYS CYS A . n 
C 3 70  VAL 70  85  85  VAL VAL A . n 
C 3 71  ASP 71  86  86  ASP ASP A . n 
C 3 72  ILE 72  87  87  ILE ILE A . n 
C 3 73  GLY 73  88  88  GLY GLY A . n 
C 3 74  MET 74  89  89  MET MET A . n 
C 3 75  MET 75  90  90  MET MET A . n 
C 3 76  LYS 76  91  91  LYS LYS A . n 
C 3 77  GLU 77  92  92  GLU GLU A . n 
C 3 78  PHE 78  93  93  PHE PHE A . n 
C 3 79  ILE 79  94  94  ILE ILE A . n 
C 3 80  LEU 80  95  95  LEU LEU A . n 
C 3 81  THR 81  96  96  THR THR A . n 
C 3 82  ASP 82  97  97  ASP ASP A . n 
C 3 83  GLU 83  98  98  GLU GLU A . n 
C 3 84  GLU 84  99  99  GLU GLU A . n 
C 3 85  VAL 85  100 100 VAL VAL A . n 
C 3 86  GLN 86  101 101 GLN GLN A . n 
C 3 87  ARG 87  102 102 ARG ARG A . n 
C 3 88  LYS 88  103 103 LYS LYS A . n 
C 3 89  ARG 89  104 104 ARG ARG A . n 
C 3 90  GLU 90  105 105 GLU GLU A . n 
C 3 91  MET 91  106 106 MET MET A . n 
C 3 92  ILE 92  107 107 ILE ILE A . n 
C 3 93  LEU 93  108 108 LEU LEU A . n 
C 3 94  LYS 94  109 109 LYS LYS A . n 
C 3 95  ARG 95  110 110 ARG ARG A . n 
C 3 96  LYS 96  111 111 LYS LYS A . n 
C 3 97  GLU 97  112 112 GLU GLU A . n 
C 3 98  GLU 98  113 113 GLU GLU A . n 
C 3 99  GLU 99  114 114 GLU GLU A . n 
C 3 100 ALA 100 115 ?   ?   ?   A . n 
C 3 101 LEU 101 116 ?   ?   ?   A . n 
C 3 102 LYS 102 117 ?   ?   ?   A . n 
C 3 103 ASP 103 118 ?   ?   ?   A . n 
C 3 104 SER 104 119 ?   ?   ?   A . n 
C 3 105 LEU 105 120 ?   ?   ?   A . n 
C 3 106 ARG 106 121 ?   ?   ?   A . n 
C 3 107 PRO 107 122 ?   ?   ?   A . n 
C 3 108 LYS 108 123 ?   ?   ?   A . n 
C 3 109 LEU 109 124 ?   ?   ?   A . n 
C 3 110 SER 110 125 ?   ?   ?   A . n 
D 3 1   PHE 1   216 ?   ?   ?   B . n 
D 3 2   ASP 2   217 ?   ?   ?   B . n 
D 3 3   ARG 3   218 ?   ?   ?   B . n 
D 3 4   ASN 4   219 ?   ?   ?   B . n 
D 3 5   VAL 5   220 ?   ?   ?   B . n 
D 3 6   PRO 6   221 221 PRO PRO B . n 
D 3 7   ARG 7   222 222 ARG ARG B . n 
D 3 8   ILE 8   223 223 ILE ILE B . n 
D 3 9   CYS 9   224 224 CYS CYS B . n 
D 3 10  GLY 10  225 225 GLY GLY B . n 
D 3 11  VAL 11  226 226 VAL VAL B . n 
D 3 12  CYS 12  227 227 CYS CYS B . n 
D 3 13  GLY 13  228 228 GLY GLY B . n 
D 3 14  ASP 14  229 229 ASP ASP B . n 
D 3 15  ARG 15  230 230 ARG ARG B . n 
D 3 16  ALA 16  231 231 ALA ALA B . n 
D 3 17  THR 17  232 232 THR THR B . n 
D 3 18  GLY 18  233 233 GLY GLY B . n 
D 3 19  PHE 19  234 234 PHE PHE B . n 
D 3 20  HIS 20  235 235 HIS HIS B . n 
D 3 21  PHE 21  236 236 PHE PHE B . n 
D 3 22  ASN 22  237 237 ASN ASN B . n 
D 3 23  ALA 23  238 238 ALA ALA B . n 
D 3 24  MET 24  239 239 MET MET B . n 
D 3 25  THR 25  240 240 THR THR B . n 
D 3 26  CYS 26  241 241 CYS CYS B . n 
D 3 27  GLU 27  242 242 GLU GLU B . n 
D 3 28  GLY 28  243 243 GLY GLY B . n 
D 3 29  CYS 29  244 244 CYS CYS B . n 
D 3 30  LYS 30  245 245 LYS LYS B . n 
D 3 31  GLY 31  246 246 GLY GLY B . n 
D 3 32  PHE 32  247 247 PHE PHE B . n 
D 3 33  PHE 33  248 248 PHE PHE B . n 
D 3 34  ARG 34  249 249 ARG ARG B . n 
D 3 35  ARG 35  250 250 ARG ARG B . n 
D 3 36  SER 36  251 251 SER SER B . n 
D 3 37  MET 37  252 252 MET MET B . n 
D 3 38  LYS 38  253 253 LYS LYS B . n 
D 3 39  ARG 39  254 254 ARG ARG B . n 
D 3 40  LYS 40  255 255 LYS LYS B . n 
D 3 41  ALA 41  256 256 ALA ALA B . n 
D 3 42  LEU 42  257 257 LEU LEU B . n 
D 3 43  PHE 43  258 258 PHE PHE B . n 
D 3 44  THR 44  259 259 THR THR B . n 
D 3 45  CYS 45  260 260 CYS CYS B . n 
D 3 46  PRO 46  261 261 PRO PRO B . n 
D 3 47  PHE 47  262 262 PHE PHE B . n 
D 3 48  ASN 48  263 263 ASN ASN B . n 
D 3 49  GLY 49  264 264 GLY GLY B . n 
D 3 50  ASP 50  265 265 ASP ASP B . n 
D 3 51  CYS 51  266 266 CYS CYS B . n 
D 3 52  ARG 52  267 267 ARG ARG B . n 
D 3 53  ILE 53  268 268 ILE ILE B . n 
D 3 54  THR 54  269 269 THR THR B . n 
D 3 55  LYS 55  270 270 LYS LYS B . n 
D 3 56  ASP 56  271 271 ASP ASP B . n 
D 3 57  ASN 57  272 272 ASN ASN B . n 
D 3 58  ARG 58  273 273 ARG ARG B . n 
D 3 59  ARG 59  274 274 ARG ARG B . n 
D 3 60  HIS 60  275 275 HIS HIS B . n 
D 3 61  CYS 61  276 276 CYS CYS B . n 
D 3 62  GLN 62  277 277 GLN GLN B . n 
D 3 63  ALA 63  278 278 ALA ALA B . n 
D 3 64  CYS 64  279 279 CYS CYS B . n 
D 3 65  ARG 65  280 280 ARG ARG B . n 
D 3 66  LEU 66  281 281 LEU LEU B . n 
D 3 67  LYS 67  282 282 LYS LYS B . n 
D 3 68  ARG 68  283 283 ARG ARG B . n 
D 3 69  CYS 69  284 284 CYS CYS B . n 
D 3 70  VAL 70  285 285 VAL VAL B . n 
D 3 71  ASP 71  286 286 ASP ASP B . n 
D 3 72  ILE 72  287 287 ILE ILE B . n 
D 3 73  GLY 73  288 288 GLY GLY B . n 
D 3 74  MET 74  289 289 MET MET B . n 
D 3 75  MET 75  290 290 MET MET B . n 
D 3 76  LYS 76  291 291 LYS LYS B . n 
D 3 77  GLU 77  292 292 GLU GLU B . n 
D 3 78  PHE 78  293 293 PHE PHE B . n 
D 3 79  ILE 79  294 294 ILE ILE B . n 
D 3 80  LEU 80  295 295 LEU LEU B . n 
D 3 81  THR 81  296 296 THR THR B . n 
D 3 82  ASP 82  297 297 ASP ASP B . n 
D 3 83  GLU 83  298 298 GLU GLU B . n 
D 3 84  GLU 84  299 299 GLU GLU B . n 
D 3 85  VAL 85  300 300 VAL VAL B . n 
D 3 86  GLN 86  301 301 GLN GLN B . n 
D 3 87  ARG 87  302 302 ARG ARG B . n 
D 3 88  LYS 88  303 303 LYS LYS B . n 
D 3 89  ARG 89  304 304 ARG ARG B . n 
D 3 90  GLU 90  305 305 GLU GLU B . n 
D 3 91  MET 91  306 306 MET MET B . n 
D 3 92  ILE 92  307 307 ILE ILE B . n 
D 3 93  LEU 93  308 308 LEU LEU B . n 
D 3 94  LYS 94  309 309 LYS LYS B . n 
D 3 95  ARG 95  310 310 ARG ARG B . n 
D 3 96  LYS 96  311 311 LYS LYS B . n 
D 3 97  GLU 97  312 312 GLU GLU B . n 
D 3 98  GLU 98  313 313 GLU GLU B . n 
D 3 99  GLU 99  314 314 GLU GLU B . n 
D 3 100 ALA 100 315 315 ALA ALA B . n 
D 3 101 LEU 101 316 316 LEU LEU B . n 
D 3 102 LYS 102 317 317 LYS LYS B . n 
D 3 103 ASP 103 318 318 ASP ASP B . n 
D 3 104 SER 104 319 319 SER SER B . n 
D 3 105 LEU 105 320 320 LEU LEU B . n 
D 3 106 ARG 106 321 321 ARG ARG B . n 
D 3 107 PRO 107 322 ?   ?   ?   B . n 
D 3 108 LYS 108 323 ?   ?   ?   B . n 
D 3 109 LEU 109 324 ?   ?   ?   B . n 
D 3 110 SER 110 325 ?   ?   ?   B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  SG ? C CYS 9  ? A CYS 24  ? 1_555 ZN ? E ZN . ? A ZN 150 ? 1_555 SG ? C CYS 12 ? A CYS 27  ? 1_555 111.6 ? 
2  SG ? C CYS 9  ? A CYS 24  ? 1_555 ZN ? E ZN . ? A ZN 150 ? 1_555 SG ? C CYS 29 ? A CYS 44  ? 1_555 111.9 ? 
3  SG ? C CYS 12 ? A CYS 27  ? 1_555 ZN ? E ZN . ? A ZN 150 ? 1_555 SG ? C CYS 29 ? A CYS 44  ? 1_555 110.8 ? 
4  SG ? C CYS 9  ? A CYS 24  ? 1_555 ZN ? E ZN . ? A ZN 150 ? 1_555 SG ? C CYS 26 ? A CYS 41  ? 1_555 122.1 ? 
5  SG ? C CYS 12 ? A CYS 27  ? 1_555 ZN ? E ZN . ? A ZN 150 ? 1_555 SG ? C CYS 26 ? A CYS 41  ? 1_555 104.5 ? 
6  SG ? C CYS 29 ? A CYS 44  ? 1_555 ZN ? E ZN . ? A ZN 150 ? 1_555 SG ? C CYS 26 ? A CYS 41  ? 1_555 94.7  ? 
7  SG ? C CYS 45 ? A CYS 60  ? 1_555 ZN ? F ZN . ? A ZN 151 ? 1_555 SG ? C CYS 64 ? A CYS 79  ? 1_555 114.3 ? 
8  SG ? C CYS 45 ? A CYS 60  ? 1_555 ZN ? F ZN . ? A ZN 151 ? 1_555 SG ? C CYS 51 ? A CYS 66  ? 1_555 109.2 ? 
9  SG ? C CYS 64 ? A CYS 79  ? 1_555 ZN ? F ZN . ? A ZN 151 ? 1_555 SG ? C CYS 51 ? A CYS 66  ? 1_555 109.1 ? 
10 SG ? C CYS 45 ? A CYS 60  ? 1_555 ZN ? F ZN . ? A ZN 151 ? 1_555 SG ? C CYS 61 ? A CYS 76  ? 1_555 107.4 ? 
11 SG ? C CYS 64 ? A CYS 79  ? 1_555 ZN ? F ZN . ? A ZN 151 ? 1_555 SG ? C CYS 61 ? A CYS 76  ? 1_555 109.0 ? 
12 SG ? C CYS 51 ? A CYS 66  ? 1_555 ZN ? F ZN . ? A ZN 151 ? 1_555 SG ? C CYS 61 ? A CYS 76  ? 1_555 107.7 ? 
13 SG ? D CYS 12 ? B CYS 227 ? 1_555 ZN ? G ZN . ? B ZN 350 ? 1_555 SG ? D CYS 29 ? B CYS 244 ? 1_555 119.6 ? 
14 SG ? D CYS 12 ? B CYS 227 ? 1_555 ZN ? G ZN . ? B ZN 350 ? 1_555 SG ? D CYS 26 ? B CYS 241 ? 1_555 105.6 ? 
15 SG ? D CYS 29 ? B CYS 244 ? 1_555 ZN ? G ZN . ? B ZN 350 ? 1_555 SG ? D CYS 26 ? B CYS 241 ? 1_555 93.0  ? 
16 SG ? D CYS 12 ? B CYS 227 ? 1_555 ZN ? G ZN . ? B ZN 350 ? 1_555 SG ? D CYS 9  ? B CYS 224 ? 1_555 106.5 ? 
17 SG ? D CYS 29 ? B CYS 244 ? 1_555 ZN ? G ZN . ? B ZN 350 ? 1_555 SG ? D CYS 9  ? B CYS 224 ? 1_555 109.7 ? 
18 SG ? D CYS 26 ? B CYS 241 ? 1_555 ZN ? G ZN . ? B ZN 350 ? 1_555 SG ? D CYS 9  ? B CYS 224 ? 1_555 123.0 ? 
19 SG ? D CYS 51 ? B CYS 266 ? 1_555 ZN ? H ZN . ? B ZN 351 ? 1_555 SG ? D CYS 64 ? B CYS 279 ? 1_555 100.7 ? 
20 SG ? D CYS 51 ? B CYS 266 ? 1_555 ZN ? H ZN . ? B ZN 351 ? 1_555 SG ? D CYS 61 ? B CYS 276 ? 1_555 112.8 ? 
21 SG ? D CYS 64 ? B CYS 279 ? 1_555 ZN ? H ZN . ? B ZN 351 ? 1_555 SG ? D CYS 61 ? B CYS 276 ? 1_555 98.7  ? 
22 SG ? D CYS 51 ? B CYS 266 ? 1_555 ZN ? H ZN . ? B ZN 351 ? 1_555 SG ? D CYS 45 ? B CYS 260 ? 1_555 123.6 ? 
23 SG ? D CYS 64 ? B CYS 279 ? 1_555 ZN ? H ZN . ? B ZN 351 ? 1_555 SG ? D CYS 45 ? B CYS 260 ? 1_555 109.9 ? 
24 SG ? D CYS 61 ? B CYS 276 ? 1_555 ZN ? H ZN . ? B ZN 351 ? 1_555 SG ? D CYS 45 ? B CYS 260 ? 1_555 108.0 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-05-03 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS      refinement       . ? 1 
HKL-2000 'data reduction' . ? 2 
HKL-2000 'data scaling'   . ? 3 
CNS      phasing          . ? 4 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   OP2 
_pdbx_validate_close_contact.auth_asym_id_1   D 
_pdbx_validate_close_contact.auth_comp_id_1   DT 
_pdbx_validate_close_contact.auth_seq_id_1    427 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   NH2 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   ARG 
_pdbx_validate_close_contact.auth_seq_id_2    50 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.19 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    OD1 
_pdbx_validate_symm_contact.auth_asym_id_1    B 
_pdbx_validate_symm_contact.auth_comp_id_1    ASP 
_pdbx_validate_symm_contact.auth_seq_id_1     286 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    OD1 
_pdbx_validate_symm_contact.auth_asym_id_2    B 
_pdbx_validate_symm_contact.auth_comp_id_2    ASP 
_pdbx_validate_symm_contact.auth_seq_id_2     286 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   8_555 
_pdbx_validate_symm_contact.dist              2.03 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            "O3'" 
_pdbx_validate_rmsd_bond.auth_asym_id_1            C 
_pdbx_validate_rmsd_bond.auth_comp_id_1            DG 
_pdbx_validate_rmsd_bond.auth_seq_id_1             404 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            "C3'" 
_pdbx_validate_rmsd_bond.auth_asym_id_2            C 
_pdbx_validate_rmsd_bond.auth_comp_id_2            DG 
_pdbx_validate_rmsd_bond.auth_seq_id_2             404 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.376 
_pdbx_validate_rmsd_bond.bond_target_value         1.419 
_pdbx_validate_rmsd_bond.bond_deviation            -0.043 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.006 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O4'" D DC  432 ? ? "C1'" D DC  432 ? ? N1 D DC  432 ? ? 110.73 108.30 2.43 0.30 N 
2 1 CA    A CYS 41  ? ? CB    A CYS 41  ? ? SG A CYS 41  ? ? 120.98 114.20 6.78 1.10 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ARG A 22  ? ? -54.95  41.49   
2  1 ASP A 29  ? ? -60.58  -179.61 
3  1 ASN A 37  ? ? 88.26   20.57   
4  1 MET A 39  ? ? -58.75  104.78  
5  1 LYS A 53  ? ? -62.78  -78.44  
6  1 ARG A 54  ? ? -51.51  19.15   
7  1 LYS A 55  ? ? 29.00   64.70   
8  1 PHE A 62  ? ? -128.50 -106.18 
9  1 ASP A 65  ? ? -162.01 42.98   
10 1 GLU A 105 ? ? -75.03  32.23   
11 1 MET A 106 ? ? -154.88 -23.35  
12 1 GLU A 112 ? ? -146.96 15.25   
13 1 ARG B 222 ? ? 68.83   -175.02 
14 1 ILE B 223 ? ? 67.10   111.33  
15 1 ASP B 229 ? ? -60.57  -171.28 
16 1 ASN B 237 ? ? 89.33   12.82   
17 1 LYS B 255 ? ? 85.28   -7.71   
18 1 ALA B 256 ? ? -19.51  118.99  
19 1 PHE B 262 ? ? -124.25 -112.76 
20 1 LYS B 270 ? ? -50.15  -4.99   
21 1 ASP B 271 ? ? -112.15 -77.90  
22 1 ARG B 273 ? ? -27.45  -68.37  
23 1 LEU B 320 ? ? -77.51  30.67   
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 DA C 413 ? ? 0.055 'SIDE CHAIN' 
2 1 DC D 423 ? ? 0.061 'SIDE CHAIN' 
3 1 DT D 428 ? ? 0.065 'SIDE CHAIN' 
4 1 DC D 429 ? ? 0.076 'SIDE CHAIN' 
5 1 DA D 430 ? ? 0.061 'SIDE CHAIN' 
6 1 DC D 432 ? ? 0.066 'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 109 ? CG  ? C LYS 94  CG  
2  1 Y 1 A LYS 109 ? CD  ? C LYS 94  CD  
3  1 Y 1 A LYS 109 ? CE  ? C LYS 94  CE  
4  1 Y 1 A LYS 109 ? NZ  ? C LYS 94  NZ  
5  1 Y 1 A ARG 110 ? CG  ? C ARG 95  CG  
6  1 Y 1 A ARG 110 ? CD  ? C ARG 95  CD  
7  1 Y 1 A ARG 110 ? NE  ? C ARG 95  NE  
8  1 Y 1 A ARG 110 ? CZ  ? C ARG 95  CZ  
9  1 Y 1 A ARG 110 ? NH1 ? C ARG 95  NH1 
10 1 Y 1 A ARG 110 ? NH2 ? C ARG 95  NH2 
11 1 Y 1 A LYS 111 ? CG  ? C LYS 96  CG  
12 1 Y 1 A LYS 111 ? CD  ? C LYS 96  CD  
13 1 Y 1 A LYS 111 ? CE  ? C LYS 96  CE  
14 1 Y 1 A LYS 111 ? NZ  ? C LYS 96  NZ  
15 1 Y 1 A GLU 112 ? CG  ? C GLU 97  CG  
16 1 Y 1 A GLU 112 ? CD  ? C GLU 97  CD  
17 1 Y 1 A GLU 112 ? OE1 ? C GLU 97  OE1 
18 1 Y 1 A GLU 112 ? OE2 ? C GLU 97  OE2 
19 1 Y 1 A GLU 113 ? CG  ? C GLU 98  CG  
20 1 Y 1 A GLU 113 ? CD  ? C GLU 98  CD  
21 1 Y 1 A GLU 113 ? OE1 ? C GLU 98  OE1 
22 1 Y 1 A GLU 113 ? OE2 ? C GLU 98  OE2 
23 1 Y 1 A GLU 114 ? CG  ? C GLU 99  CG  
24 1 Y 1 A GLU 114 ? CD  ? C GLU 99  CD  
25 1 Y 1 A GLU 114 ? OE1 ? C GLU 99  OE1 
26 1 Y 1 A GLU 114 ? OE2 ? C GLU 99  OE2 
27 1 Y 1 B ARG 230 ? CG  ? D ARG 15  CG  
28 1 Y 1 B ARG 230 ? CD  ? D ARG 15  CD  
29 1 Y 1 B ARG 230 ? NE  ? D ARG 15  NE  
30 1 Y 1 B ARG 230 ? CZ  ? D ARG 15  CZ  
31 1 Y 1 B ARG 230 ? NH1 ? D ARG 15  NH1 
32 1 Y 1 B ARG 230 ? NH2 ? D ARG 15  NH2 
33 1 Y 1 B ARG 267 ? CG  ? D ARG 52  CG  
34 1 Y 1 B ARG 267 ? CD  ? D ARG 52  CD  
35 1 Y 1 B ARG 267 ? NE  ? D ARG 52  NE  
36 1 Y 1 B ARG 267 ? CZ  ? D ARG 52  CZ  
37 1 Y 1 B ARG 267 ? NH1 ? D ARG 52  NH1 
38 1 Y 1 B ARG 267 ? NH2 ? D ARG 52  NH2 
39 1 Y 1 B ARG 302 ? CG  ? D ARG 87  CG  
40 1 Y 1 B ARG 302 ? CD  ? D ARG 87  CD  
41 1 Y 1 B ARG 302 ? NE  ? D ARG 87  NE  
42 1 Y 1 B ARG 302 ? CZ  ? D ARG 87  CZ  
43 1 Y 1 B ARG 302 ? NH1 ? D ARG 87  NH1 
44 1 Y 1 B ARG 302 ? NH2 ? D ARG 87  NH2 
45 1 Y 1 B LYS 303 ? CG  ? D LYS 88  CG  
46 1 Y 1 B LYS 303 ? CD  ? D LYS 88  CD  
47 1 Y 1 B LYS 303 ? CE  ? D LYS 88  CE  
48 1 Y 1 B LYS 303 ? NZ  ? D LYS 88  NZ  
49 1 Y 1 B ARG 304 ? CG  ? D ARG 89  CG  
50 1 Y 1 B ARG 304 ? CD  ? D ARG 89  CD  
51 1 Y 1 B ARG 304 ? NE  ? D ARG 89  NE  
52 1 Y 1 B ARG 304 ? CZ  ? D ARG 89  CZ  
53 1 Y 1 B ARG 304 ? NH1 ? D ARG 89  NH1 
54 1 Y 1 B ARG 304 ? NH2 ? D ARG 89  NH2 
55 1 Y 1 B GLU 305 ? CG  ? D GLU 90  CG  
56 1 Y 1 B GLU 305 ? CD  ? D GLU 90  CD  
57 1 Y 1 B GLU 305 ? OE1 ? D GLU 90  OE1 
58 1 Y 1 B GLU 305 ? OE2 ? D GLU 90  OE2 
59 1 Y 1 B MET 306 ? CG  ? D MET 91  CG  
60 1 Y 1 B MET 306 ? SD  ? D MET 91  SD  
61 1 Y 1 B MET 306 ? CE  ? D MET 91  CE  
62 1 Y 1 B LYS 309 ? CG  ? D LYS 94  CG  
63 1 Y 1 B LYS 309 ? CD  ? D LYS 94  CD  
64 1 Y 1 B LYS 309 ? CE  ? D LYS 94  CE  
65 1 Y 1 B LYS 309 ? NZ  ? D LYS 94  NZ  
66 1 Y 1 B ARG 310 ? CG  ? D ARG 95  CG  
67 1 Y 1 B ARG 310 ? CD  ? D ARG 95  CD  
68 1 Y 1 B ARG 310 ? NE  ? D ARG 95  NE  
69 1 Y 1 B ARG 310 ? CZ  ? D ARG 95  CZ  
70 1 Y 1 B ARG 310 ? NH1 ? D ARG 95  NH1 
71 1 Y 1 B ARG 310 ? NH2 ? D ARG 95  NH2 
72 1 Y 1 B LYS 317 ? CG  ? D LYS 102 CG  
73 1 Y 1 B LYS 317 ? CD  ? D LYS 102 CD  
74 1 Y 1 B LYS 317 ? CE  ? D LYS 102 CE  
75 1 Y 1 B LYS 317 ? NZ  ? D LYS 102 NZ  
76 1 Y 1 B ASP 318 ? CG  ? D ASP 103 CG  
77 1 Y 1 B ASP 318 ? OD1 ? D ASP 103 OD1 
78 1 Y 1 B ASP 318 ? OD2 ? D ASP 103 OD2 
79 1 Y 1 B ARG 321 ? CG  ? D ARG 106 CG  
80 1 Y 1 B ARG 321 ? CD  ? D ARG 106 CD  
81 1 Y 1 B ARG 321 ? NE  ? D ARG 106 NE  
82 1 Y 1 B ARG 321 ? CZ  ? D ARG 106 CZ  
83 1 Y 1 B ARG 321 ? NH1 ? D ARG 106 NH1 
84 1 Y 1 B ARG 321 ? NH2 ? D ARG 106 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A PHE 16  ? C PHE 1   
2  1 Y 1 A ASP 17  ? C ASP 2   
3  1 Y 1 A ARG 18  ? C ARG 3   
4  1 Y 1 A ASN 19  ? C ASN 4   
5  1 Y 1 A VAL 20  ? C VAL 5   
6  1 Y 1 A ALA 115 ? C ALA 100 
7  1 Y 1 A LEU 116 ? C LEU 101 
8  1 Y 1 A LYS 117 ? C LYS 102 
9  1 Y 1 A ASP 118 ? C ASP 103 
10 1 Y 1 A SER 119 ? C SER 104 
11 1 Y 1 A LEU 120 ? C LEU 105 
12 1 Y 1 A ARG 121 ? C ARG 106 
13 1 Y 1 A PRO 122 ? C PRO 107 
14 1 Y 1 A LYS 123 ? C LYS 108 
15 1 Y 1 A LEU 124 ? C LEU 109 
16 1 Y 1 A SER 125 ? C SER 110 
17 1 Y 1 B PHE 216 ? D PHE 1   
18 1 Y 1 B ASP 217 ? D ASP 2   
19 1 Y 1 B ARG 218 ? D ARG 3   
20 1 Y 1 B ASN 219 ? D ASN 4   
21 1 Y 1 B VAL 220 ? D VAL 5   
22 1 Y 1 B PRO 322 ? D PRO 107 
23 1 Y 1 B LYS 323 ? D LYS 108 
24 1 Y 1 B LEU 324 ? D LEU 109 
25 1 Y 1 B SER 325 ? D SER 110 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1KB6 'double helix'        
1KB6 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DC 1  1_555 B DG 18 1_555 -0.603 -0.290 0.300  2.226   -11.903 -0.893 1  C_DC401:DG436_D C 401 ? D 436 ? 19 1 
1 A DA 2  1_555 B DT 17 1_555 0.371  0.021  0.204  0.203   -3.521  -2.156 2  C_DA402:DT435_D C 402 ? D 435 ? 20 1 
1 A DC 3  1_555 B DG 16 1_555 -0.126 -0.368 -0.323 11.995  -4.706  -5.712 3  C_DC403:DG434_D C 403 ? D 434 ? 19 1 
1 A DG 4  1_555 B DC 15 1_555 -0.190 -0.148 0.194  -3.947  -7.380  -1.873 4  C_DG404:DC433_D C 404 ? D 433 ? 19 1 
1 A DG 5  1_555 B DC 14 1_555 0.045  -0.248 -0.134 -3.257  -6.603  -2.591 5  C_DG405:DC432_D C 405 ? D 432 ? 19 1 
1 A DG 6  1_555 B DC 13 1_555 -0.476 -0.335 -0.796 -17.822 -7.180  0.150  6  C_DG406:DC431_D C 406 ? D 431 ? 19 1 
1 A DT 7  1_555 B DA 12 1_555 -0.937 -0.094 -0.078 -3.857  -7.001  1.121  7  C_DT407:DA430_D C 407 ? D 430 ? 20 1 
1 A DG 8  1_555 B DC 11 1_555 0.080  -0.275 -0.012 3.281   -0.415  -0.530 8  C_DG408:DC429_D C 408 ? D 429 ? 19 1 
1 A DA 9  1_555 B DT 10 1_555 -0.041 -0.047 0.144  9.409   -17.402 0.144  9  C_DA409:DT428_D C 409 ? D 428 ? 20 1 
1 A DA 10 1_555 B DT 9  1_555 0.136  -0.067 0.355  7.810   -15.800 0.214  10 C_DA410:DT427_D C 410 ? D 427 ? 20 1 
1 A DT 11 1_555 B DA 8  1_555 0.263  -0.262 0.101  -1.695  -10.790 1.710  11 C_DT411:DA426_D C 411 ? D 426 ? 20 1 
1 A DG 12 1_555 B DC 7  1_555 -0.138 -0.315 -0.416 -1.997  1.066   -1.256 12 C_DG412:DC425_D C 412 ? D 425 ? 19 1 
1 A DA 13 1_555 B DT 6  1_555 0.252  -0.198 -0.205 -10.278 -7.702  -2.202 13 C_DA413:DT424_D C 413 ? D 424 ? 20 1 
1 A DG 14 1_555 B DC 5  1_555 0.300  -0.119 -0.150 -3.023  1.031   -4.556 14 C_DG414:DC423_D C 414 ? D 423 ? 19 1 
1 A DG 15 1_555 B DC 4  1_555 -0.592 -0.299 -0.385 -3.257  -9.492  -0.163 15 C_DG415:DC422_D C 415 ? D 422 ? 19 1 
1 A DA 16 1_555 B DT 3  1_555 0.435  -0.346 0.161  8.292   -9.551  0.419  16 C_DA416:DT421_D C 416 ? D 421 ? 20 1 
1 A DC 17 1_555 B DG 2  1_555 0.533  -0.469 0.071  2.627   -4.516  -0.574 17 C_DC417:DG420_D C 417 ? D 420 ? 19 1 
1 A DA 18 1_555 B DT 1  1_555 0.457  -0.236 0.225  10.072  -6.139  3.874  18 C_DA418:DT419_D C 418 ? D 419 ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DC 1  1_555 B DG 18 1_555 A DA 2  1_555 B DT 17 1_555 -0.230 -0.058 3.464 1.210  4.611  41.732 -0.588 0.454  3.431 6.448  
-1.691  41.991 1  CC_DC401DA402:DT435DG436_DD C 401 ? D 436 ? C 402 ? D 435 ? 
1 A DA 2  1_555 B DT 17 1_555 A DC 3  1_555 B DG 16 1_555 0.609  -0.024 3.164 6.399  -0.465 31.010 0.041  0.050  3.222 -0.857 
-11.810 31.651 2  CC_DA402DC403:DG434DT435_DD C 402 ? D 435 ? C 403 ? D 434 ? 
1 A DC 3  1_555 B DG 16 1_555 A DG 4  1_555 B DC 15 1_555 -0.290 0.116  3.643 -8.426 7.199  39.430 -0.725 -0.628 3.594 10.422 
12.199  40.898 3  CC_DC403DG404:DC433DG434_DD C 403 ? D 434 ? C 404 ? D 433 ? 
1 A DG 4  1_555 B DC 15 1_555 A DG 5  1_555 B DC 14 1_555 0.279  -0.766 3.499 2.724  8.047  37.172 -2.244 -0.065 3.280 12.425 
-4.206  38.097 4  CC_DG404DG405:DC432DC433_DD C 404 ? D 433 ? C 405 ? D 432 ? 
1 A DG 5  1_555 B DC 14 1_555 A DG 6  1_555 B DC 13 1_555 -0.220 -0.660 3.682 5.498  5.377  29.383 -2.453 1.640  3.414 10.378 
-10.611 30.351 5  CC_DG405DG406:DC431DC432_DD C 405 ? D 432 ? C 406 ? D 431 ? 
1 A DG 6  1_555 B DC 13 1_555 A DT 7  1_555 B DA 12 1_555 -0.574 -0.274 3.006 -5.630 0.312  27.489 -0.633 -0.059 3.057 0.648  
11.691  28.051 6  CC_DG406DT407:DA430DC431_DD C 406 ? D 431 ? C 407 ? D 430 ? 
1 A DT 7  1_555 B DA 12 1_555 A DG 8  1_555 B DC 11 1_555 0.704  1.679  3.238 4.005  1.476  42.870 2.140  -0.561 3.340 2.013  
-5.463  43.072 7  CC_DT407DG408:DC429DA430_DD C 407 ? D 430 ? C 408 ? D 429 ? 
1 A DG 8  1_555 B DC 11 1_555 A DA 9  1_555 B DT 10 1_555 -0.417 1.230  3.408 -0.916 6.481  33.182 0.984  0.557  3.587 11.213 
1.585   33.804 8  CC_DG408DA409:DT428DC429_DD C 408 ? D 429 ? C 409 ? D 428 ? 
1 A DA 9  1_555 B DT 10 1_555 A DA 10 1_555 B DT 9  1_555 0.152  -0.218 3.233 -1.281 1.417  37.073 -0.529 -0.408 3.216 2.227  
2.013   37.120 9  CC_DA409DA410:DT427DT428_DD C 409 ? D 428 ? C 410 ? D 427 ? 
1 A DA 10 1_555 B DT 9  1_555 A DT 11 1_555 B DA 8  1_555 0.054  -0.737 3.511 2.030  1.731  37.964 -1.365 0.193  3.473 2.657  
-3.115  38.055 10 CC_DA410DT411:DA426DT427_DD C 410 ? D 427 ? C 411 ? D 426 ? 
1 A DT 11 1_555 B DA 8  1_555 A DG 12 1_555 B DC 7  1_555 0.772  0.458  3.445 4.827  7.677  31.387 -0.634 -0.461 3.532 13.832 
-8.697  32.639 11 CC_DT411DG412:DC425DA426_DD C 411 ? D 426 ? C 412 ? D 425 ? 
1 A DG 12 1_555 B DC 7  1_555 A DA 13 1_555 B DT 6  1_555 -1.135 0.330  3.478 -6.808 1.964  38.097 0.234  0.797  3.632 2.977  
10.321  38.727 12 CC_DG412DA413:DT424DC425_DD C 412 ? D 425 ? C 413 ? D 424 ? 
1 A DA 13 1_555 B DT 6  1_555 A DG 14 1_555 B DC 5  1_555 0.069  -0.690 3.390 -0.395 10.551 33.501 -2.738 -0.174 3.039 17.764 
0.665   35.080 13 CC_DA413DG414:DC423DT424_DD C 413 ? D 424 ? C 414 ? D 423 ? 
1 A DG 14 1_555 B DC 5  1_555 A DG 15 1_555 B DC 4  1_555 0.011  -0.466 3.411 3.998  2.271  29.213 -1.413 0.858  3.338 4.467  
-7.866  29.565 14 CC_DG414DG415:DC422DC423_DD C 414 ? D 423 ? C 415 ? D 422 ? 
1 A DG 15 1_555 B DC 4  1_555 A DA 16 1_555 B DT 3  1_555 -1.035 1.154  3.186 -7.268 0.148  42.458 1.558  0.693  3.315 0.202  
9.948   43.047 15 CC_DG415DA416:DT421DC422_DD C 415 ? D 422 ? C 416 ? D 421 ? 
1 A DA 16 1_555 B DT 3  1_555 A DC 17 1_555 B DG 2  1_555 0.651  -0.012 3.439 3.141  2.320  32.435 -0.448 -0.581 3.476 4.134  
-5.598  32.663 16 CC_DA416DC417:DG420DT421_DD C 416 ? D 421 ? C 417 ? D 420 ? 
1 A DC 17 1_555 B DG 2  1_555 A DA 18 1_555 B DT 1  1_555 -0.520 0.955  3.337 -1.154 2.298  34.198 1.247  0.695  3.407 3.901  
1.958   34.291 17 CC_DC417DA418:DT419DG420_DD C 417 ? D 420 ? C 418 ? D 419 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'ZINC ION' ZN  
5 water      HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 4 ZN  1  150 150 ZN  ZN  A . 
F 4 ZN  1  151 151 ZN  ZN  A . 
G 4 ZN  1  350 350 ZN  ZN  B . 
H 4 ZN  1  351 351 ZN  ZN  B . 
I 5 HOH 1  609 609 HOH WAT C . 
I 5 HOH 2  614 614 HOH WAT C . 
I 5 HOH 3  634 634 HOH WAT C . 
J 5 HOH 1  602 602 HOH WAT D . 
J 5 HOH 2  605 605 HOH WAT D . 
J 5 HOH 3  607 607 HOH WAT D . 
J 5 HOH 4  612 612 HOH WAT D . 
J 5 HOH 5  613 613 HOH WAT D . 
J 5 HOH 6  623 623 HOH WAT D . 
J 5 HOH 7  626 626 HOH WAT D . 
J 5 HOH 8  629 629 HOH WAT D . 
J 5 HOH 9  630 630 HOH WAT D . 
J 5 HOH 10 633 633 HOH WAT D . 
K 5 HOH 1  601 601 HOH WAT A . 
K 5 HOH 2  603 603 HOH WAT A . 
K 5 HOH 3  604 604 HOH WAT A . 
K 5 HOH 4  606 606 HOH WAT A . 
K 5 HOH 5  608 608 HOH WAT A . 
K 5 HOH 6  610 610 HOH WAT A . 
K 5 HOH 7  611 611 HOH WAT A . 
K 5 HOH 8  616 616 HOH WAT A . 
K 5 HOH 9  617 617 HOH WAT A . 
K 5 HOH 10 619 619 HOH WAT A . 
K 5 HOH 11 621 621 HOH WAT A . 
K 5 HOH 12 622 622 HOH WAT A . 
K 5 HOH 13 625 625 HOH WAT A . 
K 5 HOH 14 628 628 HOH WAT A . 
K 5 HOH 15 631 631 HOH WAT A . 
L 5 HOH 1  615 615 HOH WAT B . 
L 5 HOH 2  618 618 HOH WAT B . 
L 5 HOH 3  620 620 HOH WAT B . 
L 5 HOH 4  624 624 HOH WAT B . 
L 5 HOH 5  627 627 HOH WAT B . 
L 5 HOH 6  632 632 HOH WAT B . 
#